Page 1

Shalat Jumat Di Mana? Lihat hal. C4 Dan C5

Masjid Raya Medan

WASPADA Demi Kebenaran Dan Keadilan

Harian Umum Nasional Terbit Sejak 11 Januari 1947. Pendiri: H. Mohd. Said (1905 - 1995), Hj. Ani Idrus (1918 - 1999)

JUMAT, Kliwon, 20 Juli 2012/30 Sya’ban 1433 H

No: 23931 Tahun Ke-66

Terbit 28 Halaman (A1-12, B1-8, C1-8)

Harga Eceran: Rp2.500,-

1 Ramadhan Besok Assad Out Dari Syria JAKARTA ( Waspada): Pemerintah melalui Kementerian Agama menetapkan 1 Ramadhan 1433 H/ 2012 M jatuh pada Sabtu (21/7) besok. Penetapan awal puasa bagi umat Islam di Indonesia berdasarkan hasil sidang Isbat untuk menentukan 1 Ramadhan

tahun 2012. Walaupun Ormas Muhammadiyah menetapkan 20 Juli 2012 sebagai awal puasa. Sidang Isbat yang dipimpin

Menteri Agama ( Menag ) H. Suryadharma Ali di kantor Kementerian Agama ,Jakarta, Kamis ( 19/7 ) malam, dihadiri wakil menteri Agama H. Nasaruddin Umar, duta besar negara sahabat, tokoh agama, para ulama, sejumlah tokoh organisasi kemasyarakat ( ormas ) dan pe-

jabat kantor Kementerian Agama RI. Dari hasil pemantauan sejumlah pakar hisab rukyat yang tergabung dalam Badan Hisab Rukyat (BHR) Kemenag di ber-bagai daerah, untuk melakukan rukyatul hilal atau pengamatan bulan baru di sejumlah titik yang tersebar di sejumlah wilayah tanah air. Seperti di Observatorium Hilal Lhok Nga, Aceh; Pekanbaru, Riau; Menara Timur Universitas Pendidikan Indonesia (UPI), Bandung; Observatorium Bosscha, Lembang, Bandung, Jawa Barat, Pos Observasi Bulan (POB) Bukit Belabelu, Bantul, Yogyakarta, Jawa Tengah (seperti di Semarang, Rembang, Jepara, Solo, Batang, Tegal, Kebumen, dan

Lanjut ke hal A2 kol. 1

DAMASKUS (AP): Presiden Syria Bashar Assad kabarnya telah keluar (out)dari negerinya dan kini berada di Latakia yang terletak di sebelah barat Syria. Informasi ini disampaikan oleh pihak oposisi Syria dan salah seorang diplomat Barat.

ipar Assad. Sementara itu dua orang lainnya diketahui merupakan figur militer kuat di pemerintahan Assad, demikian diberitakan media Kamis, (19/7). Spekulasi yang berkembang menyebutkan, Assad berada di Latakia demi mem-

berikan komando untuk merespon langsung insiden pengeboman itu. Namun, belum ada konfirmasi atas informasi ini. Tidak disebutkan juga kapan tepatnya Assad berangkat ke Latakia yang berbatasan dengan Turki itu. Barat memberikan res-

pon positif atas insiden pengeboman yang menewaskan tiga figur penting bagi rezim Syria tersebut. Juru bicara Gedung Putih Jay Carner bahkan meyakinkan, pasca pengeboman ini, Assad mulai kehilangan kendali atas kekuasaannya. (m10)

Presiden Assad sendiri dilaporkan tidak pernah membuat penampilan publik sejak insiden pengeboman yang menewaskan tiga pejabat penting di pemerintahannya. Bahkan salah seorang pejabat tinggi Syria yang tewas dalam insiden pengeboman itu adalah saudara

Tayangan Lawakan Dan Gosip Tidak Sesuai Semangat Puasa Waspada/Surya Efendi

PLT Gubsu H Gatot Pujo Nugroho bersama petugas BMKG meneropong posisi hilal (bulan) untuk menentukan 1 Ramadhan 1433 H di anjungan lantai 9 kantor Gubsu di Medan, Kamis (19/7). Tim Bidang Hisab Rukyat Sumut tidak dapat melihat hilal karena tertutup awan.

Marhaban Ya Ramadhan Prof. Dr. Syahrin Harahap, MA Guru Besar IAIN Sumut ADALAH sangat menarik bahwa Rasulullah Saw, langsung menyampaikan bahwa ‘Siapa saja yang bergembira menyambut kedatangan bulan Ramadhan akan diampuni segala dosa-dosanya’. Bagi seorang muslim sudah barang tentu meyakini bahwa apa pun yang diucapkan Rasulullah adalah referensi utama dan diyakini tidak pernah mengandung kebohongan dan kepalsuan. Karena beliau bukan tipe pemimpin yang pernah berkamuflase dan menyampaikan janji-janji kosong. Namun sabda Rasulullah tersebut menyisakan tanda tanya; apa sebenarnya makna dan hikmah yang terkandung dibalik kewajiban ibadah ini? Dan apa pula yang perlu dilakukan untuk mendapatkan hikmah dan kemanfaatan yang terkandung di dalamnya.

Lanjut ke hal A2 kol. 2

Asmara Subuh Dan Petasan Dilarang MEDAN (Waspada): Aktivitas anak muda yang biasa disebut asmara subuh dan dilakukan usai sahur selama Ramadhan ternyata telah menjadi perhatian serius bagi Forum Koordinasi Pimpinan Daerah (FKPD) Sumatera Utara (Sumut). Mengingat kebiasaan yang dilakukan di beberapa titik Kota Medan itu sering menimbulkan keresahan bagi masyarakat. Plt Gubernur Sumut H Gatot Pujo Nugroho saat membacakan 20 poin kesimpulan Lanjut ke hal A2 kol. 3

MEDAN (Waspada): Imbauan Menteri Agama Suryadharma Ali kepada pimpinan televisi untuk tidak menyiarkan tayangan gosip dan lawakan selama Ramadhan cukup beralasan. Selain kedua acara itu tidak sesuai dengan semangat puasa, secara psikologis gosip punya dampak negatif. Mereka yang suka gosip menjadi senang mencampuri kehidupan orang lain. “Mereka yang suka bergosip umumnya memiliki harga diri yang rendah sehingga mereka merasa senang ketika ada orang lain yang melakukan sesuatu yang dinilainya dapat meningkatkan harga dirinya,” kata Direktur Biro Persona Psikolog Dra. Irna Minauli, M.Si kepada Waspada, Kamis (19/7), menanggapi imbauan Menag terkait acara lawakan dan gosip selama Ramadhan. Tayangan gosip seperti ini banyak disukai oleh kaum hawa atau ibu rumah tangga. Mereka merasa perlu meng-update

Hikmah Puasa Oleh Tgk. H. Ameer Hamzah Shumu tashihhu (berpuasalah kamu supaya sehat)

Waspada/ist

WAKIL Ketua DPRD Sumut, Kamaluddin Harahap menyerahkan berkas pendaftaran kepada Tim Pilkada PAN Sumut, Suhandi dan Hendra Cipta. Kamaluddin didampingi istrinya Hj Ernawati M.Ag, Ketua PW Pemuda Muhammadiyah Sumut Ihsan Rambe, Sekum DPD IMM Sumut Jahiddin Daulay, Presiden AMBe Muhamamdiyah Adami, di Rumah PAN Jalan Krakatau Medan, Kamis (19/7).

Kamaluddin Harahap Mendaftar Ke PAN Medan dan sekitarnya Subuh: 05:02

“Hai orang-orang yang beriman, diwajibkan atas kamu berpuasa sebagaimana diwajibkan atas orang-orang sebelum kamu agar kamu bertaqwa.” (al-Baqarah ayat 183)

7 Daerah Rawan Gizi Buruk MEDAN (Waspada): Dinas Kesehatan Sumatera Utara menetapkan 7 kabupaten/kota di wilayah Sumut rawan gizi buruk. Adapun 7 kab/kota itu yakni Humbahas, Madina, Nias Utara, Nias Selatan, Tapanuli Utara, Tapanuli Selatan dan Tapanuli Tengah. Kepala Bidang Pelayanan Kesehatan (Yankes) Dinkes Sumut, dr Kustina melalui staf Yankes Rini Suhartini SKM MA mengatakan, selama tahun 2011, sedikitnya ada 71 anak mengalami gizi buruk dari 7 kabupaten/kota tersebut. Lanjut ke hal A2 kol. 5

835 Peserta UMPN Polmed Gelombang II Lulus MEDAN (Waspada): Lebih kurang 835 orang dari 6.681 peserta mengikuti Ujian Masuk Politeknik Negeri Medan (UMPN) Gelombang II di Kampus Politeknik Negeri Medan (Polmed) Jl. Almamater Kampus USU Medan, dinyatakan lulus. “Bagi peserta dinyatakan lulus, Senin (22/7), kembali hadir untuk mendaftar ulang ke Kesdam Jl. Gaperta,” kata Pembantu Direktur I Polmed, Ir Abul Basir MT, Kamis (19/7) kepada Waspada melalui telefon selular, Basir mengatakan, saat mendaftar ulang peserta minamal harus membawa ijazah dan kartu ujian. Setelah mendaftar ulang peserta/calon mahasiswa akan mengikuti tes kesehatan. “Pengumuman hasil ujian UMPN gelombang II bisa dilihat di papan informasi kampus Polmed dan media cetak Lanjut ke hal A2 kol. 5

Hasil Seleksi UMPN baca di halaman A4.

Ada-ada Saja

SUNGGAL, DELISERDANG (Waspada) : Masyarakat Kecamatan Sunggal Kab. Deliserdang menyatakan dukungan sepenuhnya sekaligus mendoakan Drs H Amri Tambunan (foto) yang telah mendaftarkan diri menjadi salah satu kandidat Cagubsu untuk memimpin Sumut lima tahun ke depan.

Lanjut ke hal A2 kol. 6

40 Jam Main ‘Video Game’

Waspada/Armin Nasution

GUS Irawan Pasaribu (kiri tengah) bersama isteri, anak dan keluarga besarnya berbaur dengan anak yatim di Gus Center kemarin.

Sambut Ramadhan, Gus Muliakan Anak Yatim

MEDAN (Waspada): Wakil Ketua DPRD Sumut, Ir H Kamaluddin Harahap M.Si, Kamis (19/7), resmi mendaftarkan diri sebagai Cagubsu ke Partai Amanat Nasional (PAN) Sumut, di Rumah PAN Jl. Krakatau Medan.

MEDAN (Waspada): Menyambut Ramadhan yang segera tiba, calon Gubernur Sumatera Utara Gus Irawan Pasaribu bersama Yayasan Murni Gus Irawan Foundation mengundang anak yatim ke Gus Center di Jl. Pattimura dan berbagi dengan mereka, kemarin. Di kesempatan tersebut terlihat Gus Irawan Pasaribu dan isterinya Ny. Murni Gus Irawan menyerahkan santunan bagi ratusan anak yatim se-Kota Medan, Sabtu. Kegiatan yang disebutnya memuliakan anak yatim ini juga sekaligus memaknai syukur atas peresmian Gus Center

Lanjut ke hal A2 kol. 3

Lanjut ke hal A2 kol. 6

Optimis Diusung PAN Jadi Cagubsu Imsak: 04:52

Lanjut ke hal A2 kol. 1

AP

GAMBAR video amatir yang dirilis Ugarit News, Rabu (18/7), merekam Tentara Pembebasan Syria saat bentrok dengan pasukan pemerintah di Damaskus, Syria.

Amri Tambunan Tidak Perlu Kampanye

Al Bayan

PARA ahli hadits menyebutkan; sehat yang dimasudkan dalam hadits tersebut ada dua macam, yakni sehat jasmani dan sehat rohani dari berbagai penyakit lahir dan batin. Sehat jasmani bermakna tidak sakit-sakitan, segar dan bergairah dalam bekerja sehingga menimbulkan vitalitas beribadah. Malam seperti abid (ahli ibadah), siang hari seperti singa (bekerja keras). Sedangkan sehat jiwa tidak hilang akal (gila), berpikir positif, mendalami ilmu dan menjalin hablum minallaah (hubungan dengan Allah) dan hablum minannaas (hubungan sesama manusia). Manusia seperti itulah yang dijanjikan muttaqin oleh Allah SWT. Lanjut ke hal A2 kol. 2

(memperbarui-red) dirinya. “Tapi sayang sekali yang di update adalah kehidupan para artis dan selebritis yang seringkali tidak ada nilai edukatifnya. Seharusnya kita meng-update pengetahuan umum, politik, ekonomi, sosial dan yang lainlainnya yang lebih bermanfaat,” terangnya. Menurutnya, acara gosip dan lawak seringkali menjadi ajang bagi para procrastinator, yaitu orang yang suka menundanunda waktu untuk mengerjakan tugas utama lainnya. “Dalam kadar tertentu lawakan dan hiburan lainnya memang diperlukan, namun jangan seperti melebihi sehingga akhirnya menghabiskan sebagai waktu kita yang sangat berharga,” imbuhnya. Dijelaskannya, ketika orang menjadi procrastinator, maka cenderung menghabiskan waktu untuk entertaint atau

HOBI bermain video games sering membuat orang terlena dan lupa waktu. Hobi ini pula yang menyebabkan seorang remaja 18 tahun di Tainan, Taiwan Selatan, tewas setelah main video games selama 40 jam tanpa berhenti. Kantor berita AAP melaporkan, Chuang menyewa ruang pribadi untuk bermain game di kafe Internet (semacam warnet) di kota Tainan, Taiwan bagian selatan.

