Issuu on Google+

Siapa Imam Anda...? Lihat hal. C4 Dan C5

Masjid Raya Medan

JUMAT, Pon, 24 Mei 2013/14 Rajab 1434 H

WASPADA Demi Kebenaran Dan Keadilan

www.waspadamedan.com

Harian Umum Nasional Terbit Sejak 11 Januari 1947 Pendiri : H. Mohd. Said (1905 - 1995) Hj. Ani Idrus (1918 - 1999) ISSN: 0215-3017

Terbit 28 Halaman (A1-12, B1-8, C1-8)

No: 24232 Tahun Ke-67

Harga Eceran: Rp2.500,-

Hari Ini UN SMA/MA/SMK Di Sumut Diumumkan

2.519 Siswa Tak Lulus

MEDAN (Waspada): Sebanyak 2.519 siswa SMA, MA dan SMK di Sumatera Utara dinyatakan tidak lulus Ujian Nasional (UN) tahun pelajaran 2012/2013, karena tidak memenuhi standar nilai kelulusan yang disyaratkan.

“Hasil UN tingkat SMA/MA dan SMK di Sumut tahun ini mengalami penurunan signifikan dibandingkan tahun sebelumnya,” kata Sekretaris Dinas Pendidikan Sumatera Utara, Drs Hendri Siregar,

Kamis (23/5). Didampingi Ketua Panitia UN Sumut, Yusri, SH, Hendri Sirgar mengatakan siswa tidak lulus masing-masing dengan rincian, SMK dengan jumlah peserta UN sebanyak 82.425

siswa yang tidak lulus 1.616 siswa atau sekitar 1,96 persen. Kemudian, lanjutnya, SMA/ MA jurusan/program IPA dengan jumlah peserta 64.680 orang yang tidak lulus sebanyak 736 siswa atau sekitar 1,14 per-

sen. Sedangkan program IPS dengan jumlah peserta ujian 52.280 orang yang dinyatakan tidak lulus sebanyak 2.196 siswa atau sekitar 4,02 persen.

Lanjut ke hal A2 kol. 6

BPIH Embarkasi Medan 3.263 Dolar AS M E D A N ( Wa s p a d a ) : Jamaah calon haji (Calhaj) tahun ini, sudah bisa melunasi Biaya Penyelenggaraan Ibadah Haji (BPIH) tahun 2013 sejak 22 Mei s/d 12 Juni 2013 . Untuk BPIH Embarkasi Medan tahun 2013 mencapai 3.263 dolar, sedangkan pembayaran dilakukan setiap jam kerja pukul 10 s/d 16 di Bank Penerima Setoran Biaya Penyelenggara Ibadah Haji (BPS-BPIH). Kepala Kantor Kementerian Agama Wilayah Provinsi Sumatera Utara, Drs Abd Rahim

Pelunasan Terakhir 12 Juni M.Hum bersama Kabid Haji dan Umroh Drs Abd Rahman Harahap, Kamis (23/5) di Aula Kantor Kementerian Agama

Wilayah Sumut menyebutkan, Calhaj yang sudah melakukan penyetoran selambatnya 3 hari, segera mendaftar ulang ke Ke-

menterian Agama kabupaten/ kota tempat domisili Calhaj. Sedangkan jamaah yang telah mendapat porsi dan masuk

gikan kepada anggota Kongres sehari sebelum Presiden Barack Obama diperkirakan menjanjikan keamanan nasional yang lebih transparan dalam pidato tentang upaya menindas terorisme. Seorang pejabat Gedung Putih mengatakan, Obama akan menyampaikan lewat pidatonya kenapa menggunakan pesawat tanpa awak dinyatakan ‘perlu,

10 Perempuan Paling Berpengaruh Di Dunia Majalah ekonomi terkemuka, Forbes, kembali melansir daftar 100 perempuan paling berpengaruh di muka Bumi. Dalam daftar tersebut, terselip nama Managing Director Dana Moneter Internasional (IMF), Sri Mulyani Indrawati. Daftar ini terdiri atas berbagai tokoh perempuan dunia, dari pemimpin negara, pebisnis hingga artis. Mereka menjadi agen pengubah dunia yang sebenarnya, penuh dengan gagasan, pengaruh, dan otoritas. Mereka mengubah dunia dengan cara yang segar dan menyenangkan. Sembilan kepala negara masuk dalam daftar ini, satu di antaranya berada di peringkat pertama. Kanselir Jerman Angela Merkel berada di posisi puncak, ketujuh kalinya dalam 10 tahun terakhir. Lanjut ke hal A2 kol. 6

sesuai hukum dan tepat’. Pidatonya itu akan disampaikan bersamaan dengan penandatanganan panduan kebijakan presiden dalam menetapkan standar serangan pesawat tanpa awak AS, kata pejabat itu. Reuters melaporkan awal minggu ini, pemerintah telah memutuskan untuk memberi kuasa kepada Pentagon dalam hal pengoperasian pesawat tanpa awal yang sekarang ditangani CIA. Tindakan tersebut akan menggeser penggunaan kenderaan tanpa awak itu berada dalam pengawasan kongres yang lebih luas. Dalam suratnya untuk anggota Kongres, Holder membenarkan bahwa AS‘secara khusus menyasar dan membunuh’ ulama Awlaki, yang kelahiran New Mexico, di Yaman pada tahun 2011. Dia mengatakan, tiga orang warga Amerika lainnya yang dibunuh, namun tidak sengaja menjadi sasaran, adalah putra Awlaki yang masih remaja Abdulrahman, Samir Khan,

Lanjut ke hal A2 kol. 3

Antara

SEJUMLAH mahasiswa Institut Teknologi Medan (ITM) berunjuk rasa dengan menyandera mobil plat merah di Medan, Kamis (23/5). Mereka menolak rencana kenaikan harga BBM.

Belum Ada Wacana PKS Ke Luar Dari Koalisi Demokrat: Silakan JAKARTA (Waspada): Usul Wakil Sekretaris Jenderal PKS Fahri Hamzah kepada partainya untuk keluar dari koalisi pemerintah Susilo Bambang Yudhoyono, disikapi oleh Ketua Fraksi PKS Hudayat NurWahid. Menurut Hidayat Nur Wahid, Kamis(23/5), belum ada wacana dari internal partainya untuk keluar dari koalisi pemerintahan, meskipun tidak ter-

tutup kemungkinan bagi PKS untuk keluar dari koalisi. Pembahasan soal koalisi, kata Hidayat, merupakan wewenang Dewan Pimpinan Tingkat Pusat (DPTP) PKS yang terdiri dari Ketua Majelis Syuro, Presiden PKS, Sekjen dan Bendahara Dewan Pimpinan Pusat PKS, Ketua Dewan Syariah, serta Ketua Majelis Pertimbangan Partai. “Jadi Majelis Syuro dan

DPTP mempertimbangkan seluruh perkembangan yang ada, termasuk APBNP, kondisi sosial ekonomi politik di masyarakat, dan beragam hal lain,” kata Hidayat di gedung DPR RI, Senayan, Jakarta. Menurut Hidayat, PKS tidak mutlak harus berada dalam koalisi. Secara prinsip, koalisi

Lanjut ke hal A2 kol. 5

SABANG (Waspada) : Seorang polisi yang bertugas di Polres Sabang, Kamis (23/5) menggagalkan pelaksanaan hukum cambuk di Masjid Agung, kota itu. Awalnya, tiga pelanggaran maisir (judi) yang sudah divonis Majelis Hakim di Mahkamah Syar’iyah Kota Sabang, Kamis siang bersiap hendak menghadapi eksekutor hukuman cambuk masing-masing 6 kali. Sidang ketiga kasus judi disidangkan terpisah untuk Muliadi, 36, dipimpin Majelis Hakim diketuai Zaini Usman, SH didampingi dua hakim anggota yaitu Drs Abdul Basyir Ihksanuddin dan Drs Zukri, SH. Kasus judi yang didakwakan terhadap Brigadir Irwanuddin alias One, 28, dalam persidangan dipimpin Hakim Drs Ramli dan dua hakim anggotanya Abdul Basyir Ikhsanuddin dan Drs Zukri, SH. Sedangkan kasus judi yang menimpa Sulastri alias Suli, 39, dalam sidang yang dipimpin Hakim Drs Indra Suhadi, SAg dan hakim anggota Drs Ramli dan Drs Zukri. Masing-masing Majelis Hakim berkesimpulan, ketiga

Dosen Unsyiah Tewas Terjatuh BANDA ACEH (Waspada): Seorang dosen Biologi FMIPA Universitas Syiah Kuala (Unsyiah), Edi Rudi, 42, ditemukan tewas bersimbah darah di belakang Laboratorium Terpadu kampus tersebut, Kamis (23/5). Korban diduga terjatuh dari lantai tiga gedung yang berada di Jl. Syeh Abdul Rauf tersebut. Awalnya, jenazah korban ditemukan Munasir, 23, seorang petugas laboratorium yang sedang piket malam hingga pagi itu. Munasir mengaku terkejut ketika melihat sesosok mayat bersimbah darah dengan posisi terlentang mengenakan kaos oblong dan celana olahraga di

Lanjut ke hal A2 kol. 1

sesuai selisih besaran BPIH yang telah dibayarkan BPIH 1434 H /2013 M. Abd Rahim menambahkan, jika sisa kuota haji yang berasal dari setiap provinsi berakhir masa pelunasan BPIH 1434 H/ 2013 M yakni 12 Juni, pemerintah akan melanjutkan untuk pelunasan tahap sisa kuota nasional yakni 18 s/d 26 Juni 2013. “Artinya, jika Calhaj tidak melakukan pelunasan maka gugur haknya sebagai Calhaj

Lanjut ke hal A2 kol. 3

Anggota Polres Sabang Gagalkan Hukuman Cambuk

AS Bunuh 4 Warganya Dalam Serangan Pesawat Tanpa Awak WASHINGTON, AS (Reuters): Pemerintah AS untuk pertamakali mengakui serangan pesawat tanpa awak milik negara adi daya itu telah menewaskan empat warganya, termasuk seorang ulama Anwar al-Awlaki di Yaman dan Pakistan. Jaksa penuntut umum Eric Holder Rabu (22/5) menyebutkan nama-nama warga AS yang tewas dalam surat yang diba-

dalam alokasi kuota haji tahun keberangkatan tahun 1434/ 2013M, namun tidak melunasi BPIH 1434H/2013 M, sampai 12 Juni 2013, secara otomatis menjadi waiting list tahun berikutnya.Kuotanya beralih menjadi kuota haji nasional. Sedangkan Calhaj yang telah melunasi BPIH 1434 H/2013 M atau tahun sebelumnya namun tidak dapat berangkat dan tidak membatalkan diri dan akan berangkat pada tahun ini, harus membayar kekurangan atau menerima pengembalian

terdakwa terbukti melanggar pasal 6 ayat 1 jo. Pasal 23 ayat 2 qanun Provinsi NAD Nomor 13 Tahun 2003, dan diancam hukuman aqubat cambuk. Majelis hakim ketiga perkara sama-sama menjatuhkan hukuman cambuk sebanyak 6 kali terhadap pelaku judi. Karena Majelis hakim menjatuhkan vonis cambuk sebanyak 6 kali, Jaksa Penuntut Umum dan terdakwa menerima isi putusan dan tidak melakukan banding. Sebab itu Jaksa Penuntut Umum selaku eksekutor rencananya selepas shalat Zuhur akan dieksekusi cambuk di depan Masjid Agung Babussalam Sabang. Tapi eksekusi itu gagal dilakukan setelah seorang di antaranya diambil anggota polisi yang belum diketahui identitas dan pangkatnya. Menurut sumber Waspada, salah satu terdakwa yang divonis cambuk adalah anggota Polres Sabang.Sebelum dicambuk oknum tersebut dijemput oleh oknum Polres Sabang dibawa ke Mapolres tidak diketahui apa sebabnya.

Lanjut ke hal A2 kol. 3

175 Kg Ganja Untuk Medan Disita

Waspada/Ibnu Kasir

LAPANGAN tawaf yang terasa mengecil karena adanya pagar pembatas darurat yang dihias dengan relief sehingga tidak kelihatan ada sejumlah pekerja yang sibuk di belakangnya. Pada gambar lain dari internet, alat-alat berat dan para pekerja sedang bekerja di belakang dinding.

Al Bayan

Mata

Oleh Tgk. H. Ameer Hamzah MANUSIA diciptakan Allah Azzawajalla dalam bentuk yang sangat indah (ahsani taqwim). Wajahnya dihiasi dua mata yang bagus sebagai alat penglihatan. Dengan mata mereka dapat melihat alam ciptaan Allah SWT, berjalan ke arah yang dituju, melihat sejauh mata menangkap cahaya, tepi langit atau laut yang tak terbatas. Mata dapat membedakan warna, siang dan malam, gelap dan terang, dan lain-lain. Susah dibayangkan bila manusia kehilangan indra mata. Bagi orang-orang beriman indra mata digunakan sebaikbaiknya untuk menyaksikan ayat-ayat Allah, baik qauniah maupun ghairu qauniyah. Dengan mata mereka membaca hadis-hadis Rasulullah, kitab-kitab peninggalan ulama. Dengan kenikmatan mata mereka menyaksikan kebesaran Allah di alam semesta. Sebaliknya orang-orang kafir dan fasik malas sekali mempergunakan matanya kepada halhal yang baik.

Lanjut ke hal A2 kol. 3

Renovasi Masjidil Haram Berlanjut, Lapangan Tawaf Sementara Mengecil MATAF atau lapangan tempat melaksanakan tawaf di Masjidil Haram, Makkah, terasa mengecil bila dibandingkan dengan keadaan beberapa tahun yang silam. Perasaan yang sama dikemukakan oleh seorang kolega anggota rombongan Waspada ketika kami memasuki lokasi pada Jumat (17/5). Mengecilnya lapangan tersebut terkait renovasi Masjidil Haram sejak akhir musim haji tahun lalu. Sebagian lapangan dipagari dinding tripleks tebal yang digambari dengan motif tiang-tiang bangunan sehingga kesibukan para pekerja dan kebisingan alat-alat bangunan yang berada di belakangnya tidak terlihat dan dapat teredam. Para jamaah tawaf pun dapat melakukan tawaf dengan khusuk. Jika perluasan lapangan tawaf selesai, maka lapangan tersebut akan menampung 150.000 jamaah tawaf per jam, sekitar hampir tiga kali lebih besar dari sebelumnya, 52.000 jamaah. Perluasan Masjidil Haram terbagi dalam tiga bagian. Perluasan ruang shalat di dalam masjid dan lapangan tawaf tiga tingkat kelak

akan mengakomodasi satu juta jamaah. Kemudian pengembangan halaman luar masjid dan pengembangan zona layanan dan prasarana dan sarana yang mendukung kawasan masjid tersebut. Untuk perluasan kawasan di luar area masjid, dilakukan penggusuran terhadap pemukiman, pertokoan dan hotel di sekitarnya. Ada 1.800 properti real estate dan hotel digusur masing-masing berada pada enam wilayah sekitar Masjidil Haram, diantaranya Shaab Aamir, Jabal Abadi, Jabal Al-Madafie, Jarwal, Jabal Al-Ka’bah, Jabal Al-Qala dan Jabal Ajyad. Biaya ganti untung sebesar SR 30 miliar (Rp78 triliun). Program perluasan bahagian dalam dan luar dari masjid tersebut dijadwalkan rampung tahun 2020. Pekerjaan akan distop selama empat bulan, yakni selama ramadhan hingga usai musim haji, demikian menurut bulletin Saudi Press Agency yang Waspada kutip. H. Ibnu Kasir

BLANGKEJEREN (Waspada) : Satuan Narkoba Polres Gayo Lues, dibantu aparat Polsek Kec. Rikit Gaib menggagalkan pengiriman 175 Kg ganja asal Desa Agusen, Kec. Rikit Gaib, Kab. Gayo Lues, yanga akan dikirim ke Medan. Kapolres Gayo Lues AKBP Sofyan Tanjung, Kamis (23/5) mengatakan, upaya penggagalan penyelundupan ganja itu, Rabu (22/5) sekira pukul 17.30. Ganja tersebut dibawa menggunakan mobil minibus BK 610 RS melewati jalur jalan Takengen, Aceh Tengah dan dicegat Tim Reserse Narkoba di Desa Lanjut ke hal A2 kol. 2

Ada-ada Saja Biksu Palsu Ngemis Beli Mobil Dan Moge BIRO Administrasi Gunung Wutai di China, beberapa waktu lalu, menutup dua kuil di wilayah tersebut lantaran telah terjadi bisnis ilegal yang dilakukan dengan modus berkedok biksu palsu.

Lanjut ke hal A2 kol. 2

Serampang - Nggak lulus, jangan meraung ya - He...he...he...


Siapa Khatib Shalat Jumat Anda ? Lihat Hal. C4-C5 JUMAT, Pon, 24 Mei 2013/14 Rajab 1434 H

WASPADA Demi Kebenaran Dan Keadilan

http://epaper.waspadamedan.com

z zNo: 24232 * Tahun Ke-67

Harian Umum Nasional Terbit Sejak 11 Januari 1947 Pendiri : H. Mohd. Said (1905 - 1995) Hj. Ani Idrus (1918 - 1999) ISSN: 0215-3017

Terbit 28 Halaman (A1-12, B1-8, C1-8) z zHarga Eceran: Rp 2.500,-

Waspada/Ibnu Kasir

LAPANGAN tawaf yang terasa mengecil karena adanya pagar pembatas darurat yang dihias dengan relief sehingga tidak kelihatan ada sejumlah pekerja yang sibuk di belakangnya. Pada gambar lain dari internet, alat-alat berat dan para pekerja sedang bekerja di belakang dinding.

Renovasi Masjidil Haram Berlanjut, Lapangan Tawaf Sementara Mengecil

MATAF atau lapangan tempat melaksanakan tawaf di Masjidil Haram, Makkah, terasa mengecil bila dibandingkan dengan keadaan beberapa tahun yang silam. Perasaan yang sama dikemukakan oleh seorang kolega anggota rombongan Waspada ketika kami memasuki lokasi pada Jumat (17/5). Mengecilnya lapangan tersebut terkait renovasi Masjidil Haram sejak akhir musim haji tahun lalu. Sebagian lapangan dipagari dinding tripleks tebal yang digambari dengan motif tiang-tiang bangunan sehingga kesibukan para pekerja dan

kebisingan alat-alat bangunan yang berada di belakangnya tidak terlihat dan dapat teredam. Para jamaah tawaf pun dapat melakukan tawaf dengan khusuk. Jika perluasan lapangan tawaf selesai, maka lapangan tersebut akan menampung 150.000 jamaah tawaf per jam, sekitar hampir tiga kali lebih besar dari sebelumnya, 52.000 jamaah. Perluasan Masjidil Haram terbagi dalam tiga bagian. Perluasan ruang shalat di dalam masjid dan lapangan tawaf tiga tingkat kelak akan mengakomodasi satu juta jamaah. Kemudian

pengembangan halaman luar masjid dan pengembangan zona layanan dan prasarana dan sarana yang mendukung kawasan masjid tersebut. Untuk perluasan kawasan di luar area masjid, dilakukan penggusuran terhadap pemukiman, pertokoan dan hotel di sekitarnya. Ada 1.800 properti real estate dan hotel digusur masing-masing berada pada enam wilayah sekitar Masjidil Lanjut ke hal A2 kol 4

Hari Ini UN Diumumkan 2.519 Siswa Tingkat SMA Di Sumut Tidak Lulus

MEDAN (Waspada): Sebanyak 2.519 siswa SMA, MA dan SMK di Sumatera Utara dinyatakan tidak lulus Ujian Nasional (UN) tahun pelajaran 2012/2013, karena tidak memenuhi standar nilai kelulusan yang disyaratkan.

“Hasil UN tingkat SMA/ MA dan SMK di Sumut tahun ini mengalami penurunan signifikan dibandingkan

tahun sebelumnya,” kata Sekretaris Dinas Pendidikan Sumatera Utara, Drs Hendri Siregar, Kamis (23/5).

Didampingi Ketua Panitia UN Sumut, Yusri, SH, Hendri Sirgar mengatakan siswa tidak lulus masing-masing dengan

rincian, SMK dengan jumlah peserta UN sebanyak 82.425 siswa yang tidak lulus 1.616 siswa atau sekitar 1,96 persen.

Kemudian, lanjutnya, SMA/MA jurusan/program Lanjut ke hal A2 kol 6

Pengangguran Tertinggi Dunia, Arab ‘Usir’ TKI

Waspada/M.Ferdinan Sembiring

SEKRETARIS Dinas Pendidikan Sumut, Drs Hendri Siregar (tengah) saat mengumumkan tingkat kelulusan siswa SMA/MA/SMK di Sumut, Kamis (23/5) di gedung Dinas Pendidikan Sumut Jln T. Cik Ditiro Medan Foto di hal 1 waspada File 24-FOTO pengumuman UN

BPIH Embarkasi Medan 3.263 Dolar AS

PIHAK Kedutaan Besar RI (KBRI) di Jeddah sudah mendesak seluruh tenaga kerja ilegal yang di Arab Saudi memenuhi semua persyaratan untuk memperbarui dokumentasinya. Konsul Muda Penerangan Sosial Budaya KJRI Jeddah Nur Ibrahim menegaskan, kemarin, saat ini pihak konsulat masih akan berkonsentrasi memenuhi semua kebutuhan para tenaga kerja itu. “Ribuan orang harus kita layani sampai deadline yang sudah ditentukan pemerintah Arab Saudi. Doakan agar saudara kita di sini tidak mengalami masalah apa pun dan semua kita selesaikan sesuai prosedur,” jelasnya. Seperti diberitakan sebelumnya saat ini pemerintah Arab Saudi memberikan amnesti atau semacam dispensasi untuk memperbaiki status iqamah (perpanjangan visa kerja) atau pulang ke Indonesia sebelum tanggal 3 Juli 2013. Kepadatan di KBRI Jeddah menunjukkan banyaknya jumlah tenaga kerja ilegal di Arab Saudi. Saat berada di KJRI Jeddah, salah satu tenaga kerja Indonesia Suryati yang ditemui mengaku sedang mengurus iqamah atau perpanjangan izin kerja. Selain perpanjangan visa kerja, satu opsi lagi adalah memulangkan para TKI ilegal itu. Lanjut ke hal A2 kol 5

Pelunasan Terakhir 12 Juni MEDAN (Waspada): Jamaah calon haji (Calhaj) tahun ini, sudah bisa melunasi Biaya Penyelenggaraan Ibadah Haji (BPIH) tahun 2013 sejak 22 Mei s/d 12 Juni 2013 . Untuk BPIH Embarkasi Medan tahun 2013 mencapai 3.263 dolar, sedangkan pembayaran dilakukan setiap jam kerja pukul 10 s/d 16 di Bank Penerima Setoran Biaya Penyelenggara Ibadah

Haji (BPS-BPIH). Kepala Kantor Kementerian Agama Wilayah Provinsi Sumatera Utara, Drs Abd Rahim M.Hum bersama Kabid Haji dan Umroh Drs Abd Rahman Harahap, Kamis (23/5) di Aula Kantor Kementerian Agama Wilayah Sumut menyebutkan, Calhaj yang sudah melakukan penyetoran selambatnya 3 hari, segera mendaftar

Al Bayan

Mata Oleh: H. Ameer Hamzah MANUSIA diciptakan Allah Azzawajalla dalam bentuk yang sangat indah (ahsani taqwim). Wajahnya dihiasi dua mata yang bagus sebagai alat penglihatan. Dengan mata mereka dapat melihat alam ciptaan Allah SWT, berjalan ke arah yang dituju, melihat sejauh mata menangkap cahaya, tepi langit atau laut yang tak terbatas. Mata dapat membedakan warna, siang dan malam, gelap dan terang, dan lain-lain. Susah dibayangkan bila manusia kehilangan indra mata. Bagi orang-orang beriman indra mata digunakan sebaik-baiknya untuk menyaksikan ayat-ayat Allah, baik qauniah maupun ghairu qauniyah. Dengan mata mereka membaca hadis-hadis Rasulullah, kitab-kitab peninggalan ulama. Dengan kenikmatan mata mereka menyaksikan kebesaran Allah di alam semesta. Sebaliknya orang-orang kafir dan fasik malas sekali mempergunakan matanya Lanjut ke hal A2 kol 2

ulang ke Kementerian Agama kabupaten/kota tempat domisili Calhaj. Sedangkan jamaah yang telah mendapat porsi dan masuk dalam alokasi kuota haji tahun keberangkatan tahun 1434/2013M, namun tidak melunasi BPIH 1434H/ 2013 M, sampai 12 Juni 2013, secara otomatis menjadi Lanjut ke hal A2 kol 3

Waspada/M Edison Ginting

PARA pekerja Indonesia berusaha mengurus dokumen mereka di KJRI Jeddah kemarin. Tingginya pengangguran di Arab membuat sebagian besar TKI Indonesia akan dipulangkan ke tanah air.

Pilot Kanada Masuk Islam Di Medan MEDAN ( Waspada): Percy James Howard Beers, seorang pilot asal Kanada kelahiran 24 Oktober 1978 resmi memeluk agama Islam setelah namanya tercatat di kantor KUA Kec. Medan Kota, Kamis (23/5). Percy yang selama ini menganut agam non muslim berganti nama menjadi Muhammad Syarif. Kehadirannya di kantor KUA Medan Kota, Percy didampingi kekasihnya Dety, 21, warga Jakarta diterima Kepala KUA Medan Kota Naga Sakti, M.Ag bersama saksi sekaligus pembimbing Percy yakni Zul Anhar Rangkuti dan Ustadz H David Omara, MA. Selesai proses administrasi di kantor KUA tersebut, Percy menuju Masjid

Antara

CETAKKAN BATIK MOTIF ACEH. Perajin menata cetakan motif batik di Balai rumah batek Dewan Kerajinan Nasional (Dekranas) Provinsi Aceh, Banda Aceh, Kamis (23/6). Balai rumah batik Dekranas Provinsi Aceh memiliki 100 lebih cetakkan batik motif khas Aceh sementara hasil kerajinannya dijual antara Rp250.000 hingga Rp1 juta untuk ukuran satu baju tergantung jenis kain yang diinginkan.

175 Kg Ganja Untuk Medan Disita BLANGKEJEREN (Waspada): Satuan Narkoba Polres Gayo Lues, dibantu aparat Polsek Kec. Rikit Gaib menggagalkan pengiriman 175 Kg ganja asal Desa Agusen, Kec. Rikit Gaib, Kab. Gayo Lues, yanga akan dikirim ke Medan. Kapolres Gayo Lues AKBP Sofyan Tanjung, Kamis (23/5) mengatakan, upaya penggagalan penyelundupan ganja itu, Rabu (22/5) sekira

pukul 17.30. Ganja tersebut dibawa menggunakan mobil minibus BK 610 RS melewati jalur jalan Takengen, Aceh Tengah dan dicegat Tim Reserse Narkoba di Desa Kenyaran, Kec. Pantan Cuaca, Kab. Gayo Lues. Dikatakan, proses penangkapan sangat alot. Sebelum tertangkap, pelaku lolos dari hadangan anggota Polsek dan Koramil Kec. Rikit Gaib. Namun, dalam penge-

jaran , para tersangka dapat ditangkap. Tersangka yang diamankan Mah,37, warga Desa Melati, Kec. Perbaungan, Serdang Bedagai, Sumut dan Wendi,19, warga Simpang Jernih, Kab. Aceh Timur. Kedua tersangka ini mengaku hanya sebagai kurir dengan upah Rp200 ribu per Kg oleh pemilik barang yang sekarang masih diburu. (cjs)

Ada-ada Saja

Biksu Palsu Ngemis Beli Mobil Dan Moge

BIRO Administrasi Gunung Wutai di China, beberapa waktu lalu, menutup dua kuil di wilayah tersebut lantaran telah terjadi bisnis ilegal yang dilakukan dengan modus berkedok biksu palsu. Di negeri Tirai Bambu

Lanjut ke hal A2 kol 5

Waspada/Surya Efendi

PERCY (Muhammad Syarif) menunjukkan surat resmi masuk Islam usai menunaikan shalat zuhur di Masjid Agung Medan, Kamis (23/5). Agung Jl. Diponegoro Medan lancar membaca surat Al untuk menunaikan shalat Ikhlas sewaktu di kantor Zuhur. ‘’Ini shalatnya yang per- KUA tadi,’’ sebut Ustadz tama sebagai Muslim. Beliau Lanjut ke hal A2 kol 7 (Percy-red) sangat fasih dan

Serampang - Yang nggak lulus jangan nangis ya - He.... he....he....


Berita Utama

A2 Dosen Unsyiah Tewas BANDA ACEH (Waspada) : Seorang dosen Biologi FMIPA Universitas Syiah Kuala (Unsyiah), Edi Rudi, 42, ditemukan tewas bersimbah darah di belakang Laboratorium Terpadu kampus tersebut, Kamis (23/5). Korban diduga terjatuh dari lantai tiga gedung yang berada di Jl. Syeh Abdul Rauf tersebut. Awalnya, jenazah korban ditemukan Munasir, 23, seorang petugas laboratorium yang sedang piket malam hingga pagi itu. Munasir mengaku terkejut ketika melihat sesosok mayat bersimbah darah dengan posisi terlentang mengenakan kaos oblong dan celana olahraga di belakang laboratorium sekira pukul 07:00. Lalu, ia melapor ke petugas keamanan. Seorang pegawai laboratorium lainnya, Sahidin, 52, kepada wartawan di lokasi kejadianmenyebutkan, luka di kepala korban cukup parah. “Saat kejadian suasana laboratorium sepi,” ujar dia. Kapolsek Syiah Kuala AKP Yusuf Hariadi mengatakan, pihaknya mengev akuasi jenazah korban ke RSU Zainal Abidin Banda Aceh untuk divisum. “Indikasi sementara tidak ditemukan keterlibatan pihak ketiga dalam kasus ini,” ujar dia. Yusuf menambahkan, berdasarkan hasil visum dan olah tempat kejadian perkara,

pihaknya tak menemukan indikasi tindak kriminal dalam kasus ini. Diduga korban terjatuh dari lantai tiga gedung tersebut dan kepalanya terbentur beton teras. “Korban meninggal langsung di tempat,” katanya. AKP Yusuf Hariadi, kepada wartawan mengatakan, menurut istri almarhum Edi Rudi, korban mengidap darah tinggi. “Korban keluar dari rumah sekitar pukul 05:30. Kata istrinya ada yang memanggilnya keluar, kemudian dia keluar seorang diri dengan berjalan kaki,” kata Kapolsek. Setelah keluar, korban yang tinggal di Kopelma Darusalam, kompleks dosen tak kunjung pulang ke rumahnya. Pihak keluarga mencarinya, dan sekitar pukul 07:00, korban ditemukan tidak bernyawa oleh Munasir, 23, mahasiswa yang jaga malam di Lab terpadu Unsyiah. Edi Rudi, dosen Biologi Perairan dan Kelautan Fakultas Matematika dan IPA Unsyiah, yang juga pakar terumbu karang itu dikenal sebagai sosok yang berprestasi dan juga baik di mata mahasiswa. Edi pernah membawa nama baik Unsyiah di level nasional dan tingkat internasional melalui makalah-makalah yang dibuatnya. Edi mengajar mata kuliah Biologi Perairan. (b07/cb01)

“Pengumuman kelulusan untuk jenjang sekolah SMA/ MA dan SMK diumumkan serentak seluruh Aceh hari ini (Jumat, 24/5) pukul 17:00 di sekolah masing-masing,” ujar Laisani, Kamis (23/5) sore di Banda Aceh. Sebelumnya, Laisani melakukan rapat internal menyangkut pengumuman UN 2013 di Dinas Pendidikan Aceh. Rapat itu diikuti kadis dan perwakilan Dinas Pendidikan dari 23 kabupaten/kota di Aceh. Laisani didampingi Sekre-

Anggota Polres Sabang Gagalkan Hukuman Cambuk SABANG (Waspada): Seorang polisi yang bertugas di Polres Sabang, Kamis (23/5) menggagalkan pelaksanaan hukum cambuk di Masjid Agung, kota itu. Awalnya, tiga pelanggaran maisir (judi) yang sudah divonis Majelis Hakim di Mahkamah Syar’iyah Kota Sabang, Kamis siang bersiap hendak menghadapi eksekutor hukuman cambuk masingmasing 6 kali. Sidang ketiga kasus judi disidangkan terpisah untuk Muliadi, 36 dipimpin Majelis Hakim diketuai Zaini Usman, SH didampingi dua hakim anggota yaitu Drs Abdul Basyir Ihksanuddin dan Drs Zukri, SH. Kasus judi yang didakwakan terhadap Brigadir Irwanuddin alias One, 28 dalam

Jawaban Problem Catur, TTS Dan Sudoku Dari Halaman Sport. Jawaban Problem Catur: 1. Md6+, Rf7. 2. Mf6+, Re8. 3. Bd8+mat. Jawaban TTS: TTS Topik

Mimbar Jumat

persidangan dipimpin Hakim Drs Ramli dan dua hakim anggotanya Abdul Basyir Ikhsanuddin dan Drs Zukri, SH. Sedangkan kasus judi yang menimpa Sulastri alias Suli, 39 dalam sidang yang dipimpin Hakim Drs Indra Suhadi, SAg dan hakim anggota Drs Ramli dan Drs Zukri. Masing-masing Majelis Hakim berkesimpulan, ketiga terdakwa terbukti melanggar pasal 6 ayat 1 jo. Pasal 23 ayat 2 qanun Provinsi NAD Nomor 13 Tahun 2003, dan diancam hukuman aqubat cambuk. Majelis hakim ketiga perkara sama-sama menjatuhkan hukuman cambuk sebanyak 6 kali terhadap pelaku judi. Karena Majelis hakim menjatuhkan vonis cambuk sebanyak 6 kali, Jaksa Penuntut Umum dan terdakwa menerima isi putusan dan tidak melakukan banding. Sebab itu Jaksa Penuntut Umum selaku eksekutor rencananya selepas shalat Zuhur akan dieksekusi cambuk di depan Masjid Agung Babussalam Sabang. Tapi eksekusi itu gagal dilakukan setelah seorang di antaranya diambil anggota polisi yang belum diketahui identitas dan pangkatnya. Menurut sumber Waspada, salah satu terdakwa yang divonis cambuk adalah anggota Polres Sabang.Sebelum dicambuk oknum tersebut dijemput oleh oknum Polres Sabang dibawa ke Mapolres tidak diketahui apa sebabnya. Salah seorang Jaksa yang dihubungi Waspada mengatakan mereka tidak bisa memberikan informasi karena pimpinan sedang berada di luar daerah. Sementara Kapolres Sabang AKBP Chomariasih,SH ketika dihubungi Waspada via telepon mengatakan, salah satu terhukum cambuk adalah anggotanya Brigadir Irwanuddin. (b31)

Albayan ....

Jawaban Sudoku:

9 5 1 6 8 4 2 3 7

4 2 6 7 3 5 1 9 8

7 8 3 1 2 9 6 5 4

3 6 8 5 9 2 7 4 1

1 4 9 8 7 3 5 2 6

2 7 5 4 6 1 3 8 9

8 1 2 3 4 6 9 7 5

5 9 4 2 1 7 8 6 3

6 3 7 9 5 8 4 1 2

kepada hal-hal yang baik. Mata orang kafir memang dapat melihat seperti mata orang mukmin juga, tetapi mereka tidak bisa melihat makna di baliknya. Padahal semua yang mereka lihat itu ciptaan Allah SWT tetapi mereka tidak mengenal Allah yang sebenarnya. Ada sebagian mereka mengenal Allah tetapi mereka mensyarikatkan Allah dengan makhluk-Nya, padahal Allah tidak ada sekutu bagi-Nya. Kegagalan mata orang kafir dan munafik melihat hakikat yang sebenarnya, digolongkan ‘buta’ oleh Allah meski mereka dapat melihat.

Jumat 24 Mei 2013

Masyarakat Agara Dukung Kapolda Aceh Berantas KKN

Waspada/Mahadi Pinem

KAPOLDA Aceh Irjen Pol Herman Effendi berserta ibu, Rabu (22/5) malam disambut di pendopo Bupati Agara Ali Basrah,beserta ibu. Tampak Kapolda Herman Effendi diabadikan saat menerima cenderamata berupa pisau mekhemu berbintang tiga.

99,48 Persen Lulus, Siswi Asal Medan Dan SMA Di Aceh Masuk 10 Terbaik UN JAKARTA (Waspada): Hasil rekapitulasi Kementerian Pendidikan dan Kebudayaan menyebutkan, dari 1.581.286 siswa peserta UN, 8.250 siswa atau 0,52 persen diantaranya tidak lulus. “Jadi 99,48 persen siswa peserta UN tahun ini lulus,” jelas Mendikbud Muhammad Nuh, Kamis (23/5). Persentase kelulusan ter-

Kelulusan SMK 99,43%, SMA/MA 96,9% BANDA ACEH (Waspada): Ti ngkat ke lulus a n uji a n nasional (UN) untuk jenjang pendidikan SMK tahun ajaran 2012/2013 di Aceh mencapai 99,43 persen. Kelulusan SMK ini meningkat dibanding tahun ajaran 2011/2012, yang hanya 98,3 persen. Sedangkan untuk SMA/ MA tahun 2013, Ketua UN 2013 Aceh Laisani menyebutkan, kelulusannya sekitar 96,9 persen atau terjadi penurunan dibanding tahun 2012, sekitar 99,26 persen.

WASPADA

taris Panitia UN Aceh, Zukarnaini belum bisa menyebutkan lebih rinci tentang kelulusan sekolah untuk jenjang SMA/MA dan SMK. “Detailnya nanti, ini angka persentase kelulusan umum saja,” tandasnya. Pihaknya juga belum bisa mengungkapkan jumlah kelulusan SMALB dan Paket C, karena itu diumumkan secara khusus. Jumlah peserta UN tahun 2013 di Aceh untuk jenjang SMA sebanyak 44.936 peserta, MA 12.103 peserta dan SMK 10.560 peserta. (b06)

BPIH Embarkasi ....

waiting list tahun berikutnya.Kuotanya beralih menjadi kuota haji nasional. Sedangkan Calhaj yang telah melunasi BPIH 1434 H/ 2013 M atau tahun sebelumnya namun tidak dapat berangkat dan tidak membatalkan diri dan akan berangkat pada tahun ini, harus membayar kekurangan atau menerima pengembalian sesuai selisih besaran BPIH yang telah dibayarkan BPIH 1434 H /2013 M. Abd Rahim menambahkan, jika sisa kuota haji yang berasal dari setiap provinsi berakhir masa pelunasan BPIH 1434 H/ 2013 M yakni 12 Juni, pemerintah akan melanjutkan untuk pelunasan tahap sisa kuota nasional yakni 18 s/d 26 Juni 2013. “ Artinya, jika Calhaj tidak melakukan pelunasan maka gugur haknya sebagai Calhaj tahun ini, karena pembayaran gelombang kedua menjadi kuota nasional dan yang sudah usia lanjut di atas 83 tahun. Karena itu diingatkan kepada Calhaj agar segera melakukan pelunasan,” kata Abd Rahim. Sementara jamaah yang melunasi BPIH tahun 2006, 2007, 2008,2009,2010,2011 dan 2012, namun tidak membatalkan diri dan akan berangkat tahun ini, termasuk jamaah haji lunas. Jamaah ini bisa menambah setoran jika BPIH ternyata mengalami kenaikan dari tahun saat dia membayarkan, atau menerima kembalian BPIH jika pembayaran lebih rendah daripada pembayaran dia sebelumnya. “ Tahun depan, jika Calhaj sudah melakukan pelunasan tetapi tidak berangkat tahun yang sama dan tidak berangkat tahun berikutnya, secara otomatis nomor porsinya hilang, Calhaj tersebut bisa menerima pengembalian uang dari BPS setempat dan jika ingin berangkat haji, maka melakukan pendaftaran ulang dengan nomor porsi yang baru,”kata Selain mata kepala, juga ada mata hati (batin). Mata batin manusia ada yang terang ada juga yang buta. Inilah yang disebut dalam Alquran,”bukan matanya yang buta tetapi matanya batinnya yang ada dalam dada” . Di hari akhirat nanti orang yang buta mata hati juga buta mata kepalanya.”Di dunia mereka buta mata hati di akhirat juga mereka buta. Zaman sekarang sangat banyak manusia yang menyalahgunakan matanya, mereka melihat hal-hal yang haram, aurat, gambar dan film porno, hiburan yang bertentangan dengan syariat, bahkan ada yang menghabiskan waktu

sebut sedikit turun dibanding tahun sebelumnya yang mencatat kelulusan 99,50 persen. Stabilnya angka kelulusan membuat Nuh bersyukur bahwa kekacauan yang terjadi pada pelaksanaan UN SMA yang menyebabkan tertundanya pelaksanaan UN di 11 propinsi pada akhirnya tidak berpengaruh pada penilaian hasil akhir UN. “Terbukti kalau kekacauan kemarin tidak memberi dapak signifikan. Hasilnya diumumkan serentak besok (hari ini, Jumat, 24/5-red),” kata Nuh. Lebih lanjut Nuh mengatakan bahwa dari hasil rekapitulasi kelulusan siswa tahun ini dijumpai ada 24 sekolah yang tidak bisa meluluskan satu pun siswanya. Artinya sekolah tersebut tingkat kelulusannya 0 persen. Sedang sekolah yang berhasil meluluskan siswanya 100 persen tercatat 15.476 sekolah dengan jumlah siswa 1,3 juta siswa. Hasil UN tertinggi tahun ini masih didominasi oleh siswa asal Bali dan perolehan Abd Rahim yang menyebutkan masa tunggu untuk Calhaj di Sumatera Utara hingga 2023 mencapai 80.493 orang Kepada wartawan kemarin, Abd Rahim menyampaikan tahun ini transportasi Calhaj melalui Embarkasi Medan menggunakan Garuda Indonesia. Keberangkatan pada 10 September dan masuk Asrama Haji 9 September. Sementara jamaah haji gelombang 1 mendarat di Jeddah langsung ke Madinah dan gelombang II mendarat di Jeddah langsung ke Makkah. Terkait Bandara Polinia yang akan dipindahkan ke Kualanamu (KNIA), Abd Rahim mengatakan tahun ini kemungkinan penerbangan untuk Calhaj Embarkasi Medan masih dilaksanakan dari Bandara Polonia Medan. Hal lain yang disampaikan, kuota haji Sumut tahun ini 8.234 orang terdiri dari 8.180 jamaah dan 54 Petugas Haji Daerah (TPHD). Sedangkan hari pertama pelunasan BPIH sudah ada 250 orang yang mendaftar untuk Calhaj Sumatera Utara, dari Medan seperti disampaikan Kasi Haji dan Umroh Ahmad Qosbi MA, sudah 50 orang yang melaporkan sudah melakukan pelunasan dengan menunjukkan bukti setoran BPIH. Sampai hari kedua 23 Mei 2013 yang telah melunasi BPIH sebanyak 1.047 orang dengan kurs 1 USD=Rp9.823. (m37)

Renovasi ....

Haram, diantaranya Shaab Aamir, Jabal Abadi, Jabal AlMadafie, Jarwal, Jabal Al-Ka’bah, Jabal Al-Qala dan Jabal Ajyad. Biaya ganti untung sebesar SR 30 miliar (Rp78 triliun). Program perluasan bahagian dalam dan luar dari masjid tersebut dijadwalkan rampung tahun 2020. Pekerjaan akan distop selama empat bulan, yakni selama ramadhan hingga usai musim haji, demikian menurut bulletin Saudi Press Agency yang Waspada kutip. * H. Ibnu Kasir membaca buku-buku novel yang merusak akidah dan moral. Hanya mata-mata yang mendapat rahmat dari Allah yang selalu membaca Alquran hadis, ilmu agama dan ilmu pengetahuan. Para ilmuan menyebut-kan, di dalam mata manusia terdapat 130 juta sel yang bisa menangkap cahaya. Jika sel-sel itu rusak, maka mata mulai kabur, semakin banyak rusaknya semakin kabur sehingga sampai buta. Sel-sel itu semakin cepat rusak bila memandang hal-hal yang haram, dan sel-sel itu semakin kuat bila selalu melihat hal-hal yang baik dan bermakna. Wallahu a’lam.

hasil UN yang kurang memuaskan adalah Aceh. Meski demikian, salah satu sekolahnya yakni SMAN 10 Fajar Harapan Kota Banda Aceh, berhasil masuk 10 besar sekolah dengan nilai UN murni ke75 siswanya mencapai 8,79. Nilai terbaik juga diraih sejumlah siswa diantaranya peserta UN dari SMAN 4 Kota Denpasar, Bali, bernama Kadek Vani Apriyanti. Nilai UN murninya mencapai 9,87. Siswa lainnya yang masuk 10 besar nilai UN mur ni terbaik adalah Helena Martha Friska Saragih N dari SMA Me t h o d i s t K o t a M e d a n dengan nilai UN murni mencapai 9,78. Menurut Nuh, penentuan kelulusan sekolah tetap menggunakan kombinasi hasil UN (60 persen) dan hasil ujian akhir sekolah (UAS) atau nilai raport (40 persen). Dengan komposisi penilaian tersebut maka UN tidak menjadi satusatunya penentu kelulusan siswa. Hal yang menarik dari hasil UN tahun ini, kata Nuh terdapat penurunan rata-rata nilai UN sebanyak 1,2 point di mana tahun lalu berjumlah 7,57 sekarang menjadi 6,35. Menjawab pertanyaan apakah ada kemungkinan UN dihentikan karena kelulusan mencapai 99,5, Djemar i Mardapi dari Badan Standar Nasional Pendidikan (BSNP), mengatakan hal itu tidak mungkin. UN masih diperlukan bukan hanya sebagai pemetaan, tapi juga penentu kompetensi kualitas pendidikan di Indonesia. (dianw)

Pengangguran ....

“Saya sudah bekerja enam tahun di sini tapi belum diberikan apa pun oleh majikan,” katanya. “Majikan bilang akan dibayar sekalian. Tapi saya merasa perlu mendapatkan visa kerja. Biar bisa tetap tinggal di sini,” katanya di depan KJRI Jeddah kemarin. Persoalan yang dialaminya nyaris sama dengan banyaknya tenaga kerja wanita lain yang terlihat berbaris rapi di depan kantor kedutaan. Untuk pengurusan visa kerja, KJRI Jeddah membuat tempat pengurusan berbeda. Satu loket untuk pria dan di sisi lain untuk perempuan. Keluhan pekerja Indonesia yang ‘menambang’ rial di Arab Saudi itu terungkap di depan KJRI. Berbagai keluhan pembayaran gaji dan repotnya mengurus dokumen mengemuka. Bahkan di bawah suhu panas yang berada rata-rata

Ada-ada Saja ....

memang tengah marak biksu palsu yang mengemis di sekitar pusat perbelanjaan dengan target utama kalangan berduit. Namun pada akhirnya, uang dari hasil mengemis justru dibelikan beberapa barang pribadi. Bahkan saking banyaknya pendapatan mereka dari mengemis, biksu palsu bisa membeli motor sport. Dilansir Car News China, Rabu (22/5), dua orang biksu palsu terlihat mengendarai sepeda motor Ninja 300, di salah satu jalan di Guangdong, China. Dengan mengenakan jubah berwarna abu-abu, keduanya terlihat santai menggeber Ninja berkelir putih tanpa menggunakan helm. Biar terlihat lebih gaya, si biksu palsu menggunakan kacamata hitam. Kawasaki Ninja 300 dibanderol 60.000 yuan atau Rp95,5 juta di China. Tidak hanya motor, media lokal China pernah memberitakan para biksu palsu juga pernah mengendarai mobil mahal, membeli iPhone, bahkan mengunjungi panti pijat. (vn/m09)

bahkan hotel tempat menginap rombongan Kapolda Herman Effendi, mereka bayar sendiri. Nawawi Mamas selaku ketua adat, menyampaikan salut dan bangga dengan kinerja Kapolda Aceh, yang baru perdana menyambangi Agara ini, terkait peningkatan kinerja Polri di Aceh, maupun tentang rekrutmen bintara polisi yang bebas dari KKN. Herman Effendi mengatakan, di dalam kepemim-pinannya, polisi harus ramah di dalam pelayanan, tidak diperbolehkan melakukan pungli dan meningkatkan kinerja polisi yang bebas KKN, serta mengutamakan pelayanan. Soal permasalahan kantor TNGL di Langkat, Sumut dan pihak TNGL tidak kooperatif

dengan pemkab Agara akan disampaikan di dalam forum muspida tingkat I. Berdasarkan penilaian Polda Aceh, potensi konflik di Aceh ada 230, untuk Agara ada 9 macam potensi yang bisa memacu konflik, di antaranya soal tapal batas, juga tentang wilayah TNGL. Terkait persoalan tenaga honorer siluman yang disampaikan Fajri, mahasiswa UGL, Kapolda berjanji akan mengkajinya. Sedangkan Kapolres Agara Trisno Riyanto menyebutkan, permasalahan tenaga honorer sudah dilimpahkan kepada kejaksaan, di mana Kepala BKD Agara berikut 2 stafnya juga seorang tenaga honorer telah dinyatakan sebagai tersangka. (b25)

Pilot Kanada ....

H David Omara, MA kepada Waspada di Masjid Agung Medan. Sementara, Percy yang tidak bisa berbahasa Indonesia itu mengatakan memeluk agama Islam sudah lama diimpikannya, sejak dia menjadi pilot 20 tahun lamanya pada salah satu perusahaan penerbangan yang setiap hari berkeliling Kanada, Afrika dan sejumlah negara di Timur Tengah. ‘’Saat mengunjungi negara-negara mayoritas Muslim tersebut, saya banyak bergaul dengan warga Muslim dan bertanya tentang Islam,’’ katanya dan menambahkan, dia sudah dua bulan bergabung di Garuda Indonesia juga sebagai pilot.Ia mengaku sangat tertarik dengan Islam. ‘’Temanteman banyak memberi masukan tentang Islam, termasuk

dorongan kekasih saya, Dety yang saya kenal setahun lalu,’’ sebutnya. Selama dua bulan berada di Indonesia ini setiap ada kesempatan dirinya banyak belajar lewat buku-buku tentang Islam yang dibeli maupun yang diberi teman-temannya. ‘’Baru kali ini niat saya memeluk agama Islam terkabul,’’ tuturnya. Percy kini menetap di perumahan Royal Sumatera Jl. Djamin Ginting, Padangbulan Medan. Selama dua bulan menjadi pilot Garuda dengan rute Medan – Banda Aceh – Pekanbaru – Padang – Palembang, dia banyak bertemu dan bergaul dengan warga Muslim di kawasan penerbangannya tersebut. ‘’Islam itu agama yang indah dan damai,’’ pungkasnya. (m46)

Hari Ini ....

IPA dengan jumlah peserta 64.680 orang yang tidak lulus sebanyak 736 siswa atau sekitar 1,14 persen. Sedangkan program IPS dengan jumlah peserta ujian 52.280 orang yang dinyatakan tidak lulus sebanyak 2.196 siswa atau sekitar 4,02 persen. Selanjutnya, kata Siregar, SMA/MA jurusan /program bahasa peserta UN 55 orang dan tidak lulus 10 siswa atau 18,08 persen. Sementara jurusan Agama peserta 436 tidak lulus 6 orang atau 1,38 persen,“ ungkap Siregar. Dia mengatakan secara keseluruhan jumlah siswa di Sumut tidak lulus sebanyak 2.519 dari jumlah 117.961 peserta UN 2013 atau sekitar 2,51 persen yang tidak lulus. ”Artinya ada penurunan tingkat kelulusan, sebab tahun lalu, yang tidak lulus hanya 0,08 persen, “ tegasnya.

Dijelaskannya, tingkat kelulusan UN tingkat SMA/ MA/SMK di Sumut tahun ini hanya mencapai 97,49 persen dari 117.961 peserta, atau menurun dari tahun sebelumnya di mana tingkat kelulusan 2012 mencapai 99,8 persen hanya 0,08 persen yang tidak lulus. “Persentase kelulusan SMA/ MA/SMK tahun ini secara keseluruhan turun dibandingkan tahun sebelumnya,“ ulangnya. Dia mengatakan, persentase ketidaklulusan siswa tersebut merupakan secara global se-Sumut. Namun, sekolah di kab/kota yang paling banyak siswanya tidak lulus belum dapat dirinci. “Mungkin pihak dinas kab/kota yang akan merilisnya di daerah masing-masing, “ tegasnya. Sedangkan untuk pengumuman di masing-masing sekolah, kata Siregar, dilakukan hari ini, Jumat (24/5).

Mengenai teknis pengumuman terserah kepala sekolah, boleh dengan memanggil orangtua maupun dengan mengirimkan surat ke rumah siswa atau menempelkan di dinding pengumuman sekolah. Menjawab wartawan, apakah penyebab kegagalan siswa tahun ini akibat keterlambatan distribusi soal, Siregar enggan merincinya.”Kita tidak bisa menyimpulkan atau menuduh penyebab ketidaklulusan ini akibat distribusi naskah soal UN bermasalah,” katanya. Sedangkan, bagi siswa tidak lulus, menurutnya, kemungkinan diberikan kesempatan mengikuti ujian paket C. “Mungkin ini akan ada langkah solusi dari pusat, tapi, kami tetap menunggu kepastian dari pimpinan. Tunggu aja instruksi Kemendikbud,” tegasnya. (m49)

40 derajat celcius dan sedikit intimidasi dari polisi setempat mereka tetap bertahan. Sebab kalau yang ilegal tidak mengurus dokumen akan dipenjarakan. “Opsi yang menyuruh TKI pulang sebenarnya sama dengan mengusir tenaga kerja kita dari sini. Sebab jumlah pengangguran di Arab Saudi sudah terlalu tinggi. Penduduk setempat pun kini ingin bekerja di sektor informal yang sudah lama dilakoni pekerja dari Indonesia,” kata M. Abdullah, supir taksi di Arab yang sudah 16 tahun. Bagi majikan yang mempekerjakan tenaga kerja ilegal juga cukup jelas hukumannya. siapapun yang tertangkap menampung pekerja ilegal menghadapi penjara dua tahun dan denda maksimum 2.700 dolar AS. Pemberian amnesti ini merupakan perubahan yang paling besar dalam sejarah undang-undang ketenagakerjaan Arab Saudi. Data resmi menunjukkan saat ini terdapat sekitar delapan juta pekerja asing di Arab Saudi, sebagian besar tenaga kerja dengan gaji kecil. Data pihak imigrasi me-

nyebutkan sekira 200.000 tenaga kerja dideportasi dalam tiga bulan pertama tahun ini. Untuk mendorong percepatan amnes itu, pemerintah Arab Saudi juga menggelar razia pekerja asing. Koran setempat memberitakan tenaga kerja asing yang bekerja di Arab Saudi secara massal langsung menjauh dari pusat perkantoran, sekolah, pertokoan, dan tempat kerja lainnya. Ini karena pemerintah Saudi telah melancarkan razia terhadap warga ilegal. Pihak berwajib telah merazia gedung perkantoran dan memeriksa dokumen di pos-pos pemeriksaan di jalan-jalan utama untuk mencari warga asing yang bekerja secara ilegal. Tindakan ini merupakan janji dari pemerintah Saudi yang menyatakan bahwa tahun ini akan mengurangi tingkat pekerja asing yang semakin banyak bekerja di sektor swasta dan membuat jumlah pengangguran kaum muda Saudi melonjak. Selama akhir pekan lalu pekerja asing telah menyebarkan info melalui media sosial terkait razia dan langsung mengubah banyak tem-

pat kerja tidak beroperasi. Kegiatan di Jeddah terlihat melambat sebab para pekerja di jasa angkutan asing takut dengan adanya pemeriksaan dokumen dan banyak yang mengurus iqamah. Sementara di Ibu Kota Riyadh, toko-toko yang bergerak di sektor retail dan kedai kopi hanya menempatkan satu pekerja di masingmasing toko. Arab Saudi saat ini memang menjadi negara paling banyak menerima tenaga kerja asing. Ternyata alasan Arab Saudi memperjelas status para pekerja itu untuk mengantisipasi pengangguran di negaranya. Tingkat pengangguran di Arab tertinggi di dunia. Menurut Organisasi Buruh Sedunia Perserikatan Bangsa-Bangsa (ILO), kondisi ini disebabkan beberapa faktor, salah satunya kebijakan di dunia Arab salah sarah. Selain itu, pengangguran disebabkan meluasnya ketidakadilan sosial, dan selama dua puluh tahun terakhir liberalisasi ekonomi tidak tertata dengan baik. Di Arab pengangguran mencapai 23,3 persen. Sedangkan rata-rata dunia 13,9 persen. * Armin Nasution

KUTACANE ( Waspada): Temuh ramah Kapolda Aceh Irjend Drs Herman Effendi, dengan pemerintah daerah dan elemen masyarakat Aceh Tenggara, di pendopo Bupati Agara, Kamis (23/5), membahas masalah TNGL, honorer siluman ser ta komitmen memberantas korupsi, kolusi dan nepotisme (KKN). Ro m b o n g a n K a p o l d a Herman Effendi, tiba di Agara dari Medan, Rabu (22/5) bersama nyonya dan Kabid Propam serta Kabid Humas Polda Aceh, diterima dengan acara tepung tawar oleh tokoh adat Nawawi Mamas, Wakil Bupati Agara Ali Basrah beserta Nyonya Wabup, Ketua DPRK Salim Fakhri, Ketua MPU Hasanuddin Mendabe, berikutnya Ali Basrah menyerahkan cendramata pisua mekhemu berbintang tiga, sebagai lambang kebesaran bagi warga kehormatan kepada Kapolda. Kapolda menerima masukan kondisi Agara dari Bupati Ali Basrah, bahwa warga Agara multietnis, di mana 73 persen masyarakatnya adalah muslim. Luas wilayah Agara 415.000 hektare, di mana 91 persennya merupakan wilayah TNGL dan hutan lindung, sisanya 9 persen menjadi areal penggunaan lain termasuk pada sebagai sandaran hidup rakyat Agara, di mana lebih dari 91 persen rakyat di bumi Sepakat Segenep ini menyandarkan hidup mereka di sektor pertanian. Ketua DPRK Agara Salim Fakhri menilai Kapolda Aceh dinilai sebagai Kapolda yang paling transparan se-Indonesia, dan dibuktikan tidak membebani daerah yang disambangi,


Berita Utama

A2

WASPADA Jumat 24 Mei 2013

Pilot Kanada Masuk Islam Di Medan MEDAN (Waspada): Percy James Howard Beers, seorang pilot asal Kanada kelahiran 24 Oktober 1978 resmi memeluk agama Islam setelah namanya tercatat di kantor KUA Kec. Medan Kota, Kamis (23/5). Percy yang selama ini menganut agama non muslim berganti nama menjadi Muhammad Syarif. Kehadirannya di kantor KUA Medan Kota, Percy didampingi kekasihnya Dety, 21, warga Jakarta diterima Kepala KUA Medan Kota Naga Sakti, M.Ag bersama saksi sekaligus pembimbing Percy yakni Zul Anhar Rangkuti dan Ustadz

Waspada/Ismanto Ismail

PETUGAS pemadam kebakaran menyemprotkan air ke arah api yang membakar barang-barang di dalam ruko Pasar Ikan Lama.

Satu Toko Pakaian Di Pasar Ikan Lama Terbakar MEDAN (Waspada): Satu ruko berlantai II yang membuka usaha dagang pakaian muslim dan lainnya di Pasar Ikan Lama, Jl. Perniagaan, Lingk. 5 , Kel. Kesawan, Kec. Medan Barat, Kamis (23/5) malam, terbakar. Saksi mata kepada Waspada di lapangan mengatakan, awalnya asap dan api terlihat dari bagian tengah Pasar Ikan Lama. Selanjutnya, warga bersama penjaga malam pasar itu Husin Lubis, 60, bergegas masuk dalam lokasi dan mencari dari mana sumber api. Setelah di cek, ternyata api berasal dari ruko berlantai II yang dibagi dua, yakni satu usaha milik Pak Haji dan milik Anum. Dari lokasi kebakaran itu, terdengar tiga kali ledakan. Namun, belum diketahui apakah ledakan dari tabung gas atau lainnya. Belasan mobil pemadam kebakaran milik Pemko Medan yang turun kesulitan masuk ke lokasi karena sempit , sehingga petugas terpaksa memakai slang panjang agar air bisa menjangkau lokasi kebakaran. Beberapa saat kemudian, api berhasil dipadamkan. Kapolsek Medan Barat Kompol Nasrun Pasaribu, SH, SIK didampingi Kanit Reskrim Iptu Syarifur Rahman, SH mengatakan, yang terbakar hanya satu ruko untuk dua usaha.Tidak ada korban jiwa, sedangkan kerugian material maupun asal api masih menjelidikan. Dalam kasus ini, polisi sudah memintai keterangan sejumlah saksi. Sedangkan, Lurah Kesawan H Amri Parinduri, SH didampingi Kepling 5 H.Abdul Muin Bahajad, SH mengatakan, Pasar Ikan Lama dijaga empat orang penjaga malam.Mereka ronda di lokasi itu setelah pemilik usaha menutup dagangannya. Melihat ada kepulan asap, mereka terus mencari sumbernya dan melaporkan ke atasan untuk ditindaklanjuti. (m36)

Dosen Unsyiah ... belakang laboratorium sekira pukul 07:00. Lalu, ia melapor ke petugas keamanan. Seorang pegawai laboratorium lainnya, Sahidin, 52, kepada wartawan di lokasi kejadianmenyebutkan, luka di kepala korban cukup parah. “Saat kejadian suasana laboratorium sepi,” ujar dia. Kapolsek Syiah Kuala AKP Yusuf Hariadi mengatakan, pihaknya mengevakuasi jenazah korban ke RSU Zainal Abidin Banda Aceh untuk divisum. “Indikasi sementara tidak ditemukan keterlibatan pihak ketiga dalam kasus ini,” ujar dia. Yusuf menambahkan, berdasarkan hasil visum dan olah tempat kejadian perkara, pihaknya tak menemukan indikasi tindak kriminal dalam kasus ini. Diduga korban terjatuh dari lantai tiga gedung tersebut dan kepalanya terbentur beton teras. “Korban meninggal langsung di tempat,” katanya. AKP Yusuf Hariadi, kepada

175 Kg Ganja ...

Jawaban Problem Catur, TTS Dan Sudoku Dari Halaman Sport. Jawaban Problem Catur: 1. Md6+, Rf7. 2. Mf6+, Re8. 3. Bd8+mat. Jawaban TTS: TTS Topik

wartawan mengatakan, menurut istri almarhum Edi Rudi, korban mengidap darah tinggi. “Korban keluar dari rumah sekitar pukul 05:30. Kata istrinya ada yang memanggilnya keluar, kemudian dia keluar seorang diri dengan berjalan kaki,” kata Kapolsek. Setelah keluar, korban yang tinggal di Kopelma Darusalam, kompleks dosen tak kunjung pulang ke rumahnya. Pihak keluarga mencarinya, dan sekitar pukul 07:00, korban ditemukan tidak bernyawa oleh Munasir, 23, mahasiswa yang jaga malam di Lab terpadu Unsyiah. Edi Rudi, dosen Biologi Perairan dan Kelautan Fakultas Matematika dan IPA Unsyiah, yang juga pakar terumbu karang itu dikenal sebagai sosok yang berprestasi dan juga baik di mata mahasiswa.Edi pernah membawa nama baik Unsyiah di level nasional dan tingkat internasional melalui makalahmakalah yang dibuatnya. Edi mengajar mata kuliah Biologi Perairan. (b07/cb01)

Mimbar Jumat

Kenyaran, Kec. Pantan Cuaca, Kab. Gayo Lues. Dikatakan, proses penangkapan sangat alot. Sebelum tertangkap, pelaku lolos dari hadangan anggota Polsek dan Koramil Kec. Rikit Gaib. Namun, dalam pengejaran , para tersangka dapat ditangkap. Tersangka yang diamankan Mah,37, warga Desa Melati, Kec. Perbaungan, Serdang Bedagai, Sumut danWendi,19, warga Simpang Jernih, Kab. Aceh Timur. Kedua tersangka ini mengaku hanya sebagai kurir dengan upah Rp200 ribu per Kg oleh pemilik barang yang sekarang masih diburu. (cjs)

Ada-ada Saja ...

Jawaban Sudoku:

9 5 1 6 8 4 2 3 7

4 2 6 7 3 5 1 9 8

7 8 3 1 2 9 6 5 4

3 6 8 5 9 2 7 4 1

1 4 9 8 7 3 5 2 6

2 7 5 4 6 1 3 8 9

8 1 2 3 4 6 9 7 5

5 9 4 2 1 7 8 6 3

6 3 7 9 5 8 4 1 2

Di negeri Tirai Bambu memang tengah marak biksu palsu yang mengemis di sekitar pusat perbelanjaan dengan target utama kalangan berduit. Namun pada akhirnya, uang dari hasil mengemis justru dibelikan beberapa barang pribadi. Bahkan saking banyaknya pendapatan mereka dari mengemis, biksu palsu bisa membeli motor sport. Dilansir Car News China, Rabu (22/5), dua orang biksu palsu terlihat mengendarai sepeda motor Ninja 300, di salah satu jalan di Guangdong, China. Dengan mengenakan jubah berwarna abu-abu, keduanya terlihat santai menggeber Ninja berkelir putih tanpa menggunakan helm. Biar terlihat lebih gaya, si biksu palsu menggunakan kacamata hitam. Kawasaki Ninja 300 dibanderol 60.000 yuan atau Rp95,5 juta di China. Tidak hanya motor, media lokal China pernah memberitakan para biksu palsu juga pernah mengendarai mobil mahal, membeli iPhone, bahkan mengunjungi panti pijat. (vn/m09)

H David Omara, MA. Selesai proses administrasi di kantor KUA tersebut, Percy menuju Masjid Agung Jl. Diponegoro Medan untuk menunaikan shalat Zuhur. ‘’Ini shalatnya yang pertama sebagai Muslim. Beliau (Percy-red) sangat fasih dan lancar membaca surat Al Ikhlas sewaktu di kantor KUA tadi,’’ sebut Ustadz H David Omara, MA kepada Waspada di Masjid Agung Medan. Sementara, Percy yang tidak bisa berbahasa Indonesia itu mengatakan memeluk agama Islam sudah lama diimpikannya , sejak dia menjadi pilot 20 tahun lamanya pada salah satu perusa-

haan penerbangan yang setiap hari berkeliling Kanada, Afrika dan sejumlah negara di Timur Tengah. ‘ ’Saat mengunjungi negaranegara mayoritas Muslim tersebut, saya banyak bergaul dengan warga Muslim dan bertanya tentang Islam,’’ katanya dan menambahkan, dia sudah dua bulan bergabung di Garuda Indonesia juga sebagai pilot.Ia mengaku sangat tertarik dengan Islam. ‘’Teman-teman banyak memberi masukan tentang Islam, termasuk dorongan kekasih saya, Dety yang saya kenal setahun lalu,’’ sebutnya. Selama dua bulan berada

di Indonesia ini setiap ada kesempatan dirinya banyak belajar lewat buku-buku tentang Islam yang dibeli maupun yang diberi teman-temannya. ‘’Baru kali ini niat saya memeluk agama Islam terkabul,’’ tuturnya. Percy kini menetap di perumahan Royal Sumatera Jl. Djamin Ginting, Padangbulan Medan. Selama dua bulan menjadi pilot Garuda dengan rute Medan – Banda Aceh – Pekanbaru – Padang –Palembang, dia banyak bertemu dan bergaul dengan warga Muslim di kawasan penerbangannya tersebut. ‘’Islam itu agama yang indah dan damai,’’ pungkasnya.(m46)

Waspada/Surya Efendi

PERCY (Muhammad Syarif ) menunjukkan surat resmi masuk Islam usai menunaikan shalat zuhur di Masjid Agung Medan, Kamis (23/5).

Elemen Islam Jabar Secara Nasional, 99,48 % Lulus UN Tolak Miss World BOGOR (Waspada): Sejumlah elemen Islam di Jawa Barat, MUI Kota Bogor, FKUB, Muhammadiyah, NU, Persis, Aisyiah, HASMI, HTI, Fos Armi, Garis, BSMI, FUI, PPI, dan kalangan partai seperti PAN, PPP, PBB, menolak kontes wanita tercantik sejagat Miss World di kota hujan itu. Rencananya, Indonesia untuk kali pertama didaulat menjadi tuan rumah Miss World 2013. Sebanyak 130 kontestan akan berkompetisi untuk meraih mahkota wanita tercantik sejagat, di mana karantina peserta dilaksanakan di Nusa Dua Bali dan puncak acara digelar di Sentul International Convention Center (SICC) Bogor, 28 September mendatang. Sambutan baik yang diberikan Gubernur Jawa Barat terhadap acara ini ternyata tidak

BPIH Embarkasi ... tahun ini, karena pembayaran gelombang kedua menjadi kuota nasional dan yang sudah usia lanjut di atas 83 tahun. Karena itu diingatkan kepada Calhaj agar segera melakukan pelunasan,” kata Abd Rahim. Sementara jamaah yang melunasi BPIH tahun 2006, 2007, 2008,2009,2010,2011 dan 2012, namun tidak membatalkan diri dan akan berangkat tahun ini, termasuk jamaah haji lunas. Jamaah ini bisa menambah setoran jika BPIH ternyata mengalami kenaikan dari tahun saat dia membayarkan, atau menerima kembalian BPIH jika pembayaran lebih rendah daripada pembayaran dia sebelumnya. “ Tahun depan, jika Calhaj sudah melakukan pelunasan tetapi tidak berangkat tahun yang sama dan tidak berangkat tahun berikutnya, secara otomatis nomor porsinya hilang, Calhaj tersebut bisa menerima pengembalian uang dari BPS setempat dan jika ingin berangkat haji, maka melakukan pendaftaran ulang dengan nomor porsi yang baru,”kata Abd Rahim yang menyebutkan masa tunggu untuk Calhaj di Sumatera Utara hingga 2023 mencapai 80.493 orang Kepada wartawan kema-

AS Bunuh ... seorang warga Amerika keturunan Pakistan yang tewas di Yaman, dan Jude Kenan Mohammed dari North Carolina, yang didakwa atas tuduhan teroris di AS di tahun 2009 dan dibunuh di Pakistan. Para pejabat AS sebelumnya mengakui secara diamdiam bahwa dua orang dari keluarga Awlaki dan Khan dibunuh dalam serangan pesawat tanpa awak. Kematian Mohammed juga akibat serangan pesawat tanpa awak,

Anggota Polres ... Salah seorang Jaksa yang dihubungi Waspada mengatakan mereka tidak bisa memberikan informasi karena pimpinan sedang berada di luar daerah. Sementara Kapolres Sabang AKBP Chomariasih,SH ketika dihubungi Waspada via telepon mengatakan, sa-

didukung oleh elemen Islam di Jawa Barat. Mereka kompak menolak ajang pemilihan itu karena identik dengan aksi buka-bukaan baju yang diharamkan agama. Penolakan tersebut dengan cara penandatanganan surat pernyataan pada acara milad ke 13 Keluarga Muslim Bogor kemarin. Alasan Ahmad Heryawan yang menilai kontes ini akan berjalan lebih sopan karena tidak ada bikini yang digunakan pada kontes tersebut tidak menyurutkan langkah tokoh-tokoh umat Islam untuk menolak kontes bukabukaan aurat terbesar di dunia tersebut. Ajang MissWorld 2013 di Indonesia diselenggarakan oleh MNC Group milik Hary Tanoesoedibjo. Liliana Tanaja Tanoesoedibjo, istri Hary Tanoe, merupakan pendiri Miss Indonesia Organization. rin, Abd Rahim menyampaikan tahun ini transportasi Calhaj melalui Embarkasi Medan menggunakan Garuda Indonesia. Keberangkatan pada 10 September dan masuk Asrama Haji 9 September. Sementara jamaah haji gelombang 1 mendarat di Jeddah langsung ke Madinah dan gelombang II mendarat di Jeddah langsung ke Makkah. Terkait Bandara Polinia yang akan dipindahkan ke Kualanamu (KNIA), Abd Rahim mengatakan tahun ini kemungkinan penerbangan untuk Calhaj Embarkasi Medan masih dilaksanakan dari Bandara Polonia Medan. Hal lain yang disampaikan, kuota haji Sumut tahun ini 8.234 orang terdiri dari 8.180 jamaah dan 54 Petugas Haji Daerah (TPHD). Sedangkan hari pertama pelunasan BPIH sudah ada 250 orang yang mendaftar untuk Calhaj Sumatera Utara, dari Medan seperti disampaikan Kasi Haji dan Umroh Ahmad Qosbi MA, sudah 50 orang yang melaporkan sudah melakukan pelunasan dengan menunjukkan bukti setoran BPIH. Sementara sampai hari kedua 23 Mei 2013 yang telah melunasi BPIH sebanyak 1.047 orang dengan kurs 1 USD=Rp9.823. (m37) kata seorang sumber yang mengetahui masalah itu. Surat Holder itu membeberkan pembenaran tindakan CIA membunuh Awlaki, yang menurut Holder ‘telah berulangkali berniat menyerang warga AS dan berharap serangan itu akan menghilangkan nyawa warga Amerika’. Pembunuhan terhadap Awlaki, 40, merupakan kasus pertama dan terang-terangan diumumkan di mana seorang warga AS memang diincar untuk dibunuh dengan pesawat tanpa awak. (m23) lah satu terhukum cambuk adalah anggotanya Brigadir Irwanuddin. Jadi sebelum dieksekusi harus dilakukan koordinasi lebih dahulu dengan pihak kepolisian sebagai institusinya. ‘’Karena ada aturan dan prosedur yang harus dilakukan tidak boleh langsung dieksekusi tanpa sepengetahuannya selaku atasan,’’ sebut Kapolres. (b31)

Al Bayan ... Mata orang kafir memang dapat melihat seperti mata orang mukmin juga, tetapi mereka tidak bisa melihat makna di baliknya. Padahal semua yang mereka lihat itu ciptaan Allah SWT tetapi mereka tidak mengenal Allah yang sebenarnya. Ada sebagian mereka mengenal Allah tetapi mereka mensyarikatkan Allah dengan makhluk-Nya, padahal Allah tidak ada sekutu bagi-Nya. Kegagalan mata orang kafir dan munafik melihat hakikat yang sebenarnya, digolongkan “buta” oleh Allah meski mereka dapat melihat. Selain mata kepala, juga ada mata hati (batin). Mata batin manusia ada yang terang ada juga yang buta. Inilah yang disebut dalam Alquran,”bukan matanya yang buta tetapi matanya batinnya yang ada dalam dada” . Di hari akhirat nanti orang yang buta mata hati juga buta mata

Keuntungan besar jelas akan didapat oleh pihak penyelenggara, wajar saja karena hak siar lajang lenggak-lenggok wanita lajang berbusana minim itu sepenuhnya milik penyelenggara. Miss World tidak ubahnya Miss Universe, hanya beda pemilik saja. Jika Miss World punya pengusaha Inggris, Miss Universe adalah milik pengusaha Amerika Donald Trump. Kedua kontes ini selain ajang untuk memperkenalkan produk pakaian renang/bikini juga terdapat misi politik yang harus diemban oleh pemenang kontes ini. (Rep/o)

Sekda Langkat Mundur STABAT (Waspada): Surya Djahisa mengundurkan diri dari jabatannya sebagai Sekda Langkat. Pengunduran itu dia sampaikan kepada para PNS saat membimbing apel pagi di halaman Kantor Bupati Langkat, Kamis (23/5). Tembusan surat telah dia sampaikan kepada Kepala Badan Kepegawaian Daerah yang sebelumnya ditujukan kepada Bupati Langkat. Dikatakannya mengundurkan diri atas kesadaran sendiri karena harus konsentrasi menjalani persidangan di Pengadilan Tipikor Medan, dalam kasus dugaan korupsi pengadaan jasa konsultan dalam penghitungan kelebihan pembayaran pajak penghasilan PNS tahun anggaran 2003. Saat ini sudah berlangsung dua kali persidangan. Pengumuman pengunduran diri yang dilakukan Sekda membuat heboh jajaran PNS Pemkab Langkat, sebab masa tugas Surya Djahisa seharusnya berakhir Agustus 2014. Kabag Humas Pemkab Langkat Rizal Gultom ketika dimintai tanggapannya mengatakan, belum ada pelaksana tugas yang ditunjuk. (a03)

Belum Ada Wacana ... adalah dokumen yang ditandatangani bersama antara SBY dengan para mitra koalisinya, yang di dalamnya disepakati banyak hal, termasuk etika berkoalisi. “Maka bagian-bagian itulah yang harus dikaji DPTP secara objektif sesuai realitas di lapangan, apakah koalisi perlu atau tidak,” kata Hidayat. Secara terpisah, Partai Demokrat meminta PKS tidak buru-buru bicara keluar dari koalisi hanya karena internal mereka sedang ditimpa musibah. “Partai Demokrat sendiri menghadapi semua masalah kami dan menyelesaikannya secara internal. Kami tidak akan menyalahkan pihak-pihak lain, dan tidak berkompromi dengan koruptor,” ujar Ketua Fraksi Demokrat Nurhayati Ali Assegaf. Namun jika PKS sungguhsungguh ingin keluar koalisi, Demokrat mempersilakan. “Kalau memang mau mundur, merasa tidak nyaman, tinggal tarik saja mentermenteri PKS dari kabinet. Pak SBY masih punya orang-orang terbaik,” kata Nurhayati. (m11/vvn)

kepalanya.”Di dunia mereka buta mata hati di akhirat juga mereka buta. Zaman sekarang sangat banyak manusia yang menyalahgunakan matanya, mereka melihat hal-hal yang haram, aurat, gambar dan film porno, hiburan yang bertentangan dengan syariat, bahkan ada yang menghabiskan waktu membaca buku-buku novel yang merusak akidah dan moral. Hanya mata-mata yang mendapat rahmat dari Allah yang selalu membaca Alquran hadis, ilmu agama dan i lmu pengetahuan. Para ilmuan menyebutkan, di dalam mata manusia terdapat 130 juta sel yang bisa menangkap cahaya. Jika sel-sel itu rusak, maka mata mulai kabur, semakin banyak rusaknya semakin kabur sehingga sampai buta. Sel-sel itu semakin cepat rusak bila memandang halhal yang haram, dan sel-sel itu semakin kuat bila selalu melihat hal-hal yang baik dan bermakna. Wallahu a’lam.

JAKARTA (Waspada): Hasil rekapitulasi Kementerian Pendidikan dan Kebudayaan menyebutkan, dari 1.581.286 siswa peserta UN, 8.250 siswa atau 0,52 persen diantaranya tidak lulus. “Jadi 99,48 persen siswa peserta UN tahun ini lulus,” kata Mendikbud Muhammad Nuh, Kamis (23/5).Namun, persentase kelulusan tersebut sedikit turun dibanding tahun sebelumnya yang mencatat kelulusan 99,50 persen. Stabilnya angka kelulusan membuat Nuh bersyukur, karena kekacauan yang terjadi pada pelaksanaan UN SMA yang menyebabkan tertundanya pelaksanaan UN di 11 provinsi tidak berpengaruh pada penilaian hasil akhir UN. “Terbukti kekacauan kemarin tidak memberi dapak signifikan. Hasilnya diumumkan serentak besok (hari ini, Jumat, 24/5-red),” kata Nuh. Nuh mengatakan dari hasil rekapitulasi kelulusan siswa ta-

hun ini, ada 24 sekolah yang tidak bisa meluluskan satu pun siswanya. Artinya sekolah tersebut tingkat kelulusannya 0 persen. Sedang sekolah yang berhasil meluluskan siswanya 100 persen tercatat 15.476 sekolah dengan jumlah siswa 1,3 juta siswa. Hasil UN tertinggi tahun ini masih didominasi oleh siswa asal Bali dan perolehan hasil UN yang kurang memuaskan adalah Aceh. Begitupun, salah satu sekolahnya yakni SMAN 10 Fajar Harapan Kota Banda Aceh, berhasil masuk 10 besar sekolah dengan nilai UN murni ke-75 siswanya mencapai 8,79. Nilai terbaik juga diraih sejumlah siswa, diantaranya peserta UN dari SMAN 4 Kota Denpasar, Bali, bernama KadekVani Apriyanti. Nilai UN murninya mencapai 9,87. Siswa lainnya yang masuk 10 besar nilai UN murni terbaik adalah Helena Martha Friska Saragih N dari SMA Methodist Kota Medan

dengan nilai UN murni mencapai 9,78. Menurut Nuh, penentuan kelulusan sekolah tetap menggunakan kombinasi hasil UN (60 persen) dan hasil ujian akhir sekolah (UAS) atau nilai raport (40 persen). Dengan komposisi penilaian tersebut maka UN tidak menjadi satu-satunya penentu kelulusan siswa. Hal yang menarik dari hasil UN tahun ini, kata Nuh terdapat penurunan rata-rata nilai UN sebanyak 1,2 point dimana tahun lalu berjumlah 7,57 sekarang menjadi 6,35. Menjawab pertanyaan apakah ada kemungkinan UN dihentikan karena kelulusan mencapai 99,5, Djemari Mardapi dari Badan Standar Nasional Pendidikan (BSNP), mengatakan hal itu tidak mungkin. UN masih diperlukan bukan hanya sebagai pemetaan, tapi juga penentu kompetensi kualitas pendidikan di Indonesia. (dianw)

Hasil UN Di Aceh

Kelulusan SMK 99,43 %, SMA/MA 96,9 % BANDA ACEH (Waspada): Tingkat kelulusan ujian nasional (UN) untuk jenjang pendidikan SMK tahun ajaran 2012/2013 di Aceh mencapai 99,43 persen. Kelulusan SMK ini meningkat dibanding tahun ajaran 2011/2012, yang hanya 98,3 persen. Sedangkan untuk SMA/ MA tahun 2013, Ketua UN 2013 Aceh Laisani menyebutkan, kelulusannya sekitar 96,9 persen atau terjadi penurunan dibanding tahun 2012, sekitar 99,26 persen. “Pengumuman kelulusan

untuk jenjang sekolah SMA/ MA dan SMK diumumkan serentak seluruh Aceh hari ini (Jumat, 24/5) pukul 17:00 di sekolah masing-masing,” ujar Laisani, Kamis (23/5) sore di Banda Aceh. Sebelumnya, Laisani melakukan rapat internal menyangkut pengumuman UN 2013 di Dinas Pendidikan Aceh. Rapat itu diikuti kadis dan perwakilan Dinas Pendidikan dari 23 kabupaten/kota di Aceh. Laisani didampingi Sekretaris Panitia UN Aceh, Zukar-

naini belum bisa menyebutkan lebih rinci tentang kelulusan sekolah untuk jenjang SMA/MA dan SMK. “Detailnya nanti, ini angka persentase kelulusan umum saja,” tandasnya. Pihaknya juga belum bisa mengungkapkan jumlah kelulusan SMALB dan Paket C, karena itu diumumkan secara khusus. Jumlah peserta UN tahun 2013 di Aceh untuk jenjang SMA sebanyak 44.936 peserta, MA 12.103 peserta dan SMK 10.560 peserta. (b06)

2.519 Siswa ...

dari 117.961 peserta, atau menurun dari tahun sebelumnya di mana tingkat kelulusan 2012 mencapai 99,8 persen hanya 0,08 persen yang tidak lulus. “Persentase kelulusan SMA/ MA/SMK tahun ini secara keseluruhan turun dibandingkan tahun sebelumnya, “ ulangnya. Dia mengatakan, persentase ketidaklulusan siswa tersebut merupakan secara global se-Sumut. Namun, sekolah di kab/kota yang paling banyak siswanya tidak lulus belum dapat dirinci. “Mungkin pihak dinas kab/kota yang akan merilisnya di daerah masing-masing, “ tegasnya. Sedangkan untuk pengumuman di masing-masing sekolah, kata Siregar, dilakukan hari ini, Jumat (24/5). Mengenai teknis pengumuman ter-

serah kepala sekolah, boleh dengan memanggil orangtua maupun dengan mengirimkan surat ke rumah siswa atau menempelkan di dinding pengumuman sekolah. Menjawab wartawan, apakah penyebab kegagalan siswa tahun ini akibat keterlambatan distribusi soal, Siregar enggan merincinya.”Kita tidak bisa menyimpulkan atau menuduh penyebab ketidaklulusan ini akibat distribusi naskah soal UN bermasalah,” katanya. Sedangkan, bagi siswa tidak lulus, menurutnya, kemungkinan diberikan kesempatan mengikuti ujian paket C. “Mungkin ini akan ada langkah solusi dari pusat, tapi, kami tetap menunggu kepastian dari pimpinan. Tunggu aja instruksi Kemendikbud,” tegasnya. (m49)

Forbes menulis Sri Mulyani sebagai ekonom yang berhasil membawa Indonesia keluar dari krisis keuangan. Ia lalu menjadi managing director dan wanita paling se-

nior di Bank Dunia sejak 2010. Sri Mulyani bertugas untuk mengawasi operasi Bank Dunia di kawasan Asia, Afrika, Eropa, Amerika Latin, dan Timur Tengah.

Selanjutnya, kata Siregar, SMA/MA jurusan /program bahasa peserta UN 55 orang dan tidak lulus 10 siswa atau 18,08 persen. Sementara jurusan Agama peserta 436 tidak lulus 6 orang atau 1,38 persen, “ ungkap Siregar. Dia mengatakan secara keseluruhan jumlah siswa di Sumut tidak lulus sebanyak 2.519 dari jumlah 117.961 peserta UN 2013 atau sekitar 2,51 persen yang tidak lulus. ”Artinya ada penurunan tingkat kelulusan, sebab tahun lalu, yang tidak lulus hanya 0,08 persen, “ tegasnya. Dijelaskannya, tingkat kelulusan UN tingkat SMA/MA/ SMK di Sumut tahun ini hanya mencapai 97,49 persen

10 Perempuan ... Sementara itu, 24 chief executive officer juga masuk dalam daftar ini dengan total pendapatan perusahaan mencapai US$893 miliar. Dari 100 wanita berpengaruh dunia tersebut, terselip nama Sri Mulyani Indrawati di peringkat 55. Sri Mulyani mengalahkan beberapa nama tenar seperti Arianna Huffington, Editor in Chief Huffington Post, desainer Miuccia Prada, dan penulis JK Rowling. Bahkan, Forbes memasukkan Sri Mulyani dalam peringkat lima wanita paling berpengaruh di Asia.

