Page 1

Harga Eceran Rp2.500,-

Demi Kebenaran Dan Keadilan

WASPADA Harian Umum Nasional Terbit Sejak 11 Januari 1947. Pendiri: H. Mohd. Said (1905 - 1995), Hj. Ani Idrus (1918 - 1999) ISSN: 0215-3017

KAMIS, Kliwon, 20 Februari 2014/19 Rabiul Akhir 1435 H

No: 24497 Tahun Ke-68

Terbit 24 Halaman

Antara

Antara

LAHAR dingin melewati Jembatan Pondok Agung yang rusak di Siman, Kediri, Jawa Timur, Rabu (19/2). Hujan deras yang mengguyur puncak Gunung Kelud pada Selasa (18/2) sore, berimbas pada meluncurnya lahar dingin.

TERSANGKA kepemilikan narkoba Salim Bin Muhammad Yusof (tengah) yang merupakan Polisi Diraja Malaysia, dikawal polisi usia menjalani sidang dengan agenda putusan di PN Medan, Rabu (19/2).

Lahar Dan Erupsi Kelud Sama-sama Berbahaya

Miliki Sabu, PN Medan Vonis Polisi Malaysia 4 Tahun

SURABAYA (Antara): Geolog ITS Surabaya, Dr Ir Amien Widodo MSi, mengatakan. lahar dingin dan erupsi (muntahan isi perut gunung) Gunung Kelud (1.730 mdpl) di kawasan Kediri-Blitar-Malang, Jawa Timur sama-sama berbahaya. “Selama status Gunung Kelud belum turun dari Awas menjadi Siaga berarti potensi bahaya dari gunung itu masih ada. Lahar dingin yang datang sejak Selasa (18/2) itu tidak kalah berbahayanya daripada erupsi pada Kamis (13/2) hingga Jumat (14/2),” katanya di Surabaya, Rabu (19/2). Oleh karena itu, pakar geologi ITS Surabaya itu mengharapkan warga di sekitar Kelud harus tetap menghindar, kemudian warga yang tinggal di dekat aliran sungai yang berhulu ke Kelud juga harus menyingkir. “Hingga kini, PVMBG (Pusat Vulkanologi dan Mitigasi Bencana Geologi) masih mengingatkan warga di kawasan Kelud dalam radius 10 kilometer tetap harus steril dan warga di aliran sungai yang berhulu ke Kelud juga harus menyingkir,” katanya. Lanjut ke hal A2 kol. 1

MEDAN (Waspada): Polisi Diraja Malaysia Salim Bin Muhammad Yusof, 49, divonis 4 tahun penjara denda Rp800 juta subsider 3 bulan penjara oleh Majelis Hakim yang bersidang di Pengadilan Negeri (PN) Medan, Rabu (19/2). Majelis Hakim, diketuai M Isya dalam amar putusannya menyatakan, Salim terbukti memiliki sabu seberat 0,5 gram. Perbuatan terdakwa terbukti melanggar Pasal 112 jo 127 UU No 35/2009 tentang narkotika golongan satu. Vonis yang dijatuhkan Majelis Hakim sama dengan tuntutan yang diajukan Jaksa Penuntut Umum (JPU). Salim ditangkap petugas di Bandara Internasional Polonia Medan pada Mei 2013. Dari tangan terdakwa, petugas Bea Cukai bandara menyita 0,5 gram sabu yang dibawa dari negaranya. Polisi berpangkat kopral itu langsung ditahan oleh penyidik Polda Sumut. Salim mengaku datang ke Medan hanya untuk berlibur, sekaligus ingin mencari calon istri. Namun bukan istri yang didapat, Salim malah masuk penjara. Kepada petugas, Salim mengaku sudah sering mengonsumsi sabu. (m38)

Waspada/gito ap

MASSA mengaku dari kelompok tani Cerdas Percut Seituan (jongkok) diamankan di Mapoldasu karena berusaha menduduki wilayah bandara KNIA, Rabu (19/2).

Coba Duduki KNIA, 21 Ditahan Pemungutan Suara Ulang 2 TPS Di Sei. Semayang

Pasangan AZAN Unggul MEDAN (Waspada): Pemungutan suara ulang Pilkada Deliserdang di dua TPS (Tempat Pemungutan Suara) yakni (TPS) 18 dan 40 di Desa Sei Semayang, Kec. Sunggal, sesuai putusan sela Mahkamah Konstitusi (MK), Rabu (19/2) berlangsung aman dan lancar hingga selesai pukul 13:00. Pasangan calon Bupati Deliserdang H Ashari Tambunan dan calonWakil Bupati H. Zainuddin Mars unggul dengan perolehan 496 suara.

Pantauan Waspada, pemungutan suara ulang tersebut mendapat kawalan ratusan aparat keamanan dari Poldasu dibantu TNI. Bahkan, Poldasu menempatkan 1 unit mobil water canon, serta mendirikan tenda Posko Pengamanan di lapangan depan Kantor Desa Sei Semayang yang menjadi lokasi TPS 40. Selain hadir para Komisioner KPU Lanjut ke hal A2 kol. 3

MEDAN (Waspada): 21 Dari 500 orang Kelompok Tani Cerdas, Kec. Percut Seituan, Kab. Deliserdang ,ditahan di Polda Sumut karena berusaha menduduki Kualanamu Internasional Airport (KNIA), Rabu (19/2). Mereka hendak menggelar aksi di depan gerbang bandara terkait persoalan tanah. Direktur Dit Reskrimum Poldasu Kombes Pol. Dedi Irianto melalui Wakil Direktur AKBP Wawan Munawar kepada wartawan di Mapoldasu mengatakan, ada 21 orang yang diamankan di Polda. “Mereka dianggap sebagai provokator karena menggerakkan massa untuk menduduki bandara,” sebutnya. Menurut Wawan, berdasarkan informasi dari Polres Lanjut ke hal A2 kol. 1

Berita terkait baca halaman B1

Gubsu: Silakan Masyarakat Marah Kepada PLN MEDAN (Waspada): Gubsu H. Gatot Pujo Nugroho menyatakan, jika masyarakat mau marah kepada PLN, silakan marah asal sesuai jalur yang benar. Hal itu dikatakan Gatot yang mengaku sangat tidak puas dengan kinerja PT PLN (Persero) di Wilayah Sumut terkait seringnya terjadi pemadaman belakangan ini. “Saya kalau dalam konteks sebagai kepala

Pemerintah Provinsi Sumut jelas merasa tidak puas dengan kinerja PLN. Saya waktu Plt, didesak-desak soal Asahan III, setelah ada izin lokasi akhirnya di lapangan tidak ada. Izin Batangtoru sudah saya keluarkan, hasilnya mana ada,” kata Gatot, dan mengulangi kata-kata ‘tidak puas dengan kinerja PLN’ berulang-ulang kepada wartawan di Kantor Gubsu, Rabu (19/2). Lanjut ke hal A2 kol. 6

KPK Surati Presiden Dan DPR Hentikan Revisi KUHAP JAKARTA (Antara): Komisi Pemberantasan Korupsi (KPK) mengirimkan surat kepada Presiden Susilo Bambang Yudhoyono dan Dewan Perwakilan Rakyat (DPR) tentang permintaan penghentian pembahasan revisi Kitab Undangundang Hukum Pidana dan Kitab Undang-undang Hukum Acara Pidana “Tadi surat sudah dikirim

Waspada/Feirizal Purba

POLISI mengawal ketat sekeliling TPS 40 saat berlangsungnya penghitungan suara sekaitan pemungutan suara ulang di Desa Sei. Semayang, Kec. Sunggal, Kab. Deliserdang.

Polisi Diminta Usut Temuan Surat Suara Hilang MEDAN (Waspada): Pengamat politik USU Prof. Ridwan Rangkuti MA minta polisi mengusut tuntas kasus hilangnya surat suara Pilkada Deliserdang dari 2 TPS di Desa Seisemayang, Sunggal, yang ditemukan kembali di Kantor Desa Sei Semayang Selasa(18/2). Sebab, menurut Prof. Ridwan, ditemukannya surat suara yang sempat hilang dari TPS 18 dan TPS 40 Desa Seisemayang di kantor Desa bertendensi mendiskreditkan aparatur Pemkab Deliserdang. Hal itu ditegaskan Prof Rid-

wan Rangkuti MA kepada wartawan di Medan, Rabu (19/2). Menurut dia, kasus hilangnya surat suara dari 2 TPS itu sudah ditangani kepolisian bahkan sudah ditetapkan tersangkanya.’’Namun, tiba-tiba ditemukan sehari sebelum pencoblosan ulang mengganti surat suara yang hilang sesuai putusan sela Mahkamah Konstitusi,’’ katanya. Ridwan mengemukakan, tipis kemungkinan yang menaruh surat suara itu adalah aparatur desa termasuk aparat Pemkab Deliserdang, karena

setelah dinyatakan pencoblosan ulang di dua TPS itu, surat suara itu tidak berharga lagi, melainkan hanya kertas biasa saja. Lagi pula, kata Ridwan, seandainya surat suara itu sengaja disimpan oleh aparatur pemerintah, tidak ada kepentingannya karena saat itu belum dihitung hasil Pilkada. “Jadi untuk apa disembunyikan ?” ujarnya. Atas dasar itu, ujar Ridwan, KPU Deliserdang harus bertanggungjawab atas hilangnya surat suara itu dan kepolisian Lanjut ke hal A2 kol. 6

ke presiden, pimpinan DPR, dan panja (panitia kerja) DPR,” kata Juru Bicara KPK Johan Budi di Jakarta, Rabu (19/2). Pimpinan DPR yang dimaksud adalah Ketua DPR Marzuki Alie sedangkan ketua panja revisi KUHP dan KUHAP adalah Wakil Ketua Komisi III DPR dari fraksi Partai Golkar Aziz Syamsuddin. Lanjut ke hal A2 kol. 3

Banyak Aduan Hakim Nakal Tanpa Bukti JAYAPURA (Antara): Ketua Bidang Pengawasan Hakim dan Investigasi KomisiYudisial Eman Suparman mengatakan masih ada hakim yang suka mintaminta, termasuk yang menerima cenderamata dari kepala daerah. ”Kalau sekarang hakim masih mending dan sudah jauh berkurang, hakim yang masih suka minta, suka iseng-iseng minta masih ada.Tapi kalau dulu 10 hakim, contohnya neh, tapi sekarang ini tinggal tiga, berarti masih ada kan,” kata Eman Suparman di Jayapura, Papua, Rabu (19/2). Ia mencontohkan seperti terjadi kepada seorang hakim di Manado, Sulawesi Utara yang berkelakar di sebuah kantin. “Eh kalau mau bagi-bagi uang jangan mereka saja, bagi semua,” kata Eman menirukan perka-

taan seorang hakim di Manado yang diadukan oleh pelapor. Eman mengatakan kasus itu akhirnya belum bisa diproses karena ada bantahan dari hakim itu. Dan panitera yang saat itu ada di kantin juga mengaku tidak mendengar, hanya ada bukti dari aduan pelapor, jadi tidak kuat. “Banyak laporan tentang hakim yang nakal tapi tidak disertakan alat bukti, inilah titik lemahnya. Di Papua juga ada, malah kami minta agar aduan hakim yang nakal disertakan bukti tapi sampai sekarang tidak ada balasannya, itu ada di Sorong, Merauke dan lainnya,” katanya. Eman sayangkan ada laporan aduan tentang hakim yang berperilaku nakal di Papua hanya saja tidak disertakan alat bukti.“Termasuk ada hakim yang Lanjut ke hal A2 kol. 7

Bawa Uang, Awas Ban Kempis

Al Bayan

Neg Ne g eri Bencana Oleh Tgk H Ameer Hamzah Katakanlah: “Siapakah yang dapat menyelamatkan kamu dari bencana di darat dan di laut, yang kamu berdoa kepada-Nya dengan berendah diri dan dengan suara yang lembut (dengan mengatakan): “Sesungguhnya jika Dia menyelamatkan kami dari (bencana) ini, tentulah kami menjadi orang-orang yang bersyukur.” BENCANA apapun yang menimpa sesuatu negeri, membuat manusia kalut. Seakan-akan dunia sudah datang kiamat saat itu. Saya merasakan kekalutan yang luar biasa ketika Gempa dan Tsunami Aceh terjadi tiba-tiba, 26 Desember 2004 silam. Anak dan istri terpisah, lari ke lain arah, baru berjumpa enam jam kemudian. Begitu juga keluarga yang lain merasakan penuh ketakutan dan kekalutan berkumpul dalam diri mereka yang ditimpa bencana.

Lanjut ke hal A2 kol. 6

waspadamedan.com Waspada Daily

@Harian_Waspada

Waspada/Arianda Tanjung

PANIT Jahtanras Polresta Medan Ipda M Karo-karo memeriksa rekaman CCTV yang berada di Kantor Harian Waspada, Jl Letjen Suprapto, Rabu (19/2). Pemeriksaan terkait perampokan bersenjata api yang menimpa seorang ibu rumah tangga tak jauh dari kantor tersebut. MEDAN ( Waspada): Uang tunai Rp 24 juta berikut satu kamera Canon milik seorang ibu rumah tangga, Yunita Frida, 36, penduduk Perumahan Tanjung Permai, Desa Helvetia, Kec. Sunggal, Deliserdang, lenyap digasak

kawanan perampok bersen-jata api, di Jl. Letjen Suprapto, Medan, Rabu (19/2) malam. Menurut korban didampingi suaminya, Irham Hagabean Nasution kepada sejumlah personil Polresta Medan dan Polsek Medan Kota yang turun

ke tempat kejadian perkara(TKP), malam itu usai makan bakso di kawasan Jl. Ir. H. Djuanda, Medan, Yunita dan suaminya mampir di kantor sang suami di Lanjut ke hal A2 kol. 7

Waspada/Ist

GUBSU H Gatot Pujo Nugroho tampak serius saat mendengarkan penjelasan dari Direktur Keuangan PT AP 2 L Manurung didampingi Dir Ops Kebandarudaraan Endang A Sumiarsa, GM KNIA HT Said Ridwan dan Liaison Officer Kehumasan HM Wasfan W Widodo di ruang kerja gubernur, Rabu (19/2).

Pemprovsu Dukung PT AP 2 Jadikan KNIA Aerotropolis MEDAN (Waspada): Pemerintah Provinsi Sumatera Utara mendukung PT Angkasa Pura 2 yang akan mengembangkan Kualanamu International Airport (KNIA) menjadi modern airport yaitu bandara aerotropolis. “Kami menyambut dan akan mendukung penuh rencana ini,” ujar Gubsu H Gatot Pujo Nugroho saat menerima audiensi PT Angkasa Pura 2 yang dihadiri Direktur Keuangan Laurensius Manurung , Direktur Operasi Kebandarudaraan En-

dang A Sumiarsa, General Manager KNIA HT Said Ridwan, ST, MM dan Liaison Officer Kehumasan HM Wasfan W Widodo di Kantor Gubsu, Rabu (19/2). Gubsu selain berjanji membuat Perda terkait itu, juga mengungkapkan pihaknya sudah sejalan dengan visi PT AP 2 yakni memiliki visi pengembangan KNIA yang diintegrasikan dengan Pelabuhan Belawan. “Kita menginginkan Kualanamu terintegrasi dengan kawasan Belawan dengan

Istri Oknum TNI AU Diadukan Ke Polisi MEDAN (Waspada): Polisi Militer TNI Angkatan Udara (POM TNI AU) melalui Kasidik Kapten Andri mengadukan A, 21, istri Serka FS dari TNI AU ke Polresta Medan, Rabu (19/2) sore. Tantri, 29, selaku keluarga A kepada wartawan mengatakan, POM TNI AU hendak melaporkan A diduga telah membantu suaminya melarikan diri dari sel TNI AU. FS ditahan karena disersi. ‘’ Sudah 5 bulan dia enggak tugas,” kata Tantri. Kata Tantri, FS ditangkap petugas POM TNI AU untuk mempertanggungjawabkan perbuatannya. FS ditahan di sel TNI AU. Namun, kata Tantri, saat dijenguk sang istri , FS memaksa sang istri untuk membawa gergaji. ‘’Sang istri sempat menolak permintaan suaminya. Namun karena terus didesak, sang istri menyetujui permintaan itu,’’ kata Tantri dan menambahkan, saat dalam sel, FS mengancam mau bunuh diri kalau A tidak membawa gergaji. Ternyata,gergaji itu itu untuk memotong jeruji sel yang ditempatinya agar dia bisa melarikan diri. “Kalau kami tau, udah kami tangkap sendiri. Makanya kami bingung,’’ kataTantri. Pantauan wartawan, sejumlah petugas POMTNI AU terlihat masuk ke dalam ruang SPKT Polresta Medan. A selaku terlapor digiring petugas ke ruangan SPKT guna dimintai keterangan. Kasidik POM TNI AU Kapten Andri, saat dikonfirmasi sebelumnya meminta agar wartawan bersabar. (m39)

dukungan kawasan bisnis dan perumahan sehingga menjadi kota baru,” harap Gubsu. Laurensius dalam kesempatan itu menjelaskan konsep yang menggabungkan antara airport city dengan kawasan yang terintegrasi ini akan memberi efek berganda mendorong pertumbuhan ekonomi daerah. “Jadi KNIA akan dikembangkan sebagai gerbang utama Indonesia dengan konsep aerotropolis (kota di dalam bandara). Berbeda dengan Bandara Soekarno-Hatta yang sulit dikembangkan karena minimnya lahan dan sudah banyaknya pembangunan di sekitar kawasan,” papar Laurensius. Laurensius menambahkan, berbeda dengan Kualanamu yang masih memungkinkan untuk dikembangkan dengan konsep modern airport. Kombinasi antara airport city dengan kawasan terintegrasi yang menjadikan aerotropolis,” sebut Manurung yang optimis kawasan aerotropolis akan memberikan multiplier effect yang besar bagi perekonomian daerah. Lanjut ke hal A2 kol. 2

Serampang - Ban kempis bahaya, kantong kempis bahaya juga - He...he...he...


Harga Eceran Rp2.500

Demi Kebenaran Dan Keadilan

WASPADA Harian Umum Nasional Terbit Sejak 11 Januari 1947. Pendiri: H. Mohd. Said (1905 - 1995), Hj. Ani Idrus (1918 - 1999) ISSN: 0215-3017

KAMIS, Kliwon, 20 Februari 2014/19 Rabiul Akhir 1435 H

No: 24497 * Tahun Ke-68 Terbit 24 Halaman Antara

Waspada/Ist

GUBSU H Gatot Pujo Nugroho saat foto bersama dengan jajaran pejabat PT AP2 dan Kadishub Provsu A Siahaan (kiri). Dari kiri Liaison Officer Kehumasan HM Wasfan W Widodo, GM KNIA HT Said Ridwan, Dir Keuangan L Manurung dan Dir Ops Kebandarudaraan PT AP 2 Endang A. Sumiarsa.

BUPATI LEBAK DIPERIKSA KPK: Bupati Lebak Iti Octavia Jayabaya memberikan keterangan pers sebelum menjalani pemeriksaan penyidik KPK di Gedung KPK, Jakarta, Rabu (19/2). Iti diperiksa sebagai saksi bagi terdakwa Gubernur Banten nonaktif Atut Chosiyah dalam kaitan sengketa Pilkada Lebak di MK.

Pemprovsu Dukung PT AP 2 Jadikan KNIA Aerotropolis

Asap Riau Selimuti Medan

MEDAN (Waspada): Pemerintah Provinsi Sumatera Utara mendukung PT Angkasa Pura 2 yang akan mengembangkan Kualanamu International Airport (KNIA) menjadi modern airport yaitu bandara aerotropolis. “Kami menyambut rencana ini, dan akan mendukung penuh rencana ini,” ujar Gubsu H Gatot Pujo Nugroho saat menerima audiensi PT Angkasa Pura 2 yang dihadiri Direktur Keuangan Laurensius Manurung, Direktur Operasi Kebandarudaraan Endang A Sumiarsa, General Manager KNIA HT Said Ridwan, ST, MM dan Liaison Officer Kehumasan HM Wasfan W Widodo di Kantor Gubsu. Gubsu pada kesempatan itu, selain berjanji membuat Perda terkait itu, juga mengungkapkan pihaknya sudah sejalan dengan visi PT AP 2 yakni memiliki visi pengembangan KNIA yang diintegrasikan dengan Pelabuhan Belawan. “Kita menginginkan Kualanamu terintegrasi dengan kawasan Belawan, dengan dukungan kawasan bisnis dan perumahan sehingga menjadi kota baru,” harap Gubsu. Laurensius dalam kesempatan itu menjelaskan konsep yang menggabungkan antara airport city dengan kawasan yang terintegrasi ini akan memberi efek berganda mendorong pertumbuhan ekonomi daerah. “Jadi KNIA akan dikembangkan sebagai pintu utama gerbang utama Indonesia dengan konsep aerotropolis (kota di dalam bandara). Berbeda dengan Bandara Soekarno-Hatta yang sulit dikembangkan karena minimnya lahan dan sudah banyaknya pembangunan dilakukan Lanjut ke hal A2 kol 4

Waspada/gito ap

MASSA mengaku dari kelompok tani Cerdas Percut Seituan (jongkok) diamankan di Mapoldasu karena berusaha menduduki wilayah bandara KNIA, Rabu (19/2). --Berita terkait di halaman B1

MEDAN (Waspada): BMKG Wilayah I mencatat, asap tipis yang ditimbulkan kebakaran lahan dan hutan di Riau sudah berembus ke Sumatera Utara, khususnya Medan. Namun sampai Rabu(19/2) belum mengganggu pergerakan penerbangan di Kualanamu International Airport (KNIA). Sementara itu, titik api (hot spot) yang muncul di kawasan Sumut berdasarkan pantauan satelit Terra dan Aqua, Selasa (18/2), mencapai 15 titik tersebar di beberapa daerah. Mega Sirait, SP, kepala Seksi Data dan Informasi pada Badan Meteorologi Klimatologi dan Geofisika (BMKG) Wilayah I stasiun Bandara Kualanamu, saat dikonfirmasi, Rabu membenarkan. Katanya, berdasarkan data, jarak tembus pandang di kawasan Medan bahkan KNIA mencapai 800 hingga 3000 meter, belum terimbas kepada pergerakan penerbangan di KNIA. “Penerbangan masih aman,” ujar Mega, dan menambahkan, asap yang terlihat saat ini, merupakan akumulasi asap selama beberapa hari sebelumnya, dimana asap tetap bertahan di udara karena tidak ada hujan yang membawa asap turun ke permukaan. Menurut Mega, kawasan Riau termasuk daerah terparah setiap tahun kebakaran hutan seperti di kawasan Kota Dumai, Bengkalis dan Rokan Hilir yang terpantau dari satelit Terra. Sedangkan, di Sumatera Utara kawasan kebakaran terluas yaitu di Mandailing Natal, Tapanuli Selatan dan Tapanuli Tengah. Di Aceh yang terparah kekeringan di Aceh Barat, Aceh Jaya dan Singkil. (m32)

Massa Tani Duduki KNIA 21 Orang Ditahan Poldasu MEDAN (Waspada): 21 Dari 500 orang dari Kelompok Tani Cerdas, Kec. Percut Seituan, Kab. Deliserdang ditahan di Polda Sumut karena berusaha menduduki Kualanamu Internasional Airport (KNIA), Rabu (19/2). Mereka hendak menggelar aksi di depan gerbang bandara terkait persoalan tanah.

Direktur Dit Reskrimum Poldasu Kombes Pol. Dedi Irianto melalui Wakil Direktur AKBP Wawan Munawar kepada wartawan di Mapoldasu mengatakan, ada 21 orang yang diamankan di Polda. “Mereka dianggap sebagai provokator karena menggerakkan massa untuk mendu-

duki bandara,” sebutnya. Menurut Wawan, berdasarkan informasi dari Polres Deliserdang, Rabu sekira pukul 10:00, ada 500-an massa mengaku kelompok tani Cerdas dari tiga desa, yaitu Desa Bandarsetia, Desa Percut dan Desa Kolam, Kecamatan Percut Seituan bergerak dari Desa

Batangkuis mengarah bandara. Tujuannya menduduki wilayah bandara. Saat itu petugas yang telah berjaga-jaga berusaha melakukan upaya persuasif agar massa tidak menggelar aksi di pintu gerbang bandara, namun massa bersikeras untuk tetap menggelar aksi. “Tinda-

kan persuasif aparat kepolisian diabaikan massa dengan melakukan perlawanan, sehingga dilakukan penangkapan,” sebut Wawan. Mengenai motif para pengunjukrasa hendak menduduki wilayah bandara, Wa w a n m e n g a k u b e l u m mengetahuinya. “Motifnya

KY: Ada Hakim Suka Minta-minta JAYAPURA (Antara): Ketua Bidang Pengawasan Hakim dan Investigasi Komisi Yudisial Eman Suparman mengatakan masih ada hakim yang suka minta-minta, termasuk yang menerima cenderamata dari kepala daerah. ”Kalau sekarang hakim masih mending dan sudah jauh berkurang, hakim yang masih suka minta, suka isengiseng minta masih ada. Tapi kalau dulu 10 hakim, contohnya neh, tapi sekarang ini tinggal tiga, berarti masih ada kan,” kata Eman Suparman kepada Antara saat berada di

Jayapura, Papua, Rabu (19/2). Ia mencontohkan seperti terjadi kepada seorang hakim di Manado, Sulawesi Utara yang berkelakar di sebuah kantin. “Eh kalau mau bagibagi uang jangan mereka saja, bagi semua,” kata Eman mencoba menirukan perkataan seorang hakim di Manado yang diadukan oleh pelapor. Eman mengatakan kasus itu akhir nya belum bisa diproses karena ada bantahan dari hakim itu. Dan panitera yang saat itu ada di kantin juga Lanjut ke hal A2 kol 1

KPK Surati Presiden Dan DPR Hentikan Revisi KUHAP JAKARTA (Antara): Komisi Pemberantasan Korupsi (KPK) mengirimkan surat kepada Presiden Susilo Bambang Yudhoyono dan Dewan Perwakilan Rakyat (DPR) tentang permintaan penghentian pembahasan revisi Kitab Undang-undang Hukum Pidana dan Kitab Undang-undang Hukum Acara Pidana “Tadi surat sudah dikirim ke presiden, pimpinan DPR, dan panja (panitia kerja) DPR,” kata Juru Bicara KPK Johan Budi di Jakarta, Rabu (19/2). Pimpinan DPR yang dimaksud adalah Ketua DPR

Marzuki Alie sedangkan ketua panja revisi KUHP dan KUHAP adalah Wakil Ketua Komisi III DPR dari fraksi Partai Golkar Aziz Syamsuddin. Sebelumnya Wakil Ketua KPK Bambang Widjojanto mengatakan bahwa revisi tersebut ditunda karena tidak bisa dikerjakan bila hanya memiliki waktu di bawah 100 hari. “Pembahasan KUHP-nya harus terlebih dahulu karena UU materil, bila formil mengatur bagaimana UU materil Lanjut ke hal A2 kol 6

Al Bayan

Antara

Antara

BANDARA YOGYAKARTA DIBUKA: Calon penumpang menunggu jadwal keberangkatan di Bandara Adi Sutjipto, Yogyakarta, Rabu (19/2). Setelah lima hari tutup pasca semburan abu vulkanik Gunung Kelud, Bandara Adi Sutjipto kembali dibuka dengan penerbanagan pertama pukul 12.00 WIB.

LAHAR DINGIN GUNUNG KELUD: Lahar dingin melewati Jembatan Pondok Agung yang rusak di Siman, Kediri, Jawa Timur, Rabu (19/2). Hujan deras yang mengguyur puncak Gunung Kelud pada Selasa (18/2) sore, berimbas pada meluncurnya lahar dingin dan merobohkan sebagian dinding Waduk Siman.

Lahar Dan Erupsi Kelud Sama-sama Berbahaya SURABAYA (Antara): Geolog ITS Surabaya, Dr Ir Amien Widodo MSi, mengatakan. lahar dingin dan erupsi (muntahan isi perut gunung) Gunung Kelud (1.730 mdpl) di kawasan Kediri-Blitar-Malang, Jawa Timur sama-sama berbahaya. “Selama status Gunung Kelud belum turun dari Awas menjadi Siaga berarti potensi bahaya dari gunung itu masih ada. Lahar dingin yang datang sejak Selasa (18/2) itu tidak kalah berbahayanya daripada erupsi pada Kamis (13/2) hingga Jumat (14/2) lalu,” katanya di Surabaya, Rabu (19/2). Oleh karena itu, pakar geologi ITS Surabaya itu mengharapkan warga di sekitar Kelud harus tetap menghindar, kemudian warga yang tinggal di dekat aliran sungai yang berhulu ke Kelud juga harus menyingkir. “Hingga kini, PVMBG (Pusat Vulkanologi dan Mitigasi Bencana Geologi) masih mengingatkan warga di kawasan Kelud dalam radius 10 kilometer tetap harus steril dan warga

di aliran sungai yang berhulu ke Kelud juga harus menyingkir,” katanya. Menurut Ketua Pusat Studi Kebumian, Bencana, dan Perubahan Iklim (PSKBPI) ITS Surabaya itu, instruksi PVMBG itu harus dipatuhi hingga ada penurunan status Kelud dari Awas menjadi Siaga. “Selama mereka masih mencatat tingginya tingkat kegempaan, ya Kelud masih berbahaya,” katanya. Berdasarkan pengamatannya, lahar dingin yang berasal dari campuran pasir, air, batu, dan lumpur itu tetap berbahaya, karena material yang sama itulah yang telah memporakporandakan Pacet (Mojokerto) dan Situbondo pada beberapa tahun lalu. “Saya yakin, saat Kelud meletus itu ada material yang Lanjut ke hal A2 kol 6

Oleh: H. Ameer Hamzah Katakanlah: “Siapakah yang dapat menyelamatkan kamu dari bencana di darat dan di laut, yang kamu berdoa kepada-Nya dengan berendah diri dan dengan suara yang lembut (dengan mengatakan): “Sesungguhnya jika Dia menyelamatkan kami dari (bencana) ini, tentulah kami menjadi orang-orang yang bersyukur.” BENCANA apapun yang menimpa sesuatu negeri, membuat manusia kalut. Seakan-akan dunia sudah datang kiamat saat itu. Saya merasakan kekalutan yang luar biasa ketika Gempa dan Tsunami Aceh terjadi tibatiba, 26 Desember 2004 silam. Anak dan istri terpisah, lari ke lain arah, baru berjumpa enam jam kemudian. Begitu juga keluarga yang lain merasakan penuh

Lanjut ke hal A2 kol 2 Antara

@Harian_Waspada

PANYABUNGAN (Waspada): Balai Besar BMKG Wilayah I Medan sesuai hasil pantauan Satelit NOOA-18, ditemukan hotspot (titik api) 5 titik di Kab. Mandailing Natal. “Tetapi yang berhasil kami pantau hanya 4 titik yakni titik api yang berada di areal perusahaan perkebunan PT. DIS, PT. MAL, PT. Rendi serta perkebunan transmigrasi SP I dan II Muara Batanggadis,” kata Kepala Badan Penanggulangan Bencana Daerah (BPBD) Madina Risfan Juliardi melalui Sekretaris Zulkhairi Pulungan di Panyabungan,

Lanjut ke hal A2 kol 4

PASUKAN bersepeda motor Polda Aceh membentuk formasi saatmembubarkan masa perusuh dalam latihan meningkatkan kemampuan pengamanan pemilu di Mapolda Aceh, Banda Aceh, Rabu (19/2). Polda Aceh terus menggelar latihan secara rutin untuk meningkatkan kemampuan personilnya, dalam mengamankan pemilu legislatif dan pilpres 9 April mendatang.

Rabu (19/2). Dalam beberapa hari terakhir, kata Zulkhairi, api meluas ke pemukiman warga di SP I dan II Singkuang, sehingga mengakibatkan 25 unit rumah terbakar. Ke 25 rumah yang terbakar merupakan rumah panggung yang kosong karena sudah ditinggal penghuninya.Kebakaran sudah terjadi sejak tiga minggu lalu.Kemarau disertai angin kencang penyebab utama mudahnya lahan gambut dilalap api. Lanjut ke hal A2 kol 6

AS Bantu 200 Ribu Dolar Tanggap Darurat Sinabung JAKARTA (Waspada): Pemerintah Amerika Seriat melalui Duta Besarnya untuk Indonesia, Robert Blake, memberi bantuan tambahan untuk tanggap darurat bencana letusan Gunung Sinabung di Sumatra Utara. Bantuan sebesar 200.000 dolar AS itu dalam bentuk dukungan logistik. Dalam keterangan tertulis, Rabu (19/2) Pemerintah AS memberikan dukungan operasional dan logistik melalui Badan Nasional Penanggulangan Bencana (BNPB), yang terus mengelola tindakan tanggap darurat karena letu-

Pemungutan Suara Ulang 2 TPS Di Sei. Semayang

Pasangan AZAN Unggul

Negeri Bencana

Waspada Daily

Dia menyebutkan, sehari sebelumnya Polres Deliserdang juga mengamankan sejumlah pria diduga hendak melakukan aksi sama. “Saya dapat info ada beberapa orang ditahan di Polres karena hendak melakukan aksi yang

Titik Api Terpantau Di Lima Lahan Perkebunan Madina

LATIHAN PEMANTAPAN PENANGANAN PEMILU DI ACEH

waspadamedan.com

belum jelas, masih dalam penyelidikan. Tetapi info awal mereka hendak menguasai bandara,” ujar Wawan mengatakan tidak ada alasan massa datang ke bandara. “Tetapi kalau mereka datang ke bandara hendak menggunakan maskapai penerbangan silahkan saja,” katanya.

MEDAN (Waspada): Pemungutan suara ulang Pilkada Deliserdang di dua TPS (Tempat Pemungutan Suara) yakni (TPS) 18 dan 40 di Desa Seisemayang, Kec.Sunggal, sesuai putusan sela Mahkamah Konstitusi (MK), Rabu (19/2) berlangsung aman dan lancar hingga selesai pukul 13:00. Sementara, pasangan calon Bupati Deliserdang H Ashari Tambunan dan calon Wakil Bupati H. Zainuddin Mars unggul dengan perolehan 496 suara. Pantauan Waspada, pemungutan suara ulang tersebut mendapat kawalan ratusan aparat keamanan dari Poldasu dibantu TNI. Bahkan, Poldasu menempatkan 1 unit mobil water canon, serta mendirikan tenda Posko Pengamanan di lapangan depan Kantor Desa Seisemayang yang menjadi lokasi TPS 40. Selain hadir para Komisioner KPU Deliserdang, juga 4 Komisioner KPU Sumut, yakni Mulia Banurea (ketua), Yulhasni, Benget Silitonga dan Evi Novida Ginting serta Aulia Andri dari Bawaslu Sumut dan Kapolresta Medan memantau langsung pemungutan suara ulang tersebut. Siangnya, hadir Sekdaprovsu Nurdin Lubis didampingi Asisten Umum Hasiolan Silaen, Kaban Kesbanglinmas Provsu Eddy Sofyan, meninjau TPS 40. Secara terpisah, Lanjut ke hal A2 kol 1

san Gunung Sinabung di Kab. Karo dan memberikan bantuan kepada masyarakat yang terkena dampak bencana. Pendanaan ini merupakan tambahan dari bantuan 100.000 dolar AS yang telah diberikan sebelumnya pada tanggal 6 Februari untuk menyediakan pasokan dasar bagi mereka yang tinggal di penampungan dan menderita karena terjadinya letusan. “Untuk masyarakat yang terpaksa mengungsi dari rumahnya, saya berharap Lanjut ke hal A2 kol 6

Polisi Peras Warga Rp5 Juta Di Balige BALIGE ( Waspada): Tim Reserse Kriminal Polres Toba Samosir diduga melakukan pemerasan terhadap seorang warga Rp5 juta di Balige dengan alasan terlibat dalam Lanjut ke hal A2 kol 5

Serampang - Akhirnya satu putaran - He.... he....he....


Berita Utama

A2 Pasangan Azan .... Bupati Deliserdang H Amri Tambunan bersama Wabup Zainuddin Mars (calon Wabup incumbent) beserta staf hadir di Kantor Camat Sunggal. Hasil penghitungan sementara di dua TPS tersebut pasangan nomor 1 H. Azhari Tambunan – H. Zainuddin Mars (AZAN) memperoleh 496 suara, pasangan Drs Akhmad Tala’a – H. Hardi Mulyono memperoleh 198 suara. Secara rinci menurut catatan staf KPU Provinsi Sumut, pada TPS 18 pasangan Azan memperoleh 251 suara dan TPS 40 memperoleh 245 suara, pasangan No. 2 tidak memperoleh suara, pasangan No. 4 di TPS 18 tidak memperoleh suara namun mendapat 1 suara di TPS 40, pasangan No. 4 di TPS 18 peroleh 1 suara di TPS 40 tidak peroleh suara, pasangan No. 5 tidak memperoleh suara di dua TPS tersebut, pasangan No. 6 di TPS 18 peroleh 76 suara dan di TPS 40 peroleh 122 suara, pasangan No. 7 di TPS 18 tidak memperoleh suara namun di TPS 40 mendapat 1 suara. Selanjutnya, pasangan No. 8 hingga No. 11 tidak ada memperoleh suara. Data diperoleh dari staf KPU Sumut, sesuai DPT ada 1.120 pemilih di dua TPS tersebut. Namun, pada TPS 18 terdata 581 , sedangkan suara tidak sah 5, sementara di TPS 40 sesuai DPT terdata 551 orang namun hingga pencoblosan ditutup pukul 13:00, pemilih yang mencoblos 372 dengan satu suara batal karena mencoblos pasangan No. 1 dan No. 6. Secara terpisah Komisioner KPU Deliserdang Zakaria Siregar yang dihubungi menjelaskan, soal Pilkada Deliserdang satu atau dua putaran, tergantung putusan Mahkamah Konstitusi (MK). ‘’KPU Deliserdang hanya melaksanakan putusan sela MK untuk melakukan pemungutan suara ulang di 2 TPS Desa Sei. Semayang. Karena Pilkada ini masih dalam sengketa di MK, KPU Deliserdang akan menyerahkan hasil penghitungan suara itu ke MK, sedangkan hasil finalnya juga menunggu putusan MK,’’ ungkap Zakaria.

Di saat-saat para pemilih melakukan pencoblosan, terjadi dua aksi protes dari kalangan warga. Protes pertama, terhadap posisi bilik suara,bilik pencoblosan yang memungkinkan warga melihat pemilih melakukan pencoblosan. Akibat protes tersebut suasana di TPS 40 sempat memanas, namun mereda setelah ada kesepakatan memindahkan meja tempat bilik pencoblosan tersebut. Aksi protes kedua, datangnya sekelompok kaum ibu membawa poster-poster karton bertuliskan kata-kata penolakan terhadap dilaksanakannya pemungutan suara ulang. Kaum ibu tersebut berteriak-teriak meminta pemungutan suara ulang tidak dilaksanakan karena diduga terjadi kecurangan-kecurangan serta telah ditemukannya surat suara yang hilang. Tetapi, aksi protes tersebut tidak berlangsung lama, dan kaum ibu itu membubarkan diri. Se d a n g k a n , p e n g h i tungan suara di TPS 18 dan 40 dimulai pukul 14:00. Saat penghitungan suara, di sekeliling kedua TPS tersebut mendapat pengawalan ketat polisi, dan ratusan warga yang menyaksikan pengitungan tersebut hingga selesai. Novum Ketua KPU Deliserdang, Moh. Yusri yang dikonfirmasi soal surat suara hilang yang ditemukan di ruang Polindes Kantor Kades Sei. Semayang, menyatakan, ditemukannya surat suara yang sempat hilang itu menjadi novum atau bukti baru dalam persidangan di MK. Masalah surat suara yang hilang itu tidak menjadi bagian dari pokok perkara yang disidangkan di MK. Untuk itu, kami segera laporkan ke MK dan berharap MK berlaku adil,’’kata Yusri. Cawabup Deliserdang H. Hardi Mulyono (pasangan nomor 6) yang ditemui di selasela berlangsungnya pemungutan suara ulang di TPS 40, menegaskan, tetap akan mengajukan gugatan ke MK. Hardi menilai pemungutan suara ulang di dua TPS Desa Sei. Semayang, Kec. Sunggal, tidak dengan bebas dan rahasia.

Sedangkan Cawabup Deliserdang (incumbent), H. Zainuddin MARS saat ditemui di rumah dinas Camat Sunggal, mengatakan, masyarakat Desa Sei.Semayang sudah makin dewasa dalam berdemokrasi. Sehingga, katanya, suara yang dihasilkan di dua TPS tersebut mudah-mudahan segera menyelesaikan masalah Pilkada yang sudah berlarutlarut. Namun, semua ini belum final karena hasilnya masih harus dilaporkan lagi ke MK. ‘’Jadi masih menunggu, apa hasil putusan MK nanti,’’ katanya. Terkait adanya keinginan pasangan lain akan mengajukan gugatan ke MK, Zainuddin menyatakan, hal itu sah-sah saja karena merupakan hak warga negara. Tunggu Laporan Informasi Waspada peroleh, Polresta Medan masih menunggu laporan dari Panitia Pengawas Pemilu (Panwaslu) Deliserdang terkait ditemukan surat suara Pilkada Deliserdang yang hilang dari dua TPS tersebut. “Masih menunggu laporan Panwaslu DS untuk memproses kasus tersebut,” kata Kasat Reskrim Kompol Jean Calvijn Simanjuntak dan memperkirakan, satu dua hari ini Panwaslu DS membuat laporan ke Polresta Medan. Sehingga untuk saat ini,kata Calvijn, pihaknya belum bisa melakukan penyidikan sampai Panwaslu membuat laporan polisi. (m34/m39)

Antara

PENAMBANG PASIR KELUD NEKAD: Sejumlah penambang pasir nekat beraktivitas di sungai Bladak yang mengalirkan lahar dingin gunung Kelud di Desa Gambar, Nglegok, Blitar, Jawa Timur, Rabu (19/2). Sejumlah penambang pasir di kawasan tersebut nekad melanjutkan aktivitas meski Badan Nasional Penanggulangan Bencana (BNPB) sudah mengimbau agar masyarakat tidak mendekati kawasan sekitar aliran lahar dingin gunung kelud.

lan Brandan, Rabu (19/2). Ia menjelaskan korban yang bernama Muhammad Dedi ditembak ketika hendak pergi ke ladang bersama dua rekannya. Kepada polisi korban mengaku dihadang oleh petugas saat menuju ladang yang berada di kawasan Taman Nasional Gunung Leuser bersama dua temannya. Karena petugas itu berkata “Jangan bergerak”, korban dan

dua temannya lari lalu terdengar dua suara tembakan. Bokong korban tertembak. Tambunan mengatakan polisi sedang meminta keterangan dari korban dan akan mengumpulkan bukti di lokasi penembakan. “Jadi duduk permasalahan yang sebenarnya masih harus kita dalami dulu untuk mencari tahu apa motif dibalik penembakan warga ini,” katanya.

Kepala BKPP Bireuen Dipukul OTK BIREUEN (Waspada): Kepala Badan Kepegawaian Pendidikan dan Pelatihan (BKPP) Kab. Bireuen M Isa dipukul orang tidak dikenal (OTK) di ruang kantornya, Rabu (19/2). pukul 10:45. Informasi Waspada himpun di lokasi kejadian, laki-laki itu datang mengendarai kereta bersama temannya dan parkir di halaman depan kantor BKPP di bagian barat kantor pusat Pemkab Bireuen. Disebut-sebut, dua pria itu masuk ke ruang sekretaris BKPP. Waktu itu, M Isa berada di sana berbicara dengan stafnya. Dua pria itu menghampiri M Isa, dan seorang di antaranya memukul wajah korban. Kemudian kabur. Aparat Polres Bireuen yang datang ke BKPP Bireuen setelah menerima laporan segera mengamankan M Isa dalam ruangannya.Personel Satpol PP Bireuen menjaga ketat ruangan itu.Penyebab pemukulan masih diselidiki polisi. (cb02/b17) Waspada/Feirizal Purba

Jawaban Problem Catur, TTS Dan Sudoku

KY: Ada Hakim ....

Dari Halaman Sport. Jawaban Problem Catur: 1. Mf8, Mg1+. 2. RxM, GxK atau Be8. 3. BxKg8+mat. Jawaban TTS: TTS

POLISI mengawal ketat sekeliling TPS 40 saat berlangsungnya penghitungan suara sekaitan pemungutan suara ulang di Desa Sei. Semayang, Kec. Sunggal, Kab. Deliserdang.

Olahraga

mengaku tidak mendengar, hanya ada bukti dari aduan pelapor, jadi tidak kuat. “Banyak laporan tentang hakim yang nakal tapi tidak disertakan alat bukti, inilah titik lemahnya. Di Papua juga ada, malah kami minta agar aduan hakim yang nakal disertakan bukti tapi sampai sekarang tidak ada balasannya, itu ada di Sorong, Merauke dan lainnya,” katanya. Eman sayangkan ada laporan aduan tentang hakim yang berperilaku nakal di Papua hanya saja tidak disertakan alat bukti. “Termasuk ada hakim yang menerima cenderamata dari para kepala daerah setempat. Saya tidak mau sebutkan, nanti jika bermasalah akan saya tanyakan itu,” katanya tanpa menyebutkan berapa jumlah hakim yang nakal di Papua.

Al Bayan ....

Jawaban Sudoku:

2 5 9 8 6 7 3 1 4

7 6 3 4 5 1 2 8 9

4 8 1 3 9 2 6 7 5

1 7 5 1 3 8 4 6 2

8 3 2 9 4 6 9 5 7

6 9 4 7 2 5 8 3 1

5 4 8 6 7 9 1 2 3

9 2 6 5 1 3 7 4 8

3 1 7 2 8 4 5 9 6

ketakutan dan kekalutan berkumpul dalam diri mereka yang ditimpa bencana. Manusia sangat kalut jika ditimpa musibah, orang tua kehilangan anak-anaknya, anak-anak juga kehilangan orang tuanya, Ada yang jatuh sambil berlari, ada yang menangis, ada yang berteriak minta tolong, dan yang paling mengharukan ketika orangorang lanjut usia (jompo) dan tunanetra yang ditinggalkan anak saudaranya. Semua nafsi-nafsi. Lalu Tsunami dahsyat menelan mereka, ada yang cedera, ada yang selamat bahkan yang paling banyak menjadi mayat. Hal serupa juga terjadi ketika gempa dan tsunami di Yogyakarta, Bom di Bali, Bom di Jakarta, Lumpur Panas di

Ke depan, Eman harapkan adanya dukungan pemerintah pusat untuk membuka kantor penghubung Komisi Yudisial di Papua. Sejak Selasa (19/2) pagi, Eman Suparman mantan ketua Komisi Yudisial itu berada di ibu kota Provinsi Papua, Kota Jayapura untuk menjadi salah satu pemateri dalam seminar transparansi yang diselenggarakan oleh The Jawa Pos Institute of pro Otonomi ( JPIP) yang disponsori oleh Usaid Indonesia. Acara itu sendiri ditujukan kepada insan pers di Kota Jayapura dengan tujuan memberikan pemahaman yang baik dan benar soal transparansi daerah soal pembangunan di segala bidang dan kebijakan lainnya dari lembaga atau instansi pemerintah yang menggunakan APBN atau APBD. Porong, meletus Gunung Berapi, Gunung Sinabung dan Gunung Kelud. Mengapa manusia kalut? Karena manusia takut bencana tersebut menimpanya, dan lebih takut lagi kehilangan nyawanya. Ketika kalut itulah, manusia merasakan perlu pertolongan Allah SWT. Di satu sisi bencana memang sudah tertulis dalam takdir Allah sehingga manusia tidak mungkin menolaknya. Allah berfirman: Tiada satu bencanapun yang menimpa di bumi dan tidak pula pada dirimu sendiri melainkan telah tertulis dalam kitab (Lauhul Mahfudz) sebelum Kami menciptakannya (QS. Alhadid: 22). Tetapi dalam Ilmu Tauhid juga dikatakan adanya takdir “ghairu lazim”, yakni takdir yang digeser atau diubah Allah

Kamis 20 Februari 2014

6.598 Tenaga Honorer K2 Aceh Lulus Tes CPNS

Masuk Ke TNGL, Seorang Pengungsi Ditembak LANGKAT (Antara): Seorang pengungsi Aceh yang bermukim di Sei Siminyak, Kec. Sei Lepan, Kab. Langkat, Sumatera Utara, ditembak di kawasan Taman Nasional Gunung Leuser (TNGL). Saat ini korban dirawat di Rumah Sakit Tanjung Selamat di Kec. Batangserangan. “Ada warga pengungsi Sei Lepan yang tertembak,” kata Kepolsek Pangkalan Brandan AKP SR Tambunan di Pangka-

WASPADA

Pemprovsu Dukung .... si sekitar kawasan,” papar Laurensius. Laurensius menambahkan, berbeda dengan Kualanamu yang masih memungkinkan untuk dikembangkan dengan konsep modern airport. Kombinasi antara airport city dengan kawasan terintegrasi yang menjadikan aerotropolis,” sebut Manurung yang optimis kawasan aerotropolis akan memberikan multiplier effect yang besar

Massa Tani .... sama, tetapi apa motifnya saya tidak tahu” ujarnya. Saat ini aparat kepolisian terdiri dari Sabhara Poldasu, Polres Deliserdang disiagakan di wilayah jalan masuk bandara. “Mereka disiagakan untuk mengantisipasi kemungkinan aksi susulan,” kata Wawan mengimbau masyarakat tidak terprovokasi oleh orang-orang tidak bertanggung jawab yang ingin membuat Sumut tidak kondusif.(m27) SWT karena sayang kepada hamba-Nya yang takwa. Sepanjang Sumatera dan Jawa, negeri ini terdapat ratusan Gunung Api melingkar ibarat cincin. Allah mampu menahan gunung api supaya tidak meletus, menahan laut agar tidak tsunami, menahan lempeng bumi agar tidak patah yang menyebabkan gempa. Bagaimana caranya supaya Allah menolong kita manusia? Tentu dengan cara kita beriman dan bertakwa kepada Allah SWT dengan sepenuh hati. Kita suburkan negeri ini dengan sinergi kebenaran dan kita lenyapkan sinergi kebatilan. Tetapi selama ini sinergi kebenaran dan kebatilan bercampur aduk seperti kopi dan susu. Cara-cara seperti itu justru mempercepat datangnya takdir Allah menimpa kita.

bagi perekonomian daerah. Begitupun, sebut Manurung, untuk mewujudkan konsep aerotropolis diperlukan dukungan Pemerintah Daerah terutama Peraturan Daerah tentang Rencana Tata Ru a n g Wi l a y a h . Ko n s e p pengembangan Kualanamu sebagai bandara aertropolis hendaknya masuk dalam RTRW Pemprovsu yang saat ini dalam proses finalisasi di Kemendagri. Manurung mereferensikan, bandara akan memberikan kontribusi 5 persen bagi produk Domestik Bruto (PDB) daerah. Namun jika dengan konsep aerotropolis akan memberikan dampak multiplier effect yang tinggi bagi perekonomian daerah, sehingga dapat memberi kontribusi diperkirakan 15-30 persen bagi PDB daerah. (m16)

Polisi Peras Warga .... permainan judi pertandingan bola. Infor masi dihimpun wartawan di lapangan, Rabu (19/2), dugaan pemerasan terhadap warga berinisial P terjadi 12 Januari 2014.P dituduh terlibat judi pertandingan liga sepakbola. Tim yang dipimpin Ipda B dengan anggota Bripka M,S dan R memaksa masuk ke dalam rumah P, selanjutnya melakukan pengancaman dan intimidasi sehingga membuat P ketakutan. Dalam keadaan terjepit terjadi tawar menawar .Para oknum tersebut minta sebesar Rp10 juta, namun kemampuan P hanya sebesar Rp5 juta. Transaksi penyerahan uang sebesar Rp5 juta dilakukan di Restoran Bunga Toba Hotel Op.Herti Balige Kanit Propam Polres Tobasa Iptu Bintang Simanungkalit yang dikonfirmasi via telepon selular mengatakan belum mengetahui peristiwa itu. (a22)

J A K A RTA ( Wa s p a d a ) : Sebanyak 6598 tenaga honorer kategori II (K2) dari 5 pemerintah kota,17 pemerintah kabupaten dan Pemerintah Provinsi Daerah Istimewa Aceh dinyatakan lulus tes Calon Pegawai Negeri Sipil (CPNS) oleh Panitia seleksi nasional (Panselnas) CPNS, Rabu (19/2) pagi. Dari data yang diumumkan, sebanyak 6.598 honorer K2 yang dinyatakan lulus itu, Kabupaten Aceh Utara berhasil meluluskan 808 orang dan merupakan jumlah terbesar di wilayah Provinsi Aceh. Posisi terbanyak berikutnya adalah Kabupaten Bieureun, Aceh Tamiang dan Aceh Timur. Sementara pemda yang jumlah kelulusan paling sedikit adalah Kota Subulussalam, yakni 32 orang. Seleng-

kapnya hasil tes CPNS dari jalur tenaga honorer K2 dapat diakses melalui cpns.menpan. go.id, dan sscn.bkn.go.id. Menteri Pendayagunaan Aparatur Negara dan Reformasi Birokrasi (PANRB) Azwar Abubakar dalam Raker dengan Pansus Guru DPD-RI, Rabu (19/2) mengatakan, setelah Aceh diumumkan berarti tinggal lima provinsi yang belum diumumkan, yakni NTT, Maluku, Maluku Utara, Papua Barat dan Papua. Sedangkan instansi pusat yang belum antara lain Kementerian Pendidikan dan Kebudayaan dan Kementerian Agama. Jumlah kelulusan honorer K-2 Aceh Pemer intah Aceh (42 orang), Kab. Aceh Besar (331 orang), Kab. Pidie (555 orang),

Kab. Aceh Utara (808 orang),Kab. Aceh Timur (649 orang), Kab. Aceh Barat (370 orang),Kab. Aceh Tengah (457orang), Kab. Aceh Tenggara (163 orang), Kab. Simeuleu (233 orang), Kab. Bieureun (674), Kab. Aceh Singkil (50 orang), Kab. Aceh Barat Daya (178 orang), Kab. Gayo Lues (174 orang), Kab. Aceh Tamiang (672 orang, Kab. Nagan Raya (234 orang), Kab. Aceh Jaya (74 orang), Kab. Bener Meriah (384 orang), Kab. Pidie Jaya (124 orang), Kota Sabang (37 orang), Kota Banda Aceh (72 orang), Kota Langsa (58 orang),Kota Lhokseumawe (227) orang dan Kota Subulussalam (32 orang). Jumlah yang semua diterima 6.598 orang.

Lahar Dan Erupsi ....

sekitar lereng Gunung Kelud. “Sekitar 50 juta meter kubik lahar dingin kini berada di sekitar lereng Gunung Kelud, apalagi akibat cuaca terakhir ini mudah jadi banjir lahar dingin,” kata Kepala Pusat Data Informasi dan Humas BNPB Sutopo Purwo Nugroho melalui pesan singkat di Jakarta, kemarin. Sutopo menjelaskan hujan deras yang menguyur wilayah Gunung Kelud sejak pukul 15.00, telah menyebabkan banjir lahar dingin di sungaisungai di daerah Kabupaten Kediri dan Kabupaten Malang. Lahar dingin tersebut membawa material pasir, batu, dan kayu. “Tentu saja 50 juta meter kubik tersebut tidak akan terjadi sekaligus. Tergantung dari hujan yang terjadi,” jelas dia. Ratusan orang terjebak Sedikitnya 300 orang warga Desa Pandansari, Kabupaten Malang, Jawa Timur, terjebak dan terisolasi akibat jembatan desa yang terputus diterjang lahar dingin Gunung Kelud, Rabu. Menurut Kepala Bagian Tan g g a p D ar ur at B ad an Penanggulangan Bencana Daerah (BPBD) Kabupaten Malang, Bagyo Setyono, ada

sekitar 300 warga di Dusun Selangon, Desa Pandansari, Kecamatan Ngantang, yang sampai sekarang masih terjebak banjir. “Sebenar nya, kondisi mereka berada di titik aman dari erupsi Gunung Kelud. Namun, terjangan banjir lahar dingin membuat warga tidak bisa keluar dari dusun itu. Kami dan anggota TNI dan relawan mencari jalur alternatif untuk memasok logistik ke dusun itu,” katanya. Ja l u r m e n u j u D u s u n Selangon, Desa Pandansari, tersebut kembali diguyur hujan lebat yang disertai angin kencang, bahkan sebagian wilayah Kecamatan Kasembon dan Pujon pun juga diguyur hujan sehingga cuaca sangat dingin. Guyuran hujan lebat dan angin kencang tersebut telah memutus jembatan hingga akses ke Dusun Selangon terputus. Sementara itu pasukan Divisi Kostrad di Singosari juga dikerahkan untuk menyelamatkan warga Pandansari tersebut. “Kami sudah mengerahkan satu truk pasukan Kostrad ke lokasi,” kata Pangdiv Kostrad Mayjend Agus Kriswanto.

berapa kerugian akibat kebakaran lahan dan hutan itu, karena data resmi dari dinas terkait seperti Dinas Kehutanan dan Perkebunan (Dushutbun) belum ada. Kebakaran lahan dan hutan di pantai barat Kab. Mandailing Natal sulit dipantau, karena umumnya merupakan lahan jenis gambut ditanami sawit. Rembetan api kebakaran telah menghaguskan 25 unit milik warga di Kecamatan Muara Batanggadis. “Kebakaran tidak terpantau akibat lahan gambut. Di gambut itu, api kadang tidak terlihat di permukaan, namun tiba-tiba api sudah menyala, sehingga kita sangat memerlukan penambahan armada untuk mengantisipasi titik-titik api di pemukiman warga,” ucapnya. Menurutnya, data sementara yang ada merupakann

estimasi berdasarkan laporan Muspika Muara Batanggadis. Kobaran api terus menyebar sehingga luas lahan dan hutan terbakar mendekati 1.000 hektar dan merembet ke pemukiman penduduk. Camat Muara Batanggadis Zulham Efendi yang dihubungi via telepon seluler, membenarkan adanya rumah warga yang terbakar dikarenakan meluasnya kebakaran hutan dan perkebunan di wilayah itu. Sementara anggota DPRD Madina dari Komisi II Ilyas Siswadi mengaku prihatin terhadap musibah kebakaran tersebut. “Pemkab Madina harus segera membuat tim investigasi ke lapangan terkait kebakaran perkebunan swasta yang ada di Muara Batanggadis, sehingga diketahui asal muasal api tersebut,” tuturnya. (a28)

cana Gunung Berapi USAID terus memberikan bantuan teknis dan peralatan kepada Pusat Vulkanologi dan Mitigasi Bencana Geologi (PVMBG) guna mendukung pemantauan dan tanggap darurat letusan gunung berapi di daerah Sinabung. Peralatan tersebut membentuk jaringan pemantau seismik dan digunakan oleh PVMBG untuk mendirikan tiga stasiun lapangan seismik dan sebuah stasiun pangkalan untuk pemantauan gunung berapi secara langsung dan memberikan informasi seketika kepada masyarakat di sekitar gunung berapi dan membantu menyelamatkan jiwa.

Beberapa hari sebelumnya, Panglima Komando Militer AS Kawasan Pasifik (PACOM), Laksamana Samuel J. Locklear, menyatakan simpati kepada masyarakat yang terkena dampak letusan gunung Sinabung di Kabupaten Karo, Sumatera Utara. Maka, militer AS yang dia pimpin siap membantu bila diperlukan. “Perkenankan saya memberikan simpati dan doa kepada masyarakat di Sumatera Utara yang terkena dampak letusan gunung itu, yang telah memakan korban jiwa. Kami siap membantu semampu mungkin,” kata Laksamana Locklear dalam kunjungan singkat di Jakarta, Kamis (6/2). (vn)

KUHAP dan RUU KUHP yang dipimpin Aziz Syamsudin dengan 26 orang anggota dari berbagai fraksi. Panja telah memanggil sejumlah pihak terkait, kecuali KPK untuk membahas RUU KUHAP. RUU KUHP memuat 766 pasal atau bertambah 197 pasal dari KUHP lama yang hanya memuat 569 pasal. Setidaknya ada 12 isu penting yang yang menjadi polemik dalam RUU KUHAP yang berpotensi melemahkan atau memangkas kewenangan KPK yaitu pertama, dihapuskannya ketentuan penyelidikan, kedua KUHAP berlaku terhadap tindak pidana yang diatur di luar KUHP (Kitab Undang-undang Hukum Pidana), ketiga penghentikan penuntutan suatu perkara, keempat tidak memiliki kewenangan perpanjangan penahanan pada tahap penyidikan, kelima masa penahanan

kepada tersangka lebih singkat. Keenam, hakim dapat menangguhkan penahanan yang dilakukan penyidik, ketujuh penyitaan harus izin dari hakim, kedelapan penyadapan harus mendapat izin hakim, kesembilang penyadapan (dalam keadaan mendesak) dapat dibatalkan oleh hakim, kesepuluh putusan bebas tidak dapat diajukan kasasi kepada Mahkamah Agung. Kesebelas putusan Mahkamah Agung tidak boleh lebih berat dari putusan pengadilan tinggi, dan terakhir ketentuan pembuktian terbalik tidak diatur. Menur ut data Koalisi Masyarakat Sipil Antikorupsi dan Reformasi Hukum, hanya ada 12-13 orang yang hadir dari anggota panitia kerja dalam proses pembahasan RUU KUHAP di DPR.

jatuh di puncak dan bila diguyur hujan deras akan bisa turun dan kalau turunnya material itu mirip banjir bandang akan bsa merusak segalanya seperti kereta api menabrak benda apapun tanpa henti,” katanya. Buktinya, lahar dingin Kelud dilaporkan sudah memutus jembatan, merusak tanaman siap panen, bangunan dan infrastruktur lainnya. “Ibarat banjir bandang, awalnya memang kecil tapi lama kelamaan akan membesar dan sangat erosif (merusak), apalagi kalau membawa batuan besar, sehingga lahar dingin itu bisa sangat mengerikan,” katanya. Selain ditentukan perubahan status gunung dari Awas ke Siaga, ia menambahkan tingkat bahaya Kelud juga sangat ditentukan hujan yang melanda puncak Kelud. “Selama hujan belum berhenti, berarti lahar di atas masih mungkin turun dan membahayakan siapapun,” katanya. Simpan 50 Juta M3 Sementara itu pascaerupsi Gunung Kelud diperkirakan ada sekitar 50 juta meter kubik material lahar yang berada di

Titik Api .... Dikatakan, akibat lahan gambut, titik api sulit untuk diperediksi dan dipadamkan, namun pihaknya terus melakukan pemantauan di lapangan untuk meminimalisir kebakaran yang meluas pemukiman warga. “Sampai saat ini mobil pemadam (Damkar) milik BPBD Madina masih kita tempatkan di Muara Batang Gadis. Ini dilakukan untuk mengantisipasi meluasnya titik api ke pemukiman penduduk,” ungkapnya. Pihak BPBD telah membuat nota dinas kepada Plt Bupati Mandailing Natal tentang kebakaran lahan dan hutan yang sudah meluas ke areal pemukiman warga untuk ditetapkan sebagai siaga darurat. Menjawab wartawan, Sektetaris BPBD Madina itu belum dapat memperkirakan

AS Bantu .... bantuan yang diberikan oleh rakyat Amerika akan memberikan ketenangan sampai saat mereka dapat meninggalkan tempat evakuasi, “kata Duta Besar AS, Robert Blake. Melalui Kantor Urusan Bantuan Bencana Luar Negeri AS Badan Pembangunan Internasional AS (USAID), kontribusi baru ini akan mendukung pengelolaan logistik darurat BNPB untuk bencana Sinabung. Bantuan tersebut akan digunakan untuk melatih dan membimbing staf BNPB, dan memastikan bantuan tanggap darurat yang efektif terhadap masyarakat yang mengungsi akibat letusan. Program Bantuan Ben-

KPK Surati .... bekerja, kalau UU materilnya belum diatur bagaimana UU formilnya (KUHAP) diatur? Nanti itu kan berbahaya bisa tumpang tindih, saling mengikari,” ungkap Bambang. Surat KPK tersebut memuat dua lampiran dan satu pengantar. “Isi penghantarnya itu posisi KPK terhadap revisi, usulan KPK, kemudian materi eksekutifnya, KPK minta agar revisi ini ditunda karena tidak bisa dikerjakan di bawah 100 hari,” jelas Bambang. RUU KUHAP dan KUHP diserahkan Kementerian Hukum dan HAM kepada Komisi Hukum DPR pada 6 Maret 2013, kedua rancangan regulasi tersebut masuk ke dalam prioritas Program Legislasi Nasional periode 2009-2014. Setelah menerima kedua naskah itu, DPR membentuk Panja Pembahasan RUU

(ant/Humas Kementerian PAN-RB)


Berita Utama

A2 PANGKEP (Antara): Presiden Susilo Bambang Yudhoyono mengatakan, pemilihan umum merupakan sebuah keniscayaan dalam kehidupan berdemokrasi, sehingga bukanlah menjadi sesuatu hal yang harus ditakuti. “Pemilu bukanlah sesuatu yang harus ditakuti, tidak usah diseram-seramkan,” kata Presiden dalam acara peresmian Pabrik Semen PT Tonasa Unit V, di Pangkep, Sulawesi Selatan, Rabu (19/2). Ia mengingatkan, beberapa kali pelaksanaan Pemilu di Indonesia, ternyata berjalan tertib aman dan demokratis serta dunia internasional juga memberikan pujian. Untuk itu, ujar dia, berbagai pihak diminta dapat menyelenggarakan Pemilu dengan niat yang sama dan menjaga agar situasi sosial dan politik tetap terjaga dengan baik.

Masuk Ke TNGL, Seorang Pengungsi Ditembak

Coba Duduki KNIA, ... Deliserdang, Rabu sekira pukul 10:00, ada 500-an massa mengaku kelompok tani Cerdas dari tiga desa, yaitu Desa Bandarsetia, Desa Percut dan Desa Kolam, Kecamatan Percut Seituan, bergerak dari Desa Batangkuis mengarah ke bandara. Tujuannya menduduki wilayah bandara. Saat itu petugas yang telah berjaga-jaga berusaha melakukan upaya persuasif agar massa tidak menggelar aksi di pintu gerbang bandara, namun massa bersikeras untuk tetap menggelar aksi. “Tindakan persuasif aparat kepolisian diabaikan massa dengan melakukan perlawanan, sehingga dilakukan penangkapan,” sebut Wawan. Mengenai motif para pengunjukrasa hendak menduduki wilayah bandara, Wawan mengaku belum mengetahuinya. “Motifnya belum jelas, masih dalam penyelidikan. Tetapi info awal mereka hendak menguasai bandara,” ujar Wawan mengatakan tidak ada alasan massa datang ke bandara. “Tetapi kalau mereka datang ke bandara hendak menggunakan maskapai penerbangan silakan saja,” katanya. Dia menyebutkan, sehari sebelumnya Polres Deliserdang juga mengamankan sejumlah pria diduga hendak melakukan aksi sama. “Saya dapat info ada beberapa orang ditahan di Polres karena hendak melakukan aksi yang sama, tetapi apa motifnya saya tidak tahu,” ujarnya. Saat ini aparat kepolisian terdiri dari Sabhara Poldasu, Polres Deliserdang disiagakan di wilayah jalan masuk bandara. “Mereka disiagakan untuk mengantisipasi kemungkinan aksi susulan,” kata Wawan mengimbau masyarakat tidak terprovokasi oleh orang-orang tidak bertanggung jawab yang ingin membuat Sumut tidak kondusif.(m27)

Lahar Dan Erupsi Kelud ... Menurut Ketua Pusat Studi Kebumian, Bencana, dan Perubahan Iklim (PSKBPI) ITS Surabaya itu, instruksi PVMBG itu harus dipatuhi hingga ada penurunan status Kelud dari Awas menjadi Siaga. “Selama mereka masih mencatat tingginya tingkat kegempaan, ya Kelud masih berbahaya,” katanya. Berdasarkan pengamatannya, lahar dingin yang berasal dari campuran pasir, air, batu, dan lumpur itu tetap berbahaya, karena material yang sama itulah yang telah memporakporandakan Pacet (Mojokerto) dan Situbondo pada beberapa tahun lalu.“Saya yakin, saat Kelud meletus itu ada material yang jatuh di puncak dan bila diguyur hujan deras akan bisa turun dan kalau turunnya material itu mirip banjir bandang akan bisa merusak segalanya seperti kereta api menabrak benda apapun tanpa henti,” katanya. Buktinya, lahar dingin Kelud dilaporkan sudah memutus jembatan, merusak tanaman siap panen, bangunan dan infrastruktur lainnya. “Ibarat banjir bandang, awalnya memang kecil tapi lama kelamaan akan membesar dan sangat erosif (merusak), apalagi kalau membawa batuan besar, sehingga lahar dingin itu bisa sangat mengerikan,” katanya. Selain ditentukan perubahan status gunung dari Awas ke Siaga, ia menambahkan tingkat bahaya Kelud juga sangat ditentukan hujan yang melanda puncak Kelud. “Selama hujan belum berhenti, berarti lahar di atas masih mungkin turun dan membahayakan siapapun,” katanya. Jawaban Problem Catur, Simpan 50 Juta M3 Sementara itu pascaerupsi TTS Dan Sudoku diperkirakan ada sekitar 50 juta meter kubik material lahar yang Dari Halaman Sport. berada di sekitar lereng Gunung Kelud. “Sekitar 50 juta meter kubik Jawaban Problem Catur: lahar dingin kini berada di sekitar lereng Gunung Kelud, apa1. Mf8, Mg1+. lagi akibat cuaca terakhir ini mudah jadi banjir lahar dingin,” 2. RxM, GxK kata Kepala Pusat Data Informasi dan Humas BNPB Sutopo atau Be8. Purwo Nugroho melalui pesan 3. BxKg8+mat. singkat di Jakarta, kemarin. Sutopo menjelaskan hujan deras yang menguyur wilayah Gunung Kelud sejak pukul 15.00, Jawaban TTS: telah menyebabkan banjir lahar dingin di sungai-sungai di daeTTS Olahraga rah Kab. Kediri dan Kabupaten Malang. Lahar dingin tersebut membawa material pasir, batu, dan kayu. “Tentu saja 50 juta meter kubik tersebut tidak akan terjadi sekaligus. Tergantung dari hujan yang terjadi,” jelas dia.

Pemprovsu Dukung ...

Jawaban Sudoku:

2 5 9 8 6 7 3 1 4

7 6 3 4 5 1 2 8 9

4 8 1 3 9 2 6 7 5

1 7 5 1 3 8 4 6 2

8 3 2 9 4 6 9 5 7

6 9 4 7 2 5 8 3 1

5 4 8 6 7 9 1 2 3

9 2 6 5 1 3 7 4 8

3 1 7 2 8 4 5 9 6

Begitupun, sebut Manurung, untuk mewujudkan konsep aerotropolis diperlukan dukungan Pemerintah Daerah terutama Peraturan Daerah tentang Rencana Tata Ruang Wilayah. Konsep pengembangan Kualanamu sebagai bandara aertropolis hendaknya masuk dalam RTRW Pemprovsu yang saat ini dalam proses finalisasi di Kemendagri. Manurung mereferensikan, bandara akan memberikan kontribusi 5 persen bagi produk Domestik Bruto (PDB) daerah. Namun jika dengan konsep aerotropolis akan memberikan dampak multiplier effect yang tinggi bagi perekonomian daerah, sehingga dapat memberi kontribusi diperkirakan 15-30 persen bagi PDB daerah. (m16/m28)

Kamis 20 Februari 2014

AS Bantu 200 Ribu Dolar Tanggap Darurat Sinabung

Presiden: Pemilu Tak Perlu Ditakuti

LANGKAT (Antara): Seorang pengungsi Aceh yang bermukim di Sei Siminyak, Kec. Sei Lepan, Kab. Langkat, Sumatera Utara, ditembak di kawasan Taman Nasional Gunung Leuser (TNGL). Saat ini korban dirawat di Rumah Sakit Tanjung Selamat di Kec. Batangserangan. “Ada warga pengungsi Sei Lepan yang tertembak,” kata Kepolsek Pangkalan Brandan AKP SR Tambunan di Pangkalan Brandan, Rabu (19/2). Ia menjelaskan korban yang bernama Muhammad Dedi ditembak ketika hendak pergi ke ladang bersama dua rekannya. Kepada polisi korban mengaku dihadang oleh petugas saat menuju ladang yang berada di kawasan Taman Nasional Gunung Leuser bersama dua temannya. Karena petugas itu berkata “Jangan bergerak”, korban dan dua temannya lari lalu terdengar dua suara tembakan. Bokong korban tertembak. Tambunan mengatakan polisi sedang meminta keterangan dari korban dan akan mengumpulkan bukti di lokasi penembakan. “Jadi duduk permasalahan yang sebenarnya masih harus kita dalami dulu untuk mencari tahu apa motif dibalik penembakan warga ini,” katanya.

WASPADA

Antara

KEBAKARAN HUTAN ANCAM PEMUKIMAN WARGA: Warga melihat api yang membakar lahan gambut di kawasan Jalan Parit Indah, Pekanbaru, Riau, Rabu (19/2). Kebakaran hutan dan lahan yang semakin meluas itu kini mulai mengancam pemukiman warga.