Lanjut ke hal A2 kol. 1

Serampang - Selama puasa jangan banyak kali becakap - He...he...he...


Siapa Khatib Shalat Jumat Anda ? Lihat Hal. C4-C5 JUMAT, Kliwon, 20 Juli 2012/30 Sya’ban 1433 H

WASPADA Demi Kebenaran Dan Keadilan

http://epaper.waspadamedan.com

z zNo: 23930 * Tahun Ke-66

Terbit 28 Halaman (A1-12, B1-8, C1-8) z zHarga Eceran: Rp 2.500,-

1 RAMADHAN BESOK MEDAN (Waspada): Pemerintah menetapkan 1 Ramadhan 1433 Hijriah jatuh pada hari Sabtu (21/7) besok. “Dari laporan pemantauan dilakukan di beberapa titik di Indonesia, hilal belum terlihat kemarin, sehingga 1 Ramadhan 1433 H jatuh pada Sabtu (21/7),” kata Menteri Agama RI Suryadharma Ali dalam sidang isbat di Gedung Kementerian Agama, Jakarta, Kamis (19/7) malam. Penetapan itu dibacakan setelah pembacaan laporan pengamatan hilal oleh Direktur Urusan Agama Islam dan Pembinaan Syariah, Direktorat Jenderal Bimbingan Masyarakat (Binmas), Kementerian Agama, Ahmad Jauhari. Lapo-

Parpol Peserta Pemilu 2014 Ditetapkan Desember 2012 JAKARTA (Antara): Komisi Pemilihan Umum, Kamis (19/ 7) menyatakan akan menetapkan parpol peserta Pemilu 2014 pada 11 - 15 Desember 2012. Sebelumnya, pada 9 Agustus - 7 September tahun yang sama, KPU membuka pendaftaran parpol-parpol peserta Pemilu 2014. Setelah itu KPU akan

ran rukyat yang masuk ke pusat sebanyak 38 lokasi. Semuanya menyatakan tidak melihat hilal, ujar Jauhari. Titik lokasi pemantauan antara lain Papua, Papua Barat, Lanjut ke hal A2 kol 1

5 anak. Sedangkan bulan Julinya, Madina 8 anak, Tapanuli Utara 2 anak, Tapanuli Selatan 5 anak, dan Tapanuli Tengah 5 anak,” ungkap Rini, Kamis (19/7). Keseluruhan laporan 71 kasus ini, sambungnya, merupakan laporan kasus yang diberikan dana pendampingan dari APBD provinsi. “Masingmasing pasien diberikan uang pendamping sebesar Rp 365 ribu dan uang ini diberikan kepada orangtua penderita,” jelasnya. Sedangkan penanganan bagi penderita gizi buruk, sudah dilakukan tindakan sesuai standart operasional prosedur (SOP). “Diberikan konsumsi susu kepada penderita untuk Lanjut ke hal A2 kol 1

Marhaban YÂ Ramadhan Oleh: Prof. Dr. Syahrin Harahap, MA Guru Besar IAIN Sumut

ADALAH sangat menarik bahwa Rasulullah Saw., langsung menyampaikan bahwa ‘Siapa saja yang bergembira menyambut kedatangan bulan Ramadhan akan diampuni segala dosa-dosanya’. Bagi seorang muslim sudah barang tentu meyakini bahwa apa pun yang diucapkan Rasulullah adalah referensi utama dan diyakini tidak pernah mengandung kebohongan dan kepalsuan. Karena beliau bukan tipe pemimpin yang pernah berkamuflase dan menyampaikan janji-janji kosong. Namun sabda Rasulullah tersebut menyisakan tanda Lanjut ke hal A2 kol 6

Al Bayan

Hikmah Puasa

Lanjut ke hal A2 kol 1

SBY: Menteri Sibuk Berpolitik Silakan Mundur

7 Daerah Di Sumut Rawan Gizi Buruk

MEDAN (Waspada): Dinas Kesehatan Sumatera Utara menetapkan 7 kabupaten/ kota di wilayah Sumut rawan gizi buruk. Adapun 7 kab/kota itu yakni Humbahas, Madina, Nias Utara, Nias Selatan, Tapanuli Utara, Tapanuli Selatan dan Tapanuli Tengah. Kepala Bidang Pelayanan Kesehatan (Yankes) Dinkes Sumut, dr Kustina melalui staf Yankes Rini Suhartini SKM MA mengatakan, selama tahun 2011, sedikitnya ada 71 anak mengalami gizi buruk dari 7 kabupaten/kota tersebut. “Sepanjang bulan April April 2011, Humbahas merawat sebanyak 8 anak, Madina 7 anak, Nias Utara 6 anak, Nias Selatan 10 anak, Tapanuli Utara 5 anak, Tapanuli Selatan 10 anak dan Tapanuli Tengah

memverifikasi parpol-parpol ini melalui dua tahap, yaitu verifikasi administratif pada 11 Agustus - 14 September 2012 dan verifikasi faktual pada 4 - 10 Oktober 2012. Sebelum sampai ke tahap itu, Kamis ini, KPU menggelar acara penyuluhan peraturan tentang pendaftaran, verifikasi

Waspada/Surya Efendi

HILAL TIDAK TERLIHAT: Petugas BMKG meneropong posisi hilal (bulan) untuk menentukan 1 Ramadhan 1433 H di anjungan lantai 9 kantor Gubsu di Medan, Kamis (19/7). Tim Bidang Hisab Rukyat Sumut tidak dapat melihat hilal karena tertutup awan.

JAKARTA (Antara): Presiden Susilo Bambang Yudhoyono mengimbau seluruh anggota Kabinet Indonesia Bersatu II untuk memprioritaskan tugas negara dari pada tugastugas politik dari partai politik (parpol) masing-masing. “Saudara yang juga tentu berasal dari partai politik akan menjalankan tugas politik, tetapi sekali lagi saya ingatkan

GUS Irawan Pasaribu (kiri tengah) bersama isteri,anak dan keluarga besarnya berbaur dengan anak yatim di Gus Center kemarin.

Plt Gubernur Sumut H Gatot Pujo Nugroho saat membacakan 20 poin kesimpulan pertemuan FKPD menjelang Ramadhan menyebutkan, salah satu yang menjadi perhatian mereka adalah kegiatan asmara subuh. Mereka menilai kegiatan tersebut sudah meresahkan dan mengganggu masyarakat serta rawan Lanjut ke hal A2 kol 3

Lanjut ke hal A2 kol 3

Lanjut ke hal A2 kol 2

Selama Ramadhan, Asmara Subuh Dan Petasan Dilarang MEDAN (Waspada): Aktivitas anak muda yang biasa disebut asmara subuh dan dilakukan usai sahur selama Ramadhan ternyata telah menjadi perhatian serius bagi Forum Koordinasi Pimpinan Daerah (FKPD) Sumatera Utara (Sumut). Mengingat kebiasaan yang dilakukan di beberapa titik Kota Medan, itu sering menimbulkan keresahan bagi masyarakat.

40 Jam Main ‘Video Game’

insiden pengeboman itu adalah saudara ipar Assad. Sementara itu dua orang lainnya diketahui merupakan figur militer kuat di pemerintahan Assad, demikian diberitakan media Kamis, (19/7). Spekulasi yang berkembang menyebutkan, Assad berada di Latakia demi memberikan komando untuk merespon langsung insiden pengeboman itu. Namun, belum ada konfirmasi atas informasi ini. Tidak disebutkan juga kapan tepatnya Assad berangkat ke Latakia yang berbatasan dengan Turki itu. Barat memberikan respon positif atas insiden pengeboman yang menewaskan tiga figur penting bagi rezim Syria tersebut. Juru bicara Gedung Putih Jay Carner bahkan meyakinkan, pasca pengeboman ini, Assad mulai kehilangan

Presiden Assad sendiri dilaporkan tidak pernah membuat penampilan publik sejak insiden pengeboman yang menewaskan tiga pejabat penting di pemerintahannya. Bahkan salah seorang pejabat tinggi Suriah yang tewas dalam

Kamaluddin Harahap Daftar Ke PAN Optimis Akan Diusung PAN Jadi Cagubsu

Oleh: H. Ameer Hamzah Shumu tashihhu (berpuasalah kamu supaya sehat) PARA ahli hadits menyebutkan; sehat yang dimasudkan dalam hadits tersebut ada dua macam, yakni sehat jasmani dan sehat rohani dari berbagai penyakit lahir dan batin. Sehat jasmani bermakna tidak sakitsakitan, segar dan bergairah dalam bekerja sehingga menimbulkan vitalitas beribadah. Malam seperti abid (ahli ibadah), siang hari seperti singa (bekerja keras).

Lanjut ke hal A2 kol 2 Waspada/Ist

WAKIL Ketua DPRD Sumut, Kamaluddin Harahap menyerahkan berkas pendaftaran kepada Tim Pilkada PAN Sumut, Suhandi dan Hendra Cipta. Kamaluddin didampingi istrinya Hj Ernawati M.Ag, Ketua PW Pemuda Muhammadiyah Sumut Ihsan Rambe, Sekum DPD IMM Sumut Jahiddin Daulay, Presiden AMBe Muhamamdiyah Adami, di Rumah PAN Jalan Krakatau Medan, Kamis (19/7).

Lanjut ke hal A2 kol 1

Ada-ada Saja

Assad Sudah Keluar Syria DAMASKUS (AP): Presiden Syria Bashar Assad kabarnya telah keluar dari negerinya dan kini berada di Latakia yang terletak di sebelah barat Syria. Informasi ini disampaikan oleh pihak oposisi Syria dan salah seorang diplomat Barat.

jangan tinggalkan tugas utama kita, sumpah kita untuk memprioritaskan tugas pemerintahan, memprioritaskan tugas melayani rakyat,” katanya saat memimpin sidang kabinet di Kantor Presiden Jakarta, Kamis (19/7). Presiden menilai situasi politik yang memanas pada

Waspada/Armin Nasution

Sambut Ramadhan, Gus Muliakan Anak Yatim MEDAN (Waspada): Menyambut Ramadhan yang segera tiba, calon Gubernur Sumatera Utara Gus Irawan Pasaribu bersama Yayasan Murni Gus Irawan Foundation mengundang anak yatim ke Gus Center di Jl. Pattimura dan

HOBI bermain video games sering membuat orang terlena dan lupa waktu. Hobi ini pula yang menyebabkan seorang remaja 18 tahun di Tainan, Taiwan Selatan, tewas setelah main video games selama 40 jam tanpa berhenti. Kantor berita AAP melaporkan, Chuang menyewa ruang pribadi untuk bermain game di kafe Internet (semacam warnet) di kota Tainan, Taiwan bagian selatan. Lanjut ke hal A2 kol 5

berbagi dengan mereka, kemarin. Di kesempatan tersebut terlihat Gus Irawan Pasaribu dan isterinya Ny. Murni Gus Irawan menyerahkan

Tak Perlu Kampanye Masyarakat Siap Dukung H. Amri Tambunan

MEDAN ( Waspada): Wakil Ketua DPRD Sumut, Ir H Kamaluddin Harahap M.Si, Kamis (19/7), resmi mendaftarkan diri sebagai Cagubsu ke Partai Amanat Nasional (PAN) Sumut, di Rumah PAN Jalan Krakatau Medan. Saat mendaftarkan diri, Kamaluddin Harahap didampingi Ketua Pimpinan Pusat (PP) Pemuda Muhammadiyah, Anang Anas Azhar MA, Ketua PW Pemuda Muhammadiyah Sumut, Ihsan Rambe SE MSi, Sekretaris PD Pemuda Muhammadiyah Medan, Edi Saputra ST, Presiden A n a k Me l a y u B e r s a t u (AMBe) Muhammad

SUNGGAL, Deliserdang (Waspada): Masyarakat Kecamatan Sunggal Kab. Deliserdang menyatakan dukungan sepenuhnya sekaligus mendoakan Drs H Amri Tambunan (foto) yang telah mendaftarkan diri menjadi salah satu kandidat Cagubsu untuk memimpin Sumut lima tahun ke depan. Pernyataan sikap serta dukungan itu didasarkan selama memimpin Deliserdang Pak Amri telah banyak berbuat serta memberikan berbagai gagasan dan terobosan bagi kepentingan rakyat dan hasilnya telah dinikmati banyak warga baik melalui program GDSM (Gerakan Deli Serdang Membangun) bidang infrastruktur, konsep “Cerdas” bidang pendidikan,“Ceria” bidang kesehatan serta program kemanusiaan melalui gerakan “Baru Yakin”

Lanjut ke hal A2 kol 2

Lanjut ke hal A2 kol 5

“Hai orang-orang yang beriman, diwajibkan atas kamu berpuasa sebagaimana diwajibkan atas orang-orang sebelum kamu agar kamu bertaqwa”. (al-Baqarah ayat 183) Imsak: Subuh:

04:52 05:02

Serampang - Dilarang banyak cakap ... - He.... he....he....