Berikut daftar 10 perempuan paling berpengaruh di dunia versi Forbes: 1. Angela Merkel (Kanselir Jerman) 2. Dilma Rousseff (Presiden Brazil) 3. Melinda Gates (Co-Chair Bill & Melinda Gates Foundation) 4. Michelle Obama (Istri Presiden Barack Obama) 5. Hillary Clinton (Politisi) 6. Sheryl Sandberg (Chief Operating Officer Facebook) 7. Christine Lagarde (Managing Director IMF) 8. Janet Napolitano (Sekretaris Departemen Pertahanan Dalam Negeri AS) 9. Sonia Gandhi (Politikus, presiden Kongres India) 10. Indra Nooyi (Chief Executive Officer Pepsi.Co).(vn/m09)


WASPADA Jumat 24 Mei 2013

Medan Metropolitan

A3

Nelayan Sumut Cetak Rekor MURI BELAWAN (Waspada): Sebanyak 1973 nelayan Sumut berhasil mencetak rekor menarik jaring ikan terpanjang di Indonesia dengan yang panjang 2.013 meter. Kegiatan ini tercatat di Museum Rekor Indonesia (MURI) dengan nomor 5979. Usaha mencetak rekor MURI tersebut dilaksanakan di Mako Lantamal I, Kamis (23/5), atas kerjasama Dinas Kelauatan dan Perikanan (DKP) Pemprovsu, Lantamal I dan Himpunan Nelayan Seluruh Indonesia (HNSI) Kota Medan. Gubernur Sumatera Utara Gatot Pujo Nugroho mengata-

kan, kegiatan cetak rekor penarik jaring terpajang itu dilaksanakan dalam rangka memperingati Hari Kebangkitan Nasional (Harkitnas) ke 105 dan sebagai pemicu semangat menumbuhkembangkan rasa kebersamaan bangsa dalam membangun Indonesia. “Kita harapkan pencatatan rekor MURI ini tidak sekadar seremonial, tapi jadi momentum memicu semangat kebersamaan membangun bangsa,” ucapnya. Pada kesempatan itu, Gubsu didampingi Danlantamal I Laksamana Pertama TNI Didik Wahyudi dan Plt. Wali Kota Medan Zulmi Eldin memberikan buku panduan melaut praktis,

kartu asuransi kesehatan dan keselamatan kerja nelayan. “Kita harus bangga kepada nelayan, karena mereka juga salah satu dari bagian pembangun bangsa. . Di buku itu ada aturan-aturan yang harus diikuti nelayan saat melaut,” ujar Gatot. Sementara itu, Ketua HNSI Kota Medan Zulfahri Siagian mengatakan, sebanyak 1973 nelayan yang ikut dalam acara cetak rekor itu melambangkan tahun terbentuknya HNSI. Sedangkan panjang jaring 2013 meter merupakan perwujudan dari tahun dilaksanakannya cetak rekor MURI tersebut. “Jadi momentum ini juga kita manfaatkan sebagai peringatan HUT HNSI. Semoga ke depan sema-

kin jaya dan tetap konsisten membela kepentingan nelayan,” tegas Zulfahri. Di tempat terpisah, Anggota DPRD Kota Medan dari Fraksi PAN, HT Bahrumsyah mendukung kegiatan pemecahan rekor MURI itu. Namun, anggota Komisi B ini mengingatkan pengurus organisasi nelayan agar tetap komit memperjuangkan kepentingan anggotanya. “Saat ini masih banyak buruh nelayan yang di-PHK tanpa jaminan dan bekerja di bawah UMK. Pengurus organisasi nelayan harus muncul mengadvokasi nasib nelayan itu dan jangan mengambil kepentingan dengan mengatasnamakan nelayan,” ujarnya. (h03)

63 Tersangka Terjaring Ops Antik Toba 2013 Waspada/Surya Efendi

TARIK JARING: Gubsu Gatot Pujo Nugroho bersama Danlantamal I Belawan Laksma Didik Wahyudi serta 1.973 nelayan menarik jaring ikan dengan panjang 2.013 meter di depan Mako Lantamal I Belawan, Kamis (23/5), guna memecahkan rekor MURI.

MEDAN (Waspada): Sedikitnya 63 tersangka terjaring Ops Antik Toba 2013 yang digelar Sat Reserse Narkoba Polresta Medan dan jajaran Polsek pada 16 - 23 Mei 2013. “Ada 49 kasus dengan 63 tersangka dan barang bukti yang terjaring Ops Antik jajaran Polresta Medan,” kata Kasat Reserse Narkoba Polresta Medan Kompol Dony Alexander didampingi sejumlah perwira saat paparan Ops Antik Toba 2013 di Polresta Medan, Kamis (23/5). Dony menjelaskan, barang bukti dari 63 tersangka berupa 39,2 kg ganja; 31,36 gram sabu; 729 butir ekstasi; 7 sepedamotor, 1 mobil Avanza, 1 softgun jenis pistol dan 324 peluru mimis. “Para tersangka ini dijerat Pasal, 111 Pasal 112, Pasal 114, Pasal 127 UU RI No. 35 tahun 2009 karena menyimpan, memiliki, mengedarkan, menjual atau menggunakan narkotika dengan ancaman pidana penjara paling singkat 4 tahun dan paling lama 20 tahun penjara,” jelas Dony. Ops Antik Toba 2013 yang digelar ini dengan sasaran khusus narkoba. “Jajaran Polresta Medan berharap daerah ini bisa bersih dari narkoba. Karena itu, perlu dukungan semua pihak dalam pemberantasan narkoba termasuk para orangtua agar me-

ngawasi aktivitas anak-anaknya,” ujar Dony. Dalam hal ini, polisi terus berupaya melakukan sosialisasi bahaya narkoba karena bisa

merusak generasi bangsa mulai dari sekolah hingga perguruan tinggi. “Dengan adanya partisipasi semua pihak seperti alim ulama,

tokoh masyarakat dan lainnya, kita berharap di sekitar lingkungan pemukiman penduduk tidak ada lagi peredaran narkoba,” demikian Dony. (m39)

Waspada/Rudi Arman

KASAT Reserse Narkoba Polresta Medan Kompol Dony Alexander (dua kiri) menginterogasi tersangka narkoba yang terjaring Ops Antik Toba 2013 di Polresta Medan, Kamis (23/5).


Medan Metropolitan

A4

WASPADA Jumat 24 Mei 2013

Faktor Manusia Dominasi Penyebab Kecelakaan MEDAN (Waspada): Kasat Lantas Polresta Medan Kompol Budi Hendrawan menegaskan, kecelakaan lalulintas kebanyakan disebabkan faktor manusianya. “Faktor manusia paling banyak menjadi penyebab kecelakaan karena mencoba mendahului kendaraan lain atau berpindah jalur, tidak jaga jarak, mengebut, terobos lampu merah, mabuk, dan lainnya,” kata Kompol Budi, Kamis (23/5). Selanjutnya, lanjut dia, disebabkan faktor alam, jalan, dan prasarana jalan seperti rambu, marka dan perlintasan kereta api.“Inilah yang menjadi penyebab kecelakaan dan paling banyak factor manusianya yang belum tertib berlalulintas,” ujarnya. Ditanya apakah di Medan kesadaran pengendara tentang lalulintas sudah cukup, Budi menjelaskan, pengendara di Medan sudah cukup tertib berlalulintas dibandingkan dua ta-

hun lalu. “Saat ini pengendara sepedamotor yang melintas di jalan sudah mulai tertib memakai helm walaupun tidak melonjak drastis tapi ada perubahan,” sebutnya. Dalam Ops Simpatik Toba 2013 ini, pihaknya berupaya memberikan sosialisasi dan penyuluhan kepada sopir angkot, penarik becak bermotor dan pengendara sepedamotor. “Sopir angkot kita imbau untuk tidak menaik dan menurunkan penumpang disembarang tempat, begitu juga betor dan pengendara sepedamotor harus memakai helm dan menghidupkan lampu siang hari,” tuturnya. Budi menjelaskan, selama Ops Simpatik yang dimulai 727 Mei 2013, Sat Lantas Polresta Medan telah menilang 2.415 pengendara sepedamotor dan teguran simpatik 2.039. “Mereka ini ditilang karena kesalahan tidak memakai helm, menerobos lampu merah, tidak hidup lampu siang hari,” jelasnya. Ditanya dari 2.415 jumlah

tilang, untuk pelajar berapa pengendara yang ditilang, kata Budi, pelajar yang kena tilang ada 300 orang karena tidak memakai helm dan tidak memiliki SIM. “Kita imbau kepada orangtua agar tidak memberikan sepedamotor kepada anaknya yang tidak memiliki SIM. Karena selain berbahaya bagi si pelajar yang belum mengetahui tertib berlalulintas juga bisa membahayakan pengendara lainnya dan bisa menimbulkan kecelakaan lalulintas,” sebutnya. Selain itu, Sat Lantas Polresta Medan juga memberikan imbauan kepada pihak sekolah agar tidak memperbolehkan pelajar yang belum memiliki SIM untuk membawa sepedamotor. “Guru-guru juga kita berikan masukan agar mengawasi muridnya yang membawa sepedamotor apakah sudah memiliki SIM atau belum,” tutur Budi. Pengetahuan Rendah Psikolog, Rahmadani Hidayatin menilai, pelanggaran lalulintas yang dilakukan para pe-

ngendara di jalan raya, tidak terlepas dari rendahnya pengetahuan mereka tentang sikap berkendaraan. “Beli kendaraan bisa, tapi pengetahuan di jalan raya enggak ada. Akhirnya, pengendara melakukan berbagai pelanggaran, misalkan tidak tahu bahwa lampu kuning itu pertanda harus hati-hati karena akan ada lampu merah yang harus menghentikan kendaraan. Kenyataan, setelah titik terakhir kuning, kendaraan masih melaju. “Inikan pelanggaran lalulintas. Padahal waktu berhenti itu hanya beberapa detik, sekaligus memberikan waktu pada kenderaan untuk istirahat sejenak, tapi karena penggendara tidak punya pengetahuan tentang itu, maka dia langsung melajukan kendaraannya. Saat yang sama kendaraan lain melaju, terjadilah tabrakan dan dua belah pihak sama-sama bersikeras tidak salah. Inikan problem,” kata Hidayatin, Kamis. Dia menyebutkan, pengetahuan berlalulintas yang rendah

ini diperparah lagi dengan efek jera yang diberikan pihak penegak hukum yang memberikan ruang kepada pelaku pelanggaran, dengan lobi-lobi di lapangan jika melakukan kesalahan. “Ada yang bisa bernegoisasi dengan petugas dan pergi begitu saja jika sudah melakukan pelanggaran. Ini menjadi tradisi yang tidak memberikan efek jera kepada pengemudi kendaraan, sehingga prilaku membuat kesalahan di jalan raya akan terulang,” tuturnya. Apakah prilaku pelanggaran peraturan di jalan raya bisa ditertibkan ? “Saya yakin bisa. Meskipun butuh proses yang panjang, karena manusia itu pada umumnya akan bisa merubah prilaku jika mereka dipersiapkan untuk bisa mengikuti aturan. Penegak hukum hendaknya selalu bersosialisasi tentang tata cara berlalulintas. Kemudian memastikan setiap orang yang akan memiliki SIM sudah paham betul tentang aturan berlalulintas. Selain itu, tidak mempermudah pembe-

Kapal Perang India Singgah Di Belawan MEDAN (Waspada): Dua kapal perang India —INS Mahish dan INS Bangaram— Kamis (23/5), singgah di pelabuhan peti kemas internasional Gabion, Belawan, dalam rangka menghadiri penutupan patroli bersama dengan kode sandi Indindo. Dan Guskamla Armabar Laksamana Pertama (Laksma) TNI Arusukmono IS mengatakan, kapal tersebut berada di Belawan guna mengikuti penutupan patroli bersama Indindo yang berlangsung sejak 6 Mei lalu. Laksma TNI Arusukmono mengatakan, melalui kerjasama ini, lalulintas pelayaran di sepanjang perbatasan Indonesia dan India berhasil diamankan. Menurutnya, banyak kapal yang digeledah karena dicurigai me-

ngangkut barang ilegal. Namun dia tidak menyebutkan jumlah kapal dan barang yang ditahan. Arusukmono menambahkan, seratusan anggota TNI AL dan 175 personel AL India terlibat dalam patroli pengamanan bersama itu. Commander Jatinder Singh, perwira AL India yang memimpin misi tersebut mengatakan, banyak yang telah dilakukan AL India dan TNI AL dalam patroli bersama yang sampai ini telah memasuki periode ke-21. Menurut Atase Pertahanan India Kaltik Murti, kerjasama gabungan itu merupakan wujud kerjasama strategis yang disetujui Presiden Susilo Bambang Yudhoyono saat berkunjung ke India tahun 2005. Kerjasama tersebut menyoroti hubungan pertahanan yang erat

antara kedua negara. Hubungan pertahanan kedua negara telah tumbuh dan berkembang dengan aktivitas bersama yang rutin diadakan ditambah dengan pertukaran personel antara angkatan bersenjata kedua negara. Sesuai dengan kerjasama strategis itu, TNI AL dan AL India mengadakan, patroli bersama dua kali dalam setahun di dekat Garis Batas Perairan Internasional guna menjaga bagian penting dari Samudera India agar tetap aman dan terjamin bagi

pengiriman kapal-kapal dan perdagangan internasional. Kedua kapal India —INS Mahish dan INS Bangaram, yang diperkuat pesawat Dornier — merupakan bagian dari kekuatan patroli bersama Indindo ke-21 itu yang berlangsung dari 6 Mei sampai 26 Mei. Sementara kapal perang Indonesia yang menyertai kerjasama itu adalah KRI Patiunus dan satu pesawat TNI AL yang secara bersama-sama melakukan patroli terkoordinasi di ujung Selat Malaka dan Laut

Andaman. Upacara pembukaan kerjasama keamanan Indindo itu dipimpin Panglima Komando Gabungan Wilayah Andaman dan Nikkobar di Port Blair pada 6 Mei sampai 9 Mei lalu. Unsurunsur tersebut telah mengadakan pertemuan di Belawan sejak 22 Mei guna berpartisipasi dalam upacara penutupan yang diselenggarakan di Lantamal I. Ikut menyambut kedatangan kedua kapal perang India itu Konsul Jenderal India di Medan Basir Ahmed.(h03/m10)

PN Medan Belum Jawab Surat KPU MEDAN (Waspada) : Pengadilan Negeri (PN) Medan belum menjawab surat Komisi Pemilihan Umum (KPU) Provinsi Sumatera Utara atas status Tahan Manahan Panggabean, bakal calon legislatif (Bacaleg) DPRDSU. Hal itu terungkap ketika Waspada mengkonfirmasi Humas PN Ahmad Guntur di Pengadilan Negeri (PN) Medan, Kamis (23/ 5), tentang status Tahan Manahan Penggabean. “Benar, kita telah menerima surat dari KPU Sumut yang meminta salinan putusan yang bersangkutan apakah sudah berkekuatan hukum tetap, dan ancaman hukuman diatas lima tahun atau lebih. Mereka meminta salinan putusan itu,” ujar Ahmad Guntur. Namun, lanjutnya, saat ini PN masih mencari berkasnya, karena putusannya sudah lama. “Setelah berkasnya ada, kita akan segera menjawab status tersebut ke KPU,” ujarnya. Dia menjelaskan, status Tahan Manahan Panggabean dari fraksi PartaiDemokratsaatinisepertinyasudahinkrah.“Dimanasebelumnya diPengadilanNegeri(PN)Medan,diadivonis17bulan.Diamengajukan kasasi, namun ditolak dan kembali ke PengadilanTinggi (PT) Sumut. Saat itu putusannya adalah divonis 8 bulan 15 hari,” ujarnya seraya menambahkan, pihaknya sedang melakukan pengecekan apakah statusnya tahanan politik atau pidana umum. Secara terpisah, komisioner KPU Sumut , Jamaluddin Rambe, Bengkel Ginting maupun Kabag Teknis dan Hubmas KPU Provsu Maruli Pasaribu menyebutkan, hingga Kamis (23/5) sore, KPU Sumut belum menerima jawaban dari PN Medan mengenai status Tahan Manahan Panggabean. Diakui pihak KPU Sumut ada menerima lampiran dalam berkas Bacaleg Tahan Manahan Panggabean, berupa keterangan dari PN Medan. Namun itu atas permintaan yang bersangkutan sendiri, bukan jawaban atas surat KPU Sumut kepada PN Medan. Menurut Bengkel Ginting, permintaan sendiri itu boleh-boleh saja, tetapi ini antarlembaga KPU Sumut dan PN Medan. Berkaitan itu, dijadwalkan tim KPU Sumut akan ke PN Medan, Jumat (24/5). (m38/m34)

Poldasu Sita Dua Mobil Dirut PDAM Tirtanadi MEDAN (Waspada): Poldasu melalui Subdit III Tindak Pidana Korupsi (Tipikor) menyita dua mobil mewah milik Direktur Utama (Dirut) PDAM Tirtanadi Medan, AR dari kediamannya di Komplek Pondok Surya Blok I No. 39, Kec. Helvetia Timur, Kamis (23/5). Penyitaan aset tersebut terkait dugaan korupsi voucher penagihan rekening air pada tahun 2012 senilai Rp17 miliar. Dari penyidikan Tipikor Poldasu, aliran dana yang masuk ke rekening pribadi AR sebesar Rp3,8 miliar sehingga dia ditahan. Pantauan Waspada di lapangan, dua mobil yang disita Tipikor Poldasu yakni Mitsubishi Pajero Sport warna hitam BK 111 IU dan ToyotaCamrywarnahitamBK176R.Selainduamobiltersebut,penyidik juga mengamankan sejumlah dokumen yang berkaitan dengan kasus itu. “Hari ini kita sita aset tersangka, yaitu mobil Pajero dan Camry. Juga ada dokumen terkait dengan kasus yang kita tangani,” kata Kepala Unit I Subdit III Tipikor Poldasu Kompol B Sihombing, perwira yang memimpin penggeledahan di kediaman Dirut PDAM Tirtanadi Medan. Lebih empat jam petugas melakukan penggeledahan di rumah tersebut, disaksikan keluarga tersangka dan pejabat pemerintahan setempat. Sekira pukul 17:15, petugas membawa sejumlah dokumen dan dua mobil.(m27/m36)

Waspada/Ismanto Ismail

PETUGAS Tipikor Poldasu mengeluarkan mobil Mitsubishi Pajero Sport dan Toyota Camry dari garasi rumah Dirut PDAM Tirtanadi Medan di Komplek Pondok Surya Blok I No. 39, Kec. Helvetia Timur, Kamis (23/5) sore.

rian SIM, terutama bagi mereka yang hanya mengandalkan uang karena bisa beli kendaraan, tetapi belum paham tata aturan berlalulintas,” sebutnya. Menurut Hidayatin, hal yang paling penting adalah

memberikan efek jera bagi mereka yang melanggar peraturan lalulintas dengan mencabut SIM dan mempersulit pembelian kendaraan karena standar mereka selaku pengendara belum maksimal. Jika pengendara

tidak memiliki SIM saat berkendara, hukuman lebih berat harus disiapkan agar masyarakat bisa tertib berlalulintas. “Harus dimulai, jika tidak, akan lebih banyak pelaku pelanggaran,” ujarnya. (m39/m37)

Sidang Tipikor APBD Pemkab Deliserdang

Pengadilan Bukan Tempat Menjustifikasi Bersalah MEDAN (Waspada) : Sidang perkara dugaan korupsi APBD TA 2008, 2009, dan 2010 dengan terdakwa tiga pejabat/staf Pemkab Deliserdang yaitu Kadis PU Deliserdang Ir Faisal dan Bendahara Pengeluaran PU Elfian dalam satu berkas, serta berkas terpisah terdakwa Agus Sumantri (Bendahara Umum Daerah/BUD), dilanjutkan di Pengadilan Tipikor (Tindak Pidana Korupsi) PN Medan, Rabu (22/5). Persidangan yang dipimpin hakim ketua Denny L Tobing SH, dengan acara mendengar keterangan saksi meringankan Staf PU Deliserdang Sungkunen Barus, dan tiga ahli hukum yaitu Dr H Darwinsyah Minin SH, MS, Dr Mirza Nasution SH, MHum, dan Prof Dr Erlina SE MSi, Ak. Dalam kapasitasnya sebagai ahli, Darwinsyah Minin, mantan Kabid Pengkajian Badiklat Provsu menerangkan, pengadilan bukanlah tempat menjustifikasi orang bersalah tetapi pengadilan tempat mencari kebenaran materil. Oleh karena itu setiap orang yang diajukan JPU ke sidang, percayakan saja kepada majelis hakim dengan mengajukan fakta dan bukti, bahwa apa yang didakwakan JPU tidak benar. Ini disampaikan Darwinsyah Minin menanggapi pernyataan terdakwa Faisal yang menyatakan, dirinya heran karena dijadikan terdakwa dan dituntut JPU dengan dalih uang hilang, tapi faktanya Pemkab Deliserdang tidak merasa ada uang yang hilang. Menurut terdakwa, faktanya justru ada hutang kepada pihak ketiga (swasta/rekanan) termasuk ada hibah tanah dari masyarakat. Menurut Darwinsyah yang mengaku pernah tugas di Inspektorat ini, di dalam praktik dan untuk kepentingan masyarakat, bisa saja terjadi SKPD mengerjakan pekerjaan melebihi dari post atau pagu anggaran, dan itu namanya utang. Tapi itu bukan utang individu kepala SKPD nya, melainkan utang jabatan SKPD di Pemkabnya. “Kalau berutang karena kepala SKPD nya menjalankan Tupoksi sesuai kewajiban yang dibebankan Pemkabnya, perbuatan Kepala SKPD nya belum ranah pidana, malah perlu diberi reward,” tuturnya. Soal SKPD berhak mengelola utang piutang, harus diterjemahkan seperti apa dalam praktiknya, dengan merujuk pada UU Otonomi Daerah demi kepentingan dan kesejahteraan rakyat. Kata

dia, SKPD dapat melakukan kewajiban sesuai Tupoksinya tanpa harus menunggu adanya perintah dari Bupati (diskersi karena force mayer) atau kebijakan, sesuai bidang si SKPD tersebut. Mengenai salah satu Tupoksi, kepala SKPD menyediakan sarana untuk umum seperti membangun jalan, misalnya sesuai anggaran untuk 10 Km. Tapi dibangun menjadi 15 Km sesuai kebutuhan masyarakat, maka seharusnya negara yang untung bukan rugi. “Kenapa ini dipidana, gimana negara ini mau maju,” sebut ahli dalam sidang dihadiri tim JPU dari Kejari L Pakam dipimpin PD Pasaribu SH (Kasi Pidsus) dan tim penasehat hukum H Hakim Tua Harahap SH, MH, Taufik Siregar SH, MH, Raja Faisal Harahap SH. Ahli mengatakan, tidak ada batasan waktu bagi seorang SKPD dalam menjalankan kewajibannya. “Batasannya, yah sejak diangkat jadi SKPD sampai dicopot-lah,” katanya. Ketika ditanya, jika atas temuan BPK di SKPD dalam penggunaan APBD 2008 diperbaiki lalu dimasukkan lagi ke APBD berikutnya 2009, dan juga belum tuntas penyelesainnya sudah dibebankan pula ke APBD 2010, apa itu pidana? Menurut ahli, kondisi demikian masih ranah masalah administrasi karena masih ada mekanisme penyelesaiannya. Misalnya, volume pekerjaan itu kurang atau fisik pekerjaan itu tidak sesuai RAB, masih ada perbaikan atau restitusi (kembalikan kelebihan pembayaran). Tapi setelah itu, sudah dikasih kesempatan dan ditagih tidak ada pelaksanaan penyelesaian serta ada kesengajaan, baru masuk ranah pidana. Mengenai istilah berpotensi kerugian negara dalam laporan atau temuan BPK yang dijadikan penyidik dasar pemeriksaan, menurut ahli istilah “berpotensi” bukanlah data definif dan bukan fakta ril melainkan masih abu-abu, kecuali ada hasil auditor. Contohnya, berpotensi tsunami tetapi bisa saja tidak terjadi tsunami Dua saksi ahli lainnya yang sudah sempat disumpah yaitu Mirza Nasution dan Erlina tidak jadi didengar karena menurut hakim sudah petang, sementara masih ada sidang perkara korupsi lain dari daerah.”Memeriksa seorang ahli saja sudah lebih 3 jam, kita tunda sampai Rabu depan,” sebut hakim. (m38)

Sampaikan Pengaduan Soal Dugaan Monopoli Pelindo Ke DPD RI:

Perusahaan Bongkar Muat Ancam Mogok Waspada/Muhammad Joni

LAKSMA Arusukmono IS (kiri) bersama Commander Jatinder Singh foto bersama di pelataran terminal peti kemas internasional di Gabion, Belawan, Kamis (23/5).

Kejatisu Tingkatkan Proses Hukum Dugaan Korupsi APBD Sibolga MEDAN (Waspada): Tim Pidsus Kejatisu meningkatkan proses hukum kasus dugaan tindak pidana korupsi (Tipikor) dalam penggunaan APBD untuk Belanja Modal Pengadaan Lahan Pembangunan Perkantoran dan Perumahan pada Dinas Pengelolaan Pendapatan Keuangan Daerah (Dinas PPKD) Pemko Sibolga, dari penyelidikan (Lid) ke tahap penyidikan (Dik) karena ditemukan bukti permulaan yang cukup terjadinya penyimpangan, setelah memanggil dan meminta keterangan sejumlah pejabat Pemko Sibolga. Kasi Penkum Kejatisu Chandra Purnama SH, mengatakan hal itu kepada wartawan di ruang kerjanya, Kamis (23/5), ketika ditanya perkembangan proses hukum penanganan kasus dugaan Tipikor di Pemko Sibolga, terkait pengadaan tanah untuk pembangunan Rusunawa (rumah susun sederhana sewa) tersebut, yang diduga terjadi semacam mark-up harga nilai pembelian lahan dari

warga pemilik tanah, sehingga merugikan keuangan negara. “Dari hasil penyelidikan ditemukan bukti permulaan yang cukup terjadinya penyimpangan, posisi penanganan kasus terkait penggunaan APBD dalam kegiatan pengadaan lahan untuk Rusunawa di Pemko Sibolga itu sekarang sudah tahap penyidikan. Mengenai siapa-siapa tersangkanya tergantung hasil pemeriksaan di penyidikan nantinya,” kata Chandra. Disebutkan, pada tingkat penyelidikan tim Pidsus Kejatisu sudah memanggil sejumlah pejabat di Pemko Sibolga seperti Sekda Pemko Sibolga M Sugeng, Camat Sibolga Selatan Sahat Sugeng, Ka Orkum Pemko Sibolga Irfan Nasution, Plt Kadispenda Juanuar Siregar, dan pihak swasta selaku pemilik tanah Juli List untuk dimintai keterangan terkait dugaan penyimpangan dalam penggunaan APBD 2012 Pemko Sibolga untuk pengadaan lahan tersebut.

Menurut Chandra, kasus di Pemko Sibolga itu juga termasuk salah satu dari sejumlah kasus yang sedang ditangani Kejatisu ikut digelar di Jampidsus Kejagung pekan lalu. Kata dia, tanah untuk Rusunawa itu terletak di Jln. Merpati Sibolga Selatan, yang untuk pengadaan tanahnya sudah ada ketentuan yang baru tahun 2012, namun belum ada peraturan pelaksananya. Awalnya tanah itu dibeli Rp1,5 miliar kemudian berikutnya Rp5,3 miliar sehingga total Rp6,8 miliar dari APBD 2012. Ditanya wartawan apakah tim penyidik akan memanggil Wali Kota Sibolga, menurut Kasi Penkum Kejatisu, untuk tahap penyidikan akan dilakukan penjadwalan ulang pemanggilan siapa saja yang keterangannya dibutuhkan penyidik dari Pemko Sibolga maupun yang terkait lainnya.”Biarkan tim penyidik bekerja dulu ,baru nanti kita tanyakan pengembangannya,” tutur Chandra. (m38)

MEDAN (Waspada): 70 Perusahaan bongkar muat barang yang tergabung dalam Asosiasi Perusahaan Bongkar Muat Indonesia (APBMI) mengancam akan mogok secara nasional dan menghentikan seluruh aktivitas kerja pada 3 Juni mendatang. Secara nasional ada 1.043 perusahaan bongkar muat di bawah naungan APBMI yang sepakat melakukan mogok. Hal itu ditegaskan Ketua DPW APBMI Sumut Herbin Polin Marpaung didampingi Sekretaris Budi Susanto dan Bendahara Salomo Nababan kepada wartawan di Medan, Kamis (23/5).‘’Kami menghentikan segala aktivitas bongkar muat di Pelindo I, II, III dan Pelindo IV, karena dugaan monopoli yang mereka lakukan sangat sistematik,’’ tegas Herbin. Herbin menjelaskan, dugaan monopoli yang sistematik itu sangat merugikan perusahaan bongkar muat dan berimbas pada ruginya para buruh bongkar. Monopoli itu berkedok mening-

katkan kualitas dan kuantitas kerja. “Seharusnya Pelindo berfungsi sebagai penyedia fasilitas sesuai UU tentang Pelayaran, bukan sebagai pemain yang mirip calo,’’ tegasnya. Karena itu, lanjut Herbin, mereka mengadu ke Anggota DPD RI asal Sumut Parlindungan Purba dengan harapan dapat menuntaskan masalah dugaan monopoli tersebut. Sementara itu, Anggota DPD RI asal Sumut Parlindungan Purba menyatakan siap memfasilitasi pertemuan kedua belah pihak dan mencari solusinya.‘’Saya sudah sering mendengar keluhan dari perusahaan bongkar muat tentang kinerja Pelindo. ‘’Bulan depan KTT APEC akan berlangsung di Kota Medan. Kita tidak ingin mendengar adanya gangguan karena masalah perusahaan bongkar muat dengan Pelindo ini. Pelindo jangan arogan. Ayo diskusi dan cari solusinya,’’ tegas Parlindungan.(m46)

Waspada/Surya Efendi

MENGADU KE DPD: Ketua APBMI Sumut Herbin Polin Marpaung bersama bendahara menyampaikan surat pengaduan tentang kinerja Pelindo I ke Anggota DPD RI asal Sumut Parlindungan Purba (kiri) di Medan, Kamis (23/5).

Perubahan Arus Lalulintas Harus Dievaluasi MEDAN (Waspada): Program rekayasa lalulintas yang dilaksanakan Dinas Perhubungan Kota Medan hingga kini belum menunjukkan perkembangan. Fakta di lapangan kemacatan masih tetap terjadi di sejumlah ruas jalan. Anggota DPRD Medan Parlaungan Simangunsong, Selasa (21/5), menilai Dishub Kota Medan perlu melakukan evaluasi terhadap rekayasa lalulintas. Karena sejauh ini, dalam perjalanan rekayasa lalulintas masih terdapat beberapa titik yang perlu dikaji ulang. Misalnya, di Jln. Ahmad Yani VII menuju Jln. Perdana dan Jln. Hindu. Di titik ini, kemacatan yang terjadi di pagi hari sudah menjadi pemandangan yang biasa. Anehnya, ini tidak mendapat respon. Selain itu, titik lainnya yang perlu dievaluasi Jln. Merak Jingga. Perubahan arus di area ini mubazir dan relatif berbahaya. Karena, dengan seringnya terjadi kemacatan yang panjang, bahkan sampai melintasi rel kereta api. Kalau tiba-tiba tengah macat dan kemudian kereta api melintas, ini bisa menimbulkan kecelakaan dan bukan tidak mungkin bisa menyebabkan korban jiwa. “Rekayasa lalulintas ini perlu dikaji ulang. Jangan ada kesan, perubahan arus lalulintas karena kepentingan atau pesanan segelintir orang dengan menepiskan kepentingan umum,”

ujar Simangunsong. Menyinggung soal jalur kereta api rute Kwala Namu, menurut Ketua Komisi D DPRD Medan ini, PT Kereta Api Indonesia (KAI) perlu menyiapkan sistem pengaturan transportasi menuju lokasi Bandara KA Kuala Namu agar tidak menambah dan memperparah kemacetan lalulintas di Kota Medan dan sekitarnya. Kata dia, operasional kereta api menuju Bandara KA Kuala Namu tersebut akan menambah kemacatan arus lalulintas. Belakangan ini saja, arus lalulintas di Kota Medan, sudah sangat macat meski kereta api tidak melintas disebabkan banyaknya jumlah kendaraan yang tidak sebanding dengan lebar jalan. “Karena itu, sulit dibayangkan tingkat kemacatan di Kota Medan dengan beroperasi jalur menuju bandara yang sedang dibangun di Kabupaten Deliserdang tersebut,” tuturnya yang mengusulkan agar untuk rute kereta api dibangun fly over atau memindahkan stasiun kereta api ke area lain, misalnya Medan Amplas. Ditambahkannya, apalagi jadwal keberangkatan menuju Bandara Kuala Namu tersebut diperkirakan cukup banyak disebabkan banyaknya penumpang yang akan menggunakan jasa kereta api. Simangunsong juga meminta selain pengaturan transportasi, PT Kereta Api Indonesia (KAI) diharapkan mampu memperkuat pengamanan di berbagai perlintasan yang cukup banyak di jalur

menuju Bandara Kuala Namu tersebut.

Prihatin Sementara itu, anggota DPRD Medan Drs Godfried Lubis mengkritisi tinggi angka kecelakaan lalulintas. Dia mengaku prihatin dengan terus meningkatnya angka kecelakaan lalulintas di jalan raya. Ironisnya, kecelakaan terjadi disebabkan karena tidak patuhnya pengendara terhadap peraturan lalulintas. Anggota Komisi D DPRD Medan ini mengatakan, setiap hari ada enam orang meninggal dunia akibat kecelakaan lalulintas. Kondisi tersebut harus segera diantisipasi dengan melakukan berbagai langkah dan kebijakan. Operasi Simpatik yang setiap tahun digelar kepolisian, menurut Godfried, perlu dievaluasi secara menyeluruh, karena tidak sepenuhnya mencapai target yang diinginkan. Sebab, selain menekan angka kecelakaan, operasi itu juga bertujuan menanamkan kedisiplinan berlalulintas. “Tujuan Operasi Simpatik itu adalah menanamkan kedisiplinan berlalulintas. Namun kenyataan di lapangan, kedisiplinan masyarakat untuk mematuhi rambu-rambu lalulintas semakin menurun. Artinya perlu pembenahan dan kajian bagaimana agar masyarakat patuh terhadap peraturan lalulintas, karena kesalahannya didominasi faktor manusia,” katanya. (m30)


WASPADA Jumat 24 Mei 2013

Drs H Nazaruddin Hasibuan

Sering Dapat Rezeki Tak Terduga MENJADI seorang khatib Jumat dengan honor yang terbilang murah antara Rp200 ribu Rp 300 ribu, tidak menyurutkan hatinya untuk terus menekuni profesi ini. Dialah Drs. H. Nazaruddin Hasibuan (foto),seorang guru di Madrasah Ibtidaiyah Negeri Tanjungsari Medan. “Kalau dinilai dari segi materi memang kecil, tapi saya merasakan manfaat yang tak ternilai harganya. Sering tak terpikirkan oleh saya bilangan honornya setiap kali menjadi khatib. Karena setelah itu, ada saja rezeki yang diberikan Allah dengan berbagai cara,” kata Nazaruddin yang ditemui Waspada, Kamis (16/5). Menurut Nazaruddin, selalu ada jamaah shalat yang memberikan uang saku dan buku-buku agama yang bisa dijadikan sebagai sumber referensi untuk meningkatkan ilmu pengetahuannya. “Sejak menjadi khatib tahun 1990, saya tidak pernah memperhitungkan honor yang diberikan pengurus atau kenaziran masjid. Karena apa yang saya lakukan adalah dakwah. Makanya, sampai sekarang terus saya tekuni,” ungkapnya seraya menambahkan, pertama kali menjadi khatib di Masjid Nurul Huda Asrama Brimob Jln. Wahid Hasyim Medan. Salah satu materi Khutbah Jumat yang dia sampaikan terkait dengan kaum pria yang tergiur pada tahta, harta dan wanita. “Akibat tiga masalah itu, akhirnya nama mereka tercemar. Guna menghindari hal itu, sangat perlu mempersiapkan diri dengan menguatkan ilmu dan iman, membuang sifat serakah dan meningkatkan kharisma diri agar jadi contoh yang baik bagi orang lain. “Dalam menyampaikan khutbah Jumat, saya senantiasa mengutamakan hal yang berkaitan dengan persoalan umum di masyarakat dan bulan kebesaran Islam. Demikian juga jika menyampaikan tausiyah di berbagai kelompok pengajian. Bulan ini, adalah bulan Rajab, maka hal-hal yang harus dikerjakan pada bulan Rajab ini menjadi materi saya saat ceramah,” kata ayah empat anak yang selalu menganjurkan setiap orang bersedekah. Di usianya yang sudah 54 tahun ini, Nazaruddin berharap masih diberi Allah kemudahan menjadi seorang khatib, agar ilmu yang didapatinya saat kuliah di IAIN pada Fakultas Syariah dan ilmu yangdidapatkansecaraotodidakbisadisampaikankepadamasyarakat. “Dakwah itu wajib bagi setiap muslim sesuai dengan cara yang dipilih, apakah dengan perbuatan atau perkataan,” ujarnya. (m37)

Az Zikra Gelar Zikir Akbar MEDAN (Waspada): Majelis Zikir Az Zikra Sumatera Utara mengadakan zikir akbar bersama di Masjid Al Amin Jln. Prof HM Yamin SH, baru-baru ini. Acara di awali pembacaan ayat suci Alquran oleh Qori Ustad Sazali SPdI, dilanjutkan dengan shalat sunat tasbih. Setelah itu, dilaksanakan Istighfar, shalawat nabi sambil berzikir dan berdoa bermunajat kepada Allah yang dipandu Ustad Drs Kirwanto SPd, diikuti para jamaah dengan khusuk dan tawaduk. Ustadz H Zulkarnain SAg, SPdI, dalam tausiyahnya mengajak memanfaatkan bulan Rajab untuk meningkatkan amal ibadah karena pahalanya 70 kali lipat dibanding hari biasa. Perbanyak shalat sunat, puasa sunat atau mengganti puasa yang tertingal dan banyaklah bersedekah. “Bulan Rajab bulan Allah, pada bulan ini terjadinya peristiwa Israk Mikraj Nabi Besar Muhammad SAW, bulan penuh keberkahan. Bulan Rajab adalah bulan pembersihan diri adalah persiapan untuk memasuki bulan Ramadhan. Hai orang yang beriman peliharalah dirimu dan keluargamu dari siksa api neraka,” ujarnya. Menurut Zulkarnain, bagi yang beramal dengan berilmu maka lebih tinggi nilai pahalanya dibandingkan dengan orang yang beramal tanpa berilmu. Beramal bulan Rajab pahalanya 70 kali lipat, beramal bulan Sya’ban pahalanya 700 kali lipat, dan beramal bulan Ramadhan pahalanya 1000 kali lipat. “Kita orangtua harus menjadi contoh di keluarga, ajak istri dan anak-anak kita untuk melaksanakan shalat, sesudah ini ajak keluarga terdekat kita,” tuturnya. (cwan)

Dies Natalies UMA Usung Pesan “Culture and History” MEDAN (Waspada): Perhelatan akbar mengusung tema “Culture and History” menandai Peringatan Dies Natalies 30 Tahun Universitas Medan Area (UMA). Berbagai event seperti pameran, fashion show, tarian, teater, funbike, pesta kembang api, UMA Idol, napak tilas dan lainnya, akan mengisi momen bersejarah UMA itu, yang digelar 10-15 Juni 2013 mendatang. Rektor UMA Prof Dr. H. M. Yakub Matondang MA melalui Wakil Rektor III Ir. Zulheri Noer MP didampingi Kahumas Ir. Asmah Indrawati dan sejumlah mahasiswa,Selasa (21/5), mengatakan, 30 tahun UMA berbakti mendidik dan mengabdi pada bangsa, tentu sudah banyak hal yang telah dilakukan. UMA telah melahirkan sekitar 25.000 alumni yang kini bekerja di berbagai posisi sgrategis di pemerintahan, swasta dan wirausaha. Ini tidak lain karena kualitas lulusan yang terus diperhatikan, ditambah kepercayaan pemerintah dan masyarakat yang terus meningkat kepada UMA.(m49)

Rudi, Ketua Pewarta Polresta Medan MEDAN (Waspada): Rudi Arman dari HarianWaspada terpilih menjadi Ketua PersatuanWartawan (Pewarta) Unit Polresta Medan, setelah mengungguli kandidat lainnya Amru Lubis dari Harian Analisa dalam pemilihan yang diselenggarakan, Media Centre Polresta Medan Jln. HM Said, Kamis (23/5). Pada proses penghitungan suara yang dihadiri 15 dari 18 anggota Pewarta itu, Rudi Arman meraih 10 suara, sedangkan Amru Lubis mendapat 4 suara, 1 suara abstain. Dia segera menggantikan posisi Chairum Lubis untuk menduduki jabatan Ketua Pewarta periode 2013-2015. Dalam kesempatan itu, Rudi Arman mengharapkan agar seluruh wartawan anggota Pewarta yang setiap harinya meliput berita-berita kriminal di lingkungan Polresta Medan dan jajarannya, tetap menjalin kekompakan dalam melaksanakan tugas-tugas di lapangan. “Saya mengharapkan dukungan dari rekan-rekan sesama wartawan dan saling menjaga kekompakan, sehingga roda organisasi berjalan lancar dan kinerja di lapangan dalam mencari data untuk dijadikan bahan berita tidak ada kendala,” ujarnya. Sementara itu, Chairum Lubis, mantan ketua Pewarta, berharap agar ke depannya program kerja Pewarta semakin ditingkatkan dan terus menjalin kemitraan dengan aparat kepolisian sehingga informasi dari narasumber bisa diperoleh secara akurat. Ketua panitia pemilihan Rickson Pardosi mengatakan, proses pemilihan pengurus baru Pewarta Polresta Medan periode 20132015 berjalan tertib sesuai dengan aturan yang berlaku. (h04)

Waspada/Andi Aria Tirtayasa

KETUA Pewarta Unit Polresta Medan periode 2013-2015 Rudi Arman menerima berkas-berkas pertanggungjawaban dari Chairum Lubis, mantan ketua Pewarta, usai pemilihan pengurus baru di Media Centre Polresta Medan, Kamis (23/5).

Medan Metropolitan A5 Indonesia Krisis Lagu Anak Penyanyi Cilik Bawakan Lagu Orang Dewasa MEDAN (Waspada): Saat ini, Indonesia mengalami krisis lagu anak-anak. Dalam 10 tahun terakhir, hampir tidak ada lagu baru untuk anak. Industri musik anak terkesan jalan di tempat. Kondisi ini membuat pengamat dan pendidik musik khawatir. “Saat ini, kita krisis lagu anak, sehingga tidak jarang anak-anak menyanyikan lagu orang dewasa,” kata pengamat musik nasional, Purwacaraka pada seminar bertema: ”Penciptaan Lagu Anak” yang digelar Fakultas Bahasa dan Seni Universitas Negeri Medan (Unimed), di kampus itu, Kamis (23/5). Selain Purwacaraka, tampil sebagai narasumber antara lain, Psikolog Dina Nazriani, Dosen Unimed Theodora Sinaga dan

DR Hidayat. Para narasumber sependapat, Indonesia mengalami krisis lagu anak-anak. Menurut Purwacaraka dan para narasumber, hampir satu dekade tidak ada lagu baru bagi anak-anak. Lirik penuh edukasi tergeser oleh lagu-lagu bertemakan cinta. “Bahkan, di acara pencarian bakat penyanyi cilik, yang dinyanyikan lebih banyak lagu orang dewasa. Ini salah siapa? Bahkan, acara terkesan bukan mendidik anak, melainkan mengeksploitasi anak, “ kata Purwacaraka. Para narasumber yang tampil bergantian menyampaikan materi sesuai disiplin ilmu masing-masing itu mengungkapkan keprihatinannya terhadap perkembangan musik anak di Indonesia. Dia menilai, musik anak di negeri ini sedang krisis.

“Padahal, lagu anak-anak yang bersifat edukatif diperlukan sebagai salah satu upaya pembelajaran sekaligus pembangunan karakter bangsa,” tambah Dr. Hidayat dan Theodora Sinaga. Menurut Purwacaraka, hampir 90 persen dari populasi anak Indonesia cenderung membawakan lagu-lagu orang dewasa yang sedang popular. Sementara itu, para orangtua, pendidik dan pemerhati khawatir melihat fenomena penyanyi cilik yang terbiasa menyanyikan lagu orang dewasa tanpa pengertian dan penghayatan yang sesuai dengan usia mereka. Para narasumber sepakat untuk memberikan semangat bagi pencipta lagu anak, perlu terus digelar acara atau pentas musik anak. Di samping itu,

Workshop Desain Grafis Dan Perwajahan SPS Sumut MEDAN (Waspada): Serikat Penerbitan Suratkabar (SPS) Sumatera Utara menggelar Workshop Desain Grafis dan Perwajahan di Hotel Garuda Plaza Medan, Kamis (23/5). Kegiatan yang menghadirkan pembicara S. Melala Megasari, Kepala Desain Korporate Tempo Group ini diikuti 36 perwakilan dari 15 suratkabar anggota SPS Sumut. Ketua SPS Sumut H. Teruna J. Said diwakili Sekretaris SPS Sumut Farianda Putra Sinik,SE mengatakan, perkembangan teknologi telah memberi sentuhan pada perwajahan surat kabar. Karenanya wajah koran di Sumatera Utara sudah harus mengikuti perkembangan zaman dan kemajuan teknologi. “Kita berharap dari workshop ini memberi pemahaman dan pengetahuan baru bagi suratkabar yang ada di Sumatera Utara sehingga perwajahannya semakin bagus,” ujar Farianda. Dalam persentasinya Melala membawakan materi “Pemanfaatan Foto, Ilustrasi dan Infografis Bagi DesainYang Optimal”. Pada sesi kedua membawakan tema “Praktik Merancang Tata Wajah/Cover”. Menurut Melala, infografis akan menyajikan materi kepada pembaca secara lebih ringkas namun lengkap karena disertai gambar dan informasi yang mendukung. Dalam workshop itu dia memberikan contoh-

contoh desain perwajahan suratkabar yang inovatif dan kaya informasi serta data-data. Pada bagian lain dia menekankan, perlunya koordinasi antara redaktur, desainer dan layouter. Dengan komunikasi yang lancar, maka bisa dihasilkan yang paling baik. “Masingmasing jangan merasa paling benar,” katanya. Sementara Ketua Panitia Porman Wilson Manalu, yang juga Wakil Ketua SPS Sumut menjelaskan, workshop ini merupakan kegiatan yang dirancang SPS untuk meningkatkan kualitas perwajahan koran di Sumut. “Tujuanya agar wajah koran di Sumut lebih kreatif dalam tampilannya,” ujarnya seraya menambahkan bahwa persoalan desain perwajahan

suratkabar tidak bisa lagi disepelekan karena sudah sejajar dengan isi koran. Porman juga mengatakan, kegiatan ini akan dilanjutkan dengan semacam penghargaan bagi suratkabar yang dinilai memiliki perwajahan baik. Penghargaan tersebut akan diserahkan pada Hari Ulang Tahun (HUT) SPS nanti. Sebelumnya, SPS Sumut telah menggelar workshop tentang periklanan dengan target menambah iklan di koran masing-masing. Pada Juni 2013 mendatang, SPS Sumut akan menggelar kegiatan workshop pemasaran koran. “Tujuannya agar koran di Sumut bisa lebih memahami teknik pemasaran yang lebih baik,” kata Porman.(m07)

Waspada/Dedi Sahputra

KEPALA Desain Korporate Tempo Group S.Melala Megasari saat berbicara dalamWorkshop Desain Grafis dan Perwajahan yang diselenggarakan SPS Sumut di Hotel Garuda Plaza Medan, Kamis (23/5).

APEC Ingin Sumut Jadi Laboratorium Pengembangan UKM MEDAN (Waspada): Negara-negara yang tergabung dalam APEC (Asia Pacific Economic Coorporation) antara lain Jepang, China, dan Korea Selatan berkeinginan menjadikan Sumatera Utara sebagai laboratorium pengembangan usaha kecil dan menengah (UKM) di kawasan Asia Pasifik. Hal itu diungkapkan DR YoongYuan Kim, perwakilan Pemerintah Korea Selatan, dalam rapat persiapan The 35th APEC HRDWG (Human Resources DevelopmentWorking Group) Meeting yang di gelar di Kantor Gubernur Sumut Jln. Pangeran Diponegoro Medan, Rabu (22/5). Rapat yang dipimpin Asisten Perekonomian dan Pembangunan (Ekbang) Setdaprovsu Ir Hj Sabrina MSi, mewakili Gubernur Sumut H Gatot Pujo Nugroho ST, turut hadir sejumlah perwakilan dari Kementerian Pendidikan dan Kebudayaan (Kemendikbud), Kementerian Tenaga Kerja dan Transmigrasi (Kemenakertrans), dan sejumlah instansi terkait di Pemprov Sumut. Menurut DR Yoong, Sumut

memiliki potensi Sumber Daya Manusia (SDM) yang besar untuk bisa dikembangkan dalam pemberdayaan usaha kecil dan menengah. “Karena potensi itu Pemerintah Korea Selatan sangat berharap sumbangan dana negaranya di Bank Pembangunan Asia (ADB/Asia Developmen Bank) bisa secara maksimal dimanfaatkan Provinsi Sumut dalam pengembangan sektor usaha kecil dan menengah,” katanya. Sementara perwakilan dari Kemendikbud maupun dari Kemenakertrans mengutarakan, North Sumatera Initiation (Inisiasi Sumatera Utara) yang implementasinya berupa menjadikan Sumut sebagai laboratorium pengembangan UKM di kawasan Asia Pasifik, akan dibahas secara terpadu dalam rapat yang digelar di Kota Medan dari 22 Juni- 6 Juli. Nantinya, rapat (senior official meeting/SOM) yang diikuti 21 negara peserta APEC diharapkan bisa mewujudkan embrio kerjasama antara Pemprov Sumut dengan Korea Selatan, dalam hal North Sumatera Ini-

tiation paling lambat September 2013. Untuk itu, Pemprov Sumut diharapkan bisa merangkul sejumlah perguruan tinggi di daerahnyagunamerealisasikanInitiation North Sumatera tersebut. Mendengar pemaparan perwakilan Kemendikbud dan Kemenakertrans RI ini, Sabrina yang mewakili Gubsu mengucapkan terima kasih atas kepercayaan ditunjuknya Kota Medan sebagai penyelenggara The35thAPECHRDWGMeeting. Terkait harapan agar Pemprov Sumut bisa merangkul kerjasama sejumlah perguruan tinggi untuk menambah pembobotan Sumut sebagai Laboratorium Pengembangan UKM, Sabrina atas nama Pemprov Sumut berjanji akan bekerja maksimal untuk hal tersebut. “Kami (Pemprov Sumut) sangat antusias untuk merwujudkan harapan negara-negara peserta APEC ini. Untuk itu, kami berharap dalam diskusidiskusi pengembangan Sumber Daya Manusia (SDM) yang akan dilakukan nantinya, bisa menghasilkan konsensus bersama,” ujarnya. (m28)

Ruko Dan Rumah Terbakar MEDAN (Waspada): Satu ruko berlantai III yang digunakan sebagai kantor perusahaan swasta berada di areal pertokoan Jln. Guru Patimpus No 1-J, Kel. Silalas, Kec. Medan Barat, Kamis (23/5) sekira pukul 12:30, terbakar. Tidak ada korban jiwa namun keru-gian diperkirakan mencapai Rp30 juta. Informasi yang diperoleh di lokasi kebakaran, asal api dari lantai II. Kepulan asap tebal yang tiba-tiba keluar dari lantai II itu membuat para penghuni ruko lainnya sempat panik karena api dikhawatirkan akan merembes ke toko-toko lainnya. Kobaran api hanya membakar televisi dan meja-meja. Mobil milik Dinas Pencegah dan Pemadam Kebakaran Pemko Medan yang segera tiba di lokasi akhirnya berhasil mema-

damkan kobaran api, sehingga tidak meluas ke lantai III dan lantai dasar. Seorang pegawai ruko Septa, 25, mengaku saat itu sedang berada di lantai dasar bersama tiga orang pekerja lainnya dan tidak mengetahui ada kebakaran di lantai II. Api hanya marak di lantai II saja dan tidak sampai ke lantai III. “Saat itu, kami sedang duduk-duduk di lantai dasar dan tiba-tiba ada sejumlah warga yang melihat kobaran api di lantai II,” ujarnya. Sementara itu, pemilik kantor D br Nainggolan, 50, menjelaskan, akibat kebakaran tersebut, kerugian ditaksir mencapai Rp30 juta sedangkan penyebab kebakaran diduga karena arus pendek (korsleting). Rumah Terbakar Sehari sebelumnya, Rabu

(22/5), diduga korsleting listrik, rumah permanen milik Abang di Jln. Bilal Gang Landasan, Kel. Sarirejo,Kec.MedanPolonia,terbakar. Saksi mata kepada Waspada mengatakan, asap dan api terlihat pukul 08:00. Warga sekitar langsung berusaha memadamkan api agar tidak merambat ke rumah tetangga lainnya. Namun, usaha warga tidak berhasil, api dengan cepat menghanguskan rumah tersebut. Api baru dapat dipadamkan setelah Mobil Pemadam Kebakaran milik Pemko Medan dating ke lokasi memberikan bantuan pemadaman. Sementara petugas Polsek Medan Baru yang berada di TKP segera melakukan pengamanan. Dalam peristiwa itu tidak ada korban jiwa, sedangkan kerugian belum diketahui. (h04/m36)

Waspada/M.Ferdinan Sembiring

PENGAMAT musik nasional Purwacaraka menyampaikan materi pada seminar nasional “Penciptaan Lagu Anak” di Fakultas Bahasa dan Seni Unimed, Kamis (23/5). siaran televisi menambah volume atau ruang untuk anakanak. “Sekarang ini, kita rindu lirik lagu anak yang sarat pendidikan, etika, moral dan semangat anak-anak,” kata mereka. Dengan begitu, menurut Psikolog Dina Nazriani, lagu anak membawa pesan edukasi akan memberikan proses tumbuh kembang anak sesuai usia dan tahap perkembangan, nilai kehidupan dan spiritual, serta intelegensi musikalnya akan lebih baik. Purwacaraka menambahkan, fakta dan realita menunjukkan banyak bermunculan band-band di kalangan anak muda dan dewasa dengan beraneka macam aliran serta ratusan judul lagu. Tentu saja ini sangat membanggakan terkait kreativitas dan jiwa anak muda yang suka dengan musik. Namun berbeda halnya dengan musik dan lagu anakanak. Berbanding terbalik, lagu yang dikhususkan bagi anakanak semakin krisis dan semakin hilang seperti ditelan bumi akibat kalah popular dari lagu dewasa.

Perkembangan dunia musik saat ini dihadapkan kepada dunia bisnis belaka. Akibatnya, tidak jarang lagu-lagu pop cenderung mengisahkan tentang percintaan yang secara tidak langsung memiliki dampak kurang baik terhadap anakanak. Bahkan, anak-anak lebih mengenal lagu-lagu orang dewasa dibandingkan dengan lagu-lagu yang dikhususkan bagi mereka. Katanya, lagu anak-anak memang sudah menjadi kerinduan kita bersama, orangtua di rumah, guru di sekolah dan di lingkungan dimana anak berkumpul seperti saat bersosialisasi dengan teman-teman mereka. “Sering dijumpai mereka (anak-anak) lebih hafal dan senang menyanyikan lagulagu orang dewasa yang sedang hits. Sebaliknya, hanya sedikit yang tahu tentang lagu anakanak,” ujarnya. Purwacaraka mengakui lagu anak-anak tidak mendapatkan tempat yang baik jika ditinjau dari sisi bisnis. Hal ini sudah pasti terkait daya jual atau dapat dikatakan lagu anak-

anak tidak menguntungkan bila dihadapkan pada dunia hiburan dan bisnis. “Harapan kita bersama, jangan biarkan lagu anak-anak hilang. Sebuah keharusan semua pihak seperti pemerintah, pihak sekolah, pihak dunia hiburan dan media seperti televisi, radio, surat dan sebagainya untuk memperhatikan hal ini, jika tidak ingin lagu anak tinggal cerita dan semakin krisis,” ujarnya. Sementara itu, Ketua Panitia Pagelaran Pentas Seni Budaya Fak. Bahasa dan Seni Unimed Ifwanul Hakim dan Ari Ridwan mengatakan, kegiatan yang berlangsung empat hari ini merupakan rangkaian acara puncak dari pagelaran seni dan budaya . Sebelumnya, katanya, mereka juga menampilkan pentas drama, seni budaya dari berbagai etnis di Sumatera Utara. Disamping itu, panitia juga menggelar dialog interaktif terkait penggunaa Bahasa Indonesia melibatkan narasumber dari kalangan pakar bahasa Unimed. (m49)


Ekonomi & Bisnis

A6

WASPADA Jumat, 24 Mei 2013

Petani Lamteuba Dilatih Mengolah Kemiri

KNIA Momentum Peningkatan Pariwisata

BANDA ACEH (Waspada): Belasan Petani asal Lamteuba Kabupaten Aceh Besar dilatih mengolah Kemiri menjadi produk yang dapat meningkatkan ekonomi masyarakat. Pelatihan pengolahan itu dilakukan oleh tenaga ahli difasilitasi oleh Badan Narkotika Nasional (BNN) RI. “Program kita bagaimana masyarakat berhenti menanam ganja, dan mengalih fungsi lahan yang sebelumnya ditanam ganja menjadi kemiri atau komoditi lain,”ungkap Deputi BNN Bidang Pemberdayaan Masyarakat, Irjen Pol Drs.V Sambudiyono Selasa (21/5) siang, usai memberikan sambutan pada pembukaan pelatihan diikuti oleh komonitas Masyarakat Petani Binaan BNN di Lamteuba, Menurut Sambudiyono kemiri sebagai tanaman yang sudah di tanam secara turun temurun oleh Masyarakat Lamteuba perlu sentuhan teknologi dan ketrampilan, “Ini akan sangat menguntungkan, petani kita latih ketrampilan pengolahan,” sebut Sambudiyono. Selain Kemiri, Petani lamteuba juga di berdayakan dengan menanam nilam, jahe dan kopi, BNN berharap komoditi tersebut akan menjadi komoditi unggulan. “BNN tidak ingin lagi hasil alam yang keluar dari lamteuba itu ganja, masyarakat harus malu, tolong ajak, tolong sampaikan, menanam ganja itu tidak ada manfaatnya bahkan merusak generasi bangsa,” sebut Sambudiyono di hadapan aparatur desa dan muspika serta belasan petani lamteuba. (b08)

MEDAN (Waspada): Asosiasi biro perjalanan umum (Association of The Indonesian Tours & Travel Agencies/ Asita), berharap Kuala Namu International Airport (KNIA) dapat peroperasi tahun ini. Karena Asita, akan menjadikan operasional bandara itu sebagai momentum peningkatan sektor pariwisata daerah ini. Ketua Asita Sumut Solahuddin Nasution, mengatakan itu, usai dilantik menjadi Ketua Asita Sumut periode 2013-2017, di Hotel Gran Aston, Medan, Rabu (22/5). Karena, dengan beroperasinya KNIA pusat perekonomian pasti akan berubah dari yang selama ini berpusat di Kota Medan, berubah ke Kuala Namu. Solahuddin, mengatakan Kuala Namu juga dapat menjadi image baru bagi perkembangan pariwisata di Sumut. Karena itu, pihaknya juga berharap bukan hanya bentuk fisik bandara saja yang baru, tapi juga reorganisasi dan pelayanan itu dapat menimbulkan image atau wajah baru bagi pariwisata di Sumut. Seperti pelayanan karantina, petugas bandara dan bea cukai. Sementara itu, Ketua DPP Asita Asnawi Bahar, menjelaskan bahwa dirinya telah melantik jajaran pengurus di 22 provinsi dari 33 provinsi di Indonesia. Dia berpesan agar Asita sumut lebih meningkatkan lagi kerjasama dengan pihak penerbangan maupun jajaran pariwisata lainnya. Tujuannya untuk mendorong peningkatan wisata daerah yang juga akan berdampak pada perekonomian daerah. Asnawi, melantik jajaran pengurus Asita Sumut, antara lain Solahuddin Nasution, (Ketua), CHJ Gultom (wakil ketua I), Adil Anwar (wakil ketua II) dan H Soehady Aris (wakil ketua III). H.RYuriandi Siregar (sekretaris), Rio Adrian Sukma (wakil sekretaris), Le le Joelaika (bendahara) dan Hendra (wakil bendahara). Kepengurusan DPD Asita juga dilengkapi dengan sejumlah bidang. Diantaranya bidang tata niaga tiket internasional, tata niaga teket domestic, promosi dan pemasaran dan lainnya. (m32)

Tujuh Pasar Ikan Di Bireuen Masih Terlantar KUALA Bireuen (Waspada): Sebanyak tujuh buah pasar ikan di beberapa Kecamatan dalam Kabupaten Bireuen sudah dibangun 2012 lalu hingga saat ini masih terlantar belum difungsikan. Kadis Perindagkop UKM Bireuen Darwansyah,SE yang dikonfirmasi Waspada di kantornya Rabu (22/5) mengatakan, belum berfungsinya beberapa pasar ikan di Kabupaten Bireuen lantaran fasilitasnya belum lengkap. Soal belum difungsikan bukan tanggung jawab Dispenrindagkop dan UKM, itu tanggung jawab Dinas Pasar, ujarnya Sementara Sekcam Kuala Drs M Hasan didampingi Kasi PMG Amiruddin,SE dihubungi Waspada di kantornya Rabu (22/5) menjelaskan, pembangunan pasa ikan Kecamatan Kuala di Desa Cot Unoe dengan dana Otsus 2012 sebesar Rp 432.134.000, kondisinya sudah siap 100 persen. Hingga saat ini kondisi pasar ikan Kecamatan Kuala di desa Cot Unoe, disekitarnya sudah ditumbuhi ilalang dan semak belukar. Untuk mencegah agar Pasaikan ikan tidak rusak diharapkan dinas terkait dapat segera melengkapi fasilitasnya agar dapat segera funsikan, pinta Sekcam. Pengamatan Waspada, enam buah pasar ikan lainnya yang masih terlantar pasar ikan Matang Nibong Kecamatan Jeunieb, pasar ikan Blang Cot Tunong, Kecamatan Jeumpa, pasar ikan Desa Meuse Kecamatan Kuta Blang, pasar ikan Cot Ie Ju Kecamatan Peusangan, pasar ikan Beunyot Kecamatan Juli dan pasar ikan desa Geulanggang Gampong Kecamatan Kota Juang. (b12)

Harga Kopi Gayo Turun, Kopi Luwak Bertahan REDELONG (Waspada):Harga kopi Gayo sejak tiga bulan terakhir mengalami penurunan. Bahkan sampai dengan saat ini, harga jual komiditi unggulan Kabupaten Bener Meriah dan Aceh Tengah itu, masih rendah. Bahkan diprediksi untuk beberapa bulan kedepan harga kopi masih belum akan naik. Meski kondisi harga kopi Gayo terus merosot sejak beberapa bulan terakhir, namun tidak demikian dengan harga penjualan kopi luwak, minuman yang juga disebut kopi tahi musang ini sama sekali tidak terpengaruh. Harga kopi di Kabupaten Aceh Tengah dan Bener Meriah, terus merosot sejak memasuki masa panen raya kopi di gayo beberapa bulan lalu. Penurunan harga kopi sangat drastis dari Rp 7.000/bambu, menjadi Rp 4.500/bambu untuk jenis kopi gelondongan. Sedangkan untuk kopi hijau (green bean) sebelumnya Rp 33 ribu/ bambu, turun menjadi Rp 27 hingga Rp 28 ribu/bambu. General Manager Koperasi Permata Gayo, Kabupaten Bener Meriah, Armia, Rabu (22/5), mengatakan, faktor penyebab semakin turunnya harga kopi, diprediksi panen kopi di dataran tinggi Gayo bertepatan dengan panen raya di Negara Brazil dan Kolombia. “ Kalau harga di terminal New York juga sangat turun drastis. Bahkan menjadi harga terendah sejak 15 tahun terakhir ,” kata Armia. Lebih lanjut disampaikan, permintaan kopi Gayo dari Amerika dan Eropa juga mengalami penurunan sehingga Pertama Gayo mulai kurang mengekspor kopi ke negara-negara tersebut. Berkurangnya permintaan disebabkan para buyer (pembeli) telah memprediksi harga kopi akan terus semakin turun. Meski kondisi harga kopi Gayo terus merosot, namun tidak demikian dengan harga penjualan kopi luwak. “ Karena kopi luwak merupakan kopi sangat spesial. Artinya kopi luwak tidak mengikuti harga kopi dunia, makanya masih tetap bertahan dengan harga tinggi ,” kata Sekjen Asosiasi Kopi Luwak Gayo, Zam Zam Mubarak, Rabu (22/5). (b33)

Daftar Harga Bahan Pokok Di Medan, Senin (20/5) Beras KKB Beras Jongkong IR64 Gula Pasir Minyak Goreng Curah Kuning Minyak Goreng Bimoli 1000 ml Terigu Segi Tiga Biru Terigu Cakra Kembar Terigu Kunci Daging Sapi Murni Daging Ayam Broiler Daging Ayam Kampung Telur Ayam Broiler Telur Ayam Kampung Garam Bata (250 gr) Garam Halus Cabai Merah Cabai Rawit Cabai Hijau Bawang Merah Bawang Putih Tomat Kol Kentang Ikan Asin Teri Ikan Kembung Kacang Hijau Kacang Tanah Kacang Kedelai Minyak Tanah Susu KM Bendera 357 gr Susu KM Indomilk 390 gr Susu Bubuk Dancow 400 gr Susu Bubuk Indomilk 400 gr

: Rp9.700 per kg : Rp8.500 per kg : Rp12.500 per kg : Rp9.000 per kg : Rp11.500 per btl : Rp7.500 per kg : Rp7.500 per kg : Rp7.000 per kg : Rp85.000 per kg : Rp21.500 per kg : Rp60.000 per kg : Rp1.000 per butir : Rp3.000 per butir : Rp4.000 per btg : Rp4.000 per kg : Rp30.000 per kg : Rp18.000 per kg : Rp18.000 per kg : Rp22.000 per kg : Rp15.000 per kg : Rp5.000 per kg : Rp3.000 per kg : Rp8.000 per kg : Rp80.000 per kg : Rp30.000 per kg : Rp12.000 per kg : Rp20.000 per kg : Rp8.000 per kg : Rp9.000 per liter : Rp7.600 per kaleng : Rp8.200 per kaleng : Rp28.000 per kotak : Rp27.200 per kotak (m41)

Harga Emas LM Lokal (99,99%)

427.000

Emas (99,5%)

330.000

Emas Perhiasan (70%)

328.000

Emas Putih (75%)

340.000

Suasa

214.000 (m41)

Antara

Seorang pedagang menata cabai merah di pasar induk Indramayu, Jawa Barat, Kamis (23/5). Jelang kenaikan harga BBM, harga komoditi sayuran mulai merangkak naik, seperti harga cabai merah naik dari harga Rp. 16rb/kg menjadi Rp. 20rb/kg.

Harga Daging Sapi Diupayakan Turun Sebelum Ramadhan BANDUNG (Antara): Menteri Perdagangan Gita Wirjawan, menyebutkan komit untuk berupaya menurunkan harga daging sapi sebelum bulan Ramadhan. Menurutnya, telah menjadi komitemen pemerintah untuk akan menurunkan harga daging sapi, karena saat ini harga tersebut masih mahal.Yakni Rp70. 000 hingga Rp95.000 per kg. GitaWirjawan, mengaakan itu usai melakukan kunjungan

ke Pasar Kosambi Bandung, Kamis (32/5). Katanya, komitmen untuk menurunkan harga daging sai itu juga merupakan amanah Presiden SBY kepada dirinya. Dengan upaya yang dilakukan, diharapkan harga daging sapi nantinya berada di kisaran Rp65.000 per kg. ‘’Ini amanah Pak Presiden dan nanti malam saya akan bertemu dengan Menteri Pertanian untuk mencari solusi agar daging sapi ini bisa turun,” kata dia. Menurut Gita, akibat tingginya harga daging sapi dan sapi bakalan, para pedagang banyak yang mengeluhkan hal tersebut kepada dirinya. Karena selama ini penjualan mereka berku-

rang. ‘’Banyak pedagang mengeluh. Katanya biasa mereka menjual satu ekor, sekarang hanya setengah ekor. Itu karena kenaikan harganya yang dari Rp70 ribu ke Rp90 ribu,” katanya. Menurut Gita, selama ini memang pasokan daging sapi dan sapi bakalan dari dalam negeri mengalami pengurangan. Sehingga mau tidak mau pemerintah harus mendatangkan pasokan tersebut dari luar negeri. “Nah ini kita harus tingkatkan pasokan, memang kalau pasokannya kurang dari dalam negeri maka mau tidak mau kita harus datangkan dari tempat laih. Itu yang diprioritaskan oleh

pedagang atau penjual daging sapi bahwa bukan hanya dagingnya saja tapi yang sapi bakalan juga,” katanya. Pihaknya menyakini jika dilakukan kerjasama yang baik antara Kementerian Perdagangan dan Kementerian Pertanian maka komitmen untuk menurunkan harga daging sapi sebelum puasa akan tercapai. “Kalau kita bisa bekerjasama yang baik dengan Kementerian Pertanian maka Insya Allah harga bisa turun dalam waktu dekat dan kita bisa memenuhi target agar harga daging sapi bisa turun sebelum Ramadhan itu bisa tercapai,” katanya.

Kesenjangan Ekonomi Di Asia-Pasifik Meningkat JAKARTA (Antara): Bank Pembangunan Asia (ADB) menyebut, meski Asia-Pasifik menunjukkan kinerja yang baik dalam mengurangi kemiskinan, tetapi kesenjangan penghasilan di kawasan tersebut menghalangi kemajuan dalam mengentaskan kemiskinan. “Meski catatan masa lalu menunjukkan pertumbuhan ekonomi tinggi, pengurangan kemiskinan yang tajam tetap menjadi prioritas pembangunan utama setelah 2015,” kata Dirjen Evaluasi Independen

ADB,Vinod Thomas, dalam rilis ADB yang diterima di Jakarta, Kamis (23/5). Menurut Vinod Thomas, beragam studi mengindikasikan bahwa pola pertumbuhan ekonomi tidak akan cukup dalam menghambat lonjakan kesenjangan yang mengancam pertumbuhan ekonomi yang berkelanjutan. Jurang perbedaan jumlah harta-benda antara si kaya dan si miskin semakin melebar di sekitar separuh kawasan Asia-Pasifik yang menjadi tempat tinggal dari 80 persen

populasi kawasan tersebut. Selain itu, lanjutnya, kesenjangan ekonomi Asia tidak hanya terbatas pada minimnya penghasilan, tetapi juga dalam ketimpangan yang besar dari beragam aspek lainnya seperti pelayanan dasar kesehatan. “Kualitas pertumbuhan ekonomi adalah esensial,” kata Thomas. Ia mengingatkan bahwa ter-abaikannya kualitas pertumbuhan di sejumlah kawasan juga berdampak kepada beban yang harus dihadapi masyarakat di sejumlah negara. Seperti

malnutrisi di antara anak-anak India, serta menurunnya kesehatan akibat polusi udara kronis di China. Di Indonesia, Wakil Ketua MPR RI Hajriyanto Y. Tohari menyatakan kesenjangan sosial dan ketidakadilan harus menjadi perhatian serius karena semakin memprihatinkan. “Keadilan yang timpang dan kesenjangan yang sangat lebar harus jadi perhatian serius,” katanya dalam sosialisasi empat pilar kehidupan berbangsa di Kota Sorong, Papua Barat, Selasa (30/4).

KUR Untuk Pertanian/ Perikanan Rendah Di Aceh BANDA ACEH (Waspada): Pemerintah dan sektor pebankan di Aceh dipandang perlu meningkatakan perhatian pada sektor pertanian dan perikanan. Karena menurut Gubernur Zaini Abdullah, penyaluran Kredit Usaha Rakyat (KUR) masih lebih banyak dialokasikan untuk sektor perdagangan, hotel dan restoran. Sementara sektor pertanian hanya berkisar 17,11 persen. Gubernur Aceh mengatakan itu dalam sambutannya yang dibacakan Asisten Keistimewaan, Pembangunan dan Ekonomi Setda Aceh, T. Said Mustafa, pada sosialisasi perluasan KUR koridor/ wilayah Sumatera, Kamis (23/5), di Banda Aceh. Zaini, menyebutkan tingkat kemiskinan di Aceh saat ini mencapai 19,46 persen, jauh di atas tingkat kemiskinan nasional berkisar 12,11 persen. Sedangkan tingkat pengangguran berkisar 8,28 persen juga di atas nasional hanya sebesar 5,92 persen. Sementara, jumlah realisasi KUR di Aceh sampai dengan 31 Maret 2013 mencapai Rp2 triliun dengan jumlah debitur 139.163 orang. Rata-rata kredit perdebitur berkisar Rp14,38 juta dengan rasio kredit bermasalah sekitar 5,31 persen. Sementara itu, Kepala Kantor Perwakilan Bank Indonesia Aceh, Zulfan Nukman, menilai tantangan penyaluran KUR di Aceh, selain perlunya perluasan dan peningkatan pemahanan KUR kepada masyarakat juga masih terbatasnya jangkauan perbankan didaerah-daerah.(b06)

Produksi Gas Metan Dari Sampah BANDA ACEH (Waspada): Pemerintah Kota Banda Aceh merencanakan memproduksi gas metan dari tumpukan sampah di Tempat Pembuangan Akhir (TPA) di Gampong Jawa. Hal itu dilakukan sebagai solusi menambah Pendapatan Asli Daerah (PAD) di tahun 2014. Sampah di lokasi tersebut diperkirakan mampu mencukupi produksi gas metan hingga lima tahun. Kepala Seksi TPA, Dinas Kebersihan dan Keindahan Kota (DK3) Banda Aceh, Basrizal, mengatakan itu, Selasa (22/05). Katanya, setiap hari sekitar 600 ton sampah dibuang ke TPA. Itu dapat menjadi pembangkit energi alternatif, seperti gas netan pendorong turbin pembangkit listrik. ‘’ Saat ini sudah ada enam pipa gas metan aktif yang siap digunakan untuk pembangkit tenaga turbin listrik,”sebutnya. Menurutnya, jika produksi gas metan terealisir maka sampah yang ada di kota Banda Aceh dan Aceh Besar tidak lagi di buang ke TPA Gampong Jawa. Tempat itu hanya menjadi lokasi transit sebelum sampah dibuang ke ke TPA Blang Bintang. Barizal, juga menyampaikan, sampah di TPA Gampong Jawa juga akan dijadikan bahan baku dasar memproduksi pupuk kompos. Seluruh hasil produksi akan dijual ke masyarakat dan diharapkan mampu menjadi pemasukan bagi PAD. (cb06)

Ekonomi Batubara Jalan Di Tempat SEJARAH mencatat bahwa era tahun 1930-an, kota Tanjungtiram merupakan pusat perekonomian Batubara. Kota pantai itu terkenal sebagai pusat produksi ikan terbesar di wilayah Sumatera setelah Bagan Siapi-api, Riau. Secara giografis, kedudukan kota Tanjungtiram, sungguh stratergis dalam pengembangan ekonomi, karena posisinya berhadapan dengan Selat Malaka, yang ramai dilalui dan dikunjungi kapal nasional dan internasional. Karena itu, Belanda memilih membangun pelabuhan laut berskala internasional di Tanjungtiram sebagai pintu gerbang ke luar masuk barang dan orang di wilayah Batubara dan sekitarnya. Keberadaan kota Tanjungtiram sebagai produksi ikan terbesar wilayah Sumatera plus berdirinya pelabuhan internasional sangat signifikan mendongkrak kesejahteraan masyarakat. Tingkat peredaran uang yang cukup besar mendorong tingginya daya beli masyarakat, sehingga semua sektor-sektor ekonomi bergerak, tumbuh dan berkembang. Nelayan tidak pernah mengeluh, karena ikan hasil tangkapan selalu melebihi kebutuhan sehari-hari dan permintaan pasar. Sementara keberadaan pelabuhan menjadikan Tanjungtiram semakin ramai dikunjungi hingga menjadikan kota jasa. Pertumbuhan ekonomi masyarakat Tanjungtiram ketika itu tidak hanya disokong oleh besarnya produksi ikan hasil tangkapan dan kehadiran pelabuhan semata. Akan tetapi, produksi sektor perkebunan

Waspada/Erwan Efendi.

Dermaga pelabuhan Internasional Tanjungtiram-Port Klang, Malaysia, yang terus ditata dan diperluas oleh Departemen Perhubungan RI, namun tidak berfungsi sebagai mana diharapkan hingga menyebabkan asset negara itu mubazir. tanaman keras seperti kopra dan tanaman padi dan sejenisnya luar biasa. Meskipun sistem pertanian hanya mengandalkan tadah hujan dan tidak mengenal pupuk, namun setiap tahun petani tidak pernah gagal panen. Setiap tahun juga, sejumlah masyarakat muslim dari wilayah itu mampu menunaikan rukun Islam ke lima di Makkah dari hasil pertanian. Era emas ekonomi masyarakat Tanjungtiram dan sekitarnya itu memang sulit untuk dapat diraih kembali. Hal ini mengingatkan besarnya jumlah pertumbuhan penduduk sementara potensi ekonomi dari sumber daya alam (SDA) yang dikelola, baik di laut maupun di darat luasnya tidak per-

nah bertambah. Selain itu, pertumbuhan pendudukan menjadikan semakin ketatnya persaingan di lapangan, sehingga sering terjadi bentrokan seperti di laut antara nelayan jaring ikan dengan nelayan pukat grondong. Kini, para nelayan tidak lagi merasa aman ketika menangkap ikan di laut untuk mencari nafkah memenuhi kebutuhan keluarga. Sedang jaminan rasa aman itu secara signifikan tidak pernah ada. Hukum rimba nyaris sering terjadi di laut. Siapa yang kuat dialah berkuasa.Yang lemah menjadi teraniayah. Pemimpin cerdas Dalam konteks ini, masyarakat Batubara menginginkan

pemimpin yang cerdas, arif dan bijaksana dalam mengelola potensi ekonomi. Kebijakan pembangunan sektor ekonomi harus jelas memihak kepada kepentingan masyarakat dan dilakukan dalam bingkai regulasi yang kuat, transparan serta akuntabel. Sebab, selama ini ada kesan kebijakan pembangunan di Batubara bukan hanya sektor ekonomi tapi apa saja, cenderung berbau kepentingan syahwat personal, kelompok atau golongan. Cara berfikir pemanfaatan sumber ekonomi seperti ini tentu tidak akan mampu mengangkat kesejahteraan masyarakat Batubara, terutama di kawasan pesisir yang sudah tenggelam jauh. Contoh kasus adalah pena-

taan pulau Salanama. Secara rasional, penataan pulau itu sama sekali tidak memihak bagi kepentingan peningkatan ekonomi masyarakat kebanyakan kecuali hanya keinginan pemerintah. Karenanya, wajar kalau penataan yang menghabiskan APBD puluhan miliar rupiah itu mendapat kritik tajam kalangan tokoh masyarakat. Akan tetapi, sosial kontrol rasional tokoh masyarakat itu sama sekali tidak menjadi penghalang bagi penguasa tempatan untuk memenuhi keinginan ‘syahwatnya’. Masukan, saran dan pendapat dianggap seperti angin lalu, sehingga menimbulkan rasa kecewa mendalam para tokoh masyarakat. Masyarakat menginginkan Bupati Batubara memprioritaskan kembali beroperasinya pelabuhan internasional Tanjungtiram-Port Klang, Malaysia, yang sudah terhenti sejak beberapa tahun belakangan ini. Keinginan masyarakat itu wajar dan sangat beralasan. Melihat dari sisi potensi ekonomi, pengoperasian kembali pelabuhan itu akan jauh lebih menguntungkan dibanding penataan pulau Salanama yang belum jelas prosepeknya ke depan, kecuali hanya sekadar pencitraan. Hal itu sudah terbukti, ketika pelabuhan itu beroperasi di bawah kendali pihak swasta, geliat ekonomi masyarakat mulai terasa. Berbagai sektor ekonomi terlihat mulai bangkit seperti pedagang terutama pedagang kecil, transportasi, buruh angkutan, biro jasa, tukang ojek, dan lain-lain. Sisi lain, dengan beroperasinya kembali pelabuhan itu terbukanya lapangan pengerjaan baru bagi masyarakat meskipun sebagai buruh. Kedatangan dan kepergian orang melalu pelabuhan tersebut akan menambah banyaknya uang yang beredar di Tanjungtiram menye-

babkan tingginnya daya beli masyarakat. Harusnya Pemkab Batubara punya rasa malu. Sebab tanpa bantuan pemda, ditangan swasta pelabuhan itu sempat beroperasi dan sangat bermanfaat bagi masyarakat. Bahkan, pada saatnya pelabuhan Tanjungtiram akan mampu menyaingi pelabuhan Teluk Nibung di Tanjungbalai. Karena pelabuhan Tanjungtiram lebih dekat bagi penumpang yang datang seperti dari Aceh, Medan, Taput, Siantar, Simalungun. Jadi, tidak mungkin Pemda Batubara yang memiliki kekuasaan dan modal tidak mampu mengelola potensi ekonomi itu. Kini para tokoh masyarakat di kawasan itu telah memahami mengapa Bupati Batubara ngotot untuk menata pulau Salanama dan mengabaikan potensi besar pelabuhan Internasional Tanjungtiram-Port Klang, Malaysia. Kemudian, kini getol menyoliasisakan pengembangan pelabuhan di Kuala Tanjung yang akan menjadi pelabuhan Internasional Global Hub. Kebijakan bupati itu menimbulkan kesan selain tidak memiliki itikat baik untuk meningkatkan kesejahteraan masyarakat tempatan juga telah tercium adanya semacam gerakan pembiaran terhadap keadaan pahit masyarakat di kawasan itu. Ini mungkin secara politis, agaknya bupati sudah membaca bahwa masyarakat di kawasan itu tidak lagi memilih dirinya pada pilkada September 2013 dengan berbagai alasan yang signifikan. Karenanya pencitraan terus dilakukan, tapi masyarakat Batubara tidak akan mau kehilangan tongkat untuk ke dua kalinya. Jadi, kalau pun dikatakan pembangunan ekonomi Batubara sudah berjalan, tapi berjalan di tempat. � Erwan Efendi.


Nusantara

WASPADA Jumat 24 Mei 2013

A7

LHI Janjikan Rumah Rp3 M Ke Ibu DM JAKARTA (Waspada): Tersangka kasus suap penambahan kuota impor daging sapi, Luthfi Hasan Ishaaq (LHI), pernah berjanji memberikan sejumlah hartanya kepada keluarga DM, istri sirinya. Hal tersebut diungkapkan oleh salah seorang kerabat orangtua, Umam Bahanan. “Si Luthfi sempat janji sama ibu, mau ngasih rumah seharga Rp 3 miliar, mobil mewah, dan mau dibikinin apotek,” ujar Umam kepada wartawan saat Umam berkunjung ke rumah DM di kawasan Cipinang Cempedak, Kamis (23/5) pagi. Janji tersebut, kata Umam, diceritakan oleh ibunda DM, Mufida alias Umi. Ia mengatakan, janji tersebut diungkapkan Luthfi saat keluarga DM masih mengontrak di sebuah rumah sederhana di kawasan Kebon Nanas, Jakarta Timur, sebelum pindah ke rumah kontrakan yang lebih besar di Cipinang Cempedak, Jakarta Timur. Meski demikian, hingga terakhir Umam bertemu dengan Mufida sekitar empat hari lalu, janji Luthfi yang disebut-sebut ibunya menikah dengan DM tidak kunjung terlaksana, bahkan hingga Luthfi tersangkut kasus

dugaan penambahan kuota impor daging sapi oleh KPK. “Ibu Mufida merasa tertekan karena adanya kasus soal anaknya ini, juga karena Luthfi tukang bohong. Ibunya merasa tertipu,” ujarnya. Umam membenarkan jika DM telah menikah secara siri dengan Luthfi Hasan. Hal itu dikatakan Mufida kepadanya. Namun, Umam tidak mengetahui persis kapan tepatnya keduanya menikah karena kedua orangtua DM tak pernah memberitahukan perihal status DM. Kedatangan Umam dan Sakli (kerabat DM) ke rumah kontrakan DM pada Kamis siang diketahui untuk mengurus perpindahan kredit kontrakan atas permintaan ibunda DM. Namun, Sakli dan Umam mengaku bingung karena tidak ada seorang pun di rumah seluas 300 meter persegi itu. Sementara itu, ponsel ibunda DM tak tersambung. DM adalah seorang pelajar SMK di Jakarta Timur yang pernah dipanggil KPK sebagai saksi kasus dugaan pencucian uang Luthfi. Ia diduga punya hubungan dengan Luthfi.(kcm)

Wapres Setuju Harga BBM Bersubsidi Segera Diputuskan JAKARTA (Waspada): Wakil Presiden (Wapres) Boediono setuju harga bahan bakar minyak (BBM) bersubsidi segera diputuskan agar ada kejelasan bagi pelaku ekonomi. Karena harga BBM ini berimplikasi luas terhadap berbagai harga kebutuhan, terutama tingkat inflasi, yang berdampak pada anggaran negara. “Kebijakan BBM saya setuju diputuskan segera, karena usulannya sudah ada dan jelas,” katanya pada pembukaan Indonesia Banking Expo (IBEX) dengan tema Penguatan Struktur Perbankan Nasional untuk Meningkatkan Daya Saing dalam Menghadapi Era Masyarakat Ekonomi ASEAN (MEA) di Jakarta, Kamis (23/5). Ia mengatakan, meskipun BBM akhirnya harus dinaikkan, namun kenaikannya masih sangat terukur. “Ada kenaikan tapi sangat terukur baik solar maupun premium. Kita ingin dampaknya seminimal mungkin. Kita akan menyampaikan hal ini kepada anggota dewan. DPR dan pemerintah sedang bekerja keras, saya juga minta dukungan dari perbankan,” tutur Wapres. Sebelum ada kenaikan BBM diputuskan, lanjut Boediono, kompensasi dampak bagi masyarakat miskin harus disetujui oleh Dewan Perwaklan Rakyat (DPR). “Pemerintah menginginkan kompensasi itu terutama bagi yang tidak mampu. Kita sudah menyampaikan usulan ke DPR tentang Anggaran Pendapatan Belanja Negara Perubahan (APBNP) 2013,” ucapnya.

Ditegaskan, keputusan segera mengenai BBM ini adalah untuk meredam ketidakpastian. Apalagi kebanyakan harga barang sudah merangkak naik. “Tentu dukungan rekan perbankan bisa dipercepat. Kita samasama menyelesaikan masalah ini, agar ketidakpastian lenyap,” harapnya. Ketua Perhimpunan Bankbank Umum Nasional (Perbanas) Sigit Pramono meminta kepada pemerintah agar segera memberikan kepastian soal rencana kenaikan harga BBM ini. Karena dari ketidakpastian BBM ini menimbulkan risiko terhadap makro ekonomi, sehingga bank sulit memprediksi untuk rencana bisnis bank kedepannya. “IBEX (Indonesia Banking Expo 2013) ini ketiga kalinya, temanya disesuaikan dengan isu strategis yang sedang hangat di perbankan. Kita juga minta khususnya kepada Bapak Boediono yang terkait subsisdi BBM agar persoalan ini segera diambil keputusannya, apapun keputusannya kami dukung,” tegas Sigit saat sambutan di IBEX. Selain masalah BBM, Sigit juga menyinggung soal kesiapan perbankan Indonesia dalam hal regulator, pemodal, dan pelaku dalam menghadapi serbuan negara-negara ASEAN di pasar domestik terkait berlangsungnya Masyarakat Ekonomi ASEAN (MEA) di akhir 2015. Perlu persiapan Indonesia untuk bisa menyerbu negaranegara lainnya dalam persiapan MEA. (j03)

KPK Bantah Daftar Nama Penerima Uang Fathanah

Antara

SALAM KOMANDO: Panglima TNI Agus Suhartono (tengah) melakukan salam komando bersama Kepala Staf Angkatan Darat (KASAD) yang baru Letjen Moeldoko (kiri) dan mantan KASAD Jenderal Pramono Edhie Wibowo usai upacara serah terima jabatan KASAD di lapangan upacara Mabes AD, Jakarta Pusat, Kamis (23/5).

Poldasu Peringkat Pertama Pelayanan Terburuk JAKARTA (Waspada) : Kepolisian Daerah Sumatera Utara merupakan peringkat pertama pelayanan terburuk dan pengaduan masyarakat yang paling banyak masuk ke Komisi Kepolisian Nasional (Kompolnas) tahun 2013. “Polda Sumut merupakan peringkat teratas paling buruk pelayanannya, dan tertinggi laporan masyarakat yang masuk ke Kompolnas periode Januari sampai pertengahan Mei 2013,” kata Komisioner Kompolnas Edi Sahputra Hasibuan diruang

kerjanya kepada Waspada di Jakarta, Kamis (23/5). Menurut Edi Hasibuan, di bawah Polda Sumut yang masuk katagori pelayana buruk dan banyaknya laporan masyarakat adalah Polda Jawa Timur, Polda Jawa Barat, Polda Metro Jaya dan Polda Jawa Tengah. “Selain laporan buruknya pelayan polisi terhadap masyarakat, laporan yang diterima Kompolnas khususnya adalah sengketa lahan, judi dan narkoba. Termasuk tentang diskresi yang keliru. Ini bukti polisi di Sumut kurang baik,” kata Edi Hasibuan.