Asap Riau Selimuti Medan MEDAN (Waspada) : BMKG Wilayah I mencatat, asap tipis yang ditimbulkan kebakaran lahan dan hutan di Riau sudah berembus ke Sumatera Utara, khususnya Medan. Namun sampai Rabu(19/2) belum mengganggu pergerakan penerbangan di Kualanamu International Airport (KNIA). Sementara itu, titik api (hot spot) yang muncul di kawasan Sumut berdasarkan pantauan satelit Terra dan Aqua, Selasa (18/2), mencapai 15 titik tersebar di beberapa daerah. Mega Sirait, SP, kepala Sek-

si Data dan Informasi pada Badan Meteorologi Klimatologi dan Geofisika (BMKG) Wilayah I stasiun Bandara Kualanamu, saat dikonfirmasi, Rabu membenarkan. Katanya, berdasarkan data, jarak tembus pandang di kawasan Medan bahkan KNIA mencapai 800 hingga 3000 meter, belum terimbas kepada pergerakan penerbangan di KNIA. “Penerbangan masih aman,” ujar Mega, dan menambahkan, asap yang terlihat saat ini, merupakan akumulasi asap selama beberapa hari sebelumnya, dimana

asap tetap bertahan di udara karena tidak ada hujan yang membawa asap turun ke permukaan. Menurut Mega, kawasan Riau termasuk daerah terparah setiap tahun kebakaran hutan seperti di kawasan Kota Dumai, Bengkalis dan Rokan Hilir yang terpantau dari satelit Terra. Sedangkan, di Sumatera Utara kawasan kebakaran terluas yaitu di Mandailing Natal, Tapanuli Selatan dan Tapanuli Tengah. Di Aceh yang terparah kekeringan di Aceh Barat, Aceh Jaya dan Singkil. (m32)

KPK Surati Presiden ...

memuat 569 pasal. Setidaknya ada 12 isu penting yang yang menjadi polemik dalam RUU KUHAP yang berpotensi melemahkan atau memangkas kewenangan KPK yaitu pertama, dihapuskannya ketentuan penyelidikan. Kedua, KUHAP berlaku terhadap tindak pidana yang diatur di luar KUHP (Kitab Undang-undang Hukum Pidana). Ketiga, penghentikan penuntutan suatu perkara.Keempat tidak memiliki kewenangan perpanjangan penahanan pada tahap penyidikan.Kelima masa penahanan kepada tersangka lebih singkat. Keenam, hakim dapat menangguhkan penahanan yang dilakukan penyidik.Ketujuh, penyitaan harus izin dari hakim.Kedelapan, penyadapan harus mendapat izin hakim. Kesembilan, penyadapan (dalam keadaan mendesak) dapat dibatalkan oleh hakim. Kesepuluh, putusan bebas tidak dapat diajukan kasasi kepada Mahkamah Agung. Kesebelas putusan Mahkamah Agung tidak boleh lebih berat dari putusan pengadilan tinggi, dan terakhir ketentuan pembuktian terbalik tidak diatur. Menurut data Koalisi Masyarakat Sipil Antikorupsi dan Reformasi Hukum, hanya ada 12-13 orang yang hadir dari anggota panitia kerja dalam proses pembahasan RUU KUHAP di DPR. Akan “Berlari” Meski Satu Kaki Ketua Komisi Pemberantasan Korupsi (KPK) Abraham Samad mengatakan, KPK tetap akan “berlari” memberantas

korupsi meski hanya dengan satu kaki, seiring pembahasan RUU KUHP dan KUHAP yang mengarah kepada pelemahan komisi ini. “Kami akan tetap berjalan di jalurnya meski ada pihak yang berkepentingan untuk memotong sebelah kaki KPK sehingga lari tertatih. Insya Allah kami tetap berjalan dengan sebelah kaki,” kata Abraham di kantor KPK, Jakarta, Rabu (19/2). Lebih lanjut Ketua KPK mengatakan, publik tidak perlu khawatir terhadap potensi mandeknya upaya pembongkaran korupsi seiring kemungkinan pembahasan RUU KUHP dan KUHAP yang akan terus berlangsung. “Tidak usah khawatir pada kemungkinan tidak berjalannya upaya membongkar korupsi,” katanya. Meski begitu, KPK akan tetap mengupayakan pencegahan potensi pelemahan terhadap KPK dengan berupaya menunda pembahasan itu. ”Surat sudah kami kirimkan hari ini ke pemerintah dan DPR. Tentu kami tunggu res-pon dari presiden dan seyogya-nya kita berpikir positif bahwa rekomendasi yang diajukan KPK itu Insya Allah mungkin diikuti. Paling tidak pemerintah ambil langkah yang lebih konstruktif bukan destruktif seperti dengan menunda atau menarik pembahasan itu.” “KPK dalam posisi menunggu apakah surat yang direkomendaasikan ditindaklanjuti pemerintah. Kami berharap bahwa langkah-langkah pemberantasan korupsi berjalan dengan kecepatan yang diinginkan,” katanya.

data 581, sedangkan suara tidak sah 5, sementara di TPS 40 sesuai DPT terdata 551 orang namun hingga pencoblosan ditutup pukul 13:00, pemilih yang mencoblos 372 dengan satu suara batal karena mencoblos pasangan No. 1 dan No. 6. Secara terpisah Komisioner KPU Deliserdang Zakaria Siregar yang dihubungi menjelaskan, soal Pilkada Deliserdang satu atau dua putaran, tergantung putusan Mahkamah Konstitusi (MK). ‘’KPU Deliserdang hanya melaksanakan putusan sela MK untuk melakukan pemungutan suara ulang di 2 TPS Desa Sei. Semayang. Karena Pilkada ini masih dalam sengketa di MK, KPU Deliserdang akan menyerahkan hasil penghitungan suara itu ke MK, sedangkan hasil finalnya juga menunggu putusan MK,’’ungkap Zakaria. Di saat-saat para pemilih melakukan pencoblosan, terjadi dua aksi protes dari kalangan warga. Protes pertama, terhadap posisi bilik suara,bilik pencoblosan yang memungkinkan warga melihat pemilih melakukan pencoblosan. Akibat protes tersebut suasana di TPS 40 sempat memanas, namun mereda setelah ada kesepakatan memindahkan meja tempat bilik pencoblosan tersebut. Aksi protes kedua, datangnya sekelompok kaum ibu membawa poster-poster karton bertuliskan kata-kata penolakan terhadap dilaksanakannya pemungutan suara ulang. Kaum ibu tersebut berteriak-teriak meminta pemungutan suara ulang tidak dilaksanakan karena diduga terjadi kecurangan-kecurangan serta telah ditemukannya surat suara yang hilang. Tetapi, aksi protes tersebut tidak berlangsung lama, dan kaum ibu itu membubarkan diri. Sedangkan, penghitungan suara di TPS 18 dan 40 dimulai pukul 14:00. Saat penghitungan

suara, di sekeliling kedua TPS tersebut mendapat pengawalan ketat polisi, dan ratusan warga yang menyaksikan penghitungan tersebut hingga selesai. Novum Ketua KPU Deliserdang, Moh. Yusri yang dikonfirmasi soal surat suara hilang yang ditemukan di ruang Kantor Kades Sei. Semayang, menyatakan, ditemukannya surat suara yang sempat hilang itu menjadi novum atau bukti baru dalam persidangan di MK. Masalah surat suara yang hilang itu tidak menjadi bagian dari pokok perkara yang disidangkan di MK. ‘’Untuk itu, kami segera laporkan ke MK dan berharap MK berlaku adil,’’kata Yusri. Cawabup Deliserdang H. Hardi Mulyono (pasangan nomor 6) yang ditemui di selasela berlangsungnya pemungutan suara ulang di TPS 40, menegaskan, tetap akan mengajukan gugatan ke MK.Hardi menilai pemungutan suara ulang di dua TPS Desa Sei. Semayang, Kec. Sunggal, tidak dengan bebas dan rahasia. Sedangkan Cawabup Deliserdang (incumbent), H. Zainuddin Mars saat ditemui di rumah dinas Camat Sunggal, mengatakan, masyarakat Desa Sei.Semayang sudah makin dewasa dalam berdemokrasi. Sehingga, katanya, suara yang dihasilkan di dua TPS tersebut mudah-mudahan segera menyelesaikan masalah Pilkada yang sudah berlarut-larut. Namun, semua ini belum final karena hasilnya masih harus dilaporkan lagi ke MK. ‘’ Jadi masih menunggu, apa hasil putusan MK nanti,’’ katanya. Terkait adanya keinginan pasangan lain akan mengajukan gugatan ke MK, Zainuddin menyatakan, hal itu sah-sah saja karena merupakan hak warga Negara. (m34/m39/m40)

Sebelumnya Wakil Ketua KPK Bambang Widjojanto mengatakan bahwa revisi tersebut ditunda karena tidak bisa dikerjakan bila hanya memiliki waktu di bawah 100 hari menjelang Pemilu. “Pembahasan KUHP-nya harus terlebih dahulu karena UU materil, bila formil mengatur bagaimana UU materil bekerja, kalau UU materilnya belum diatur bagaimana UU formilnya (KUHAP) diatur? Nanti itu kan berbahaya bisa tumpang tindih, saling mengikari,” ungkap Bambang. Surat KPK tersebut memuat dua lampiran dan satu pengantar. “Isi penghantarnya itu posisi KPK terhadap revisi, usulan KPK, kemudian materi eksekutifnya, KPK minta agar revisi ini ditunda karena tidak bisa dikerjakan di bawah 100 hari,” jelas Bambang. RUU KUHAP dan KUHP diserahkan Kementerian Hukum dan HAM kepada Komisi Hukum DPR pada 6 Maret 2013, kedua rancangan regulasi tersebut masuk ke dalam prioritas Program Legislasi Nasional periode 2009-2014. Setelah menerima kedua naskah itu, DPR membentuk Panja Pembahasan RUU KUHAP dan RUU KUHP yang dipimpin Aziz Syamsudin dengan 26 orang anggota dari berbagai fraksi. Panja telah memanggil sejumlah pihak terkait, kecuali KPK untuk membahas RUU KUHAP. RUU KUHP memuat 766 pasal atau bertambah 197 pasal dari KUHP lama yang hanya

Pasangan AZAN ... Deliserdang, juga 4 Komisioner KPU Sumut, yakni Mulia Banurea (ketua), Yulhasni, Benget Silitonga dan Evi Novida Ginting,Ketua Bawaslu Sumut Syafrida R.Rasahan dan Aulia Andri dan Kapolresta Medan Kombes Nico Afinta karo-karo Sik, SH, MH memantau langsung pemungutan suara ulang tersebut. Siangnya, hadir Sekdaprovsu Nurdin Lubis didampingi Asisten Umum Hasiolan Silaen, Kaban Kesbanglinmas Provsu Eddy Syofian meninjau TPS 40. Secara terpisah, Bupati Deliserdang H Amri Tambunan bersama Wabup Zainuddin Mars (calon Wabup incumbent) beserta staf hadir di Kantor Camat Sunggal. Hasil penghitungan sementara di dua TPS tersebut pasangan nomor 1 H. Azhari Tambunan – H. Zainuddin Mars (AZAN) memperoleh 496 suara, pasangan Drs Akhmad Tala’a – H. Hardi Mulyono memperoleh 198 suara. Secara rinci menurut catatan staf KPU Provinsi Sumut, pada TPS 18 pasangan AZAN memperoleh 251 suara dan TPS 40 memperoleh 245 suara, pasangan No. 2 tidak memperoleh suara, pasangan No. 4 di TPS 18 tidak memperoleh suara namun mendapat 1 suara di TPS 40, pasangan No. 4 di TPS 18 peroleh 1 suara di TPS 40 tidak peroleh suara, pasangan No. 5 tidak memperoleh suara di dua TPS tersebut, pasangan No. 6 di TPS 18 peroleh 76 suara dan di TPS 40 peroleh 122 suara, pasangan No. 7 di TPS 18 tidak memperoleh suara namun di TPS 40 mendapat 1 suara. Selanjutnya, pasangan No. 8 hingga No. 11 tidak ada memperoleh suara. Data diperoleh dari staf KPU Sumut, sesuai DPT ada 1.120 pemilih di dua TPS tersebut. Namun, pada TPS 18 ter-

JAKARTA (Waspada): Pemerintah Amerika Seriat melalui Duta Besarnya untuk Indonesia Robert Blake, memberi bantuan tambahan untuk tanggap darurat bencana letusan Gunung Sinabung di Sumatera Utara. Bantuan sebesar 200.000 dolar AS itu dalam bentuk dukungan logistik. Dalam keterangan tertulis, Rabu (19/2) Pemerintah AS memberikan dukungan operasional dan logistik melalui Badan Nasional Penanggulangan Bencana (BNPB), yang terus mengelola tindakan tanggap

darurat karena letusan Gunung Sinabung di Kab. Karo dan memberikan bantuan kepada masyarakat yang terkena dampak bencana. Pendanaan ini merupakan tambahan dari bantuan 100.000 dolar AS yang telah diberikan sebelumnya pada tanggal 6 Februari untuk menyediakan pasokan dasar bagi mereka yang tinggal di penampungan dan menderita karena terjadinya letusan. “Untuk masyarakat yang terpaksa mengungsi dari rumahnya, saya berharap bantuan yang diberikan oleh rakyat

Amerika akan memberikan ketenangan sampai saat mereka dapat meninggalkan tempat evakuasi, “kata Duta Besar AS, Robert Blake. Melalui Kantor Urusan Bantuan Bencana Luar Negeri AS Badan Pembangunan Internasional AS (USAID), kontribusi baru ini akan mendukung pengelolaan logistik darurat BNPB untuk bencana Sinabung. Bantuan tersebut akan digunakan untuk melatih dan membimbing staf BNPB, dan memastikan bantuan tanggap darurat yang efektif terhadap masyarakat yang mengungsi akibat letusan. (vn)

Komisi III Perhatikan Keberatan KPK Terkait Pembahasan RUU KUHP-KUHAP JAKARTA (Waspada): Komisi III DPR RI memberikan perhatian khusus terhadap surat permintaan Komisi Pemberantasan Korupsi (KPK) agar pembahasan Revisi UndangUndang Kitab Undang-Undang Hukum Acara Pidana dan Kitab Undang-Undang Hukum Pidana (RUU KUHAP dan KUHP) dihentikan. Dalam rapat panitia kerja (Panja) RUU KUHP yang dipimpin Wakil Ketua Komisi III Al Muzammil Yusuf , Rabu (19/2) memberikan kesempatan kepada seluruh fraksi memberikan tanggapan terhadap surat tersebut. “Saya melihat surat ini ada di meja saya siang ini pukul 13:00 WIB, jadi ditujukan kepada Presiden SBY ditembuskan kepada 6 pihak termasuk kepada DPR. Kita perlu menanggapi perkembangan ini sebelum memulai rapat,” ujar Muzammil di Gedung DPR, Jakarta. Menanggapi hal itu anggota Komisi III dari Fraksi Partai Demokrat Harry Witjaksono mengatakan surat keberatan dari KPK tersebut tidak ada pengaruhnya karena yang terlibat dalam pembahasan adalah Pemerintah bersama DPR. “Jadi selama pemerintah masih ada disini, kita lanjutkan pembahasannya,”ujarnya. Sedangkan anggota Komisi III dari Fraksi Partai Golkar Nudirman Munir mengingatkan kondisi yang berkembang sekarang adalah akibat pemberitaan media yang mengekpos beberapa pasal dalam RUU KUHP dan KUHAP, melemahkan KPK. Menurutnya, pandangan tersebut tidak benar dan bisa jadi

dilontarkan oleh pihak-pihak yang tidak senang proses pembahasan RUU ini berlangsung. “Dalam banyak kesempatan, kita sudah tegaskan KPK itu adalah lex specialis, jadi tidak ada upaya melemahkan KPK dengan pembahasan ini. Yang lebih berbahaya adalah apabila pembahasan RUU KUHP/KUHAP yang merupakan warisan penjajah Belanda ini tertunda karena banyak pihak yang diuntungkan dengan KUHAP yang ada sekarang,” tandasnya.

Polisi Diminta Usut ...

sehari sebelum pemungutan suara ulang di 2 TPS, surat suara yang sempat hilang ditemukan di Kantor Desa. Pertama sekali diketahui oleh Komisioner KPU Deliserdang, Fajar Pasaribu yang mengawal distribusi logistik ke Desa Seisemayang. Temuan ini dilaporkan kepada polisi yang ikut serta mengawal distribusi logistik dan diamankan sekaligus memasang garis polisi di lokasi . Usut Tuntas Secara terpisah, Ketua KPUD Deliserdang M Yusri mendesak kepolisian mengusut tuntas dalang dibalik hilangnya surat suara dari dua kotak TPS di Desa Sei Semayang. Hal tersebut dikatakan M Yusri, didampingi Kapolres Deliserdang AKBP Dicky Patrianegara saat memberikan keterangan kepada wartawan di kantor Desa Sei Semayang terkait ditemukannya surat suara yang hilang , Selasa (18/2) malam. Menurut Yusri, surat suara yang hilang dari kotak sua-

mengusut tuntas siapa yang menaruh surat suara yang sempat hilang itu di kantor Desa setempat. “Ini permasalahan serius dan bukan sekedar temuan surat suara. Sebab seandainya ada pihak yang sengaja menaruh surat suara itu di kantor aparatur pemerintah, Pemkab Deliserdang dapat menjadi terfitnah. Ini menjadi preseden nasional karena mencemarkan nama baik pemerintah,” ujarnya. Namun,Ridwan memuji kedewasaan politik masyarakat Deliserdang sudah canggih sehingga tidak terpancing emosi sehingga tidak mengganggu proses pemungutan suara ulang di 2 TPS ini. Ridwan mengemuka-kan, kasus itu bukan tidak pidana biasa melainkan sudah luar biasa karena merupakan kejahatan politik dan kejahatan HAM sesuai Deklarasi Universal HAM. Sebagaimana diberitakan,

Gubsu: Silakan ... Menjawab sikap Pemprovsu, yang mungkin akan mengambilalih pengelolaan PLN, Gatot mengatakan belum terpikirkan. “Sebenarnya kalau PLN komitmen dengan kinerjanya, Sumut tidak bakalan defisit listrik,” ujar Gatot dan mempertanyakan,apa problem PLN? Dia minta tim audit independen mengaudit perusahaan negara itu. “Tim audit independen segeralah mengaudit kinerja PLN agar masalah ini tidak terlalu lama,” kata Gatot. Kondisi PLTA minihidro, lanjut Gatot, sekarang banyak yang hancur. Pemprovsu telah membentuk tim dan akan

Sementara itu dalam penjelasannya mewakili pemerintah Dirjen HAM Kemenkumham Harkristuti Harkrisnowo mengatakan tidak benar informasi yang berkembang bahwa KPKtidakpernahdilibatkandalam pembahasan RUU KUHAP dan KUHP. Ia menyebut naskah RUU ini sudah dibahas Tim Penyusun yang dibentuk pemerintah sejak lama. Dalam prosesnya mantan Ketua KPK periode lalu Taufikurahman Ruki sering memberikan masukan. (aya)

Bawa Uang, Awas Ban ... di Jl. Letjen Suprapto untuk urusan pekerjaan. Beberapa menit kemudian, mereka bermaksud pulang. Tetapi beberapa meter dari kantor, mobil Gran Max BK 1273 JZ yang mereka naiki terasa oleng. Setelah berhenti tidak jauh dari penjual sate dan diperiksa, ternyata ban kiri belakang kempis dan ditemukan paku menancap di ban mobil tersebut. ‘’Saya tinggal sebentar istri di mobil berikut tas berisi kamera Canon yang di dalamnya juga tersimpan uang Rp24 juta, karena hendak memanggil tukang tambal ban dekat Jembatan Suprapto. Saat kembali, istri saya menjerit dan menyatakan dia ditodong dengan senjata api oleh seorang pria dan merampas tas,’’katanya dan menceritakan,kawanan perampok yang mengendarai kereta sebanyak dua orang. Satu orang beraksi dan satunya lagi siaga di atas kereta. Menurut Irham, sejak awal dia merasa curiga ketika hendak meninggalkan tempat parkir di Jl. Djuanda, karena juru parkirnya cuma seorang. Pria yang menerima uang parkirnya mengenakan sweater kotak-kotak. ‘’Sesuai keterangan istri saya, ciri-ciri pria yang melakukan penodongan dengan senpi mirip dengan pria jukir di Jl. Djuanda sebelumnya,’’kata Irham. Irham meyakini, dia dan istrinya sudah diikuti kedua perampok dan kemudian mengembosi ban mobilnya dengan alat paku tembak. Personil Polresta Medan dan Polsek Medan Kota setelah memintai keterangan korban, langsung bergerak memburu kedua pelaku.(m34)

Banyak Aduan Hakim Nakal ... menerima cenderamata dari para kepala daerah setempat. Saya tidak mau sebutkan, nanti jika bermasalah akan saya tanyakan itu,” katanya tanpa menyebutkan berapa jumlah hakim yang nakal di Papua.

melakukan mediasi untuk mencari di mana persoalannya.’’Kemungkinan bisa saja di permodalan. Kita akan membentuk tim,’’ kata Gatot. Gatot menyebutkan, pihaknya akan mempertemukan PLTA atau perusahaan yang telah mengantongi izin dengan pihak perbankan. Satu-satunya bank yang akan membantu persoalan itu adalah Islamic Development Bank. Untuk itu, kata Gatot, kalau ada pihak swasta yang ingin berinvestasi silakan saja. Pemprovsu akan mendukung dengan memberikan izin lokasi, izin prinsip dengan catatan kalau izinnya ada di Pemprovsu. “Datang ke saya, saya akan permudah,” ucapnya. (m28)

Al Bayan ... Manusia sangat kalut jika ditimpa musibah, orang tua kehilangan anak-anaknya, anak-anak juga kehilangan orang tuanya, Ada yang jatuh sambil berlari, ada yang menangis, ada yang berteriak minta tolong, dan yang paling mengharukan ketika orang-orang lanjut usia (jompo) dan tunanetra yang ditinggalkan anak saudaranya. Semua nafsi-nafsi. Lalu Tsunami dahsyat menelan mereka, ada yang cedera, ada yang selamat bahkan yang paling banyak menjadi mayat. Hal serupa juga terjadi ketika gempa dan tsunami di Yogyakarta, Bom di Bali, Bom di Jakarta, Lumpur Panas di Porong, meletus Gunung Berapi, Gunung Sinabung dan Gunung Kelud. Mengapa manusia kalut? Karena manusia takut bencana tersebut menimpanya, dan lebih takut lagi kehilangan nyawanya. Ketika kalut itulah, manusia merasakan perlu pertolongan Allah SWT. Di satu sisi bencana memang sudah tertulis dalam takdir Allah sehingga manusia ti-

ra TPS 40 dan TPS 18 telah ditemukan di ruangan Polindes Kantor Desa Sei Semayang sehari sebelum pemungutan suara ulang di dua TPS tersebut. Untuk itu, kata Yusri, Panwaslu Deliserdang dan Polresta Medan harus mengusut tuntas untuk mengungkap para pelaku yang menghilangkan surat suara sehingga mengganggu proses demokrasi Pilkada Deliserdang. Sementara itu, Kapolres Deliserdang yang dikonfirmasi terkait proses penyidikan hilangnya surat suara tersebut mengatakan , kasusnya telah sampai ke pihak kejaksaan. Kapolres menjelaskan proses hukumnya menunggu keputusan pihak kejaksaan. Sebelumnya, Polres Deliserdang menetapkan Ketua KPUD Deliserdang M Yusri dan Sekretarisnya Hayat Simatupang sebagai tersangka dalam kasus dugaan tindak pidana Pilkada Deliserdang terkait hilangnya surat suara dari kotak suara TPS 40 dan TPS 18 di Sei Semayang. Informasi Waspada peroleh, Polresta Medan masih menunggu laporan dari Panitia Pengawas Pemilu (Panwaslu) Deliserdang terkait ditemukan surat suara Pilkada Deliserdang yang hilang dari dua TPS tersebut. “Masih menunggu laporan Panwaslu DS untuk memproses kasus tersebut,” kata Kasat Reskrim Kompol Jean Calvijn Simanjuntak dan memperkirakan, satu dua hari ini Panwaslu DS membuat laporan ke Polresta Medan. Sehingga untuk saat ini,kata Calvijn, pihaknya belum bisa melakukan penyidikan sampai Panwaslu membuat laporan polisi. (m11/m34/m39/m40)

dak mungkin menolaknya. Allah berfirman : Tiada satu bencanapun yang menimpa di bumi dan tidak pula pada dirimu sendiri melainkan telah tertulis dalam kitab (Lauhul Mahfudz) sebelum Kami menciptakannya (QS. Alhadid: 22). Tetapi dalam Ilmu Tauhid juga dikatakan adanya takdir “ghairu lazim”, yakni takdir yang digeser atau diubah Allah SWT karena sayang kepada hamba-Nya yang takwa. Sepanjang Sumatera dan Jawa, negeri ini terdapat ratusan Gunung Api melingkar ibarat cincin. Allah mampu menahan gunung api supaya tidak meletus, menahan laut agar tidak tsunami, menahan lempeng bumi agar tidak patah yang menyebabkan gempa. Bagai-mana caranya supaya Allah menolong kita manusia? Tentu dengan cara kita beriman dan bertakwa kepada Allah SWT dengan sepenuh hati. Kita suburkan negeri ini dengan sinergi kebenaran dan kita lenyapkan sinergi kebatilan. Tetapi selama ini sinergi kebenaran dan kebatilan bercampur aduk seperti kopi dan susu. Cara-cara seperti itu justru mempercepat datangnya takdir Allah menimpa kita.


Medan Metropolitan

WASPADA Rabu 19 Febuari 2014

A3

Amin Diculik Enam Pria Ngaku Petugas Poldasu MEDAN (Waspada): M Alim alias Amin, 37, warga Jln. Pembinaan, Desa Bandarsetia, Kec. Percut Seituan, diculik oleh enam pelaku yang mengaku petugas Poldasu, Rabu (19/2) sekira pukul 04:00. Informasi yang diperoleh dari Beta, 35, istri Amin, di Polsek Percut Seituan, peristiwa itu berawal dari kedatangan enam pria yang mengendarai mobil Kijang Innova ke rumah Amin. Setelah memarkirkan mobilnya di depan rumah, keenam pelaku langsung menggedorgedor pintu rumah Amin. Saat itu, Amin dan istri serta anakanaknya sedang tertidur lelap. Setelah mendengar suara orang yang memanggil nama suaminya, Beta segera terbangun dan bergegas membukakan pintu depan. Ketika pintu terbuka, para pelaku mengatakan, bahwa mereka petugas dari Poldasu dan meminta Beta agar diam dan tidak berteriak karena

mereka akan menangkap Amin. Istri korban yang ketakutan, hanya pasrah ketika melihat para pelaku masuk ke dalam kamarnya. Tak lama, keenam pelaku keluar dari dalam kamar membawa Amin. Selanjutnya Amin dimasukkan ke dalam mobil. Tidak hanya itu saja, para pelaku juga membawa 2 sepedamotor jenis Supra X 125 dan Smash milik korban. Selanjutnya pelaku meninggalkan rumah korban. Menurut Beta, ketika akan menangkap Amin, para pelaku tidak ada menunjukkan surat penangkapan. Pelaku tersebut mengatakan, mereka telah mengintai Amin selama 2 minggu terakhir. “Keenam pria itu tidak menunjukkan surat penangkapan atas nama suami saya. Ketika saya tanyakan kasus apa yang telah dilakukan Amin, pelaku tak memberikan jawaban. Salah

seorang pria mengatakan, mereka telah mengintai suami saya selama 2 minggu ini,” ujarnya. Saat ditanya apakah suaminya pernah bertikai dengan orang lain atau permasalahan lainnya, Beta mengaku tidak tahu. “Sepengetahuanku suamiku lebih banyak di rumah dan tidak punya masalah apaapa dengan orang lain,” tuturnya. Karena khawatir keberadaan suaminya, Beta mendatangi Polsek Percut Seituan untuk memastikan apakah suaminya berada di kantor polisi itu atau tidak. “Setelah saya cek, ternyata suami saya tidak ada ditahan di Polsek Percut Seituan,” sebut Beta yang tampak kebingungan dan mengaku profesinya sehari-hari hanya pedagang pecal keliling. Setelah mengetahui suaminya tak ada di Polsek Percut Seituan, Beta akhirnya pergi dan rencananya akan mencari suaminya ke markas Poldasu. (h04)

Mesin Genset Meledak Ruko Terbakar Waspada/Ismanto Ismail

KAPOLSEK Medan Barat Kompol Ronny Nicolas Sidabutar, SIK, SH (kanan) didampingi Wakapolsek AKP Kosim S, SH, (dua dari kiri) dan Kanit Reskrim AKP Semeon Sembiring, SH (kiri) saat menginterogasi empat tersangka perampok.

Korban Perampokan Tewas Polsek Medan Barat Tangkap Empat Pelaku Kejahatan MEDAN (Waspada): Rosteti Br. Tampubolon, 50, penduduk Medan yang menjadi korban perampokan di Jln. Merak Jingga, akhirnya tewas setelah menjalani perawatan di salah satu rumah sakit. Kendati peristiwa itu terjadi pada Desember 2013, namun Kapolsek Medan Barat Kompol Ronny Nicolas Sidabutar, SIK menginstruksikan jajarannya agar tetap memburu para pelaku kejahatan jalanan tersebut. Hasilnya, pada Rabu (19/2), Tim Khusus Reskrim Polsek Medan Barat berhasil menangkap empat pelaku yang berulangkali melakukan aksi perampokan di wilayah hukum Polresta Medan. Dua diantaranya adalah pelaku perampokan yang menewaskan Rosteti Br. Tampubolon. Para tersangka yakni, SH, 19, penduduk Jln. Sidorukun, Gg. Mandau Pulo Brayan Darat II, Kec. Medan Barat; JR, 18 dan AOR, 19, pelajar SMA penduduk Jln. Sidodame, Medan Timur. Sedangkan satu lagi tersangka AP, 19, warga Dusun II, Pasar XII, Kec. Percut Seituan, Kab. Deli-

serdang. Sedangkan dua pelaku lainnya masih dalam pengejaran. “Selain menangkap empat tersangka, polisi menyita barang bukti sepedamotor Suzuki FU warna hitam BK 3093 AEF, Yamaha Mio warna merah tanpa nomor polisi dan Yamaha RX King BK 4065 FG, tas warna coklat dan lainnya,” kata Kapolsek Medan Barat Kompol Ronny Nicolas Sidabutar, SIK, SH kepada Waspada, Rabu (19/2) sore. Saat memberi keterangan kepada wartawan, Ronny didampingi Wakapolsek AKP Kosim S, SH; Kanit Reskrim AKP Semeon Sembiring, SH dan Panit Reskrim Iptu Alex Silalahi, SH. Dia mengatakan, kasus itu terungkap pada Rabu (19/2) dinihari. Awalnya, tim yang dipimpin Kanit Rekrim Polsek Medan Barat AKP Semeon Sembiring, SH dibantu Panit Reskrim Iptu Alex Silalahi, SH sedang melakukan Operasi Hunting terhadap para pelaku kejahatan. Saat melintas di Jln. Sidorukun, polisi mendapat informasi tentang keberadaan tersangka SH yang terlibat berbagai kasus pencurian. Lalu petugas

TPL Dan Masyarakat Jalin Program Tumpang Sari MEDAN (Waspada): PT. Toba Pulp Lestari, Tbk (TPL) dan masyarakat di Kecamatan Borbor Kabupaten Tobasa Samosir, belum lama ini menjalin program Tumpang Sari penanaman jagung diantara tanaman Eucalyptus dikawasan Hutan Tanaman Industri (HTI) TobaPulp. Sedikitnya 20 ribu bibit jagung ditebar dan 800 kg pupuk urea diberikan langsung kepada petani. Teknis penanaman dilakukan dengan cara menanam jagung diantara pohon Eucalyptus, yang telah berumur 3 bulan dengan jarak 50 cm. Pengelolaannya dilakukan langsung oleh masyarakat setempat yakni Bangun Simanjuntak dan Janro Sinaga. Keduanya merupakan koordinator perwakilan dari para petani di Kecamatan Borbor. Bangun Simanjuntak mengatakan, kelompok petani dibagi dua, untuk mengelola lahan masing-masing 2 hektare di atas lahan konsesi TPL. “Sebagai masyarakat dan petani, kami senang dengan program tumpang sari yang dilakukan TPL, karena program ini sangat membantu dalam menghasilkan pendapatan baru bagi petani”, ujar Bangun Simanjuntak.(m25/rel)

menuju ke lokasi dan meringkus tersangka SH yang terlibat kasus pencurian sepedamotor milik Nurudin Setiawan. Ketika diinterogasi, tersangka SH juga mengaku terlibat berbagai kasus perampokan di Medan. Pada Desember 2013, tersangka SH dan JR melakukan perampokan terhadap Rosteti Br. Tampubolon di Jln. Merak Jingga Medan. Saat itu, korban bersama anaknya mengendarai sepedamotor. Ketika melintas di Jln. Merak Jingga, pelaku merampok tas milik korban. Korban yang berusaha mempertahankan tas tersebut, akhirnya terjatuh dari sepedamotor. Korban mengalami luka berat pada bagian kepala. Setelah merampas tas milik korban, pelaku tancap gas mela-

rikan diri. Sedangkan korban dibawa ke rumah sakit terdekat guna menjalani perawatan intensif. Meski sempat mendapat pertolongan medis, namun korban meninggal dunia karena mengalami pendarahan. Dalam kasus perampokan tersebut, tersangka SH, JR dan AOR dikenakan pasal 365 ayat (1), ayat (2) ke 1e, 2e, ayat (4) yo 53 dan pasal 46 ayat (1) ke 2e KUHPidana. Hasil pengembangan, kata Kompol Ronny, pihaknya menangkap tersangka AP yang terlibat kasus perampokan gelang emas seberat 50 gram di Jln. Bilal Medan. Tersangka AP merupakan buronan Polsek Medan Barat dalam kasus perampokan terhadap pengendara sepedamotor di Jln. Bilal, Kec. Medan Timur.

Tersangka AP bersama temannya mengendarai sepedamotor merampas gelang emas yang melingkar di tangan kiri korban. Saat hendak melarikan diri, sepedamotor milik tersangka terjatuh. Namun teman tersangka melarikan diri, sedangkan tersangka AP berhasil diringkus petugas Polsek Medan Barat. Usai menjalani pemeriksaan, tersangka SH mengaku telah melakukan aksi perampokan sejak tahun 2012. “Sudah tidak terhitung lagi berapa kali saya melakukan perampokan,” ungkapnya. Sedangkan, tersangka JR mengaku sering beraksi di Jln. Karya, kawasan Pulo Brayan dan Glugur, Jln. Amir Hamzah, Jln. Sekip serta Jln. Adam Malik Medan. Hasil kejahatan digunakan untuk berfoya-foya. (m36)

MEDAN (Waspada): Garagara mesin genset meledak, satu rumah toko (ruko) yang berada di pinggir Jln. AR Hakim, Kel. Sukaramai II, Kec. Medan Area, Rabu (19/2) sekira pukul 00:30, nyaris tinggal puing. Meski tidak menimbulkan korban jiwa, namun kerugian diperkirakan puluhan juta rupiah. Informasi yang diperoleh di lokasi kebakaran, peristiwa kebakaran itu berawal saat di kawasan tersebut terjadi pemadaman arus listrik PLN. Selanjutnya, pemilik ruko Chandra, 44, menghidupkan mesin genset yang berada di belakang rumahnya. Kemudian Chandra dan keluarganya beranjak ke ruang tidur di lantai II, sedangkan lantai I tempat usaha. Namun, sekira pukul 24:30, beberapa menit setelah lampu PLN menyala, tiba-tiba mesin genset tersebut mengeluarkan asap tebal disusul suara ledakan. Selanjutnya, kepulan asap hitam mengepul ke ruangan lantai II dan III. Salah seorang anak Chandra yang sudah remaja kebetulan baru tiba di depan rumahnya. Dia terkejut melihat kepulan asap membubung tinggi.Warga sekitar yang mengetahui adanya kepulan asap disusul kobaran api, spontan berteriak kebakaran dan menggedor pintu rumah sembari melempari lantai

II agar penghuninya terbangun. Chandra dan keluarganya akhirnya terbangun dan menyelamatkan diri dengan cara melompat dari lantai II yang ditampung oleh warga. Sejumlah mobil milik Dinas Pencegah dan Pemadam Kebakaran Pemko Medan yang tiba di lokasi berhasil memadamkan api sehingga tidak merembes ke rumah warga lainnya. Kapolsek Medan Area Kom-

pol Rama Samtama Putra menjelaskan, berdasarkan keterangan dari sejumlah warga, penyebab kebakaran diduga karena ledakan mesin genset. “Saat listrik PLN menyala kembali, mesin genset itu meledak dan mengeluarkan asap. Namun, petugas masih menunggu hasil penyelidikan dari Labfor, apakah penyebab kebakaran gara-gara ledakan mesin genset atau sebab lainnya,” ujarnya.(h04)

Waspada/Andi Aria Tirtayasa

SEJUMLAH warga menyaksikan ruko yang terbakar di Jln. AR Hakim, Kel. Sukaramai II, Kec. Medan Area, Rabu (19/2) dinihari.

Antisipasi Kejahatan

Polisi Patroli Di Daerah Pinggiran PLN Tidak Serius Tangani Listrik Gedung DPRD Medan MEDAN (Waspada): Kondisi listrik di gedung DPRD Kota Medan masih bermasalah. Sebab, seluruh “penghuni” gedung dewan itu terus kegerahan dalam menjalankan aktivitas akibat kurangnya daya listrik. Kondisi ini semakin jelas terlihat ketika DPRD Kota Medan menggelar sidang paripurna. Menyikapi hal ini, anggota DPRD Kota Medan dari Fraksi Partai Demokrat DPRD Kota Medan, Parlaungan Simangunsong menilai kondisi itu terjadi karena ketidakseriusan PLN maupun pihak ketiga selaku rekanan pembangunan proyek gedung DPRD dengan Pemko Medan dalam mengurus penambahan daya listrik ke gedung DPRD Medan. “Kalau PLN dan pihak rekanan (PT Perumahan Pembangunan, red) dan Pemko Medan

serius, dari dulu sudah selesai masalah ini,” tegas Parlaungan, Rabu (19/2). Ketua Asosiasi Kelistrikan dan Mekanikal Indonesia (AKLI) Sumut ini menceritakan, ketika Rapat Dengar Pendapat (RDP) dengan Dinas Perkim beberapa waktu lalu sudah pernah diusulkan agar penambahan daya gedung DPRD disegerakan, karena masih ada prioritas untuk gedung-gedung pemerintah. “Waktu GM PT PLN (Persero)Wilayah Sumut dijabat pak Krisna, gedung pemerintah masih diprioritaskan. Sekarang nasi sudah menjadi bubur, jadi tidak akan mungkin daya listrik gedung DPRD dari 105 KVA bisa bertambah menjadi 650 KVA sesuai kebutuhan,” sebut Parlaungan. Sebab, tambah Parlaungan, kondisi kelistrikan di Sumut

sedang mengalami defisit sekitar 200 MW yakni, Lot 3 di Belawan dan Labuhan Angin masing-masing lepas 100 MW. “Memang, ada sewa genset 150 MW untuk memback-up, tapi 30 MW tidak bisa beroperasi di Kuala Namu karena masalah BBM,” ujarnya. Kondisi ini, sambung Parlaungan, tidak bisa diperbaikinya PLTGU Belawan unit 1 dan 2 yang masih dalam proses hukum. “Diperbaiki saja tidak bisa, apalagi dioperasikan. Ditambah lagi pembangkit di Aceh yang baru diopersikan sudah rusak. Jadi, bagaimana mau masuk penambahan daya ke Gedung DPRD ini, kalau sekarang saja masih defisit,” ungkapnya. Terkait keterangan Kadis Perkim Ir Gunawan yang mengatakan masalah listrik gedung DPRD akan selesai pada Maret mendatang, menurut Parlaungan, hal itu tidak mungkin. “Tak mungkin itu, karena kita masih defisit,” tegasnya. (m30)

MEDAN (Waspada): Kapolresta Medan Kombes Pol Nico Afinta Karokaro SIK, SH, MH, mengintruksikan anggotanya melakukan patroli di daerah pinggiran untuk mengantisipasi aksi kejahatan. “Polresta Medan mendapat tambahan personel dari Poldasu untuk melakukan patroli di kawasan daerah pinggiran kota Medan yang mulai rawan kejahatan,” kata Nico usai apel malam di Lapangan Merdeka Medan, Sabtu (15/2) malam. Hadir dalam apel Waka Polresta Medan AKBP Hondawan Naibaho, Kabag Ops Kompol Sugeng Riyadi, Kasat Reskrim Kompol Jean Calvijn Simanjuntak, Kasat Lantas Kompol M. Budi Hendrawan, Kasat Res Narkoba Kompol Dony Alexander, Kasat Intelkam Kompol Faisal Naiputulu, Kasat Sabhara Kompol Tris dan para Kapolsek. Menurut Nico, kehadiran polisi di jam rawan khususnya di daerah pinggiran sangat diperlukan oleh masyarakat. “Diharapkan dengan adanya tambahan personel yang disebar di titik rawan di wilayah hukum Polresta Medan, bisa memenuhi harapan masyarakat

akan kehadiran polisi,” sebutnya. Dijelaskannya, ada 47 personel Poldasu yang dikerahkan di daerah pinggiran wilayah hukum Polresta Medan, untuk mengantisipasi aksi tindak kejahatan. Mereka ini akan melakukan patroli menggunakan sepedamotor, karena lebih praktis dan pergerakannya lebih lincah tidak memakan waktu saat menuju ke lokasi kejadian, serta bisa cepat menjangkau semua wilayah. Mengenai kegiatan malam, Nico menjelaskan, terus dilakukan jajaran Polresta Medan dengan melibatkan personel Intelkam, Serse, Lantas, Narkoba, dan Sabhara. “Tidak hanya di hari Sabtu saja tetapi di hari lain juga kegiatan malam kita laksanakan. Waktu dan tempatnya bisa berbeda,” tuturnya. Medan Tertib Dalam kesempatan itu, Kapolresta menuturkan, bulan

ini jajaran Sat Lantas Polresta Medan melaksanakan Medan Tertib Lalulintas dengan melakukan penindakan terhadap pengendara yang tidak mematuhi lalulintas. “Polresta Medan sudah berkordinasi dengan Dandim, Denpom untuk melakukan operasi bersama Medan Tertib lalulintas yang didukung instansi TNI dan pemerintah,” sebutnya. Menurut dia, instansi yang sudah berkoordinasi dengan Polresta Medan diminta untuk memberikan imbauan kepada seluruh anggotanya untuk tertib berlalulintas. “Jadi dari kita dulu penyelenggara negara yang akan memberikan contoh untuk Medan Tertib lalu lintas sehingga masyarakat nantinya mengikuti,” katanya. (m39)


Medan Metropolitan

WASPADA Kamis 20 Februari 2014

A3

Amin Diculik Enam Pria Ngaku Petugas Poldasu MEDAN (Waspada): M Alim alias Amin, 37, warga Jln. Pembinaan, Desa Bandarsetia, Kec. Percut Seituan, diculik oleh enam pelaku yang mengaku petugas Poldasu, Rabu (19/2) sekira pukul 04:00. Informasi yang diperoleh dari Beta, 35, istri Amin, di Polsek Percut Seituan, peristiwa itu berawal dari kedatangan enam pria yang mengendarai mobil Kijang Innova ke rumah Amin. Setelah memarkirkan mobilnya di depan rumah, keenam pelaku langsung menggedorgedor pintu rumah Amin. Saat itu, Amin dan istri serta anakanaknya sedang tertidur lelap. Setelah mendengar suara orang yang memanggil nama suaminya, Beta segera terbangun dan bergegas membukakan pintu depan. Ketika pintu terbuka, para pelaku mengatakan, bahwa mereka petugas dari Poldasu dan meminta Beta agar diam dan tidak berteriak karena

mereka akan menangkap Amin. Istri korban yang ketakutan, hanya pasrah ketika melihat para pelaku masuk ke dalam kamarnya. Tak lama, keenam pelaku keluar dari dalam kamar membawa Amin. Selanjutnya Amin dimasukkan ke dalam mobil. Tidak hanya itu saja, para pelaku juga membawa 2 sepedamotor jenis Supra X 125 dan Smash milik korban. Selanjutnya pelaku meninggalkan rumah korban. Menurut Beta, ketika akan menangkap Amin, para pelaku tidak ada menunjukkan surat penangkapan. Pelaku tersebut mengatakan, mereka telah mengintai Amin selama 2 minggu terakhir. “Keenam pria itu tidak menunjukkan surat penangkapan atas nama suami saya. Ketika saya tanyakan kasus apa yang telah dilakukan Amin, pelaku tak memberikan jawaban. Salah

seorang pria mengatakan, mereka telah mengintai suami saya selama 2 minggu ini,” ujarnya. Saat ditanya apakah suaminya pernah bertikai dengan orang lain atau permasalahan lainnya, Beta mengaku tidak tahu. “Sepengetahuanku suamiku lebih banyak di rumah dan tidak punya masalah apaapa dengan orang lain,” tuturnya. Karena khawatir keberadaan suaminya, Beta mendatangi Polsek Percut Seituan untuk memastikan apakah suaminya berada di kantor polisi itu atau tidak. “Setelah saya cek, ternyata suami saya tidak ada ditahan di Polsek Percut Seituan,” sebut Beta yang tampak kebingungan dan mengaku profesinya sehari-hari hanya pedagang pecal keliling. Setelah mengetahui suaminya tak ada di Polsek Percut Seituan, Beta akhirnya pergi dan rencananya akan mencari suaminya ke markas Poldasu. (h04)

Mesin Genset Meledak Ruko Terbakar Waspada/Ismanto Ismail

KAPOLSEK Medan Barat Kompol Ronny Nicolas Sidabutar, SIK, SH (kanan) didampingi Wakapolsek AKP Kosim S, SH, (dua dari kiri) dan Kanit Reskrim AKP Semeon Sembiring, SH (kiri) saat menginterogasi empat tersangka perampok.

Korban Perampokan Tewas Polsek Medan Barat Tangkap Empat Pelaku Kejahatan MEDAN (Waspada): Rosteti Br. Tampubolon, 50, penduduk Medan yang menjadi korban perampokan di Jln. Merak Jingga, akhirnya tewas setelah menjalani perawatan di salah satu rumah sakit. Kendati peristiwa itu terjadi pada Desember 2013, namun Kapolsek Medan Barat Kompol Ronny Nicolas Sidabutar, SIK menginstruksikan jajarannya agar tetap memburu para pelaku kejahatan jalanan tersebut. Hasilnya, pada Rabu (19/2), Tim Khusus Reskrim Polsek Medan Barat berhasil menangkap empat pelaku yang berulangkali melakukan aksi perampokan di wilayah hukum Polresta Medan. Dua diantaranya adalah pelaku perampokan yang menewaskan Rosteti Br. Tampubolon. Para tersangka yakni, SH, 19, penduduk Jln. Sidorukun, Gg. Mandau Pulo Brayan Darat II, Kec. Medan Barat; JR, 18 dan AOR, 19, pelajar SMA penduduk Jln. Sidodame, Medan Timur. Sedangkan satu lagi tersangka AP, 19, warga Dusun II, Pasar XII, Kec. Percut Seituan, Kab. Deli-

serdang. Sedangkan dua pelaku lainnya masih dalam pengejaran. “Selain menangkap empat tersangka, polisi menyita barang bukti sepedamotor Suzuki FU warna hitam BK 3093 AEF, Yamaha Mio warna merah tanpa nomor polisi dan Yamaha RX King BK 4065 FG, tas warna coklat dan lainnya,” kata Kapolsek Medan Barat Kompol Ronny Nicolas Sidabutar, SIK, SH kepada Waspada, Rabu (19/2) sore. Saat memberi keterangan kepada wartawan, Ronny didampingi Wakapolsek AKP Kosim S, SH; Kanit Reskrim AKP Semeon Sembiring, SH dan Panit Reskrim Iptu Alex Silalahi, SH. Dia mengatakan, kasus itu terungkap pada Rabu (19/2) dinihari. Awalnya, tim yang dipimpin Kanit Rekrim Polsek Medan Barat AKP Semeon Sembiring, SH dibantu Panit Reskrim Iptu Alex Silalahi, SH sedang melakukan Operasi Hunting terhadap para pelaku kejahatan. Saat melintas di Jln. Sidorukun, polisi mendapat informasi tentang keberadaan tersangka SH yang terlibat berbagai kasus pencurian. Lalu petugas

TPL Dan Masyarakat Jalin Program Tumpang Sari MEDAN (Waspada): PT. Toba Pulp Lestari, Tbk (TPL) dan masyarakat di Kecamatan Borbor Kabupaten Tobasa Samosir, belum lama ini menjalin program Tumpang Sari penanaman jagung diantara tanaman Eucalyptus dikawasan Hutan Tanaman Industri (HTI) TobaPulp. Sedikitnya 20 ribu bibit jagung ditebar dan 800 kg pupuk urea diberikan langsung kepada petani. Teknis penanaman dilakukan dengan cara menanam jagung diantara pohon Eucalyptus, yang telah berumur 3 bulan dengan jarak 50 cm. Pengelolaannya dilakukan langsung oleh masyarakat setempat yakni Bangun Simanjuntak dan Janro Sinaga. Keduanya merupakan koordinator perwakilan dari para petani di Kecamatan Borbor. Bangun Simanjuntak mengatakan, kelompok petani dibagi dua, untuk mengelola lahan masing-masing 2 hektare di atas lahan konsesi TPL. “Sebagai masyarakat dan petani, kami senang dengan program tumpang sari yang dilakukan TPL, karena program ini sangat membantu dalam menghasilkan pendapatan baru bagi petani”, ujar Bangun Simanjuntak.(m25/rel)

menuju ke lokasi dan meringkus tersangka SH yang terlibat kasus pencurian sepedamotor milik Nurudin Setiawan. Ketika diinterogasi, tersangka SH juga mengaku terlibat berbagai kasus perampokan di Medan. Pada Desember 2013, tersangka SH dan JR melakukan perampokan terhadap Rosteti Br. Tampubolon di Jln. Merak Jingga Medan. Saat itu, korban bersama anaknya mengendarai sepedamotor. Ketika melintas di Jln. Merak Jingga, pelaku merampok tas milik korban. Korban yang berusaha mempertahankan tas tersebut, akhirnya terjatuh dari sepedamotor. Korban mengalami luka berat pada bagian kepala. Setelah merampas tas milik korban, pelaku tancap gas mela-

rikan diri. Sedangkan korban dibawa ke rumah sakit terdekat guna menjalani perawatan intensif. Meski sempat mendapat pertolongan medis, namun korban meninggal dunia karena mengalami pendarahan. Dalam kasus perampokan tersebut, tersangka SH, JR dan AOR dikenakan pasal 365 ayat (1), ayat (2) ke 1e, 2e, ayat (4) yo 53 dan pasal 46 ayat (1) ke 2e KUHPidana. Hasil pengembangan, kata Kompol Ronny, pihaknya menangkap tersangka AP yang terlibat kasus perampokan gelang emas seberat 50 gram di Jln. Bilal Medan. Tersangka AP merupakan buronan Polsek Medan Barat dalam kasus perampokan terhadap pengendara sepedamotor di Jln. Bilal, Kec. Medan Timur.

Tersangka AP bersama temannya mengendarai sepedamotor merampas gelang emas yang melingkar di tangan kiri korban. Saat hendak melarikan diri, sepedamotor milik tersangka terjatuh. Namun teman tersangka melarikan diri, sedangkan tersangka AP berhasil diringkus petugas Polsek Medan Barat. Usai menjalani pemeriksaan, tersangka SH mengaku telah melakukan aksi perampokan sejak tahun 2012. “Sudah tidak terhitung lagi berapa kali saya melakukan perampokan,” ungkapnya. Sedangkan, tersangka JR mengaku sering beraksi di Jln. Karya, kawasan Pulo Brayan dan Glugur, Jln. Amir Hamzah, Jln. Sekip serta Jln. Adam Malik Medan. Hasil kejahatan digunakan untuk berfoya-foya. (m36)

MEDAN (Waspada): Garagara mesin genset meledak, satu rumah toko (ruko) yang berada di pinggir Jln. AR Hakim, Kel. Sukaramai II, Kec. Medan Area, Rabu (19/2) sekira pukul 00:30, nyaris tinggal puing. Meski tidak menimbulkan korban jiwa, namun kerugian diperkirakan puluhan juta rupiah. Informasi yang diperoleh di lokasi kebakaran, peristiwa kebakaran itu berawal saat di kawasan tersebut terjadi pemadaman arus listrik PLN. Selanjutnya, pemilik ruko Chandra, 44, menghidupkan mesin genset yang berada di belakang rumahnya. Kemudian Chandra dan keluarganya beranjak ke ruang tidur di lantai II, sedangkan lantai I tempat usaha. Namun, sekira pukul 24:30, beberapa menit setelah lampu PLN menyala, tiba-tiba mesin genset tersebut mengeluarkan asap tebal disusul suara ledakan. Selanjutnya, kepulan asap hitam mengepul ke ruangan lantai II dan III. Salah seorang anak Chandra yang sudah remaja kebetulan baru tiba di depan rumahnya. Dia terkejut melihat kepulan asap membubung tinggi.Warga sekitar yang mengetahui adanya kepulan asap disusul kobaran api, spontan berteriak kebakaran dan menggedor pintu rumah sembari melempari lantai

II agar penghuninya terbangun. Chandra dan keluarganya akhirnya terbangun dan menyelamatkan diri dengan cara melompat dari lantai II yang ditampung oleh warga. Sejumlah mobil milik Dinas Pencegah dan Pemadam Kebakaran Pemko Medan yang tiba di lokasi berhasil memadamkan api sehingga tidak merembes ke rumah warga lainnya. Kapolsek Medan Area Kom-

pol Rama Samtama Putra menjelaskan, berdasarkan keterangan dari sejumlah warga, penyebab kebakaran diduga karena ledakan mesin genset. “Saat listrik PLN menyala kembali, mesin genset itu meledak dan mengeluarkan asap. Namun, petugas masih menunggu hasil penyelidikan dari Labfor, apakah penyebab kebakaran gara-gara ledakan mesin genset atau sebab lainnya,” ujarnya.(h04)

Waspada/Andi Aria Tirtayasa

SEJUMLAH warga menyaksikan ruko yang terbakar di Jln. AR Hakim, Kel. Sukaramai II, Kec. Medan Area, Rabu (19/2) dinihari.

Antisipasi Kejahatan

Polisi Patroli Di Daerah Pinggiran PLN Tidak Serius Tangani Listrik Gedung DPRD Medan MEDAN (Waspada): Kondisi listrik di gedung DPRD Kota Medan masih bermasalah. Sebab, seluruh “penghuni” gedung dewan itu terus kegerahan dalam menjalankan aktivitas akibat kurangnya daya listrik. Kondisi ini semakin jelas terlihat ketika DPRD Kota Medan menggelar sidang paripurna. Menyikapi hal ini, anggota DPRD Kota Medan dari Fraksi Partai Demokrat DPRD Kota Medan, Parlaungan Simangunsong menilai kondisi itu terjadi karena ketidakseriusan PLN maupun pihak ketiga selaku rekanan pembangunan proyek gedung DPRD dengan Pemko Medan dalam mengurus penambahan daya listrik ke gedung DPRD Medan. “Kalau PLN dan pihak rekanan (PT Perumahan Pembangunan, red) dan Pemko Medan

serius, dari dulu sudah selesai masalah ini,” tegas Parlaungan, Rabu (19/2). Ketua Asosiasi Kelistrikan dan Mekanikal Indonesia (AKLI) Sumut ini menceritakan, ketika Rapat Dengar Pendapat (RDP) dengan Dinas Perkim beberapa waktu lalu sudah pernah diusulkan agar penambahan daya gedung DPRD disegerakan, karena masih ada prioritas untuk gedung-gedung pemerintah. “Waktu GM PT PLN (Persero)Wilayah Sumut dijabat pak Krisna, gedung pemerintah masih diprioritaskan. Sekarang nasi sudah menjadi bubur, jadi tidak akan mungkin daya listrik gedung DPRD dari 105 KVA bisa bertambah menjadi 650 KVA sesuai kebutuhan,” sebut Parlaungan. Sebab, tambah Parlaungan, kondisi kelistrikan di Sumut

sedang mengalami defisit sekitar 200 MW yakni, Lot 3 di Belawan dan Labuhan Angin masing-masing lepas 100 MW. “Memang, ada sewa genset 150 MW untuk memback-up, tapi 30 MW tidak bisa beroperasi di Kuala Namu karena masalah BBM,” ujarnya. Kondisi ini, sambung Parlaungan, tidak bisa diperbaikinya PLTGU Belawan unit 1 dan 2 yang masih dalam proses hukum. “Diperbaiki saja tidak bisa, apalagi dioperasikan. Ditambah lagi pembangkit di Aceh yang baru diopersikan sudah rusak. Jadi, bagaimana mau masuk penambahan daya ke Gedung DPRD ini, kalau sekarang saja masih defisit,” ungkapnya. Terkait keterangan Kadis Perkim Ir Gunawan yang mengatakan masalah listrik gedung DPRD akan selesai pada Maret mendatang, menurut Parlaungan, hal itu tidak mungkin. “Tak mungkin itu, karena kita masih defisit,” tegasnya. (m30)

MEDAN (Waspada): Kapolresta Medan Kombes Pol Nico Afinta Karokaro SIK, SH, MH, mengintruksikan anggotanya melakukan patroli di daerah pinggiran untuk mengantisipasi aksi kejahatan. “Polresta Medan mendapat tambahan personel dari Poldasu untuk melakukan patroli di kawasan daerah pinggiran kota Medan yang mulai rawan kejahatan,” kata Nico usai apel malam di Lapangan Merdeka Medan, Sabtu (15/2) malam. Hadir dalam apel Waka Polresta Medan AKBP Hondawan Naibaho, Kabag Ops Kompol Sugeng Riyadi, Kasat Reskrim Kompol Jean Calvijn Simanjuntak, Kasat Lantas Kompol M. Budi Hendrawan, Kasat Res Narkoba Kompol Dony Alexander, Kasat Intelkam Kompol Faisal Naiputulu, Kasat Sabhara Kompol Tris dan para Kapolsek. Menurut Nico, kehadiran polisi di jam rawan khususnya di daerah pinggiran sangat diperlukan oleh masyarakat. “Diharapkan dengan adanya tambahan personel yang disebar di titik rawan di wilayah hukum Polresta Medan, bisa memenuhi harapan masyarakat

akan kehadiran polisi,” sebutnya. Dijelaskannya, ada 47 personel Poldasu yang dikerahkan di daerah pinggiran wilayah hukum Polresta Medan, untuk mengantisipasi aksi tindak kejahatan. Mereka ini akan melakukan patroli menggunakan sepedamotor, karena lebih praktis dan pergerakannya lebih lincah tidak memakan waktu saat menuju ke lokasi kejadian, serta bisa cepat menjangkau semua wilayah. Mengenai kegiatan malam, Nico menjelaskan, terus dilakukan jajaran Polresta Medan dengan melibatkan personel Intelkam, Serse, Lantas, Narkoba, dan Sabhara. “Tidak hanya di hari Sabtu saja tetapi di hari lain juga kegiatan malam kita laksanakan. Waktu dan tempatnya bisa berbeda,” tuturnya. Medan Tertib Dalam kesempatan itu, Kapolresta menuturkan, bulan

ini jajaran Sat Lantas Polresta Medan melaksanakan Medan Tertib Lalulintas dengan melakukan penindakan terhadap pengendara yang tidak mematuhi lalulintas. “Polresta Medan sudah berkordinasi dengan Dandim, Denpom untuk melakukan operasi bersama Medan Tertib lalulintas yang didukung instansi TNI dan pemerintah,” sebutnya. Menurut dia, instansi yang sudah berkoordinasi dengan Polresta Medan diminta untuk memberikan imbauan kepada seluruh anggotanya untuk tertib berlalulintas. “Jadi dari kita dulu penyelenggara negara yang akan memberikan contoh untuk Medan Tertib lalu lintas sehingga masyarakat nantinya mengikuti,” katanya. (m39)


Medan Metropolitan

A4 Mulia Bagikan Sembako Untuk Bilal Mayit

AKP Sugiono Meninggal Di Mapoldasu

Pengedar Narkoba Diringkus MEDAN (Waspada): Pengedar sabu-sabu berinisial Ed, 36, warga Jln. Karya Gang Adil, Kel. Karangberombak, Kec. Medan Barat, diringkus petugas Reskrim Polsek Medan Helvetia, Rabu (19/2) siang. Dari tersangka Ed, polisi menyita 3 paket sabu-sabu sebagai barang bukti. Informasi yang diperoleh di kepolisian, penangkapan terhadap pengedar sabu-sabu tersebut ternyata tidak mudah. Rabu pagi, petugas Reskrim Polsek Medan Helvetia melihat tersangka berjalan seorang diri di Jln. Karya Gang Sepakat, Kel. Karangberombak. Polisi lalu mengikuti tersangka. Namun, keberadaan petugas diketahui tersangka Ed. Dia buru-buru melarikan diri, sehingga dikejar petugas. Meski sempat nyaris menghilang, akhirnya tersangka Ed berhasil disergap dua petugas Reskrim dan terjadi pergumulan. Setelah bergumul beberapa menit, tersangka Ed akhirnya tak berkutik. Dari kantong celananya, tersangka Ed memperlihatkan 3 paket sabu-sabu yang hendak diantar ke rumah pelanggannya di Jln. Karya. “Sabu-sabu itu saya beli dari bandar lainnya. Selanjutnya, saya racik kembali dan dijual ke dalam plastik kecil paket hemat. Satu paket untungnya hanya Rp50 ribu,” sebut Ed. Sementara itu, Kanit Reskrim Polsek Medan Helvetia AKP Hendrik Temaluru mengatakan, tersangka Ed dikenakan pasal sebagai pengedar dan pengguna sabu-sabu sehingga ancaman hukumannya mencapai 15 tahun penjara. (h04)

Waspada/Andi Aria Tirtayasa

KANIT Reskrim Polsek Medan Helvetia AKP Hendrik Temaluru (kanan) memperlihatkan tiga paket sabu-sabu yang disita dari tersangka Ed (tengah) yang ditangkap di Jln. Karya Gang Sepakat, Kel. Karangberombak, Kec. Medan Barat.

Waspada/Rudi Arman

KASAT Reskrim Polresta Medan Kompol Jean Calvijn Simanjuntak (kiri) didampingi Kanit Jahtanras AKP Daniel Marunduri dan Panit Reskrim menginterogasi ketiga tersangka curanmor di Polresta Medan, Rabu (19/2).

Poldasu Akan Tindaklanjuti Jika Terkait Korupsi MEDAN (Waspada): Alokasi anggaran bimbingan teknis (Bimtek) anggota DPRD Kota Medan yang mencapai Rp21,4 miliar, terus menjadi sorotan berbagai kalangan. “Alokasi anggaran Bimtek para anggota DPRD Medan itu dinilai kurang tepat dan sarat kepentingan pribadi,” kata Pengamat Siosologi Politik Institut Agam Islam Negeri Sumatera Utara (IAIN-SU) Dr. Ansari Yamamah kepada Waspada di Medan, Rabu (19/2). Dia berpendapat, ada tiga hal yang patut dipersoalkan dalam kegiatan itu. Pertama, masa jabatan anggota DPRD Medan segera berakhir. Waktu efektif mereka tinggal beberapa bulan lagi. Setelah itu, mereka disibukkan dengan aktivitas Pemilu 2014. Dikhawatirkan, mereka tidak mungkin melaksanakan tugas kedewanan secara penuh. Jadi, kapan lagi mereka mensosialisasikan Bimtek itu. “Iya, kalau mereka yang mengikuti Bimtek itu terpilih lagi menjadi wakil rakyat. Tapi, siapa menjamin itu,” tegasnya. Kedua, dari aspek anggaran, Bimtek diperkirakan menelan dana tidak sedikit. Sangat tidak elok jika dana begitu besar digunakan anggota DPRD untuk sesuatu yang tidak jelas. Ketiga, dari aspek manfaat. Apa yang diperoleh DPRD selama Bimtek, dipastikan tidak diterapkan karena tidak ada lagi agenda penting yang harus dilakukan anggota DPRD saat ini, kecuali membahas dan menetapkan APBD 2014. Karena itu, Bimtek tersebut tidak beda

dengan membuang garam di laut. “Dari semua itu, anggaran Bimtek tidak bisa diterima secara akal sehat, baik dari aspek waktu, anggaran, dan manfaatnya. Modus menghabiskan uang di penghujung masa jabatan, bukan sesuatu yang baru,” tegasnya. Dia berharap, para anggota DPRD lebih arif mengelola anggaran. Terlebih, situasi bangsa ini dalam suasana berkabung. Bencana silih berganti melanda. Alangkah baiknya, jika mereka berjibaku memperjuangkan dana bantuan kepada saudarasaudara kita yang tertimpa bencana. Menurutnya, apa yang sedang dipertontonkan para anggota DPRD Medan, menunjukkan wajah wakil rakyat kita saat ini. Hal ini harus menjadi pelajaran berharga bagi rakyat, jangan lagi mau termakan janjijanji saat kampanye. “Tinggalkan, elit politik yang tidak peduli dan ingkar janji kepada rakyat dan beri tempat kepada wakil rakyat yang pro rakyat. Momen tahun politik ini sangat tepat memberikan pelajaran bagi mereka yang tidak pro rakyat,” ungkapnya. Sampai kapan pun daerah ini tidak akan maju, kalau karakter wakil rakyatnya seperti ini. “Kalau ingin daerah ini lebih baik, maka jadilah pemilih cerdas dan rasional. Cerdas mencermati rekam jejak dan rasional menolak tawaran politik transaksional,” tegasnya. Yamamah berpendapat, di tengah rendahnya kualitas pelayanan publik dan perekonomian masyarakat Kota Medan, seharusnya menjadi pertim-

bangan dalam menyusun program anggaran. “Program dan penyusunan anggaran pro rakyat harus menjadi prioritas,” tegasnya. Artinya, alokasi anggaran Bimtek ini, perlu dipertimbangkan lagi. Sebab, semua pihak menilai anggaran tersebut sebagai sesuatu menyedihkan, apalagi dialokasikan di penghujung masa bakti DPRD Medan. “Para wakil rakyat yang terhormat diharapkan merenung dan melihat derita rakyat yang samakin terpuruk,” ujar Yamamah. Pemborosan Di tempat terpisah, pengamat ekonomi Sumut Gunawan Benjamin menilai anggaran Bimtek anggota DPRD Medan tersebut adalah pemborosan. Memang yang dipertanyakan masyarakat adalah efektivitas program tersebut terhadap kinerja anggota DPRD itu sendiri, bukan semata-mata nilai uangnya. Menurut Gunawan, model pengembangan kemampuan anggota dewan seperti ini memang bagus guna meningkatkan kapasitas anggota DPRD itu sendiri. Namun, harus ada tolak ukur keberhasilannya dan manfaatnya bagi masyarakat. “Apakah dengan Bimtek tersebut anggota DPRD nanti mampu merumuskan kebijakan yang dapat meningkatkan taraf hidup masyarakat atau semacamnya. Jika tidak, mending uangnya digunakan untuk hal lain yang lebih produktif dan bermanfaat bagi masyarakat kita sendiri,” ujar akademisi dari IAIN Sumut ini, Rabu (19/2). Gunawan mencontohkan,

UKM Instrumen Utama Dalam Mensejahterakan Rakyat Disertasi Doktor (S3) miliknya dalam bidang Ilmu Perencanaan Wilayah pada sidang terbuka Guru Besar USU di Biro Rektor USU, baru-baru ini. Disaksikan Rektor Universitas Methodist Indonesia (UMI)

MEDAN (Waspada): Tiga sindikat pencurian sepedamotor ditangkap Reskrim Unit Jahtanras Polresta Medan dalam penyergapan dari kawasan Jln. Kenangan Raya, Kel. Tanjung Sari, Kec. Medan Selayang, Rabu (19/2) sore. Dari ketiga tersangka BA, 27, warga Jln. Karya IV Gang Soripada, RL alias Bokir alias Boim, 42, warga Jln. Karya IV Balai Desa Gang Soripada atau Jln. Kotanopan Tapsel dan L, 35, warga Dusun II Jln. Pringgan, Desa Helvetia, Kec. Sunggal, disita barang bukti Yamaha Mio merah BK 8942 ACE dan Yamaha Vega ZR BK 6181 AAG. Kasat Reskrim Kompol Jean Calvijn Simanjuntak didampingi Kanit Jahtanras AKP Daniel Marunduri saat ekspos tangkapan mengatakan, penangkapan ketiga tersangka ini berawal adanya laporan korbannya, Tuk Ani dengan nomor STPL/275/K/I/2014 pada 31 Januari 2014 atas kasus pencurian sepedamotor. Petugas yang mendapat laporan, turun kelokasi melakukan penyelidikan. Berdasarkan keterangan saksi-saksi, petugas akhirnya menemukan identitas ketiga tersangka. Saat dilakukan penangkapan, ketiga tersangka tengah melakukan transaksi jual beli sepedamotor hasil kejahatan tersebut kepada penadahnya warga asal Aceh. “Kita menangkap ketiga pelaku saat berada di rumah tersangka, RL alias Bokir,” kata Calvijn. Menurut dia, petugas sempat mengalami kesulitan saat hendak menangkap ketika tersangka. Pasalnya, ketiga tersangka ini sempat melakukan perlawanan. Sementara itu, tersangka RL mengaku sudah berulang kali melakukan pencurian sepedamotor. Bahkan, disetiap kali beraksi, dia selalu melukai korbannya yang mencoba melakukan perlawanan. Tersangka RL mengaku, sudah pernah masuk penjara dengan kasus yang sama. “Saya sudah pernah dipenjara pada tahun 2012 kasus pencurian sepedamotor. Ini yang kedua kalinya saya ketangkap,” katanya. Ditanya hasil kejahatanya dijual kemana, RL mengaku dijual ke Aceh dengan harga Rp1,5 juta. “Setiap berhasil melakukan aksi, hari itu juga sepedamotor kami jual ke Aceh,” sebutnya mengatakan, karena sudah ada yang menampung sepedamotor hasil kejahatan itu. Mengenai uang hasil kejahatannya dipergunakan untuk berfoya-foya. “Uangnya dibagi sama-sama teman yang melakukan curanmor untuk foya-foya,” ujar RL alias Bokir alias Boim. Berkaitan dengan penangkapan RL, kata Calvijn, akan mengecek ke beberapa Polsek apakah tersangka RL pernah ditangkap di polsek lainnya dan pelaku lainnya. “Ketiga tersangka dikenakan pasal 363 ayat 2 ayat 1 ke-3e,4e dan 5e KUHPidana dengan ancaman diatas 5 tahun penjara,” tuturnya. (m39)

Bimtek Sarat Kepentingan Pribadi

Anton AP Sinaga Pertahankan Disertasi Doktor MEDAN (Waspada): Drs. Anton AP Sinaga, MSi, dosen Kopertis Wilayah I Sumatera Utara yang juga Pembantu Dekan I (PD I) Fakultas Ekonomi Universitas Methodist Indonesia berhasil mempertahankan

Kamis 20 Februari 2014

Tiga Sindikat Curanmor Ditangkap

MEDAN (Waspada): Mulia Syahputra Nasution Caleg nomor urut 7 dari Partai Persatuan Pembangunan (PPP) daerah pemilihan (dapil) II Percut Seituan, Kab. Deliserdang memberikan tali asih dengan membagikan sembako kepada bilal mayit se Desa Sambirejo, Minggu (16/2). Dia mengaku mendapat ilmu banyak dalam acara silaturahmi dengan kaum ibu dan bapak bilal mayit se-Desa Sambirejo Timur. Mulia sangat terharu atas perhatian dan saran dari kaum bapak dan ibu bilal mayit yang kebanyakan para orangtua. “Saya sadar untuk menjadi bilal mayit tidaklah mudah. Itu bisa kita lihat mulai dari mengurus jenazah, memandikan, mensucikan dari nazis, mengkafani, dan memakamkannya,” katanya. Ini merupakan fardhu kifayah yang wajid dilaksanakan oleh seluruh umat Islam seluruh dunia. “Namun dengan keberadaan bilal mayit ini maka tugas berat itu bisa diatasi,” ujarnya. Koordinator acara Risnandar dan Sekretaris Yanti yang juga warga Desa Sambirejo Timur mengatakan, para ibu dan bapak bilal mayit se-Desa Sambirejo Timur, Percut Seituan, mendukung dan mendoakan Mulia Syhaputra Nasution menjadi anggota dewan di Deliserdang nanti. Menurut mereka, Mulia Syahputra Nasution banyak mendengar wejangan dari orangtua di sini yang pesannya, jika ingin hidup sukses harus rendah hati dan terus giat belajar. Terutama jika ingin menjadi wakil rakyat. “Kami juga memintanya jangan lupa rakyat miskin dan berbaktilah kepada orangtua serta negara,” sebut Rinandar didampingi elemen masyarakat dariWakil Ketua Peduli Bangsa M Abdi Siahaan dan Ketua Komunikasi Masyarakat Pemberdayaan Indonesia (Kompi) Sumut Firzan Moraza Lubis. (m39)

MEDAN (Waspada): Staf Bagian Bidang Dokter dan Kesehatan (Bid Dokkes) Polda Sumut AKP Sugiono meninggal dunia usai melaksanakan apel pagi di Mapoldasu, Rabu (19/2) sekira pukul 09:30. Informasi dari rekan-rekannya, usai apel pagi itu AKP Sugiono pergi ke kantin yang berada di samping Sentra Pelayanan Kepolisian Terpadu (SPKT) dan memesan kopi. Namun tidak berapa lama, dia merasakan sesak di dada, kemudian pindah posisi duduk dari kantin ke kursi terbuat dari marmer yang berada tepat di gedung SPKT. “Kemungkinan karena sesak, dia pindah duduk mencari angin,” kata mereka menyebutkan saat apel, AKP Sugiono sudah mengeluhkan sakti di bagian dadanya. Ketika duduk di kursi batu, perwira pertama itu tergeletak, sehingga beberapa rekannya membawa ke Dokkes untuk pemeriksaan. Ternyata, AKP Sugiono sudah meninggal dunia. Kabid Humas Poldasu Kombes Pol. Heru Prakoso membenarkan perwira pertama itu meninggal mendadak saat di Polda. “Ya, saya dapat laporan meninggal sekira pukul 10. Setelah dibawa ke Dokkes jenazah disemayamkan di rumah duka,” ujarnya.(m27)

WASPADA

Ir. Pantas Simanjuntak, MM dan Dekan FE UMI Medan Drs. Saur Melina Sipayung, MSi, Anton AP Si n a g a m e m p e r t a h a k a n disertasinya di hadapan komisi penguji Prof. Dr. Lic.reg.reg. Sirojuzilam, SE; Prof. Dr. Marlon

Waspada/ist

DR. ANTON AP Sinaga, SE, MSi (kanan) menerima ucapan selamat usai mempertahankan disertasi doktornya dalam bidang Ilmu Perencanaan Wilayah SPS S3 USU.

Sihombing, MS dan Prof. Dr. Mohd Nur Syechalad (Guru Besar Unsiyah Banda Aceh) bertopik “Pengaruh Pemberdayaan Usaha Kecil dan Menengah Terhadap Pengembangan Ekonomi Lokal dan Kesejahtaraan Masyarakat di Kota Medan”. Bertindak sebagai promotor yakni Prof. Erlina, SE, Ak, MSi, PhD (Guru besar FE USU), Co Promotor Prof. Dr. Badaruddin, MA (USU) dan Prof. Dr. Alwind Surya, SE, MPd, PhD (Guru Besar Kopertis Wil I Sumut (NAD). Saat itu, Anton AP Sinaga dinyatakan lulus dengan predikat memuaskan. Anton AP Sinaga mengatakan, sektor pengembangan UKM saat ini masih belum bisa menjadi sektor unggulan dan skala prioritas dari pemerintah. Sementara sektor ini sangat menjanjikan untuk pengembangan ekonomi lokal yang bisa menghadirkan kesejahteraan bagi warga kota Medan. Bahkan Anton AP Sinaga melakukan komparasi dengan berbagai negara maju bahwa sektor UKM di berbagai negara maju seperti Eropa, Singapura, Malaysia, Jepang dan Korea Selatan sangat memberdayakan UKM sehing-

ga punya akses ke pasar global, kompetitif dan berkelanjutan. Menurut Anton, UKM merupakan sektor yang sangat produktif, strategis, vital, bahkan instrumen utama dalam mensejahterakan masyarakat. Kontribusi UMKM terhadap produk domestik bruto (PDB) pada tahun 2010 mencapai Rp3,446 triliun atau meningkat 4,5 lipat dari jumlah PDB tingkat ratarata 15,33 persen setiap tahunnya dengan rata-rata kontribusi terhadap PDB nasional mencapai 57,5 persen. Berdasarkan skala UKM, usaha mikro merupakan penyumbang terbesar dengan rata-rata 58 persen dari total PDB UMKM. Sedangkan usaha kecil dan menengah berkontribusi masing-masing 18 persen dan 24 persen. Laju pertumbuhan usaha mikro selama 20062010 mencapai 51,4 persen, sedikit lebih rendah yang mencapai 5,98 persen dan 5,34 persen. Dalam penyerapan tenaga kerja, pada tahun 2011, UMKM berhasil menyerap sekitar 101 juta jiwa tenaga kerja atau 97,4 persen dari total tenaga kerja nasional.(m25/rel)

anggaran Bimtek yang besar tersebut akan lebih bermanfaat bila untuk pengembangan UKM, membantu biaya kesehatan masyarakat dan tenaga kerja, mengumpulkan pengusaha kecil di Medan, serta mendengarkan dan membantu mereka keluar dari kesulitan ekonomi akhir-akhir ini. Tentunya banyak hal lain yang bisa digunakan untuk kepentingan rakyat. “Kita mengharapkan ada perubahan ke arah yang lebih baik. Idealnya anggaran yang ditetapkan untuk anggota DPRD bisa dikaitkan dengan peningkatan kesejahteraan rak-

yat. Misalnya dengan anggaran sebesar ‘X’ miliar, maka target regulasi baru yang dikeluarkan sebesar ‘Y’ atau jumlah orang miskin berkurang sebesar ‘Z’. Tanpa ada target atau tolak ukur, anggaran yang digunakan bagaikan konsumsi rutin yang tidak memberikan gizi bagi kesehatan kita,” pungkasnya. Ditindaklanjuti Sementara itu, Kepala Bidang Humas Poldasu Kombes Pol. Raden Heru Prakoso mengatakan, kegiatan apapun yang terkait kasus korupsi akan ditindaklanjuti, termasuk jika ditemukan dugaan korupsi pada pengalokasian anggaran

Bimtek anggota DPRD Medan. “Kalau memang ada bukti dan ditemukan dugaan korupsi dalam pengalokasian anggaran itu, tentu polisi akan menindaklanjuti,” kata Heru menjelaskan. Menurutnya, polisi tidak bisa menduga-duga apakah dalam penyaluran anggaran itu ada penyelewengan atau tidak. “Harus ada bukti untuk memulai penyidikan, atau ada laporan terkait kasus penyelewengan dengan disertai bukti yang ada untuk memulai penyelidikan. Namun Polri komit, jika memang ada bukti dugaan korupsi pasti ditindaklanjuti,” kata dia. (m41/m49/m27)

Bank Sumut Salurkan Dana CSR MEDAN (Waspada): Sebagai wujud tanggungjawab sosial, Bank Sumut bekerjasama dengan Pemerintah Kabupaten Samosir menyalurkan dana Corporate Social Responsibility (CSR), di lapangan SMA 1 Pangururan, belum lama ini. CSR yang disalurkan dalam bentuk pengadaan barang berupa alat mesin pertanian bagi kelompok petani dan peralatan teknologi informasi pendukung proses belajar mengajar untuk beberapa sekolah serta peralatan olahraga, dengan total bantuan senilai Rp347,8 juta. CSR untuk sektor ekonomi-pertanian adalah hand tractor sebanyak 4 unit yang disalurkan kepada Kelompok Tani Sibindong dari Desa Parasoran Urat, Kec. Palipi, Kelompok Tani Mula Tani dari Desa Bonan Dolok, Kec. Sianjur Mulamula, Kelompok Tani Saurdot dari Desa Sampur Toba, Kec. Harian, dan Kelompok Tani Gapoktan Sepakat Bersatu dari Desa Pintu Sona, Kec. Pangururan. Untuk sektor pendidikan, bantuan CSR yang disalurkan yakni 9 unit laptop, masing-masing untuk SMPN 1 Simanindo, SMP Satu Atap Negeri 2 Sianjur Mulamula, SMPN 4 Simanindo, SMPN 2 Simanindo, SMPN 1 Sitiotio, SMP Satu Atap Negeri 2 Onanrunggu, SMKN 1 Simanindo, SMPN 1 Harian, dan SMPN 1 Sianjur Mulamula. Sedangkan 14 unit infokus berikut standing screen disumbangkan kepada SMAN 1 Pangururan, SMAN 2 Pangururan, SMAN 1 Simanindo, SMAN 1 Onanrunggu, SMAN 1 Palipi, SMAN 1 Sitiotio, SMAN 1 Sianjur Mulamula, SMAN 1 Ronggurnihuta, SMKN 1 Nainggolan, SMKN 1 Palipi, SMKN 1 Simanindo, dan SMKN 1 Harian. Selain itu, juga diberikan bantuan peralatan olahraga kepada 26 sekolah tingkat SMP dan SMA di Kabupaten Samosir. Bantuan tersebut diserahkan langsung oleh Bupati Samosir Ir Mangindar Simbolon didampingi Direktur Pemasaran Bank Sumut Ester

Junita Ginting dan Pemimpin Cabang Pangururan Jansen Manurung kepada penerima manfaat yang dipusatkan di lapangan SMAN 1 Pangururan. Mangindar Simbolon mengatakan, program CSR tersebut dikhususkan kepada kelompokkelompok masyarakat tertentu, sehingga tidak semua bisa mendapatkannya. “Karena itu, diharapkan penerima program CSR Bank Sumut dapat memanfaatkan bantuan tersebut dengan sebaikbaiknya dan yang terpenting dapat mengembangkannya, agar jangan terus-menerus mengandalkan bantuan,” kata Bupati. Bupati mengingatkan, Bank Sumut adalah bank milik masyarakat Sumatera Utara, termasuk milik masyarakat Samosir karena Pemkab Samosir memiliki saham di Bank Sumut, sehingga masyarakat dan Pemkab harus bersama-sama ikut membesarkan Bank Sumut untuk bisa bersaing secara sehat dengan bank-bank lainnya. Direktur Pemasaran Bank Sumut Ester Junita Ginting mengatakan, program CSR Bank Sumut merupakan wujud kepedulian dan tanggungjawab sosial Bank Sumut kepada masyarakat Sumatera Utara. ”Sepanjang tahun 2013, Bank Sumut telah menyalurkan dana CSR di Sumatera Utara sebesar Rp4,6 miliar,” ujarnya. Dana CSR ini diambil dari penyisihan sebagian laba perusahaan yang dipergunakan untuk program-program bermanfaat dan dapat memberdayakan masyarakat dalam rangka peningkatan kesejahteraan sosial, kualitas hidup insani dan lingkungan hidup secara berkelanjutan. Model penyalurannya dilakukan dengan pola kemitraan bersama pemerintah kabupaten/kota di Sumatera Utara. Secara khusus, Ester menyampaikan rasa terimakasih manajemen Bank Sumut kepada Bupati Samosir beserta jajarannya yang telah memberikan dukungan positif atas kemitraan program dalam penyaluran CSR Bank Sumut.(m28)

Waspada/Amir Syaripuddin

BUPATI Samosir Mangindar Simbolon dan Direktur Pemasaran Bank Sumut Ester Junita Ginting menyerahkan 4 unit Hand Tractor kepada kelompok tani yang menerima bantuan CSR Bank Sumut, di halaman SMAN 1 Pangururan, Kab. Samosir.