Berita Utama

A2 7 Daerah ....

meningkatkan gizinya. Berapa lama diberikan susu, itu tergantung usia penderita,” tandasnya. Kata dia, 71 kasus ini merupakan laporan selama tahun 2011 yang dirawat di rumah sakit. “Yang dilaporkan ini berdasarkan dari dana untuk pendampingan saja. Diluar dari ini, ada. Mungkin tidak dilaporkan,” katanya. Sementara itu, menurut staf Dinkes Sumut Haris Rambe MA,PHD mengatakan untuk pendekatan kasus gizi buruk mestinya dilakukan secara multi sektor, tidak singel sektor. “Yang penting mencegah gizi buruk dengan sistem ketahanan pangan atau food security,” ujarnya. (h02)

1 Ramadhan ....

Maluku, Maluku Utara, Gorontalo, Sultengara, Sulut, Sultengah, NTT, Bali, NTB, Sulsel, Mamuju, Kaltengah, Kaltim, Kalbar, Kaltim, Kalsel, Jatim, DIY, Jateng, hingga Aceh. Sejumlah tokoh Islam telah hadir di antaranya Ketua Komisi VIII DPR, Ida Fauziah, Perwakilan dari BMKG, perwakilan ormas Islam seperti Persis, HTI dan sebagainya, PBNU, dan lembaga Islam seperti MUI, Dewan Masjid Indonesia, Badan Hisab Rukyat, dan ICMI. Tidak ada perbedaan pendapat dalam sidang isbat yang digelar malam itu dengan melibatkan sejumlah ormas Islam. Menteri Agama pada Ka-

SBY: Menteri Sibuk....

tahun politik —yang disebutnya akan mulai setelah Agustus mendatang— adalah hal yang wajar sebagai bagian dari demokrasi, terutama menjelang pemilihan umum 2014. Namun, ia menegaskan, para pejabat negara yang memegang amanah rakyat dan bangsa harus tetap kompak dalam menjalankan tugas. “Mari bersama-sama dan seperti dulu tahun 2008 bagi saudara yang memang tidak bisa membagi waktu dan harus menyukseskan tugas politik, parpol manapun, saya persilakan baik-baik untuk mengundurkan diri,” katanya. Presiden berjanji tidak akan menghalang-halangi menteri atau pejabat negara yang terus terang mengaku tidak dapat membagi perhatiannya antara tugas di pemerintahan dan partai politik. “Kalau itu memang pilihan dan tujuannya jelas, saya tidak

Parpol Peserta ....

dan penetapan parpol peserta Pemilu Legislatif 2014 di Gedung Komisi Pemilihan Um u m ( K P U ) . 7 3 p a r t a i mengirimkan perwakilan untuk mengikuti ini. “Penyuluhan ini dilakukan untuk mengkomunikasikan tahapan penyelenggaraan pendaftaran dan verifikasi parpol peserta Pemilu legislatif 2014 kepada partai-partai yang ada,” kata Komisoner KPU Ida Budhiati di Jakarta, Rabu. Ida menyebutkan pada rancangan penyelenggaraan Pemilu legislatif 2014 ada beberapa perbedaan dengan Pemilu sebelumnya.

2 5 3 8 6 1 7 9 4

6 1 9 4 3 7 8 2 5

8 7 4 9 5 2 6 3 1

9 4 5 6 1 8 3 7 2

7 8 1 2 9 3 4 5 6

3 2 6 7 4 5 1 8 9

4 3 8 5 2

1 9 2 3 7 4 9 5 1 6 7 8

5 6 7 1 8 9 2 4 3 *****41

Jumat 20 Juli 2012

Pengusaha Hotel Tewas Ditikam Di Mobil KABANJAHE (Waspada): Seorang pengusaha hotel melati, Antonius Sembiring, 45, warga Jl. Djamin Ginting, Gang Pijer Podi, Kabanjahe, ditemukan tewas dengan empat bekas tusukan benda tajam di tubuhya. Jasad korban ditemukan di dalam mobil miliknya Daihatsu Terrios warna putih yang terparkir di belakang Stadion Samura Kabanjahe, Rabu (18/7) malam. Jeston Sitohang, salah seorang warga setempat mengatakan, korban ditemukan dalam posisi tergeletak di jok tengah mobilnya dalam kondisi bersimbah darah. Saat itu, mis sorenya telah mendengar pemaparan presentasi keadaan hilal dari Badan Hisab Rukyat Kementerian Agama. Sebelumnya, Suryadharma juga menyayangkan ketidakhadiran Muhammadiyah dalam sidang isbat ini. Namun ia tidak mau menjawab pertanyaan wartawan mengenai perbedaan hisab Muhammadiyah dan pemerintah. Muhammadiyah dalam maklumatnya menetapkan 1 Ramadhan jatuh pada Jumat (20/7). “M a s a l a h i t u j a n g a n dipersoalkan . Perhitungan itu ada ilmunya. Para ahli-ahli menyampaikan berdasarkan ilmunya masing-masing,” pungkasnya. (m13/ant)

posisi korban seperti hendak keluar dari dalam mobil. Pihak kepolisian yang menerima laporan segera turun ke tempat kejadian peristiwa dan mengevakuasi jasad korban ke RSU Kabanjahe untuk keperluan visum. Mobil korban diamankan di Mapolres

Tanah Karo. Menurut informasi, pelaku yang menghabisi korban lebih dari satu orang.Korban ditikam pada dada sebelah kiri menembus jantung, luka lecet di leher, luka tusuk lengan kiri dan leher. Salah seorang keluarga

korban, Rianto Sembiring, warga Jandi Meriah, Kec. Tiganderket saat ditemui di Mapolres Karo, Kamis (19/7) pagi, mengatakan, korban selama ini mengontrak salah satu Hotel Lestari di Jl. Djamin Ginting Kabanjahe. Mobil tersebut baru dibelinya. (a36)

Selama Ramadhan ....

Aparat kepolisian serta instansi terkait dalam hal ini Dinas Perindustrian dan Perdagangan juga diminta untuk melakukan pengawasan serta pencegahan terhadap para spekulan penimbun kebutuhan bahan pokok. Khusus untuk pengamanan transportasi dan antisipasi kemacatan serta bencana alam seperti longsor, ditugaskan kepada Dinas Perhubungan dan Dinas Bina Marga untuk mempersiapkan secara khusus keperluan yang dibutuhkan.Menyiapkan alat berat di lokasi rawan longsor, memperbaiki jalan dan jembatan yang rusak terutama di jalur padat arus kenderaan. Dan menghentikan aktivitas pengerjaan jalan dan jembatan pada lima hari sebelum Idul Fitri. Sementara, Kapolda Sumut Irjen Pol Wisjnu Amat

Sastro sebelumnya memberikan perhatian khusus pada aktivitas asmara subuh yang kerap dilakukan muda-mudi di beberapa titik tertentu di Kota Medan serta kota lainnya di Sumut. Dia menilai aktivitas tersebut dapat memancing emosi warga yang dapat menimbulkan perlawanan dan merusak kondusifitas selama Ramadhan. Perhatian serius lainnya terkait bentrok antardua Organisasi Kepemudaan (OKP) yang terjadi beberapa hari lalu. Dia sudah melakukan pendekatan dan meminta kedua pimpinan OKP untuk menghentikannya. Serta berjanji akan menangkap pelaku dalam waktu 2-3 hari ke depan agar kembali kondusif. (m28)

kecelakaan. “Kami meminta kepada walikota/bupati dan aparat di bawahnya serta instansi terkait untuk melarang dan menghindari kegiatan asmara subuh,” kata Gatot usai pertemuan FKPD menyambut Ramadhan di Gubernuran, Jl. Jenderal Sudirman, Medan, Kamis (19/7). Selain itu, selain asmara subuh, penjualan petasan serta penggunaan petasan selama Ramadhan harus dilarang. Aparat keamanan diminta untuk melakukan pengawasan dan razia rutin. Sedangkan bagi pengusaha diminta untuk memberikan Tunjangan Hari Raya (THR) dua pekan sebelum Idul Fitri. Pemerintah akan menggelar operasi pasar untuk menjamin ketersediaan stok sembilan bahan pokok.

Asyad Sudah ....

kendali atas kekuasaannya. Masih beda Sementara itu, Presiden AS Barack Obama dan timpalannya dari Rusia Vladimir Putin mengakui mereka berbeda pendapat tentang Syria dan sepakat melanjutkan pembahasan bagi tercapainya penyelesaian, kata Gedung Putih. Di dalam pembicaraan mereka melalui telefon, kedua presiden itu membahas ‘situasi yang berkembang’ dan ‘kerusuhan yang meningkat’ di negara Arab tersebut. Mereka sepakat mengenai perlunya

untuk “mendukung peralihan politik sesegera mungkin yang mencapai sasaran bersama kami tentang diakhirnya kerusuhan dan dihindarinya memburuknya situasi,” kata Gedung Putih. Akibat perbedaan yang ‘menggantung’ mengenai pendekatan bagi krisis 16bulan di Syria, Dewan Keamanan PBB memutuskan untuk menunda sampai Kamis pagi waktu setempat pemungutan suara yang mulanya dijadwalkan Rabu tentang rancangan resolusi mengenai Syria. (m10)

motivasinya bagi anak-anak yatim tersebut. Dia berharap, anak-anak yang hadir di Gus Center ini akan menjadi orang-orang sukses di masa depan. “Untuk mencapai kesuksesan, adikadik harus giat belajar. Tidak perlu risau dengan keadaan, yang terutama kita punya kemauan untuk sukses dan maju,” ujar Gus Irawan Pasaribu. Menurut Gus, kemauan yang kuat untuk sukses tersebut menjadi modal besar untuk mencapai keberhasilan. Karena Allah SW T sudah memberikan jaminan kesuksesan, bagi orang-orang yang mau mengubah keadaannya menjadi lebih baik. “Allah SWT sudah berjanji, tidak ada yang mampu mengubah nasib suatu kaum, selain kaum itu sendiri. Maka kita pun harus mau mengubah hidup kita, maka Allah SWT akan memudahkannya,” terang mantan Direktur Utama PT Bank Sumut ini. Selanjutnya Gus bersama

isteri dan keluarga besarnya menyerahkan langsung bingkisan dan santunan pada anak yatim tersebut. Tak lupa, Gus terus memberikan kata-kata motivasinya. Aura kebahagian jelas terlihat dari wajah Gus dan anak-anak tersebut. Penggagas acara, yang juga abang kandung Gus Irawan Pasaribu, Panusunan Pasaribu, dalam sambutannya menambahkan kegiatan ini menandakan menjelang Ramadhan masih banyak anak-anak yatim yang perlu diperhatikan. Kehadiran anak-anak yatim ini menjadi wujud syukur pihaknya untuk mengawali perjuangan memenangkan Gus Irawan sebagai Gubernur Sumut 2013 – 2018. “Kami mohon doa dari anak-anak kami ini, dengan harapan, Allah SWT akan memudahkan dan memberkahi langkah kita di depan. Kiranya apa yang kita lakukan, akan menjadi nilai ibadah,” terangnya. (m06)

Kamaluddin ....

mengaku, berdasarkan UU Otonomi Daerah (Otda) tentang Pilkada, maka PAN belum bisa mencukupi berdasarkan UU tersebut. Parpol yang mengusung pasangan calon harus memenuhi syarat 15% kursi di legislatif. Karenanya, dia juga menjalin komunikasi dengan Parpol lainnya, termasuk Partai Golkar dan PPRN. “Selain PAN, saya sudah mendaftarkan diri juga di Partai Golkar dan PPRN, dan menyusul lagi di Partai Politik lainnya,” ujar Kamaluddin Harahap. Kamaluddin menyampaikan pencalonannya sebagai Ca g u b s u , b u k a n k a re n a ambisi, namun lebih jauh dari itu ingin berbuat untuk Sumatera Utara. “Saya ingin berbuat untuk Sumut, saya ingin bersama rakyat untuk merubah Sumut. Kita butuh perubahan,” katanya. Sementara, Wakil Ketua PW Muhammadiyah Sumut,

Prof Dr Hasyimsyah Nasution MA mengatakan, sebagai k a d e r Mu h a m m a d i y a h , Kamaluddin Harahap harus lebih banyak bekerja keras. Sebab, kata dia, orang yang bekerja keras akan diberikan jabatan terbaik dalam hidup ini. “Kami tetap memberikan doa dan dukungannya, yakinlah orang yang bekerja akan diberikan Allah SWT tempat yang terbaik. Saya tau bagaimana Kamaluddin Harahap ini dalam meniti hidupnya. Nah, semuanya dilalui dengan perjuangan,” kata Hasyimsyah. Usai memberikan katakata pelepasan, Hasyimsyah mengucapkan selamat berjuang sebagai kader Muhammadiyah untuk Sumut I. Memang kata dia, perjuangan itu masih panjang, karenanya semua pihak khususnya kader Muhammadiyah juga harus memberikan support kepada Kamaluddin. (m12)

Al Bayan ....