Untuk ini kata Edi Hasibuan, Kapolda Sumut Irjen Pol Wisjnu Amat Sastro diharapkan dapat membenahi personilnya agar dapat memperbaiki pelayanan pada masyarakat. “Kapolda Sumut harus merespon laporan masyarakat, paling tidak bisa memperbaiki pelayanan terhadap masyarakat. Sebagai pelayan dan pengayom, Polda Sumut diminta segera meningkatkan kinerjanya,” kata Edi Hasibuan yang ditunjuk menangani dan membawahi Polda Sumut. Anggota Kompolnas asal Kabupaten Paluta Selatan ini

sangat prihatin dengan predikat terburuk yang disandang Polda Sumut sampai pertengahan Mei ini. “Tindak kriminal perjudian dan narkoba juga sangat memprihatinkan. Ditambah lagi personil polisi yang tersandung kasus narkoba seperti penangkapan 3 anggota polisi di kota Rantauprapat, Labuhanbatu pada Rabu (22/2) malam. Sangat ironis sekali, dimana polisi hasus membasmi narkoba, tapi justru anggota polisi yang tersandung barang haram itu,” terang Edi Hasibuan.(j02)

Antara

Pemerintah Diminta Prioritaskan Infrastruktur JAKARTA (Waspada): Pemerintah didesak lebih memperhatikan infrastruktur penghubung kota, desa dan lokasi strategis. Karena itu perlu dialokasikan anggaran infrastruktur di dalam APBN 2013 dan RAPBN 2014. “Kita minta pemerintah mengoptimalkan ekonomi domestik dengan cara menjaga inflasi dibawah lima persen,” ujar Juru bicara Fraksi Partai Golkar Azwir Dainytara saat membacakan pandangan fraksinya atas pokok-pokok pembicaraan pendahu-luan RAPBN 2014, di sidang paripurna, di

Gedung DPR, Jakarta, Kamis, (23/5). Sedang Fraksi PDI Perjuangan menilai saat ini telah terjadi ketimpangan masyarakat yang semakin parah dan harus segera diatasi. FPDIP melihat harga-harga kebutuhan pokok yang terus meningkat dan tidak terkendali, serta masih banyaknya makelar kasus . Padahal kita tengah menggali banyak potensi pajak, terutama untuk sektor pertambangan dan penanaman modal asing. Untuk belanja negara, lanjut juru bicara FPDIP Muhammad

Mulyadi , FPDP menyarankan agar mendahulukan kebutuhan belanja yang bersentuhan dengan masyarakat. Misalnya dengan menciptakan lapangan kerja. Sementara F PKS mendesak pemerintah meningkatkan belanja modal dan investasi, terutama pada sektor pertanian dan industri pengolahan nasional. “Ini penting dalam rangka mendorong pertumbuhan ekonomi yang lebih tinggi dan berkualitas, meningkatkan ketahanan pangan, meneciptakan lapangan kerja, dan menurun-

kan tingkat keimiskinan,”ujar juru bicara PKS Ecky Awal Muharam. Menurut Ecky, gini ratio Indonesia meningkat dari 0,32 tahun 2004 menjadi 0,41 pada 2012. Ini suatu angka terburuk dan tertinggi dalam sejarah Indonesia. “Oleh karena itu, Fraksi PKS meminta pemerintah untuk lebih serius memperbaiki kinerja konsumsi pemerintah, meningkatkan daya saing dan investasi, membangun industri nasional, memperbaiki kinerja sektor tradable, dan memperbaiki kualitas pertumbuhan,” tuturnya. (aya)

Perempuan Harus Melek Keuangan JAKARTA ( Waspada): Gengsi dan gaya hidup mewah membuat perempuan di perkotaan hidup dalam kungkungan pola hidup konsumtif. Perempuan demikian, cenderung sulit mengelola keuangan secara bijaksana. Alhasil, tidak sedikit yang akhirnya terjerumus dalam kehidupan yang suram, terjerat hutang atau mengalami prahara dalam rumah tangganya. Padahal, menurut Menteri Negara Pemberdayaan Perempuan dan Perlindungan Anak, Linda Gumelar, perempuan memegang peranan penting dalam pengelolaan keuangan, baik dalam rumah tangga maupun lingkungan pekerjaan. Karena itu, perempuan harus sadar alias melek pentingnya mengelola keuangan. Saat ini, data terbaru dari Kementerian Dalam Negeri (Kemendagri) mengatakan, dari total 251,9 juta jiwa penduduk Indonesia, lebih

dari 122,3 juta jiwa atau 48,56 persen adalah perempuan. “Suatu jumlah yang cukup besar dan seyogyanya merupakan aset bangsa yang potensial bagi pembangunan di berbagai bidang, termasuk ekonomi,” kata Linda, usai meresmikan Pojok Baca dan Informasi Perempuan di Kelurahan Petamburan, Jakarta Pusat, Kamis (23/5). Pojok Baca dan Informasi Perempuan ini hasil kerjasama Yayasan Cinta Anak Bangsa dan Standart Chartered Bank (SCB) sebagai bagian dari Corporate Social Responsibility (CSR). Karena itu, Linda mengatakan sangat menghargai berbagai upaya masyarakat untuk mencerdaskan perempuan Indonesia dalam hal mengelola keuangan. Salah satunya dengan mendirikan taman bacaan, dimana banyak perempuan dan remaja menyadari pentingnya membuka wawasan dan ilmu supaya tidak terjebak dalam

pola hidup konsumtif. Di sisi lain, kemandirian ekonomi perempuan juga akan mempercepat terciptanya harapan pemerintah dalam meningkatkan jumlah usaha kecil dan menengah. Saat ini, iklim ekonomi kreatif Indonesia telah bergerak cepat dan mam-pu mendongkrak jumlah pengusaha dari 0,08 persen menjadi 1,8 persen. “Sampai 2015 nanti harapannya akan terus muncul sebanyak 1juta pengusaha baru di Indonesia. Dan perempuan, sudah membuktikan banyak konrtibusinya dalam hal ini,” tandas Linda. Pojok Baca dan Informasi yang diresmikan Linda berisi sedikitnya tiga ribu buku. Tidak hanya membaca, nantinya kegiatan pelatihan keuangan juga akan diberikan kepada sedikitnya 100 perempuan pengusaha kecil di lingkungan sekitar. (dianw)

Waspada/dianw

MENTERI Negara Pemberdayaan Perempuan dan Perlindungan Anak, Linda Amalia Sari Gumelar (kanan) bersama Group Chief Executif Standart Charter, Peter Sand (dua dari kanan) menyempatkan diri bermain bersama anak-anak usai meresmikan Pojok Baca dan Informasi bagi perempuan di Kelurahan Petamburan, Jakarta Pusat, Kamis (23/5).

Pesta Rakyat “Horas Parapat Fiesta”

Gairahkan Pariwisata Parapat Dan Lestarikan Budaya JAKARTA (Waspada): Penasehat pesta rakyat ‘ Horas Parapat Fiesta’ menegaskan, pelaksaanan pagelaran ‘ Horas Parapat Fiesta’ yang akan digelar masyarakat Kec. Girsang Sipangan Bolon Parapat , tanggal 27- 30 Juni 2013 murni untuk kepentingan kepariwisatawan kota turis Parapat yang mengalami penurunan kunjungan wisatawan yang drastis. Salah satu faktor penyebab merosotnya kedatangan wisatawan ke Parapat , bukan hanya karena kota kecil yang berada di pinggiran pantai Danau Toba itu, tidak pernah mendapat pembenahan, tetapi ketidakadaan hiburan berupa atraksi budaya tardisiona dan perlombaan olah raga air menjadi salah satu alasan berkurangnya wisatawan ke Parapat. Melihat kenyataan inilah masyarakat Kec. Girsang Sipangan Bolon Parapat melakukan pertemuan dan sepakat untuk membentuk satu lembaga guna melaksanakan pesta rakyat ‘ Horas Parapat Fiesta’. Mudah-mudahan pelaksanaan pesta rakyat Horas Parapat Fiesta ini, bisa mengairahkan kepariwisataan Parapat dan membunuh rasa sepi wisatawan. Jadi pesta rakyat

JAKARTA(Antara): KPK (Komisi Pemberantasan Korupsi) membantah kebenaran data yang beredar di sejumlah media mengenai nama-nama penerima dana dari Ahmad Fathanah. “Data itu bukan dari KPK, jadi kami tidak tahu dan namanama itu dari mana dan belum tentu sama dengan nama-nama yang diberikan dari hasil analisis Pusat Pelaporan dan Analisis Transaksi Keuangan ke KPK,” kata Juru Bicara KPK Johan Budi di Jakarta, Kamis (23/5). Ahmad Fathanah adalah tersangka kasus suap pengurusan kuota impor daging sapi di Kementerian Pertanian dan tindak pidana pencucian uang. Sebelumnya beredar di media daftar yang memuat 45 nama perempuan yang disebut mendapatkan uang dari Fathanah sejak Maret 2004 hingga Februari 2013 dengan jumlah bervariasi mulai Rp1 juta hingga Rp2 miliar. “Jadi nama-nama itu tidak bisa disimpulkan akan dipanggil KPK atau tidak,” tambah Johan. Nama-nama tersebut di antaranya ada sejumlah perempuan yang pernah dipanggil KPK seperti Dewi Kirana, Linda Silviani (istri dari Ahmad Zaki yaitu asisten pribadi mantan presiden Partai Keadilan Sejahtera Lutfhi Hasan Ishaaq), istri ketiga Fathanah Sefti Sanustika serta penyanyi dangdut Tri Kurnia Rahayu. Wakil Ketua PPATK Agus Santoso mengatakan bahwa PPATK tidak pernah mempublikasikan data tersebut. “PPATK tidak pernah mempublikasikan data itu dan tidak pernah membuat segmentasi analisis aliran dana ke kelompok peremupan dan laki-laki,” kata Agus. Ia menyatakan, berdasarkan pasal 5 Undang-undang Tindak Pidana Pencucian Uang No 8 tahun 2010 penerima aliran dana dapat dikategorikan sebagai pelaku pasif atau penadah dan harus diminta pertangungjawabkan. “Berhubung proses penyidikan dalam kasus ini menjadi kewenangan KPK, maka masyarakat ikuti saja penyidikan KPK karena PPATK telah menyerahkan Laporan Hasil Analisis yang menyangkut banyak nama dan masih melakukan pendalaman transaksi-transaksi untuk membantu KPK mengungkap kasus ini,” tambah Agus. Sebelumnya KPK menyita empat mobil mewah milik Fathanah yaitu Toyota FJ Cruiser hitam bernomor polisi B 1330 SZZ dan Alphard putih bernomor polisi B 53 FTI yang dibeli di dealer di Pondok Indah, Land Cruiser Prado hitam bernomor B 1739 yang dibeli dari dealer Wiliam Mobil di Pondok Indah, serta satu Mercedes Benz. Fathanah bersama mantan presiden PKS Luthfi Hasan Ishaaq disangkakan melakukan pencucian uang dengan sangkaan melanggar pasal 3 atau pasal 4 atau pasal 5 Undang-Undang nomor 8 tahun 2010 tentang Tindak Pidana Pencucian Uang jo pasal 55 ayat 1 ke-1 KUHP. Tindak pidana asal yang disangkakan kepada mereka adalah suap penambahan kuota impor daging sapi yang berasal dari PT Indoguna Utama.

ini murni untuk kepentingan kepariwisataan Parapat sekaligus sebagai upaya menggali dan melestarikan budaya Batak, “ ujar penasehat Horas Parapat Fiesta Edison Rumahorbo dan Tumpan Sinaga, Kamis, (23/5), yang secara khusus datang ke Jakarta untuk menggalang kebersamaan dengan masyarakat Parapat yang tinggal di ibukota. Menurut Edison Rumahorbo, untuk mendanai pesta rakyat ini, masyarakat Kec. Girsang Sipangan Bolon Parapat sebagai pelaku pariwisata bahu membahu dan didukung penuh para pelaku pariwisata di bidang perhotelan dan restauran, serta Muspika setempat. Dia menyakinkan, seluruh tokoh masyarakat, pelaku pariwisata, sudah berkomitmen bahwa pesta rakyat ini tidak boleh menjadi alat untuk kepentingan tujuan tertentu dari kelompok manapun, apalagi dari partai politik untuk kepentingan menjelang Pemilu 2014. Sekali lagi saya tegaskan pesta rakyat Horas Parapat Fiesta ini merupakan kepedulian masyarakat Parapat untuk menghidupkan suasana Parapat sebagai daerah tujuan wisata sekaligus mengali dan melestarikan budaya Batak.

Jadi janganlah ada yang berusaha mempolitisasi pesta rakyat ini, “ ujar mantan anggota DPRD Simalungun ini. Edison dan Tumpan sebagai wakil dari masyarakat Kec. Girsang Sipangan Bolon Parapat, datang secara khusus ke Jakarta untuk menjelaskan sepenuhnya visi dan misi pelaksanaan Horas parapat Fiesta kepada masyarakat parapat yang tinggal di Jakarta, sekaligus mengajak kebersama untuk bergotongroyong mendanai pesta itu demi menghidupkan kepariwisataan Parapat. Adapun panitia pelaksana Horas Parapat Fiesta ini adalah, Pelindung MUSPIKA Kecamatan Girsang Sipanganbolon, Penasehat Edison Rumahorbo, Rinawati Sianturi (Medan), Tumpan Sinaga, Jatua Sidabutar, Lebanus Ambarita, Josdi Situmorang,SE, Benny Sinaga, Halomoan Sirait, Tuaris Sinaga, Ketua Umum Mayor Laut (KH)Agussalim,S.Sos, Ketua Pelaksana Jhony Sinaga, SH, Sekretaris, Washington H.Sirait, Bendahara Junjungan Hutagaol. Kepanitiaan ini juga dilengkapi seksi-seksi. ( aya)

WAKIL Ketua Komisi IX DPR dari Fraksi PPP Irgan Chairul Mahfiz (kanan) bersama anggota Komisi IX DPR dari Fraksi PDI Perjuangan Rieke Diah Pitaloka (kiri), anggota Komisi IX DPR dari Fraksi Golkar Poempida Hidayatulloh (kedua kanan) dan Pengurus Harian YLKI Husna Zahir (kedua kiri) menjadi pembicara dalam diskusi Dialektika di Gedung Parlemen, Senayan, Jakarta Pusat, Kamis (23/5).

Irgan Chairul Mahfiz:

BPJS Bukan Untuk Pencitraan, Tetapi Harus Dilaksanakan JAKARTA (Waspada): Pemerintah tidak memiliki komitmen yang baik untuk mengatasi rakyat miskin yang sakit serta banyaknya kasus rakyat miskin tak tertangani oleh dokter di rumah sakit (RS) di Jakarta, dan daerah-daerah melahirkan program jaminan sosial melalui Undang-undang Badan Penyelenggara Jaminan Sosial (BPJS), yang akan dilaksanakan mulai Januari 2014. Namun, pihak DPR khawatir pelaksanaannya akan semrawut jika infrastruktur, dokter, obat-obatan, anggaran, dan sosialisasinya tidak siap. “BPJS ini bagus, tapi persiapannya harus cepat. Kalau tidak, RS akan kewalahan, dan tak mustahil akan terjadi seperti di Jakarta, di mana ada RS yang mengundurkan diri. Padahal, itu tak boleh karena melanggar UU No.44/2009 tentang RS,” tandas Wakil Ketua Komisi IX DPR RI Irgan Chairul Mahfiz dalam dialog ‘Tolak KJS dan nasib BPJS’ bersama anggota Komisi IX DPR Rike Diah Pitaloka (FPDI Perjuangan), Poempida Hidayatullah (FPG), dan Huzna Zahir dari YLKI di DPR RI Jakarta, Kamis (23/5). Untuk itu lanjut Irgan, pemerintah dan DPR harus mematangkan sistem BPJS tersebut, termasuk besaran premi-pembayaran ke RS oleh setiap pasien, sumber daya manusia, infrastruktur, obat-obatan dan sebagainya. “Semua itu harus cepat, karena hitungannya tahunan, bukan lima tahunan. BPJS ini suatu keharusan sebagai kehendak negara. Jadi, banyak hal yang harus diperhatikan negara. Bukan hanya pencitraan, melainkan harus direalisasikan,” tambah politisi PPP itu. Apalagi anggaran yang dialokasikan hanya 2,07 persen dari APBN atau sekitar Rp 31,2 triliun, jauh dibanding pendidikan yang 20 persen. Semestinya 5 persen atau sekitar Rp 75 triliun. “Pada prinsipnya RS dan dokter harus bernagkat dari ideologi dan nasionalisme agar benar-benar untuk rakyat. Pemerintah harus merubah kebijakan dari konsumtif seperti BLT, Balsem, Bansos, dan sebagainya,” kata Irgan. Rieke menegaskan jika usapa mengatasi rakyat sakit di Indoensia dibutuhkan kesamaan ideologi dan nasionalisme, bahwa membantu dan mengabdi kepada rakyat itu khususnya dalam menangani kesehatan itu sebagai amanat pendiri bangsa ini. dan, BPJS (Badan Penyelenggera Jaminan Sosial) ini sebagai salah satu solusinya, yang perlu komitmen pemerintah. Karena itu tugas DPR bukan saja menggolkan BPJS, melainkan harus mendorong bagaimana program itu dijalankan oleh pemerintah. “Persoalannya mau atau tidak? Jangan selalu beralasan masalah dana, karena Provinsi Aceh dengan program yang sama dengan premi Rp 17.000,-, Pemda Purwakarta, dan Jakarta, sendiri bisa. Rumah Sakit pun tak perlu takut, karena tetap dibayar, dan itu tak akan membuat RS bangkrut,” tegasnya. Untuk itu Oneng mempertanyakan sikap Presiden Susilo Bambang Yudhoyono (SBY), yang pernah menyatakan agar masalah rumah sakit tersebut diserahkan ke sistem pasar. “Kalau diserahkan ke sistem pasar, lalu bagaimana komitmen dan kewajiban pemerintah dalam membantu kesehatan rakyat? Jadi, negara harus hadir, dan wajib menyelesaikan masalah ini dengan melakukan efisiensi dengan alokasi anggaran yang lain,” ungkap mantan Cagub Jawa Barat itu. Sejauh itu Poempida menyayangkan Menteri Kesehatan (Menkes) yang sampai hari tidak terbuka terhadap data-data yang dibutuhkan DPR, terkait penyakit apa saja yang mayoritas diderita rakyat, obat apa saja yang banyak dibutuhkan, berapa dana yang diperlukan, dan sebagainya harus dilakukan dengan transparan. “Komisi IX DPR optimis BPJS ini akan terlaksana, dan hanya berbeda persepsi dengan pemerintah dalam pelaksanaan Januari 2014nanti,” katanya. Menurut Huzna Zahir, program Kartu Jakarta Sehat (KJS) maupun BPJS ini berlaku untuk semua orang, termasuk rakyat yang tidak bekerja. Maka wajar jika program KJS membludak, karena selama ini rakyat takut mendatangi rumah sakit, akibat dibayangi biaya yang mahal. (j07)


Luar Negeri

A8

WASPADA Jumat 24 Mei 2013

Polisi: Bom Tewaskan 13 Orang Di Pakistan Baratdaya QUETTA, Pakistan (Antara/AFP): Sebuah bom yang ditanam di becak mengoyak kendaraan yang digunakan oleh pasukan keamanan di baratdaya Pakistan, Kamis (23/5), menewaskan sedikitnya 13 orang, kata polisi. Bom itu diledakkan dari jarak jauh, mengandung sekitar 100 kg bahan peledak dan menargetkan satu truk yang membawa anggota pasukan paramiliter pemerintah di pinggiran Quetta, ibu kota Provinsi Baluchistan yang bergolak. Baluchistan, provinsi terbesar namun yang paling berkembang di Pakistan, dilanda aksi kekerasan sektarian dan pemberontakan yangberlangsunglamadilancarkanolehkaumseparatis,danseranganserangan terhadap pasukan keamanan sering terjadi. “Setidaknya 12 orang tewas, 11 dari mereka adalah aparat keamanan,” kata pejabat senior polisi Fayyaz Sumbal kepada AFP. “Bom itu ditanam di becak (roda tiga). Targetnya adalah sebuah truk Baluchistan Constabulary yang membawa petugas keamanan.” Sebanyak 11 orang terluka dalam serangan itu, katanya. Seorang petugas penjinak bom mengkonfirmasi insiden dan korban yang tewas. Baluchistan, yang berbatasan dengan Afghanistan dan Iran, memiliki cadangan gas yang signifikan dan sumber daya lainnya, tetapi pembangunan telah dibatasi oleh situasi keamanan yang mudah terguncang. Sepuluh hari yang lalu kepala polisi provinsi lolos dari serangan bom mobil bunuh diri di luar rumahnya di Quetta, yang menewaskan sedikitnya enam orang dan melukai 46 lainnya.

Kamboja Cetak 12 Juta Kertas Suara Buat Pemilu Juli PHNOM PENH, Kamboja (Antara/Xinhua-OANA): Komite Pemilihan Umum Kamboja (NEC) akan mencetak 12 juta kertas suara buat pemilihan umum pada 28 Juli, kata Sekretaris Jenderal lembaga pemilihan itu Tep Nytha kepada wartawan Kamis (23/ 5). Dia mengatakan pemilihan umum mendatang akan menelan biayasebanyakAS$21juta,yangmenjaditanggungjawabPemerintah Kamboja. Delapan partai politik telah secara resmi mendaftarkan dirikeNECuntukmengkutipemilihanumummendatang.Sebanyak 9,67 juta orang Kamboja memenuhi syarat sebagai pemilih, katanya. Tiga partai besar termasuk di antara yang mendaftarkan diri adalah Partai Rakyat Kamboja —yang memerintah dan dipimpin oleh PMHunSen,kelompokoposisiutamaPartaiPenyelamatanNasional Kamboja —yang dipimpin oleh Sam Rainsy, yang hidup di pengasingan,dankuburoyalisPartaiFuncinpec,pimpinanNorodom Arun Rasmey —anak paling kecil mendiang Raja Sihanouk.

Filipina Bertekad Pertahankan Wilayahnya Dari China

Palestina: Israel Hentikan Provokasi PBB, NewYork (Waspada): Palestina meminta Dewan Keamanan (DK)PBBagarmenekanIsraeluntukmengakhiriprovokasinya,termasuk pembatasan akses ke tempat suci di Jerusalem Timur, kata seorang utusan Palestina kepada wartawan di Markas PBB, New York. “Kami telah mengirim empat surat kepada Presiden Dewan KeamanandanSekjenPBB,selamaduapekanbelakangan,mengenai kebijakantidaksahdanpraktekkekuatanpendudukanIsrael,terutama di wilayah pendudukan Jerusalem Timur dan sekitarnya, terutama yang berkaitan dengan provokasi terhadap tokoh agama Kristen Palestina dan juga umat Muslim Palestina,” kata Riyadh Mansour, PengamatTetapPalestina untuk PBB, setelahkonsultasi DK mengenai situasi di Timur Tengah Rabu. “Provokasi ini meningkatkan ketegangan di Kota Suci Al-Quds (Jerusalem),” kata Mansour, yang disertai olehWakil Tetap Marokko untuk PBB Moahmmed Loulichki. “Tentu saja, orang dapat menambahkan ke dalam (provokasi) itu kegiatan Israel yang berkaitan dengan permukiman, teristimewa 300 unit di Beit El di dekat Ramallah,” kata Mansour sebagaimana dikutip Xinhua. “Kami kembali menyampaikan seruan kami bahwa Dewan Keamanan harus memikul tanggung-jawabnya mengenai kekuatan pendudukan Israel ... untuk menjamin keselamatan dan kebebasan beragama bagi rakyat Palestina tak peduli apa pun agama mereka di Kota Suci Jerusalem dan tidak mengulangi provokasi ini —yang telahkamilaporkanselamaduapekanbelakangan,”iamenambahkan. Awal Mei, menurut beberapa laporan, polisi Israel menghentikan kunjungandiplomatasingyangdiselenggarakanolehkelompokKristen Palestina, saat mereka berusaha memasuko Kota Tua Jerusalem. Sementara itu, Administrasi Sipil, badan pemerintah Israel yang menguasai wilayahTepi Barat Sungai Jordan dan beroperasi di bawah Kementerian Pertahanan, memberi lampu hijau bagi pembangunan 300 rumah baru di permukimanTepi Barat, Beit El, di dekat Ramallah. Terpecah untuk damai Dalam perkembangan lainnya, pemerintah Israel terpecah mengenai masalah perdamaian dengan Palestina, kata perunding danMenteriKehakimanTzipiLivniKamis(23/5)menjelangpertemuan dengan Menlu AS Serikat John Kerry. “Ada perbedaan ideologi di jantung pemerintah,” kata Livni kepada radio publik. Mengulur-ulur proses perdamaian sejak September 2010 “hanya melayani kepentingan mereka untuk berpikir bahwa setiap harinya (tanpa perjanjian damai) memungkinkan mereka untuk membangun rumah baru,” katanya, mengacu pada pemukiman Yahudi yang dibangun di wilayah Palestina yang diduduki, isu utama yang mencegahkembalikeperundingan.“Tetapiinibukanposisimayoritas penduduk Israel,” katanya menambahkan. Pernyataan Livni datang beberapa jam menjelang pertemuan dengan Kerry, yang tiba di Israel pada Kamis untuk mendorong dimulainya kembali pembicaraan, pada kunjungan keempat ke kawasan sejak menjabat pada Februari. (bbc/rtr/m10)

Seorang Tentara AS Rekam Gambar Kadet Wanita Mandi WASHINGTON (Antara/Reuters): Seorang tentara berpangkat sersan di akademi militer AS di West Point, dituduh melakukan pelanggaran dengan merekam kadet perempuan yang sedang mandi pancuran, petugas pertahanan mengatakan pada Rabu mengenai skandal seks terbaru yang mengguncang pihak militer. Sersan Michael McClendon bulan ini dituntut dengan empat pelanggaran undang-undang militer AS yaitu melakukan perbuatan tidak senonoh, melalaikan tugas, melakukan kekerasan dan penganiayaan, serta melanggar disiplin dan tata cara, kata juru bicara militer George Wright. Wright menjelaskan bahwa McClendon juga diselidiki atas kepemilikan gambar-gambar yang tidak patut yang diambil tanpa izin. Namun dia tidak menjelaskan lebih rinci. The New York Times yang pertamakali melaporkan peristiwa ini mengatakan, gambar-gambar tak patut itu antara lain rekaman seorang kadet perempuan yang sedang mandi yang dibenarkan oleh petugas pertahanan tetapi tidak bersedia disebutkan namanya. McClendon yang bertugas di akademi militer yang bergengsi di New York sejak 2009, sudah dipindahkan ke Fort Drum di New York setelah gugatan diajukan 14 Mei, ujar Wright. McClendon bertugas sebagai opsir bintara taktis di akademi militer itu dan tugasnya adalah melatih dan mendampingi 212 kadet dengan tujuan utama untuk mengembangkan kepemimpinan dan tanggung jawab pada para siswa itu. Wakil Kepala Staf Akademi Militer, Jenderal John Campbell mengatakan, tugas tersebut dialihkan segera setelah kejadian di West Point dilaporkan.“Para kadet kami harus yakin bahwa masalah seperti ini harus ditangani secepatnya dengan tepat, dan sistem tanggung jawab kami berjalan dengan benar,” katanya. Laporan tuntutan kepada McClendon itu terjadi menyusul serangkaian skandal seks yang memalukan di kalangan militer AS yang membuat anggota kongres mengajukan rencana untuk mengeluarkan aturan yang lebih ketat bagi Pentagon dalam menangani masalah kejahatan seksual.

Laporan Dari Malaysia:

The Associated Press

PARA anggota kepolisian meletakkan karangan bunga yang diserahkan pada mereka oleh masyarakat di lokasi serangan teror di Woolwich, tenggara London, Inggris, Kamis (23/5). The Komite Darurat pemerintah Inggris mengadakan sidang Kamis setelah dua penyerang membunuh seorang pria di siang hari bolong di London yang telah meningkatkan kecemasan akan terorisme telah kembali lagi ke London.

Inggris Dilanda Teror Larang Tentara Pakai Atribut Angkatan Bersenjata LONDON, Inggris (Waspada): Penikaman seorang tentara Inggris hingga tewas membuat negara itu memperketat pengamanan. Barak-barak militer diminta diawasi ketat, tentara juga dihimbau tidak memakai atribut angkatan. TheMirrormelaporkanKamis (23/5), perintah ini datang dari MenteriDalamNegeriInggriTheresa May usai rapat Cobra. Dalam rapat tersebut, hadir Menteri PertahananPhilipHammond,Walikota London Boris Johnson, Komisaris PolisiHogan-HowedanAsistennya CressidaDicksertabeberapaagen intelijen. Setelah diberitahu adanya indikasi kuat tindak terorisme, seluruh barak militer di London diminta dijaga ketat. Peristiwa penikamanolehduaMuslimradikal itu terjadi hanya sekitar 400 meter dari barak militer Woolwich, sebelah tenggara London. Selain itu, tiga divisi dan seluruh brigade di Inggris juga menghimbau pasukannya agar mengenakanpakaiansipildiwilayahwilayah rawan dan tidak membawa tas militer, kaus atau apapun yang bisa mengancam keselamatan mereka. Menhan Hammond juga

mengatakan bahwa keamanan tentara Inggris akan ditinjau lagi menyusul peristiwa ini. Insiden ini terjadi di siang bolong, Rabu di jalan yang ramai diWoolwich. Dua pelaku menabrak korban dan menikamnya hingga tewas. Pelaku berhasil dilumpuhkan polisi dan ditahan untuk diselidiki. Diduga pelaku berasal dari Nigeria. MantanMendagraiJohnReid menduga pelaku adalah militan yang beraksi seorang diri tanpa afiliasi dengan al-Qaeda atau jaringan teror lainnya. Jika memang seperti ini, maka tindak-tanduk pelaku atau para calon pelaku sangat sulit diprediksi. “Serangan tipe serigala sendirian mungkin terinspirasi oleh al-Qaeda tapi tidak memiliki rencana yang jelas. Sangat sulit dilacak, bahkan tidak jarang dilakukan oleh orang-orang yang sama sekali tidak punya catatan kejahatan,” kata Reid.

Korban tewas dikapak dua pria berpaham radikal di tengah jalan pada tengah hari di London. Para pelaku mengaku balas dendamataspembunuhanyangdilakukan tentara Inggris di negaranegara Islam Timur Tengah. Menurut Reuters Kamis, peristiwa berdarah itu terekam kamera warga dan disiarkan ke seanteroInggrisolehstasiunberita ITV. Dalam sebuah tayangan, pelaku yang merupakan warga kulit hitam itu memegang pisau dan kapak, tangannya berlumuran darah. “Kami bersumpah dengan nama Allah, kami tidak akan berhentimemerangikalian.Alasan kami melakukan ini, karena Muslimdibunuhsetiaphari,”kata pria berusia 20-30an ini. Menurut laporan saksi mata, korban awalnya ditabrak oleh mobil para pelaku sebelum ditikam. Mobil itu sendiri remuk menghantam tiang lampu jalan. Lalu, seorang pelaku menikam korbanhinggaterkapardantewas. Peristiwa itu terjadi di siang bolong, di tengah jalan Woolwich yang sibuk. Korban diketahui mengenakan kaus “Help for Heroes”, sebuah lembaga amal untuk mem-

bantu veteran perang Inggris. Saksi mengatakan, pelaku mencoba memenggal kepala korban, namun berhasil dicegah beberapa orang wanita, warga sekitar. Polisiyangdatangkelokasilangsungmelumpuhkankeduapelaku dan menahan mereka. Belum diketahuiidentitasparapelaku,tapi sumber kepolisian mengatakan kemungkinan keduanya terlibat jaringan militan di Nigeria. PM David Cameron menganggapiniadalahtindakanterorisme.Dialangsungmemerintahkan investigasi dilakukan oleh Komando Pemberantasan Terorisme, Densus 88-nya Inggris. The Guardian melaporkan Kamis, Cameron terpaksa mempercepat kunjungannya ke Prancis untuk bertemu Presiden Francois Hollande karena kasus ini. Dia langsung memerintahkan Menteri Dalam Negeri Theresa May untuk menggelar pertemuan Cobra. Pertemuan Cobra adalah singkatan dari Cabinet Office Briefing Rooms (COBR). Pertemuan di ruangan ini hanya dilakukan pada situasi darurat. Terakhir,pertemuanCobradilakukan pada Agustus 2011, pada kerusuhan di London. (bbc/vn/m10)

Warga Malaysia Didakwa Lakukan Penghasutan, Tiga Lagi Ditahan KUALA LUMPUR, Malaysia (AP): Pihak berwenang Malaysia Kamis (23/5) menahan tiga tokoh anti pemerintah, mendakwa seorang aktivispelajarmelakukan penghasutandanmenyitaratusan suratkabaroposisi,meningkatkan ketegangan politik setelah pemilihan nasional yang diklaim diwarnai kecurangan. Aktivis oposisi melancarkan sejumlah aksi demonstrasi damai sejakpemilihanumum5Meilalu, yangdimenangkankoalisiBarisan Nasional dengan jumlah yang semakin sedikit di parlemen. Para aktivis tersebut menyatakan, koalisi yang telah berkuasa sejak tahun 1957, mempertahankan kekuasaan lewat manipulasi suara dan tindakan tidak sah lainnya, meski PM Najib Razak dan pihak penyelenggara pemilihan mem-

bantah tuduhan tersebut. Penahanan terbaru dilakukan terhadap Tian Chua, seorang pejabat senior di Partai Keadilan RakyatpimpinanAnwarIbrahim, Haris Ibrahim, aktivis sayap kanan yang memimpin kelompok anti pemerintah, dan Tamrin Ghafar, seorang anggota partai oposisi. Ketiga orang itu mengecam Barisan Nasional dalam pertemuan politik baru-baru ini. Chua menulis diTwitter bahwapolisimenahannyadibandara dan mengatakan padanyadia ditahan karena melakukan penghasutan. Haris dan Tamrin ditahan secara terpisah, namun tidak jelas mereka diperiksa karena kasus apa. Pejabat polisi yang menangani kasus mereka tidak bisa segera dihubungi. Setelahpenahanannya,Chua

menulis di Twitter agar warga Malaysia tidak membiarkan dirinya‘dilumpuhkan oleh rasa takut tapi seharusnya terus berkumpul dan memiliki keyakinan’. Penangkapanmerekadilakukan beberapa jam setelah jaksa penuntut mendakwa Adam Adli (24), seorang pelajar, membuat pernyataanmenghasuttermasuk mengimbau orang-orang untuk “turun ke jalanan guna merebut kekuasaan” ketika berpidato dalam satu forum politik. Dia mengakutidakbersalahdipengadilan distrik Kuala Lumpur Kamis dan dibebaskandenganuangjaminan menjelang sidang 2 Juli lalu. Adam, yang ditahan akhir pecan lalu, menghadapi hukuman tiga tahun penjara dan denda jika dinyatakan bersalah. Ratusan orang berdemon-

strasi secara damai selama beberapa hari terakhir menentang penahanan Adam. Adam dikenal publik di tahun 2011 ketika dia menurunkan bendera bergambar Najib di markas partai berkuasaitudalamsatuaksidemonstrasi. Dia juga diskors dari mengajar selama tiga semester di satu perguruan tinggi negara wilayah Malaysia. Secaraterpisah,Kementraian Dalam Negeri Kamis mengatakan,pihaknyamenyitalebih2.500 tiras suratkabar yang diterbitkan partai oposisi dari toko-toko di seluruh penjuru negeri itu sejak Rabu. Surat ijin yang dikeluarkan bagi partai itu menetapkan suratkabarituhanyauntukkalangan anggota partai bukan dijual ke public, kata kementrian tersebut dalam satu pernyataan.(m23)

MANILA, Filipina (AP/Antara/AFP): Filipina mengungkapkan tekadnya untuk mempertahankan apa yang menjadi hak mereka, sebagai respon atas aksi kapal-kapal perang China yang mengitari pulaukarangdiLautChinaSelatanyangdidudukiolehmarinirFilipina. Filipina pada pekan ini memprotes aksi provokatif dan ilegal yang dilakukan kapal perang China di dekat pulau Second Thomas, namun China mengabaikan protes tersebut dan berkeras bahwa kawasan tersebut adalah bagian dari wilayahnya. Jurubicara Kementerian Luar Negeri Filipina Raul Hernandez mengatakan Kamis (23/5), kapal perang China bersama dua kapal patrolidansatuarmadakapalnelayanmasihberadadidekatdangkalan tersebut.“Merekaseharusnyatidakberadadisana.Merekatidakberhak untuk berada di sana.. tak ada seorangpun meragukan kesungguhan rakyatFilipinauntukmempertahankanhakkamidiwilayahtersebut,” kata Hernandez. “Angkatan Laut dan penjaga pantai kami diberi mandat untuk menegakkan hukum di Filipina,” katanya. China mengklaim hampir seluruh wilayah Laut China Selatan, bahkan perairan yang berada jauh dari daratan negara itu serta kawasan dekat pantai milik negaranegara AsiaTenggara. Filipina,Vietnam, Malaysia, Brunei danTaiwan jugamengklaimkepemilikanatassebagiankawasanlautanyangselama beberapadekadeberpotensimenjadipemicukonflikmiliterdikawasan tersebut. Pulau Second Thomas adalah sekelompok pulau kecil dan karang di Kepulauan Spratly, sekitar 200 km baratlaut pulau Palawan, Filipina. Semua negara yang mengklaim kawasan itu, kecuali Brunei, menempatkan tentara masing-masiing di berbagai pulau dan atol di Kepulauan Spratly untuk menegaskan klaim mereka. Second Thomas Shoal dijaga oleh marinir Filipina diatas kapal bekas Perang Dunia II yang sengaja didamparkan di sana pada akhir 1990-an untuk dijadikan markas. Pulau tersebut berlokasi sekitar 41 kilometer sebelah timur pulau karang Mischief yang direbut China pada 1995. Kawasan Second Thomas dan pulau karang Mischief berada dalam wilayah ekonomi eksklusif Filipina dan perairan di dekatnya sangat kaya dengan ikan. Tahun lalu, China juga menduduki pulau Scarborough, kawasan yang juga kaya sumber daya perikanan yang posisinya lebih dekat dengan Filipina dibanding China, setelah sebelumnya juga terjadi ketegangan serupa namun akhirnya Filipina memilih mundur. Sementara itu, pemerintah Taiwan menilai pernyataan penyesalan Filipina terkait insiden penembakan kapal nelayan Kamis lalu, belum menunjukan itikad baik sepenuhnya untuk memulihkan hubungan antara kedua negara. “Tanggapan pemerintah Filipina sampai sekarang tidak cukup positif, memuaskan, dan konkret. Pernyataan penyesalan yang tidak berdasar adalah kalimat yang diucapkan juru bicara Kepresidenan Filipina, Edwin Lacierda, yang menyebutkan penyesalan, namun menanggapi kejadian itu sebagai inisden‘yang tidak diinginkan’,” kata pemerintahTaiwanpadaketeranganpersKamarDagangdanEkonomi Taipei (TETO) untuk Indonesia yang diterima Kamis.(m10)

Pria Jepang, 80, Pecahkan Rekor Mencapai Puncak Everest KATHMANDU, Nepal (Antara/Reuters): Seorang pria Jepang berumur 80 tahun dan dikenal sebagai pendaki gunung serta pernah empat kali menjalani operasi bedah jantung, berhasil mencapai puncak tertinggi Everest, Kamis (23/5) dan menjadi lansia pertama yang menaklukkan puncak gunung tertinggi di dunia itu. YuichiMiurayangmengambiljalurpendakianstandarditenggara yang dirintis oleh pelopor pendakian Puncak Everest, Sir Edmund Hillary dan Tenzing Norgay 60 tahun yang lalu, mencapai puncak gunung pada ketinggian 8.848 meter di atas permukaan laut pada pukul 09.00 waktu setempat. Dalam pendakian ini Miura ditemani oleh tiga warga Jepang lainnya termasuk putranya serta enam orang sherpa berkebangsaan Nepal. “Rasanya hebat,” kata Miura kepada anggota keluarga dan pendukungnya yang berkumpul di Tokyo, melalui telepon satelit dari puncak tersebut. Miura yang pertamakali mendaki Everest pada tahun 2003 dan mengulanginya lagi lima tahun kemudian, mengambil rekor lansia pendaki Everest dari orang Nepal bernama Min Bahadur Sherchan yang mencapai puncak itu pada usia 76 pada tahun 2008 silam. “Rekornya tidak penting buat saya,” kata Miura kepada Reuters bulan April lalu sebelum berangkat menuju Everest. “Yang terpenting adalah bisa mencapai puncak.” Miura menginap di ketinggian 8.500 meter padadi dataran tempat yang dijuluki“Zona Kematian” sebelum melakukan langkah pendakian terakhir, bukan pada pemberhentian di ketinggian 8.000 meter yang biasa digunakan oleh kebanyakan pendaki untuk beristirahat sebelum menuju puncak, kata petugas di Kementerian Pariwisata Nepal, Gyanendra Shrestha. Pendakiannya mendapat pehatian besar di Jepang, dengan menyiarkan laporan petualangannya melalui telefon satelit setiap hari berikut foto-foto pendakian, termasuk suatu malam ketika Miura dan rekan-rekan sependakian menjadi mabuk oleh teh hijau Jepang danmakansushigulungditendamerekapadaketinggianditepigunung.

Memenuhi Undangan Hari Keputraan Ke-70 Raja Perlis SEJUMLAH wartawan Medanmendapatundanganberkunjung ke salah satu negara bagian Malaysia, yang undangannya langsung datang dari Raja Muda (Pangeran Mahkota) Negeri Perlis Syed Faizuddin Putra Jalalullail. Biasanya undangan berkunjungkeMalaysiaselalunyadatang dari Tourism Malaysia atau pejabat pariwisata agar para wartawan tersebut ikut berpartisipasi meningkatkan dunia pariwisata negara tetangga itu. TetapikaliiniRajaMudaSyed Faizuddin mengambil momen ulangtahun hari keputraan ayahannyayangke-70RajaSyedSirajuddin Ibni Almarhum Tuanku Syed Putra Jamalullail pada Jumat 17 Mei 2013 yang diselenggarakan di Istana Arau di Kangar, ibukota Perlis. Terasa suasananya lain, karena biasanya wartawan yang mendapatundanganberkunjung keMalaysiaselaludibawaketem-

pat-tempat tertentu yang memungkinkan dapat meningkatkan angka wisata ke Malaysia. Rombongan 10 wartawan ditambah Direktur Tourism Malaysia di Medan Nor Asikin Haron berangkatmenujuPenangdengan menggunakan pesawat Firefly yang terbang dari Medan sekitar pukul 11:00WIB.Tiba di Penang, perut sudah terasa lapar sekitar pukul 01:00 waktu setempat. Makan nasi Kandar adalah salah satu yang harus dinikmati pada saat keluar dari bandara Penang. Setibanya di Perlis, rombongan meneruskan perjalanan ke perbatasan Perlis-Thailand di dekat Hadyai. Di perbatasan PadangBesarrombonganbergabung dengan lima wartawan Thailand yang akan mengikuti Seminar Kewartawanan IMT-GT yang diselenggarakan di kampus Universiti Teknologi MARA di Arau Jumat (17/5). Setelah itu, perjalanan dilan-

jutkankekantorKelabMediaPerlis (KEMPs)yangdisambutketuanya Adenan. Di kantor KEMPs itu rombongan tidak berlama-lama, kemudianperjalanandilanjutkan ke kampus Universiti Teknologi MARAdiArau.Disinirombongan tidak lama karena telah terlalu lelah,makalangsungkemestamu yang disediakan, bukan di hotel. Hari pertama masih belum ada acara resmi yang harus dipenuhi, kecuali Kamis (16/5) malam untuk menghadiri acara makan malam bersama Ketua KEMPs Adenan dan Timbalan Ketua KEMPs Shahidi Shahidan dan Effendey Harun, sekretaris KEMPs dan juga seorang wartawan foto yang aktif membantu memenuhi kebutuhan rombongan. Malam itu rombongan mendapat petunjuk protokoler istana saat menghadiri upacara Hari KeputraanRajaPerlisdariShahidi, yang sekaligus pemberian undangan resmi. Dia memberikan

petunjuk agar tidak melakukan tindakan yang melanggar aturan istana, terutama pakaian rapi, pakai jas hitam, kemeja putih, dasi hitam dan songkok (topi). “Jangan ada yang lupa, terutama pakaian dan undangan, karena akan ada pemeriksaan,” kata Shahidi. Hadiri upacara kebesaran Pukul 08:00 rombongan tiba di Istana Arau untuk menghadiri upacarakebesarandenganparade pasukankerajaan.Sebagiantamu ada yang menyaksikan upacara tersebut, tetapi sebagian lainnya menikmati sarapan yang disediakan kerajaan dan tidak ada paksaan agar semua tamu harus menyaksikan parade pasukan kehormatan. Padapukul09:30semuatamu dimintamasukkeBalairungIstana di mana akan berlangsung pemberianbintang-bintangkehormatan kerajaan yang diberikan lang-

sung Raja Syed Sirajuddin.Di balairunginimemangharustertib, janganadayangjalanhilirmudik, terutama pada saat upacara. Satu persatu upacara dilakukan dan sebelum waktu sholat Jumatsemuanyasudahselesaidan dilanjutkan pada acara jamuan makan malam kerajaan di Istana Arau. Acara itu juga diharuskan mengenakanpakaianresmi,sebagaimana pada saat menghadiri upacara pagi hari, ketika mengikutipemberianpingatuntukpara pekerja setia kerajaan. Acara makan malam itu dalambentukbanquet,denganmenu ala Barat. Di meja terlihat telah tersaji minuman ‘warna alkohol’ membuat rombongan tamu dari Medan kaget, apakah kerajaan menyediakan arak. Setelah bertanya kepada pelayan, ternyata minuman itu adalah jus anggur dari kebun anggur kerajaan. (mujo)

Waspada/Muhammad Joni

RAJA MUDA Syed Faizuddin Putra Jalalullail (mengenakan pakaian tradisional kerajaan Melayu) berfoto bersama para wartawan Medan dan Thai sesaat selesai upacara penyerahan penghargaan pada ‘kaki tangan kerajaan’ di Balairung Kerajaan di Istana Arau Jumat (17/5).


Sport

WASPADA Jumat 24 Mei 2013

A9

PSBL Bonyok JAKARTA (Waspada): PSBL Langsa gagal memenuhi target membawa pulang poin dari kandang Persipasi Bekasi, setelah dicukur empat gol tanpa balas pada laga lanjutan Divisi Utama Liga Prima Indonesia Sportindo (LPIS) 2013 di Stadion Tambun, Bekasi, Kamis (23/5).

PengurusKONIAsahanEfiIrwansyah Pane, Anda Rambe, Dodi Riswanda, dan Harris ST. (a31)

Empat gol kemenangan tuan rumah dicetak melalui hatrik striker Eka Santika menit 36, 39, dan 45. Satu gol penutup tuan rumah dibukukan lewat tendangan keras legiun asingnya, Walesi da Silva, pada pertengahan babak kedua. Pelatih PSBL, Anwar, ditemui Waspada seusai laga tampak tidak bisa menyembunyikan kekecewaan. Maklum saja, ini adalah kekalahan telak pertama yang dialami anak asuhnya, sepanjang mengarungi kompetisi di Grup I musim ini. “Waduh! bonyok kita Bang. Ini kekalahan terbesar kami sepanjang laga musim ini,” keluh Anwar sembari merapikan duduknya di pinggir lapangan. Mengenai faktor kekalahan anak asuhnya, Anwar mengata-

TTS TOPIK

MIMB AR JUMA T MIMBAR JUMAT

TIM U-12 SSB Bakrie bersama Bupati Asahan Drs H Taufan Gama Simatupang MAP, Kadis Porabudpar Asahan H Erwis Edi Pauja Lubis SH MAP, dan Pengurus KONI Asahan di Halaman Kantor Bupati, Kamis (23/5).

Bupati Lepas SSB Bakri Asahan 16 Besar Nasional DCN 2013 KISARAN(Waspada): Bupati Asahan, Drs H Taufan Gama Simatupang MAP, Kamis (23/5), resmi melepas tim U12 SSB Bakrie Asahan yang akan bertanding di babak 16 Besar Nasional Danone Nations Cup (DNC) Stadion Bojonegoro, Kuningan, Jakarta, 1-2 Juni 2013. Dalam acara penglepasan yang berlangsung di Aula Kenanga Kantor Bupati Asahan itu, rombongan tim SSB Bakrie dan pelatih Sabirin didampingi Kadis Porabudpar Asahan yang juga Manajer Bintang Jaya Asahan, H Erwis Edi Pauja Lubis SH MAP. Bupati berpesan kepada para pemain SSB Bakrie untuk berjuang maksimal dan senantiasa menjunjung sportivitas dalam pertandingan nanti. Menurutnya, satu kebanggaan

bisa mewakili Provinsi Sumut di tingkat nasional dan itu hendaknya dibalas dengan prestasi. “Bila adik-adik nantinya pulang sebagai pemenang, Bapak siap memberikan hadiah buat adik-adik sekalian. Maka, berjuanglah untuk jadi pemenang, saya yakin kalian mampu untuk itu,” ujar Taufan. Erwis mengatakan pihaknya telah memberi bantuan kostum dan perangkat lainnya untuk SSB Bakrie berlaga di Jakarta. Erwis juga menambahkan KONI Asahan melalui Ketua Umum Nurkarim Nehe SE MSP telah pula memberi uang saku bagi para pemain. “Anak-anak akan bertolak ke Jakarta melalui Bandara Polonia Medan pada Rabu (29/5) nanti,” ujar Erwis dalam acara penglepasan yang turut dihadiri

merah di laga sebelumnya saat menghadapi tuan rumah Persika Karawang, serta Suhendi yang harus duduk manis akibat akumulasi kartu kuning. “Tanpa dua pilar tersebut memang cukup berpengaruh

dalam menjaga performa tim. Tapi sesungguhnya, kondisi lapangan sangat berat buat anakanak. Semoga saja, kekalahan besar seperti ini tidak terulang,” pungkas Anwar. Pelatih Persipasi Bekasi,

Warta Kusuma, menolak anggapan kemenangan timnya diperoleh lantara buruknya kondisi lapangan. Sebab anak asuhnya pun tampil di lapangan yang sama, sehingga tidak bisa dijadikan alasan. (yuslan)

kan lebih karena faktor lapangan. Kondisi rumput yang basah dengan tanah liat yang lengket sangat menyulitkan timnya mengembagkan permainan. Terlebih, karena tidak satu pun pemain PSBL Langsa yang memiliki sepatu khusus untuk lapangan yang berlumpur. “Itu kendala terbesar kami. Lapangan sangat tidak layak untuk menggelar pertandingan Divisi Utama. Makanya, anak-anak hanya bisa bertahan hingga 30 menit awal. Setelah itu, mereka sering ketinggalan lari, karena sepatunya sudah penuh tanah,” imbuh Anwar. Mantan Pelatih Persiraja Banda Aceh dan PSAP Sigli ini pun menyoroti absennya dua pilarnya di laga tersebut, yakni Rijaldi yang mendapat kartu

Seleksi Tenis Meja Porwanas

MENDATAR

MENURUN

Anggota PWI Diminta Segera Daftarkan Diri MEDAN (Waspada): Menghadapi Pekan Olahraga AntarWartawan Nasional (Porwanas) di Banjarmasin, September 2013, Siwo PWI Sumut kembali menggelar event olahraga mempertandingkan cabang tenis meja. Tujuan event ini, tidak lain menjaring wartawan anggota PWI Sumut untuk dipersiapkan menghadapi Porwanas nantinya. Jadi, anggota PWI Sumut diminta segera mendaftarkan diri secepatnya mengingat waktu akhir tinggal Jumat (24/5) ini. Bagi peserta dapat mendaftar langsung ke PWI Sumut dengan

Rahma. Ketua Panitia Ali Murthado didampingi Sekretaris Ayub Kesuma, Kamis (23/5), mengatakan, dua jenis kegiatan tersebut akan digelar pada Sabtu-Minggu (25-26/5). Untuk wartawan dilangsungkan Sabtu (25/5) mulai pukul 09.00WIB dengan kategori kelompok usia 40 tahun ke atas dan 39 tahun ke bawah. “Masing-masing kelompok usia ini akan memperebutkan juara tunggal dan ganda. Khusus ganda, tidak harus dari satu media,” kata Ali. Selain kegiatan seleksi wartawan PWI, juga akan memper-

tandingkan kejuaraan antarkadet usia 12 tahun ke bawah sebagai bentuk memasyarakatkan tenis meja di kalangan pelajar SD, sehingga diharapkan mereka berbondong-bondong ikut mendaftarkan diri. Bagi yang ingin mendaftar bisa langsung ke kantor PWI Jl Parada Harahap Medan atau mengirim sms ke 081275587997 bagi yang berada di luar Kota Medan berisikan nama/umur/ kota tempat tinggal (daerah) dan kontribusi dibayar pada saat sebelum pembukaan. Dikatakan, khusus kadet hanya mempertandingkannomortunggal.(m18)

Perkemi Musperprov Hari Ini MEDAN (Waspada): Pengurus Provinsi Persaudaraan Beladiri Kempo Indonesia (Perkemi) Sumatera Utara akan menggelar Musyawarah Persaudaraan Provinsi (Musperprov) di Hotel Madani Medan, 24-25 Mei 2013. Ketua Pengprov Perkemi Sumut, Ir H Uchwatul Achyar, melalui Ketua Panitia Musperprov, Azwir Agus SH MHum, Kamis (23/ 5), mengatakan Musperprov dilaksanakan sebagai bentuk pertanggung jawaban pengurus dan pembentukan pengurus baru. Dijelaskan, tujuan dilaksanakannya Musperprov juga untuk mempererat tali persaudaraan sesama kenshi di Sumatera Utara dalam menentukan masa depan Perkemi Sumut yang lebih cerah. Secara khusus, Musperprov ini dilaksanakan untuk meminta pertanggung jawaban Pengprov periode 2009-2013, baik laporan kerja maupun laporan keuangan. “Musperprov nantinya sekaligus memilih ketua umum dan formatur untuk menyusun struktur kepengurusan periode 20132017. Merumuskan program kerja kepengurusan Perkemi Sumut periode 2013-2017, serta membahas dan memutuskan hal-hal lain yang sesuai kebutuhan dan perkembangan Perkemi Sumut,” ujar Azwir. Disebutkan, peserta Musperprov sesuai pasal 135 ART, yaitu utusan Pengkab/Pengkot maksimal tiga orang, anggota DK, DP, BPK provinsi maksimal tiga orang, pimpinan MSH provinsi satu orang, Pengprov dan komisinya 27 orang. “Pengprov Perkemi Sumut dibentuk dan dipilih dalam mekanisme Musperprov yang dilaksanakan setiap empat tahun sekali sesuai tertib organisasi dan administrasi Perkemi. Kita berharap hasil Musperprov ini dapat melahirkan kepengurusan yang baik dan mampu membawa Perkemi Sumut lebih baik ke depan,” pungkas Azwir. (m42)

PS Sergai Jinakkan Merah Putih TELUKMENGKUDU (Waspada): PS Sergai berhasil menjinakkan PS Merah Putih Perbaungan 4-1 dalam laga ujicoba di Lapangan Pondok Baru PT Socfindo, Desa Mata Pao, Kec Teluk Mengkudu, Rabu (22/5) sore. Empat gol tim berjuluk Baung Bertandik itu, masing-masing diciptakan Rizal dan Reza di babak pertama dan dua gol oleh Baginda di babak kedua. Pertandingan yang dipimpin wasit Trisno Ariwibowo itu berlangsung seru dengan disaksikan ratusan penonton. Manajer PS Sergai, Drs Joni W Manik MM di dampingi Sektim Eka Dharma Subakti, mengatakan para pemain PS Sergai yang diarsiteki pelatih Suganda Lubis dan kawan-kawan telah menunjukkan kemajuan dalam laga tersebut. “Mudah-mudahan penampilan PS Sergai terus meningkat, sehingga saat melakoni kompetisi senantiasa mampu tampil maksimal dan disegani tim-tim lawan,” sebut Joni. (c03)

Problem Catur Putih melangkah, mematikan lawannya tiga langkah.

Jawaban di halaman A2. 8

7

6

5

4

3

2

1 A

B

C

D

E

F

G

H

Sudoku 1. 3. 5. 7.

Nama nabi pertama. Nabi ke-2. Nabi ke-3. Al———, surat Al Quran yang menyebut nabi Nuh berdakwah selama 1000 tahun kurang 50 tahun. 10. Dipotong sedikit pada saat berhaji. 11. Keyakinan yang sungguhsungguh (Arab populer). 14. Deret (diluruskan dalam shalat berjamaah). 16. Huruf ke-10 abjad Arab. 17. Ruang kecil tempat imam memimpin shalat berjamaah. 19. Al———, surat wajib dibaca dalam setiap rakaat shalat. 20. Juru dakwah; Orang yang mengumandangkan takbir dan tahmid dalam shalat berjamaah. 22. Sangat marah. 23. Tidak bermoral; Cabul. 24. Tawaf sebelum meninggalkan kota Makkah. 26. Huruf ke-2 abjad Arab. 27. Tempat wuquf jamaah haji. 29. Ampun (Arab): Mudah-mudahan Allah memberikan rahmat dan ——Nya kepada kita. 30. Neraka paling dalam dan panas. 31. Nama anak nabi Adam, korban pembunuhan pertama di dunia.

1. Surat terakhir Al Quran (tulis dengan “al” dan satu “n”). 2. Surat Al Quran yang menyebut nabi Khidir mengajari ilmu kesabaran kepada Musa a.s. 3. Tiga kali disebut Rasulullah sebelum ayah. 4. Iri hati; Dengki (tidak sama artinya dengan syirik). 5. Orang yang menjadi pilihan Allah untuk menerima wahyuNya. 6. Nama salah satu neraka. 8. Abu———, sahabat Rasulullah. 9. Orang yang menuntut kebenaran atau ilmu dengan sungguhsungguh (Arab); Ali bin Abi—— (tanpa huruf h). 12. Al———, surat ke-8 Al Quran, artinya rampasan perang. 13. Permohonan ampun kepadaAllah. 15. Pemimpin rombongan haji. 16. Bulan ke-3 tahun Hijriah; Bulan Maulid. 18. Bapak: ——Hurairah. 20. Kewajiban seseorang saat junub. 21. Jiwa orang yang meninggal; Roh. 25. Binatang luar biasa yang akan keluar dari perut bumi menjelang kiamat. 26. Abadi; Kekal. 28. Siksa Tuhan.

Isi dengan angka 1 sampai 9. Tidak boleh ada pengulangan angka mendatar, menurun, maupun di kotak 3x3 bergaris tebal. Tingkat kesulitan: sangat sulit (*****), bisa diselesaikan dalam waktu kurang dari 20 menit. Jawabannya lihat di halaman A2 kolom 1.

1

2

2 8 6 1 9

3 8 8

4 5 9 9 5 7 4 1

3 2 9

3 3 9

6

4

*****40


Sport Munich Mau 90 Menit

A10

WASPADA Jumat 24 Mei 2013

BERLIN (Waspada): Playmaker Bayern Munich, Bastian Schweinsteiger, optimis timnya mampu mengatasi Borussia Dortmund dalam tempo 90 menit pada final Liga Champions besok malam di Stadion Wembley. “Kami mau menang dalam 90 menit, karena itu kami mesti menjaga konsentrasi. Kami punya rencana dan saya optimistis,” tegas Schweinsteiger dalam The Sun, Kamis (23/5). Bintang yang akrab disapa Schweini ini masih terkenang final tahun lalu, saat harus menelan kekalahan dari Chelsea setelah melewati dua babak tambahan serta adu penalti. Padahal saat itu FC Hollywood sempat unggul 1-0 lebih dulu, sebelum dibalas Didier Drogba menit 88. “Kami memiliki skuad yang lebih baik ketimbang musim lalu. Lagipula di final kali ini se-

bagian besar pemain bisa tampil,” klaim gelandang Jerman berusia 27 tahun itu. Tapi Schweini paham, misi FC Hollywood mengejar kejayaan tak akan mudah. Karena Dortmund sudah pasti akan memberikan perlawanan sengit. “Dortmund tim tangguh, nanti akan menjadi pertandingan yang ketat. Dan kita tahu banyak hal dapat terjadi dalam sebuah laga,” ujarnya lagi. Winger Franck Ribery juga optimistis, Munich mampu menjinakkan Die Borussens pada All-Germany Final di London. Bintang asal Prancis itu bahkan sesumbar, FC Holly-

wood masih lebih kuat dibanding Marco Reus cs. “Jika kami semua siap dan punya kemauan 100 persen, kami pasti akan keluar sebagai pemenang. Kami mengetahui kekuatan Dortmund luar-dalam,” beber Ribery kepada Sky Sports. Bagi Munich, final musim ini juga kesempatan untuk membayar kegagalan musim lalu setelah dipaksa menyerah lewat adu penalti oleh The Blues di markas mereka sendiri, Allianz Arena. “Sangat penting untuk tidak terlalu memberikan tekanan kepada kami. Kami tidak tahu apakah kami masih bisa lolos ke final Liga Champions lagi. Itulah sebabnya, kami bakal berusaha sekuat tenaga untuk mengangkat trofi Liga Champions nanti,” tekad Ribery. Persaingan Bayern dan Dortmund tak hanya tersaji di final Liga Champions. Di pentas

Bundesliga, kedua klub top Jerman ini juga kerap terlibat persaingan sengit dalam perebutan tempat teratas. Musim ini Die Roten berada di depan Dortmund. Pasukan Jupp Heynckes keluar sukses mengunci gelar Bundesliga usai mengoleksi 91 poin dari 34 laga, unggul 25 poin di atas tim asuhan Juergen Klopp. “Penampilan Dortmund sangat luar biasa saat menyingkirkan Real Madrid di semifinal, tapi kami hanya berpikir diri kami sendiri. Kami lebih kuat,” klaim Ribery. Hanya saja bek sentral Dante Bonfirm tak sudi meremehkan Die Borussens. Meskipun Bayern dua kali mengalahkan Dortmund dalam empat pertemuan musim ini di kancah domestik, bek asal Brazil itu tetap melihat Robert Lewandowski cs sebagai acaman laten.

“Mereka tim yang hebat dan penuh perjuangan. Tak masalah bagaimana cara mereka bermain, apakah mengandalkan penguasaan bola atau serangan balik.Yang jelas, mereka sangat cepat dan berbahaya,” ucap Dante. Ditambahnya, tak ada perbedaan siapapun lawan yang dihadapi pada partai puncak kompetisi paling glamour sejagad raya tersebut. “Bagi saya tak ada bedanya siapapun lawan yang dihadapi, karena ini final Liga Champions,” jelas Dante. “Selain pendukung Bayern dan Dortmund, mungkin yang lain lebih suka jika yang tampil salah satunya Barcelona atau Madrid. Tapi bagi para pemain, itu tak ada bedanya,” pungkas pemain berusia 29 tahun tersebut. (m15/vvn/sun/sky/fifa)

Piszczek Tunda Operasi BASTIAN Schweinsteiger (kiri) menghindarkan perpanjangan waktu dan adu penalti saat menghadapi Marco Reus cs di London. -AP-

Loew Berandai-andai LONDON (Waspada): Pelatih Timnas Jerman, Joachim Loew (foto), berandai-andai menanggapi final Liga Champions musim ini, yang menyajikan All-Germany Final antara Bayern Munich dan Borussia Dortmund. Menurut Loew, jika final dua tim Jerman itu berlangsung tahun lalu sebelum Euro 2012, tentu dampaknya positif bagi Der Panzer. Sayangnya, 12 bulan lalu, para pemain Bayern harus tertunduk setelah dikalahkan Chelsea lewat adu penalti pada partai puncak di Allianz Arena. “Momen ini All-Germany Final akan menjadi hal bagus bagi kami, jika terjadi jelang Piala Eropa tahun lalu. Kekecewaan para pemain Bayern sesudah kekalahan pada final di Munich begitu sulit untuk ditangani,” kenang Loew melalui Soccerway, Kamis (23/5). Para pemain Jerman yang dibawa Loew ke Euro 2012 sebagian besar justru bintang Bayern. Menurutnya, hal itu mempengaruhi mental Mario Gomez cs, yang akhirnya disingkirkan Italia di babak semifinal. “Kami kehilangan euforia dan kebanggaan yang dibutuhkan untuk mendapatkan gelar internasional. Sekarang situasi jelas lebih menguntungkan,” papar pelatih berusia 53 tahun itu. Namun Loew mengaku, terlalu dini mengatakan pres-

AP

tasi Dia Bavarians dan Die Borussens musim ini di Eropa akan berpengaruh besar bagi kejayaan Der Panzer di Piala Dunia 2014 Brazil. “”Ini adalah proses yang panjang. Saya pikir kami berada di awal untuk mempertahankan hal ini,” tegas Loew, yang menggantikan peran mantan bosnya Juergen Klinsmann pasca Piala Dunia 2006 Jerman. Menatap final yang turut ditayangkan langsung SCTV, Minggu (26/5) dinihari mulai pkl 01:45 WIB, para pendukung Bayern dan Dortmund diminta hati-hati menyantap makanan yang nantinya tersaji di sekitar Stadion Wembley. Selain harganya selangit, makanan yang ada di sana juga terlalu berlemak. Reporter Bild, Henning Feindt, menggambarkan stadion berkapasitas 90 ribu kursi itu punya berbagai fasilitas mewah. Atmosfernya, tempat duduk, ruang kaki, hingga toilet juga tidak luput dari pujian. Namun ada satu hal yang

Lisbon 2014, Berlin 2015 Tuan Rumah Final LONDON (Antara/AFP): Badan Sepakbola Eropa, Kamis (23/5) mengumumkan, Stadion Olimpiade Berlin akan menjadi tuan rumah final Liga Champions 2015. Untuk 2014, partai puncaknya akan berlangsung di Lisbon Estadio da Luz. Keputusan ini diambil setelah pertemuan selama dua hari di London, menjelang partai final 2012-2013 di Stadion Wembley. Juga diputuskan bahwa final Liga Eropa 2015 akan dilangsungkan di Warsawa. Bayern Munich akan menghadapi rival beratnya di Bundesliga, Borussia Dortmund, lewat final sesama Jerman besok malam di Wembley, Final di Berlin merupakan jatah kedelapan kalinya yang diberikan UEFA kepada Jerman. Teraktual tahun 2012 di Allianz Arena, ketika tuan rumah Munich dipecundangi Chelsea melalui adu penalti. Dibangun oleh pemerintahan Nazi Adolf Hitler pada 1936 untuk olimpiade musim panas, Stadion Berlin berkapasitas 74.064 penonton. Stadion itu pernah menjadi tuan rumah final Piala Dunia yang dimenangkan Italia serta selalu menjadi tempat final Piala Jerman setiap tahunnya sejak 1985.

Messi Cs Tur Timur Tengah MADRID (Antara/AFP): Lionel Messi dan rekan-rekan satu timnya dari Barcelona mengikuti tur Timur Tengah, Agustus mendatang, termasuk menggelar lokakarya olahraga seperti pelatihan sepak bola bagi anak-anak Palestina dan Israel. Rencana itu dibantu pemerintah Israel dan Pemerintah Otonomi Nasional Palestina (PNA) dengan tajuk Tur Damai Barcelona (Barcelona Peace Tour). Lokakarya itu akan berlangsung pada 3-4 Agustus. AP “Ini suatu prakarsa yang akan melibatkan dua iven bagi perdamaian di mana pada saat itu anak-anak dari Israel dan Palestina akan berpartisipasi dan semua pemain Barcelona akan hadir,” demikian pernyataan dalam laman Barca, Kamis (23/5). “Proyek ini memungkinkan dilakukan berkat kolaborasi yang beragam dari pemerintah Israel dan Palestina. Barcelona menjadi suatu poin dialog antara Israel dan Palestina.

menjadi sorotan Feindt, yakni makanan. “Oh sosis, saya benar-benar tidak bisa merekomendasikan mereka,” tulis Feindt dalam laporannya. Feindt menjelaskan, suporter harus mengeluarkan uang £6,60 atau Rp102 ribu untuk satu hot dog. Mengenai citarasa, Feindt malah memberi nilai merah kepada hot dog Wembley. “Hot dog itu disiram bawang dan ketika saya memeriksa bagian dalamnya, itu penuh lemak yang menyembul dan memercik ke hadapan saya. Hati-hati dengan sosis Wembley,” saran Feindt melalui Bild. (m15/okz/sw/bild)

BERLIN (Waspada): Bek Borussia Dortmund, Lukasz Piszczek, tak salah menunda operasi pada pinggangnya sampai tuntasnya laga final Liga Champions melawan Bayern Munich besok malam di London. Padahal menurut laman UEFA, Kamis (23/5), operasi dimaksud merupakan solusi utama untuk menuntaskan masalah cedera yang sering dialaminya sepanjang dua musim terakhir. Pemain asal Polandia itu selama ini terpaksa mentas dengan menggunakan suntikan penahan rasa sakit. Masalah pada pinggang Piszczek sudah dirasakan sejak masih membela Hertha Berlin. Karena cedera tersebut, dia sempat absen hingga setengah kompetisi. Namun demi final di Wembley, bek berusia 27 tahun itu bersedia menahankan sakitnya. Apalagi menurut jadwal medis, setelah menjalani operasi dia mesti akan menjalani masa istirahat hingga lima bulan sebelum bisa dipastikan kembali bermain. Kasus Piszczek beda de-

Bonus Dortmund Di Bawah Bayern

AP

ngan gelandang Dortmund Mario Goetze, yang terpaksa absen melawan Franck Ribery dan kawan-kawan, karena cedera otot paha. Bintang Jerman berusia 20 tahun yang akan gabung FC Hollywood musim depan, mengalami cedera pada semifinal leg kedua melawan Real Madrid, 30 April lalu. Goetze sudah berpacu dengan waktu untuk bugar agar dapat mentas di ibukota Inggris. Tapi akhirnya dia terpaksa menangisi nasibnya. “Final adalah tujuan saya, saya berjuang keras untuk dapat pulih dalam beberapa pekan terakhir. Saya benar-benar menyesal tidak mampu membantu tim pada pertandingan penting ini,” ucap Goetze melalui laman www.bvb.de. “Saya tentu saja akan pergi ke London untuk mendukung teman-teman,” ungkap Goetze, yang sempat bergabung dalam latihan tim Dortmund, Selasa lalu. Sangat menyesakkan, mengingat pelatih Juergen Klopp pun sempat menyuarakan ke-

AP

LUKASZ Piszczek (kiri) menunda operasi pinggang seusai duel melawan Franck Ribery dan kawan-kawan. yakinannya bahwa sang gelandang kreatif segera pulih untuk menghadapi calon klub barunya. Peran Goetze kemungkinan besar akan digantikan sesama

BERLIN (Waspada): Borussia Dortmund sudah mempersiapkan bonus bagi pemainnya jika mampu mengalahkan Bayern Munich pada final Liga Champions besok malam di Stadion Wembley, London. Namun bonus untuk setiap anggota pasukan Juergen Klopp (foto) tidak sebesar yang diperuntukkan bagi para pemain Bayern. Menurut Daily Mail , Kamis (23/5), manajemen Die Borussens menjanjikan bonus £126 ribu (setara Rp1,8 miliar) per pemain. Sedangkan pelatih Klopp akan mendapat £250 ribu (setara Rp3,6 miliar) jika mampu mempecundangi FC Hollywood. Jumlah bonus yang diberikan manajemen Dortmund jauh di bawah anak asuh Jupp Heynckes. Bahkan manajemen Die Roten sudah memberikan £150 ribu (setara Rp2,2 miliar) kepada masing-masing pemainnya usai menggasak Barcelona agregat 7-0 di babak semifinal. Chairman Karl-Heinz Rummenigge, mengatakan manajemen Bayern siap memberi bonus lebih banyak kepada pemainnya jika mampu mengalahkan Si Kuning Hitam. “Ini akan menjadi rekor jumlah bonus yang pernah kami

pemain Jerman, Kevin Grosskreutz, yang akan pindah ke posisi sayap kiri dengan Marco Reus digeser ke tengah. Klopp juga memiliki opsi untuk menggeser Ilkay Gundogan

ke belakang penyerang Robert Lewandoski, atau memainkan Nuri Sahin sebagai gelandang bertahan. (m15/ant/rtr/uefa)

keluarkan. Tapi jika kami memberikannya, maka Munich akan memenangi ketiga trofi, dan saya akan sangat senang untuk membayarnya,” beber Rummenigge. Namun perbandingan bonus kedua finalis, pasti menambah tinggi tensi final di London. Sebelumnya Klopp malah menyindir Bayern dengan menyebutnya sebagai “musuh James Bond” karena dengan kekayaannya berusaha menggaet para pemain top dari para rivalnya di Bundesliga. Teraktual, bintang Dortmund Mario Gotze yang akan hengkang ke Allianz Arena musim depan. Kemungkinan beberapa rekannya seperti striker Robert Lewandowski dan bek Mats Hummels, ikut menyusul mandah dari Signal Iduna Park. “Kami bukan supermarket, namun mereka (Munich) menginginkan para pemain kami, karena tahu kami tidak sanggup membayar dengan harga mahal. Jika itu rencana Bayern, mereka seperti musuh James Bond,” sindir Klopp. “Klopp berpikir, dia mesti menyampaikan sebuah gambaran ke penjuru dunia, lalu dia harus melakukannya. Tapi kami tidak merasa perlu menanggapinya,” jwan Mattias Sammer, Direktur Olahraga Bayern. (m15/vvn/dm/tz)


Sport

WASPADA Jumat 24 Mei 2013 KUALA LUMPUR (Waspada): Perubahan strategi yang dilakukan tim Indonesia nyaris membuahkan hasil positif ketika melawan China di laga perempatfinal Piala Sudirman 2013 di Putra Stadium Bukit Jalil, Kuala Lumpur, Kamis (23/5). Kendati sudah berjuang maksimal, Indonesia tetap kalah 2-3. Liliyana Natsir tampil di laga pertama berpasangan dengan Tontowi Ahmad, ganda campuran membangkitkan motivasi Indonesia lewat kemenangan 21-18, 14-21, 21-16 atas Xu Chen/ Ma Jin. Sayang, game kedua yang dilakoni Liliyana atau akrab disapa Butet gagal ditandai sukses di awal. Bersama Nitya Krishinda Maheswari mewakili ganda putri di partai kelima atau penentu, Liliyana tidak mampu menghadiahi kemenangan bagi tim Indonesia. Setelah berjuang alot selama 37 menit, Liliyana/Nitya tumbang 12-21, 19-21. Atas kegagalan ini, Indonesia harus rela tersingkir di babak delapan besar. Selain ganda putri, kekalahan juga dialami kedua tunggal. Melawan Chen Long, Tommy Sugiarto kalah 21-11, 21-15. Di tunggal putri, Lindaweni Fanetri juga kesulitan mengimbangi permainan Li Xuerui hingga akhirnya takluk 16-21, 13-21. Asa Indonesia sempat dihadirkan ganda putra. Bermodalkan permainan stabil, Rian Agung Saputro/Angga Pratama mengalahkan CaiYun/Fu Haifeng 19-21, 21-18, 21-15 dalam tempo 62 menit. Di laga lain, ganda putra Ko Sung-hyun dan Lee Yong-dae memastikan Korea Selatan melaju ke semifinal setelah meraih kemenangan atas Ingo Kindervater/Johannes Schoettler 2113, 21-10. Alhasil, Korsel menumbangkan Jerman 3-0. Setelah China dan Korsel, dua tiket semifinal lain direbutkan Denmark yang menaklukkan China Taipei 3-0 dan Thailand yang sukses mengatasi Jepang 3-1. Ironis bagi Indonesia karena ini merupakan pertama kali skuad Merah Putih gagal menembus semifinal Piala Sudirman. Dari 12 kali digelar, Indonesia juara satu kali di edisi pertama dan enam kali menjadi runner-up. Sisanya, lima kali anak-anak Garuda selalu kandas di semifinal. (m33/ant)

A11

Indonesia Kalah Terhormat

Antara

TONTOWI Ahmad (kanan) dan Liliyana Natsir menjatuhkan diri ke lapangan ketika menyudahi laga melawan Xu Chen/Ma Jin pada perempatfinal Piala Sudirman di Stadion Putra, Bukit Jalil, Kuala Lumpur, Kamis (23/5). Tontowi-Liliyana menang, namun secara keseluruhan tim Indonesia kalah 2-3 atas China.

City Antusias Sambut Pellegrini LONDON (Waspada): Para pemain Manchester City sangat antusias menyambut kedatangan calon manajer anyar Manuel Pellegrini (foto), yang sudah memutus kontrak kerjanya dengan Malaga.

AP

JUAN MATA dan para pemain Chelsea memberikan tanda tangan kepada pendukung mereka Busch Stadium, St. Louis, Amerika Serikat, Kamis (23/5) pagi WIB.

Mou 4 Tahun Lagi Tukangi Biru LONDON (Waspada): Pelatih Jose Mourinho (foto) sudah sepakat menukangi lagi Chelsea dengan kontrak kerja empat tahun. Menurut Daily Star, Kamis (23/5), Mourinho akan terbang ke London pada 2 Juni 2013, setelah tim asuhannya Real Madrid melakoni jornada pamungkas La Liga Primera melawan Osasuna. Sesampainya di London, pelatih asal Portugal itu langsung akan menandatangani kontrak untuk masa kerja kedua kalinya di Stamford Bridge. Dia akan menerima gaji £250 ribu (setara Rp3,5 miliar) per pekan, namun Daily Star meyakini, manajer berumur 50 tahun itu bisa mengantongi hingga £50 juta (setara Rp736 miliar) selama empat tahun. Gaji sebesar Rp3,5 miliar per pekan itu tiga kali lipat dari yang didapatkan Mou ketika kali pertama melatih London Blues pada 2004 hingga 2007. Mantan pelatih Inter Milan dan FC Porto itu akan ditemani dua asistennya di Madrid saat ini, pelatih fisik Rui Faria dan pelatih kiper Silvino Louro. Dia terpaksa mesti mencari satu asisten lagi, sebab Aitor Karanka memutuskan tak ikut gabung ke London. Karanka, tangan kanan Mourinho di Santiago Bernabeu sejak 2010, memilih untuk melatih klub lain di luar Spanyol. Mou seperti dilansir Mirror, sudah menetapkan pemain incarannya, enam merupakan kewajiban bagi manajemen London Blues. Karenanya pemilik Chelsea, Roman Abramovich, siap

menggelontorkan uang £100 juta atau Rp1,47 triliun untuk membeli pemain baru. Winger Juan Mata dalam posisi aman. Sedangkan Fernando Torres yang bergaji besar, kemungkinan dikorbankan agar Si Biru tidak melanggar peraturan Financial Fair Play. Tiga bek, dua gelandang, dan satu striker siap bergabung musim panas mendatang. Striker Atletico Madrid, Radamel Falcao, menjadi buruan utama Mourinho, tapi Blues AP harus bersaing ketat dengan AS Monaco dan Manchester City. Striker Zenit St Petersburg, Hulk, menjadi incaran cadangan. Pemain lain yang menjadi buruan Mourinho adalah bomber Bayer Leverkusen, Andre Schurrle. Gelandang Malaga, Isco, bidikan selanjutnya. Mou juga menginginkan bek muda Porto Eliquim Mangala dan gelandang Everton Marouane Fellaini. Selain nama-nama tersebut, Mou ingin memanggil kembali kiper asal Belgia Thibaut Courtois, yang telah dua musim dipinjamkan ke Atletico. (m15/okz/ds/mirror)

Irina Pamer Kemolekan Badan PARIS ( Waspada): Irina Shayk (foto), kekasih superstar Real Madrid, Cristiano Ronaldo, tampil menggoda pada pemutaran perdana film berjudul All Is Lost baru-baru ini di Festival Film Cannes, Prancis. Irina mengenakan gaun hitam dengan bagian dada yang terbuka, seperti pamer aset berharganya di hadapan fotografer. Menurut Daily Mail, Kamis (23/5), Irina datang tanpa didampingi Ronaldo. Saat berjalan di karpet merah, cewek cantik asal Rusia berusia 27 tahun itu sama sekali tidak canggung memamerkan kemolekan badannya. Gaun hitam yang menempel ketat membuat lekuk tubuh model cantik ini semakin menggoda. Kesan nakal coba ditampilkan Irina lewat renda-renda pada bagian roknya yang di-

Wordpress.com

biarkan menjuntai hingga ke lantai. Namun yang tak kalah menantang adalah bagian dadanya. Irina seperti sengaja membiarkan bagian itu terbuka, sehingga menampilkan bagian payudaranya. Dia bahkan bersedia melakukan berbagai pose dengan ta-

tapan menantang. Irina merupakan wanita kelahiran Yemanzhelinsk, Rusia, 6 Maret 1986. Dia dikenal sebagai model pakaian dalam wanita. Meski kerap tampil menantang dalam berbagai sesi pemotretan, Irina selalu menolak saat ditawari untuk tampil polos.

Irina berhubungan Ronaldo sejak Mei 2010. Keduanya bertemu saat sama-sama menjalani pemotretan produk merek Armani. Meski beberapa kali diusik rumor perselingkuhan, hubungan Irina dan Ronaldo tetap harmonis sampai sekarang. Ronaldo sendiri dikabarkan kena skorsing dua pertandingan di level Copa del Rey, setelah diusir keluar lapangan saat El Real menderita kekalahan pertama dari Atletico Madrid selama 14 tahun terakhir pada final Piala Raja pekan lalu di Santiago Bernabeu. Enternador Madrid Jose Mourinho juga mendapat skorsing dua pertandingan dari Federasi Sepakbola Spanyol, setelah diusir dari area teknik saat timnya kalah 1-2 dalam pertandingan tersebut. (m15/vv/dm/afp)

Fans Rossoneri Dukung Allegri

AP

MILAN, Italia (Antara/ Reuters): Para fans AC Milan yang disebut ‘Ultras’ dan punya pengaruh besar, mendukung sekaligus meminta allenatore Massimiliano Allegri (foto) dipertahankan. Ini merupakan ultimatum atas spekulasi pemilik klub Silvio Berlusconi berencana memecatnya. Kelompok penggemar yang memiliki nama “Curva Sud” itu mengeluarkan pernyataan yang memuji Allegri atas kemampuannya membimbing tim

berisi pemain muda. I Rossoneri berhasil bangkit dari start buruk untuk finis di peringkat ketiga Liga Seri A dan lolos ke playoff Liga Champions musim depan. “Hari ini, kami mendapati diri kami dengan proyek yang baru dimulai dan segera dibongkar oleh pilihan presidensial,” kata pernyataan di situs www. curvasud.it, Kamis (23/5). Tifosi Rossoneri secara khusus mengkritik laporan-laporan yang menyatakan mantan gelandang Milan Clarence See-

dorf, yang belum punya pengalaman kepelatihan dan saat ini bermain untuk Botafogo di Brazil, berpeluang didatangkan sebagai pengganti Allegri. Menurut mereka, seseorang seperti Seedorf atau siapapun yang memiliki nol pengalaman sangat riskan untuk tugas yang sangat berat pada putaran pendahuluan Liga Champions. “Kami berharap ada rasa hormat untuk Milan sebagai institusi dan para penggemar,” tegas Curva Sud.

Setelah winger Samir Nasri, bek Pablo Zabaleta ikut menyanjung pelatih asal Chile tersebut. “Strategi sepakbolanya hebat,” sanjung Zabaleta, seperti dilansir Mirror, Kamis (23/5). “Seseorang yang saya kenal dan percaya mengatakan kepada saya bahwa dia (Pellegrini) seorang pelatih yang luar biasa saat ini,” tambah bek sayap asal Argentina itu. Pellegrini memang disebutsebut sebagai kandidat terkuat untuk menggantikan posisi pelatih Roberto Mancini yang telah dipecat City, menyusul kegagalan mempersembahkan satu trofi pun pada musim ini. Setelah menjuarai Liga Premier 2011-2012 dan Piala FA 2010-2011, The Eastland tahun ini paceklik gelar. Pasukan Mancini hanya menjadi runner-up Liga Premier, kalah di final Piala FA dan tersingkir di fase grup Liga Champions. “Pellegrini juga seseorang yang sangat tenang. Dia suka memainkan sepakbola atraktif,”

ucap Zabaleta. “Rekornya di Eropa juga hebat, hal itulah yang belum kami lakukan dengan baik akhir musim ini,” katanya menambahkan. Beda dengan kiper Joe Hart, yang terkesan belum terbuka untuk mengomentari calon bos anyar mereka. “Siapa pun yang datang, kami akan memberikan segala kemampuan yang kami miliki,” tekad Hart. Dia malah menyesali pemecatan Mancini. “Kami memiliki kesuksesan di bawah Roberto, namun klub mengambil keputusan untuk bergerak maju (memecatnya) dan kami harus bereaksi sebagai pemain,” jelasnya kepada Sports Mole. Hart ingin manajer anyar nantinya mampu mengasah dan mengeluarkan semua kemampuan terbaik mereka. Harapan itu kemungkinan mampu dijawab Pellegrini, yang sebelumnya telah mengangkat levelVillarreal dan Malaga ke tingkat elit di Spanyol dan Eropa.

AP

Tinggali Malaga Pellegrini sendiri sudah mengumumkan akan meninggalkan Malaga akhir musim nanti. “Secara profesional, ini jam-jam terakhir saya di Malaga. Minggu nanti, saya akan melatih pada pertandingan terakhir saya di Rosaleda.,” papar Pellegrini pada upacara penghargaan di kota Costa del Sol. “Semua orang memiliki hak untuk mengikuti jalur mereka masing-masing. Saya tidak pergi karena ambisi keuangan, namun karena proyek olahraga yang akan mengizinkan saya merasa dapat memenuhinya,” tambah mantan pelatih Real Madrid tersebut. Tapi Pellegrini tidak memberi keterangan lebih rinci mengenai masa depannya. Setelah mampu membawa Malaga me-

Fulham Boyong Boateng, Amorebieta LONDON (Antara/Reuters): Gelandang Ghana Derek Boateng (foto) dan bek Venezuela Fernando Amorebieta, sukses diboyong Fulham dengan transfer bebas. Boateng sudah memainkan 46 pertandingan internasional bersama Ghana. Pemain berusia 30 tahun itu gabung Fulham dari klub Dnipro Dnipropetrovsk (Ukraina).

Mantan pemain Getafe, FC Koeln dan Panathinaikos itu meneken kontrak setahun yang dapat diperpanjang lagi di Craven Cottage, London. Sedangkan Amorebieta, yang bermain bagi Timnas Spanyol di level junior tetapi sudah delapan kali membela tim seniorVenezuela, menandatangani kontrak empat tahun. “Saya terkesan dengan para

pemain berbakat yang sudah berada di klub (Fulham) ini. Saya menantikan bertemu dengan mereka pada pelatihan pramusim, Juli mendatang,” ujar Amorebieta dalam laman www.fulhamfc.com, yang dikutip Kamis (23/5). Bek sentral kelahiran 25 Maret 1985 itu datang dari Athletic Bilbao, yang sudah 250 kali diperkuatnya selama delapan

nembus perempatfinal Liga Champions, musim ini Malaga berada di peringkat keenam La Liga dan akan menjamu Deportivo La Coruna, Minggu (26/5) malam. Pertandingan terakhir Isco cs musim ini adalah melawat ke markas Barcelona pada 1 Juni. “Itu akan sangat emosional dan saya berharap dapat meninggalkan klub dengan tempat di kompetisi Eropa. Kesepakatan dengan klub telah digratifikasi dan memuaskan,” beber entrenador berumur 59 tahun tersebut. Dijuluki sebagai ‘Sang Insinyur’, Pellegrini memiliki hubungan yang baik dengan pemain, pendukung dan pemilik Malaga dari Konsorsium Qatar. Setelah investasi awal pada sektor pemain ketika pemilik klub mengambil alih Malaga pada 2010, mereka kemudian menjual sejumlah aset terbaik di antaranya Santi Cazorla dan Nacho Monreal ke Arsenal. Juga striker Salomon Rondo ke Rubin Kazan. Malaga telah mengajukan banding terhadap skorsing satu tahun penampilan Eropa yang dijatuhkan UEFA kepada Pengadilan Arbitrase Olahraga (CAS) dan berharap bisa mendapat keputusannya awal bulan depan. (m15/vvn/mirror/rtr/afp) Reuters

musim terakhir di La Liga Primera.