Medan Metropolitan

WASPADA Kamis 20 Februari 2014

Jadwal Penerbangan Di Bandara KNIA Flight

Pukul

Kampus UISU Diserang

No. Penerbangan Ke Flight

Pukul

GARUDA INDONESIA 1 Jakarta GA-181 2 Jakarta GA-183 3 Jakarta GA-185 4 Jakarta GA-187 5 Jakarta GA-143 6 Jakarta GA-189 7 Jakarta GA-191 8 Jakarta GA-193 9 Jakarta GA-195 10 Banda Aceh GA-278 11 Banda Aceh GA-142 12 Banda Aceh GA-280 14 Palembang GA-266 15. Palembang GA-268 16. Batam GA-270 17. Batam GA-272 18. Padang GA-260 19. Penang GA-804 20. Pekanbaru GA-276 21. Tanjungkarang GA-270

05.15 08.55 11.00 12.10 13.20 13.55 16.45 18.30 20.30 07.15 09.40 17.10 06.00 17.40 09.30 14.20 10.35 10.55 06.00 12.35

Jakarta Jakarta Jakarta Jakarta Jakarta Jakarta Jakarta Jakarta Jakarta Banda Aceh Banda Aceh Banda Aceh Palembang Palembang Batam Batam Padang Penang Pekanbaru Tanjungkarang

GA-180 GA-142 GA-182 GA-184 GA-186 GA-188 GA-190 GA-192 GA-196 GA-279 GA-143 GA-281 GA-267 GA-269 GA-271 GA-273 GA-261 GA-805 GA-277 GA-271

08.10 08.55 10.15 11.25 13.10 16.00 17.30 19.30 22.10 09.50 12.35 19.45 09.55 21.35 12.50 20.45 16.25 13.20 08.45 20.10

CITILINK 1. Jakarta 2. Jakarta 3. Jakarta 4. Jakarta 5. Batam

QG-831 QG-837 QG-833 QG-835 QG-882

08:40 09:30 18:50 20:10 14:55

Jakarta Jakarta Jakarta Jakarta Batam

QG-830 QG-832 QG-836 QG-834 QG-883

05:55 06:55 12:15 17:25 16:40

AIR ASIA 1 Kuala Lumpur 2 Kuala Lumpur 3 Kuala Lumpur 4 Kuala Lumpur 5 Penang 6 Penang 7 Kuala Lumpur 8 Bangkok 9 Bandung 10 Surabaya 11 Bandung 12 Penang 13 Pekanbaru 14 Singapura 15 Kuala Lumpur

QZ-8050 06.20 QZ- 8054 17.40 AK- 1351 08.00 AK-1355 17.55 QZ-8072 14.25 AK-1581 18.45 AK-1357 21.20 QZ-8084 14.15 QZ-7987 08.45 QZ-7611 13.15 QZ-7981 17.10 QZ-8078 06.25 QZ-8028 11.30 QZ-664 07.45 QZ-8052 13.30

Kuala Lumpur Kuala Lumpur Kuala Lumpur Kuala Lumpur Penang Penang Kuala Lumpur Bangkok (2,4,6) Bandung Surabaya Bandung Penang Pekanbaru Singapura Kuala Lumpur

QZ-8051 QZ-8055 AK-1350 AK-1354 QZ-8073 AK-1580 AK-1356 QZ-8085 QZ-7986 QZ-7610 QZ-7980 QZ-8079 QZ-8029 QZ-665 QZ-8053

08.30 10.55 07.35 17.00 16.35 18.30 21.05 16.40 11.30 09.55 19.55 08.35 12.50 10.35 15.55

Wakil Direktur Dit Reskrimum Poldasu AKBP Wawan Munawar kepada wartawan di Mapoldasu mengatakan, pihaknya masih memeriksa ke-25 orang tersebut, termasuk korban penganiayaan. Selain itu diamankan beberapa alat bukti seperti palu dan linggis. Namun Wawan belum

LION AIR 1 Jakarta 2 Jakarta 3 Jakarta 4 Jakarta 5 Jakarta 6 Jakarta 7 Jakarta 8. Jakarta 9 Jakarta 10 Jakarta 11 Jakarta 12 Jakarta 13 Jakarta 14 Penang 15 Penang 16 Jakarta 17 Jakarta 18 Jakarta 19 Jakarta 20 Jakarta 21 Surabaya 22 Surabaya 23 Banda Aceh 24 Jakarta

JT- 211 JT- 381 JT- 397 JT-207 JT- 301 JT-395 JT- 303 JT- 215 JT-201 JT- 387 JT-399 JT-383 JT-385 JT-1282 JT-1288 JT-205 JT-203 JT-219 JT-309 JT-209 JT-0970 JT-972 JT-396 JT-305

0545 06.45 07.50 08.40 10.00 11.00 11.50 12.25 12.50 13.50 15.20 15.50 17.40 08.05 13.35 2010 18.00 20.40 19.30 21.00 07.00 12.55 12.15 18.30

Jakarta Jakarta Jakarta Jakarta Jakarta Jakarta Jakarta Jakarta Jakarta Jakarta Jakarta Jakarta Jakarta Penang Penang Jakarta Jakarta Jakarta Jakarta Jakarta Surabaya Surabaya Banda Aceh Jakarta

JT-380 JT-300 JT-394 JT-302 JT-214 JT-200 JT-204 JT-398 JT-382 JT-384 JT-202 JT-212 JT-396 JT-1283 JT-1289 JT-206 JT-208 JT-386 JT-308 JT-218 JT-971 JT-973 JT-397 JT-210

08.20 09.20 10.20 11.10 11.40 12.10 13.10 14.40 15.10 16.05 17.20 17.50 19.45 10.25 15.55 09.20 18.25. 21.05 22.20 23.50 12.15 16.00 07.05 07.20

Orang Yang Dianggap Lemah Dan Miskin Bisa Raih Sukses

MALAYSIA 1 Kuala Lumpur 2 Kuala Lumpur 3 Kuala Lumpur

MH-861 MH-865 NH-841

09.40 15.45 07.00

Kuala Lumpur Kuala Lumpur Kuala Lumpur

MH-860 MH-864 MH-840

08.50 15.00 06.15

SILK AIR 1 Singapura 2 Singapura 3 Singapura

MI-233 MI-237 MI-235

08.40 20.35 13.15

Singapura Singapura Singapura

MI-234 MI-238 MI-236

07.35 19.50 12.20

VALUAIR 1 Singapura (2.4,7) VF-282 2 Singapura (1,3,6) VF-284 3 Singapura (Jumat)VF-282

10.35 18.30 09.45

Singapura (2.4.7) VF-281 Singapura (1,3,6) VF-283 Singapura (Jumat)VF-281

09.55 17.40 09.05

SRIWIJAYA AIR 1 Jakarta 2 Jakarta 3 Batam 4 Pekanbaru 5 Pekanbaru 6 Banda Aceh 7 Penang 8 Padang 9 Jakarta

SJ-021 SJ-011 SJ-035 SJ-043 SJ-041 SJ-010 SJ-102 SJ-021 SJ-017

13.15 15.55 16.50 10.20 17.20 12.50 07.20 16.00 08.05

Jakarta Jakarta Batam Pekanbaru Pekanbaru Banda Aceh Penang Padang Jakarta

SJ-010 SJ-016 SJ-034 SJ-042 SJ-040 SJ-011 SJ-103 SJ-020 SJ-016

18.10 16.20 14.55 11.50 15.45 14.20 09.50 14.10 17.20

FIRE FLY 1 Subang 2 Penang 3. Penang

FY -3413 FY- 3403 FY- 3407

14.35 10.55 18.20

Subang Penang Penang

FY-3412 FY-3402 FY-3406

14.05 10.35 17.55

10.45

Jakarta

RI-093

08.55

MANDALA AIRLINE 1 Singapura RI-861

Tiba Dari

25 Diamankan Di Poldasu MEDAN (Waspada): Polda Sumut mengamankan 25 orang, di antaranya berpakaian Satuan Pengamanan (Satpam) yang mengaku suruhan UISU Al Munawwarah atas kasus pengrusakan dan penganiayaan, Rabu (19/2). Mereka sebelumnya menyerang dan merusak kampus Kedokteran UISU di Jln. Sisingamangaraja depan PDAM Tirtanadi, serta melakukan penganiayaan.

menjelaskan detail peristiwa itu. “Informasi yang diperoleh, tadi pagi mereka mendatangi kampus kedokteran dan hendak mengambil alih dengan cara paksa. Mereka merusak pagar kampus. Soal detail kasusnya masih dalam pemeriksaan,” katanya. Salah seorang mahasiswa Kedokteran UISU Haikal, 20, mengatakan, kejadian tersebut sekira pukul 07:30. Puluhan sekuriti dan pegawai dari UISU Al Munawwarah datang untuk menduduki kampus kedokteran dengan membawa palu dan linggis. Mereka melakukan pengrusakan, sehingga proses belajar mengajar terganggu. Beberapa pegawai dan mahasiswa Kedokteran UISU berusaha menghalangi, tetapi mendapat penganiayaan. “Pegawai kebersihan mengalami luka-luka karena dianiaya, termasuk beberapa mahasiswa,” sebutnya di dampingi sejumlah

rekannya saat membuat laporan di Poldasu. Menurut Haikal, saat kejadian itu dirinya berada di dalam kampus bersama temantemannya, sehingga tidak bisa keluar dari kampus. “Kami dikepungpuluhansekuritiyangmembawa palu, balok dan lainnya. Sangat mencekam suasananya, mereka menghancurkan kacakaca, pintu, gerbang,” ujarnya. Hal itu dibenarkan pengawas keamanan kampus kedokteran. “Mereka melakukannya dengan cara-cara preman, sama seperti saat mengambil alih kampus utama UISU beberapa tahun lalu,” tuturnya. Pengrusakan dan penyerangan berhenti setelah aparat kepolisian Polsek Medan Kota yang menerima informasi segera melakukan pengamanan dan menangkap para pelaku. Keseluruhannya kemudian diserahkan ke Poldasu untuk proses pemeriksaan.(m27)

Ganesha Operation

MEDAN (Waspada): Kepala Wilayah Ganesha Operation (GO) Sumbagut Ir. Jamso Haryono menegaskan, orang orang yang dinilai zero, lemah, miskin, bahkan dianggap hina, bisa meraih sukses. “Dengan visi yang jelas, memperbaiki citra diri, tekad yang kuat , kegigihan, konsisten dan strategi, maka orang yang dianggap lemah tadi akhirnya bisa meraih sukses,” kata Jamso Haryono saat memotivasi 2.500 siswa dan orangtua dalam seminar The Power of Change, from Zero to Hero di Auditorium Unimed, Minggu (16/2). Dicontohkannya, Wahyudin anak miskin dari Bekasi yang sejak kelas IV SD harus memulung mulai pukul 01.00 dinihari untuk menyambung hidup dan biaya sekolah, akhirnya berhasil menjadi Sarjana Akuntansi dan berniat melanjutkan studi S2 Perpajakan. “Chairul Tanjung, Si Anak Singkong berhasil menjadi konglomerat dan masuk daftar 17 orang terkaya di Indonesia dengan kekayaan Rp18 triliun lebih. Dia berangkat dari keterbatasan dan keterpurukan. Bahkan Thomas Alfa Edison yang dianggap idiot , akhirnya menjadi ilmuwan terkemuka di dunia. Semuanya diawali dari visi dan tekad berubah dari zero menjadi hero,” tegas Jamso. Karena itu, siswa GO harus mampu meneladani mereka yang sukses dan harus mau

Waspada/ist

SALAH seorang siswa GO menyerahkan ikrar perubahan sikap kepada orangtuanya pada acara seminar di Auditorium Unimed, Minggu (16/2). berubah. “Tinggalkan kegiatan yang menjauhkan kita dari visi, seperti berlama-lama nonton film, main game, nongkrong di mall, facebook, chatting dan lainnya. Prioritaskan belajar, apalagi mulai17Februari2014telahdibukapendaftaranSNMPTN.Strategi sudah kami berikan, tetapkan pilihan setelah konsultasi dengan pengajar GO,” terangnya. Di akhir acara Jamso meminta seluruh peserta agar menuliskan ikrar perubahan sikap dan menyerahkannya langsung kepada orangtua masing-masing. Terasa suasana haru karena tidak sedikit siswa dan orangtua berpelukan. Bahkan orangtua menangis menerima janji perubahan sikap putra-putri mereka. “Saat terindah bagi orang

tua adalah ketika mereka menangis, bukan karena terluka oleh tingkah lakumu, tetapi karena bangga akan prestasimu,” ujar Jamso mengakhiri paparannya. Sementara itu, Kepala Bagian Akademik GO Sumbagut, Edi S. Tinambunan, ST menambahkan, seminar motivasi yang secara rutin dilaksanakan 4 kali setahun berhasil meningkatkan jumlah siswa GO yang lulus PTN dan masuk SMA favorit dari tahun ke tahun. “Tentu saja didukung fasilitas buku, rumus The King, Try Out yang dilengkapi dengan Evaluasi Prestasi Belajar (EPB), musik klasik, strategi menuju sukses (SMS) dan lainnya,” ujarnya. (rel/h02)

Jadwal Perjalanan Kereta Api No KA

Nama KA

U28 A U30 A U32 A U34 A U27 A U29 A U31 A U33 A U37 A U38 A U39 A U40 A U41 A U42 A U43 A U44 A U35 A U36 A U45 A U46 A U47 A U48 A U49 A U50 A U51 A U52 A U53 A U54 A U55 A U56 A U57 A U58 A U59 A U60 A

SRI BILAH SRI BILAH SRI BILAH SRI BILAH SRI BILAH SRI BILAH SRI BILAH SRI BILAH SIREKS SIREKS PUTRI DELI PUTRI DELI PUTRI DELI PUTRI DELI PUTRI DELI PUTRI DELI SRI LELA SRI LELA SRI LELA SRI LELA SRI LELA SRI LELA SRI LELA SRI LELA SRI LELA SRI LELA SRI LELA SRI LELA SRI LELA SRI LELA SRI LELA SRI LELA SRI LELA SRI LELA

Kelas

Dari

Tujuan

EKS/BISNIS BISNIS EKS/BISNIS EKS/BISNIS EKS/BISNIS EKS/BISNIS BISNIS EKS/BISNIS EKONOMI EKONOMI EKONOMI EKONOMI EKONOMI EKONOMI EKONOMI EKONOMI EKONOMI EKONOMI EKONOMI EKONOMI EKONOMI EKONOMI EKONOMI EKONOMI EKONOMI EKONOMI EKONOMI EKONOMI EKONOMI EKONOMI EKONOMI EKONOMI EKONOMI EKONOMI

MEDAN MEDAN MEDAN MEDAN RANTAU P RANTAU P RANTAU P RANTAU P SIANTAR MEDAN TANJUNG B MEDAN TANJUNG B MEDAN TANJUNG B MEDAN TEBING T MEDAN BINJAI MEDAN BINJAI MEDAN BINJAI MEDAN BINJAI MEDAN BINJAI MEDAN BINJAI MEDAN BINJAI MEDAN BINJAI MEDAN

Berangkat

Datang

RANTAU P 07.47 RANTAU P 10.17 RANTAU P 15.44 RANTAU P 23.03 MEDAN 07.52 MEDAN 14.58 MEDAN 17.18 MEDAN 23.13 MEDAN 08.08 SIANTAR 14.30 MEDAN 07.50 TANJUNG 06.49 MEDAN 13.06 TANJUNG B 13.11 MEDAN 19.36 TANJUNG B 17.33 MEDAN 05.42 TEBING TINGGI 18.44 MEDAN 05.46 BINJAI 05.02 MEDAN 07.14 BINJAI 06.30 MEDAN 09.15 BINJAI 08.30 MEDAN 12.18 BINJAI 10.00 MEDAN 13.53 BINJAI 13.09 MEDAN 16.49 BINJAI 14.37 MEDAN 19.00 BINJAI 18.16 MEDAN 21.40 BINJAI 20.56

13.56 15.46 22.02 04.38 14.04 10.17 22.55 04.47 11.54 18.24 12.54 11.11 18.01 17.45 00.29 22.24 07.42 20.57 06.15 05.31 07.43 06.59 09.44 08.59 12.47 10.29 14.22 13.38 17.18 15.06 19.29 18.45 22.09 21.25

Jadwal Keberangkatan KA Bandara Medan –Kuala Namu

Kuala Namu- Medan

No. KA

No. KA

Berangkat

Tiba KNIA

Berangkat KNIA Tiba Medan

U62 04:00 04:37 U61 05:05 06:50 U2A 04:50 05:27 U65 07:33 08:15 U4A 06:15 06:52 U1A 08:00 08:46 U6A 07:16 07:53 U3A 09:05 09:49 U8A 08:20 08:57 U5A 09:25 10:10 U10A 09:10 09:47 U7A 10:20 11:07 U12A 10:40 11:17 U9A 11:50 12:37 U14A 11:10 11:47 U11A 12:25 13:09 U16A 12:10 12:47 U13A 13:25 14:12 U18A 13:45 14:22 U15A 14:55 15:42 U20A 14:15 14:52 U17A 15:30 16:14 U22A 15:15 15:52 U19A 16:25 17:12 U24A 16:45 17:22 U21A 17:55 18:42 U26A 17:15 17:52 U23A 18:30 19:14 U66 18:15 18:52 U25A 19:56 20:40 U68 19:17 19:54 U67 20:40 21:17 U70 20:01 20:38 U69 21:15 21:59 U72 21:10 21:57 U71 23:30 00:07 NB: Tiket dapat dibeli di stasiun KA Bandara Medan dan Kuala Namu. Pembayaran dapat menggunakan Kartu Prabayar, Debit dan Kredit Card. Tiket dapat dipesan 7 hari sebelum berangkat. (m32)

A5

Waspada/Andi Aria Tirtayasa

KANIT Lantas Polsek Medan Area AKP Mukin Rambe memperhatikan personel Lantas Aiptu Dwikora hendak menilang seorang pengendara sepedamotor yang tidak memakai helm di Jln AR Hakim Medan, Rabu (19/2) sekira pukul 11:00.

Unit Lantas Polsek Medan Area Tindak 377 Pengendara Sepedamotor MEDAN (Waspada): Selama pelaksanaan Operasi Medan Tertib, Unit Lantas Polsek Medan Area menindak 377 pengendara kendaraan bermotor karena tidak mematuhi peraturan lalulintas di jalan raya. Pengendara kendaraan bermotor yang tidak memiliki surat izin mengemudi (SIM), mendominasi kasus pelanggaran peraturan lalulintas. Kapolsek Medan Area Kompol Rama Samtama Putra melalui Kanit Lantas AKP Mukmin Rambe menjelaskan, pelaksanaan Operasi Medan Tertib di wilayah hukum Polsek Medan Area digelar di beberapa lokasi seperti di Jln AR Hakim, Jln Asia

dan di persimpangan Jln Sutrisno - Jln. Denai - Jln AR Hakim. “Pengendara sepedamotor yang tidak memiliki SIM mendominasi surat tilang, disusul tidak memiliki STNK, tidak memakai helm dan tidak memiliki perlengkapan sepedamotor,” jelas AKP Mukmin Rambe di sela-sela pelaksanaan razia di Jln. AR Hakim Medan. Rambe menjelaskan, dari 377 surat tilang yang diberikan kepada para pengendara kenderaan bermotor tersebut, 198 diantaranya karena pengendara tidak memiliki SIM dan 82 pengendara ditilang karena tidak memiliki STNK. Sementara, 107 Pengendara lainnya ditilang

karena tidak memiliki SIM, STNK dan tanpa helm sehingga sepedamotornya ditahan. Kanit Lantas Polsek Medan Area AKP Mukmin Rambe menjelaskan, Operasi Medan Tertib bertujuan mengajak masyarakat agar disiplin berlalulintas di jalan raya sekaligus mematuhi peraturan lalulintas sehingga mencegah terjadinya kecelakaan di jalan raya. “Bila masyarakat disiplin dalam berlalulintas di jalan raya, tidak menerobos lampu merah atau mematuhi rambu-rambu, maka akan memberi kenyamanan dan keamanan terhadap pengguna jalan lainnya,” sebut AKP Mukmin Rambe. (h04)

Yayasan Indah Medan Gelar Capping Day MEDAN (Waspada): Yayasan Indah Medan menggelar Capping Day (pemasangan cap) untuk 147 mahasiswa Akademi Kebidanan (Akbid) dan Akademi Keperawatan (Akper) angkatan XII, di Auditorium Unimed, Selasa (18/2). 148 Mahasiswa yang mengikuti capping day tersebut, terdiri dari 96 mahasiswa Akbid dan 52 mahasiswa Akper. Turut hadir Kepala Dinas Kesehatan Sumut dr. Raden Roro Siti Hartati Suryantini, PembinaYayasan Indah Medan H.Harris Sy Hasibuan, KetuaYayasan Indah dr. M. Rizki Ramadhan Hasibuan, Direktris Akbid EnniYusriani Nasution, Direktur Akper Ambali Azwar Siregar, Direktur RS Permata Bunda dr. Syaiful Munawar Sitompul, Direktur RS Kesdam, para dosen dan orangtua mahasiswa. Kadis Kesehatan Sumut dr. Raden Roro Siti Hartati Suryantini mengatakan, perawat dan bidan memiliki posisi penting terutama dalam pencapaian sasaran MDGs dengan cara memberi pelayanan berkesinambungan dan paripurna. Berfokus pada aspek pencegahan, promosi dengan berlandaskan

kemitraan dan pemberdayaan masyarakat. Sementara itu, Wakil dari Kopertis Wilayah I Sumut Solahuddin mengatakan, capping day ini merupakan bukti bahwa Yayasan Indah telah melaksanakan proses belajar dan mengajar sesuai dengan kurikulum. Dia berharap para mahasiswa Akbid dan Akper terus menimba ilmu pengetahuan dan perilaku yang baik sehingga mudah beradaptasi dengan lingkungan. Para mahasiswa Yayasan Indah juga diharapkan mampu menjaga nama baik almamater sebagai wadah melahirkan tenaga bidan dan perawat profesional yang baik dan bermoral. Kopertis juga mengimbau kepada para dosen dan staf pengajar Yayasan Indah agar terus mengembangkan potensi diri dengan melanjutkan pendidikan ke jenjang yang lebih tinggi yakni S2 atau S3. Sebab, dosen dan staf pengajar yang berkualitas dapat menghasilkan lulusan yang bermutu. Tingkatkan Kualitas Ketua Yayasan Indah dr. M. Rizki Ramadhan mengatakan,

kegiatan capping day setiap tahun dilaksanakan Yayasan Indah. Momen ini sebagai penglepasan mahasiswa Akper dan Akbid untuk melaksanakan praktik di sejumlah rumah sakit. “Mahasiswa Akbid dan Akper ini akan menjalani praktik pelayanan kesehatan di RSU Dr. Pirngadi Medan, RS Permata Bunda, Rumkit Kesdam I/BB, RS Martha Friska, RS Indah dan klinik persalinan lainnya,” kata Rizki didampingi Direktur Akper Ambali Azwar Siregar. Sejauh ini, Yayasan Indah telah melahirkan tenaga kesehatan yang handal, seperti bidan, perawat dan tenaga farmasi. “Untuk tahun ini,Yayasan Indah menampung 237 mahasiswa baru, diantaranya 96 mahasiswa Akbid dan 52 Akper serta Akademi Farmasi (Akfar) sebanyak 89 mahasiswa,” ujarnya. Pada kesempatan itu, Rizki menambahkan, Yayasan Indah dalam waktu dekat akan meningkatkan statusnya menjadi Sekolah Tinggi Kesehatan (STIKes). “Saat ini masih dalam pengurusan di Pusat, serta pembangunan gedungYayasan Indah Medan,” ujarnya.(h02)

Pemko Harus Sediakan Outlet Sampah

Waspada/ist

REKTOR UISU Dr. Ir. Mhd. Asaad, MSi menyerahkan bantuan perlengkapan sekolah kepada anakanak korban kebakaran.

FE UISU Al Manar Bantu Korban Kebakaran Belawan MEDAN (Waspada): Keluarga Besar Fakultas Ekonomi Universitas Islam Sumatera Utara (FE UISU) Al Manar menyalurkan bantuan pendidikan dan sembako untuk korban kebakaran di Gg. Sejahtera, Lingkungan 6 dan 7 Kelurahan Belawan Bahari (Kampung Kurnia ), Kecamatan Medan Belawan, Senin (17/2). Bantuan tersebut diserahkan Rektor UISU Dr. Ir. Mhd. Asaad, MSi kepada para korban kebakaran di halaman SMA/ SMK Yapim Taruna Belawan. Bantuan pendidikan tersebut berupa perlengkapan sekolah seperti pakaian seragam, alat tulis, buku dan tas untuk 109 siswa yang terdiri dari 48 siswa SD, 28 siswa SMP dan 23 siswa SMA. Sedangkan bantuan semba-

ko berupa, 49 kardus mie instan, 49 karung beras masing-masing 10 kg dan 49 sarung. “Ini merupakan kegiatan peduli pendidikan Fakultas Ekonomi UISU dalam rangka pengabdian masyarakat pada Milad ke-59, momen ini merupakan bakti sosial kami, setidaknya menjadi penyejuk atas musibah ini,” ucap Rektor UISU Mhd. Asaad didampingi Pembantu Rektor I Syofyan, SE, MSi; pembantu rektor IV Drs. H. Syarifuddin Al Hayat, MA; Dekan FE UISU H. Misri SE, MSi dan unsur pembantu dekan serta mahasiswa/i Fakultas Ekonomi UISU. Asaad berharap, bantuan yang diberikan bermanfaat untuk menunjang pendidikan anak-anak yang menjadi korban

kebakaran. Fitri salah seorang korban kebakaran mengucapkan terimakasih atas bantuan yang diberikan tersebut. “Semoga ini menjadi berkah buat kami dan anak-anak kami,” katanya dengan rasa haru. Sementara itu, Sekretaris Kecamatan Medan Belawan Saud Sinaga mewakili korban juga mengucapkan terimakasih atas bantuan yang diberikan Fakultas Ekonomi UISU. Seperti diketahui, kebakaran melanda Lingkungan 6 dan 7, Kelurahan Belawan Bahari (Kampung Kurnia), Kecamatan Medan Belawan terjadi pada 26 Januari. Akibat peristiwa itu, 35 rumah musnah dan 14 rumah terpaksa dirusak untuk proses pemadaman api.(m08)

MEDAN (Waspada: Pemerintah Kota (Pemko) Medan melalui Dinas Kebersihan diminta menyediakan outlet-outlet sampah di seluruh kawasan Medan. Karena keberadaannya sejalan dengan upaya membebaskan ibukota Sumut dari sampah dan sekaligus mendukung keberadaan bank sampah. Permintaan itu disampaikan Ketua DPRD Kota Medan Drs H Amiruddin dalam siaran pers yang diterima Waspada, Rabu (19/2), dalam menanggapi belum maksimal penanganan sampah, sehingga Kota Medan belum bebas dari sampah. Menurut Amiruddin yang juga Caleg DPRD Medan dari Partai Demokrat Dapil Medan 1 dengan No.Urut 2, keberadaan outlet sampah itu ibarat bank dengan ATM nya, bertujuan agar masyarakatmudahmenyetorkan sampah yang dimiliki. Dia menyebutkan, penyediaan outlet sampah merupakan cara lain meningkatkan ekonomi kerakyatan. “Jadi, outlet yang disediakan itu nantinya berfungsi memudahkan masyarakat mengelola sampah, sehingga juga akan bermanfaat untuk meningkatkan perekonomian mereka,” kata politisi Demokrat Medan ini. Cara lain yang bisa dilakukan Pemko Medan, sebut Amiruddin, menerapkan sistem door to door dengan menyiapkan angkutan khusus untuk

mengambil dan menarik sampah langsung ke masyarakat. Sebagai Ketua DPRD Medan, Amiruddin mengakui, permasalahan sampah di Medan masih harus dicari solusi yang pas dalam mengatasinya. Untuk itu, sistem manajemen kelola sampah yang baik sangat diperlukan sehingga tujuan menjadikan Medan bebas sampah bisa terwujud. Dia mengharapkan agar sampah terkelola dengan baik dan sekaligus mampu menjadi potensi dalam peningkatan ekonomi warga ke depan. Pemko Medan segera memasukkan program pengelolaan sampah dalam Rencana Pembangunan Jangka Menengah Daerah (RPJMD) Medan. “Dengan masuknya sistem

pengelolaan sampah dalam RPJMD Medan, diharapkan dapat terbentuknya Unit Pengelolaan Sampah (UPS), dimana sampah yang berasal dari masyarakat dapat langsung dikelola oleh masyarakat di setiap UPS yang terbentuk,” tuturnya. Diketahui, Pemko Medan kerjasama dengan Kota Kitakyushu, Jepang, dalam waktu dekat akan membangun bank sampah dan rumah kompos di Kelurahan Belawan Sicanang, Kec. Medan Belawan. Dengan kerja sama itu diharapkan dapat mewujudkan keinginan untuk menjadikan ibukota Provinsi Sumatera Utara bersih dari sampah. Sekaligus menjadikan Medan sebagai percontohan dalam pengelolaan sampah di Indonesia.(m22)

Waspada/Ist

KETUA DPRD Medan Drs H Amiruddin mengunjungi salah satu kantor kelurahan di Kecamatan Medan Area, untuk melihat dari dekat upaya yang dilakukan pihak kelurahan dalam mengatasi sampah.


Medan Metropolitan

A6

WASPADA Kamis 20 Februari 2014

Wakil Ketua DPRD Medan Dilaporkan Ke BKD MEDAN (Waspada): Wakil Ketua DPRD Medan Ikrimah Hamidy, dilaporkan ke Badan Kehormatan Dewan (BKD), Rabu (19/2), terkait ucapannya yang menyatakan rapat dengar pendapat (RDP) Komisi D yang digelar pada Senin (11/2) lalu tidak sah. Wakil Ketua DPRD Medan ini dilaporkan oleh Ketua Kope-

rasi Serba Usaha Subur Provinsi Sumatera Utara (KSU Subur Provsu) Jansen Butarbutar. Dalam surat pengaduan Jansen No. 476/KSU-SB/II/2014 Tanggal 19 Februari 2014 tersebut, BKD diminta agar memanggil Ikrimah Hamidy untuk mengklarifikasi ucapannya yang menyatakan rekomendasi hasil RDP Komisi D itu batal dan tidak sah. Kata Jansen, RDP itu dilakukan atas permohonan warga ter-

Konsolidasi Amil Zakat Untuk Sinergi Sinabung MEDAN ( Waspada): 13 Organisasi Pengelola Zakat dan Filantropi Islam di Sumatera Utara, melakukan rapat koordinasi untuk sinergi berkelanjutan membantu pengungsi yang berada di lereng Gunung Sinabung dan permasalahan umat, Rabu (19/2). Para lembaga zakat yang hadir di antaranya Dompet Dhuafa Waspada, Rumah Zakat, PKPU, Baitul Maal Muamalat, Baitul maal Hidayatullah, PZU Persis, Yayasan Baitul Maal Bank Rakyat Indonesia, Lazis PLN, Baituzzakah Pertamina, LAZ Ulil Albaab, Lazis Namira, dan Lazis Bank Sumut. “Kami menunggu momen seperti ini. Kekuatan lembaga zakat dan filantropi Islam di Sumatera Utara ini luar biasa. Bayangkan jika bersatu, tentu sangat membantu umat,” ujar Manager Fundraising dan Markom Dompet Dhuafa Waspada Sulaiman. Rapat yang diselenggarakan di RM Ayam Bakar Wong Solo Polonia Medan, melahirkan empat kesepakatan di antaranya, pertama, mengaktifkan kembali asosiasi organisasi pengelola zakat, yaitu forum zakat dengan membentuk kepanitiaan persiapan musyawarah wilayah forum zakat. Kedua, persiapan advokasi setelah peraturan pemerintah sebagai regulasi turunan dari UU No 23 Tahun 2011 dilahirkan. Ketiga, dakwah paska erupsi Gunung Sinabung, dan keempat pembenahan sarana masjid yang rusak akibat erupsi Sinabung. Dalam forum itu para amil mendiskusikan tentang peta jalan zakat setelah UU Zakat dikukuhkan oleh Mahkamah Konstitusi pada 30 Oktobr 2013 lalu. Forum akan memfasilitasi anggota yang belum legal dan kerjasama kelembagaan. “ Fungsi FOZ salah satunya adalah advokasi anggota,” ujar Hambali, GM Dompet Dhuafa Waspada. Lembaga zakat bersepakat untuk menghimpun data, bantuan, dan sinergi di tiga program, yaitu dakwah, kesehatan, dan tempat ibadah. Yayasan Baitul Maal BRI siap menyediakan tong wudhu, Baituzzakat Pertamina dan Rumah Zakat juga memiliki program serupa. Dompet Dhuafa Waspada telah mengirim dai sejak tahun 2010 ke Tanah Karo dan ini akan menjadi program penting lembagalembaga zakat di Sumatera Utara kedepannya. (cwan)

Rumah Polisi Dibobol Maling MEDAN (Waspada): Rumah milik Brigadir Fhiristman Tampubolon, 33, anggota Sat Lantas Polresta Medan, di Jln. Harapan Pasti, Kec. Medan Denai, Senin (17/2) sekira pukul 04:00, dibobol maling. Akibatnya, korban kehilangan 1 laptop, Ipad, 2 handphone, dan sejumlah surat-surat penting lainnya. Informasi yang diperoleh di kepolisian, pada saat kejadian, Brigadir Fhiristman Tampubolon tertidur di ruang tamunya. Saat itu, Tampubolon terbangun dari tidurnya karena gigitan nyamuk. Dia melihat pintu depan rumahnya sudah terbuka lebar, sehingga nyamuk-nyamuk bebas masuk ke rumahnya. Merasa curiga, korban segera memeriksa kondisi pintu rumahnya, namun tidak ada yang rusak, sedangkan kunci rumah masih tergantung di pintu tersebut. Diduga, korban lupa mengunci pintu rumahnya. Ketika dia memeriksa isi rumah, ternyata laptop merk Accer, Ipad dan 2 handphone miliknya telah raib. Maling yang diperkirakan lebih dari dua orang itu, juga menggondol beberapa surat penting lainnya. Korban segera melaporkan peristiwa tersebut ke Polsek Medan Area, sedangkan petugas Identifikasi Polresta Medan juga sudah melakukan olah TKP. (h04)

Pengedar Sabu Divonis Tujuh Tahun Penjara MEDAN (Waspada): Terdakwa Sumantri yang melakukan transaksi narkoba dengan petugas kepolisian yang menyaru sebagai pembeli, divonis tujuh tahun penjara dalam persidangan di ruang Chandra I Pengadilan Negeri Medan, Selasa (18/2). Dalam agenda sidang putusan tersebut, majelis hakim yang diketuai Gerchat Pasaribu SH, juga menghukum terdakwa dengan denda Rp1 miliar dan apabila tidak dapat membayar denda dapat diganti kurungan penjara selama 1 bulan. “Sesuai fakta-fakta persidangan, terdakwa telah terbukti secara sah dan meyakinkan memiliki dan mengedarkan narkotika golongan I bukan tanaman dan melanggar Pasal 112 ayat 2 UU No.35 Tahun 2009 tentang narkotika dan menjatuhkan hukuman kepada terdakwa selama 7 tahun penjara, denda Rp1 miliar subsider 1 bulan,” kata hakim. Terdakwa yang mendengar putusan tersebut langsung saja mengangguk-angguk menerima putusan tersebut. Begitu juga dengan Jaksa Penuntut Umum (JPU) Pengganti Randi Tambunan yang menggantikan JPU Rismaidi menerima putusan tersebut. Putusan yang dijatuhkan majelis hakim ini lebih rendah dari tuntutan jaksa yang dalam persidangan sebelumnya menuntut selama 9 tahun penjara. Sebelumnya, terdakwa ditangkap saat melakukan transaksi narkoba dengan petugas kepolisian yang menyaru sebagai pembeli. Dari tersangka, petugas menemukan bungkusan sabu seberat 101,29 gram. (m38)

kait normalisasi Sungai Sulang Saling. “Kita hadir atas undangan resmi DPRD Medan. Namun ketika Ikrimah Hamidy diminta untuk memaraf rekomendasi hasil RDP, malah dia menyatakan RDP batal dan tidak sah,” ujarnya. Padahal, kata Jansen, RDP dihadiri empat anggota Komisi D DPRD Medan yakni CP Nainggolan (ketua), Daniel Pinem (sekretaris), M Faisal dan Ahmad Arif (anggota). Selain itu hadir juga sejumlah perwakilan SKPD Pemko Medan seperti Kadis Pertamanan Zulkifli Sitepu, perwakilan Dinas TRTB, Dinas Perkim, dan pihak BWSS. “Kita tidak mengerti kenapa Ikrimah Hamidy tidak mau memaraf rekomendasi hasil RDP dan malah menyatakan rekomendasi Komisi D batal dan tidak sah. Karena itu kami minta BKD memanggil Ikrimah untuk

mengklarifikasi hal itu,” sebutnya. Kepentingan Pribadi Sementara itu, Ikrimah Hamidy saat dikonfirmasi mengaku sudah tahu dirinya dilaporkan ke BKD. Baginya pengaduan tersebut tidak masalah dan dia mengaku siap kalau dipanggil BKD. “Tidak apa-apa, saya akan hadapi biar sekalian kita bongkar ada apa dibalik usulan normalisasi Sungai Sulang Saling yang membawa-bawa kepentingan masyarakat,” katanya. Ikrimah menuturkan, dirinya tidak mau memaraf hasil RDP di Komisi D DPRD Medan pada Senin (11/2) lalu yang akan menjadi rekomendasi DPRD Medan, karena ada hal-hal yang mencurigakan dan diduga ada kepentingan pribadi di dalamnya. “Saya curiga ada oknum-

oknum tertentu yang bermain dan memanfaatkan surat rekomendasi itu untuk kepentingan pribadi dengan membawabawa nama masyarakat. Jadi saya tidak mau terlibat, makanya saya menolak memarafnya,” tuturnya. Selain itu, menurut Ikrimah, kewenangannya sebagai Wakil Ketua DPRD Medan sekaligus Koordinator Komisi D untuk mendisposisi surat terkait permohonan warga tersebut juga telah dilangkahi. Artinya, dari sisi administrasi sudah tidak sesuai prosedur. “Sebagai Koordinator Komisi D harusnya saya yang mendisposisi surat masuk maupun surat keluar yang berkaitan dengan Komisi D. Tetapi dalam masalah ini kewenangan saya sudah dilangkahi, dari sisi prosedur instansi ada yang janggal,” ujarnya. (m30)

Tak Lulus CPNS

Waspada/Amir Syarifuddin

GUBSU Gatot Pujo Nugroho memberi sambutan pada peringatan Maulid Nabi Muhammad SAW, di Aula Martabe Kantor Gubsu, Rabu (19/2).

Gubsu: Peringatan Maulid Satu Truk Sampah Dibuang Ke Kantor Camat Pancurbatu Jangan Hanya Seremonial

MEDAN (Waspada): Halaman kantor Camat Pancurbatu di Jln. Jamin Ginting “dihadiahi” satu truk sampah, Senin (17/2). Aksi tersebut bentuk kekecewaan beberapa honorer di kantor camat itu yang tidak lulus CPNS kategori dua (K2). Informasi diterima wartawan, peristiwa tersebut dipicu kekecewaan para tenaga honorer telah mengabdi selama 20 tahun lebih gagal menjadi CPNS. Dari tujuh honorer kantor Camat Pancurbatu yang melakukan testing CPNS, hanya tiga dinyatakan lulus dan dua di antaranya lulus diindakasikan karena ada permainan. Menurut sumber, ada dugaan terjadi KKN dalam penerimaan CPNS di Kabupaten Deliserdang. Hal itu, kata dia, dibuktikan adanya pegawai honoryangsudah20tahunmengabdi, namun tidak lulus CPNS. Seperti yang dialami Amrin Ginting dan Suhardi. Amrin bekerja di tempat pembuangan

akhir (TPA) sampah sejak tahun 1991. Begitu juga Suhardi selaku sopir truk pengangkut sampah sudah mengabdi sejak tahun 1991. Namun, keduanya yang ikut tes dalam penerimaan CPNS di Kabupaten Deliserdang beberapa bulan lalu, dinyatakan tidak lulus. Selain mereka, juga ada dua lagi yang dinyatakan tidak lulus yakni Efendi dan Nizar Laksamana Tarigan. Anehnya, sebut sumber, dari ketiga orang yang dinyatakan lulus, ada yang tidak dikenal di lingkungan Kantor Camat Pancurbatu. Mungkin hanya namanya yang terdaftar sebagai pegawai honor, sedangkan orangnya tidak pernah masuk bekerja. ”Kemungkinan sistem perekrutan CPNS di Kabupaten Deliserdang bukan tergantung kepada lamanya masa bertugas. Buktinya NH dan AS (kedua honor lulus) jarang berada di Kantor Camat Pancurbatu,” kata sumber.

Sementara itu, Camat Pancurbatu Antonius Pangaribuan ketika dikonfirmasi mengaku dirinya baru enam bulan menjabat, sehingga tidak mengetahui dua honorer di kantornya yang lulus CPNS. Menurut Antonius, prosedur pengajuan sudah selesai pada camat terdahulu. “Yang jelas mereka lepas seleksi, berarti persyaratan sudah terpenuhi,” sebutnya. Ketika dipertanyakan dua pegawai honorer yang lulus testing CPNS tidak pernah masuk bekerja, hal itu dibuktikan pengakuan pegawai lainnya yang tidak mengenal mereka, Camat mengatakan, mereka itu memang benar pegawai honor tapi tidak tiap hari masuk kerja. Ketika disinggung soal sampah yang dibuang ke halaman kantornya, Antoni menuturkan hal tersebut merupakan bentuk kekecewaan honorer yang tidak lulus dalam seleksi CPNS untuk K2.(m40)

Pembunuh Anak Polisi Diboyong Dari Yogyakarta MEDAN (Waspada): Tersangka pembunuh anak anggota Sat Lantas Polresta Medan direncanakan tiba di Polresta Medan, Selasa (18/2) malam, setelah ditangkap di kawasan Sleman, Yogyakarta. “Rencananya malam ini tiba di Polresta Medan karena pukul 16:00 naik pesawat dari Bandung. Kalau sudah sampai Medan nanti kita ekspos,” kata Kasat Reskrim Kompol Jean Calvijn Simanjuntak. Dijelaskannya, lamanya tersangka RV, 25, warga Jln. Pendidikan, Medan Tembung, diboyong ke Medan, karena terkendala penerbangan yang tidak diizinkan pemerintah terkait meletusnya Gunung Kelud. Demi keselamatan penerbangan maka bandara yang berdekatan terpaksa ditutup. “Kalau tidak ada halangan malam ini tersangka sampai di Polresta Medan untuk menjalani pemeriksaan terkait penikaman terhadap korban Mustafa Bakri, 21,” sebutnya. Kata Cavijn, tersangka ditangkap Reskrim Unit Ranmor Polresta Medan dalam penyergapan dari tempat persembunyiannya di Sleman,Yogyakarta, Minggu (16/2). Tersangka RV masih berada di Sleman dan rencananya akan diterbangkan ke Medan, untuk menjalani proses hukum. Sedangkan Kanit Ranmor Iptu Bambang G Hutabarat yang dikonfirmasiWaspada mengatakan, selama dalam pelarian di Sleman, tersangka bersembunyi di rumah kakaknya dan sudah bekerja di salah satu swalayan di kota Sleman. “Pengakuannya setelah menikam korban hingga tewas, tersangka yang takut ditangkap polisi melarikan diri ke rumah saudaranya di

Sleman, bahkan sudah bekerja,” kata Bambang. Peristiwa pembunuhan ini terjadi, Sabtu 12 Oktober 2013. Korban Mustafa Bakri, 21, tewas mengenaskan ketika mengunjungi rumah pacarnya AA, 13, yang masih satu kawasan dengannya di Jln. Pendidikan, Medan Tembung. Korban tewas seketika akibat tusukan senjata tajam yang dilakukan tersangka RV menembus tubuhnya sebanyak empat kali. Warga yang melihat kejadian itu langsung membawa korban ke RS Haji, sedangkan pelaku kabur. Insiden itu bermula saat korban yang merupakan mahasiswa sebuah perguruan tinggi swasta di Medan, bertandang ke rumah kekasihnya yang masih sangat belia. Status AA yang masih duduk di bangku kelas satu SMP membuat orangtuanya menentang keras hubungan asmara itu. Pada malam naas itu, ibu AA meminta anak sulungnya RV menyuruh Mustafa pulang. “Mama yang suruh pulang. Bang Mus langsung pulang, tapi sebentar dia datang lagi,” kata AA di RS Haji. Kedatangan kedua inilah emosi RV, selaku abang kandung AA memuncak. Menurut pengakuan AA, abangnya langsung mendatangi Mustafa dan kemudian menusukkan pisau ke dadanya. Pada tikaman pertama, korban sempat melawan hingga membuat RV melepaskan tusukan kedua hingga keempat yang membuat korban roboh. AA mengaku sangat menyesalkan kejadian itu karena menimbulkan kerugian besar bagi pribadinya. Pasalnya, dia harus kehilangan dua orang sekaligus. “Pacar saya mati jadinya. Abang pun kalau pulang pasti langsung ditangkap,” tuturnya. (m39)

MEDAN (Waspada): Gubernur Sumatera Utara H Gatot Pujo Nugroho ST, MSi, berharap peringatan Maulid Nabi Muhammad SAW 1435 H Pemerintah Provinsi Sumatera Utara, tidak hanya menjadi acara seremonial saja. Melainkan, apa-apa yang diajarkan oleh para penceramah menjadi bekal dan oleh-oleh bagi seluruh Pegawai Negeri Sipil (PNS) dilingkungan Pemprovsu. “Semua nilai yang diajarkan para penceramah hendaknya bisa menjadi bekal dan oleholeh untuk dibawa pulang dan diterapkan di meja kerja. Sehingga sistem pemerintahan ini menjadi lebih baik lagi, institusi ini menjadi lebih bersih dan berwibawa,” kata Gatot saat memberi sambutan pada Peringatan Maulid Nabi Muhammad SAW 1435-H yang digelar Pemprovsu, di Aula Martabe Kantor Gubsu, Rabu (19/2). Hadir Ketua Tim Penggerak PKK Sumut Hj Sutias Handayani Gatot Pujo Nugroho, Wagubsu Ir H Tengku Erry Nuradi MSi, Sekdaprovsu H Nurdin Lubis SH, MM, pejabat esselon II, III dan IV, serta pegawai di lingkungan Pemerintah Provinsi Sumatera Utara. Sesuai tema yang diangkat yakni ‘Dengan Memperingati Maulid Nabi Muhammad SAW 1435-H Kita Bangun Sumber Daya ManusiaYang Memiliki Integritas Dalam Berbangsa dan Bernegara, Religius dan Berkompetensi Tinggi” menurut Gubsu sangat sejalan dengan visi dan misi Pemprovsu. “Kita ingin menghadirkan birokrat yang bersih dan berwibawa juga kita ingin menghadirkan SDM kenapa? Karena saya bersama wakil Gubernur Ingin 5 tahun ke depan Sumatera Utara manjadi provinsi yang daya saing. Kata kunci daya saing menurut saya adalah permasalahan infrastruktur tetapi yang lebih penting adalah SDM,” sebutnya. Dengan manusia yang bersih dan berwibawa, yang memiliki kompetensi, maka, dengan

kompetensi menjadi manusia yang berdaya saing. “Banyangkan seorang Rasul yang hidup di komunitas yang didiskripsikan masyarakat Jahiliyah, tapi mampu merubah dari sesuatu yang gelap dan jahil menjadi lebih baik. Untuk itu, kepada Sekdaprovsu, Staf Ahli, Asisten dan Pimpinan SKPD saya mengimbau agar tiga hal yang diingatkan penceramah dalam peringatan Maulid ini untuk dijalankan,” tegas Gubsu. Karena apa? Menurut Gubsu, karena pemimpin adalah yang duluan lapar daripada masyarakat yang dipimpinnya. “Kalau tadi saya dengar ada PNS yang belum gajian, teryata bukan belum gajian hanya belum menerima TPP. Untuk itu, yang belum saya minta secepatnya TPP dibayarkan,” katanya. Gubsu berharap, kepala SKPD menjadi contoh tauladan bagi bawahannya dan kepada semua, membuat agar Alquran mewarna kontitusi, institusi dan instansi. “Marilah sekali lagi kita jadikan nilai-nilai itu menginspirasi intitusi dan instansi kita sehingga menjadi instansi bersih dan berwibawa yang berdaya saing,” ujarnya. Sementara itu, Ustadz KH Amiruddin MS dalam ceramahnya mengatakan, setiap manusia mempunyai tugas elemen batin yang potensial yakni intelektual, ritual, dan emosional. “Kalau kaitan bagaimana membangun pemerintahan yang bersih apakah pemerintahnya dan rakyatnya sama objek yang dituju yakni akal untuk berfikir dan mengolah alam semesta, kedua qolbu untuk beriman dan meyakini ada pencipta pemilik yang pengatur alam semesta dan ketiga emosional ada daya dorong untuk mendrop energi,” ujarnya. Maka, bila qolbu ini terhubung pada Allah SWT apapun dan dimanapun juga akan dilihat Allah. “Kita merasa tetap ada yang mengawasi. Maka lahirlah sifat jujur amanah, bersih. Insyaallah intinya intelektual, spiritual, dan emosional harus berimbang,” tuturnya.(m28)

Tas Pengendara Sepedamotor Dirampok MEDAN (Waspada): Pulang berlibur dari objek wisata Bukitlawang, tas milik Khairani, 42, warga Jln. Pimpinan Gang Suka Dame, Kel. Sei Kera Hilir I, Kec. Medan Perjuangan, dirampok dua pelaku yang mengendarai sepedamotor jenis Mio di Jln. Letda Sujono, Kec. Medan Tembung, Minggu (16/2) malam. Usai membuat laporan pengaduan di Polsek Percut Seituan, Selasa (18/2), Khairani menuturkan, kejadian berawal saat dia bersama anak perempuannya baru pulang liburan di daerah objek wisata Bukitlawang menuju rumah orangtuanya di kawasan Titi Sewa Tembung, mengambil sepedamotornya yang dititipkan. Setelah mengambil sepedamotor jenis Scoopy miliknya, korban dan anaknya pulang menuju ke rumahnya. Namun, setibanya di Jln. Letda Sujono, korban menghentikan laju sepedamotornya karena ada pengemudi beca motor yang berhenti tepat di depannya. Tiba-tiba kedua pelaku yang diduga telah mengikuti korban, langsung mendekat. Seorang pelaku yang dibonceng langsung merampas tas yang berada di pangkuan putrid korban dari sebelah kanan. Korban spontan berteriak rampok sembari mengejar kedua pelaku.

Warga juga ikut melakukan pengejaran terhadap pelaku yang kabur menuju Jln. Aksara. Tetapi pelaku berhasil kabur dari kejaran korban. Akibat peristiwa tersebut, korban kehilangan tas berisi Hp, SIM, STNK dan dompet yang berisikan uang Rp300 ribu. Di tempat terpisah, Suhairi Ramadhan ,40, warga Desa Bandarsetia, Kec. Percut Seituan, Senin (17/2) sekira pukul 24:00, dirampok dua pelaku mengendarai sepedamotor di Jln. Prof HM Yamin, Kec. Medan Timur, persis depan toko roti Majestik. Korban menderita luka-luka karena terjatuh saat mempertahankan tasnya yang akan dirampok. Menurut Suhairi, pada malam itu dirinya mengendarai sepedamotor jenis Vespa hendak pulang ke rumahnya usai melaksanakan tugas piket malam di Jln. Ahmad Yani Medan. Saat melintas di Jln. Prof HM Yamin, tiba-tiba dua pengendara sepedamotor merampas tasnya. “Tas yang kubawa dirampas oleh seorang pelaku, namun aku berusaha mempertahankannya. Akibatnya, Vespaku jatuh dan aku tersungkur. Wajahku luka-luka dan kakiku luka memar,” tutur Suhairi yang berprofesi wartawan di koran terbitan Medan. (h04)


Nusantara

WASPADA Kamis 20 Februari 2014

Penerbangan AirAsia Rute Yogyakarta Kembali Beroperasi JAKARTA ( Waspada): AirAsia kembali mengoperasikan rute dari dan ke Yogyakarta setelah Bandara Internasional Adisutjipto dibuka Rabu (19/2) pukul 12:00 WIB menyusul kondisi terkini yang dinilai aman dan kondusif untuk penerbangan. Pesawat AirAsia Indonesia dengan nomor penerbangan QZ 8448 telah mendarat di Yogyakarta dari Denpasar pukul 12:43 WIB. Penerbangan AirAsia Indonesia selanjutnya dari Bandara Adisutjipto adalah QZ 8449 dengan rute Yogyakarta – Denpasar pukul 13:10 WIB. Presiden Direktur AirAsia Indonesia, Dharmadi mengatakan, seiring dengan dibukanya Bandara Internasional Adisutjipto pukul 12:00 WIB itu, maka penerbangan AirAsia dari dan ke Yogyakarta mulai Kamis (20/2) akan beroperasi normal sesuai jadwal. ”Dimana penerbangan pertama adalah rute Yogyakarta – Denpasar QZ 8441 pukul 06:25 WIB. Sementara

penerbangan Solo-Kuala Lumpur masih dihentikan sementara waktu sampai dibukanya kembali Bandara Adi Sumarmo,” kata Dharmadi dalam siaran persnya di Jakarta, Rabu (19/2). Selanjutnya Dharmadi menyampaikan rute penerbangan AirAsia dari Bandara Internasional Adisutjipto yakni,Yogyakarta – Jakarta,Yogyakarta – Denpasar, Yogyakarta – Singapura, dan Yogyakarta – Kuala Lumpur. Bagi penumpang pemegang tiket penerbangan dengan jadwal keberangkatan sebelum pukul 12:00WIB hari ini dapat memilih salah satu dari dua opsi. Opsi pertama pemindahan jadwal penerbangan (reschedule) di rute yang sama maksimal lima hari setelah pembatalan penerbangan tanpa dikenakan biaya. Opsi kedua Credit Shell, yaitu deposit di AirAsia senilai harga tiket yang dapat digunakan untuk pembelian tiket AirAsia lainnya dengan masa berlaku tiga bulan.(j02)

JELANG PILEG DAN PILPRES 2014 Ir Dra Giwo Rubianto M.Pd:

Suara Perempuan Untuk Perempuan JAKARTA (Waspada): Perjuangan perempuan untuk duduk di kursi parlemen pusat dan daerah sebaiknya diapresiasi oleh para pemilih perempuan dengan memberikan suaranya. “Suara perempuan untuk perempuan sangat penting, sebab tanpa ada perempuan di parlemen, bagaimana mungkin kepentingan perempuan akan diperjuangkan,” imbau Ir Dra SriWoerjaningsih MPd atau akrab disapa Giwo Rubianto, Caleg dari Giwo Rubianto partai Golkar, Rabu (19/2). Ia yakin dengan kemajuan teknologi dan semakin membaiknya pendidikan perempuan, caleg-caleg perempuan makin banyak yang berkualitas. Tak kalah dengan caleg laki-laki termasuk dalam hal memperjuangkan kepentingan masyarakat. Mantan Ketua Komisi Perlindungan Anak Indonesia (KPAI) ini juga menyoroti soal politik dan konsekuensi biaya. Menurutnya, politik memang membawa konsekuensi biaya, tetapi pola pikir bahwa biaya politik adalah untuk membeli suara (politik uang), alias bagi-bagi uang kepada konstituen, sudah saatnya diakhiri. “Biaya politik sebaiknya lebih kepada pembiayaan untuk program-program yang ber-

manfaat bagi masyarakat. Misalnya program pendidikan dan pemberdayaan ekonomi,” kata Giwo. Semua caleg baik tingkat DPR RI (pusat) maupun tingkat daerah (DPRD) harus sama-sama memiliki tanggungjawab mendidik masyarakat untuk tidak terjebak pada pola politik transaksional, pola pikir jual beli suara. Giwo mengatakan bahwa saat terjun ke daerah pemilihanWaspada/Dianw nya (dapil) yakni Jakbar-Jakut dan Pulau Seribu, masih ada sekelompok masyarakat yang memang menginginkan men-dapatkan uang, sembako atau bahkan kerudung.“Saya memang ketemu lang-sung. Agak sulit ya untuk mengubah pola pikir mereka yang memang sudah terjadi bertahun-tahun dan cenderung berulang,” tambahnya. Tetapi sesulit apapun, semua caleg termasuk dirinya memiliki tanggung jawab besar mengubah pola pikir masyarakat dari politik transaksional menjadi politik masa depan. Artinya, politik yang dilandasi dengan cara berpikir cerdas, sehingga saat menentukan pilihannya, masyarakat lebih mempertimbangkan kualitas caleg yang akan dipilihnya. (dianw)

Hariara Ajak Caleg Di Dapil Sumut 1 Deklarasikan Persaingan Sehat JAKARTA (Waspada): Calon anggota legislatif Partai Golkar untuk daerah pemilihan Sumut, Hariara Tambunan, SE,SH, mengajak seluruh caleg DPRRI, DPRD Provinsi dan DPRD Kab/ Kota untuk mendeklarasikan kebersamaan guna bersaing secara sehat, fair, jujur dengan mengedepankan kekeluargaan dan persaudaraan, sehingga tercipta suasana yang harmonis selama masa kampanye pemilu legislatif dan pemilihan presiden. “Saya mengajak seluruh caleg berkumpul dan mendeklarasikan kebersamaan guna bersiang sehat dan fair dan tidak saling menghujat,” ujar Hariara di Jakarta, Rabu (19/2). Wakil Bendahara DPP Partai Golkar ini

menekankan para caleg yang terdiri dari kader partai politik, harus memberikan pendidikan politik dan menunjukkan kepada rakyat bahwa politik bukan alat untuk saling menghujat, tetapi hanya kenderaan untuk meyakinkan rakyat akan kemampuan para caleg menyuarakan aspirasi rakyat Sumut, jika dirinya dipercaya rakyat sebagai wakilnya. “Saat ini kita membuktikan kepada rakyat pemilik amanah bahwa kita betul- betul untuk mengabdi dan bukan untuk mencari dan mendapatkan kedudukan,” tandasnya. Hariara menekankan, yang terpenting adalah penyampaian visi dan misi caleg untuk meyakinkan rakyat sehingga memilih calegnya yang benar-benar amanah. (aya)

7 Bandara Di Jawa Kembali Beroperasi

Rute Tujuan Medan Kembali Normal JAKARTA (Waspada): Tujuh bandara udara (bandara) di Pulau Jawa yang tutup sejak Jumat, 14 Februari 2014 akibat abu vulkanik dari letusan Gunung Kelud di Jawa Timur, semuanya sudah kembali beroperasi. Ketujuh bandara tersebut adalah Bandara Tulung Wulung Cilacap, Abdul Rachman Saleh Malang, AhmadYani Semarang, Juanda Surabaya, Husein Sastranegara Bandung, Adi Sumarmo Solo, dan Bandara Adi SuciptoYogyakarta. Rute tujuan Medan dari kota-kota besar utama di Jawa pun kembali normal. Bandara Adi Sumarmo, Solo, Jawa Tengah diputuskan Kementerian Perhubungan buka hari ini Kamis (20/2), setelah tutup 7 hari. Rencananya bandara internasional ini akan beroperasi mulai pukul 07:00. Keputusan tersebut diambil usai rapat koordinasi yang melibatkan TNI AU dan juga mempertimbangkan semua laporan masuk, termasuk laporan BMKG. Adi Sumarmo termasuk bandara yang paling parah terkena abu Kelud di banding 6 bandara lainnya yang terpaksa ditutup. Sehari sebelumnya Rabu (19/2), Bandara Adi Sucipto, Yogyakarta dibuka kembali setelah tutup enam hari. Bandara internasional ini pun kembali menerima kedatangan wisatawan yang hendak berwisata ke Kota Gudeg dan sekitarnya. Rencananya Adi Sucipto

akan di buka Rabu pagi hari namun ternyata diundur mulai pukul 12:00 siang akibatnya beberapa penerbangan batal terbang hingga mengakibatkan ratusan penumpang terlantar menunggu sejak pagi. Berdasarkan informasi yang diterima Waspada dari PT Angkasa Pura I (AP I), penerbangan yang batal Rabu pagi antara lain rute Yogyakarta tujuan Balikpapan dan Citylink tujuan Kalimantan. Selain itu semua penerbangan Lion Air hari ini juga masih di-cancel (dibatalkan). Maskapai penerbangan yang sudah terbang mulai Rabu siang dari bandara internasional ini antara lain Garuda Indonesia mulai terbang sejak jam 12 siang menuju Bandara Cengkareng, lalu Citilink ke Halim Perdana Kusumah, dan Wings Air yang akan mengudara ke Juanda. Juga ada Mandala, Sriwijaya, Air Asia, Citylink, dan Tiger Air. Sebelum dibuka kembali, lebih dari 1300 personel TNI Angkatan Udara, Kepolisian, dan petugas PT Angkasa Pura bekerjakeras membersihkan bandara ini dari abu Kelud. Pada Selasa sore masing-masing petugasnya mengecek peralatan navigator, radar, lampu-lampu runway (landasan pacu), lampu terminal, maskapai, dan pesawat yang akan terbang kembali. Sementara Bandara Tunggul Wulung Cilacap dan Abdul Rachman Saleh Malang sudah beroperasi sejak Sabtu (15/2). Bandara Abdul Rachman Saleh

juga tidak halal, karena proses pemotongan dilakukan menggunakan mesin, bukan pisau dengan menyebutkan “Bismillahirrahmanirrahim” sesuai syarat halal. “Pemerintah juga melarang, dalam Peraturan no.82 tahun 2013, impor karkas tidak disahkan. Tapi ini beredar,” kata dia. Peraturan Menteri Pertanian No.82 tahun 2013 tentang Pemasukan Karkas, Daging, Jeroan dan atau Olahannya ke dalam Wilayah NKRI membatasi impor bagian-bagian tertentu dari unggas, karena dikhawatirkan dapat merusak kesehatan, apalagi bila diimpor dari negara yang belum bebas dari penyakit mulut dan kuku. MUI juga menduga karkas mengandung zat yang berbahaya, karena menurut Khaeruddin, suntik pada penggemukan ayam dilakukan di bagian paha, sehingga di Amerika, paha ayam tidak dikonsumsi manusia. “Kami sudah menyurati BPOM atas temuan ini, tapi belum mendapatkan jawaban apakah itu berbahaya atau tidak,” kata dia.

Belanda-RI Kerja Sama Riset Bidang Logistik JAKARTA (Waspada): Pemerintah Indonesia dan Belanda sepakat melanjutkan kerja sama dalam hal riset bidang logistik melalui program Living Lab Logistics. Kerja sama yang melibatkan pemerintah, sejumlah universitas dan perusahaan dua negara tersebut diprakarsai oleh Netherlands Universities Foundation for International Cooperation (Nuffic), sebuah lembaga Belanda untuk kerja sama internasional di bidang pendidikan tinggi. “Lewat kerja sama ini diharapkan pembangunan sumber daya manusia (SDM) antar Indonesia dan Belanda menjadi lebih baik, karena proses alih pengetahuan berjalan efektif dan mendalam. Sehingga diharapkan nantinya bisa memacu inovasi mutakhir industri serta mendukung pengembangan akademik bagi universitas,” kata koordinator Living Lab Logistics, Frits Blessing dalam jumpa media sekaligus peluncuran buku tahunan Living Lab Logistics 2013 di Jakarta, Senin (17/2). Kerja sama riset dibidang logistik ini sebenarnya sudah dimulai setahun lalu. Namun, ditambahkan Frits Blessing, kerja sama ini akan terus diperpanjang dengan fokus riset mengambil wilayah Indonesia bagian timur. “Melalui Living Lab Logistics, para mahasiswa, dosen, dan peneliti dari institusi pendidikan tinggi yang memiliki keahlian di bidang logistik dihubungkan

dengan perusahaan yang bergerak di bidang serupa,”kata Frits. Menurut Frits, Living Lab Logistics berkait prioritas sektor politik dan ekonomi di kedua negara, yakni pengembangan Sistem Logistik Nasional di Indonesia dan Sektor Utama Logistik di Belanda. Dr. Elly Sinaga Adriana, Direktur Jenderal Badan Penelitian dan Pengembangan Kementerian Perhubungan menerima buku tahunan Living Lab Logistics 2013 atas nama pemerintah Indonesia. Dia berharap penelitian terapan bersamasama dengan mitra Living Lab Logistics ini mengarah pada percontohan dan prototipe yang dapat digunakan dalam logistik ketahanan pangan yang bermanfaat bagi Indonesia Pertengahan Februari ini rombongan mahasiswa Belanda telah tiba di Indonesia untuk melakukan riset di perusahaan-perusahaan logistik di Indonesia. Mereka berasal dari universitas sains terapan yang ada di Belanda yakni HAN, NHTV dan Rotterdam University of Applied Sciences. Sementara mahasiswa Indonesia yang akan mengadakan riset di Belanda berasal dari Institut Teknologi Sepuluh Nopember (ITS) Surabaya, Universitas Gadjah Mada (UGM) Yogyakarta dan Sekolah Bisnis Internasional Trisakti (TIBS) Jakarta. (dianw)

Waspada/adjik

BANDARA Adi Sucipto Yogyakarta kembali beroperasi usai tutup akibat abu Kelud. memulai aktivitas sejak Sabtu pagi. Tercatat ada tiga pendaratan pesawat Sriwijaya Air dari Jakarta di bandara ini yakni pada pukul 10:05 WIB dan 13:45 WIB dan sorenya satu pendaratan lagi juga dari Jakarta. Sedangkan Di Bandara Tunggul Wulung satu pesawat komersial mendarat di bandara ini pada Sabtu saat udara cerah. Namun esoknya, Minggu (16/2) baru semua normal kembali. Begitupun dengan Bandara Ahmad Yani Semarang, Juanda Surabaya, dan Bandara Husein

Sastranegara Bandung yang juga sudah buka sejak Minggu. Sejumlah perusahaan penerbangan juga sudah menerbangkan kembali pesawatnya dari ketiga bandara internasional ini. Salah satunya AirAsia. Dalam siaran persnya, AirAsia menjelaskan rute penerbangan AirAsia yang kembali beroperasi antara lain dari Bandara Juandara Surabaya menuju Medan, Surabaya Denpasar, Surabaya - Jakarta, Surabaya - Makassar, Surabaya - Bandung, Surabaya - Kuala Lumpur, Surabaya - Singapura,

Surabaya - Bangkok, Surabaya - Penang, dan Surabaya - Johor Bahru. Dari AhmadYani Semarang adalah rute Semarang - Kuala Lumpur, Semarang - Singapura, dan Semarang – Surabaya. Sedangkan rute penerbangan yang kembali dioperasikan dari Husein Sastranegara Bandung adalah rute Bandung - Medan, Bandung – Denpasar, Bandung - Pekanbaru, Bandung - Surabaya, Bandung Singapura, Bandung - Kuala Lumpur, dan Bandung - Johor Bahru. (adji k.)

Pendidikan Harus Tancap Gas JAKARTA (Waspada): Pembangunan pendidikan yang berkualitas menjadi syarat mutlak peningkatan daya saing bangsa. Pasalnya, perkembangan ilmu pengetahuan dan teknologi yang cepat telah melahirkan sejumlah perubahan tak terduga. “Jika tidak tancap gas, maka Indonesia bisa terus ketinggalan dengan negara-negara lain, bahkan di kawasan ASEAN,” kata pakar kependudukan dan lingkungan hidup Prof Dr Emil Salim saat berbicara di Konvensi Pendidikan yang digelar Persatuan Guru Republik Indonesia (PGRI) di Bentara Budaya Jakarta, Rabu (19/2). Emil mengimbau agar pemerintah dan bangsa ini terus meningkatkan kuantitas belajar

manusia Indonesia. Seperti diketahui, lama belajar manusia Indonesia tidak sampai 8 tahun. Sedangkan di kalangan negaranegara ASEAN, lama belajar sudah lebih dari 9 tahun, bahkan sudah ada yang mencapai angka belasan tahun. Di sisi lain, kecintaan pada sains dan matematika ditengarai mampu meningkatkan daya kognitif manusia. Saat ini, kualitas kognitif manusia Indonesia hanya berkisar pada poin 400. Sedangkan yang dibutuhkan untuk ikut dalam percaturan persaingan teknologi di kawasan Asia, khususnya, diperlukan rerata kognitif skill sebanyak 600 poin.”Tidak dapat dibayangkan, bagaimana kita mampu mengejar Korea Selatan atau China, kecuali kalau

kita mau tancap gas untuk terus membenahi pendidikan kita,” kata Emil. Saat ini, kualitas manusia Indonesia tidak sebanding dengan kekayaan sumber daya alam. Alhasil, paradigma masih berkutat pada upaya mengeksploitasi alam, bukan mengelola dengan arif dan bijaksana. “Sumber daya alam kita besar, tapi daya kreativitas dalam mengolah dan mengelola sumber daya alam itu yang ketinggalan. Kita harus tancap gas, bukan pada eksploitasi alam, tapi lebih pada pengembangan dan pengelolaan alam yang lebih baik. Inilah yang nantinya memberi nilai lebih pada daya saing manusia Indonesia di mata internasional,” kata Emil Salim. Senada dengan Emil, Ketua

PGRI Sulistyo menekankan kepada pemerintah untuk memiliki suatu platform atau arahan yang jelas tentang sistem pendidikan Indonesia ke depan. Karena dengan pendidikan, manusia dapat bertahan dan mencapai kesejahteraan dalam kehidupannya.”Bahkan lebih dari itu, pendidikan dapat meningkatkan peradaban dan menjadi daya ungkit kemajuan suatu bangas,” ujar Sulistyo. Karena itu, lanjut Sulistyo, keberhasilan sejati sebuah sistem pendidikan bukan sematamata terumuskan dalam angkaangka evaluasi statistik sebagaimana tergambar lewat keberadaan Ujian Nasional (UN), tapi tercermin dari bangsa itu mengatur diri dan kehidupannya melalui sistem politik dan pe-

merintahan yang dijalankan serta berkembangnya peradaban dan kesejahteraan hidup di tengah masyarakat. Sementara itu, Kepala Badan Pengembangan Sumber Daya Manusia Pendidikan dan KebudayaandanPenjaminMutu Pendidikan dan Kebudayaan (BPSDMPK-PMPK), Syawal Gultom mengatakan, Konvensi Pendidikan yang diadakan PGRI dapat dijadikan pijakan dalam menciptakan instrumen pengembangan guru-guru supaya lebih berkualitas. “Guru yang berkualitas dapat menciptakan suasana belajar yang lebih kondusif. Dari situ akan tercipta pendidikan berkualitas dan generasi yang lebih berkualitas dan berdaya saing tinggi,” kata Syawal. (dianw)

DPR Dukung Upaya Perangi Kejahatan Transnasional

MUI Batam Peringatkan Peredaran Paha Ayam Impor Tanpa Sertifikat Halal BATAM (Antara): Majelis Ulama Indonesia Kota Batam memperingatkan warga atas peredaran paha ayam impor dari Amerika yang masuk tanpa sertifikat halal MUI dan dikhawatirkan mengandung bahan berbahaya. “Paha ayam dari Amerika beredar di Batam, padahal itu dilarang pemerintah,” kata Wakil DirekturLembagaPengkajianPanganObat-obatan dan Kosmetika Majelis Ulama Indonesia Kepri Khaeruddin Nasution di Batam, Rabu (19/2). Menurut Khaeruddin, dalam izin impor yang diterima MUI, karkas atau bagian-bagian tertentu dari unggas hanya untuk pangan buaya dan babi bukan untuk dikonsumsi manusia. Namun, dalam pengurusan sertifikasi halal, MUI menemukan belasan jasa katering yang menggunakan paha ayam impor itu sebagai bahan olahan pangan. Ia juga menduga paha ayam asal Amerika itu beredar luas di pasar-pasar Batam. “Saya rasa ada juga yang dijual di pasar-pasar,” kata dia. Dalam telaah MUI, paha ayam impor itu

A7

Waspada/Surya Efendi

TREASURY CENTER: Pengamat ekonomi Faisal Basri (kiri) berbincang dengan Direktur Bank Mutiara Ahmad Fajar (dua kanan) didampingi komisaris Eko B Supriyanto (dua kiri) dan kepala wilayah Sumatra Suryo (kanan) di Hotel JW Marriott Medan, Senin (17/2) malam. Treasury Center yang baru diresmikan itu agar nasabah dapat bertransaksi valas secara real time dengan internet dan mobile banking.

Agilent Technologies Inc Perkenalkan Platform Baru Bagi Ilmuwan JAKARTA (Waspada): Agilent Technologies Inc memperkenalkan platform-platform baru bagi para ilmuwan dan peneliti yang melakukan uji coba dengan menggunakan solusi-solusi spektroskopi. Dengan teknologi analisa unsur yang canggih dan mudah digunakan yang ditawarkan oleh platform-platform baru ini, para ilmuwan dan peneliti dapat menjalankan lebih banyak aplikasiaplikasi yang menantang dengan kinerja yang lebih baik dan penggunaan yang lebih mudah. Pada saat yang sama, laboratorium dan institusi mendapatkan nilai lebih dari penerapan teknologi-teknologi terbaru tersebut. Produk-produk spektroskopi terkini dari platform-platform baru ini adalah Agilent 7900 Inductively Coupled Plasma Mass Spectrometer (ICP-MS) dan Agilent 4200 Microwave Plasma Atomic Emission Spectrometer (MP-AES). Kedua bio-analisis instrumen ini dapat digunakan oleh para ilmuwan, ahli kimia dan analis Indonesia yang bekerja di berbagai industri utama seperti pertanian, lingkungan, pangan, medis, pertambangan energi/migas, air dan petro-kimia. “Para pelanggan dan mitra kami di Indonesia telah menyampaikan keprihatinan mereka mengenai isu-isu keamanan, keaslian dan kualitas. Mereka juga tertarik untuk melengkapi laboratorium mereka dengan teknologi-teknologi canggih yang menawarkan kinerja yang jauh lebih baik, nilai yang lebih tinggi serta mudah digunakan untuk menyambut tantangan-tantangan di masa depan, “ kata Catherine Janto, Channels Partner Manager, International Distributors Operations, Divisi Life Sciences and Chemical Analysis, Agilent, dalam siaran pers, baru-baru ini. Menurut dia, Agilent menanggapi berbagai kebutuhan pelanggan kami yang ada saat ini dan juga untuk di masa yang akan datang dengan teknologi-teknologi terbaru dari platformnya. Dengan tersedianya ini, banyak para pelanggan yang akan dapat memperluas kemampuan laboratorium mereka, menyederhanakan alur kerja dan meningkatkan kinerja. Menurut Philip Binns, Agilent Vice President of Spectroscopy Products, pengenalan 4200 MP-AES dan 7900 ICP-MS ini menunjukkan kepemimpinan Agilent yang terdepan di dunia dalam hal analisa unsur dan komitmennya untuk menyediakan alat-alat terbaik dalam memenuhi kebutuhan aplikasi para pelanggan.(rel/m44)

JAKARTA (Waspada): Dalam upaya memerangi kejahatan lintas negara, DPRRI melalui sidang paripurna memberikan persetujuan atas Rancangan Undang-Undang (RUU) untuk perjanjian RI-Korea Selatan dan RI-India terkait bantuan hukum dalam masalah pidana. “RUU ini penting dalam rangka memerangi tindak kejahatan atau pidana yang bersifat transnasional yang dapat terjadi pada situasi global seperti saat ini, dan memberi respon terhadap perkembangan tindak pidana yang semakin canggih dan meresahkan masyarakat,” kata Wakil Ketua Komisi III Al Muzammil Yusuf dalam laporannya pada rapat paripurna yang dipimpim Wakil Ketua DPR Pramono Anung di Gedung DPR, Jakarta, Selasa (18/2). Dijelaskan, RUU ini dibahas Komisi III DPR bersama Kementerian Hukum dan HAM

dan Kementerian Luar Negeri. “Penegakan hukum dan keamanan memerlukan kerja sama internasional. Perjanjian ini diharapkan dapat pula mempererat hubungan bilateral saling menguntungkan dengan Korea dan India,” harapnya. Menteri Luar Negeri Marti Natalegawa mengatakan pengesahan perjanjian ini merupakan bukti nyata komitmen pemerintah terhadap pemberantasan kejahatan lintas batas termasuk korupsi. Ia juga menekankan, UU ini memberikan landasan hukum yang kuat bagi kerja sama aparat kedua negara, dalam menyita, membekukan dan mengembalikan aset hasil kejahatan dalam konteks penyidikan, penuntutan dan pelaksanaan hukuman. Anggota DEN Sebelumnya, pada rapat paripurna ini, DPR RI juga telah menetapkan 8 anggota Dewan

Energi Nasional (DEN) periode 2014-2019. Ketua Komisi VII DPR RI, Sutan Bhatoegana menyampaikan laporan hasil uji kelayakan dan kepatutan calon anggota DEN periode 2014-2019 yang telah dilaksanakan Komisi VII. “Dari hasil uji kelayakan dan kepatutan yang dilakukan KomisiVII DPR RI dan melalui mekanisme pemungutan suara, Komisi VII telah menetapkan 8 calon anggota DEN periode 2014-2019,” ujar Sutan Bhatoegana. Kedelapan anggota DEN periode 2014-2019 yaitu: Tumiran dan Rinaldy Dalimi, masing-masing dari kalangan akademisi, Achdiat Atmawinata dan Abadi Poernomo dari kalangan industri, Andang Bachtiar dari kalangan teknologi, A. Sonny Keraf dari lingkungan hidup, Syamsir Abduh dan Dwi Hary Soeryadi dari kalangan konsumen. (aya)

Samsung Tawarkan Kemudahan Untuk Bekerja Dan Memotret BALI (Waspada): Samsung, kembali memperkenalkan produk terbarunya berupa Galaxy Notpro dan Samsung Smart Camera. Peralatan yang bisa memberikan kemudahan bagi profesional maupun pebisnis serta kemudahan untuk menyimpan moment berharga dengan kamera tercanggih di kelasnya. Di hadapan awak media dari berbagai kota di Indonesia, Rabu (19/2) diperkenalkan Samsung Galaxy NotPro 12.2 inch layar lebar menggunakan WQXGA 16;10 dengan resolusi jernih (2560 x 1600) dengan lebih dari 4 juta pixel. Disamping itu, ada juga pendukung produktivitas yang menghadirkan fitur S-Pen dan note serta aplikasi lainnya yang mempermudah menyelesaikan pekerjaan. Diana Djohor Product Marketing Samsung dan Febri Rusli, selaku Product Marketing Manager Samsung menyebutkan, dengan komponen yang dimiliki NotePro ini memudahkan penggunanya untuk bisa bekerja

perseorangan maupun langsung rapat di satu ruangan dari berbagai kota. “Fasilitas Samsung e-meeting memberikan kemampuan kolaborasi dengan memberikan fasilitas bagi konsumen saling berbagai dokumen tanpa mengakses server. Konsumen juga dapat dengan mudah mengakses komputernya di rumah maupun di kantor secara langsung. Selain itu, dengan Samsung galaxy notepro dengan fitur remote pc konsumen dengan mudah mengakses dan mengedit dokumen dari jarak jauh,” papar Diana. Sebelumnya, Samsung memperkenalkan kamera NX30 dengan kemampuan tembak 20.3MP. Seri NX30 merupakan peningkatan dari NX300 yang pernah diumumkan perusahaan tahun lalu. Kamera ini memiliki fitur rekam video 1080p HD (60 frame per detik) serta konektivitas WiFi dan NFC. NX30 juga mendukung rekam audio dengan

mikrofon serta pengaturan ISO 100-25.600. NX30 diperkuat Sensor CMOS APS-C 20.3MP serta fitur Tiltable Electronic Viewfinder (XGA, 2.359K-dot resolution). Kameranya juga memiliki kecepatan rana atau Shutter Speed 1/8000 detik dan mampu menjepret 9 frame foto per detik. Samsung Smart Camera ini juga memudahkan untuk berbagi foto melalui fitur Tag & Go. Sehingga, perangkat bisa mentransfer foto dengan cepat ke smartphone atau tablet. Fitur Photo Beam juga memungkinkan pengguna untuk mentransfer foto dan video ke gadget mobile dengan cara menyentuh secara bersamaan tanpa perlu konfigurasi yang rumit. Perangkat anyar ini juga memiliki layar 3 inci Super Amoled Swivel and Touch Display. Kamera dengan fitur AutoShare dan Remote Viewfinder Pro (zooming dan jepret dari jarak jauh) ini dibanderol dengan harga Rp12 juta. (m37)


A8 1 CM

WASPADA

Rp. 22.200

2 CM

BURSA AUTOMOTIVE Informasi Pembaca

Bursa Automotive AC BR CL ND DB

: Air Condition : Ban Radial : Central Lock : Nippon Denso : Double Blower

PS PW RT VR EW

: Power Stearing : Power Window : Radio Tape : Velg Racing :Electric Window

DAIHATSU TERIOS TX Th’ 07 Matic, Type Paling komplit, Hitam Met, BK 2 angka, mobil cantik, 1 tangan dr baru, Rp. 131 Jt. Depan Kampus uisu No. 200. 0 8 2 1 6 7 6 7 7 0 0 0 / 7 8 5 1 4 0 2

DAIHATSU BARU PROMO SPECIAL * TERIOS ADV DP. 35Jtan * G.Max Pu DP 9Jtan * Xenia Sporty DP 32Jtan * Ayla Dp 25Jtan INFO Sales Hub : Riza 0 8 5 2 7 7 4 7 2 5 4 2

* ASTRA DAIHATSU GEMPITA * Proses Cepat, Mudah & Pasti OK All New Xenia 1.3 DP 30 Jt-An, Angs 3,9Jt-An New Terios TS Extra Dp 35Jt-An, Angs 4,3Jt-An Ayla D Plus DP 25Jt-An, Angs 2,2Jt-An Sirion DP 26Jt-An, Angs 3,7Jt-An Granmax Pick Up DP 10Jt-An, Angs 2,8Jt-An Hub : ISMAIL 0813 7526 7670 T OP SALES DEALER RESM I DAI H AT SU 1 0 0 % BARU . Xenia, Terios, Granmax Pick Up, Dll. Dp Nego, Diskon Kandas, ProsesCepat, Ayub Meliala. 0 8 5 2 0 7 9 9 9 8 0 0 , 0 8 5 3 5 9 2 3 2 9 9 9

DIJUAL - HONDA NEW CITY 2004 Matic, Hitam, Ex Wanita - SUZUKI KARIMUN 2002, Kuning Metalic, Cat Original Harga Nego. Hub 081 163 4227

Rp. 33.000

3 CM

Rp. 44.000

M I T SU BI SH I L 300 Pick Up Thn 1996. Warna Coklat, Harga 65Juta Nego. Hub 0 8 2 1 6 1 6 1 0 9 0 2

SUZUKI KARIMUN Thn 2000. Warna Abu - Abu Metalik. Hub 0 8 1 2 6 5 9 9 2 6 5 5 SUZUKI ESCUDO 1600 (2006) Silver, Kondisi spt Baru, Dijamin Tdk KEcewa (Simpanan Km 50 Rb), Bantu Credit HP 0 8 1 2 6 9 4 5 0 4 5 8

T OYOTA KIJANG JANTAN Thn 88. W. Hitam, siap pakai, Hrg Rp 40Jt Nego. Hp : 0 8 2 1 6 0 8 0 2 0 0 9 T OYOTA COROLLA Twincam 89, BK 1831 ZU, Warna merah, kondisi mulus. Hub 0 8 2 1 6 3 9 9 3 0 2 2 # T OYOTA D E A L E R M E DA N # INFO MOBIL BARU, Special Februari. Hub. Anwar Damanik. 0823 7088 0815 TOYOTA TWINCAM 16 Thn 91. BK Mdn, Asli Pajak Baru Dibayar, Warna Biru, Mobil Original, Ac Dingin, siap pakai. Jl. Gaperta Gg. Pembangunan No. 52 B. 0 8 1 2 6 0 4 9 2 2 1 6

AGYA Dp 31,6Jt-an ; Angs 2,5Jt-an AV AN Z A Dp 42,5Jt-an ; Angs4,1 Jt-an TOYOTA I N N OV A Dp 58,8Jt-an ; Angs 5,4 Jt-an BARU Hub. PURBA 0813 9736 0333 T OYOTA YARIS J 2010 Hitam, Lkp, Tgn 1, An Sendiri, STNK Pjg Mdn, 118Jt Nego. Hub 0812 6572 021 081 7757 415. Maaf TP

4 CM

Rp. 55.000

6 CM

Rp. 121.000

8 CM Rp. 137.500

6x6,6 kolom Rp. 165.000

Kamis, 20 Februari 2014

FAX.4531010

T OYOTA BA RU 1 0 0 % Ready Stock Agya, Semua Tipe, AVANZA, INNOVA, RUSH, FORTUNER, HILUX - YARIS, Sudah Bisa Inden, Bisa Tukar Tambah. Hub 0 8 1 3 6 1 2 0 1 7 1 9 / 0813 7644 0200

DI J U AL 1 UNIT TOYOTA KIJANG KAPSUL LSX Biru Tua Metalic 2003 Bensin, Power Window, Kondisi Mulus, 100Juta. Minat Hubungi 0813 9733 3970

I nfo Pe m e sa na n I k la n H ub. PI N BB 2 6 2 4 7 F5 E H P. 0 8 7 7 1 7 8 4 4 0 3 5 - 0 8 1 1 6 0 4 6 9 0

HARGA SUDAH TERMASUK PPN 10%

MULTAZAM UMROH & MANASIK HAJI 2014 * UMROH REGULER 09 HR (3, 9, 19 MARET. 3,11, 25 APRIL 2014) * UMROH REGULER 11 HR ( 23 FEB, 15, 23 MARET 2014) * UMROH PLUS DUBAI (APRIL 2014) * UMROH PLUS AQSHA DAN JORDANIA (ISRA’ MIRAJ, MEI 2014) * UMROH PLUS TURKY 12 HR (APRIL 2014) S/ * UMROH PLUS CAIRO 11 HR (APRIL 2014) LU

S U Z U K I KARIMUN Th’00. Biru Metalik, Mobil cantik, Rp. 53Jt/BU. Hub 0 8 1 2 6 0 1 5 5 8 5 / 7 8 5 1 4 0 2

P

H SU MANASIK HAJI O NK H U SETIAP HR SABTU : 14.00 - 16.00 WIB HR MINGGU : 09.00 - 11.00 WIB BERTEMPAT : MESJID AGUNG MEDAN JLN. PANGERAN DIPONEGORO

S

K AN T OR PU SAT : JLN. TITI PAPAN / PERTAHANAN NO. 10 SEI SIKAMBING D MEDAN

H P. 0812.6495.8456, 0813.6137.2321 0852.0648.6301, 0823 6252 6008 TELP. 061- 4576116 FAX 061-4512319

BURSA SERVIS/ASSESORIS MOBIL

PROMO JOK MOBIL CICILAN 0% MANDIRI 6 X 12 BULAN Type Promo

SEDAN

MINI BUS

PROMO I Rp. 700.000 Rp. 800.000 PROMO II Rp. 1.000.000 Rp. 1.100.000 PROMO III Rp. 1.400.000 Rp. 1.600.000 Hub.