Menjalankan puasa berarti seseorang menahan diri, tidak makan minum, selama 14 jam. Dari 14 jam tersebut, hanya enam jam perut kosong. Secara awam dapat dipahami, perut yang kosong (bukan lapar) dapat membuka pikiran untuk bergerak mencari karunia Allah, sedangkan perut yang selalu kenyang lebih banyak tidur, pikiranpun akhirnya tidak jalan. Kata Hamka: Ular yang makan kambing (karena terlalu kenyang) tidak bisa ke mana-mana. Demikian, tamsilan yang sering dikatakan orang kepada orang yang banyak makan. Dalam hadits lain disebutkan, perut adalah sumber penyakit. Bila seseorang makan berlebih-lebihan sering dihinggapi berbagai penyakit fisik dan mental sekaligus. Di segi fisik, orang itu akan kelebihan lemak, malas bergerak, kemungkinan

serangan jantung, ginjal, sesak nafas dan lain-lain. Apabila fisik telah terganggu membuat mental turut terganggu. Orang yang sudah sakit-sakitan, tentu sudah payah bergerak melaksanakan salat, kerja dan berpikir yang cemerlang. Para Hu k a m a’ m e n y e b u t k a n , dalam tubuh yang sehat terdapat pikiran yang waras. Menurut ajaran Islam, puasa tidak hanya disuruh menahan lapar dan haus saja, tetapi juga menahan pandangan dari berbagai godaan, baik godaan setan maupun godaan hawa nafsu. Segenap pencaindra harus dipelihara agar tidak melewati batas. Kalau seluruh pancaindra dibiarkan tidak berpuasa, tidak ada artinya menahan lapar dan dahaga. Puasa yang akan memberi hikmah sehat adalah puasa lahir batin yang berkualitas tinggi seperti yang diajarkan oleh Nabi.

bisa menghalang-halangi, tidak bisa. Tetapi kalau Pak SBY saya ada tugas politik tetapi tidak ada satupun pekerjaan pemerintahan yang saya tinggalkan, terimakasih, saya akan bilang begitu,” katanya. Kepala Negara mengatakan akan lebih puas jika seluruh jajaran pemerintahan dapat bersama-sama dengan kompak menyelesaikan tugas pemerintahan dengan baik.

Sambut Ramadhan ....

santunan bagi ratusan anak yatim se-Kota Medan, Sabtu. Kegiatan yang disebutnya memuliakan anak yatim ini juga sekaligus memaknai syukur atas peresmian Gus Center Jalan Pattimura No 342, Medan yang berlangsung Minggu lalu. Gus Irawan Pasaribu bersama isteri, berbaur bersama ratusan anak yatim dari berbagai panti asuhan di Medan tersebut. Sebelum acara dimulai, Gus juga menyempatkan diri untuk berkomunikasi langsung dengan anak-anak tersebut. Acara dimulai dengan pembacaan ayat suci Al Quran dan pembacaan ayat-ayat pendek yang dipimpin langsung oleh salah seorang anak yatim. Setelah itu, Gus Irawan Pasaribu diminta untuk menyampaikan sambutannya. Dalam pidatonya yang singkat Gus Irawan, yang dikenal sebagai salah satu entrepreneur andal yang dimiliki Sumatera Utara, memberikan

Adami, Jamaah pengajian Belawan, Sekum DPD IMM Sumut, Jahiddin Daulay, Pengurus Ikatan Alumni Pe s a n t re n At t h o i y y i b a h Indonesia (IKAPPAI) Sumut, Jawaban Problem Catur, Ahmad Khairuddin dan puluhan pendukung lainnya. TTS Dan Sudoku Kamaluddin Harahap juga Dari Halaman Sport. dilepas Wakil Ketua PW Muhammadiyah Sumut, Prof Dr H Hasyimsyah Nasution MA Jawaban Problem Catur: atas nama Muhammadiyah Sumut. Kamaluddin mendaf1. ......, Bh3 (target tar ke Rumah PAN Sumut, Bh1+mat). diterima Sekretaris Tim Pil2. Bg7+ (terpaksa), kada Sumut, Suhandi dan RxB. Hendra Cipta SE. Kamaluddin Harahap me3. Mg2+, Bg3. nyatakan optimis, akan di4. dxc5, Ke5. Putih usung PAN dalam pencalomenyerah. nannya pada Pilgubsu 2013 mendatang. “Saya optimis, Jawaban TTS: DPP PAN akan menetapkan TTS Topik MARHABAN RAMADHAN saya sebagai Cagubsu nanti, saya yakin itu. DPP akan lebih jeli melihat calon untuk Pilgubsu mendatang,” katanya. Wasekjen DPP PAN ini

Jawaban Sudoku:

WASPADA

Sedangkan sehat jiwa tidak hilang akal (gila), berpikir positif, mendalami ilmu dan menjalin hablum minallaah (hubungan dengan Allah) dan hablum minannaas (hubungan sesama manusia). Manusia seperti itulah yang dijanjikan muttaqin oleh Allah SWT. Prof Dr Hamka menyebutkan, “Dengan berpuasa, insya Allah kedua jenis kesehatan itu akan terpenuhi. Para ahli kedokteran telah meneliti tentang pengaruh puasa dan kesehatan. Di negeri-negeri Islam, pada bulan Ramadhan, kriminalitas sangat berkurang, sedangkan di bulan-bulan yang lain angkanya termasuk tinggi. Ini memunjukkan bulan puasa itu, karena umat Islam berpuasa sehingga secara abstrak setan tidak mampu menggoda”.

Ada-ada Saja ....

Ia mulai bermain Diablo III pada 13 Juli siang. Kemudian, selama hampir dua hari nonstop, Chuang bermain tanpa makan di kafe tersebut. Pada 15 Juli pagi, seorang pelayan memasuki ruangan tersebut dan menemukan Chuang sedang beristirahat di meja. Setelah pelayan tersebut membangunkannya, Chuang berdiri, berjalan beberapa langkah, dan tersungkur ke lantai. Cuang dibawa ke rumah sakit setempat. Namun, tak lama setelah tiba di rumah sakit, dia dinyatakan meninggal. Polisi Taiwan kini tengah menyelidiki penyebab kematiannya melalui otopsi. Perkiraan awal menunjukkan bahwa Chuang mengalami masalah pembuluh darah (kardiovaskular) akibat duduk terlalu lama dalam posisi yang sama selama berjam-jam. Ini bukan pertama kalinya peristiwa seperti ini terjadi. Sebelumnya, Februari lalu, seorang pria di New Taipei ditemukan tewas dalam posisi merosot dari kursi, menghadap komputer dengan tangan masih menjangkau keyboard setelah bermain games selama 23 jam. Penyebab kematiannya dilaporkan sebagai serangan jantung. (net/rzl)

Tak Perlu ....

(Bedah rumah masyarakat miskin/kurang mampu) dengan sasaran 10.000 unit rumah masyarakat miskin. Pernyataan itu dikemukakan tokoh masyarakat Sei Mencirim Kec.Sunggal Nurrahman Rasyad pada penyerahan 30 kunci rumah untuk warga kurang di Kecamatan Sunggal dan Hamparan Perak yang telah selesai dibedah melalui gerakan “Baru Yakin” serta penyerahan berbagai bantuan di antaranya bibit ikan, benih jagung, benih padi, itik, e-KTP dan bantuan perbaikan irigasi kepada warga Kec.Sunggal, Selasa (17/7). Di hadapan seribuan warga yang hadir, Nurrahman m e n y e b u t k a n Pa k A m r i “ngak” perlu menggelar kampanye di Sunggal. ”Kami warga masyarakat siap untuk memenangkannya menjadi orang nomor satu di Sumut, tegasnya. Menurut Nurrahman, selama memimpin Deliserdang dua periode (2004-2009 dan 2009 sampai sekarang-red) berbagai program pembangunan terlaksana secara merata dan baik. Kami warga Sunggal sudah menikmati “kue” pembangunan itu terbukti seluruh gang di wilayah ini telah dicor, jelas Nurrahman. Namun satu hal yang diharapkan warga masyarakat Kec. Sunggal khususnya dan Deliserdang umumnya upaya percepatan pembangunan yang telah dilakukan di Deliserdang selama ini harus tetap dilanjutkan. “Kalaupun nantinya bapak tidak lagi menjabat bupati, kami sangat mengharapkan bapak menitipkan seluruh program dan gagasan yang telah berjalan selama ini kepada pengganti bapak agar upaya percepatan pembangunan dapat berlanjut terus,” pinta Nurrahman. Sementara itu, Bupati Deliserdang Drs. H. Amri Tambunan yang hadir menyerahkan 30 kunci rumah untuk warga kurang mampu itu, menyampaikan rasa bangga melihat semangat kebersamaan yang diperlihatkan warga dalam mewujudkan masa depan yang lebih baik dengan melakukan percepatan pembangunan di daerah ini. Bupati mengatakan ketika warga sudah menunjukkan

Waspada/Amir Syarifuddin

PLT Gubsu H. Gatot Pujo Nugroho didampingi anggota Forum Koordinasi Pimpinan Daerah (FKPD) Sumut memberikan keterangan kepada wartawan usai rapat FKPD, di Gubernuran Medan, Kamis (19/7).

Marhaban ....

tanya; apa sebenarnya makna dan hikmah yang terkandung dibalik kewajiban ibadah ini? Dan apa pula yang perlu dilakukan untuk mendapatkan hikmah dan kemanfaatan yang terkandung di dalamnya. Disinilah kita melihat apresiasi umat terhadap penyambutan Ramadhan yang sangat variatif; mulai dari persiapanpersiapan yang bersifat fisikjasmaniyah seperti pengumpulan informasi dan persiapan makanan dan minuman yang menguatkan stamina, pembenahan interior dan eksterior rumah serta tempat ibadahnya, sampai kepada persiapan obat-obatan penyejuk lambung dan menghindari kekambuhan penyakit mag yang diderita. Ada yang teringat dan ziarah, kembali mencari serta membersihkan makam orangtua, famili, dan kerabat. Pada saat yang sama ada pula yang menyambutnya dengan penguatan iman, keyakinan, dan kesiapan bathin untuk memasukinya. Sembari penuh harap agar bagaimanapun apresiasi yang diberikan hendaknya memperoleh perkenan dari Yang Maha Kuasa dan Maha Pemurah. Memang kehadiran Ramadhan sangat revolusioner dalam kehidupan umat manusia. Sebab meskipun Allah mensyari’atkan puasa kepada nabi dan umat sebelum Rasulullah Muhammad Saw., tetapi ibadah puasa tersebut—dari sudut substansi dan pelaksanaannya—tidak sama dengan ibadah puasa Ramadhan. Paling tidak ada lima spesifikasi dan sudah barang tentu merupakan keutamaan ibadah Ramadahan dibanding dengan puasa lain; antar zaman maupun ibadah puasa internal Islam. Pertama, Ramadhan diantar oleh bulan mulia sebelumnya, bulan Sya’ban, yang— selain memiliki kemuliaan

tersendiri—juga disunatkan melaksanakan puasa di dalamnya. Setelah Ramadhan, bulan Syawal, meskipun ditetapkan sebagai bulan hari raya, namun umat disunatkan untuk melakukan puasa enam hari yang sangat tinggi nilainya. Secara sederhana saja dapat dipahami bahwa suatu iven atau peristiwa yang didahului oleh kegiatan yang lebih sederhana sebagai pembukaan dan diakhiri dengan kegiatan tertentu sebagai penutupan pastilah memiliki nilai yang sangat tinggi. Kedua, ibadah Ramadhan diiringi dengan ibadah-ibadah lain di dalamnya; shalat tarawekh, tadarus, zakat fitrah, dan lain-lain yang disyari’atkan sebagai bagian dari ibadah Ramadhan yang mengisyaratkan betapa besarnya nilai ibadah ini. Ketiga, Puasa Ramadhan memberi kesempatan kepada manusia—tanpa dipaksa dan dipengaruhi orang lain—untuk secara tulus mengenali dirinya yang sebenarnya. Demikian pula dapat mengenali Tuhan dan ke-Mahakuasaan-Nya. Sebab tidak ada kondisi yang lebih efektif menyadarkan manusia akan hakekat dirinya melebihi kondisi penderitaan dan rasa lapar. Badi’uzzaman Sa’id Nursi, pemikir dan sufi besar Turki, pernah menjelaskan bahwa hanya dalam kondisi susah dan laparlah manusia dapat dengan tulus mengenali dirinya dan Tuhannya tanpa dipengar uhi orang lain. (Badi’uzzaman Sa’id Nursi: Risalat al-Nur). Keempat, Ramadhan menyuguhkan egalitarianisme yang sangat revolusioner serta sangat efektif mendevaluasi kecongkakan, kesombongan, dan segala macam arogansi; karena harta, pangkat, jabatan, dan pengaruh dan popularitas. Sebab pada kenyataannya bila Allah menarik hak untuk ma-

kan dan minum, ternyata manusia berada dalam kondisi yang sama, bisa lapar, sangat lemah, dan tidak punya kuasa apa-apa. Kelima, Ramadhan menyuguhkan kepada manusia arti kekuatan batin, tekad, dan kesetiaan. Sebab dalam kondisi lapar seseorang harus tetap berbicara sopan, berprilaku terpuji, dan menjaga harga diri. Bukan seperti prilaku yang diperlihatkan oleh orang yang memiliki ketergantungan yang keterlaluan terhadap banyaknya makanan dan minuman, hingga kerap saling menjelekkan, menghina, menghasut, dan mengkhianati. Jika bukannya terbiasa untuk saling membunuh hanya karena perebutan makanan, minuman, dan segala bentuk jabatan, kekayaan, dan kemewahan. Dilihat secara demikian maka sangatlah logis pesan Rasulullah bahwa kegembiraan menyambut Ramadhan akan menghapuskan dosa. Dan dengan demikian ibadah Ramadhan adalah kebutuhan semua umat manusia—bukan saja muslim tetapi juga yang akan menjadi muslim—karena ibadah ini memberi kesempatan kepada siapa saja untuk menegakkan kemanusiaannya melalui cara dan kesempatan yang berbeda. Oleh karenanya mari kita sambut dengan bathin, dengan persiapan iman, keyakinan, ketulusan, kesediaan merendahkan hati, meninggalkan kebiasaan untuk mengambil dan merampas hak orang lain, serta memperlihatkan perangai kita yang bersemi sebagai makhluk Allah yang dapat diandalkan. Meskipun kita lakukan persiapan fisik-jasmaniah hanyalah sebagai aktualisasi dari iman dan keikhlasan. Marhaban ya..Ramadhan. Wa Allâhu A’lamu bi al-Shawâb.