Sport

A12

WASPADA Jumat 24 Mei 2013

Bintang Terang LeBron MIAMI, AS (Waspada): Menerima bola, balik badan, dan langsung menyerang ring Indiana Pacers hingga mengejutkan Paul George cs menjadi kunci kemenangan Miami Heat di Game 1 NBA Playoff Wilayah Timur, Kamis (23/5). Aksi lay-up LeBron James tersebut sudah cukup membuat Heat mengalahkan Pacers 103-102 lewat overtime.

AP

Hasil Kamis (23/5) Nico Rosberg Lewis Hamilton Fernando Alonso Felipe Massa Mark Webber Kimi Raikkonen Romain Grosjean Jenson Button Sebastian Vettel Paul di Resta Adrian Sutil Sergio Perez Nico Hulkenberg Pastor Maldonado Esteban Gutierrez Daniele Ricciardo Jean Eric Vergne Valeri Bottas Jules Bianchi Charles Pic Max Chilton Giedo van der Garde

Mercedes Mercedes Ferrari Ferrari Red Bull Lotus Lotus McLaren Red Bull Force India Force India McLaren Sauber Williams Sauber Toro Rosso Toro Rosso Williams Marussia Caterham Marussia Caterham

1’14.759 1’15.077 1’15.196 1’15.278 1’15.404 1’15.511 1’15.718 1’15.959 1’16.014 1’16.046 1’16.349 1’16.434 1’16.823 1’16.857 1’16.935 1’17.145 1’17.184 1’17.264 1’17.892 1’18.212 1’18.784 1’19.031

AP

Mercedes Beri Bukti MONACO (Waspada): Tampil tercepat di sesi free practice pertama, Nico Rosberg (foto) lagi-lagi mencatatkan diri sebagai pebalap terbaik di sesi pelatihan bebas kedua GP Monaco, Kamis (23/5). Mercedes juga menampilkan Lewis Hamilton di posisi kedua. Di sirkuit jalanan Monaco, kecepatan Rosberg tak tertandingi peserta lain. Setelah melahap 45 putaran, pebalap asal Jerman itu tampil gemilang dengan catatan waktu terbaik 1 menit 14,759 detik. Hamilton menempel rekan setimnya itu dengan selisih 0,318 detik. Posisi ketiga ditempati pebalap Ferrari, Fernando Alonso, yang sebelumnya berada di tempat kedua. Tandem Alonso di skuad Kuda Jingkrak, Felipe Massa, melesat di urutan empat dengan catatan 1:15,278. Duet Red Bull berbeda nasib setelah Mark Webber merebut peringkat lima dan Sebastian Vettel tergeser di posisi sembilan. Di antaraWebber danVettel ada Kimi Raikkonen dan Romain Grosjean (Lotus) serta Jenson Button (McLaren). Melengkapi komposisi 10 pebalap teratas, ada Paul di Resta (Force India). Di sesi pertama, Rosberg mengungguli Alonso. Di belakang mereka berdua terdapat Grosjean, Massa, dan Hamilton. Bila Button tetap di peringkat delapan, Webber menempati posisi tujuh dan Vettel di peringkat 10. (m33/auto)

LAY-UP LeBron James (6) menjadi penentu kemenangan Miami Heat atas Indiana Pacers pada Game 1 NBA Final Wilayah Timur di AmericanAirlines Arena, Miami, Kamis (23/5).

Di kala waktu tersisa 2,2 detik, LeBron tampil heroik bagi tuan rumah Heat dalam laga yang ditandai 18 skor imbang dan 17 peralihan pimpinan skor. Tambahan dua poin terakhir dari LeBron melengkapi raihan 30 angka 10 rebound, dan 10 assist selama pertandingan yang memakan waktu total 3 jam 18 menit. Sebenarnya Heat sempat di atas angin kala unggul 92-89

di detik-detik terakhir waktu reguler. Namun Paul George mencetak three point bagi Pacers untuk memaksa pertandingan berlanjut ke babak tambahan waktu. Dalam lima menit tambahan, George juga menjadi pahlawan dengan tiga free throw dan Pacers pun unggul 102-101. Namun, pertahanan pasukan Frank Vogel lengah ketika LeBron menguasai bola dan men-

jadi penentu kemenangan sang juara bertahan. “Kedua tim bertarung dengan keras. Namun kami beruntung bisa meraih kemenangan,” kata LeBron. Pelatih Pacers, Frank Vogel, mengakui salah mengambil keputusan ketika menyimpan Roy Hibbert di bangku cadangan pasca-time out Heat. Pasalnya, Hibbert merupakan defender terbaik milik Pacers. Pada Game 2 yang berlangsung Sabtu (25/5) besok,Vogel berjanji akan menebus kesalahannya itu. “Selamat datang di Final Wilayah Timur! Siapa tim yang

Pasang Iklan Telp. 4528431 HP. 081370328259 Email: iklan_waspada@yahoo.co.id

paling ngotot, maka dialah yang akan melaju ke final. Meski kami butuh overtime untuk mengalahkan Pacers, kami senang punya modal satu game,” papar Pelatih Heat, Erik Spoelstra. “Sungguh melegakan akhirnya mengakhiri laga tadi sebagai pemenang. Kini, kami harus lebih siap menghadapi

Game 2,” sebut LeBron sesaat hendak bergegas ke ruang ganti. Dwyane Wade menambah 19 poin bagi Heat yang juga mendapat 17 angka dari Chris Bosh dan 16 poin dari Chris Anderson. Sementara itu, Pacers tetap dimotori George dengan 27 poin diikuti David West 26 angka. (m33/ap)


Sumatera Utara

WASPADA Jumat 24 Mei 2013

Kota

Zhuhur ‘Ashar

Medan B. Aceh Binjai Bireuen B. Pidie G. Sitoli K. Jahe Kisaran Kutacane Langsa

12:24 12:37 12:24 12:31 12:31 12:28 12:24 12:20 12:27 12:26

15:48 16:01 15:49 15:55 15:55 15:52 15:49 15:44 15:51 15:50

Magrib 18:33 18:49 18:34 18:43 18:42 18:34 18:33 18:29 18:36 18:37

‘Isya

Imsak

Shubuh Syuruq

Kota

19:46 20:03 19:47 19:57 19:55 19:47 19:46 19:42 19:49 19:50

04:42 04:52 04:43 04:47 04:47 04:50 04:44 04:39 04:45 04:43

04:52 05:02 04:53 04:57 05:57 05:00 04:54 04:49 04:55 04:53

L.Seumawe L. Pakam Sei Rampah Meulaboh P.Sidimpuan P. Siantar Balige R. Prapat Sabang Pandan

06:12 06:22 06:13 06:17 06:18 06:20 06:13 06:09 06:15 06:13

Zhuhur ‘Ashar 12:30 12:23 12:22 12:34 12:21 12:22 12:22 12:19 12:37 12:23

15:54 15:47 15:46 15:58 15:45 15:46 15:46 15:43 16:01 15:47

Magrib

‘Isya

Imsak Shubuh Syuruq

Kota

18:42 18:32 18:32 18:44 18:28 18:31 18:30 18:26 18:50 18:30

19:55 19:45 19:45 19:57 19:40 19:44 19:43 19:39 20:03 19:43

04:45 04:41 04:40 04:51 04:43 04:42 04:43 04:40 04:51 04:45

Sibolga Sidikalang Sigli Singkil Stabat Takengon T.Balai Tapaktuan Tarutung T.Tinggi

04:55 04:51 04:50 05:01 04:53 04:52 04:53 04:50 05:01 04:55

06:16 06:11 06:10 06:21 06:13 06:11 06:12 06:09 06:22 06:14

Zhuhur ‘Ashar 12:23 12:24 12:34 12:27 12:24 12:31 12:19 12:29 12:22 12:22

15:47 15:49 15:58 15:51 15:48 15:55 15:43 15:54 15:47 15:46

B1

Magrib

‘Isya

Imsak

Shubuh Syuruq

Kota

18:30 18:33 18:47 18:35 18:34 18:42 18:28 18:39 18:30 18:31

19:43 19:46 20:00 19:48 19:47 19:55 19:41 19:52 19:43 19:44

04:45 04:44 04:50 04:48 04:42 04:48 04:39 04:48 04:44 04:41

04:55 04:54 05:00 04:58 04:52 04:58 04:49 04:58 04:54 04:51

Panyabungan Teluk Dalam Salak Limapuluh Parapat Gunung Tua Sibuhuan Lhoksukon D.Sanggul Kotapinang Aek Kanopan

Dihisab oleh: Tim Ahli Badan Hisab dan Rukyat (BHR) Sumut

06:14 06:14 06:20 06:17 06:12 06:18 06:09 06:18 06:13 06:10

Zhuhur 12:20 12:27 12:25 12:20 12:22 12:20 12:19 12:29 12:23 12:18 12:19

‘Ashar Magrib 15:44 15:51 15:49 15:45 15:47 15:44 15:44 15:53 15:47 15:42 15:44

18:25 18:32 18:33 18:30 18:31 18:26 18:25 18:41 18:31 18:25 18:28

‘Isya

Imsak

Shubuh Syuruq

19:38 19:45 19:46 19:43 19:44 19:39 19:38 19:54 19:44 19:38 19:40

04:43 04:50 04:45 04:40 04:42 04:42 04:42 04:45 04:44 04:39 04:40

04:53 05:00 04:55 04:50 04:52 04:52 04:52 04:55 04:54 04:49 04:50

06:12 06:20 06:15 06:09 06:12 06:11 06:11 06:15 06:14 06:09 06:09

Empat Oknum Polri Tersangka Pemeras Menyerahkan Diri LANGKAT (Waspada): Empat tersangka pelaku penculikan, penganiayaan dan pemerasan terhadap Juliadi Singarimbun, 40, warga Besitang, yang mengaku aparat Poldasu, menyerahkan diri ke Polresta Medan. Satu dari empat pelaku yakni Aipda BH, bertugas di Paminal Polresta Medan. Sedangkan Bripka ST, Brigadir Sy T dan Brigadir JT, ketiganya anggota Polsekta Medan baru. Menurut informasi, ke empat oknum penegak hukum ini menyerahkan diri, Rabu (22/5) malam ke Polres Medan, sementara dua rekan mereka warga sipil belum tertangkap. Kapolres Langkat AKBP Leonardus Eric Bhismo melalui Kasat Reskrim, AKP Rosyid Hartanto kepada Waspada, Kamis (23/5) mengatakan, pihaknya

telah mengintrogasi ke empat oknum polisi ini di Polresta Medan. “Para tersangka sedang dikonfrontir dengan korban,” ujarnya. Kasat Reskrim mengatakan, saat diintrogasi, tersangka mengaku khilaf karena dalam menjalankan tugasnya tidak disertai surat perintah tugas. Maksud mereka, hendak mengambil mobil milik salah seorang yang digadaikan kepada Juliadi Singarimbun. Tapi AKP Rosyid belum bersedia memberi komentar lebih jauh terkait keterlibatan ke empat oknum polisi ini dalam ka-

Penipu Jamaah Umroh Diringkus STABAT (Waspada): Polsek Stabat Resort Langkat meringkus seorang pria warga Sumatera Barat terkait penipuan perjalanan ibadah umroh senilai Rp650 juta. Kapolsek Stabat AKP Zulkarnaen mengatakan tersangka SP, 40, warga Sumbar ditangkap di Padang dan kini masih dalam perjalanan menuju Langkat. Dikatakannya, ada 32 warga Langkat yang jadi korban penipuan pelaku. “Pelaku membuka biro jasa perjalanan umroh di Stabat dan mencari warga yang ingin menunaikan ibadah umroh. Setelah uang diterima dari para korban, pelaku kabur ke Padang,” kata AKP Zulkarnaen, Kamis (23/5) sore. Para korban sebelumnya tak menaruh curiga saat menyetor sejumlah uang karena tidak langsung berhubungan dengan pelaku, melainkan melalui perantara yang dikenal baik. Sementara oknum perantara tersebut menerima fee dari SP setiap mendapat calon korban, senilai Rp1 juta dan dijanjikan berangkat umroh jika dapat mencari 10 orang.(a03)

Wamen PU Bahas Soal Jalan Di Tebingtinggi TEBINGTINGGI (Waspada): Saat melakukan kunjungan kerja ke beberapa daerah di Sumut, termasuk di Kota Tebingtinggi, Wakil Menteri (Wamen) Departemen Pekerjaan Umum (PU), Dr Ir Hermanto Dardak, M.Sc membahas masalah perlunya jalan Tol dan pelebaran jalan provinsi, Medan- Tebingtinggi. Dalam kunjungannya ke Kota Tebingtinggi disambut Wali Kota Tebingtinggi Ir H. Umar Zunaidi Hasibuan, MM di rumah Dinas Walikota Jalan Sutomo, Selasa (21/5). Dia menilai, perjalanan ke Medan dari Kota Tebingtinggi bisa memakan waktu antara 3 hingga 4 jam, sehingga perlu ada pelebaran jalan untuk memperkecil waktu jarak tempuh. Pembangunan jalan tol yang sudah masuk tahap lelang, serta proses pembebasan lahan di sepanjang jalan untuk pembangunan tol sudah tak ada masalah. “Akses jalan ke Kualanamu sebenarnya bagian dari jalan tol Medan – Tebingtinggi,” jelasnya. Pemerintah mendukung pembangunan jalan dari Medan ke Kualanamu. Jalan tol Medan - Tebingtinggi sedang proses tender, kita berharap pembangunannya bisa segera dimulai karena pembebasan tanah sudah berjalan,” harap Hermanto. Mengenai bendungan Bajayu yang disebut-sebut sebagai penyebab terjadinya banjir di Kota Tebingtinggi, juga diharap segera dapat diselesaikan, yakni dengan memindah bendungan beberapa kilometer ke arah hilir. “Kita berupaya untuk mengurangi genangan air, untuk itu kita coba melihat kondisi lapangan dengan memindahkannya ke arah hilir 2,5 km, sebab kalau sudah dipindah maka beban air yang menggenangi Kota Tebingtinggi berkurang. “Ini juga dalam proses tender dan ini proyek multiyears. Artinya bukan selesai tahun ini tapi berkelanjutan, dan dalam tahun ini juga terlaksananya proyek tersebut,” terang Hermanto kembali. Pada kesempatan itu Wali Kota Tebingtinggi Ir H. Umar Zunaidi Hasibuan menyampaikan terimakasih atas kunjungan Wamen PU. Diharapkan, dengan kunjungan itu semua masalah pembangunan yang selama ini terkendala di Kota Tebingtinggi, segera teratasi.(a11)

sus penculikan, penganiayaan dan pemerasan yang merusak citra Polri itu. Peristiwanya berawal dari kedatangan JP, 40, warga Stabat, 18 April lalu ke rumah korban untuk meminjam uang Rp15 juta dengan alasan istrinya operasi melahirkan. Sebagai jaminan, JP mengagunkan mobil Toyota Avanza BK 1799 KG. Sepuluh hari kemudian Juliadi Singarimbun para pelaku mengaku dari Polda Sumut, menumpang mobil Toyota Avanza BK 1112W warna gelap. Mereka

menuduh korban mencuri mobil, kemudian membawa paksa korban ke Medan. Di perjalanan, korban mengaku dianiaya, bahkan seorang pelaku memukulkan gagang pistol sejenis revolver. Setiba di Medan, pelaku menggiring korban ke rumah makan di depan Tapian Daya, dan minta uang tebusan untuk pembebasan. Dalam kondisi tertekan, korban menghubungi keluarganya di Diski. Keluarga korban kemudian menyerahkan uang untuk pembebasan Rp7 juta ke-

pada pelaku. Merasa belum puas, pelaku menguras uang Rp2 juta dari dompet korban. Korban dalam laporannya menyatakan, mobil Toyota Avanza BK 1799 KG digadai JP kepadanya Rp15 juta. AKP Sukerman disela kunjungannya ke Mapolsek Pangkalansusu kepada Waspada mengatakan, pihaknya menangani kasus penipuan atas tersangka JP, terkait kasus penganiayan dan pemerasannya ditangani Polres Langkat. (a02/a03)

‘Sulap’ Mangrove Jadi Lahan Pribadi, Akiang Tersangka STABAT (Waspada): Polres Langkat menetapkan WG alias Akiang tersangka kasus alih fungsi ratusan hektar hutan mangrove menjadi perkebunan kelapa sawit, di Desa Selotong Kec. Secanggang. “Hari ini kita tetapkan WG alias Akiang sebagai tersangka, selaku pemilik lahan juga pengusaha. Tidak tertutup kemungkinan tersangka bertambah,” kata Kapolres Langkat melalui Kasat Reskrim AKP Rosyid Hartanto, Kamis (23/5). Dia menambahkan, tersangka dijerat UU no. 5 tahun 1990 tentang konservasi sumberdaya alam dan UU no. 41 tahun 1999 tentang kehutanan, dengan

ancaman lima tahun penjara. Dari sekitar 300 hektar kawasan hutan bakau objek penyelidikan di Desa Selotong, belasan hektar di antaranya ditanami sawit oleh tersangka dan kini usia panen. Jumlah lahan masih berdasarkan penyidikan yang belum rampung dan garapan tersangka berpeluang masih banyak di Kec. Secanggang. Sejalan dengan itu tersangka memiliki surat sebagai alat hak yang dikeluarkan perangkat desa. Untuk mengungkap keterlibatan pihak-pihak yang‘bermain’, penyidik tim khusus penanganan alih fungsi mangrove terus mengembangkan kasusnya dengan meminta keterangan

sejumlah pihak, sebab menurut penyidik tidak dibenarkan areal pelestarian mangrove ‘disulap’ menjadi lahan pribadi. Pantauan Waspada, di Semenanjung Langkat Karang Gading Kec. Secanggang bermuara ke Desa Pantai Jaringhalus, hutan mangrove binasa berganti kelapa sawit. Polres Langkat juga menyelidiki kasus alih fungsi mangrove di Desa Air Hitam Kec. Gebang seluas 25 hektar. Sebelumnya, polisi menahan Direktur PT. MAR, Bas alias Acin di Desa Pulau Sembilan Kec. P. Susu dalam kasus serupa, yakni ‘menyulap’ 400 ha hutan mangrove menjadi perkebunan kelapa sawit.(a03)

Sergai Juara II Promosi Infrastruktur AITIS 2013 SERGAI (Waspada): Kabupaten Serdang Bedagai (Sergai) juara II kategori promosi infrastruktur di ajang Asosiasi Pemerintah Kabupaten Seluruh Indonesia (APKASI) Internasional Trade and Investment Summit (AITIS) 2013, dipusatkan di

Jakarta International Expo (JIExpo) Kemayoran Jakarta berlangsung 15 - 17 Mei 2013. Hal ini dikemukakan Bupati Sergai Ir. HT. Erry Nuradi, MSi yang juga Wakil Ketua APKASI melalui Kabag Humas Dra. Indah Dwi Kumala di ruang ker-

Waspada/Edi Gultom

ASISTEN Ekbangsos Drs. Amirullah Damanik mewakili Bupati Sergai Ir. HT. Erry Nuradi menerima piala dan piagam penghargaan juara II kategori promosi infrastruktur di ajang APKASI Internasional Trade and Invesment Summit (AITIS) 2013, di International Expo (JIExpo) Kemayoran Jakarta.

janya, kompleks Kantor Bupati Sergai di Sei Rampah, Kamis (23/5). Penghargaan diserahkan Menteri Koperasi dan Usaha Kecil dan Menengah Indonesia, Syarief Hasan saat menutup event skala international, barubaru ini kepada Bupati Sergai Ir. HT. Erry Nuradi diwakili Asisten Ekbangsos Drs. Amirullah Damanik bertempat di JIExpo Kemayoran Jakarta. Dikemukakan, kegiatan ini sebagai strategi paling tepat untuk mempublikasi potensi dan produk asli daerah-daerah di Indonesia. “Selain itu AITIS bertujuan memperkenalkan langsung potensi daerah di Indonesia kepada para investor luar mau pun dalam negeri,” ujar Bupati Erry Nuradi. Event akbar ini menghasilkan berbagai transaksi bisnis juga berbagai kegiatan usaha. Termasuk nota kesepahaman yang tercipta antara daerah dan pemilik modal serta terjalinnya komunikasi antara para pelaku usaha dengan daerah. Yang akhirnya dapat mensukseskan Master plan Percepatan dan Perluasan Perekonomian Indonesia atau MP3I, jelas Bupati Erry Nuradi.(a08)

OK Arya, Sosok Pekerja Keras Dan Tokoh Pemekaran SEJUMLAH warga desa di Kec. Talawi, Kab. Batubara menyusun strategi untuk kemenangan H. OK Arya Zulkarnain, SH, MM sebagai Calon Bupati Batubara melalui jalur perseorangan, pada Pilkada yang dijadwalkan berlangsung September 2013. “Kami tau betul sosok OK Arya, selain tokoh pemekaran juga gigih bekerja terutama memajukan pembangunan demi mewujudkan Batubara sejahtera dan berjaya,” kata Togar, tokoh Batak dalam pertemuan sekaligus menyusun tim relawan kemenangan OK Arya untuk kedua kali (20132018) di Desa Padang Genting, kemarin malam. Penyusunan tim relawan tersebut menurut mereka dilakukan atas inisiatif sendiri, diawali percakapan satu sama lain, sehingga dapat berkumpul bersama membicarakan langkah-langkah yang akan dilakukan. Kenapa OK, katanya, karena dia adalah sosok pekerja keras dan salah satu tokoh pemekaran. Mungkin tanpa per-

juangan yang dilakukannya bersama para tokoh dan komponen masyarakat lainnya, Batubara tidak jadi seperti sekarang. Contoh kecil salah satu terobosan yang dilakukan OK Arya selama kepemimpinannya, masyarakat semakin mudah berurusan dengan telah tersedianya sarana kantor pemerintahan di Desa Perupuk dan Gambus Laut, dimana selama ini kawasan itu tak “terjamah” pembangunan. Selain itu, juga mengangkat desa pesisir dari ketertinggalan mau pun kekumuhan dan merubahnya menjadi pemukiman permanen. “Lihat, Desa Bagan Dalam Kec. Tanjungtiram, dulu masuk katagori Desa Inpres Tertinggal (IDT). Desa yang kumuh itu kini berubah menjadi permanen, termasuk kondisi jalan hingga gang,” ujar warga lainnya. Demikian juga merubah kawasan rawan banjir menjadi tidak banjir setelah dilakukan pengerukan sungai maupun anak sungai. “Apakah dulu langkah ini pernah dilakukan, kalau ti-

dak semasa kepemimpinan OK Arya sebagai Bupati Batubara. Jika pun ada dilakukan, tapi pekerjaannya setengah hati,” tuturnya. OK tidak saja membangun masa sekarang, namun lebih dari itu dia menggebrak pembangunan untuk anak cucu ke depan melalui pengembangan

Pelabuhan Kuala Tanjung sampai ke arah Perupuk Kec. Lima Puluh, menjadi Pelabuhan Global Hub Internasional yang disebut-sebut ketiga terbesar di Asia. Selain itu menciptakan SDM handal, agar anak daerah tidak tertinggal dan dapat bersaing dengan anak-anak dari daerah lain di Indonesia.

“Apa hanya karena mengirim bunga papan mau pun bentuk sumbangan lainnya pada setiap kegiatan sosial di masyarakat, sudah bisa dikatakan mengabdi untuk Batubara Negeri Beradat Tanah Bertuah, hanya masyarakatlah yang menilainya.” * Iwan Has

Waspada/Iwan Has

MASYARAKAT dari berbagai dusun dan desa di Kec. Talawi bersama Bupati OK Arya setelah menggelar pertemuan untuk kemenangannya.

Waspada/HM Husni Siregar

DIRJEN Kependudukan dan Pencatatan Sipil, Ir Irman, M.Si bersama Wabup Deliserdang, H. Zainuddin Mars dan Kadis Dukcapil Drs H. Ali Yusuf Siregar meninjau pelaksanaan e-KTP di Sunggal.

Dirjen Dukcapil Tinjau Pelaksanaan e-KTP Di DS SUNGGAL, Deliserdang (Waspada): Direktur Jenderal Kependudukan dan Pencatatan Sipil (Dirjen Dukcapil) Kemendagri Ir Irman, M.Si dan rombongan didampingi Asisten I Pemprovsu Hasiolan Silaen, SH, meninjau perkembangan dan pelaksanaan perekaman e-KTP (Kartu Tanda Penduduk elektronik) di Kab. Deliserdang yang dipusatkan di kantor Camat Sunggal, Rabu (22/5). Kunjungan Dirjen Dukcapil disambut Wabup Deliserdang H. Zainuddin Mars, Kadis Dukcapil Drs HM Ali Yusuf Siregar, MAP, Kadis Infokom Drs Neken Ketaren dan Camat se Kab. Deliserdang beserta para Kepala Desa. Didampingi Wabup H. Zainuddin Mars, Camat, Kepala Desa dan sejumlah tokoh masyarakat, Dirjen meninjau perekaman e-KTP di kantor Camat Sunggal dan di SMAN 1 Sunggal bagi siswa/siswi yang telah wajib e-KTP. Dalam kesempatan itu, Dirjen Ir Irman menyampaikan terimakasih kepada Pemkab Deliserdang yang berperan aktif dan melakukan sosialisasi e-KTP sehingga warga Deliserdang antusias melakukan perekaman e-KTP. Kementerian Dalam Negeri yakin perekaman e-KTP di Deliserdang selesai akhir Juli 2013, sehingga akhir tahun 2013 e-KTP tersalurkan

kepada semua warga. Dirjen juga mengungkapkan e-KTP berlaku secara nasional dan nantinya berlaku seumur hidup. Sehingga dalam penggunaannya harus dijaga dengan baik. Menyangkut boleh atau tidaknya difotocopy, menurut Dirjen e-KTP boleh difotocopy. Menurut Dirjen Dukcapil, kelebihan mendasar dari e-KTP karena di dalamnya dilengkapi chip, memuat biodata, pasfoto, tandatangan dan sidik jari penduduk. Sehingga dengan demikian e-KTP tak mungkin bisa dipalsukan atau digandakan. Chip hanya bisa dibaca dengan card reader (alat pembaca chip). SementaraWabup Deliserdang H. Zainuddin Mars melaporkan jumlah penduduk Deliserdang 2.057.370 jiwa dan jumlah wajib KTP tercatat 1.364.118 jiwa. Capaian wajib e-KTP yang telah merekam 892.099 jiwa (81,10 persen). Jumlah wajib e-KTP yang belum terekam 472.019 jiwa. Sedangkan jumlah e-KTP yang telah dikirim dari Jakarta 809.233 lembar (75 persen). Usai melakukan pertemuan dengan para Camat, Kepala Desa dan masyarakat, Dirjen danWabup H. Zainuddin Mars meninjau pelaksanaan perekaman e-KTP di SMA Negeri 1 Sunggal.(a06)

Soal Alih Fungsi Lahan Mangrove Ratusan Warga Datangi Mapolsek PA N G K A L A N S U S U (Waspada): Ratusan warga Desa Pulausembilan, Kec. Pangkalansusu, yang kontra terhadap alih fungsi hutan mangrove PT MAR, Kamis (23/5), mendatangi Mapolsek, sebagai wujud solidaritas atas tiga rekan mereka yang ditetapkan sebagai tersangka. Warga pesisir yang umumnya bekerja sebagai nelayan tradisional datang menumpang boat dan dari lokasi Tempat Pelalangan Waspada/Asrirrais Ikan (TPI) Jalan Pelabuhan, MASYARAKAT Desa Pulausembilan datangi Mapolsek mereka naik dumptruk, kemudian secara bersama-sa- Pangkalansusu sebagai wujud solidaritas atas tiga rekan mereka ma menuju Mapolsek Pang- yang ditetapkan sebagai tersangka. kalansusu. Warga datang mendampingi ketiga rekan terhadap kegiatan di lapangan. Padahal, perumereka yang ditetapkan sebagai tersangka sahaan perkebunan ini tak punya izin. terkait kasus penganiayaan terhadap seorang Tak tegasnya pemerintah menghentikan karyawan PT MAR, Surya Tamadhan, 22. Kor- aktivitas di lapangan berpotensi menimbulkan ban dianiaya karena dituding turut menyerang konflik horizontal antar masyarakat penentang anggota dewan. alih fungsi dengan pendukung PT MAR. Dengan Herman dan beberapa rekannya menya- adanya pembiaran, berarti secara tak langsung takan terus mengikuti proses pemeriksaan dan pemerintah membuka ruang terjadinya konflik. seandainya ketiga rekan mereka In, De dan PT MAR tahun 2012 pernah menyampaikan Le dijebloskan ke sel, mereka akan terus berta- permohonan izin lokasi atas lahan yang dikonhan di Mapolsek. versi seluas 371,11 ha kepada Bupati Langkat. Untuk mencari solusi atas permasalahan Namun ditolak, sebab berdasarkan peta pola ini, Kapolsek Pangkalansusu, AKP Untung ruang RTRW Kab. Langkat, lokasi kebun berada Robert bersama Kapolsek Besitang, AKP Suker- di kawasan lindung sempadan pantai. man berupaya memediasi dengan melakuAKP Untung Robert dikonfirmasi Waspada kan dialog bersama sejumlah perwakilan di ruang kerjanya usai dialog dengan masyarakat, masyarakat. menyatakan pihaknya tetap mengedepankan Seorang warga, Sakhyan, menuding apa- pendekatan humanis untuk menyelesaikan ratur desa terindikasi berpihak kepada pengu- masalah ini. Terkait upaya perdamaian, menurut saha ditandai tidak adanya upaya pelarangan dia, menunggu kehadiran korban.(a02)

Gadis Lugu Mengaku Diperkosa TEBINGTINGGI (Waspada): Seorang gadis berusia 22 tahun, Pur, warga Tebingsyahbandar, Kab. Ser-gai mengaku diperkosa seorang pria di areal perkebunan sawit PD. Paya Pinang Group, di Desa Paya Pinang, Kec. Tebingsyahbandar, Kab. Sergai, Rabu (22/ 5) sekira pukul 09.30. Korban warga Dusun IV, Desa Paya Pinang, Kec. Tebingsyahbandar, Kab. Sergai bekerja sebagai karyawan toko fotocopy di Jalan Sutomo, Kota Tebingtinggi menuturkan perkosaan berawal saat korban membeli lontong sarapan pagi. Pur berjalan kaki ke arah Simpang Tangsi, dan bertemu seorang pemuda tak dikenal. Setelah ngobrol, pria itu mengajak membeli sarapan lontong di tempat lain. “Saya seperti tak sadar saat diajak membeli sarapan di tempat lain,” aku korban kepada polisi. Selesai sarapan, pelaku mengajak korban ke arah Jalan Deblod Sundoro menuju areal perkebunan sawit PD. Paya Pinang Group, Desa Paya Pinang, Kec. Tebingsyahbandar, Kab. Sergai. Korban dibawa ke tempat sepi dan diperkosa. “Awalnya mulut saya ditutup pakai

tangan, saya menjerit minta tolong, tapi tak ada orang yang mendengar. Pelaku mengancam akan membunuh kalau saya terus berteriak,” akunya. Petugas melakukan visum ke RS Bhayangkara. Hasilnya, terdapat luka akibat benda tumpul pada kemaluan korban.(a11)

Memiliki Sabu Ditangkap Polisi BINJAI (Waspada): IM alias Iksan, 17, warga Jalan Dr Wahidin Km 19 Gg. Pacet Kel. Sumbermulio Rejo, Kec. Binjai Timur, Selasa (21/ 5) sekitar pukul 20.15 diringkus anggota Serse Narkoba Polres Binjai di belakang rumahnya, karena memiliki satu paket sabu. Menurut keterangan, awalnya petugas mendapat informasi tersangka mengedarkan sabu. Petugas yang turun ke lokasi langsung menyergap tersangka.Kini tersangka bersama barang bukti diamankan di Polres Binjai. Kasat narkoba Polres Binjai AKP Achiruddin Hasibuan, SH, M.Hum, mengatakan kasusnya dalam pengembangan.(a05)


Sumatera Utara

B2 WASPADA

Pemimpin Umum Dr. Hj. Rayati Syafrin Pemimpin Redaksi/Penanggung Jawab H. Prabudi Said Wakil Pemimpin Umum/Wapemred H. Teruna Jasa Said Wakil Penanggung Jawab H. Sofyan Harahap Redaktur Senior H. Azwir Thahir Pemimpin Perusahaan: Dr. Hj. Rayati Syafrin. Wakil Pemimpin Perusahaan: H. Bahtiar Tanjung. Iklan: Hj. Hilda Mulina (Kabag), Rumondang Siagian (Medan), Lulu Lusia Damayanti (Jakarta). Redaktur Pelaksana Berita: Armin Rahmansyah Nasution. Redaktur Pelaksana Opini & Artikel: Dedi Sahputra. Redaktur Minggu & Akhir Pekan: Muhammad Thariq. Redaktur Berita: H. Halim Hasan, Hendra DS. Redaktur Medan: David Swayana. Redaktur Sumatera Utara: H.T. Dony Paridi. Redaktur Aceh: M. Zeini Zen. Redaktur Luar Negeri: H. Muhammad Joni. Redaktur Nusantara: H. Halim Hasan. Redaktur Olahraga: Jonny Ramadhan Silalahi. Redaktur Ekonomi: Zulkifli Harahap. Redaktur Agama: H. Syarifuddin Elhayat. Litbang: H. Akmal AZ (Kabag). Humas: H. Erwan Effendi (Kabag), Aidi Yursal. Promosi: Edward Thahir (Koordinator). Sekretaris Redaksi: Hj. Hartati Zein. Pemasaran: H. Subagio PN (Medan), Zultamser (Sumatera Utara), Sinur Manik (Aceh). Asisten Redaktur: Irwandi Harahap (Medan); Irham Hagabean Nasution (Sumatera Utara); Armansyah Thahir (Sumatera Utara, Otomotif); Diurna Wantana (Aceh); Austin Antariksa (Olahraga, KMS Kreasi); Syafriwani Harahap (Luar Negeri, Popular, Pariwisata); Rudi Faliskan (Berita); Erwin Siregar (Opini); Hj. Hoyriah Siregar (Ekonomi); T. Junaidi (Hiburan); Hj. Erma Sujianti Tarigan (Agama), Hj. Neneng Khairiah Zen (KMS Remaja, Mode); Anum Purba (Keluarga); David Swayana (Infotainmen); Hj. Ayu Kesumaningtyas (Kesehatan); Dedi Riono (Budaya); Denny Adil (Pelangi). Wartawan Kota Medan: Umum: H. Amir Syarifuddin, Ismanto Ismail, Rudi Arman, Zulkifli Darwis, H. Abdullah Dadeh, H. Suyono, Hj. Ayu Kesumaningtyas, Feirizal Purba, Gito AP, M. Ferdinan Sembiring, M. Edison Ginting, Anum Purba, Sahrizal, Sulaiman Hamzah, Sugiarto, Rustam Effendi, Mursal Alfa Iswara, Andi Aria Tirtayasa, Avli Yarman. Olahraga: Austin E. Antariksa, H. Syahputra MS, Setia Budi Siregar, Dedi Riono. Fotografer: Muhammad Faisal, Hang Tuah Jasa Said, Surya Effendi, Hamdani. Otomotif: Armansyah Thahir. Koran Masuk Sekolah/KMS: Arianda Tanjung, Dio Utama. Wartawan Jakarta: Andi Yanto Aritonang (Koordinator Liputan), Hermanto, H. Ramadhan Usman, Hasriwal AS, Nurhilal, Edi Supardi Emon, Agus Sumariyadi, Dian Warastuti, Aji K, Yuslan Kisra. Wartawan Sumatera Utara: Binjai: H. Riswan Rika, Nazelian Tanjung. Deli Serdang: H.M. Husni Siregar, Hotma Darwis Pasaribu, Rizaldi Anwar, M. Suhandi Nasution. Serdang Bedagai: Eddi Gultom, Edi Sahputra. Stabat: H. Ibnu Kasir, Abdul Hakim. Pangkalan Brandan: Chairil Rusli, Asri Rais. Kabanjahe/ Berastagi: Dickson Pelawi, Basita Bukit, Dedek Mohan Basri Hasibuan, Micky Maliki. Tebingtinggi: Muhammad Idris, Abdul Khalik. Pematangsiantar: Mulia Siregar, Edoard Sinaga. Simalungun: Ali Bey, Hasuna Damanik, Balas Sirait. Aek Kanopan: Indra Muheri Simatupang, Syahril Ilham. Rantau Prapat: Armansyah Abdi, Neirul Nizam, Budi Surya Hasibuan. Kota Pinang: Hasanuddin Harahap, Deni Syafrizal Daulay. Pangururan: Edison Samosir. Balige: Jimmy Sitinjak. Sidikalang: Natar Manalu. Tarutung: Parlindungan Hutasoit. Sibolga/Tapanuli Tengah: Alam Satriwal Tanjung. Padangsidimpuan: H. Syarifuddin Nasution, Sukri Falah Harahap, Ahmad Cerem Meha. Gunung Tua: Sori Parlah Harahap. Sibuhuan: Idaham Butarbutar, Syarif Ali Usman. Panyabungan: Munir Lubis, Sarmin Harahap, Alpin Lubis. Gunung Sitoli: Bothaniman Jaya Telaumbanua. Kisaran: Nurkarim Nehe (Koordinator Liputan Asahan, Batubara & Tanjungbalai), Bustami Chie Pit, Sapriadi. Batubara: Helmy Hasibuan, Agus Diansyah Hasibuan, Sahril, Iwan Hasibuan. Tanjung Balai: Rahmad Fansur Siregar, Rasudin Sihotang. Wartawan Aceh: Banda Aceh: Aldin Nainggolan (Ka Perwakilan/Koordinator Liputan), Muhammad Zairin, Munawardi Ismail, Zafrullah, T. Mansursyah, T. Ardiansyah, Jaka Rasyid, Gito Rollies, H. Rusli Ismail, Arman Konadi. Aceh Besar: Iskandarsyah. Lhokseumawe: Bustami Saleh (Ka Perwakilan/Koordinator Liputan), M. Jakfar Ahmad, Zainal Abidin, Zainuddin Abdullah, Maimun, Arafat Nur. Kuala Simpang: Muhammad Hanafiah. Langsa: H. Syahrul Karim, H. Ibnu Sa’dan, H. Samsuar, Dedek Juliadi. Lhoksukon: Musyawir, Mustafa Kamal. Idi: Muhammad H. Ishak. Bireuen: HAR Djuli, Amiruddin, Abdul Mukti Hasan. Takengen: Bahtiar Gayo, Irwandi. Sigli: Muhammad Riza. Sabang: T. Zakaria Al-Bahri. Subulussalam: Khairul Boang Manalu. Tapaktuan: Zamzamy Surya. Blangpidie: Sudarmansyah Putra. Kutacane: Mahadi Pinem, Ali Amran. Blangkejeren: Jasvira Sautisa. Bener Meriah: Khairul Akhyar, Irham Hakim. Singkil: Tarmizi Ripan, Mansurdin. Sinabang: Muhammad Rapyan.

� Semua wartawan WASPADA dilengkapi dengan kartu pers. Jangan layani dan segera laporkan ke pihak berwajib atau ke Sekretaris Redaksi bila ada yang mengaku wartawan WASPADA tetapi tidak bisa menunjukkan kartu pers yang sah, ditandatangani Pemimpin Redaksi �

Hubungi kami

TANJUNGBALAI (Waspada): Seorang oknum petugas Polres Tanjungbalai diduga melakukan pungutan liar (pungli) di Jl. Jenderal Sudirman, Km. 7, perbatasan Asahan-Tanjungbalai, Kamis (23/5). Pantauan Waspada, sejumlah mobil yang melintas menuju Kab. Asahan baik pengangkut barang maupun penumpang tampak berhenti sejenak depan pos polisi tersebut, dan yang duduk di sebelah kiri sopir lalu mengulurkan tangan sembari menyodorkan sejumlah uang. Petugas yang ada di pos polisi kemudian berlari mengejar lalu menyalami tangan yang telah terselip uang pecahan kertas. Setelah uang itu sampai di ta-

ngan petugas, mobil kemudian melanjutkan perjalanan. Seorang sopir truk Colt Diesel pengangkut ikan segar berhasil dikonfirmasi Waspada mengaku, setiap melintas di sana, dia harus menyetor uang sebesarlimarriburupiah.Jikati-dak, maka sopir akan diteriaki, apalagi yang menjaga oknum pembantu polisi (banpol) arogan. “Tak apa-apalah bang kasih lima ribu setiap melintas, yang penting aman di jalan,” tutur

KISARAN (Waspada): Dinas Tenaga Kerja (Disnaker) Kab Asahan, melakukan investigasi terkait kasus 10 remaja yang diduga di bawah umur yang dipekerjakan tanpa gaji, dan bila perlu akan dilakukan penjemputan. “Kita masih mempelajari kasus ini. Berdasarkan data awal, pemberangkatan 10 remaja yang dipekerjakan PT yang ada di Kerinci, Provinsi Riau, sebelumnya tidak ada pemberitahuan kepada Disnaker,” jelas Kadisnaker Jaya Prana Sembiring, saat dikonfirmasi

Waspada, Kamis (23/5). Oleh sebab itu, pihaknya masih melakukan koordinasi dengan Dinas dan instansi terkait, membentuk tim untuk penjemputan itu. “Bila dugaan itu benar, 10 remaja yang dipekerjakan tidak mendapat upah yang layak, maka mereka akan melanggar UU tentang perlindungan anak. Dan ini akan diproses sesuai dengan hukum yang berlaku,” jelas Jaya. Sebelumnya 10 orang tua remaja itu diperiksa Polres Asahan untuk menindak lanjuti laporan itu dan kini polisi ma-

LIMAPULUH (Waspada): Ratusan massa yang berasal dari berbagai desa Kec. Tanjungtiram, Talawi dan Limapuluh mendatangi KPU Batubara di Jalan Perintis Kemerdekaan Kec. Limapuluh, Kamis (23/5). Kedatangan mereka guna menyampaikan sikap “mencabut” dukungan terhadap salah satu calon perseorangan pasangan bupati menjelang Pilkada Batubara menurut jadwal berlangsung September 2013, sekaligus ditindaklanjuti dengan mengisi formulir B3 sesuai identitas warga untuk diserahkan ke KPU.

“Kami kemari semata untuk menyatakan sikap tidak pernah memberikan dukungan terhadap pasangan Cabup perseorangan Drs H GM S dengan H AD,” tukas Aidir Yanto alias Pakde di sela-sela aksi. Sedangkan Ridwan Amra, selaku mewakili warga Desa Pahlawan dan Bogak, secara tegas mengatakan masyarakat merasa tidak senang dan tertokoh jika adanya memberikan dukungan terhadap pasangan Cabup tersebut. “Ini faktor kami kemari guna menyatakan sikap secara langsung ke KPU,” ujarnya sembari mengatakan me-

KANTOR PUSAT Jalan Letjen Suprapto/Brigjen Katamso No. 1 Medan 20151 Tel: (061) 4150858, Faks Redaksi: (061) 4510025, Faks Tata Usaha: (061) 4531010. E-mail Redaksi: redaksi@waspadamedan.com KANTOR PERWAKILAN DAN BIRO � Perwakilan dan Biro Jakarta: Jalan Siaga II No. 6 C Pejaten Barat, Pasar Minggu Jakarta Selatan. Tel: (021) 79197052, Faks: (021) 79199874. � Perwakilan dan Biro Banda Aceh: Jalan Ratu Syafiatuddin No. 21 C, Banda Aceh. Tel & Faks: (0651) 22385.

Pencetak: PT Prakarsa Abadi Press, Jalan Sidorukun Medan. Isi di luar tanggung jawab percetakan

Dishub T. Balai Belum Mampu Tertibkan Terminal Bayangan TANJUNGBALAI (Waspada): Dinas Perhubungan Kota Tanjungbalai belum mampu menertibkan terminal bayangan di sejumlah titik Jalan Jenderal Sudirman. Razia yang digelar Kamis (23/5), tidak membuahkan hasil positif. Buktinya angkutan umum masih menaikkan dan menurunkan penumpang di luar terminal Utama Sijambi. “Kita sudah razia tadi pagi, memang hasilnya belumlah maksimal,” kata Kepala Bidang Hubungan Darat Dishub Kota Tanjungbalai, Khairul, kepada Waspada. Menurut Khairul, razia itu masih sebatas sosialisasi atau imbauan dan belum ada sanksi tegas. Razia tersebut digelar di tiga titik terminal liar kawasan Jalan Jenderal Sudirman. Di lapangan, menurut Khairul, sempat terjadi adu argumen antara petugas Dishub dengan awak angkutan umum. “Nggak ada kendala berarti, pihak angkutan hanya merasa terganggu saja dengan kehadiran kami,” kata Khairul. Lebih lanjut dikatakan Khairul, terhitung sejak razia ini, pihak angkutan masih diberi keringanan sampai 3 bulan ke depan. Jika batas akhir nanti pihak angkutan masih membandal, maka kata Khairul, barulah diberikan sanksi. “ Kita kordinasilah dengan Satlantas untuk memberikan sanksinya nanti,” kata Khairul. Ditanya penyebab angkutan enggan masuk ke terminal Utama Sijambi,Khairulmengakuiakibatminimnyafasilitasditerminaltersebut. “Bermacam-macam alasan mereka, salah satunya fasilitas terminal kurang kondusif. Hal itu memang kita akui,” ujar Khairul. Pantauan Waspada, tiga titik terminal bayangan yang digunakan angkutan umum itu, masih beroperasi seperti hari-hari sebelumnya. Terminal Utama Sijambi, hanya digunakan untuk numpang lewat saja, padahal petugas Dishub banyak yang ‘berkeliaran’ di pintu masuk dan keluar terminal. (a14)

sih dalam pendalaman kasus tersebut. Sementara Ketua Komisi Perlindungan Anak Indonesia (KPAI) Kab. Asahan RMK Margolang, mengapresiasi peran aktif dan mau peduli dan mau menjemput 10 remaja itu. “Terima kasih kepada kepada Pemkab Asahan yang mau peduli, dan kemi harap para pelakunya bisa ditindak tegas, karena 10 remaja itu masih di bawah umur dan melanggar UU Perlindungan Anak,” jelas Masrgolang. (a15)

Ratusan Massa Pemilih Cabut Dukungan Cabup Batubara

SIUPP: 065/SK/MENPEN/SIUPP/A.7/198 tanggal 25 Februari 1988 Anggota SPS No. 13/1947/02/A/2002

Harga iklan per mm kolom: Hitam-putih Rp. 13.000,-, berwarna Rp. 36.000,Halaman depan: hitam-putih Rp. 39.000,-, berwarna Rp. 108.000,Ukuran kolom: 40,5 mm. E-mail Iklan: iklan@waspadamedan.com

pria berbadan ringkih tersebut yang enggan dimuat identitasnya. Sementara, seorang pedagang tak jauh dari pos polisi membenarkan ada pungutan di pintu masuk Kota Tanjungbalai ini. Namun dia tidak tahu resmi atau tidaknya pengutipan itu. “Kalau ngambil uang gitu ya sering kalilah bang. Tapi tak tahulah aku resmi atau tidak,” ungkap wanita itu. Aktivis LSM M Robby MA mengecam pengutipan itu. Dia meminta agar Kapolres Tanjungbalai AKBP ML Hutagaol menindak tegas oknum yang telah mencoreng nama baik institusi kepolisian. “Sekarang polisi kan lagi menggalakkan pencitraan, jadi yang begini harus dibersihkan,” pungkas Robby. (tim)

Disnaker Investigasi 10 Remaja Dipekerjakan Tanpa Gaji

Komisaris Utama: Tribuana Said Direktur Utama: dr. Hj. Rayati Syafrin, MBA, MM

� Biro Asahan, Batubara & Tanjungbalai: Jalan Sutami No. 30 Kisaran. Tel: (0623) 41412.

Jumat 24 Mei 2013

Pungli Di Depan Pos Polisi T. Balai

Penerbit: PT Penerbitan Harian Waspada

� Perwakilan dan Biro Lhokseumawe: Jalan Iskandar Muda No. 65, Lhokseumawe. Tel: (0645) 42109.

WASPADA

Waspada/Iwan Has

SEBAGIAN warga sedang mengisi formulir B3 menyatakan tidak memberikan dukungan terhadap salah satu pasangan perseorangan Cabup di KPU Batubara.

minta KPU untuk memberikan formulir B3 untuk mengisi pernyataan mencabut dukungan terhadap pasangan calon perseorangan tersebut . Sebelumnya Ketua KPU Kab. Batubara Khairil Anwar, SH, MSi didampingi anggota, Donni Husein Harahap, SE, Masri Purba, SH dan Taufik Abdi Hidayat, S.Sos menjelaskan, kewenangan tugas KPU antara lain meneliti ulang jika adanya dukungan tidak pada tempatnya atau manipulasi data untuk dilakukan perbaiki sebagaimana Pasal 55. “Jika ini terjadi dan mendapat protes warga dilakukan perbaiki sebagaimana wewenang KPU,” ujarnya. Donni Husein Harahap mengatakan, kedatangan masyarakat sebagai bukti kekuatan KPU untuk menjalankan kerja sebagaimana peraturan berlaku agar tidak terjadi pembohongan dalam memberikan dukungan khususnya terhadap calon perseorangan yang diusung. Kepada warga diharapkan untuk mengisi formilir B3 yang diserahkan secara benar sebagaimana identitas diri KTP dan menandatangani. Setelah menyatakan sikap dan menyerahkan formulir, warga terdiri kaum ibu dan nelayan tersebut kembali pulang dengan tertib meninggalkan KPU menumpang angkutan desa dan truk. (a13/c05)

Akbar Tandjung: Pembangunan Bangsa Dari Kesatuan Budaya KISARAN (Waspada): Tokoh Nasional Akbar Tandjung mengatakan, bahwa pembangunan bangsa itu didasari oleh kesatuan budaya yang berbeda, untuk menuju dan mencapai cita-cita nasional dan kehidupan yang lebih baik. Hal itu diungkapkannya saat pembukaan Pergelaran Senin Budaya Daerah (PSBD) Kabupaten Asahan 2013, di kawasan Terminal Madya Kisaran, Rabu (22/5). Akbar Tanjung menuturkan, bahwa bangsa ini bukan dibangun atas suku dan agama. Melainkan persatuan dan kesatuan yang mengikat suku dan etnis untuk melangkah bersama dan mensukseskan pembangunan. Oleh sebab itu perbedaan suku dan budaya jangan jadikan celah perpecahan, namun menjadi kekuatan untuk membangun. “Persatuan dan kesatuan itu harus dilestarikan, karena hal itu menjadi modal dalam mencapai cita-cita nasional, dan kehidupan yang sejahtera dalam negara,” jelas Akbar Tandjung yang juga mantan Ketua DPR RI. Sementara Bupatai Asahan Taufan Gama Simatupang,

dalam sambutannya, mengucapkan terimakasih kepada suku dan etnis yang ada di Asahan yang ikut berpartisipasi dan mensukseskan PSBD ini. “Kita berharap, dengan kegiatan ini persatuan dan persaudaraan antarsuku dan etnis yang selama ini terjalin dengan baik, bisa lebih ditingkatkan lagi, demi

pembangun Asahan yang lebih baik,” jelas Taufan. Pembukaan ini dihadiri seluruh Muspida, tokoh agama, adat dan budaya, serta Dandim 0208/AS Letkol Inf Muhammad Ali, Danyonif 126/KC Letkol Inf Agusman Heri, dan Kapolres Asahan AKBP Yustan Alpiani. (a15/a31)

Waspada/tim

OKNUM petugas Polres Tanjungbalai berpangkat Briptu mengambil uang diduga pungutan liar dari truk BK 9364 NA.

Bulog Drive Kisaran Diduga Salurkan Beras Buruk KISARAN (Waspada): Beras miskin yang disalurkan Bulog Drive Kisaran untuk warga kurang mampu di Desa Perbangunan, Kec. Seikepayang, Kab. Asahan, diduga kualitasnya tidak layak konsumsi. Dari 662 karung goni yang disalurkan, terdapat 48 karung yang rusak dan dikembalikan ke Bulog Kisaran. Pengembaliannya pun menimbulkan polemik, karena sempat ditahan Polsek Tanjungbalai Selatan ketika truk pengangkutnya melintas di wilayah Polres Tanjungbalai. “Saat diterima, 48 karung beras memang sudah rusak dan tidak layak dikonsumsi. Beras itu rusaknya memang dari Bulog,” kata Bupati Asahan Drs.H.Taufan Gama Simatupang melalui Kabag Humas Zainal Arifin kepada Waspada Kamis (23/5). Oleh sebab itu, kata Zainal, Satker di Kecamatan bertindak dan mengembalikan beras itu ke Bulog, sekaligus minta supaya

diganti dengan beras layak konsumsi. “ Sudah diganti oleh Bulog,” kata Zainal. Sebelumnya, Kepala Seksi Pelayanan Publik (Kasi PP) Bulog Sub Divisi Regional (Dirve) III Kisaran,Sutrisman, dikonfirmasi Waspada, mengaku pihaknya sudah mengganti 48 karung beras miskin yang rusak untuk wilayah Desa Perbangunan. Menurut Sutrisman, penahanan truk yang mengangkut 48 karung beras miskin itu, hanya salah paham. Dan, beras tersebut, menurut Sutrisman, memang rusak dan sudah diambil dan diganti dengan beras baru. “ Sudah kita ganti beras yang rusak itu,” kata Sutrisman. Pemerhati sosial, M Roby MA, menyatakan, Badan Urusan Logistik Drive Kisaran sebaiknya tidak menyalurkan beras untuk rakyat miskin yang berkualitas buruk. Jika ditemukan beras rusak, kata Roby, sebaiknya tidak dibagi ke masyarakat. “ Janganlah beras buruk diberikan kepada warga miskin,” ketus Roby. (a14)

Miliki Narkoba Napi Ditangkap TANJUNGBALAI (Waspada): Seorang narapidana Lembaga Pemasyarakatan Pulosimardan Kota Tanjungbalai, RSP alias Anto, 26, ditangkap petugas gabungan LP dan Polres Tanjungbalai karena diduga memiliki narkoba jenis ganja, Rabu (22/5) malam. Penangkapan napi kasus pencurian warga Kel. Pasarbaru, Kec. Seitualang Raso ini, berawal saat seorang narapidana lainnya melihat Anto memegang ganja. Kejadian itu lalu dilaporkan kepada sipir penjara, lalu dilakukan penggeledahan. Dari kantong celana sebelah kiri Anto, petugas menyita daun ganja kering siap pakai seberat 1,23 gram. Modus tersangka dengan menyembunyikannya dalam lipatan uang pecahan seribu rupiah. Anto yang divonis hakim Pengadilan Negeri

Kota Tanjungbalai 10 bulan penjara, diwawancara wartawan di Mapolres mengaku ganja tersebut bukan miliknya. Penghuni kamar blok C nomor 4 ini berdalih secara tidak sengaja menemukan di kamar mandi umum, lalu mengambilnya. “Kutengok tergeletak di kamar mandi, kuambil aja bang. Yah, gara-gara ini, tambah lagilah hukumanku,” pungkas pria beranak dua yang seyogyanya akan bebas bulan September 2013. Kapolres Tanjungbalai AKBP ML Hutagaol melalui Kasat Narkoba AKP Novie Ardhie didampingi Kasubbag Humas AKP Y Sinulingga membenarkan penangkapan itu. Dikatakan, kurun waktu 2013, tiga narapidana LP Pulosimardan dan seorang sipir ditangkap atas kepemilikan narkoba. (a32)

Bupati Labusel Lantik 57 Pejabat KOTAPINANG (Waspada): Janji Bupati Labusel Wildan Aswan Tanjung mengangkat Camat Sungaikanan Kholil Zubri menjadi eselon II sebagai kompensasi atas suksesnya pelaksanaan MTQ dan FSN beberapa waktu lalu ternyata bukan isapan jempol. Rabu (22/ 5) siang Kholil resmi dilantik menjadi Kepala Badan Lingkungan Hidup (BLH) bersama 56 pejabat lainnya. Selain Kholil, lima pejabat eselon II lain yang turut dilantik yakni Zulkifli yang sebelumnya menjabat Asisten I menjadi Kepala Dinas Pendidikan menggantikan Naga Parlaungan Lubis yang dilantik menjadi Asisten III, Hopner Ritonga yang sebelumnya menjabat Kepala DPPAD menjadi Kepala Sekretariat DPRD, Fuadi sebelumnya Kasatpol PP-Linmas menjadi Asisten I, dan Mangayat Jago menjadi Staf Ahli. Bupati juga melantik 21 pejabat eselon III di antaranya Lahamid Nasution menjadi Camat Sungaikanan, Hasian Harahap sebagai Camat Kotapinang, Hasyim menjadi Kastpol PP-Linmas, Raja Asi Purba menjabat Kabag Pembangunan pada Sekretariat Daerah, dan Rosul

Dongoran menjabat Inspektur Pembantu Bidang Keuangan dan Kekayaan Usaha Daerah pada Inspektorat. Sementara 30 pejabat eselon IV juga diambil sumpahnya bersama lima PNS yang sebelumnya menjabat eselon II. Pada kesempatan itu Bupati mengingatkan kepada seluruh pejabat meningkatkan loyalitasnya dalam bekerja. Menurutnya, parameter utama dalam menentukan jabatan terhadap PNS melalui beberapa pertimbangan yakni, kapasitas dan kompetensinya, integritas, loyalitas, moralitas, dan kepangkatan. “Serta pengabdian dan komitmen terhadap tugas dan tanggung jawab,” katanya. Secara terpisah, pasca pelantikan pejabat eselon yang dilakukan Bupati, khususnya menyangkut pencopotan Zuhri sebagai Kepala Sekretariat DPRD, pada hari yang sama DPRD Labusel menggelar konferensi pers. Pada pertemuan yang dihadiri dua pimpinan dewan dan 10 anggota dewan, DPRD menilai Pemkab Labusel khususnya Bupati telah menyalahi Undang-undang. (c18)

Plt Kadis PU Mangkir Dari Panggilan DPRD TANJUNGBALAI (Waspada): Pelaksana Tugas Kadis Pekerjaan Umum Kota Tanjungbalai, Abu Hanifah, mangkir dari panggilan komisi C DPRD kemarin. Otomatis pihak legislatif pun kecewa, terlebih pemanggilan itu beragendakan evaluasi persiapan Dinas PU dalam melaksanakan pembangunan pada TA 2013. “Kita sangat kecewa, sebab rapat kerja akhirnya dibatalkan,” kata Sekretaris Komisi C DPRD Kota Tanjungbalai, Hakim Tjoa Kian Lie kepada Waspada Kamis (23/5). Oleh sebab itu, lanjut Hakim, pihaknya akan kembali memanggil mantan Kepala Bapemas Asahan tersebut pekan depan. Hal ini harus dilakukan karena menurut Hakim, sampai saat ini belum ada tanda-tanda persiapan Dinas PU untuk melaksanakan pembangunan TA 2013. “Pada 2012, banyak kegiatan Dinas PU yang

tidak rampung sehingga untuk menghindari hal serupa kita memanggil Plt.Kadis untuk evaluasi persiapan mereka menghadapi TA 2013 ini,” ujar Hakim. Disebutkan Hakim, kendati telah memasuki pertengahan tahun, tidak satupun kegiatan yang dimulai di Dinas PU. “Anggaran dinas itu sebesar Rp84 miliar yang tersebar di beberapa bidang. Ini sudah akhir Mei, kapan lagi dimulai kegiatan, ada apa ini? Kita tidak menginginkan banyak lagi kegiatan yang tak rampung seperti tahun sebelumnya,” ujar Hakim. Mengenai keterlambatan pekerjaan 2012 di Dinas PU, menurut Hakim, belum ada penjelasan resmi dari pihak eksekutif ke legislatif. Seperti pembangunan jembatan Selat Tanjung Medan senilai Rp10 miliar lebih. Dan, pekerjaan jembatan itu, kata Hakim, dianggarkan kembali tahun ini. (a14)

Wisuda IAIDU Asahan

Waspada/Sapriadi

TOKOH Nasional Akbar Tandjung diberikan tombak dan perisai adat Suku Nias, oleh Nurkarim Nehe, didampingi Bupati Asahan Taufan Gama Simatupang, saat meninjau rumah adat pada pembukaan PSBD Asahan.

KISARAN (Waspada): Institut Agama Islam Daar Al Uluum (IAIDU) Asahan, mewisuda sarjana XIX sebanyak 128 orang. Acara tersebut berlangsung di kampus IAIDU Asahan, di Kisaran, Kamis (23/5). Rektor IAIDU Drs.H.A Muin Isma Nasution dalam sambutannya menyatakan dengan diwisudanya 128 orang, berarti IAIDU Asahan sepanjang wujudiahnya sebagai Perguruan Tinggi Islam Swasta yang ada di Kabupaten Asahan telah mempersembahkan 1.631orang alumninya ke tengah-tengah masyarakat. Muin Isma berharap wisudawan/ti dapat dan mampu mengamalkan dan mengabdikan ilmu pengetahuannya bagi agama, nusa dan bangsa. Bupati Asahan Drs.H.Taufan Gama Simatupang, MAP dalam sambutannya berharap

peranan sarjana keagamaan khususnya sarjana IAIDU Asahan mampu mencegah dan meminimalisir terjadinya persoalan tentang agama, dan selanjutnya memfasilitasi masyarakat dalam memberikan pemahaman agama yang benar. Kegiatan juga diisi orasi ilmiah oleh Prof.Dr.Haidar P.Daulay, MA dengan materi “Islam dan Pendidikan Karakter Bangsa” membangun karakter bangsa melalui pemberdayaan pendidikan agama. Wisudawan/ti terbaik IAIDU Asahan angkatan XIX tahun akademik 2012/2013 yakni Nur Adalah Nasution dari Fakultas Tarbiyah/ Pendidikan Agama Islam, Nurul Jannah Sitorus (Tarbiyah/Pendidikan Islam) dan Ade Syahfitri (Syari’ah/Ahwal Al Syakhsiyyah). (a31)


Sumatera Utara

WASPADA Jumat 24 Mei 2013

B3

Sekda Gunungsitoli Diganti Mendadak GUNUNGSITOLI (Waspada): Wali Kota Gunungsitoli, Drs. Martinus Lase, MSP melakukan pergantian jabatan Sekretaris Daerah Kota Gunungsitoli dari pejabat lama Drs. Firman Harefa, SPd, M.Si kepada pejabat baru Drs. Edison Ziliwu, MM, M.Si. Pelantikan dilaksanakan di aula Samaeri Lantai II Kantor Wali Kota Gunungsitoli, Rabu (22/5). Para PNS di lingkungan Pemko Gunungsitoli terkejut karena pergantian Sekda dilakukan secara mendadak.

Pelantikan Drs. Edison Ziliwu, MM, M.Si yang sebelumnya menjabat Kadis Kesehatan menjadi Sekda Kota Gunungsitoli berdasarkan SK Gubernur Sumatera Utara No: 821.23/1642/ 2013 tanggal 26 April 2013.

Hadir pada pelantikan itu di antaranya Ketua DPRD Kota Gunungsitoli, Sowa’a Laoli, SE, Wakil Wali Kota Gunungsitoli, Aroni Zendrato, sejumlah pejabat mewakili Muspida namun pejabat lama tidak terlihat pada acara tersebut. Wali Kota Gunungsitoli, Drs. Martinus Lase, MSP pada sambutannya mengatakan, pengangkatan, pemindahan, dan pemberhentian pegawai negeri sipil dalam jabatan struktural merupakan hal biasa dan lumrah dalam organisasi mana pun, termasuk organisasi pemerintah daerah. Mutasi dan promosi dilakukan sesuai dengan kebutuhan organisasi dalam rangka kelancaran tugas-tugas kedinasan dan dalam rangka pembinan karier PNS itu sendiri. Menurut Martinus peneta-

pan pejabat baru Sekretaris Daerah Kota Gunungsitoli telah memenuhi tahapan sesuai diatur dalam ketentuan berlaku termasuk dengan UU Kepegawaian. Dia berharap kepada Sekda Kota Gunungsitoli yang baru dilantik kiranya dapat mengemban amanah yang diberikan negara dan dijalankan dengan penuh pengabdian dan komitmen dan rasa tanggungjawab yang tinggi. Pantauan di lingkungan Kantor Wali Kota Gunungsitoli pada acara pergantian dan pelantikan Sekda Kota Gunungsitoli, sejumlah PNS yang ditemui Waspada mengaku sedih dan terkejut atas pergantian pejabat Sekda Kota Gunungsitoli yang dikenal selama ini sangat ramah dan dekat dengan pegawai. Baik pegawai maupun se-

jumlah kalangan di Kota Gunungsitoli bertanya-tanya kenapa Sekda Kota Gunungsitoli diganti mendadak dan apakah tidak sebaiknya menunggu hingga September 2013 di saat yang bersangkutan memasuki masa pensiun. Kepada wartawan,Wali Kota Gunungsitoli Drs. Martinus Lase, M.SP usai pelantikan, mengharapkan pejabat Sekretaris Daerah Kota Gunungsitoli yang baru, Drs. Edison Ziliwu, MM, M.Si menggantikan Drs. Firman Harefa, S.Pd, M.Si dapat membuat terobosan baru dalam meningkatkan disiplin pegawai. Selain itu juga harus mampu menjadi mediator antara eksekutif dengan legislatif sehingga dapat terwujud pelaksanaan peningkatan kesejahteraan masyarakat di daerah ini. (a25)

Otorita Asahan: Dana Bina Lingkungan PT Inalum Rp772 Miliar Milik Negara

Waspada/ Rap.Negara Siregar

KELUARGA korban kebakaran di Kel. Tanjung Tongah, Siantar Martoba, Pematangsiantar, menerima bantuan berupa beras dan air mineral yang diserahkan Kepala Cabang PT.Jamsostek Rasidin, SH (ke tiga kanan) dan Kabid. Umum dan SDM Ferri Rinaldi (kanan).

Korban Kebakaran Masih Dirawat Di RS Jamsostek Serahkan Bantuan PEMATANGSIANTAR (Waspada): Salah seorang warga korban kebakaran di Kel. Tanjung Tongah, Kec. Siantar Martoba Pematangsiantar, Jumiti, 43, sampai, Rabu (22/5) sore masih dirawat di rumah sakit swasta di daerahnya. Sedangkan kesibukan korban kebakaran lainnya sudah membersihkan reruntuhan rumah. Jiran tetangga sibuk mengumpulkan bantuan di jalan raya Pematangsiantar-Tebingtinggi. Peristiwa kebakaran yang terjadi Selasa tengah malam, itu sempat membuat warga Kel. Tanjung Tongah yang jauh dari jalan besar dan padat perumahan, panik, ketika api mulai membakar rumah Jumiti. Kepala cabang PT.Jamsostek Pematangsiantar, Rasidin,SH bersama Kepala Bidang Umum dan SDM Ferri Rinaldi dan stafnya Robby, yang menerima kabar tentang adanya rumah karyawan pabrik terbakar, Rabu sore langsung ke lokasi kebakaran memberikan bantuan berupa beras dan air mineral kepada korban. Bantuan spontan itu, sebut Rasidin, untuk membantu korban sebelum bantuan lainnya turun. (crap)

Bangun Jembatan Bailley Di Simalungun SIMALUNGUN (Waspada): Guna menanggulangi rusaknya jalan penghubung antara Kab. Simalungun dengan Kab. Batubara akibat bencana alam setahun lalu, tepatnya di Nagori (Desa) Pematang Syahkuda, Kec. Gunung Malela, Pemkab Kabupaten Simalungun akan bekerjasama dengan Kodam I/BB untuk memasang jembatan bailley. Bupati Simalungun JR Saragih, mengungkapkan itu saat bersama Dandim 0207/Simalungun, Sekda Gidion Purba, serta beberapa pimpinan unit kerja di jajaran Pemkab Simalungun, meninjau jembatan itu, baru-baru ini. Bupati menjelaskan, jembatan itu merupakan jalur utama bagi masyarakat untuk melakukan aktivitas sehari-hari sehingga sejak jembatan itu rusak, masyarakat harus melewati areal perkebunan yang tentunya akan memakan waktu lebih lama. “Karena itu, kita akan meminta bantuan TNI untuk menanggulangi jembatan ini,” katanya. Menurut bupati, Pemkab Simalungun telah berulangkali mengajukan permohonan dan berkoordinasi dengan provinsi agar jalanitusegeraditanggulagi,namunhinggasaatinibelumjugaditangani. “Untuk itu, Pemkab Simalungun akan melakukan kerjasama dengan TNI memasang jembatan bailley milik TNI,” katanya. “Soal jembatan bailley milik TNI, kita sudah berkomunikasi dengan Pangdam I/BB dan secara prinsip pihaknya telah setuju. Saya juga sudah membuat surat permohonan kepada Pangdam. Saya yakin jembatan bailley akan segera terpasang, karena saya paham betul, TNI akan selalu hadir untuk mengatasi kesulitas masyarakat,” papar bupati. (a30)

ATM Tak Berfungsi, Nasabah BRI Kecewa PAKPAK BHARAT (Waspada): Kekecewaan para nasabah Bank Rakyat Indonesia (BRI) Unit Salak kian panjang. Setelah sebelumnya sekira dua minggu mengalami gangguan, kini Anjungan Tunai Mandiri (ATM) yang terdapat di BRI Unit Salak juga mengalami kerusakan hampir sepanjang hari. “Sudah sekitar tiga minggu terakhir ATM-nya tidak berfungsi lagi dan selalu tertutup rapat” ujar W. Tumangger salah seorang nasabah BRI Unit Salak pengguna ATM. Kepala Unit BRI Salak Daniel Sitepu kepada Waspada, Selasa (21/5), menyebutkan, satu minggu terakhir pihaknya telah melakukan perbaikan, namun belum kunjung mampu menuntaskan masalah kerusakan jaringan yang dihadapi pihaknya. “Tahu sajalah Pak, kita ini kan bisnis Pak. Ada persaingan,” sindir Sitepu. Ia berjanji, kerusakan tersebut awal Juni 2013 dituntaskan. Kerusakan jaringan yang disebabkan serangan virus terhadap jaringan dan ATM mereka akan dituntaskan dengan melakukan pembersihan serta melakukan pengetatan pengamanan. “Kita akan melakukan penggantian home, sehingga seluruh pelayanan kita dapat normal kembali,” pungkasnya. (csb)

Residivis Jual SS PEMATANGSIANTAR (Waspada): Meski sudah menjadi residivis akibat perbuatan yang sama, seorang kuli bangunan, AH, 40, warga Jalan Pondok Indah, Kel. Bantan, Kec. Siantar Barat, Kota Pematangsiantar diduga menjual narkotika jenis sabu-sabu (SS) sehingga ditangkap Sat Narkoba Polres. Penangkapan terhadap AH dilakukan Sat Narkoba Polres di rumahnya pada Selasa (21/5) pukul 05:00. Saat dilakukan penangkapan, ditemukan barang bukti yang disita dari dalam rumah AH berupa SS 10 paket kecil. Penggrebekan ke rumah AH dilakukan Sat Narkoba yang dipimpin KBO Ipda Resbon Gultom, sesudah menerima informasi dari masyarakat yang menyebutkan adanya peredaran narkotika di Jalan Pondok Indah. Penggerebekan dilakukan sesudah melalui penyelidikan dan pengintaian berjam-jam di sekitar rumah AH. Kapolres Pematangsiantar AKBP Alberd TB Sianipar, S.Ik, MH saat dikonfirmasi melalui Kasubbag Humas AKP Efendi Tarigan dan Kasat Narkoba AKP Sofyan, Rabu (22/5) menyebutkan AH tetap ditahan dan masih dalam pemeriksaan serta pengembangan. “Pada 2010, ketika ditangkap, AH juga menolak barang bukti yang didapat darinya. Tapi, dalam persidangan, AH dihukum 4 tahun penjara dan menjalani hukuman 2,6 tahun,” imbuh Sofyan. (a30)

P E M ATA N G S I A N TA R (Waspada): Otorita Asahan menyatakan dana bina lingkungan dari PT Inalum Rp772 miliar yang seharusnya disalurkan PT Inalum ke 10 kabupaten/kota di kawasan Danau Toba, Sumatera Utara sejak tahun 20092013, menjadi milik negara yang harus disetor ke kas negara. “Berdasarkan hasil rapat Badan Pembina Otorita Asahan, diputuskan uang Rp772 miliar menjadi milik negara yang harus disetor ke kas negara. Keputusan itu dikukuhkan surat Menkeu RI pada 29 Agustus 2012, harus disetorkan ke kas negara. Menkeu RI turut memutuskan dana bina lingkungan disalurkan melalui APBN,” jawab Ketua Otorita Asahan Efendi Sirait melalui telepon selular, Rabu (22/5). Seperti diberitakan, anggota DPRD Simalungun Rospita

Sitorus mengungkapkan kepada wartawan, sesuai hasil audit Badan Pemeriksa Keuangan (BPK), dana bina lingkungan dari PT Inalum ke 10 kabupaten/kota yang berada di kawasan Danau Toba, Sumut, Rp772 miliar tidak disalurkan sejak tahun 1999-2013 dan ternyata parkir di 31 rekening dikelola Otorita Asahan (Waspada, Kamis (23/5). Sirait menjelaskan, dana bina lingkungan Rp772 miliar itu diperoleh dari sebagian keuntungan penjualan domestik PT Inalum dan dialokasikan ke 10 kabupaten/kota yang berada di kawasan Danau Toba, Sumut berdasarkan kesepakatan Otorita Asahan dengan Presiden Direktur PT Inalum. “Sejak saya menjadi ketua Otorita Asahan 2008, Otorita Asahan sudah menyalurkan dana bina lingkungan Rp25Rp30 miliar per tahun untuk 10

kabupaten/kota di sekitar proyek Asahan. Dana bina lingkungan diperuntukkan bagi pelestarian lingkungan, beasiswa dan pemberdayaan ekonomi rakyat,” papar Sirait. Namun, ungkap Sirait, sejak 29 Agustus 2012, atas saran BPK dan surat Menkeu, dana bina lingkungan itu harus disetorkan ke kas negara dan biaya program lingkungan harus melalui APBN. “Sejak Agustus 2012, kami sudah menyetorkankekasnegaraRp500 miliar. Sisanya akan disetorkan secara bertahap.” Mengenai annual fee yang belum dibayar sejak ke-27-29, Sirait menyatakan PT Inalum tiap tahunnyasudahmelunasisebagai kewajiban perusahaan. “PT InalummelaluiOtoritaAsahansudah membayar annual fee setiap tahunkeMenkeu.”MenurutSirait, annual fee dibayarkan tiap tahun di kisaran Rp50-Rp60 miliar. (a30)

40 Ranmor Ditilang Di Taput, 19 Diamankan Di Samosir TARUTUNG (Waspada): Dalam 16 hari, Sat Lantas Polres Tapanuli Utara (Taput) sudah mengeluarkan 40 tilang untuk kendaraan roda empat dan roda dua dalam pelaksanaan Operasi Simpatik Toba 2013, dipimpin Kasat Lantas AKP Eduard Simamora. “Dari jumlah tilang itu, sudah termasuk untuk pelanggaran pajak kendaraan, SIM dan tidak memakai lampu bagi roda dua di siang hari. Sedangkan teguran secara tertulis ada 234 kasus, kecelakaan lalulintas (la-

kalantas) ada tiga peristiwa di antaranya satu luka berat dan tujuh ringan serta kerugian Rp13 juta,” ujar Kasat Lantas PolresTaputdampingiKaurbinOpsLantas IPTU LS Gultom dan Kasubbag Humas AIPTU W Baringbing kepada sejumlah wartawan di Tarutung, Kamis (23/5). Menurut Kasat Lantas, tujuan dimaksimalkannya pelaksanaan operasi simpatik Toba 2013 di wilayahnya, untuk mengurangi tingkat kecelakaan dan pelanggaran Lalin di jalan raya, dan merupakan rangkaian

Waspada/Parlin Hutasoit

KASAT Lantas Polres Taput AKP Eduard Simamora pimpin Operasi Simpatik Toba 2013 dengan melakukan upaya preventif kepada pengemudi angkot.

pembinaan kepada masyarakat agar mematuhi peraturan berlalulintas. Di Samosir Untuk memberikan kenyamanan berlalulintas di jalan raya, Polres Samosir melalui Satuan Lalu Lintas giat melakukan penertiban terhadap kendaraan bermotor (ranmor) roda dua terkait kelengkapan kendaraan maupun surat-surat kendaraan di seluruh wilayah Kab. Samosir. “Hal ini dilakukan sesuai adanya keluhan masyarakat terkait sejumlah kendaraan roda dua di jalan menggunakan knalpot blong sehingga mengganggu kenyamanan masyarakat pengguna jalan, juga untuk menghindari adanya korban akibat laka lantas,” ujar Kasat Lantas Polres Samosir AKP T Sitorus menjawab Waspada di ruang kerjanya, Kamis (23/5). Lebih lanjut dia mengatakan, seluruh kendaraan roda dua yang ditahan sebagai barang bukti 19 kendaraan dan sudah diboyong/diamankan ke Mako Polres Samosir. “Namun dari sejumlah kendaraan tersebut, tidak ada yang terlibat kasus curanmor,” ujar mantan perwira Bag Ops Dit Lantas Poldasu sembari mengungkapkan, Sat Lantas Polres Samosir pada Mei melaksanakan Operasi Simpati 2013. (a21/c11)

Hari Jadi Provsu Diseminarkan P E M ATA N G S I A N TA R (Waspada): Lahirnya Provinsi Sumatera Utara (Provsu) pada 14 April 1947 di Kota Pematangsiantar merupakan bagian sejarah nasional Indonesia dan bukan sejarah lokal. Terbentuknya Sumut, mementahkan opini Belanda dalam forum internasional yang menyebutkan pemerintahan RI sudah tidak ada lagi. Apalagi, Medan sebagai ibukota Provsu sudah diduduki Belanda saat itu setelah Jakarta dan Yogyakarta. Meski tokoh Indonesia seperti Soekarno, Syahrir, Agus Salim dan lain-lain ditawan Belanda, Mr. SM. Amin yang dilantik T. Mohd. Hasan (Gubernur Sumatera) sebagai Gubernur Muda Sumut, tetap eksis menjalankan roda pemerintahan dari Pematangsiantar. Namun, karena Belanda melancarkan Agresi Militer pada 29 Juli 1974 dan menduduki Pematangsiantar, SM. Amin akhirnya pindah ke Kutaraja, Aceh untuk mengatur strategi pemerintahan. Wilayah Sumut sendiri ketika dibentuk terdiri dari keresidenan Sumatera Timur, Tapanuli dan Aceh. Penegasan itu disampaikan tiga narasumber terdiri Dr. Phil. Ichwan Azhari (Ketua PussisUnimed),Dr.Suprayitno,M.Hum (Ketua Prodi Magister Ilmu Sejarah USU Medan) dan Muhammad TWH (Legiun Veteran RI

Medan) pada Senin (20/5) di FKIP Universitas Simalungun (USI), Jalan Sisingamangaraja, Kota Pematangsiantar, Senin (20/5) serta dipandu moderator Drs. Ulung Napitu, M.Si. Kegiatan ini merupakan rangkaian dari peringatan Hari Kebangkitan Nasional (Harkitnas) tahun 2013 yang pada saat ini diperingati di seluruh Indonesia. Dalam seminar yang dibuka Wali Kota Pematangsiantar Hulman Sitorus, SE, diwakili Sekda Donver Panggabean, M.Si, mengemuka gagasan tentang dijadikannya tanggal pelantikan Mr. SM. Amin sebagai Gubernur Muda Sumut pada 14 April 1947 sebagai hari jadi Provsu. Pelantikan SM Amin itu merupakan

tindak lanjut dari rapat Dewan Perwakilan Rakyat Sumatera (DPRS) di Bukit Tinggi pada 16 April 1946. Selama ini, peringatan Hari Jadi Provsu pada 15 April 1948. Hal ini diambil dari tanggal ditetapkannya UU tentang sistem pemerintahan yang dilanjutkan dengan pelantikan Mr. SM Amin sebagai Gubernur Sumut oleh Presiden Soekarno pada 19 Juni 1948. “Tapi, perlu diingat, Provsu sudah lebih dulu ada ketimbang UU itu, hingga, pelantikan pertama SM Amin sebagai Gubernur Muda di Pematangsiantar 14 April 1947, dirasa lebih tepat dibuat sebagai hari jadi Sumut,” tegas Ichwan Azhari. (a30)

Hakim Langgar Kode Etik Belum Dijatuhi Sanksi PEMATANGSIANTAR (Waspada): Wakil Ketua Pengadilan Negeri (PN) Pematangsiantar,Viktor Pakpahan sampai masih menunggu perintah dari Ketua PN Pematang siantar,Abner Situmorang,SH untuk menjatuhkan sanksi kepada hakim JP yang terbukti melanggar kode etik hakim. “Belum ada informasi (tentang sanksi) yang saya dapatkan, tapi jika ada perintah dari Ketua Pengadilan Negeri Pematangsiantar akan langsung kita jatuhkan sanksinya,” kata Wakil Ketua Pengadilan Negeri Pematangsiantar,Viktor Pakpahan,SH kepada Waspada di ruang kerjanya, Senin (20/5). Hakim JP sebelumnya diduga kuat dan meyakinkan telah melanggar kode etik hakim dan melanggar keputusan bersama ketua Mahkama Agung (MA) Republik Indonesia dan Ketua Komisi Yudisial (KY) Republik Indonesia nomor 047/KMA/SKB/IV/2009 dan nomor 02/SKB/P.KY/IV/2009. (crap)

Waspada/Bothaniman Jaya Telaumbanua

Drs. Edison Ziliwu, MM, M.Si mengucapkan sumpah janji saat dilantik menjadi Sekda Kota Gunungsitoli olehWali Kota Gunungsitoli di aula Samaeri Lantai II KantorWali Kota Gunungsitoli.

Warga Keluhkan Pelayanan Puskesmas Tongkoh BERASTAGI (Waspada): Warga mengeluhkan pelayanan Pusat Kesehatan Masyarakat (Puskesmas) Desa Tongkoh, Kec. Berastagi, Kab. Karo. Puskesmas ini dikeluhkan karena pelayanan yang kurang baik, bahkan peralatan dinilai sangat minim. “Saya sangat kecewa dengan pelayanan di Puskesmas Desa Tongkoh. Pasalnya, saat tadi pagi saya membawa anak saya, Handayani yang berumur dua tahun sakit akibat demam panas tinggi atau step, samasekali tidak dilayani perawat di Puskesmas tersebut,” terang Jhon Hendrik Peranginangin, 33, kepada Waspada, Rabu (22/5) Kekecewaan dialaminya bermula ketika dia dan istrinya Maya, 28, membawa anaknya ke Puskesmas akibat step. Namun, begitu sampai di Puskesmas yang sudah tiga tahun beroperasi, para perawat samasekali tidak menangani pertolongan pertama. Jangankan untuk dikasih obat, disentuhpun tidak. “Malah salah satu perawat yang saya temui menyarankan, untuk dibawa aja ke Puskesmas

yang lain atau terdekat, karena di situ perlengkapan seperti gas oksigen tidak ada,” terang bapak tiga anak tersebut. Kepala Puskesmas Dr Ester br Ginting kepada Waspada di ruang kerjanya mengatakan, sebenarnya kalau penyakit step tidak begitu perlu memakai peralatan oksigen, untuk penanganan pasien. “Masalah perawat saya diangap telah mengabaikan pasien, saya yakin itu tidak benar,” ujarnya. Mungkin, lanjut dia, perawatnya juga panik, karena itu perawat menyarankan untuk dibawa ke Puskesmas yang lain, agar secepatnya dapat ditangani. “Masalah oksigen tidak ada, sebenarnya ada. Tapi saat ini dalam keadaan kosong, begitu juga dengan mobil ambulance yang sudah tidak layak pakai, berikut bangunan Puskesmas ini sebenarnya tidak layak untuk dijadikan Puskesmas,” terangnya, yang mengakui sudah mengajukan kepada Kadis Dinkes, baik berupa perlengkapan peralatan Puskesmas sampai bangunan agar diperbaharui. (c19)

Peringatan Harkitnas Di P. Siantar Dan Karo PEMATANGSIANTAR (Waspada):Wali Kota Hulman Sitorus, SE memimpin peringatan Hari Kebangkitan Nasional (Harkitnas) ke-105 Kota Pematangsiantar dibantu Camat Siantar Marimbun Fidelis Sembiring, SSTP sebagai komandan upacara di Lapangan H. Adam Malik, Senin (20/5). Wali Kota turut membacakan pidato Menkominfo Ir. Tifatul Sembiring yang antara lain meminta momentun Harkitnas harus mampu melecut kembali nilai kebersamaan sebagai bangsa dalam menghadapi globalisasi dengan menggelorakan rasa bangga dan cinta tanah air. Sedangkan peringatan Hardiknas di Kab. Karo diwarnai rangkaian upacara di taman makam pahlawan Jalan Veteran Kabanjahe, Senin (20/5), dihadiri Bupati Karo diwakili Asisten 1 Terkelin SH, unsur muspida, Ketua DPRD Karo Effendi Sinukaban SE, Ketua PN Sri Kuncoro SH, Kajari Kabanjahe I Dewa Gede Wirajuna

SH, Dandim 0205/TK Letkol Meyer Putong, Danyon 125 Simbisa Letkol Parluhutan Marpaung serta Daulat AruanWakapolres Karo. Danyon Batalyon 125 Simbisa Letkol Parluhutan Marpaung yang merupakan komandan upacara usai upacara mengungapkan, peringatan Harkitnas merupakan momentum mendongkrak pribadi generasi penerus bangsa untuk bisa menghargai dan menghormati perjuangan pahlawan dengan meneruskan citacita mereka yang belum tuntas. Dandim 0205/TK Letkol Meyer Putong menambahkan, peringatan Hardiknas setidaknya memberikan semangat baru untuk meyadarkan generasi penerus bahwa, kemerdekaan fisik sudah kita raih namun perjuangan bukan berhenti sampai di situ saja tapi masih banyak yang harus diperjuangkan seperti pengentasan kemiskinan, pembangunan SDM, pembrantasan korupsi dan lain sebagainya. (a30/c10)

‘Batalkan PAW Anggota KPUD Simalungun’ SIMALUNGUN ( Waspada): Komisi Pemilihan Umum (KPU) Provinsi Sumatera Utara (Provsu) didesak membatalkan pergantian antar waktu (PAW) anggota KPUD Kabupaten Simalungun Syamsul Nahar, karena menjadi pengurus partai politik (parpol). “Dari investigasi yang kami lakukan, Syamsul Nahar menjabat sebagai Wakil Ketua Partai Kebangkitan Bangsa (PKB) Simalungun periode 2008-2013 sesuai SK DPP PKB Nomor:2872/DPP-02/IV/A.1/2008 tertanggal 31 Januari 2008,” ungkap Ketua Tim Pers Independent Pencari Fakta Pemerhati Pemilu Siantar-Simalungun RD. Manik kepada wartawan, Rabu (22/5). Menurut Manik, pihaknya sudah menyampaikan bukti keterlibatan Syamsul Nahar dalam parpol, hingga tidak memenuhi syarat dilantik sebagai anggota KPUD Simalungun menggantikan almarhum Jhon Alden Sumbayak.