ELITE MOTOR Jl. Nibung II No. 114 Medan (Samping Medan Plaza)

Telp. 061- 76224409, 0811608140 dekat Carrefour

F D C D

KIRIMKAN... DATA IKLAN MINI ANDA DALAM BENTUK

DIGITAL

Keterangan lebih lengkap silahkan hubungi: TELPON : 061 - 4576602 FAX : 061 - 4561347 * Format: JPG - TIFF (Photoshop)

BUTUH DANA

BURSA PENDIDIKAN

PERLU DANA CEPAT DAN TANPA UANG SURVEY

BUTUH DANA

BU T U H U AN G K ON TAN CAI R 3 H ARI (Setelah Surve Usaha dan Jaminan) SK Camat 10 Jt S/d 100 Jt, SHM 100 JT S/D Miliar Take Over. Hub 0812 6437 095 - 0813 6004 2399

N O. POM . T R. 8 7 3 6 3 5 5 2 2

KONSULTASI DAN BANTUAN HUKUM

1 Hari Clear, Khusus Surat Tanah, Tanpa Izin Usaha / Syarat Gampang. Hub 0 8 1 2 6 0 7 8 7 2 3 0 SOLU SI DAN AI T U N AI Bunga 1 % - 3 %, 1 Hari Cair, Max 1 Milyar, Jaminan : SHM, SK Camat, HGB, Take Over, BPKB Mobil, Spd Mtr, Over Leasing, Bantu Pelunasan BPKB. Hub : Rinaldi 0821 6757 1653, 0853 6100 3453

MINYAK URUT BOXING

MULTAZAM ADIL SEJAHTERA

Khusus Kota Madya Medan 1 Hari Cair. Hub 0812 6369 0129 ( Kak Cut)

BURSA LOWONGAN

Hukum Syar’i - P e m b a g i a n H a r t a Wa r i s a n - Wa k a f - Hibah - Sadaqah - Perkawinan dan Perceraian - Ekonomi Islam Hukum Perdata Hukum Pidana Dilayani oleh : Advokat - advokat Muslim yang berpengalaman

MENCARI TK. Pangkas yg berpengalaman. Hubungi : 0852 7772 9251. Jaminan 50.000. Pangkas DOLLY Sp. Marindal

K a nt or Pusa t : Jl. Titipapan Gg. Pertahanan No. 10 Sei Sikambing - D Medan HP.08126044852 (Syapri Chan SH., M. Hum) 081397223734 (Hamdan Sukri Harahap,SHI.,SH) T e lp : 0 6 1 -4 5 7 6 1 1 6 Fa x .0 6 1 -4 5 1 2 3 1 9

Sgr Daftarkan unt di tempatkan jd Guru TK/ Paud hub: Jl. Karyawisata No. 23A Johor. Ph. 7861690 HP. 0852 62704985 Medan

KLINIK TRADISIONAL ALAT VITAL DI TAN GAN I LAN GSU N G A.H . AM ARU DI N DARI BAN T EN

DI BU T U H K AN Pria Bag. Marketing, sanggup Berjualan Secara Konvensional Maupun On-Line. Lamaran diantar ke : TOKO Olala. Jl. H.M Said No. 120 c Kp. Durian Medan

BURSA ELEKTRONIK DI J U AL MESIN CETAK OFFSET TYPE 220. Yang Berminat Hubungi HP : 0853 6185 9955 - 0813 6167 3866 NB : TANPA PERANTARA

DI J U AL 2 nd : Mixer mx 182 Y, Inter M (2.0). Power 1500 w, 2000 W, BMB Drox 55 (c) Daj7 II, Dar 800, 500, 1000, EQ Dod, Yamaha, Terima Visa 0 %. Jln Indragiri Dkt Asia 7 3 4 5 4 8 7

Metode pengobatan dengan cara ditotok dibagian syaraf dan kelemahannya dan diberikan Ramuan/ Jamu, 100% alami tidak ada efek samping bebas usia, bebas untuk semua agama, REAKSI DITEMPAT K H U SU S PRI A: - Panjang: 13, 15, 16, 18, 20 - Besar: 3, 4, 5, 6 - Impotensi - Kurang Keras/Ejakulasi dini - Tidak punya keturuan - Hernia K H U SU S WAN I TA: - Memperbesar payudara - Mempersepit vagina K O N S U LTA S I U M U M : - Buka Aura - Pengasihan/penglarisan usaha - Masalah rumah tangga - Ingin dapat jodoh/pelet Alamat: J l. SM . Ra ja de pa n H ot e l GARU DA PLAZ A sa m ping K linik BU N DA Gg. Ke lua rga N o. 1 3 C H P. 0 8 1 2 6 0 5 7 6 4 4 4

BURSA PELUANG USAHA

SERVICE

AC

CU CI + B . PASAN G

BURSA KOMPUTER

OBRAL LAPTOP BESAR - BESARAN

Special Kaos * Promosi * Sekolah * Olahraga * Instansi / Dinas * DLL

Toshiba 15” =1,99 Jt * MERK TERKENAL * KWALITAS TERJAMIN * DIGARANSI

Hubungi - 0813 7508 3972 - 0853 5880 0373 - (0 6 1 ) 8 4 4 3 4 4 9

Pondok Kelapa no. 9B Medan Ringroad Tersedia Cicilan 12 Bln

BURSA MATERIAL ATAP & DINDING EURODEK ALUMINIUM ZINC - AZ - 150

PAGAREURO

R

Hub: (061) 7364920 - 7323590

KLINIK TERAPY/ ALAT VITAL

MAK EROT YANG TERUJI DAN T ERBU K T I Izin Dinkes No. 448 Hak Paten No. 00.2004.09965.10041

Dengan H. TEJA SAEFUL Cucu Asli Mak Erot Bersama Ust. M. OTONG Bila anda ingin perkasa ingat jangan sampai salah masuk, carilah yang benar-benar pewaris ilmu mak Erot sejati, karena keahlian H. Teja Saeful sudah tidak diragukan lagi dalam menangani keluhan seputar alat vital bahkan pengobatan H. Teja Saeful sudah terkenal di seluruh Indoneisa dan kota-kota besar di Indonesia, sudah ribuan pasien tertolong dipengobatan Mak Erot ini yang aman tanpa efek samping, bahkan dimanca negara sekalipun pengobatan Mak Erot SUDAH TIDAK DIRAGUKAN LAGI KEBERHASILANNYA, INGAT untuk kaum pria jangan sampai anda terhina kaum wanita karena kondisi alat vital yang kurang sempurna K H U SU S WAN I T A: K H U SU S PRI A: - Ingin punya keturunan - Ejakulasi dini - Memperkencang & - Impotensi memperbesar payudara - Memperpanjang “Alvit” - Keras dan tahan lama, dll - Memperbesar “Alvit” DI J AM I N 100% K ON SU LT ASI U M U M : H AN YA T EM PAT - Buka aura K AM I K LI N I K - Cari jodoh M AK EROT - Pelaris - Mencari orang hilang J L. LAK SAN A N O. 6 2 A M ASU K DARI J L. AM ALI U N Y U K I SI M PAN G RAYA M EDAN (PRAK T EK T ETAP) H P: 0 8 1 2 4 0 3 8 3 3 3 - w w w.t e ra pia lat vit a lm a ke rot .c om

BURSA PERABOT

Harap Hubungi:

Toko Bandung Jaya Jln. MT. Haryono No. 91/105 MEDAN Telp. (061) 4566414 - 4522412 Email: bandungjaya91@gmail.com

KAMBING ETAWA / P.E Kambing Perah Dijual 110 Ekor, Jantan/ Betina/Anak. Hub : H.M FAZAL KARIM HP 0812 6471 2769

SPRING BED DIJUAL MURAH Spring Bed 6 kaki 2 lapis Rp. 1.250.000 Spring Bed 5 kaki 2 lapis Rp. 1.200.000 Spring Bed 4 kaki 2 lapis Rp. 1.100.000 Spring Bed 3 kaki 2 lapis Rp. 1.000.000 Spring Bed 3 kaki Dorong Rp. 1.150.000 Garansi Per 10 tahun Hub Telp. (061) 661.8116 - (061) 661.6802 - 75107000

GRAH A I N T ERI OR M e ne rim a Te m pa ha n da n Pe m a sa nga n Lemari Pakaian / Master Room, Buffet TV,Skat Ruangan / Gypsum, HPL, Pengecatan,Kitchen Set, Bed Set, Plafond Gypsum, Wallpaper. Jl. Ayahanda / Jl. Sendok No. 10 Medan - HP 0813 9610 1512 / GIRIN

Mau Menjual Rumah, Tanah, Kendaraan, Barang

GALVANIS

SERVICE KONSTRUKSI

EUROMESH BAJA U-50

R

KOLOM PRAKTIS EURO R BAJA U-50 SIAP PAKAI LEBIH PRAKTIS & HEMAT DARI BESI BETON

PRODUKSI:

PT. REZ EK I PRI M A J AYA ABADI Jl. Sutomo No. 436 Medan 20231 (samping Bank Maspion) Telp. (061) 452.2588 - 415.7504 - 455.7204 - 455.7194 Fax. (061) 415.7504 SUMUT - INDONESIA

BURSA KESEHATAN

T EM PAH AN M U RAH - Lemari pakaian 3 pintu Sungkai asli Rp. 1.500.000 tempahan - Kitchen set atas bawah Sungkai asli Rp. 1,5 Jt/mtr Hub Telp. (061) 661.8116 - (061) 661.6802- 75107000

ELEKTRONIK Kulkas, M. Cuci, Dispenser H u b . M a j u Te k n i k - 0 6 1 .7 0 3 0 1 1 8 - 0813 6244 4913

Dpt Diperoleh di Sumatera - Aceh

WC WC

TUMPAT/ SAL. AIR

8 4 5 .8 9 9 6 0812.631.6631 Bergaransi/ Jl.Kpt. Muslim

Jl. P. BRAYAN MEDAN

HP. 0813 7035 7291 0813 6210 8239 Ada Garansi

Kerajinan Tangan atau Barang Dagangan Lain? Ya Tentu...Pasang Iklan di... Surat Kabar Tercinta:

Harian

WASPADA Untuk informasi lebih lengkap hub

TEL. (061) 4576602 FAX. (061) 4561347

HERBAL & TERAPI OZON Kanker, Diabetes, Kista, Prostat, Lemah Syahwat, Osteoporosis, Radang Sendi, Rematik, Asam Urat, Saraf Terjepit, Kesuburan, Gangguan Tidur, Sakit Pinggang, Pengapuran, Stroke, dll. Dr. Suba H P : 0 8 5 2 7 0 4 4 4 7 1 8 J l. Pa sunda n N o. 3 2 -B Te lp : 4 5 5 0 3 6 2 M e da n

BURSA ALAT MUSIK


Luar Negeri Uganda Tolak Tekanan Obama Tentang Undang-Undang Anti-Gay

A9

WASPADA

Kamis 20 Februari 2014

KAMPALA, Uganda (Antara/Reuters): Uganda pada Selasa (18/2) menolak seruan Presiden Amerika Serikat Barack Obama kepada pemimpinnya Yoweri Museveni untuk tidak menandatangani undang-undang antihomoseksualitas, dan mengatakan AS sedang berusaha untuk memeras negara Afrika timur itu. PadaMinggu,duaharisetelah Presiden Museveni mengatakan ia akan menandatangani undang-undang yang secara luas dikritikdiluarnegerisebagaikeras dan tidak adil, Obama memperingatkan bahwa akan mempersulit hubungan Amerika Serikat denganUgandadanmenjadisatu “langkah mundur bagi seluruh

rakyat Uganda.” Seorang pejabat senior pemerintahan Obama mengatakan Washington-yangmengirimbantuanbesarlebihdari400jutadolar AS per tahun - akan meninjau hubunganASdenganUganda,sekutu regional utama dalam melawan ekstremismekubuIslamdiSomalia. Tetapi Menteri Etika dan In-

tegritas Simon Lokodo mengatakanbantuantidakharusmengikat sikap Uganda mengenai homoseksualitas. “Kami tidak ingin memeras orang lain. Ini sangat tidak jujur, sangat tidak bertanggung jawab dantidakramahkarenamenyinggung perilaku masyarakat lain untuk sumberdayamereka,”kata Lokodo kepada Reuters TV di Kampala. Homoseksualitas adalah hal yang tabu di banyak negara Afrika. Praktek seksualitas seperti itu sekarang ilegal di 37 negara di benua itu, dan para aktivis mengatakan bahwa beberapa gay Afrika tak berani melakukan kehidupan seksualitasmerekasecaraterbuka,

takut penjara, kekerasan dan kehilangan pekerjaan mereka. Di salah satu dari negara Afrika, Gambia, Presiden Yahya Jammehmenyebut homoseksual “hama”padaSelasadanmengatakan bahwa pemerintahnya akan memberantasmerekasepertinyamuk penyebab malaria. Museveni belum mengatakan kapan ia berencana untuk menandatangani undang-undang itu. RUU anti-gay diperkenalkan pada tahun 2009 dan awalnya mengusulkan hukuman mati bagitindakanhomoseksual,tetapi diubahdenganhukumanpenjara termasuk seumur hidup untuk apayangdisebuthomoseksualitas

yang parah. Kategorinyamencakuppraktek seks gay dengan anak di bawah umur, di mana korban terinfeksi HIV dan di mana korban rentan seperti orang cacat. Lokodo mengatakan bahwa dia akan bertemu Obama, ia akan menceritakan bahwa ia telah membuat pilihan yang tepat dengan menikahi seorang wanita. “Sayaakanmengatakankepadanya terus-terang bahwa ia pilih dengan arah yang benar untuk menikahi Michelle,” katanya. “Mereka telah menghasilkan anak-anak, mengapa dia mendorongdanmempromosikanorang lain, laki-laki dan perempuanperempuandenganjeniskelamin

sama untuk hidup bersama dan tidak memiliki keturunan seperti dia?.” Obama, seorang Demokrat yang telah melobi untuk memperluas hak-hak untuk gay Amerika dan mendukung pernikahan sesama jenis, mendesak negara Afrika itu negara untuk mengakhiridiskriminasiterhadapkaum homoseksual. Dalam sebuah pernyataan, UNAIDS badan PBB mengenai HIV/AIDS, juga memperingatkan bahwa undang-undang akan membuat makin banyak orangorang gay menghindari tes dan pengobatan HIV ketika mereka menghadapi penuntutan atau penjara.

Pengunjuk Rasa Kepung Kantor PM Yingluck BANGKOK,Thailand(Antara/AFP):ParapengunjukrasaThailand mengepung kantor Perdana Menteri Yingluck Shinawatra yang digunakan sebagai markas besar penanggulangan krisis di Bangkok, Rabu (19/2). Aksi itu meningkatkan kampanye mereka satu hari setelah terjadinya serangkaian bentrokan di jalan-jalan hingga menewaskan lima orang dan melukai lusinan lainnya di Bangkok. Lonjakan kekerasan itu telah menurunkan harapan bahwa krisis politik yang telah berlangsung selama tiga bulan di Thailand itu akan berkurang. Krisis tersebut sejauh ini telah menewaskan 16 orang —baik dari pihak pengunjuk rasa maupun kepolisian— serta ratusan orang mengalami luka-luka akibat tembakan dan ledakan granat. Beberapa ribu pengunjuk rasa antipemerintah berkerumun di luar kantor kementerian pertahanan di kota pinggiran Bangkok, tempatYingluck mengadakan pertemuan dalam beberapa pekan terakhir ini. Mereka berkerumun di luar setelah dihalau dari kantor Yingluck yang terkepung di kompleks kantor pemerintah. PM Yingluck diperkirakan tidak berada di dalam kantor pada saat berlangsungnya pengepungan. Ketegangan menurun setelah parapejabatmiliterdilokasisetujuuntukberbicarakepadapemimpin unjuk rasa Suthep Thaugsuban. “KalauYingluck masih datang untuk bekerja, kami akan datang ke sini setiap hari,” kata Suthep. Pemimpin oposisi itu bahkan mengesankan bahwa Perdana Menteri Yingluck kemungkinan diusir dari Thailand. “Perlawanan terhadap Yingluck harus ditingkatkan.” Pada Selasa, kekerasan pecah setelah polisi antihuru-hara berupaya membersihkan lokasi-lokasi demonstrasi di daerah bersejarah di Bangkok. Seorang polisi tewas ditembak dan empat warga sipil juga kehilangan nyawa, demikian diungkapkan pusat pelayanan darurat Erawan ketika menyebutkan catatan terbaru soal korban jiwa pada hari Rabu.

Ledakan Di Beirut Dekat Pusat Budaya Iran, Empat Tewas BEIRUT, Lebanon (Reuters): Ledakan besar dekat pusat kebudayaan Iran di pinggiran kota bagian selatan ibukota Lebanon, Beirut, pada Rabu (19/2) menewaskan sedikitnya empat orang dan menciderai 19 lainnya, kata sumber keamanan. Sumber keamanan mengatakan, ledakan sepertinya disebabkan bom mobil dan sepedamotor yang dipasangi bahan peledak. DaerahtersebutdikuasaipejabatpolitikSyiahdangerakanmilitan Hizbullah. Kedutaan Iran di daerah yang sama diincar serangan bom pada November, satu dari serangkaian bom di selatan Beirut sejak Juli. Kedutaan Kuwait juga terletak di daerah yang sama. LiputantelevisiLebanonmemperlihatkansejumlahtrukterbakar dan tentara Lebanon berdiri di jalanan. Seorang pria yang terluka dibawa dengan tandu dan seorang gadis remaja dievakuasi oleh dua pria. Pecahan kaca memenuhi jalan itu dan gedung-gedung di sekitarnya rusak.(m23)

Cuaca Panas Menyerang Malaysia

Reuters

GEDUNG SERIKAT . Perdagangan terlihat dilalap api di Lapangan Kemerdekaan di saat bentrokan masih terus berlanjut antara pengunjukrasa anti-pemerintah dan pasukan keamanan di Kiev, Rabu (19/2).

25 Orang Tewas Saat Polisi Serbu Kamp Protes Ukraina KIEV, Ukraina (/Reuters/Antara/AFP):Setelahbentrokanselama berjam-jamlamanya,polisiberhasil menguasaiduapertigaLapangan Kemerdekaan,pusatdaritigabulan aksi unjukrasa terhadap Presiden ViktorYanukovich, pada pukul 8 pagi Rabu (19/2). Lapangan tersebut mirip zona perang di mana asap hitam dan api terlihat membakar gedung serikat perdagangan, yang digunakan sebagai markas antipemerintah. Kementrian Kesehatan, yang terus mendata jumlah korban tewas, mengatakan 25 orang te-

was dalam bentrokan di ibukota itu, di mana sembilan orang di antaranya polisi. Banyak korban yang tewas akibat tembakan dan ratusan orang cidera, di mana puluhan diantaranyadalamkondisiparah, kata polisi dan pihak oposisi. Polisi, yang berlindung di belakangperisai,menghancurkan tenda-tenda para pengunjukrasa dan poster anti pemerintah di sisi selatan lapangan itu. Namun,parapengunjukrasa, banyak di antara mereka mengenakanmaskerdankelelahankarena bentrokan, masih terus mem-

banjiri lapangan itu dari arah lain dan siap melawan polisi untuk hari kedua. Di seberang lapangan orangorang menggunakan pangkur untukmenghancurkanbebatuan yangmerekamenggunakansebagai proyektil untuk dilemparkan ke arah polisi. “Mereka bisa saja datang dalam jumlah ribuan namun kami tidak akan menyerah. Kami tidak punya tempat lain. Kami akan bertahan di sini sampai menang dan menguasai Maidan sampai akhir,” kata seorang penduduk berusia 44 tahun di Ternopil.

Maidan adalah sebutan lokal untuk Lapangan Kemerdekaan. “Kami ingin anak-anak kami tumbuh di negara yang normal di mana hukum peradaban yang diberlakukan bukan hukum penjajahan,” kata Vitaly. Uni Eropa, PBB, AS dan NATO semua menyuarakan keprihatinanatasbentrokanitu,dengan KepalaKebijakanLuarNegeriUni EropaCatherineAshtonmengatakan dia“sangat khawatir tentang eskalasi kegentingan baru ini”. Sekjen PBB Ban Ki-moon menyerukanuntukmenahandiri dandialog,sementaraWashington

mengatakan “terkejut” oleh kekerasan dan mengatakan Presiden UkrainaViktorYanukovych harus “menenangkan situasi”. PadaSelasaterlihatbentrokan pertama sejak pertengahan Januari di ibu kota Ukraina, yang telah dilanda demonstrasi antipemerintah sejak PresidenViktor Yanukovych pada November menolak mendukung pakta Uni Eropa dan bersikap lebih dekat dengan Rusia. Para pengunjuk rasa sempat merebut markas besar partaiYanokuvych setelah beberapa ratus menyerang dengan bom molotov dan menghancurkan jalanjalan tetapi kemudian menarik diri saat asap mengepul terus dari bagianbangunan,katasaksimata. Bentrokan berkobar Senin pagi setelah sekitar 20.000 pengunjuk rasa damai berbaris dari tenda perkemahan mereka yang luas ke arah parlemen untuk menuntut para legislator memecat presiden dari kekuasaan. Komisaris perluasan UE Stefan Fuele, yang terlibat dalam

upaya meredakan krisis Ukraina, mengatakan pejabat sementara perdana menteri Sergei Arbuzov telah mengatakan kepadanya bahwa pemerintah akan melakukan semua yang bisa dilakukan untuk menjaga senjata-senjata di jalan tetap “bungkam”. Para petugas medis yang bekerja di rumah-rumah sakit lapangan yang dijalankan oleh oposisi sebelumnya mengatakan bahwa tiga pengunjuk rasa tewas karena lukatembakdansekitar150orang lainnya terluka, dimana sekitar 30 berada dalam kondisi serius. PartaiWilayah yang berkuasa Yanukovych mengatakan bahwa seorang karyawan di kantor pusatnyajugaditemukantewassetelah pengunjuk rasa sempat menyita gedung itu. Satu polisi meninggal saat dibawakerumahsakitsetelahditembak di lehernya, kata kementerian dalamnegeri.PolisiKievkemudian mengatakan bahwa kedua polisi meninggal karena luka tembak. Sekitar 47polisilainnyaterluka,kata pihak berwenang.(m23)

KUALA LUMPUR, Malaysia (Antara News): Malaysia dilanda cuacapanassejakbeberapapekanterakhirdengansuhuudaraberkisar 34 hingga 36 derajat celsius, sehingga sumber-sumber air di beberapa kawasan mengering serta memicu kebakaran lahan. Cuaca panas dan kering itu diperkirakan berlanjut hingga pekan depan sehingga meningkatkan risiko kebakaran terbuka di lokasi kering. Penduduk di berbagai wilayah mengalami gangguan pasok air sehingga perusahaan air setempat harus mengirimkan tangkitangki air ke berbagai lokasi yang mengalami kekeringan. Kekeringan memicu kebakaran di beberapa lahan terbuka dan hutan seperti di Kepala Batas (Pulau Pinang), lereng hutan Taman MelawatiAmpang(KualaLumpur),hutanGunungTempurung(Perak), serta sebuah lokasi pembuangan sampah akhir di Perlis. Wakil Ketua Pengarah Strategi dan Teknik Kantor Meteorologi Malaysia Rosaidi Che Abas mengatakan, cuaca panas di sebagian besar negeri di Semenanjung saat ini mengakibatkan kekeringan. “Keadaan cuaca panas kering pada setiap Januari dan Februari merupakan situasi normal dan apa yang kita alami sekarang belum pada tahap kemarau,” katanya seperti dikutip media lokal di Kuala Lumpur, Rabu (19/2). Untukmengatasimasalahpenurunanpermukaanairdibeberapa sumber air utama di Lembah Klang, pemerintah melakukan pembenihan awan mulai minggu ini untuk memastikan hujan turun. Wakil Menteri Tenaga, Teknologi Hijau dan Air, Datuk Seri Mahdzir Khalid mengatakan Lembaga Urus Air Selangor (LUAS) yang bertanggungjawab memastikan pasok air mentah mencukupi, akan segera menjalankan proses itu.

Pentagon: Kapal AL AS Kandas Di Laut Hitam WASHINGTON, AS (Antara/AFP): Salah satu dari dua kapal angkatan laut Amerika Serikat yang dikirim ke Laut Hitam sebagai tindakan pencegahan keamanan untuk Olimpiade Sochi kandas di satu pelabuhan Turki, kata para pejabat Selasa (18/2). Kapal fregat USS Taylor sejenak kandas pada Rabu malam ketika sedang bersiap-siap untuk tambat di Samsun, di mana kapal itu akan mengisi bahan bakar, kata para perwira Angkatan Laut. “Tidak ada korban luka yang dilaporkan, dan kejadian tersebut saat ini sedang dalam investigasi,” kata Angkatan Laut dalam sebuah pernyataan.Kapalitumampukedermagadipelabuhandandilakukan pemeriksaanawalyangmenunjukkanbaling-balingkapalmengalami beberapa kerusakan, tetapi tidak ada kerusakan pada lambungnya, kata para pejabat. Tidak jelas kapan kapal, yang memiliki awak sekitar 200 pelaut itu, akan kembali ke tugasnya di Laut Hitam, kata Komandan Philip Rosi, juru bicara Armada Keenam AS, yang mengawasi kapal-kapal Amerika di Mediterania. Dia mengatakan dalam sebuah email bahwa “terlalu dini untuk menentukan dampak terhadap jadwal.” Insiden memalukan itu terjadi setelah Pentagon membuat poin mengumumkan pengerahan kapal serta kapal lain, USS Mount Whitney, kapal komando, ke wilayah tersebut bertepatan dengan Olimpiade Musim Dingin.

Biarawati Dipenjara Karena Memasuki Fasilitas Nuklir AS CHICAGO, AS (Antara/ AFP): Seorang biarawati lanjut usia yang menerobos masuk ke salah satu fasilitas nuklir dengan penjagaan ketat di Amerika Serikat,mendapathukumantiga tahun penjara, media setempat melaporkan. Suster Megan Rice (84) mendobrak pagar dan melewati beberapa lapis penjagaan di kompleks keamanan nasional Y-12 diTennessee bersama dua orang anggota kelompok cinta damai Transform Now Plowshare, pada Juli 2012. Mereka sempat berada di dalam kompleks selama dua jam sampai ditangkap oleh petugas keamanan. Pada waktu itu mereka membentangkan spanduk dan menulis kata-kata “Berkaryalah untuk Perdamaian, Bukan untuk Perang” dengan darah manusiadidindinggudangpenyimpanan dan pemroses uranium

yang diperkaya untuk pembuatan bom nuklir. Kejadian itu mendorong kongres untuk mengulas sistem keamanan fasilitas nuklir di Amerika Serikat. Rice yang sudah ditahan di penjara sejak divonis tahun lalu mendesak hakim untuk menjatuhkan hukuman maksimal atas kejahatannya dalam sidang yang berlangsung selama empat jam. “Tolong tidak usah memberi keringanan kepada saya,” media Tennessse mengutip perkataan Rice. “Menghabiskan sisa hidup saya di penjara akan menjadi kehormatan bagi saya.” Hakim federal Amul Thapar mengatakan merupakan pergulatan untuk menemukan hukuman yang pantas guna memberi keseimbangan atas masa lalunya yang berkarya demi kebaikan dengan pelanggaran hukum yang dilakukannya untuk tujuan akhir masalah politik. Thapar mengatakan bahwa

melanggar hukum bukanlah cara untuk mencapai tujuan politik. Ia berharap bahwa hukuman penjara yang setimpal akan mencegah orang lain melakukan hal serupa. Ia memberi hukuman penjara 35 bulan bagi Rice, surat kabar setempat melaporkan. Dua rekannya yaitu Michael Walli (64) dan Greg Boertje-Obe (58) dihukum lima tahun dan dua bulanpenjarakarenamerekajuga mempunyai catatan kejahatan sebelumnya. NewYork Time mengatakan bahwa Rice, warga asli NewYork sudah ditangkap sebanyak 50 kali karena melakukan pelanggaran danjugapernahdihukumpenjara selama enam bulan. Disebutkanbahwapada1998 ia ditangkap karena melakukan aksi protes di sekolah militer di Georgia yang mendidik tentara Amerika Latin untuk memerangi pemberontak kiri. Dikatakan

bahwa beberapa dari mere-ka melakukan pelanggaran Hak Asasi Manusia. Rice menjalani hukuman enam bulan di penjara federal. “Itu membuka mata saya lebar-lebar,” katanya dalam wawancara dengan Times pada 2012. “Saat kamu mempunyai pengalaman di dalam penjara, akan menurunkan banyak sekali kebutuhan kita.” Rice mengatakan bahwa senjata nuklir“adalah masalah” yang paling menekan pada zaman ini. “Ini suatu kejahatan terhadap industri yang sudah berumur 70 tahun,” katanya kepada Times. “Kitamenghabiskanbelanja yang banyak untuk senjata nuklir dibandingkan untuk pendidikan,kesehatan,perhubungan, bantuan bencana alam dan sejumlah badan pemerintah lainnya, sepanjang yang saya ingat.”


Sport

A10

WASPADA Kamis 20 Februari 2014

AP

KAPTEN City Vin cen t Kom pan y gu n dah k etik a w asit bek Martin Dem ich elis (k an an ) diberik an k artu m erah oleh w asit Jon as Erik sson d i Etih ad Stadiu m , Man ch ester, Rabu (19/2) din ih ari W IB.

Eriksson Rampok City MANCHESTER, In ggris (Wasp ad a): Man ajer Man u el Pellegrin i, m en u d in g wasit Jon as Eriksson telah ‘m eram p ok’ p elu an g Man ch ester City ketika m en jam u Barcelon a p ad a leg p ertam a b ab ak 16 Besar Liga Ch am p ion s. Dalam duel di Etihad Stadium itu, Selasa (Rabu WIB), Eriksson m en ggan jar hadiah p en alti kep ad a Barca m en it 53. Pasaln ya, bek City Martin Dem ichelis m en ekel sesam a p e m a in Ar ge n t in a Lio n e l Messi, yan g seben arn ya terjad i d i lu ar kotak p en alti. “Saya kira salah besar m en om in asikan seoran g wasit yan g telah m elaku kan kesalahan saat m em im pin Barcelona untuk m ewasiti kem bali

di sin i. Saya bilan g sekali lagi dia telah m eram pok hasil duel in i,” ke ca m Pe lle gr in i m e lalui Sky Sports, Rabu (19/ 2). Un tuk m en yem purn akan h u ku m an itu , Dem ich elis diusir Erikssen keluar lapangan. The City harus tem pur dengan 10 pem ain sepanjang sisa laga, se d a n gka n Me ssi su kse s m en geksekusi ten dan gan pen alti terseb u t. “Itu b u kan satu -satu n ya, dia m elakukan kesalahan -ke-

salahan sejak awal. Sangat sulit m en gan alisis p ertan d in gan karen a kep em im p in an n ya,” sesal Pellegrin i. Pria Ch ile yan g b iasan ya m am p u m em en dam p erasaan, m engkritik habis wasit asal Swe d ia p e n ya n d a n g b a d ge FIFA se la m a 12 t a h u n d a n sam pai kin i telah m ewasiti 22 laga Liga Cham pions tersebut. Pellegrin i sep ertin ya siap m engam bil risiko bisa dikenai sanksi berat oleh badan sepakbola Eropa (UEFA), karena kritik kerasn ya. “Saya bicara kepada dia (Eriksson) di akhir laga dan berkata bahwa dia pasti senang sekali karena telah m em u tu skan (h asil) d u el,” sen tiln ya. “Barcelon a tak p u n ya p elu a n g u n t u k m e n ce t a k go l

sa m p a i h u ku m a n terh a d a p Dem ichelis. Wasit tidak im parsial (m em ihak), dia tidak m engawasi laga,” tam bah m antan p elatih Malaga, Real Mad rid d an Villarreal terseb u t. Gol kedua El Barca dicetak bek sayap Dan iel Alves m en it 90. Men urut Pellegrin i, bukan h al bagu s m em ilih wasit dari Swedia untuk m em im pin duel akb ar terseb u t. “Dia tid a k m em u tu ska n pelanggaran atas (Jesus) Navas sebelum penalti itu. Untuk pen alti itu sen diri, p elan ggaran terjad i d i lu ar kotak p en alti,” ratap Pellegrin i. D ia s u d a h m a r a h s a a t Eriksson dipilih, karen a wasit in i m en gab aikan d u a h u ku m an p en alti Barcelon a p ad a p e re m p a t fin a l Liga Ch a m -

Pasukan Tata Lebih Efisien

AP

KIPER Barca Victor Valdes tetap k erja k eras m en gam an k an gem pu ran 10 pem ain Citizen s di Etih ad Stadiu m .

MANCHESTER ( Wasp ada): Kap ten Man ch ester City Vin cen t Kom p an y m en egaskan , Barcelon a sam a sekali tidak lebih u n ggu l dari tim n ya ken d ati m am p u m en an g 2-0 pada leg pertam a babak 16 besar Liga Ch am p ion s. “Ap akah m ereka tim terbaik yan g kam i hadapi? Tidak sam a sekali. Nam u n m ereka lebih efisien, m ereka m em iliki ban yak p em ain berku alitas,” kata Kom p an y, Selasa (19/ 2). Setelah berm ain tanpa gol se p a n ja n g b a b a k p e rt a m a , Barca bin aan en tren ador Ger a rd o ‘Ta t a’ M a r t in o b a r u m am p u m en em b u s keb u n tu a n setela h Citizen s h a ru s b erm ain d en gan 10 p em ain sejak m en it 53. “Skor 0-2 itu sa n ga t su lit b a gi ka m i. Ta p i t id a k b e ra r t i ka m i m e r a sa m ereka leb ih su -p erior d ari kam i,” klaim Kom -p an y. Pe la n gga r a n t e r h a d a p Lion el Messi d i lu ar garis p enalti City m em buat bek Martin Dem ichelis diusir wasit ke luar lapangan dan berbuah penalti b agi Barca. Messi yan g m en ja d i a lgo jo su kse s m e m a n faatkan p elu an g in i. Na m u n ke h ila n ga n se orang pem ain tidak m em buat pasukan Manuel Pellegrini kehilangan peluang untuk m enciptakan gol balasan. Menit 80 David Silva m enerjang, tapi ki-

per Victor Valdes sukses m enep is b ola. Menit 82 Gerard Pique bisa m enam bah keunggulan El Catalan , n am un goln ya dian ulir wasit Jon as Eriksson karen a leb ih d u lu terjeb ak offside. D a n i Alve s k e m u d i a n m e m b u n gka m p u b lik tu a n rum ah berkat goln ya di ujun g laga, setelah kerjasam a satu d u a d en gan rekan sen egaran ya, Neym ar d a Silva. Livescore dan ESPN m en catat, pasukan Tata m enguasai 62 persen penguasaan bola dengan m enghasilkan tujuh tend an gan ke arah gawan g, sed an gkan City m en gu asai 38 p ersen d an m em b u at en am an cam an ke gawan g Vald es. Perlawan an h eb at 10 p em ain Th e Eastlan d itu m em buat gelan dan g Barca An dres Iniesta tetap waspada pada leg kedua di Cam p Nou, 12 Maret m en d atan g. “Ha sil ya n g sa n ga t b a ik bagi kam i. Tap i City m em iliki tim fan tastis d an b erm ain d i level sangat tinggi dengan perm ain an yan g m en ekan ,” jelas In iesta. “Meskip u n h asiln ya b aik bagi kam i, nam un kam i belum m en gam bil apa-apa dari laga t a d i. De n ga n m e m p e r t im bangkan level lawan, kam i belu m b isa m en gatakan lolos,” tegas Iniesta.(m 15/ant/fe/espn)

City 32% 0 9 3 1 2 19 0 2 1

Barca Penguasaan Bola 68% 2 Skor Akhir 10 Tembakan Total Tembakan Tepat 4 4 Tembakan Pojok 3 Penyelamatan 10 Pelanggaran Offsides 6 2 Kartu Kuning 0 Kartu Merah *Sumber ESPN

p ion s 2012 m elawan AC Milan di San Siro. Keberatan dan tudingan Pellegrini ditanggapi b ia sa sa ja o le h en t ren a d or Barca Gerardo ‘Tata’ Martin o. “Saya tidak berbicara soal wasit, atau p alin g tid ak saya tidak terlalu banyak berbicara tentang m ereka, karena itu tak akan berarti apa-apa. In tin ya, saya h an ya foku s p ad a area m a n a tim in i h a ru s d ikem b an gkan ,” sen til Tata. Tetap i p ria Argen tin a itu m arah ketika m enanggapi polem ik Messi. “Messi m ungkin berada di lu ar kotak p en alti, tap i kam i juga dirugikan wasit, ketika gol kam i (d icetak Gerard Piqu e) dian ulir m eski Cesc Fabregas (pem beri um pan ) berada dalam posisi on side,” klaim Tata lewat AS. (m 15/ant/rtr/sky/as)

sp ektaku ler dari jarak 18 m eter ke p ojok atas gawan g kip er Bern d Len o m en it 42. Rekru ta n a n ya r d a ri Newca stle, Yo h a n Cabaye, m encetak gol keem pat PSG dua m enit seb elu m laga u sai. “Gol p ertam a, ked u a d an ketiga terja d i d i b a b a k p erta m a . Di b a b a k kedua, kam i tetap m em ain kan gaya kam i. In i m em an g m alam yan g b aik,” p ap ar Ib ra. Berkat tam b ah an d u a goln ya ke gawan g Leverkusen, m antan penyerang AC Milan, Barcelon a, In ter Milan , Ju ven tu s d an Ajax Am sterdam itu , m em u n caki daftar p en cetak gol Liga Ch am p ion s. Ib ra kin i m en goleksi 10 gol, u n ggu l satu bola dari superstar Real Madrid Christiano Ron aldo. Ron aldo m asih bisa m en am bah pun di golnya ketika El Real m enjajal FC Schalke pada

LEVERKU SEN, Je rm a n (Wasp ada): Ru di Voeller, Direktur Olahraga Bayer Leverkusen, m enuding tim nya terlihat ‘lapok’ saat dihancurkan 0-4 oleh tam unya Paris SaintGerm ain (PSG) p ad a leg ked u a b a b a k 1 6 b e s a r Liga Ch am p ion s. “Selalu sulit untuk berkom entar setelah m enyaksikan p e r t a n d in ga n se p e r t i it u . Sungguh kekalahan yang m en yakitkan ,” p ap ar Voeller. “Kalah m elawan tim besar seperti PSG m em an g bukan m asalah besar. Tapi kalah 0-4 m em b u at kam i terlih at bodoh,” katan ya lagi, seperti dikutip dari Sky Sports, Rabu

Leverkusen: Bernd Leno, Emir Spahic, Toprak, Simon Rolfes (Stefan Reinartz 46’),Andres Guardado, Bender, Hilbert, Gonzalo Castro, Sydney Sam (Philipp Wollscheid 62’), Son (Julian Brandt 46’), Stefan Kiessling Paris SG: Salvatore Sirigu, Gregory Van Der Wiel, Thiago Silva, Alex, Maxwell, Thiago Motta, Blaise Matuidi (Yohan Cabaye 67’), Marco Verratti, Lucas Moura, Zlatan Ibrahimovic, Ezequiel Lavezzi (Javier Pastore 75’) (19/ 2). Zlatan Ibrah im ovic m en jadi bintang kem enangan PSG d i Ba yAre n a , Se la sa (Ra b u WIB). Pe n ye ra n g ja n gku n g Swedia itu m encetak sepasang gol dan dua gol lainnya datang d a ri d u e t ge la n d a n g Yo h a n Cab aye d an Blaise Matu id i. Keka la h a n tela k d i ka n dang m em buat peluang Lever-

kusen untuk lolos dari 16 Besar Liga Cham pions ham pir m ustahil. Voeller pun m erasa m alu p ad a kin erja tim n ya. “Kam i harus m em balikkan keadaan m ulai saat ini. Jika Anda tertin ggal ketika laga baru berjalan dua m enit, itu m em atikan ,” sesal striker legen daris Leverku sen d an Tim n as Jerm an terseb u t.

or Calon Top Sk Skor Liga Champions

Kans lolos anak asuh Sam i Hyyp ia itu d en gan d em ikian san gat b erat p ad a leg ked u a m arkas Les Parisiens, Parc des Princes, 12 Maret m endatang. “Kam i berm ain sangat buruk selam a 45 m enit pertam a.

Manchester City vs Barcelona 0-2 City (1-4-5-1): Joe Hart; 4 Vincent Kompany, 26 Martin Demichelis, 22 Gael Clichy, 5 Pablo Zabaleta; 13 Alexandre Kolarov (Joleon Lescott 58’), 21 David Silva, 42 Yaya Toure, 15 Jesus Navas (Samir Nasri 58’), 25 Fernandinho, 9 Alvaro Negredo (Edin Dzeko 74’). Barca (1-4-3-3): 1 Víctor Valdes, 22; Dani Alves, 3 Gerard Pique, 18 Jordi Alba, 14 Javier Mascherano; 8 Andres Iniesta, 6 Xavi Hernandez, 16 Sergio Busquets, 10 Lionel Messi, 9. Alexis Sanchez (Neymar da Silva 74’), 4 Cesc Fabregas (Sergi Roberto 86’). “Ka m i p a h a m jika b isa m en gon trol du el, m aka kam i m am pu m enciptakan banyak m asalah untuk m ereka. Sebab m ereka tidak m am p u m en gh ad ap i tim -tim yan g b an yak m en guasai bola,” klaim Alves. “Ka m i b e r t a h a n sa n ga t b aik. Kam i selalu b erkesem patan m enang jika tidak kebobolan dan kam i berhasil m encetak clean sh eet den gan m em ain kan sep akb ola can tik,” tam b ah p en cetak gol ked u a Barca terseb u t. Men u ru t gelan dan g Cesc Fabregas, sukses m enekuk City m erupakan balasan terhadap p ara p en geritik, yan g m en u -

d in g Barca su d ah tid ak m enakutkan lagi seperti beberap a tah u n lalu . “Beb erap a oran g b erb icara terlalu ban yak, tapi m ereka harus tutup m ulut selam a b eb erap a h ari ke d ep an m ulai sekarang,” tegasnya kep ad a Football Espan a. “Para p en dukun g m en aru h ban yak tekan an kep ada kam i, tap i itu lah alasan m en ga p a ka m i t a m p il b e git u sp esial. Mu n gkin m alam in i kam i m em p eroleh p oin u n tuk m em buktikan , kam i berm ain b agu s d an m en d ap at h a sil b a gu s,” p u n gka s Fa b regas. (m 15/a nt/a s/fe)

Leverkusen 36% 0 5 2 4 6 14 1 4 1

PSG

Penguasaan Bola 64% Skor Akhir 4 Tembakan Total 12 Tembakan Tepat 10 Tembakan Pojok 1 Penyelamatan 2 Pelanggaran 6 Offsides 2 Kartu Kuning 1 Kartu Merah 0 *Sumber ESPN

baik secara tim juga sudut pand an g tiap in d ivid u ,” katan ya lagi. Gelan dan g Blaise Matuidi m e m b u ka ke u n ggu la n t im tam u ketika laga baru berjalan tiga m enit. Zlatan Ibrahim ovic m em asukkan gol kedua lewat p en alti m en it 39. Han ya tiga m en it b ersela n g, p e n ya ra n g ja n gku n g Swedia itu m enam bahkan gol keduan ya sekaligus m en utup

b ab ak p ertam a d en gan keu n ggu lan tiga b ola. Bin tan g b aru Yoh an Cabaye m en utup pesta gol PSG d en gan gol in d ah n ya m en it 88. Kem en an gan em pat bola ini, praktis m em buat satu kaki Les Parisiens sudah m enapak d i b ab ak p erem p atfin al. “Pertam a, kam i m encoba u n tu k m en ikm ati kem en angan tandang ini. Setelah m en galah kan Valen cien n es (d i Ligue On e), saya dapat m elih at kam i m em iliki tim yan g san gat fokus, sem uan ya m enunggu laga ini (m elawan Leverkusen) sepanjang waktu,” jelas Blan c. “Ketika kalian m em iliki pem ikiran positif, sem uan ya akan b aik-b aik saja. Ditam bah kam i m encetak gol cepat m en it ketiga yan g m em buat m u d a h s e ga la n ya ,” t e ga s m antan pelatih Tim nas Prancis tersebu t. (m 15/okz/uefa)

10 Zlatan Ibrahimovic (PSG) 9 Cristiano Ronaldo (Madrid) 7 Lionel Messi (Barcelona) 6 Sergio Aguero (Man City) 5 Alvaro Negredo (Man City) m en ggan tikan p osisi Son Heu n g-Min . Men it 62 tu an ru m ah kem bali m en ggan ti p e m a in n ya . P h illip p Wo lls c h e id m a s u k m enggantikan Sydney Sam . Sedangkan pelatih PSG Laurent Blanc m em asukkan Cabaye untuk m en ggan tikan Matu id i m en it 67. Cabaye kem udian m en utup pesta gol PSG, m em an faatkan u m p an jitu Lu cas Mou ra. “Saya san gat sen an g m elih at p en am p ilan tim in i. Ju ga p en tin g bagi saya bisa m en cetak gol,” u cap Cab aye. (m 15/a nt/a fp /uefa )

TRIO Leverk u sen (k iri k e k an an ): Lars Ben der, Gon zalo Castro dan Ju lian Bran dt, galau pasca k ek alah an m em alu k an di BayAren a. -AP-

Bayer Leverkusen vs Paris St Germain 0-4

MANCHESTER ( Wasp ada): Daniel Alves tertawa m end en gar kom en tar Barcelon a m engalahkan Manchester City 2-0 karen a diu n tu n gkan oleh wasit Jon as Eriksson di Etihad Stad iu m . “Ad a b an yak oran g yan g m au berbicara tentang hal itu. Kam i h an ya m elaku kan p ekerjaan dengan m elakoni partai besar dan kadang m enang, kad an g kalah ,” b alas Alves. “Tap i oran g-oran g selalu m e m b ic a r a ka n w a s it ka la Barca m enang, itu cara m ereka m em u ji kam i,” sin dir bek sayap Brazil itu m elalui AS, Rabu (19/ 2). Polem ik wasit Eriksson terp u sat p ad a in sid en b ek City Martín Dem ich elis m en ekel Lion el Messi d i lu ar garis p enalti tim tuan rum ah m enit 53. Eriksson m engusir Dem ichelis d e n ga n k a r t u m e r a h d a n m em berikan El Barca hadiah tendangan 12 pas, yang sukses disaran gkan Messi ke gawan g kip er Joe Hart.

LEVERKUSEN (Waspada): Pelatih Lau ren t Blan c (foto), m em uji habis anak-anak Paris Saint Germ ain yang m em perm alu kan tu an ru m ah Ba yer Leverku sen 4-0 d i BayAren a. Blan c m alah m en gklaim , Les Parisiens tam pil sem purna hin gga m am pu m en an g telak p ada laga leg p ertam a babak 16 besar Liga Cham pion s terseb u t. “Kalian dapat m engatakan kelem ah an Leverku sen , n am u n p en am p ilan kam i tad i sem p u rn a. Sem an gat tim san gat bagu s. Saya m en gu cap kan selam at untuk sem ua yang berm ain ,” klaim Blan c dalam lam an UEFA, Rab u (19/ 2). “Kam i b elu m lolos, kam i datang kem ari untuk berm ain baik dan p ersiap an kam i ternyata berakhir bagus. Cara kam i berm ain m em uaskan saya,

26 Feb ru ari m en d atan g. Gol cep at PSG didah u lu i den gan p elan ggaran Sim on Rolfes terh ad ap Matu id i, yan g kem u d ian su kses m em aksim alkan n ya. Les Parisiens terus m engancam dengan m enciptakan leb ih b an yak p elu an g d ib an d in g Leverku sen . Ibra m em buat tim tam u un ggul 2-0 ketika m en yelesaikan h ad iah ten d an gan p en alti, b u ah p elan ggaran Sp ah ic d i kotak terlaran g pasukan Sam i Hyypia. Tidak lam a kem udian , b in tan g Swed ia itu m en cetak gol ked u an ya d en gan cara sp ektaku ler. Mengawali babak kedua, Hyypia langsung m erom bak barisan depan pasukan n ya un tuk m e n a ja m ka n se ra n ga n . Re in a n rtz m a su k m e n gga n t ika n Ro lfe s d a n Ju lia n Bra n d t

Leverkusen Lapok

Barca Balas Pengeritik

Les Parisiens Sempurna

Ibra Merasa Semuanya Lebih Mudah LEVERKUSEN, Jerm an (Waspada): Zlatan Ib rah im ovic m en gaku , Paris Sain t-Germ ain (PSG) m en an g m udah atas Bayer Leverkusen pada leg pertam a babak 16 besar Liga Cham p ion s. Dalam duel di BayArena, Selasa (Rabu WIB) tersebut, PSG pesta gol 4-0 karen a sem uan ya d ip e r m u d a h go l c e p a t ge la n d a n g Bla ise Matu idi ketika laga baru berjalan tiga m en it. “Kam i m em ain kan laga yan g bagus, kam i m en cetak gol di awal laga. Ketika kam i cep at m em im pin, m aka pertandingan m enjadi jauh lebih m udah,” beber Ibra di situs resm i UEFA, Rab u (19/ 2). Setelah gol Matu id i, Ib ra m en yaran gkan gol kedua m elalui titik putih m enit 39 dan m en am bahkan gol keduan ya den gan ten dan gan

BOMBER Barca Lion el Messi (atas) ditek el Martin Dem ich elis tipis di lu ar garis pen alti Man ch ester City. -AP-

Kam i sam a sekali tidak m em en an gkan satu p un p erebutan bola dan m em udahkan segala n ya u n tu k m ereka ,” tu tu r Om er Toprak, bek Leverkusen b eru sia 24 tah u n asal Tu rki. (m 15/a nt/sky/d p a )

AP

BIN TAN G k em en a n ga n PSG Z la t a n Ib ra h im ov ic (k iri) m erayak an goln ya k e gaw an g Leverk u sen den gan rek an n ya Marco Verratti di BayAren a, Rabu (19/2) din ih ari W IB.


Sport

WASPADA Kamis 20 Februari 2014

A11

Pembangunan Gedung ISC Lamban Pora Sudah Di Ambang Pintu IDI (Waspada): Pekan Olahraga Aceh (Pora) XII tahun 2014 di Aceh Timur, sudah di ambang pintu. Dalam beberapa kali pertemuan, Aceh Timur sebagai tuan rumah tetap optimis Pora akan berlangsung sukses. Namun di sisi lain, pembangunan Gedung Idi Sport Centre (ISC) di Desa Titi Baro, Kecamatan Idi Rayeuk, hingga saat ini baru mencapai 30 persen. Padahal seharusnya rekanan sudah menyelesaikan setidaknya 40 persen fisik bangunan. “Akibat faktor alam, sehingga pembangunan ISC baru tahap 30 persen. Seharusnya sesuai kontrak sudah mencapai 40 persen. Namun kita dari Panitia Penyelenggara (PP) Pora meminta kepada pihak pemegang proyek untuk mempekerjakan pekerjanya siang dan malam, agar bisa selesai tepat waktu,” ujar Sekjen PP Pora XII/2014, Firman Dandy, kepada Waspada, Rabu (19/2). Firman mengaku pihaknya terus ikut memantau pembangunan Gedung ISC yang akan menggelar sebagian besar cabang olahraga Pora. “Pora akan mempertandingkan 24 cabor dan tujuh cabor dipusatkan di ISC (indoor) serta lima cabor di luar Gedung ISC (outdoor),” sebut Firman. Dijelaskan, tujuh cabor yang akan dipertandingkan dalam Gedung ISC adalah bulutangkis, pencak silat, taekwondo, karate, kempo, tarung derajat, dan anggar. Sedangkan lima cabor di BEBERAPA pekerja menyelesaikan pembangunan Gedung ISC di depan Pusat Perkantoran Pemkab Aceh Timur di Kecamatan Idi, Rabu (19/2). -Waspada/M. Ishak-

luar Gedung ISC, yakni tenis lapangan (4 lapangan), bola basket (2 lapangan), bola voli (2 lapangan), bola voli pasir (2 lapangan), dan sepak takraw (2 lapangan). Untuk cabor yang dipusatkan di Lapangan Pusat Pemerintahan Aceh Timur, terdiri atas panahan, tinju, dan panjat tebing. Untuk cabor renang dipusatkan di Kolam Tirta Raya Banda Aceh. Selam dibagi dua tempat, yakni selam nomor laut di Perairan Kuala Idi dan nomor kolam di Kota Langsa. Cabor dayung akan diperioritaskan di Sungai Ranto Selamat. Ditambahkan, cabor balap motor berlangsung di Jl Pusat Pemkab Aceh Timur yang kini sudah siap pengaspalan. “Untuk cabor menembak dan berburu, dipusatkan di Lapangan Pusat Perkantoran Aceh Timur, baik indoor maupun out door,” ujar Firman, sembari menambahan cabor catur dan tenis meja akan berlangsung di di Aula Maghnit School di Peureulak. Selanjutnya, cabor angkat besi dan bina raga di Aula SKB Kecamatan Idi Timur. Atletik nomor lintasan di Banda Aceh yang akan berlangsung sepekan sebelum dibukanya Pora. Untuk atletik, selain nomor lari, seluruhnya dipusatkan di Idi seperti lompat dan lempar. “Sepakbola di Stadion Mon IX Idi dan Stadion TM Djafar Julok. Sedangkan para atlet akan menginap di 15 sekolah, masing-masing di Kec. Peureulak Timur, Peureulak Kota, Peureulak Barat, Peudawa, Idi Rayeuk, Darul Aman, Nurussalam, dan Julok,” bebernya. Sedangkan untuk penginapan Kepala Daerah, lanjut Firman, telah disiapkan hotel yang ada di Kabupaten Aceh Timur. Untuk tim juri, akan menginap di beberapa kantor yang tersedia di pusat pemerintahan,” pungkas Firman. (b24)

Menpora Segera Terbitkan Permen Selesaikan Konflik KONI-KOI JAKARTA (Waspada): Menteri Pemuda dan Olahraga, Roy Suryo (foto), berjanji segera menerbitkan Peraturan Menteri (Permen) baru sebagai solusi menyelesaikan konflik yang melanda dua lembaga olahraga tanah air, yakni KONI dan KOI. Menurutnya, penulisan draft Permen yang nantinya akan menjadi dasar dalam mengakhiri konflik antara KOI dan KONI, seperti yang saat ini tengah terjadi, sudah memasuki tahap akhir, sehingga dalam waktu dekat akan segera diumumkan. “Sebenarnya sudah hampir selesai. Memang ada sedikit keterlambatan. Sebab kami harus mengoreksi semua draft

Permen agar tidak ada yang terlewatkan. Jangan sampai nantinya ada masalah baru muncul,” kata Roy kepada wartawan usai membuka Pocari Sweat Futsal Championship, di Kantor Kemenpora, Rabu (19/2). Ditambahkan, Permen yang segera diterbitkan nantinya bakal menjelaskan tugas dari KONI-KOI secara lebih detail. Maklum saja, karena

Wadokai Kecewa Forki Atim LANGSA (Waspada): Pengurus Federasi Olahraga KarateDo Indonesia (Forki) Cabang Aceh Timur, dituding tidak profesional dengan memanggil tiga orang atlet binaan Perguruan Wadoryu Karate-Do Indonesia (Wadokai) cabang Aceh Timur tanpa permisi. Pelatih Wadokai Aceh Timur, T Syamsuddin, mengatakan seharusnya Forki memberitahukan kepada pengurus Wadokai untuk merekrut atlet karate yang akan dipersiapkan menghadapi Pekan Olahraga Aceh (Pora) 2014. Namun yang terjadi para pengurus Forki asal panggil saja tanpa memberitahu dojo serta organisasi tempat atlet dibina. “Mereka anggap apa kami ini yang telah bertahun-tahun membina atlet sehingga berhasil seperti saat ini,” ujarnya kepada Waspada, Rabu (19/2). “Meski Wadokai berada di bawah naungan Forki, ada aturan yang seharusnya dihormati Forki Aceh Timur. Tidak asal main panggil atlet, sehingga semua pihak merasa dihargai,” tambah T Syamsuddin. Dijelaskan, pihaknya bukan tidak mengizinkan atlet Wadokai membela Forki Aceh Timur, namun aturan pemanggilan harus jelas. “Kita sangat senang atlet binaan dipanggil mebela nama daerah, namun tolong sekali lagi aturan dan cara pemangilannya jelas,” katanya. Tiga atlet binaan Wadokao Aceh Timur dipanggil untuk mengikuti pelatihan penuh yang dilaksanakan Forki Aceh Timur dalam rangka menghadapi Pora di Aceh Timur pada pertengahan tahun 2014 ini, adalah M Saifan, Rizki Wahyudi, dan Ari. (b22)

selama ini Undang-Undang Sistem Keolahragaan Nasional (UU SKN) dan Peraturan Presiden, masih belum mampu meredam terjadinya ‘tabrakan’ antara KONI-KOI dalam menjalankan tugas dan fungsi masing-masing. “Memang banyak juga pihak menilai kalau Permen tidak perlu diterbitkan. Tapi, kami rasa itu sangat perlu. Pasalnya, kalau kita ingin membatasi tugas KONI-KOI lewat Undang-Undang, itu sangat tidak mungkin karena proses pem-

buatannya sangat lama,” tegas Roy, sembari mengatakan Permen nantinya akan mengatur kewenangan dan tugas antara KONI dan KOI, sehingga tidak akan ada lagi ‘tabrakan’ tugas untuk kedua institusi tersebut. Seperti diketahui, konflik antara KONI-KOI muncul saat persiapan SEA Games Myanmar akhir tahun lalu. Saat itu, KONI-KOI selalu bertabrakan dalam menjalankan tugas dan fungsi masing-masing. Hal itu disebabkan karena tidak dipahaminya UU SKN dan Per-

pres yang ada secara utuh, sehingga keduanya pun saling klaim. “Dengan adanya Permen nanti, saya jamin tidak akan ada lagi overlap fungsi dan tugas masing-masing. Saya ingin selesaikan Permen ini secepatnya dan sesempurna mungkin, sehingga jangan sampai ada masalah yang terjadi di era kepemimpinan menteri berikutnya. Waktu saya tinggal lima bulan sebagai Menpora,” pungkas Roy. (yuslan)

Sakhyan Tinjau Stadion Madina PANYABUNGAN (Waspada): Menteri Pemuda dan Olahraga (Menpora) diwakili Deputi Pengembangan Pemuda, Drs H Sakhyan Asmara MSP didampingi Plt Bupati Madina Drs Dahlan Hasan Nasution, meninjau langsung pembangunan Stadion Madina, Rabu (19/20). Stadion bertarap internasional itu, terletak di Padang Harapan, Desa Sarak Matua, Kecamatan Panyabungan Utara, Kabupaten Mandailing Nata. Peninjaun itu sebagai tindak lanjut pihak Kemenpora menjadikan 2014 sebagai tahun kebangkitan olahraga di Indonesia, khususnya di Madina. “Kemenpora berharap dukungan semua pihak dalam rangka peningkatan olahraga yang memiliki peranan pen-

ting dalam menciptakan masyarakat yang sehat dan SDM andal,” ujar Sakhyan Asmara. Dijelaskan, tahun kebangkitan olahraga secara nasional tidak saja membutuhkan pembangunan sarana fisik, tetapi juga peningkatan pembangunan di bidang SDM, termasuk mengadakan diklat dan pelatihan kepada atlet, juri, wasit, dan instrumen olahraga lainnya. Khusus Stadion Madina, Sakhyan berjanji akan memperjuangkan anggaran untuk peningkatan pembangunan stadion tersebut, karena hingga saat ini pembangunannya belum selesai, karena terkendala pendanaan. Sakhyan optimis peningkatan olahraga di Madina bisa tercapai, karena Bupati Madina, Dahlan Hasan Nasution,

juga seorang pejabat negara yang dulu dikenal turut berjuang untuk pengembangan olahraga di Sumateta Utara. “Dahlan Hasan ini sahabat dekat saya waktu sama-sama menjabat di Pemprov Sumatera Utara. Karena itu, saya optimis kebangkitan olahraga di Madina ini akan tercapai. Makanya kita harus sama-sama bekerja keras,” ucap Sakhyan. Kelanjutan pembangunan Stadion Madina yang awal pembangunannya diresmikan langsung Menpora yang saat itu masih dijabat Adiyaksa Dault tahun 2007, sangat diharapkan masyarakat Madina. Karenanya, dana bantuan dari pemerintah melalui Kemenpora sangat diharapkan untuk penyelesaian pembangunan stadion tersebut. (c14)

Agara Ikut 8 Cabor Pora KUTACANE (Waspada): Kabupaten Aceh Tenggara (Agara) akan mengikuti delapan cabang olahraga Pekan Olahraga Aceh (Pora) ke-XII tahun 2014 di Aceh Timur. “Agara akan menurunkan 31 atlet yang sebelumnya telah lolos Prakualifikasi Pora. Mereka akan didampingi sejumlah ofisial untuk tampil pada delapan cabor,” ujar Wakil Bupati sekaligus Ketua KONI Agara, H Ali Basrah, kepada Waspada di ruang kerjanya, Rabu (19/2). Delapan cabor yang akan diikuti adalah bola voli pasir putri, atletik, catur, karate, tinju, renang, tenis lapangan, dan pencak silat. “Jumlah kontingen kita memang sangat minim, namun melihat semangat juang dan komitmen para atlet, kita optmisi Agara berprestasi,” katanya. Dikatakan, awalnya Agara sangat berharap cabor sepakbola, bola voli putra dan putrid serta bulutangkis, juga bisa lolos ke Pora. Namun ternyata cabor tersebut gagal melewati Pra Pora.(b26)

Waspada/Sarmin Harahap

DEPUTI Pengembangan Pemuda Kemenpora, Drs Sakhyan Asmara MSP didampingi Plt Bupati Madina Dahlan Hasan Nasution, meninjau Stadion Madina, Rabu (19/2).

TTS TOPIK

Problem Catur

Waspada/Yuslan Kisra

MENPORA, Roy Suryo, memberi keterangan kepada wartawan terkait segera diterbitkannya Permen baru sebagai solusi menyelesaikan konflik KONI-KOI, Rabu (19/2).

PRSI Berharap Tambahan Kuota JAKARTA (Waspada): Sekjen Persatuan Renang Seluruh Indonesia (PRSI), Made Suryadana, menegaskan pihaknya tengah berupaya mendapat tambahan kuota atlet yang akan diberangkatkan ke Asian Games Incheon, Korea, dari lima atlet menjadi sembilan. Menurut Made, sangat disayangkan sekiranya empat atlet PRSI yang tengah dipersiapkan sejak kembali dari SEA Games Myanmar, tidak diberangkatkan ke Asian Games. Padahal secara jenjang, keempat atlet tersebut sangat potensi medali. “Masih perlu satu sesi lagi dengan pemerintah terkait pendanaan Asian Games Incheon. Atlet yang diajukan ada sembilan, cuma hanya lima yang diakomodir oleh pemerintah melalu Prima,” kata Made, di sela-sela peluncuran program Master Swimming di Jakarta, Rabu (19/2). Ditambahkan, kelima atlet yang sudah mendapat persetujuan Prima, yakni Indra Gunawan, Saimen, Triadi Fauzi, Glen Victor, dan Raisa, terus menjalani persiapan di Bandung dan Jakarta. Hal yang sama dilakukan empat atlet lainnya yang terus digenjot latihan. Senada dengan itu, Ketua Umum PRSI, Sandiaga Uno, menegaskan pihaknya optimistis para perenangan Merah Putih bisa menyumbangkan medali di ajang multievent tingkat Asia nanti. Hanya saja, ia menolak menyebutkan jenis medali yang bisa dibawa pulang.

8

7

6

5

4

3

2

1

A

B

C

D

E

F

G

H

Dukung Renang Master Pada bagin lain, orang nomor satu di PRSI ini menegaskan dukungannya terhadap peluncuran Renang Master

OLAHRA GA OLAHRAGA

yang digagas para praktisi renang tanah air. Hal tersebut untuk lebih memasyarakatkan olahraga aquatic, khususnya nomor renang di tanah air. “PRSI mendukung penuh peluncuran Renang Master. Sangat diharapkan program ini berjalan sesuai harapan, sehingga olahraga renang semakin digemari, meski usia perenang yang masuk kategori master adalah di atas 25 tahun,” tandas Sandiaga. (yuslan)

Sudoku

Putih melangkah, mematikan lawannya tiga langkah.

Jawaban di halaman A2.

“Target medali sudah pasti. Melihat performa anak-anak dalam pemusatan latihan, kami otimistis bisa membawa pulang medali. Kami ingin memecahkan sejarah merebut medali di Asian Games, setelah terakhir diperoleh pada 1990 silam,” tegas Sandiaga.

MENDATAR

MENURUN

1. Olahraga yang diurus Perbasi. 4. Pukulan dalam tinju. 6. Olahraga bola dua regu, dipisah net dan bola tidak boleh jatuh ke lantai. 7. Produsen mobil balap Formula-1. 9. Kelompok pemain dalam olahraga. 10. Gerak badan diatas kolam dengan menggunakan tangan dan kaki. 12. Pukulan dalam tinju selain jab. 14. Benda bulat yang dipukul atau ditendang dalam pertandingan beberapa cabang olahraga. 15. Tunggal; Sendiri. 17. Didier——, mantan bomber klub sepakbola Chelsea. 19. World Boxing Association. 20. Burung pemangsa yang sering dipakai untuk nama klub olahraga. 22. Balap. 23. Klub sepak bola Inggris. 24. Perserikatan (sepak bola bayaran). 25. Lompat; ——Indah, hanya ada dalam olahraga renang. 26. Klub sepak bola Spanyol, kota wisata pantai.

1. Kota ada istana presiden di Jawa Barat, punya klub sepak bola PSB. 2. Sepeda (Inggris). 3. Tidak menang, tidak seri. 4. Klub sepak bola Italia dijuluki “Nyonya Tua”. 5. Olahraga menggelindingkan bola besar untuk merobohkan sejumlah gada/pin. 7. Cabang olahraga sepakbola di lapangan yang jauh lebih kecil. 8. Nama pesepak bola naturalisasi Indonesia yang muncul dalam iklan tv (dua suku kata, tulis tanpa spasi). 11. Alfred——, pelatih sepakbola Indonesia asal Austria. 13. Grup (Inggris). 14. Bisbol (Inggris)l. 16. Gerak badan untuk menguatkan dan menyehatkan tubuh, seperti sepakbola dll. 18. Peluang; Kesempatan. 19. Woman (Indonesia). 21. Dobel.

Isi dengan angka 1 sampai 9. Tidak boleh ada pengulangan angka mendatar, menurun, maupun di kotak 3x3 bergaris tebal. Tingkat kesulitan: sulit (****), bisa diselesaikan kurang dari 15 menit. Jawabannya di halaman A2 kolom 1.

2 7 3 4 3 6 5 1 1 4

8 7 3 9 4 4

4 7 6 5 3 7

3 1

5 1 8 9 3 7 8 6 ****232


Sport

WASPADA Kamis 20 Februari 2014

A11 Hari Ini, Pemko Turunkan Satpol PP Tim Ngaku PSMS Bertahan

Waspada/Arianda Tanjung

HINGGA Rabu (19/2), tim mengaku PSMS masih tetap menjalani latihan di Stadion Kebun Bunga Medan.

MEDAN (Waspada): Hingga Rabu (19/2), klub mengaku PSMS Medan pimpinan Indra Sakti, tetap bertahan menggelar latihan di Stadion Kebun Bunga Medan. Kemarin, merupakan hari kedua tim itu berlatih dan sudah mengenakan kostum bertuliskan PSMS. Kehadiran tim tersebut di Stadion Kebun Bunga, membuat pengurus PSMS pimpinan dr M Fauzi Nasution, mengaku berang dan sudah melaporkannya kepada Pemko Medan. “Pihak Pemko Medan akan menurunkan Satpol PP besok (hari ini) untuk menangani masalah ini, mengingat yang mendapat surat izin pemakaian Stadion Kebun Bunga adalah kami,” ujar Sekum PSMS, Julius Raja. Dikatakan, surat izin dimaksud tertanggal 5 Februari 2014 dan ditandatangani Sekda Pemko Medan, Ir Syaiful Bahri. “Dalam surat dimaksud, tertulis Pemko Medan dengan ini menerangan bahwa PSMS dan PT Pesemes benar menggunakan aset Pemko Medan, yaitu Stadion PSMS/Kebun Bunga di Jl Candi Borubudur, Kel. Petisah Tengah, Kec. Medan Petisah, Kota Medan,” kata Raja, menerangkan isi surat. Raja mengaku tidak mengerti apa motif tim tersebut menggelar latihan di Stadion Kebun Bunga. Padahal klub tersebut kabarnya sudah berlatih di tempat yang lain. “Ya, ini kita serahkan saja sepenuhnya ke Pemko Medan, terpenting PSMS harus satu,” ujarnya. Saat dikonfirmasi, pelatih klub mengaku PSMS Medan, Kustiono, tidak banyak berkomentar soal alasan mereka menggelar latihan di Stadion Kebun Bunga. “Saya tidak bisa komentar, tanya saja sama manajemen,” ucap Kustiono, singkat. (m33/cat)

Menpora Segera Terbitkan Permen Selesaikan Konflik KONI-KOI JAKARTA (Waspada): Menteri Pemuda dan Olahraga, Roy Suryo (foto), berjanji segera menerbitkan Peraturan Menteri (Permen) baru sebagai solusi menyelesaikan konflik yang melanda dua lembaga olahraga tanah air, yakni KONI dan KOI. Menurutnya, penulisan draft Permen yang nantinya akan menjadi dasar dalam menghakhiri konflik antara KOI dan KONI, seperti yang saat ini tengah terjadi, sudah memasuki tahap akhir, sehingga dalam waktu dekat akan segera diumumkan. “Sebenarnya sudah hampir selesai. Memang ada sedikit keterlambatan. Sebab kami harus mengoreksi semua draft Permen agar tidak ada yang terlewatkan. Jangan sampai nantinya ada masalah baru muncul,” kata Roy kepada war-

tawan usai membuka Pocari Sweat Futsal Championship, di Kantor Kemenpora, Rabu (19/2). Ditambahkan, Permen yang segera diterbitkan nantinya bakal menjelaskan tugas dari KONI-KOI secara lebih detail. Maklum saja, karena selama ini Undang-Undang Sistem Keolahragaan Nasional (UU SKN) dan Peraturan Presiden, masih belum mampu meredam terjadinya ‘tabrakan’ antara KONI-KOI dalam menjalankan tugas dan fungsi masing-masing.