keikutsertaan dalam pembangunan, tentu pemerintah akan ikut bersama-sama di sana. Seperti adanya masukan dari warga untuk perbaikan jalan utama menuju Desa Suka Maju Kec.Sunggal, secara spontan Bupati menginstruksikan Dinas PU agar segera mungkin menyahuti pemintaan warga serta melakukan perbaikan yang spontan mendapat appalus dari warga masyarakat. Camat Sunggal Drs Sariguna Tanjung MSi menjelaskan rangkaian kegiatan yang digelar satu hari penuh diawali dengan penanda tanganan prasati peresmian gedung baru Koperasi Simpan Pinjam “Surya Abadi Mandiri” Desa Sei Mencirim yang memiliki asset Rp16.863.245.178.serta panen Jagung varitas unggul Pioner 27 bersama Bupati Drs H Amri Tambunan.

Sedangkan di Desa Sukamaju digelar penyerahan secara simbolis kunci rumah berikut surat tanah dan IMB yang selesai dibedah kepada warga kurang mampu di Kec. Sunggal dan Kec.Hamparan Perak. Di Kec.Sunggal pada tahap ke empat ini diserahkan 18 unit hingga seluruhnya selesai dibangun 65 unit. Sedangkan di Kec.Hamparan Perak tahap kedua 11 unit hingga keseluruhan 28 unit. Selain itu juga diserahkan secara simbolis e-KTP yang sudah selesai kepada 5 warga, bantuan sektor pertanian berupa Bansos dana rehab jaringan irigasi usaha tani Kelompok Tani Desa Medan Krio Rp 86 juta, Benih padi kepada kelompok tani, benih Jagung hibrida, bantuan ternak itik kepada peternak dan bantuan 30.000 ekor bibit ikan

lele serta bantuan beasiswa Rp 1 juta setiap bulan kepada 28 siswa berprestasi yang lulus jalur undangan di Perguruan Tinggi Unimed, USU, Polmed d a n I T Te l k o m 2 0 1 2 . Kemudian penandatanganan p ra s a s t i p e m b a n g u n a n Kolam renang dan Sekolah Islam terpadu Villa Kelapa Gading serta Ruang Kelas Baru SMA Negeri I Sunggal. Dalam kunjungan sehari di Kec.Sunggal, H. Amri Tambunan turut didampingi Ketua TP PKK Hj Anita Amri Tambunan,Asisten I H Syafrullah, Kadis Infokom Drs Neken Ketaren, Kadis Kesehatan Dr H Masdulhaq Siregar SpOG (K) MHA, Kadis Dikpora Hj Sa’adah Lubis, adis Kependudukan dan Capil Drs H MA Yusuf Siregar MAP, Camat Hamparan Perak Drs Sariguna Tanjung MSi dan Muspika Sunggal. (a06/m34/m13)


Berita Utama

A2

7 Daerah... “Sepanjang bulan April April 2011, Humbahas merawat 8 anak, Madina 7, Nias Utara 6, Nias Selatan 10, Tapanuli Utara 5, Tapanuli Selatan 10 dan Tapanuli Tengah 5 anak. Sedangkan bulan Julinya, Madina 8 anak, Tapanuli Utara 2 anak, Tapanuli Selatan 5 anak, dan Tapanuli Tengah 5 anak,” ungkap Rini, Kamis (19/7). Keseluruhan laporan 71 kasus ini, sambungnya, merupakan laporan kasus yang diberikan dana pendampingan dari APBD provinsi. “Masing-

835 Peserta...

nyampaikan berdasarkan ilmunya masing-masing,” tutur Suryadharma Ali. Sementara, Ketua Majelis Ulama Indonesia (MUI), Amidan meminta masyarakat tidak mempermasalahkan perbedaan awal Ramadhan dan harus saling menghormati. “Kami minta kepada masyarakat, perberbedaan tersebut jangan dipertajam. Jangan dibesar-besarkan,” kata Amidan sambil menambahkan, penentuan awal Ramadhan memiliki dasar hukum dan metode masing-masing. “Jangan sampai merasa paling

benar, karena semua ada dasar hukumnya,” tegas Amidan. Sedang Sekretaris Jenderal Kementeran Agama (Sekjen Kemanag) H. Bahrul Hayat dalam komentarnya meminta kepada semua pihak untuk saling menghormati apabila terjadi perbedaan dalam penetapan awal Ramadhan tahun ini. “ Saya kira dengan saling menghormati mudah-mudahan akan tercipta kondisi yang lebih baik. Jadi Ramadhan akan dimulai dengan pilihan bagi warga masyarakat yang meyakini hari tertentu sebagai awal puasa,” tutur Bahrul. (j06)

salah satunya di Harian Waspada,” tegasnya. Sebelumnya, dia mengatakan untuk tahun ini jumlah mahasiswa baru Polmed yang bakal diterima 1.500 orang. Basir menyinggung jumlah peserta UMPN Gelombang I sebanyak 2.452 orang jauh dari prediksi. Soalnya, untuk tahun ini, sistem pendaftaran dilakukan secara online dan membayar uang pendaftaran di PT Bank Sumut.”Jumlahnya meningkat dari tahun sebelumnya,” tegasnya. Secara umum pelaksanaan UMPN Gelombang I dan Gelombang II berjalan lancar. Direktur Polmed, M Syahruddin ST MT berserta Pudir IV, Cipta Darma tetap meninjau pelaksanaan UMPN itu. (m49)

Asmara Subuh...

Kamis (19/7). Selain asmara subuh, penjualan petasan serta penggunaan petasan selama Ramadhan harus dilarang. Aparat keamanan diminta melakukan pengawasan dan razia rutin. Sedangkan bagi pengusaha diminta untuk memberikan Tunjangan Hari Raya (THR) dua pekan sebelum Idul Fitri. Pemerintah akan menggelar operasi pasar untuk menjamin ketersediaan stok sembilan bahan pokok. Sementara, Kapolda Sumut Irjen Pol Wisjnu Amat Sastro sebelumnya memberikan perhatian khusus pada aktivitas asmara subuh yang kerap

dilakukan muda-mudi di beberapa titik tertentu di Kota Medan serta kota lainnya di Sumut. Dia menilai aktivitas tersebut dapat memancing emosi warga yang dapat menimbulkan perlawanan dan merusak kondusifitas selama Ramadhan. Perhatian serius lainnya terkait bentrok antardua Organisasi Kepemudaan (OKP) yang terjadi beberapa hari lalu. Dia sudah melakukan pendekatan dan meminta kedua pimpinan OKP untuk menghentikannya serta berjanji akan menangkap pelaku dalam waktu 2-3 hari ke depan agar kembali kondusif. (m28)

Saat mendaftarkan diri, Kamaluddin Harahap didampingi Ketua Pimpinan Pusat (PP) Pemuda Muhammadiyah, Anang Anas Azhar MA, Ketua PW Pemuda Muhammadiyah Sumut, Ihsan Rambe SE MSi, Sekretaris PD Pemuda Muhammadiyah Medan, Edi Saputra ST, Presiden Anak Melayu Bersatu (AMBe) Muhammad Adami, Jamaah pengajian Belawan, Sekum DPD IMM Sumut, Jahiddin Daulay, Pengurus Ikatan Alumni Pesantren Atthoiyyibah Indonesia (IKAPPAI) Sumut, Ahmad Khairuddin dan puluhan pendukung lainnya. Keberangkatan Kamaluddin Harahap dilepas Wakil

Ketua PW Muhammadiyah Sumut, Prof Dr H Hasyimsyah Nasution MA atas nama Muhammadiyah Sumut. Pendaftaran Kamaluddinditerima Sekretaris Tim Pilkada Sumut, Suhandi dan Hendra Cipta SE. Pada kesempatan itu, Kamaluddin Harahap menyatakan optimis, akan diusung PAN dalam pencalonannya pada Pilgubsu 2013. “Saya optimis, DPP PAN akan menetapkan saya sebagai Cagubsu nanti, saya yakin itu. DPP akan lebih jeli melihat calon untuk Pilgubsu mendatang,” katanya. Wasekjen DPP PAN ini mengaku, berdasarkan UU Otonomi Daerah (Otda) tentang Pilkada, PAN belum bisa mencukupi berdasarkan UU terse-

but. Parpol yang mengusung pasangan calon harus memenuhi syarat 15% kursi di legislatif. Karenanya, dia menjalin komunikasi dengan Parpol lainnya, termasuk Partai Golkar dan PPRN. Kamaluddin menyampaikan pencalonannya sebagai Cagubsu, bukan karena ambisi, namun ingin berbuat untuk Sumatera Utara. Sementara, Wakil Ketua PW Muhammadiyah Sumut, Prof Dr Hasyimsyah Nasution MA mengatakan, sebagai kader Muhammadiyah, Kamaluddin Harahap harus lebih banyak bekerja keras. Sebab, kata dia, orang yang bekerja keras akan diberikan jabatan terbaik dalam hidup ini. (m12)

seseorang menahan diri, tidak makan minum, selama 14 jam. Dari 14 jam tersebut, hanya enam jam perut kosong. Secara awam dapat dipahami, perut yang kosong (bukan lapar) dapat membuka pikiran untuk bergerak mencari karunia Allah, sedangkan perut yang selalu kenyang lebih banyak tidur, pikiranpun akhirnya tidak jalan. Kata Hamka: Ular yang makan kambing (karena terlalu kenyang) tidak bisa ke manamana. Demikian, tamsilan yang sering dikatakan orang kepada orang yang banyak makan. Dalam hadits lain disebut-

kan, perut adalah sumber penyakit. Bila seseorang makan berlebih-lebihan sering dihinggapi berbagai penyakit fisik dan mental sekaligus. Di segi fisik, orang itu akan kelebihan lemak, malas bergerak, kemungkinan serangan jantung, ginjal, sesak nafas dan lain-lain. Apabila fisik telah terganggu membuat mental turut terganggu. Orang yang sudah sakit-sakitan, tentu sudah payah bergerak melaksanakan shalat, kerja dan berpikir yang cemerlang. Para Hukama’ menyebutkan, dalam tubuh yang sehat terdapat

pikiran yang waras. Menurut ajaran Islam, puasa tidak hanya disuruh menahan lapar dan haus saja, tetapi juga menahan pandangan dari berbagai godaan, baik godaan setan maupun godaan hawa nafsu. Segenap pencaindra harus dipelihara agar tidak melewati batas. Kalau seluruh pancaindra dibiarkan tidak berpuasa, tidak ada artinya menahan lapar dan dahaga. Puasa yang akan memberi hikmah sehat adalah puasa lahir batin yang berkualitas tinggi seperti yang diajarkan oleh Nabi.