“Meski ada revisi kepengurusan tahun 2011 dan nama Syamsul Nahar tidak termasuk lagi dalam kepengurusan, namun setidaknya sampai tahun 2011 yang bersangkutan masih pengurusparpol,hinggasesuaiketentuantidakboleh menjadianggotaKPUDSimalungun,”tegasManik. Ketua PKB Kabupaten Simalungun Mondanuddin Purba yang dikonfirmasi wartawan secara terpisah mengakui Syamsul Nahar pada kepengurusan periode 2008-2013 masuk dalam kepengurusan sebagai Wakil Ketua, namun pada revisi kepengurusan periode 2011-2016, namanya tidak lagi masuk dalam kepengurusan. Ketua KPU Provsu Surya Perdana yang dihubungi wartawan melalui telepon seluler menyebutkan pihaknya masih meminta klarifikasi dari PKB Simalungun, terkait nama Syamsul Nahar yang akan diproses sebagai anggota KPUD Simalungun PAW. (a30)

Pejabat Muda Humbahas Diwajibkan Naikkan IPM DOLOKSANGGUL (Waspada): Pejabat muda di Kab. Humbang Hasundutan (Humbahas) diwajibakan menaikkan Indeks Pertumbuhan Manusia (IPM) Humbahas. Selain IPM, para pejabat muda diharapkan menjadi pioner pembangunan paradigma baru dalam pengelolaan pemerintahan. Sekira 40 persen pejabat baru di Hum-bahas saat ini merupakan pengangkatan baru dari para Pegawai Negeri Sipil (PNS) yang masih usia muda. Keberanian pengangkatan pejabat baru tersebut diharapkan dapat menjadi motivasi untuk para PNS di Humbahas agar bersaing dalam peningkatan mutu kualitas kerja dalam pelayanan publik. “Dari 54 pejabat yang kita lantik, 40 persen tenaga baru yang kita harapkan sebagai apresiasi untuk kinerja baik mereka di Humbahas,” ujar Sekretaris Daerah Kabupaten (Sekdakab) Humbahas Saul Situmorang kepada wartawan di Doloksanggul, baru-baru ini.

Mantan Kepala Bappeda Taput ini, mengatakan, para pejabat baru tersebut juga diberikan target untuk pencapaian sejumlah nilai di Humbahas terlebih dalam peningkatan sumberdaya manusia. Sebab salah satu tolak ukur prestasi yang diraih Humbahas tidak lepas dari peningkatan IPK. “Angka pasti saya kurang ingat, yang pasti mereka harus mampu menaikkan IPK Humbahas,” jelasnya. Selain itu, para pejabat baru juga diberikan tanggungjawab untuk pemaksimalan kerja di masing-masinginstansi,sehinggajikadalamenam bulan para pejabat baru tidak menunjukkan hasil, Pemkab akan mengambil langkah baru. Anggota DPRD Humbahas JimmyTogu Purba mengatakan,pengelolaanpemerintahansepenuhnya ada di tangan kepala daerah. Segala bentuk upayauntukpemaksimalanmutupelayananpublik akan didukung legislatif. “Sehingga jika ada inovasidalampenataanpemerintahanyangpositif akan kita apresiasi,” katanya. (a21)

Pemkab Humbahas Datangkan Dokter Spesialis DOLOKSANGGUL (Waspada): Minimnya pelayanan Rumah Sakit Umum (RSU) Doloksanggul akibat tidak adanya dokter spesialis yang permanen akan dibenahi tahun ini. Pembenahan tersebut meliputi penyedian dokter spesialis tetap dan insentif yang tinggi. Sekretaris Daerah Kabupaten Humbang Hasundutan (Sekdakab Humbahas) Saul Situmorang SE.Msi mengatakan, saat ini Pemkab Humbahas sedang menunggu kembalinya sejumlah dokter spesialis yang sedang melakukan tugas belajar di luar daerah. Untuk tahun ini, Pemkab Humbahas akan menarik kembali dokter yang disekolahkan daerah sesuai dengan berakhirnya masa tugas belajar. “Ada empat dokter spesialis yang saat ini kita sekolah, dua di antaranya tahun ini akan kembali ke daerah dan melayani masyarakat

secara intensif,”ujarnya kepada wartawan di Doloksanggul,baru-baru ini. Saul mengatakan, untuk menunjang ketersediaan dokter spesialis tersebut Pemkab Humbahas telah menyiapkan dana Rp15 juta per bulan untuk masing-masing dokter Selain itu, keberadaan dokter nantinya akan mengisi kelengkapan seluruh fungsi pelayanan di RSU Doloksanggul. “Jadi kita minta semua bersabar saja, Pemkab serius membenahi pelayanan kesehatan ini,” jelasnya. Ketika ditanya mengenai keberadaan sejumlah tenaga yang tidak sesuai dengan fungsinya di RSU Doloksanggul, termasuk direktur yang dinilai banyak pihak sebagai titipan salahsatu kepala daerah, Saul mengatakan bahwa itu tidak benar. Sebab selama ini pelayanan RSU Doloksanggul sudah cukup maksimal. (a21)


B4 1 CM 2 CM

WASPADA

Rp. 12.000 Rp. 24.000

3 CM Rp. 36.000 4 CM Rp. 48.000

BURSA

AUTOMOTIVE Informasi Pembaca

Bursa Automotive

AC BR CL ND DB

: : : : :

Air Condition Ban Radial Central Lock Nippon Denso Double Blower

PS PW RT VR EW

: Power Stearing : Power Window : Radio Tape : Velg Racing :Electric Window

BMW 317, Thn 97, Warna biru Metalic, Hub : 061 7628 4576 CHEVROLET AVEO 1,5 L AT Matic, Thn 2005 Warna Silver Metalik (Over Kredit) Balik Dp 30 Jt(Nego). Sisa Angs 2,7Jtx19 B u l a n . Hub Hp 0 8 7 8 6 8 0 2 2 4 8 3 DAIHATSU BARU SAHABAT KELUARGA

- Grand Max Pu Dp 10 Jt Angs 2,5 Jtan 4 Th - Xenia X Plus Dp 29 Jt Angs 3,5 Jtan 4 Th - Xenia R Dlux Dp 33 Jt Angs 4,2 Jt 4 Th Proses Cepat data Di jemput. Info pemesanan Hub: HASIBUAN ASTRA : 081263624634 ( Siap membantu anda)

DAIHATSU TERIOS Tx th 2009, W. Hitam, Ac Doble, lengkap, sehat, original, tngn pertama, pemakai jarang pakai. Hrg : 162 Jt/ Damai. Hub : 0853 6182 2458

DAIHATSU MOBIL 100 % Baru dan Kredit Termurah, Discount Full. Xenia 1300 cc Dp 30 Jtan / Nego Terios Dp 30 Jtan / Nego Grandmax 1300 cc Dp 12 Jtan / Nego Data Dijemput pasti ok. Hub PRIMA 0852 616 5427 - SARIAMAN MARPAUNG, 0852 7023 1310 DAIHATSU FEROZA Th’94, Hitam, Bk Medan, Lengkap. Sangat Mulus, Masih Orisinil. Jl. Jermal IV No 84 Denai Medan. Hp. 0823 7006 7110

“DAIHATSU BAGI HADIAH” GRAN Max PICK UP 1.3 DP 11 jt’an Angs 2 jt’ an Gran Max Minibus 1.3D Dp 23 jt’an Angs 2 jt’an Luxio D Dp 27jt’an Angs 3 jt’an Xenia 1.0 D Dp 27jt’an Angs 3 jt’an Terior Ts’Xtra Dp 32 jt’an Angs 3 jt’an Hubungi : Erwin HP 081263154132 DAIHATSU ESPAS 1.600 cc Minibus, Warna Biru Met, Bk Medan, Cat dan mesin mulus, Siap pakai. Hrg Nego. Hp 0811652506 DAIHATSU CHARADE Thn 80, W.biru, Hrg Rp. 12 Juta. Nego. Hub : Jl. Aluminium II. No 11. Tnjng Mulia. Hp 081397704080 DAIHATSU CHARADE CLASSI Thn 94. W. Abu- Abu Met. Lengkap Bk Medan. Hub : Jl. Aluminum II. No 11 Tg Mulia. Hp 081397704080 ALL NEW XENIA (2) DUAL AIR BAG

New Xenia 1.3 X (Air Bag) Dp 37 Jt Angs 3,6 (59 Bulan) New Xenia 1.3 R. Dlux Dp 40 Jt. Angs 3,9 (59 Bulan) New Grand Max Pu 1.3 Dp 10 Jt Angs 2,5 (48 Bulan) Panjar Sekarang Ke : Arif Nasution Astra 081260052465

HYUNDAI ACCENT Th 2000. Warna Hitam, Cat Mulus, Bk Medan, Komplit. Harga 52 Jt Nego. Hub. 081265992655

HYUNDAI ATOZ Th 2000, Warna Biru, Mulus, Lengkap. Hub 085296632368 HYUNDAI ATOZ Thn 2000 Tipe GLS Warna Silver/ Abu - Abu Metalik, Bk Medan, Ac, Tape, Velg Racing. Mobil Sangat Terawat dan mulus. Siap pakai. Jl Gaperta Gg. Pembangunan No. 52 B. 0812 6049 2216

HONDA ACCORD PRESTIGE Thn 87. W Merah. Siap pakai, Lengkap, Bk Medan. Hub : Jl. Aluminium II No. 11 Tg Mulia. Hp 081397704080

5 CM 6 CM

Rp. 65.000 Rp. 78.000

MERCEDEZ - BENZ 1996 C-200

Hitam Metalic, Bk Medan Asli (No. PIL), Jok Kulit. Dual Air Bag, Mulus, (Original). Hub : 0813 6113 8100 (Tanpa Perantara)

Rp. 91.000 Rp. 104.000

BURSA

LOWONGAN

NISSAN 100 % BARU Dp 15 JTAN March Dp 20 JTAN Grand Livina X Trail, Juke, Serena Evalia, Elgrand, Navara. Hub Sdr Bintang = 061.770 666 18/ 0813.9397.4840

TOYOTA AVANZA Th 2007, W Silver Mtalic, Ac, Tape, Vr, Br, Ps, Pw, Cl, Jok kulit. Bk Medan, Body Kaleng Mulus. H. Nego. Hub 0852 7599 6758 TOYOTA INNOVA Th 2008, W Hitam Metalic, Ac, Dbl, Tape, Vr, Br, Ps, Pw, Cl, Bk Medan, Body Kaleng mulus seperti baru. H. Nego. Hub 0813 6233 0595 TOYOTA KIJANG CAPSUL. Th 2003, W Biru Metalic, Ac, DBL, Tape, Vr, Br, Ps, Pw, Cl, Jok kulit. Bk Medan. Body Lempang Mulus. H. Nego. Hub 0813 7582 3555

DIJUAL 1 UNIT TOYOTA TWINCAM Thn 90, Warna Hijau Met, Ac Dingin/ Tape/Ban Baru.Harga 45,5 Jt Nego. 082361577916

INFO TOYOTA BARU

Dapatkan Special Harga Dan Info Seputar Toyota Baru Hub. Anwar Damanik 082370880815

TOYOTA LGX Bensin Tahun 2003, War na merah Hati, Satu Tangan Dari Baru. Hub081376393977 Dan 08126003736 (TP) # DEALER TOYOTA BARU #

Dapatkan Info Dan Penawaran Terbaik Kami Seputar Toyota Baru Anda, Hub Anwar Damanik. 082370880815

TOYOTA KIJANG LSX THN 2003, Warna Biru metalic, Ac, Db, Pw, Cl. Bensin. Hub : 0812 6032 3982 TOYOTA KIJANG LGX 1,8 CC Efi Pemakaian 2004, W. Kuning Silver Plat Bk Lengkap. Ac Double, Tape, Tape, Pr, Br, Cl, Pw, Remot. Jok Kulit Mulus Original Body Kaleng. Bu Hub. Hp. 0823 6152 9274 MDN.

TOYOTA KIJANG KAPSUL LGX Th 97. Bensin.Hrg 90 Juta. Nego. Hub : Hp 0852 6162 5469

BUTUH DANA PINJAMAN DANA CEPAT

ISUZU PANTHER New Royale Thn’99, W. Biru, Bk Asli Mdn, Ac Dbl, Pw, Ps, Tp, Vr, Br, Jok kulit, Mobil sehat, Terawat dan mulus sekali, siap pakai. Hrg 76 Jt Nego (Jual cepat/BU). Hub : 0853 6082 8533

ISUZUPANTHER HI-GRADE Thn’95, Bk Asli Medan, Biru Met, Cantik & Bagus. lengkap. Rp 64 Jt/Nego. Hub : 0813 9765 4472

Jaminan apa saja Sertifikat Tanah mobil & Sp. Motor. Segala tahun. Hub. 061-8222774 HP. 0853 6199 1500

BU T U H DAN A

DANA CEPAT

1 HARI CAIR JAMINAN : SHM, SKC, AKTA NOTARIS SYARAT GAMPANG HUB : 081260181864

1. Tenaga Pijak Refleksi & Body Massage 2. Facial, Totok Wajah Syarat : - Pria & Wanita, Menarik, Umur max 30 Tahun - Berpengalaman Min 1 Thn (Pendapatan Tinggi ) Lamaran & Test Jl. Yos Sudarso No 138 M. P. Brayan Medan Hp : 08129369406

DIBUTUHKAN TENAGA KERJA/ KARYAWAN

SUZUKI APV TIPE X Th 2005, W. Hitam, Ac Doble, Tape, Tv, Cd, Vr, Br, Bk Mdn, Sgt Mulus. Jrg Pakai. Hrg : 100 Jt/Damai. Hub : 0813 7618 8118

SUZUKI DP 46 Jt-an Bawa Pulang Ertiga BIG Dp 17 Jt-an Bawa Pulang Pick Up PROMO Hub:081264400770/ 085297747999

9 CM Rp. 126.000 10 CM Rp. 140.000

DICARI TERAPIST

Griya ANANTA REFLEXOLOGY & FAMILY SPA

SUZUKI CARRY Pick up Th 99. W.Hitam, SUZUKI Carry Alexander Th 92 W. AbuAbu,Tape, Vr, Br, Body Lempang Mulus. H. Nego. Hub 0852 6129 5788

Spesialis Surat Rumah dan BPKB. Proses 5 Jam Cair, Tanpa Usaha, 3 Juta - 1 Milyar. Jaminan, SHM, SK Camat, HGB. BPKB Mobil, Spd. Mtr, Truk, Mobil kredit. Dan Bantu Pelunasan BPKB. Hub. Family Finance. 0813 7044 6668 - 0813 7044 6633

MITSUBISHI L300,M.B. Star Wagon 2002, BPKB 1 Nama, Non Ac.Mesin sehat, Body Lempang. Peminat Hub 082166415998

7 CM 8 CM

Segera daftarkan untuk ditempatkan jd Guru TK/Paud hub: Jl. Karyawisata No. 23A Johor. Phone: 7861690, Hp: 085262704985 Medan

DIBUTUHKAN SEGERA

Kami perusahaan yang bergerak di bidang kontraktor membutuhkan karyawan, untuk ditempatkan sebagai:

-Staff Administrasi Dengan syarat-syarat sbb :

1.Wanita 2.Belum Menikah 3.Pendidikan min D3 (Jur. Sekretaris, Akuntansi dan Manajemen Perkantoran) 4.Dapat Menggunakan Aplikasi Komputer Dengan Baik. 5.Dapat Menggunakan Internet 6.Diutamakan yang sudah memiliki pengalaman kerja di perusahaan kontraktor 7.Dapat bekerja dalam tim 8.Berpenampilan menarik, bertanggung jawab, jujur dan memiliki integritas tinggi Surat Lamaran kami terima paling lama 1 minggu dari Iklan ini diterbitkan. Surat Lamaran dikirim ke alamat:

CV. CITRA MATRA PRATAMA Jl. Sunggal No. 411 Kec. Medan Sunggal Medan Telp/Fax : 061-8468562

DIBUTUHKAN SEGERA

Tenaga Kerja Untuk Posisi: X Finance/Keuangan (Code: F/K) X Accounting (Code: ACC) X Tele Marketing/EO (Code: TM) X Customer Relation Officer

(Code: CRO) X Administrasi Kantor (Code: AK) X Multimedia/Design Grafis/Komputer (Code : IT) Syarat: a. Min. D3 (S1 Diutamakan) Sesuai Bidangnya, b. Laki2/Perempuan, c. Fresh Graduated are Welcome (Pengalaman di bidangnya dan kemampuan IT adalah prioritas), d. Komputer, Bahasa Inggris, bisa baca Al-Qur’an, e. Alumni ESQ diutamakan (Lampirkan ID Alumni dan atau sertifikat), f. Suka Organisasi, Kerja Keras, Target, Under pressure, g.Bersedia ditempatkan di seluruh Grup Bisnis dan Cabang seluruh Indonesia atau Luar Negeri. Lamaran ditujukan ke : ESQ Leadership Center - ACT Consulting SUMBAGUT (Wilayah Sumatera Utara - Aceh) U.p. HR Reps./Department Jl. Gaperta/Manaf Lubis No. 25 C, Helvetia, Medan - 20124 Email to: aji.esq165@gmail.com, cc ke: yk.aswin@yahoo.co.id Paling lama 2 (dua) minggu setelah iklan terbit

Di Perbengkelan, Bersedia ditempatkan di Jalan pasar Merah, Jln Pondok Kelapa, Jln setia Budi. Posisi Sebagai 1.Kasir/Pembukuan 2.Door Smeer (Cuci Mobil) 3.Mekanik (Berpengalaman) 4.Asisten Mekanik 5.Tukang bubut Lamaran diantar Ke : Bengkel Star Servis Jalan Setia Budi Pasar V No. 435 / 88 S Hub : Bpk. Ronald Simanjutak Di : 081361253678

DIBUTUHKAN SEGERA Universitas Graha Nusantara Padang

Sidimpuan yang sedang dalam proses penegerian melakukan rekruitmen untuk calon dosen dengan kualifikasi pendidikan S1 program studi : Matematika, Fisika, Biologi, Kimia, Teknik informatika, Teknik Mesin, Teknik Elektro, Teknik Pertambangan, Teknik Sipil dan Teknik Arsitektur. Bagi peserta yang telah mengikuti test dan dinyatakan lulus akan disekolahkan kembali mengambil beasiswa Pra S2 ke ITB, ITS dan UGM. Bagi anda yang berminat silahkan mengajukan lamaran dengan persyaratan sebagai berikut : 1.Pria dan wanita 2.Memiliki ijazah S1 dan tidak sedang mengikuti pendidikan formal lainnya. 3.Menguasai komputer (MS. Office, Power Point) 4.Memiliki dedikasi yang kuat untuk dunia pendidikan dan bersedia untuk melanjutkan pendidikan dengan beasiswa Pra S2 apabila dinyatakan lulus. 5.Bersedia mengikuti tahapan ujian yang dijadwalkan 6.Membayar uang kontribusi sebesar Rp.100.000,(seratus ribu rupiah),pada mengikuti test. Persyaratan Administrasi : 1.Surat lamaran asli ditulis dengan bermaterai Rp. 6000,2.Curriculum Vitae 3.Foto copy ijazah Strata 1 dilegalisir 4.Foto copy transkip nilai 1 Strata1dilegalisir 5.Foto copy KTP 6.Pas Photo ukuran 3x4 = (2) dua lembar Ketentuan : A)Lamaran Ditujukan Kepada Rektor Universitas Graha Nusantara Padang Sidimpuan B)Persyaratan Administrasi & Surat Lamaran Dapat diantar Langsung atau Dikirim via pos dengan alamat Ruang BAAK Kampus II Universitas Graha Nusantara Padang Sidimpuan Jl. Dr Sutomo No. 14 Gg. Ikip Kota Padang Sidimpuan Kode Pos 22718 C)Pendaftaran ditutup tanggal 25 Mei 2013 dan ujian Seleksi akan dilaksanakan tanggal 29 Mei 2013 Di kampus II Universitas Graha Nusantara Padang Sidimpuan D)Informasi Lebih Lanjut silahkan hubungi 081260463587 ( Bpk. Emirza)

LOWONGAN KERJA

Sebuah Perusaahaan Outsourcing yang bergerak di bidang Pengamanan ( Security ) membuka lowongan pekerjaan sebagai berikut : A. Ka. Operasional. - Pria, max. 60 tahun - Pensiunan TNI / PORLI (Min. Mayor atau kompol) - Mampu bekerja dibawah tekanan dan mempunyai program kerja yang baik - Bisa bekerja dalam tim, dan memiliki kemampuan komunikasi yang baik B. Staff Operasional - Pria, max. 38 tahun - Pendidikan min. SMA - Pengalaman min. 2 tahun di bidang operasional - Disiplin, jujur, ulet, dan bertanggung jawab - Bisa bekerja dalam tim, memiliki kemampuan komunikasi yang baik - Mampu bekerja dibawah tekanan dan mempunyai program kerja yang baik C. Manager - Pria, max. 40 tahun - Pendidikan min. S1 (semua jurusan ) - Pengalaman min. 3 tahun dibidang Outsourcing - Mampu menguasai computer - Mampu bekerja dibawah tekanan dan mempunyai program kerja yang baik - Disiplin, jujur, ulet, dan bertanggung jawab - Bisa bekerja dalam tim, memiliki kemampuan komunikasi yang baik D. Ka. Personalia - Pria / Wanita, max. 38 tahun. - Pendidikan min. S1 Hukum - Pengalaman min. 2 tahun dibagian personalia - Disiplin, jujur, ulet dan bertanggung jawab - Bisa bekerja dalam tim, memiliki kemampuan komunikasi yang baik - Mampu bekerja dibawah tekanan dan mempunyai program kerja yang baik E. Security F. S u p i r ( D r i ve r ) Untuk lamaran mohon dikirimkan ke alamat PT. W ir a Pr adana Mukti Jalan Gatot Subroto No 325 ( Depan Brastagi Supermaket ) selambat - lambatnya 1 minggu setelah iklan lowongan ini diterbitkan

MINI & EFEKTIF IKLANKAN PRODUK ANDA

11 CM Rp. 165.000 12 CM Rp. 180.000

IKLAN KHUSUS 6x1,5 kolom Rp. 120.000

Jumat, 24 Mei 2013

FAX.4561347 Info Iklan Hub. 0821 60 126688

HARGA BELUM TERMASUK PPN 10%

AMANAH UMROH

BURSA

UMROH 2013

PROPERTY

-

Informasi Pembaca Bursa Property

G R : Garasi LB KM : Kamar Mandi LT KP : Kamar Pembantu RM KT : Kamar Tidur RT SHM: Sertifikat Hak Milik

: Luas Bangunan : Luas Tanah : Ruang Makan : Ruang Tamu

RUMAH DIJUAL

Luas : 342 M2 SHM, 3 KT, 2 KM Tegel Gg. Damai Lr. Teratai No. 107 P. Brandan harga 500 Jt boleh nego. Hub : 0852 7681 4650, 0852 6134 6717

Umroh Reguler 9 Hari Umroh Reguler 14 Hari Umroh Plus Turkey 12 Hari Umroh Plus Dubai 22 Juni Umroh Ramadhan: 9 Hari 14 Juli 11 Hari 17 Juli 14 Hari 12 Juli

14 & 27 Juni 21 Juni 17 Juni 2013

Bagi Jamaah luar kota menginap di Hotel Madani (Gratis)

DIJUAL RUMAH

Pesawat via Singapore

Komp Villa Malina, 2 KT, 1 KM, Ruang tamu, Ruang Tv, Luas tanah 8x15 M.Komplek Di Pinggir Jalan Ringroad Setia Budi. Hp 081375606299

DAFTAR SEGERA

KANTOR: GEDUNG GELORA PLAZA Lt. 1 Jl. SM. Raja No. 4 / 18 Medan

Telp. 061-7326981, 0813 7503 1889, 0852 6213 3488

DIJUAL RUMAH MEWAH

Hal Luas untuk Kel Besar. Uk. Tembok keliling ABCD 1500m. Surat SHM Sertifikat. Uk 30x36 m. 1.067m, Jl. Purwosari Komp DPR Medan dkt cemara asri dan Komp Wartawan. harga 2,8 M/ Nego. Hub 081377489000

RUKO DIJUAL

Jl. IR Juanda 4x17M. 3 1/2 Tingkat Sebelah BRI/Depan ACE - MDN. Hub. 061 7624 1933

DIJUAL RUMAH MASIH BARU

JL. STM Komp Suka Cipta Residence No. 18 (Sudut Kanan). SHM, 2 TK, 3 KT, 2 KM, UT 7,5 x 14 M, Type 86/ 84, Siap Huni, Strategis (Bisa Tembus JL. Sm Raja) HUB : 081375762777 /082160200550

RUMAH MINIMALIS

Uk : 7,5 x 13,5 M. Keramik Siap Huni. Harga 90 Jt/Nego. D. Bandar Klippah. Hub: 081361380916 082362851907

DIJUAL MURAH RUKO 3 TINGKAT

SHM, Komp. Makro Bisnis Center. No. 27 C. Jl. Gatot Subroto Km. 8. Harga 720 Jt. Hub. 0823 7061 2467 DIJUAL RUMAH Di Jl Mandor Krakatau LT : 640 M2, LB : 250 M2, SHM. Hub : 08192011688 DIJUAL RUMAH PERMANEN Uk tanah 15x30 M. SHM. Komplek BTN(samping Kantor DPR). Krg Baru. K. Simpang ( A C E H TA M I A N G ) H a r g a 6 0 0 J t . Nego. Hp 081362190476

DIJUAL RUMAH

LT : 300 M2, LB : 280M2, 2 Lantai, 3 KM, 5 KM, SHM. Jl. kupula II No 14 L. SKEP. B.ACEH. Hub : 085277051366 (Tanpa Perantara)

DIJUAL

Rumah Masih baru Jl. BERINGIN VII Simp Jl Balai Desa No. 42 B Helvetia Gaperta. (SHM) LT/LB. 225/140m2. KT 4, KM 2, Ac 2 Bh, Air Panas, Kicthen Set, Kompor Tanam 4 Tungku, Gas alam, Kulkas jumbo 2 pintu Masih baru, Mesin Cuci, meja/kursi makan jati, 2 buah lemari pakaian, 2 bh tempat tidur, Garasi / Carport bisa 3 bh mobil,(TP) Hrg 900 Juta Nego Hub 0 8 1 1 6 0 3 0 5 8 Atau 08126459438

DIKONTRAKKAN Ruko 2 Lantai beserta usaha pangkas 4 kursi cocok dijadikan usaha salon Jl. Mencirim/Depan Pasar Lama. Kp. Lalang Medan, Serius Hub :081361796525

PERUMAHAN SAMANHUDI PERMAI

Jl. Samanhudi Kec. Binjai Selatan Kotamadya Binjai Segera miliki “RUMAH TYPE 36/72 TANPA DP” dengan cicilan : 10 tahun = 950.600,-, 15 tahun = 736.200,-, 20 tahun = 635.200,Hub : 082161075500, 085297204172, TERBATAS !!! 061 821 6177

DIJUAL CEPAT/ MURAH (BU)

Rumah Mempunyai Sertifikat Hak Milik BPN. Jl. Puri Gg. Wasono No 4i Medan Kota. Peminat Hub. 0812 6323 8511 (TP) DIJUAL

2 UNIT RUKO 3 Tingkat (Baru) Jl. Matahari Depan Kantor Perumnas Helvetia. Hub : 081370238010

CV. ZAK COMMUNITY Jl. Karya Jaya - EKADAME II

Mengerjakan *Design Rumah

*Konstruksi *Landscape /Taman *Pengukuran *Pemetaan Hub : Bapak Said - Hp : 081264058059

LOWONGAN KERJA

Pergur uan ISLAM AS-SYAFI’IYAH INTERNASIONAL MEMBUTUHKAN :

1. GURU, 2. SEKRETARIS, 3. SATPAM SYARAT : A. Lulusan S1/A IV (1) B. Memiliki Laptop (1) C. Mampu Berbahasa Inggris Min Pasif (1,2) D. Dapat Mengoperasikan Power Point (1) E. Memiliki Kendaraan Sendiri (1,2,3) F. Berpenampilan Menarik (1,2,3) G. Lamaran Ditulis Tangan H. Pengalaman 2 Tahun (1,2) I. Usia Max 35 Tahun J. Sehat Jasmani dan Rohani K. Diutamakan tamatan Sekretaris (2) L. Tinggi Badan Min 168 CM (3) * Kirimkan Lamaran Lengkap Ke Jl. Karya Wisata II No 1 Medan Johor * Test Akan Dimulai Tanggal 27 Mei 2013 DIJUAL RUMAH

6X10 M, Luas Tanah 1200 M2. Desa Sekip Jl Sadar Lubuk Pakam Harga 400Jt/Nego. Hub 0857 6185 4615

TANAH DIJUAL TANAH

Sebidang Tanah Sawah/ Darat Luas 16 Rante. Harga Rp. 16,5 Jt/ Rante/ Nego (SHM). Lokasi Tepi Irigasi Besar dan Jalan Besar Di Dusun V Desa Pematang Sijonam Kec. Perbaungan Serdang Bedagai. Hub. Pemilik 0821 6262 7448 (ALAN) LANGSA

DIJUAL TANAH SHM Ukuran 19x58 M. Jln Panglima polem (Kp Jawa Belakang) Hub : 0896 8543 5200 DIJUAL TANAH Pinggiran Jalan 5Mx25M Jl. JOHOHAR SEI MENCIRIM DEPAN MASJID AL IKHLAS 100M SIMPANG PAJAK REBO 08126057661

Ingin Promosikan Produk Anda Harian

WASPADA Media yang Tepat untuk Iklan Anda

PESANTREN MODERN DARUL ULUM AL - MUHAJIRIN TSANAWIYAH - ALIYAH

DI ASUH ALUMNI2 TIMUR TENGAH - SAUDI ARABIA, MESIR DAN INDIA PRESTASI : JUARA I B. ARAB - B. INGGRIS SE KAB LANGKAT PROGRAM UNGGULAN : B. ARAB - B. INGGRIS, SAINS - TAHFIZUL QUR’AN SARANA : BOLA KAKI, VOLLY, BASKET DLL DAFTARKAN SEGERA PUTRA/I BAPAK DAN IBU KE : PESANTREN DARUL ULUM AL MUHAJIRIN JL. BINJAI KUALA KM 13 PADANG CERMIN SELESAI LANGKAT CONTACT PERSON : 0813.7630.8291 / 0821.6792.1296

DR H SYAFII SIREGAR, MA Ketua Yayasan

H.ABD.MALIK SARUMPAET, MA Pimpinan Harian

DIJUAL TANAH

Jl. Pukat IV No. 5 Bantan Timur Medan Tembung. L: 388m2, 3M. Nego. SHM. Hub. 0813 7672 9352 Putra a.n. Babang DIJUAL TANAH

AKSES Jln Non TOL Ke Bandara Kuala Namu (Beroperasi 25 Juli 2013) & Jarak 3 Km Ke Bandara sisi Kiri, Luas I = 3700m2, II = 1550m2, III = 413 m2 SHM & S K C a m a t ( TA N A H KAMPUNG BUKAN EX. PTPN) cocok buat Kantor, Rumah Makan, Hotel, Pembuatan SHM dapat dibantu, Maaf TP Hub : 081396640992

DIJUAL SEGERA

Tanah Lokasi : Jln Protokol Dan L.Pakam Km 21 Sertifikat : No 173 Panjang : 40 M lebih Lebar : 20 M Harga : Rp 655 Juta T. Perantara: ------Hubungi 082168742031

SERVICE

AC

TV

ELEKTRONIK CUCI + B. PASANG

Kulkas, M. Cuci, Dispenser H u b . M a j u Te k n i k - 061.7030 118 - 0813 6244 4913

PAKAR TV TOSHIBA, SONY, POLYTRON. DLL. Kulkas, M.Cuci, Lcd, Projection Hub RIDWAN Hp 081263034400. Siap ditempat & Bergaransi

TERCECER

TELAH TERCECER

Surat Tanah AN. HAJI HAFSHUDDURI. No 10/5/ STB/1989 Tgl 25 April 1989 Sekitar Jln Perniagaan Kota Stabat Menuju Medan. Anggota ahli Waris An. Solahuddin. Alamat Jl. Fl Tobing / Kasuari Lk-III Kisaran.

TERCECER

Telah Hilang/Tercecer Lampiran Dari Surat Pelepasan Hak Ganti Rugi No. 593.83/271/ 1990 Tanggal 14 Februari 1990. Lampiran yang Hilang Tercecer Yakni :

1. Surat Pernyataan/Pengakuan tanggal 03 Februari 1990 2. Surat Keterangan kepala Desa SM. DISKI No. 593.83/ / 1990

Hilang Tercecer Di Sekitar Jl. Bintang Terang Dusun XV Desa Muliorejo Kecamatan Sunggal Sampai Jalan Binjai Simpang Kp. Lalang Km 9,5, Tercecer pada Hari Kamis Tanggal 01 Mei 2013 Sekitar Pukul 16.00 Wib BERITA TERCECER

1(satu) buah surat tanah Ukuran 10x46 Mtr. No.241/LEG/ 0 1 7 / V I I I / 2 0 0 5 Te r l e t a k d i Jl.Sukabaru Link. VI Kel Padang Bulan Selayang I. Kec. Medan Selayang. A N . T H E R E S I A TARIGAN

TERCECER BERITA TERCECER

1(satu) Buah surat tanah Ukuran 23x30 Mtr. No. 305/LEG/ 0 1 7 / X / 2 0 0 4 Te r l e t a k D i J l . Sukabaru Gg. Pribadi Link VI Kel. Padang Bulan Selayang I. Kec. Medan Selayang. AN IR Ruslan Ginting

BERITA KEHILANGAN

Telah Tercecer IJAZAH SD, SMP, SMA, Dan Perguruan Tinggi USU atas nama MUKMIN SALEH SIREGAR di JL. Mandala By Pass Kec. Medan Denai. Bagi yang menemukan IJAZAH tersebut, Mohon dapat di Berikan Kepada saya, Alamat : Jl. Usman Siddik Gg. Wongso, TITI SEWA atau Hubungi Saya, Telp . 061-7851353 Hp . 081361072176 Saya tidak akan menuntut dan akan diberikan imbalan sepantasnya

TERCECER/HILANG

BKPB & STNK BK 313 DB. A/N GABRIEL HARSO PRASETYANTO, IR. Jln Anugerah VII No 11 Ds Sampali Kec. P. Seituan. No Sin 0053482 - IE No Ka EP70 - 9502323

TERCECER

STUK. BK 8845 CO.No uji : AB 01.016613. A/N: FAJAR AGUNG EXPRESS. ALAMAT : Jl Letda Sujono No 312 Medan. Merk : HINO

HILANG/TERCECER

1(Satu) buah Bpkb Mobil No. 5158 554 N. Bk 8332 LU. AN. PT Arista Putra Mandiri. Alamat: Jl. Sisingamangaraja/ Jl. Alfalah I Medan

TERCECER

STUK. BK 1590 GL. No uji : MDN 60732 A. A/N : MOPEN MORINA. ALAMAT : Jl. Letda Sujono No. 18 Medan. Merk : DAIHATSU


Sumatera Utara

WASPADA Jumat 24 Mei 2013

B5

Tersangka Komplotan Penembak Toke Getah Orang Dekat Korban P.SIDIMPUAN (Waspada): Dalam waktu 1 x 24 jam, personel Sat Reskrim Polres Tapanuli Selatan berhasil menangkap satu dari lima komlotan pelaku penembakan yang menewaskan toke getah, Sangkot Siregar, 55, di Desa Sipenggeng, Kec. Batangtoru. Informasi di MapolresTapsel, Kamis (23/5), pelaku berinisial

SP alias UP, merupakan orang dekat atau kepercayaan korban.

Warga Gunungtua Jae Harapkan Perbaikan Rambin Dan Madrasah PANYABUNGAN (Waspada): Warga Desa Gunungtua Jae, Kec. Panyabungan, Kab. Mandailing Natal mengharapkan pemerintah daerah segera memperbaiki rambin dan madrasah yang rusak diterjang banjir bandang Aek (Sungai ) Rantopuran Februari 2013. “Selain rambin yang rusak parah, tiga lokal gedung madrasah milik masyarakat hanyut terbawa arus banjir dan kini kedua fasilitas tersebut membutuhkan pembangunan dari pemerintah maupun pihak lain,” ujar Edi Junaedi, tokoh masyarakat Desa Gunungtuajae kepada Waspada, Kamis (23/5). Menurutnya, rambin yang menghubungkan Desa Gunungtua Jae dengan Desa Lumbanpasir yang tersisa hanya abutmen saja. Sebelum hanyut dihantam banjir, keberadaan jembatan gantung tersebut selama ini sangat vital sebagai jalur ekonomi kedua desa menuju persawahan dan perkebunan warga. “Sejak rambin itu roboh, aktivitas pertanian dan perkebunan warga menjadi terkendala dan makin sulit dalam hal pengangkutan hasil pertanian. Begitu juga akses menuju dan pulang sekolah bagi anak sekolah makin sulit, karena anak-anak harus memutar jalan dengan jarak tempuh yang jauh,” ucapnya. (a28)

Wakil Menteri PU Kucurkan Anggaran Bangun Madina PANYABUNGAN (Waspada): Dalam rangka perjalanannya dari Sumatera Utara ke Sumatera Barat, Wakil Menteri Pekerjaan Umum (PU) Hermanto Dakdak singgah di Kab. Mandailing Natal, tepatnya di Kota Panyabungan, Rabu (22/5). “Wakil Menteri PU telah melihat secara langsung kondisi berbagai infrastruktur di Madina, kemudian kepada beliau telah kami sampaikan insfrastruktur yang dibutuhkan masyarakat dan ini akan menjadi bahan masukan bagi Kementrian PU untuk mengucurkan anggaran pembangunan pusat nantinya ke daerah ini,” ujar Wabup Dahlan Hasan Nasution. Kunjungan singkat Hermanto disambut Wakil Bupati Madina Dahlan Hasan Nasution di rumah makan Paranginan II Jalan Lintas Timur Panyabungan. Selain melihat secara langsung berbagai kondisi infrastruktur di daerah ini, rombongan Hermanto menikmati hidangan khas Mandailing Natal di tempat tersebut. Sambil mencicipi kuliner asli Madina di rumah makan itu, Wabup Dahlan Hasan menyampaikan kepada Wakil Menteri PU berbagai fasilitas insfrastruktur yang sangat dibutuhkan masyarakat, khususnya dana pembangunan jalan. Sejumlah ruas jalan saat ini banyak mengalami kerusakan. Dahlan menjelaskan, pihak Kementerian PU melalui Hermanto Dakdak bersedia membantu anggaran untuk pembangunan berbagai sarana infrastruktur di Madina. “Wakil Menteri PU menyatakan siap memberikan bantuan untuk percepatan pembangunan infrastruktur di Madina, karena sekarang ini sudah banyak yang rusak parah bahkan belum tersentuh pembangunan,” ungkapnya. (a28)

Alumni SMPN 1 Siabu Reuni Akbar PANYABUNGAN (Waspada): Seratusan alumni SMP Negeri 1 Siabu, Kab. Mandailing Natal (Madina) angkatan 1982 mengadakan reuni akbar di aula Hotel Rindang Panyabungan, Kamis (23/5). Acara disponsori Hj.Ti Aisah Ritonga yang juga anggota DPRD Sumatera Utara (Sumut) dari Partai Demokrat, bertujuan menjaga dan meningkatkan silaturrahmi antara sesama alumni. Hadir diacara reuni, empat guru SMPN 1 Siabu yang sebagian sudah pensiun dan ada yang masih aktif. Ti Aisyah Ritonga dalam sambutannya menyampaikan silaturahmi didasari rasa rindu dan untuk mempererat persaudaraan antar sesama siswa angkatan 1982. Ia juga menyampaikan terimakasih sedalam-dalamnya kepada semua dewan guru yang telah banyak mengajari pengetahuan sehingga mampu dalam menjalani hidup meraih kesuksesan. (c14)

Pihak keluarga korban sejak awal memang sudah menaruh rasa curiga terhadap tersangka. Sebelum kejadian, pelaku dan korban sama-sama mengambil uang penjualan getah ke pabrik Kirana Sapta di Desa Panompuan, Kec. Angkola Timur, Tapsel. Namun di tengah perjalanan pulang atau di Desa Sianggunan, SP alias UP turun dan membiarkan bosnya itu pulang sendirian ke Batangtoru mengendarai Toyota Fortuner

BB 1007 HC. “Kita mengidentifikasi SP alias UP sebagai salahseorang di antara pelaku, setelah memintai keterangan sejumlah saksi. Kemudian dikuatkan oleh rekaman percakapan dan pesan yang ada pada telepon selularnya,” kata seorang perwira di Mapolres Tapsel. Saat ini, sebut sumber, beberapa personel Sat Reksrim Polres Tapsel telah membawa tersangka SP alias UP ke salahsatu

tempatdiluarProv.SumateraUtara untuk mengejar dan menangkap empat tersangka lainnya. Masih menurut sumber yang merupakan perwira di Polres Tapsel ini, korban ditembak dengan jarak yang tidak terlalu jauh menggunakan senjata api laras pendek (pistol-red) jenis FN. Diperkirakan, saat ditembak korban sedang mengemudi dan menelepon seseorang dengan posisi kaca sebelah kanan mobil terbuka. (a27)

‘Jika KPU Palas Jujur Dan Tegas, Tidak Ada Calon Perseorangan’ SIBUHUAN (Waspada): Jika Komisi Pemilihan Umum (KPU) Kab. Padanglawas (Palas) selaku panitia penyelenggara pemilihan umum kepala daerah (Pemilukada) jujur dan tegas dalam menjalankan tugas sesuai aturan yang ada, diprediksi tidak akan ada calon perseorangan yang lolos. Demikian Ketua Fraksi PDI Perjuangan DPRD Kab. Padanglawas Idham Hasibuan, Rabu (22/5). Katanya, saat ini proses verifikasi factual berkas dukungan calon perseorangan sedang berjalan di tingkat PPS, untuk menentukan kandidat yang akan masuk dalam bursa pencalonan Bupati dan Wakil Bupati Pemilukada Palas, September 2013. Karena, menurut sejumlah informasi dan data diperoleh, dukungan calon perseorangan hampir rata-rata setiap desa atau tingkat PPS dimanipulasi, tidak ada data dukungan yang valid, malah ada indikasi pemal-

suan KTP untuk mendapatkan data dukungan perseorangan. “Dan bila manipulasi data dukungan calon perseorangan ini tetap diterima dan tidak ada tindakan, maka sama halnya panitia penyelenggara pemilukada turut melakukan manipulasi dalam pelaksanaan Pemilukada Palas,” ujar Idham Hasibuan. Atas Siregar, Divisi Teknis Penyelengga Pemilu KPU Kab. Padanglawas, mengatakan, saat ini sedang berjalan verifikasi faktual terkait dukungan calon perseorangan, untuk mempertegas kebenaran dukungan pasangan calon bersangkutan. Dikatakan, menurut berkas dukungan yang masuk di KPU Palas, pasangan calon Rustam E. Hasibuan- Tongku Halik Hasibuan mendapat dukungan dari 15.000 lebih pemilih di Padanglawas, sedang pasangan dr. Alwi Mujahid HasibuanSupartin mendapat dukungan 113.750.

Dukungan Dicatut Sejumlah warga Kab. Padanglawas protes karena nama mereka dicatut pasangan calon perseorangan sehingga fotokopi KTP dan tandatangannya ada di berkas dukungan pasangan itu, padahal mereka tidak merasa memberi dukungan. “Yang menjadi pertanyaan bagi saya adalah dari mana mereka mendapatkan fotokopi KTP itu, bahkan nama saya juga dicatut dalam dukungan tersebut. Saya menduga ada keterlibatan pihak lain,” ungkap Ilyas Hasibuan, warga Desa Pasar Latong Kec. Lubuk Barumun, yang juga salahsatu pengurus Partai Demokrat di Desa tersebut. Karena itu, dukungan terhadap calon Bupati dan calon Wakil Bupati Palas (bukan Padanglawas Utara/Paluta seperti dilansir Waspada sebelumnya) periode 2014-2019 dari jalur perseorangan, diduga direkayasa. (a33/a34)

Persoalan Lahan PTPN IV Kebun Sosa Belum Tuntas SOSA (Waspada): Koperasi Tani (Koptan) Sinar Fajar Desa Hutaraja Lamo, Kec. Sosa, Kab. Padanglawas (Palas) akan kembali menagih penyelesaian lahan afdeling IX PTP Nusantara (PTPN) IV Kebun Sosa yang sampai saat ini belum tuntas. Warga meminta direksi tidak tutup mata, apalagi sebelumnya telah ada kesepakatan bersama. Sejumlah elemen masyarakat Desa Hutaraja Lamo menilai, pimpinan PTPN IV Kebun Sosa tidak memiliki niat tulus untuk menyelesaikan persoalan lahan dengan masyarakat yang berada di sekitar lingkungan perusahaan milik BUMN itu. Seperti disampaikan Idham Hasibuan, Ketua Koperasi Sinar Fajar Desa Hutaraja Lamo yang juga anggota DPRD Padanglawas bersama Kepala Desa Hutaraja Lamo Ibrahim Hasibuan, SP, bahwa masalah lahan afdeling IX PTPN IV Kebun Sosa

yang sampai saat ini penyelesaiannya belum tuntas. Dikatakan, walaupun telah berulangkali dilakukan mediasi mencari solusi penyelesaian, malah sejumlah kesepakatan telah dibuat, namun tetap saja masyarakat dibohongi, dengan berbagai dalih dan alasan demi menunda penyelesaian. Termasuk, lanjut dia, yang terkhir telah ada hasil kesepakatan bersama antara PTPN IV dengan Koperasi Sinar Fajar serta Muspida Plus, 25 November 2010 lalu yang ditandatangani unsur pemerintah, legislatif, pihak PTP N IV juga dari Koperasi Sinar Fajar. Dan notulen perjanjian tersebut sesuai dengan surat tuntutan Koperasi Sinar Fajar No.01/KTSP/XI/2010, dengan catatan apabila tidak direalisasikan pihak PTPN IV, maka Koperasi Sinar Fajar berhak menduduki afdeling IX. Di antara poin kesepakatan

itu termasuk, pihak PTP N IV akan meminta agar BPN melakukan pengukuran lahan plasma Mondang II selambatnya April 2013. Selain memberi dana talangan hidup kepada masyarakat anggota koperasi Sinar Fajar Rp400.000/bulan mulai 2012 hingga maret 2013. Kemudian PTP N IV akan melakukan pemeliharaan, penyisipan, pemupukan dan pemanenan di lahan plasma koperasi Sinar Fajar sampai akhir April 2013, seterusnya diserahkan ke koperasi Sinar Fajar Desa Hutaraja Lamo. Ironisnya, lanjut dia, satu butir dari hasil kesepakatan bersama itu sampai saat ini tidak ada yang dipenuhi pihak manajemen PTP N IV kebun Sosa. Manajer PTP N IV Kebun Sosa Ir. Nasrul, Kamis (23/5) saat coba dikonfirmasi tidak berhasil. Menurut Darmanto, Asisten Tata Usaha PTP N IV Kebun Sosa, manajer sibuk dan banyak tamu. (a33)

Waspada/Sori Parlah Harahap

PASANGAN Letkol Kav Sutan Siregar-Ir Zukifli Rambe resmi mendaftar ke KPU sebagai calon Bupati dan calon Wakil Bupati Paluta. Pasangan ini datang mengenakan seragam putih polos dikawal ratusan pendukungnya.

PDIP Dan PPP Daftarkan Sutan-Zul Ke KPU Paluta GUNUNGTUA (Waspada): Hari ke lima pembukaan pendaftaran Calon Bupati dan Wakil Bupati Padanglawas Utara (Paluta), pasangan Letkol Kav Sutan Siregar-Ir Zukifli Rambe resmi mendaftar ke KPU Paluta, di Jalan Bangau, Kel. Pasar Gunungtua, Kec. Padangbolak, Kamis (23/5). Pasangan ini diusung Partai Persatuan Pembangunan (PPP) yang memiliki dua kursi di DPRD Paluta dan PDI-P memiliki tiga kursi. Pantauan Waspada, pasangan ini datang mengenakan seragam putih polos dikawal ratusan pendukungnya, berjalan kaki dari Kantor PDIP Jalan Gunungtua-Langga Payung, Kel. Pasar Gunungtua menuju ke Kantor KPU Kab. Paluta berjarak sekira 1 Km. Di Kantor KPU, pasangan ini sempat menuliskan buku tamu sebelum menemui Ketua KPU untuk menyerahkan berkas pendaftarannya. Ikut serta juga seluruh pengurus Parpol pendukung yakni dari PDI Perjuangan dan PPP; ter-

masuk ketua dan sekretaris. “Insya Allah, saya sangat optimis bisa memenangkan Pilkada atas izin Allah SWT dengan pasangan saya Zulkifli Rambe,” ucap Sutan. Sutan juga menyampaikan, dia senang bisa berpasangan dan bekerjasama dengan Ir. Zul Kipli Rambe. Karena, sosok Ketua DPC PPP ini merupakan tokoh muda yang berpikiran maju untuk membangun Paluta. Disinggung soal kompetisi yang akan dijalaninya dalam Pilkada Paluta melawan figur incumbent, terutama sosok Drs H Bachrum Harahap yang merupakan Calon Bupati berpasangan dengan H Riskon Hasibuan yang masih menjabat sekarang ini, Sutan menyatakan, hal itu tidak menjadi persoalan. “Saya ini maju untuk mengedepankan kepentingan bangsa dan masyarakat. Masalah incumbent atau tidak, itu semua kita serahkan kepada rakyat,” ungkap Sutan sambil berjalan meninggalkan Kantor KPU bersama rombongan pendukungnya. (a35)

Kuliah Dari Usaha Kain Klos Rakitan PROBLEM kampas kopling aus sering dialami pengemudi mobil. Bagaimana cara menanganinya ketika keuangan Anda sedang tipis? Tentunya, Anda tak ingin mengalami celaka, walaupun harus tetap melakukan pengiritan. Memang, kampas kopling berbagai jenis mesin diesel dan non-diesel, juga kampas kopling sepedamotor di setiap kendaraan memiliki fungsi yang tak lepas dari komponen (sparepart) mesin lainnya untuk menggerakkan dan memindahkan persineling. Waspada/Ahmad Cerem Meha Adamal Tampubolon, ADAMAL Tampubolon, 36, seorang mahasiswa Fakultas 36, seorang mahasiswa Ekonomi salahsatu PTS di Kota Padangsidimpuan menggeluFakultas Ekonomi salahsatu ti usaha kain kampas kopling manual dengan harga relatif perguruan tinggi swasta terjangkau. (PTS) di Kota Padangsidimpuan menggeluti usaha kain kampas kopling ekonominya demi masa depan yang lebih baik manual dari lentik jemari tangannya. Tentu saja di bengkel sewaannya merakit kampas kopling dengan harga murah dan relatif terjangkau (kain klos) yang sederhana di Jalan Sudirman, Kel. Sadabuan, Kota Padangsidimpuan, depan dibanding harga buatan pabrik. Usaha kecilnya itu mengantarkannya ke Bank Sumut.“Harga kain klos (kampas kopling) PTS dan menafkahi tiga anaknya dari seorang rakitan kita masih terjangkau dibandingkan istri guru SD di kota pelajar itu. Alhamdulillah, buatan pabrik. Bila mesin tak kuat lagi di tanjakan, berarti kain klosnya sudah aus,” ujarnya kepada saat ini dia sedang menyusun skripsi. Namun, Adamal berupaya mendongkrak Waspada, Rabu (22/5). Ahmad Cerem Meha


Opini

B6 TAJUK RENCANA

Kurikulum Lama Gagal Arang Habis Besi Binasa

K

ementerian Pendidikan dan Kebudayaan akan menentukan nasib pelaksanaan Ujian Nasional (UN) melalui konvensi nasional yang akan digelar pada September mendatang, tempatnya mungkin di Jakarta. Memutuskan UN lewat konvensi memang sesuatu yang baru. Artinya, pemerintah dalam hal ini Kemendikbud tidak ingin dicap diktator sehingga menggunakan konvensi untuk mengesankan demokratis. Hemat kita, tidak sulit memprediksi hasilnya. Sebab, konvensi yang diselenggarakan Kemendikbud bisa saja diatur hasilnya. Biasanya para utusan sudah mendapat briefing atau arahan untuk memilih pyoyek UN tetap berjalan. Inilah yang selalu terjadi di jalur pemerintahan, harus taat dan patuh pada pemimpin. Sehingga kalau sinyal dari pimpinan proyek UN harus diadakan setiap tahun maka konvensi tak ubahnya adegan sinetron seremonial karena hasilnya sudah direkayasa sejak dari daerahdaerah. Seperti halnya konvensi di partai politik. Tidak murni ditentulan oleh masyarakat di masing-masing daerah. Selalu yang menentukan adalah pengurus DPC dan DPD sehingga arahan atau kuncinya selalu dari pusat (DPP).Konvensi yang dibuka oleh Partai Demokrat (PD) masih penuh tanda tanya, apakah memang murni atau hanya untuk pencitraan semata. Masalahnya elektabilitas partai pemenang Pemilu ini lagi anjlok di mata masyarakat akibat banyaknya kasus suap dan korupsi yang melanda para elite partai berlambang bintang mercy, antara lain kasus Nazaruddin dan Angelina Sondakh (keduanya sudah divonis), menyusul tokoh di atasnya Andi Mallarangeng dan Anas Urbaningrum. Tokoh yang kita sebut terakhir sudah dipecat dari jabatan Ketua Umum DPP PD pasca penetapannya sebagai tersangka oleh KPK. Ide konvensi memang bagus tapi faktanya selalu direkayasa. Kalau mau mengadakan konvensi tirulah konvensi ala pemilihan calon Presiden AS. Semuanya terbuka dan bisa dibuktikan hasilnya benar-benar murni pilihan rakyat di berbagai daerah. Kita yakin kalau murni merupakan suara dari masyarakat maka bakal banyak tokoh nasional yang ikut serta dalam konvensi Capres Partai Demokrat atau parpol lainnya. Tapi, kalau hanya seremonial belaka maka yang maju nanti hanyalah tokoh karbitan yang tidak kuat di akar rumput. Sebab, yang berkualitas sudah tahu bakal kalah dan akan mundur teratur. Justru itu ide Kemendikbud mengadakan konvensi untuk memutus nasib UN tergantung dari kejujuran elitenya. Bisa saja konvensi hanya akal-akalan karena selama ini proyek UN selalu ditentang oleh masyaIntisari rakat dan guru sehinggasetiap tahun selalu saja ramai pihak-pihak mempermasalahkan UN diberlakukan untuk SD, Kurikulum lama model perlu-tidaknya SMP dan SMU. multiple choice dianggap Poin penting lain, berdasarkan Peraturan Nomor 32 Tahun 2013 yang ditangagal maka kurikulum Pemerintah datangani Presiden Susilo Bambang Yudhobaru jangan sampai me- yono pada 7 Mei lalu disebutkan bahwa pemerintah menugaskan Badan Standar Nasiongalami nasib sama. nal Pendidikan (BSNP) adalah penyelenggara UN di tingkat pendidikan dasar dan menengah dikecualikan untuk jenjang SD/MI/ SDLB atau sekolah sederajat lainnya. Artinya, besar kemungkinan UN untuk tingkat SD/MI/SDLB atau sederajat bakal ditiadakan tahun depan. Sebab, kualitas pembelajaran di masing-masing daerah selalu tidak sama sehingga sulit untuk bisa di UN-kan. Mustahil soalnya bisa disamakan sehingga model ujiannya pun harus diubah. Tidak lagi UN tapi disesuaikan dengan sarana dan prasarana pendidikan di masing-masing daerah sebagai solusi tepat menggantikan proyek ‘’mubazir’’ UN. Jika UN untuk SD sudah dihapus, maka sejalan dengan diberlakukannya kurikulum pendidikan baru pada tahun 2013 ini tidak tertutup kemungkinan untuk meniadakan UN untuk strata di atasnya. Sehingga kontroversi UN dapat diakhiri dengan elegan. Tidak ada yang merasa dikalahkan dan dimenangkan. Yang penting kualitas pendidikan nasional yang saat ini carut-marut, terkesan ganti menteri ganti kurikulum, hanya menghamburkan uang negara yang konon mencapai ratusan miliar rupiah setiap tahunnya, namun hasilnya nol besar. Terbukti dunia pendidikan kita semakin tertinggal, kalah dengan negara-negara lain, seperti Singapura, Malaysia, Thailand dan Filipina. Dengan pemberlakuan kurikulum baru 2013 diharapkan metode pengajaran siswa semakin mengarah pada penalaran berpikir anak didik untuk meningkatkan kualitas dan daya saing pelajar kita yang selama ini terkesan hanya menghafal dan seriusnya saat menjelang UN dengan membahas soal-soal belaka sehingga tingkat kompetensinya semakin rendah. Ke depan dunia pendidikan kita akan semakin tertinggal jika model pendidikan, sarana dan perkembangannya semakin tidak kondusif. Kita setuju diterapkan kurikulum baru yang menelan anggaran mahal Rp2 triliun lebih. Tapi agar tidak sia-sia kurikulum baru harus diikuti dengan peningkatan kualitas guru karena metode mengajar dan buku-bukunya ikut berubah. Kurikulum lama dengan model multiple choice atau pilihan ganda sudah dianggap gagal. Maka kurikulkum baru bisa mengalami nasib carut-marut yang sama jika gurugurunya tidak mengubah model mengajarnya. Ibarat pepatah arang habis besi pun binasa.+

APA KOMENTAR ANDA SMS 08116141934

Faks 061 4510025

Facebook Smswaspada

+6281360615480 ASSLM ‘ALAIKUM pak ustadz Tgk H Ameer Hamzah. Terima kasih atas tulisan bapak di waspada kolom al bayan tentang azab akhirat. Sungguh air mataku menetes membacanya ingat dosa yang telah kulakukan. Hanya pertolongan Allah yang mampu menyelamatkanku dari siksa. +6281376263859 Pak Arifim...kita tidak bisa lepas dari Mazhab. .sumbernya semua dari Rasul. Mazhab yang 4 itu tdk pernah bentrok ..malah saling meng Imami satu sama lainnya. Biarlah orang Tahlilan,tepung Tawar, Azan Jum’at 2X, baca Yasin di kematian. Kalau masih menyalahkan mengakibatkan persoalan besar nantinya. Lihat muslim Palestina tercerai berai di hajar Jahudi...Muslim Rohingnya kucar kacir di hajar Buddha di Myanmar. Kalau perlu rekrut aja relawan Muslim kesana berperang Jihad Fisabilillahl. Ini...baru paten pak Arifin. .biayanya pak Arifin lah yang tanggung semuanya.. Nama pak Arifin akan harum sampai liang kubur...yakinlah....Pak.... ....jangan seperti ini lagi nama bapak jadi jelek jadinya. Sok hebaat...sok pintar..sok segala2nya.. Berthobatlah ..Pak...mumpung masih terbuka pintu Thobat untuk Bapak. Intinya yang benar itu adalah Allah SWT. +6281375134878 Engkau lebih tau marikita menuntut ILMU Sampai MATE Terimakasih WASPADA +6281375134878 Saudaraku penulis Apa komentar Anda Sabtu 18 mei 2013 anda Keliru Bid’ah hanya mengenai ibadah adapun mobil hp itu hal Dunia kata Rasulullah SAW Duniamu. +6285260220574 Sebagai orang awam dan miskin ilmu agama, tolonglah para ulama/ustad/kyai/guru agama menjelaskan apa yang ditulis dr. Arifin Sakti SpKK mengenai bid’ah dalam ibadah yang di sebutkannya itu. Saya mohon dengan sangat penjelasannya lewat harianWASPADA ini agar tidak ada keraguan dalam hati saya sebagai orang yang bodoh agar kelak saya berbahagia di akhirat nanti. AMIN... +628126430089 Apakah Prof Ali Jum’ah yang dari Mesir lebih pintar dari Umar r.a. ? Sehingga ada USTADZ yang lebih menerima penafsiran si Prof masa kini mengenai Tawasul daripada yang dicontohkan para Sahabat Nabi s.a.w. ? Sadarlah ziarah kubur diperlukan hanya untuk mengingatkan manusia akan hak yang paling hakiki, yaitu mati. Bukan untuk tujuan lain. Be careful ustadz, bisa terjebak syirik. +628126430089 Tanda tangan saksi hanya untuk keperluan dunia (hukum negara), sedang eksistensi saksi nikah adalah persyaratan hukum Islam (dunia dan akhirat). +6281219617084 Islam kau permalukan dengan bawa nama2 Partai dakwah (partai korupsi sapi ) harapan nya kepada seluruh kita masyarakt untuk bisa memilih pemimpin masa depan yang baik Jangan ada terulang pemimpin korup dan bawa2 Agama Islam nan suci dan bersih . Dan jangan pula Alquran kita suci nan mulia kau korupsi pengadaan ny karena sudah cukup 0,56% dari tanah republik ini kau timbun dengan lumpur perusahaan mu (lapindo) dan maju pula jadi capres. Hati2 masyarakat di tenggelamkan nya ingat dia orang bisnis. +6281375411631 Laporan ada main judi dan ada transaksi narkoba aja cepat responya, tapi ada laporan anak hilang eh di suruh cari dulu,udah jumpa baru lapor. Polisi apaan tuh,makanya masyarakat sekarang banyak yang pada geram sama yang namanya polisi, karena melayani masyarakat milih2, mana yang cepat cairnya itu yang di respon. Hancur kita di buatnya. Berubahlah wahai polisiku, biar masyarakat sayang padamu. Semoga...

WASPADA Jumat 24 Mei 2013

PKS: Korupsi & Loyalitas Kader Oleh Wasisto Raharjo Jati Gejala disorientasi ideologi tarbiyah mulai menggejala di tubuh PKS ketika partai ini secara terbuka mulai membuka diri sebagai partai terbuka dengan merangkul tokoh-tokoh non Islam.

P

rahara yang tengah menerpa Partai Keadilan Sejahtera (PKS) sekarang ini tidak hanya menurunkan derajat elektabilitas partai politik tersebut, namun juga menimbulkan disorientasi terhadap nilai-nilai gerakan tarbiyah maupun dakwah di Indonesia. Hal ini dikarenakan PKS sendiri tumbuh dan berkembang dari gerakan tarbiyah yang terinspirasi harakah (gerakan) Ikhwanul Muslimin di Mesir sehingga kedua hal tersebut saling bertautan sama sekali. Maka isu korupsi daging sapi impor dan gratifikasi terhadap perempuan tentunya membuat orang semakin skeptis ide-ide pemurnian agama Islam yang ditawarkan oleh PKS dan tarbiyah. Padahal sebelum adanya kedua kasus tersebut, PKS sebenarnya merupakan partai yang solid baik dari sisi pengkaderan maupun loyalitas terhadap ideologi. Nilai-nilai dakwah memang sangatlah ditonjolkan dalam strategi PKS baik sesama internal umat Islam maupun eksternal seperti halnya jihad, taat, tsabat (sungguh-sungguh), tajarrud (tahan godaan), ukhuwah, dan tsiqah (tenggang rasa). Maka tidaklah mengherankan apabila PKS kemudian banyak memiliki massa baik dari internal maupun eksternal. Solidilitas maupun loyalitas tersebut dibangun melalui model dakwah gerakan tarbiyah di Indonesia yakni tanzhimi, sya’bi, muassasi, daulah. Tanzhimi berarti dakwah secara sembunyisembunyi melalui sistem halaqah dari rumah ke rumah, sya’bi yakni pendirian institusi-institusi pendidikan sebagai basis penggemblengan para calon kader PKS. Hal tersebut dapat kita simak dari berdirinya lembaga sekolah Islam terpadu, institusi ekonomi syariah, maupun lembaga zakat. Muassasi yakni model kelembagaan yakni berdirinya partai (hizb) sebagai alat perjuangan, dan yang terakhir adalah daulah (negara). PKS sendiri sebenarnya merupakan perwujudan dari muassasi tersebut sebagai representasi dari partai

berbasis dakwah. Nama keadilan sebenarnya merupakan konstruksi ideologis Ikhwanul Muslimin yang bertujuan mengangkat kesetaraan umat Islam di dunia. Langkah PKS menuju daulah sebenarnya sudah terbaca saat Pemilu 2004 dimana partai ini meraup suara sebesar 8.325.020 suara atau 7,34% suara nasional yang sebelumnya hanya 1.436.563 (1,37 persen). Lonjakan tersebut memang sangatlah luar biasa bagi PKS yang notabene partai baru dengan ideologi baru dalam konstelasi politik Indonesia yang serba pragmatis. Adapun pada Pemilu 2009 lalu 8.206.955 (7,9 persen), dan mampu menaikkan jumlah kursinya di DPR naik menjadi 57 kursi (10 persen). Disorientasi Dakwah Dan Politik PKS Gejala disorientasi ideologi tarbiyah mulai menggejala di tubuh PKS ketika partai ini secara terbuka mulai membuka diri sebagai partai terbuka dengan merangkul tokoh-tokoh non Islam. Hal tersebut sebenarnya menjadi bibit konflik pertama bagi PKS yang sebenarnya mengajarkan dakwah politik dalam pemurnian agama Islam. Terbukanya partai politik tersebut mengakibatkan tokoh-tokoh non kader mulai masuk dan menggerogoti ideologi tarbiyah partai tersebut. Hal inilah yang sekiranya bisa menjelaskan kemunculan Ahmad Fathanah sebagai orang luar PKS namun dekat dengan petinggi PKS. Meskipun demikian, dalam tingkatan internal kader sendiri, ada fenomena unik yang perlu dicermati dalam soliditas dan loyalitas kader terhadap partai tersebut. Adapun survei yang dilakukan Bulaksumur Empat Research and Consulting menarik untuk dicermati mengenai loyalitas dan soliditas kader sebagai alat katrol elektabilitas partai politik. Rilis yang digelar pada pertengahan Mei 2013 lalu memperilihatkan seberapa besar kekeuatan kader dalam memengaruhi keadaan elektabilitas beberapa partai politik peserta Pemilu 2014 bila Pemilu

digelar pada waktu dekat ini. Partai Nasdem menjadi partai yang memiliki tingkat reabilitas kader sebesar 17,3 persen, disusul Partai Keadilan Sejahtera (PKS) 16,1 persen, Partai Demokrasi Indonesia Perjuangan (PDIP) 15,7 persen, Gerindra 13,2 persen, Hanura 12,1 persen, Demokrat 7,9 persen, Partai Golkar 6,2 persen, Partai Amanat Nasional (PAN) 2,1 persen, Partai Persatuan Pembangunan (PPP) 1,7 persen, Partai Kebangkitan Bangsa (PKB) 1,5 persen, Partai Bulan Bintang (PBB) 1,4 persen, Partai Keadilan dan Persatuan Indonesia (PKPI) 0,7 persen dan yang tidak memberikan jawaban sebesar 4 persen. Realita tersebut mengindikasikan bahwa loyalitas dan soliditas kader memang sangatlah menentukan kesuksesan partai politik. Munculnya PKS sebagai partai kedua terkuat tingkat realibilitas, soliditas, maupun loyalitas kader setelah Nasdem memang menjadi distorsi tersendiri. Hukum alam yang berkembang biasanya memvonis partai akan turun ketika tersangkut kasus korupsi. Dalam hal ini,

sepertinya kasus korupsi sapi maupun gratifikasi perempuan memang menjadi penurun suara eksternal dari PKS, namun sejatinya dari internal PKS sebenarnya memiliki mesin elektabilitas yang kuat dan jarang dijumpai oleh partai politik manapun. Para elit PKS mungkin melupakan nilai-nilai tajarrud (tahan godaan) yang menjadi dasar kenapa korupsi begitu menghantam PKS. Namun di satu sisi pula, kader PKS berada di bawah justru semakin solid dalam mengemban dakwah sesuai dengan nilai-nilai tersebut. Maka yang menjadi poin penting dalam masalah korupsi PKS ini adalah terjadi dualisme yakni disorientasi nilai dakwah sehingga PKS terjeremus secara kelembagaan, namun reorientasi nilai dakwah juga terjadi di tingkatan kader bahwa PKS sendiri masih bisa eksis dengan mengandalkan nilai-nilai dakwah maupun tarbiyah. Penulis adalah Analis Politik UGM Dan Bulaksumur Empat Research Consulting (BERC).

(Masa Depan) PKS Dalam Ujian Berat Oleh Sofyan Harahap Jika tidak siap berbenah diri partai agama ini bisa menjadi partai gurem alias mengalami penurunan suara drastis pada 2014.

N

asib Partai Keadilan Sejahtera (PKS) benar-benar di ujung tanduk. Tergantung bagaimana skenario Ahmad Fathanah (AF) dan Komisi Pemberantasan Korupsi (KPK). Jika keduanya buka-bukaan maka masa depan partai berasaskan Islam ini bisa tenggelam ditinggal masyarakat (umat Islam dan para kader) karena kelakuan AF dkk lebih parah dari nonmuslim. Yang pasti AF berupaya menutupi keterlibatan orang-orang PKS, terutama di kalangan elite partainya. Namun hal itu tidak mudah. Sebab, KPK sudah punya cukup bukti keterlibatan sejumlah tokoh PKS yang segera dibuka di depan sidang pengadilan. Kalau melihat taktik KPK dalam membongkar kasus yang melibatkan Presiden PKS Luthfi Hasan Ishaaq (LHI), sepertinya tidak mungkin LHI yang sudah dipecat dari jabatannya itu, bahkan sudah digantikan posisinya di DPR RI, masih bisa berkelit dan selamat dari jerat hukuman. Secara organisasi sudah tepat putusan Dewan Syuro PKS segera mengganti LHI. Reaksi positif untuk menyelamatkan PKS itu diharapkan bisa menghindari PKS dari kehancuran total. Tapi, likaliku perjalanan kasus AF dan LHI ini masih panjang, segalanya bisa terjadi. Masyarakat khususnya konstituen PKS bukan orang-orang bodoh atau mengikuti taklid buta, apalagi di kalangan komunitas terpelajarnya. Mereka cerdas. Masyarakat pada akhirnya berpikir realistis. Islam memerintahkan para pemeluknya untuk mengikuti dalil (nash berupa Al-Quran dan hadis) sehingga tidak memperkenankan seseorang untuk mengekor pemimpinnya, apalagi sudah ketahuan melakukan pelanggaran hukum dan moral. Awalnya PKS berupaya menutupi kebobrokan moral para tokohnya dengan mengatakan penangkapan LHI bermuatan politis. Sebab, tanpa pemeriksaan awal langsung dijadikan tersangka. Sementara tokoh dari partai lain, seperti Andi Mallarangeng dan Anas Urbaningrum, malah belum ditahan sama sekali. Dari segi ini terkesan KPK pilih kasih. Namun juru bicara KPK Johan Budi sudah menjelaskan, KPK tidak pilih kasih. Masalah LHI langsung dijadikan tersangka dan ditahan karena dalam kategori tertangkap tangan, sedangkan menyangkut tokoh dari Partai Demokrat bukan tertangkap tangan sehingga KPK butuh dua barang bukti dan keterangan saksi dulu. Upaya PKS membela diri dengan menyebut AF sebagai calo, makelar proyek, dan bukan kader PKS hanya sedikit menolong. Apalagi cara KPK membongkar tabiat buruk AF yang

sudah gonta-ganti perempuan cantik dari kalangan artis sinetron, penyanyi dangdut sampai mahasiswa jelas memperburuk citra PKS, seakan kader PKS punya tabiat amoral seperti AF yang merupakan teman dekat LHI. Belakangan citra PKS semakin hancur. Ternyata LHI pun punya banyak istri dan ‘’simpanan’’ istri muda yang masih duduk di bangku SMK. Kemunculan remaja belia bernama Darin Mumtazah menambah panjang daftar perempuan yang diduga terlibat dalam pusaran kasus suap impor daging sapi. Darin diduga istri simpanan tersangka LHI karena sesama pengurus PKS pun tidak mengetahuinya, namun kita hakkul yakin orang sekelas LHI mengerti betul ajaran Islam. LHI pasti menikahi istrinya yang masih ABG itu. Dalam Islam memang dibolehkan seseorang lelaki yang mampu berbuat adil mengawini empat orang wanita, menjadi istri-istrinya, membentuk keluarga sakinah, mawadah dan warahmah. Tentunya dalam hal kawin ‘’betambuah’’ ini tidak ada permasalahan dalam internal dan bagi kader PKS karena hal itu dianggap mengikuti sunnah Rasulullah. Artinya, seorang lelaki yang mampu hanya punya satu istri malah bisa-bisa dianggap aneh dan tidak menjalankan sunnah Rasulullah jika tidak berpoligami. Tradisi Arab Terkesan dalam internal PKS mengawini dua-tiga sampai empat perempuan sesuatu yang biasa saja. Tentu tidak semuanya. Mungkin sudah menjadi tradisi orang Arab yang konon di sana, keempat istri dalam satu rumah dianggap wajar. Istri pertama di lantai-1, istri kedua di lantai-2, istri ketiga di lantai3 dan istri keempat di lantai-4. Tampak lebih adil ketimbang Eyang Subur si dukun nyeleneh yang memperistri sampai delapan perempuan dalam satu rumah, masing-masing istri diberi satu kamar bersama anak-anaknya. Kita perlu mengingatkan bahwa kawin sampai empat perempuan itu merupakan ketentuan Al-Quran dan sunnah Nabi SAW. Bukan sekadar mengikuti tradisi orang Arab. Apalagi kalau niatnya sudah jelek, misalnya untuk mengalihkan sebagian harta dari hasil korupsi dan taktik pencucian uang. Tradisi yang tidak benar dan menyimpang dari ajaran Quran seharusnya ditolak. Tidak semua tradisi bangsa Arab itu bagus untuk diikuti. Kalau ingin mempertahankan tradisi leluhur bangsa lain ikutilah yang baik-baik, misalnya tentang ilmu agamanya, ibadahnya, sedekahnya, jihadnya. Bukan yang ‘’enak-enak’’nya saja mengikuti hal-hal

yang salah dengan mengatasnamakan sunnah Nabi SAW. Misalnya terkait dengan poligami dalam Islam merupakan praktik yang dibolehkan (mubah). Artinya tidak larang namun tidak dianjurkan). Islam membolehkan seorang pria beristri hingga empat orang istri dengan syarat sang suami harus dapat berbuat adil terhadap seluruh istrinya. Dan jika kamu takut tidak akan dapat berlaku adil maka (nikahilah) seorang saja. Beberapa ulama kontemporer seperti Syekh Muhammad Abduh , Syekh Rashid Ridha, dan Syekh Muhammad al-Madan (ketiganya ulama terkemuka Al Azhar “Mesir” Mesir) lebih memilih memperketat penafsiran poligami. Muhammad Abduh dengan melihat kondisi Mesir saat itu (tahun “1899” 1899), memilih mengharamkan poligami. Syekh Muhammad Abduh mengatakan: Haram berpoligami bagi seseorang yang merasa khawatir akan berlaku tidak adil. Dari situsWikipedia disebutkan bahwa Nabi “Muhammad” Muhammad SAW melakukan praktik poligami pada delapan tahun sisa hidupnya, sebelumnya ia beristri hanya satu orang selama 28 tahun. Setelah istrinya meninggal (“Khadijah” Khadijah) barulah ia menikah dengan beberapa wanita. Kebanyakan dari mereka yang diperistri Muhammad adalah janda mati, kecuali “Aisyah” Aisyah (putri sahabatnya “Abu Bakar” Abu Bakar). Mekanisme beristeri lebih dari satu wanita yang diterapkan Nabi SAW adalah strategi untuk meningkatkan kedudukan “Perempuan” perempuan dalam tradisi “Feodal” feodal Arab pada abad ke-7 Masehi. Saat itu, nilai sosial seorang perempuan dan “Janda” janda sedemikian rendah sehingga seorang laki-laki dapat beristri sebanyak mereka suka. Sebaliknya, Nabi membatasi praktik poligami, mengkritik perilaku sewenang-wenang, dan menegaskan keharusan berlaku adil dalam beristeri lebih dari satu wanita. Ketika Nabi melihat sebagian sahabat mengawini delapan sampai sepuluh perempuan,merekadimintamenceraikan dan menyisakan hanya empat. Itulah yang dilakukanNabikepadaGhilanbinSalamah ats-Tsaqafi RA, Wahb al-Asadi, dan Qais bin al-Harits. Dan, inilah pernyataan eksplisit dalam pembatasan terhadap kebiasan poligami yang awalnya tanpa batas sama sekali. Partai gurem Sesungguhnya apa yang terjadi dan dialami PKS saat ini merupakan cobaan. Terkesan PKS bangga atas peningkatan pamor partainya. Dalam setiap Pemilu pasca reformasi partai ini memperoleh penambahan jumlah suara, sehingga Pemilu 2014 menjadi ujian terberat. Jika tidak siap berbenah diri partai agama ini bisa menjadi partai gurem alias mengalami penurunan suara drastis pada 2014. Tepat kalau PKS segera melakukan evaluasi, terutama terkait soliditas dan

citra partai setelah muncul kasus suap impor daging sapi yang menyeret LHI sebagai tersangka. Sebab, upaya pembelaan diri, seperti diperlihatkan tokoh PKS lainnya sama sekali tidak banyak menolong, malah membuat PKS semakin ternodai karena KPK punya banyak cara untuk mengungkap‘’borokborok’’ dalam partai tersebut . Lihat saja pembelaan Fahri Hamzah, jelas menepuk air di dulang terpercik muka sendiri. Menurut dia, Darin (istri muda LHI) hanyalah alat yang digunakan pihak-pihak tertentu, termasuk KPK untuk menghancurkan PKS, yakni dengan cara melakukan pembusukan moral yang akan berdampak pada turunnya citra partai. KPK dituding ingin memenangkan opini publik dengan menyinggung keterlibatan wanita-wanita AF dan LHI, lalu masuk ke hukumnya. Ya, memang begitulah politik, apalagi di tahun politik menuju Pemilu dan Pilpres. Justru itu, jangan main-main dengan jabatan (amanah), jangan mengejar duniawi harta berlimpah, jangan menjadikan parpol sebagai tameng mencari keuntungan pribadi dan kelompok, sementara rakyat dan konstituen merasa ditinggalkan hanya menjadi obyek penderita.*** Penulis adalah Wapemred Waspada

Pengumuman Redaksi menerima kiriman karya tulis berupa artikel/opini, surat pembaca. Kirim ke alamat redaksi dengan tujuan ‘Redaktur Opini Waspada’ dengan disertai CD atau melalui opiniwaspada@yahoo. com. Panjang artikel 5.000-10.000 karakter dengandilengkapibiodatapenulisdan kartu pengenal (KTP). Naskah yang dikirim adalah karya orisinil, belum/ tidak diterbitkan di Media manapun. Tulisan menjadi milik Waspada dan isi tulisan menjadi tanggungjawab penulis.

SUDUT BATUAH * Kasus kecelakaan lalu lintas di Medan tinggi - Padahal jalanan macet lo! * MAS nyasar ke KNIA, salah pilot dan ATC - Anggap saja uji coba * Ekonomi Sumut tumbuh 6,3 persen - Pantesan makin ramai plaza, he...he...he

oel

D Wak


Opini

WASPADA Jumat 24 Mei 2013

B7

Fatwa MUI Kota Medan “Umat Islam selalu beda pendapat dalam mengurus jenazah”, demikian judul berita salah satu surat kabar terkemuka di kota Medan edisi Senin 8 April 2013 halaman 6. Ternyata berita tersebut adalah siaran pers Majelis Ulama (MUI) Kota Medan atas terselenggaranya Muzakarah Problematika Akhlaq pada pelaksanaan Fardhu Kifayah, Sabtu 6 April 2013. Ketua MUI Kota Medan yang diwakili Sekretaris Umum MUI Kota Medan H. Hasan Maksum M.Ag mengatakan bahwa di kalangan umat selalu terjadi beda pendapat dalam pelaksanaan pengurusan jenazah terutama dari etikanya. Karena itu muzakarah ini dapat memberikan pencerahan kepada para penyelenggara khususnya dan masyarakat pada umumnya. Masih menurut H. Hasan Maksum M.Ag, persoalan etika dimaksud seperti adab jenazah menghadap kanan ketika akan di sholatkan, membawa ke kuburan untuk dimakamkan dan perbuatan yang disunnahkan dan atau yang dimakruhkan dalam prosesi fardhu kifayah tersebut. Karenanya pelaksanaan dan atau yang dimakruhkan dalam prosesi fardhu kifayah tersebut. Karenanya pelaksanaan muzakarah ini dapat memberikan penjelasan kepada umat Islam terutama dalam memahami dasar atau dalil-dalil pelaksanaan fardhu kifayah tersebut. Dengan tegas H. Hasan Maksum M.Ag menyebutkan; Kalau Memang Berdasarkan Hukum Syar’i Maka Umat Harus mengikutnya”. Hukum syar’i yang dimaksud beliau adalah segala ketentuan berdasarkan perintah Al-Qur’an dan tuntunan Nabi Muhammad SAW melalui risalah As Sunnah yang bersumber dari hadis (perkataan-perkataan/petunjuk Nabi Muhammad SAW) yang shohih wamaqbula. Tapi sangat disayangkan dalam durasi hitungan detik, hati dan pikiran sdra. Hasan Maksum M.Ag tiba-tiba mendua atau berpaling 90 derajat dengan mengatakan:“Namun Kalau Hanya Berdasarkan Kebiasaan Atau Adat Istiadat di Masyarakat Maka Umat Tetap Melaksanakan Sepanjang Tidak Bertentangan Dengan Hukum Islam”. Pada akhir pernyataan beliau bahwa kalau umat sudah dapat membedakan mana yang bersumber dari dalil hukum dan mana yang hanya menjadi kebiasaan maka umat tidak harus memperdebatkannya. Sungguh pernyataan seperti inilah yang menyebabkan runtuhnya ruh syar’i itu sendiri yang bersumber dari Alqur’an-As Sunnah) maka telah sepakat para ulama Salaf (terdahulu) berkata: “Ketahuilah Oleh-Mu Bahwa Jauh Lebih Mudah Menyelamatkan Para Pelaku Maksiat (pencuri, perampok, pembunuh, pezina, koruptor, penjudi, pemabuk, pecandu narkoba dari pada menyelamatkan orangorang atau kaum atau kelompok yang mengklaim lebih banyak tetapi bersungguhsungguh menekuni perbuatan kesyirikan dan kebid’ahan. Maka jauh-jauh hari para ulama Salaf (terdahulu) mengisyaratkan bahwa bersabarlah “bersabarlah” “bersabarlah”......,kompetisi, berjihalah.....berjihadlah.....karena kelak di tengah orang berkompetisi dan bersungguh-sungguh serta menekuni perbuatan SYIRIK (mempersekutukan Allah dan Rasul-NYA) maka Allah SWT akan menghadrkan di tengah m e re k a s e k e l o m p o k o ra n g y a n g m e n g a j a k k e p a d a Ke t a u h i d a n ; d a n bersabarlah,,,,,bersabarlah,,,,,bersabarlah,,,,,berjihadlah,,,,,berjihadlah. Karena kelak di tengah orang yang berkompetisi dan bersungguh-sungguh serta menekuni perbuatan Bid’ah (Kesesatan) maka Allah SWT akan menghadirkan ditengah-tengah mereka sekelompok orang yang mengajak agar kembali kepada Sunnah Nabi Muhammad SAW). Insya Allah bagi siapa yang diberi hidayah setelah menerima risalah kebenaran itu maka tiada satupun yang dapat menyesatkannya dan dialah yang diberi tanggung jawab untuk menyelamatkan generasi berikutnya dari bahaya laten kesyirikan dan kebid’ahan yang sesat dan menyesatkan itu. Sesungguhnya Sunnah Nabi SAW tentang tahapan fardhu kifayah (penyelenggaraan jenazah) itu sudah sempurna dan itulah contoh dan petunjuk yang baik benar selamat secara paripurna. Kita sangat menyayangkan pernyataan sdra H. Hasan Maksum M.Ag tidak secara transparan atau diplomasi sekalipun tentang apa yang dimaksud Kebiasaan Dan Adat Istiadat Dimasyarakat terkait penyelenggaraan fatdhu kifayah itu. Alasan apa beliau membolehkan bercampurnya kebiasaan dan adat istiadat itu. Apakah yang dimaksud beliau menyangkut: membaca-baca Alqur’an atau tahlilan saat jenazah disemayamkan atau pasca 3, 7, 40, 100, 1000 hari pasca kematian? Atau membaca Suratul Fatiha 3 x,,,,, saat memberangkatkan jenazah dan setiap Fatihah melangkah sekali? Atau menabur bunga sepanjang jalan saat mengiringi jenazah ke masjid waktu hendak di sholatkan atau mengantar jenazah ke pemakaman? Atau berlebih-lebihan dalam mengenakan kain kafan? Atau zikir tradisional setelah mensyalatkan jenazah hingga menanyakan kepada jamaah shalat jenazah tentang apakah jenazah ini khaiiiiirrrrr/ baiiiiiiikkkkk 3x? Atau duduk-duduk mengelilingi pusara setelah pemakaman kemudian berzikir dan tahlilan dengan alasan mengajari jenazah atau mengirim pahala tambahan bagi jenazah? Atau hal-hal lain yang mengayikkan bagi perbaikan gizi hayat orang banyak? Kita berdoa kepada Allah Swt kiranya MUI Kota Medan bekerja dengan perinsip Alquran-As Sunnah dan tidaklah mengajak secara tidak langsung kepada hal yang aneh-aneh atau dipandang tradisi dan kebiasaan yang turun temurun sejak nenek moyang. Tegakkan Sunnah.....Patahkan Bid’ah. Wallahu a’lam. Mahlil Hamdani Medan

Pemutaran Film Dokumenter Setelah 15 Tahun Reformasi Pemutaran perdana film dokumenter karya senias film nasional Tino Saronggalo diputar perdana di Rumah Cerdas yang berlokasi di Halat Center Medan, pada Selasa (21/5) malam. Gambaran dari film tersebut merupakan kegiatan yang merefleksikan kehidupan kita dalam berbangsa dan bernegara dalam waktu 15 tahun terakhir. Kegiatan ini patut diapresiasi, terutama untuk kalangan kampus, setidaknya dapat menginspirasi mahasiswa di Medan. Rumah Cerdas sebagai pabriknya masyarakat kreatif tetap akan terus menggulirkan kegiatan semacam ini ke kampus-kampus,khususnya yang berminat pada film dokumenter. Kegiatan ini adalah yang perdana, karena itu tidak perlu tunggu penonton banyak dulu, yang penting terus kita digulirkan. Film berdurasi 87 menit yang dipandu narasinya oleh Tora Sudiro tersebut memaparkan tentang gerakan mahasiswa yang berhasil menumbangkan rezim orde baru, dengan lengsernya Presiden Soeharto yang telah berkuasa selama 32 tahun. Namun setelah peristiwa yang mengorbankan darah putra-putri pertiwi itu, tujuan reformasi tidak tercapai, malah arah reformasi terus semakin jauh dari yang diharapkan oleh mahasiswa. Film tersebut telah lulus sensor untuk remaja dan TV sesuai informasi yang dikirim dari produser sekaligus sutradara yang membesut film tersebut, Tino Saroenggalo pada Surat Tanda Lulus Sensor bernomor 2697/DVD/R/TV/05.2018/2013. Pihak Bumi Kreasi Film Jakarta sudah mengirimkan informasi, film ini sudah lulus sensor, rencananya film ini akan terus diputar di kampus-kampus di Sumut. Jufri Bulian Ababil Panitia

Pak Wali, Warga Butuh Bioskop Di Medan! Berkembangnya pusat-pusat perbelanjaan di kota besar di Indonesia, tidak terkecuali Medan semakin marak. Antara lain dengan dibangunnya Medan Mall, Thamrin Plaza, Sun Plaza, Millenium Plaza, Medan Fair Plaza dan Palladium Plaza di tengah kota. Mengikut di dalamnya ada bioskop yang berganti nama menjadi twenty one (21) dan nama lainnya. Hal ini membawa pengaruh bagi tutupnya sejumlah bioskop konvensional. Masalahnya, sekalipun mall berkembang pesat, namun dalam konteks pasar tradisional, pemerintah kota tetap menegaskan bahwa pasar-pasar tradisional akan dilindungi. Bahkan mengeluarkan sebuah konsep peremajaan bernama revitalisasi pasar-pasar tradisional. Lalu bagaimana dengan bioskop konvensional? Tentang hal ini nampaknnya pemerintah kurang memberi perhatian. Apakah karena umumnya bioskop itu sebelumnya dikelola swasta? Bagaimana persis alasannya kita tidak tahu. Mengingat pusat informasi yang selama ini dikelola pemerintah hanyalah RRI dan TVRI.Sedangkan Perfilman mulai dari aspek produksi maupun pengelolaan diserahkan kepada pihak swasta. Pemerintah hanya regulasi saja. Mengingat film juga merupaka alat untuk membaca dan melihat masa lalu, dan juga sebagai sarana pendidikan bagi kita. Maka ada baiknya Medan sebagai kota menuju Metropolitan yang akan memasuki usianya ke 413 tahun, seharusnya bisa menunjukkan situs (warisan) perfilman di kota ini. Misalkan dengan merevitalisasi sebuah bioskop yang ada di kota Medan yang pengelolaannya oleh pemerintah kota cq Taman Budaya Medan misalnya. Dimana di sana ada gedung kesenian Medan, gedung amphiteater, aula pertemuan, sekolah sinema dan sebuah pusat dokumentasi kebudayaan. Mengapa tidak? Itulah harapan kita kepada Bapak Drs H Dzulmi Eldin selaku Plt.Wali Kota Medan yang baru saja menerima mandat sebagai pengganti wali kota yang sedang non aktif. Semoga dikabulkan! Miduk Hutabarat Pegiat di Komunitas Taman Jl. Sei Galang No. 9 Medan.