PRSI Berharap Tambahan Kuota JAKARTA (Waspada): Sekjen Persatuan Renang Seluruh Indonesia (PRSI), Made Suryadana, menegaskan pihaknya tengah berupaya mendapat tambahan kuota atlet yang akan diberangkatkan ke Asian Games Incheon, Korea, dari lima atlet menjadi sembilan. Menurut Made, sangat disayangkan sekiranya empat atlet PRSI yang tengah dipersiapkan sejak kembali dari SEA Games Myanmar, tidak diberangkatkan ke Asian Games. Padahal secara jenjang, keempat atlet tersebut sangat potensi medali. “Masih perlu satu sesi lagi dengan pemerintah terkait pendanaan Asian Games Incheon. Atlet yang diajukan ada sembilan, cuma hanya lima yang diakomodir oleh pemerintah melalu Prima,” kata Made, di sela-sela peluncuran program Master Swimming di Jakarta, Rabu (19/2). Ditambahkan, kelima atlet yang sudah mendapat persetujuan Prima, yakni Indra Gunawan, Saimen, Triadi Fauzi, Glen Victor, dan Raisa, terus menjalani persiapan di Bandung dan Jakarta. Hal yang sama dilakukan empat atlet lainnya yang terus digenjot latihan. Senada dengan itu, Ketua Umum PRSI, Sandiaga Uno, menegaskan pihaknya optimistis para perenangan Merah Putih bisa menyumbangkan medali di ajang multievent tingkat Asia nanti. Hanya saja, ia menolak menyebutkan jenis medali yang bisa dibawa pulang. “Target medali sudah pasti. Melihat performa anak-anak dalam pemusatan latihan, kami otimistis bisa membawa pulang medali. Kami ingin memecahkan sejarah merebut medali di Asian Games, setelah terakhir diperoleh pada 1990 silam,” tegas Sandiaga. Dukung Renang Master Pada bagin lain, orang nomor satu di PRSI ini menegaskan dukungannya terhadap peluncuran Renang Master yang digagas para praktisi renang tanah air. Hal tersebut untuk lebih memasyarakatkan olahraga aquatic, khususnya nomor renang di tanah air. “PRSI mendukung penuh peluncuran Renang Master. Sangat diharapkan program ini berjalan sesuai harapan, sehingga olahraga renang semakin digemari, meski usia perenang yang masuk kategori master adalah di atas 25 tahun ,” tandas Sandiaga. (yuslan)

“Memang banyak juga pihak menilai kalau Permen tidak perlu diterbitkan. Tapi, kami rasa itu sangat perlu. Pasalnya, kalau kita ingin membatasi tugas KONI-KOI lewat Undang-Undang, itu sangat tidak mungkin karena proses pembuatannya sangat lama,” tegas Roy, sembari mengatakan Permen nantinya akan mengatur kewenangan dan tugas antara KONI dan KOI, sehingga tidak akan ada lagi ‘tabrakan’ tugas untuk kedua institusi tersebut. Seperti diketahui, konflik

antara KONI-KOI muncul saat persiapan SEA Games Myanmar akhir tahun lalu. Saat itu,

Fauzi Atau Indra Sakti? Sabtu, Klub-klub Rapat MEDAN (Waspada): PSMS Medan pimpinan dr Muhammad Fauzi Nasution SpB, menyesalkan sikap Indra Sakti Harahap yang terus ngotot mempertahankan posisinya sebagai Ketua Umum PSMS, walau klub-klub anggota Ayam Kinantan telah menyabut mandatnya. Sekum PSMS, Julius Raja SE, Rabu (19/2), mengatakan dr Fauzi telah menghubungi Indra Sakti dan menyampaikan sikapnya yang siap menyerahkan jabatan Ketua Umum PSMS, jika memang klub-klub menghendaki itu. “Ketua Umum Fauzi tidak mau ribut-ribut, karena terpenting baginya adalah PSMS

satu. Kalau memang Indra Sakti Harahap sanggup mengelola PSMS, dia siap menyerahkannya, dengan catatan klub-klub juga masih menginginkan Indra Sakti,” kata Raja. Untuk itu, pihaknya akan mengumpulkan klub-klub anggota PSMS di Sekretariat Stadion Kebun Bunga Medan, Sabtu (22/2) nanti. Rapat akan menentukan sikap klub-klub, menginginkan dr Fauzi atau Indra Sakti sebagai ketua umum. Ditanya kemungkinan dalam pertemuan Sabtu nanti, klub-klub memihak ke Indra Sakti? Raja mengaku tidak ada masalah dan siap legowo. “Yang penting PSMS satu. Ka-

lau memang kita tidak disukai, kenapa harus bertahan? Sikap kami legowo saja,” tegasnya. Seperti diketahui, Indra Sakti tetap ngotot sebagai Ketua Umum PSMS. Bahkan Indra telah membentuk tim PSMS sendiri dan mulai berlatih pada Selasa (18/2) lalu, di Stadion Kebun Bunga Medan. Akibatnya, dalam Stadion Kebun Bunga ada dua tim yang berlatih. Pemandangan itu membuat penonton yang menyaksikan latihan M Affan Lubis cs, terkejut dan bertanyatanya mengapa masih dua tim PSMS? Padahal sebelumnya klub-klub anggota PSMS sudah sepakat hanya ada satu klub Ayam Kinantan. (m17)

FKPSSU Siapkan Tiga Tim Piala Ricky Yakobi MEDAN (Waspada): Forum Komunikasi Pelatih Sepakbola Sumatera Utara (FKPSSU) menyiapkan tiga tim sekaligus, dalam menghadapi turnamen U-10 dan U12 Piala Ricky Yacobi tahun 2014 di Lapangan Eks Mabes AU Pancoran, Jakarta, 29-30 Maret. “Pengiriman tiga tim ini sebagai upaya meningkatkan pembinaan, dengan menambah jam tanding pemain. Pemain yang memperkuat tiga tim dimaksud, merupakan siswa SSB anggota FKPSSU,” ujar Ketua FKPSSU, Legirin SPd,

TTS TOPIK

Problem Catur

Waspada/Yuslan Kisra

KONI-KOI selalu bertabrakan dalam menjalankan tugas dan fungsi masing-masing. Hal itu disebabkan karena tidak dipahaminya UU SKN dan Perpres yang ada secara utuh, sehingga keduanya pun saling klaim. “Dengan adanya Permen nanti, saya jamin tidak akan ada lagi overlap fungsi dan tugas masing-masing. Saya ingin selesaikan Permen ini secepatnya dan sesempurna mungkin, sehingga jangan sampai ada masalah yang terjadi di era kepemimpinan menteri berikutnya. Waktu saya tinggal lima bulan sebagai Menpora,” pungkas Roy. (yuslan)

Rabu (19/2). Dikatakan, pihaknya terus memantau perkembangan pemain SSB anggota FKPSSU. Tidak sekadar memantau, pihaknya juga berupaya membantu meningkatkan kualitas pembinaan dengan mengirimkan pemain dalam sejumlah kejuaraan tingkat provinsi maupun nasional. “Tiga tim yang akan kami kirim terdiri atas satu tim U10 dan dua tim U-12. Seluruh pemain merupakan hasil seleksi FKPSSU terhadap SSB anggota. Seleksi yang dipimpin trio pelatih Marzuki Hara-

hap, Iswandi, dan Suwarno, awalnya diikuti 75 pemain dan sudah dipangkas menjadi 45 pemain dipersiapkan ke Jakarta,” ujarnya. Sekretaris Tim Sumadi Jainal didampingi Manajer Tim H Eko Hariawan, mengatakan SSB yang telah mengirimkan pemain untuk diseleksi adalah SSB Sriwijaya, Harapan Bangsa, Garuda Putra, Waskita Jaya, Lokomotif, Pusaka Putra, Putra Mulia, Kenari Utama, Tunas Baru, dan SSB Postab. Rencanya, tim akan bertolak ke Jakarta pada 28 Maret. (m42)

Waspada/Sarmin Harahap

DEPUTI Pengembangan Pemuda Kemenpora, Drs Sakhyan Asmara MSP didampingi Plt Bupati Madina Dahlan Hasan Nasution, meninjau Stadion Madina, Rabu (19/2).

Sakhyan Tinjau Stadion Madina PANYABUNGAN (Waspada): Menteri Pemuda dan Olahraga (Menpora) diwakili Deputi Pengembangan Pemuda, Drs H Sakhyan Asmara MSP didampingi Plt Bupati Madina Drs Dahlan Hasan Nasution, meninjau langsung pembangunan Stadion Madina, Rabu (19/2). Stadion bertaraf internasional itu, terletak di Padang Harapan, Desa Sarak Matua, Kecamatan Panyabungan Utara, Kabupaten Mandailing Nata. Peninjaun itu sebagai tindak lanjut pihak Kemenpora menjadikan 2014 sebagai tahun kebangkitan olahraga di Indonesia, khususnya di Madina. “Kemenpora berharap dukungan semua pihak dalam rangka peningkatan olahraga yang memiliki peranan penting dalam menciptakan masyarakat yang sehat dan SDM andal,” ujar Sakhyan Asmara. Dijelaskan, tahun kebangkitan olahraga secara nasional tidak saja membutuhkan pembangunan sarana fisik, tetapi juga peningkatan pembangunan di bidang SDM, termasuk mengadakan diklat dan pelatihan kepada atlet, juri, wasit, dan instrumen olahraga lainnya. Khusus Stadion Madina, Sakhyan berjanji akan memperjuangkan anggaran untuk peningkatan pembangunan stadion tersebut, karena hingga saat ini pembangunannya belum selesai, karena terkendala pendanaan.

OLAHRA GA OLAHRAGA

8

7

6

5

4

3

2

1

A

B

C

D

E

F

G

H

ma bekerja keras,” ucap Sakhyan. Kelanjutan pembangunan Stadion Madina yang awal pembangunannya diresmikan langsung Menpora yang saat itu masih dijabat Adhyaksa Dault tahun 2007, sangat diharapkan masyarakat Madina. Karenanya, dana bantuan dari pemerintah melalui Kemenpora sangat diharapkan untuk penyelesaian pembangunan stadion tersebut. (c14)

Sudoku

Putih melangkah, mematikan lawannya tiga langkah.

Jawaban di halaman A2.

Sakhyan optimis peningkatan olahraga di Madina bisa tercapai, karena Bupati Madina, Dahlan Hasan Nasution, juga seorang pejabat negara yang dulu dikenal turut berjuang untuk pengembangan olahraga di Sumatera Utara. “Dahlan Hasan ini sahabat dekat saya waktu sama-sama menjabat di Pemprov Sumatera Utara. Karena itu, saya optimis kebangkitan olahraga di Madina ini akan tercapai. Makanya kita harus sama-sa-

MENDATAR

MENURUN

1. Olahraga yang diurus Perbasi. 4. Pukulan dalam tinju. 6. Olahraga bola dua regu, dipisah net dan bola tidak boleh jatuh ke lantai. 7. Produsen mobil balap Formula-1. 9. Kelompok pemain dalam olahraga. 10. Gerak badan diatas kolam dengan menggunakan tangan dan kaki. 12. Pukulan dalam tinju selain jab. 14. Benda bulat yang dipukul atau ditendang dalam pertandingan beberapa cabang olahraga. 15. Tunggal; Sendiri. 17. Didier——, mantan bomber klub sepakbola Chelsea. 19. World Boxing Association. 20. Burung pemangsa yang sering dipakai untuk nama klub olahraga. 22. Balap. 23. Klub sepak bola Inggris. 24. Perserikatan (sepak bola bayaran). 25. Lompat; ——Indah, hanya ada dalam olahraga renang. 26. Klub sepak bola Spanyol, kota wisata pantai.

1. Kota ada istana presiden di Jawa Barat, punya klub sepak bola PSB. 2. Sepeda (Inggris). 3. Tidak menang, tidak seri. 4. Klub sepak bola Italia dijuluki “Nyonya Tua”. 5. Olahraga menggelindingkan bola besar untuk merobohkan sejumlah gada/pin. 7. Cabang olahraga sepakbola di lapangan yang jauh lebih kecil. 8. Nama pesepak bola naturalisasi Indonesia yang muncul dalam iklan tv (dua suku kata, tulis tanpa spasi). 11. Alfred——, pelatih sepakbola Indonesia asal Austria. 13. Grup (Inggris). 14. Bisbol (Inggris)l. 16. Gerak badan untuk menguatkan dan menyehatkan tubuh, seperti sepakbola dll. 18. Peluang; Kesempatan. 19. Woman (Indonesia). 21. Dobel.

Isi dengan angka 1 sampai 9. Tidak boleh ada pengulangan angka mendatar, menurun, maupun di kotak 3x3 bergaris tebal. Tingkat kesulitan: sulit (****), bisa diselesaikan kurang dari 15 menit. Jawabannya di halaman A2 kolom 1.

2 7 3 4 3 6 5 1 1 4

8 7 3 9 4 4

4 7 6 5 3 7

3 1

5 1 8 9 3 7 8 6 ****232


Sport

A12

WASPADA Kamis 20 Februari 2014

Pacers Perkasa Di Kandang INDIANAPOLIS, AS (Waspada): Setelah istirahat usai menjalani partai All-Star, kompetisi NBA kembali bergulir, di mana klub Indiana Pacers berhasil menyudahi perlawanan Atlanta Hawks dengan skor 108-98, dalam laga di Indianapolis, AS, Rabu (19/2). Keperkasaan Pacers didapat berkat permainan gemilang Paul George. Forward All-Star ini

mencatat angka tertinggi untuk timnya dengan mengemas 26 poin, termasuk empat kali lem-

paran tiga angka yang dibuatnya pada pertandingan ini. George mendapatkan bantuan dari David West yang membuat 17 angka. Penampilan cemerlang diperlihatkan Kyle Korver yang membuat 19 poin. Sayangnya, aksi Korver tidak membantu Hawks terhindar dari kekalahan enam kali beruntun. Pemain tim tamu, Lou Williams menambah dengan membuat 18 poin. Hawks terus memberikan perlawanan sepanjang pertan-

dingan. Setelah sempat tertinggal 19 poin dari Pacers di kuarter ketiga, Hawks mencetak tujuh poin beruntun yang dihasilkan oleh lemparan tiga angka dari Korver, dua tembakan bebas Jeff Teague, dan dua kali tembakan bebas Williams, mengubah skor menjadi 75-63. Namun, Pacers berhasil meninggalkan perolehan poin Hawks ketika Ian Mahinmi mengonversikan tiga poin, ditambah tembakan tiga angka dari Danny Granger semakin memperlebar keunggulan Pacers

Marquez Dan Pedrosa Sambangi Jakarta

AP

FORWARD Indiana Pacers, Paul George (24) melakukan dunk untuk membuat poin di laga lanjutan NBA di Indianapolis, Rabu (19/2). Pacers menang 108-98.

Serena Sempat Frustasi DUBAI, UEA (Waspada): Petenis putrid nomor satu dunia, Serena Williams berhasil memenangi pertandingan pertama di Dubai Open. Petenis nomor satu dunia itu berhasil menyudahi perlawanan Ekaterina Makarova 7-6 (10/8), 6-0 dalam laga di Dubai, Rabu (19/2). Namun, Serena yang mendapatkan wild card di turnamen ini, sempat merasa frustasi karena mendapatkan perlawanan dari Makarova pada awal set pertama. Beruntung, dia berhasil menyudahi perlawanan petenis nomor 24 dunia itu lewat tie break 7-6 (10/8). Setelah menang di set pertama, Serena bermain semakin lebih baik pada set berikutnya. Dia sama sekali tidak memberikan kesempatan kepada Makarova untuk mengembangkan permainan. Serena memenangkan pertandingan dengan skor mudah 6-0 “Itu merupakan sebuah pertandingan sulit di babak pertama dan saya sedikit frustrasi. Saya sudah berlatih dan itu sama sekali tidak terlihat,” kata adik kandung Venus Williams itu, diberitakan ABS-CBN. “Saya membuat banyak kesalahan yang biasanya tidak saya lakukan dan servis saya tidak bagus. Tapi, saya berusaha untuk berpikir positif dan set kedua berjalan lebih baik. Badan terasa lebih baik,” lanjutnya. (abs/m47)

JAKARTA (Waspada): Dua pebalap Repsol Honda, Marc Marquez dan Dani Pedrosa akan menyambangi Jakarta, pekan depan untuk menemui fans di Tanah Air. “Senang bisa datang ke Indonesia pekan depan. Ini akan menjadi pertama kali untuk saya dan saya senang bisa menemui fans di sana,” demikian pengumuman Marquez lewat akun Twitter, @marcmarquez93, Rabu (19/2). Nama Marquez memang mulai mencuat pada musim lalu. Meski melakoni sebagai

pembalap debutan, Marquez berhasil menjadi juara dunia dengan merebut gelar dari tangan rivalnya, rider Yamaha Jorge Lorenzo. Selain Marquez, Pedrosa juga sudah tidak sabar untuk menemui kembali fansnya yang ada di Indonesia. “Pada 1 Maret, saya akan berada di Jakarta untuk menemui fans saya,” lanjut Pedrosa. Ini kedua kali Pedrosa pernah menyambangi Jakarta. Sebelumnya, dia pernah ke tanah air pada musim 2010. (oz/m47)

Net

Marc Marquez (kiri) dan Dani Pedrosa.

Kemenangan Warnai Comeback Nadal RIO DE JANEIRO, Brazil (Waspada): Petenis putra nomor satu dunia Rafael Nadal memperlihatkan cedera yang dialaminya sudah sembuh. Nadal berhasil meraih kemenangan atas Daniel GimenoTraver dengan skor 6-3, 7-5 pada babak pertama di Rio Open di Rio de Janeiro, Brazil, Rabu (19/2). Ini merupakan pertandingan pertama (cameback) Nadal (Foto) sejak menelan kekalahan melawan StanislasWawrinka di final Australia Open 2014, tiga pekan lalu. Partai melawan Gimeno-Traver memang mengunggulkan Nadal untuk menang. Petenis asal Spanyol itu mengalami cedera punggung

AP

setelah pertandingan di partai puncak Australia Open itu. Praktis, muncul pertanyaan

mengenai kesehatannya pada awal musim ini. Tahun lalu, Nadal baru sembuh dari cedera

Pacquiao Harus KO Bradley

AP

SERENA Williams mengembalikan bola lawannya Ekaterina Makarova di ronde kedua turnamen Dubai Duty Free di Dubai, UEA, Rabu (19/2).

LAS VEGAS, AS (Waspada): Juara dunia tinju asal Filipina, Manny Pacquiao, diklaim harus meraih kemenangan KO atas Timothy Bradley pada pertarungan kelas welter WBO di MGM Grand, Las Vegas, AS, 12 April mendatang. Kemenangan KO akan menyelamatkan karier Pacman. Untuk kali kedua Pacquiao akan menghadapi Bradley. Sebelumnya, pada pertarungan Juni 2012, Pacquiao dikalahkan petinju asal Amerika Serikat itu dan kehilangan gelar juara dunia kelas welterWBO lewat hasil yang controversial. Penasihat Pacquiao, Mi-

chael Koncz, mengatakan, petinju 35 tahun itu harus kembali menunjukkan penampilan garangnya saat melawan Bradley. Koncz yakin kemenangan angka atas Bradley tidak akan meningkatkan pamor Pacquiao, yang menurun drastis dalam dua tahun terakhir. “Hasil 12 ronde tidak akan membantu karier Pacquiao. Jika keputusan 12 ronde, maka sudah saatnya kita harus duduk bersama dan mendiskusikan apa yang diinginkan Pacquiao di dunia tinju. Dia harus menang KO,” ujar Koncz. Tugas berat bagi Pacquiao

untuk bisa meraih kemenangan KO atas Bradley, yang tidak pernah kalah dari 32 pertarungan. Kali terakhir Pacman menang KO di atas ring tinju adalah ketika melawan Miguel Cotto pada November 2009. “Saya pikir kami masih harus membuktikan kepada dunia kalau Pacquiao masih ada, seperti yang dia tunjukkan 5 tahun lalu. Ya, dia semakin tua dan semakin pintar. Petarung pintar adalah yang tidak membuang banyak tenaga. Tapi, saya masih ingin Pacquiao menang KO atas Bradley,” tegas Koncz. (bsc/m47)

lutut yang membuatnya absen cukup lama. “Daniel adalah pemain spesialis di lapangan tanah liat, jadi buat saya ini menjadi sebuah pertandingan hebat setelah menjalani masa istirahat setelah pertandingan final di Australia karena masalah cedera punggung. Saya berlatih sedikit. Jadi saya senang bisa kembali dan meraih kemenangan,” kata Nadal. Nadal memiliki rekor yang sangat cemerlang bila bermain di kandang dengan rekor 294 kali menang dan 21 kali kalah. Tak heran, dia sering disebut sebagai The King of Clay atau Raja Lapangan Tanah Liat. Permainan Nadal mendapatkan pujian dari Fabio Fognini. “Untuk Rio, masyarakat di Brasil dan semua orang sangat menyenangkan karena Nadal adalah petenis nomor satu dunia. Untuk turnamen ini khususnya, karena ini merupakan tahun pertama, jadi saya rasa cukup membantu,” ujar Fognini, mengenai Nadal, Rabu (19/2). Selain Nadal, David Ferrer juga berhasil mencatat kemenangan. Petenis asal Spanyol itu berhasil menumbangkan Jeremy Chardy dengan skor 62 6-3. (anb/m47)

Hasil lengkap Atlanta – Indiana Cleveland – Philadelphia Toronto – Washington Charlotte – Detroit Orlando – Milwaukee New York – Memphis Miami – Dallas Phoenix – Denver San Antonio -LA Clippers menjadi 101-82, akhirnya tuan rumah menutup pertandingan dengan kemenangan. Sementara di Dallas, LeBron James membuktikan kapasitasnya sebagai pemain jempolan dengan membawa Miami Heat mempermalukan Dallas Mavericks 117-106. Kiprah King James, julukannya, tidak terbendung oleh pemain bertahan tuan rumah. Mantan pemain Cleveland Cavaliers tersebut menghasilkan 42 poin, sembilan rebound dan lima assist di markas Mavericks. Kemenangan ini sekaligus merupakan yang ketiga secara beruntun atas Mavericks di musim ini. Terakhir Heat ka-

98 – 108 114 – 85 103 – 93 108 – 96 100 – 104 93 – 98 117 – 106 112 – 107 113 – 103 lah dari Mavs adalah pada final NBA musim 2011. Pelatih Mavs, Rick Carlisle memuji performa James. “James adalah pemain hebat dan kami tahu dia sangat jago. Dia mampu mencetak banyak poin saat melawan kami terakhir kali dan dia bahkan lebih baik malam ini,” ujar Carlisle. James ikut meramaikan pertandingan All-Star Selasa (18/ 2). Meski demikian, dia sama sekali tidak terlihat kelelahan ketika berlaga di lapangan membela bendera Heat. “Saya masih kelelahan. Tapi ketika saya berada di lapangan, saya harus mencoba membuat semuanya ter-wujud,” kata James. (esp/m47)

Hamilton Tak Masalah Regulasi Baru SAKHIR, Bahrain (Waspada): Adanya regulasi baru di F1 tahun ini, mengenai pembatasan bahan bakar sebagai program hemat energi, dikhawatirkan akan membuat banyak pebalap ragu untuk menginjak penuh gas kendaraannya. Namun, pebalap Mercedes, Lewis Hamilton (Foto), diperkirakan tidak akan mengalami hal serupa. Menurut ketua tim teknis Mercedes, Net Paddy Lowe, driver asal Inggris itu, telah banyak beradaptasi dengan program hemat energi tersebut di tahun-tahun sebelumnya. Meski Hamilton berulang kali memperlihatkan rasa frustasinya atas pembatasan tersebut, namun Lowe yakin pria berusia 29 tahun itu dapat mengatasinya. “Saya rasa kalian terlalu melebih-lebihkan aspek tersebut (pembatasan bahan bakar). Jelas, pembatasan tersebut menjadi sebuah kendala saat bertanding. Namun saya harap, kami tidak melihatnya sebagai kendala utama,” ucap Lowe, Rabu (19/2). “Ada beberapa kesempatan di tahun lalu, di mana aspek ini menghentikan seorang pembalap, dan Lewis (Hamilton). Contohnya, membatasi diri di tiap putaran, dan terkadang sangat membuatnya frustasi. Namun sesungguhnya, hal tersebut menjadi kasus dalam Formula One bertahun-tahun, yang berhubungan dengan pengaturan bahan bakar dan ban kendaraan,” sambungnya. Pembatasan bahan bakar di musim 2014 ini, yakni 100kg bahan bakar per satu kali balapan. Berikutnya, di Sakhir, Bahrain, Hamilton akan kembali mengetes mobil baru Mercedes, untuk kemudian bergantian dengan pembalap kedua, Nico Rosberg. (aus/m47)


Sport

A12

WASPADA Kamis 20 Februari 2014

Mimpi Buruk Red Bull SAKHIR, Bahrain (Waspada): Mimpi buruk di tes pramusim Formula One (F1) 2014 di Jerez belum berakhir bagi Red Bull Racing. Pada hari pertama ujicoba di Sirkuit Sakhir, Bahrain, Rabu (19/2), RB10 milik Red Bull lagi-lagi bermasalah. Kali ini, juara dunia Sebastian Vettel ketiban sial. Setelah menyelesaikan total 21 lap di Jerez, Red Bull sepertinya be-

lum melakukan pembenahan maksimal jelang tes di Sakhir. Terbukti, Vettel langsung terhenti di putaran pertama kala

mobilnya mengeluarkan asap. Di sisi lain, tim-tim F1 lain terus menjalani sesi ujicoba dengan baik. Lewis Hamilton menjadi peserta tercepat di sesi pagi. Pebalap Mercedes asal Inggris ini mencatat 1 menit 39,153 detik. Posisi runner-up ditempati rookie McLaren asal Denmark, Kevin Magnussen. Dalam 14

putaran pertamanya, Magnussen mencatat waktu 1:39.224. Tempat ketiga ada Nico Hulkenberg (Force India) dengan waktu 1:39.292 disusul Adrian Sutil (Sauber) dan Fernando Alonso (Ferrari). Sayangnya, Hamilton gagal mengulangi suksesnya di sesi sore hari. Di sini, giliran Hulkenberg menjadi pebalap tercepat. Usai melahap 78 lap, Hulkenberg menutup hari pertama dengan waktu terbaik 1:36.880. Hamilton sendiri harus puas turun dengan posisi ketiga, tepat di belakang Alonso yang memperbaiki catatan waktunya. Gagal di pagi hari, Vettel bangkit dan menempati peringkat lima dengan waktu 1:40,224 hasil menjajal 14 lap. Pebalap Jerman ini masih

kalah dari Magnussen. Tes hari pertama di Sakhir juga ditandai debut Romain Grosjean mengemudi Lotus E22. Sebelumnya, mobil teranyar Lotus tersebut diperkenalkan kepada publik di Sirkuit Jerez, Spanyol. Namun, kubu Lotus memilih absen di sesi perdana itu. Praktis, ini menjadi yang pertama kali Lotus menjajal mobil E22. Hasil tes sesi pagi memang belum memuaskan untuk Grosjean. Pebalap asal Prancis itu hanya mampu mencatat waktu 1 menit 44.832 detik. Pada hari kedua, Grosjean kembali akan menjajal mobil E22 milik Lotus dan Pastor Maldonado merasakan kemudi pada dua hari berikutnya. (m33/auto)

Hasil Tes Rabu (19/2)

f1live

SEBASTIAN Vettel terpaksa memadamkan asap yang keluar dari mobil RB10 saat melakoni tes pramusim F1 di Sirkuit Sakhir, Bahrain, Rabu (19/2).

Nico Hulkenberg Fernando Alonso Lewis Hamilton Kevin Magnussen Sebastian Vettel Adrian Sutil Robin Frijns Daniil Kvyat Romain Grosjean Felipe Massa Jules Bianchi

Jerman/Force India Spain/Ferrari Inggris/Mercedes Denmark/McLaren Jerman/Red Bull Jerman/Sauber Belanda/Caterham Rusia/Toro Rosso Prancis/Lotus Brazil/Williams Prancis/Marussia

1:36.880 (78 lap) 1:37.879 (64) 1:37.908 (74) 1:38.295 (81) 1:40.224 (14) 1:40.443 (82) 1:42.534 (68) 1:44.346 (5) 1:44.832 (8) - (5) - (3)

LeBron Cs Lanjut Fokus DALLAS, AS (Waspada): LeBron James lagi-lagi membuktikan kapasitasnya sebagai bintang NBA. Melawan Dallas Mavericks dalam lanjutan kompetisi pasca-All Star Weekend 2014, Rabu (19/2), Miami Heat menang 117-106. Penampilan LeBron yang biasa dijuluki King James tidak terbendung oleh pemain bertahan tuan rumah. Mantan bintang Cleveland Cavaliers tersebut menghasilkan 42 poin sembilan rebound, dan lima assist. Kemenangan ini sekaligus merupakan ketiga beruntun atas Mavericks musim ini. Terakhir, Heat kalah dari Mavs yang mengandalkan Dirk Nowitzki terjadi pad final NBA 2011. Atas penampilan gemilangnya, Rick Carlisle memuji performa LeBron. “LeBron adalah pemain hebat dan kami tahu dia sangat jago. Dia mampu mencetak banyak poin saat melawan kami terakhir kali dan dia bahkan lebih baik malam ini,” ujar Pelatih Mavericks itu. Padahal, LeBron dan sejumlah bintang lain baru meramaikan pekan NBA All-Star pekan lalu di New Orleans. Meski begitu, anggota skuad Timnas AS itu sama sekali tidak terlihat kelelahan membela Heat kontra Mavs.

“Saya masih kelelahan. Tapi ketika saya berada di lapangan, saya harus berusaha membuat semuanya terwujud,” kata LeBron santai. Tim elite Wilayah Timur lainnya juga menuai sukses serupa, yakni Indiana Pacers. Dimotori Paul George dan David West, Pacers menyudahi perl a w a n a n A t l a n t a Ha w k s 108-98. Pacers menang berkat permainan gemilang George. Forward All-Star ini mencatat angka tertinggi untuk timnya dengan 26 poin, termasuk empat three point. George mendapatkan bantuan dari West yang mendonasi 17 angka. Di Wilayah Barat, San Antonio Spurs memenangi pertarungan sengit melawan LA Clippers. Spurs mengatasi Chris Paul cs dengan hasil akhir 113-103. Marco Belinelli yang menjadi jawara three point NBA All Star 2014 memimpin Spurs dengan koleksi 20 poin. Namun top skor Spurs disandang Patrick Mills yang mencetak total 25 angka. Dari Clippers, duet Chris Paul dan Blake Griffin tetap produktif. Bila Paul mendulang 11 poin sembilan assist, maka Griffin mengumpulkan 35 angka 12 rebound. (m33/ap)

Hasil Rabu (19/2) Indiana v Atlanta Cleveland v Philadelphia Toronto v Washington Charlotte v Detroit Memphis v NY Knicks Milwaukee v Orlando Miami Heat v Dallas Phoenix v Denver San Antonio v LA Clippers

108-98 114-85 103-93 108-96 98-93 104-100 117-106 112-107 113-103

AP

BEK Giorgio Chiellini (2 kiri) mengharapkan rekan-rekannya di Juventus menikmati pengalaman mentas di Liga Europa.

Juventus Stadium Jadi Senjata R O M A (Waspada): Bek sentral Giorgio Chiellini optimis, magis Juventus Stadium bisa menjadi senjata mematikan bagi para tamu Super Juve musim ini di UEFA Europe League. Terutama bagi klub Turki, Trabzonspor, yang menjadi lawan The Old Lady pada leg pertama babak 32 besar dinihari WIB nanti di Turin. “Juventus Stadium akan menjadi senjata bagi kami. Sebab, suasana yang tercipta di markas kami akan membuat para lawan merasa takut,” klaim Chiellini melalui Football Italia, Rabu (19/2). Bianconeri harus berlaga di kompetisi kasta kedua Eropa ini, setelah hanya menduduki peringkat tiga di klasemen grup babak penyisihan Liga Champions. Kans Nyonya Tua menjadi jawara sangat besar, mengingat kualitas para saingan secara rata-rata masih di bawah kontestan Liga Champions. Apalagi partai final bulan Mei mendatang, dilangsungkan di Juventus Stadium. Karenanya Chiellini berharap, rekan-rekannya tampil serius sekaligus menikmati pengalaman mentas di kompetisi

antar klub yang dulunya bernama UEFA Cup tersebut. Hanya sayangnya, bek Italia berusia 29 tahun itu belum bisa main menjamu Trabzonspor, karena mengalami cedera betis. Begitu pula tandemnya di jantung pertahanan Juve, Andrea Barzagli. “Betis ini terasa lebih baik, untungnya itu bukan cedera serius. Saya akan mencoba untuk memulihkan sesegera mungkin, karena kami memiliki banyak pertandingan penting selama beberapa pekan ke depan,” tekad Chiellini. Napoli Sulit Sama seperti Super Juve, Napoli sebagai rivalnya dalam perburuan scudetto Liga Seri A, pun berusaha menikmati kesempatan mentas di UEFA Europe League. Allenatore Rafael Benitez bahkan sangat serius meracik strategi untuk memenangi laga dinihari WIB nanti di markas Swansea City, Liberty Stadium. “Tentu saja laga nanti akan sangat sulit. Swansea menampilkan sepakbola bagus dan tidak akan membiarkan kami berlama-lama menguasai bola,” beber Benitez. Mantan manajer Chelsea dan Liverpool ini tahu persis karakter tak pernah menyerah The Swans, yang tampil di are-

Europa League Malam Ini (GMT) 17:00 18:00 18:00 18:00 18:00 18:00 18:00 18:00 20:05 20:05 20:05 20:05 20:05 20:05 20:05 20:05

Anzhi Makhachkala v Genk Chornomorets v Lyon Dnipropetrovsk v Tottenham Dynamo Kiev v Valencia Esbjerg v Fiorentina Juventus v Trabzonspor Liberec v AZ Alkmaar PAOK Salonika v Benfica Ajax Amsterdam v Salzburg Porto v Eintracht Frankfurt Lazio v Ludogorets Razgrad Maccabi Tel-Aviv v Basel NK Maribor v Sevilla Real Betis v Rubin Kazan Swansea City v Napoli Viktoria Plzen v Shakhtar

na ini sebagai jawara Piala FA. Kegundahan Benitez kian kuat, karena penyerang andalannya, Gonzalo Higuain, mengalami cedera saat Napoli mengatasi Sassuolo 2-0 akhir pekan lalu di Seri A. “Higuain mengalami cedera di punggungnya dan kami akan mengevaluasi kondisinya. Saya belum bisa memastikan apakah dia akan main melawan Swansea,” papar pelatih asal Spanyol itu. Selain Higuain, I Partenopei juga belum dapat memastikan partisipasi dan penjaga gawang Pepe Reina, yang masih bergelut dengan cedera lutut. (m15/goal/fi/uefa)

Radwanska Tampil Antiklimaks

AP

BINTANG Miami Heat LeBron James (6) tak terhadang menembus pertahanan Dallas Mavericks dalam lanjutan kompetisi NBA, Rabu (19/2).

Duet Honda Datang Pekan Depan JAKARTA (Waspada): Dua pebalap andalan Repsol Honda, Marc Marquez (foto kanan) dan Dani Pedrosa (foto kiri), akan menyambangi Jakarta, pekan depan. Kedua rider asal Negeri Matador itu dipastikan hadir menemui fansnya di tanah air. Setelah kedatangan Jorge Lorenzo dan Valentino Rossi dari tim Yamaha, para penggemar balapan MotoGP di Indonesia kembali akan kedatangan pebalap dunia. Kali ini, giliran Marquez dan Pedrosa yang mendapatkan kesempatan menemui fansnya di Jakarta. “Senang bisa datang ke Indonesia pekan depan. Ini akan menjadi pertama kali untuk saya dan saya senang bisa menemui fans di sana,” demikian pengumuman Marquez lewat akun Twitter, @marcmarquez93, Rabu (19/2). Nama Marquez memang mulai mencuat pada musim lalu. Meski melakoni sebagai pebalap debutan alias rookie, Marquez berhasil menjadi juara dunia dengan merebut gelar dari

motogp

tangan rivalnya, Lorenzo. Selain Marquez, Pedrosa juga sudah tidak sabar untuk menemui kembali fansnya di Indonesia. “Pada 1 Maret, saya akan berada di Jakarta untuk menemui fans saya,” lanjut Pedrosa. Bagi Pedrosa, kedatangannya ke Indonesia merupakan yang kedua kali. Sebelumnya, Pedrosa pernah datang menjumpai penggemar fanatiknya pada musim 2010. (m33/mgp)

DUBAI (Waspada): Unggulan kedua Agnieszka Radwanska (foto) secara tak terduga langsung tersingkir dari ajang Dubai Tennis Championships, Rabu (19/2). Petenis Polanda itu disingkirkan Flavia Pennetta (Italia) di babak kedua. Radwanska, juara Dubai 2012 lalu, dikalahkan Pennetta yang lolos dari babak kualifikasi 4-6, 1-6. Pekan lalu, Radwanska juga tersingkir saat baru menapak babak kedua Qatar Terbuka di Doha. Sebenarnya, Aga sempat unggul 4-1 di set pertama, tetapi kemudian kehilangan enam game beruntun dan menyerah 4-6. Di set kedua, petenis terbaik Polandia itu juga langsung tertinggal 0-3 sebelum menyerah 1-6. Di perempatfinal, Pennetta akan menghadapi Venus Williams. Petenis veteran asal Amerika Serikat (AS) ini menundukkan Ana Ivanovic (Ser-

bia) 6-2, 6-1. Adik kandung Venus, Serena, juga mendampingi ke babak delapan besar. Namun, Serena sempat dibuat kewalahan oleh Ekaterina Makarova (Rusia). Beruntung, Serena berhasil menyudahi perlawanan petenis nomor 24 dunia itu lewat tiebreak 10-8. Setelah memenangi set pertama, Serena bermain lebih stabil pada set berikutnya dengan sama sekali tidak memberikan kesempatan kepada Makarova mengembangkan permainan. Serena pun memenangkan pertandingan 6-0. “Itu merupakan sebuah pertandingan sulit di babak pertama dan saya sedikit frustrasi. Saya sudah berlatih dan itu sama sekali tidak terlihat,” kata Serena. “Saya membuat banyak kesalahan yang biasanya tidak saya lakukan dan servis saya tidak bagus. Tapi, saya berusaha untuk berpikir positif dan

AP

set kedua berjalan lebih baik. Badan terasa lebih baik,” tutup ratu tenis dunia tersebut. (m33/ap)


Sumatera Utara

WASPADA Kamis 20 Februari 2014

Kota Medan B. Aceh Binjai Bireuen B. Pidie G. Sitoli K. Jahe Kisaran Kutacane Langsa

Zhuhur 12:41 12:54 12:42 12:49 12:48 12:45 12:42 12:37 12:44 12:44

‘Ashar 16:01 16:15 16:01 16:09 16:08 16:04 16:01 15:57 16:04 16:04

Magrib 18:42 18:54 18:43 18:48 18:48 18:48 18:43 18:39 18:45 18:44

‘Isya

Imsak

Shubuh Syuruq

Kota

19:52 20:03 19:52 19:58 19:58 19:58 19:53 19:48 19:55 19:54

05:12 05:27 05:13 05:21 05:20 05:14 05:12 05:08 05:15 05:16

05:22 05:37 05:23 05:31 05:30 05:24 05:22 05:18 05:25 05:26

L.Seumawe 12:47 L. Pakam 12:40 Sei Rampah12:39 Meulaboh 12:51 P.Sidimpuan12:39 P. Siantar 12:39 Balige 12:39 R. Prapat 12:36 Sabang 12:54 Pandan 12:41

06:38 06:53 06:39 06:47 06:46 06:40 06:38 06:34 06:41 06:41

Zhuhur ‘Ashar 16:07 16:00 15:59 16:11 15:57 15:59 15:58 15:55 16:14 15:59

B1

Magrib

‘Isya

Imsak

Shubuh Syuruq

Kota

Zhuhur ‘Ashar

Magrib

‘Isya

Imsak

Shubuh Syuruq

Kota

Zhuhur

‘Ashar

Magrib

‘Isya

Imsak

Shubuh Syuruq

18:47 18:41 18:40 18:52 18:41 18:41 18:41 18:38 18:53 18:43

19:56 19:51 19:50 20:01 19:51 19:51 19:51 19:48 20:03 19:53

05:19 05:11 05:11 05:23 05:08 05:10 05:10 05:06 05:27 05:10

05:29 05:21 05:21 05:33 05:18 05:20 05:20 05:16 05:37 05:20

Sibolga Sidikalang Sigli Singkil Stabat Takengon T.Balai Tapaktuan Tarutung T.Tinggi

12:40 12:42 12:52 12:45 12:42 12:48 12:37 12:47 12:40 12:39

18:43 18:44 18:51 18:47 18:42 18:48 18:38 18:48 18:42 18:40

19:53 19:53 20:01 19:56 19:52 19:58 19:48 19:58 19:52 19:50

05:10 05:12 05:24 05:15 05:13 05:20 05:07 05:18 05:10 05:10

05:20 05:22 05:34 05:25 05:23 05:30 05:17 05:28 05:20 05:20

Panyabungan Teluk Dalam Salak Limapuluh Parapat GunungTua Sibuhuan Lhoksukon D.Sanggul Kotapinang AekKanopan

12:37 12:44 12:42 12:38 12:40 12:37 12:37 12:46 12:41 12:35 12:37

15:56 16:02 16:01 15:57 15:59 15:56 15:55 16:07 16:00 15:54 15:56

18:41 18:48 18:44 18:39 18:42 18:40 18:40 18:46 18:43 18:38 18:39

19:50 19:58 19:54 19:49 19:51 19:49 19:49 19:56 19:52 19:47 19:48

05:06 05:13 05:13 05:09 05:10 05:07 05:06 05:19 05:11 05:05 05:07

05:16 05:23 05:23 05:19 05:20 05:17 05:16 05:29 05:21 05:15 05:17

06:45 06:37 06:36 06:48 06:34 06:36 06:35 06:32 06:53 06:36

15:59 16:01 16:12 16:04 16:01 16:08 15:56 16:06 15:59 16:59

Dihisab oleh: Tim Ahli Badan Hisab dan Rukyat (BHR) Sumut

06:36 06:38 06:50 06:40 06:38 06:46 06:33 06:43 06:35 06:36

06:32 06:39 06:38 06:34 06:36 06:32 06:31 06:45 06:36 06:31 06:33

SPORC TNGL Tembak Seorang Warga LANGKAT (Waspada): Dedy, 30, warga Amandamai, Kec. Sei Lepan tertembak senjata api laras panjang jenis PM 1A1 milik petugas Satuan Polisi Reaksi Cepat (SPORC) di kawasan Damarhitam, Resort Sei Lepan, SPTNWilayahVI, Rabu (19/2). Korban dievakuasi ke Rumah Sakit Tanjungselamat, Kec. Padangtualang untuk perawatan akibatlukatembakpadapangkalpahamenembus pantat kiri. Belum diperoleh penjelasan resmi terkait kronologis insiden ini, sebab pihak Balai BesarTaman Nasional Gunung Leuser (BBTNGL) sendiri mengaku belum mendapat informasi detail. Kepala Seksi Pemolaan Taman Nasional (SPTN)WilayahVITNGL,TR.Tarigan,dikonfirmasi Waspada mengatakan, pasca insiden keenam petugas berupaya menyelamatkan diri ke hutan karena seluruh akses jalan ke luar diblokir perambah. Dia menyatakan belum mengetahui secara pasti apakah warga itu tertembak karena melakukan perlawanan yang mengancam keselamatan petugas. “Biasanya petugas Polhut atau SPORC tidak pernah melepaskan tembakan,” katanya.

Waspada/Khairul K Siregar

PETUGAS Polres Deliserdang berusaha membubarkan massa mengatasnamakan Forum Rakyat Bersatu (FRB) saat akan melakukan aksi demo di Bandara KNIA, di kawasan Desa Tanjung Sari Batangkuis.

Akan Demo Ke Bandara KNIA 29 Massa FRB Diamankan Polisi BATANGKUIS (Waspada): 29 Orang massa yang tergabung dalam Forum Rakyat Bersatu (FRB) diamankan polisi dari tempat berbeda saat akan mengadakan aksi demo menuju Bandara Kualanamu Internasional (KNIA). Kapolres Deliserdang AKBP Dicky Patrianegara, S.Ik, SH, M.Si didampingi Kasat Reskrim Polres Deliserdang AKP Arifin Fahreza, SH dan Kapolsek Batangkuis AKP S. Simaremare menjelaskan itu, Rabu (19/2) di Mapolsek Batangkuis kepada wartawan. Dikatakan Kapolres, pada Rabu (19/2) dinihari sejumlah massa tergabung dalam FRB datangdariLangkatmengendarai 4 bus dan menginap di rumah salah satu warga di Desa Sena. Kedatangan massa ini mengundang reaksi, sebab tidak ada yang dikenal. Hal itu kemudian dilaporkan ke Polsek Batangkuis. Sejumlah petugas Polsek Batangkuis dipimpin Kapolsek AKP S. Simaremare kemudian mendatangi mereka, menanyakan kedatangan mereka dinihari

hinggamenimbulkankecurigaan. Dari salah seorang massa yang akhirnya diketahui berasal dari FRB, diperoleh jawaban mereka akan melakukan aksi demo ke Bandara KNIA, Rabu pagi. Di samping akan demo, mereka juga akan melakukan aksi menuntut pengembalian tanah di lahan eks PTPN II karena menurut mereka pihak PTPN II sama sekali tidak memiliki hak menguasai tanah tersebut. Akhirnya polisi membawa 8 dari mereka bersama bus ke Mapolres Deliserdang untuk penyelidikan. Sedangkan massa lainnya dipersilakan kembali ke Langkat. Selanjutnya pada Rabu pagi, sejumlah massa mengaku dari Forum Rakyat Bersatu juga melakukan hal sama. Massa datang

Taman Siswa Akan Buka Program S2

dari arahTembung dan melintasi daerah Batangkuis. Namun sebelum sampai Bandara KNIA, sejumlah polisi dari Polres Deliserdang dibantu petugas Poldasu yang sudah siaga sebelumnya berhasil menghalau mereka di kawasan DesaTanjung Sari, atau beberapa meter dari Mapolsek Batangkuis. Dalam aksi itu sempat terjadi bentrok antara petugas dengan

massa, dan petugas mengamankan 21 orang ke Mapolres untuk pemeriksaan. Menurut Kapolres, kedatanganmassaFRBuntukmelakukan aksi di Bandara KNIA sangat tidak dibenarkan, dan dianggap dapat merusak alat vital milik pemerintah bukan hanya Pemprovsu, tapi Indonesia. “Bila terjadi kerusuhan di bandara internasional ini, maka

jelas negara akan mengalami kerugian yang sangat besar akibat terganggunya penerbangan. Di samping itu mereka tidak punya izin resmi sehingga dapat dikatakan ilegal,” kata Kapolres. Di antara mereka ada yang membawasenjatatajamsehingga perlu ditindak tegas. Untuk sementara mereka dibawa ke Mapolres Deliserdang.(crul)

Waspada/Ibnu Kasir

Forum Anak Langkat Bantu Pengungsi Sinabung LANGKAT (Waspada): Forum Anak Langkat dikomandoi pembinanya Delia Pratiwi bersama sejumlah anak-anak sekolah SD, SMPdanSMAmenyerahkanbantuanuntukpengungsiErupsiGunung Sinabung di Desa Telagah, Sei Bingai, Langkat, Senin (17/2). Selain pengungsi Sinabung di Langkat, Delia Pratiwi didampingi dewan penasehat Forum Anak Langkat H. Sujarno dan KetuaWanita Pujakesuma Sumut, Hj. Nuraida Ngogesa juga mengunjungi pengungsi di Tiga Binanga dan Posko Lapangan Samura Kabanjahe. Usai menyerahkan bantuan, Delia Pratiwi yang merupakan putri sulung Bupati Langkat H. Ngogesa Sitepu, berdialog bersama sejumlah anak pengungsi guna memberi semangat dan motivasi agar mereka terus rajin belajar. Sementara itu Pembina Forum Anak Langkat H Sujarno yang juga KadisPdanPLangkatmengemukakan,bantuanyangdiberikanberupa beras, pakaian layak pakai, obat – obatan, roti dan uang saku kepada anak-anak yang masih sekolah bernilai Rp250 juta.(a01/a03)

Waspada /ist

DELIA Pratiwi Sitepu saat menghibur anak-anak pengungsi Sinabung di Posko Pengungsian Tiga Binanga, Karo.

Kaki PNS Mantan Napi Sabu Ditembak Dalam Kasus Sabu STABAT (Waspada): Petugas Sat Narkoba nyidikan,” tambah Kasat Narkoba. Polres Langkat, Rabu (19/2) pagi meringkus dua Dalam penangkapan itu polisi menyita satu pemilik narkotika jenis sabu di Kec. Hinai, satu gram sabu bersama alat isap. Tersangka SU baru diantaranyaPNSBadanKesbangLinmasLangkat. empat bulan bebas dari LP Tanjungpura setelah SU, 35, oknum PNS yang kabur saat pe- menjalani hukuman 1,5 tahun dalam kasus nangkapan ditembak petugas kaki kirinya setelah sama.(a03) mengabaikan tembakan peringatan. Kapolres Langkat melalui Kasat Narkoba AKP Lukmin Siregar didampingi Kaur Bin Ops (KBO) Sat Narkoba Ipda Zul Iskandar menuturkan, keduanya sudah lama jadi target penangkapan. “Saat polisi menggeledah rumah tersangka MU, 33, di Tanjungbringin Kec. Hinai, tiba-tiba tersangka SU kabur sehingga terjadi kejar-kejaran dan tembakan peringatan. SU berhenti berlari setelah tersungkur ditembak kakinya,” kata AKP Lukmin. Tersangka langsung dibawa ke klinik di Mapolres untuk pengobatandankinidiperiksa intensifuntukpengembangan Waspada/Abdul Hakim kasus. “Dugaanawaldiahanya KASAT Narkoba Polres Langkat AKP Lukmin (kanan) dan KBO pemakai, namun berpeluang juga sebagai pengedar, ter- Sat Narkoba Ipda Zul Iskandar mengapit kedua tersangka pemilik gantung perkembangan pe- sabu.

Empat Hari Terapung Di Laut, Nelayan Langkat Selamat BUPATI Langkat H. Ngogesa Sitepu bersama H. Indra Salahuddin usai dilantik menjadi Sekda Langkat di Serambi Jentramalay rumah dinas bupati di Stabat.

TEBINGTINGGI (Waspada): Perguruan Taman Siswa Kota Tebingtinggi berencana membuka program Pasca Sarjana (S2) pada tahun ajaran 2014/2015. Rencana itu dibuat setelah belum adanya kesempatan untuk membuka perguruan tinggi akibat terkendala moratorium pendidikan tinggi oleh Kementerian Pendidikan. Hal itu disampaikan Ketua Perguruan Taman Siswa Kota Tebingtinggi, Ki Drs. Muhammad Ardi, kemarin di ruang kerjanya didampingi Kabid Pendidikan Taman Siwa Ki Joko Sulistyo. Dikatakan, rencana pembukaan program pendidikan pasca sarjana bekerjasama dengan Universitas Islam Sumatera Utara (UISU) Medan. “Dalam waktu dekat MoU ditandatangani,” kata Muhammad Ardi. Naskah itu akan ditandatangani Ketua Program Pasca Sarjana UISU Dr. Eddy Suprayitno, SE, MM dengan Ketua Taman Siswa Ki Drs. Muhammad Ardi. “Untuk saat ini dibuka program magister manajemen (MM),” terang Ardi. “Pprogrampendidikanpascainiuntukmemutusrantaikemiskinan di masyarakat,” imbuh Ardi. Rencananya, Prof Dr. Sri Edi Swasono akan hadir pada proses pendidikan di pasca sarjana ini.(a09)

Secara terpisah Humas BB TNGL SumutAceh, Rahmad Simbolon menegaskan, ada kemungkinan terjadi baku tembak antara petugas dengan warga pemburu burung Langkong, karena mereka menggunakan senjata api kaliber 5 mm. Terkait insiden ini, pihakTNGL telah berkoordinasi dengan Polres Langkat. Ditanya apakah keenam personil petugas masih terkepung di dalam hutan karenaaksesjalandiinformasikandiblokir,iaenggan menjawab. Kapolsek P. Brandan, AKP SR Tambunan dikonfirmasi Waspada mengatakan, sejumlah anggota Polsek dan personil dari Polres telah diturunkan ke lapangan. Salah seorang warga usai menjenguk korban mengatakan, Dedy bersama dua rekanya sekira pukul 10:00 hendak ke ladang. Di pertengahan jalan mereka bertemu petugas TNGL dan ketika diperintah berhenti, ketiga warga ini langsung kabur. Dedy saat itu terjatuh dan secara bersamaan peluru milik petugas menerjang pangkal paha menembus pantatnya. Aksi penembakan ini diprotes warga. “Kalau terbukti bersalah ditangkap saja, jangan main tembak,” kata warga.(a02/a03)

Bupati Lantik Sekda Langkat STABAT (Waspada): Belakangan ini tuntutan masyarakat terhadapkinerjabirokrasisemakin tinggi,masyarakatsemakincerdas memahami hak-haknya untuk ikut berperan melakukan pengawasan dan kontrol terhadap jalannya pemerintahan. Kondisi tersebut sebagai bentuk keberhasilan pembangunan yang patut disyukuri guna menguatkan komitmen keberpihakan terhadap kepentingan masyarakat serta mewujudkan

pemerintahan yang baik. Karenanya,kataBupatiLangkat H. Ngogesa Sitepu, SH saat melantik H. Indra Salahuddin sebagaiSekdaLangkatdiSerambi Jentramalay rumah dinas bupati diStabat,Rabu(18/2),kedudukan Sekda memiliki peran sangat strategis guna kelancaran penyelenggaraanbidangpemerintahan, pembangunan dan sosial pelayanan masyarakat. Bupati Ngogesa berharap Sekda mampu melakukan ber-

bagai trobosan secara kreatif dan inovatif untuk tumbuhkembangnya perekonomian daerah serta terpeliharanya harmonisasi di kalangan masyarakat, dengan memberdayakan seluruh tugas dan kewenangan pada masingmasing satuan perangkat kerja daerah. Sebelumnya, H. Indra Salahuddindihunjuksebagaipelaksana Sekda menggantikan pejabat lama H. Surya Djahisa yang memasuki masa pensiun.(a01/a03)

STABAT (Waspada): Empat nelayan asal Desa Kwala Langkat dan Pematangcengal Kec.TanjungpuraLangkat,selamatsetelahempathariterapung di lautan lepas perbatasan perairan Aceh. Informasi dihimpun, keempat nelayan Sayuti Nizar,49,Agam,Muslim,32,danUyut,pergimelaut sejak Kamis (13/2) malam dari Perairan Tapak Kuda menggunakan satu boat. Sesampainya di lautan lepas Selat Malaka boat yang mereka gunakan mengalami kerusakan mesin hingga terapung di laut empat hari. Mereka

mencoba pulang menggunakan cara manual dengan mengayuh, namun terkendala cuaca buruk. KemudianSenin(17/2),nelayanDesaKelantan Kec. Brandan Barat yang melaut menemukan keempat korban terapung. Mereka kemudian ditolong dan dipulangkan keTanjungpura, Selasa (18/2) malam. Sementara Kades Pamatangcengal Arusman, Rabu (19/2), membenarkan keempatnya telah kembali dengan selamat.(a03)

PKL Di Batangkuis Akan Ditertibkan BATANGKUIS (Waspada): Tim terpadu terdiri dari Satpol PP Deliserdang, Dinas Perhubungan, Dinas Pasar dan unsur Muspika Batangkuis, Jumat (21/ 2) besok akan menertibkan sejumlah PKL di sepanjang Jalan Utama Batangkuis Pekan, depan Pasar Tradisional Batangkuis. Hal itu dikatakan Camat Batangkuis Drs. M. Abduh Rizali Siregar, M.Si kepada Waspada di ruang kerjanya, kemarin, usai rapat dengan tim terpadu terkait penertiban PKL tersebut. Menurut Camat Abduh, penertiban merupakan kegiatan rutin tim terpadu Pemkab Deli-

serdang dalam hal ini Satpol PP, untuk menjadikan kecamatan ini menjadi kota yang bersih, nyaman dan aman bagi masyarakat, terlebih dengan hadirnya BandaraKualanamusebagaibandara internasional kebanggaan masyarakat Sumut khususnya Deliserdang. “Kita menilai pedagang tersebut tidak teratur, bahkan pekarangan rumah penduduk sekitar pun menjadi tempat menyusun dagangan,” ujar Abduh. Seperti yang disampaikan SanusiSimanjuntaksalahseorang pedagang bahan sembako di dalam pasar tradisional tersebut, banyak sekali pedagang yang

menjual aneka ragam dagangan didepanpasartradisionalBatangkuis dan enggan masuk ke dalam sehingga berpengaruh terhadap pendapatan pedagang di dalam. Camat juga menyebut pihaknya sudah melayangkan surat pemberitahuankepadapedagang untuk tidak lagi melakukan aktivitas di luar pasar tradisional. Sementara S. Siregar, karyawanPTMojopahitselakupengelola pasar tradisional Batangkuis sangat mendukung tim terpadu menertibkan PKL yang berada di luar pasar, sebab masih banyak lokasi kosong disediakan pihak pengeloladilengkapifasilitas.(crul)

APKLI Deliserdang Lantik 10 DPC DELISERDANG (Waspada): Dewan Pimpinan Daerah (DPD) Asosiasi Pedagang Kaki Lima Indonesia (APKLI) Deliserdang melantik 10 pengurus Dewan Pimpinan Cabang (DPC) APKLI tingkat kecamatan, di Wisma Tanjung Indah, Deliserdang, Kamis (13/2). DPC APKLI yang dilantik masing-masing DPC APKLI Tanjungmorawa, Batangkuis, Lubukpakam, Beringin, Galang, Pantai Labu, Percut Seituan, Sunggal,Delitua,Kutalimbarudan Hamparan Perak.

Ketua DPD AKLI Deliserdang, Erwin Ramadani mengimbau pengurus APKLI yang baru dilantik menjadi garda terdepan dalam memperjuangkan kesejahteraan anggotanya. “Saya berharap tiap DPC menyusun program kerja yang mengacu pada upaya memperjuangkan hak dan meningkatkan kesejahteraan anggotanya,” ujar Erwin. Erwin menegaskan, tiap DPC APKLI wajib memperjuangkan nasib pedagang kaki lima di Deliserdang yang kian memprihatinkan. Keberadaan bandara Kuala-

namu International Airport (KNIA) yang megah sekaligus menjadi gerbang baru Sumut, tidak memberikan dampat signifikant terhadap peningkatan kesejahteraan pedangan kaki lima. Padahal, keluar masuk barang dan jasa mengalami lonjakan luar biasa sejak bandara terbaik di Indonesia tersebut beroperasi. Usai pelantikan digelar seminar dengan tema “PKL Deliserdang Di antara Penggusuran dan Implementasi Perpres No 125 tahun 2012”.(m46)

Edi Saputra/Waspada

WAKIL Ketua DPRD Sergai, H. Sayutinur didampingi Kades Sei Bamban, A. Sihotang, Kades Suka Damai, Karnain di lokasi bangunan leaning yang hancur akibat jebolnya tanggul.

Tanggul Sungai Sibaro Jebol TEBINGTINGGI (Waspada): Tanggul sungai Sibaro jebol sepanjang 20 meter di lokasi Daerah Intek(DI)SibaroDesaPertapaan,Kec.Tebingtinggi, Kab. Serdang Bedagai, mengakibatkan leaning sepanjang 150 meter yang baru selesai dikerjakan hancur. Selain itu dampak cukup mengkhawatirkan jebolnyatanggultersebutsekitar6.000hektarsawah dengan tanaman padi rata-rata usia 30 hari hingga 60 hari di empat kecamatan terancam kering. Wakil Ketua DPRD Sergai, Drs. H. Sayutinur, M.Pd didampingi Kepala Desa Sei Bamban, A. Sihotang, SH, Kepala Desa Suka Damai, Karnain, Kepala Desa Pematang Terang, Tomson Sormin dan lainnya, Rabu (19/2) menuturkan, pihaknya mendapat kabar tanggul sungai Sibaro jebol Minggu (16/2) kemarin. “Kedatangan kami bersama Kepala Desa, Ketua IP3A, Ketua P3A dari 4 kecamatan guna melakukanpeninjauanuntukselanjutnyamencari solusi berkoordinasi dengan Pemkab Sergai,

mengingat air dari bendungan DI Sibaro sangat dibutuhkan petani di Kec. Sei Bamban, Tanjung Beringin, Tebingtinggi serta Bandar Khalipah. Jika tidak segera ditangani sekitar 6.000 hektar tanaman petani usia tanaman 30-60 hari terancam kekeringan,” terang H. Sayuti. Ditambahkan Ketua IP3A DI Sibaro, Suwarno, bendungan DI Sibaro merupakan sumber air satu-satunya untuk mengairi sekitar 6.713 hektar areal persawahan di empat kecamatan. Jika dalam sepekan tidak diperbaiki tanaman padi akan kekeringan terlebih di musim kemarau ini berdampak gagal panen. SementaraPengawasbangunanleaningDinas PSDA Sergai, Sutikno yang juga Kepala UPTD IV, menuturkan bangunan leaning yang hancur baru selesai dikerjakan dengan anggaran Rp180 juta bersumber dari APBD Sergai tahun 2013, merupakan proyek luncuran karena hingga waktu batas akhir belum selesai dikerjakan berhubung lokasi tergenang banjir.(c03)


Sumatera Utara

B2

WASPADA Kamis 20 Februari 2014

Diciduk, Gelapkan Bantuan Pengungsi Gunung Sinabung KABANJAHE (Waspada): Aparat Polres Tanah Karo menciduk tersangka penggelapan bantuan, termasuk sembako, yang seharusnya diperuntukkan membantu pengungsi korban erupsi Gunung Sinabung di Posko Tigabinanga. Tersangka KG, 55, warga Pekanbuah, Kec. Tigabinanga, Kab. Karo,dicidukpersonilSatReskrim saat membawa bantuan diduga digelapkannya dari Posko Tigabinanga.DiaditangkapdiGangKalihara, Kabanjahe, Rabu (19/2). Di hadapan petugas, tersang-

kamenjawabpertanyaandengan tenang. “KG merasa tidak berdosa ketika kita tanyain, dia kelihatan begitu tenang. Tersangka mengaku, baru satu kali melakukan aksi pengelapan sembako pengungsi poskoTigabinangga,” ungkap Kapolres T. Karo AKBP

Alberd Sianipar kepada Waspada. Dikatakan Alberd, modus pelaku yang berperan sebagai anggota tim penanganan logistik di posko pengungsian desanya, membuat dia mudah menyelewengkan sembako. Ketika logistik datang ke posko, dia langsung menyisipkan sembako dan benda yang akan digelapkannya dengan mengendarai sepedamotormiliknya,kemudian dibawanya ke rumahnya yang tidak jauh dari posko. “Setelahmerasaaman,kemu-

dian tersangka membawa barang-barang tersebut ke Gang Kalihara Kabanjahe, dititipkan di rumah saudaranya dan rencananya akan dijual di seputaran Kabanjahe,” jelasnya. Barangyangberhasildiamankan dari rumahnya, lanjut Alberd, seperti empat selimut, satu ambal, lima sarung, 17 buku tulis, 17 kotak makanan ringan, enam bungkus minyak goreng, rinso satu kilo, gula putih, satu kotak mi instan dan bubuk teh. Sedangkan di Gg Kaiahara

Kabanjahe, barang yang diamankan berupa beras, minyak goreng dan tas bantuan Presiden saat datang ke Karo. “Tersangka masih diproses, kita mintai keterangan dan akan kita dalami. Apakahdiamemangsudahsering melakukan aksi seperti itu atau hanya baru kali ini saja,” pungkas Alberd. Sebelumnya, aksi penggelapan bantuan pengungsi Sinabung pernah terungkap di Posko Masjid Agung Kabanjahe, Kamis (13/2). (c19/c10)

Tewas Saat Cegah Warga Berkelahi SIDIKALANG (Waspada): Bermaksud mencegah warga berkelahi dengan cara memisahkan keduanya, seorang warga DesaPalding,Kec.Tigalingga,Kab. Dairi, justru tewas dibunuh. Pembunuhan terjadi di Desa Palding, Selasa (18/1), mengakibatkan Irwansyah Putra Ginting,

27, tewas di tempat kejadian diduga pelakunya berinisial KT, 31, warga Desa Pandan, Kec. Siempatnempu Hulu. Hal itu dijelaskan Kasubbag Humas Polres, AKP Lamhot Limbong didampingi Kasat ReskrimAKPHasianPanggabean dan Kanit Reskrim Ipda J.S-

Warga Berampu Harapkan Gedung SD Ditimpa Pohon Segera Diperbaiki SIDIKALANG (Waspada):Warga Desa Berampu, Kec. Berampu, Kab. Dairi, mengharapkan pemerintah untuk segera memperbaiki gedung SD Negeri No.030303 Berampu. Dua lokal rubuh ditimpa pohon beringin, Jumat (14/2) sore. Orangtua murid, Jaspin Sihombing, 50, kepada Waspada, Rabu (19/2) mengatakan, pohon beringin ukuran besar tumbang menimpa gedung sekolah. Dua ruangan belajar tidak dapat lagi dipergunakan untuk belajar, karena rusak total termasuk mejakursi. Salahseorang di antara guru yang tidak bersedia disebutkan namanya mengatakan, saat kejadian para murid dan guru sudah pulang. Sebab, kejadiannya sekira pukul 17.00. Saat itu angin cukup kencang dan menumbangkan pohon besar dan menimpa gedung sekolah. Pasca kejadian itu, sebagian siswa belajar sore, karena dua ruangan belajar rusak total termasuk mobiler. Kepala Bidang Sarana dan Prasarana Dinas Pendidikan, Drs. Adler Tindaon kepada Waspada, Rabu (19/2) mengatakan sudah menerima laporan dari kepala sekolah tentang bencana yang menimpa gedung SD tersebut. ‘’Kita sudah meneruskan laporan itu kepada Bupati. Ruangan belajar yang rubuh akan segera mendapat perbaikan sehingga murid tidak ada lagi yang belajar sore,’’ katanya. (a20)

iringoringo kepada Waspada, Rabu (19/2). Kronologi kejadiannya, menurut Kasubbag Humas, ketika korban melihat tersangka bertengkarmulutdenganseorang warga Desa Palding berinisial SG, 35. Ketika itu, KT dan SG samasama emosi dan nyaris adu jotos,

sehingga korban berusaha untuk memisahkan keduannya. Namun, tanpa diduga, KT langsung menusuk dada korban dan tewas di tempat. Sedangkan KT dan SG sama-sama melarikan diri setelah melihat korban rubuh ke tanah bermandikan darah. Dikatakan, jauh sebelumnya,

antara KT dan SG pernah berselisih paham, sehingga pertengkaran itu diduga ada unsur dendam. Namun, sangat disayangkan, korban hendak memisahkan mereka, malah menjadi korban pembunuhan dan tewas di tempat. Keduanya dalam pengejaran petugas. (a20)

Pemkab Simalungun Tunggu Surat Resmi Kelulusan Ujian CPNS K-2 SIMALUNGUN (Waspada): Terkait beredarnya pengumuman kelulusan nama-nama pesertaujianCPNSK.2yangdapat diaksesmelaluimediacetakmaupunwebsite,PemkabSimalungun melalui Kadis Pehubungan, Komunikasi dan Informatika, Mixnon Andreas Simamora, mengatakan, pengumuman tersebut belum final. HalitudikemukakanMixnon menyikapiadanyapengumuman kelulusandanuntukmenghindari terjadinya mis komunikasi antara peserta ujian CPNS K.2 (kategori 2) dan Pemkab Simalungun. Dikatakan, Pemkab Simalungun hingga saat ini masih menunggu pemberitahuan resmi melalui surat dari Menteri Pendayagunaan Aparatur Negara (Menpan) RI maupun Badan Kepegawaian Negara (BKN). “Pengumuman itu belum final dan masih menunggu surat

pemberitahuan resmi dari MenpandanBKNPusat,”katanya kepada wartawan kemarin. Dijelaskannya, tenaga honor yang masuk dalam K.2 di Simalungun berjumlah 1.014 orang, namun yang mengikuti ujian Calon Pegawai Negeri Sipil (CPNS) pada November 2013 lalu 982 orang. Pihaknya berharap, semua peserta ujian lulus 100 persen, mengingat para peserta itu telah mengabdi di Pemkab Simalungun bertahun-tahun, bahkanadayangsudahmencapai di atas 15 tahun mengabdi. “Itu yang menjadi harapan kita, agar mereka lulus 100 persen dalam ujian ini,”ujarnya. Sementara di tempat terpisah, Kepala Badan Kepegawaian Daerah (BKD) Simalungun, Jamesrin Saragih, SPd mengatakan, sebagai lembaga resmi tentunya Pemerintah Kabupaten (Pemkab) Simalungun hanya

Waspada/Natar Manalu

SALAH seorang petani di Desa Huta Rakyat, Kec. Sidikalang, Kab. Dairi memperlihatkan tongkol jagung yang sudah botak karena bijinya ludes dilantak hama tikus. Foto direkam Selasa (18/2).

mempedomani surat resmi. Untuk itu jika ada tenaga honor K.2 yang namanya tercantum lulus pada web site maupun media cetak, Pemkab Simalungun belumdapatmenindaklanjutinya. Jika nantinya surat resmi yang sampai kepada Pemkab ternyata tidak sesuai dengan pengumumanmedia,makaPemkabhanya berpedoman kepada surat resmi. “Kami masih menunggu pengumuman resmi atau surat pemberitahuan resmi dari Menpan,BKNPusatmelaluiBKD Provinsi Sumatera Utara,” kata Jamesrin. Kepala BKD itu mengatakan, bila pihaknya sudah menerima hasil pengumuman resmi tentang kelulusan ujian CPNS K.2 dari Menpan atau BKN pusat, akan mengumumkannya di Kantor BKD termasuk di media agar para peserta dapat mengetahuinya. (a29)

Hama Tikus Mengganas Di Sidikalang SIDIKALANG (Waspada): Hama tikus di sejumlah desa di Kec. Sidikalang, Kab. Dairi, kini mengganas menyerang tanaman jagung. Kondisi ini, misalnya, terlihat di Desa Huta Rakyat. Menurut beberapa petani, populasi hama itu di luar ambang batas membuat petani pusing menghadapi gangguan tersebut. Sebab, dalam hitungandua pekan, seranganhamadiperkirakan hanya menyisakan 20 persen hasil produksi. Padahal, tanaman itu secara umum belum tua. Akibat serangan hama, petani desa terpaksa panenlebihdini,dipetikwalaubelummasak.Kalau tidak,bisanol.Ketimbang hancurtotal,petanimemilih panenmeskibelumwaktunya.Haltersebutdijelaskan salahseorang di antara petani, Riana boru Siregar, kepada Waspada, Selasa (18/2). Dikatakan,sebagianbesartongkoljagungtelah botak karena bijinya ludes dilantak. Padahal, perawatan sudah dilakukan maksimal termasuk pembersihan lahan. Usaha tani dimaksud tergolong rutin digeluti. Sudah banyak masyarakat

menjerit. Ia heran, biasanya serangan mengganas pada saat musim hujan. Kali ini, justru mengamuk di kala kemarau panjang. Petani lainnya,Salamat Naibaho,45 mengatakan, berbagai jenis usaha untuk menghalau serangan hama itu telah dilakukan di antaranya pembersihan lahan,memasang racun dan lainnya,namun tidak berfaedah. Bahkan populasi hama semakin meningkat. Dikatakan, umunya petani jagung di desa itu mengalamihalsama.Diperkirakan,puluhanhektar tanaman jagung mengalami gagal panen. SeranganhamamenurutNaibaho,telahdilaporkan ke dinas pertanian. Kepala Dinas Pertanian Dairi Ir Herlina Lumbantobing hendak dikonfirmasi, Rabu (19/2) tidak berhasil. Menurut stafnya, Kadis sedang banyak tamu.Namun sumber di kantor itu menyebutkan, sudah menerima laporan dari petani tentang seranganhamatersebut.Timpenyuluhakansegera ke lapangan, sebutnya. (a20)

Musrembang Kecamatan Ajibata AJIBATA (Waspada): Dalam pemantapan tahapan usulan-usulan setiap desa, Kecamatan Ajibata melaksanakan Musyawarah Perencanaan Pembangun(Musrembang) tingkat kecamatan di Cafe Naborsahan Ajibata, Selasa (18/2). Musrembang kecamatan dibuka Camat Ajibata Gibson Sinaga, AP dihadiri Kabid Litbang Bapeda DikkyTampubolon mewakili BupatiToba Samosir Kasmin Simanjuntak, anggota DPRD Toba Samosir Herbet Sibuea, Kadis Pasar Toba Samosir Arifin Silaen, Pimpinanan SKPD/staff, KepalaDesa,SekretarisDesa,UPTD,Bindes,Tokoh masyarakat, Tokoh Agama, okoh Pemuda, LSM. Musrembang kecamatan dilaksanakan untuk membahas dan menyepakati usulan rencana

kegiatan pembangunan desa/kelurahan yang menjadikegiatanprioritaspembangunandiwilayah kecamatan masing-masing. Camat Ajibata Gibson Sinaga memaparkan usulan-usulan yang sudah terealisasi pada tahun anggaran 2013 seperti perkerasan jalan, saluran, jalan setapak, pembukaan jalan. Bupati Toba Samosir Kasmin Simanjuntak melalui Kabid Litbang Bapeda Dikky Tampubolon dalam arahannya mengharapkan agar pelaksanaan Musrembang tertib, lancar, dan penuh kesungguhan sehingga menghasilkan usulan program kegiatan yang realistis dan berkualitas berdasarkan kebutuhan masyarakat. (crn)


Sumatera Utara

WASPADA Kamis 20 Februari 2014

B3

Akibat Kabut

Penerbangan Dari Pinangsori Batal Pinangsori, TAPTENG (Waspada): Akibat kabut yang melanda Kota Sibolga dan Kab. Tapanuli Tengah, beberapa penerbangan dari Bandara FL Tobing Pinangsori terpaksa dibatalkan, Rabu (19/2). Padahal, puluhan penumpang yang akan berangkat dari Bandara di Tapteng menuju Bandara Kualanamu telah sempat berada di Bandara Pinangsori. Informasi dihimpun Waspada di Bandara Pinangsori, Rabu (19/2), puluhan penumpang pesawat dari maskapaiWings Air (Group Lion Air) sudah sempat menunggu pesawat yang akan dijadwalkan berangkat sekira pukul 11:30. “Informasi dari maskapai Wings Air sebelumnya, tidak ada

kami peroleh penerbangan akan batal.Padahal,kamisudahsempat datangdibandaraini,”keluhcalon penumpang berasal dari Kota Sibolga,Tapteng,bahkansebagian dari Padangsidempuan dan sekitarnya. Menurut Kepala Bandara FL Tobing Pinangsori Ambar Suryoko yang ditanyai, mengaku, batal-

Pemkab Palas Belum Terima Hasil Pengumuman CPNS Honorer K2 SIBUHUAN (Waspada): Kepala badan Kepegawaian Daerah (BKD) Padanglawas Syaiful Bahri Siregar yang juga Plt Sekda mengatakan, belum menerima hasil pengumuman CPNS honorer K2 yang resmi oleh Kemenpan atau BKN. “Kita belum bisa bisa menyikapi kelulusan CPNS honorer kategori 2 yang diumumkan melalui internet, karena kami belum menerima surat resmi dari BKN terkait pemberitahuan yang pasti tentang pengumuman hasil ujian K2,” ujar Syaiful di Sibuhuan, Selasa (18/2). Kata Syaiful, saat ini para peserta memang sudah bisa melihat nama-nama pemenang hasil tes CPNS K2 itu melalui situs internet, namun menurutnya pengumuman hasil tes CPNS K2 bukan wewenang daerah. Karena itu Pemkab Palas masih menunggu informasi resmi BKN. Dalam daftar peserta CPNS Honorer Kategori 2 (K2) yang diumumkan untuk daerah Kabupaten Padanglawas, terdapat 262 orang peserta yang dinyatakan lulus. (a34)

Pembangunan Diharap Tepat Sasaran PANYABUNGAN (Waspada): Untuk lebih meningkatkan kesejahteraan masyarakat, pembangunan di tahun 2014 ini baik pembangunan fisik berupa infrastruktur jalan dan fasilitas umum lainnya diharapkan tepat sasaran. ‘’Sebab, menurut kita di tahun-tahun sebelummnya banyak pembangunan yang terkesan mubazir dan tidak dapat dimanfaatkan masyarakat,’’ujarsalahseorangpengamatsosialMandailingJulu,Sangkot Syukur Spd, kepada Waspada di Panyabungan, Selasa (18/2). Menurutnya, masih banyak pembangunan di tahun-tahun sebelumnya yang tidak tepat sasaran dan juga tidak berkualitas sehingga masyarakat tidak dapat memanfaatkannya. Di samping itumasihbanyakwargapedesaanyangmembutuhkanpembangunan namun tidak terealisasikan. “Sangat disayangkan apabila pembangunan yang di programkan pemerintah tidak termanfaatkan dengan baik. Inikan sama saja dengan menghambur-hamburkan uang negara,” katanya. Untukitu,harapnya,pemerintahlebihmemprioritaskanmembangun desaterpencilsehinggabisamembangkitkantarafkehidupandandapat meningkatkan kesejahteraan masyarakat. (c15)

Pengedar Narkotika Diciduk SIDIKALANG (Waspada):Tersangka pengedar narkotika berinisial MS, 24, warga Dusun Gunung Sayang Desa Palding, Kec. Tigalingga, Dairi, diciduk Satuan Intelkam dari sebuah gubuk kebun kopi desa itu, Senin (17/2). Hal tersebut dijelaskan Kasubbag Humas Polres Dairi, AKP Lamhot Limbong kepada Waspada, Rabu (19/2). Menurut Limbong, awalnya intel Polres ada menerima informasi dari masyarakat, seorang warga desa tersebut, MS sedang berada di sebuah gubuk kebun kopi tidak jauh dari rumahnya, sedang membungkus narkotika jenis sabu dan daun ganja kering. Informasi itu ditindaklanjuti dan satuan intel meluncur ke lokasi. Ternyata tersangka langsung diciduk dan digelandang ke Mapolres. Dari gubuk tersebut diamankan satu bungkusan berisikan sabu, 29 bungkusan jie sabu siap edar, 1 bungkusan berisi daun ganja kering, 1 unit timbangan digital, uang tunai Rp11.159.000. Dikatakan,satubungkusanberisidaunganja,telahdipisahkembali dengan bungkusan kecil. Namun Limbong belum mengetahui berapa kilogram daun ganja kering dan berapa kilogram sabu tersebut. ‘’Barang haram itu belum ditimbang,’’ sebutnya. (a20)

APK Ditertibkan Di Padangbolak GUNUNGTUA (Waspada): Puluhan alat peraga kampanye (APK) yang menyalahi aturan di wilayah Kec. Padangbolak ditertibkan Panitia Pengawas Kecamatan (Panwascam) Padangbolak dibantu petugas Satuan Polisi Pamong Praja (Satpol PP) Kab. Padanglawas Utara (Paluta), Minggu, (16/2). Panwascam Padangbolak sudah berulangkali menyurati dan melakukan penurunan APK yang cara pemasangannya menyalahi aturan. Namun, tetap saja masih ada APK calon anggota legislatif (Caleg) yang melanggar. Penertiban dipimpin Ketua Panwaslu Kecamatan Padangbolak, Tohong P Harahap SPd, MSi, bersama sejumlah Petugas Pengawas Pemilu Lapangan (PPL), sedangkan petugas Satpol PP dikomandoi Kakan Satpol PP Ali Jaffar diwakili Kasi Penegakan Hukum Sukri A Siregar . Ketua Panwascam Padang Bolak Tohong P Harahap usai penertiban mengungkapkan, pihaknya menemukan banyak para calon legislatifyangkembalimemasangAPKmeskisudahpernahditertibkan. Bahkan, penertiban ini terhitung sudah yang kelima kalinya. Padahal, para Caleg yang memasang APK tidak sesuai sudah pernah berjanji tidak akan lagi memasang APK di tempat terlarang. (a35)

Lokakarya Peningkatan Hasil Usaha Petani Kopi ARSE (Waspada): Dalam meningkatkan pemahaman petani, Lembaga Ovata Indonesia mengadakan lokakarya diikuti 158 petani kopi dari empat kecamatan yakni Kec. Sipirok, Arse, Saipar Dolok Hole, Aek Bilah di GedungTaman Bermain, Desa Aek Haminjon,Kec. Arse, Kab. Tapanuli Selatan, baru-baru ini. Kegiatan tersebut bertujuan untuk mengubah paradigma baru seputar peningkatan usaha di bidang tanaman kopi yang sudah mulai redup, dimana pada tahun 1700, Sipirok adalah salahsatu daerah penghasil kopi terbaik di dunia. Bupati Tapsel, H. Syahrul M Pasaribu, SH diwakili Kepala BP2KP Tapsel, A. Siregar, mengatakan, kegiatan lokakarya sudah tiga kali dilaksanakan Lembaga Ovata Indonesia, sekaligus mendidik petani. Menurut pengurusYPMHB,Yuriandi Siregar, kegiatan ini untuk mengembalikan kembali Sipirok sebagai penghasil kopi terbaik di dunia seperti pada era 1700 hingga 1800. Dalam arahannya, Bambang HS, mengatakan, dalam budidaya kopi arabika lebih mengedepankan tata syarat pembukaan lahan yang semulanya merupakan area hutan, areal kebun campur serta areal semak. “Hasilnya bisa sama antara kopi robusta dengan kopi ateng, malah kopi dapat bertahan tumbuh dalam jangka waktu yang sangat lama , dan cocok ditanam di daerah Sipirok,” kata Bambang Lanjutnya, kopi berada di urutan kedua komoditas di dunia setelah minyak bumi yang dibutuhkan manusia. Kopi arabika hampir 70 persen diminati sedangkan kopi robusta hanya sekira 30 persen. Sementara salah satu pengusaha kopi, Amila Sholih, mengatakan ,peminat kopi arabika sangat banyak sehingga penjualan bubuk kopi arabika mampu menghasilkan untung cukup besar. Lokakarya ini kerjasama Lembaga Ovata Indonesia Sipirok dengan beberapa pengusaha seperti UD Angkola Sipirok, UD Tonggi Bayo Pane Arse, Usaha Karya Serasi, Subur Collection Jakarta, Global Cosmetic Pekanbaru dan para petani kopi di Sipirok. (a26)

nya penerbangan dariWings Air. “Karena kabut yang melanda bandara ini, maka pesawat dari maskapaiWingsAirterpaksabatal berangkat dari Kualanamu. Seyogianya pukul 11:15 pesawat telahmendaratdibandarainidan akan berangkat pukul 11:30,” kata Ambar S yang dihubungi via selulernyasembarimenyebutkan ada maskapai lain yang juga batal mendarat yakni Susi Air. Dijelaskan Ambar S, jarak pandang di Bandara Pinangsori, kurang dari 300 meter yang menyebabkankesulitanuntukmelakukan pendaratan dan pemberangkatan. “Karena jarak pandang yang relatif pendek itu, menyulitkan

pesawat untuk mendarat, maka pesawat Wings Air tak jadi berangkat dari Kualanamu. Idealnya, jarak pandang pesawat yang bisa mendarat di Bandara Pinangsoriiniminimal1.000meter,” jelas Ambar. TentangpembatalanmendaratnyapesawatWingsAir,katanya, tentunya untuk keselamatan penerbangan.”Jadi tak mungkin pihak maskapai memaksakan pesawat berangkat dan tidak bisa mendarat karena faktor kabut itu.Kepadaparapenumpangyang akan berangkat ke Kualanamu, ditunda keberangkatannya Kamis(20/2),itupunkalaujarakpandang di bandara ini telah normal sedikitnya 1.000 meter,”sebutnya.