ling tidak ada lima spesifikasi dan sudah barang tentu merupakan keutamaan ibadah Ramadahan dibanding dengan puasa lain; antar zaman maupun ibadah puasa internal Islam. Pertama, Ramadhan diantar oleh bulan mulia sebelumnya, bulan Sya’ban, yang—selain memiliki kemuliaan tersendiri—juga disunatkan melaksanakan puasa di dalamnya. Setelah Ramadhan, bulan Syawal, meskipun ditetapkan sebagai bulan hari raya, namun umat disunatkan untuk melakukan puasa enam hari yang sangat tinggi nilainya. Secara sederhana saja dapat dipahami bahwa suatu iven atau peristiwa yang didahului oleh kegiatan yang lebih sederhana sebagai pembukaan dan diakhiri dengan kegiatan tertentu sebagai penutupan pastilah memiliki nilai yang sangat tinggi. Kedua, ibadah Ramadhan diiringi dengan ibadah-ibadah lain di dalamnya; shalat taraweh, tadarus, zakat fitrah, dan lain-lain yang disyari’atkan sebagai bagian dari ibadah Ramadhan yang mengisyaratkan betapa besarnya nilai ibadah ini. Ketiga, Puasa Ramadhan memberi kesempatan kepada manusia—tanpa dipaksa dan dipengaruhi orang lain—untuk secara tulus mengenali dirinya yang sebenarnya. De-

mikian pula dapat mengenali Tuhan dan ke-MahakuasaanNya. Sebab tidak ada kondisi yang lebih efektif menyadarkan manusia akan hakekat dirinya melebihi kondisi pender i t a a n d a n r a s a l a p a r. Badi’uzzaman Sa’id Nursi, pemikir dan sufi besar Turki, pernah menjelaskan bahwa hanya dalam kondisi susah dan laparlah manusia dapat dengan tulus mengenali dirinya dan Tuhannya tanpa dipe-ngaruhi orang lain. (Badi’uzzaman Sa’id Nursi: Risalat al-Nur). Keempat, Ramadhan menyuguhkan egalitarianisme yang sangat revolusioner serta sangat efektif mendevaluasi kecongkakan, kesombongan, dan segala macam arogansi; karena harta, pangkat, jabatan, dan pengaruh dan popularitas. Sebab pada kenyataannya bila Allah menarik hak untuk makan dan minum, ternyata manusia berada dalam kondisi yang sama, bisa lapar, sangat lemah, dan tidak punya kuasa apa-apa. Kelima, Ramadhan menyuguhkan kepada manusia arti kekuatan batin, tekad, dan kesetiaan. Sebab dalam kondisi lapar seseorang harus tetap berbicara sopan, berprilaku terpuji, dan menjaga harga diri. Bukan seperti prilaku yang diperlihatkan oleh orang yang memiliki ketergantungan yang keterlaluan terhadap

banyaknya makanan dan minuman, hingga kerap saling menjelekkan, menghina, menghasut, dan mengkhianati. Jika bukannya terbiasa untuk saling membunuh hanya karena perebutan makanan, minuman, dan segala bentuk jabatan, kekayaan, dan kemewahan. Dilihat secara demikian maka sangatlah logis pesan Rasulullah bahwa kegembiraan menyambut Ramadhan akan menghapuskan dosa. Dan dengan demikian ibadah Ramadhan adalah kebutuhan semua umat manusia—bukan saja muslim tetapi juga yang akan menjadi muslim—karena ibadah ini memberi kesempatan kepada siapa saja untuk menegakkan kemanusiaannya melalui cara dan kesempatan yang berbeda.. Oleh karenanya mari kita sambut dengan bathin, dengan persiapan iman, keyakinan, ketulusan, kesediaan merendahkan hati, meninggalkan kebiasaan untuk mengambil dan merampas hak orang lain, serta memperlihatkan perangai kita yang bersemi sebagai makhluk Allah yang dapat diandalkan. Meskipun kita lakukan persiapan fisikjasmaniah hanyalah sebagai aktualisasi dari iman dan keikhlasan. Mar haban ya.. Ramadhan. Wa Allâhu A’lamu bi al-Shawâb.

Waspada/Surya Efendi

TARAWEH: Jamaah Masjid Taqwa Cabang Muhammadiyah Kampung Dadap Jl. Mustafa Medan, Kamis (19/7) malam, mendengarkan ceramah agama sebelum melaksanakan shalat taraweh.Warga Muhammadiyah hari ini, Jumat (20/7) melaksanakan ibadah puasa sedangkan pemerintah menetapkan 1 Ramadhan 1433 H jatuh pada hari Sabtu (21/7).

1 Ramadhan... Cilacap), Mataram, Nusa Tenggara Barat; SPD LAPAN, Biak, Papua; Makassar, Sulawesi Selatan; Samarinda, Kali-mantan Timur; Nusa Tenggara Barat; Pantai Gebang, Madura; SPD LAPAN Pameungpeuk, Garut, Jawa Barat. Maka disimpulkankan ketinggian hilal tidak mencapai dua derajat Hasil sidang isbat ini adalah gabungan dari rukyat dan hisab.

Tayangan... menghibur diri saja sehingga melupakan tugas lainnya. “Mereka jadi enggan melakukan hal-hal lain yang dianggap kurang menyenangkan.” Di bulan Ramadhan ini justru saatnya kita untuk meningkatkan spiritualitas kita. “Diharapkan kita dapat meningkatkan kecerdasan emosional dan spiritual seseorang. “Kita belajar untuk mengendalikan emosi kita sekaligus meningkatkan keimanan kita,” terangnya. Surati Kemenag RI Hal serupa juga diungkapkan oleh Ketua Komisi B DPRD Medan Surianda Lubis. Menurutnya, bulan Ramadhan haruslah diisi dengan tayangan yang bernuansa keagamaan yang kuat seperti tayangan diskusi keagamaan, napak tilas Rasul dan Nabi. Sehingga Ramadhan ini benar-benar kondusif sehingga dapat meningkatkan kapasitas ilmu agama.

Ada-ada Saja... Ia mulai bermain Diablo III pada 13 Juli siang. Kemudian, selama hampir dua hari nonstop, Chuang bermain tanpa makan di kafe tersebut. Pada 15 Juli pagi, seorang pelayan memasuki ruangan itu dan menemukan Chuang sedang beristirahat di meja. Setelah pelayan itu membangunkannya, Chuang berdiri, berjalan beberapa langkah, dan tersungkur ke lantai. Cuang dibawa ke rumah sakit. Namun, tak lama setelah tiba di rumah sakit, dia meninggal. Polisi Taiwan kini tengah menyelidiki penyebab kematiannya melalui otopsi. Perkiraan awal menunjukkan bahwa Chuang mengalami masalah pembuluh darah

Jawaban Problem Catur, TTS Dan Sudoku Dari Halaman Sport. Jawaban Problem Catur: 1. ......, Bh3 (target Bh1+mat). 2. Bg7+ (terpaksa), RxB. 3. Mg2+, Bg3. 4. dxc5, Ke5. Putih menyerah. Jawaban TTS:

Jawaban Sudoku: 6 1 9 4 3 7 8 2 5

8 7 4 9 5 2 6 3 1

9 4 5 6 1 8 3 7 2

7 8 1 2 9 3 4 5 6

3 2 6 7 4 5 1 8 9

4 3 8 5 2

1 9 2 3 7 4 9 5 1 6 7 8

“Acara lawakan dan gosip itu tidak memberikan edukatif dan bisa mengotori kesucian Ramadhan. Untuk itu, pemimpin pertelevisian harus benarbenar berupaya tidak menayangkan acara-acara yang kurang bermanfaat di bulan Ramadhan. Ini merupakan bentuk tanggungjawab mereka untuk mengeleminir acaraacara yang tidak memberikan edukatif itu,” imbuhnya. Bahkan, Surianda akan menyurati Kemenag RI jika nanti masih melihat acaraacara yang tidak mendidik itu. “Dalam hal ini kita akan berkoordinasi dengan Kementerian Agama Kota Medan. Sudah seharusnya pemerintah memberi tindakan tegas dan memberikan teguran jika tayangan-tayangan itu mengotori kesucian Ramadhan, karena itu sudah mencederai perasaan umat Islam,” katanya, dan menyarankan masyarakat tidak menonton tayangan yang tidak memberikan nilai-nilai edukatif. (h02) (kardiovaskular) akibat duduk terlalu lama dalam posisi yang sama selama berjam-jam. Ini bukan pertama kalinya peristiwa seperti ini terjadi. Sebelumnya, Februari lalu, seorang pria di New Taipei ditemukan tewas dalam posisi merosot dari kursi, menghadap komputer dengan tangan masih menjangkau keyboard setelah bermain games selama 23 jam. Penyebab kematiannya dilaporkan sebagai serangan jantung. (net/rzl)

Albayan... Prof Dr Hamka menyebutkan, “Dengan berpuasa, insya Allah kedua jenis kesehatan itu akan terpenuhi. Para ahli kedokteran telah meneliti tentang pengaruh puasa dan kesehatan. Di negeri-negeri Islam, pada bulan Ramadhan, kriminalitas sangat berkurang, sedangkan di bulan-bulan yang lain angkanya termasuk tinggi. Ini memunjukkan bulan puasa itu, karena umat Islam berpuasa sehingga secara abstrak setan tidak mampu menggoda”. Menjalankan puasa berarti

Marhaban...

TTS Topik MARHABAN RAMADHAN

2 5 3 8 6 1 7 9 4

Kepada wartawan Menag menyayangkan ketidakhadiran Muhammadiyah dalam sidang isbat ini. Namun ia tidak mau menjawab pertanyaan wartawan mengenai perbedaan hisab Muhammadiyah dan pemerintah. “Kalau soal itu jangan dipertentangkan. Tapi ini kan perhitungan itu pada dasarnya ada ilmunya. Jadi ini bukan masalah like or dislike. Dan ahli-ahli yang ada di sini me-

5 6 7 1 8 9 2 4 3 *****41

Disinilah kita melihat apresiasi umat terhadap penyambutan Ramadhan yang sangat variatif; mulai dari persiapanpersiapan yang bersifat fisikjasmaniyah seperti pengumpulan informasi dan persiapan makanan dan minuman yang menguatkan stamina, pembenahan interior dan eksterior rumah serta tempat ibadahnya, sampai kepada persiapan obat-obatan penyejuk lambung dan menghindari kekambuhan penyakit mag yang diderita. Ada yang teringat dan ziarah, kembali mencari serta membersihkan makam orangtua, famili, dan kerabat. Pada saat yang sama ada pula yang menyambutnya dengan penguatan iman, keyakinan, dan kesiapan bathin untuk memasukinya. Sembari penuh harap agar bagaimanapun apresiasi yang diberikan hendaknya memperoleh perkenan dari Yang Maha Kuasa dan Maha Pemurah. Memang kehadiran Ramadhan sangat revolusioner dalam kehidupan umat manusia. Sebab meskipun Allah mensyari’atkan puasa kepada nabi dan umat sebelum Rasulullah Muhammad Saw., tetapi ibadah puasa tersebut—dari sudut substansi dan pelaksanaannya—tidak sama dengan ibadah puasa Ramadhan. Pa-

pertemuan FKPD menjelang Ramadhan menyebutkan, salah satu yang menjadi perhatian mereka adalah kegiatan asmara subuh. Mereka menilai kegiatan tersebut sudah meresahkan dan mengganggu masyarakat serta rawan kecelakaan. “Kami meminta kepada walikota/bupati dan aparat di bawahnya serta instansi terkait untuk melarang dan menghindari kegiatan asmara subuh,” kata Gatot usai pertemuan FKPD menyambut Ramadhan di Gubernuran, Jl. Jenderal Sudirman, Medan,

Kamaluddin...

masing pasien diberikan uang pendamping Rp 365 ribu dan uang ini diberikan kepada orangtua penderita,” jelasnya. Sedangkan penanganan bagi penderita gizi buruk, sudah dilakukan tindakan sesuai standart operasional prosedur. “Diberikan konsumsi susu kepada penderita untuk meningkatkan gizinya. Berapa lama diberikan susu, itu tergantung usia penderita,” tandasnya. Kata dia, 71 kasus ini merupakan laporan selama tahun 2011 yang dirawat di rumah sakit. “Yang dilaporkan ini berdasarkan dari dana untuk pendampingan saja. Diluar dari ini, ada. Mungkin tidak dilaporkan,” katanya. Sementara itu, menurut staf Dinkes Sumut Haris Rambe MA,PHD mengatakan untuk pendekatan kasus gizi buruk mestinya dilakukan secara multi sektor, tidak singel sektor. “Yang penting mencegah gizi buruk dengan sistem ketahanan pangan,” ujarnya. (h02)

Amri Tambunan... Pernyataan sikap serta dukungan itu didasarkan selama memimpin Deliserdang Pak Amri telah banyak berbuat serta memberikan berbagai gagasan dan terobosan bagi kepentingan rakyat dan hasilnya telah dinikmati banyak warga baik melalui program GDSM (Gerakan Deli Serdang Membangun) bidang infrastruktur, konsep “Cerdas” bidang pendidikan,“Ceria” bidang kesehatan serta program kemanusiaan melalui gerakan “Baru Yakin” (Bedah rumah masyarakat miskin/kurang mampu) dengan sasaran 10.000 unit rumah masyarakat miskin. Pernyataan itu dikemukakan tokoh masyarakat Sei Mencirim Kec.Sunggal Nurrahman Rasyad pada penyerahan 30 kunci rumah untuk warga kurang di Kecamatan Sunggal dan Hamparan Perak yang telah selesai dibedah melalui gerakan “Baru Yakin” serta penyerahan berbagai bantuan di antaranya bibit ikan, benih jagung, benih padi, itik, e-KTP dan bantuan perbaikan irigasi kepada warga Kec.Sunggal, Selasa (17/7). Di hadapan seribuan warga yang hadir, Nurrahman menyebutkan Pak Amri “ngak” perlu menggelar kampanye di Sunggal. ”Kami warga masyarakat siap untuk memenangkannya menjadi orang nomor satu di Sumut, tegasnya. Menurut Nurrahman, selama memimpin Deliserdang dua periode (2004-2009 dan

Sambut Ramadhan... Jalan Pattimura No 342, Medan yang berlangsung Minggu lalu. Gus Irawan Pasaribu bersama isteri, berbaur bersama ratusan anak yatim dari berbagai panti asuhan di Medan itu. Sebelum acara dimulai, Gus juga menyempatkan diri untuk berkomunikasi langsung dengan anak-anak tersebut. Acara dimulai dengan pembacaan ayat suci Al Quran dan pembacaan ayat-ayat pendek yang dipimpin langsung oleh salah seorang anak yatim. Setelah itu, Gus Irawan Pasaribu diminta untuk menyampaikan sambutannya. Dalam pidatonya yang singkat Gus Irawan, yang dikenal sebagai salah satu entrepreneur andal yang dimiliki Sumut, memberikan motivasinya bagi anak-anak yatim itu. Dia berharap, anak-anak yang hadir di Gus Center ini