Rekening “Wah” Sang Aiptu Oleh Effan Zulfiqar Harahap Rekening Aiptu LS yang menyentuh angka satu triliun memang mengagetkan tapi tidak mengherankan.

L

uar biasa, bila betul Aiptu Labora Sitorus (LS) yang bertugas di Polres Raja Ampat, Papua, punya rekening Rp1,5 triliun sesuai laporan Pusat Pelaporan dan Analisis Transaksi Keuangan (PPATK). Bagaimana tidak, LS yang berpangkat Aiptu punya rekening lebih dari satu triliun rupiah. Perputaran uang LS yang tak wajar itu terjadi dalam aktivitas transaksi lewat bank selama kurun waktu dari tahun 2007 sampai 2012. Ia diduga menimbun kekayaan melalui enam puluh rekening yang berbeda di beberapa bank. Percaya atau tidak berdasarkan PP Nomor 24 tahun 2013 tentang Peraturan Gaji Anggota Polri, gaji pokok berpangkat Aiptu paling rendah hanya Rp2.079.600 dan tertinggi Rp3.417.400. Bandingkan dengan gaji pokok jenderal bintang tiga alias Komjen, paling tinggi Rp4.872.700. Sedangkan jenderal bintang 4 gaji pokok paling tinggi Rp5.025.000. Rasanya sangat mustahil seorang yang berpangkat Aiptu seperti LS punya rekening yang sedemikian dasyat jumlahnya. Aiptu LS yang pernah berkerja di Polres Sorong juga punya rumah yang sangat mewah di Kota Sorong yang dikelilingi pagar setinggi 2 meter. Rumah LS berlokasi di Tampa Garam, Rufei, Kota Sorong. Rumah dari kayu olahan alam itu cukup besar, dikelilingi tembok setinggi 2 meter. Halaman rumah digunakan untuk menyimpan kayu olahan dan sebagai pabrik penggergajian dengan jumlah karyawannya kurang lebih 50 orang. LS juga punya rumah yang cukup mewah di tanah kelahirannya. Dari mana saja sumber pundi-pundi uang LS? Ia diduga punya sejumlah bisnis yang bergerak dalam industri pengelolaan kayu dengan nama perusahaan PT.Rotua dan bisnis bahan bakar mi-

nyak (BBM) dengan bendera perusahaan PT Seno Adi Wijaya. Lewat dua macam bisnis inilah diduga kuat LS mengeruk keuntungan besar yang terus mengalir ke rekeningnya. Ada dugaan LS melakukan pembalakan liar dan penimbunan/penyeludupan BBM. Kayukayu hasil olahan sebagian diseludupkan ke luar Papua. Adapun BBM dijual ke industri dan kapal-kapal. Sebaliknya, LS menyebut semua bisnisnya legal. Rekening Aiptu LS yang menyentuh angka satu triliun memang mengagetkan tapi tidak mengherankan. Kabarnya LS menjadi mesin “ATM” bagi beberapa koleganya di Polres dan Polda? Sehingga ia bisa leluasa menjalankan bisnisnya dengan aman. Hebatnya, lokasi tempat tinggal LS dekat dengan Mapolda Papua. Logikanya tidak mungkin semua aktivitas LS yang dianggap “haram” itu tidak ketahuan. LS bisa jadi tidak bekerja sendiri, tapi melibatkan beberapa pihak yang sudah pasti kecipratan rezeki dari bisnis-bisnisnya. Agak aneh memang, seharusnya atasannya tahu betul aktivitas bisnis yang dilakukan LS selama yang suda jelas termasuk kategori pelanggaran terhadap Pasal 5 Peraturan Pemerintah Nomor 2 Tahun 2003 tentang Peraturan Disiplin Polri. Di samping itu sudah jelas menjadi tanggungjawab atasan untuk mengawasi sepak terjang bawannya sendiri. Sangat tidak masuk akal selama lima tahun LS melakukan bisnis tersebut tidak diketahui atasannya. Apalagi diduga kuat bisnis yang dijalankan LS tidak legal. Cerita soal rekening LS yang sangat janggal itu sebenarnya bukan hal baru yang membuat kita terheran-heran. Sebelumnya, tahun 2005 soal rekening tak wajar yang dimiliki beberapa perwira Polri sudah muncul. Ketika itu, 15 peting-

gi kepolisian diduga memiliki rekening tak wajar. Dokumen menyangkut namanama perwira Polri pemilik rekening yang janggal itu sudah sempat diserahkan Kepala PPATK Yunus Husein waktu itu kepada Jenderal Sutanto, Kapolri ketika itu. Tahun 2010 soal rekening mencurigakan milik petinggi polisi ini muncul kembali seperti yang ditulis majalah Tempo edisi 28 Juni-4 Juli 2010 dengan judul “Rekening Gendut Perwira Polisi”. Tempo menulis ada enam perwira tinggi dan perwira menengah melakukan “transaksi yang tidak sesuai profil” alias melampaui gaji bulanan mereka. Terakhir, tahun 2012 ada kasus suap yang melibatkan Inspektur Jendral Djoko Susilo dalam kasus tindak pidana korupsi dan pencucian uang proyek pengadaan alat simulator surat ijin mengemudi (SIM). Namun kedua kasus ini hilang dan menguap begitu saja, tak jelas akhir ceritanya. Polisi hanya mau sebatas menglarifikasi, tanpa ada tidak lanjut pemeriksaan terhadap para pemilik rekening gendut tersebut. Hanya kasus yang menimpa Inspektur Jenderal Djoko Sulilo yang diproses sampai ke pengadilan dan itupun mungkin karena KPK yang menanganinya. Kasus-kasus rekening gendut petinggi Polri itu tidak ada penyelesaian akhirnya. Sangat berbeda dengan kasus rekening tak wajar LS yang tak sampai seminggu kasus itu mencuat ke permukaan, tim dari Polda Papua dan Mabes Polri langsung melakukan penahanan dan menjadikan tersangka Labora telah dijadikan tersangka kasus dugaan penimbunan BBM, pembalakan liar dan Tindak Pidana Pencucian Uang (TPPU). Adapun kasus yang melibatkan petinggi Polri sebelumnya tak satupun mereka ditahan dan apalagi menjadi tersangka hingga kasus itu reda dengan sendirinya. Ironisnya nama-nama yang diduga punya rekening gendut itu malah diberi jabatan strategis. Banyak pihak menilai kasus rekening tambun Aiptu LS tidak akan tuntas, jika yang menangani Polri sendiri bila berkaca dari kasus

rekening gendut yang pernah melibatkan petinggi Polri. Sudah pasti, bila Polisi tak bisa menuntaskan rekening tak wajar LS akan semakin menguatkan opini publik, Polri tidak mau menjalankan reformasi birokrasi di internalnya. Memang, seharusnya yang menangani kasus LS adalah KPK bukan Polri itu pendapat publik. Untuk itu sangat diharapkan Mabes Polri dan Polda Papua dalam menangani kasus LS ini bisa bekerja secara profesional, transparan dan tuntas sehingga diketahui jelas kemana saja uang LS mengalir dan siapa yang menjadi backing bisnisnya yang diduga ilegal. Keseriusan Polri menangani kasus ini akan menjadi bukti kuat komitmen lembaga Polri dalam upaya melakukan bersih-bersih di lingkungan internal kepolisian. Artinya tindakan ini diharapkan akan lebih menaikkan citra Polri yang terpuruk karena perilaku buruk beberapa oknum Polri yang terlibat korupsi. Publik tahu betul tidak sedikit polisi pemilik kekayaan yang tak wajar dengan pangkat bintara dan perwira. Ini bukan cerita baru dan sudah menjadi rahasia umum yan sudah seperti fenomena gunung es. Publik juga tahu tidak sedikit pula polisi yang berpangkat bintara dan perwira hidup pas-pasan dan apa adanya. Mengabdikan diri dengan tulus iklas sebagai pelindung dan pengayom masyarakat di wilayah-wilayah terpencil dan pulau-pulau terluar tanpa pernah bermimpi suatu ketika punya rekening gendut seperti LS. Komitmen polisi melakukan reformasi di internal mereka menjadi sesuatu yang sangat urgen dan mendesak, terutama menertibkan dan menindak anggotanya yang punya rekening dengan jumlah yang tak wajar. Kasus LS ini harus bisa menjadi pintu masuk untuk membongkar siapa saja yang terlibat dan menikmati hasil uang dari bisnis LS tersebut, khususnya di internal Polri. Penulis adalah Wakil Rektor I Universitas Muhammadiyah Tapanuli Selatan – Kota Padangsidimpuan.

Laboranomics Oleh Jonson Rajagukguk, SE, SSos, MAP Labora Sitorus memang seorang ekonom sejati yang paham betul apa itu ilmu ekonomi murni yang rasional.

B

oleh dibilang Aiptu Labora Sitorus (laboranomics) adalah murid teladan Adam Smith yang memahami betul konsep ekonominya sebagaimana yang dituliskan dalam bukunya TheWealth Of Nation (1776)— sebagai cikal bakal lahirnya ideologi kapitalis di dunia. Pada pertengahan abad ke-18, lahirlah paham baru yang dinamakan liberalisme dari Adam Smith (1723 – 1790) di Inggris. Menurut dia, bukan soal pertanian atau perdagangan yang harus dipentingkan, tetapi titik beratnya diletakkan pada pekerjaan dan kepentingan diri. Jika seseorang dibebaskan untuk berusaha, dia harus dibebaskan pula untuk mengatur kepentingan dirinya. Sebab itu ajaran laiser aller, laisser passer (merdeka berbuat dan merdeka bertindak) menjadi pedoman bagi persaingan mereka. Selanjutnya manusia memasuki kancah individualisme yang ditandai dengan nafsu menumpuk harta sebanyak-banyaknya yang ditimbulkan persaingan yang bebas tadi. Dari paham liberalisme, timbulah kaum borjuis yang akhirnya menimbulkan sistem ekonomi, sistem ekonomi kapitalis (H. Nur Kholis, SAg, MSh. Ec, UII) Celakanya lagi di tubuh Polri sendiri bisa muncul kaum borjuis. Padahal Polri merupakan wasit dalam menegakkan hukum-hukum ekonomi agar virus kapitalisme jangan sampai menjalar. Tegaknya hukum ekonomi akan mampu mengeliminir munculnya kapitalisme modern yang ternyata sudah mengalami kegagalan total, bahkan di kampung ne-

gara kapitalis sendiri. Terlepas daripada itu, beberapa tahun lalu istilah rekening gendut dalam tubuh Polri menjadi masalah yang mencengangkan. Dugaan beberapa jenderal yang punya rekening mencurigakan. ICW sempat memberikan data kepada KPK beberapa jenderal yang punya rekening gendut. Istilah rekeing gendut dipergunakan dalam terminologi dimana para jenderal punya rekening di bank yang mencurigakan karena melebihi kapasitas gajinya. Logikanya, darimana seorang jenderal punya uang sangat besar dalam miliaran rupiah dengan jumlah gaji yang bisa dihitung pakai jari? Istilah rekening gendut dalam tubuh Polri pun menjadi term dalam masyarakat kita. Apa yang terjadi dalam tubuh Polri dengan kecurigaan memunyai rekening gendut memang bisa kita terima. Di tengah reformasi kelembagaan Polri dengan sasaran penertiban oknum Polri, mulai dari bintara sampai jenderal merupakan upaya menjadikan Polri sebagai aparat negara yang amanah dan profesional. Salah satu target reformasi internal Polri adalah oknum Polri yang menjaga integritas sebagai abdi masyarakat. Apakah reformasi internal Polri ini berhasil? Memang sudah banyak pembenahan dilakukan. Terlepas daripada kelemahan di sana-sini Polri sudah mulai ada perubahan. Bagaimana mengelola perubahan ini ke arah yang lebih baik tentu menjadi tantangan bagi internal Polri itu sendiri. Bisa dipastikan semua anak bangsa

inisangattercengangdenganpemberitaan semua media seorang polisi berpangkat Aiptu memiliki uang sampai Rp1,5 triliun di rekening pribadinya. Dalam hitungan sederhana secara statistik gaji semua perwira tinggi dalam hitungan satu tahun jika dikumpulkan masih kalah menghadapi uang yang dimiliki Aiptu Labora Sitorus tersebut. Dari mana sang bintara yang bertugas di Polda Papua ini memperoleh uang sebesar itu? Kalau memang Aiptu Labora sedari dulu ingin menjadi pengusaha mengapa masih mengenakan seragam Polrinya? Dalam hitungan waktu bekerja, kapan lagi Labora menjalankan tugasnya sebagai Polisi jika memang mengurusi bisnisnya sebagaimana pembelaan dirinya bahwa dia memiliki perusahaan? Usut demi usut, isunya masalah illegal logging dan penyeludupan BBM merupakan bisnis yang dikembangkan di Sorong. Memang bisa kita terima kalau illegal logging adalah bisnis yang bisa membuat seseoang bisa menjadi kaya mendadak. Kayu sangat dibutuhkan dalam industri apapun. Harga kayu juga relatif mahal karena supply yang mungkin terbatas. Bisa kita maklumi jika seseorang mampu mengoptimalkan bisnis kayu di hutan Papua, terlepas dengan cara ilegal maka dengan sendirinya bisa mengumpul pundi-pundinya dengan waktu cepat. Jika memang benar Labora terlibat illegal logging maka tidak usah heran bisa mengumpulkan uang sebanyak itu. Labora Sitorus memang seorang ekonom sejati yang paham betul apa itu ilmu ekonomi murni yang rasional. Menurut ilmu ekonomi konvensional, sesuai pahamnya tentang rational economics man, tindakan individu dianggap rasional jika tertumpu kepada kepentingan diri sendiri (self interest) yang menjadi satu-satunya tujuan bagi seluruh aktivitas. Dalam

ekonomi konvensional, perilaku rasional dianggap ekuivalen (equivalent) dengan memaksimalkan utiliti. Ekonomi konvensionalmengabaikanmoraldanetikadalam pembelanjaan dan unsur waktu adalah terbatas hanya di dunia saja tanpa mengambilkira hari akhirat. Adam Smith menyatakan bahwa tindakan individu yang mementingkan kepentingan diri sendiri pada akhirnya akan membawa kebaikan masyarakat seluruhnya karena tangan tak tampak (invisible hand) yang bekerja melalui proses kompetisi dalam mekanisme pasar (H. Nur Kholis, SAg, MSh.Ec). Apa yang terjadi dengan Labora merupakanpilihanyangsangatrasionaldalam ilmu ekonomi—untung besar. Labora memahamiilmuekonomiitudanmemunculkan laboranomics yang dijalankan dengan praktik penyalahgunaan kekuasaan. Apapun namanya itu semua, keberadaan harta Labora sungguh tidak patut dengan status seorang anggota Polri. Hak semua orang untuk menjadi kaya, tetapi dengan cara yang etis. Kalau mau menjadi pengusahasilahkanmundurduludariKepolisian. Semoga kasus Labora Sitorus segera diusut oleh Polri dan membuka kepada publik.Siklusrekeninggendutdalamtubuh Polri harus sesegra diakhiri. Polri adalah institusi yang bertujuan menciptakan rasa aman,ketertiban,pelayananpublikkepada masyarakat. Polri bukan institusi yang bertujuan mengumpulkan harta dalam jumlah yang tidak masuk akal. Kalau mau jadi kaya silahkan jadi pengusaha, itupun pengusaha yang menjalankan usahanya dengan hukum ekonomi resmi dan bukan dengan cara penghalalan segala cara untuk memuaskan nafsu ekonominya seperti dalam kasus Laboranomics. Penulis adalah Dosen STIE-STMIK IBBI Medan, Kepala PPM Pada LPPM STMIK IBBI Medan.


Agenda 07.00 Dahsyat 09.00 Sinema Pagi 11.00 Intens 12.00 Seputar Indonesia 12.30 X Factor Indonesia 15.30 Cek And Ricek 16.00Silet 16.30 Seputar Indonesia 17.00 Akibat Pernikahan Dini 18.00 Jodohku 19.00 Berkah 20.00 X Factor Indonesia

CATATAN

07:00 SL Inbox 09:00 Hot Shot 10:00 SCTV FTV 11:00 SL Liputan 6 Terkini 11:03 SCTV FTV 12:00 SL Liputan 6 Siang 12:30 SCTV FTV Siang 14:30 SL Eat Bulaga Indonesia 16:30 SL Liputan 6 Petang 17:00 Heart Series 2 18:15 Pesantren & Rock n Roll Season 3 19:30 Love in Paris Season 2 20:45 Ustad Fotocopy 22:00 Alm Ustad Jefri Al Buchori Dalam Kenangan

07:00 Upin & Ipin Dkk 07:30 Pose 08:00 Layar Unggulan 09:30 Kisah Unggulan 11:00 Kribo 11:30 Lintas Siang 12:00 Layar Kemilau 13:30 I Drama 15:00 Top Pop 16:00 Lintas Petang 16:30 Tuntas 17:00 Animasi Spesial 18:00 Bola Bolu 19:00 Tendangan Si Madun Season 3 20:30 Raden Kian Santang 22:00 Hidayah 00:00 Premier Preview

07:30 Fenomania 08:00 Seleb @ Seleb 09:00 KLIK! 10:00 Ngobrol Asik 11:00 New Friends 11:30 Topik Siang 12:00 Seputar Obrolan Selebriti 13:00 Bule Ngefans 13:30 Chhota Bheem Aka Bima Sakti 14:00 Panda Fanfare Aka Kungfu Panda 14:30 Duckula 15:00 Tom & Jerry 15:30 Curious George 16:00 Mr. Bean 16:30 Topik Petang 17:00 Coboy Junior 18:00 Pesbukers 19:30 RT Sukowi 20:30 Galaxy Superstar 2 21:30 Sinema Spesial

07:00 Halo Polisi 07:30 KISS Pagi 08:00 Sinema TV Spesial 10:00 Pagi Pagi Bagi Bagi 11:30 Patroli 12:00 Sinema Pintu Taubat Siang 14:00 HOT KISS 15:00 Fokus 15:30 Jangan Anggap Aku Kecil 16:00 Drama Korea: Faith @ The Great Doctor 17:00 Drama Korea: Fashion King 18:00 Drama Seri Indonesia: Setulus Kasih Ibu 19:00 Sinema Indonesia: Suamiku Kembali 20:00 Take Me Out Indonesia Season 2 22:00 Pesta Semarak Indosiar

07:05 Bedah Editorial Media Indonesia 08:05 8 Eleven Show 11:05 Sisi Berita 11:30 Metro Siang 13:05 Wideshot 17:05 Metro Hari Ini 18:05 Prime Time News 20:05 Suara Anda 20:30Wonderful Living 21:05 Top News 21:30 Kick Andy 23:05 Eagle Documentary Series 23:30 Metro Sport

Jadwal acara TV di atas bisa diubah sewaktu-waktu oleh stasiun TV yang bersangkutan tanpa pemberitahuan

WASPADA Jumat 24 Mei 2013

07:30 New Ranking 1 08:30 Bagi Bagi Berkah 09:00 Mozaik Islam 09:30 New Peppy The Explorer 10:00 Milik Indonesia 10:30 Reportase Siang 11:00 Insert 12:00 Bioskop Indonesia Premiere 14:00 Sketsa 15:15 Show Imah 16:30 Reportase Sore 17:00 Insert Investigasi 18:00 Koki Lima 19:00 Bioskop TRANSTV Spesial 21:00 Bioskop TransTV 23:00 Bioskop TransTV 01:00 Reportase Malam 01:30 Sinema Dini Hari

07:00 Live News : Apa Kabar Indonesia Pagi 09:00 Selera Asal 09:30 Live News : Kabar Pasar Pagi 10:00 Coffee Break 11:00 Live News : Kabar Siang 13:30 Ruang Kita 14:30 Live News : Kabar Pasar 15:00 Best Match Indonesian Super League 2012 - 2013 17:30 Live News : Kabar Petang 19:30 Kabar Utama 21:30 Live News : Kabar Malam 22:30 Menyingkap Tabir 23:00 Kabar Arena

07:30 The Penguins Of Madagascar 08:00 Thomas and Friends 08:30 Sketsa Tawa 09:30 Kungfu Chef 10:00 Obsesi 11:00 Buletin Indonesia Siang 12:00 Tinkerbell 14:00 100% Ampuh 15:30 Fokus Selebriti 16:00 Arjuna 16:30 Spongebob Squarepants 17:30 Coboy Junior Terhebat 18:30 Big Movies 20:30 Big Movies 23:30 Big Movies

07:30 Selebrita Pagi 08:00 Makan Besar 08:30 Gak Nyangka 09:00 Ups Salah 09:30 Spotlite 10:30 Warna 11:30 Redaksi Siang 12:00 Selebrita Siang 12:30 Si Bolang 13:00 Laptop Si Unyil 13:30 Dunia Binatang 14:00 Wollipop 14:30 Tau Gak Sih 15:00 Bara Supercook 15:30 Jejak Si Gundul 16:00 Redaksi Sore 16:30 Merajut Asa 17:00 Orang Pinggiran 18:00 Hitam Putih 19:00 On The Spot 20:00 Opera Van Java 22:00 Bukan Empat Mata 23:30 Dua Dunia 00:00 Wisata Malam 00:30 Sport7 Malam **m31/G

Penggalan Kisah Hidup Hasyim Asy’ari Dalam Sang Kiai K.H. Hasyim Asy’ari duduk termenung di rumahnya, memikirkan nasib negerinya. Sang Kiai, diperankan Ikranagara, prihatin negerinya terus menerus dijajah. Setelah ratusan tahun dijajah Belanda, Jepang yang mengaku menjadi saudara tua menduduki Indonesia. Wahid Hasyim (Agus Kuncoro) dan adik-adiknya pun tak kalah gundah karena Jepang sebentar lagi mendekat ke Pesantren Tebuireng, Jombang, Jawa Timur. Mereka melihat banyak ulama yang ditangkap Jepang karena dituduh memimpin gerakan anti-Nippon. “Banyak hal yang bisa dibicarakan, tetapi kalau menyangkut akidah, tidak bisa,” kata sang Hadratus Syaikh kala itu, merujuk pada penolakannya melakukan seikerei. Tentara Jepang pun menu-

duh Hasyim Asy’ari sebagai penyebab kerusuhan di Cukir. Demi keselamatan ratusan santri Tebuireng, Hasyim pun mau dibawa tentara Jepang. Perjuangan Hasyim Asy’ari tidak berhenti di situ, setelah bebas, ia bersama putranyaWahid berjuang untuk mempersiapkan kemerdekaan Indonesia, mulai dari mendirikan Mas-yumi hingga Barisan Hizbullah. Pro dan kontra dialami sang Kiai, termasuk dari salah satu santrinya yang setia, Harun (Adipati Dolken) menganggap gurunya itu kini memihak Jepang. Nasionalisme Melalui film ini, penonton diajak untuk melihat sekelumit pemikiran K.H. Hasyim Asy’ari tentang negara. Film ini memotret kisah hidup pemimpin Te-

satu pemain berpendapat salah satu pertimbangannya mau terlibat dalam film ini adalah karena ia melihat sekarang ini rasa nasionalisme di kalangan anak muda menipis. Mereka, generasi muda sekarang, menurutnya lebih mengenal pahlawan asing seperti Che Guevara dan Abraham Lincoln. “Pejuang dalam negeri, kita cuma tahu mereka jadi nama jalan, tapi nggak tahu perjuangan mereka seperti apa demi kemerdekaan Indonesia,” tuturnya. “Nggak gampang lho, mempertahankan kemerdekaan dan kesatuan,” katanya, ketika berperan sebagai Wahid Hasyim, ayah dari mendiang Abdurrahman Wahid. Media film ini menurutnya menjadi salah satu cara untuk menunjukkan bangga menjadi

orang Indonesia. Senada dengan Agus, aktris Christine Hakim (Nyai Kapu, istri Hasyim Asy’ari) berharap film ini menjadi salah satu cara agar generasi muda mengenal sosok-sosok pahlawan nasional. “Nanti idolanya malah ‘Iron Man’. Mau ke mana bangsa ini kalau tidak bisa menghargai para pendiri bangsa,” katanya usai pemutaran film Sang Kiai di Kuningan, Jakarta. Meski membuat buku ini berdasarkan biografi Sang Kiai, sutradara Rako Prijanto mengaku memasukkan beberapa karakter fiktif, seperti tokoh Harun diperankan Adipati Dolken. “Saya butuh karakter yang mewakili pandangan masyarakat sekitar, untuk perbandingan sehingga cerita bisa bergulir,” jelasnya.(ant)

Psy “Gangnam Style” Persembahkan Konser Untuk Indonesia

Sedekah Alam Ala Charly Setia Band KENDATI tanpa target muluk-muluk mendampingi sehabat dekatnya - Muhtarom yang maju sebagai Calon Bupati Garut lewat jalur perseorangan, Muhammad Charly van Houten, punya program kerja andalan agar diperhitungkan pada Pilkada September 2013 mendatang. “Sebetulnya saya tak menyangka digandeng Kang Muhtarom mendampingi beliau sebagai calon Wakil Bupati pada Pilkada Garut empat bulan mendatang. Walau begitu, sebagai calon non partai yang sudah resmi mendaftarkan diri ke KPU Garut, kami berdua sudah punya strategi andalan agar turut diperhitungkan kandidat lain dan menarik simpatik serta dukungan warga Kota Dodol yakni program Shodaqoh atau Sedekah Alam,” papar Charly – pentolan Setia Band kepadaWaspada di Planet Hollywood Jakarta, baru-baru ini. Ditemui selepas preview film dibintanginya Jangan Menangis Sinar (JMS) diproduseri konsultan supranatural - Ki Kusumo, vokalis, pemusik dan gitaris kelahiran Cirebon, 5 November 1981 ini menambahkan, program Sedekah Alam rancangan Muhtarom – Cabup berlatar belakang PNS dan Dosen Filsafat - perlu lebih digalakkan bersama masyarakat Garut. Hal itu agar hutan lindung di daerah ini sebanyak 80 persen dari luas wilayahnya yang terkenal ke suluruh Indonesia dapat terjaga dengan baik. “Kalau terpilih menjadi Garut Satu dan Dua, lewat program Sedekah Lingkungan kami akan menggalakkan semua masyarakat di 183 Desa tersebar di 38 Kecamatan untuk lebih giat menanam pohon baik di lingkungan rumahnya, maupun di kawasan hutan lindung secara berkesinambungan,” jelas Charly juga siap mengembangkan kesenian daerah setempat lengkap dengan rencana membangun Gedung Kesenian Garut yang megah. Seperti diketahui film JMS juga dibintangi Yulia Rachman, Terry Putri, Ki Kusumo, Yati Surachman, Riyanto RA dan me-nampilkan artis cilik Anggita Anjani dan Axel Putra Kusuma, diangkat dari kisah nyata bocah Sinar di Desa Riso, Polewali Mandar – Sulawesi Barat yang sempat disambangi Charly. Siswi kelas satu SD dan masih berusia 6 tahun ini harus merawat ibunya yang lumpun seorang diri. “Film ini tak hanya sebagai tontonan, tapi juga tuntunan. Sinar adalah potret kecil dari jutaan anak Indonesia yang kurang beruntung. Meski hidup miskin namun tetap rajin sekolah dan berbakti kepada orangtuanya,” ujar Ki Kusumo, produser film JMS. * (AgusT)

buireng itu dalam periode 19421947, zaman pendudukan Jepang dan setelah Indonesia merdeka. Dalam salah satu adegan, Hasyim ASy’ari yang sedang bercakap-cakap dengan putranya Wahid mengemukakan pendapat mereka tentang agama dan nasionalisme. “Nasionalisme dan agama itu tidak berada dalam kubu yang berbeda. Justru dari agama, lahirlah nasionalisme,” kataWahid, yang diamini sang ayah. Pun ketika Bung Karno, melalui utusannya, bertanya mengenai hukum membela negara, ia langsung mengumpulkan cendikiawan muslim untuk membahas hal ini.“Membela negara itu wajib hukumnya. Termasuk ke dalam jihad fisabilillah,” kata Hasyim Asy’ari. Agus Kuncoro sebagai salah

Melly Goeslaw

Band Potret Tampilkan Formasi Baru Grup band yang besar di era 90an, Potret, kini kembali bermusik dengan tambahan dua anggota baru. Potret semula beranggotakan Melly Goeslaw (vokal), Anto Hoed (bass), dan Aksan Sjuman (drum). Kini, Potret memiliki gitaris Nikita Dompas dan pianis Merry Kasiman. “Konsepnya pakai lagu-lagu Potret yang dulu tapi aransemen total,” kata Melly saat menggelar jumpa pers Konser K-20 Spesial Melly Goeslaw di Balai Sarbini, Jakarta. Anto menambahkan dengan formasi baru ini, tentunya

berpengaruh pada genre musik yang diusung Potret. “Ini sebenarnya kami mau cross over, ada alternatif, jazz, ada bentuk rock yang gak terlalu keras. Pengaruhnya, mereka membuat kontribusi yang banyak untuk itu,” jelas Anto. Mengamini pernyataan Aksan sebelumnya, Anto juga menyatakan mereka kali ini fokus padaliveperformance,bukanhanya penampilan yang direkam. Potret formasi baru ini tidak menutup kemungkinan untuk membuat lagu baru.“Sampai saat ini sih kami masih brainstorming untuk

lagu-lagu lama,” kata Melly. Melly berencana memperkenalkan formasi baru ini pada konser“K-20 Spesial Melly Goeslaw” akan disiarkan di salah satu televisi swasta. Tetapi, Melly menolak bila dikatakan ini sebagai salah satu cara untuk menunjukan Potret masih ada. “Potret bukan band yang ingin eksis. Kami band ingin bermusik. Titik,” tegas Melly. “Bahwa Potret masih bermusik. Bukan potret masih ada, tapi masih bermusik. Dan selalu ingin membuat sesuatu untuk musik,” kata Melly.(ant)

Penari dan pelantun hits Gangnam Style yang fenomenal akan mempersembahkan konser untuk para penggemar di Indonesia bertajuk Psy Harmony Concert. “Saya merasa terhormat bisa mempersembahkan pentas untuk Indonesia,” kata Psy melalui keterangan tertulis dikirimkan promotor V Entertainment & Sports (VES) dan S27 Entertainment, Rabu. Konser akan berlangsung pada 6 Juli 2013 pukul 19.00 di Stadion Gelora Bung Karno. Jadwal penjualan tiket diinformasikan kemudian. Konser bertajuk Psy Harmony Concert ini akan menjadi penampilan Psy pertama kalinya di Indonesia dan menandai Korea-Indonesia FriendshipYear 2013. Pada konser di Jakarta yang spesial ini, Psy juga akan berkolaborasi dengan artis papan atas Indonesia. Konser Psy di Jakarta juga telah diumumkan secara resmi Pemerintah Kota Se-

oul di website mereka. Sementara itu, Park Jae-Sang lebih dikenal dengan nama panggungnya Psy, adalah penyanyi asal Korea Selatan, penulis lagu, rapper, penari, produser rekaman dan bintang televisi. Psy dikenal di seluruh dunia dengan hit single nya Gangnam Style. Video musik Gangnam Style merupakan video per-

Psy/popdust.com tama kalinya dilihat sebanyak 1,6 miliar kali di YouTube. Baru-baru ini, Psy telah merilis single keduanya Gentleman yang sukses meraih Guinness World Record sebagai video paling banyak dilihat dalam 24 jam yaitu sebanyak 50 juta kali di YouTube dan sebagai single artis Asia pertama sukses menembus tangga lagu top-10 Billboard.(ant)

Indonesia Jadi Kiblat Mode Busana Muslim Dunia

Charly

Indonesia Islamic Fashion Fair (IIFF) diharpakan dapat mempertahankan pasar busana muslim dan mendorong kreatifitas perancang mode busana muslim untuk lebih kreatif dan inovatif sehingga Indonesia kelak dapat menjadi kiblatnya mode busana muslim dunia. Ketua Umum Asosiasi Perancang Pengusaha Mode Indonesia (APPMI)Taruna K. Kusmayadi mengatakan tujuan tersebut dapat tercapai dengan kerjasama banyak pihak, mulai dari desainer, pemerintah, dan industri garmen dalam menjalankan road map menuju target Indonesia menjadi kiblat fashion muslim dunia. Dia juga menyebut desainer memiliki tugas untuk memperbaiki “attitude” berbisnis sehingga dapat memperkuat pasar busana muslim dalam negeri. “Desainer jangan jago kandang saja, kuatkan pasar dalam negeri untuk bisa keluar negeri,”

katanya dalam jumpa media IIFF 2013, Rabu. IIFF diharapkan dapat mengeksplorasi kekuatan Indonesia dalam industri kreatif fashion busana muslim. Selain itu, ajang tersebut bertujuan mendorong pertumbuhan ekonomi dengan menjual kemampuan kreatif mode muslim Indonesia ke level dunia. IIFF juga ditargetkan menjadi salah satu tujuan belanja busana muslim utama bagi Indonesia. Indonesia Islamic Fashion Fair 2013 memberikan wadah dan kesempatan bagi desainer pemula memamerkan hasil karya mereka di empat zona berbeda. Acara berlangsung 30 Mei hingga 2 Juni di Assembly Hall, Jakarta Convention Center menyediakan empat zona berbeda, yaitu Start.Up, Support Material, Desainer, dan Brand. Pembagian zona tersebut merupakan hal baru dilakukan

pada IIFF tahun ini, kata Ketua Pelaksana IIFF 2013 Irna Mutiara dalam jumpa media di Jakarta, Rabu. “Salah satunya Start Up, tempat para pemula calon desainer mempersembahkan konsep,” tutur dia. Para desainer yang hadir dalam zona Start Up adalah orangorang sudah memiliki konsep brand, namun belum memproduksi secara massal. Ajang ini membuka kesempatan bagi para desainer baru untuk mengembangkan bisnis, misalnya bekerjama dengan pengusaha atau dilamar perusahaan besar. Sementara zona Support Material diisi para produsen material pendukung seperti renda, kancing, dan bordir. Zona Designer dan Brand menampilkan karya para desainer dan brand ternama. Dibanding tahun lalu, IIFF 2013 akan lebih meriah, kata Irna. Selain ada parade, peragaan busana, peluncuran buku, dan

Model memperagakan busana muslim pada pembukaan Indonesia Islamic Fashion Fair/ant talkshow, jumlah brand dan desainer yang terlibat pun meningkat. Tahun ini ada 182 brand/ desainer bergabung dalam IIFF 2013, meningkat dari jumlah tahun lalu yaitu 128 brand/desai-

ner. Para desainer dan brand di IIFF tahun ini terdiri dari lintas generasi, mulai dari Irna Mutiara, Shafira, ItangYunasz, Dian Pelangi, Ria Miranda, Ida Ro-

yani, Hannie Hananto, Dina Midiani, Monika Jufry, Anne Avantie, NajuaYanti, Kivitz, Up2Date, Zoya, Rya Baraba, hingga Amalia Amman. (ant)


Aceh

WASPADA Jumat 24 Mei 2013

SIGLI (Waspada): Ratusan santri Dayah Pasantren Khairuddaraini, Kecamatan Padang Tiji, Kabupaten Pidie berunjuk rasa di Mapolres Pidie, Kamis (23/5) pagi. Mereka menuntut, MK, 21,(salah seorang guru ngaji-red) dibebaskan dari sangkaan pencabulan. MK, 21, warga Desa Teugoeh Drien Gogo, Kecamatan Padang Tijie ditangkap polisi, Minggu (12/5) atas laporan keluarga santri wati Dayah Pesantren Khairuddaraini atas tuduhan pecabulan yang dilakukan di dalam bilik pesantren, Kamis (19/5) malam. Namun tuduhan itu ditolak ratusan santri, dengan alasan MK yang dituduhkan pencabulan itu tidak melakukannya. “ Ini fitnah. Tgk MK saat itu sedang menolong mengobatinya yang sedang kerasukan roh jahat. Kami melihatnya dari luar bilik. Semua tuduhan itu fitnah,” kata Fadliana, salah seorang santri wati. Tgk Saidul Umuri, 27, salah seorang guru ngaji kepada Waspada menjelaskan, peristiwa itu terjadi secara mendadak. Saat itu, sekira pukul 21:00 ia sedang melakukan tes baca Alquran terhadap pelapor dan kawan-kawannya di salah satu balai pengajian di

C1

Tuntut Guru Dibebaskan, Santri Demo Markas Polisi

Waspada/Muhammad Riza

RATUSAN santri Dayah Pasantren Khairuddaraini, Kecamatan Padang Tiji, Kabupaten Pidie, Kamis (23/5) sekira pukul 06:00 berunjuk rasa Mapolres Pidie. Mereka menuntut polisi segera membebaskan salah seorang guru ngaji yang diduga melakukan cabul terhadap seorang santri wati dibawah umur. dalam komplek pesantren. Lalu pelapor meminta izin untuk ke toilet, namun ia tidak mengizinkan. Tidak lama kemudian tanpa minta izin kepadanya, pelapor

turun dari balai pengajian dan masuk ke dalam biliknya yang katanya untuk istirahat.” Karena pelapor sering kerasukan, lalu Tgk MK ikut masuk ke dalam bilik pelapor dengan tujuan me-

ngusir roh jahat dalam tubuh pelapor. Makanya tidak mungkin beliau melakukan pencabulan, dan itu fitnah, karena kejadian itu juga dilihat santri lainnya dari bilik sebelah” katanya.

Kapolres Pidie AKBP Dumadi melalui Kasat Reskrim AKP Raja Gunawan, menjelaskan, berdasarkan pengakuan korban dan saksi-saksi yang dimintai keterangan, tersangka MK, 21

telah melakukan pencabulan terhadap pelapor yang saat itu sedang istirahat di dalam bilik karena sakit. Tersangka katanya sempat mempereteli tubuh pelapor yang sedang dalam kon-

Rp 8,5 M Uang Sertifikasi Guru Kota Langsa Belum Dibayar Waspada/Dede Juliadi

KASDIM 0104/Aceh Timur Mayor Inf Nasrun Nasution menyerahkan secara simbolis 35 sepedamotor dinas TNI semi trail kepada Babinsa Koramil di jajaran Kodim 0104/Aceh Timur di halaman Makodim setempat, Kamis (23/5)

Kasdim 0104/Atim Serahkan 35 Sepedamotor Dinas LANGSA (Waspada): Kasdim 0104/Aceh Timur Mayor Inf Nasrun Nasution menyerahkan 35 unit sepeda motor dinas TNI jenis Honda Mega Pro semi trail kepada Babinsa Koramil di jajaran Kodim 0104/Aceh Timur di halaman Makodim setempat, Kamis (23/5). Penyerahan ditandai dengan serah terima kunci berikut 35 sepedamotor disaksikan segenap jajaran personil TNI di jajaran lingkungan Kodim 0104/Aceh Timur. Kasdim 0104/Aceh Timur Mayor Inf Nasrun Nasution mengatakan, penyerahan sepedamotor dinas merupakan bentuk dukungan dan bantuan TNI AD untuk meningkatkan kinerja dan memberikan kemudahan kepada para babinsa dalam memperlancar pelaksanaan tugasnya dalam melaksanakan pemantauan wilayah teritorial masing-masing Babinsa. “Dengan adanya sepedamotor dinas tersebut diharapkan Babinsa lebih giat lagi dalam melaksanakan tugas di desa binaannya,” katanya. Kasdim meminta, kepada para personil penerima sepedamotor dinas, untuk melengkapi diri dengan perlengkapan keamanan yang memadai dan berusaha merawat kendaraan dengan baik guna menjamin daya tahan kendaraan dan keselamatan pribadi dan setiap sepedamotor yang telah diberikan sepenuhnya digunakan untuk kepentingan kedinasan dan bukan untuk keperluan lain di luar tugas utama TNI dalam upaya menjaga kedaulatan NKRI. (m43)

LANGSA (Waspada) : Ribuan guru dan kepala sekolah di semua jenjang lembaga pendidikan (mulai TK/SD sampai sekolah menengah) berikut pengawas sekolah yang bertugas dalam wilayah pemerintahan Kota Langsa, hingga saat ini belum dibayar uang sertifikasi untuk bulan November dan Desember 2012. Anehnya, uang sertifikasi untuk bulan Januari hingga Maret 2013, sudah dicairkan kepada mereka pertengahan Mei lalu. Hal itu menimbulkan tanda tanya di kalangan para tenaga pendidik di Kota Langsa. Pasalnya, kenapa uang sertifikasi bulan November dan Desember 2012 yang sudah cukup lama belum diselesaikan sedangkan bulan Januari hingga Maret 2013 sudah dicairkan. “Wajar dong, kalau kami pertanyakan karena terjadi lompatan pembayaran. Di mana letak permasalahannya, harus diketahui,” ungkap seorang kepala sekolah. Sekretaris Dinas Pendidikan Kota Langsa Drs Amir Hamzah yang dikonfirmasi Waspada, Kamis (23/5) membenarkan uang hak guru dua bulan itu belum diselesaikan hingga saat ini. Menurut Amir, uang sertifikasi yang belum dibayar itu (November-Desember

2013) berkisar Rp 8,5 miliar. Uang belum diterima di daerah dan dana tersebut saat ini masih di pusat. ‘’Dalam kaitan ini, Dinas Pendidikan sudah mengajukan permintaan pembayaran,’’ kata Amir. Lebih lanjut Amir Hamzah menjelaskan, kebutuhan uang sertifikasi bagi tenaga pendidik Kota Langsa untuk tahun 2012 berkisar Rp 38 miliar lebih. Dari jumlah yang dibutuhkan untuk pembayaran sertisikasi tersebut, Kota Langsa hanya menerima Rp 30 miliar. Setelah dicairkan kepada mareka yang berhak menerimanya ternyata mengalami kekurangan yang cukup besar yakni Rp 8,5 miliar. Jadi, ini masalahnya sehingga belum dapat dibayar uang sertifikasi untuk guru di Langsa. Amir Hamzah yang hampir enam tahun bertugas di Kantor Syariat Islam dan baru tiga bulan

disi lemas karena baru sembuh dari kerasukan roh halus. “ Dari pengakuan korban dan saksi-saksi. Saat berada dalam bilik dan posisi korban sedang terbaring. Pelaku sempat meminta korban diam karena takut didengar oleh santri sambil tangan pelaku terus bergentayangan meraba-raba tubuh korban yang usianya masih di bawah umur” ungkap Raja Gunawan. Gunawan dengan tegas, mengatakan polisi tidak akan membebaskan tersangka MK karena dalam kasus dugaan pencabulan anak di bawah umur ini sudah memenuhi usur. “ Kami tidak bisa membebaskan tersangka, karena dalam kasus ini sudah memmenuhi semua unsur. Jadi mestinya para santri menghormati proses hukum, dan biarkan keputusan hakim yang menentukannya” ujar Raja. Bagi Polisi, kata Raja Gunawan tindakan ratusan santri yang mendatangi Mapolres Pidie untuk meminta dibebaskan tersangka yang merupakan guru ngaji di pesantren itu, adalah hak mereka selaku warga negara. Apalagi kedatangan mereka dengan cara baik-baik. “ Mereka datang baik-baik dan kita terima mereka pun dengan cara baik-baik. Kami sudah menjelaskan kepada me-

reka terkait proses hukum yang dilakukan penyidik. Kami menjelaskan kepada mereka bahwa BAP yang kita buat bukan ngarang-ngarang tetapi berdasarkan pengakuan korban dan saksi-saksi dan juga pengakuan tersangka sendiri” jelasnya. Ratusan santri dari Dayah Pasantren Khairuddaraini, Kecamatan Padang Tiji, masih bertahan di lapangan tengah Mapolres Pidie. Mereka menunggu keputusan dari pihak penyidik yang disampaikan pada perwakilan mereka yang diterima Kasat Reskrim bersama beberapa perwira polisi lainnya. Amatan Waspada, Kamis (23/5) pagi. Ratusan santri itu datang ke ,Mapolres Pidie sekira pukul 06:00, tidak ada teriakan yel-yel dari santri. Setiba di pintu masuk Mapolres Pidie, rombongan santri itu dihadang sejumlah anggota polisi yang sedang berjagajaga. Rombongan santri itu disambut beberapa perwira Polisi antara lain, Kasat Intel AKP Apriadi dan Kasat Reskrim AKP Raja Gunawan. Setelah melakukan negosiasi, lalu beberapa perwakilan santri yang melakukan unjukrasa dibolehkan masuk dan diterima di saung depan ruang Satreskrim. (b10)

Aceh Segera Miliki 4 Pelabuhan Bebas LHOKSEUMAWE ( Waspada): Marzuki Daud,Tim Pemantau Aceh-Papua yang juga anggota DPR RI asal Aceh, Kamis (23/5) di Hotel Lidograha Aceh Utara di Lhokseumawe mengatakan, pada 2013 ini, Pemerintah Aceh segera memiliki pelabuhan bebas. Sekarang ini, pemerintah pusat sedang membahas persoalan ini di Jakarta. Marzuki mengatakan, selama ini Provinsi Aceh tidak dapat melakukan ekspor-impor melalui pelabuhan karena terhalang Kepmen Pertanian dan Kepmen Perda-gangan. Karena dua Kepmen tersebut, pemerintah pusat membatasi kegiatan ekspor-impor, sedangkan Pelabuhan Tanjung Priok, Tanjung Perak dan Pelabuhan Dumai bebas melakukan ekspor dan impor. Sekarang ini, untuk membuka pelabuhan bebas di Provinsi Aceh sudah ada kajian yang dilakukan Irjen Perdagangan Luar Negeri kepada Menko Perekonomian untuk mengkaji tentang tahap pertama. “Untuk tahap pertama kita minta empat pelabuhan saja untuk dijadikan pelabuhan bebas yaitu Pelabuhan Kuala

bertugas sebagai Sekretaris Disdik mengakui, belum bisa memastikan kapan anggaran uang sertifikasi tersebut cair dari pusat. Dikatakan, tugas Disdik mengajukan kembali ke pusat dan ini sudah kita ajukan, katanya. Persoalan Nasional Ketika ditanya perkiraan kapan bisa cair, Amir Hamzah dengan enteng menjawab dana bisa cair dan bisa tidak karena menurutnya pemerintah sudah memberikan Rp 30 miliar dan itu harus dicukupi dan dibagikan kepada guru sesuai dengan jumlah dana yang tersedia. Menurut Amir Hamzah, permasalahan seperti ini, bukan hanya dialami guru di Kota Langsa saja tetapi juga guruguru lain di Aceh bahkan Indonesia. Untuk uang sertifikasi guru ini, masih butuh Rp 8,7 T lagi,” tandasnyalebihlankut.(b21)

Langsa, Pelabuhan Malahayati, Pelabuhan Susoh dan Pelabuhan Krueng Geukueh. Keempat pelabuhan ini pada 2013 harus dibangun,” kata Marzuki Daud. Otomatis dengan hidupnya keempat pelabuhan itu, perekonomian Aceh akan berjalan, rakyat dapat pekerjaan dan pengangguran dapat dikurangi. Ditanya apakah semua rencana itu dapat berjalan, Marzuki kembali menegaskan, pada 2013 pelabuhan-pelabuhan itu harus berjalan. Untuk melancarkan rencana tersebut, Menteri Perdagangan, Menteri Perhubungan, BKPM, Pelindo I, kemudian Menko Perekonomian, dan berbagai instansi terkait akan duduk kembali dan mereka akan membahas untuk mencabut Kepmen Pertanian dan Kepmen Perdagangan. Hasil pembicaraan SBY, Presiden dan Zaini Abdullah, Gubernur Aceh beberapa waktu lalu, presiden cukup merespon keinginan tersebut, dan gubernur telah meminta bahan kepada Marzuki Daud untuk membahas persoalan itu. “Dari 4 pelabuhan yang kita minta, tahap pertama akan diperjuangkan dan mendapat prioritas Pelabuhan Krueng Geukueh dan Kuala Langsa,” katanya. (b18)

Klarifikasi Berita BKPP Aceh Timur Terima Sejumlah Aduan K-II

Markas Ganja Digerebek IDI (Waspada): Aparat polisi gagal menangkap seorang tersangka yang masuk target operasi (TO) dalam sebuah operasi khusus personel Satuan Narkoba Polres Aceh Timur di Gampong Teupin Jareng, Kecamatan Idi Rayeuk, Aceh Timur, Selasa (21/5) sekira pukul 12:00. Penggerebekan itu dilakukan petugas berdasarkan informasi masyarakat setempat, di mana rumah TO itu kerap dilakukan transaksi narkoba jenis ganja. Namun dalam penggerebekan itu, polisi tidak berhasil menangkap TO. Identitas telah dikantongi, tetapi petugas meminta istrinya berinisial MR bin MA untuk memberikan keterangan di Polres Aceh Timur. Kapolres Aceh Timur AKBP Muhajir melalui Kasat Narkoba AKP Adi Sofyan, Kamis (23/5) membenarkan. “Target kita lari dan istrinya hanya dibawa ke Polres untuk dimintai keterangan dan setelah diperiksa selanjutnya dikembalikan ke orangtuanya,” katanya. (b24)

LANGSA (Waspada): Kepala BKPP Aceh Timur, Bustami, SH menegaskan, sehubungan dengan berita Waspada, Rabu (22/5) di halaman C7 dengan judul BKPP Aceh Timur terima sejumlah aduan K-II, ada beberapa hal yang perlu diklarifikasi guna melengkapi berita tersebut. Hal itu dikatakan Bustami, SH kepada wartawan, Kamis (23/5) melalui siaran persnya. Menurutnya, dalam forum pertemuan pada Selasa (21/5) di aula DPRK, ketika dikonfirmasi para wartawan berkaitan dengan honor K-II. Kami hanya menyatakan bahwa banyak masukan atau bantahan masyarakat terhadap uji publik pegawai honor K2.

“Kami tidak merinci dari instansi mana saja dan juga tidak merinci nama-nama mereka satu per satu. Semuanya masih dalam proses penelitian, baik oleh BKPP maupun inspektorat. Kemudian, kepada mereka yang namanya dicantumkan dan merasa kurang nyaman kami mohon maaf,” katanya. Kemudian, untuk pendaftaran honor KII mengacu pada edaran Menpan-RB No. 5 tahun 2010 dan edaran Menpan-RB No. 3 tahun 2012. Sedangkan PP No. 56 tahun 2012 mencatumkan tentang penerimaan CPNS K-II melalui seleksi nasional dan pengangkatan dokter dan tenaga ahli melalui formasi khusus. (m43)

Masyarakat Juga Tidak Mau Disebut Sebagai Kaum Duafa

Waspada/Maimun Asnawi

IR ARIFIN HAMID, Kepala Dinas Cipta Karya bersama anggota DPRK Aceh Utara turun ke lapangan untuk memverifikasi rumah tidak layak huni sesuai dengan proposal yang masuk ke dinas tersebut. Foto itu diabadikan ketika Kadis itu berkunjung ke Kecamatan Langkahan. DI ERA tahun 70-an hingga tahun 2000-an Kabupaten Aceh Utara pernah mendapat julukan sebagai daerah petro dolar. Pasalnya, Aceh Utara memiliki kekayaan alam yang berlimpah khusus untuk kekayaan Migas yang dikelola oleh Mobil Oil, kini dikelola oleh ExxonMobil. Karena itu pula, nama Kabupaten Aceh Utara harum di tingkat nasional dan manca negara, karena Aceh Utara merupakan salah satu kabupaten penyumbang pembangunan Indonesia terbesar. Namun setelah eksplorasi Migas hampir rampung dilakukan oleh ExxonMobil dan PT Arun NGL, tidak ada tanda-tanda kalau Aceh Utara merupakan kabupaten kaya di Provinsi Aceh. Betapa tidak, ruas jalan lingkungan yang panjangnya 7000 Km dan sebagiannya

merupakan jalan prioritas peningkatan ekonomi rakyat hingga kini belum dapat dibangun dengan layak. Belum lagi berbicara persoalan air bersih dan rumah duafa (rumah tidak layak huni). Khusus untuk persoalan rumah tidak layak huni, sesuai data yang dimiliki Dinas Cipta Karya, Kabupaten Aceh Utara mengantongi 37.000 unit rumah yang harus segera dibantu. Data tersebut telah disimpan Dinas Cipta Karya jauh sebelum peristiwa gempa dan tsunami menghantam Bumi Sultan Iskandar Muda pada Desember 2004. Pasca bencana dahsyat itu terjadi, ratusan NGO dari berbagai negara datang membawa bantuan. Para NGO dan BRR bentukan pemerintah dalam sekelip mata telah berhasil membangun berbagai sarana infras-

truktur yang luluhlantak dihantam gelombang raksasa itu, termasuk memperbaiki semua rumah yang hancur khususnya rumah-rumah warga yang berada di pesisir pantai yang jumlahnya diperkirakan mencapai 15.000 unit. 37.000 dikurangi 15.000 sama dengan 22.000. Mulai dari tahun 2008, 2009, 2010, 2011, dan 2012, Kabupaten Aceh Utara terus melaksanakan pembangunan rumah dhuafa, baik menggunakan dana APBK, Otsus maupun APBN. Diperkirakan dalam jangka waktu itu mampu membangun 2.000-an unit rumah tidak layak huni. Itu artinya, sekarang Aceh Utara masih memiliki 20.000 unit rumah tidak layak huni. Untuk menyelesaikan pekerjaan rumah (PR), Kabupaten Aceh Utara membutuhkan waktu 40 tahun ke depan, karena setiap tahun Aceh Utara hanya mampu melaksanakan pembangunan rumah tidak layak huni sekitar 500-an unit, baik menggunakan dana APBK, Otsus maupun APBN. “Ini merupakan pekerjaan besar yang harus kita kerjakan. Aceh Utara tidak akan mampu menyelesaikan PR itu sendirian, butuh bantuan Pemerintah Pusat,” kata H Muhammad Thaib, Bupati Aceh Utara didampingi Ir Arifin Hamid, Kepala Dinas Cita Karya, Kamis (23/5). Karena ini merupakan pekerjaan tim, maka pada tahun 2012 DR Ahmad Farhan Hamid, Wakil MPR RI asal Aceh, pulang ke Aceh Utara untuk melihat langsung kondisi rumah duafa di beberapa kecamatan. Waktu

itu dia mengintruksikan dinas bersangkutan untuk melakukan pendataan ulang. Wakil MPR RI itu berjanji akan memperjuangkan bantuan rumah di tingkat pusat melalui Kementerian Perumahan Rakyat, namun sampai kini belum ada bantuan yang turun, meskipun masyarakat telah bertanya berkali-kali. Kondisi ini telah menambah beban Dinas Cipta Karya Aceh Utara. Tidak sanggup menahan malu, baru-baru ini, Ir Arifin menghadap Farhan Hamid untuk menagih janji. Mendapat laporan itu, Farhan Hamid memberikan tanggapan positif dan berjanji dengan segenap kemampuan yang dimilikinya akan terus berusaha agar bantuan rumah tidak layak huni dapat diberikan kepada Aceh Utara sebagai daerah penyumbang devisa terbesar untuk pembangun Bumi Pertiwi ini. “Kita sudah masukkan proposal bantuan rumah tidak layak huni ke Kementerian Perumahan Rakyat di Jakarta. Melalui proposal itu kita mohon bantuan 15.000 unit rumah tidak layak huni. Untuk mendapatkan bantuan, saya akan terus menerus melobi ke Jakarta. Pak Farhan juga berjanji akan berjuang untuk itu,” katanya. Kalau sekiranya Aceh Utara mendapatkan bantuan rumah duafa 15.000 unit dari Pemerintah Pusat, maka sisa rumah yang belum terbantu 5.000 unit. Untuk membangun sisa rumah itu membutuhkan waktu sekitar 6 tahun saja, jika setiap tahun Aceh Utara berkemampuan membantu 500-an unit meng-

gunakan dana APBK dan Otsus. “Kami sangat berharap, Pemerintah Pusat mau membantu 15 ribu unit rumah agar persoalan rumah duafa di Aceh Utara cepat terselesaikan,” harap H. Muhammad Thaib, Bupati Aceh Utara. Anggaran Minim Karena minimnya anggaran, Dinas Cipta Karya Aceh Utara terpaksa membuat dua kategori penerima bantuan. Kategori pertama, rumah bantuan akan diberikan kepada calon penerima yang memiliki umur 45 tahun ke atas dan memiliki tanggungan di atas 4 orang. Usia itu dinilai sudah tidak produktif lagi. Kategori ke dua, bantuan akan diberikan kepada rumah yang berlantai tanah, berdinding tepas, beratap rumbia dan berukuran kecil. Bagi yang memiliki kriteria itu akan menjadi prioritas. “Pastinya, cepat atau lambat mereka akan kita bantu,” katanya. Ditanya berapa unit rumah bantuan yang diberikan Aceh Utara di tahun 2013, Ir Arifin Hamid mengatakan, 300 unit dengan type-36 dengan dana Rp50 juta. Pembangunannya telah dimulai sejak 1 Mei 2013 dan kini pekerjaannya telah mencapai 30 persen dan pada Juli 2013 ke 300 unit rumah itu harus selesai dikerjakan. Untuk tahun 2013, Aceh Utara juga mendapat jatah 800 unit rumah, namun sampai kini belum ada kejelasannya. Banyaknya rumah duafa di Aceh Utara menggambarkan, kabupaten itu sebagai daerah paling miskin di Provinsi Aceh

meskipun kabupaten ini pernah berjaya, namun kejayaannya tidak berefek pada pembangunan daerah. Buktinya, Aceh Utara hingga kini belum mampu mensejahterakan lebih dari setengah juta jiwa warganya. Karena itu, untuk menekan jumlah warga duafa, Pemerintah Aceh membutuhkan program pemberdayaan ekonomi rakyat. Sebenarnya, kata Ir Arifin Hamid, jumlah rumah yang harus dibantu lebih banyak lagi, namun setelah diverifikasi ke lapangan, banyak warga duafa yang masih berusia produktif yang usianya berkisar antara 25

hingga 35 tahun. Pemberian bantuan kepada mereka ditunda dulu, sambil berharap akan ada peningkatan pendapatan seiring adanya program pemberdayaan ekonomi rakyat dari Pemerintah Aceh. Kalau kondisi ekonomi Aceh sudah bagus, tentu masyarakat bisa mendapatkan uang minimal pendapatan mereka standar produk domestik regional bruto, maka akan ada uang disisihkan untuk membangun rumah. Usia 25-35 tahun dianggap sebagai usia produktif. Masyarakat tersebut masih memiliki waktu panjang untuk ber-

juang memperbaiki kondisi ekonomi keluarganya, tentunya peningkatakan ekonomi akan bisa mereka perbaiki jika Pemerintah Aceh fokus pada program peningkatan sumberdaya manusia dan peningkatan pemberdayaan ekonomi masyarakat. Kondisi ekonomi Kabupaten Aceh Utara sekarang ini betul-betul sedang bermasalah. “Saya yakin, kalau masyarakat sudah memiliki uang sendiri, mereka juga tidak mau diberikan predikat sebagai kaum duafa. Maimun Asnawi, SH.I

Waspada/Maimun Asnawi

INILAH salah satu rumah tidak layak huni yang berada di Kecamatan Muerah Mulia, Aceh Utara. Sekilas tampak gubuk tersebut bukan tempat manusia beristirahat tapi seperti kandang hewan, namun di dalam rumah itu dihuni oleh kakek dan nenek yang sudah lanjut usia dan memiliki keterbatasan fisik.


Aceh

WASPADA Jumat 24 Mei 2013

Unsyiah: Banyak Yang Bisa Diambil Dari KNIA

Anggota PPK Langsa Bimtek LANGSA (Waspada): 25 Anggota Panitia Pemilihan Kecamatan (PPK) di 5 kecamatan dalam wilayah Pemko Langsa mengikuti bimbingan teknis (bimtek) verifikasi faktual calon anggota DPD-RI di aula kantor Komisi Independen Pemilihan (KIP) Kota Langsa, Kamis (23/5). Menurut Ketua KIP Kota Langsa, Agusni AH, SE, bimtek ini bertujuan untuk memberikan bimbingan secara teknis tata cara verifikasi faktual, dengan langsung menerjunkan PPK ke lapangan dan supervisi KIP itu sendiri. Selain itu, dalam Bimtek verifikasi faktual ini juga akan melakukan pengecekan ke lapangan KTP dukungan masyarakat terhadap calon anggota DPDRI asal Provinsi Aceh. Kemudian, terang Agusni lagi, untuk verifikasi faktual calon anggota DPD ini, sesuai arahan KIP Aceh, maka akan dilakukan, Jumat (24/5). Di mana, anggota PPK akan langsung turun ke lapangan melakukan pengecekan terhadap sampling 10 persen KTP dukungan masyarakat, yang sudah dikirimkan pihak KIP Aceh kepada KIP setempat. (m43)

Napi Kabur Ditemukan Di Rawa-rawa

Waspada/Rizaldi Anwar

LHOKSUKON (Waspada): Saiful Bahri, 19, narapidana kasus pencabulan terhadap anak-anak, yang kabur dari Rutan Lhoksukon, Rabu (22/5) ditemukan pada hari yang sama, di rawarawa Desa Reudeub, Kec. Lhoksukon, Aceh Utara, sekitar pukul 18:30. “Sekarang, dia kita tahan di sel khusus tanpa lampu, sampai batas waktu yang belum ditentukan. Bisa sepekan, biasa juga lebih,” kata Muhammad Saleh, Kepala Rumah Tahanan Negara (Rutan) Lhoksukon, kemarin. Menurut Saleh, ditahan di ‘sel gelap’ lumrah bagi narapidana yang berusaha kabur dari penjara. Semua rutan memiliki ruang tahanan khusus ini. “Kecuali itu, narapidana yang berusaha kabur juga diberi sanksi dicabut beberapa haknya, termasuk hak mendapat keringanan hukuman,” tambah Saleh. (b19/ b18)

Bengkel Tambal Ban Terbakar LHOKSEUMAWE (Waspada) : Sebuah bengkel tambal ban di Gampong Blang Cruem, Kemukiman Kandang, Kecamatan Muara Dua, Kota Lhokseumawe, Kamis (23/5) pukul 10:00 hangus terbakar. Tidak ada korban jiwa dalam peristiwa tersebut, namun kerugian ditaksir mencapai ratusan juta rupiah. Adi, 35, warga Kandang, Kota Lhokseumawe yang kebetulan pada saat itu sedang menambal ban sepeda motornya di bengkel tersebut mengatakan, saat itu Hamdani, pemilik bengkel yang juga merangkap sebagai tukang sedang menambal ban sepeda motornya. Tiba-tiba muncul percikan api dan setika itu juga api membesar hingga membakar bengkel. Melihat situasi yang tidak menguntungkan itu, Adi dan Hamdani bergegas mengeluarkan sepedamotor, kompresor, tabung gas dan beberapa barang lain dari bengkel. Begitupun sejumlah barang lainnya ludes terbakar. Api dari bengkel tersebut sempat membakar teras rumah Fauziah yang letakkan sekitar lima meter di belakang bengkel itu. Api juga sempat membakar sebagian kecil isi rumah, namun tidak begitu parah. Tidak berapa lama kemudian, datang beberapa unit mobil pemadam kebakaran. Petugas langsung berupaya memadamkan api, namun saat sedang melakukan pemadaman ternyata arus listrik di lokasi tersebut belum padam dan nyaris beberapa warga menjadi korban karena kesetrum arus listrik. (b18)

KE-40 mahasiswa dan para dosen Unsyiah foto bareng dengan pihak PIU PT Angkasa Pura II Kualanamu di depan terminal KNIA

Larangan Menari

Kalangan Seniman Keberatan LHOKSEUMAWE (Waspada): Terkait Bupati Muhammad Thaib yang melarang kaum perempuan dewasa menari saat menyambut tamu di Aceh Utara, membuat kalangan seniman di daerah itu keberatan. Mereka menyarankan agar Pemkab menseminarkan imbauan ini terlebih dahulu. Ketua Dewan Kesenian Aceh (DKA) Aceh Utara, Nurdin Ismail, Kamis (23/5) sebagai pelaksana kegiatan seni mengaku keberatan dengan imbauan bupati terkait perempuam dewasa tidak boleh menari. Namun, bila ini menjadi keputusan bupati, dia hanya dapat menja-

lankan sebagai bawahan. Kata Ayah Din, sapaan akrab Nurdin, dalam seni tari tidak lenggokan tubuh perempuan yang berlebihan dan sensualitas, apalagi pakaiannya menutupi aurat. Bahkan tarian Aceh dinilai sangat santun garakannya. Maka sangat tidak logis, tarian ini bisa membangkitkan nafsu biologis kaum laki-laki. Katanya lagi, adat, budaya dan seni Aceh sangat diharapkan bisa bertahan sepanjang masa. Bila ada satu aturan terbentur dengan adat, budaya dan seni, maka cari solusi agar ini tetap bisa dijalankan. Karena bangsa yang berhasil adalah bangsa yang melestarikan seni, budaya dan adat. Hal senada juga disampaikan pelaku seni Aceh Utara, Tarmizi. Menurutnya, sangat tidak mungkin dilakukan pembata-

san bagi perempuan dewasa dilarang menari di tempat umum. Secara lokal dan nasional setiap tahun ada perlombaan tari, diikuti siswi setingkat SMP dan SMA. Bahkan Pekan Kebudayaan Aceh (PKA) di Banda Aceh setiap lima tahun sekali diadakan oleh provinsi jelas-jelas semisal ranup lampuan, likok pulo yang dimainkan putri-putri remaja. Maka di sini perlu singkronisasi antar pemerintah provinsi dan kabupaten. Kedua pelaku seni ini menyarankan kepada Bupati Aceh Utara agar melakukan seminar terhadap larangan ini, jangan sampai mengambil kebijakan terlebih dahulu. Seminar ini diundangelemnenberkompeten seperti pelaku, pakar seni budaya adat, ulama, LSM, akademisi dan instansi terkait lainnya. (cmk)

Muslim Aid Indonesia Tanam 14.000 Mangrove PEUREULAK (Waspada): Muslim Aid Indonesia bekerjasama dengan Dinas Kehutanan, DKP, Dinas Sosial, TAGANA dan BPDAS melakukan penanaman 14.000 mangrove (bakau) di kawasan pesisir pantai Peureulak, Kabupaten Aceh Timur, tepatnya di Gampong Leuge, Kamis (23/5). Aceh Program Koordinator, TeukuYouvan, kepada wartawan mengatakan, tanaman bakau ini dinilai akan berkontribusi dalam menyerap karbon di udara dan mencegah serta mengurangi dampak perubahan iklim. Di samping itu keanekaragaman hayati yang melekat bersama dengan hutan mangrove akan menjadi suatu siklus rantai makanan yang menguntungkan penghidupan manusia. “Program penanaman mangrove di pesisir pantai gampong Leuge akan berakhir Mei 2013 ini,” ujarnya. Program penanaman mangrove di pesisir Peureulak ini merupakan program pengurangan risiko bencana dan perubahan iklim yang kedua dalam implementasi program Muslim Aid Indonesia di pantai timur Aceh, sebelumnya Muslim Aid Indonesia juga telah melakukan program serupa di Kuala Langsa pada saat penanaman 13.500 mangrove di daerah yang rentan terhadap ancaman bencana yang sama. (cri)

Sejumlah Pejabat Pemkab Bireuen Dimutasi BIREUEN (Waspada): Sejumlah pejabat di lingkungan Pemerintah Kabupaten Bireuen dimutasi, Selasa (21/5) petang. Prosesi rotasi pejabat ini dilakukan bupati setempat, H Ruslan M. Daud dan disaksikan Wakil Bupati, Ir H Mukhtar, MSi, dan sejumlah pejabat eselon II. Pada lampiran Keputusan Bupati Bireuen Nomor: Peg.821. 22/Kpts.416/2013, pejabat eselon II yang dimutasi yaitu, Drs Darmansyah dari jabatan lama Kepala Dinas Kependudukan dan Pencatatan Sipil sebagai staf ahli Bidang Politik dan Hukum Pemkab Bireuen yang sebelumnya dijabat Ali Yuzar, SH. Sedangkan Ali Yuzar, SH dilantik sebagai kepala dinas menggantikan Drs Darmansyah. Berikutnya, Zamri, SE, sebelumnya sekretaris pada Dinas Pengelolaan Pasar, Kebersihan, dan Pertamanan dilantik menjadi Kepala Dinas Pengelolaan Pasar, Kebersihan, dan Pertamanan. Sedangkan posisi yang ditinggalnya diisi M. Nasir, SP. Bupati Bireuen H Ruslan M Daud juga melakukan pergantian pejabat eselon III dan IV di sejumlah Satuan Kerja Perangkat Daerah (SKPK) setempat. Selain itu, rotasi pejabat juga dilakukan pada jabatan fungsional. Berdasarkan lampiran Surat Keputusan Bupati Bireuen nomor: Peg.824/Kpts/419/2013, sebanyak 31 guru dan kepala sekolah juga dilakukan penyegaran. (b17)

Penerbangan Di Bandara SIM Banda Aceh Tiba (flight, asal, waktu)

Garuda Indonesia

GA 0278 Medan GA 0142 Jakarta/Medan GA 0146 Jakarta/Medan

Lion Air

JT 304 Jakarta JT 306 Jakarta/Medan JT 396 Jakarta/Medan

Sriwijaya Air

SJ 010 Jakarta/Medan

Air Asia

QZ 8023 Medan AK 1305 Kuala Lumpur *

Fire Fly

FY 3401 Penang* * Setiap Senin, Rabu, Jumat dan Minggu.

Berangkat (flight, tujuan, waktu)

07:05 10:45 14:50

GA 0279 Medan GA 0143 Medan/Jakarta GA 0147 Medan/Jakarta

07:45 11:3 0 15:45

11:35 15:55 21:30

JT 397 Medan/Jakarta JT 307 Jakarta JT 305 Medan/Jakarta

06:00 12:15 16:35

12:50

SJ 011 Medan/Jakarta

13:35

12:00 11:20

QZ 8022 Medan AK 1306 Kuala Lumpur*

12:25 11:45

14:00

FY 3400 Penang*

14:20

C3

Waspada/Mustafa Kamal

SALAH satu gerakan dalam tarian ranup lampuan yang dimainkan wanita dewasa di Aceh Utara saat menyambut pejabat penting negara. Foto direkam 15 Maret 2013

Proyek Aceh Timur ‘Lari’ Ke Aceh Tamiang IDI (Waspada): Aneh, proyek yang seharusnya dikerjakan di wilayah Kabupaten Aceh Timur tiba-tiba dipindahkan ke Aceh Tamiang. Hal itu terlihat dari plang proyek yang akhirnya menimbulkan kecurigaan dugaan permainan dan kong kali kong antara rekanan dengan pengawas proyek. Untuk itu, kinerja pengawas proyek yang dananya bersumber dari Anggaran Pendapatan Belanja Negara (APBN) perlu dipertanyakan. Sehingga tidak merugian daerah. Bahkan, sejumlah proyek APBN lainnya di Aceh juga dinilai asal jadi dari segi kualitast jalan negara yang dibangun sepanjang wilayah pantai timur Provinsi Aceh mu-

lai dari Aceh Utara hingga ke Tamiang. Informasi yang diperoleh, Kamis (23/5) menyebutkan, salah satu proyek yang dinilai aneh yakni rehab Jembatan Kodok di Jalan Lintasan Sumatera (Jalinsum) Banda Aceh - Medan yaknu di Desa Meudang Ara, Kabupaten Aceh Tamiang. Proyek itu diduga proyek siluman. Pasalnya, pada plang proyek jelas tertulis untuk pemeliharaan Jembatan Krueng Punti, Kecamatan Darul Aman (Idi Cut), KabupatenAcehTimur,tapilokasi itu di Kab. Aceh Tamiang. Proyek itu dikerjakan oleh PT Jaya Bersama & Sons di bawah pengawasan PT Anugrah Krida Pradana dengan nomor

KU.08.08/CTR.BR.A2/10/ APBN/2013 tanggal 25 Februari 2013 yang anggarannya bersumber dari dana APBN murni dengan nomor paket WIL1.4A. Tetapi Pagu Anggaran tidak ditulis pada plang proyek yang dipacangkan di sana. Direktur Eksekutif Yayasan Advokasi Rakyat Aceh (YARA) Safaruddin, SH ketika dimintai tanggapannya mengatakan, pada proyek tersebut jelas-jelas terjadi pembohongan Oleh karenanya, kinerja tim pengawas proyek dipertanyakan atas pemindahan proyek tersebut dan kepolisian diminta untuk melakukan penyelidikan atas rehab jembatan di Jalinsum itu. (b24)

KUALANAMU, Deliserdang (Waspada): Ketua Jurusan/Arsitektur Universitas Syiahkuala (Unsyiah), Ir. Izziah Hasan, MSc. Ph.D, menegaskan banyak yang bisa diambil pelajaran dari pembangunan Kualanamu International Airport (KNIA). “Kita harus bangga dengan karya anak bangsa sendiri ini. Banyak yang bisa diambil pelajaran dari sini, khususnya untuk mahasiswa Unsyiah jurusan arsitektur, di antaranya pembangunan struktur dan plafon dari bandara ini.” demikian putri mantan Rektor IAIN Ar-Raniry, Ibrahim Hasan ini saat mengunjungi KNIA bersama 40 mahasiswa/i Unsyiah di Terminal Keberangkatan KNIA, Rabu (22/5). Berbicara singkat dan lugas, dosen lulusan perguruan tinggi dari Negeri Kangguru (Australia) dan Paman Sam (Amerika Serikat) ini mengatakan, pihaknya amat tertarik dengan bagian-bagian bangunan yang ada di KNIA ini. “Seperti materialnya dan lain sebagainya,” ucapnya sembari berjalan didampingi Kordinator Zainuddin, ST. MSc, para dosen yakni Zahrul

Fuadi ST. MT, Erna Mutia ST, MT, Masdar Djama-luddin, ST dan Ir Munardy MT sebagai pem-bimbing. Kunjungan ke-40 mahasiswa Unsyiah Juruasan/Program Studi (Prodi) Arsitektur Fakultas Teknik Banda Aceh, itu diterima Ass. Teknik Project Implementation Unit (PIU) PT Angkasa Pura II Kualanamu, Bambang Hermanto dan Kasi Hukum dan HumasWisnu Budi Setianto. Dua petinggi PIU PT AP II Kualanamu memberikan presentase, yang sebelumnya ke-40 mahasiswa dibawa langsung melihat hasil pembangunan yang telah rampung, di antaranya, terminal, appron, taxi way dan run way. “Saya puas dapat melihat langsung pembangunan KNIA yang selama ini saya baca dari Waspada,” bilang salah seorang mahasiswi Unsyiah kepada harian ini usai tanya jawab di ruang rapat PIU. Kunjungan itu diakhiri dengan pemberian cenderamata dari kedua belah pihak dan foto bersama.(m16)

15 Calon Anggota KIP Diserahkan Ke DPRK Langsa LANGSA (Waspada): Tim Penjaringan dan Penyaringan anggota Komisi Independen Pemilihan (KIP) Kota Langsa menyerahkan berkas 15 calon anggota KIP periode 2013-2018 ke Dewan Perwakilan Rakyat Kota (DPRK) Langsa untuk mengikuti uji kelayakan dan fit and proper test yang dilakukan Pansus DPRK Langsa, Kamis (23/5). “Ke-15 calon anggota KIP Kota Langsa periode 2013-2018 itu merupakan hasil akhir setelah melakukan serangkaian tahapan seleksi terhadap 25 calon yang lulus ujian tulis beberapa waktu lalu,” kata Ketua Tim Penjaringan dan Penyaringan Calon Anggota Komisi Independen Pemilihan (KIP) Kota Langsa, Ir Dedek Juliadi Rendra, Kamis (23/5). Disebutkan, penyerahan nama 15 calon itu diterimaWakil Ketua I DPRK Langsa, Syahyuzar AKA di ruang kerjanya disaksikan tim pansel yakni Ir Dedek Juliadi Rendra (Ketua) Mukhsin, SH, (Sekretaris), M Syafrizal, S.Sos.I, Tasnim Lubis,SPd.I dan Zulfahmi, S.Ag (Anggota). “Dengan penyerahan 15 nama itu ke dewan, maka tugas kami (pansel) telah selesai, selanjutnya menjadi wewenang dewan untuk melakukan uji kelayakan dan kepatutan dan menetap-

kan lima komisioner KIP Kota Langsa periode 2013-2018,” ujarnya. Dedek menyatakan, apresiasi kepada seluruh peserta yang telah mengikuti seleksi dan menaati aturan yang ada. Begitu pula terima kasih kepada kalangan masyarakat yang telah mendukung kelancaran tahapan demi tahapan seleksi sehingga tugas Pansel terselesaikan tanpa ada masalah dan kendala. Adapun ke-15 calon anggota KIP Langsa yang lulus uji wawancara yakni: Agusni, Kasrun, Ngatiman, Munawir, Bahtiar, Ridwan, Marida Fitriani, Syukri, Syamsul Bahri, Amrunsyah, Riswandar, Joko Santoso, Cut Dara Meutia, Eka Syahputra dan Azhar Marzuki. Sementara itu, Syahyuzar,AKA, mengucapkan terima kasih kepada Tim Penjaringan dan Penyaringan calon anggota Komisi Independen Pemilihan (KIP) Kota Langsa yang telah bekerja semaksimal mungkin mulai dari akhir perekrutan hingga penetapan 15 calon anggota KIP. “Mudah-mudahan ke-15 orang calon anggota KIP orang-orang terbaik yang telah dipilih sesuai dengan ketentuan dan undang-undang yang berlaku,” harapnya.(b21)

Bayi Ditemukan Di Semak-semak MADAT (Waspada): Warga Kecamatan Madat, Aceh Timur, Kamis (23/5) pagi, dihebohkan dengan ditemukannya seorang bayi berjenis kelamin perempuan byang diduga baru lahir di semak-semak, dekat rumpun pisang, di Dusun Mawar, Desa Seuneubok Pidie. Saat ditemukan, bayi dalam kondisi telanjang dan masih berlumur air ketuban. Hampir sekujur tubuh dikerubuti semut dan lalat. Bahkan, di atas ubun-ubunnya, sudah berbelatung. Sementara lehernya dijerat dengan pelepah daun pisang kering. “Sepertinya, orang tua bayi malang ini berniat menghabisi nyawa anaknya. Tapi, Tuhan masih mentakdirkan dia tetap hidup,” kata Iskandar Yahya, Sekdes Seuneunok Pidie, Kec. Madat, Aceh Timur, di lokasi penemuan bayi tersebut, kemarin. Sekdes menambahkan, bayi itu dilihat pertama kali oleh Nurbaiti, 43, warga setempat yang kebetulan sedang bercocok tanam. Temuan ini, kemudian dikabarkan ke warga lain dan diteruskan ke aparat desa dan polisi. “Awalnya, saya mendengar suara tangisan bayi. Saya pikir suara anak kambing. Setelah saya cari ke sana-sini, terlihat bayi tersebut persis di sudut luar pagar kebun, tempat saya bercocok

tanam,” sela Nurbaiti. Setelah aparat desa tiba di lokasi beberapa menit kemudian bayi itu langsung diambil, lalu dibawa ke Puskesmas Madat. “Sekitar jam 5 subuh, beberapa warga sempat mendengar suara sepedamotor. Diduga, itu sepedamotor pelaku,” tambah Aminah, 40, ibu rumah tangga yang tinggal dekat lokasi kejadian. Muhammad Arda Bili, tenaga medis yang menangani bayi tersebut di Puskesmas Madat menjelaskan, hasil pemeriksaan sementara, ditemukan luka gores di pipi kanan bayi dan luka bekas jeratan di leher. Namun secara umum, kesehatan bayi cukup baik dan tergolong sehat. Bayiberkulitputihini,diperkirakanbarudilahirkan 4 atau 5 jam sebelum ditemukan. Kepala Dusun Mawar, Desa Seuneubok Pidie, Iskandar mencurigai pembuang bayi warga Desa Seuneubok Pidie. Dia mengaku akan menyisir dan memeriksa rumah yang mencurigakan demi menemukan pelaku. Kapolres Aceh Timur AKBP Muhajir melalui Kapolsek Madat Ipda Zainir mengatakan, polisi masih menyelidiki motif kasus dan identitas pelaku. “Untuk sementara, bayi itu dirawat oleh keluarga Iskandar, Kepala Dusun Mawar,” papar kapolsek. (b19)

Waspada/Musyawir

BAYI yang ditemukan di Desa Seuneubok Pidie, saat dirawat di Puskesmas Madat, Kamis (23/5)

Walau Diancam, Tagore Tetap Berdarah ‘Merah’ MANTAN Bupati Bener Meriah, Ir. Tagore (foto), benar-benar membuat kejuatan di Aceh. Atribut merah tetap disandangnya, walau pengurus DPD PDIP Aceh menolak kehadiran tokoh pejuang NKRI ini menjadi caleg DPR RI. Walau mendapat tantangan luar biasa dari DPD PDIP Aceh, tetapi Tagore tetap “menyemburkan” darah merah. Ancaman pengurus DPD PDIP Aceh, bahwa pihaknya akan mundur bila Tagore masuk dalam daftar caleg PDIP untuk, tidak membuat pengurus DPP PDI pusat gentar. Tagore tetap dimasukkan dalam daftar Caleg. Kamis (23/5) di gedung Reje Ilang, Takengen, Tagore mendeklarasikan diri sebagai caleg DPR RI dari PDIP untuk wilayah dua Aceh dengan nomor urut 6. Wilayah dua Aceh meliputi Aceh Tengah, Bener Meriah, Bireuen, Lhokseumawe, Aceh Utara, Aceh Timur dan Tamiang. “Ini amanah DPP pusat, hari ini saya jalankan amanah untuk deklarasi,” sebut Tagore di hadapan ratusan tokoh pejuang dari Bener Meriah dan Aceh Tengah. Sebelum pengurus DPP PDIP Aceh mengganjal Tagore, Golkar

terlebih dahulu sudah “mendepak” kadernya, walau sudah puluhan tahun membawa kejayaan Golkar. Tagore tidak dimasukkan dalam daftar caleg Golkar, walau menurut Tagore, kualitasnya lebih baik bila dibandingkan dengan caleg DPR RI lainnya dari Golkar di Aceh. AhirnyaTagore mundur dari Golkar. Mundurnya tokoh pejuang provinsi ALA ini, diikuti sejumlah pengurus teras Golkar di Bener Meriah. Golkar Aceh geger, kehilangan tokoh panutan untuk wilayah tengah Aceh. “Golkar Aceh memiliki sistem yang salah. Dengan sengaja menciptakan diskriminasi dan penzaliman untuk rakyat wilayah tengah Aceh. Makanya saya bangkit, karena tidak ada keterwakilan Gayo di pusat,” sebut Tagore saat dilangsungkan deklarasi. Mereka yang duduk di DPR RI mengatasnamakan rakyat di enam kabupaten ini, bukan membela wilayah tengah. Akan tetapi justru mengkhianati keinginan mayoritas rakyat pedalaman Aceh ini, sebut Tagore. “Saya siap mati demi membela rakyat wilayah tengah ini.

menginjak negeri ini, sudah saatnya kita punya tekad siap mati untuk membela negeri ini,” sebut Tagore yang diikuti yel yel dan tepukan tangan hadirin. “Saya bukan mencari kekayaan maju menjadi caleg. Tetapi membela nasib rakyat Gayo dan rakyat lainnya di enam kabupaten ini. Khususnya wilayah ten g a h . Sa y a Waspada/ Bahtiar Gayo MANTAN Bupati Bener Meriah yang didepak dari mendapatkan Golkar Aceh akhirnya mengenakan atribut paket proyek merah, walau DPD PDIP Aceh tetap menggan- PLTA Peusajalnya.Terlihat Tagore saat mendeklarasikan maju n g a n 3 d e ngan nilai Rp sebagai caleg DPR RI. 3 triliun lebih, Sudah saatnya kita yang dizalimi tetapi itu saya tinggalkan demi di Aceh bangkit membela ne- membela rakyat Gayo di pusat,” geri. Jangan biarkan orang lain sebutnya.