Sebelumnya, kata dia, pada Sabtu (15/2), pesawat Wings Air juga batal mendarat di Pinangsori yang juga disebabkan kabut yang melanda bandara ini.”Kita berharap, kiranya kabut akan segera berakhir, sehingga kedatangan dan keberangkatan pesawat dari bandarainiakannormalkembali,” pungkas Ambar S. Diberitakan sebelumnya, didugakuatkarenakebakaranlahan perkebunan ribuan hektar di kawasanTapanuli Bagian Selatan (Tabagsel), mengakibatkan kabut yang melanda Kota Sibolga dan TapanuliTengah.Apalagi,Bandara Pinangsori lebih tebal kabutnya, karena lebih dekat jaraknya dibandingkan Sibolga. (cpol)

Waspada/Dede Basri Hasibuan

SIAPKAN MENU: Personil TNI di posko utama erupsi Gunungapi Sinabung Kab. Karo Sumut, tepatnya di Kabanjahe/Kantor DPRD Karo menyiapkan menu makanan untuk TNI, Basarnas dan relawan yang ada di posko utama. Seperti terekam kamera Rabu (19/2).

Waspadai ISPA Akibat Kabut ANJ Agri, TNI, Dan Warga Gotroy Bersihkan Bekas Banjir

2.000 Masker Dibagi Di Sibolga SIBOLGA (Waspada): Akibat kabut yang melanda Kota Sibolga dan sekitarnya, bisa berakibat kepada berbagai penyakit bagi masyarakat terutama ISPA (Infeksi Saluran Pernafasan Akut), iritasi mata perih, dan berbagai penyakit lainnya. Apalagi, selama ini daerah ini masihberlangsungmusimkemarau dan suhu agak panas. Untuk itudiharapkankepadawargaagar mengurangi keluar rumah jika dianggap tidak perlu dan banyak mengonsumsi air putih. “Akibat kabut dan kemarau yangsaatinimelandaKotaSibolga bisa berakibat ISPA dan berbagai penyakit lainnya. Untuk itu, kita

mengimbau kepada warga terutama anak-anak agar mengurangi keluar rumah, jika tidak merasa perlu,”kata Kadis KesehatankotaSibolgaYusufBatubaramenjawab Waspada, Rabu (19/2). Sebelumnya, lanjut Kadis Kesehatan,Senin(17/2)kemaren, sebagai antisipasi awal pihaknya telah membagikan 2.000 masker kepada warga Kota Sibolga. “Dibeberapakawasandikota ini,kitatelahmembagikanmasker kepada sejumlah pengendara sepeda motor dan pejalan kaki, termasuksejumlahsiswaSDsebagai antisipasi awal untuk mencegah penyakit yang ditimbulkan kabut. Karena saat ini stok masker

habis,kitatelahmemesannyadan informasinya akan segera sampai dan akan langsung kita bagikan kepada warga yang lebih prioritas membutuhkannya,” lanjutnya. Selain itu juga, pihaknya telah menginstruksikankepadaseluruh paramedis untuk melaporkan dengansegerajikaterjadipenyakit yang berjangkit akibat kabut dan musim kemarau ini. “Selain itu juga, kita telah melakukan pendataan ke seluruh puskesmas, praktik dokter dan juga paramedis lainnya apakah adakecenderunganberjangkitnya penyakit yang ditimbulkan oleh kabut dan musim kemarau ini,” sebutnya. (cpol)

M Yusuf Jadi Sekda Madina PANYABUNGAN (Waspada):Plt Bupati Madina, Drs.Dahlan Hasan Nasution atas nama Mendagric/qGubsusecararesmi melantik H.M.Yusuf Nasution, M.Si sebagai Sekda Madina, Rabu (19/2). Upacara serah terima dan pengambilan sumpah jabatan berlangsgung di lapangan upacara Kantor Bupati Lama dihadiri unsur Muspida antara lain Kapolres Madina, AKBP Mardiaz K.D,S.Ik,M.Hum. Ketua DPRD Madina, As Imran Khaitamy, SH, Ketua KNPI Madina, Mulyadi Nasution dan juga dihadiri Kemenpora bagian Deputi Pengembangan Pemuda, Drs.H.Sakhyan Asmara,MAP, serta Kepala SKPD dan jajarannya.. Plt Bupati Madina, Dahlan HasanNasutionberharappejabat Sekda yang baru dilantik bisa mengemban tugas yang diamanahkannegaradenganbaik. DengandilantiknyapejabatSekda depinitif,programpembangunan untuk kesejahteraan masyarakat bisa ditingkatkan ke arah lebih baik, termasuk juga peningkatan disiplin kerja di kalangan pegawai dalam konteks perwujudan visi dan misi Madina ke depan.

“Saya harap pejabat sekda yang baru bisa kuat dan mampu menjalankan amanah dengan baik, termasuk jabatan sebagai baperjakat,” ucap Dahlan Hasan. M.Yusuf Nasution,M.Si di lantik sebagai Sekda Madina berdasarkan SK Mendagri Nomor: X.133.12/18/SJ,tanggal17Februari 2014. SK Mendagri itu merupa-

kan tindak lanjut SK Gubernur Sumateta Utara Nomor: 821.23/ 450/2014, dan surat usulan Bupati Madina nomor:800/2965/ BKD/2013, tanggal 22 November 2013 tentang pengangkatan jabatan Sekda Madina. Sebelumnya, jabatan Plt Sekda Madina di jabat Marwan Bhakti Siregar yang juga Pejabat Kepala Inspektorat. (c14)

melalui Danramil 19 Siais, Kapten Inf Pardamean, menyebut Gotroy ini merupakan program TNI AD khususnya dijajaran Kodim 0212/TS dalam rangka karya bhakti membantu masyarakat yang terkena musibah bencana. Sekaligus mewujudkan kemanunggalan TNI dengan rakyat. “Kegiatan ini merupakan tindak lanjut dari arahan Dandim 0212/TS Letkol Inf Chrishardjoko kepada seluruh jajaran TNI, khususnya Koramil yang ada di wilayah teroterialnya agar cepat tanggap terhadap keluhan masyarakat. Apalagi di daerah rawan bencana,” ujarnya. Koordinator Publik Affair PT ANJ Agri untuk Wilayah Sumatera Utara,Tri Hidayat, menyambut baik kerjasama perusahaan, TNI, dan masyarakat yang telag melaksanakan Gotroy. Katanya, perusahaan akan tetap respek dan peduli kepada lingkungan sekitar. “Aksi nyata ini merupakan bagian dari tanggungjawab sosial perusahaan, dan apa yang dilakukan oleh masyarakat dan TNIinisangatpositifdanharusterusditingkatkan,” ujar Tri Hidayat. (a27)

Bocah Paluta Gizi Buruk, Bidan Desa Kena Sanksi GUNUNGTUA (Waspada): Kepala Dinas (Kadis) Kesehatan Kabupaten Padanglawas Utara, dr Junaidah Harahap MKes memberikan sanksi administratif kepada bidan desa Fitri Siregar yang bertugas di Desa Gariang, Kec. Padangbolak Julu, terkait ditemukannya balita Santy Boru Harahap yang mengidap gizi buruk. Menurutnya, sanksi yang diberikan berupa penahanan gaji selama tiga bulan dan akan menarik bidan desa tersebut ke Dinas Kesehatan PemkabPalutauntukdiberikanbimbinganselama batas waktu yang dibutuhkan. Selama ini gaji Fitri Siregar sebesar Rp1,5 juta per bulan. “Kita akan tahan gajinya selama tiga bulan dan akan ditarik ke dinas untuk diberikan bimbingan,” ujarnya kepada Waspada, usai berkunjung ke RSUD Gunungtua, baru-baru ini. Lanjutnya, setelah dimintai keterangan dari bidan desa tersebut, diketahui kasus gizi buruk ini terjadi memang akibat dari kelalaian dari bidan desa yang kurang memperhatikan balita yang

ada di desa tempatnya bertugas. Untuk mengantisipasi agar kejadian serupa tidak terjadi lagi maka pihak Dinas Kesehatan Paluta dalam waktu dekat akan memanggil serta mengumpulkan seluruh bidan desa yang bertugas diPalutauntukdievaluasidandiberikanbimbingan dan arahan. “Kita akan segera memanggil semua bidan desa untuk dievaluasi dan saya harap ke depannya tidak ada lagi kasus seperti ini,” tegasnya. Sebelumnya, Santy Boru Harahap, bayi usia 2 tahun asal Desa Gariang, Kec. Padangbolak, Kab. Paluta mengalami gizi buruk, dan saat ini sedangdirawatdiRuangMelati,RSUDGunungtua. Sementara Nurhamilan Boru Siregar, ibunda Santy Boru Harahap, balita penderita gizi buruk, bekerjasebagaipambayu(penganyamdaunpandan) untuk dijadikan tikar. Dalam sehari, Nurhamilan mampu mengerjakan 2 sampai 3 tikar pandan dan menukar2tikarpandandengan1literberas.“Sehariharipekerjaankuhanyamambayu,”ujarNurhamilan Siregar dengan suara sendu. (a35)

Putusan Hakim PA P.Sidimpuan Bertentangan Dengan Pasal 105 Waspada/Sarmin Harahap

PLT Bupati Madina, Dahlan Hasan Nasution saat menyerahkan SK kepada Sekda Madina yang baru dilantik, M.Yusuf Nasution di Kantor Bupati Lama, Panyabungan.

Tingkatkan Fasilitas Dan Mutu Pendidikan Kejuruan Di Palas LUBUK BARUMUN (Waspada): Pemerintah kabupaten (Pemkab) Padanglawas diminta perhatikan peningkatan pendidikan sekolah kejuruan, seperti SMK Negeri 1 Lubuk Barumun yang kini masih memiliki fasilitas gedungbelajaryangsangatminim. Menurut Kepala Sekolah Menengah Kejuruan (SMK) Negeri1LubukBarumun,Bidarlis Nur Ibrahim Rangkuti, S.Pd, MM, sekolah yang dipimpinnya dibangun sejak tahun 2010 yang lalu telah mengalami kemajuan sekalipun dengan sarana dan fasilitas sangat terbatas. Sekalipun demikian, tidak menyurutkan semangat para siswauntukberprestasimembenahi keahlian dan kepribadian yang mandiri,sehinggasetelahmenye-

ANGKOLA SELATAN (Waspada): Karyawan PT Austindo Nusantara Jaya (ANJ) Agri bersama puluhan prajurit TNI dari Koramil 19 Siais Kodim 0212/Tapanuli Selatan, dan warga bergotongroyong (gotroy) membersihkan bekas banjir bandang yang melanda Dusun Janji Matogu, Kel. Pardomuan, Kec. Angkola Selatan, Kab. Tapanuli Selatan, beberapa waktu lalu. Dalam kegiatan yang digagas PT ANJ Agri Siais itu, dilakukan pembersihan saluran air, pengecatan Masjid Al Hidayah, pembersihan lingkungan SD dan SMP Satu Atap Dusun Janji Matogu.“Gotroy ini berlangsung selama dua hari,” kata General Manager (GM) PT ANJ Agri Siais, MulkanNasution,bersamaDanramil19Siais,Kapten Inf Pardamean Sihombing, Senin (17/2). Juga menggelar diskusi tentang bela negara kepadamasyarakatdiMasjidAlHidayah,sekaligus menyerahkan bantuan PT ANJ Agri Siais dan sumbanganKoramil 19 Siais kepada pengurus masjid. Dandim 0212/TS, Letkol Inf Chrishardjoko,

lesaikan studi di SMK Negeri 1 Lubuk Barumun mampu mandiridengankeahliandimiliki, bila tidak mampu melanjutkan pendidikankejenjanglebihtinggi. Dikatakan, untuk menghadapi tantangan kurikulum baru 2014 ini, sungguh berat beban dihadapi, karena mengingat kondisibangunangedungsekolah yang masih minim, hanya ada delapan lokal belajar, sementara jumlah rombongan belajar (rombel) mencapai 12 rombel. Sedang jumlah murid mencapai 266 orang dari empat program studi, termasuk jurusan agribisnis perikanan, busana butik, akuntansi dan administrasi perkantoran. Sedang guru hanya 32 orang, itupun hanya 11 orang yang PNS

dan 20 tenaga honorer. Maka melihat kondisi ini masih sangat banyak fasilitas pendukung yang dibutuhkanuntukmeningkatkan kualitaspendidikan,apalagiuntuk penerapan kurikulum baru di tahun 2014 ini yang tidak memungkinkanadanyakelasparalel. Sebagaiman disampaikan Abdul Hakim Hasibuan ketua komite SMK 1 Lubuk Barumun, ia bersama wali murid lainnya juga sangat berharap perhatian pemerintah terhadap peningkatan fasilitas SMK N 1 Lubuk Barumun demi peningkatan mutu pendidikan dan keterampilan para siswa/i, sehingga kelak bisa hidup mandiri, manakala tidak mampu melanjutkan pendidikan ke jentang perguruan tinggi. (a33)

Waspada/Idaham Butarbutar

KEPALA SMK Negeri 1 Lubuk Barumun Bidarlis Nur Rangkuti, S.Pd, MM memberi motivasi kepada siswa dalam melaksanakan praktik belajar, termasuk dalam agribisnis perikanan maupun dalam busana dan butik.

P. SIDIMPUAN (Waspada): Putusan hasil sidang Majelis Hakim Pengadilan Agama (PA) Padangsidimpuan pada persidangan hak asuh anak di ruang sidang Pengadilan Agama Padangsidimpuan, Kec. Sidimpuan Tenggara, Rabu (5/2) bertentangan dengan hukum Kompilasi Islam pasal 105. Demikian Masniarty Siagian, SE ibu kandung Rafli Ardiansyah, 11,dan Faiz Alfiansyah, 2, dalam banding yang diajukan 11 Februari 2014, karena majelis hakim menolak anak berumur 11 dan 2 tahun diasuh ibu kandungnya, sedangkan ibu kandung adalah seorang Pegawai Negeri Sipil (PNS) dan sanggup untuk mengasuh anaknya Sebelumnya, Ketua Majelis hakim, Dra. Rabiah Nasution, serta hakim anggota, Dra. Emmafatri, SH, MH dan Drs. H. Ahmad Rasidi, SH, MH, panitera pengganti, ABD. Rasyid, S. Ag dengan nomor perkara 194/Pdt.P/2013/PA.Pspk Tanggal 5 Februari 2014. Pertimbangan putusan Majelis Hakim berdasarkan kepentingan dan kebaikan serta kenyamanan kedua orang anak penggugat dan tergugat sesuai amanah dari pasal 41 hurup (a) Undang-undang No 1 tahun 1974 Hasil keputusan itu, pihaknya merasa keberatan, dimana pada pasal berbunyi pemeliharaan anak yang belum mumayyiz atau belum berumur 12 tahun adalah hak ibunya, namun hakim menolak memberikan hak asuh kepada ibu kandung. “Putusan bertentangan dengan kompilasi

hukum Islam, seharusnya hak asuh jatuh kepada ibu“kataMasniarty,saatmendatangikantorharian umum Waspada Perwakilan Tapanuli, Kec. Sidimpuan Selatan, Selasa (18/2). Kata Masniarty, pihaknya telah melakukan banding terhadap putusan persidangan, banding sudah di terima oleh Panitera Pengadilan Agama Kota Padangsidimpuan, H. Sugeng Heriono, SH, pada selasa (11/2), dan akan dilanjutkan ke PengadilanTinggiAgamaProvinsiSumateraUtara. “Untuk membatalkan putusan Pengadilan AgamaP.Sidimpuan,sertamenolakputusanhakim pada poin 3 dan 5 dan sekaligus menghukum tergugat untuk membayar semua ongkos dan biaya yang timbul dalam perkara ini, “ jelasnya. Masniarty berharap, agar Majelis Hakim Pengadilan Tinggi Agama Medan memeriksa dan mengadili perkara tersebut, sehingga menerima putusan banding dari pihaknya dalam pokok perkara poin 3 dan 5. Disampaikannya,pihaktergugatberkilahtidak melarang anaknya berjumpa dengan dirinya, namun pada kenyataannya setelah perceraian tersebut, anaknya yang berumur 2 tahun sama sekali tidak dapat dipertemukannya. Diceritakannya,sebelumdilakukanpersidangan perkara, Ketua Pengadilan Agama Padangsidimpuan, H. Riswan Lubis, telah melakukan mediasi, dalam mediasi, pihak Pengadilan Agama lebihmengacukepadapasal105Kompilasihukum Islam. Namun pada hasil putusan berbeda jauh dengan yang disampaikan saat mediasi. (a26)

Penyaluran Raskin Jangan Disalahgunakan GUNUNGSITOLI (Waspada):Wali Kota Gunungsitoli, Drs. Martinus Lase, MSP meminta seluruh aparat kecamatan dan desa/kelurahan di Kota Gunungsitoli agar tidak menggunakan momen penyaluran beras untuk rakyat miskin (Raskin) untuk kepentingan pribadi/golongan, apalagi untuk kepentingan pemilu yang akan datang. Dia berharap tim koordinasi pengelolaan Raskintahun2014ditingkatKecamatandanDesa/ Kelurahandapatmelaksanakantugasdenganbaik. Wali Kota Gunungsitoli, Drs. Martinus Lase, MSP menyampaikan itu dalam rapat koordinasi penyaluran program Raskin tahun 2014 di wilayah KotaGunungsitoliyangdilaksanakanAulaSamaeri, KantorWali Kota Gunungsitoli, Senin (17/2). Martinus mengatakan, pelaksanaan rapat koordinasi penyaluran program beras untuk rakyat miskin tahun 2014 merupakan salahsatu bentuk transparansi Pemerintah Kota Gunungsitoli. Menurutnya, hal tersebut dilakukan karena program beras untuk rakyat miskin mempunyai subsidi yang bertujuan untuk meningkatkan kesejahteraan masyarakat khususnya rumah tangga miskin. Wali Kota Gunungsitoli menyebutkan, jumlah rumah tangga sasaran penerima manfaat (RTS-

PM) dan kuota beras untuk rakyat miskin tahun 2014 di Kota Gunungsitoli tidak ada perubahan dengan tahun lalu, yakni 13.612 RTS-PM dan kuota beras 2.450.160 kg. Sebelumnya,AsistenISetdaKotaGunungsitoli Bagian Pemerintahan, Oimonaha Waruwu menjelaskan jika pendistribusian beras untuk rakyat miskin tahun 2013 sudah terlaksana seratus persen. Oimonaha mengungkapkan untuk memotivasi koordinator yang bertugas menyalurkan beras untuk rakyat miskin tahun 2014 dapat melaksanakan tugas dengan baik, Pemerintah Kota Gunungsitoli akan menggelar program Raskin Award Kecamatan terbaik dalam pendistribusian beras untuk rakyat miskin. Kabag Perekonomian Setda Kota Gunungsitoli, Yohanes Yasarudi Halawa menjelaskan program pemerintah yang dicanangkan pada akhir t 2013 yang berencana menambah kuota beras untuk rakyat miskin dari 15 Kg/KK menjadi 20 Kg/KK pada tahun 2014 tidak jadi diberlakukan. Hal tersebut ditegaskan surat Menteri Koordinator BidangKesejahteraanRakyatnomorB-189/MENKO/ KESRA/XII/2013tanggal16Desember2013perihal pagu Raskin Provinsi tahun 2014. (a25)


Sumatera Utara

B4 WASPADA Pemimpin Umum Dr. Hj. Rayati Syafrin Pemimpin Redaksi/Penanggung Jawab H. Prabudi Said Wakil Pemimpin Umum/Wapemred H. Teruna Jasa Said Wakil Penanggung Jawab H. Sofyan Harahap Redaktur Senior H. Azwir Thahir Pemimpin Perusahaan: Dr. Hj. Rayati Syafrin. Wakil Pemimpin Perusahaan: H. Bahtiar Tanjung. Iklan: Hj. Hilda Mulina (Kabag), Rumondang Siagian (Medan), Lulu Lusia Damayanti (Jakarta). Redaktur Pelaksana Opini & Artikel: Dedi Sahputra. Redaktur Minggu & Akhir Pekan: Muhammad Thariq. Redaktur Berita: H. Halim Hasan, Hendra DS. Redaktur Medan: David Swayana. Redaktur Sumatera Utara: H.T. Dony Paridi. Redaktur Aceh: H. Akmal AZ. Redaktur Luar Negeri: H. Muhammad Joni. Redaktur Nusantara: H. Halim Hasan. Redaktur Olahraga: Jonny Ramadhan Silalahi. Redaktur Ekonomi: Zulkili Harahap. Redaktur Agama: H. Syarifuddin Elhayat. Litbang: H. Akmal AZ (Kabag). Humas: H. Erwan Efendi (Kabag), Aidi Yursal. Promosi: Edward Thahir (Koordinator). Sekretaris Redaksi: Hj. Hartati Zein. Pemasaran: Zultamser. Asisten Redaktur: Irwandi Harahap (Medan); Irham Hagabean Nasution (Sumatera Utara); Armansyah Thahir (Sumatera Utara, Otomotif); Diurna Wantana (Aceh); Austin Antariksa (Olahraga, KMS Kreasi); Syafriwani Harahap (Luar Negeri, Popular, Pariwisata); Rudi Faliskan (Berita); Erwin Siregar (Opini); Hj. Hoyriah Siregar (Ekonomi); T. Junaidi (Hiburan); Hj. Erma Sujianti Tarigan (Agama), Hj. Neneng Khairiah Zen (KMS Remaja, Mode); Anum Purba (Keluarga); David Swayana (Infotainmen); Hj. Ayu Kesumaningtyas (Kesehatan); Dedi Riono (Budaya); Denny Adil (Pelangi), Hang Tuah Jasa Said (Potret). Wartawan Kota Medan: Umum: H. Amir Syarifuddin, Ismanto Ismail, Rudi Arman, Zulkili Darwis, H. Abdullah Dadeh, H. Suyono, Hj. Ayu Kesumaningtyas, Feirizal Purba, Gito AP, M. Ferdinan Sembiring, M. Edison Ginting, Anum Purba, Sahrizal, Sulaiman Hamzah, Sugiarto, Rustam Efendi, Mursal Alfa Iswara, Andi Aria Tirtayasa. Olahraga: Austin E. Antariksa, H. Syahputra MS, Setia Budi Siregar, Dedi Riono. Fotografer: Muhammad Faisal, Hang Tuah Jasa Said, Surya Efendi, Rizky Rayanda. Otomotif: Armansyah Thahir. Koran Masuk Sekolah/KMS: Arianda Tanjung, Dio Utama. Wartawan Jakarta: Andi Yanto Aritonang (Koordinator Liputan), Hermanto, H. Ramadhan Usman, Hasriwal AS, Nurhilal, Edi Supardi Emon, Agus Sumariyadi, Dian Warastuti, Aji K, Yuslan Kisra. Wartawan Sumatera Utara: Binjai: H. Riswan Rika, Nazelian Tanjung. Deli Serdang: H.M. Husni Siregar, Hotma Darwis Pasaribu, Rizaldi Anwar, M. Suhandi Nasution. Serdang Bedagai: Eddi Gultom, Edi Sahputra. Stabat: H. Ibnu Kasir, Abdul Hakim. Pangkalan Brandan: Chairil Rusli, Asri Rais. Kabanjahe/ Berastagi: Dickson Pelawi, Basita Bukit, Dedek Mohan Basri Hasibuan, Micky Maliki. Tebingtinggi: Muhammad Idris, Abdul Khalik. Pematangsiantar: Mulia Siregar, Edoard Sinaga. Simalungun: Hasuna Damanik, Balas Sirait. Aek Kanopan: Indra Muheri Simatupang, Syahril Ilham. Rantau Prapat: Armansyah Abdi, Neirul Nizam, Budi Surya Hasibuan. Kota Pinang: Hasanuddin Harahap, Deni Syafrizal Daulay. Pangururan: Edison Samosir. Balige: Jimmy Sitinjak. Sidikalang: Natar Manalu. Tarutung: Parlindungan Hutasoit. Sibolga/Tapanuli Tengah: Alam Satriwal Tanjung. Padangsidimpuan: H. Syarifuddin Nasution, Sukri Falah Harahap, Ahmad Cerem Meha. Gunung Tua: Sori Parlah Harahap. Sibuhuan: Idaham Butarbutar, Syarif Ali Usman. Panyabungan: Munir Lubis, Sarmin Harahap, Alpin Lubis. Gunung Sitoli: Bothaniman Jaya Telaumbanua. Kisaran: Nurkarim Nehe (Koordinator Liputan Asahan, Batubara & Tanjungbalai), Bustami Chie Pit, Sapriadi. Batubara: Helmy Hasibuan, Agus Diansyah Hasibuan, Sahril, Iwan Hasibuan. Tanjung Balai: Rahmad Fansur Siregar, Rasudin Sihotang. Wartawan Aceh: Banda Aceh: Aldin Nainggolan (Ka Perwakilan/Koordinator Liputan), Muhammad Zairin, Munawardi Ismail, Zafrullah, T. Mansursyah, T. Ardiansyah, Jaka Rasyid, Gito Rollies, H. Rusli Ismail, Arman Konadi. Aceh Besar: Iskandarsyah. Lhokseumawe: Bustami Saleh (Ka Perwakilan/Koordinator Liputan), Zainal Abidin, Zainuddin Abdullah, Maimun, Arafat Nur. Kuala Simpang: Muhammad Hanaiah. Langsa: H. Syahrul Karim, H. Ibnu Sa’dan, H. Samsuar, Dedek Juliadi. Lhoksukon: Musyawir, Mustafa Kamal. Idi: Muhammad H. Ishak. Bireuen: HAR Djuli, Amiruddin, Abdul Mukti Hasan. Takengen: Bahtiar Gayo, Irwandi. Sigli: Muhammad Riza. Sabang: T. Zakaria Al-Bahri. Subulussalam: Khairul Boang Manalu. Tapaktuan: Zamzamy Surya. Blangpidie: Sudarmansyah Putra. Kutacane: Mahadi Pinem, Ali Amran. Blangkejeren: Jasvira Sautisa. Bener Meriah: Khairul Akhyar. Singkil: Tarmizi Ripan, Mansurdin.

Semua wartawan WASPADA dilengkapi kartu pers yang sah, ditandatangani Pemimpin Redaksi 

Hubungi kami Penerbit: PT Penerbitan Harian Waspada Komisaris Utama: Tribuana Said Direktur Utama: dr. Hj. Rayati Syafrin, MBA, MM SIUPP: 065/SK/MENPEN/SIUPP/A.7/198 tanggal 25 Februari 1988 Anggota SPS No. 13/1947/02/A/2002 KANTOR PUSAT Jalan Letjen Suprapto/Brigjen Katamso No. 1 Medan 20151 Tel: (061) 4150858, Faks Redaksi: (061) 4510025, Faks Tata Usaha: (061) 4531010. E-mail Redaksi: redaksi@waspadamedan.com KANTOR PERWAKILAN DAN BIRO  Perwakilan dan Biro Jakarta: Jalan Siaga II No. 6 C Pejaten Barat, Pasar Minggu Jakarta Selatan. Tel: (021) 79197052, Faks: (021) 79199874.  Perwakilan dan Biro Banda Aceh: Jalan Ratu Syaiatuddin No. 21 C, Banda Aceh. Tel & Faks: (0651) 22385.  Perwakilan dan Biro Lhokseumawe: Jalan Iskandar Muda No. 65, Lhokseumawe. Tel: (0645) 42109.  Biro Asahan, Batubara & Tanjungbalai: Jalan Sutami No. 30 Kisaran. Tel: (0623) 41412. Harga iklan per mm kolom: Hitam-putih Rp. 13.000,-, berwarna Rp. 36.000,Halaman depan: hitam-putih Rp. 39.000,-, berwarna Rp. 108.000,Ukuran kolom: 40,5 mm. E-mail Iklan: iklan@waspadamedan.com Pencetak: PT Prakarsa Abadi Press, Jalan Sidorukun Medan. Isi di luar tanggung jawab percetakan

Tewas Ditabrak Truk Usai Nonton Balap Liar PEMATANGSIANTAR (Waspada): Seorang remaja putri, korban Rizki Wardani Nasution, 16, pelajar SMK, warga Jalan Handayani, Kel. Bah Kapul, Kec. Siantar Sitalasari, Kota Pematangsiantar tewas sesudah sepedamotor ditumpanginya diduga tergelincir dan ditabrak satu unit truk tronton. Informasi dihimpun menyebutkan korban tewas sesudah sepedamotor Honda Vario BK 4326 WAB dikemudikan temannya Jean Febri S, 16, warga Jalan Pelopor, Kelapa Dua, Kel. Bah Sorma, Kec. Siantar Sitalasari tergelincir di tikungan JalanTuan Rondahaim Saragih, Kel.Tanjung Pinggir, Kec.Siantar Martoba pada Minggu (16/2) pukul 17:00 dan korban selanjutnya ditabrak mobil Mitsubishi Colt Diesel BK 8760 LM yang dikemudikan Surya Ali, 43, warga setempat. Awalnya, Jean mengajak korban menonton balapan liar di jalan didepanterminalTanjungPinggirdanmenjemputnyadipersimpangan jalan ke rumah korban. Usai menonton balapan liar, Jean dan korban berniat pulang dan melaju dari arah Jalan Tuan Rondahaim Saragih. Tiba-tiba, sepedamotor dikemudikan Jean selip di persimpangan jalan ketika sedang menikung dan terjatuh bersama Jean dan korban serta sempat terseret di badan jalan. Saat bersamaan, truk yang datang dari arah berlawanan, langsung menabrak korban yang terjatuh di tengah badan jalan. Korban yang mengalami luka berat di kepalanya, langsung tewas di tempat kejadian, sedang Jean hanya mengalami luka ringan. Informasi itu segera sampai ke Polsek Siantar Martoba yang segera tiba di tempat kejadian dan disusul personil Sat Lantas Polres Simalungun. Sesudah melakukan olah tempat kejadian, korban segera dibawa ke RSUD Dr. Djasamen Saragih untuk divisum, sedang Jean bersama pengemudi mobil truk, sepeda motor Jean dan mobil truk diamankan di Sat Lantas. Kapolres Pematangsiantar AKBP Slamet Loesiono, SIK saat dikonfirmasi melalui Kasubbag Humas AKP Nuriaman Ray Rangkuti, Senin (17/2) menyebutkan, kecelakaan lalulintas yang mengakibatkan satu korban jiwa itu masih dalam proses pemeriksaan. (a30)

WASPADA Kamis 20 Februari 2014

MIN Kotapinang Galang Dana Untuk Sertifikat Lahan Sekolah KOTAPINANG (Waspada): Sejumlah orangtua siswa Madrasah Ibtidaiyah Negeri (MIN) Kotapinang, Kab. Labusel mengeluhkan pengutipan uangRp50 ribu per wali murid untuk biaya pengurusan penerbitan sertifikat lahan sekolah sekolah tersebut. Salah seorang orangtua siswa yangtidakinginnamanyadisebut kepada Waspada, Rabu (19/2), mengaku terkejut saat menerima surat No. Mi.02.07/PP.01.1//2014 yang isinya meminta kepada wali murid untuk memberikan bantuan sukarela sebesar Rp50 ribu untuk biaya pengurusan sertifikat lahan sekolah. Padahal, kata dia, sekolah tersebut merupakan sekolah negeri di bawah naungan Kementerian Agama.

“Tiba-tiba masuk surat yang ditandatangani Komite dan KepalaSekolah,untukmelakukan pembayaran pengurusan sertifikat tanah sekolah tersebut. Memang di dalam surat tersebut tertuliskan infak, tetapi besarnya ditetapkan. Bukannya seikhlas hati,” katanya. Kepala MIN Kotapinang Abdul Fatah SAg yang dikonfirmasi, membenarkan adanya pengutipan tersebut. Namun kata dia,

pengutipan dilakukan berdasarkan rapat komite sekolah. “Pengutipanituuntukpembuatan sertifikat lahan sekolah ini. Karena surat hibah yang ditandatangani pada 19 September 1995 lalu telah hilang dan akan dilakukan pengurusan kembali. Jika sertifikat tidak ada, kita akan sulit mendapatkan bantuan dari kementerian lagi,” katanya. Dijelaskan,hinggasaatinidana yang telah terkumpul sebesar Rp11 juta yang seluruhnya merupakan sumbangan orangtua murid.Sementaralanjutdia,dana yang diperlukan mencapai Rp25 juta. “Kita tidak menekankan. Jika orangtua murid tidak membayar, tidak dipaksakan. Namanya juga sumbangan,” katanya. (c18)

Waspadai Udara Panas TANJUNGBALAI (Waspada): Tingginya suhu udara dan teriknya matahari di Kota Tanjungbalai,selamahampirempatpekan terakhir dikhawatirkan bisa menimbulkan berbagai permasalahan terutama persoalan kesehatan dan bencana kebakaran. Guna menghindari hal yang tidak diinginkan, Kabag Humas Pemko Tanjungbalai Dra. Darul Yana Siregar mengimbau masyarakatsenantiasawaspadadengan menjaga kondisi kesehatan. Ada beberapa hal yang dianjurkan untuk mencegah terjadinya infeksi saluran pernafasan dan penyakit kulit. Antara lain, menggunakan masker karena angin cenderung berhembus kencang saat udara panas sehingga menerbangkan debu. Selain

itu,‘wajibkan’ diri mengkonsumsi air yang cukup terutama saat beraktivitas di luar rumah supaya tidak kekurangan cairan. Kemudian konsumsi buahbuahan segar guna menjaga tubuh tetap bugar dan prima. Jangan lupa mengenakan jaket dan payunguntukmenghindaripanas terik terutama yang beraktivitas di bawah matahari langsung. “Intinya mencegah lebih baik daripada mengobati,” kata Darul Yana. Sementara, Kepala Badan Penanggulangan Bencana Daerah Kota Tanjungbalai Mahdin Siregar melalui Kasi Rehabilitasi dan Rekonstruksi Sofyan ST juga mengimbau agar tidak membuang puntung rokok sembarangan. Sebab, barang dan benda

di sekitar pada musim panas sangat kering, rapuh, dan mudah terbakar. Sofyan juga mengingatkan wargatidakmeninggalkanrumah dalam kondisi kompor dan peralatan elektronik menyala. Kasus kebakaran umumnya disebabkan dua hal di atas dan itu apalagi semakin seringnya terjadi pemadaman beberapa waktu belakangan ini. Pantauan Waspada, meski matahari tertutup kabut asap di langit KotaTanjungbalai, namun udaranya panas menyengat. Banyak warga menggunakan payung,mandidisungai,danmenggunakan lumpur agar terasa dingin. Di sisi lain, dagangan minuman seperti cendol, sop buah, jus, dan air tebu, laris manis. (a32)

PU Bina Marga Tak Juga Perbaiki Lubang Di Jembatan Jalinsum P. BRANDAN (Waspada): LubangdiJalinsumMedan-Aceh tepatnyadijembatankembarKel. Alurdua, Kec. Sei Lepan meski sangat membahayakan keselamatan pengendara, namun hinggakinitakjugadiperbaikipihak DinasPUBinaMargaPemprovsu. Lubang yang terdapat di sisi kananjembataninisudahlamadibiarkanmenganga.Jikapengendara tidak ekstra hati-hati melintas, khususnyamalamhari,dikhawatirkanbisaterpersokkedalamlubang. Pantauan Waspada kemarin, kondisi aspal jalan di lintasan jembatanmenghubungkankedua provinsiini,kerusakannyamerata. Upaya perbaikan atau perawatan yang dilakukan Dinas PU Provinsiselamainitaklebihhanya sebatastambalsulam.Wargayang ditemuidiseputarlokasimengaku kecewa terhadap pemerintah karena tak maksimal melakukan perawatan jalan.(a02/c01)

Bupati Batubara Serahkan Beasiswa Jamsostek LIMAPULUH (Waspada): Bupati Batubara H. OK Arya Zulkarnain, SH, MM menyerahkan secara simbolis bantuan Jamsostek berupa beasiswa dalam bentuk tabungan kepada 40 siswa SD, SMP, SMA/sederajat dan mahasiswa di Limapuluh, Selasa (18/2). Masing-masing penerima mendapatkan bantuan bervariasi Rp1,8 juta s/d Rp2,4 juta dengantotalkeseluruhanmencapaiRp78.600.000. Hadir dan turut menyaksikan penyerahan bantuan beasiswa tersebut, Ketua DPRD Batubara, Selamat Arifin MSi, Dewan Pendidikan beserta Manager PT. Jamsostek Kisaran Asran Pane, S.Sos didampingi staf Erni Veronika dan undangan. Bupati Batubara mengatakan, pendidikan

sebagai pilar utama pembangunan dan secara bersama berkewajiban untuk memajukan bak istilah kata pepatah, tuntutlah ilmu sampai ke negeri China. Artinya prestasi yang telah diraih hendaknyadapatdipertahankandanditingkatkan. Bantuan beasiswa tersebut lanjutnya dapat dipergunakandanmanfaatkandenganbaikdalam menunjang kemajuan pendidikan. Manager PT. Jamsostek Kisaran Asran Pane menyebutkan, penyerahan beasiswa merupakan agenda rutin tahunan, melalui proses pengajuan. Beasiswa diberikan dengan nilai bervariasi, untuk SD dan SMP Rp1,8 juta atau dengan perhitungan kebutuhan Rp150.000/bulan. Sedangkan SMA dan mahasiswa, Rp2,4 juta untuk setahun. (a13)

Seluruh Instansi Tidak Kesampingkan K3 LIMAPULUH (Waspada): Bupati Batubara H. OK Arya Zulkarnain, SH, MM mengharapkan seluruh instansi untuk tidak mengesampingkan pentingnya keselamatan dan kesehatan kerja. “Aturan ini telah dibuat untuk melindungi hak seluruh pekerja dan buruh sehingga tidak ada alasan bagi perusahaan untuk tidak melaksanakan,” tukas Bupati pada upacara peringatan Hari Keselamatan dan Kesehatan Kerja (K3) di lapangan Dolok Estate, Limapuluh, Selasa (18/2). Selain K-3, juga upaya peningkatan kualitas Sumber Daya Manusia (skill) sebagai salahsatu

tantangan di sektor ketenagakerjaan saat ini. “Seluruh perusahaan harus memberikan perhatian, termasuk peningkatan kualitas melalui pelatihan ketenagakerjaan dan diklat baik dilaksanakan swasta maupun pemerintah,” ujarnya. Kepala Dinas Tenaga Kerja Erynaldo menyampaikan, peringatan K-3 dilaksanakan setiap tahun. Pemkab Batubara akan selalu mengingatkan seluruh perusahaan yang ada untuk mengacu pada peraturan perundang-undangan yang mengatur tentang keselamatan kerja diantaranya UU No.1 Tahun 1970. (a13)

Pramuka Membina Kader Berkepribadian

Waspada/Asrirrais

LUBANG di jembatan Jalinsum Alurdua, Kec. Sei Lepan, siap menelan korban.

4 Minggu Bertahan Hidup Tanpa Batok Kepala TANJUNGBALAI (Waspada): Diprediksi hanya mampu bertahan selama enam hari, bayi lahir tanpa tempurung kepala hingga kini masih menunjukkan tandatanda kesehatan yang membaik. Setelah dirawat intensif di RSUD Tanjungbalai, bayi itu akhirnya dirujuk ke RSU Adam Malik Medan, Rabu (19/2). Annisa Faiha Siregar, putri pertama dari pasangan M. Abdul Karim Siregar dan Hamni Sihombing, lahir 24 Januari 2014 lalu di salahsatuklinikdiKisaranmelalui operasi caesar dengan berat badan 2,2 kilogram. Begitu lahir, Annisa langsung dirujuk ke RSU Kartini atau Katarina Kisaran dan menjalani perawatan selama seminggu, baru selanjutnya dibawa ke rumah di Jl. HM.Nur, Kel. Pahang, Kec. Datukbandar, Kota Tanjungbalai. “Selama tujuh hari di rumah, tiba-tiba wajahnya membiru dan kesulitan bernafas sehingga kami larikan ke RSUD Tanjungbalai,” kata keluarganya, Raja Palti Siregar, kepada Waspada di RSUD Tanjungbalai.DiRSUDmilikPemkoTanjungbalaiitu,Annisakembali mendapatperawatanintensifdan ditempatkan di dalam inkubator. Untukmemenuhiasupangizinya, paramedis memberikan susu melalui alat bantu, begitu juga denganobat-obatansehinggabertahan selama empat minggu. “Kata dokter, kasus seperti ini jarang terjadi. Biasanya bayi penderita ancepalus atau tidak memiliki batok kepala hanya bertahan seminggu, tapi kenyataannyaAnnisamasihbertahanhingga hari ini,” ujar Palti. Oleh sebab itu, tatkala dokter menyarankan untuk dirujuk ke RSU Adam Malik, menurut Palti, keluargalangsungmenyetujuinya dengan harapan Annisa bisa bertahanlebihlama. “Masihbesar peluang hidupnya, sebab kata

Waspada/Iwan Has

BUPATI Batubara H OK Arya Zulkarnain, SH, MM ketika menyerahkan bantuan beasiswa Jamsostek dalam bentuk tabungan di Limapuluh.

dokter detak jantung juga baik,” kata Palti. Spesialis anak yang menangani Annisa, dr.Johan,SpA mengakui penderita ancepalus atau anensefali biasanya hanya lima persen yang mampu bertahan hidup seperti Annisa. Hanya saja menurut Johan, ada sedikit perbedaan dengan kasus lainnya. Annisa, sebut Johan, kendati lahir tanpa batok kepala, namun memiliki jaringan otak yang berada di luar, sedangkan bayi ancepalus lainnya kebanyakan tidak memiliki jaringan otak sehingga tak mampu bertahan lama. Lebih lanjut dikatakan Johan,

berdasarkan teori medis, anak lahir tanpa tempurung kepala, ada beberapa faktor pemicunya. Di antaranya, saat dalam kandungan, anak tersebut kurang mendapat asupan gizi yang baik, dan kekurangan asam folat. Sementara, pasangan M.Abdul Karim Siregar dan Hamni Sihombing hanya bisa pasrah dengan kondisi anak pertamanya ini. “Hanya bisa pasrah dengan kondisiini.Mudah-mudahanada perhatian Pemerintah untuk membantu kami, “ ujar Karim saathendakmeninggalkanRSUD Tanjungbalai menuju RSU Adam Malik Medan. (a14)

SIBUHUAN (Waspada): Gerakan pramuka membina kader berkepribadian luhur sebagai penerus bangsa, karena melalui kegiatan kepramukaan akan ditanamkan nilai-nilai sebagaimana yang tercantum dalam satya dan darma pramuka. Demikian disampaikan Bupati Padanglawas, H. Ali Sutan Harahap dalam sambutannya pada acara pelantikan pengurus kwartir cabang (Kwarcab) gerakan pramuka Kabupaten Padanglawas di Lapangan SMK Pelita Harapan Kecamatan Lubuk Barumun, Senin (17/2). Dikatakan, melalui kegiatan kepramukaan akan ditanamkan nilai-nilai kewajiban baik terhadap Tuhan, negara, sesame, juga diri sendiri seperti tercantum dalam staya dan darma pramuka, sehingga dapat membentuk kaum muda yang

memilikiwatak,kepribadianyangluhursebagaikader penerus bangsa di masa mendatang. Maka para penguruskwartircabangharusmampumenentukan program yang tepat dan bermanfaat, karena dapat berakibat pada pola pendidikan generasi muda. Sekretaris Kwarcab Pramuka Kabupaten Padanglawas, Zainuddin Hasibuan, S.Pd dalam kesempatan itu manyampaikan ikrar bersama pengurus lainnya bahwa kepengurusan kwarcab gerakan Pramuka Kabupaten Padanglawas masa bakti 2014-2019 siap untuk mengembangkan dan memajukan Pramuka kwarcab Padanglawas. Namun, tetap berharap dukungan semua pihak, baik pemerintah daerah maupun para tokoh pramuka, sehingga kwarcab Pramuka Padanglawas bisa mengukir nama baik daerah baik di tingkat provinsi maupun nasional. (a33)

Waspada/Idaham Butar butar

SEKRETARIS Pramuka Kwarcab Padanglawas membacakan ikrar satya dan darma pramuka, saat upacara pelantikan pengurus kwarcab Padanglawas masa bakti 2014-2019.

Pengumuman Tes CPNS K-2 Di Paluta Belum Jelas

Waspada/Rahmad F Siregar

ANNISA Faiha Siregar yang lahir tanpa tempurung kepala menunjukkan tanda-tanda kesehatan yang baik. Untuk perawatan lebih lanjut, Annisa dirujuk ke RSU Adam Malik Medan, Rabu (19/2).

GUNUNGTUA (Waspada): Pengumuman hasil tes CPNS dari pelamar kategori 2 masih membingungkan sejumlah peserta yang ikut melamar di lingkungan Pemerintah Kabupaten Padanglawas Utara (Pemkab Paluta). Hal itu terlihat dari sistem maupun tata cara penyampaian hasil tes CPNS yang sempat tertunda beberapa kali. Selain itu, pengumuman hasil tes CPNS pun sangat tidak bisa dipahami, karena pengumuman resmi dari BKD Paluta terkait hasil tes CPNS sampai hari ini tak kunjung diumumkan. Padahal, dari berbagai sumber situs di internet, para pelamarsudahbisamengaksesuntukmengetahui nama-nama pemenang dari jalur kategori 2 itu. Pantauan Waspada, dalam seminggu ini, terlihat sejumlah pelamar sibuk mondar-mandir berdatangan ke kantor BKD Paluta di Jalinsum Gunungtua- Padangsidimpuan, Kec. Padangbolak. Salahsatu pelamar yang enggan namanya dimuatmengakumerasabingungdengantatacara penyampaian hasil tes pengumuman dari tenaga honorer kategori 2. “Jujur, aku bingung. Dari BKD pengumumannya belum ada, sedangkan di internet sudah keluar pengumumannya, ada apa ini,” ujarnya. Plt Sekda Paluta Drs Hailullah Harahap MM dikonfirmasi terkait pengumuman ini meminta kepada peserta agar bersabar dalam menunggu

pengumuman resmi dari Pemkab melalui BKD Paluta. Hailullahmengakubelummendapatpetunjuk dan teknis tatacara penyampaian hasil tes CPNS dari K2 itu untk di umumkan kepada masyarakat, sebab jika nanti sudah ada pengumumannya, panitia melalui BKD akan menyampaikannya secara resmi dan akan dimuat di media cetak. Di lain hal, Daftar pengumuman CPNS (Calon Pegawai Negeri Sipil) kategori dua (K2) yang diumumkan melalui website menimbulkan keresahan bagi masyarakat. Pasalnya sejumlah nama yang tercantum dalam pengumuman K2 itu bukanlah orang-orang yang benar mengabdi terhadap negara khususnya di lingkungan Disdik (Dinas Pendidikan) maupun lingkungan Pemkab Paluta. Dalam pengumuman melalui website itu nama-nama yang tercantum dalam pengumuman K2 di bukanlah orang yang bekerja atau mengabdi di sekolah atau di dinas tersebut. “Kami sudah telusuri, ternyata semua nama yang tercantum dalam pengumuman K2 itu diduga rekayasa dan harus ditinjau ulang,” kata Ketua Perwada Paluta Darwin Siregar kepada Waspada, Selasa, (18/2). Menurutnya pengumuman itu tidak mengedepankan asas kepastian hukum dan akan mengikis kepercayaan masyarakat terhadap pemerintah. (a35)


WASPADA Kamis 20 Februari 2014

SUARA AKADEMIK

Kasus Ijazah Kepala Daerah Di Sumut SALAH satu persyaratan pokok untuk ikut mencalonkan diri sebagai calon kepala daerah seperti yang ditetapkan oleh Komisi Pemilihan Umum (KPU), harus memiliki ijazah asli, sebagai bukti surat tanda tamat belajar. Dalam konteks ini, sebelum meloloskan seseorang menjadi calon, sebagai penyelenggara pemilihan umum kepala daerah (pemilu kada), KPU dituntut untuk harus cermat dan teliti, memeriksa keaslian ijazah yang diberikan dan jika dicurigai KPU harus melakukan chek and richek dan investigasi mendalam untuk mencari kebenaran. Jika ijazah aslinya hilang atau terbakar, yang bersangkutan harus meminta surat pengganti ijazah ke sekolahnya setelah terlebih dahulu meminta surat keterangan hilang atau terbakar dari kepolisian. Selain itu, surat keterangan hilang tidak boleh dua kali keluar, apa lagi di tempat yang berbeda. Jika persyaratan tentang ijazah ini tidak dapat dipenuhi sebagaimana mestinya, maka tidak ada alasan KPU untuk tidak menggugurkannya sebagai calon. Oleh karena, KPU tidak boleh bermain api, karena sebagai penyelenggara pemilu kada, pasal 2 UU No 15 tahun 2011 tentang penyelenggaraan pemilu telah menegaskan bahwa KPU harus berpedoman pada asas: mandiri, jujur, adil, kepastian hukum, tertib, kepentingan umum, keterbukaan, proporsionalitas, profesionalitas, akuntabelitas, efisiensi dan efektivitas. Justru yang menjadi pertanyaan kita sebagai masyarakat kebanyakan, begitu ketatnya persyaratan KPU khusus tentang ijazah, namun masih ditemukan kasus ijazah kepala daerah yang bermasalah dan sampai ke Pengadilan Tata Usaha Negara (PTUN) meskipun sudah dilantik. Padahal, jika KPU benar-benar melaksanakan tugas sebagaimana diamanahkan undang-undang, kasus itu tidak akan pernah terjadi. Jika alasannya karena kekhilapan atau kelalaian, semakin sulit diterima akal sehat, sebab rentang waktu proses pencalonan kepala daerah bukan seperti main catur, tetapi memakan waktu berbulan-bulan, sehingga memiliki waktu dan ruang yang cukup pula untuk tidak terjadinya kekhilapan dan kelalaian. Apalagi personil KPU bukan hanya ketua, tapi secara kolektif dilaksanakan oleh lima komisioner dan semua keputusan pastilan diambil melalui rapat pleno bukan bermusyawarah dengan diri sendiri (intrapersonal). Jika tidak karena kelalaian dan kekhilapan, mengapa KPU meloloskan calon kepala daerah yang memiliki ijazah bermasalah. Kita menduga, dalam konteks ini sudah terjadi persekongkolan jahat untuk melolosakan yang harusnya tidak boleh lolos. KPU tidak lagi melaksanakan tugas sebagaimana diamanahkan undangundang, sehingga peraturan diabaikan dan diganti dengan keinginan. Sangat tidak mungkin kalau KPU tidak mengetahui mana yang disebut surat pengganti ijazah atau surat keterangan hilang atau terbakar dari kepolisian, jika tidak tahu harus bertanya kepada ahlinya. Jadi, tidak hanya dengan menunjukan surat keteranganhilangatausuratketeranganpernahsekolahdansuratpengganti ijazah lantas KPU menerima bersangkutan menjdi calon. Kita berharap PTUN yang mengadili kasus ijazah kepala daerah benar-benar meneliti persoalan yang sesungguhnya terjadi, tidak menerima begitu saja pernyataan karena kekhilapan dan kelalaian. Jika salah, katakan salah meskipun calon bersangkutan sudah dilantik menjadi kepala daerah, jangan takut dengan berbagai tekanan. Sebagi penyelanggara pemilu, KPU juga dapat dituntut karena melakukan tindak pidana merugikan hak orang lain, meloloskan yang tidak memenuhi syarat dengan memanfaatkan kekuasaan. Begitu juga kepala daerah bersangkutan bukan hanya digugurkan haknya sebagai kepala daerah tapi juga dapat dituntut secara hukum dengan tuntutan bersekongkol hingga merugikan hak orang lain. Semoga.

SOSOK

OK Saidin: Doktor Disangka Dokter SOSOK dosen Fakultas Hukum Universitas Sumatera Utara (FK USU) ini memang tidak terlalu agresif, namun keberadaannya tidak hanya dikenal di kalangan kampus tapi juga di tengah-tengah masyarakat di luar kampus. Ayah dari empat orang anak ini, di mata masyarakat Batubara dikenal sebagai salah seorang pejuang yang ikut membidani lahirnya Kabupaten Batubara. Gagasan, fikiran dan pandangannya selalu bernas dan jauh ke depan untuk bagaimana memajukan kampung kelahirannya. Kesungguhannya untuk terus aktif dalam memisahkan Batubara dari Kabupaten Asahan, menjadikan Dr. OK. Saidin, SH, MH (foto) semakin dikenal dalam komunitasnya. Pengorbanannya bukan hanya dalam bentuk moral tapi juga material dan senantiasa di kenang masyarakat Batubara Begitu juga kedekatannya dengan masyarakat, tidak melihat latar belakang. Semua lapisan bahkan menjadi sahabat semua etnis. Ini karena sosoknya yang komunikatif. Bersahabat tidak memilih, karena itu bagian dari membangun silaturrahim. Pria berkulit sawo matang ini sukses menyelesaikan pendidikan dasar di SDN No. 2 di tanah kelahiran Tanah Hitam Hulu, Kabupaten Batubaram, SMPN di Limapuluh, dan SMAN 8 Medan. Tak hanya di situ, putra kelahiran Kampung Torap, 13 Februari 1962 ini meneruskan pendidikan S-1 di Fakultas Hukum (FH) USU, S2 KPK UGM/USU dan S-3 FH USU. OK. Saidin menceritakan pengalamannya setelah menyandang gelar doktor. Ketika itu teman dari kampung Batubara memberikan ucapan selamat dan ingin bertemu setelah mendapat kabar darinya menyandang gelar doktor. Ketika bertemu, teman mengucapkan selamat dan meminta dirinya diobati karena sedang sakit. Mendengar permintaan itu, suami dari Syarifah Sufina, SH ini tidak dapat berbicara banyak. OK Saidin paham kalau tamunya itu berfikir S-3 yang disangdangnya adalah bidang kesehatan bukan keilmuan, sehingga minta pengobatan. “Jadi, saya kasih aja vitamin,” tutur OK Saidin. Sebagai sosok yang dikenal, mantan calon bupati Batubara tahun 2008 ini pernah menjadi Ketua HMI Cabang Medan Bidang Kemahasiswaan , Wakil Ketua Bidang Cendikiawan AMPI Sumut, Wakil Sekretaris KAHMI Sumut, Sekjen MABMI. Kini Dr. OK. Saidin terus berkiprah memberikan kontribusi terbaik di kampus untuk membangun generasi yang lebih baik. Bagi OK Saidin menuntut ilmu tidak ada batasannya, karena hal itu harus dilakukan sepanjang hidup. (m26)

Golput No, Awasi Yes By: Rizki Syahputra, Mahasiswa IAIN SU PERAN pemuda dalam kehidupan berbangsa dan bernegara selalu berada di garda terdepan sebagai pengawal dinamika kehidupan bangsa. Dari berdirinya negeri ini hingga harus berjibaku mengawal rezim politik penguasa. Pemuda selalu memberi kontribusi signifikan bagi perkembangan negara. Akan tetapi, saat ini sedikit sekali pemuda yang masih teguh mengawasi jalannya pemerintahan, kecuali mereka adalah pemuda-pemudi yang tergabung dalam gerakan mahasiswa. Bahkan pemuda-pemudi kita mulai enggan dengan urusan yang menyangkut politik. Diawal tahun 2014 ini menjadi momentum untuk kita semua sebagai pemuda, dimana tahun-tahun yang lalu kita melalui detik demi detik, jam demi jam, hari demi hari, minggu demi minggu, bulan demi bulan kita habis kan dengan kesibukan-kesibukan, mau itu kebaikan dan keburukan yang tanpa kita sadari kita lakukan. Menjadi pemuda memang gampang, tapi tidak segampang

Universitaria B5 Guru Besar USU Pengabdian Masyarakat Di Bagan Percut MEDAN (Waspada): Sebanyak 60 lebih guru besar dan lima dekan Univesitas Sumatera Utara (USU) dipimpin Prof. Dr. Dharma Bakti, MS melaksanakan pengabdian masyarakat dalam bentuk ceramah, latihan dan pembinaa ekonomi masyarakat di Bagan Percut Sei Tuan, Kabupaten Deli Serdang, baru-baru ini. Menurut Prof Dharma, kehadiran para guru mencerminkan masih memiliki jiwa pengabdian yang tinggi, hanya selama ini belum dikoordinir dengan baik. Karena itu, hal-hal seperti ini sangat perlu diperhatikan dan ditingkatkan agar para guru besar lebih merasakan keadaan kehidupan masyarakat. Pengabdian masyarakat merupakan salah satu kewajiban guru besar/dosen perguruan tinggi mentransfer ilmu pengetahuan yang dimilikinya dalam rangka meningkatkan pengetahuan dan keterampilan masyarakat, sehingga dapat meningkatkan kesejahteraan

masyarakat itu sendiri. “Insya Allah kalau saya menjadi Rektor USU 2014 program ini akan saya tingkatkan,” tutur Prof. Dharma. Dia juga menyebutkan, berbagai program yang dilakukan harus mampu menyentuk langsung kehidupan masyarakat seperti pembinaan budidaya perikanan, pertanian, pengolahan kimia yang berkaitan dengan kulit udang dan pelatihan organisasi/keluarga dan masyarakat. Ramli, tokoh masyarakat Bagan Percut Sei Tuan, merasa senang dan kagum atas kehadiran guru besar USU di sini dan ramai sekali untuk membina masyarakat dan sangat membanggakan. Dari perbincangan yang saya dengar, kata Ramli, ketua rombongan Prof. Dr. Dharma Bakti, MS akan mencalonkan diri sebagai pemimpin USU, kami dan seluruh anggota masyarakat Medoakan semoga Allah SWT merealisasikan tujuan yang dicita-citakan, sehingga kerajasama ini dapat terjalin lebih baik dan terprogram.(m26)

Waspadsa/Ist

PARA guru besar dan enam dekan USU berfoto bersama dengan masyarakat Bagan Percut Sei Tuan.

Kelompok Berseragam Larikan Berkas FK UISU

Unpri Dukung Program Kesehatan Nasional

MEDAN (Waspada): Fakultas Kedokteran Universitas Islam Sumatera Utara (FK UISU) Medan Jalan SM Raja Medan kehilangan satu map berisi berkas pentingn setelah dilarikan komplotan berseragam security dan sempat mengusai kampus beberapa saat, Rabu (19/2). Sekira pukul 6.30 hingga 8.00 Wib, komplotan berseragam biru dongker mengusai FK UISU SM Raja Medan dan melarang mahasiswa untuk masuk

MEDAN (Waspada): Ketua PembinaYayasan Universitas Prima Indonesia (Unpri) dr I Nyoman Ehrich Lister M.Kes, AIFM mengatakan, dalam rangka pembangunan nasional berkesinambungan, dibutuhkan masyarakat yang sehat, cerdas, terampil, menguasai ilmu pengetahuan dan teknologi. I Nyoman menyebutkan, untuk mencapai masyarakat yang sehat, selain pola hidup sehat, dibutuhkan fasilitas kesehatan dan tenaga kesehatan dari berbagai bidang ilmu dan jenjang pendidikan serta peran masyarakat. Unpri ikut bertanggung jawab mendukung program pemerintah, dalam mengisi kebutuhan tenaga kesehatan, dengan mendirikan fakultas-fakultas ilmu kesehatan, antara lain fakultas kedokteran, fakultas kedokteran gigi, fakultas kesehatan masyarakat, fakultas keperawatan dan kebidanan serta fakultas psikologi. “Semua fakultas tersebut, telah menghasilkan alumni,” kata I Nyoman Ehrich Lister dalam peresmian Rumah Sakit Pendidikan Royal Prima yang dilakukan oleh Wakil Gubernur Sumatera Utara HT Erry Nuradi, di Jalan Abdul Hamid/Ayahanda Medan, Minggu (16/2). Acara tersebut dihadiri Ketua Yayasan Unpri A.G Subrata SH, Ketua Badan Pelaksana Harian (BPH) Unpri Tommy Leonard SH MKn, Direktur Utama RS Royal Prima dr. Deli Theon Sp.Pk MARS, Kapoldasu diwakili Wasis Murjito, Koordinator Kopertis Wilayah I Sumut-NAD Prof Dian Armanto, Kepala Dinas Kesehatan Provinsi Sumut, Ketua PN Jakarta Utara, Rektor Unpri Prof dr Djakobus Tarigan AAI, DAAK, Wakil Rektor I Prof DR Monang Panjaitan drg MS MA, Wakil Rektor II Unpri Ermi Girsang SKM, MKes, Wakil Dekan I Fakultas Ekonomi Hendry SE MM, Wakil Dekan III FK Unpri Dr Ali Napiah Nasution dan Ka Humas Unpri Ramli J Marpaung SH. Menurutnya, dari keunggulan yang dimiliki tersebut akan menghasilkan pengobatan yang lebih baik dan survive rate yang lebih tinggi. “Atas namaYayasan, saya serahkan penggunaan Rumah Sakit Royal Prima kepada Direktur Rumah Sakit, agar dapat dimanfaatkan sebesar-besarnya untuk kesejahteraan seluruh masyarakat tanpa kecuali,” tegasnya. Pada kesempatan itu,Wagubsu HT Erry Nuradi mengharapkan Rumah Sakit Royal Prima yang terletak di Jalan Abdul Hamid/ Ayahanda Medan ini dapat mendukung terwujudnya pelayanan Rumah Sakit yang berstandar Internasional di Sumatera Utara. “Kita juga mengharapkan Rumah Sakit Royal Prima ini mampu menjadi andalan dalam menuju Medical Tourism di Provinsi Sumut,” ujar Erry Nuradi seraya menyatakan bangga karena Kota Medan sudah memiliki RS baru yang tidak kalah dengan rumah sakit yang ada di Sumut. (m41)

guna melaksanakan perkuliahan. Aparat kepolisian yang mengetahui hal itu berhasil membekul puluhan anggota komplotan dan langsung membawanya ke Poldasu untuk dimintai keterangan. Mahasiswa Semester VII FK UISU, Jimmy, mengaku ada sekira 50 orang anggota komplotan mencoba menghalangi mahasiswa/mahasiswi untuk masuk ke kampus FK UISU Medan, sehingga terjadi dorong-

dorongan pagar. Jimmy juga menjelaskan, pada pristiwa itu terjadi juga penganiayaan terhadapWawan, pegawai klining service, saat ini telah divisum karena terdapat goresan di lehernya. Puluhan anggota komplotan itu juga berhasil merusak pintu masuk ke ruangan administrasi dan pintu masuk dapur fakultas. Rektor UISU Medan Dr. Ir Mhd Asaad, MSi, Pembantu Rektor I, Sofyan, SE, MSi, Pembi-

na Yayasan UISU Medan H T Hamdy Oesman Delikhan Alhajj (gelar Raja Muda) melihat kondisi kamnpus itu.“Saya minta Poldasu mengusut kasus ini dan menindak para pelaku pengambilan berkas,” tegas Rektor. Rektorjugamenyatakanbahwa prosres belajar mengajar dan ujian di FK UISU Medan hingga saat ini berjalan dengan baik,“Integrasi FK UISU Medan adalah ataskehendakmahasiswasendiri, “kata Rektor Mhd Asaad. (m26)

Mahasiswa FE UNA Ikut Latihan Menulis Skripsi MEDAN (Waspada): Fakultas Ekonomi Universitas Asahan (FE UNA) melatih para mahasiswa tentang penulisan skripsi, sebagai langkah tepat memberikan keterampilan bagi calon sarjana dalam mempersiapkan tugas akhir menyelesaikan studinya di FE, Senin (10/2). Rektor UNA melalui Pembantu Rektor I, Ir. Ramlan Tambunan, M.Sc dalam pengarahannya pada acara pembukaan Workshop Penulisan Skripsi FE mengatakan, kegiatan ini merupakan langkah tepat untuk menjawab persoalan yang selama ini dihadapi sebagian besar mahasiswa dalam penulisan skripsi, sehingga mahasiswa mampu melahirkan karya ilmiah tanpa harus mengambil jalan pintas. “Kegiatan ini positif bagi peningkatan kualitas lulusan FE UNA, karena dengan keterampilan dimiliki, mahasiswa akan terhindar mengambil jalan pintas untuk menyelesaikan skripsi mereka,” tegas PR I Bidang Akademik UNA. Dekan FE UNA, Drs Nisfu Fhitri, M.Si mengatakan, Workshop Penulisan Skripsi menjadi tekad dari segenap jajarannya untuk meminimalisir indikasi adanya plagiat yang mungkin saja terjadi, dikarenakan mahasiswa tidak memiliki pengetahuan dan keterampilan bagaimana seharusnya mereka membuat skripsi. “Kami tak ingin skripsi ma-

hasiswa hasil plagiat, karena gelar yang sandang bisa digugurkan termasuk diberhentikan dari pekerjaan dan banyak lagi sangsi yang lain,” kata Nisfu Fhitri. Ketua Panitia Pelaksana Workshop Penulisan SE UNA Tahun Akademik 2013/2014,

Drs. M. Saleh Malawat, MMA didampingi Sekretaris Panitia, M. Anshori, SE melaporkan kegiatan dua hari 10-11 Februari 2014 menyertakan mahasiswa kelas regular dan eksekutif semester delapan. Materi diberikan bab I pen-

dahuluan berisi latar belakang masalah, bab II tentang kajian teoretis, bab III membahas metode penelitian, bab IV tentang hasil penelitian dan pembahasan, babV penutup berisi kesimpulan dan saran serta materi program SPSS. (m26 )

Kopertis Wilayah I Yakin UISU Kembali Eksis

Waspada/Ist

PEMBANTU Rektor I Bidang Akademik UNA, Ir. Ramlan Tambunan, M.Sc didampingi Dekan FE UNA, Drs. Nisfu Fhitri, M.Si dan Ketua Panitia Workshop Penulisan Skripsi FE Ekonomi UNA, Drs. M. Saleh Malawat, MMA secara bersama-sama menyerahkan dokumen secara simbolis kepada peserta workshop, Senin (10/2).

FE UNA Gelar Pelatihan Jurnal Internasional MEDAN (Waspada): Fakultas Ekonomi Universitas Asahan (FT UNA) menggelar Pelatihan Penulisan Artikel Ilmiah Publikasi Jurnal Nasional dan Internasional sebagai upaya meningkatkan motivasi dosen menulis karya ilmiah di jurnal berskala nasional dan internasional di Aula Fakultas Ekonomi Kampus UNA Kisaran, Sabtu (8/2). Rektor UNA melalui Pem-

bantu Rektor II, Dra. Harneny Pane, M.Si pada pembukaan menyampaikan apresiasinya terhadap kegiatan yang digagas FE UNA bekerjasama Tim EDP Universitas Sumatera Utara, pihaknya berharap melalui kegiatan ini dapat meningkatkan motivasi dosen agar melahirkan karya ilmiah sebagai perwujudan Tridharma Perguruan Tinggi. “Kita berharap para dosen

memutarkan telapak tangan. Lihat saja kata-kata dari pemimpin pertama negeri ini “Beri aku 10 pemuda akan ku guncang dunia” begitulah sepenggal katakata bijak dari sang proklamator di negeri ini. Bayangkan beliau ha-nya perlu 10 pemuda untuk mengguncang dunia. Begitu hebatnya pemuda dizaman penjajahan dulu, begitu agresifnya pemuda ketika melawan penjajah di negeri ini. Lantas apakah pemuda saat ini seperti beberapa tahun silam? apakah pemuda saat ini seperti api yang membara ketika negara mereka dijajah? Kalian yang menentukan sendiri karismatik para pemuda. Aku hanya ingin mengatakan pemuda saat ini beda dengan pemuda lima puluh tahun yang lalu. Pemuda saat ini apatis dan matrealistis, ini membuat para pemimpin di negeri ini dengan mudahnya membohongi anak bangsa. Perubahan tahun sudah datang dari 2013 menuju 2014, biasanya banyak orang-orang berharap akan menjadi lebih baik lagi di tahun sebelumnya. Tapi

yang ikut dalam kegiatan pelatihan ini dapat melahirkan karya ilmiah sekaligus dipublikasikan melalui jurnal nasional maupun internasional”, ujar PR II UNA Bidang Administrasi dan Keuangan tersebut. Dekan FE UNA, Drs Nisfu Fhitri, M.Si mengatakan melalui pelatihan ini diproyeksikan lahir karya ilmiah sebanyak mungkin, dan yang tak kalah penting-

nya bagaimana sesegera mungkin melahirkan jurnal di lingkungan FE UNA. Ketua Panitia Pelaksana Pelatihan Penulisan Artikel Ilmiah Publikasi Jurnal Nasional dan Internasional FE UNA Tahun 2014, Hadi Suriono,SE,MM didampingi Sekretaris Panitia, Drs Dailami, M.I.Kom melaporkan, dasar kegiatan kebijakan Kemendikbud RI. (m26)

aku hanya berharap di tahun yang baru ini merupakan momentum bagi saya dan kalian kaum muda, kaum intelektual yang akan membawa negeri ini menerobos masa depan para pendahulu, kita harus siap menjadi garda terdepan untuk perubahan negeri ini. Tahun 2014 adalah tahun di mana bergulirnya pesta demokrasi bangsa Indonesia untuk menentukan wakil rakyat dan presiden. Kunci suksesnya Pemilu 2014 ada di tangan pemuda, artinya suara pemuda sangat dibutuhkan untuk menghasilkan pemimpin baru negeri ini.Akan tetapi, apatisnya sikap pemuda terhadap politik, mengindikasikan pemuda akan mengabaikan hak pilihnya (golput). Di sinilah petaka itu benar-benar muncul, bila pemuda memilih untuk tidak memilih maka pemuda sungguh-sungguh melukai panji sejarah pemuda bangsa ini. Harriet Beecher Stowe pernah berkata: “Masa lalu, sekarang, dan yang akan datang sebenarnya hanya satu, mereka adalah hari ini.” Untuk itu, jadikanlah sumpah pemuda yang diucapkan para leluhur sebagai inspirasi dinamika yang terjadi hari ini demi terwujudnya masa depan bangsa Indonesia yang lebih baik. Selamat datang tahun baru, tahun dimana pemilihan umum akan digelar di seluruh tanah air indonesia, tahun yang menentukan arah apa, bagaimana dan mau kemana kita bawa negara ini. Selamat datang tahun politik.

MEDAN (Waspada) : Koordinator Kopertis Wilayah I Sumut/ NAD Prof. Dian Armanto, M.Pd, M.Sc, Ph.D, bersama Kepala Diklat Pemprovsu Prof Zainuddin mengunjungi stand pameran Universitas Islam Sumatera Utara (UISU) Kampus Jalan Karya Bakti pada Pekan Pendidikan Tinggi Sumatera 2014 di Grand Palladium Medan. “Dengan keberadaan UISU saat ini, saya yakin ke depan akan semakin eksis, seperti dimasa-masa lalu,” ujar Dian Armanto, ketika berbincang-bincang dengan Kepala Humas UISU Drs H Almatsyah MAP. Pada pameran yang digelar 14 s/d 16 Februari 2014 tersebut, UISU menampilkan hasil keterampilan mahasiswa FKIP berupa bahan bekas yang didaur ulang menjadi barang layak pakaian antara lain seperti payung, tas, dompet, selop dll. Selanjutnya menampilkan pestisida organik serta kompos organik untuk skala rumah tangga hasil penemuan mahasiswa Fakultas Pertanian UISU yang sudah disosialisasikan di daerahdaerah di Sumut. LPPM UISU juga menampilkan hasil penelitian dosen berupa karakteristik umbi-umbian untuk mendukung menggadong sebagai kearifan lokal Sumut dalam memperkuat ketahanan pangan. Juga ditampilkan hasil karya UISU dibidang jurnalistik aitu Warta Kampus dan Warta UISU. Kepala Humas UISU Drs H Almatsyah MAP mengatakan UISU, sesuai visinya menjadi perguruan tinggi yang Islami, handal, teruji dan bermartabat mulia, dicintai oleh masyarakat dan diridhoi Allah SWT. UISU dalam misinya, lanjut Alamtsyah, melaksanakan pendidikan dan pengajaran penelitian dan pengabdian kepada masyarakat dan dakwah Islamiyah secara profesional untuk membentuk sarjana muslim dan nasional yang berkualitas, beriman, bertaqwa, berakhlak mulia, berilmu, dan beramal saleh. (m26)

Waspada/Ist

KOORDINATOR KopertisWilayah I Sumut/NAD Prof.Dian Armanto, M.Pd, M.Sc, Ph.D didampingi Kepala Humas UISU Drs H Almatsyah MAP meninjau stand pameran UISU.