WASPADA Jumat 20 Juli 2012

Pengusaha Hotel Tewas Ditikam Di Mobil KABANJAHE (Waspada): Seorang pengusaha hotel melati, Antonius Sembiring, 45, warga Jl. Djamin Ginting, Gang Pijer Podi, Kabanjahe, ditemukan tewas dengan empat bekas tusukan benda tajam di tubuhnya. Jasad korban ditemukan di dalam mobil miliknya Daihatsu Terrios yang terparkir di belakang Stadion Samura Kabanjahe, Rabu (18/7) malam. Jeston Sitohang, salah seorang warga setempat mengatakan, korban ditemukan dalam posisi tergeletak di jok tengah mobilnya dalam kondisi bersimbah darah. Saat itu, posisi korban seperti hendak keluar dari dalam mobil. Pihak kepolisian yang menerima laporan segera turun ke TKP dan mengevakuasi

jasad korban ke RSU Kabanjahe untuk keperluan visum. Menurut informasi, pelaku yang menghabisi korban lebih dari satu orang.Korban ditikam pada dada sebelah kiri menembus jantung, luka lecet di leher, luka tusuk lengan kiri dan leher. Salah seorang keluarga korban, Rianto Sembiring, warga Jandi Meriah, Kec. Tiganderket saat ditemui di Mapolres Karo, Kamis (19/7) pagi, mengatakan, korban selama ini mengontrak salah satu Hotel Lestari di Jl. Djamin Ginting Kabanjahe. Mobil tersebut baru dibelinya. Kapolres Tanah Karo melalui Kasat Reskrim AKP Harry Azhar mengatakan dalam kasus ini sejumlah saksi telah dimintai keterangan. (a36)

2009 sampai sekarang-red) berbagai program pembangunan terlaksana secara merata dan baik. Kami warga Sunggal sudah menikmati “kue” pembangunan itu terbukti seluruh gang di wilayah ini telah dicor, jelas Nurrahman. Namun satu hal yang diharapkan warga masyarakat Kec. Sunggal khususnya dan Deliserdang umumnya upaya percepatan pembangunan yang telah dilakukan di Deliserdang selama ini harus tetap dilanjutkan. “Kalaupun nantinya bapak tidak lagi menjabat bupati, kami sangat mengharapkan bapak menitipkan seluruh program dan gagasan yang telah berjalan selama ini kepada pengganti bapak agar upaya percepatan pembangunan dapat berlanjut terus,” pinta Nurrahman. Sementara itu, Bupati Deliserdang Drs. H. Amri Tambunan yang hadir menyerahkan 30 kunci rumah untuk warga kurang mampu itu, menyampaikan rasa bangga melihat semangat kebersamaan yang diperlihatkan warga dalam mewujudkan masa depan yang lebih baik. Camat Sunggal Drs Sariguna Tanjung MSi menje-laskan rangkaian kegiatan yang digelar satu hari penuh diawali dengan penanda tanganan prasati peresmian gedung baru Koperasi Simpan Pinjam “Surya Abadi Mandiri” Desa Sei Mencirim yang memiliki asset Rp16.863.245.178.- serta panen Jagung varitas unggul Pioner 27 bersama Bupati Drs H Amri Tambunan.

Sedangkan di Desa Sukamaju digelar penyerahan secara simbolis kunci rumah berikut surat tanah dan IMB yang selesai dibedah kepada warga kurang mampu di Kec. Sunggal dan Kec.Hamparan Perak. Di Kec.Sunggal pada tahap ke empat ini diserahkan 18 unit hingga seluruhnya selesai dibangun 65 unit. Sedangkan di Kec.Hamparan Perak tahap kedua 11 unit hingga keseluruhan 28 unit. Selain itu juga diserahkan secara simbolis e-KTP yang sudah selesai kepada 5 warga, bantuan sektor pertanian berupa Bansos dana rehab jaringan irigasi usaha tani Kelompok Tani Desa Medan Krio Rp 86 juta, Benih padi kepada kelompok tani, benih Jagung hibrida, bantuan ternak itik kepada peternak dan bantuan 30.000 ekor bibit ikan lele serta bantuan beasiswa Rp 1 juta setiap bulan kepada 28 siswa berprestasi yang lulus jalur undangan di Perguruan Tinggi Unimed, USU, Polmed dan IT Telkom 2012. Dalam kunjungan sehari di Kec.Sunggal, H. Amri Tambunan turut didampingi Ketua TP PKK Hj Anita Amri Tambunan,Asisten I H Syafrullah, Kadis Infokom Drs Neken Ketaren, Kadis Kesehatan Dr H Masdulhaq Siregar SpOG (K) MHA, Kadis Dikpora Hj Sa’adah Lubis, adis Kependudukan dan Capil Drs H MA Yusuf Siregar MAP, Camat Hamparan Perak Drs Sariguna Tanjung MSi dan Muspika Sunggal.(a06/m34/m13)

akan menjadi orang-orang sukses di masa depan. “Untuk mencapai kesuksesan, adikadik harus giat belajar. Tidak perlu risau dengan keadaan, yang terutama kita punya kemauan untuk sukses dan maju,” ujar Gus Irawan Pasaribu. Menurut Gus, kemauan yang kuat untuk sukses tersebut menjadi modal besar untuk mencapai keberhasilan. Karena Allah SW T sudah memberikan jaminan kesuksesan, bagi orang-orang yang mau mengubah keadaannya menjadi lebih baik. “Allah SWT sudah berjanji, tidak ada yang mampu mengubah nasib suatu kaum, selain kaum itu sendiri. Maka kita pun harus mau mengubah hidup kita, maka Allah SWT akan memudahkannya,” terang mantan Direktur Utama PT Bank Sumut ini. Selanjutnya Gus bersama isteri dan keluarga besarnya

menyerahkan langsung bingkisan dan santunan pada anak yatim tersebut. Tak lupa, Gus terus memberikan kata-kata motivasinya. Aura kebahagian jelas terlihat dari wajah Gus dan anak-anak. Penggagas acara, yang juga abang kandung Gus Irawan Pasaribu, Panusunan Pasaribu, dalam sambutannya menambahkan kegiatan ini menandakan menjelang Ramadhan masih banyak anak-anak yatim yang perlu diperhatikan. Kehadiran anak-anak yatim ini menjadi wujud syukur pihaknya untuk mengawali perjuangan memenangkan Gus Irawan sebagai Gubernur Sumut 2013 – 2018. “Kami mohon doa dari anak-anak kami ini, dengan harapan, Allah SWT akan memudahkan dan memberkahi langkah kita di depan. Kiranya apa yang kita lakukan, akan menjadi nilai ibadah,” terangnya.(m06)


Medan Metropolitan

WASPADA Jumat 20 Juli 2012

A3

Kadisbudpar Diminta Awasi Jual-Beli Stan Ramadhan Fair

Waspada/Surya Efendi

SEJUMLAH pekerja sedang membangun tenda Ramadhan Fair di ruas Jln. Masjid Raya, Kamis (19/7). Ramadhan Fair pada tahun ini akan dibuka secara resmi pada 25 Juli dan berakhir pada 17 Agustus 2012.

MEDAN (Waspada): Puluhan massa yang tergabung dalam Jaringan Keadilan Nusantara (Jaksa) dan Lembaga Pemuda Kreatif (Lapak) menggelar aksi unjukrasa di Kantor Wali Kota Medan, Kamis (19/7). Mereka meminta kepada Kepala Dinas Kebudayaan dan Pariwisata (Kadisbudpar) Kota Medan Busral Manan mengawasi dengan ketat proses penyaluran stan-stan Ramadhan Fair yang diselenggarakan tahun ini. Ada indikasi stan yang disediakan tidak tepat sasaran, bahkan diduga ada stan yang dijual sebesar Rp3-5 juta. “Kami meminta kejelasan Kadisbudpar Kota Medan Busral Manan. Karena ada dugaan stan-stan Ramadan Fair diberikan kepada staf Disbudpar Kota Medan,” kata Syawaluddin Harahap selaku koordinator aksi. Menurut Syawaluddin, tujuan diadakan Ramadhan Fair di dua tempat untuk memeriahkan bulan suci Ramadhan dan membantu masyarakat kecil

ekonomi menengah ke bawah. “Mendengar hal ini, masyarakat Kota Medan semakin tidak nyaman sehingga menimbulkan krisis kepercayaan terhadap elitelit Pemko Medan,” jelasnya. Kadisbudpar Kota Medan Busral Manan melalui Kabid Promosi Disbudpar Kota Medan Agus Suriyono membantah pihaknya melakukan jual beli stan Ramadhan Fair. “Mana ada kita jual beli stan. Proses pengundian juga baru selesai dan kita lakukan secara terbuka di depan halamanWisma Kartini. Seluruh pemohon yang masuk ke kita sebanyak 500 lebih kita undang untuk hadir dan nomor pemohon yang tercabut langsung kita proses di situ,” ucap Agus. Jika ada pedagang yang nomornya tidak tercabut saat pengundian, seharusnya bisa berbesar hati dan dapat mengikutinya pada tahun depan. “Kalau tidak menang dalam pengundian, jangan tuding Disbudpar melakukan jual beli stan,” tegas Agus.(m50)

Potret Masyarakat Kampung Kubur

Terbiasa Penggerebekan MEDAN (Waspada): Kampung kubur, nama ini begitu tersohor di Kota Medan setelah aparat gabungan TNI-Polri menggerebek lokasi tersebut karena disinyalir menjadi tempat peredaran narkoba. Di jalan menyerupai gang sepanjang sekira 1 km itu, terdapat sekitar 170 rumah warga. Konon, ada di antara warga yang disebut-sebut menyediakan tempat untuk menggunakan narkoba. Paling tidak itu yang dikatakan warga di sana dan beberapa orang yang pernah menikmati narkoba di Kampung Kubur. Lokasinya berada di kawasan Jln. Zainul Arifin, Kelurahan Petisah Tengah, Kec. Medan Pe-

tisah. Kamis (19/7) siang, Waspada menelusuri jalan itu, pasca penggerebekan dilakukan ratusan aparat gabungan TNI-Polri. Dari pengamatan Waspada, situasi di sana terlihat biasabiasa saja. Tidak terlihat kegusaran diraut wajah masyarakat setempat. Mereka seolah-olah sudah terbiasa dengan penggerebekan yang dilakukan pihak kepolisian. Padahal sehari sebelumnya, ratusan aparat kepolisian dan TNI bersenjata lengkap, menggerebek Kampung Kubur. Selain menangkap tiga tersangka, polisi juga memeriksa seluruh warga yang keluar dan masuk ke Kampung Kubur. Bahkan, para pelajar berseragam SMP juga tidak luput dari penggeledahan. Bagian kebanyakan masya-

Muspika Medan Barat Razia Rumah Kos MEDAN (Waspada): Sepasang remaja yang masih berstatus pelajar dan mahasiswa dijaring oleh unsur Muspika Kecamatan Medan Barat, saat melakukan razia di sejumlah tempat kos-kosan di Kelurahan Sei Agul, Kamis (19/7). Remaja berinisial DAS, 22, mahasiswa perguruan tinggi swasta dan teman wanitanya berinisial MS ,17, ditemukan berada dalam satu kamar kos di Lingkungan II, Jalan Danau Marsabut, Kel. Sei Agul, sedangkan seorang lagi wanita berinisial CA, 20, diamankan dari dalam kamar kos karena tidak memiliki identitas. Ketiga penghuni kamar kos tersebut selanjutnya dibawa ke kantor Lurah Sei Agul untuk menjalani pemeriksaan. Lurah Sei Agul Yuda P Setiawan yang dikonfirmasiWaspada menjelaskan, setiap lingkungan di wilayahnya terdapat beberapa rumah kos yang dihuni oleh mahasiswa atau pekerja dari luar wilayahnya. Sebagian telah melapor kepada kepala lingkungan setempat dan sebagian lagi tidak ada yang melapor. “Ketiga orang yang diamankan karena tidak memiliki kartu tanda penduduk dan berada di dalam kamar dan bukan suami istri,” sebutnya. Dijelaskan dia, keberadaan sepasang remaja yang berada

dalam satu kamar tersebut masih ditelusuri dan kedua orangtua masing-masing segera dipanggil dan akan dikembalikan kepada keluarganya. Saat melakukan razia, unsur Muspika Kecamatan Medan Barat didampingi Kapolsek Medan Barat Kompol Nasrun Pasaribu, personel Koramil Medan Barat dan sejumlah kepala lingkungan di Kelurahan Sei Agul. Razia dilakukan di tempat kos Elite dan Nabila Kos. Ditempat ini, semua penghuni kos dirazia serta dilakukan pemeriksaan dan mereka semua memiliki kartu tanda penduduk (KTP). Pihak kelurahan hanya menahan KTP para penghuni kos karena kebanyakan dari luar kota. “Saya kuliah di Medan dan KTP saya memang KTP luar Medan,”ujar Indah, 20, salah seorang penghuni kamar kos. Selanjutnya, petugas melakukan razia ke Nabila Kos. Dari tempat ini, petugas mengamankan dua wanita dan satu pria dari tempat ini. Kedua wanita tersebut diamankan yakni MS, 17, warga Jln. Diponegoro, Gunung Sitoli, dan CA, 20, karena tak mempunyai identitas lengkap. Sementara yang pria, DAS, 23, warga Jalan HM Joni Gang Cemara, Medan, diamankan karena kedapatan di dalam kamar kos bersama MS. (h04)