“Kita yang memiliki Aceh ini dizalimi oleh tatanan elit politik Aceh. Gayo sudah mendirikan kerajaan Aceh Darussalam, namun manusia yang mendirikan Aceh Darussalam ini tidak dihargai. Semut aja diinjak melawan, apalagi kita yang punya harga diri,” sebut mantan Ketua Partai Golkar Bener Meriah ini. Tagore memang sosok fenomenal di Aceh. Saat Aceh dibalut konflik, lelaki berdarah veteran ini, terang-terangan menantang GAM dalam membela idiologi. Tagore berani frontal dengan pihak GAM. Saat Irwandi yusuf menjabat gubernur, mantan bupati di negeri lembah merapi ini, terang terangan menantang Irwandi, walau sama-sama memiliki lencana di dada yang berbeda level. Giliran Zikir (Zaini AbdullahMuzakir Manaf) berkuasa, Tagore Abubakar, tidak lagi duduk di kursi pemerintahan. Namun pejuang pemekaran Provinsi Aceh Leuser Antara (ALA) ini tetap menunjukkan sikapnya menantang gubernur terpilih. Apalagi bila berbicara NKRI, lelaki dari Bintang, Gayo Lut ini,

nadanya terus meninggi. Baginya tidak boleh apapun di negeri ini selain NKRI. Tagore sudah membuktikan kesetiannya pada bumi pertiwi saat konflik membalut Aceh. Kini pejuang NKRI ini bergabung dengan PDIP, partai yang jauh-jauh hari sudah mendukung pemekaran provinsi ALA. Walau saat terakhir penutupan pendaftaran Caleg, Tagore baru muncul di PDIP, namun pengurus pusat PDIP mendukungnya. Bahkan DPP PDIP, siap mengambil risiko bila berbenturan dengan pengurus DPD PDIP Aceh. Sungguh sebuah kejutan bagi partai dalam lingkaran bulat berkepala banteng ini. Akankah PDIP pusat kecewa dengan mendukung Tagore untuk ke senayan. Saat pemilihan caleg nanti akan terbukti jawabannya. Walau mayoritas masyarakat wilayah tengah Aceh mendukung Tagore, tetapi Allah maha berkuasa atas segala-galanya. Bagaimana sejarah yang akan diukir oleh anak almarhum Abu Bakar Bintang ini? Waktu yang akan menjawabnya. Bahtiar Gayo


Aceh

C2 BANDA ACEH(Waspada): Pemerintah Kota Tangerang, Provinsi Banten, tertarik untuk mengadopsi program pembangunan dan aplikasi e-kinerja milik Pemko Banda Aceh Banda Aceh. Hal itu disampaikan Kepala Bagian Perencanaan Sekretariat Daerah Pengendalian Kegiatan Pembangunan (BPSPKP) Pemko Tangerang, Nana Trisiasana saat melakukan study banding ke Pemerintah Kota Banda Aceh, Rabu (22/5). Kunjungan rombongan Pemko Tangerang, itu disambut Asisten III Ir T Buchari Budiman, Kabag Organisasi dan beberapa Kabag Balai Kota lainnya. Kata dia, setelah mereka melakukan study ke Pemkoa Banda Aceh, selain ingin mengadopsi sistem aplikasi pembangunan, mereka juga tertarik dalam penerapan e-kinerja yang diterapkan Pemko Banda Aceh. (b02)

SUBULUSSALAM (Waspada): H-30 pelaksanaan Musabaqah Tilawatil Quran (MTQ) ke31 Tingkat Provinsi Aceh, Juni 2013 di Subulussalam, panitia lokal (panlok) siap 80 persen. Demikian Wali Kota Subulussalam, Merah Sakti pada gelar Rapat Koordinasi (Rakor) terpadu panitia pengarah, penyelenggara dan utusan Kab/Kota MTQ ke-31 Aceh di gedung guru Dinas Pendidikan Kebudayaan Pemuda dan Olahraga setempat, Kamis (23/5). Selaku tuan rumah, Sakti berharap mampu meraih tiga sukses, yakni sukses panitia, prestasi dan pertanggungjawaban anggaran. “Mampu mencapai prestasi lima besar sudah cukup membanggakan,” ujar Sakti. Kadis Syariat Islam Aceh, Syahrizal Abbas selaku Penitia Pengarah, saat membuka rakor menyampaikan pesan Gubernur Aceh agar

Lagi, Wakil Wali Kota Sabang Lantik Pejabat

Pelatihan Pengelola Manajemen Dayah Dan Sekolah SABANG (Waspada): Guna meningkatkan pembangunan pendidikan, Dinas Syariat Islam Sabang menggelar pelatihan pengelola manajemen dayah dan sekolah, dibuka secara resmi Wali Kota Sabang Zulkifli H Adam, Selasa (21/5). Pelatihan pengelola manajemen dayah dan sekolah yang diikuti 50 peserta yang terdiri dari para pegelola dayah, guru dan santri dalam Kota Sabang itu berlangsung di Aula Dishubkominfo Sabang. Wali Kota Sabang mengatakan, Pemerintah daerah sangat mendukung dan menyambut baik atas terselenggaranya pelatihan bagi pengelola dan guru dan santri dayah dan ini merupakan komitmen pemerintah terhadap pembangunan institusi pendidikan. (b31)

Satu Bacaleg Perempuan Di Abdya Tak Mampu Baca Alquran BLANGPIDIE (Waspada) : Sebanyak 52 Bakal Calon Legislatif (Bacaleg) mengikuti tes uji baca Al-Quran susulan di Aula Kantor Komisi Independen Pemilihan (KIP) Kabupaten Aceh Barat Daya (Abdya) pada Rabu (22/5). Dari jumlah daftar bakal calon sebanyak 50 bacaleg dinyatakan lulus, sementara 2 bacaleg perempuan dinyatakan gugur, satu dari PKPI karena sakit dan satunya lagi dari Partai Nasional Demokrat (NasDem) karena tidak mampu membaca Alquran. Ketua KIP Abdya Nazli kepada wartawan, Kamis (23/5) mengatakan, bacaleg yang gugur itu tidak bisa digantikan lagi, karena keduanya perempuan maka akan mengubah daftar calon dalam partai itu, satu bacaleg perempuan gugur maka akan gugur pula dua bacaleg laki-laki dalam dapil itu. (b08)

Waspada/Khairul Boangmanalu

PANITIA pengarah MTQ ke-31 Prov. Aceh, Syahrizal Abbas membuka Rakor Terpadu Panitia Pengarah, Penyelenggara dan Utusan Kab/Kota di Subulussalam, Kamis (23/5)

Kios Jatah Pasar Inpres Jadi Sarang Maksiat TAKENGEN (Waspada): Akibat belum layak huni, kios yang dibangun Pemda Aceh Tengah untuk jatah korban kebakaran 2011 dan pembongkaran 2010 di Pasar Inpres Takengen hingga kini belum ditempati para pedagang. Hal itu mulai berdampak buruk bagi warga pasar. Pasalnya, area bangunan yang belum ditempati, mulai dimanfaatkan segelintir orang untuk aksi maksiat. Diduga ada ‘mafia’ terselubung yang melakukan praktik prostitusi dan judi di sana. “Terlepas dari belum atau layaknya bangunan kios, saya mendesak area pasar sesegera mungkin bisa diduduki pedagang pasar. Apalagi, kini sudah ada mafia yang mulai memanfaatkannya untuk ajang mesum dan judi,” sebut Hamdani, Reje (gecik) Bale Atu, Pasar Inpres, di hadapan Kadis Disperindag AcehTengah dan para peda-gang saat berlangsungnya rapat membahas persoalan pasar di Oproom setempat, Kamis (23/5). Menurut Hamdani, mirisnya lagi, sejumlah mafia pasar

ini sepertinya sangat terorganisir. Sulit dicegah, bahkan terkesan semena-mena. “Para wartawan mohon ditulis dan angkat persoalan ini,” pintanya. Hujan Interupsi Amatan Waspada, dalam rapat membahas tehnis penempatan pedagang di Pasar Inpres, hujan interupsi mewarnai berlangsungnya acara. Para pedagang selain mengeluhkan keberadaan kios yang belum layak pakai, juga menginginkan Disperindag membagi lapak secara adil. Melarang penerimaan jatah kios secara ganda bagi korban. “Diharap tidak ada lagi jual beli atau sewa menyewa kios dari pedagang ke orang lain. Karena ini sangat merugikan kami, “ ucap seorang pedagang. Surita, pedagang lainya mengusulkan, pembagian penempatan jatah kios supaya merata. Tidak membedakan antara korban kebakaran maupun korban yang kiosnya dibongkar. “Saya merupakan 1 dari 16 pedagang yang jadi korban kebakaran. Saat itu Wabup Aceh Tengah berjanji akan memprioritas kami dalam persoalan pembagian kios. Lokasi tempat

berjualan kami harus di lapak yang sama. Kami tidak ingin ditempatkan di bangunan pasar atas,” imbuh Mukti Hasan, pedagang lainnya. Menanggapi itu, Kadis Perindustrian dan Perdagangan Aceh Tengah, Munzir didampingi Kabagnya, Zainul Purba, mengharapkan persoalan dapat diselesaikan secara musyawarah dan mufakat. “Mengenai adanya tiang bangunan tidak sesuai spek sejumlah 3 unit ruko atau pintu kios yang belum layak, kami nantinya akan menurunkan konsultan ke sana. Selanjutnya, kami juga akan melarang, adanya pergantian kepemilikan lapak yang tidak sesuai prosedur,” jelas Zainul. Selain itu lanjutnya, dalam aturan kontrak yang telah dibuat pihaknya dengan pedagang menyebutkan apabila lapak sudah tidak digunakan seorang pengelola, harus mengembalikannya ke Pemda. “Sesuai hasil kesepakatan kita bersama, untuk penempatan kios di bagian bangunan bawah adalah para korban kebakaran. Namun untuk bagian atas nantinya akan dibagi melalui teknis undian,” paparnya. (cb09)

Selektif Salurkan Bantuan Masyarakat IDI (Waspada): Pemkab Aceh Timur diminta untuk benarbenar selektif dalam penyaluran bantuan baik itu modal usaha, rencangan pembangunan rumah dhuafa maupun beasiswa bagi mahasiswa yang akan disalurkan pada tahun ini. Demikian disampaikan Said Maulana, salah satu tokoh muda Idi yang juga mahasiswa Fakultas Hukum Unsam Langsa kelas Idi, Kamis (23/5). Menurutnya, Pemkab Aceh Timur saat ini memang sudah mulai melakukan pembangunan baik fisik maupun nonfisik, karena itu bantuan yang disalurkan supaya tepat sasaran dan sangat disayangkan apabila anggaran daerah tersebut diterima oleh masyarakat yang tidak berhak. (cri)

Posko Bencana Nelayan Abdya Telan Dana Rp150 Juta BLANGPIDIE (Waspada) : Selama kurun waktu 10 hari terakhir, penggunaan posko bencana hilangnya sejumlah nelayan di Kabupaten Aceh Barat Daya bertempat di Ujung Serangga, Kecamatan Susoh telah menelan dana kurang lebih Rp150 juta. Kepala Badan Penanggulangan Bencana Kabupaten (BPBK) Abdya Jusbar, Rabu (22/5) di ruang kerjanya mengungkapkan, anggaran tanggap darurat sebesar Rp150 juta bersumber dari APBK Abdya tahun 2013 telah habis terserap dalam pembukaan posko bencana dan biaya operasional pencarian nelayan Abdya yang hilang diterpa badai beberapa waktu lalu. “Yang paling besar biaya operasional yakni uang minyak rata-rata Rp15 juta per hari, belum lagi biaya uang makan,” ungkapnya.(b08)

Kepala BPM Ajak Wartawan Pantau PNPM Mandiri NAGAN RAYA (Waspada) : Kepala Badan Pemberdayaan Masyarakat Said Azman mengajak wartawan untuk memantau perkembangan PNPM Mandiri di setiap kecamatan dalam desa di Kabupaten Nagan Raya. Dalam pertemuan tersebut dihadiri Ketua AWAN Teuku Ridwan, Kabid BPM Nasruddin Abu Bakar di ruang kepala Suka Makmue, Rabu (22/5). Pertemuan antara wartawan dengan Kepala BPM dan beberapa pelaksana lain membahas tentang alokasi bantuan langsung kepada masyarakat (ABLM), UPK, tahun 2013 yang berasal dari dana APBN dan APBD sebesar Rp 680 juta, Rp170 juta, Rp188 juta lebihdengan jumlah keseluruhan Rp 1.038.537.000 serta anggaran lainnya tentang pengeluaran anggaran tersebut. Kepala Badan Pemberdayaan Masyarakat Said Azman menyampaikan kepada wartawan untuk sama- sama memantau keadaan di kecamatan dan desa karena banyak pembangunan PNPM disimpangsiurkan dan terlaksana asal jadi. “Hal ini perlu kita lakukan pengecekan langsung untuk mengetahui PNPM di desa tersebut,’’ katanya. (cb07)

mampetakan semua problematika yang sedang dan mungkin akan terjadi sehingga bisa diantisipasi sedini mungkin. Dikatakan, kepercayan sebagai penyelenggara MTQ adalah kehormatan besar, sehingga konsekuensinya semua pihak harus mampu mensukseskan dengan partisipasi aktif semua kab/kota. “Jangan jadi pemenang atau juara tapi sifatnya kamuflase atau substansinya kosong,” tandasnya menambahkan, komplain kabupaten kota terhadap penyelenggaraan MTQ salah satu indikator kalau agenda nasional itu tidak sukses. Hadir Jemarin anggota DPRA, tim biro keistimewaan Setdaprov Aceh, jajaran Kemenag Prov. Aceh, mewakili kab/kota se-Aceh, para Kepala SKPK Subulussalam, Muspida plus, Muspika setempat dan undangan. (b28)

Wartawan Kaji Kitab Kuno Berumur 400 Tahun BANDA ACEH (Waspada): Kalangan wartawan di Banda Aceh yang tergabung dalam Kaukus Wartawan Peduli Syariat Islam, berkesempatan mengkaji kita kuno berusia 400 tahun. Kitab tersebutditulisulamabesarAceh,SyekhAbdurrauf As-Singkili, dengan judul Mir’atul Tullab. Dalam kegiatan yang berlangsung, Rabu (22/5) malam di Rumoh Aceh Kupi Luwak, Jeulingke itu menghadirkan Filolog Aceh, Hermansyah, dan Wakil Ketua MPU Aceh Faisal Aly. Menurut Hermansyah, karya ulama besar Aceh itu hingga kini belum ada tandingannya, terutama di bidang tasawuf, kalam, tafsir, dan fiqih. Di antara kitab-kitab yang dikarang Malikul Adil Kerajaan Aceh itu adalah Mir’atul Tullab fi Tashil al-ma’rifah al-Ahkam wal Syari’ah lil Malik al-Wahhab (Cermin segala mereka menuntut ilmu fiqh untuk memudahkan mengenal segala syariat Allah). Kitab tersebut disusun atas permintaan Sultanah yang berkuasa saat itu Sultanah Tajul Alam Safiatuddin Syah. Syeihk Abdurrauf pada pendahuluan kitabnya menyebutkan sejak awal dengan tipis menolak menerima tugas tersebut. “Beliau beralasan belum fasih menulis dalam bahasa jawi (Melayu) karena sudah lama di Mekkah, Madinah danYaman. Namun, untuk membantunya, sultanah mengirimkan dua

orang yang mahir bahasa Melayu,” jelasnya. Hermansyah menjelaskan, Kitab Mir’atul Tullab terdiri dari tiga bab. Pertama tentang fiqih, terkandung di dalamnya persoalan muamalah (perdata), nikah, mawari, dan segala permasalahan keluarga. Lalu yang kedua tentang hukum Ba’I yaitu persoalan jual beli termasuk di dalamnya mengkaji tentang laba-rugi. Dan yang ketiga hukum jinayah. “Kitab ini sangat terkenal, sehingga kerajaan Mindano di Filipina menjadikan kitab itu sebagai rujukan,” kata dia lagi. Sedangkan ulama Aceh Faisal Aly yang juga mengisi acara tersebut menjelaskan, banyak kitab kuno ulama Aceh tidak disebutkan penulisnya. “Karena ulama-ulama ketika itu menulis dengan ikhlas serta bertawasul kepada Allah. Lalu, dalam mengarang kitab tersebut, umumnya para ulama zaman dulu tak banyak menyebutkan dalil-dalil hadist atau ayat Alquran. “Sebab ketika dibutuhkan dalil-dalil shaheh, beliau membaca serta langsung menjelaskanya, karena semuanya sudah hafal,” ujar pimpinan dayah ini. Begitu juga dengan karya dibuatnya langsung ditulis tangan. “Hanya orang-orang yang sufi mampu melakukan itu tanpa kesalahan dan begitu rapi hasilnya,” papar Faisal Aly. (b07)

Rakyat Aceh Butuh Sarung Hanura BANDA ACEH (Waspada) : Ketua DPD Partai Hanura Provinsi Aceh, Syafruddin Budiman mengatakan, kain sarung merupakan hal terpenting dalam kehidupan rakyat Aceh. “Tua muda di Aceh butuh sarung, budaya pakai sarung mungkin kurang di perkotaan, tapi di beberapa daerah di Aceh budaya pakai sarung masih dipertahankan dalam kehidupan sehari-hari,” ungkap Syafruddin Budiman saat menerima 800 paket bantuan peduli Hanura untuk korban banjir di Aceh Selatan, Kamis (23/5) di kantor DPD Hanura Prof Aceh, Kawasan Lheungbata, Banda Aceh. Bantuan untuk korban banjir itu berasal dari DPP Partai Hanura yang dibawa Ketua Bidang Sosial DPP Partai Hanura Halimah Patrika S dan akan diantar langsung kepada korban bencana ke Aceh Selatan. Selain sarung, dalam paket bantuan yang disalurkan kader Partai Hanura itu juga terdapat sembako, seperti gula, beras dan susu. “Bantuan ini merupakan bantuan Hanura untuk korban banjir di Aceh Selatan,” kata Syafruddin Bu-

diman. 800 Paket bantuan itu akan didistribusikan, Jumat (24/5) di dua lokasi di Kluet Utara, dan pada siang harinya paket bantuan akan diserahkan untuk korban banjir di Kecamatan Bakongan, dan Kecamatan Trumon. Tidak hanya itu, bantuan peduli Hanura juga akan dibagikan kepada masyarakat miskin di setiap kabupaten/kota di Aceh. “Dalam waktu dekat juga bantuan itu akan sampai langsung kepada yang menbutuhkan,” ungkap Syafruddin. Bantuan untuk 23 kabupaten/kota di Aceh itu, menurut Syafruddin, merupakan program Partai Hanura dan sudah berlangsung di beberapa daerah di Jawa. “Saat ini program itu sudah berlangsung di Jawa Barat, dan pada waktunya akan juga tiba di Aceh,” papar Syafruddin. Banjir di Aceh Selatan telah memporakporandakan sejumlah infrastruktur dan ribuan hektare sawah, Pemkab Aceh Selatan melalui Kepala Badan Penanggulangan Bencana Daerah (BPBD) Kabupaten Aceh Selatan, Masdi memperkirakan kerugian akibat banjir itu mencapai Rp1 triliun. (b08)

Bupati Pidie Warning SKPK

Rakyat Butuh Pembangunan Dan Kesejahteraan BANDA ACEH (Waspada) : Masalah pembangunan dan kesejahteraan masyarakat belum sepenuhnya tercapai di Aceh. Maka untuk mencapai perspektif itu, Asosiasi Pertanian Palawija Aceh (APPA) ingin berkontribusi memajukan pembangunan dengan mengelola potensi alam Aceh terutama sektor pertanian khususnya palawija di setiap daerah di Aceh, sehingga paling tidak kesejahteraan masyarakat di pedesaan meningkat. Ketua APPA Basri Hasyim menyatakan, setidaknya ada tiga hal yang sangat dibutuhkan rakyat Aceh saat ini yang tidak dapat dipisahkan antara satu dengan lain, yakni perdamaian, pembangunan dan kesejahteraan. “Jadi ketiga hal ini harus menjadi satu,” kata Basri Hasyim, Rabu (22/5). (b09)

Jumat 24 Mei 2013

H-30 MTQ Ke-31 Aceh, Panlok Siap 80 Persen

Pemko Tangerang Tertarik Adopsi e-Kinerja Pemko Banda Aceh

SABANG (Waspada): Lagi, Wakil Wali Kota Sabang Nazaruddin melatik 94 pejabat Eselon III Dan IV dilingkungan Pemerintah Kota Sabang yang berlangsung di Aula Wali Kota Sabang, Selasa (21/5). Pejabat eselon III yang dilantik antara lain, Bakhtiar,SE sebagai Kabag Umum pada Sekretariat DPRK Sabang, sebelumnya Sekretaris Dispora Sabang, Sanusi, SE dilantik sebagai Sekretaris pada Sekretariat MPD sebelumnya Kasubag Program dan pelaporan pada Badan Kesbang Pol dan Linmas. Sajuddin,SH sebagai Sekretaris Dinas Kesehatan sebelumnya Kabid Politik Pemerintahan dan Keamanan pada Badan Kesbang Pol dan Linmas. Tarmizi Walad sebagai Kabid Politik Pemerintahan dan Keamanan pada Badan Kesbang Pol dan Linmas. M. Jamal, sebagai Kabid Pengawasan Hubungan Industral pada Dinsosnaker. Avid Sutiaji, Kabid Kebersihan dan Pertamanan pada Bapedalkep. Abdul Wahab Kabid. Pendaftaran Penduduk pada Dinas Kependudukan dan Capil. Irwan Kabid Kepemudaan pada Dispora, Aryanti Kabid. Pencatatan Sipil pada Dinas Kependudukan dan Capil. (b31)

WASPADA

Waspada/Muhammad Riza

BUPATI Pidie Sarjani Abdullah didampingi Ketua PP PKK Pidie Ny. Rohana Razali Sarjani Abdullah disambut dengan tarian Preh Jamee (Tunggu Tamu-red) saat menghadari acara penilai Gampong (Desa) Rapana, Kecamatan Mutiara Timur, sebagai Desa Gammawar) oleh Tim penilaian dari Provinsi Aceh.

Partisipasi Masyarakat Penting Dalam Pembangunan SIGLI (Waspada): Pelaksanaan pembangunan daerah, menempatkan masyarakat sebagai faktor penting demi suksesnya pembangunan suatu daerah, termasuk Kabupaten Pidie. Hal ini disampaikan Bupati Pidie Sarjani Abdullah pada acara penilaian Desa Rapana, Kecamatan Mutiara Timur, sebagai Gampong Mawaddah Warrahmah (Gammawar) oleh Tim Penggerak PKK Provinsi Aceh, Rabu (22/5). Menurut Bupati Sarjani, Semangat yang berimplikasi pada prakarsa dan kreativitas dan peran serta masyarakat akan berjalan dengan baik dan sukses. Sebab, betapapun baik kebijakan pemerintah di kabupaten, tidak akan berhasil tanpa adanya dukungan masyarakat yang didasari pemahaman dan persepsi yang sama. Begitupun kata dia, untuk mengukur keberhasilan pembangunan di suatu gampong (desa-red) diperlukan upaya penguatan kelembagaan, peningkatan motivasi dan kerjasama masyarakat. Dalam kesempatan itu, Bupati Pidie Sarjani, menilai kegiatan penilaian Desa Rapana, se-

bagai desa Gammawar diharapkan dapat meningkatkan partisipasi seluruh elemen masyarakat untuk menuju tercapainya pembangunan di daerah berjuluk pang ulee buet ibadat, pang ulee hareukat meugoe itu. Dengan adanya perlombaan Gampong Gammawar ini, Bupati Pidie Sarjani Abdullah, mengharapkan kesejahteraan masyarakat dapat ditingkatkan melalui pembinaan yang dilakukan, serta mampu lebih meningkatkan pola hidup masyarakat Gampong lebih maju dan berkembang. “Untuk mengukur tingkat kemajuan dan perkembangan suatu Gampong dapat dilihat dari tingkat pencapaian kegiatan pembangunan dan kemajuan serta keberhasilan masyarakat dalam mengubah pola hidupnya menuju ke arah yang lebih baik” kata Bupati Sarjani. Karena itu lanjut Bupati Sarjani, dirinya sangat berharap perlombaan itu benar-benar dapat dijadikan sebagai salah satu tolak ukur dan keberhasilan pembangunan di gampong dalam berbagai bidang terutama bidang pemerintahan, pembangunan dan kemasyarakatan. Selain itu dari perlombaan

dapat dijadikan acuan oleh pemerintah daerah dalam menentukan prioritas pembangunan dalam rangka pemerataan pembangunan di seluruh Kabupaten Pidie. Ketua PP PKK Pidie Rohana Razali Sarjani Abdulla, mengatakan Gampong (desa-red) Rapana merupakan gampong MawaddahWa rahmah binaan Tim Penggerak PKK Kabupaten Pidie 2013. “ Di sini kami telah melakukan berbagai kegiatan positif yang bertujuan untuk terus meningkatkan derajat kehidupan masyarakat, dengan pola penguatan kapasitas kelembagaan, pemberdayaan ekonomi, peningkatan sarana dan prasana, serta yang sangat penting adalah perwujudan 10 program pokok PKK” katanya. Kendati begitu sebut Rohana, pihaknya mengakui masih banyak kekurangan yang dimiliki Gampong Gammawar, namun dengan segala keterbatasan itu Tim Penggerak PKK Pidie terus berusaha untuk dapat tampil sebaik mungkin.” Dan inilah kondisi riil Gampong Rapana ini, inilah perwujudan masyarakat Pidie secara umum,” jelasnya. (b10)

SIGLI (Waspada): Bupati Pidie Sarjani Abdullah me warning (memperingatkan-red) seluruh jajaran Satuan Kerja Perangkat Kabupaten (SKP) untuk bekerja lebih maksimal. Teguran itu disampikan menyusul lambannya realisasi proyek 2013. “ Kami sudah melakukan evaluasi terhadap realisasi proyek 2013 terhadap semua SKPK. Dari evaluasi yang kami lakukan itu hampir semua SKPK sama bagusnya. Namun yang paling baik Dinas Syariat Islam (DSI), karena dari laporannya sudah ada sekira 47 persen realisasi yang dilakukan” kata mantan Panglima Gerakan Aceh (GAM) wilayah Pidie itu. Sarjani menjelaskan mestinya realisasi proyek 2013 sudah mencapai di atas 50 persen, mengingat waktunya sudah terdesak. Ia berharap semua SKPK dapat melakukan pantauan dilapangan terhadap kegiatan pembangunan yang sedang dilakukan oleh para rekanan. Dengan cepatnya dilakukan realisasi proyek, maka Pemkab Pidie bisa lebih cepat melakukan pembahasan anggaran 2014. “ Saya tidak ingin kinerja bagai Kura kura

jalan. Padahal Pidie termasuk cepat dalam pembahasan anggaran 2013. Tapi jangan sampai lamban dalam pelaksanaan kegiatan. Kalau realisasi anggaran cepat, maka kita dapat segera melakukan pembahasan anggaran 2014,” kata Sarjani Abdullah kepada Waspada di sela-sela menghadiri acara penilaian Desa Rapana, Kecamatan Mutiara, sebagai Desa Gammawar. Di tempat terpisah Sekda Pidie H Said Mulyadi, SE.MSi membenarkan Bupati Pidie telah melakukan evaluasi terhadap kinerja SKPK dalam melakukan kegiatan proyek 2013. Namun dia membantah ada beberapa dinas yang mendapat teguran keras dari orang nomor satu di daerah itu. “ Tidak benar itu. Bupati hanya meminta kepada SKPK untuk meningkatkan kinerja saja” katanya. Said Mulyadi mengatakan, semua SKPK Pidie bekerja sangat baik, kendati begitu dia juga berharap semua dinas harus lebih maju dalam melakukan realisasi proyek yang juga dinilainya masih rendah. “ Kami juga kembali melakukan evaluasi pada 5 Juli mendatang,” demikian Said Mulyadi. (b10)

5 Bulan Tulah Keuchik Di Abdya Belum Dibayar MANGGENG (Waspada) : Sejumlah Kepala Desa (Keuchik) dalam kabupaten Aceh Barat Daya dilaporkan belum menerima jerih payah (Tulah) selama lima bulan terakhir, dampaknya para Tuha Gampong tidak optimal dalam bekerja. Akibatnya kegiatan dalam gampong mengalami sedikit gangguan. Sudirman Kepala Desa Tengah, Kecamatan Manggeng kepada Waspada, Rabu (22/5) mengaku, selama 5 bulan jerih payah kepala desa di Abdya belum dibayar. Mereka (para keuchik) berharap pemerintah melalui Badan Pemberdayaan Masyarakat, Pemberdayaan Perempuan dan Keluarga Sejahtera (BPMPP dan KS) segera membayar jerih payah sejumlah keuchik. “Akibat tidak dibayar jerih payah selama 5 bulan itu, kami tidak bisa melaksanakan kegiatan gampong secara maksimal, untuk itu kami berharap pemerintah segera melakukan pembayaran kepada sejumlah gampong yang ada di Abdya agar roda pemerintahan desa dapat berjalan dengan lancar,”ungkapnya. Pernyataan yang sama juga diutarakan oleh Kepala Desa Ladang Panah Kecamatan Manggeng Nisai, pihaknya menjelaskan, saat gaji atau tulah kepala desa itu tidak dibayar maka semua kebutuhan yang berhubungan dengan desa akan lumpuh. “Sulitnya karena tidak ada biaya untuk operasional maka setiap kegiatan yang berhubungan dengan desa selalu tertunda,”tuturnya.

Terkait dengan belum dibayarnya tulah sejumlah kepala desa itu, Kepala BPMPP dan KS Abdya Hj Rabi’atul Adawiyah Z, Apt, M.Kes kepada Waspada terpisah menjelaskan persoalan terlambat pembayaran tulah sejumlah kepala desa itu karena masih dalam pembahasan Peraturan Bupati Abdya (Perbub). “Pada awal Juni kita sudah bisa membayar tulah sejumlah kepala desa di Abdya, saat ini kita akan melakukan konsultasi terlebih dahulu dengan Pak Sekda, kemudian mengenai Perbup sudah kita keluarkan dan akan diteruskan ke bagian hukum setdakab Abdya untuk ditindaklanjuti,” ungkapnya. Lebih lanjut Rabi’atul Adawiyah mengatakan, seharusnya pembayaran tulah kepala desa akan diterima setiap 4 bulan sekali (catur wulan) namun karena ada 20 desa pemekaran yang masih belum teregrestasi pada Departemen Dalam Negeri (Depdagri) sehingga membuat keterlambatan pembayaran tulah pada sejumlah kades tersebut. “Kita tetap usulkan 152 desa termasuk juga didalamnya desa pemekaran, tapi hasil temuan BPK mengatakan kalau 20 desa tersebut masih dalam status belum teregister, secara aturan pemekaran desa boleh dilakukan pada tahun 2014 nanti, untuk itu kita belum jelas lagi apakah 20 desa itu boleh dibayar tulahnya atau tidak, yang jelas untuk 132 desa definitif akan segera dilakukan pembayaran,” lanjutnya saat ditemui diruang kerjanya. (b30)


C4

Daftar Khatib Shalat Jumat

MEDAN AREA Amaliah Jl. Amaliun Gg. Bandung Kota Matsum II Ar-Rahim Ranting Halat Kota Matsum Al-Chairat Jl. A.R. Hakim Gg. Sederhana No. 22 Al-Hidayah Jl. A.R. Hakim Gg. Sukmawati Al-Huda Jl. Gedung Arja Gg. Jawa No. 46 Lingk. III Al-Ikhlash Taqwa Jl. Medan Area Selatan No. 129 Al-Ikhwaniyah Jl. Utama/Amaliun Gg. Tertib No. 15 Al-Istiqomah Jl. Seto No. 33 Kel. Tegal Sari II Al-Mukhlishin Jl. Sutrisno Gg. Sehati No. 8 Al-Manar Jl. Laksana No. 47 Al-Makmur Gg. Langgar/Bahagia No. 25 Al-Misbah Jl. A.R. Hakim Gg. Langgar/Damai No. 27 Al-Wathan Jl. A.R. Hakim Gg. Langgar No. 53 Darul Ikhlas Jl. Batu No. 13 Kel. Sei Rengas Permata Hidayatul Islamiyah Jl. Gajah No. 39 Istiqlal Jl. Halat No. 36 Kel. Kota Matsum IV Jamik Jl. Medan Area Selatan No.289 Kel.Sukaramai-I Jamik Jl. Sutrisno Gg. Damai I No. 6 Kel. Komat I Khalid Ibnul Walid Jl. Rahmadsyah No. 366 Khairiyah Jl. Rahmadsyah/Puri Gg. Subur No. 192 Muslim Jl. Gedung Arca No. 3 Muslimin Jl. Dr. Sun Yat Sen No. 71 Nurul Huda Jl. Denai Gg. Pinang No. 12 Tegal Sari-I Perguruan Ketuhanan Jl. Puri Gg. Perguruan No. 4 Rahmat Jl. Denai Gg. I No. 2 Kel. Tegal Sari I Quwwatul Muslimin Jl. H.M. Jhoni No. 69-D Silaturrahim Jl. Emas No. 10 Silaturrahim Jl. Bromo Gg. Silaturrahim No. 11 Syekh Hasan Maksum Jl. Puri Gg. Madrasah No. 181 Taqwa Jl. Bromo Gg. Aman No. 23 Taqwa Jl. Bromo Gg. Taqwa No. 11 Taqwa Jl. Bromo Gg. Salam No. 26 Taqwa Jl. A.R. Hakim Gg. Langgar No.8-A. Tegal Sari III Taqwa Jl. Puri No. 183 Kompleks Mesjid Taqwa Taqwa Lalang Jl. Gedung Arca Gg. Sehat No. 8

Drs. Kamal Fauzi Khairul Saleh, S. Sos Drs. H. Hamid Mashudi Drs. Zainal Arifin Gunawan, MA Drs. H. Jalaluddin Hasibuan M. Yahya Drs. H. Muniruddin, M.Ag Drs. H. Nurman Almi Drs. H. Muaz Tanjung, MA Drs. H. Zainal Abidin Zen H. Zuhri Nasution, Lc Drs. Idris Ritonga Drs. Mukhsin Harahap Drs. Muslim Nasution H. Abd. Latief Khan, S.Ag H. Nurdin Muhammad, BA Drs. H. Yahya Tambunan Drs. Abdul Rozaq Drs. H. Abd. Sani Sinaga H.A. Rahman Sofyan, Lc, SE, MA Drs. H. Mar’i Batubara Syahril Basroh, S.HI Drs. H. Syamsuddin Panarik Suharsono, Lc Azman Nasution, S.HI Drs. H.M. Mukhtar Amin H. Zulfiqar Hajar, Lc Drs. Ibrahim Yunan H. Mardiansyah, Lc Drs. Armia Yusuf M. Ridwan Hisda Mahmud Yunus Daulay, MA Jamaluddin Albatahani Drs. Adri, K. Drs. Tanwir Siagian

MEDAN AMPLAS Ar-Rahmat Jl. Bajak II-H Harjosari II Al-Huda Jl. Bajak I No. 2 Kel. Harjosari II Al-Hidayah Mapolda Sumut Jl.S.M.Raja Km.10,5 No.60 Al-Hidayah Jl. Kongsi Gg. Syukur No. 307 Marindal I Al-Hikmah Jl. Garu II B Kel. Harjosari I Al-Muslimin Jl. Pangilar No. 35-A Kel. Amplas Baiturrahman Jl. Bajak III Kel. Harjosari II Daarul Azhar Jadid Jl. Bajak II Gg. Cengkeh No. 1 Ikhlashiyah Jl. Garu I No. 69 Kol. Harjosari I Jami’Harjosari Jl. S.M. Raja Km. 6,5 No. 21 Jamik Jl. Panglima Denai No. 23 Kampus UNIVA Jl. S.M. Raja No. 10 Kompl. UNIVA Nurul Barkah Jl. Selambo IV No. 7 Nurul Iman Jl. S.M. Raja Km. 9 Nurul Tuvail Khatijah Jl. Garu IV No. 140 Ramadhan Jl. Pertahanan No. 37 Kel. Timbang Bali Ramadhan Jl. Garu VI Kel. Harjosari I Salman Jl. STM Kel. Sitirejo II Taqwa Jl. S.M. Raja Gg. Pulau Harahapan No. 1-B

Prof. Dr. H. Asmuni, MA Efendy Sadli, SE, MA Drs. H. Bahrum Saleh Hsb., MA Abdul Aziz, S.Pd.I Hasnan, S.Ag Hasbullah, MA Drs. H. Fahmi Ahmad Drs. H. Muniruddin, M.Ag

MEDAN BARAT Akmal Jl. Putri Merak Jingga No. 19 At-Taqwa Jl. Puteri Hijau No. 14 Al-Ikhlas PT. Kereta Api Indonesia Jl. Prof.HM Yamin 14 Al-Jihad Jl. Kom. Laut Yos Sudarso/Jl. Pertempuran Al-Muttaqin Jl. Karya No. 41 Kel. Sei Agul Al-Musaabiqiin Jl. Kapten Maulana Lubis Al-Massawa Jl. Temenggung (Arab) No. 2-4-6 Al-Wiraji Jl. Karya Ujung Gg. Sosro Lingk. XVI Kel. K.B. Baitusy Syifa Jl. Putri Hijau No. 15 Jami’ Jl. Merdeka No. 3 P. Brayan Kota Lama Jl. Mesjid Gg. Bengkok No. 62 Kel. Kesawan Maraset Jl. Sei Deli No. 139 Kel. Silalas Nurul Hidayah Jl. Danau Singkarak Gg. Masjid No. 6 Nurul Islam Jl. Karya Lingk.VIII No.203 Kel.K.Berombak Rabithatul Muslimin Jl. K.L. Yos Sudarso Lorong 14-A Syuhada Jl. Danau Toba No. 2 Kel. Sei Agul Taqwa Jl. Karya Gg. Madrasah No. 24

Bulian Malfa, S.Ag Drs. H. Saliman Tarigan H. Irwansyah Daulay, MA Drs. Rabusir Karokaro Darwan Saudi, S.Ag Drs. H. Sangkot Saragih, MH Drs. Indra Suheiry H. Hasan Maksum, MA Drs. H.M. Noor Hasibuan Drs. Mulkan Silalahi DR. H. RamlanY. Rangkuty, MA Zulkhamsah Lubis H. Sa’dullah Ahmad Batubara H. Nano Wahyudi, Lc Drs. H. Ramli Drs. H. Nurdin Muhammad Drs. Hasanuddin, MD, MA

MEDAN BELAWAN As-Sa’adah Kel. Belawan Bahagia Jamik Belawan Jl. Selebes Belawan Taqwa Jl. Veteran Belawan Raya Taqwa Belawan Salam Jl. Pelabuhan I No. 1 Kp. Salam Belawan-II

Junaedi Husda, S.Ag H. Mahmud Sholeh, MA Drs. Dalail Ahmad, MA Drs. Sutikno Fahmi H. Mhd. Nur Wahabi, S.Pd.I

MEDAN DELI Amaliyah Jl. Pancing Pasar IV Amalyatul Huda Jl. Nusa Indah No. 22-A Kel. Tg. Mulia Ar-Rahim Jl. Simpang Tanjung No. 1-A Ar-Ridha Komp. TNI-AL Jl. Alumunium Raya Tg. Mulia As-Sa’adah Jl. Alumunium IV Gg. Tawon Tg. Mulia Abu Qosyim Jl. Mangaan VIII Lingk. I Mabar Hilir Al-Amin Jl. R.P. Hewan Lingk. III Kel. Mabar Hilir Al-Amanah Jl. K.L. Yos Sudarso No. 638 Kel. Tg. Mulia Al-Qurqaan Jl. Alfaka Raya/Sp. Alfaka VIII Lingk. VI Al-Fithriyah Jl. Kawat II Kel. Tg. Mulia Hilir Al-Ikhlas Jl. Alumunium III Lingk. XII Kel. Tg. Mulia Al-Munawwarah Jl. Pulau Batam No. 1 Al-Syarifah Jl. Metal Gg. Rukun No. 06 Lingk. XVIII Darussalam Jl. Suasa Selatan Lingk.IX Kel. Mabar Hilir Jamik Jl. K.L. Yos Sudarso Km. 6,2 Tg. Mulia Jam’iyyatush Shoolihiin Kel. Tg. Mulia Nurul Iman Lingk. 27 Tg. Mulia Nurul Ikhsan Jl. Mangaan I Lingk. VIII Mabar

M. Bahrum Drs. Achyaruddin Waizul Qarni, MA Azhar Rokan H. Norman, BA Drs. H. Darma Bakti Suhaimi, S.HI Drs. A. Samsuri Matondang Maimun Al-Bantani Drs. Aminan Sas Butarbutar Shofyan, M.S. Drs. Paino Ahd. Yunan Siregar, S.Ag H. Sairin Drs. Abdul Kadi Hasibuan Muhyiddin Abd. Wahab, S.Pd.I Ilyas Hasyim

MEDAN DENAI Arafah Jl. Pertiwi No. 22 Kel. Binjai Amal Bakti Jl. Raya Menteng Gg. Abadi No. 21-A Ar-Ridha Jl. Camar 18 Blok II Perumnas Mandala At-Thoharah Jl. Raya Medan Tenggara Kel. Binjai Al-Anshor Jl. Raya Medan Tenggara Gg. Anshor Al-Falah Jl. Rawa Ujung No. 298 Lingk. XIII Tegal Sari Al-Hidayah Jl. Bromo Gg.Masjid Al-Hidayah Kel. Binjai Al-Hasanah Perumnas Mandala Al-Mukhlishin Jl.Enggang I Perumnas Mandala Al-Muslimun Jl. Bromo (Rawa Sembilang) Gg. Kurnia Al-Muhajirin Jl. Garuda II Perumnas Mandla Al-Muqorrobin Jl. Raya Menteng Kel. Binjai Al-Ridha Jl. Jermal VII Baiturrahman Jl. Medan Tenggara VII No. 42 Baiturrahim Jl. Pelajar Timur Gg. Darno No. 5 Darul Ilmi Murni Jl. Terusan Dalam/Simp. Jl. Tapanuli Hijraturridha Jl.Selamat Ujung Gg. Subrah S. Limun Jannatul ‘Alim/Musholla Al-Muttaqim Jl. Pancasila Muslimin Jl. Selam II No. 47 Tegal Sari Mandala I Nurul Islam Jl. M. Nawi Harahap Nurul Iman Jl. Rawa I Lr. Sedar Nur Hidayah Jl. Datuk Kabu No.17BGg.Masjid No.11-C Nurul Hidayah Jl. Tangguk Bongkar 2 Rahmatullah Jl. Kramat Indah Gg. Trenggeno II

Faizal Lubis, S.Ag, MA Muhammad Junaidi Rafdinal, MAP Drs. Tenerman

MEDAN HELVETIA Ar-Raudhah Jl. Persatuan No. 22 Helvetia Timur Ar-Ridho Jl. Pembangunan No. 128 Helvetia Timur As-Syakirin Jl. Gaperta I Kompl. TNI-AD Gaperta As-Syarifah Jl. Pembangunan Kompl. Pondok Surya At-Taubah Jl. Pasar II Kel. Cinta Damai Aththolibin Husni Jl. Veteran Gg. Utama Desa Helvetia Al-Falah Jl. Palem Raya Perumnas Helvetia Al-Falah Jl. Cendana Blok 17 Perumnas Helvetia Al-Hidayah Jl. Bakti Luhur No. 21 Kel. Dwikora Al-Hasanah Jl. Setia No. 41 Tg. Gusta Al-Hasanah Jl. Istiqomah Helvetia Timur Al-Ikhlas Jl. Bakti Luhur No. 13 Al-Ikhlas Jl. Bahagia Lingk. VI Kel. Cinta Damai Al-Ikhlas Jl. Jongkong Kompl. Dolog SU Lingk.I, II, III Al-Mustaqim Jl. Kapten Muslim No. 226 Al-Masturah Jl. Binjai Km 7,8/Jl. Sekolah No. 29 Al-Mahabbah Jl. Kelambir Lima Gg. Sentosa Tg. Gusta Bahrul Ulum P4TK Jl. Setia Budi No. 75 Darussalam Jl. Asrama No. 11 Istiqomah Jl. Amal Luhur No. 65 Kel. Dwikora Ikhlasiyah Jl. Amal Luhur No. 29 Kel. Dwikora Khasyiim Jl. Karya Ujung Pasar III Nurul Iman Jl. Sumarsono Dusun V Shilaturrahmi Jl. Perkutut Lingk. XXII Kel. Helv. Tengah Tjut Nyak Dhien Jl. Gatoat Subroto/Jl. Rasmi No. 28 Taqwa Jl. Kamboja Raya No.319 Blok 4 Perum. Helvetia Taqwa Jl. Pemasyarakatan Gg. Masjid No. 7 Sukadono Taqwa Jl. Setia No. 30 Tanjung Gusta Taqwa Jl. Kapten Sumarsono Gg. Safar Pasar II Taqwa Jl. Kapten Muslim Gg.Jawa Lr. Muhammadiyah Umar Bin Khattab Jl. Kalpataru Kel. Helvetia Timur

Rajudn Sagala, S.Kom, S.Pd.I Miftahuddin, S.Ag Drs. H. Khairul Anwar Drs. Mas Rahim Salabi H. Alfan Arbudi Drs. H. Syahrinal Lubis Drs. Syamsuri Drs. H. Muchtar Baijuri M. Bahren, AR, S.Pd.I Darwin Pasaribu, S.Pd.I Sodiqin, S.Ag Abdul Karim, S.Ag Mahyuddin, S.Pd.I H.M. Nadzrul Fakhri Hamyar H. Najib Sanusi Hasan Drs. Ali Amnar Tambunan Yusriza, S.Pd.I Drs.H.M. Yusril Fuat Juariadi, S.Pd.I Hakimuddin, S.Ag Drs. H.M. Yazid Mufti Lubis Drs. Zulkifli Nasution Drs. M. Abdi, HK H. Syarifuddin Nasution Drs. Khairul Anwar, MA Drs. H. Azhar Razak Lubis Nurdin Arsyad, S.Ag Nuzli Mahendra DR. H. Syahrul Nasution, M.Ag DR.Nahar Alang Abdul Ghani, Lc, MA Abdul Mutholib Daulay, MA

MEDAN JOHOR Abdul Mukmin Dalimunthe, S.Pd.I Drs. Syamsul Anwar H. Syamsuddin Noor, S.Ag Drs. H. Musaddat Lubis, M.Ag Drs. H. Ali Asri, MA Sulaiman Nasution Drs. M. Tholib Harahap, MA Drs. Isa Anshori, S.Pd.I Drs. Sofyan Daulay Drs. H. Syahrul Effendi Siregar H. Yusri Indra, Lc Drs. Alimuddin Siregar, M.Hum M. Tholib Harahap, S.Ag, MA Drs. Rozali Umar Drs. Ramli, AT M. Yusuf Mudin Pohan, S.Pd.I Drs. H. Azwardin Nasution M. Nasir, S.Pd.I

MEDAN BARU Agung Jl. P. Diponegoro No. 26 Al-Amanah Jl. Diponegoro No.30A Kom.Gd.Keuangan Al-Falah Bank Sumut Lantai X Jl. Imam Bonjol No. 18 Al-Hasanah Jl. Letjend. Jamin Ginting No. 314 Al-Ikhlas Jl. Sei Padang No. 129 Ikhwanul Ikhlas Jl. Batu Gingging No. 12 Muslimin Jl. Sei Batang Serangan No. 93 Nurul Muslimin Jl. DR. Pardede No. 42

Taqwa Jl. Jermal III No. 10 Taqwa Jl. Pancasila Gg. Masjid No.1 Kel.T.S.Mandala III Taqwa Jl. Mandala By Pass No. 140 Taqwa Jl. Seksama Gg. Rela No. 10

M. Nursyam, S.Pd.I Drs. Mas’ud Panjaitan Abdil Muhadir Ritonga, S.Pd.I H. Abdullah Sani, Lc, S.Pd.I Drs. Nazamuddin Hutapea Drs. Amri Susanto, MA DR. H. Ardiansyah, Lc, MA Drs. H. Syarifuddin El Hayat H. Darwin Zainuddin, MA Drs. H. Effendi Sipayung Drs. H. Hayat Harahap Drs. H. S. Silalahi Khoiruzzaman, S.HI, S.Pd.I Drs. H. Rusli, MR Drs. H. Jamhir Mustafa Khairuddin Daulay, S.Pd.I Drs. Ahmadi Ahyar Rustam Efendi Hasibuan, S.Ag T. Syarifuddin, S.Ag Badu Amin Nasution, S.Ag Junaidi Arsyad, S.HI Harun Ar Rasyid Abdul Hamid Harahap, S.Ag Mhd. Saleh Rambe

Amanah Jl. Eka Bakti Ujung Lingk. IV Kel. Gd. Johor Arrahman Jl. Brigjen Zein Hamid Kel. Titi Kuning Annazhirin Jl. Karyawisata, Gedung Johor Ainul Iman Jl. Ekawarni I Kel. Gedung Johor Ar-Raudhah Kompl. Rispa I Blok V Kel. Gedung Johor Assyafi’iyah Jl. STM - Suka Tari No. 9 Kel. Suka Maju Al-Amin Jl. Eka Surya Gg.Kencana Lingk. XI Kel.Gd.J. Al-Badar Jl. Karya Dharma No.19 Kel. Pangk. Masyhur Al-Firdaus Jl. Karya Jaya Gg. Eka Jaya II Lingk. II Al-Furqon Jl. Karya Perbatasan Lingk. XII P. Masyhur Al-Huda Jl. Eka Surya Psr. V Gg. Sidodadi Ged. Johor Al-Hidayah Jl. Brigjen Katamso Km. 7,2 Kel. Titi Kuning Al-Hidayah Jl. Karya Jaya Kel. Gedung Johor Al-Ikhlas Jl. STM Suka Ikhlas Kel. Gedung Johor Al-Ikhlas Jl. Eka Suka Raya No. 18-A Kel. Ged. Johor Al-Ikhlas Jl. Karya Tani Lingk. VII Kel. Pkl. Masyhur Al-Ihsan Jl. Suka Tabah No. 15 Al-Muslimin Jl. STM Suka Luhur Al-Muharram Jl. Eka Budi Kel. Gedung Johor Al-Mahmudiyah Jl. Brigjen Hamid Km 6,5 Kel. T.Kuning Al-Mukhlishin Jl. Karya Sehati No. 14 Kel.Pkl. Masyhur Baiturrahmah Jl. Karya Jaya No. 101 Pkl. Masyhur Baitussholihin Jl. Karya Bakti No. 71 Kel. P. Masyhur Baitul Iman Jl. Karya Jaya Asrama Arhanus P. Masyhur Daurun Nur Jl. Suka Eka No.221 Lingk.XI Kel. S.Maju Fajar Ramadhan Perumahan Johor Indah Permai II Graha Deli Permai Jl. Sidodadi Pasar IV Kel. Gd. Johor Muslimin Jl. Karya Jaya, Kel. Pangk. Masyhur Muttaqiin Jl. Luku I No. 42 Kel. Kwala Bekala Nurul Aldys Jl. Karya Bakti No. 34 Pangk. Masyhur Nurul Falah Jl. Eka Rasmi No. 42 Kel. Gedung Johor Nurul Huda Jl. Letjen Ginting Km. 8 Kwala Bekala Nurul Huda Jl. M. Basir No. 9-A Kel. V Kel. P. Masyhur Nurul Iman Jl. Stasiun No. 75 Kel. Kedai Durian Nurul Ikhwan Jl. Karya Kasih Kel. P. Masyhur Sholihin Jl. Karya Jaya No. 160-C Taqwa Jl. Brigjen Zein Hamid Gg. Sado Titi Kuning

Mukhlis Mu’as, S.HI Drs. Rizaluddin Siregar M.Z. Musa Ritonga, S.Pd.I Drs. Sunaryo H.M. Saleh Umar, S.Pd Drs. H. Khaidir Tanjung Muhammad Amri Sembiring, S.HI Drs. Lukman Hakim Drs. Usman Hsb., SH, M.Hum Mhd. Ridwan, S.Pd.I Drs. Jamaluddin Pohan DR. H. Harun Al-Rasyid, MA Abdul Razak, S.Ag Drs. H. Legimin Syukri Prof. Dr. H. NawirYuslem, MA Matsaluddin Brutu, Lc M. Yunus Zein, BA H. Ruskhan Nawawi, BA Abdul Rahim Fakhrurrozi, S.Pd.I Muhammad Shaleh, SHI, MA

MEDAN LABUHAN Al-Husain Jl. Raya Griya Martubung Kel. Besar Al-Istiqomah Blok IV Griya Martubung Kel. Besar Al-Mukarramah Kampung Besar Darat Kel. Martubung Baitul Ikhwan Jl. T.Lestari 12/198 Blok V Gr. Martubung Nurul Hidayah Jl. Veteran Lr. Sukoharjo No.27-A Psr. V Nurul Khairiyah Jl. Veteran Ujung Psr X Ds Manunggal Silaturrahmi Jl. Tangguk Damai Blok III Gr. Martubung

K.H. Zulkarnaen Drs. H. Abd. Halim Ibrahim, SH,MH Drs. Milyan Yusuf, MA Drs. Nazaruddin, R. Drs. M. Ridwan H. Zainul Arifin Harahap Drs. Adlansyah

MEDAN MARELAN Ar-Ridha Jl. Platina Raya Lingk. 21 Kel. Rengas Pulau Al-Barokah Jl. Kapt. Rahmad Buddin Gg. Mangga Al-Ikhlas Jl. Marelan IX Lingk. VII Kel. Tanah 600 Al-Muslimin Jl. Masjid Pasar V Marelan Jami’atul Khairiyah Jl. Marelan VII Kel. Tanah 600 Taqwa Jl. Penghulu Lama Gg. Famili Paya Pasir Taqwa Kampung Tengah Lingk. IX Terjun Taqwa Pasar 3 Timur Regas Pulau Marelan

Ruslan Idris Batubara, S.Pd.I Drs. Suherman, M.Ag Razali Taat, S.Pd.I Drs. H.M. Joyo Drs. H. Irfan Said Batubara Drs. M. Tholib Harahap, MA Rajali Ta’at, S.Pd.I Drs. H. Legimin Syukri H.A. Muaz Tanjung, S.Pd Drs. Syahroni Husein Mukhlis Muaz, S.HI

MEDAN PERJUANGAN Amal Jl. Ngalengko Lr. Saudara No. 11 Ar-Rahmah Jl. Gurilla Gg.Melati No.5 Kel. S.Kerah Hilir Ar-Ramlah Jl. Sejati No. 16 Kel. Sidorame Barat Ar-Ridho Jl. Rakyat No. 33 Kel. Sidorame Timur Al-Amin Jl. Prof. H.M. Yamin SH, No. 482 Al-Falaah Jl. Ibrahim Umar (Gg. Sado) No. 3

MEDAN PETISAH Amaliyah Jl. M. Idris No. 22 Kel. SPT II Annas Jl. Ibus Raya/Jl. Rotan Kompleks Diskes Ar-Ridhwan Jl. Abd. Hamid No. 28 As-Syahaadah Jl. Sikambing Belakang No. 18 Asy-Syura Jl. Surau No. 18 Kel. Sei Putih Timur Al-Hidayah Jl. Periuk Gg. Mesjid No. 2 Al-Ihsan Jl. PWS No. 48 Kel. Sei Putih Timur II Al-Mukhlisin Jl. Sei Rokan No. 2 Al-Mukarram Jl. Sikambing Gg. Patimura No. 9 Al-Yasamin Jl. PWS Istiqamah Pasar Petisah Jamik Jl. Kejaksaan Kebun Bunga Nurul Islam Jl. Kertas No. 2 Raya Aceh Sepakat Jl. Mengkara No. 2 Petisah Tengah Tagarrub Jl. Darussalam No. 24 Ubudiyah Jl. Kebun Bunga Kel. Petisah Tengah

Mashur Utama Hasibuan, S.Pd.I DR. M. Jamil Drs. Syafruddin Syam, MA Maulana Siregar, MA H. Najib Sanusi Husin Lubis H. Junaidi Drs. H. Hasanul Arifin Nasution Drs. H. Azhar Buyung M. Halim Harahap, S.Pd.I Dr. H. Azhari AkmalTarigan, MA H. Zulfikar Hajar, Lc Drs. Marwan Nasution H. Maskam Elba, BA Drs. Muhammad Shalihul Amri Abubakar Hasan Usman Ridwan Matondang

Amaliyah Jl. Balai Desa Gg. Amal No. 43 Al-Hidayah Jl. Starban Kel. Polonia Al-Hidayah Jl. Komodor Udara Adi Sucipto Al-Hasanah Jl. Teratai No.17-A Lingk.V Kel. Sari Rejo Al-Ikhlas Jl. Sejati No. 08 Kel. Sari Rejo Bakti Jl. Mongonsidi I Baru No. 11 Kel. Anggrung Dirgantara Jl. Imam Bonjol No. 52 P. TNI AU Soewono Hidayatullah Jl. Dc. Musi Lingk. I Kel. Sukadamai Silaturrahim Jl. Antariksa No. 64 Kel. Sari Rejo Sabilillah Komp. TNI-AU Karang Sari-I Kel. Sari Rejo Taufiq Jl. Pendidikan Gg. Taufiq No. 17-D

Suherwin, Sos.I H. Imam Muhdi Haris Munandar, S.HI Drs. M. Yusuf As’adi Drs. M. Darwis, MA DR. H. Mahmuddin,MA Drs. H. Ahmad Syaukani Hrp. Ramadhan, S.HI H.M. Syafiar Siregar, MA Drs. M. Yusuf Marpaung, S.HI H. Usman Batubara

MEDAN SELAYANG Ar-Ridho Jl. Abdul Hakim Pasar I Tanjung Sari Drs. H. Sanidi Sitorus Al-Furqon Jl. Setiabudi Pasar I Tanjung Sari H.A. Gozali Rangkuti Al-Ghufron Jl. Suka Baru No. 21 Kel. PB Selayang I Drs. Edi Purnomo Al-Ikhlas Jl. Raharja No. 25 Kel. Tg. Sari Drs. H. Rahmad S. Pohan Al-Ikhlas Pasar V Tg. Sari Zamaksyari Al-Ikhlas Pasar 7, Padang Bulan Drs. H. Tarmizi Al-Istiqomah Jl. Sei Asahan Gg. Masjid No. 3 Drs. H.M. Syafruddin Jami’ Jl. Pasar I Lingk. VIII Tg. Sari Drs. Suparmen Sareh Muslimin Jl. Setia Budi Kel. Tg. Sari H.M. Nuh, MSP. Nabawi Jl. Bunga Mawar XIV Sugianto, S.HI Nurussalam Jl. Bunga Cempaka Pasar III Drs. H. Zahiruddin Nasution Nurul Huda Jl. Bunga Asoka No. 117 Asam Kumbang Drs. H. Khairuman Arsyad, M.Hum Nurul Iman Jl. Penerbangan No.77 Komp.Perhubungan Hidayatullah Sinaga, S.Sos.I Nurul Mukmin Jl. Bunga Mawar No. 46 Kel. P. Bulan Drs. Arifinsyah Nurul Mukmin Jl. Bunga Kantil 18 Psr VII Pd. Bulan Drs. Mulyono, M.Pd. Nurul Mukminin Jl. Kenanga Raya No. 10 Kel. Tg. Sari M. Syahrizal Manurung, S.Ag, S.Pd.I Taqwa Jl. Bunga Wijaya Kesuma Gg. Masjid No. 1 PCM Tj. Sari Taqwa Jl. Abdu Hakim No. 2 Pasar I Tg. Sari DR. M. Qorib, MA Taqwa UMA Kampus II Jl. Setia Budi No. 79 79-B Drs. Epi Brata Madya, MA MEDAN SUNGGAL Ar-Rahmat Jl. Mesjid No. 20 Dusun III Desa Helvetia As-Saajidiin Jl. Prasetya I Komp. BTN Dusun III Sei. S. At-Taqwa Makodam I/Bukit Barisan Jl. Binjai Km. 7 Al-Badar Jl. Binjai Km. 6,8 Al-Falah Jl. Murni No. 27 Tg. Rejo Al-Huda Jl. Perjuangan No. 44 Tg. Rejo Al-Hikmah Jl. Kiwi No. 7 Sei Sikambing-B Al-Ikhlas Jl. Beo Indah No. 15 Sei Sikambing-B Al-Ikhlas Jl. Binjai Km. 16,5 Dusun I Aman Damai Al-Islamiah Jl. Binjai Km. 14,5 Gg.Gembira DS. V Diski Al-Ikhwan Jl. Gatot Subroto Km. 8,5 Pasar 5 Al-Istimomah Dusun I Desa Pujimulio Al-Irma Jl. Rajawali Sei Sikambing-B Al-Jihad Jl. Sunggal No. 129 Al-Muttaqin Jl. Hanura No. 10 Tanjung Rejo Al-Mujahirin BBLKI Medan Al-Musabbihin Jl. Masjid Al Musabbihin Blok C TSI Darul Huda Jl. Kasuari No. 53-55 Sei Sikambing-B Dermawan Jl. Rajawali No. 19 Sei Sikambing-B Ikhwanul Muslim Dusun VII Gg. Damai Desa Paya Geli Isti’adah Jl. Amal No. 4 Kel. Sunggal Istiqamah Jl. Perwira Utama No. 20 Kampung Lalang Istiqamah Jl. Dr. Mansur No. 155 Kel. Tg Rejo Jami’ Jl. Masjid No. 6 Tg. Rejo No. 6 Jamik Jl. Pinang Baris No. 19 Kel. Lalang Jamik M. Jayak Jl. Jend. Gatot Subroto Km.5,5 No.184 Lama Raudhatussuffah Jl. TB. Simatupang (P. Baris) Nurul Huda Jl. Sei Serayu No. 38 Kel. Babura Nurul Hikmah PT. Perkebunan Nusantara-III Kandir Nurul Ikhsan Jl. Kelambir Lima No. 53-B Kel. Lalang Nur Rukiah Jl. Pungguk No. 42 Kel. Sei Sikambing-B Silaturrahim Jl. Perintis Kemerdekaan Km.13,7 P.Besar Shafiyyatul Amaliyyah Jl. Setia Budi No.191 Tg.Rejo Syafinatus Salamah Perum Bulog Jl.Gatot Subroto 180 Taqwa Jl. Garuda Masjid Taqwa Sei Sikambing-B Taqwa Sugengrejo Jl. Merpati Gg.Mushola Sei. S-B

Amirwan, S.Ag Drs. H. Syarifuddin Siagian DR. H. Ardiyansyah, MA Bintai DAM-I/BB H. Muhammad Ansori, Lc, MA H. Suhaidi Arfan, Lc, MA Drs. Abd. Rahim Gea, MA Drs. Affan Suaidi Syariman, S.Pd.I Ahmad Nazir Harahap, S.Ag Hajar Aswad, MA Ahmad Kamil, S.Pd.I Drs. Ngadiman G., S.Pd.I Drs. H. Syarifuddin, Lc Drs. Ansori Ahmad Bustami, H.S. Drs. H. Sangkot Saragih Drs. Matseh, MA Drs. Ahmad Muttaqien, S.Ag Drs. Ismail, MM Drs. H. Irham Hasibuan Drs. H. Budiman H. Syamsul Yahya, MA Drs. H. Syafi’i Zaini Muhsin Nasution H. Harun Al Rasyid, MA, Ph.D Drs. Zulkarnain Drs. Mahyudin Daulay H. Sutan Sahrir Dalimunthe, S.Ag H. Marzuki Ilhamuddin, S.Ag Drs. Abd. Wahab Kalimantan Syafruddin Syam, MA Paidi, S.Ag Drs. M.Syafei, S.Pd.I Drs. Khalidin Musa

MEDAN TIMUR Muhammad Syafi’i, S.Pd.I Muhammad Jihad, S.Pd.I Drs. H. Ilyas Halim, M.Pd Amin Utomo, S.Ag Sulaiman, S.Ag H. Sairin, S.Ag M. Iqbal, S.Pd.I Bahril Datuk, SG. MM

MEDAN MAIMUN Abidin Jl. Brigjen Katamso Km.3 Gg. Nira Kel.Kp. Baru Ar-Rahman Jl. Brigjen Katamso Gg. Perbatasan Baru Al-Mukhlish Jl. Bahagia No. 14 Kel. Sukaraja Al-Mujtahidin Gg. Lori Kampung Baru Darul Ali Jl. Brigjen Katamso Gg. Nasional No. 20 Nurul Huda Jl. Birgjen Katamso Gg. Netral Nurul Muslimin Jl. Juanda (Bundaran) Kel. Jati Jami’ Al-Fajar Jl. Brigjen Katamso Gg. Al-Fajar Jami’ Ash-Sholihin Jl. Brigjen Katamso No. 208 Jami’ Kampung Baru Jl. B. Katamso Gg.Masjid No. 53 Jami’ Aur Jl. Brigjen Katamso No. 32-D Kel. Aur

H. Zulfahmi Hutasuhut, MA Drs. Ali Imran H. Akhyar Nasution, Lc, MA Nazir Hidayat, S.Ag Drs. Sahnim Siregar Drs. H. Hasrat E. Samosir, MA Iryuha Tantawi, MA Drs. Helmi Walid Drs. H. Darwansyah, Simanjuntak Syahlul Amri Harahap, S.Ag Drs. H. Waldemar Ghozali Drs. Fauzi Usman Herman, S.Ag Drs. Usman Batubara Abd. Rahman Kasbi, BA T.A. Saladin DP, MA H. Joko Satimin Drs. H. Ngadimin Hadi Drs. Perintah Lubis

MEDAN POLONIA H. Abdul Azis Rangkuti, S.Ag M. Hasbial Mawardi Lbs., S.Ag Drs. H. Abidin Azhar Lubis Ali Badrihas Manalu, S.HI M. Nasir Ansori, S.HI, MA H.M. Bambang Irawan H., S.Ag H. Maddin Nasution Abdul Mukmin, S.Pd.I BKM M. Nurdin, S.Pd.I Drs. Zulham E. Batubara, MBA Rustam Harahap, S.Pd.I Drs. M. Syahrawi, Mj. H. Saparuddin Siregar Drs. H. Ahmad Saukani H. Arif Mhd. Erde, S.Pd.I Drs. Sariman Faruq Drs. H. Jalil Tanjung Ismail Nasution M. Jamil, S.Pd.I Drs. Borkat Harahap Drs. H. Abdul Salam Ahmad Syarbaini, S.Ag, S.Pd.I Drs. H. Adam Sakiman M. Ismail Budiman, S.Pd.I Drs. H. Bahrum Saleh Hsb., MA Drs. Asmuni Syahruddin Ritonga, S.Pd.I Drs. H. Nasib Selmi H. Muhammad Razali, S.Pd.I Surya Bhakti Harahap, S.S. Abu Bakar, S.Pd.I Sahril Basrah, S.HI M. Ilyas Dr. H. Azhar Sitompul, MA Deprizal Lubis, S.Pd.I M. Hardiyatno, SE

MEDAN KOTA An-Nazhafah Jl. Rumah Sumbul No. 4 Lingk. I Al-Hidayah Jl. Saudara Kel. Sudirejo II Al-Hasanah Jl. Tanjung Bunga II Kel. Sudirejo II Al-Ikhlas Jl. Salak No. 9 Al-Muttaqin Jl. Amaliun/Paduan Tenaga Gg. Tengah Al-Muhajirin Jl. Bajak II H. Gg. Nasional Lingk. IX Da’wah Jl. Sakti Lubis Gg. Amal No. 19-B Hikmah Hongkong Plaza Jl. Cerebon Islamiyah Jl. Jati III No. 85 Kel. Teladan Timur Jami’ Teladan Jl. Gembira No. 2 Teladan Barat Mu’allimin Jl. S.M. Raja Kp. Keluarga No. 33 Ma’ul Hayah PDAM Tirtanadi Jl. S.M. Raja No. 1 Ridho Bakti Jl. Air Bersih Lingk. IX Kel. Sudirejo-I Pahlawan Muslimin Jl. Pencak Raya Pusat Pasar Silaturrahim Jl. Pelajar No. 58 Kel. Teladan Timur Setia Amal Jl. Sakti Lubis Gg. Pegawai No. 87-C Taqwa Jl. Demak No. 3 Taqwa Jl. Turi Gg. Sepakat No. 5 Kel. Teladan Timur Thawalib Jl. S.M. Raja Gg. Thawalib No. 11 Yayasan Zending Islam Indonesia Jl.S.M.Raja No. 11

Al-Fajar Jl. Prof. H.M. Yamin SH Gg. Kelambir Al-Huda Jl. Malaka No. 117 Al-Hidayah Jl. Pahlawan Gg. Anom No. 12 Lingk. III Al-Hikmah Jl. Malaka Gg. Saudara Al-Ikhlas Jl. Setiajadi Kel. Tegalrejo Al-Muslim Jl. Pelita VI Gg. Serayu No. 10 Al-Muslimin Jl. Gerilya No. 1 Al-Mukhlishin Jl. G.B. Josua No. 8 Hidayatul Ihsaniah Jl. Sentosa Lama Gg. Aman No. 5 Ikhsaniah Jl. Gurilla No. 31-A Kel. Sei Kera Hilir I Ikhwaniyah Jl. M. Yacub No. 3 Istiqomah Jl. Bambu Runcing/Pahlawan Jami’ Sentosa Jl. Sentosa Lama Gg. Perwira No. 1 Jamik Al-Ikhwan Jl. HOS Cokroaminoto Kel. S.K. Hulu Jamik Ubudiyah Jl. Pelita-I Gg. Tangga Batu 11 Malikus Saleh Jl. Gurilla No. 10 Kel. Sei Kera Hilir Syuhada Jl. Pahlawan No. 11 Thaharah Jl. Pelita II No. 29 Kel. Sidorame Barat I Taqwa Asrama TNI-AD Glugur Hong Kel. S. Barat I

WASPADA Jumat 24 Mei 2013

Drs. H. Nasrun Zakaria Drs. H. Fandi Filham Lubis Drs. H. AhmadTaufiq, SH, MM Drs. Ahmad Dairobi Kaliman, S.Pd.I H.M. Ishaq Lubis

Arrahim Jl. Purwosari Gg. Masjid/Puskesmas P. Brayan Amaliyah Jl. Perwira II Pulo Brayan Bengkel Amal Ridha Jl. Cemara, Puro Brayan Bengkel As-Sholah Jl. Pendidikan No. 39 Glugur Darat-I Al-Barkah Jl. Setia Jadi Kel. Glugur Darat I Al-Furqan Jl. Asahan No. 78 Kel. Sidodadi Al-Hidayah Jl. Jawa No. 3 Kel. Gg. Buntu Al-Hidayah Jl. Karantina Gg. Pasaman No. 2 Kel.Durian Al-Iman Jl. Sidang Raya, Kompl. DPRD Tk.I P.B.Bengkel Al-Ikhlas Jl. Muara Sipongi Kel. Gaharu Al-Ikhlas Jl. Madiosantoto No. 197 Lingk. 14 P.B. Darat Al-Ikhwan Jl. Prajurit No. 28 Lingk. XI Gg. Bali Al-Ittihad Pulo Brayan Bengkel Al-Muslimin Jl. Brigjend Bejo/Cemara Gg. Rambutan Al-Ma’ruf Jl. Sidorukun/Wartawan No.99 P.B. Darat II Al-Waritsiin Jl. Bilal No. 71 Kel. Pulo Brayan Darat I Baiturrahman Jl. Simpang 6 P. Brayan Bengkel Bustanul Huda Jl. Perwira I Lingk. VII P.B. Bengkel Baitul Mukminin Lingk. VIII Pulo Brayan Darat I Daarul Ma’arif Jl. Damar Raya No. 8 Sidorukun Muttaqin Jl. Pasar III No. 40 Glugur Darat I Nur Chadidjah Komp. Wartawan Jl. Letter Press No. 51 Nurul Iman Jl. Bambu VI Kel. Durian Nurul Yaqin Jl. Bukit Barisan I No.74 Kel.Glugur Darat II Syuhada Jl. Budi Pengabdian No. 2 P. Brayan Kota Taqwa Jl. Bilal Gg.Keluarga No.74 Kel. P.Brayan Darat I Taqwa Jl. Kapten Mukhtar Basri No. 3 Taqwa Ubudiyah Jl. Bambu III Kel. Durian

Drs. H. Indra Harahap Eri Yanto, S.Pd.I, S.HI Drs. H. Dahron Hasibuan Drs. Suparlan Drs. Ahmad Supriyadi DR. H. Hasan Mansyur Nst., MA Drs. H. Lahmuddin Ritonga Mohd. Hakim Hamdhani, S.HI, S.Pi Husni Thamrin Rambe, S.Ag Drs. Chairial Ashadi Drs. Sahnim Siregar Drs. Adnan Ritonga, M.Ag Drs. Syahrin, AW Drs. Syarifuddin Pasaribu Drs. H. Bahron Nasution Drs. H. Syarifuddin Elhayat, M.Ag Drs. Majid Syam H.M. Rajab Asri Maswail, Lc Sutrisno Drs. H.Takhlaq Mahmud Gulam Ray Drs. H. Abdullah Jamil, M.SI Imamul Muttaqin, M.Ag Fachrurrozi Pulungan Mahmuddin Nasution, MA Watni Marpaung, MA Drs. H. Burhanuddin, MA Drs. H. Dalail Ahmad, MA Drs. H. Supardi, MA (Bersambung ke hal.C4 )


Mimbar Jumat C5 Hj.Sutias: Jangan Gusar Hadapi Kemajuan Teknologi WASPADA Jumat 24 Mei 2013

Anak adalah generasi penerus bangsa dan di tangan merekalah dititipkan masa depan bangsa ini. Untuk menjamin pendidikan yang baik untuk generasi penerus ini, dibutuhkan bimbingan orang tua dan guru yang baik pula. “Didiklah anak kita semua dengan cinta, karena dengan cinta selain mudah menransfer ilmu juga dapat membentuk karakter anak yang baik,” tutur Ketua Tim Penggerak PKK Sumatera Utara Hj.Sutias Handayani Gatot Pujo Nugroho saat bertindak sebagai Keynote Speaker pada acara Seminar di Aula Universitas Al-Azhar, Jalan Pintu Air IV Padang Bulan Medan, Kamis (16/5).

Sutias menambahkan bahwa untuk menjadi orang tua yang baik harus memiliki wawasan keilmuan dan agama yang baik pula. Selain itu dibutuhkan kesabaran dan ketekunan dalam membesarkan dan mendidik anak. Allah SWT menitipkan anak bagi orang tua selain untuk dibesarkan dan dilindungi tapi juga dididik dengan sebaik-baiknya, Jadilah orang tua yang shaleh sehingga mudah menularkan keshalehan kepada anak anak kita,” tambahnya. Lebih jauh Sutias menjelaskan bahwa di era globalisasi dengan kemajuan teknologi orang tua tidak perlu gusar apalagi menjauhinya. Internet yang kerap ditakuti

karena banyak mengandung konten negatif tidak seharusnya membuat gusar para orang tua. Menyikapi kemajuan teknologi ini, para orangtua hanya perlu lebih teliti dan tekun mendampingi anak-anaknya. Anak-anak harus dibekali ilmu keislaman sehingga bisa menjauhkan mereka dari dampak buruk internet, juga kemajuan globalisasi lain. Sutias kemudian berharap dari kegiatan seminar bertemakan “Menjadi Orang Tua Efektif di Era Globalisasi” yang dibukanya, dapat menjadi tambahan keilmuan buat para orang tua dan guru dalam mendidik anaknya. “Tebarkanlah nilai kebaikan,

maka anak kita akan biasa melakukan kebaikan itu. Sesuatu yang terbiasa dilakukan maka kita akan mudah melakukannya,” tutup Sutias. Dalam kesempatan itu ketua panitia menjelaskan seminar tersebut digelar dalam rangkaian Exhibition and Student Creation 2013 . Selain seminar, kegiatan ini juga diisi berbagai perlombaan diantaranya Tilawah Alquran, Story Telling, Stand Up Comedy, Tari Tradisional dan beragam pertunjukan kreasi lainnya. Panitia mengucapkan terimakasihnya kepada Hj.Sutias yang di tengah kesibukannya menyempatkan waktu menjadi Keynote

Speaker di acara yang mereka gelar. Mereka berharap dengan arahan istri Gubernur Sumatera Utara itu bisa menjadikan Al-Azhar lebih maju dalam memajukan

pendidikan anak bangsa. Tampak hadir Dra Elly Suhairiah staf ahli Dinas Kominfo Provsu, Head Of Marketing Pesona Edukasi Simon Bone, Ketua

Yayasan Hj Rachmah Nasution, kepala sekolah, orang tua siswa, pemerhati pendidikan, para siswa dan puluhan peserta seminar lainnya.(m28)

Waspada/H. Amir Syarifuddin

Hj.Sutias Handayani Gatot Pujo Nugroho saat menjadi keynote speaker dalam seminar ”Menjadi Orang Tua Efektif di Era Globalisasi” di Perguruan Al Azhar, Medan.

Waspada/H. Amir Syarifuddin

Waspada/H. Amir Syarifuddin

CIUM TANGAN: Sejumlah siswi SMA Al Azhar, Medan mencium tangan Hj.Sutias usai seminar “Menjadi Orang Tua Efektif di Era Globalisasi”. MEDAN TEMBUNG Akbar Baitus Sujud Jl. Metereologi Raya Gg.Karya No.1H. Abdul Karim Hasbullah, Lc Ar-Rahman Jl. Durung Gg. Aspin Rustam, S.Ag Ar-Ramli Jl. Surya Lingk. XII Kel. Indra Kasih Drs. Bahari Ahmad Ar-Ridho Jl. Jati Psr VIII Dusun X Gambir Desa B.Klippa Amiruddin Btr Ash-Shobirin Jl. Pukat Banting II (Mestika) No. 45 Drs. H. Ismail Baharuddin, MA An-Nurul Hakimiyah Tembung Jl. M. Ya’kub No. 51 Abdul Haris, S.Pd.I At-Tawwabin Jl. Pimpinan No. 1 Drs. H. Syahmenan Hasibuan Attholab Man-1Jl. Willem Iskandar No. 7-B Drs. Hamdah Syarif Al-Anwar Jl. Willem Iskandar Kel. Indra Kasih DR. H. Maratua Simanjuntak Al-Bayan Jl. Gurilla No. 10 Drs. Kastro Nadhir, S.Pd.I Al-Falah Jl. Perbatasan Bandar Khalipah-Bandar Setia M. Ridwan Al Bantani, S.Pd.I Al-Falah Jl. Kemenangan 151 Kel. Indra Kasih Raden Sitompul Al-Falah Jl. Pukat Banting IV No. 10 M. Maudin, S.Ag Al-Furqan Islamic Centre Sumut Jl. Williem Iskandar Drs. H. Ishaq Ibrahim, MA Al-Hidayah Jl. Letda Sujono No. 62 Kel. Bdr. Selamat Drs. H. Effendi Batubara Al-Huda Jl. Tuasan Gg. Aman Kel. Sidorejo Hilir Thumari Al-Hikmah Jl. Letda Sujono Gg. Amal No. 5-B Drs. Rizal Efendi Al-Ikhlas Jl. Mandala By Pass Gg. Tengah Lingk. II Drs. H. Nukman Nasution, MA Al-Ikhlas Jl. Ambai Ujung No. 15-B. Kel. Sidorejo Hilir M. Ali Husin Parinduri, S.Pd.I Al-Ikhlas Sukamaju Pasar VII Desa Bandar Klippa Drs. H. Sari Ahmad Al-Ihsan Jl. Suluh No. 148 Al-Ishlah Jl. Bustamam Dusun X/XI Bandar Khalipah Drs. Rajab Sianturi Al-Ishlah Jl. Pukat V Kel. Bantan Timur Drs. H.M. Alisyah Hasibuan Al-Ijtima’iyah Jl. Letda Sujono No. 152 Kel. Tembung Drs. Anshoruddin Nasution Al-Muslimun Jl. Pertiwi No. 94-C Ke. Bantan Drs. Amir Saleh Al-Mubiin Dusun VII/Selasih Desa Bandar Khalipah Abdul Hadi Nasution Al-Muqorrobin Jl. Pukat II/52 Kel. Bantan Timur H. Ali Sati Nasution, Lc Baiturrahman Kampus UNIMED Jl. Williem Iskandar Drs. Ramli Nur, MA Babussalam Jl. Bersama Ujung No. 260 Kel. Bantan Drs. M. Hasanuddin Baitul Muslimin Jl. Datuk Kabu Pasar III Gg. Mesjid Khairul, S.HI Darul Amin Jl. Letda Sujono Ujung No. 1 Muchtaruddin D., MA Hidayatul Muslimin Jl. Bersama No. 105 Lingk. V Drs. H.M. Yamin Ritonga Ikhlashiyah Jl. Tempuling/Suluh No. 20 Kel. Sidorejo M. Nizamuddin, SHI Jamik Al-Ikhlas Jl. Pengabdian Dusun I Desa Bdr. Setia Drs. Agen Harahap Jamik Al-Jihad Jl. Besar Tembung Dusun I No. 17 Rasyid Ma’arif, S.Pd.I Nurul Iman Jl. Pertiwi Ujung Kel. Bantan Sopyan Pulungan, S.Pd.I Nurul Ihsan Jl. Durung No. 134 Kel. Sidorejo Drs. H.M. Yamin Lubis Taqwa Jl. Enggang Raya No. 85 Perumnas Medan II M. Zainuddin Taqwa Jl. Pimpinan Gg. Delima No.11 Sei Kerah Hilir Drs. Annai Saburi Nst., MA Taqwa UMA Kampus I Jl. Kolam No. 01 Medan Estate Drs. Fachrul Rizal, M.SI Ubudiyah Jl. Taduan 109 Kel. Sidorejo Drs. Tarmizi, D. MEDAN TUNTUNGAN Al-Amin Jl. Pala Raya Perumnas Simalingkar Al-Hidayah Jl. Seroja Raya Lingk. VI Kel. Tg. Selamat Al-Hikmah Jl. Tali Air Lingk.IV Kel.Mangga K. R.S.Jiwa Al-Ikhlas Jl. Bunga Kardiol Kel. Baru Ladang Bambu Al-Ikhlash Jl. Cengkeh No. 24 Kel. Mangga Al-Muhajirin Perumnas Simalingkar Al-Muhtadin Jl. Kemiri Raya No. 1 Blok-G Al-Muttaqin Jl. Jamin Ginting Km. 14 Kel. Sidomulyo Al-Razzaq Jl. Sakura Raya Kel. Tanjung Selamat Baiturrahman Jl. Flamboyan I/04 No. 2 Tg. Selamat Baitul Rahman Jl. Rami 2 Perumnas Simalingkar Iklab Jl. Letjen. Jamin Ginting Km. 12,7 Nurul Hayat Kompl. LIZARDI Kel. Kemenangan Tani Nurul Iman Jl. Irigasi No. 12 Kel. Mangga Silaturrahim Jl. Kapas No. 13 No. 49 P. Simalingkar Taqwa Jl. Sawit Raya, Perumnas Simalingkar

Alfan Abror Parinduri, S.Ag Suwarno, S.Pd.I Drs. Nazaruddin Zainuri, S.Ag Jumendra Banurea, M.Ag Drs. H. Maad Rais Zuhirsan, Lc, MA Drs. Ismail Manurung Azhar Fauzi, S.Ag Drs. M. Yusuf Arhad M. Syafii Zulikhfan, SKM Sugito Kelana, S.Ag Nurswara Putra, ST. Awaluddin, S.Ag

DELISERDANG Amal Islamiyah Jl. Sudirman No. 4 Lubuk Pakam Amran, S.HI Aisyah Abdullathif Farah Jl. Mama Suka No. 1 Per.TPD Munawir Pasaribu, S.Pd.I, MA Ash-Sholah Jl. Roso Marindal 1 Badu Amin Nasution, S.Ag At-Taubah Blok Gading Kelambir Lima Kebun H. Perak Sudirman Al-Furqan Perum. Bumi Tuntungan SejahteraDesa SC Banta Khairullah, S.Ag Al-Hidayah Jl. Pembangunan Desa Sekip Lubuk Pakam Syahrudin Lubis Al-Hafiz Hamparan Perak Kec. Hamparan Perak Drs. H. Khairul Anwar, ZA Al-Ikhlas Jl. Delitua Km. 8,5 Dusun Desa Suka Makmur Ali Idrus, S.Pd.I Al-Ikhlas Lingk. XIII Dusun Durian Kec.Percut Sei Tuan Drs. Dahler Effendi Al-Ikhlas (YAMP). Pomplek Perkantoran Pemkab. DS Syamsul Yahya, S.HI Al-Issyah Hakim Jl. Karya Jaya Kel./Kec. Deli Tua Azman, SH Al-Muhajirin Perum. Pondok Nusantara Ds Marindal-II Drs. H. Hamdan Yazid Al-Muttaqien Jl. Besar Deli Tua Gg.Kolam Kec. Deli Tua Drs. Poltak Haahap

Al-Mukhlisin Jl. Terusan Dusun II Bandar Setia Baiturrahman Jl. Merica Raya Blok F Per. Simalingkar Baitussalam Dagang Kerawan Tanjung Morawa Baitur Rohim Jl. Purwo Desa Suka Makmur Graha Deli Permai Jl. Sidodadi Istikmal Jl. K.E. Tandean Lingk. III Bandar Sakti Jami’ Asysyakirin Deli Tua Jami’ Kel. Galang Kota Jami’ Al-Hisan Desa Silemak Kec. Hampran Perak Jami’ Lubuk Pakam Khairul Fatihin Dusun II Kec. Tg. Morawa Lahmuddin Jl. Besar Deli Tua Km.8,3 Ds Suka Makmur Misbahul Munir Jl. P. Siantar No. 1 Desa Pagar Jati Nurul Ikhwan Jl. H.A. Dahlan No. 38 Tg. Morawa Nurul Hikmah Balai Penelitian Sungai Putih Nursa’adah Jl. Raya Medan- Tanjung Morawa Km. 12 Raya Lubuk Pakam Jl. T. Raja Muda No. 26 Raya Syuhada Kec. Galang Tarbiyah Jl. Bakti Desa Sekip Lubuk Pakam Taqwa Lubuk Pakam

PERGURUAN ISLAM: Hj.Sutias bersama pengurus Yayasan Al Azhar saat meninjau fasilitas dan suasana pendidikan di perguruan Islam modern tersebut.