Opini

B6 TAJUK RENCANA

KPK Geledah Kemenag Pelayanan Haji Meningkat

M

enteri Agama Suryadharma Ali mengatakan hingga kini pemerintah Arab Saudi tidak mengubah kebijakan kuota haji. Dengan demikian, permintaan penambahan kuota dari berbagai daerah tidak dapat dipenuhi karena pemerintah Arab Saudi saat ini terus memperbaiki fasilitas dan tempat ibadah pada setiap musim haji. Dengan pembatasan kuota 20 persen yang diberlakukan sejak 2013 akan berlaku pada tiga atau empat tahun mendatang maka semakin panjanglah daftar tunggu jamaah calon haji kita.Yang seharusnya sudah bisa berangkat 10 tahun bakalan bersabar hingga 11-12 tahun ke depan. Bagi Calhaj usia muda atau kisaran 40 tahun, tenggat waktu lamanya menunggu tidak begitu menjadi masalah. Kalau umur panjang usia 50 tahun sudah bisa berangkat. Usia 50an tahun masih cukup gesit berhaji.Tapi bagaimana dengan mereka yang sudah berusia 50 tahun ke atas, bisa-bisa peluang melaksanakan rukun Islam kelima mengalami kendala. Intisari: Oleh karena itu, pemerintah Indoatau tepatnya Kemenag Urusan Haji ‘Kompleks Masjidil Haram nesia di pusat dan daerah perlu mempriotermasuk areal lingkaran ritaskanjamaahusialanjutdanitudijalandengansungguh-sungguhagarmereka tawaf hingga kini masih kan yang sudah berusia 70 tahun ke atas diberi dalam proses pembangu- peluang berangkat lebih awal mengingat usianya sudah lanjut. Kalau masih ditunda nan sehingga upaya me- bertahun-tahun lagi kondisinya bisa meatau bahkan meninggal dunia. nambah kuota haji kandas’ nurun Kalaupun diberangkat juga dalam usia sepuh mereka sudah sulit melaksanakan semua rukun dan wajib hajinya. Hemat kita, Kemenag perlu meningkatkan pelayanan haji. Jangan mentang-mentang minat berhaji semakin tinggi pemerintah seenaknya memberi pelayanan kepada para tamu Allah yang berangkat haji. Bahkan, mensugesti jamaah dengan memperbanyak amalan sabar dan sabar, di mana semakin banyak cobaan selama di tanah suci semakin ‘’baik’’ karena seakan sedang diuji keimanannya. Itu sebabnya banyak jamaah yang pasrah walau pelayanan haji buruk. Dengan banyaknya dana yang tersimpan di rekening haji saat ini, mencapai Rp80 triliun dan mampu menghasilkan keuntungan Rp2,3 triliun per tahun, maka tidak sulit buat Kemenag untuk meningkatkan pelayanan kepada para dhuyufurahman. Misalnya mencari tempat pemondokan yang dekat dengan Masjidil Haram di Makkah dan Masjidil Nabawi di Madinah. Ratusan pemondokan tersedia dan dapat disewa setiap tahunnya, asal saja pemerintah cepat tanggap dalam mencarinya. Kalau pencarian pemondokan dilakukan saat musim haji akan datang maka harganya sudah naik (mahal), maka pemondokan yang tersisa adalah di lokasi yang jauh. Situasi seperti itulah yang terjadi selama bertahun-tahun sehingga banyak jamaah haji Indonesia yang hanya beberapa kali datang shalat ke Masjidil Haram karena lokasinya jauh dan sulit mendapatkan transportasi. Justru itu, harus ada upaya perbaikan secara signifikan. Kalau tidak ada, maka KPK (Komisi Pemberantasan Korupsi) harus turun tangan secara langsung melakukan penggerebekan kantor Kemenag di pusat dan daerah-daerah. Apalagi banyak kabar tidak sedap terkait penggunaan dana haji yang jumlahnya semakin membengkak di bank-bank tertentu. Aroma korupsi menyengat hidung, sebagaimana diungkap Inspektur Jenderal (Irjen) Kemenag, M Jasin, di mana beberapa pegawai di lingkungan Kementerian Agama (Kemenag), Direktorat Jenderal Penyelenggaraan Haji dan Umrah (Ditjen PHU) diduga menyalahgunakan dan menerima uang gratifikasi yang berasal dari pengelolaan dana haji dari Biaya Penyelenggaraan Ibadah Haji (BPIH). Kalau benar mereka menggunakan atau menerima uang gratifikasi dana haji di BPIH hal itu merupakan tindak pidana korupsi. Malah mantan pimpinan KPK itu sudah menyebut sejumlah nama berinisial HWN, AR, dan FR sehingga tidak ada alasan dan tidak sulit bagi KPK untuk melacaknya. Pusat Pelaporan dan Analisis Transaksi Keuangan atau PPATK pun menemukan transaksi mencurigakan hingga Rp230 miliar dari pengelolaan dana haji tahun 2004 hingga 2012. Dalam kurun waktu tersebut, dana haji yang dikelola mencapai Rp80 triliun, dengan imbalan hasil sekitar Rp2,3 triliun per tahun. Ini jumlah yang luar biasa besar sehingga perlu serius melacak penggunaannya oleh KPK, termasuk atas nama siapa sajarekeninggendutdanahajitersebutdipakai.Jikadigunakannuntukmeningkatkanpelayanan haji oke-oke saja, asal bukan nuntuk kepentingan pribadi oknum Kemenag. +

APA KOMENTAR ANDA SMS 08116141934

Faks 061 4510025

Facebook Smswaspada

+6282167170674 Kepada Yth Bapak Presiden SBY.kalau ada kader partai Demokrat yang berbuat salah dan melakukan KORUPSI uang negara pecat saja pak dari kader Partai.masih banyak di luar yang ingin menjadi kader Partai.saat ini kader Partai Demokrat yang lagi di bidik oleh KPK yaitu Sutan Bathoegana sebelum membuat malu Partai Demokrat lebihbaikdipecatsaja.karenapakSutanBathoeganaselalumengelakkasusSKKmigas.jangan dikotori lagi Partai Demokrat dengan manusia ma +6285373491879 rullah Aj ,langsa ) +6281381817448 Dgn hormat. Sesungguhnya kita2 ini, adlh Islam SONTOLOYO. Mengaku Islam: > rajin sholat, berzikir > dari pagi ke pagi. Dari mlm ke mlm. Segala macam sholat dijalankan. Sujud menangis di tengah mlm jelang dinihari. Sendiri. Kokok ayam saling sahut.Tapi, ASTAQHFIRULLAH...> kelakuan kita dlm kehidupan se-hari2 tdk menunjukkan KETELADANAN seorang ISLAM, pembawa KEBENARAN, KEMAKMURAN dan KEADILAN melainkan KEMUNAFIKAN. Membawa KEGADUHAN di- mana2, di negeri ini. Sesungguhnya, kita2 ini, adlh SETAN dan IBLIS suka GENTAYANGAN. Singgah dan membuat RUSUH di - mana2. Lihatlah si mulut BEBEK si Fachri Hamzah ( PKS) AchmadYani ( P3) dan Bambang Soetatyo (Golkar). ASTAQHFIRULLAH...> Mari sejukkan hati dan pikiran. Lantunkan asma2 ALLAH SWT. Bertobatlah. Tak ada daya, upaya dan kekuatan kecuali pertolongan ALLAH SWT. Amin 3 YRA. Ttd = Beceen > Bukrie Coma Nst > Pemimpin Redaksi Harian Berita SINAR PAGI Jkt. +6285207065513 Nasehat buat Profesor Doctor M Hatta Magister off Arch (Ketua MUI Kota Mdn) , Kyai Zulfikar Hajar LC jg unsur pimpinan MUI Kota Mdn , oknum2 Ulama lainnya yg hidup di kota mdn : “ KALAU ANDA2 BERSIMPATIK KPD PEJABAT2 YG TELAH DINONAKTIFKAN DLM JBTNNYA KRNTERSANGKUTTP KORUPSI , MAKA SEBAIKNYA ANDA MUNDUR DARI JBTAN MUI DAN BERGABUNGLAH DGN PARA PJBT2 MAFIA KORUPSI ITU SAMPAI AKHIR HAYATMU “. +6281263988402 Assalamu’ Alaikum WW Bencana datang dimana-mana tidak peduli kepada siapa dan bagaimana tapi sayang apakah pernah kita pikirkan apa penyebabnya ? malahkan solah-olah dia yang paling benar, pakaian yang tidak sopan yang mengundang sahwat, bangga berbuat salah dimana-mana dll, sehingga apa kata seorang ustad pernah berceramah kata Allah Swt pada suatu saat nanti apa bila datang suatu zaman umatku tidak patuh lagi kepada ajaranku /perintahku maka akan kuturunkan bala tentaraku seperti Banjir, angin puting beliung, gunung meletus dll maka marilah kita sadari dan berusaha lah untuk selalu waspada dan mer ubah sikap kita mudah-mudahan terhindar dari segala bencana trima kasih. kita akan disayangi dan disenangi mereka, tapi tindak maksiat terjadi dimana-mana, narkoba, judi,perampokan, korupsi, perambahan hutan, saling salah menyungkin karena kita tidak ramah kepada alamnya tak ubahnya sandainya kita ramah kepada tetangga kita,kerabat kita, orang tua kita, atasan kita dsbnya maka +6281260847596 mohon kiranya bpk Kadis Pertamanan untk merawat kembali taman depan stadion teladan yg tdk lagi asri dimana tamannya sdh banyak yg gundul sayang rasanya tdk dirawat biaya pembuatan taman menghabiskan biaya yg cukup besar kemudian ada lg tmpt kamar mandi disekitar taman closet sdh hancur oleh karena itu ada +6281376963666 HIMBAUAN KEPADA MUI AGAR PARA KHATIB SETIAP JUM”AT MENGUMANDANGKAN UMMAT ISLAM JANGAN DEMI KOKOHNYA KITA UMMAT ISLAM DALAM PEMILU 2014 +6283194817681 GITA WIRYAWAN MEMILIKI KEBULATANTEKA D == KHAQQUL YAQIN bahwa siapa yang bersunggu h-sungguh berusaha pasti mendapat sesuatu yang dicita-cita kan . GITAW. menanggalkan jabatan empuk selaku Menteri Perdagangan R.I. Mengapa ? Demi mendapatkan mandat resmi sebagai CA.PRES. R.I. Semoga saja Pres +6282167170674 ku Asli Bangsa Indonesia.Tarian Barongsai DanYang Sejenisnya Adalah Bukan Tarian Tradisional.Dan Dari Anak Anak Sampai Orang Tua Lebih Menyukai Tarian B

WASPADA Kamis 20 Februari 2014

Kenabian Dalam Perspektif Sosiologis Oleh M Ridwan Lubis Nabi merupakan agen dari suatu proses terobosan menuju tatanan budaya yang lebih tinggi artinya lebih rasional dan sistematis

P

erjalanan kehidupan manusia selalu berupaya menuju kepada kebenaran. Oleh karena itu, manusia berupayamengoptimalkanpenggunaan akalnya untuk menemukan kebenaran itu. Sementara bagi manusia yang belum sampai kepada kebenaran akibat dari mereka belum menerima dakwah sebagai tuntunan hidup maka mereka tidak tergolong sebagai orang yang mendapat siksaan (Q.S. Al Isra’ [17]:15). Dilihat dari fungsi kemanusiaan maka terdapat dua kriteria orang yang baik yaitu orangmenjadimodelketeladanan(exemplary prophecy) dan orang yang selain menjadi model kebaikan yang menyampaikan tuntutan tentang kategori manusia. Tetapi juga ditandaimunculnyakomunitasumatmanusia yang merasa wajib mengikutinya (ethical prophecy). Demikianlah Nabi/Rasul menjadi tokoh yang menjadi idola umat manusia. Seorang Nabi pada dasarnya melakukan proses yang disebut rasionalisasi yaitu suatu konsep induk dimana budaya mendefinisikan situasi-situasi keagamaan (Max Weber, Sosiologi Agama, 2012:36). Rasionalisasi memuat beberapa langkah ketika budaya mendefinisikan situasi-situasi keagamaan. Pertama, pengklarifikasian, penspesifikasian, pensistematisan ide-ide secara intelektual. Seorang Nabi telah memberikan penjelasan tentang bagian dari kebiasaanpadamasalaluyangpatutuntukdilanjutkandan/ataujugatidakdilanjutkan.Kelanjutan sebuah tradisi diukur dari seberapa penting maknanya bagi peningkatan harkat dan martabatmanusiasebagaimakhlukTuhan.Dalam kaitan rasionalisasi itu, seorang Nabi menggerakkan upaya pemurnian dan pembaruan yang sekaligus dipahami sebagai upaya memelihara kesinambungan dan perubahan. Kedua, rasionalisasi mencakup kontrol normatif sekaligus sanksi. Lihat misalnya betapaNabimenjelaskantentangapayangharus dikerjakan (wajib), harus tidak dikerjakan (haram), anjuran dikerjakan (nadb), anjuran tidak dikerjakan (karahah), kebebasan untuk memilih (mubah). Akibat dari adanya kontrol normatif maka seorang nabi sekaligus memperkenalkan balasan serta ancaman yang disebutpahaladandosasertaakhirkehidupan yaitu surga atau neraka. Ketiga, rasionalisasi mengandung konsep

komitmen motivasi yang isinya tidak sekedar keyakinan yaitu komitmen terhadap validitas kognitif ide-ide tetapi suatu komitmen praktis yaitu kesediaan membelakangkan kepentingan pribadi untuk melayani pelaksanaan ide-ide. Oleh karena itu seorang Nabi/Rasul tidak mungkin bergerak hanya karena dorongan ego pribadinya tetapi berdasar rancang bangun ketuhanan yang disebut wahyu. Wahyu menuntun seorang Nabi/ Rasul tampil sebagai model ideal tentang kebenaran sekaligus mewujudkannya dalam kehidupan nyata. Seorang Nabi/Rasul tentulah seorang yang memiliki pandangan yang sangat jauh ke depan yang memiliki kemampuan profetik namunkemampuanyangdemikianbukanlah atas usaha sendiri tetapi karena kehendak Tuhan. Ketajaman mata hati yang dimiliki Nabi/Rasul dan diteruskan oleh sahabatsahabatnya bukanlah sesuatu yang terpisah dari praktik ’ubudiyah tetapi ia merupakan suatu kesatuan yang utuh. Paparan tentang rasionalisasi yang dimiliki seorang Nabi/Rasul tentulah bukan merupakan hal sederhana tetapi semuanya adalah atas kehendak ilahi dalam menunjukkan tanda-tandakekuasaanNya.Nabidiatassegalanya, adalah merupakan agen dari suatu proses terobosan menuju tatanan budaya yang lebih tinggi artinya lebih rasional dan sistimatis. Hal ini didukung oleh model kepemimpinan beliau yang memiliki dua ciri yaitu memiliki ketajaman mata hati (nabiyyun) serta ketajaman intelektual (failasufun). Demikianlah gambaran ketajaman cara pandang kenabian yang tersimpul dalam kemampuanrasionalisasi.Pengertianrasional adalah sebagaimana yang diuraikan di atas memiliki kemampuan klarifikasi, spesifikasi dansistimatisasi;kemampuanuntukmelakukan kontrol normatif sekaligus penegasan tentang sanksi atas segala perbuatan akibat dari adanya hukum taklif; kemudian adanya komitmen motivasi yang demikian kokoh sehingga membelakangi kepentingan pribadi dirinya karena dorongan kesungguhannya mewujudkan ide-ide tentang kebenaran. Maka tidak diragukan lagi kenapa Allah menegaskan bahwa Nabi Muhammad SAW sungguh-sungguh menjadi contoh teladan (uswatun hasanah) bagi orang-orang yang

beriman kepada Allah, Hari Kemudian dan banyakmengingatAllah(Q.S.AlAhzab[33]:21). Demikianlah para nabi diyakini oleh para umatnya selalu memiliki dua wibawa yaitu wibawa berdasar keturunan (gentilcharisma) dan wibawa karena jabatan (amtcharisma, charisma office). Lihat misalnya Nabi Muhammad yang memiliki keturunan terpandang yaitu suku QuraisysehinggatipikalQuraisytetapmenjadi idola dalam kepemimpinan umat Islam selama ratusan bahkan ribuan tahun. Demikian juga misi risalah yang dipikul beliau membangkitkan wibawa yang jauh melebihi daripemimpinmanapundipermukaanbumi sehingga para sahabat beliau rela menggadaikan seluruh hidupnya untuk mengabdi

kepada kepentingan dakwah. Hal ini disebabkan karena wibawa beliau bukanlah suatu hal yang dibuat-buat tetapi munculdariikatanbatinantarabeliaudengan sahabat-sahabatnya. Wibawa kenabian bukanlah hasil rekayasa manusia akan tetapi semata-mata anugerah Allah.Wibawa para nabi tidak hanya diterima sebagai kenyataan bagi umat yang beriman kepada Beliau tetapi juga melebar kepada umat manusia yang cinta kepada kebenaran.

Penulis adalah Guru Besar UIN Syarif Hidayatullah Jakarta.

Pemikiran Ekonomi Professor Bachtiar Oleh Coki Ahmad Syahwier Dalam salah satu tulisannya dinyatakan diperlukan agent of development. Suatu hal yang sangat tidak lazim bila pemerintah menyerahkan kegiatan ekonomi sepenuhnya kepada sistem pasar secara bebas

S

etiap Selasa, halaman opini Harian Waspada menghadirkan tulisan Professor Bachtiar Hassan Miraza yang mengulas sejumlah masalah

ekonomi aktual yang terjadi di dalam negeri maupun internasional.Tulisan selalu diakhiri dengan sejumlah saran dan rekomendasi dalam bentuk kebijakan dan program sebagai konsep pemecahan masalah yang praktis dan implementatif. Professor Bachtiar telah menulis pada harian Waspada dalam rentang waktu yang cukup lama. Dari sejumlah penulis yang mengisi halaman opini, Professor Bachtiar merupakan figur penulis yang amat rajin, disiplin dan teratur menjaga konsistensinya untuk menulis. Apabila melihat karya tulisan beliau yang terus menerus muncul seolah-olah Professor Bachtiar memiliki stamina dan daya olah pikir yang berlebih. Hal yang demikian, membuat pemikiran ekonomi Professor Bachtiar banyak menginspirasi para pelaku usaha dan birokrasi pemerintahan untuk menjadikannyasebagaidasardalammengambil kebijakan dan keputusan yang arif dan rasional. Sangat disayangkan kalau tidak mencoba memahami pemikiran ekonomi beliau yang tertuang dalam bentuk tulisan di Harian Waspada maupun pada pertemuan ilmiah di berbagai tempat. Secara umum, Professor Bachtiar sebenarnya ingin mendeskripsikan fenomena ekonomi yang berkembang dalam perekonomian daerah, nasional, dan internasional. Pada hakekatnya fenomena ekonomi adalah peristiwa ekonomi yang bisa diamati, dirasakan, diidentifikasi, dan dibuat formulasi pemecahannya. Konstruksi pemikiran ekonomi Professor Bachtiar sebetulnya dibangun atas dasar pengamatan dan pengalaman beliau sebagai seorang akademisi, pemerhati ekonomi, pejabatperguruantinggi,konsultan,stafahlipemerintahan, dan komisaris sebuah bank daerah. Karena itu, tulisan beliau cenderung bersinggungan dengan persoalan ekonomi yang berhubungan dengan eksistensinya di berbagai tugas yang diembannya. Namun, sesekali Professor Bachtiar melepaskan belenggu tugasnyahanyauntukmenyampaikananalisa, ide dan gagasan ekonomi makronya sesuai perkembangan ekonomi nasional dan internasional. Analisa ekonomi makro biasanya ingin melakukan suatu pendekatan atau membuat modelmakroekonomikamengenaipengaruh satu variabel ekonomi terhadap variabel ekonomi makro lainnya. Biasanya seorang analis akan menjelaskan satu persatu variabel ekonomi yang berpengaruh. Untuk mengukur seberapa besar pengaruh satu variabel terhadap variabel lainnya, maka digunakan suatu pendekatan dengan metode kuantitatif.

Berdasarkan penjelasan tersebut, memang terasa sulit menggolongkan pemikiran ekonomi Professor Bachtiar. Sebab, pemikiran ekonomi yang dikenal pada literatur ekonomi biasanya tergolong dalam faham liberalisme yang menempatkan mekanisme pasar sebagai sifat utamanya, dan faham sosialisme yang umumnya erat kaitannya dengan sentralistik pengaturan pemerintah yang ketat. Sebenarnya teramat sulit menempatkan pemikiran ekonomi Profesor Bachtiar masuk ke dalam faham pertama. Sebab, bilamana dicermati tulisannya seringkali menyinggung arti dan makna kesejahteraan masyarakat banyak. Padahal beliau memiliki pendirian dan pandangan menjunjung tinggi pentingnya pencapaian efisiensi dan produktivitas dalam meningkatkan daya saing setiap institusi bisnis maupun pemerintah. Menurut beliau dalam beberapa tulisannya, langkah strategis yang tepat dan sistematis memang perlu dilakukan agar terarah pada upaya pencapaian memenangkan persaingan. Bagi Professor Bachtiar teramat penting mengembangkan manajemen yang diterapkan dengan dasar kemampuan (achievement) dankedisplinan.Baikdalammengembangkan usaha berskala mikro maupun besar. Bahkan, dalam tulisan yang berhubungan dengan pengelolaan perekonomian nasional, beliau menilaimasihbanyakkebijakanmakroekonomi yang tidak menyentuh akar masalah yang dihadapi masyarakat. Artinya manajemen makroekonomi memerlukan penanganan komprehensif, kredibel, sinergis, dan bermakna kepentingan bersama yang berorientasi masa depan (future orientation) bangsa dan negara. Apabila mengenali lebih dalam perspektif Profesor Bachtiar mengenai perekonomian nasional terdapat kecenderungan bahwa beliau menganut faham pendekatan pasar (karakteristik liberalisme) yang ditransmisikan dalam bentuk kebijakan dan program yang efisien dan mengedepankan prinsip produktivitas sekaligus terukur capaian keberhasilannya. Tetapi, Profesor Bachtiar juga menekankan betapa pentingnya keadilan dan pemerataan (karakteristik sosialisme) bagi segenap masyarakat. Dalam suatu kesempatan ceramahnya di depan sebuah organisasi masyarakat, Profesor Bachtiar pernahmenyatakanpentingnyaartidemokrasi bagi sebuah bangsa. Beliau mengartikan demokrasi adalah penerapan dimensi keadilan dan pemerataan praktek bernegara danberbangsa,keadilanadalahproporsipembagian atas dasar partisipasi, kontribusi, dan peranan yang diberikan, sedangkan pemerataandiartikansebagaitidakadanyaperbedaan atau diskriminasi bagi semua yang berhak menerima suatu pembagian. Dengan demikian faham pemikiran ekonomi Professor Bachtiar mencerminkan kola-

borasi antara pendekatan pasar dan pengaturan bagi terciptanya keadilan dan pemerataan yang ditransmisikan ke dalam kebijakan dan program pembangunan yang efisien dan efektif. Sebenarnya pemikiran ini sedikit berbeda dengan teori ekonomi Keynes sebagai kerangka dasar analisis dan perumusan kebijaksanaan pembangunan negara berkembang. Sebab, Keynes menjadikan negara Eropah sebagai sumber pengkajian dan penelitiannya. Karakteristik negara Eropah tentu sangat berbeda dengan negara berkembang, salahsatunyaadalahmenyangkutketersediaan sumber daya alam dan budaya penduduk dalam menyikapi pembaharuan atau modernisasi. Tulisan Professor Bachtiar lebih banyak menggunakan fenomena ekonomi negara berkembang sebagai titik tolak proses pemikirannya, sejalan dengan pandangan seorang begawan ekonomi Professor Sumitro Djojohadikusumo (1953) yang menyatakan : ......Dari sudut kita, yang hidup di daerahdaerah yang masih underdeveloped ditinjau dari sudut ekonomi, kita hanya dapat mendekati pemecahan masalah-masalah yang besar apabila diikhtiarkan perubahan-perubahan pada faktor-faktor struktural, yang dalam pandangan Keynes dan neo-Keynesan biasanya hanya diterima sebagai kenyataankenyataan yang telah ada di dalam perangkaan masyarakat. Menurut Professor Sumitro Djojohadikusumo, perubahan hanya dapat dilakukan dengan pemecahan atas dasar usaha yang mandiri dan bekerja keras secara bersama-sama di tengah masyarakat yang terbelakang. Perubahan atau modernisasidalam pembangunan dan perekonomian menurut Professor Bachtiar memang banyak berharap pada peranan yang lebih besar pemerintah. Namundasaryangsebaiknyadilakukanpemerintah adalah politik pembangunan (development policies) yang dengan sungguhsungguh dijalankan bagi peningkatan kontribusi produksi dan investasi. Peranan yang jauh lebih aktif dari pemerintah baik pusat maupun daerah adalah meletakkan dasarpembangunandanmodernisasidisektor pertanian dan industri manufaktur. Professor Bachtiar dalam salah satu tulisannya pernah menyatakan bahwa yang diperlukandalamperananpemerintahadalah terbentuknya agent of development. Suatu halyangsangattidaklazimbilamanapemerintah menyerahkan kegiatan ekonomi dalam masyarakat sepenuhnya kepada sistem pasar secara bebas. Campur tangan pemerintah seyogianya diletakkan pada posisi menanggulangi, mengendalikan, mengeliminasi, meniadakan disparitas atau ketimpangan yang melekat pada struktur ekonomi. Dengan demikian, peranan pemerintah harus membawa masyarakat ke jalur usaha pencapaian kesejahteraan melalui alokasi sumberdaya ekonomi dalam perekonomian, mendistribusikanhasilpembangunandanpadagilirannya mewujudkan stabilas dalam perekonomian. Pandangan Professor Bachtiar dapat diintrepretasikan bahwa kondisi masyarakat yang masih tertinggal, membutuhkan agen pembangunan. Jadi, bukan peranan seperti negara Eropah yang lebih bersifat balancing agent atau sebagai agen yang menyeim-

bangkan pembangunan bagi pelaku industri tanpamempertimbangkankaummasyarakat yang termarjinalkan. Pemikiran Professor Bachtiar dan Professor Sumitro sekilas memiliki kemiripan struktural ditinjau dari konseptualnya. Paling tidak terlihat dari pertama, perananpemerintahyangdinilaisangatsentral sebagaiagenpembangunan.Kedua,kebijakan dan program pembangunan ekonomi yang bertujuan menyejahterakan. Ketiga, terhindarnya perekonomian dari distorsi ekonomi. Keempat, terwujudnya perekonomian dan pembangunan merata dan berkeadilan. Kelima, menjalankan proses pembangunan ekonomi atas dasar efisiensi dan produktivitas. Penutup Menulis adalah salah satu cara seorang ekonom untuk membahas fenomena ekonomi dengan pendekatan teori ekonomi.Tanggung jawab profesional seorang ekonom hakikatnya bagian dari tugas intelegensia. Professor Bachtiar merupakan salah seorang ekonomyangturutsertamemberisumbangan pemikiranuntukperbaikanpadatatasusunan kegiatan ekonomi masyarakat sesuai tujuan, sasaran, dan kaidah yang dikehendaki masyarakat.

Penulis adalah Dosen Fakultas Ekonomi USU, Asisten Prof.Bachtiar Hassan Miraza Tahun 19891991, syahwiercas@yahoo.com.

Pengumuman Redaksi menerima kiriman karya tulis berupa artikel/opini, surat pembaca. Kirim ke alamat redaksi dengan tujuan ‘Redaktur Opini Waspada’ dengan disertai CD atau email: opiniwaspada@yahoo.com. Panjang artikel 5.000-10.000 karakter dengan dilengkapi biodata dan kartu pengenal (KTP) penulis. Naskah yang dikirim adalah karya orisinil, belum/tidak diterbitkan di media manapun. Isi tulisan menjadi tanggung jawab penulis.

SUDUT BATUAH * Wagubsu: Jaga dan pelihara infrastruktur Sumut - Apanya dijaga, jalan banyak berlobang * Jika jadi presiden, Mahfud akan hukum mati koruptor - Berat lah,he...he...he * Para Caleg di P.Sidimpuan mulai bergerilya - Jangan semangat kali, nanti oyong oel ak D W


Opini

WASPADA Kamis 20 Februari 2014

B7

Kenali Bencana Dari Kearifan Lokal Negeri ini seolah dikelilingi berbagai macam bencana, seperti tsunami, gempa, banjir, tanah longsor, kekeringan, kebakaran hutan, angin topan dan letusan gunung berapi. Semua ini sudah pernah singgah di sini. Bencana datang silih berganti seperti ada yang mengomandoi. Baru pekan dihebohkan bencana banjir di Manado, Jakarta dan sekitarnya, disusul lentusan gunung Sinabung, dan sekarang letusan gunung Kelud sudah terjadi lagi. Bencana datang bertubi-tubi tiada henti dan dampak bencana pun tak dapat dihindari. Ribuan warga kehilangan tempat tinggal, puluhan nyawa melayang dan semua orang mengalami traumatis akibat bencana. Tidak ada yang mengetahui pasti kapan dan dimana bencana bisa terjadi, namun tentunya ada tanda dan gejala dari setiap bencana tersebut. Tanda dan gejala itu dapat berupa keadaan alam disekitarnya maupun dilihat dari tingkah laku binatang. Sebagai masyarakat yang berada di wilayah rawan bencana tentunya kita harus mengenal tanda-tanda tersebut, supaya dampak bencana dapat dikurangi. Pengetahuan tentang bencana hendaknya harus menjadi sebuah dasar dalam meghadapi bencana. Dengan mengenal tanda bencana, kita pun mempunyai kesempatan menyelamatkan diri dari bencana tersebut. Selain itu, bencana dapat diantisipasi dengan mempertahankan kearifan lokal dari suatu daerah. Kearifan lokal diartikan sebagai pandangan hidup dan pengetahuan yang berujud aktivitas, untuk menjawab permasalahan dalam pemenuhan kebutuhan masyarakat setempat (Departemen Sosial RI, 2006). Kearifan lokal ini jugalah yang meyelamatkan masyarakat Pulau Simeulu dari bencana gempa dan tsunami yang terjadi tahun 2004 silam. Dengan menyebut kata smong, mereka sudah mengerti bahwa akan terjadi banjir besar yang datang dari laut dan merekapun segera menuju pegunungan dengan membawa bekal yang cukup. Sehingga dampak bencana dari kejadian itu tidak terlalu berimbas kepada masyarakat. Konsep kearifan lokal masyarakat Pulau Simeulue, berasal dari pengamatan mereka terhadap gejala yang terjadi di alam. Ini merupakan salah satu jenis dari keraifan lokal yang terdapat di Pualau Simeulue. Sealain itu, terdapat banyak bentuk kearifan lokal lainnya yang dapat dijadikan tanda dari suatu bencana. Contoh lain yaitu seperti masyarakat yang tinggal disekitar gunung berapi, mereka mengenali bencana dengan melihat perilaku binatang yang turun ke kampung dan juga terjadi gemuruh sebagai pertanda bahwa gunung tersebut akan erupsi. Kearifan lokal ini, hendaknya harus tetap dijaga dan terus dikenalkan kepada generasi berikutnya, sehingga saat terjadi bencana dimasa depan, merekapun siap menghadapinya. Banyaknya barang bukti dari kejadian tsunami Aceh pada tahun 2004 lalu, seperti Musium Tsunami, Kapal PLTD Apung, Tugu Tsunami dan Kuburan Masal, menjadi sebuah kearifan lokal bagi anak cucu kita di masa depan. Jangan hanya sekedar menjadi barang tontonan saja, tapi juga bisa menjelaskan kejadian yang pernah terjadi dibalik peninggalan tersebut. Yelli Sustarina Mahasiswi Fakultas Keperawatan Universitas Syiah Kuala (UNSYIAH)

Dedi Sahputra

Foliopini

dedisahputra@yahoo.com

Ironic Adalah seorang pria tua yang memasuki usia 98 tahun. Dia menang lotere tapi dia meninggal dunia keesokkan harinya. Ini seperti benda kecil hitam yang mengapung di anggur putih minumanmu. Ini seperti pasukan kematian yang datang terlambat dua menit. Dan inilah ironic. Dia seperti hujan di pesta pernikahan, seperti bebas berkendara ketika sudah membayar tiket, dan dia juga seperti nasihat baik yang tak engkau hiraukan. Siapakah yang memikirkan hal seperti ini akan terjadi? Alanis Morissette—saya kira tidak bermaksud menyinggung Indonesia ketika menyanyikan lagunya itu—Ironic. Dia bahkan mungkin tak pernah berpikir tentang sebuah negeri kepulauan luas yang tengah dilanda beragam bencana ini. Toh negeri ini juga tak sial-sial amat. Masyarakatnya dipenuhi oleh orang-orang pintar. Negerinya dikaruniai kekayaan yang tersimpan di lautan, sungai-sungai, daratan, sampai pegunungannya. Alamnya indah, makanannya enakenak, gadis-gadisnya cantik rupawan, para pemudanya tampan menawan.Tontonlah TV-mu kalau tak percaya. Kalaupunlautnya luas tapi para nelayannya masih miskin-miskin,ataumeskipundaratannyaluas dari padinya impor, dan andaipun para pejabatnya cerdas dan peduli rakyat tetapi masih berperilakukorup,harap maklum saja-lah. Kami bukan tidak ingin maju cuma kami sedang memikirkan kepentingan diri sendiri dulu. Memikirkan diri sendiri? *** Ketikamemikirkantentangdasarnegara ini, saya kira Soekarno dan para pendiri bang-sainisedangmengingatJawa,Madura, Batak, Betawi, Papua dan enis lainnya. Sama ingatnya dengan Islam, Kristen, Hindu, dan Budha, orang kaya-miskin, dan seterusnya. Maka Pancasila itu seperti racikan beragam bumbuyangdiadukdalamsatuwadahyang kemudiandinamakanIndonesiaRaya.Inilah nama sebuah negeri yang menjadi sebuah entitas baru yang dilahirkan dari keragaman yang nyaris tiada duanya itu. Tapi..,entitasbaruitusendiritidakpunya ruh, karena ruhnya adalah keragaman itu sendiri, yang kemudian masing-masing menjadi sub-ordinat. Maka telingamu akan segera asing kalau ada orang yang bicara istilah bangsa Jawa, bangsa Batak, bangsa Banjar, atau bangsa Dayak dan sebagainya.

KetikaPancasilatelahmenjadidasarfalsafah negara maka ia digunakan sebagai dasar untuk mengatur penyelenggaraan negara. Dia menjadi landasan bagi segala sesuatu yang berdiri di atasnya. Tapi kalau tibatiba sekarang dia menjadi salah satu dari empat pilar, jangan lantas engkau bingung. Atau dari empat pilar itu—misalnya—di dalamUUD’45adaPancasilajanganengkau pusing. Karena keragaman tak terhitung yang berdiri di ruang yang nisbi memang mensyaratkan kebingungan dan pusing bagi siapa saya yang berani-berani mengurainya. Kompromi, ini bahasa kesehariannya. Pola ini berlangsung di alam bawah sadar kita. Ketika lihatlah kalau Migas kita harus dikuasaisatusektekuat,makabidangagama, pertanian dan lainnya dikuasai sekte-sekte yang berbeda pula. Ini bagi-bagi kue pembangunan yang kita maklumi selama ini. Ya, ini adalah pilihan. Sama halnya denganpilihannegeritetanggakitaterhadap apa yang disebut dengan “bangsa Melayu”. Seperti halnya Chi-na, India, maka Me-layu adalah entitas yang masing-ma-sing berbeda. Tetapi entitas Melayu itu kemudian mengambil posisi leading mengatasi semua entitas yang ada. Dan ketika Melayu menjadi bangsa, ketika itu segala entitas lain yang adadinegeriituserta merta menjadi sub-ordinat. Bahkan segala entitas di sekitarnya seolah beresonansi men-jadi sub-ordinat, tak terkecuali kalau engkau orang Padang, Aceh, Papua yang datang ke sana—semua-nya akan menjadi bagian dari satu suku bangsa, yaitu Melayu. Mereka menegakkan dan membesarkansesuatuyangmemangsudahada,tanpa perlu mencari sesuatu yang sebetulnya tak pernahada.Simaklah.Andaakanmendapati pola yang serupa dari berdirinya negeri Singapura. *** Sekali lagi, kita bukan kakek tua yang berumur hampir seratus tahun. Kita bukan tipe orang yang senang bukan kepalang ketika berkelimpahan untung, meski tak lama kemudian mati. Bukan! Kita hanya orang-orang yang kadung percaya bahwa politikkompromiitubaikdanbenar.Padahal dia cuma buat kita jadi pikun.

Kolom foliopini dapat juga diakses melalui http://epaper.waspadamedan.com

(Vol.492, 20/2/2014)

Memilih Caleg Perspektif IRT Oleh Endhika Sri Syahfitri, S.Farm, Apt Suara rakyat bukanlah suara Tuhan, karena suara Tuhan tak bisa dibungkam dengan bayaran segepok Rupiah. ahun 2014 ini setidaknya ada dua momen akbar yang akan dihelat, yakni pemilihan umum (Pemilu) Legislatif dan Pemilu Presiden. Sehingga tahun ini disebut sebagai tahun politik.Pemilulegislatifmenjadisangatpenting karena untuk memilih wakil kita di parlemen guna memperjuangkan aspirasi masyarakat. Masyarakat harus cerdas memilih jika ingin aspirasinya terwujud. Jika salah pilih, maka otomatis5tahunmendatangbarubisa“menggusur”merekajadiwakilkita.Sebabituberhatihatilah memilih, mencerna setiap potensi figur adalah sangat bijak dilakukan. Termasuk bagi para ibu rumah tangga (IRT) yang sehari-harinya lebih banyak bergelut dalam pekerjaan domestik dari sumur hinggadapur.Kitatetapharuspeduliterhadap even politik ini. Tak boleh ada sikap apatis alias cuek bebek terhadap Pemilu. Sebabnya, jumlah IRT yang besar secara kuantitatif tentu akan menjadi sasaran empuk para calon legslatif (Caleg) untuk memasarkan produk politiknya. Malahan, sikap golongan putih (Golput) sekalipun sejatinya hanya memberikan peluang pada sosok-sosok kurang baik untuk memimpin.

T

Genderang Kampanye Telah Ditabuh Komisi Pemilihan Umum (KPU) menetapkan masa kampanye Pemilu 2014 sejak 11 Januari 2014 hingga 5 April 2014. Hal tersebut diatur dalam Peraturan Komisi Pemilihan Umum (PKPU) nomor 21 tahun 2013 tentang Tahapan Pemilihan Umum 2014. Itu artinya perhelatan pesta demokrasi sudah dimulai. Para caleg pun mulai bergerilya masuk kampung untuk menjual“kecap” dirinya. Berbagai acaraseremonialpundilakukansebagaiupaya menariksimpatimassa.Dantentusajabanyak trikgunamendekatkandirikepadasimpatisan pemilih. Para aktivis politik ini juga tak segan mengerjakan amal-amal sosial lainnya. Ada yang membagi Sembako, ada yang membuat pengobatan gratis, ada yang melaksanakan khitananmassal,bahkanyangseringmengajak calonpemilihjalan-jalankelokasiwisatasemacam Parapat atau Pantai Cermin. Hebatnya,

terdapat pula Caleg yang nyata-nyata memberikan atau menjanjikan memberi sejumlah uang kepada pemilih yang berkomitmen mencoblos namanya di hari pemilihan. Nominalnya di pasaran sekarang berkisar Rp5100 ribu per suara. Betapa dahsyatnya! Inilah yang disebut Susan C.Stokes, guru besarIlmuPolitikUniversitasChichagodalam bukunya Mandates and Democracy: Neoliberalisme by Surprise in Latin America, sebagai rent-seekingmodel of democracy alias model demokrasi pencari rente. Akibat gaya politik ini, masyarakat tidak lagi memikirkan kualitas calon wakilnya, melainkan hanya mempersoalkan apa yang bisa mereka berikan? Istilah keren yang kian populer saat ini adalah wani piro. Publik menjadi bodoh akibat kampanye modelini.Takterpikirkanlagiancamanbahaya limatahunmendatangakibatsalahpilihcalon anggota dewan. Hal inilah yang kemudian menimbulkan struktur politik yang disebut Guillermo O’ Donnel sebagai delegative democracy, sebagai lawan dari representative democracy. Dalam representative democracy,politisi bekerja mendengar aspirasi rakyat dan memenuhi kepentingan rakyat. Sementara dalam delegative democracy,suara rakyat bagaikan anjing yang sibuk menggonggong dan politisi adalah kafilah yang terus berlalu. Bagi mereka, suara rakyat sudah dibayar lunas dengan “serangan fajar” menjelang Pemilu. Dalam kasus ini, idiom vox populi vox dei menjadi sangat tidak tepat. Suara rakyat bukanlah suara Tuhan, karena suara Tuhan tak bisa dibungkam dengan bayaran segepok Rupiah. Kiat Memilih Bagi IRT Berikut beberapa tips yang dapat digunakan menentukan pilihan para IRT. Pertama, cari informasi data Caleg dan rekam jejaknya. Ini penting kita sebagai pemilih mengetahui sedetail mungkin tentang pribadi Caleg. Di masa lalunya apakah pernah terlibat kriminal atau tindakan merugikan masyarakat. Pendidikannya seperti apa? Apakah gelar akademisnya didapat secara instan dengan membeli? Ataukah di masa lalunya figur tersebut

adalah seorang preman? Untuk Caleg muda patut kita lihat bagaimana dia ketika sekolah dan kuliah, apakah sering bolos, tawuran dan suka mencontek atau justru ia siswa berprestasi? Kedua, lihat peran dan prestasi kerjanya di masyarakat. Menjadi anggota legislatif adalah penyambung lidah rakyat. Adalah penting menilik peran figur seorang Caleg di lingkungan masyarakatnya. Apakah termasukorangsupercuekdansukarberbuatsosial? Atau bagaimana kehidupan berorganisasinya di lingkungan tempat tinggalnya? Apakah sebagai penggembira saja atau sebagai pelaku utama. Penting juga menetahui apakah ia rukun dengan tetangganya. Pertanyaan lain, apakah yang bersangkutan selalu terlibat gotong royong atau tidak? Bagaimana responsnya saat ada tetangga yang ditimpa duka kemalangan atau hajatan. Inisemuamenunjukkanbagaimanakesiapannya melayani rakyat. Jika sebelum “duduk” saja tidak aktif, bagaimana nanti ketika sudah dapat posisi uenak. Pasti akan banyak alasannya. Apalagi bagi mereka yang susah ditemui. Tembok rumahnya dibangun tinggi, pagar rumahnya dilengkapi kamera pengintai dan setiap tamu selalu dihadang Satpam karena dianggap minta duit. Ketiga, perhatikan kondisi keluarganya. Jika keluarganya harmonis dan sakinah Insya Allah ini pertanda kebaikan.Tengok lagi anak dan istrinya apakah berperilaku santun? Kalaulahistridananaknyasajatakterurusbahkan jadi begajulan–sering bolos sekolah, doyan tawuran hingga terjerumus Narkoba, ini merupakanbuktiiagagalmemimpinkeluarga, bagaimana mau memimpin negara/daerah? Namun jika istrinya berbusana sopan menutup aurat, perilakunya santun dan ramah, peduli pada sesama, bisa jadi ini dambaan kita. Jika kita saksikan anaknya tumbuh jadi shalih-shalihah, berprestasi di sekolah bahkan hafalan Alqurannya lebih baik daripada kita yang dewasa, tak salah lagi mungkin inilah harapan kita. Keempat, jangan terjebak pada ketampanan, kecantikan dan kekayaannya. Ini adalah klise dan sering kali dijadikan topeng. Maka pemilih jangan mudah terjebak karena fisik seseorangyangcantikdantampan.Melainkan harus berkolaborasi juga dengan intelektual, spritual dan emosionalnya. Dahulu banyak ibu-ibu memilih salah satu calon pemimpin denganalasangantengdanpandaimenyanyi, namun setelah dia memimpin barulah para ibu menyesali. Begitu juga dengan kekayaan,

justrukitapatutcurigadenganCalegbermodal “raksasa”, jangan-jangan ada pengusaha yang memodalinya dengan imbalan janji memenangkan proyek-proyek pengadaan barang dan jasa. Adapun Caleg perempuan, tak jadi jaminanmemperjuangkannasibperempuan. Apalagi yang dandanannya serba meriah, kena air saja takutmake-up-nya rusak, sehingga tak akan gesit jika diminta menolong rakyat. Kelima, bagaimana Shalat Subuh dan Isyanya? Kalau ia senantiasa shalat berjamaah di masjid, Insya Allah ada garansi dari Allah SWT. Pasalnya, disebutkan dalam hadis Nabi bahwa salah satu ciri orang munafik adalah susah untuk shalat Subuh dan Isya berjamaah di masjid. “Sesungguhnya shalat yang paling berat dilaksanakan oleh orangorang munafik adalah shalat Isya dan shalat Subuh. Sekiranya mereka mengetahui keutamaan keduanya, niscaya mereka akan mendatanginya sekalipun dengan merangkak.” (HR.Bukhari no. 657 dan Muslim no.651). Keenam, pastikan bukan politisi kutu loncat. Betul, kutu loncat artinya suka berpindahdarisatupartaikepartailain.Jikamendapati politisi semacam ini maka nyatalah mereka punyasikappragmatis.Berpolitikbagimereka hanyalah untuk memuluskan kepentingan pribadi. Dimana ada peluang menangguk manfaat, di situlah mereka berlabuh. Mereka tak punya visi, apalagi ideologi untuk diperjuangkan. Epilog Pada akhirnya pilihan ada di tangan kita. Yakinlah setiap pilihan apakah memilih si A, si B atau Golput sekalipun, semuanya akan dimintai pertanggungjawaban oleh Tuhan. Risiko setiap pilihan itu akan kita rasakan tak hanya di dunia, tapi juga di akhirat. Itulah sebabnya sikap apatis menjadi sangat tidak relevan. Tidak bertanggungjawab. Jika kita tak menggunakan hak pilih kita untuk memenangkan kebaikan, bersiaplah nantiTuhan menanyakan alasan dari pilihan kita. Bila kelak calon yang kita pilih berbuat keliru, adalah tugas kita untuk mengawasi dan mengingatkan.Yang penting kita ikhtiar saja. Insya Allah, Dia memberikan petunjuk dan berkah-Nya sehingga Indonesia menjadi baldatun thayyibatun warabbun ghafur. Wallahua’lam bish shawab. Penulis adalah Alumni Fakultas Farmasi USU, Bergiat Di Komunitas Ibu-Ibu Doyan Nulis (IIDN).

Lindungi Belangkas Dari Kepunahan Oleh Fitriana Saragih, S.Hut, MSi Dan Evansus Renandi Manalu, SH Eksploitasi Belangkas dalam jumlah besar, cepat atau lambat akan membawa satwa ini kepada kepunahan. Karena itu, perlu langkah-langkah progresif untuk melindungi dan mempertahankan populasinya.

T

epat hari Selasa, 7 Januari 2014, petugas Karantina Ikan Kelas II Tanjunggbalai Asahan menangkap dan menggagalkan upaya penyeludupan satwa Belangkas sebanyak 7 kotak fiber yang keseluruhannya berisi 840 ekor. Penangkapan dilakukan di Pelabuhan Teluknibung Tanjungbalai Asahan. Rencananya Belangkas ini akan dikirim kenegaratetanggaMalaysia.Sayangnyapelaku berhasil melarikan diri dan belum sempat dimintai keterangan oleh petugas. Barang buktiBelangkasyangtelahmatitersebutakhirnyadimusnahkanolehpihakBalaiBesarKSDA Sumatera Utara di Markas Komando (Mako) Satuan Polhut Reaksi Cepat (SPORC) Brigade MacanTutul Sumatera Utara, keesokan harinya. Peristiwapenangkapanperdaganganilegal dan upaya penyeludupan Belangkas ini bukanlah kasus yang pertama. Sebelumnya tanggal 15 Januari 2013, petugas Satuan Polisi Air (Satpolair) Kepolisian Resort (Polres) SerdangbedagaidalamoperasinyadiDesaPantai Cermin juga menangkap dan menyita 500 ekor Belangkas yang lagi-lagi akan dikirim ke negara Malaysia. Bukan hanya sukses me-

nyita, tetapi juga berhasil menangkap seorang pelaku yang kemudian ditetapkan sebagai tersangka. Dari 500 ekor Belangkas tersebut, 150 ekor di antaranya dalam keadaan hidup dilepasliarkan di Kawasan Suaka Margasatwa (SM). Karang Gading dan Langkat Timur Laut, sedangkan sisanya 350 ekor dalam keadaan mati dimusnahkan di halaman Kantor Satpolair Polres Serdangbedagai. Memang banyak orang yang belum mengetahui tentang Belangkas dan statusnya, sehingga peristiwa perdagangan ilegal masih terus terjadi dan berdampak kepada penurunan populasinya. Padahal menurut Peraturan perundang-undangan yang berlaku, Belangkas termasuk satwa liar yang dilindungi, sebagaimana diatur dalam Undang-undang No.5 Tahun 1990 tentang Konservasi Sumber Daya Alam Hayati dan Ekosistemnya jo. Peraturan Pemerintah No. 7Tahun 1999 tentang Pengawetan Jenis Tumbuhan dan Satwa serta jo. Surat Keputusan Menteri Kehutanan No. 12/Kpts-II/1987. Belangkas atau Mimi, atau juga dalam Peraturan Pemerintah (PP) No.7 Tahun 1999 tentang Pengawetan Jenis Tumbuhan dan Satwa dikenal dengan nama Ketam Tapak

Kuda (Tachipleus gigas). Ia merupakan biota lautyangbanyakdimanfaatkansebagaibahan baku pada industri, karena ekstrak plasma darahnya (haemocyte lysate) banyak digunakan dalam studi biomedis dan lingkungan (Pelestarian,PemanfaatanSumberdayaGenetika Mimi Ranti dan Mimi Bulan, Miswar Budi Mulya). DiluarnegeriterutamadiAmerikaSerikat, Cina dan Jepang ekstrak darah ini digunakan sebagai bahan pengujian endotoksin serta untuk mendiagnosa penyakit meningitis dan gonorhoe(RudeloedalamFachrul,1989).Selain itu ekstrak darah Belangkas memiliki sistem pengendapan purifikasi terhadap darah yang mengandung indotoksin. Belangkas mempunyai bentuk tubuh yang cembung, karapas berbentuk sepatu kuda yang tertutup cephalotorax, sehingga Orang Amerika menyebutnya“Horseshoe Crab” (Kepiting tapal kaki kuda) dan Orang Inggris menyebutnya “King Crab” (Kepiting Raja) . Di Indonesia, jenis Belangkas yang ditemukan adalah Tachipleus gigas, Tachipleus tridentatus dan Carcinoscorpius rotundicauda (Sekiguchi dan Nakamura, 1979). Sekiguchi (1988) menyatakan Belangkas jenis Tachipleus gigas banyak dijumpai di perairan estuaria hampir merata di seluruh perairan Indonesia. Semua hewan laut yang berukuran kecil dapat menjadi makanannya seperti cacing, krustasea yang umumnya ditemukan didalampasirataulumpur.Makanantersebut di dapat dengan cara mengaduk pasir dan lumpur dengan bantuan ekornya (telson) yang runcing dan karapasnya yang keras. Oleh sebab itu Belangkas digolongkan ke dalam hewan omnivora (pemakan segala) dan scavenger (pemakan bangkai).

Penutup EksploitasiBelangkasdalamjumlahbesar, cepat atau lambat akan membawa satwa ini kepada kepunahan. Karena itu, perlu langkah-langkah progresif untuk melindungi dan mempertahankan populasinya. Sosialisasi dan kampanye penyelamatan secara kontinu yang melibatkan berbagai pihak (termasuk di dalamnya unsur media/pers baik cetak maupun elektronik) menjadi salah satu langkah yang krusial dan urgen untuk dilakukan, sehingga masyarakat mengetahui informasi yang benar tentang Belangkas dan statusnya. Di bagian lain upaya penegakan hukum (law enforcement) juga menjadi hal yang tidak kalah penting dalam rangka menimbulkan efek jera bagi para pelaku dan calon pelaku produktif yang ingin mengeksplorasi dan mengeksploitasi satwa ini. Mengingat Belangkas merupakan salah satu biota laut yang prospek pemanfaatannya dapat diolah sebagai bahan baku industri farmasi, maka kedepannya patut juga dipertimbangkan upayaupayapenangkaran(budidaya/pembenihan) satwa ini, sehingga pelestariannya bisa sejalan dengan pemanfaatannya. Untuk merealisasikan semua langkah-langkah progresif tersebut, diperlukan keterpaduan berbagai pihak. Keterpaduan (kolaborasi) ini harus dimulai sedini mungkin, tanpa menunggu sampai populasinya kritis.

Fitriana Saragih, S.Hut, Msi adalah Pejabat Fungsional PEH Ahli Muda pada Balai Besar KSDA Sumatera Utara, Evansus Renandi Manalu, SH adalah Staf Sub Bagian Data, Evlap dan Humas pada Balai Besar KSDA Sumatera Utara.


Agenda

B8 06:00 GO SPOT 07:30 Dahsyat 10:30 INTENS 11:00 SILET 12:00 SEPUTAR INDONESIA SIANG 12:30 BUKA - BUKAAN 14:00 Indonesian Idol 16:00 CEK AND RICEK 16:30 SEPUTAR INDONESIA 17:00 CINTA ANAK CUCU ADAM 19:15 ANAK - ANAK MANUSIA 21:00 TUKANG BUBUR NAIK HAJI THE SERIES 22:30 Box Office Movie

CATATAN

06:30 SL Inbox 08:45 Halo Selebriti 10:00 SCTV FTV Pagi 12:00 SL Liputan 6 Siang 12:30 SCTV FTV Siang 14:30 SL Eat Bulaga Indonesia 16:30 Liputan 6 Petang 17:00 Get Married The Series 2 18:15 Diam-Diam Suka 19:45 Tiba-Tiba Cinta 21:00 Emak Ijah Pengen Ke Mekah 22:30 I Like This

07:00 Animasi Spesial 07:30 Animasi Spesial 08:30 Mister Maker Comes To Town 1 09:00 Pose 09:30 Layar Unggulan 11:00 Diantara Kita 11:30 Lintas Siang 12:00 Layar Kemilau 14:00 Tuntas 14:30 Lintas Petang 15:00 Animasi Spesial 16:30 Animasi Spesial3 17:30 Tendangan Si Madun Returns 18:30 Mnctv Sport Platinum-1 21:00 Raden Kian Santang 22:00 Suka-suka Uya 23:30 Cerita Pilihan 00:30 Midnite Great Sale 01:00 Lintas Malam

08:25 Curious George 08:55 Gon 09:25 Little Krisna 11:25 Topik Siang 11:55 Seputar Obrolan Selebriti 12:55 Mr. Bean 13:25 Tom & Jerry 13:55 Bima Sakti 14:25 Little Krishna 14:55 Bernard Bear 15:25 Curious George 15:55 Gon 16:25 Marsha & The Bear 16:55 Pesbukers 19:25 Campur-Campur 20:25 Pesbukers Best Of The Best 21:55 Sinema Spesial 23:55 Cakrawala

07:30 Semarak Sinema Spesial 08:30 Sinema Pagi 10:30 Live Kiss Pagi 11:30 Live Patroli 12:00 Sinema Pintu Taubat Siang 14:00 Hot Kiss 15:00 Live Fokus 15:30 Trending Topic 16:30 Berani Nekat 17:00 New Famili 100 18:00 Audisi D’Academy 20:00 Sinetron Unggulan : Bara Bere 21:00 Sinetron Unggulan 22:00 Sinema Unggulan

08:05 8 Eleven Show 12:00 Metro Siang 13:00 Wideshot 17:00 Metro Hari Ini 18:00 Prime Time News 19:30 Lebih Dekat 20:05 Mata Najwa 21:30 Otoblitz 22:00 Top 9 News 2 2 : 3 0 St a n d Up Comedy Show 23:05 Realitas 23:30 Metro Sport

Jadwal acara TV di atas bisa diubah sewaktu-waktu oleh stasiun TV yang bersangkutan tanpa pemberitahuan

WASPADA Kamis 20 Februari 2014

07:30 Saatnya Kita Joged 09:30 Sinema Indonesia Pagi 11:00 Insert 12:00 Bioskop Indonesia Premiere 14:00 Sketsa 14:45 Insert Investigasi 15:15 Show Imah 16:45 Reportase Sore 17:30 Oh Ternyata 18:30 Slide Show 19:30 YKS 22:30 Bioskop TransTV 01:00 Reportase Malam

07:00 Live News Apa Kabar Indonesia Pagi 09:30 Live News Kabar Pasar Pagi 10:00 Coffee Break 11:30 Live News Kabar Siang 13:30 Ruang Kita 14:30 Live News Kabar Pasar 15:30 Live News Kabar PEMILU 16:30 Sorotan Kasus 17:00 Live News Kabar Petang 19:00 Meja Bundar 20:00 Live News Apa Kabar Indonesia Malam 21:00 Live News Kabar Malam 22:00 Menyingkap Tabir 22:30 Kabar Arena

08:00 Kungfu Panda 08:30 Chuggington 09:00 Sketsa Tawa 09:30 Hot Spot 10:00 Obsesi 11:00 Buletin Indonesia Siang 12:00 Siang Seru Sama Sule 14:00 Seleb On Cam 14:30 Spot On 15:00 Fokus Selebriti 15:30 Lawan Tawa 16:30 Ada Ada Aja 17:30 Spongebob Squarepants 19:00 Big Movies 21:00 Big Movies 23:00 Big Movies

07:30 Selebrita Pagi 08:15 Spotlite 09:15 Syafa’at 10:00 Ceplas Ceplos LIVE 11:30 Redaksi Siang 12:00 Selebrita Siang 12:45 Laptop Si Unyil 13:15 Bocah Petualang 13:45 Dunia Binatang 14:15 Tau Gak Sih 14:45 Mancing Mania 15:15 Jejak Petualang 15:45 Orang Pinggiran 16:15 Redaksi Sore 17:00 Opera Van Java 18:30 Hitam Putih 19:30 On The Spot 20:30 CCTV 21:15 ILK (Indonesia Lawak Klub) 22:15 Bukan Empat Mata 23:30 Dua Dunia 01.00 Redaksi Malam **m31/G

Masuk Nominasi Oscar,

Dallas Buyers Club Kisah Nyata Penderita AIDS Roger Danuarta

Roger Positif Pakai Putaw Setelah menjalani pemeriksaan di Badan Narkotika Nasional (BNN), terbukti jenis narkoba dikonsumsi Roger Danuarta berjenis putaw. “Iya, positif putau. Tadi saya sudah by phone dengan BNN, itu adalah putau, dan yang lainnya ganja. Secara tertulis hasil dari lab BNN belum keluar, kita tinggal menunggu hasilnya,” kata Kapolsek Pulo Gadung Zulham Effendi, saat ditemui di Mapolsek Pulo Gadung, Jakarta Timur, Rabu (19/2). Selain narkoba, bukti lain yang disita polisi dari Roger adalah sebuah handphone. Dari handphone itu, polisi akan segera mengembangkan kasus tersebut, terlebih tentang keberadaan M, orang yang membantu Roger menggunakan narkoba. “Semua yang terkait bukti-bukti, semua terkait dengan apa saja bisa kita gunakan pendataan. Bukti lain kita akan ambil dan amankan, salah satunya hape. Kita akan lihat pembicaraannya apa saja (ke M),” tandasnya.(okz)

Film Dallas Buyers Club disutradarai Jean-Marc Valle, penulis skenario Craig Borten dan Melisa Wallack. Produksi ini dibintangi Matthew McConaughey, Jennifer Garner, Jared Leto dan Steve Zahn. Matthew sengaja mengurangi berat tubuhnya untuk berperan sebagi Ron Woodroof dalam Dallas Buyers Club. Film diangkat dari kisah nyata penderita AIDS ini menonjolkan Ron Woodroof, yaitu seorang anak muda kota Dallas didiagnosa terkena HIV pada tahun 1985. Menurut dokter merawat pemuda ini, waktu hidup Ron tinggal sedikit hanya sebulan saja. Karena penyakit AIDS dideritanya sewaktu-waktu dapat merenggut nyawa Ron.

Namun pemuda kota Dallas ini menolak pendapat para dokter dan tidak ingin menjadi seorang penyakitan tanpa harapan hidup. Ia berkeyakinan tak ada yang mampu membunuh koboi itu meskipun ia menderita penyakit berbahaya. Ron membuktikan keyakinannya dengan pergi ke Meksiko. Film Dallas Buyers Club merupakan perannya yang sangat mengesankan jika dibandingkan dengan keterlibatannya dalam film Mud, Magic Mike dan Killer Joe. Alur cerita film Dallas Buyers Club memang mudah dan sederhana, namun film ini menyampaikan pesan-pesan perjuangan seorang manusia untuk hidup lebih lama dan tidak berputus asa. Sebagai seorang penderita

HIV, Woodroof tidak jarang menerima sikap sinis masyarakat. Masalah penyakit HIV dan AIDS memang ramai dibicarakan pada tahun 80 dan 90-an. Kelompok masyarakat gay mendapat sorotan tajam menjadi penyebab menyebarnya virus melemahnya kekebalan tubuh ini. Dallas Buyers Club masuk nominasi penghargaan Oscar. Sebagaimana McConaughey, Jared Leto menggawangi film itu juga masuk nominasi Oscar karena perannya sebagai Rayon, seorang pria berubah kelamin menjadi wanita berteman akrab dengan pasien penyakit AIDS Ron Wondroof yang lambat laun mengubah perspektifnya dalam menilai komunitas gay, demikian Digitalspy. *Nur

Jared Leto dan Matthew McConaughey dalam film Dallas Buyers Club

Hrithik Roshan Lakukan Adegan Berbahaya

Hrithik Roshan

Hrithik Roshan bermain dalam film gress Karan Malhotra bersama Kareena Kapoor. Pertemuan Hrithik dengan istri aktor Saif Ali Khan ini dalam film baru merupakan yang pertama selama sepuluh tahun. Bintang film Krissh 3 ini memiliki pengalaman dan kesan yang baik bekerjasama dengan Karan bersaudara Malhotra dan Johar dalam produksi Agneepath. Roshan melakukan peran berbahaya dalam film thriller mendatang yaitu melompat dan berlari di atap gedung pencakar langit di daerah padat Shimla, begitu laporan The Times of India. Adegan berbahaya aktor Bollywood ini didisain dan dirancang Andy Amstrong sebelumnya bekerja sebagai sutradara adegan berbahaya film The Amazing Spider-Man 2. Mansoor, pembantu Ros-

han dalam melakukan adegan berbahaya dan seorang spesialis adegan berbahaya dari Los Angeles syuting bagian cerita yang sangat berbahaya dalam film itu. Hrithik melakukan ade-gan berbahaya melompat di ketinggian 40 kaki di atap gedung-gedung pencakar langit di Shimla. Tim film ini dijadwalkan melengkapi seluruh adegan berbahaya di New Delhi selama 12 hari. Aktor berusia 39 tahun ini tidak khawatir melakukan adegan berbahaya lagi. Ketika syuting film Bang-Bang bersama Katrina Kaif, Hrithik mengalami inisden membuat kepalanya terluka. Kondisi ini memaksanya menjalani operasi otak darurat. Sementara, bintang ini baru saja mengumumkan perpisahannya dengan istrinya Suzanne

Khan setelah 17 tahun menikah. Kini aktor diisukan dekat dengan cewek cantik seorang ahli filsafat bernama Arfeen Khan. Khan menyangkal bahwa ia pernah melakukan kontak dengan Hrithik. Pertemuan mereka berlangsung dalam satu acara seminar Arfeen dihadiri Roshan. Arfeen mengatakan, Hrithik bukan klien-nya,” begitu menurut The Times of India. Hrithik menyatakan, ia bertanggung jawab dengan apa yang terjadi dengan diri dan kehidupannya. Ia tidak suka menimpakan kesalahan kepada orang lain. Sedangkan aktris Kareena Kapoor sebelumnya tidak yakin terlibat dalam film baru produksi Karan Malhotra tersebut. Dilaporkan bahwa Ranbir Kapoor dan Deepika Padukone terlibat dalam film itu, demikian Digitalspy. *Nur

Mig33 Akuisisi Situs Artis alivenotdead.com, Mig33, salah satu komunitas hiburan dan jejaring sosial dengan pertumbuhan paling pesat di negara-negara berkembang, mengumumkan telah mengakuisisi alivenotdead.com (AnD), sebuah komunitas online di Asia Pasifik menyatukan musisi, sineas, dan para artis lain dengan para penggemarnya. Akuisi ini memberikan peningkatan signifikan pada platform hiburan milik mig33, menawarkan para penggemar dan artis cara terhubung serta memungkinkan lebih dari 1.800 artis AnD yang jumlahnya terus berkembang untuk berinteraksi, mengembangkan dan memonetisasi publik di antara pengguna mig33. “Dengan keberadaan mig33 sebagai komunitas hiburan dan jejaring sosial, kesepakatan kami dengan alivenotdead.com memiliki dua hal penting bagi para artis: interaksi unik dan monetisasi,” ujar Steven Goh, CEO dan salah satu pendiri, mig33. “Akuisisi ini merupakan langkah paling berani dilakukan mig33 untuk menawarkan para kreator konten sebuah cara unik untuk memonetisasi sambil melakukan interaksi dengan publik lewat kegiatan offline, sponsorship, chat dan banyak lagi.” Steven Goh menambahkan, “mig33 kini menawarkan para artis kesempatan untuk memonetisasi ratusan juta penggemar potensial di negara-negara ber-

kembang, dalam sebuah komunitas dengan jumlah engagement yang mampu melampaui jumlah engagement di Facebook, Twitter dan situs-situs populer lainnya.” Berbasis di Hongkong, alivenotdead.com didirikan tahun 2007 dengan tujuan memperkuat komunitas artis di seluruh dunia memungkinkan para artis berinteraksi dengan serta mengembangkan fan base mereka, berbagi informasi tentang karya kreatif mereka, serta bertemu dan berkolaborasi dengan artis-artis lainnya. Komunitas ini didirikan Patrick Lee, pemilik sejumlah perusahaan berbasis internet dan hiburan, ia juga salah satu pendiri Rottentomatoes.com – situs ulasan film sangat populer dan didirikan di tahun 2000. Chief Operating Officer alivenotdead.com, Raffi Kamalian, tetap berada di jajaran manajemen dengan posisi CEO alivenotdead.com, ia akan memimpin ekspansi mig33 di wilayah Asia dan negara-negara berkembang. “Kami telah melakukan uji coba dengan membawa artisartis dalam database kami ke platform mig33 untuk chat, kontes, dan beragam aktivitas interaktif dengan penggemar, dan sejauh ini hasilnya sangat luar biasa,” kata Raffi Kamalian. “Ke depannya, akan ada beragam kesempatan promosi artis-artis kami di sejumlah pasar

Asia Selatan yang dikuasai mig33,” tambahnya. Akuisisi ini tidak hanya menjadi langkah awal mig33 memfasilitasi pertumbuhan alivenotdead.com ke negara-negara lain di Asia, dan alivenotdead mengakselerasi jangkauan mig33 kepada komunitas artis serta memperkuat hubungan dengan media, ujar Goh. “Kami akan menyempurnakan platform mig33, memfinalisasi pencatatan saham di Bursa Efek Australia serta melakukan akuisisi aset-aset digital lainnya dengan fokus pada wilayah dengan pertumbuhan pesat di Asia, Eropa Timur, Timur Tengah dan Afrika. Direncanakan, akuisisi ini adalah yang pertama dari banyak akuisisi lainnya.” Alivenotdead.com didirikan tahun 2007 sekelompok artis Hong Kong, termasuk bintang film Daniel Wu bersama dua pendiri Rottentomatoes.com. Dibentuk sebagai komunitas online untuk menghubungkan para artis dari berbagai latar belakang – mulai dari aktor, musisi seniman – dengan para penggemarnya di seluruh dunia, situs alivenotdead.com telah berkembang hingga kini memiliki 1.800 artis dan menjadi pionir di Asia menghubungkan para artis dengan kesempatankesempatan kerja melalui booking dan endorsement online di social media. (m19)

Raffi Kamalian dan Steven Goh, CEO salah satu pendiri mig33.

Melinda

Melinda Pun Merasa Tersanjung KENDATI sebelumnya pernah jadi artis penampil di Tolak Angin Karnaval SCTV tapi baru pada roadshow 2014 ini Melinda, merasa sangat tersanjung. Pemicunya, seiring musik Dangdut kembali eksis dan menggeliat di blantika musik nasional, pada rangkaian kegiatan perpaduan hiburan dan sosial digelar di Bandung, Semarang, Malang dan Surabaya ini, aksi panggung insan Dangdut dipastikan lebih mendominasi. “Sebagai penyanyi Dangdut saya turut merasa tersanjung, Pasalnya, Karnaval SCTV tahun ini memberi kepercayaan dan porsi lebih pada insan Dangdut memeriahkan panggung musik spesial dibandingkan tahun-tahun sebelumnya,” ujar Melinda kepada Waspada di Jakarta, baru-baru ini. Bersama sederet biduanita Dangdut Zaskia Gotik, Julia Perez, Fitri Karlina, Juwita dan Jelita Bahar, Inul Daratista, Duo Anggrek, Siti Badriah, Wika Salim, Lina Geboy, Nasar, Uut Permatasari dan Trio Macan, siap bahu-membahu memberikan aksi pangung terbaik. “Di benak saya dan penyanyi Dangdut lain hanya satu kalimat yang mengkristal. Yakni, secara bergantian wajib tampil habishabisan memberikan hiburan maksimal kepada masyarakat di empat kota maupun penonton di seluruh Indonesia lewat tayanganan langsung Karnaval di layar kacaa SCTV,” tekadnya. Tentang insan dangdut bakal lebih mendominasi panggung musik spesial Karnaval, Harsiwi Achmad – Direktur Program dan Produksi SCTV menyatakan, hal tersebut merupakan permintaan dari penonton daerah. “Selain musik dangdut kembali eksis di industri hiburan tanah air.- khususnya musik dangdut genre Koplo, juga merupakan permintaan dari daerah. Mereka berdalih, kalau mau lebih menghibur, bawa penyanyi Dangdut yang banyak. ” tandasnya. *Agust

IBBI Gelar Kompetisi Gemilang 2014 Sekolah Tinggi Ilmu Ekonomi (STIE) dan Sekolah Tinggi Manajemen Informatika dan Komputer (STMIK) IBBI melaksanakan IBBI Kompetisi Gemilang 2014. Kegiatan berlangsung 14 dan 15 Februari 2014 di kampus Diamond Jl Sei Deli Medan, resmi dibuka Ketua Sekolah Tinggi Ilmu Ekonomi (STIE) IBBI Prof Dr Amrin Fauzi. Kegiatan perlombaan digelar diikuti 816 peserta terbagi dalam berbagai kategori yaitu lomba Pidato Bahasa Inggris, Pidato Bahasa Mandarin, Debat Bahasa Indonesia, Debat Bahasa Inggris, lomba vocal group, lomba modern dance, dan lomba cerdas cermat akuntansi. Peserta kegiatan perlombaan berasal dari berbagai SMA, SMK dengan peserta notabenenya adalah siswa dari berbagai macam sekolah dan daerah se-

perti Medan, Sibolga, Banda Aceh, Brastagi, Pematang Siantar dan Binjai. Ketua Panitia pelaksana IBBI Kompetisi Gemilang 2014, Lusiah, SE, MM mengatakan bahwa dengan diadakannya kegiatan ini, siswa-siswi sebagai pelajar bisa mengasah bakat dan mengukur kemampuan mereka dengan cara berkompetisi secara konsisten. Salah seorang juri Anton Sitepu mengatakan, kegiatan ini memiliki tujuan utama yakni, mengasah dan mengembangkan bakat-bakat siswa sebagai peserta perlombaan. Para juara mendapatkan piagam/trophy, sertifikat, uang tunai, dan hadiah lainnya sebagai bentuk apresiasi kepada siswa-siswi. Juara I, II, III lomba cerdas cermat akuntansi yaitu Sekolah Methodist 2 Medan, SMK Yayasan Nusantara Lubuk Pa-

kam, MA Darul Mursyd. Lomba Pidato Bahasa Inggris juara I, II, III yaitu SMA Letjen S. Parman, SMAWiyata Dharma Medan, SMA Sutomo 2 Medan. Lomba pidato bahasa mandarin juara I, II, III yaitu SMA Prime OneSchool, SMAWR. Supratman 1Medan , SMA Dr Wahidin Sudirohusodo. Lomba debat bahasa Indonesia juara I, II, III SMAN 3 Medan, SMA Kalam Kudus Siantar, SMA WR Supratman 2 Medan. Lomba debat bahasa inggris I, II, III SMA Harapan 1 Medan, SMAN 3 Medan, SMA Prime OneSchool. Lomba modern dance juara I, II, III SMA Wiyata Dharma Medan, SMA Yaspen Paba Binjai, SMA WR. Suprat-man 1 Medan. lomba vocal gro-up juara I, II, III Yaitu SMAN 1 Berastagi, SMA RK Deli Murni, SMA Bodhicita Medan.(m19)

Peserta Lomba vocal group sedang berkompetisi


Ekonomi & Bisnis

WASPADA Kamis 20 Februari 2014

KURS BANK MANDIRI Mata Uang Dolar AS Dolar Singapore Dolar Australia Euro Real Arab Saudi

Jual 11.887 9.483 10.825 16.353 3.287

Beli 11.773 9.272 10.573 16.078 3.030

Mata Uang Dolar AS Dolar Singapore Dolar Australia Euro Real Arab Saudi

Jual 11.865 9.405 10.703 16.295 3.193

KURS BI

KURS BANK BNI

KURS BANK BCA Beli 11.825 9.365 10.633 16.215 3.123

Mata Uang Dolar AS Dolar Singapore Dolar Australia Euro Real Arab Saudi

Jual 11.950 9.708 10.989 16.532 3.367

Beli 11.800 9.108 10.489 16.03 2.967

Mata Uang Jual Dolar AS 11.885 Dolar Singapore 9.423 Dolar Australia 10.777 Euro 16.288 Real Arab Saudi 3.169

Beli 11.767 9.328 10.664 16.124 3.137

B9

Bulog Dan Pemko Medan Lakukan Operasi Pasar MEDAN (Waspada): Perum Badan Urusan Logistik (Bulog) Divre Sumut bersama Pemerintah Kota Medan serta Tim Penanggulangan Inflasi Daerah (TPID) melaksanakan Operasi Pasar (OP) di beberapa kawasan. OP mulai dibuka untuk umum di Pusat Pasar, Rabu (19/2). Dua truk berisi 10 ton beras dikerahkan untuk mendukung pelaksanaan OP ini. Kadivre Bulog Sumut Fasika Khairul Zaman, menjelaskan, OP ini dilaksanakan untuk menambah suplai beras ke pasar, sehingga dapat menekan terjadinya gejolak harga karena jumlah beras dipasar menjadi banyak. Selain itu, jelas Fasika, dengan OP ini masyarakat dapat memilih beras untuk kebutuhannya sesuai dengan kemampuan sehingga. Apalagi beras yang dipasarkan ini harganya relatif murah Rp7.500 per kg. Sedangkan beras sejenis yang saat ini paling murah dijual Rp8.000 di pasar. Fasika, mengaku belum tahu kapan pelaksanaan OP berakhir. Pihaknya masih melihat animo masyarakat. ‘’Tetapi untuk sementara ini Bulog telah menyediakan persediaan beras untuk memenuhi OP ini sebanyak 50 ton,’’ katanya. Menurut Fasika, beras yang disiapkan untuk OP adalah jenis medium kualitas sedang yang

diperoleh dari Cadangan Beras Pemerintah (CBP) sehingga berapa banyak masyarakat yang membutuhkannya, beras itu tersedia di gudang. Kabag Perekonomian Pemko Medan Damar Siregar, menjelaskan, OP ini untuk sementara berlangsung di Pusat Pasar, Pasar Sukaramai dan Pasar Petisah. Kemungkinan lokasi OP bisa bertambah ke beberapa pasar lainnya. Tim ahli TPID Sumut dari BI, Deputi Kepala Perwakilan Bank Indonesia Wilayah IX SumutAceh Dewi Setyowati mengatakan, operasi pasar beras kali ini ditujukan untuk menekan laju inflasi. Apalagi, dalam beberapa tahun belakangan, beras selalu menjadi komoditas penyumbang inflasi yang cukup besar. “Kami berharap, inflasi tahun ini bisa ditekan, karena tahun lalu angka inflasi Sumut cukup tinggi,” kata Dewi Setyowati di sela-sela operasi pasar tersebut. Dewi mengatakan, TPID Sumut berharap kepada pemerintah dan instansi terkait untuk meningkatkan intensitas operasi pasar karena dianggap strategis dalam mengendalikan harga di pasaran. Selain itu, dewi juga mengatakan saat ini TPID Sumut telah melakukan pemetaan mengenai daerah yang berpotensi untuk pengembangan komoditi pangan, diharapkan tahun 2014 ini akan ada hasilnya untuk menekan inflasi. (m35)

Pemko Medan Tidak Serius Operasikan Pasar Induk Waspada/Zulkifli Darwis

Masyarakat membeli beras OP di Pusat Pasar Medan.

Pinjaman Perbankan Riba MEDAN (Waspada): Pada umumnya para pebisnis akan menggunakan pinjaman dari perbankan untuk menunjang bisnisnya, padahal pinjaman tersebut adalah riba. Bagi umat Islam, perintah meninggalkan riba adalah kewajiban, karena Nabi Muhammad SAW juga menyontohkan bisnis yang tanpa utang dan tanpa riba. Hal tersebut disampaikan seorang motifator bisnis Syamsul Arifin, saat menjadi pem-

bicara pada seminar “Rahasia Mengembangkan Bisnis Tanpa Utang, Tanpa Riba” di Garuda Plaza Hotel, belum lama ini. Seminar ini diikuti oleh lebih 100 orang pebisnis Muslim, baik dari kalangan pebisnis senior maupun pebisnis muda dan pemula. Ditegaskan bahwa riba adalah sesuatu yang sudah sangat jelas keharamannya. Akan tetapi banyak kaum Muslimin terutama pengusaha, mereka tidak menyadari keharamannya riba. “Riba secara bahasa bermakna jiyadah atau tambahan. Riba banyak macamnya. Ringkasnya riba adalah tambahan dari sebuah pokok pinjaman. Jadi setiap pinjaman atau utang yang ada tambahannya adalah riba,” katanya. Dia juga mengingatkan agar berhati-hati dengan istilah bagi

hasil dalam perbankan syariah. “Karena dalam prateknya di perbankan syariah bukan bagi hasil yang riil, tapi dimbil dari revenue. Jadi mau untung atau tidak, tetap membayar, makanya jadi riba. Riba ada 73 macam, seringan-ringannya dosa riba sama dengan memperkosa ibu kandung sendiri. Hadis Rasulullah yang lain, dosa riba sama dengan berzina dengan 36 pelacur,” katanya. Ajaran Islam juga menekankan pentingnya umat Muslim untuk mempelajari tentang hukum dagang, termasuk tentang riba ini. Karena jika tidak memahaminya maka akan terjerat ke dalam lingkaran riba secara terus menerus. “Umar bin Khattab dia berkeliling di pasar lalu berkata, Laa fii syaukina, illa man kod tafakku fid diin. Artinya,

dilarang berjualan di pasar kita, kecuali orang-orang yang sudah fakih di dalam agama alias mengerti ilmu muamalah dalam Islam,” katanya mengutip pernyataan salah seorang khulafaur rasyidin. Syamsul menekankan bahwa bisnis tanpa utang dan tanpa riba sangat dimungkinkan untuk dilakukan. Yang terpenting, seorang pebisnis Muslim mesti memahami tugasnya hidup di dunia ini adalah untuk mengabdi kepada Allah SWT. Sepanjang niat untuk pengabdian tersebut dilaksanakan secara benar, maka Allah akan menunjukkan jalan dan rezeki dari jalan yang tak disangka-sangka. Dari beberapa seminar yang telah digelar sebelumnya, Syamsul Arifin, telah merangsang pebisnis-pebisnis sukses

yang dalam menjalankan usahanya tidak menggunakan utang dan riba. “Mereka kini menjadi pebisnis dengan omzet mencapai puluhan miliar, dan itu ternyata bisa dilakukan,” ujarnya. Syamsul, menjelaskan, bahwa kebiasaan berutang dengan riba mulai digalakkan di Indonesia sejak akhir tahun 1980-an, di mana saat itu para perancang ekonomi di negeri ini menelurkan kebijakan pembangunan berbasis utang. Sejak saat itu orang mulai banyak yang terlibat dalam utang piutang dengan perbankan yang notabene merupakan praktek riba. “Padahal, orang-orang tua kita dahulu tak mengajarkan b e r u t a n g . Me re k a b i a s a menabung jika menginginkan sesuatu,” jelasnya.(m07)

Kredit Korban Erupsi Sinabung Diusulkan Dihapus M E D A N ( Wa s p a d a ) : Beberapa perbankan Badan Usaha Milik Negara (BUMN) mengajukan penghapusan kredit khusus untuk debitur yang terkena langsung dampak erupsi Gunung Sinabung. Usulan tersebut juga disampaikan Komisi XI. Usulan tentang penghapusan kredit tersebut disampaikan dalam rapat kunjungan kerja spesifik Komisi XI DPR RI dengan Bank Indonesia (BI), Otoritas Jasa Keuangan (OJK), dinas terkait, dan perbankan di Kantor Perwakilan BI Wilayah IX Sumut-Aceh, Selasa (18/2). Deputi Komisioner Bidang Perbankan OJK Pusat Irwan Lubis, mengatakan, perbankan BUMN telah mengajukan permohonan penghapusan kredit debitur korban erupsi Gunung Sinabung sama seperti ketika Gunung Merapi meletus pada 2010. Namun, finalisasi keputusan masih menunggu rekomendasi dari DPR RI.

“Pada Januari lalu ada pertemuan dengan perbankan, dimana bank khusus BUMN mengajukan permintaan hapus tagih. Namun pengajuan itu tidak bisa langsung diputuskan karena aturan legal terkait itu belum ada. Supaya disetujui, harus ada rekomendasi dari DPR RI dengan alasan kemanusiaan,” kata Irwan Lubis. Disebutkan, total kredit pinjaman dari empat desa terkena langsung dampak erupsi Gunung Sinabung yakni Kec. Payung, Namanteran, Simpang Ampat dan Tiganderket sebesar Rp71,66 miliar dari 2.288 debitur. Kredit itu berasal dari bank umum baik BUMN maupun swasta dan Bank Perkreditan Rakyat (BPR). Ada tiga bank BUMN kredit pinjamannya cukup tinggi di daerah tersebut yaitu BRI Rp51,63 miliar, Bank Mandiri Rp8,3 miliar, dan BNI Rp3,1 miliar. Kredit tersebut paling banyak disalurkan ke sektor

pertanian yakni Rp40,49 miliar kepada 1.426 debitur. Kemudian sektor perdagangan, hotel dan restoran Rp29,02 miliar kepada 815 debitur. Selanjutnya sektor jasa-jasa Rp625 juta kepada 16 debitur serta lain-lain Rp1,5 juta kepada 49 debitur. “ Te n t u n y a i n i a k a n diidentifikasi lagi. Jika debitur sudah tidak memiliki sumber penghidupan sama sekali atau lahan pertaniannya sudah rusak dan tidak punya lahan lain tentu masuk dalam daftar hapus tagih,” ujarnya. Sedangkan bagi debitur yang lahannya masih bisa diolah akan masuk dalam klasifikasi restrukturisasi yaitu mendapat keringanan baik pokok, denda maupun bunganya.“Semua tergantung dari kebijakan masingmasing bank. Pastinya dalam Peraturan Bank Indonesia (PBI) sudah dijelaskan klasifikasi debitur yang mendapat restrukturisasi atau tidak atau hapus tagih,” jelasnya.

Ir w a n m e n y e b u t k a n , kebijakan hapus tagih kredit ini masih menunggu finalisasi dari DPR RI mengingat Rancangan Undang-Undang (RUU) Pengurusan Piutang Negara dan Daerah belum rampung penetapannya. Jadi yang bisa dilakukan bank adalah mengajukan permohonan rekomendasi kepada Komisi XI DPR RI m e m b i d a n g i Ke u a n g a n , Perencanaan Pembangunan Nasional, Perbankan dan Lembaga Keuangan Non Bank. Sementara itu, Wakil Ketua Komisi XI DPR RI Hary Azhar Azis, mengatakan, penghapusan cicilan kredit pinjaman perbankan tersebut perlu dilakukan guna meringankan beban petani, karena perekonomian petani di empat kecamatan yakni Payung, Namanteran, Simpangempat dan Tiganderket lumpuh total. Anggota DPR RI Nurdin Tampubolon juga mengatakan, infrastruktur di Tanah Karo

sangat memprihatinkan akibat erupsi dan hubungan antar desa belum begitu baik, karena itu infrastruktur di sana perlu dibangun kembali. Lahan-lahan kosong dapat dimanfaatkan para petani agar mereka dapat kembali berusaha untuk bisa berproduksi. Mengenai lahan-lahan kosong, Nurdin mengatakan, hendaknya bisa diusahakan kembali, artinya bisa ditanam misalnya dengan cabai merah, bawang merah dan tanaman holtikultura lainnya. Untuk bisa berkembang, perbankan harus bisa mendukung usaha ini dengan memberikan kredit kepada petani untuk memulai usahanya kembali. Kepala Kantor Perwakilan BI Wilayah IX Sumut-Aceh Hari Utomo mengatakan, bank dapat memberikan kredit baru bagi debitur yang terkena dampak bencana Gunung Sinabung, baik perbankan konvensional maupun syariah. (m41)

Yang Penting Dapur Tetap Berasap HAMPIR setiap hari, bila hari telah menunjukkan pukul 06:00, suara martil dan mesin gerinda kayu menembus suasana keheningan pagi di kawasan Jln. Sukapura, Gang Sukapuri IV, Kelurahan Suka Maju, Kec. Medan Johor. Mereka para tukang upahan mulai bekerja mengejar target. Kondisi tersebut sudah dilakukan sejak belasan tahun lalu oleh pengrajin pembuat tangga dan papan cuci. Mesin gerinda dan gergaji hidup hampir sepanjang hari. Mesinmesin itu baru berhenti ketika aliran listrik padam.