Drs. H. Ependi Rambe Drs. M. Suhery Siregar Poniman Drs. Ajmain Drs. Asmuni Supardi Sabaruddin Bisri, Lc H. Syahrial Helmi, S.Pd.I M. Yusuf, Lc Drs. H. Yusuf Ady, MA Drs. Ngadimen, S.Pd.I Rusli, S.HI Amas Muda Lubis, BA Drs. H. Mohd. Hafiz Ismail H. Ramlan H. Abdullah Sani, Lc M. Razi T. Radian, S.Ag H. Dwi Andi Syahputra, Lc Drs. Zulkifli

BINJAI Agung Kota Binjai DR. H. Abdullah, AS Amal Jl. T. Imam Bonjol Gg. Cempaka Khairul Amri Siregar, S.Pd.I An-Nur Jl. Veteran No. 7 Lingk. 1 Kel. Tangsi Drs. H. Syamsuddin Daulay Ar-Rahmah Turiam Jl. Ikan Kakap No.1 Kel. Tanah Tinggi Drs. H. Elyunani Harahap Ath-Thohirin Jl. T. Amir Hamah Km.24 Kel. Jati Makmur Drs. H. Farhan Rawi Al-Hidayah Jl. Talam No. 28 Kel. Nangka Binjai Suherman Az-Zuhri Nasution Al-Hilal Jl. Ikan Arwana No. 17 Kel. Dataran Tinggi H.M. Effendi, MA Al-Mukhlishin Jl. Timba No. 3 Lingk. II Nangka Drs. Juniwan Aksara Al-Qadar Komplek Griya Payaroba Indah Binjai Drs. Amiruhansyah Darussalam Jl. Cut Nyak Din No. 2 Kel. Tanah Tinggi Drs. Muhammad Rafiq, MA Istiqomah Jl. T. Amir Hamzah Kel. Jatinegara Drs. H. Muslim Rawi Nurul Falah Jl. S.M. Raja No. 60 Kel. Tanah Tinggi Drs. H. Juniwan Aksara Nurul Yaqin Jl. S.M. Raja No. 94 Kel. Tanah Tinggi Drs. H. Farhan Rawi LANGKAT Azizi Tanjung Pura Ar-Raudhah Dusun VII Desa Kebun Balok Al-Furqan Stabat Al-MuhajirinJl. Kelapa Sawit Kel. Perdamaian Nurul Huda Kel. Perdamaian Kec. Stabat Nurul Iman Lingk. VII Damai Kel. Perdamaian

Drs. H.M.Yusuf Abdullah, MA M.Sapri Nasution, S.HI, S.Pd.I H. Ramsyah AR, BA H. Ibnul Mubarok, S.Sos H.M. Ja’far, S. Sakiman

TEBING TINGGI Amal Muslim Kp. Rao Annamirah Perum. Griya Prima Lingk.IV Kel. T. Marulak At-Taqwa Jl. Dr. Kumpulan Pane No. 58 Lingk. I Al-Huda Lingk. III Kel. Berohol Kec. Bajenis Al-Hidayah Jl. Nenas Kel. Rambung Kota Al-Hasanah Jl. Kartini No. 16-A Al-Hasanah Jl. Merbau Perumnas Bagelen Al-Maryam Jl. Darat Lingk. VIII Kel. Rambung Kota Al-Muthmainnah Kel. D. Sundoro Lingk. I Al-Qomar BTN. Purnama Deli Lingk. V Kel. Bulian Darul Jihad Brimob Jl. Ahmad Yani Nurul Islam Jl. P. Irian Lingk. 04 Kel. Persiakan Nurul Iman Jl. K.L. Yos Sudarso Lingk. 02 Kel. R. Laban Nurul Ikhwan Rumah Sakit Sri Pamela Raya Nur Addin Kota Tebing Tinggi Syuhada Jl. Iskandar Muda No. 79-A Tafakkur Jl. Sei Padang Lorong Batu Sangkar Kota

Ramadhan Lubis Drs. H. Abd. Manan Hasibuan Emil Sofyan, S.Pd.I Drs. Sabaran Harahap H.M. Thahir Nasution Zuhril Lubis H. Agusul Khair, S.Ag Drs. Daulat P. Sibarani, MA Suratman Erwin Syafri Siregar, S.Sos.I H. Ardhu Billi Mahmud, S.Pd.I Abdullah Sani Rangkuti Lahmanuddin M. Ilyas Hibban, S.Ag Drs. Abdul Khalik, M.AP Parman

INDRAPURA Jami’ Indrapura

Iriansyah

KISARAN Agung Jl. Imam Bonjol No. 182 Ar-Rasyidin Jl. Sei Asahan No. 42 Kel. Tegal Sari Al-Huda Jl. K.H. Ahmad Dahlan No. 1 Al-Husna TKel. Kisaran Barat Al-Husna Kel. Sidomukti Al-Hidayah Kisaran Baru Al-Inayah Kel. Siumbut-umbut Kota Kisaran Timur Al-Muttaqin Jl. Ir. H. Juanda Kel. Karang Anyer

Drs. H. Abd. Rasyid H. Sulaiman Nasution, S.Pd.I Imron Ariadin, MA Drs. H. Abdur Rasyid Drs. H.A. Rahman, P. H. Dahmul Daulay, S.Ag Amin Hidayat, S.Ag Nono Astono

Ikhwaniyah Jl. Merpati No. 44 Kel. Gambir Baru Jami’ Baiturrahim Jl. Prof. H.M. Yamin SH Nurul Huda Jl. Malik Ibrahim No. 37

Bambang Hadira Fitra, S.Ag, MA H. Ahmad Munir, Lc

ASAHAN Arif-Al Azhim Polres Asahan

Abdul Hakim Lubis, S.Ag

BATUBARA Jami’ Al-Mukhlisin PT. Moeis Kec. Sungai Suka Deras Nurul Huda Desa Tanah Tinggi Kec. Air Putih Nurul Iman Desa Perkotaan Kec. Air Putih Syuhada Sukaraja Desa Sukaraja Kec. Air Putih

Irpan Ansori Muslim Bustami Mhd. Ridho

PEMATANGSIANTAR Al-Abrar Jl. Aru Kel. Bantan Al-Amin Jl. Brigjen Rajamin Purba Kel. Bukit Sofa Al-Falah Jl. Pane No. 1 Kel. Karo Al-Falah Jl. Rakutta Sembiring No. 5 Kel. Naga Pita Al-Furqon Jl. Tekukur No. 2 Kel. Sipinggol-pinggol Al-Hanif Jl. Ade Irma Suryani Nasution No. 28 Al-Hidayah Jl. Bazoka No. 6 Kel. Bukit Sofa Al-Hidayah Jl. MelanthonSiregar No. 36 Sukamakmur Al-Hikmah Jl. Sibatu-batu Kel. Bah Kapul Al-Hilal Jl. Melanthon Siregar No. 218 P. Marihat Al-Huda Jl. Medan Km. 7,5 Kel. Tambun Nabolon Al-Huda Rindam Jl. Bangau Kel. Setianegara Al-Ihsan Gang Kapuk Kel. Tanjung Tengah Al-Ihsan Jl. Rajawali No. 26 Kel. Simarito Al-Ikhlas Jl. Ampi No. 17 Kel. Bantan Al-Ikhlas Jl. Bakung No. 44 Kel. Simarito Al-Ikhlas Blok II Sibatu-batu Makmur Al-Ikhlas Gg. Air Bersih No. 22 Kel. Naga Pitu Al-Ikhlas Jl. Mawar Karang Sari Permai Al-Ikhlas Jl. Nagur No. 45 Kel. Martoba Al-Ikhlas Jl. Silou Raya No. 2 Kel. Siopat Suhu Al-Ikhlas Jl. Tangki Kel. Naga Pita Al-Jihad Jl. Jenderal Ahmad Yani Kel. Asuhan Al-Jihad Jl. Melati No. 11 Kel. Simarito Al-Jihad Jl. Tongkol No. 86 Kel. Pardomuan Al-Khairiyah Jl. Jorlang Hataran No. 1 Kel. Simarito Al-Khoirot Tambun Timur Kel. Tambun Nabolon Al-Mukminun Jl. Sang Nawaluh Kel. Siopat Suhu Al-Musyawarah Jl. Flores II Kel. Bantan Baitul Abrar Jl. Meranti Kel. Kahean Baiturrahmah Jl. Tanah Jawa No. 75 Kel. Melayu Bakti, Jl. Singosari Kel. Bantan Bhakti Jl. Serdang Kel. Martoba Dakwah Jl. Jawa No. 23 Kel. Bantan Darul Aman Jl. Enggang No. 4 Kel. Sipinggol-pinggol Darul Maimanah Jl. Sriwjaya Gg. Mesjid Kel. Baru IlhamJl. Jenderal Ahmad Yani No. 43 Kel. Pardomuan Istiqomah, Jl. Bolakaki Kel. Banjar Jamik As-Saidah Jl. Siatas Berita Kel. Tomuan Jamik Jl. Medan Km. 4 Kel. Naga Pitu Mualifatul Bilad Jl. Setianegara II Kel. Setianegara Mujahidin Jl. Kabu-kabu No. 22 Kel. Kahean Nurul Hikmah Jl. Dr. Cipto No. 122 Kel. Simalungun Nurul Huda Blok III Kel. Bah Sorma Nurul Huda Jl. Melanthon Siregar Pematang Marihat Nurul Ihsan Jl. Nagahuta Gg. Mesjid Kel. Setianegara Nurul Iman Jl. Rakoetta Sembiring Kel. Naga Pitu Nurul Iman Tambun Timur Kel. Tambun Nabolon Rahmat Jl. Madura Bawah Kel. Bantan Rahmat Jl. Singosari No. 30 Kel. Martoba Raya Jl. Mesjid Kel. Timbang Galung Syafaat Jl. S.M. Raja Barat Kel. Bah Kapul Taqwa Ash-Sholeh, Jl. Silimakuta No. 30 Kel. Simarito Taqwa Jl. Dr. Wahidin Kel. Melayu Taqwa Jl. K.H. Ahmad Dahlan No. 18 Kel. Bukit Sofa Taqwa Jl. Merdeka No. 271 Kel. Dwikora Taqwa Jl. Patuan Anggi Gg. Perak Kel. Baru Ubudiyah Jl. Melur No. 11 Kel. Simarito

Samantio Sinaga, S.Pd.I H.M. Thamrin Nasution H. Ahmad Syuthury, S.Ag Drs. H. Khoiruddin Nasution Rahmat Lubis, BA H. Abdul Halim Lubis, S.HI Ahmad Hanafi Lubis, S.Ag Iswadi Lubis, S.Ag H. Miswan, SH Agus Pandapotan Nst., S.Pd.I Hanizar, S.Ag Drs. H. Mustafa Kamal Siregar H. Bahaluddin, S.Pd.I Drs. H. Mhd. Asli H. Sofyan Han Drs. Salahuddin, MC Muhammad Rusli, S.Ag H. Aslam Al-Huda Nst., S.Pd.I Drs. Badaruddin Dalimunthe Albar Suheri, S.Ag Drs. H. Rasyid Nasution Drs. Alhafif Syahputra, M.Pd. Drs. Rustam Asy’ari, MA H. Sardjono, S.HI Drs. H. Asy’ari Sitompul Zulfakar, SH Ramlan Purba Zulhamri Siregar, S.HI Hasyrul Syahrial Siregar, S.HI Rasyidan Mansur Sinaga, S.Pd.I Drs. H. Mustafa Kamal Siregar Wajir Caniago Sudarwin, S.Pd.I Irwansyah Nasution, S.Pd.I Yusri Nasution Muhammad Zein H.M. Thamrin Nasution Muhammad Yunan Arga Drs. Paisri, MM Drs. Tajussalim Drs. H. Ali Usman Nasution Maulana Arham Ki. A.H. Mugiono Zer Abdul Rahman Saragih, S.Pd.I Iswadi Lubis, S.Ag Drs. H. Yusri Batubara, MH Warsono Edi Wibowo, S.Pd.I Drs. H. Ammar Lubis Drs. H. Chaidir Sitompul Drs. Borkat Pandiangan, MM Tagor Muda Hasibuan Husnul Arifin, M.Pd. Fakhruddin Sagala, S.Pd.I Ahmad Fithrianto, MA Ahmad Syukri Batubara, S.Ag H. Hasan Basri Siregar, MA

SIDIKALANG Agung Jl. Mesjid No. 2 Sidikalang Al-Muhajirin Perumnas Simbara Sidikalang

Drs. H. Naik Angkat, S.Pd.I Jono Pasi, S.Ag


Mimbar Jumat

C6

Keistimewaan Bulan Rajab Dan Anjuran Puasa Rajab Oleh H.M. Nasir, Lc, MA Pimpinan Pondok Pesantren Tahfiz Alquran Al Mukhlisin Batubara, Wakil Sekretaris Dewan Fatwa Pengurus Besar Alwashliyah.

B

ulan Rajab adalah urutan ke tujuh pada kalender Hijriyah, terhitung dari Muhar-ram, Shafar, Rabiul Awal, Rabiul Akhir, Jumadil Awal, Jumadil Akhir, Rajab. Secara kebahasaan rajaba, yarjubu berarti memu-liakan. Salah satu kelebihan bulan Rajab dari bulan yang lain adalah karena dikelompokkan ke dalam empat bulan yang dihormati (Dzulqa’dah, Dzulhijjah, Muharram, Rajab), sebagaimana termaktub di dalam Alquran: Sesungguhnya bilangan bulan pada sisi Allah adalah dua belas bulan di dalam ketetapan Allah, di waktu menciptakan langit dan bumi diantaranya empat bulan yang dihormati, itulah ketetapan agama yang kokoh (QS. At-Taubah: 36). Keterangan empat bulan yang dihormati tersebut dijelaskan oleh Nabi Saw: Setahun ada 12 bulan diantaranya terdapat empat bulan haram, tiga berurut (seperti tersebut di atas) sedangkan Rajab yang penuh kemuliaan berada diantara dua bulan Jumadil dan Sya’ban (HR. Bukhari No.302). Allah Swt memuliakan bulan Rajab adalah untuk kemaslahatan manusia itu sendiri, antara lain tidak boleh melakukan peperangan, penganiayaan, dan lebih dari itu agar manusia dapat mensucikan dirinya di waktu-waktu yang dihormati Allah Swt. sebaliknya melakukan kemaksiatan pada bulan-bulan yang dihormati Allah Swt dapat lebih mengotori jiwa manusia itu sendiri. Oleh sebab itu, para ulama dan ahli hikmah selalu memilih waktu-waktu yang mulia tersebut untuk menulis dan menyelesaikan karya-karyanya. Ketika Nabi Muhammad Saw ditanya tentag puasa yang paling afdhal, Nabi Saw bersabda: Puasa yang lebih utama setelah puasa di bulan Ramadan adalah puasa di

bulan-bulan haram. Dan Nabi juga bersabda: Siapa-siapa yang puasa satu hari di bulan-bulan haram, diberi ganjaran seperti puasa 30 hari. (lihat Tafsir AlKabir, Imam Fakhruddin Arrozy, juz 16 hal.42). Sejalan dengan hadis di atas adalah hadis yang diriwayatkan

Nabi bersabda: Puasalah 3 hari (setiap bulan)! Kemudian AlBahili berkata: Tambahkan lagi ya Rasulullah! Nabi bersabda: Puasalah pada bulan-bulan haram dan berbukalah. Puasalah pada bulan-bulan haram dan berbukalah. Puasalah di bulan-bulan haram da berbukalah (Beliau mengisya-

Allah Swt memuliakan bulan Rajab adalah untuk kemaslahatan manusia itu sendiri, antara lain tidak boleh melakukan peperangan, penganiayaan, dan lebih dari itu agar manusia dapat mensucikan dirinya di waktu-waktu yang dihormati Allah Swt. oleh Abi Daud dan Ibnu Majah dari Mujibah Al-Bahiliyah bahwa dia pernah datang kepada Rasul Saw, kemudian berselang setahun dia datang lagi kepada Rasul Saw, dan sesungguhnya telah terjadi perobahan pada kondisi tubuhnya (kurus) lalu dia berkata: Wahai Rasul? Adakah engkau masih mengenal saya? Rasulullah bertanya, siapakah anda? Saya adalah AlBaihili yang datang kepadamu pada tahun lalu. Nabi bertanya, apa yang membuat kondisi tubuhmu berubah? Dahulu anda tampan! Al-Bahili menjawab: Saya tidak pernah makan semenjak kita bertemu tahun lalu kecuali hanya di waktu malam saja. Maka Rasulullah Saw bertanya? Kenapa kamu menyiksa dirimu sendiri? Kemudian dia bersabda: Puasalah kamu di bulan sabar (Ramadhan) saja, dan satu hari setiap bulan! Dan Al-Bahili menjawab: Tambah lagi ya Rasulullah! Sesungguhnya aku mampu berpuasa. Nabi bersabda: Puasalah dua hari (setiap bulan) dan Al-Bahili berkata lagi: Tambahkan lagi ya Rasulullah!

ratkan dengan 3 jari dan menggenggam 2 jari yang lain) sebagai isyarat untuk puasa 3 hari dan berbuka tiga hari tidak lebih dari itu. (lihat Aunul Ma’bud Syarah Sunan Abi Daud Juz 4 hal.506 Hadis no. 2425 bab puasa di bulan-bulan haram). Diriwayatkan oleh Imam Baihaqi dari Anas dan status hadisnya marfu’ (dihubungkan langsung kepada Nabi Saw): Bahwa di dalam surga ada sebuah sungai yang bernama sungai Rajab, airnya lebih putih dari susu, lebih manis dari madu, dan siapa-siapa yang berpuasa satu hari di bulan Rajab Allah akan memberinya minum air sungai tersebut. (lihat fatwa kubro Ibnu Hajar Al-Haitami (W. 974 H) Juz 2 hal. 4). Riwayat lain dari Abdullah bin Sa’id dengan status hadis yang sama: Siapa-siapa yang puasa 1 hari di bulan Rajab pahalanya seperti puasa 1 tahun, dan siapa-siapa yang puasa 7 hari, tertutup untuknya pintupintu neraka jahannam, dan siapasiapa yang puasa 8 hari, dibukakan untuknya 8 pintu surga, dan siapasiapa yang puasa 10 hari, Allah

memberinya apa saja yang dia minta, dan siapasiapa yang puasa 15 hari, akan mendapat seruan dari langit bahwa Allah telah mengampuni dosa-dosa yang lewat, dan bukalah lebaran baru, dan Allah telah menukar keburukankeburukanmu dengan kebaikan, siapa-siapa yang menambah lebih dari itu Allah akan menambah pahalanya. (ibid, hal.4). Hadis-hadis di atas diperdebatkan oleh pakar-pakar hadis tentang kesahihannya, ada yang mengatakan hadis-hadis di atas berstatus mauquf pada seorang tabi’in yang bernama Abi Qilabah (tidak diucapkan oleh Nabi Muhammad Saw), namun telah menjadi ketetapan di kalangan ahli hadis bahwa hadis-hadis mauquf, mursal, munqathi’, mu’adhal dapat dijadikan dalil untuk amalan-amalan yang bersifat anjuran (fadhailul ‘amal) dan ketetapan itu sudah disepakati (ijma’ ulama) dan puasa Rajab termasuk amalan-amalan yang bersifat fadhailul ‘amal). Oleh sebab itu, Imam Syihabuddin Ibnu Hajar Al-Haitami bermazhab Syafi’i membantah keras bagi orang-orang yang melarang puasa di bulan Rajab, apalagi mengatakan tidak ada dalil sama sekali perintah tentang itu. Imam Ibnu Hajar mengatakan, orang-orang tersebut jahil maghrur (orang-orang bodoh lagi tertipu dengan keodohannya). (lihat fatwa kubro Ibnu Hjar jilid 2 hal.5). Ibnu Hajar melanjutkan argumentasinya, seandainya hadis yang berbunyi “sebaik-baik puasa adalah puasa saudarku Nabi Daud, puasa berselang hari” dijadikan dalil untuk puasa Rajab itu saja sudah cukup untuk membantah orang-orang yang melarang anjuran berpuasa di bulan Rajab, karena puasa Nabi Daud tidak dikecualikan bulan Rajab di dalamnya. Wallahua’lam bil ash-shawab

Pendidikan Anak Dalam Perspektif Islam Oleh Yose Rizal, S.Ag, MM Kepala MAPN 4 Martubung Medan, Wakil Direktur Pon-Pes Darul Hikmah TPI Pengamat Khusus Bidang Pendidikan Sumatera Utara

S

ecara umum dikatakan anak adalah seorang yang dilahirkan dari perkawinan antara seorang perempuan dengan seorang laki-laki dengan tidak menyangkut bahwa seseorang yang dilahirkan oleh wanita meskipun tidak pernah melakukan pernikahan tetap dikatakan anak. Jika dalam konteks yang lebih luas, anak adalah makhluk hidup yang diberikan Allah SWT kepada manusia melalui hasil pernikahan guna meneruskan kehidupan selanjutnya. Penulis pribadi menggambarkan pengertian anak dalam konteks lain adalah bagian kecil dari sebuah kesatuan. Misalnya dari beberapa istilah seperti anak tangga, anak panah, anak kunci dll. Adapula yang memaparkan bahwa pengertian anak adalah keturunan pertama, sedangkan keturunan kedua adalah cucu. Tentunya kita mengetahui bahwa defenisi tersebut adalah dalam konteks manusia. Mengapa konteks dalam ruang lingkup pembicaraan ini begitu penting dalam pembahasan pengertian anak?, karena perbedaan konteks bisa mempengaruhi pengertian dan defenisi anak itu sendiri. Contohnya jika diambil dalam konteks hukum, anak adalah se-

seorang yang belum mencapai usia 21 tahun atau yang belum pernah kawin berdasarkan UU NO 4 Tahun 1979 pasal 1 ayat 2. Dari defenisi ini, kita melihat bahwa defenisi ini sangat berbeda dengan sebelumnya yang kita bahas diatas. Tentu kita menyadari bahwa defenisi ini sangat berbeda lagi jika ditinjau dalam konteks Negara, karena setiap Negara mempunyai defenisi/pengertian anak yang berbeda-beda. Dalam sudut pandang yang dibangun oleh Agama Islam, anak merupakan makhluk yang dhaif dan mulia, yang keberadaannya adalah kewenangan dari kehendak Allah SWTdengan melalui proses penciptaan. Oleh karena anak mempunyai kehidupan yang mulia dalam pandangan Agama Islam, maka anak harus diperlakukan secara manusiawi seperti diberi nafkah baik lahir maupun batin, sehingga kelak anak tersebut tumbuh menjadi anak yang berakhlak mulia seperti dapat bertanggung jawab dalam mensosialisasikan dirinya untuk mencapai kebutuhan hidupnya dimasa mendatang. Dalam pengertian Islam, anak adalah titipan Allah SWT kepada kedua orang tua, masyarakat, bangsa dan negara yang

Konsultasi Alquran Ikatan Persaudaraan Qari-Qariah & Hafizh Hafizah (IPQAH Kota Medan) KONSULTASI AL-QURAN adalah tanya jawab sekitar Alquran, yang meliputi: tajwid, fashohah, menghafal Alquran, Ghina (lagu) Alquran, Hukum dan ulumul Alquran. Kontak person. 08126387967 (Drs. Abdul Wahid), 081396217956 (H.Yusdarli Amar), 08126395413 (H. Ismail Hasyim, MA) 0819860172 (Mustafa Kamal Rokan).

Assalamu’alaikum Wr.Wb. Al-Ustadz, ada saya pernah mendengar hadis, “janganlah kalian jadikan rumah-rumah kalian sebagai kuburan”. apakah maknanya kita tidak boleh menanamkan mayat di rumah kita ? Mohon penjelasan. Dari Hamba Allah. Jawab : Terima Kasih atas pertanyaannya. Kami melihat hadis ini ada sambungannya yaitu dengan redaksi: “janganlah kalian jadikan rumah-rumah kalian kuburan. Sesungguhnya setan akan keluar dari rumah yang didalamnya dibacakan surat Albaqarah” atau dalam redaksi lainnya “ rumah yang didalamnya dibacakan surat Albqarah tidak akan dimasuki oleh syaitan”. (Hr. Muslim, Tirmidzi, Nasa’i). Tampaknya ada dua tafsiran hadis ini: Pertama: “jangan kalian mengubur orang mati didalam rumah kalian”. Kedua: rumah yang tidak ada zikir, ibadah dan ketaatan didalamnya dianggap seperti kuburan. Didalam hadis lain riwayat Aisyah bahwasanya nabi bersabda: “jadikanlah shalat (sunnah) kalian dalam rumah kalian dan jangan kalian menjadikannya sebagai kuburan bagi kalian, sebagaimana orang-orang Yahudi dan Nasrani menjadikan rumah mereka sebagai kuburan. Sesungguhnya rumah yang dibacakan Alquran akan terlihat oleh penghuni langit, sebagaimana bintang-bintang terlihat oleh penghuni bumi”. Jadi, jangan menanam mayat di rumah dan jangan tidak ada ketaatan dan ibadah di rumah kita. Wallahu A’lam. Al-ustadz H. Ismail Hasyim, MA.

Keteladanan dalam pendidikan merupakan metode yang berpengaruh dan terbukti paling berhasil dalam mempersiapkan dan membentuk aspek moral, spiritual dan etos anak. kelak akan memakmurkan dunia sebagai rahmatan lila’lamin dan sebagai pewaris ajaran Islam, pengertian ini mengandung arti bahwa setiap anak yang dilahirkan harus diakui, diyakini, dan diamankan sebagai implementasi amalan yang diterima oleh akan dari orang tua, masyarakat, bangsa dan negara. Perlu diketahui, anak merupakan cikal bakal lahirnya suatu generasi baru yang merupakan penerus cita-cita perjuangan bangsa dan sumber daya manusia bagi pembangunan Nasional. Anak adalah asset bangsa. Masa depan bangsa dan Negara dimasa yang akan datang berada ditangan anak sekarang. Semakin baik keperibadian anak sekarang maka semakin baik pula kehidupan masa depan bangsa. Begitu pula sebaliknya, Apabila keperibadian anak tersebut buruk maka akan bobrok pula kehidupan bangsa yang akan datang. Dari latarbelakang ini, betapa pentingnya anak dalam kehidupan sebuah Negara, karena anak yang pintar akan melahirkan sebuah Negara yang maju, untuk itu dalam mendidik anak, ada beberapa metode yang harus dilakukan orang tua dan guru. Pertama, Pendidikan dengan Keteladanan, Keteladanan dalam pendidikan merupakan metode yang berpengaruh dan terbukti paling berhasil dalam mempersiapkan dan membentuk aspek moral, spiritual dan etos anak. Mengingat pendidik adalah seorang figur terbaik dalam pandangan anak yang tindak tanduk dan sopan santunnya, disadari atau tidak akan ditiru oleh mereka. Bahkan bentuk perkataan, perbuatan dan tindak tanduknya akan senantiasa tertanam dalam kepribadian anak. Oleh karena itu masalah keteladanan menjadi faktor penting dalam menentukan baik buruknya anak. Berdasarkan paparan di atas orang tua dan guru hendaklah dalam mendidik dan membimbing remajanya atau murid-muridnya dengan cara keteladanan yang diberikan oleh orang tuanya sendiri dan guru di sekolahnya, artinya orang tua dan guru harus memberikan contoh yang baik.

Kedua, Pendidikan dengan Adat Kebiasaan, Termasuk masalah yang sudah merupakan ketetapan dalam syari‘at Islam, bahwa anak sejak lahir telah diciptakan dengan fitrah tauhid yang murni, agama yang benar dam iman kepada Allah SWT. Sesuai dengan Firman Allah SWT dalam Q.S. Ar-Ruum : 30. “Fitrah Allah yang telah menciptakan manusia menurut fitrah itu. Tidak ada perubahan pada fitrah Allah (itulah agama yang lurus tetapi kebanyakan manusia tidak mengetahui)”. Dari ayat di atas, dapat diketahui bahwa anak dilahirkan dengan naluri tauhid dan iman kepada Allah. Dari sini tampak peranan pembiasaan, pengajaran dan pendidikan bagi pertumbuhan dan perkembangan anak dalam menemukan tauhid yang murni, budi pekerti yang mulia, rohani yang luhur dan etika religi yang lurus. Tidak ada yang menyangkal, bahwa anak akan tumbuh dengan iman yang benar, menghiaskan diri dengan etika Islam bahkan sampai pada puncak nilai-nilai spritual yang tinggi dan berkepribadian yang utama, jika ia hidup dengan dibekali dua faktor pendidikan Islam yang utama dan lingkungan yang baik. Dari pendapat di atas tampaklah peranan orang tua dan guru terhadap remajanya adalah membiasakan kepada anak untuk melakukan perbuatan yang terpuji bagi pertumbuhan dan perkembangan remajanya dalam menemukan tauhid yang murni, budi pekerti yang mulia, rohani yang mulia dan etika relegi yang lurus. Ketiga, Pendidikan dengan Nasehat, Nasehat termasuk metode pendidikan yang cukup berhasil dalam pembentukkan akidah amal dan mempersiapkannya baik secara moral, emosional maupun sosial adalah pendidikan anak dengan petuah dan memberikan kepadanya nasehat-nasehat, karena nasehat dan petuah memiliki pengaruh yang cukup besar dalam membuka mata anak-anak kita, kesadaran dan martabat yang luhur, menghiasi dengan akhlak yang mulia serta membekalinya dengan prinsip-prinsip Islam. Wallahu Muafiq Ila Aqwami Thariq.

WASPADA Jumat 24 Mei 2013

Tips Shalat Khusuk Ingat Mati (4) Memahami bacaan shalat serta merenunginya merupakan salah satu jalan untuk meraih kekhusyu’an. Bahkan menjadi salah satu jalan utamanya. Rasanya orang yang jahil terhadap makna-makna yang dibacanya dari Al-Qur’an dan dzikirdzikir dalam shalat sangat sulit sekali untuk mendapatkan kekhusyu’an. Hal ini sebagaimana yang disebutkan oleh Muhammad Shalih Al-Munajid. Dalam bagian lain, Syaikh Al-Munajid menganjurkan bagi orang yang melaksanakan shalat untuk memahami bacaan Al-Quran yang dilantunkan dalam shalat. Lalu beliau menunjukkan cara untuk memahami Al-Quran, yaitu dengan memperhatikan tafsir AlQur’an sebagimana yang dikatakan oleh Ibnu Jarir. Berikut ini kekhusyukan Rasulullah SAW dalam shalatnya sehingga tumbuh rasa takutnya kepada Allah sampai-sampai air mata beliau tertumpah membasahi bumi. Diriwayatkan dari ‘Atha, dia dan ‘Ubaid bin ‘Umair pernah datang menemui Aisyah radliyallah ‘anha. Kemudian ‘Ubaid berkata, “Ceritakanlah kepada kami hal yang paling menakjubkan yang pernah Anda lihat dari Rasulullah SAW?” Aisyah menangis lalu becerita, “Pada suatu malam Rasulullah bangun, lalu berkata, “Hai Aisyah biarkan aku menyembah Tuhanku malam ini, sesungguhnya aku suka dekat denganmu dan aku menyukai apa yang engkau sukai.”Aisyah melanjutkan kisahnya, “Sesudah itu beliau bangkit dan berwudlu’, lalu berdiri untuk shalatnya. Beliau terus-menerus menangis dalam shalatnya sehingga pangkuannya basah, dan terus menangis hingga tanahnya basah. Setelah itu Bilal datang untuk memberitahukan akan masuknya waktu shubuh. Tetapi, setelah Bilal melihat beliau menangis, maka ia bertanya, “Wahai Rasulullah, Anda menangis, padahal Allah sudah mengampuni semua dosamu yang terdahulu dan yang kemudian?” Rasulullah SAW menjawab, “Tidak bolehkan aku menjadi hamba yang banyak bersyukur? Sesungguhnya malam ini telah diturunkan kepadaku beberapa buah ayat. Celakalah bagi orang membacanya tapi tidak memikirkan makna yang terkandung di dalamnya: “Sesungguhnya dalam penciptaan langit dan bumi... (QS. Al-Baqarah: 164) seluruhnya.” (HR. Ibnu Hibban dalam Shahihnya. Al-Albani). (Sumber: Badrul Taman/voaIOslam dan sumber lain).

Sombong Oleh Fachrurrozy Pulungan Forum Komunikasi Lembaga Dakwah Sumatera Utara.

“M

aka tatkala mukjizat-mukjizat Kami yang telah jelas itu sampai kepada mereka, berkatalah mereka, ‘ini adalah sihir yang nyata’. Dan mereka mengingkarinya karena ke zaliman dan kesombongan mereka. Padahal hati mereka meyakini kebenarannya. Maka perhatikanlah betapa kesudahan orang-orang yang berbuat kebinasaan “. Qur’an surah an Naml ayat 13-14. Seberat atau separah apa pun penyakit fisik yang diderita seseorang, jika hati nya sehat, ia tetap masih bisa beribadah kepada Allah SWT seperti yang ditunjukkan oleh nabi Ayyub as. Nabi Ayyub as yang menderita penyakit fisik yang sangat luar biasa, badannya penuh dengan kudis bernanah, sehingga ia hampir tidak bisa berjalan. Tetapi karena hatinya sehat, ia tetap beribadah kepada Allah SWT. Akan tetapi sebaliknya, sesehat apa pun fisik seseorang jika hatinya jatuh sakit, usahkan bangun tengah malam untuk shalat tahajjud, untuk shalat subuh pun tak mampu dilakukannya. Kalau seseorang mengalami penyakit hati, untuk menghadiri wirid malam Jum’at sebagai wadah silaturrahim di seberang rumahnya pun ia tidak mampu pergi. Sebagaimana dua tulisan sebelumnya pada Mimbar Jum’at Waspada yang lalu, penyakit hati yang digambarkan Alquran dan hadis Rasulullah SAW adalah ‘tamak dan iri hati’. Namun penyakit hati yang tak kalah bahayanya dari kedua penyakit itu adalah ‘Sombong’. Kata sombong dalam kamus bahasa Indonesia diartikan sebagai ‘membanggakan diri secara berlebih-lebihan’. Persamaan kata nya adalah ‘angkuh’ yang diartikan sebagai ‘tinggi hati’, dan ‘congkak’ yang diartikan sebagai ‘ merasa diri besar dan mulia’. Dalam Alquran, kata ‘al kibr’ atau ‘takabbur’ yang diterjemahkan sebagai ‘sombong’ disebut sebanyak empat puluh kali. Kata ‘al kibr’ atau takabbur diambil dari akar kata ‘kabbara’ yang berarti ‘ agung, mulia, kebesaran’, yang kata-kata itu menunjukkan sifat dan af’alnya Allah SWT. Dari 40 ayat Alquran itu semuanya menjelaskan bahwa, sombong adalah penyakit hati yang diderita oleh orang-orang kafir Yahudi dan Nashrani serta orang-orang munafik. Mereka tidak mau menerima kebenaran ajaran yang disampaikan oleh para Rasul untuk menyembah Allah SWT. Demikian juga sekian banyak hadis shahih Rasulullah SAW yang menggambarkan tentang penyakit sombong yang diderita orang-orang munafik, sehingga Rasulullah SAW bersabda bahwa mereka tidak akan masuk surga walau kesombongan itu ada sebesar biji atom di dalam hatinya. Hadis Shahih yang diriwayatkan imam Muslim dari Ibnu Mas’ud ini adalah gambaran dari sikap orang-orang munafik yang merasa diri mereka paling benar dan tidak mau menerima kebenaran dan meremehkan orang lain. Sombong, sebagaimana didefinisikan Rasulullah SAW itu bila telah mewabah dan menjangkiti manusia, maka tidak akan ada lagi penghormatan dan sopan santun, kebenaran menjadi barang mainan. Lebih jauh, penyakit ini akan memunculkan kezaliman, kemarahan, terorisme, permusuhan dan pelanggaran hak-hak kemanusian. Ketahuilah bahwa tidak akan bersombong kecuali orang yang menganggap dirinya besar dan tidak akan menganggap dirinya besar kecuali orang yang meyakini memiliki sifat kesempurnaan. Padahal kemuliaan dan kesempurnaan itu hanya milik Allah SWT. Bencana kesombongan itu sangat besar, dan banyak orang binasa karenanya. Bahkan para ahli ibadah serta para ulama, ustadz pun jarang yang bisa terbebas dari penyakit ini. Bagaimana tidak dikatakan besar bencananya sedang Rasulullah SAW telah menginformasikan bahwa penyakit itu penghalang bagi

Bencana kesombongan itu sangat besar, dan banyak orang binasa karenanya. Bahkan para ahli ibadah serta para ulama, ustadz pun jarang yang bisa terbebas dari penyakit ini. seseorang untuk masuk kedalam surga. Perlu untuk kita cermati bersama bahwa penyakit sombong itu bersumber dari: Pertama; Nasab/keturunan (kasta). Orang yang punya nasab/keturunan yang tinggi menganggap hinaorang yang tidak memiliki nasab seperti dirinya , sekalipun orang yang diremehkannya itu lebih tinggi ilmu dan amalnya. Kadang sebagian mereka menyombongkan diri lalu menganggap orang lain sebagai pengikut dan budaknya, sehingga ia enggan bergaul dan duduk bersama mereka. Rasulullah bersabda “Hendaklah orang meninggalkan kebanggan terhadap nenek moyang mereka yang telah menjadi batu bara di neraka.” HR. Abu Daud. Kedua; Harta kekayaan. Hal ini biasanya terjadi dikalangan para raja, pemimpin, para konglomerat, pengusaha, tuan tanah, dan para pejabat negara serta keluarga mereka. Mereka membanggakan kedudukan dan hartanya sehingga merendahkan dan melecehkan orang lain. Orang-orang semacam ini bila tidak bertaubat akan berakhir seperti Qorun yang ditelan bumi karena kesombongan terhadap harta yang dimilikinya. Syukur-syukur jika harta itu diperoleh dari hasil keringat halal, tetapi bila harta kekayaan itu dipeoleh dari korupsi, menipu, mencuri, dan merampok, apa yang disombongkan ! Ketiga; Ilmu pengetahuan. Demikian cepatnya kesombongan menjangkiti para ulama, ustadz, kaum intelektual sehingga orang yang berilmu pengetahuan mudah merasa tinggi dengan ilmu pengetahuannya. Ia merasa paling mulia diantara manusia lainnya. Ia memandang dirinya lebih tinggi dan lebih mulia disisi Allah ketimbang yang lainnya, ia merasa ibadah nya paling benar dan paling baik. Orang lain semua masuk neraka kalu tidak mengikuti apa yang dilakukannya.. Tidak mau menerima pendapat orang lain, karena ia merasa ilmunya yang paling tinggi, dan paling benar. Hal demikian bisa terjadi karena ilmu yang didapat lebih berorientasi pada duniawi semata, tanpa dilandasi keikhlasan dan pensucian jiwa dalam menuntutnya. Sebab ilmu yang didapat dengan ikhlas karena Allah dan hati yang jujur akan melahirkan sikap tawadhu’ dan rasa takut kepada Allah SWT. Keempat; Amal ibadah. Orang-orang yang zuhud dan para ahli ibadah tidak terlepas pula dari nistanya kesombongan, kekecongkakan dan tindakan melecehkan orang lain. Dengan amal dan ibadahnya ia merasa yakin akan selamat, sementara orang lain akan binasa. Sabda Rasulullah SAW “Cukuplah seseorang dinilai telah berbuat kejahatan bila ia merendahkan saudaranya sesama muslim”. HR. Muslim. Kelima; Kedudukan/status sosial. Bentuk kesombongan yang seperti ini adalah sombong terhadap makhluk, yakni dengan meremehkan dan merendahkannya. Hal ini muncul karena ia bangga dengan kedudukan dirinya sebagai orang terhormat, sebagai seorang pejabat, berpangkat, wakil rakyat dipandang masyarakat. Ia menganggap dirinya lebih mulia dari orang lain karena kedudukannya itu. Kebanggaaan terhadap diri sendiri membawanya sombong terhadap orang lain, meremehkan dan menghina mereka, serta merendahkan mereka baik dengan perbuatan maupun perkataan, ‘saya ini pejabat, atau saya ini anggota DPR, atau sya ini walikota/ bupati. Bahkan ada yang mengatakan, saya ini ustad lho! Wallahu a’lam.


WASPADA Jumat 24 Mei 2013

Mimbar Jumat

C7

Mencintai Masjid, Wafat Di Masjid Berdoalah Dengan Sungguh-sungguh (4) Terkadang Allah SWT menahan pemberian kepada hamba-Nya jika ia memohon kepada-Nya, karena adanya suatu hikmah dan pengetahuan-Nya tentang yang terbaik bagi hamba-Nya, dan terkadang dia mengakhirkan apa yang diminta hamba-Nya untuk waktu yang telah ditentukan atau untuk memberinya dengan pemberian yang lebih banyak. Maha Suci Allah Tuhan Semesta Alam. Rasulullah SAW bersabda, “Tidaklah seorang muslim berdoa kepada Allah dengan suatu doa yang di dalamnya tidak mengandung dosa dan pemutusan silaturahmi, melainkan Allah akan memberikan kepadanya salah satu dari tiga kemungkinan; (yaitu) dikabulkan segera doanya itu, atau dia akan menyimpan baginya di akhirat kelak,atau dia akan menghindarkan darinya keburukan yang semisalnya.” Maka para sahabat pun berkata, “Kalau begitu kita memperbanyaknya.” Beliau bersabda, “Allah lebih banyak lagi (memberikan pahala).” (HR. Ahmad, al-Bukhari). Hendaknya kita membesarkan harapan kita kepada Allah ketika berdoa, karena sesungguhnya Allah memberi permintaan yang besar karena kedermawanan, karunia dan kebaikan. Allah SWT tidak merasa diberatkan dengan apa yang Dia berikan, maksudnya tidak ada sesuatu yang berat bagi-Nya walaupun terasa berat bagi makhluk. Karena orang yang meminta kepada makhluk, ia tidak memintanya kecuali sesuatu yang mudah baginya untuk dikabulkan. Lain halnya dengan Rabb Semesta Alam, sesungguhnya pemberian-Nya terwujud sesuai dengan firman-Nya. Sebagaimana dijelaskan dalam firman-Nya, “Sesungguhnya perintah-Nya apabila Dia menghendaki sesuatu hanyalah berkata kepadanya,”Jadilah!” maka jadilah ia.” (Qs. Yaasiin: 82). Justru itu, perbanyak ibadah, perbanyak usaha, perbanyak doa. Lakukan doa dengan mengangungkan Allah, bersalawat kepada Nabi Muhammad SAW, lalu sampaikan doa dengan jelas, ditutup dengan harapan dikabulkan oleh Sang Penguasa Jagat Raya. (Sumber: Fathul Majid karangan Syaikh Abdurrahman Hasan Alu Syaikh cetakan Pustaka Azzam.Dimuroja’ah oleh Ustadz Jamaludin, Lc)

Isra’ Mi’raj Rasulullah SAW Oleh Heri Firmansyah, MA Kepala KUA Kec. Sirandorung Kab. Tapanuli Tengah, Dosen STIT Hasiba Barus Alumni&Pengasuh PPMDH TPI Medan

S

ebuah perjalanan religius terPerjalanan yang teramat luar biasa karena besar yang dilakukan Rasulullah SAW adalah di saat pedalam perhitungan matematika saat itu, ristiwa isra’ mi’raj, yang diabadikan Allah SWT dalam Alquran surah altidak ada satu kendaraanpun yang akan Isra’ ayat 1 “Maha suci Allah, yang temampu menempuh perjalanan jauh dari lah memperjalankan hamba-Nya pada suatu malam dari Al Masjidil ujung barat (masjid al-haram) ke ujung timur Haram ke Al Masjidil Aqsha yang telah Kami berkahi sekelilingnya, agar (Masjid al-Aqsha) dan kemudian naik ke Kami perlihatkan kepadanya sebaatas langit dalam waktu satu malam. gian dari tanda-tanda (kebesaran) kami. Sesungguhnya Dia adalah Maha mendengar lagi Maha mengetahui. Ini adalah kekuasaan itu berada di tangan pamannya Abu Lahab, rihlah ilahiy atas kehendak Allah SWT untuk menghibur yang terkenal dengan penentangannya terhadap dakwah Rasulullah SAW bahwa kekuasaan dan kekuatan-Nya Rasulullah SAW, seperti yang terekam dan diabadikan di lebih utama dan Agung di bandingkan oleh siapapun. dalam Alquran surah al-Lahab. Ini menjadikan perIsra’ maknanya perjalanan malam dimulai dari Malindungan dari keluarganyapun terpecah dan melemah, kah, tepatnya Ka’bah menuju Baitul Makdis di Palestina, membuat keamanan dirinya terancam. dan mi’raj bermakna naik ke langit, dari Baitul Makdis Selanjutnya Khadijah adalah isteri sekaligus menapaki tangga-tangga langit ke Sidratul Muntaha pendukung utama beliau. Selama ini Khadijahlah yang untuk menjumpai Allah SWT. Rasululllah mengendarai selalu mendukung Rasulullah buraq, transportasi istimewa dari surga yang dibawa MaSAW, baik moril maupun materil laikat Jibril. Apa yang menjadi catatan yang pernah penulis dalam perjuangan dakwahnya. temukan adalah sebagian orang-orang yang tidak berKhodijah lah yang menetanggung jawab menggambarkan buraq seperti badan nangkan beliau disaat begitu seekor kuda bersayap dengan wajah tiga perempuan merasa khawatir dan ketacantik, lalu menyebarkannya ditengah-tengah masyakutan saat menerima wahyu rakat. Gambar-gambar tersebut jika ditemukan henpertama digua hira’. Jika Abu daknya dibuang dan dibakar karena merupakan Thalib melambangkan pelecehan dan penghinaan terhadap buraq itu kekuasan dan power polisendiri dan perjalanan religus Rasulullah SAW tik yang mendukung Rasudalam peristiwa Isra’ Mi’raj. lullah SAW, maka Khodijah Perjalanan ini dilakukan pada malam merupakan kekuatan mahari karena malam merupakan saat diteri dan relasi hubungan mana kekhusyuan dan kesakralan suatu perdagangan yang menduibadah dapat diraih. Karena ini kung Rasulullah SAW. Karena bukanlah perjalanan biasa, beliau berasal dari keluarga perjalanan sakral nan suci terpandang dan kaya, menyebabmenuju Allah SWT, maka makan orang-orang Quraisy segan lam adalah waktu yang sangat untuk mengganggu diri dan suatepat. Sebagaimana Allah SWT minya. Relasi hubungan dagang juga memerintahkan kita undari para bangsawan ini mempunyai tuk melaksanakan shalat mapengaruh besar di Kota Makah. Karelam guna mendekatkan diri na itulah, Kedua orang terdekat Rakepadanya. Dan pada sebasulullah tersebut, yang sangat berhagian malam hari bersempengaruh dalam mendukung perjuabahyang tahajudlah kamu ngan dakwah nabi di kota Makah. sebagai suatu ibadah tamNamun dengan meninggalnya bahan bagimu; Mudah-mudahan Tumereka, Rasulullah harus berjuang han-mu mengangkat kamu ke tempat yang Terpuji. [alsendiri dengan segelintir pengikutnya, yang Isra:79]. Juga dalam surah Al-Muzammil ayat 2-6 Allah mayoritas adalah kaum lemah dan bawahan. Alhasil, SWT berfirman tentang pentingnya ibadah malam hari: penderitaan dan siksaan yang dilakukan oleh pembesar “2.Bangunlah (untuk sembahyang) di malam hari, kecuali quraisy terhadap pengikutnya semakin menjadi-jadi, sedikit (daripadanya), 3.(yaitu) seperduanya atau bahkan mereka berencana untuk membunuhnya. kurangilah dari seperdua itu sedikit. 4.Atau lebih dari Dalam keadaan terjepit dan sedih itulah, saat Raseperdua itu. dan Bacalah Alquran itu dengan perlahansulullah SAW merasa berjuang sendiri, Allah SWT melahan. 5.Sesungguhnya kami akan menurunkan nunjukkan kekuasaan dan keagungan-Nya. Allah SWT kapadamu perkataan yang berat.6.Sesungguhnya bangun menunjukkan bahwa perlindungan, pertolongan dan di waktu malam adalah lebih tepat (untuk khusyuk) dan bantuan-Nyalah yang paling utama di bandingkan siapabacaan di waktu itu lebih berkesan”. pun. Perjalanan Isra’ dan Mi’raj merupakan hiburan sekaSebelum peristiwa ini terjadi, Rasulullah SAW mengligus peneguhan hati Rasulullah SAW untuk terus bera-lami kesedihan yang sangat mendalam. Karena kedua juang dan berdakwah menyerukan Asma Allah SWT dan penolong utama beliau, pamannya yang bernama Abu mengangungkan ketauhidanNya. Perjalanan yang Thalib dan isterinya Khadijah al-Kubro dalam waktu teramat luar biasa karena dalam perhitungan matematika yang berdekatan meninggal dunia. Sehingga tahun saat itu, tidak ada satu kendaraanpun yang akan mampu tersebut dikenal dengan tahun a’m al-Huzn, tahun duka menempuh perjalanan jauh dari ujung barat (Masjid Alcita. Selama ini beliau selalu mendapatkan perlinHaram) ke ujung timur (Masjid Al-Aqsha) dan kemudian dungan dari pa-mannya atas berbagai intimidasi dan naik ke atas langit dalam waktu satu malam. Penunjukan cemoohan yang dilakukan masyarakat quraisy terhadap ke-Maha Kuasaan Allah SWT inilah yang semakin dakwah yang dilakukannya. meneguhkan Rasulullah SAW untuk terus berjuang. Masyarakat jahiliyah tidak berani mengusiknya Dengan peristiwa ini setidaknya memberikan dokarena pengaruh dan wibawa Abu Thalib. Ini dapat dirongan kepada setiap Muslim untuk tetap teguh dan maklumi karena Abu Thalib merupakan pewaris tampuk ber-juang di jalan Allah SWT. Jika dia mampu untuk kepemimpinan Bani Hasyim terlebih khusus Bani Abdul berjuang dan berdakwah di tengah-tengah masyarakat Muthalib, kakek Rasulullah SAW. Bani Hasyim dan Bani untuk mengadakan perbaikan dan kemajuan, maka Abdul Muthalib adalah merupakan keluarga besar yang lakukanlah dengan hati yang tulus karena Allah SWT mendapatkan tempat terhormat dan terpandang dikamemiliki kekua-saan yang luas yang akan dapat langan suku quraisy karena mendapatkan hak istemewa memberikannya apapun dan menolongnya dalam sedalam mengurusi jama’ah yang ingin menziarahi ka’bah, tiap kesulitan. Bahkan bila perlu dengan mengorbankan atau selaku pemegang kunci ka’bah yang memang disuharta dan jiwa. Jika tidak, minimal kita berdakwah dan cikan oleh pendudukan kota Makah. Karena Rasulullah berjuang untuk mem-perbaiki keluarga dan famili kita SAW dibawah perlindungan Abu Thalib, maka sebagian agar tetap terus teguh berada jalan Allah SWT. Peristiwa besar keluarga Bani Hasyim dan Bani Abdul Muthalib siap Isra’ Mi’raj setidaknya merupakan momentum bagi sedia untuk melindungi dan menolongnya, ini membuat umat Islam untuk mene-guhkan hati menegakkan para pembesar-pembesar quraisy yang tidak setuju akan Amar Ma’ruf dan Nahi Munkar. Ini adalah misi mulia dakwah beliau ketar-ketir dan takut untuk mengusiknya. dan teragung warisan Rasulullah SAW yang harus tetap Namun setelah meninggalnya Abu Thalib, tampuk terus dilanjutkan dan diperjuangkan.

(Belajar Dari Ke’arifan Bapak Umar Jakfar Tanjungpura)

Oleh Azhari Akmal Tarigan Staf Pengajar Fakultas Syari’ah IAIN.SU Medan

H

ari itu Jum’at tanggal 17 Mei 2013, saya terkejut mendengar khabar wafatnya Pak Umar Jakfar, seorang sosok yang saya kagumi karena kesederhanaan dan keikhlasannya dalam membangun masjid dan jama’ah. Ia wafat di Mimbar masjid sewaktu sedang berkhutbah. Suaranya yang begitu berwibawa, mulai melemah. Tubuhnya yang semula tegak berdiri kokoh, tiba-tiba roboh. Kesigapan dua jama’ah yang notabene sahabatnya berhasil menampung tubuh yang tak bertenaga itu, sehingga tidak ambruk di lantai masjid. informasi yang saya terima, beliau wafat kala itu juga. Istrinya dengan berlinang air mata berkata, bapak menghembuskan nafasnya yang terakhir tidak di hadapan istri, anak dan cucu-cucunya. Ia kembali kepada Allah di masjid yang dicintainya dan jama’ah yang selalu bersamanya. Almarhum Bapak Umar Jakfar tidaklah sepopuler Ustaz Jefry AlBukhari kendatipun ia pernah berfoto dengan Ustaz gaul tersebut. Almarhum Tidak pula pernah menghiasai layar Televesi. Tidak juga tampil di majlis-majlis pengajian layaknya ustaz kebanyakan. Ia hanya seorang Khatib di Masjid Al-Munawwarah, Rantau Panjang Tanjung Pura. Namun dibalik ketidakpopulerannya itulah tersembul ajaran dan nilai yang sangat berharga. Ia sejatinya menjadi teladan kita tentang perlunya keikhlasan dan kesederhanaan dalam membangun agama. Bisa jadi apa yang dilakukannya kecil, namun efeknya akan menjadi besar. Insya Allah, Pak Umar akan jadi teladan dan apa yang dilakukannya akan diikuti oleh banyak orang. Saya mengenal Bapak Umar Jakfar dari anak beliau yang juga merupakan sahabat saya di Fakultas Syari’ah IAIN.SU. M. Ridwan namanya. Saat ini Ridwan merupakan Doktor Ekonomi Islam pertama di IAIN.SU lulusan UIN Jakarta. Beberapa kali Pak Umar ke Medan, menjenguk tiga orang anaknya yang sedang studi, Ridwan, Fauzi dan Ulfa, saya sempatkan untuk bertemu beliau. Kami banyak bercerita tentang banyak hal. Pak Umar merupakan pendengar yang baik. Dengan penuh perhatian ia mendengarkan kalimat demi kalimat yang keluar dari mulut lawan bicaranya. Seolah tak rela satu katapun luput dari pendengarannya. Almarhum memiliki kecerdasan mendengar. Lawan bicaranya

merasa mendapatkan perhatian dan penghargaan. Pada saat gilirannya berbicara, maka mudah kita menangkap apa yang sedang bergelayut dalam pikirannya. Ia sedang memikirkan masjidnya. Memikirkan masyarakatnya. Mencari kiat bagaimana agar masyarakatnya rajin berinfak. Mendorong masyarakat untuk rajin ke masjid. Bahkan tidak jarang ia memikirkan tentang umat ini secara keseluruhan. Belakangan saya mendapat cerita, Pak Umar sejak di sekolah dasar, termasuk anak yang cerdas. Bukan saja cerdas intelektual, tetapi juga cerdas secara emosional dan spiritual. Ia satu angkatan dengan Prof. Hatta Ketua MUI Medan dan Guru Besar IAIN.SU itu. Seniornya almarhum Drs. Ahmad KS, dosen IAIN.SU pernah menganjurkan kepadanya untuk terus studi sampai ke Medan. Karena dorongan itulah, Pak Umar juga bertekad merantau ke Medan untuk melanjutkan studinya. Hanya karena ia tak mau disebut tak setia dengan temantemannya yang tidak melanjutkan studi, akhirnya ia kembali ke kampung. Saya membayangkan, andai Pak Umar studi di Medan, saya percaya beliau akan menjadi seorang ilmuwan. Ulama intelektual dan intelektula ulama. Syarat untuk itu telah dimilikinya. Beliau suka membaca dan berdiskusi. Almarhum selalu dahaga akan ilmu pengetahuan. Berikanlah kepadanya buku, niscaya ia akan melumatnya. Pak Umar juga akhirnya kuliah kendati usianyaa telah senja. Ia menyelesaikan pendidikan diploma 2 nya, karena beliau seorang guru. Kendati ia tak mencapai gelar sarjana, namun anak tertuanya M.Ridwan berhasil menjadi Doktor. Putri bungsunya berhasil meraih gelar Magister Akuntansi dan Fauzi sedag menyelesaikan sarjananya di bidang komputer. Bagi saya Pak Umar telah mengajarkan sesuatu yang penting dalam hidup ini. Ketika menjadi panitia pembangunan masjid, Pak Umar dikenal dan diakui sosok yang sangat jujur. Tak sepeserpun duit pembangunan masjid masuk ke kantong pribadinya. Itulah kesaksian yang diberikan jama’ah ketika memberangkatkan janazahnya. Ia juga tak mengambil sesuatu yang bagi banyak orang merupakan hal yang wajar. Jika pak Umar pergi ke berbagai tempat untuk mencari dana, ia tak mengenal uang minyak apa lagi

Pelajaran berharga bagi kita semua adalah, Pak Umar mengajarkan keikhlasan dan kesederhanaan. Ia memulai dari hal kecil namun ia melakukannya dengan konsisiten. uang lelah. Lebih-lebih untuk makan dan minumnya diperjalanan. Sesuatu yang sesungguhnya wajar. Kita sering menyebutnya dengan biaya operasional. Ia pakai uang dari kantongnya sendiri. tidak mengusik sedikit uang sumbangan orang. Anaknya pernah mengatakan kepada ayahnya. Wajarnya jika dana kepanitian itu dipakai untuk biaya operasional sepanjang wajar, transfaran dan disepakati oleh semua panitia dan jama’ah. Mendengar penuturan anaknya, Pak Umar mengangguk. Seolah setuju. Ia juga tidak membantah. Sekretaris panitia yang bersamanya juga mengangguk tanda setuju. Namun dalam peraktiknya, Pak Umar tetap saja pada pendiriannya. Walau ia harus mengendarai sepeda motor ke Kuala Simpang untuk mencari kayu yang terbaik dan juga murah, tak juga dana panitia itu ia gunakan. “Kapan pembangunan masjid mau selesai, jika semua orang berpikir begitu.” Tegas Pak Umar pada satu kesempatan. Pak Umar ingin masjid itu harus dibangun bersama-sama. Semua orang terutama warga kampung harus berinfak. Syukur-syukur bisa berwakaf. Almarhum ingin menumbuhkan rasa memiliki terhadap masjid. Dari rasa memiliki inilah tumbuh kecintaan kepada rumah Allah. Dari sini diharapkan muncul pula keinginan untuk selalu memakmurkannya. Dalam kerangka itulah, Pak Umar sering dipandang aneh bagi sebagian orang. Namun ia kukuh melaksanakan apa yang dianggapnya baik. Ia pernah menggagas kotak infak tak obahnya seperti keranda janazah. Ia berharap, dengan melihat itu, orang akan tersadar akan kematian. Akhirnya setiap orang mempersiapkan bekalnya menuju akhirat. Ia juga pernah membuat kotak infak di pinggir jalan. Rupanya ada saja orang yang usil. Kotak infaq itu dicuri. Akhirnya ia putuskan untuk membuatnya permanen. Kotak infak itu di cor dan di atasnya di buat kubah masjid. Sangat

artistik. Kalau kita berjalan ke kampung Pak Umar, di kiri kanan jalan, kotak infaq permanen itu akan terlihat jelas. Perjuangannya membangun masjid Al-Munawwarah bersama teman-temannya adalah perjuangan yang tak kenal lelah. Berbagai cara mereka lakukan. Sampai-sampai ada non muslim yang simpatik dengan perjuangan pak Umar. Iapun terdorong untuk menyumbang masjid itu. Sebelumnya menerima sumbangan itu, terlebih dahulu mereka pastikan bisnisnya legal. Subhana Allah, akhirnya orang tersebut memeluk Islam. Bahkan beberapa minggu sebelum kembalinya almarhum kepada sang khalik, mereka bersama-sama melaksanakan Umrah ke Baitullah. Lebih dari itu, pelajaran berharga bagi kita semua adalah, Pak Umar mengajarkan keikhlasan dan kesederhanaan. Ia memulai dari hal kecil namun ia melakukannya dengan konsisiten. Di saat banyak orang yang memperkaya diri sendiri, Pak Umar tak tertarik untuk melakukan itu. Pak Umar hanya berharap Allah ridha dengannya. Kalau kita bersikap seperti Pak Umar, pastilah tak banyak uang negara dan uang ummat yang akan menguap. Efeknya, pembangunan akan selesai dengan cepat dan segera dinikmati hasilnya oleh rakyat. Pak Umar bersama sahabat-sahabatnya yang ikhlas telah membuktikan itu semua. Masjid Al-Munawwarah itu telah berdiri megah. Masjid itu telah dimanfaatkan untuk tempat ibadah dan kegiatan keagamaan lainnya. Pak Umar pergi setelah masjid itu selesai. Di Masjid itupula Pak Umar bersama jama’ah lainnya telah bersujud kepada Allah. SWT. Selamat jalan pejuang, selamat jalan Ustaz. Mudah-mudahan kami dapat mewarisi etos keikhlasan dan kesederhanaanmu. Moga Allah mengampuni kesalahan dan kekhilafanmu. Membalas amal kebaikanmu dengan balasan yang berlipat ganda. Amin.

Sihir Adalah Perbuatan Kafir Oleh Achyar Zein Dosen Fak. Tarbiyah IAIN Sumatera Utara

D

an mereka mengikuti apa yang dibaca oleh setansetan pada masa kerajaan Sulaiman (dan mereka mengatakan bahwa Sulaiman itu mengerjakan sihir), padahal Sulaiman tidak kafir (tidak mengerjakan sihir), hanya setan-setan itulah yang kafir (mengerjakan sihir)... Q.S. al-Baqarah ayat 102. Kata “kafir” sebagaimana disebutkan oleh al-Jurjani di dalam kitabnya al-Ta’rifat ialah menutup nikmat Tuhan, baik karena keingkaran maupun karena perbuatan. Defenisi ini menunjukkan bahwa adanya keingkaran terhadap kekuasaan Tuhan yang tidak terbatas. Salah satu nikmat yang diberikan Tuhan kepada makhlukmakhluk-Nya ialah mengabulkan permintaan. Dengan kata lain, setiap permintaan makhluk tetap saja diijabah oleh Tuhan meskipun waktu pengijabahannya berbeda-beda. Hal ini sesuai dengan kebutuhan makhluk karena Tuhan lebih tahu apa yang dibutuhkan oleh makhluk-Nya ketimbang makhluk itu sendiri. Waktu pengijabahan inilah yang tidak difahami oleh sebagian orang sehingga muncul sifat tidak sabar. Peluang ini langsung ditangkap oleh setan dengan cara menawarkan pengijabahan yang sifatnya spontanitas dengan melalui media sihir. Akibat dari ketidaksabaran ini maka sebagian manusia memilih jalan yang ditawarkan oleh setan sehingga peran Tuhan tertutup. Perbuatan sihir adalah perbuatan yang sifatnya menafikan kekuasaan Tuhan dan karenanya Alquran menuduh perbuatan ini sebagai perbuatan kafir. Tuduhan Alquran ini menunjukkan bahwa prinsip-prinsip tauhid sama sekali tidak lagi kelihatan dalam praktek sihir karena selain menantang kekuasaan Tuhan maka praktek sihir juga menyamakan kekuasaan Tuhan dengan kekuasaan makhluk. Penantangan dan penyamaan kekuasaan Tuhan dengan kekuasaan makhluk pada prinsipnya adalah sebagai bentuk kekafiran terhadap kekuasaan Tuhan. Nam-

paknya, hal ini menjadi syarat utama di dalam ilmu sihir karena jika masih meyakini adanya kekuasaan Tuhan maka ilmu sihir tidak akan pernah berhasil. Upaya ini harus dilakukan supaya setan mudah memasuk-kan ilmu sihirnya. Oleh karena itu, di dalam praktek ilmu sihir, seseorang akan dialihkan kepada keyakinan bahwa ada kekuatan lain selain kekuatan Tuhan. Pada umumnya, yang menyihir dan yang meminta ilmu sihir sudah mengetahui implikasi dari perbuatan sihir yaitu harus menafikan kekuasaan Tuhan. Untuk lebih meyakinkan upaya ini maka setan tidak segansegan membalikkan fakta dengan menuduh orang-orang yang baik sebagai orang-orang yang kafir. Sebaliknya, setan terus-menerus mempropagandakan dirinya yang kafir sebagai sosok yang baik sebagaimana diungkapkan pada ayat di atas. Sebagai contoh, setan menuduh Nabi Sulayman adalah kafir namun Alquran menyatakan bahwa yang kafir adalah setan. Alasan yang dikemukakan oleh Alquran bahwa Nabi Sulayman tidak kafir karena dia tidak mengerjakan sihir. Sebaliknya alasan yang dikemukakan oleh Alquran tentang kekafiran setan karena setan mengerjakan sihir. Kadang-kadang, setan dan pa-ra tukang sihir tidak segan-segan mengelabui pasien mereka dengan pura-pura membaca ayat-ayat Tuhan sebagai mukaddimah dari praktek sihir. Akan tetapi, pasca pembacaan ayat-ayat Tuhan ini mereka membaca mantra-mantra yang sama sekali sulit untuk dimengerti. Cara seperti inilah yang banyak membuat manusia cenderung meyakini ilmu sihir. Kemudian mereka tidak segansegan pula menunjuk sebuah ayat untuk dijadikan mantra dalam perbuatan sihir dengan cara melencengkan maknanya. Bagi orang-orang yang tidak faham tentang Alquran akan mudah sekali terpengaruh sehingga sampai kepada kesimpulan bahwa cara yang seperti itu tidak bertentangan dengan ajaran-ajaran agama. Berdasarkan

Perbuatan sihir adalah perbuatan yang sifatnya menafikan kekuasaan Tuhan dan karenanya Alquran menuduh perbuatan ini sebagai perbuatan kafir. pernyataan ayat di atas bahwa bacaan-bacaan (mantra) yang terdapat di dalam sihir adalah bacaan-bacaan setan. Bacaan-bacaan ini sengaja diajarkan oleh setan agar manusia lebih tertarik kepada bacaan-bacaan yang diajarkannya dari pada ayat-ayat Tuhan. Sesuai dengan sifat setan yang senantiasa kafir kepada Tuhan maka secara otomatis bacaan-bacaan yang diajarkannya kepada manusia adalah bacaan-bacaan yang dapat membuat manusia menjadi kafir. Dikatakan sebagai “kafir” karena pelakunya menempatkan posisi sihir di atas ayat-ayat Tuhan. Prinsip yang paling mendasar dari ayat-ayat Tuhan ialah mengajari manusia untuk melakukan perbuatan-perbuatan baik dan meninggalkan perbuatan-perbuatan jahat. Adapun sihir adalah mengajari manusia untuk melakukan perbuatan-perbuatan jahat dan meninggalkan perbuatan-perbuatan baik. Kekafiran pada perbuatan sihir dapat dilihat dari implikasi yang ditimbulkannya yaitu mencelakakan orang lain. Dapat dipastikan bahwa tujuan seseorang mendatangi tukang sihir adalah untuk mencelakakan orang lain. Berbeda halnya dengan ayat-ayat Tuhan yang selalu membawa kepada pencerahan dan kemaslahatan. Selain tujuan di atas (mencelakakan orang lain) masih terdapat juga tujuan lain dari sihir yang sama sekali tidak mencelakakan orang lain seperti pelaris dan sebagainya. Meskipun demikian, sihir yang seperti ini tetap juga dianggap kafir karena telah mengenyampingkan peran Tuhan di dalamnya. Kemudian bacaan-bacaan sihir sangat tertutup dan bahkan sulit untuk dimengerti karena sifatnya memuji-memuji setan. Berbeda halnya dengan ayat-ayat Tuhan

yang bersifat transparan sehingga sangat mudah untuk dimengerti. Selain itu, pesan-pesan yang disampaikan adalah berkenaan dengan kekuasaan Tuhan. Keyakinan akan keampuhan mantra-mantra setan pada prinsipnya menolak pada keampuhan ayat-ayat Tuhan. Paling tidak, jika ini ada pada keyakinan seseorang maka telah terjadi dualisme keyakinan yang pada satu sisi mengakui keampuhan mantra setan dan pada sisi lain mengakui keampuhan ayat-ayat Tuhan. Keyakinan yang seperti ini jelas akan ditolak oleh Tuhan karena banyak ayat-ayat-Nya yang mengecam orang-orang yang menyekutukan kekuatan-Nya. Tuhan tidak mau jika kekuasaan-Nya digandengkan dengan kekuasaan makhluk dan bahkan mengutuk orangorang yang menyamakannya. Adakalnya sifat dari perbuatan sihir tidak mengorbankan orang lain seperti menggunakan pelaris dan susuk. Meskipun demikian, perbuatan sihir yang seperti ini tetap saja dianggap kafir karena menafikan peran Tuhan dalam hal rezeki. Dalam tataran ini, pihak yang bersangkutan tidak lagi memohon kepada Tuhan akan tetapi sudah yakin dengan kekuatan pelaris dan susuk yang dimilikinya. Berdasarkan paparan di atas maka dapat disimpulkan bahwa segala bentuk dan jenis sihir adalah kafir karena menonjolkan kekuatan setan dan menafikan kekuatan Tuhan. Di saat tukang sihir melakukan aksinya maka pada saat yang bersamaan muncul sifat lupa terhadap kekuasaan Tuhan yang sudah menciptakan langit dan bumi beserta segala isinya. Padahal, apa yang dilakukan oleh tukang sihir sangat tidak berarti bila dibnaidng dengan apa yang sudah diciptakan oleh Tuhan.


Mimbar Jumat

C8

WASPADA Jumat 24 Mei 2013

Syria Gunakan Teknologi Canggih Dalam Pembuatan Pedang Teknik pembuatan pedang Damaskus ini begitu rahasia sehingga hanya beberapa keluarga pandai besi di Damaskus saja yang menguasainya. Ini juga yang menyebabkan teknik pembuatan baja Damaskus akhirnya punah. SYARIAT jihad pada zaman khilafah Islam telah mendorong tidak cuma semangat yang berkobar untuk berjuang dengan mengorbankan harta dan jiwa, tetapi juga menarik sains dan teknologi ke level yang jauh lebih maju. Salah satu yang mengesankan–dan hingga kini masih misteri–adalah teknik logam (metalurgi) yang amat tinggi, dibuktikan dengan dibuatnya Pedang Damaskus pada kisaran tahun 1100 sampai tahun 1750. Pedang ini terkenal dengan ketajamannya dan memiliki bahan yang kuat dan lentur. Pedang Damaskus terkenal sebagai pedang paling tajam di dunia dan ternyata lebih tajam dari Pedang Samurai. Pasukan Eropa sangat takut oleh pedang-pedang yang dimiliki pasukan Arab dan Persia ini. Pedang mereka dengan mudah menembus baju Zirah pasukan Crusader, bahkan mampu membelah tameng. Pedang Damaskus ini sendiri dikenal sebagai pedang yang digunakan oleh Salahuddin al Ayyubi, seorang Sultan Mesir-Syria sekaligus panglima perang yang dapat merebut kembali Jerussalem dari tangan bangsa Nasrani melalui perang Hattin. Salahuddin terkenal di dunia Islam maupun

Kristen karena kepemimpinan, kecakapan militer dan sifat ksatria serta pengampunnya saat melawan tentara Salib. Dan dia juga seorang ulama. Tahun 1192, Richard Berhati Singa (Richard The Lion Heart), Raja Inggris dalam Perang Salib III, bertemu dengan Salahuddin. Sir Walter Scott dalam novelnya The Talisman mengkisahkan bagaimana keduanya memamerkan senjata masingmasing. Richard mengeluarkan pedang lebar mengkilat buatan pandai besi terbaik Inggris. Salahuddin menghunus pedang melengkung buatan pandai besi Damaskus yang tidak mengkilat. Richard memapas sebuat kotak terbuat dari besi hingga putus dan Salahuddin al Ayyubi melepaskan kain sutra halus hingga terbang dan sutra tersebut terbelah ketika tersentuh tajamnya pedang, juga mampu membelah pedang lain atau batu tanpa mengalami kerusakan sama sekali. Rahasia Teknik pembuatan pedang Damaskus ini begitu rahasia sehingga hanya beberapa keluarga pandai besi di Damaskus saja yang menguasainya. Ini juga yang menyebabkan teknik pembuatan baja Damaskus akhirnya punah. Hingga kini teknologi metalurgi yang paling

canggih pun belum mampu membuat pedang yang lebih tajam dari Pedang Damaskus. Sebuah penelitian mikroskopik terhadap pedang-pedang Damaskus, menemukan bahwa pedang-pedang tersebut memiliki semacam lapisan kaca di permukaannya. Bisa dikatakan para ilmuwan Muslim di Timur Tengah telah menguasai teknologi nano sejak seribu tahun lalu. John Verhouven, seorang Profesor di bidang materi sain di Universitas Iowa, menemukan bahwa hanya tipe tertentu dari wadah khusus untuk melebur baja ditambah elemen lain seperti vanadium akan menghasilkan pola nano yang tepat. Pada tahun 2006, para peneliti di Universitas Teknologi Dresden, Jerman, mempelajari pedang prajurit Islam dengan mikroskop elektron dan menemukan bahwa kekuatan pedang mereka mungkin berasal dari nanotube karbon dan kawat nano yang dibuat dari mineral yang disebut sementit. Struktur serupa akan menghasilkan bahan komposit modern yang kuat. Namun, resep tepat untuk membuat pedang prajurit Islam itu masih menjadi misteri. Selain itu pedang atau pisau Dasmakus ini memiliki pattern

Dakwah ‘Gaul’

- Pedang-pedang Damaskus ini ditakuti para tentara Eropa dalam perang Salib. atau pola unik di permukaannya. Pola-pola unik ini menjadikan tampilan senjata menjadi lebih keren dan menarik. Dengan teknologi terkini, diketahui bahwa efek pola air yang dimiliki pedang Damaskus diperoleh dengan menempa baja yang mengandung proporsi jumlah karbon yang besar. Daerah gelap pada permukaan pedang akibat pola yang dibuat residu karbon, sedangkan pola terang dibentuk oleh partikel ikatan karbit besi.

Kandungan karbon yang tinggi memungkinkan diperolehnya pedang dengan ketahanan tinggi, namun kehadiran karbon di campuran bahan mentah sangat sulit atau hampir tidak mungkin dikendalikan. Terlalu sedikit karbon menyebabkan pedang menjadi lemah, namun terlalu banyak karbon menyebabkannya menjadi getas. Bila proses pembuatan pedang tidak berlangsung dengan baik, baja akan membentuk

besi sementit, fase besi yang sangat rentan. Namun, para ahli metalurgi Islam mampu mengendalikan kerentanan inheren dan menempa bahan mentah tersebut menjadi senjata. Suatu artikel jurnal di Nature menjelaskan mengapa baja karbon dapat dibuat dan mengapa saat ini menghilang. Ide tersebut didasari oleh ilmu pengetahuan material modern: Nanoteknologi, hal yang sulit terpikirkan hingga abad ke-17.

Bertawassul Ke Kuburan Nabi SAW ?

(Belajar Dari Metode Dakwah Uje)

Menanggapi Tulisan Sdr. Azhari Akmal Tarigan, Waspada, 10 Mei 2013

Oleh Budi Juliandi

Oleh dr Arifin S.Siregar

Mahasiswa S3 UIN Jakarta/Dosen STAIN Langsa

Dokter Spesialis Penyakit Kulit dan Kelamin Dan Pemerhati Agama

D

akwah adalah bagian dari kegiatan Nabi Saw bahwa dakwah sejatinya tidak hanya berbentuk kata-kata, yang dilanjutkan dari generasi kegenerasi Islam. tapi juga perbuatan nyata karena disitulah letak keDakwah yang dulu hanya sebagai kewajiban berhasilan dakwah Rasulullah Saw. Beliau mengatakan: untuk menyampaikan pesan-pesan agama, kini seiring “Dakwah is not only words spoken but also actions to inperubahan zaman, berubah menjadi satu profesi. vite a person to come closer to Allah SWT. This method was Terlepas dari itu, yang diharapkan dari kegiatan dakwah also done by Prophet Muhammad Saw in spreading Islam adalah pencerahan dan perubahan ummat ke arah yang at that time. The success of the Prophet in conducting lebih baik. Menjadi da’i yang dicintai jamaah tidaklah Dakwah activities was also due to his good ethical conmudah, walaupun dengan setumpuk gelar akademik, duct.” (Dakwah tidak hanya merupakan sejumlah kataataupun keluar-masuk dari satu pesantren ke pesantren kata yang diucapkan, namun juga merupakan tindakan lain. Tulisan ini akan mengetengahkan metode dan untuk mengajak seseorang agar lebih mendekat kepada kesuksesan dakwah Uje (Ustadz Jefri al-Bukhori) yang Allah SWT. Metode dakwah ini juga telah dilakukan oleh dikenal dengan dakwah gaulnya itu. Nabi Muhammad Saw dalam menyebarluaskan agama Sebuah Transformasi Positif Islam pada saat itu. Kesuksesan Nabi melakukan kegiatan Sempat nyantri di Pesantren Darul Qalam Tanggerang dakwah juga dikarenakan akhlak beliau yang baik). tidak cukup membuat Uje menjadi dai yang terkenal. Uje Satu hal yang mungkin tidak banyak dimiliki oleh tidak hanya merupakan da’i yang lahir dari rahim penceramah lainnya adalah kepedulian Uje terhadap pesantren, namun juga lahir dari sebuah madrasah yang anak muda. Uje punya kiat tersendiri untuk memberikan bernama pengalaman hidup sebagai seorang anak muda. solusi bagi anak-anak muda yang tengah dirundung maDia adalah ‘anak hilang’ yang kemudian dapat kembali. salah. Beliau mengayomi anak muda, enak diajak ngobrol, Kiprah dakwah Uje adalah sebuah transformasi dari dan paham bagaimana berhadapan dengan anak muda seorang santri menjadi seorang artis, dan akhirnya serta bagaimana caranya memberikan solusi kepada anak memilih dunia dakmuda. Beliau tak hanya wah sejak tahun 2000 berdakwah melalui kaUje adalah contoh nyata yang dengan memadukan ta-kata, tapi juga lewat bakat dakwah dari peperbuatan nyata. Uje dapat bangkit setelah terjatuh dan santren dan bakat actadalah contoh nyata ing dari dunia sinetron. yang dapat bangkit semelepaskan diri dari segala kenaModel baru yang meletelah terjatuh dan mejitkan namanya delepaskan diri dari segala kalan anak muda. Dia bukan pengngan julukan ustadz kenakalan anak muda. amat anak muda yang secara tibagaul. Sebuah julukan Dia bukan pengamat yang punya makna beanak muda yang secara tiba bermetamorfosa menjadi da’i. liau tidak hanya sebatiba-tiba bermetamorgai seorang da’i tapi juga fosa menjadi da’i. mampu membangun komunikasi yang baik dengan Kesuksesan Dakwah Uje jamaahnya dengan bahasa yang sangat khas anak muda. Kesuksesan terbesar seorang da’i adalah penghargaan Metode Dakwah Uje masyarakat dan jamaah setelah da’i tersebut berpulang Salah satu metode dakwah yang dilakukan Uje adalah ke rahmatullah. Inilah wujud kesuksesan Uje di akhir adalah bahwa ia menyampaikan dakwahnya dengan perjalanan hidupnya di dunia. Kehormatan tersendiri gaya bahasa khas anak muda. Walaupun sempat mendapat dishalatkan di Masjid terbesar se-Asia Tenggara itu. dapat kritik dari beberapa penyelenggara dakwah Wafat di hari yang baik dan disalatkan di masjid kebangmengenai bahasa gaul yang dipakai saat berceramah, gaan ummat Islam Indonesia dengan tumpahan jamaah namun Uje tetap pada pendiriannya untuk terus berdan air mata yang mengiringi jenazah sampai ke tempat dakwah dengan gaya bahasa anak muda ketika yang peristirahatannya yang terakhir. Ini membuktikan betapa dihadapinya adalah jamaah dari kalangan anak muda. sebenarnya beliau begitu dicintai oleh banyak orang, baik Dalam tabloid Bintang edisi April 2013 Uje berujar: “Ketika yang mengenal langsung maupun tidak. Banyak orang yang dihadapi adalah anak TK, maka jadilah Guru TK, terkenal di negara ini, tapi ketika meninggal dunia, tidak jangan jadi guru SMA, enggak akan nyambung!” ditangisi oleh banyak orang, tidak banyak orang yang Seorang da’i harus mampu menyampaikan dakwah melayat jenazahnya, menshalatkan dan mengantarkan dengan bahasa yang mudah dipahami oleh anak muda ke peristirahatannya yang terakhir. daripada menyampaikan pesan-pesan agama dengan Kini Uje sudah mengahadap Allah SWT diiring-iringi bahasa-bahasa majazi, penuh dengan istilah-istilah iloleh ribuan orang yang mendoakannya. Jangan-jangan kepergian kita tidak ditangisi, malah diharapkan dan miah yang susah mereka cerna. Pesan-pesan agama disyukuri oleh orang lain karena mereka muak melihat melalui dakwah yang sejatinya bisa dengan mudah tingkah laku kita, kemewahan yang kita pamerkan serta dicerna dan dipahami, namun jika disampaikan dengan jauhnya diri kita dari umat. bahasa yang susah dimengerti akan tidak bermanfaat atau malah dapat menimbulkan multi tafsir di kalangan Penutup jamaah. Dakwah yang disampaikan dengan bahasa Dia adalah sosok da’i muda yang berjiwa muda dan yang mudah dipahami oleh pendengarnya agar menmemberikan pencerahan kepada anak-anak muda dedapatkan pemahaman yang baik sejalan dengan firman ngan model dakwah yang ‘anak muda banget’ dengan tiAllah Swt: “Kami tidak mengutus seorang Rasul pun dak mendakwahi anak muda dengan materi melulu siksa melainkan bahwa ia berbicara dengan bahasa kaumnya neraka. Disinilah menurut penulis kekhasan Uje yang (bi lisani qawmih) agar ia memberi penjelasan dengan perlu ditiru oleh da’i-da’i muda yang sedang meniti jalan terang kepada mereka.” QS Ibrahim [14: 4]. dakwah. Indikasi lain kesuksesan beliau berkiprah sebagai da’i adalah bahwa beliau sangat dicintai oleh masyarakat, Dakwah Dengan Keteladanan terutama kalangan anak muda. Fa’tabiru ya uli al-abshar! Seperti yang dikatakan oleh Shamim A Siddiqi

Pembuatan baja telah dipelajari dengan seksama dan didokumentasikan serta diturunkan bagi para ahli pedang di dunia Islam, yang menjaga dengan baik rahasia ini. Pedang Damaskus sangat berharga karena menggabungkan antara kekuatan, elastisitas dan ketahananny. Beberapa ahli metalurgi modern mengaku berhasil membuat baja yg sangat mirip dengan baja Damaskus, namun tetap belum berhasil meniru 100%. Syafri/MUinc

T

awassul artinya: perantara. Wasilah artinya: jalan yang mendekatkan diri (lihat kitab: “Kamus Istilah Islam” oleh: Moh. E.Hasim, terbitan Perpustakaan Salman Institut Teknologi Bandung). Pada Harian Waspada tgl 10 Mei 2013 ada tulisan yang berjudul “Bertawassul Kepada Nabi Muhammad SAW” oleh sdr Azhari Akmal Tarigan, yang membenarkan bolehnya kita ber-do’a dengan cara bertawassul kepada Nabi SAW di kuburan Nabi SAW atau dimana saja. Alasan beliau dengan berargumentasi pada QS AnNisa’ 64 : “.... Sekiranya mereka setelah menzalimi dirinya datang kepadaMu (Muhammad), lalu memohon ampun kepada Allah dan Rasul pun memohonkan ampunan untuk mereka, niscaya mereka mendapati Allah maha penerima taubat dan maha penyayang”. Untuk ayat ini, sdr. Azhari Akmal Tarigan sependapat dengan pendapat Prof.Dr. Ali Jum’ah yang menegaskan bahwa ayat ini sifatnya mutlak, se-hingga mereka mengartikan/ menafsirkan bolehnya bertawassul pada Nabi SAW tidak hanya semasa beliau hidup, tapi juga setelah wafat. Untuk pendapat ini kita tanggapi: Memang benar ketika berdo’a mencari wasilah dengan bertawassul pada Nabi SAW adalah boleh tapi ketika beliau masih hidup. Itupun bunyi do’anya harus hati-hati, harus dengan kalimat tidak terjebak pada berdo’a menggunakan perantara dengan cara (kalimat) yang terlarang oleh hukum lain yang ada. Misalnya: (lihat penjelasan selanjutnya). Masaalah berdo’a adalah masalah gaib. Sejauh mana menafsirkan ayat An-Nisa’ 64 itu, kita dikawal dengan petunjuk Nabi SAW dan sahabat, bagaimana pengamalan mereka terhadap ayat An-Nisa’ 64 itu. Tawassul Dimasa Nabi SAW Dan Sahabat. Sungguh mengherankan, kalau sdr. Azhari Akmal Tarigan sependapat dengan penafsiran Prof.Dr. Ali Jum’ah yang menyatakan makna (tafsir) QS An-Nisa’ 64 itu sifatnya mutlak, berlaku untuk dipedomani ketika Nabi hidup dan setelah wafat. Untuk itu apakah ustad dan Profesor lupa, ada riwayat yang menunjukkan Nabi SAW dan sahabat didalam menafsir ayat itu, sebagai batasan pengerahan agar tidak ditafsir kebablasan. Hal ini diutarakan oleh Syeikh Muhammad bin shahih Al utsaimin dan Syeikh Muhammad Nasharuddin Al-Albani pada (kitab: “Shahih Tawassul”) dan oleh Sheikul Islam

Imam Ibnu Taimiyah pada (kitab: “Tawassul dan Wasilah”). Batasan itu adalah : Pertama: Apabila anak Adam mati, maka putuslah amalnya kecuali dari 3 hal yaitu : “Ilmu yang diajarkan”, “wakaf” dan “anak yang shaleh yang mendo’akannya”. Maka Nabi SAW telah wafat, berarti tidak dapat berbuat (mendo’akan/memohonkan pada Allah) sebelum hari akhirat. Kedua: Perbuatan sahabat un-tuk mewujudkanQS An-Nisa’ 64. Dimana ketika Nabi SAW masih hidup, ketika terjadi musim kemarau, maka ada sebuah riwayat. Yang diriwayatkan oleh Anas bin Malik, dia bercerita: pada masa Rasulullah pernah masa kekeringan melanda kita. Kemudian ketika Rasulullah berkhutbah pada hari Jum’at sa’at berdiri. Berdirilah seorang Arab Badui berkata kepada Rasulullah, “Semuanya telah hancur, kelaparan dan semua solusi sudah habis karena kekeringan ini maka berdoa’lah kepada Allah untuk kita”. Kemudian beliau (Rasulullah) mengangkat tangannya berdo’a, “Ya Allah berikan kami hujan, berikan kami hujan, berikan kami hujan”. Dan orang-orang juga mengangkat tangan mereka berdo’a (masing-masing). Dan akhirnya turunlah hu-jan. Tetapi setelah Nabi SAW wafat, coba kita simak bunyi riwayat ini, bagaimana cara sahabat bertawassul. “Diriwayatkan oleh Anas bin Malik: Umar bin Khattab bila terjadi musim kemarau, maka ia meminta kepada Abbas bin Abdul Muthalib agar berdo’a turun hujan.Maka Umar berkata,Ya Allah dahulu (ketika Nabi masih hidup) kami bertawassul melalui NabiMu, maka Engkau turunkan hujan. Dan sekarang kami bertawassul kepada Mu de-ngan paman Nabi Mu, maka turun-kanlah hujan. Maka merekapun diberi-Nya hujan. (H.R Bukhari). Kalaulah memang penafsiran ayat An-Nisa’ 64 itu bisa dilakukan untuk juga setelah Nabi SAW wafat, tentu Umar RA dan sahabat cukup bertawassul pada Nabi SAW saja, apakah itu datang ke kuburan Nabi SAW, tidak perlu bertawassul pada Ibnu Abbas RA. Dengan membolehkan bertawassul pada Nabi SAW setelah beliau wafat, berarti sdr Azhari Akmal Tarigan dan Prof.Dr. Ali Jum’ah menganggap Umar bin Khattab dan sahabat salah atau keliru menafsirkan QS An-Nisa 64 itu. Apakah lebih hebat atau lebih jeli Prof.Dr. Ali Jum’ah didalam mem-beri tafsiran makna ayat An-Nisa’ 64 itu ketimbang sahabat ? Karena setelah Nabi wafat, ketika mereka berdo’a

Mengajak umat mengamalkan yang tidak jelas Sunnahnya atau tidak ada Sunnahnya, bisa berisiko tinggi. Bila benar, dapat pahala, bila salah berdosa. minta hujan, mereka sahabat meminta kehadiran Ibnu Abbas RA (paman Nabi SAW) bersama-sama mereka untuk mereka bertawassul pada Ibnu Abbas (paman Nabi SAW) dan tidak lagi bertawassul pada Nabi SAW. Ini menunjukkan tidak bisa lagi bertawassul pada yang sudah wafat. Dan banyak lagi riwayat yang menceritakan sahabat tidak pernah bertawassul pada yang wafat, tapi bertawassul pada yang hidup. Berdo’a Harus Tanpa Perantara: Berdo’a kepada Allah harus langsung (tanpa perantara). Adalah Nabi SAW bersabda “Apabila engkau meminta, hendaklah engkau minta pada Allah, dan jika engkau hendak meminta pertolongan, mohonlah kepada Allah”. QS Al-Fatihah ayat 5: “Hanya ke-pada Engkau sajalah kami menyembah dan hanya kepada Engkaulah kami mohon pertolongan”. Bertawassul boleh pada Nabi atau orang yang masih hidup, juga hati-hati ada tata cranya. Contohnya: sebuah riwayat mencontohkan: seorang buta bertawassul kepada Nabi Muhammad SAW dimasa hidupnya, agar orang buta tersebut dido’akan Rasul supaya bisa melihat. Rasulpun mengabulkan permintaan orang buta itu, tetapi Nabi menyuruh sibuta untuk berwudhu’ dulu. Maka Nabi SAW dan sibuta masing-masing berdo’a pada Allah, lalu sibuta pun melihat. Seperti yang diisyaratkan oleh Ibnu Taimiyah juga harus berhatihati bunyi do’a kita, ketika bertawassul pada do’a Nabi SAW atau orang saleh yang masih hidup. Do’a yang boleh : “Ya Allah, Nabi ku telah bermohon pada-Mu untuk kesembuhan mataku, dan aku juga bermohon pada-Mu untuk kesembuhan mataku. Perkenankanlah ya Allah !!” Do’a yang salah (batil): “Ya Allah, dengan perantaraan do’a NabiMuhammad SAW Engkau sembuhkan mataku”. (Lihat kitab : “Shahih Tawassul” oleh Shakh Muhammad bin shahih Al-Utsaimin dan Syeikh Muhammad Nashiruddin Al-Albani dan Mahmud ID Al Abbasi dan Abu Raits Al Atsari,hal. 213, 214). Tawassul mengandung 2 hal Pertama: mengandung aqidah

(menyangkut keyakinan menyangkut masalah gaib). Bila salah meyakininya, jadi bisa terjebak syirik. Kedua: cara perbuatannya bila dibuat cara yang tidak disyariatkan, terjebak bid’ah, sesat. Tawassul yang dibolehkan hanya pada 3 hal : Pertama: bertawassul dengan sifat-sifat Allah SWT: misalnya: “rahman” “rahimnya” Allah SWT. Kedua: bertawassul pada amal shaleh: misalnya : “membantu orang miskin”, “menolong orang yang sangat perlu pertolongan”. Ketiga: bertawassul dengan orang yang saleh yang masih hidup. Satu hal yang sebaiknya direnungkan oleh ulama, pendakwah yaitu: mengajak umat mengamalkan yang tidak jelas Sunnahnya atau tidak ada Sunnahnya, bisa berisiko tinggi. Bila benar, dapat pahala, bila salah: berdosa (dosanya bid’ah karena menambah ibadah dan syirik: karena meyakini masalah gaib yang tidak ada petunjuk Nabi SAW). Ketahuilah, tanpa diamalkan tawassul pada Nabi SAW ketika ziarah di kuburan Nabi SAW, tidak ada risiko bid’ah atau syirik. Yang Sunnah adalah : Ziarah ke kuburan atau kuburan Nabi SAW, hanya untuk mengingatkan kita, dimana kita besok lusa akan mati. Hindari bertawassul di kuburan Nabi SAW ketika berziarah di Medinah seperti yang dianjurkan ustad Azhari Akmal Tarigan (Harian Waspada 10 Mei 2013 hal. c7 kolom 6). Kenapa? Jawabnya: Ingat peringatan Nabi SAW yang menyatakan: “Wahai Allah, janganlah Engkau jadikan kuburku menjadi berhala (tempat meminta) yang disembah-sembah selain Allah”. Yang sangat menjadikan Allah marah kepada kaum yang menjadikan kuburan Nabi-Nabinya menjadi mesjid (tempat berdo’a). Sehingga adalah akibat dibolehkannya bertawassul di kuburan Nabi SAW, maka terjadi jemaah yang begitu khusuknya, menangis tersedu-sedu disamping kuburan Nabi SAW memohon, dan hal seperti ini tidak terjadi ketika dia berdo’a di mesjid. Pada hal tegas Nabi mengajarkan: ziarah ke kuburan hanya untuk mengingatkan kita (besok lusa) akan mati (bukan untuk memohon pada yang ditanam didalam kuburan itu).


Waspada, Jumat 24 Mei 2013