Jamaan, 57, kakek empat anak dan empat cucu ini, merupakan pemilik usaha pembuatan tangga dan papan cuci itu. Dia menggeluti pekerjaan ini sejak berusia muda. Yakni sekira awal tahun 1980. Jamaan, mengaku merantau dari kampungnya di Pasaman, Sumatera Barat tahun 1976. Di tempat rantaunya, dia tidak berpikir untuk menjadi pegawai. Pilihannya adalah menjadi wirasa usaha yang bekerja mandiri. “Awalnya tidak banyak yang membantu saya melakukan pekerjaan ini. Baru ketika anak-anak saya

Andi, Faisal (Badon) dan lainnya tamat sekolah, mereka ikut membatu saya,” kata Jamaan, ketika didatangi di tempat usahanya. Sekarang, Jamaan, mengaku sudah tidak aktif lagi terlibat bekerja. Tugasnya hanya mengawasi usaha itu. ‘’Saya sudah tua. Sudah tidak begitu kuat lagi bekerja. Saya sekarang hanya membantu anak-anak saja mengawasi pekerjaan,’’ katanya. Pengakuan Jamaan, sekarang seluruh keluarga terlibat menjalankan usaha itu. Bukan hanya anakanaknya, tapi juga menantu.

‘’Lumayanlah, penghasilan dari usaha ini cukup untuk menghidupi keluarga bahkan cucu-cucu kami,’’ katanya, Rabu (19/2). Jamaan, mengaku tidak sulit untuk mendapatkan bahan baku pembuatan tangga dan papan cuci ini. Walaupun harus dikirim dengan truk dari Pasaman, Sumatera Barat. Sedangkan hasil produksinya dipasarkan dengan cara dititipkan ke sejumlah toko alat bangunan. Tapi ada juga pembeli yang datang langsung ke rumahnya. Menurutnya, harga untuk produknya bervariasi. Tangga ukuran 1,5 meter dia

jual Rp90.000, ukuran 2 meter Rp 110.000, dan ukuran 2,5 meter Rp 150 ribu. Sementara harga papan cuci rata-rata Rp 40 ribu per keping. “Ya, kerja kecil-kecilan. Yang penting dapur tetap berasap,” kata dia. (Abdullah Dadeh)

Waspada/Abdullah Dadeh

Jamaan, bersama Yurnawan (kanan), pengrajin tangga dan papan cuci di tempat usahanya Jln. Sukapura, Kelurahan Sukamaju, Medan Johor.

MEDAN (Waspada): Anggota komisi C DPRD Medan kecewa dengan Pemko Medan. Sejumlah SKPD tidak hadir pada Rapat Dengar Pendapat (RDP) untuk membahas masalah pengelolaan Pasar Induk Sayur dan Buah di Kecamatan Medan Tuntungan. Seyogianya RDP pembahasan pengelolaan Pasar Induk Sayur dan Buah tersebut dilakukan Selasa (18/2). RDP ini merupakan rapat lanjutan dari rapat yang dilaksanakan 18 Januari 2014. Ketua Komisi C A Hie, Selasa (18/2), menyebutkan, tidak hadirnya sejumah SKPD untuk membahas masalah Pasar Induk tersebut menandakan Pemko tidak serius dalam menangani proyek ini. Padahal, kata A Hie, rapat hari itu adalah untuk mendengarkan penjelasan dari Pemko Medan tentang apa penyebab Pasar Induk Sayur dan Buah itu belum juga beroperasi hingga saat ini. Padahal pasa itu sudah dibangun sejak dua

tahun lalu dengan biaya Rp 59 miliar di Kecamatan Medan Tuntungan. ‘’Jadi, kita tahu, solusi apa yang harus diambil untuk masalah ini,’’ katanya. Dijelaskan surat undangan sudah dikirim DPRD ke Plt Walikota Medan tertanggal 13 Februari 2014. Dalam surat itu DPRD Medan minta Plt Wali Kota supaya menghadirkan badan pengawas PD Pasar, Asisten Umum, Bappeda, Kadis Perkim, Dirut PD Pasar, Kabag Hukum dan Kabag Asset Kota Medan. Namun, pada waktu pelaksanaan RDP, sejumlah SKPD itu tidak hadir. Sedangkan anggota lainnya Dianto MS menambahkan Pemko Medan harus serius menyelesaikan pembangunan serta fasilitas lainnya terkait Pasar Induk Tuntungan sehingga pedagang dapat segera direlokasi dari inti kota. Selain itu, Pemko Medan dituntut supaya memaksimalkan pelayanan terhadap kepentingan pedagang. (m30)

Abdul Sadat Ketua FSP BUMN RI MEDAN (Waspada): Abdul Sadat, dari Serikat Pekerja (SP) PT Antam terpilih secara aklamasi sebagai Ketua Umum Federasi Serikat Pekerja Badan Usaha Milik Negara Republik Indonesia (FSP BUMN RI) periode 2014-2018. Dia terpilih dalam Musyawarah Besar (Mubes) IV FSP BUMN RI. Mubes IV FSP BUMN RI berlangsung 1316 Februari 2014. Acara dibuka di Convention Center Hotel Tiara Medan dan dilanjutkan di Inna Parapat Hotel, Parapat. Mubes juga menetapkan Ketua Umum Serikat Pekerja Merdeka (SPM) PTPN II Josem Ginting sebagai Sekretaris Jenderal (Sekjen) FSP BUMN RI. Sedangkan Pengurus Majelis Pertimbangan Organisasi (MPO) masing-masing Robert Tambunan (SP PPI), A. Latif Algaf (SP BPJS Ketenagakerjaan), Agustono (SP ASDP) dan Ade Bunyamin (SP Pindad). Pelaksanaan Mubes yang dihelat empat tahun sekali itu diikuti 70 Serikat Pekerja (SP) dari 70 Anggota Federasi SP BUMN di Indonesia dengan jumlah peserta 150 orang. Mubes yang menyepakati pemilihan Ketua Umum itu

berlangsung tertib, walaupun pada awalnya muncul empat kandidat yang maju dalam pemilihan. Keempat kandidat masing-masing Abdul Sadat (SP PT Antam), M Irfan (SP Garuda), Lutfiansyah (SP Antara), dan M Yunus (SP Jasa Tirta II). Namun karena tiga calon tidak memenuhi kriteria, maka Abdul Sadat, otomatis terpilih secara aklamasi. Dalam pelaksanaan Mubes IV juga disepakati perubahan nama FSP BUMN menjadi FSP BUMN RI. Mubes juga menghasilkan beberapa rekomendasi, diantaranya memberi waktu enam bulan ke depan harus membentuk kepengurusan konfederasi SP BUMN RI. Rekomendasi lain juga mengusulkan perpanjangan usia pensiun bagi karyawan BUMN menjadi 58 tahun. Ketua Umum FSP BUMN RI Abdul Sadat, usai terpilih menegaskan, pihaknya siap mengawal Rp4.000 triliun asset BUMN yang tersebar di seluruh Indonesia. “Aset ini harus kita kawal, karena ini uang rakyat. Kita harus mampu mengamankan dan meningkatkan produktifitas,” katanya. (m08)

FK BUMN Sumut Peduli Sinabung MEDAN (Waspada): Sebagai bentuk wujud kepedulian sosial sekaligus tanggap bencana alam, Forum Komunikasi Badan Usaha Milik Negara (FK BUMN) Sumatera Utara melakukan aksi nyata, Rabu (19/2), memberikan bantuan berupa uang tunai kepada korban erupsi Gunung Sinabung senilai Rp250.000 setiap keluarga di Kabanjahe, Kabupaten Karo. Total bantuan Rp2,5 miliar. ‘’Bantuan uang tunai ini sesuai arahan dari Kementerian BUMN kepada FK BUMN Sumut, yang sebelumnya masing-masing BUMN Sumut juga telah memberi bantuan berupa kebutuhan sandang dan pangan,’’ kata humas PTPN IV Syahrul A. Siregar kemarin. Diharapkan bantuan yang diberikan dapat berguna bagi masyarakat pengungsi. FK BUMN Sumut pada dasarnya tetap komitmen kepada masyarakat untuk dapat membantu dan berbagi, sepanjang perusahaan mampu dan ini merupakan hasil karya bersama seluruh BUMN Sumut yang tergabung dalam FK BUMN

Sumut. ‘’Jangan ada 1 sen pun yang tidak sampai kepada masyarakat yang berhak menerima. FK BUMN Sumut mengharapkan keberkahan dari bantuan yang diberikan, dan berharap tidak ada lagi bencana alam di negeri ini,’’ kata direksi PTPN IV. Ada 52 BUMN Sumut yang berpartisipasi dalam bentuk logistik, dan kali ini BUMN Sumut memberi bantuan dalam bentuk uang tunai berasal dari 18 BUMN Sumut senilai Rp2,5 miliar, yaitu PTPN IV, PTPN III, PT Inalum, PT Pelindo I, PTPN II, PT PPI, PTPN I (luar Sumut), PT Telkom, PT Jasa Raharja, PT Sucofindo, PT Jasa Marga, PT KIM, PT Surveyor Indonesia, PT Sang Hyang Seri, PT Perumnas Reg I, PT PLN, PT PNM, PT Pos Indonesia. Tim dari masing-masing FK BUMN Sumut menjunjung tinggi integritas, militan dan sportif, semoga sampai ke tujuan dengan selamat, sehat dan dapat kembali untuk melaksanakan aktivitas perusahaan dengan ikhlas, kata Syahrul.(m03)


B10 Aceh Aceh Tertinggi Penderita Sakit Jiwa BANDA ACEH (Waspada): Secara persentase jumlah penderita penyakit gangguan jiwa di Provinsi Aceh merupakan yang tertinggi di Indonesia, hal itu bedasarkan hasil riset kesehatan dasar tahun 2013 yang baru saja dipublikasi oleh Kementerian Kesehatan. Hal itu dikatakan Direktur Rumah Sakit Jiwa (RSJ ) Banda Aceh Amren Rahim di DPR Aceh, kemarin. Amren mengatakan, pravelensi gangguan jiwa di Aceh mencapai 2,7 persen dari jumlah penduduk, namun tidak semua menderita gangguan jiwa di Aceh dikategorikan berat, umumnya gangguan jiwa hasil survei ini sifatnya ringan, seperti semangatnya terganggu atau sifat umum lainnya. “Banyak faktor yang menyebabkan tingginya gangguan jiwa di Aceh seperti faktor bawaan, faktor sosial, pengaruh faktor konflik dan faktor bencana, serta faktor biologi, seperti bawaan lahir. Hasil Riset Kesehatan Dasar (Riskesdas) itu menujukkan Aceh dan Yogyakarta paling tinggi kasus gangguan jiwanya,” ujarnya. Untuk mengurangi orang ganguan jiwa di Aceh perlu keterlibatan semua pihak, tidak hanya rumah sakit jiwa, bisa

juga ditangani melalui rumah singgah khususnya untuk mengembalikan harga diri penderita gangguan jiwa sehingga bisa kembali ke lingkungan masyarakat. Terkadang pasien sakit jiwa juga dipengaruhi akibat tidak adanya rumah rehabilitasi bagi penderita gangguan jiwa yang sudah sembuh. Padahal, rumah rehabilitasi ini semacam tempat transisi bagi mereka sebelum berbaur dengan masyarakat setelahmerekadinyatakansembuh. Karena tidak adanya tempat rehabilitasi tersebut, lanjut dia, tidak sedikit penderita gangguan jiwa kambuh karena mereka langsung dikembalikan ke masyarakat. Parahnya lagi, pihak keluarga tidak mau menerimanya sehingga jiwanya kembali terganggu. Sementara delegasi Norwegia Prof Arild Granerud mengatakan, pelayanan rumah sakit jiwa di Aceh sudah mulai membaik, namun perlu difikirkan kembali agar pasien dalam satu ruangan tidak terlalu banyak sehingga proses pemulihannya bisa lebih cepat. Ia mencontohkan di Norwegia satu ruang di rumah sakit jiwa dihuni tujuh sampai 15 pasien, menurutnya, jumlah ideal satu ruangan adalah 20 pasien, dan setiap pasien memiliki kamar pribadi. “Kita harus memandang dia sama dengan manusia lain, karena hal ini akan mempercepat kesembuhan dan per-

Kemarau Akibat Manusia Merusak Alam BANDA ACEH (Waspada) : Kemarau yang melanda Aceh harusnya menjadi peringatan agar kita bersahabat dengan alam. Perambahan kawasan hutan harus sudah dihentikan agar hutan menjadi media tempat menyimpan air saat hujan datang dan melepaskannya saat kemarau tiba. “Sudah saatnya kita menjaga alam kita, lingkungan kita saat ini sudah tidak seimbang lagi,” kata Saifuddin Gani, aktivis lingkungan hidup Aceh menyikapi kondisi tanah rencong yang sempat kekeringan di beberapa daerah akibat kemarau. Anggota Komisi IV DPR RI, M Ali Yakob menyebutkan pada dasarnya Aceh tidak mengalami kekurangan air untuk mengairi sektor pertanian dan perkebunan. Jumlah sumber air cukup banyak di Aceh. Hanya saja selama ini, dunia pertanian dan perkebunan masih dihadapkan dengan persoalan terbatasnya sistem irigasi. (b08)

Kesadaran PNS Abdya Rendah MANGGENG RAYA (Waspada) : Tingkat kesadaran Pegawai Negeri Sipil (PNS) di Kabupaten Aceh Barat Daya (Abdya) akan pentingnya disiplin masih sangat rendah. Pasalnya, setiap tanggal 17 pada bulan bersangkutan tersebut khususnya dan seluruh wilayah Indonesia secara rutin dilaksanakan peringatan Hari Kesadaran Nasional hingga saat ini belum mampu meningkat kesadaran abdi negara itu terutama dalam hal penegakan disiplin. Hal itu dibuktikan dengan banyaknya PNS di kabupaten setempat yang terlambat hadir untuk mengikuti apel peringatan Hari Kesadaran Nasional (HKN) yang berlangsung di halaman kantor bupati Abdya Senin (17/2) dijadwalkan pada pukul 08:00. Kasdim 0110 Abdya Mayor Inf M Ramdhan dalam amanat bupati Abdya yang dibacakannya ketika peringatan HKN hari itu mengingatkan agar PNS dapat meningkatkan disiplin, kemampuan dan pemahaman terhadap setiap peraturan yang berlaku. “Kegiatan ini bukan seremonial tanpa makna, tapi ini kegiatan penting dalam menyadarkan kita semua,”papar Kasdim. Kegiatan upacara peringatan Hari Kesadaran Nasional itu turut dihadiri para Asisten Setdakab Abdya, Wakapolres Abdya Kompol Tamlikan SH, sejumlah kepala SKPK, personel TNI/ Polri, Satpol PP dan WH serta ratusan PNS dalam lingkungan Pemkab setempat. (cza)

809 Honorer K-2 Gagal CPNS IDI (Waspada): Setelah terkatung-katung sejak 5 Februari, Kementerian Pendayagunaan Aparatur Negara Reformasi Birokrasi mengumumkan hasil seleksi Calon Pegawai Negeri Sipil (CPNS) Formasi Honorer Kategori-II (K-II). 809 Peserta seleksi K-II gagal menjadi CPNS. “Peserta seleksi honorer K-II berjumlah 1.458 orang. Namun peserta tidak hadir. Sementara peserta yang lulus seleksi menjadi CPNS berjumlah 649. Sisa yang tidak lulus 809,” kata Kepala Badan Kepegawaian Pendidikan dan Pelatihan Aceh Timur Najmuddin, Rabu (19/2). Dia menyebutkan, hasil seleksi tersebut sebagaimana yang diumumkan oleh Kemenpan-RB RI melalui situs http:// www.menpan.go.id. (b24)

bedaan Aceh dengan Norwegia, kalau kami di Norwegia staf rumah sakit dan pasien jiwa berpakaian bebas, kalau di sini seragam, sebenarnya itu tidak baik juga,” ujarnya. Arild menambahkan, penanganan terhadap pasien gangguan jiwa harus dilakukan secara cepat dan bagus sehingga si pasien tidak harus terlalu lama di rumah sakit, pasalnya semakin lama pasien di rumah sakit justru akan menambah derita

gangguan jiwa si pasien dan si pasien akan lupa cara bergaul dengan dunia sosial. Pihak rumah sakit juga harus berupaya menyediakan tempat yang memadai untuk aktivitas pasien gangguan jiwa, hal itu dipandang bisa menumbuhkan kepercaayaan diri pasien. Ketua Komisi F DPR Aceh Zuriat Suparjo mengatakan, DPRA akan mengupayakan untuk menganggarkan untuk program pembangunan tempat

rehabilitasi para pasien yang mengalami gangguan jiwa yang menurut rencana akan di bangun di wilayah Aceh Besar,” ujarnya. Nantinya, anggaran pembangunan tersebut dapat dibantu dari APBN, APBA dan juga dari Norwegia jika benar-benar niat mereka untuk membantu Aceh. Sehingga seluruh pasien sakit jiwa di Aceh bisa tertampung di tempat yang nantinya akan dibangun ini. (cb01)

Bahasa Gayo Terancam Punah IDI (Waspada): Sejarah mencatat, Bahasa Gayo merupakan salah satu bahasa tertua di dunia. Namun kini, bahasa yang digunakan sehari-hari masyarakat suku gayo itu mulai pudar. Diperkirakan, 50 tahun yang akan datang bahasa gayo akan punah. “Jika kita selaku masyarakat gayo minder dan segan menyapa sesama gayo dengan bahasa kita sendiri, maka 50 tahun yang akan datang kami yakin bahasa gayo ini akan punah,” kata TM Idris alias Aman Genap, tokoh masyarakat Gayo dari Kecamatan Simpang Jernih, Senin (17/2). Menurut dia, alasan terancam punah bahasa gayo karena warga gayo ketika berada di kota-kota besar tidak lagi menggunakan bahasa gayo, karena masyarakat gayo yang sudah berpendidikan tinggi berambisi menjadi pejabat-pejabat di tingkat kabupaten, bahkan untuk tingkat nasional. “Karena ingin jadi seorang yang profesional, maka minder menggunakan bahasa gayo,” kata Aman Genap. (b24)

Kamis 20 Februari 2014

Norwegia Ingin Kerjasama Bidang Kesehatan Jiwa BANDA ACEH (Waspada): Delegasi Norwegia berkeinginan bekerjasama dengan Pemprov Aceh di bidang kesehatan jiwa. Upaya itu disampaikan empat delegasi Norwegia dalam pertemuan dengan Komisi F DPR Aceh, Selasa (18/ 2) di ruang pimpinan DPRA. Pertemuan itu dipimpin Wakil Ketua I M Tanwier Mahdi dan hadir juga perwakilan dari dinas sosial, pimpinan rumah sakit jiwa, dan anggota komisi F, serta dari Norwegia hadir Prof Arild Granerud dan tiga delegasi lainnya. Anggota DPRA Juliat Suparjo dalam pertemuan itu mengatakan, pihak DPRA mendukung upaya kerjasama dengan Norwegia di bidang kesehatan jiwa. “Kita berharap upaya kerjasama ini bisa segera terealisasi,” katanya. Juliat menambahkan, DPRA akan mengupayakan untuk menganggarkan untuk program pembangunan tempat rehabilitasi para pasien yang mengalami gangguan jiwa yang menurut

rencana akan di bangun di wilayah Aceh Besar,” ujarnya. Nantinya, anggaran pembangunan tersebut dapat dibantu dari APBN, APBA dan juga dari Norwegia jika benar-benar niat mereka untuk membantu Aceh. Sehingga seluruh pasien sakit jiwa di Aceh bisa tertampung di tempat yang nantinya akan dibangun ini. Program DPRA, pada tempat baru nanti, pasien juga akan diajarkan merawat ternak, perikanan, dan juga bercocok tanam. Sehingga setelah mereka sembuh, maka akan mendapatkan pengetahuan untuk bisa mandiri. Sementara Arild Granerud dari delegasi Norwegia mengatakan, kerjasama di bidang kesehatan ini sudah terjalin antara Pemprov Aceh dengan pemerintah Norwegia, khususnya Hedmark University College, terutama program pertukaran mahasiswa serta riset antara kedua pihak. (cb01)

Disdik Aceh Fokus Latih 22 Ribu Guru BANDA ACEH (Waspada): Kadis Pendidikan Aceh, Anas M Adam mengatakan, pada tahun 2014 dengan anggaran sekitar Rp300 miliar dari APBA dan APBN, akan melatih kurikulum 2013 untuk sekitar 22 ribu guru, guna meningkatkan kualitas pendidikan di Aceh. “Pada tahun 2014 kita fokus pada pelatihan kurikulum 2013 kepada 22 ribu guru, kemudian ada pelatihan penguasaan materi pelajaran kepada sekitar 20.000 guru,” ujar Anas M Adam kepada wartawan, Senin (17/2) di Anjong Monmata, Banda Aceh. Anas mengakui kalau Aceh dikatakan darurat pendidikan karena rendahnya mutu pendidikan, sebagaimana disitir Menteri PAN dan

Reformasi Birokrasi, Azwar Abubakar pada lokakarya peningkatan akuntabilitas kinerja dan kualitas pelayanan publik. “Untuk Aceh sekarang ya. Kenapa saya katakan kita harus akui ya, kalau di Aceh secara fisik sudah bagus dibandingkan daerah-daerah lain. Meskipun ada sejumlah sekolah yang masih perlu penanganan dan peralatan yang mendukung pendidikan juga sudah memadai,” katanya. Hanya saja, tambah Anas, banyak alat terutama peralatan laboratorium yang masih belum mampu digunakan maksimal untuk mendukung materi ajar. “Alat-alat yang sudah ada belum mampu digunakan, jadi guru belum mampu sehingga perlu dilatih,” paparnya. (b06)

Waspada/Samsuar

MENGHAWATIRKAN: Kondisi DAS Krueng Langsa semakin mengkhawatirkan, bagian tebing sungai serta tumbuhan di atas tebing runtuh ke sungai akibat digerus aliran air, bila kondisi ini tidak segera diatasi,rumah penduduk yang berada di sepanjang DAS Krueng Langsa terancam ambruk ke sungai. Foto direkam, Rabu (19/2)

Pemkab Pidie Belum Mampu Atasi Sadap Liar Air SIGLI (Waspada): Pemkab Pidie dinilai belum mampu mengatasi sadapan air secara liar dilakukan masyarakat petani di hulu dan tengah. Akibatnya, areal persawahan di sejumlah kawasan hilir, seperti di Kecamatan Simpang Tiga, terjadi kekeringan dan terancam gagal panen. Camat Simpang Tiga, Iskandar Abbas, dalam rapat Koordinasi Keujrun Blang, dihadiri Wabup Pidie M Iriawan, di Oproom Kantor bupati, setempat Rabu (19/2) mengungkapkan, ratusan hektare sawah di kecamatan yang dipimpinnya itu telah kekeringan. Kondisi itu disebabkan ulah-ulah petani nakal yang melakukan aksi sadap air secara liar di kawasan tengah dan hulu, serta kondisi musim kemarau.

Menurut dia, ekses dari persoalan itu, kini ia harus merangkap juga sebagai keujrun blang di daerah itu, karena kejrun blang yang ditunjuk telah mengundurkan diri karena tidak tahan lagi mendengar serapah dari para petani di daerah itu yang di nilai tidak becus mengatur air. Iskandar Abbas menjelaskan, persoalan krisis air yang menyebabkan ratusan hektare areal persawahan yang tanaman padi terancam puso alias gagal panen, hal itu disebabkan tidak ada sumber air yang dapat diserap oleh tanaman padi yang mulai memutik. Untuk mengantisipasi persoalan itu, ia mengaku telah mengerahkan masyarakat petani mencari sumber air sampai ke kawasan hulu. Namun, dalam

pencarian sumber air itu, warganya banyak mendapat sadapan air secara liar di kawasan tengah dan hulu, sehingga air tidak bisa mengalir ke areal persawahan di Kecamatan Simpang Tiga yang berada di kawasan hilir. Wakil Bupati Pidie, M Iriawan menegaskan segera membentuk tim untuk turun ke lokasi penyadapan dan lakukan koordinasi dengan masyarakat. Kata dia, harus ada upaya yang jelas dan kongkrit dari tim yang dibentuk sehingga manfaatnya bisa cepat dirasakan masyarakat. Musalamina, Sekretaris Dinas Sumber Daya Air (SDA) Pidie mengakui faktor terjadinya krisis air disebabkan sadapan liar yang dibuat sendiri oleh para petani. (b10)

7.000 PNS Lhokseumawe Daftar BPJS Ketenagakerjaan LHOKSEUMAWE (Waspada): Wali Kota Lhokseumawe Suaidi Yahya akan mendaftarkan 7000-an pegawai baik PNS maupun honorer ke Badan Perlindungan Jaminan Sosial (BPJS) Ketenagakerjaan. Hal itu dilakukan sesuai Peraturan Presiden RI Nomor. 109/2013, tentang kewajiban pemerintah daerah untuk memberikan perlindungan sosial kepada PNS dan pegawai honor.

Pemerintah daerah se-Indonesia dibatasi waktu, selambatlambatnya telah harus mendaftarkan para pegawai 1 Juli 2014. “Pemberian perlindungan jaminan sosial kepada pegawai bertujuan untuk memberikan rasa aman dalam memberikan pelayanan kepada masyarakat,” kata Suaidi Yahya melalui Dasni Yuzar, Sekretaris Daerah Lhokseumawe, Selasa (18/2). Irwan Ibrahim, Kepala Cabang Badan Perlindungan Jami-

nan Sosial (BPJS) Ketenagakerjaan Lhokseumawe mengakui kebijakan Wali Kota Lhokseumawe tersebut dinilai sangat positif, karena jika terjadi kecelakaan kerja pada diri pegawai, pegawai tersebut akan mendapatkan biaya berobat Rp20 juta dan jika masih membutuhkan biaya akan ditambah Rp20 juta. Dan jika pegawai tersebut meninggal, maka diberikan santunan kepada keluarga bersangkutan Rp21 juta. (b18)

SDN 3 Darul Aman Santuni Yatim Piatu IDI (Waspada): Sebagai bentuk syukur kepada Allah SWT, Sekolah Dasar (SD) Negeri 1 Darul Aman, Kabupaten Aceh Timur menyantuni 30 yatim– piatu. Kegiatan penyantunan itu dirangkai dengan peringatan Maulid Nabi Muhammad SAW 1435 hijriyah, Senin (17/2). Kepala SDN 3 Darul Aman, Asyari mengatakan, penyantunan yatim–piatu itu dilakukan sebagai bentuk rasa sosial terhadap para anak yatim dan piatu di SDN 3 Darul Aman yang beralamat di Desa Seuneubok Baroh Idi Cut. “Kegiatan ini rutin kita laksanakan setiap memperingati maulid Nabi Muhammad SAW setiap tahun,” ujarnya. Kadis Pendidikan Aceh Timur Abdul Munir di menjelaskan, pihaknya mendukung penuh berbagai kegiatan keIslaman, termasuk ekstrakurikuler yang dilaksanakan rutin di luar sekolah. (b24)

WASPADA

Barat Studi Banding Ke Timur IDI (Waspada): Tergiur dengan berbagai gagasan di bidang perkebunan dan pertanian yang mampu mensejahterakan masyarakat serta mampu mendongkrak Pendapatan Asli Daerah (PAD), tim legislasi dari Kabupaten Aceh Barat melakukan kunjungan kerja ke Kabupaten Aceh Timur, Rabu (19/2). Kedatangan tim dari bumi Teuku Umar itu dipimpin Taufik Ali, anggota Komisi B DPRK Aceh Barat. Sementara kedatangan tim legislasi itu diterima Wakil Bupati Aceh Timur Syahrul

Bin Syama’un. Syahrul mengharapkan agar berbagai kelebihan di Aceh Barat juga ikut diberikan menjadi sebuah masukan untuk kemajuan di Aceh Timur. Sedangkan Taufik Ali, atas nama tim dari Aceh Barat mengatakan, tujuan kedatangannya ke Aceh Timur untuk meninjau proses penyelenggaraan retribusi daerah itu yang kanbarnya jauh lebih baik di bidang perkebunan, pertanian. (b24)

Waspada/M Ishak

WAKIL BUPATI Aceh Timur Syahrul Bin Syama’un menerima plakat dari tim legislasi Pemkab Aceh Barat, Rabu (19/2)

Shalat Istiqa, Abdya Plin Plan BLANGPIDIE (Waspada) : Instruksi dan imbauan Pemkab Aceh Barat Daya terkait prosesi pelaksanaan shalat Istiqa (shalat minta hujan) kini mulai menuai kecaman dari masyarakat. Pemkab Abdya dianggap tidak serius dan terkesan plin plan alias tidak konsisten dengan imbauan yang telah disebarkan ke seluruh masjid sejak Jumat (14/2) lalu, di mana Pemkab Abdya meminta masyarakat untuk menjalankan puasa sunnah secara khusus hingga Rabu (19/ 2) dan ditutup dengan shalat Istiqan. “Sejak semalam sudah beredar informasi bahwa shalat Istiqa sudah dibatalkan, demikian juga dengan puasa sunnah, kelihatannya Pemkab lebih memprioritaskan acara kunjungan Malik Mahmud ke Abdya, kita jelas menyesalkan sikap Pemkab yang plin plan seperti itu,” ungkap Julius dan Syahrizal, di balai PWI Abdya, Rabu (19/2). Pernyataan senada dikemukakan anggota DPRK Abdya Samsul Bahri dari Partai Bulan Bintang (PBB). Dirinya menyayangkan sikap Pemkab yang terkesan terlalu larut dengan kegiatan seremonial penyambutan Malik Mahmud yang bergelar Wali Nanggroe itu ke Abdya. Menurutnya walaupun ada acara seremonial yang digelar secara akbar dengan tamu seperti Malik Mahmud, Pemkab Abdya diharapkan tetap memberikan perhatian terhadap aktivitas kemasyarakatan seperti prosesi shalat Istiqa,

apalagi pelaksanaan Istiqa juga sudah sejak jauh hari di umumkan kepada masyarakat secara luas. Pasca pembatalan pelaksanaan shalat Istiqa, Ushuluddin yang juga imam Masjid Baitul Quddus di Kecamatan Susoh langsung mengajukan dan menyatakan mengundurkan diri, karena merasa malu akibat terlanjur ‘memaksa’ dan mengumumkan pelaksanaan shalat Istiqa yang kemudian secara sepihak dibatalkan oleh Pemkab setempat. “Imam masjid kami di Desa Pinang, Kec. Susoh telah mengundurkan diri akibat kebijakan Pemkab terkait pembatalan shalat Istiqa, beliau mundur akibat sudah terlanjur bersikap tegas untuk melaksanakan shalat Istiqa tersebut dan mengumumkannya sejak jauh hari, tapi dibatalkan, semestinya Pemkab mengatur dengan baik setiap rencana yang mereka buat, bukan malah amburadul seperti ini,” kata Jauhari, tokoh masyarakat susoh. Terkait polemik pembatalan pelaksanaan shalat Istiqa tersebut, Pemkab Abdya membantah telah bersikap plin plan. Kadis Syariat Islam Abdya Amirman mengatakan, pembatalan shalat Istiqa semata- mata karena adanya informasi sudah mulai turunnya hujan di sejumlah lokasi di Abdya sehingga dengan otomatis prosesi tersebut tidak lagi dianggap sesuatuyangmendesakuntukdilaksanakan.(cb05)

Waspada/Dede

KADIS Perhubungan, Komunikasi dan Informasi Langsa Jauhari Amin beserta jajaranannya foto bersama usai memantau personel di lapangan, Rabu (19/2

Dishub Langsa Siagakan Personel Di Sekolah LANGSA (Waspada): Guna memberikan kenyamanan kepada para pelajar di Kota Langsa dan mendukung ketertiban lalu lintas, Dinas Perhubungan, Komunikasi dan Informasi (Dishubkominfo) Langsa menyiagakan seluruh personelnya untuk turun ke sekolah-sekolah guna mengatur lalu lintas penyeberangan siswa yang akan masuk sekolah saat pulang dan pergi setiap harinya. Demikian dikatakan Kadis

Perhubungan Komunikasi dan Informasi Jauhari Amin, Rabu (19/2). Menurutnya, apa yang kita canangkan ini guna mendukung program Satuan Lalulintas Polres Langsa dalam menekan angka kecelakaan lalu lintas yang tinggi terjadi di Kota Langsa, apa lagi korban kecelakaan yang sering terjadi masih berusia muda dan sekolah. Maka, sejak pukul 07:00 hingga 08:30 kita sudah me-

nempatkan personel di sekolahsekolah Langsa untuk mengatur lalulintas siswa saat akan masuk sekolah dan pukul 12:00 hingga 13:00 saat siswa akan pulang sekolah. “Kita turun langsung dan bekerjasama dengan Polres Kota Langsa dan UKS agar tidak ada lagi kemacetan yang disebabkan angkot dan becak yang menaikkan dan menurunkan sewa sembarangan,” katanya. (m43)

Waspada//Rusli Ismail

SEMBARANG TEMPAT: Masih banyak pemilik mobil pribadi parkir di sembarang tempat tanpa menghiraukan rambu larangan parkir. Seperti di Jalan SA Mahmudsyah, Banda Aceh, sebuah mobil sedan parkir persis di rambu tanda larangan parkir, depan Rumah Sakit Nabila, Selasa (18/2. sehingga mengganggu pengendara lainnya saat melaju di Jalan SA Mahmudsyah


Aceh

WASPADA Kamis 20 Februari 2014

B11

Caleg Perempuan Kurang Pede LHOKSEUMAWE (Waspada): Banyak calon anggota legislatif dari kalangan perempuan kurang percaya diri (kurang pede) dan meyakini mereka dapat terpilih di ajang pesta demokrasi 9 April mendatang. Kurangnya rasa percaya diri dapat kita lihat di spanduk, baliho, dan gambar yang ter-

pasang di sejumlah tempat dari simpang jalan sampai di pohon kayu dan tiang listrik. Gambar sang caleg perempuan selalu diikuti gambar sosok pasangan atau suami mereka. “Asumsi yang muncul adalah bahwa mereka belum pernah berbuat sesuatu yang berarti dalam masyarakat. Mereka kurang terkenal sehingga harus dibayangi oleh pasangannya,” kata aktifis dan tokoh pendidik perempuan, Syarifah Rahmah di Lhokseumawe, Rabu (19/2).

FKPPI Dukung Demokrasi Di Langsa LANGSA (Waspada): Menghadapi Pemilu 9 April 2014 samasama menjaga kedamaian sehingga pemilu dapat berjalan jujur, adil dan rahasia. Apalagi, jangan sampai terjadi tindakan intimidasi, ancaman, teror yang dilakukan oleh sekelompok masyarakat yang anti-demokrasi terhadap masyarakat sipil. Demikian dikatakan Tengku Weyla yang kerap disapa Agustam Efendy, tokoh FKPPI dan keturunun Raja Weyla Meulaboh kepada wartawan, Rabu (19/2). “Untuk menjunjung tinggi nilai perdamaian tersebut, FKPPI Kota Langsa dengan samangat dan soliditas mendukung kehidupan berdemokrasi di Aceh, khususnya di Kota Langsa,” paparnya. (m43)

Fasilitasi Anak Dapatkan Haknya BIREUEN (Waspada):Wakil Bupati Bireuen Mukhtar mengatakan, pemerintah harus memfasilitasi anak untuk mendapatkan haknya sebagaimana diatur dalam Undang-Undang Nomor 23 Tahun 2002 tentang Perlindungan Anak dan Konvensi Hak Anak. Demikian antara lain disampaikanWabup Bireuen pada pembukaan Kongres Anak, Selasa (18/2) di aula lama Setdakab setempat. Dia menjelaskan, dalam undang-undang itu setiap anak juga mempunyai hak untuk berpartisipasi dalam menyampaikan pendapat.“Hak itu merupakan amanah Undang-undang Nomor 23 Tahun 2002 Tentang Perlindungan Anak dan Konvensi Hak Anak yang harus difasilitasi pemerintah daerah,” ucap Mukhtar. Lebih lanjut dia menjelaskan, setiap anak berhak hidup, tumbuh, berkembang, dan berpartisipasi secara wajar sesuai harkat dan martabat, mendapat perlindungan dari kekerasan dan diskriminasi. Kepala Badan Pemberdayaan Masyarakat, Perempuan dan Keluarga Sejahtera Bireuen Amir Addani mengatakan, kongres ini dilaksanakan untuk melahirkan Forum Anak Kabupaten Bireuen sehingga dapat mewakili daerah di tingkat lokal maupun nasional. (b17/cb02)

Wisuda UIN Ar-Raniry Digelar 27 Februari BANDA ACEH (Waspada): Wisuda semester ganjil 2013/ 2014 Universitas Islam Negeri (UIN) Ar-Raniry Banda Aceh akan dilaksanakan Kamis (27/2) di auditorium Prof Ali Hasjmy kampus setempat. Demikian disampaikan Kasubbag Humas UIN Ar-Raniry, Nazaruddin, kepada wartawan di ruang kerjanya, Rabu (19/ 2), usai rapat evaluasi panitia wisuda semester ganjil UIN ArRaniry Banda Aceh. Dia menyebutkan, jumlah peserta yang akan diwisuda semester ganjil tahun ini sebanyak 768 wisudawan. Pelaksanaan wisuda akan dilakukan sebagaimana biasanya, di mana para wisudawan akan berkumpul di Lapangan Tugu Darussalam dan selanjutnya berjalan ke tempat acara wisuda. Nazaruddin menambahkan, pendaftaran wisuda dapat dilakukan melalui Bank Aceh Syariah Capem UIN Ar-Raniry mulai 17-20 Februari, sedangkan pengambilan baju toga dapat dilakukan di Sekretariat Panitia Bagian Umum Biro Rektor UIN Ar-Raniry pada 21-25 Februari setiap jam kerja. “Calon wisudawan diharapkan dapat mengikuti gladi resik pada Rabu (26/2) pukul 14:30. Ini penting bagi setiap calon wisudawan untuk mendengarkan arahan dari panitia agar upacara wisuda dapat berjalan lancar,” harap dia. (b04)

Sebagian besar caleg bukan tokoh yang peduli nasib perempuan. Mereka terkesan muncul di parlemen dengan tujuan untuk mencari kehidupan, bukan menghidupkan, untuk mem-

bela dan memperjuankan nasib kaumnya. “Menjadi caleg tidak hanya cukup gelar sarjana dan pintar olah vokal saja, namun harus diiringi dengan kepedulian,

tanggung jawab, dan kiprahnya di dalam masyarakat perempuan yangterpinggirkan,”ucapSyarifah yang selama ini kerap menyoroti keadaan sosial menjelang Pemilu Legislatif di Aceh. (b14)

KIP Imbau Caleg Taat Aturan Kampanye BIREUEN ( Waspada): Ketua Divisi Hukum dan Pengawasan Komisi Independen Pemilihan (KIP) Kabupaten Bireuen, Agusni mengimbau agar para calon legislatif (caleg) untuk menaati aturan yakni Peraturan Komisi Pemilihan Umum (PKPU) Nomor 15 tentang Kampanye. Hal ini dikatakannya, Rabu (19/2).

Agusni menyebutkan, aturan kampanye tersebut mengatur bahwa alat peraga kampanye yang berbentuk baliho dilarang bergambar caleg. “Tapi sekarang masih banyak kita melihat baliho yang bergambar caleg,” ucapnya. Sebelumnya, kata dia, KIP Kabupaten Bireuen telah menyurati pengurus semua partai

politik agar taat aturan tersebut, namun belum semua partai politik mengindahkannya. Ketua Forum Komunikasi Pemuda Bireuen, Said Fajri mengajak semua komponen untuk mendukung terciptanya pemilu yang damai. Menurutnya, hal ini pasti akan terwujud jika semua kita menaati aturannya. (b17)

Iklan Politik Tebar Pesona Merebak LANGSA (Waspada) : Menjelang Pemilihan Umum (Pemilu) 2014, iklan politik tebar pesona merebak di sejumlah titik di Kota Langsa. Di mana, seyum pemilu legislatif yang banyak ditunjukkan oleh kebanyakan politikus dalam iklan menggunakan media alat peraga kampanye, dengan media spanduk, baliho, dan stiker, serta kartu nama berusaha menonjolkan citra. Muhammad Khairi, kandidat Master Sosial Politik Islam Pascasarjana IAIN Sumatra Utara Medan, yang juga sebagai

Wakil Ketua Pengurus Pusat Korp Alumni Zawiyah Cot Kala (PP KOPAZKA) Langsa, Rabu (19/2) mengatakan, iklan tersebut untuk menunjukkan bahwa mereka taat beragama, beberapa politisi muncul dengan peci, baju koko, bahkan sorban. Untuk menunjukkan bahwa mereka terdidik, ada politisi yang tidak segan-segan menyebutkan latar belakang pendidikan dirinya dan lulusan perguruan tinggi tertentu, dan untuk menunjukkan bahwa mereka bisa memimpin. “Iklan politik dengan gaya seperti ini tidak

ubahnya seperti iklan obat kuat lelaki,” tegasnya. Menurutnya, jika diamati iklan-iklan politik dengan menggunakan media cetak berupa alat peraga dalam bentuk spanduk, baligo, stiker dan kartu nama belum mendidik rakyat. Sebenarnya sasaran dan target yang akan dicapai dari iklan politik adalah masyarakat pemilih yang diharapkan dapat memberikan dukungan dalam bentuk pemberian suara (vote) kepada calon legislatif tertentu. (cms)

Kampanye Di Mimbar Jumat Mengundang Konflik LANGSA (Waspada): Para pengurus masjid di Langsa diminta supaya berhati-hati dalam mengundang khatib yang akan berkhutbah pada setiap shalat Jumat menjelang pemilu. Jangan sampai mimbar jumat itu digunakan untuk ajang kampanye politik, karena jika hal ini terjadi dikhawatirkan akan mengundang konflik

dalam masyarakat. Kekhawatiran it u mencuat dalam rapat rutin Forum Kewaspadaan Dini Masyarakat (FKMD) Kota Langsa yang berlangsung di aula Badan Kesbang Pol dan Linmas setempat, Rabu (19/2). Kabid Politik Pemerintahan dan Keamanan Badan Kesbang Pol dan Linmas Kota Langsa, M Husen mengungkapkan, pem-

bicaraan dalam rapat itu sebenarnya membahas berbagai hal yang menjadi tugas FKMD. “Benar, masalah kemungkinan penggunaan mimbar jumat untuk ajang kampanye juga ikut dibicarakan,” ujarnya. Dan diharapkan sebelum terjadi perlu dicegah sejak dini dengan mengingatkan para pengurus masjid agar berhati-hati. (b20)

Kemarau Gagalkan Panen Tanaman Hortikultura LHOKSEUMAWE (Waspada): Dampak panjang dari kemarau, menyebabkan ribuan hektare tanaman hortikultura di sejumlah pusat pertanian di Kecamatan Muara Satu, Lhokseumawe, gagal panen. Kebanyakan sumber air yang ada mengering dan petani tidak dapat menyiram tanaman mereka, sebagaimana terlihat pada lahan cabai merah seluas 1,5 hektare di Desa Dayah Paloh, Muara Satu, Lhokseumawe. Sejumlah tanaman yang lagi berbuah ini mati, dan mengalami kerugian puluhan juta rupiah. Ketua Kontak Tani Nelayan Andalan (KTNA) Lhokseumawe, Z Rusli MS saat meninjau lahan cabai merah milik petani, Rabu (19/2) mengatakan, dampak dari kemarau telah membuat sejumlah tanaman hortikultura milik petani gagal panen. “Apalagi saluran irigasi yang seharusnya bisa membantu petani di Lhokseumawe sudah tertutup bangunan liar,” ujarnya. (b14)

Tiba (light, asal, waktu)

Berangkat (light, tujuan, waktu)

Garuda Indonesia GA 0278 Medan GA 0142 Jakarta/Medan GA 0146 Jakarta/Medan

07:05 10:45 14:50

GA 0279 Medan GA 0143 Medan/Jakarta GA 0147 Medan/Jakarta

07:45 11:3 0 15:45

Lion Air JT 304 Jakarta JT 306 Jakarta/Medan JT 396 Jakarta/Medan

11:35 15:55 21:30

JT 397 Medan/Jakarta JT 307 Jakarta JT 305 Medan/Jakarta

06:00 12:15 16:35

12:50

SJ 011 Medan/Jakarta

13:35

Sriwijaya Air SJ 010 Jakarta/Medan

Air Asia QZ 8023 Medan AK 1305 Kuala Lumpur *

12:00 11:20

QZ 8022 Medan AK 1306 Kuala Lumpur*

12:25 11:45

14:00

FY 3400 Penang*

14:20

Fire Fly FY 3401 Penang* * Setiap Senin, Rabu, Jumat dan Minggu.

Korban Lumpuh Layu ”Layu” Tak Dapat Bantuan SYAMTALIRA ARON (Waspada): Renaldi,10, sejak balita terbaring di rumahnya, Desa Matang Meunje, Kecamatan Syamtalira Aron, Aceh Utara, karena lumpuh layu. Akibat penyakit itu dia tidak bisa tumbuh normal sehingga mengharapkan bantuan pihak terkait. Darmiah, 35, ibu Renaldi kepada wartawan beberapa waktu lalu mengisahkan, awal 2004 lalu dia mengalami demam. Namun karena tidak mampu membawa ke spesialis anak sehingga hanya mendapat perawan medis di kawasan tempat tinggalnya. Ketika itu, korban hanya mendapat obat penurun panas. Darmiah memberikan obat

tersebut sesuai petunjuk perawat. Namun karena kondisi Renaldi tidak juga membaik, akhirnya dia mengalami lumpuh. Kondisi itu juga mempengaruhi pertumbuhan korban yang tidak normal. Kedua orang tua Renaldi hanya bekerja sebagai buruh tani sehingga mereka kewalanan mendapatkan biaya untuk perawatan anaknya. Bahkan untuk membawa dia ke rumah sakit lagi, tidak memiliki biaya transportasi dan kebutuhan selama berada di tempat perawatan.Sehingga Darmiah mengharapkan bantuan pihak terkait, untuk membantu mengakhiri penderitaan anaknya. (b15)

Jalan Negara Dipenuhi Gundukan Tanah IDI (Waspada): Menyusul pelaksanaan pekerjaan penimbunan pembangunan gedung Idi Sport Centre (ISC) di Gampong Titi Baro, Kec, Idi Rayeuk, Kabupaten Aceh Timur mengakibatkan ruas jalan negara Medan-Banda Aceh yang saban harinya dilintasi dum truk pengangkut tanah timbunan dimaksud, kini kondisinya sudah ditutupi gundukan tanah kecil-kecil yang dikhawatirkan rawan kecelakaan bagi pengendara sepeda motor. Demikian dikatakan Munawir Sazli,30, salah seorang warga, Selasa (18/2), di Idi Rayeuk. “Gundukan kecil tanah liat yang sudah mengering itu

berasaldariceceranbandumtrukpengangkuttanah yang diambil dari perbukitan kawasan perkantoran pusat Pemerintahan Aceh Timur,” sebutnya. Menurutnya, semestinya rekanan pelaksana pembangunan gedung ISC dan Dinas Pekerjaan Umum Aceh Timur dapat memperhatikan kondisi seperti itu, karena tidak tertutup kemungkinan akibat gundukan tanah itu membuat pengendara khsususnya sepeda motor harus berhati-hati saat melintas agar tidak terpelesat hingga jatuh. Pada sisi lainnya, kondisi cuaca yang panas saat ini mengakibatkan timbulnya juga gumpalan debu yang merisihkan pengguna jalan. (cri)

Waspadai Pendangkalan Aqidah Umat

SMAN-1 Bireuen Dan SMA Sukma Bangsa Raih Rangking I Try Out UN BIREUEN (Waspada) : Rangking kelulusan try out UN SMAN-SMAS se- Kabupaten Bireuen yang diselenggarakan 31 Januari hingga 2 Februari 2014 , SMAN-1 Bireuen unggul meraih rangking-I IPA dan SMAS Sukma Bangsa Bireuen meraih rangking-I IPS. Ketua MKKS SMA Kabupaten Bireuen Abdul Fatah selaku ketua panitia, Rabu (19/2) mengatakan, penyelenggaraan tryout SMA dan SMK se-Kabupaten Bireuen bekerjasama Bimbingan Belajar Azkia School Medan diikuti siswa-siswi 53 SMAN-SMAS dan 10 SMKN-SMKS se-Kabupaten Bireuen untuk menguji kemampuan siswa dalam menghadapi Ujian Nasional April mendatang. Faktor penyebab banyaknya peserta try out UN tidak lulus masih banyaknya para peserta salah dalam mengisi lembaran jawaban komputer sehingga lembaran jawaban tidak terbaca komputer. (b12)

Waspada/Zainal Abidin

RENALDI, asal Desa Matang Meunje, Kecamatan Syamtalira Aron, Aceh Utara mengalami lumpuh layu. Sehingga mengharapkan bantuan pihak terkait

Waspada/Yusri

INILAH lubang yang mengangga di dermaga TPI Kecamatan Rantau Seulamat, Kabupaten Aceh Timur, Rabu (19/2)

Dermaga TPI Rantau Seulamat Butuh Perbaikan IDI (Waspada): Dermaga Tempat Pendaratan Ikan (TPI) di Gampong Rantau Panjang, Kecamatan Rantau Seulamat, Kabupaten Aceh Timur, kini kondisinya memprihatinkan. Pasalnya, bagian lantai dermaga tersebut sudah mengangga dua lubang besar yang telah runtuh ke sungai. Pengamatan di lapangan, TPI tersebut hari-harinya digunakan para nelayan setempat sebagai tempat menurunkan hasil tangkapan nelayan.

Untuk menghindari hal-hal yang tidak diinginkan, pada lubang besar lantai dermaga tersebut diberi tanda dengan menaruh kayu balok. Namun, apabila ada kendaraan yang akan mengangkut tong ikan hasil tangkapan nelayan dan dapat masuk langsung ke dermaga itu terlihat sangat hati-hati menghidari lubang dimaksud. Menurut warga setempat, kerusakan lantai bangunan TPI tersebut sudah lama terjadi yang kemungkinan disebabkan kua-

litas lantainya yang kurang baik. Warga setempat mengharapkan kepada instansi terkait dalamhaliniDinasPerikanandan KelautanAcehTimuruntukdapat memperbaiki lantai dermagaTPI yang telah rusak tersebut. Kadis Perikanan dan Kelautan Aceh Timur Ahmad mengatakan, menyangkut TPI Rantau Seulamat itu pihaknya saat ini sedang berupaya semaksimal mungkin untuk mengaktifkan secara optimal aktivitas TPI dimaksud. (cri)

BLANGKEJEREN (Waspada) : Peran ulama dalam pembangunan daerah, khususnya pembangunan mental spiritual yang harus dijalankan oleh umat Islam sehingga bangunan moral yang berlandaskan agama Islam dapat terjaga dan terpelihara dengan baik, bangunan ini tidak tergerus oleh pendangkalan aqidah yang dilakukan oleh sekelompok orang tertentu. Demikian disampaikan Faisal Ali dalam khutbah Iftitah pembukaan, Eksistensi Peran Ulama dalam Pembangunan Daerah Kabupaten Gayo Lues, Rabu (19/2) di gedung Nusa Indah Pengkala, Blangkejeren. Dilanjutkannya, beberapa hal yang mengkhawatirkan dalam pembangunan keagamaan, seperti adanya upaya pemurtadan, pendangkalan aqidah dan penyebaran aliran sesat. “Kita tentu harus bekerja keras dan beker-

jasama dengan melibatkan komponen masyarakat untuk mengawasi, membentengi dan membimbing umat Islam di Aceh. Hal tersebut dapat dimulai dari pembangunan aqidah keluarga, generasi muda dan masyarakat kita dari ancaman dan pengaruh serta aksi pendangkalan aqidah, pemurtadan, penyebaran aliran sesat dan aliran sempalan di Provinsi Aceh,” ujar Faisal. Saifuddin Puteh, Kepala Sekretariat MPU Aceh melaporkan, kegiatan eksistensi peran ulama bukan hanya sebagai sarana silaturahmi, koordinasi dan konsolidasi antara ulama dan umara dalam menjawab tantangan zaman yang semakin berat di masa yang akan datang, tetapi juga menjadi momentum penting untuk mengoptimalkan peran ulama dalam pembangunan daerah. (cjs)

Pelayanan Puskesmas Langsa Lama Tak Maksimal LANGSA (Waspada): Pelayanan Puskesmas Langsa Lama dinilai tidak maksimal. Hal ini membuat sejumlah warga yang berobat ke puskesmas itu merasa kecewa karena dan meminta kepada Wali Kota Langsa untuk menegur kepala puskesmas tersebut. Salah seorang ibu rumah tangga, Lydiawati, 28, warga Gampong Sidorejo, Kecamatan Langsa Lama, Rabu (19/2) mengungkapkan, saat itu pergi ke puskesmas tersebut untuk membawa anaknya berobat dan tiba di puskesmas sekitar pukul 11:15. Namun, setelah menunggu hingga 30 menit belum juga dipanggil, akhirnya ibu tadi bertanya kepada seseorang petugas di puskesmas tadi.

“Pak apa ada dokternya,” tanyanya dan dijawab “Saya dokternya,” ujar petugas tadi yang ternyata dokter umum di bagian poly umum. Ironisnya, dokter umum tersebut sebelumnya saat sedang asyik-asyik ngobrol dengan petugas puskesmas lainnya, padahal ada empat orang pasien yang menunggu dipanggil untuk melakukan pemeriksaan atas penyakitnya. “Seharusnya seorang dokter tidak boleh seenaknya aja menelantarkan pasiennya ketika hendak berobat,” ujarnya. Kepala Puskesmas Langsa Lama Edi Syahputramengatakan, akan memanggil dokter bersangkutan untuk mempertanyakan prihal tersebut. (cms)

merupakan tanggung jawab personal, namun akan lebih baik apabila Pemkab Gayo Lues sebagai pemegang otoritas dari penanganan bencana di bawah kendali Badan Penanggulangan Bencana Daerah (BPBD) Gayo Lues lebih mawas, tentu kejadian kebakaran dapat dicegah untuk tidak meluas. Selayaknya semua tempat usaha, dan pemukiman padat penduduk, rumah yang berdempetan dan gedung-gedung perkantoran pemerintahan harus memiliki proteksi dini dalam penanganan kebakaran. Semua ini bertujuan untuk pertolongan pertama atau aksi dini ketika muncul titik api berbahaya yang berakibat terjadinya kebakaran yang terus meluas. Konon lagi, musim kemarau yang masih berkepanjangan di daerah Gayo Lues sudah barang tentu potensi kebakaran menjadi cukup tinggi, seperti kebakaran yang terjadi di halaman belakang Gedung Inspektorat terjadi beberapa minggu silam. Apabila tidak ditangani oleh tim Pemadam Kebakaran BPBD akan menghanguskan gedung

Inspektorat kabupaten Gayo Lues tersebut. Kasus serupa juga terjadi di sekolah SMK 1 Blangkejeren hampir saja bangunan gedung sekolah tersebut terbakar akibat api yang menyerembet hingga pagar sekolah tersebut. “Kalau saja tim pemadam tak datang memadamkan api ke lokasi ini, mungkin saja sekolah ini juga akan ikut terbakar” ujar Deni salah satu guru di sekolah tersebut. Andai saja dilakukan tindakan dini sebelum tim pemadam kebakaran datang ke lokasi seperti menyemprotkan racun api berbentuk tabung yang lazim terpasang di sudut-sudut gedung dan fasilitas umum, tentu hal tersebut tidak menimbulkan kepanikan. Kepemilikan APAR (Alat Pemadam Api Ringan) baik berbentuk Tabung Racun Api atau sejenisnya adalah wajib untuk semua gedung. Dihitung berdasarkan jumlah ruang di dalamnya, luas gedung dan jumlah tingkatan gedung tersebut. Jasvira Sautisa

Pid

so (b

di

dia

Ba

ke

(B

de

un

ka

Sy

Perlunya Proteksi Pemadam Di Gayo Lues SPBN Di PPI Sigli Terlantar BLANGKEJEREN (Waspada) : Menjadi trauma yang mendalam bagi masyarakat Gayo Lues dengan terjadi kebakaran di Kampung Durin pada Desember di pengujung tahun 2013 yang lalu. Akibat kebakaran tersebut, menyebabkan belasan rumah, kendaraan, perlengkapan rumah tangga hangus terbakar, bahkan kerugian materi lainnya, musibah tersebut banyak dialami korban yang mayoritas berprofesi sebagai pedagang. Hal ini tentu menjadikan roda perekonomian masyarakat menjadi lambat dan stagnan. Duka dan pilu para korban belum lagi habis, selang beberapa hari, masyakarat Durin, Blangkejeren kembali dikejutkan dengan amukan si jago merah yang melalap 4 pintu rumah. Tercatat 5 kebakaran besar terjadi terhitung dalam kurun waktu 5 tahun terakhir dan kesemuanya berada di permukiman padat penduduk. Hal ini tentu menuntut kepada semua elemen untuk lebih waspada terhadap api. Pada prinsipnya ini semua

Ke

SIGLI (Waspada) : Station Pengisian Bahan Bakar Nelayan (SPBN) di komplek Pelabuhan Pendaratan Ikan (PPI) Kuala Pasi Peukan Baro Kota Sigli, Kabupaten Pidie, yang dibangun sejak enam tahun lalu hingga kini masih diterlantarkan. Pasalnya, hingga kini SPBN yang dibangun pada tahun 2007 tersebut belum difungsikan, sehingga saat ini kondisinya terlantar dan terancam jadi besi tua. Padahal sebelumnya Pemkab Pidie berjanji segera memfungsikan SPBN untuk pengisian BBN Waspada / Rusli Ismail bagi nelayan di sana, ungkap BANGUNAN SPBN : Seorang warga sedang berjalan diantara beberapa nelayan di sana ke- bangunan SPBN (Stasiun Pengisian Bahan Bakar Nelayan) yang pada Waspada, Senin (17/2). sejak lama tidak pernah berfungsi, sehingga terkesan bangunan Pantauan Waspada, ba- mubazir ngunan pompa SPBN yang berada di kompleks PPI Kuala Pasi Peukan Baro memfungsikan TPI tersebut. Pernyataan itu disampaikan Sarjani saat meSigli diterlantarkan begitu saja. Namun, diakui nelayan bahwa SPBN itu sudah direhab, namun nyampaikan sambutannya pada acara khenduri belum difungsikan sama sekali. Sehingga nela- laot yang digelar nelayan di komplek PPI tersebut yan terpaksa membeli solar di SPBU yang terka- beberapa waktu lalu. Kepala Dinas Kelautan dan Perikanan (DKP) dang sangat susah untuk mendapatkannya. Bupati Pidie, Sarjani Abdullah menyatakan Kabupaten Pidie, Ir Aspar yang menanggapi kekecewaannya karena miliaran dana telah permintaan Bupati Pidie mengatakan, pihaknya dialokasi untuk PPI) Pasi Peukan Baro Sigli, tapi akan memfungsikan sarana itu pada Februari masih terlantar. Bupati meminta Kepala Dinas ini. Menurutnya, terlantarnya PPI itu karena Kelautan dan Perikanan (DKP) setempat untuk sebelumnya fasilitas belum lengkap.(b09)

RI Lh

ek jug

Ge da

ST

se

tin

uja

ka

At

ini

dig

ke

ha


Aceh

B12

WASPADA Kamis 20 Februari 2014

Poltek Lhokseumawe Siap Kirim Tenaga Kerja Ke Luar Negeri LHOKSEUMAWE (Waspada): Ridwan, Direktur Politeknik Negeri Lhokseumawe, Rabu (19/2) mengatakan, pihaknya saat ini sedang mempersiapkan sumber daya manusia (SDM) yang andal di bidangnya masing-masing untuk dijadikan sebagai tenaga kerja di luar negeri, khususnya untuk industri hulu Migas. Disebutkan, cadangan Migas terbesar di dunia berada di Timur Tengah, salah satunya Qatar. Namun pasca 2016, cadangan Migas terbesar berpindah ke Australia dengan potensi migasnya jauh lebih besar dibandingkan di Timur Tengah. Dan selama ini kebutuhan tenaga kerja migas untuk Indonesia banyak digunakan oleh daerah luar, seperti Bontang, Kalimantan Timur. Seharusnya, Pemerintah Daerah Kabupa-

ten Aceh Utara dan Kota Lhokseumawe harus lebih dulu mempersiapkan SDM Migas, karena memiliki industri migas seperti ExxonMobil dan PT Arun NGL. Peluang yang ada akan dimanfaatkan Politeknik sebagai penyelenggara pendidikan tinggi, PT Arun termasuk Pemda untuk mempersiapkan tenaga kerja migas sesuai dengan kebutuhan yang diinginkan luar negeri. “Alumni Politeknik di Qatar sudah cukup banyak ditambah lagi alumni dari PT Arun, dan ternyata dalam waktu tiga bulan bekerja di sana, ternyata kemampuan mereka mampu menyaingi kemampuan dari alumni-alumni di daerah lainnya. Untuk mewujudkan cita-cita ini membutuhkan kebijakan dari Pemda. Sedangkan Politeknik hanya menyiapkan tenaga, sementara kebijakan itu milik Pemda,” kata Ridwan. (b18)

Gudang PT Laot Bangko Terbakar SUBULUSSALAM (Waspada): Gudang PT Laot Bangko yang menyatu dengan kantor arsip dan bengkel, berjarak sekira 30 meter dari perumahan karyawan di Desa Jontor Kec. Penanggalan, Subulussalam, ludes dilalap api, Rabu (19/2). Menyusul kejadian itu, sejumlah karyawan dan warga sekitar tumpah ke sana, tak kecuali personil Polsek Penanggalan. Kapolres Aceh Singkil AKBP Anang Triarsono melalui Kapolsek Penanggalan, Kapten Budimansyah di lokasi kejadian mengatakan, pihaknya akan melakukan penyelidikan lebih lanjut.

Manajer PT Laot Bangko, Fery Syahputra terpisah mengatakan, dirinya mendapat laporan saat berada di lapangan sekira pukul 13:30 dan segera turun ke Tempat Kejadian Perkara (TKP). Dikatakan, sumber api tampak muncul dari bagian plafon gudang tempat penyimpanan spare part baru dan bekas, yang juga menyatu dengan bengkel dan kantor arsip. Sejumlah peralatan yang ikut terbakar dengan besar kerugian ditaksir mencapai Rp900an juta itu seperti spare part, jonder/kendaraan MF, mobil helen, sepeda motorYamahaYT 3 unit, batre baru 9 unit buah dan bahan kimia herbisida lain. (b28)

Waspada/Amiruddin

PETUGAS BNNK Bireuen bersama Dinas Kesehatan setempat melakukan test urine siswa SMP Negeri 1 Kecamatan Juli, Rabu (19/2).

Siswa SMP Bireuen Test Urine BIREUEN (Waspada): Seratus pelajar SMP Negeri 1 Kecamatan Juli, Bireuen, ditest urine oleh Badan Narkotika Nasional Kabupaten (BNNK) setempat, Rabu (19/2). Pemeriksaan ini merupakan

serangkaian kegiatan dalam rangka peningkatan peran serta sekolah dalam menciptakan sekolah tanpa narkoba. Kepala BNNK Bireuen Agussalim mengatakan, selain test urine, BNN juga memberikan penyuluhan anti narkoba dan bimbingan tentang bahaya penyalahgunaannya. “Penyuluhan juga dengan

Terdakwa Pengeroyok Dituntut Setahun Percobaan LHOKSEUMAWE (Waspada): Kasus pengeroyokan anggota Satuan Polisi Pamong Praja (Satpol PP) Lhokseumawe dan Panitia Pengawas Pemilu (Panwaslu) Kecamatan Muara Dua, dengan terdakwa S, 30, warga Kecamatan Samudera, Aceh Utara dituntut hukuman percobaan setahun. Materi tuntutan itu dibacakan Jaksa Penuntut Umum (JPU), Edwardo, dalam sidang lanjutan kasus tersebut, Selasa (18/2) di Pengadilan Negeri Lhokseumawe. Sementara sidang dipimpin Zulfikar, dan didampingi dua hakim anggota M Jamil serta Nasri. Dalam materi tuntutan tersebut jaksa menguraikan tentang keterangan saksi yang dimintai keterangan pada sidang sebelumnya dan juga keterangan terdakwa, serta kronologis kejadian. Menurut jaksa, terdakwa melanggar Pasal 212 KUHPidana, tentang melawan pejabat yang sedang melaksanakan tugasnya. Selanjutnya, hakim menunda sidang sampai, Selasa (25/ 2) mendatang dengan agenda putusan. (cmk)

Rutan Lhoksukon Krisis Air Bersih LHOKSUKON (Waspada): Rumah Tahanan Negara (Rutan) Lhoksukon mendadak rusuh, Selasa (18/2) sekitar pukul 18:30. Puluhan narapidana mengamuk gara-gara krisis air bersih. Sebagian napi, khususnya penghuni kamar C7 melancarkan aksi protes dengan cara berteriak sembari menggoyang jeruji besi. Namun, tak lama kemudian, situasi terkendali setelah puluhan polisi didatangkan ke lokasi dan pihak rutan memasok air bersih dengan mobil tangki. Kepala Rutan Lhoksukon, M Saleh menyebutkan, air bersih sebenarnya tersedia di Rutan Lhoksukon. Namun tidak mencukupi karena jumlah tahanan dan napi sudah melebihi kapasitas Rutan. “Beberapa napi memang marah-marah. Tapi, tak lama kemudian, situasi kembali normal setelah kebutuhan air mereka kita penuhi,” katanya. M Saleh merincikan, kapasitas Rutan Lhoksukon sebenarnya hanya 90 orang. Namun, jumlah penghuni saat ini sudah mencapai 250 orang. “Kondisi ini agak riskan. Apalagi, jumlah petugas kita juga terbatas,” paparnya. (b19)

Ratusan Ha Sawah Terlantar MANGGENG RAYA (Waspada) : Ratusan hektare lahan persawahan penduduk di Kecamatan Setia dan Kecamatan TanganTangan terlantar dan tidak bisa ditanami, hal itu diakibatkan karena tidak ada sumber air yang bisa mengaliri sawah dimaksud. Informasi yang dihimpun, Selasa (18/2) diketahui, terlantarnya ratusan hektare sawah penduduk di sejumlah desa dalam 2 wilayah kecamatan itu disebabkan tersumbatnya saluran sekunder Alue Mangota Daerah Irigasi Krueng Susoh sayap kiri, di mana saluran sekunder itu mengaliri kurang lebih 3 ribu hektare sawah penduduk di dua kecamatan itu. Warga setempat sangat mengharapkan pemerintah melalui instansi terkait dapat segera memperbaiki saluran sekunder di wilayah tersebut seperti saluran sekunder Alue Mangkota Daerah Intek (DI) Krueng Susoh, yang sudah puluhan tahun tidak berfungsi normal dan belum bisa dimanfaatkan oleh petani daerah itu. (cza)

3 Ribu Anak Yatim Abdya Disantuni MANGGENG RAYA (Waspada) : Sedikitnya 3 ribu anak yatim dan yatim piatu di sembilan wilayah kecamatan di Kabupaten Aceh Barat Daya disantuni dalam acara maulid akbar nabi besar Muhammad SAW, Rabu (19/2) di Masjid NurulYaqin Desa Lhang Kecamatan Setia. Hadir dalam acara hari ituWali Nanggroe (WN) Tengku Malik Mahmud Al-Haytar Malik Mahmud bersama Sekretarisnya Paradis, didampingi Bupati Abdya Jufri Hasanuddin,Wakil Bupati Abdya Yusrizal Razali. Setiba dilokasi,Tengku Malik Mahmud langsung memberikan santunan secara simbolis kepada anak yatim, selanjutnya makan bersama dengan tiga ribu anak yatim ditambah para tamu undangan dan masyarakat setempat. Kadis Syariat Islam Abdya Amirman mengatakan, jumlah anak yatim yang disantuni hari sebanyak 3 ribu orang dari seluruh kecamatan dengan total anggaran Rp150 juta. “Semuanya sudah kita salurkan, jangan melihat jumlahnya, tapi manfaat pemerataan sehingga semua dapat menikmatinya,” katanya.(cza)

melibatkan pisikolog dari rumah sakit, yakni Cut Nazwati,” ucap Agussalim. Dia menjelaskan, dari hasil pemeriksaan urine, jika ada di antara siswa yang positif mengonsumsi narkoba, maka akan dilakukan pembinaan oleh pihak BNNK. Agussalim menambahkan, kegiatan di SMP Negeri 1 Keca-

matan Juli ini merupakan tahap awal kegiatan test urine di kalangan pelajar di Kabupaten Bireuen. “Kita rencanakan akan kita laksanakan 5 sampai 7 sekolah, setiap sekolah diambil sampelnya 100 siswa,” kata Agussalim. Samion, guru SMP Negeri 1 Kecamatan Juli, mengatakan,

pihak sekolah menyambut baik pelaksanaantesturineyangdilaksanakan oleh BNNK dan melibat tenaga dari Dinas Kesehatan. Melalui pemeriksaan ini, katanya, pihak sekolah akan mengetahui dan memberikan bimbingan jika ada di antara siswa yang mengonsumsi narkoba. (b17) Waspada/Khairul Boangmanalu

Perlu Pencegahan Jaringan Narkoba Di Kalangan Pelajar LANGSA (Waspada): Untuk mencegah dan memutuskan jaringan narkoba di lingkungan sekolah, Badan Narkotika Nasional (BNN) Kota Langsa melatih 100 pelajar SMA sebagai kader pelopor selama tiga hari di Hutan Lindung Kota Bale Jorong Kota Langsa, Minggu (16/2). Menurut Kepala BNN Kota Langsa, AKBP Navri Yulenni, Selasa (18/2), hadirnya kader pelopor di kalangan siswa SMA guna memutus mata rantai jaringan narkoba di kalangan remaja, khususnya di lingkungan sekolah. Di mana pada pelatihan kader ini diikuti 100

pelajar dari 21 sekolah se Kota Langsa. Kegiatan ini dibagi dalam dua gelombang, selama empat hari mulai dari 12-16 Februari 2014 yang terbagi dalam dua kegiatan, yakni materi ruang di Hotel Harmoni dan outbound di Hutan Kota Bale Jurong. “Pada pelatihan ini, para pelajar diberikan materi seputar narkoba, motivasi pencegahan dan membentuk jati diri untuk berani berperang melawan narkoba. Di samping itu, untuk kegiatan outbound bertujuan untuk menjalin kerjasama, rekreasi alam untuk berpikir sehat

dan kepedulian terhadap kelestarian alam,” tandas Navri. Lanjut Navri, BNN Langsa akan terus menyatakan perang terhadap narkoba, salah satu pernyataan perangi narkoba di lingkungannya melalui program penguatan kader ke sekolah-sekolah, sehingga ini membuat siswa merasakan mendapatkan hal baru. Melalui kegiatan nantinya siswa akan berpartisipasi dan mampu menciptakan lingkungan masyarakat bebas/bersih dari penyalahgunaan narkoba. (m43)

Proyek Jalan Nasional Di Lhoksukon Terindikasi Korupsi LHOKSUKON (Waspada) : Proyek jalan nasional Medan – Banda Aceh di kawasan Kecamatan Lhoksukon, Kabupaten Aceh Utara yang baru usai dibangun kembali mengalami kerusakan ternyata terindikasi korupsi, mengingat adanya dugaan status pelaksanaannya adalah sebuah perusahaan fiktif. Sesuai data yang diterima dari sumber menerangkan, proyek tersebut ditender pada Direktorat Jenderal Bina Marga, melalui unit Satuan Kerja Pelaksanaan Jalan NasionalWilayah I Provinsi Aceh. Sedangkan nama paketberupapekerjaanpelebaran jalan batas Kota Lhokseumawe s/d Panton Labu, Aceh Utara,kilo meter (Km 328). Berdasarkan surat penunjukan pemenangNo.KU. 03.01/PPK3-Br.A2/1022, tertanggal : 11 Juni 2012, kepada PT.Andalusia Samudra, beralamat Jln. T. Maha Raja No. 16,

MonGeudong, Kota Lhokseumawe, Provinsi Aceh. Kemudian, tanda tangan kontrak tertanggal : 12 Juni 2012, kontrakNo: KU.08.08/CTRBr.A2/14/APBN/2012, sedangkan nilai kontrak sebesar Rp. 4,619,996,000-, dengan batas waktu pekerjaan selama 188 hari kalender terhitung sejak 12 Juni 2012 atau selama 6 bulan lamanya. Anehnya, alamat perusahaan PT Andalusia Samudra, yang tercatat dalam dokumen kontrak Jalan T Maha Raja No.16, Mon Geudong, Kota Lhokseumawe, ternyata itu adalah sebuah alamat palsu. Waspada juga sudah menelusuri untuk mencari alamatnya, namun dilapangan justru warga sekitar mengungkapkan itu bukan alamat perusahaan dimaksud, tapi alamat milik kampus Akademi Sekretariat Manajemen (ASM) Tanah Ren-

cong di Kecamatan Banda Sakti. Kadis Bina Marga Kabupaten Aceh Utara Risawan Bintara mengaku tidak bisa menjawab konfirmasi dengan alasan sedang mengikuti rapat. Badan Koordinator LSM Masyarakat Transparansi Aceh (MaTA) Alfian mengatakan, proyek jalan negara tidak berkualitas lantaran diduga kuat terjadinya indikasi korupsi dan penyimpangan dengan modus mark-up bahan material bangunan. Seorang tokoh masyarakat Kecamatan Lhoksukon T Amri mengatakan, kondisi jalan negara yang baru saja dibangun, kini kembali mengalami kerusakan yang cukup parah. Amri menyebutkan, kondisi jalan negara yang baru usai dibangun itu sangat memprihatinkan. Sepanjang badan jalan mengalami kerusakan cukup parah. (b16)

MOBIL pemadam menyisir sisa-sisa api yang melalap gudang PT Laot Bangko, Rabu (19/2)

Kejari Langsa Menunggu Penetapan Uang Sitaan LANGSA (Waspada): Terkait kasus dugaan korupsi pembangunan aula DPRK Langsa tahun 2010, Kejaksaan Negeri (Kejari) Langsa, sedang menunggu penetapan uang sitaan dari Pengadilan Negeri Langsa, untuk melimpahkan berkas kasus tersebut ke Pengadilan Negeri Tindak Pidana Korupsi (Tipikor) Banda Aceh. Demikian disampaikan Kepala Kejaksaan Negeri (Kajari), Miftahol Arifin melalui Kasi Pidana Khusus (Pidsus), Hendarmen kepada wartawan, Rabu, (19/2), di kantornya. Dijelaskan, sebelumnya belum dilimpahkannya berkas kasus tersebut ke Pengadilan Tipikor karena masih menunggu ditandatanganinya berita acara uang sitaan tersebut dari tersangka Samsul Bahri sebagai pelaksana lapangan pembangunan aula DPRK. Karena, sebelumnya uang itu disetorkan oleh Samsul sebagai titipan.

Namun sekarang berita acara uang tersebut sudah ditandatangani oleh Samsul, hanya saja sekarang tinggal menunggu penetapan uang sitaan sebesar Rp170 juta dari Pengadilan Negeri Langsa. Jika sudah turun penetapan uang, maka selanjutnya P21, kemudian dilanjutkan tahap kedua dilimpahkan berkas perkara dugaan korupsi pembangunan aula DPR itu ke Pengadilan Negeri Tipikor Banda Aceh. Ketika ditanya, apakah tiga orang yang telah ditetapkan sebagai tersangka oleh pihak kejaksaan, yakni Syahrir sebagai Direktur PT Langsa Jaya Beutari , Zahrial sebagai konsultan pengawas, dan Syamsul Bahri sebagai pelaksana lapangan pembangunan aula DPRK akan ditahan, Hendarmen mengakui untuk sementara belum dita-han, tapi kemungkinan pada tahap kedua nanti akan ditahan, namun itupun tergantung dari Kepala Kejaksaan Negeri Langsa. (cms)

Pemkab Aceh Utara Salurkan Beras Gratis Untuk Masyarakat Miskin ACEH UTARA (Waspada): Untuk meringankan beban masyarakat miskin dalam memenuhi kebutuhan hidup, Muhammad Thaib dan Muhammad Jamil, menggratiskan beras kepada masyarakat miskin. Untuk kebutuhan tersebut, Aceh Utara mengalokasikan anggaran sebesar Rp14 miliar untuk setahun. Penyaluran beras mulai dilakukan, Rabu (19/2) dan diperkirakan selesai dilaksanakan 10 hari ke depan. Untuk tahap pertama, Aceh Utara menyalurkan beras miskin untuk lima kecamatan yaitu Kecamatan Banda Baroe, Paya Bakong, Cot Girek, Tanah Jambo Aye, dan Kecamatan Langkahan. “Untuk lima kecamatan tersebut sudah disalurkan, Rabu (19/2), untuk kecamatan lainnya dilaksanakan secara bertahap dan InsyaAllah penyaluran raskin gratis ini selesai

kita lakukan 10 hari ke depan,” kata Muhammad Thaib yang diamini Kabag Humas Fakhruradhi. Pemberian beras miskin gratis dilakukan Pemerintah Kabupaten Aceh Utara atas pertimbangan, walaupun pemerintah pusat telah memberikan beras miskin, namun masyarakat masih belum mampu menebus dengan harga per kilogram Rp1.600. Itu disebabkan kondisi ekonomi masyarakat yang lemah. Penyaluran beras miskin gratis yang disalurkan kepada masyarakat yang disalurkan itu merupakan tahap pertama untuk realisasi penyaluran raskin tahun 2014 periode 1 Januari-19 Februari 2014. Banyaknya beras yang disalurkan pada tahap pertama sebanyak 760,710 kilogram dengan jumlah rumah tangga sasaran (RTS) di 27 kecamatan. (b18)

Perebutan Lahan Jangan Korbankan Masyarakat LANGSA (Waspada): PT KAI dan Pemko Langsa diminta untuk sesegera mungkin menyelesaikan sengketa permasalahan secara tegas dan benar agar mengetahui sebenarnya pihak mana yang secara sah dan resmi. Karena jika terus dibiarkan akan menimbulkan konflik dan keributan di kalangan masyarakat, khususnya para pedagang Pasar Langsa. Ketua LIRA (Lumbung Informasi Rakyat) Provinsi Aceh, Muslim mengatakan, sehubungan dengan adanya pembangunan lapak/kios di lahan PT

Kereta Api Indonesia (KAI) Persero di area Pasar Langsa, tepatnya di kawasan rel kereta api antara Masjid Raya dengan Pasar Ikan, lahan ini saat ini menjadi perebutan para pihak dan masing-masing pihak mengklaim mempunyai hak atas lahan tersebut. “Untuk itu, LIRA bersama masyarakat pedagang Pasar Langsa mengimbau semua pihak yang bertikai di lahan tersebut jangan sampai ada pedagang yang dimanfaatkan apalagi dirugikan dalam perebutan lahan ini. Karena ini ke-

pentingan para pihak yang ingin mencari keuntungan, sementara masyarakat pedagang yang akan menjadi korban,” katanya. Apabila ini terjadi, lanjut Cut Lem, LIRA bersama ratusan bahkan ribuan masyarakat pedagang akan melawan para pihak tersebut dan elemen manapun yang membeckingnya. Persoalannya, setiap kali terjadi perebutan lahan di daerah pasar seperti yang sudah-sudah selalu masyarakat pedagang yang jadi korban, lalu mereka yang mencari keuntungan. (m43)

Waspada/Maimun Asnawi

MASYARAKAT miskin sedang menerima beras miskin yang disalurkan Pemerintah Kabupaten Aceh, Rabu (19/2)

Waspada, kamis 20 februari 2014  
Read more
Read more
Similar to
Popular now
Just for you