rakat Kampung Kubur, pemandangan seperti itu merupakan hal yang biasa dan menjadi “tontonan”. Seperti dikatakan seorang ibu tua, warga Kampung Kubur. “Penggerebekan yang dilakukan polisi kemarin, merupakan hal biasa. Karena sebelumnya polisi pernah melakukan penggerebekan, tetapi aktivitas peredaran narkoba di Kampung Kubur tetap berjalan,” ujarnya. Seorang mantan pemakai narkoba yang pernah merasakan “surganya” Kampung Kubur bercerita kepada Waspada tentang seluk-beluk peredaran narkoba di kawasan itu. Menurutnya, ada dua pintu masuk ke Kam-pung Kubur, satu berupa gang yang hanya bisa dilalui pejalan kaki dan sepedamotor. Satu lagi pintu masuk dari Jln. Zainul Arifin yang bisa dilalui mobil. “Razia yang dilakukan polisi kemarin, saya rasa tidak berpengaruh dengan peredaran narkoba di kawasan itu. Saya yakin tiga tersangka yang

ditangkap kemarin hanya kurir dan pemakai saja. Sedangkan bandarnya sama sekali tidak disentuh,” kata dia enggan menyebutkan nama bandar besar di kawasan tersebut. Sementara itu, Kepling I Kelurahan Petisah Tengah Emmy Tariman US mengatakan, penggerebekan yang dilakukan polisi di kawasan Kampung Kubur sudah dua kali dilakukan pada tahun 2012. Di tahun 2011, polisi juga pernah melakukan penggerebekan terkait peredaran narkoba. “Saya sudah sering melakukan pengecekan di lokasi. Tapi ketika saya datang, mereka bubar,” ujarnya. Dua polisi Sebelumnya, Polsek Medan Baru menangkap dua oknum polisi di kawasan Kampung Kubur. Kedua oknum tersebut diduga usai membeli narkoba. Salah seorang oknum Polri yang ditangkap berpangkat Bintara dan bertugas di Polres Langkat. Dia ditangkap timsus Reskrim Polsek Medan Baru dibantu aparat Brimobdasu ketika

sedang menumpang betor di Jln. Balai Kota depan hotel Darma Deli. Selain menangkap tersangka, polisi juga menyita barang bukti satu paket sabu yang dibeli dari kawasan Kampung Kubur. Beberapa pekan sebelumnya, seorang perwira polisi berpangkat AKP ditangkap di kawasan Kampung Kubur. Saat itu, dia keluar dari lokasi tersebut usai mengkonsumsi sabu-sabu. Dari saku celananya ditemukan satu paket sabu-sabu. Dari pengembangan yang dilakukan pihak kepolisian diketahui bahwa pembeli narkoba jenis ganja dan sabu-sabu di kawasan Kampung Kubur, tidak hanya berasal dari Medan, tapi dari daerah lainnya.(tim)

Waspada/ist

SUASANA perayaan HUT ke-51 IKWI Sumatera Utara di Gedung PWI Parada Harahap Jln. Adinegoro Medan, Kamis (19/7) sore.

IKWI Sumut Rayakan HUT Ke 51

Komit Wujudkan Kebersamaan MEDAN (Waspada): Ikatan Keluarga Wartawan Indonesia (IKWI) Sumatera Utara merayakan HUT ke 51 secara sederhana namun cukup bermakna di Gedung PWI Parada Harahap Jln. Adinegoro Medan, Kamis (19/7) sore. Acara dikemas menarik dengan rangkaian pemotongan kue ulang tahun oleh Ketua IKWI Sumut Hj Dewi Budiati Teruna Jasa Said diikuti oleh para pengurus IKWI dan warakuri IKWI disertai lagu ‘Selamat Ulang Tahun’ serta diakhiri dengan ceramah menjelang Ramadhan oleh Al Ustadz H Ali. Hadir Pembina IKWI Sumut yang juga Ketua Serikat Perusahaan Surat Kabar (SPS) Sumut H Teruna Jasa Said, Waki Ketua Bidang Organisasi PWI Sumut Khairul Muslim, Sekretaris PWI Sumut Edward Tahir, dan pengurus PWI lainnya. Ketua Umum IKWI Pusat Hj Ummi Rahayu Margiono dalam sambutannya pada HUT ke 51 IKWI dibacakan Dewi Budiati mengatakan, IKWI berdiri pada 19 Juli 1961, tepat 51 tahun pada Kamis (19/7). Berarti sejak 51 tahun lalu, IKWI sudah ikut berkiprah dan memberikan kontribusinya bagi pembangunan. Tujuan dibentuknya IKWI sebagai wadah istri wartawan dan karyawan pers itu untuk

mewujudkan dan mempererat tali silaturahmi sesama anggota. Selain itu, IKWI juga bertujuan membina kesejahteraan lahir dan bathin dalam rangka menunjang jajaran pers. Dalam visi dan misi IKWI sudah jelas, yakni berkomitmen membangun kebersamaan, namun sulit memang mewujudkannya. ”Kita sadari bahwa belum semua keluarga pers mengetahui dan mengenal antar sesamanya. Dengan wadah IKWI ini marilah kita bangun kebersamaan dan silaturahmi yang baik,” kata Ummi yang berharap berbagai program IKWI di daerah dapat terealisir dengan baik. Ummi yakin jika semua program itu dikerjakan dengan sikap optimistis maka akan dapat terlaksana dengan baik. “Kita semua dapat membina solidaritas dan kesetiakawanan anggota seperti sedang sakit dan susah. Marilah saling bantu,” sebutnya. Menurut dia, sangat baik sekali jika IKWI menggelar aksi sosial seperti donor darah yang nanti dapat bekerjasama dengan pemerintah maupun swasta. “Ke depan IKWI Sumut dapat menjadi percontohan nasional,” katanya. Wakil Ketua Bidang IKWI Sumut Khairul Muslim mewakili Ketua PWI Sumut M Syahrir

menuturkan, kehadiran IKWI dapat semakin mempererat sekaligus mengukuhkan persahabatan yang sudah terjalin dengan baik. “Solidaritas IKWI perlu ditingkatkan yang gilirannya nanti dapat meujudkan kesejahteraan anggota,” katanya. Al Ustadz M Ali dalam cermahnya mengatakan, bahwa semua yang kita jalankan ini karena izin Allah SWT. Namun meraih kesuksesan dalam bekerja perlu manajemen waktu yang tepat sehingga antara kerja dan ibadah dapat dijalankan secara bersama. ”Dalam kehidupan kita, bukan uang atau harta yang membuat tenang, melainkan Allah yang memasukkan ketenangan itu ke dalam diri kita,” katanya. Untuk itu, Allah juga memerintahkan kepada umat untuk berpuasa selama bulan Ramadhan dan wajib hukumnya. Memerintahkan kepada umatnya untuk selalu menghadiri majelis taklim, bersedekah dan zakat. Ketua IKWI Sumut Hj Dewi Budiati TJS dan Ketua SPS Sumut H Teruna Jasa Said juga memberikan tali asih kepada janda wartawan (warakawuri) untuk menyambut bulan suci Ramadhan. Secara simbolis diterima Hj Misfaniyah. (m08)


A4

Pengumuman Hasil Seleksi UMPN Polmed Gelombang Ke-2 Tahun 2012

Cadangan di Prodi ME-Pagi (10001)=15 512-11-00783 Primadona Tarigan 512-33-01509 Hakim Muttaqin P 512-11-00100 Joko Suhendro 512-11-01344 FEBRI BAHRI 512-11-00499 WINNER SITANGGANG 512-33-02397 willi sepman nababan 512-33-01089 TAUFIK KAMIL NASUTION 512-11-02044 TUAN AGUNG HUTAGAOL 512-33-02091 Bornok Lingga 512-11-01010 DOLLI DUANITO MALAU 512-11-01624 Henri W P Siahaan 512-11-00285 surya dharma 512-33-00860 Kacandra Sihotang 512-33-02030 Aron Dolmer Lumbantobing 512-33-01616 Andi Salomo Cadangan di Prodi EN-Pagi (10002) = 15 512-11-01713 RAHAYU 512-33-00386 Agus Mindiawati Hrp 512-33-02373 Sutrisno S 512-11-01830 EVA PURBA 512-11-01057 Dian Ade Sitopu 512-11-02072 Daniel Limbong 512-11-01074 ALBERT SAMSON TAMBUNAN 512-11-02004 CRISTIANY M SILALAHI 512-11-01839 OKTAVIANI S 512-11-01523 Muhammad Arief Fadillah 512-11-00219 MUHAMMAD REZA FAHLEVI 512-11-00091 ferdinand malau 512-11-01382 Maria Fransisca Zega 512-11-01152 Ulfa muharrammaini 512-11-01127 DAVID ISKANDAR SIBURIAN Cadangan di Prodi SI-Pagi (10003) = 15 512-11-00108 Rizky Alexander Purba 512-11-00460 RADEMA F CHRISTIAN S 512-33-01115 JUWITA CORRY B MANALU 512-11-02029 MUHAMMAD ALFI 512-33-00233 Syahra Mutia Ulfa 512-33-02097 FIQRIANSYAH 512-33-00946 YOSEPHIN LIMBONG 512-11-01924 ANNISA DEVI SARAGIH 512-33-01055 Mardian E P B B 512-33-01350 nova mintha ito br napitupulu 512-33-01789 Steven Christian Pinem 512-33-00885 MARIA ANDRIANI BR GINTING 512-33-00171 ELFRIDA ANASTASIA SIMBOLON 512-33-00674 ENJELINA N S 512-33-01761 Maya Ayu Puspita Cadangan di Prodi EL-Pagi (10004) = 15 512-11-00065 Muhammad Soleh 512-11-01418 JEFRY ARISTON LUMBAN GAOL 512-11-01332 Tomy Kosandra 512-11-02049 CIUS K MANURUNG 512-11-01144 TRI AYU PRATIWI 512-11-00982 Serpiko 512-33-02243 Herianto Fransiskus Sihotang 512-33-01671 LINDSAY F M RUMAPEA 512-33-00996 I R V A N BONA CHRISTOVER SIDAURUK 512-11-01814 AGUS EDI SAPUTRA 512-33-00661 martin herman 512-33-01560 KURNIAWAN KUKUH PERDANA 512-33-01173 KATERINE SILABAN 512-11-01778 ahmad sofian 512-11-01402 HENDRA FAUZY Cadangan di Prodi EK-Pagi (10005) = 15 512-11-00645 NUR AZMARSYAH 512-11-01149 Richson Siburian 512-33-00856 EGRITHA TAMPUBOLON 512-33-01013 ANDRE GLUCK STEIG SIMANULLANG 512-33-01779 FIFIAN O SIMANJUNTAK 512-11-01347 Ronny Tigor Sitanggang 512-11-01097 Anrico Boy Riansyam 512-33-00105 RESNA N. LUMBANTORUAN 512-11-00695 Ayu Wandira Br Kaban 512-11-01098 Frederich Artswendo 512-11-00785 Pardo Goklas Manalu 512-11-02417 deyu zahraini putri 512-11-01201 willy pranata 512-33-01595 Mawati Naipospos 512-11-02203 Ahmad Rizki Lubis Cadangan di Prodi TK-Pagi (10006) = 15 512-11-01704 AGUS RIZKI 512-11-01552 IVEN MT SIMANJUNTAK 512-11-00715 Muhammad Ihsan Habwandi 512-33-01282 Yudhi Abdillah 512-33-02109 AYU LESTARI N 512-33-00292 Dewantara Sinurat 512-11-01047 Mhd. Yani Alan Nuary 512-11-02173 priska sri indrayani 512-33-01134 Ristama Siboro 512-33-01144 Lusiana Munthe 512-33-01101 Daina Hilda Aritonang 512-33-02219 Fhida Junitafranata Samosir 512-33-01277 Eunike Sinaga 512-11-01901 MUTIARA C SIANIPAR 512-11-02219 Elisa Franciska M Cadangan di Prodi MI-Sore (10010) = 15 512-11-01297 CICI WAHYU PERTIWI 512-33-00488 Tengku Annisha Faradila 512-33-00213 ARTHA DINAMALA 512-33-01220 KAMELIANI BANGUN 512-11-01239 NISHA TITA MUTIARNI 512-33-00925 RAHMAH MAYA SARI 512-33-00788 Marshinta R. U. H. 512-33-01031 yuni shara 512-33-00174 Putri Liani Pasaribu 512-33-00367 M. FAISAL RIZKY HASIBUAN 512-11-00734 Mey Friska Saragih 512-33-00615 MEI MINDUANA MANIK 512-11-01799 NURUL ATIKAH 512-11-00104 deni martogi 512-33-00870 AGUSTINA SIMORANGKIR Cadangan di Prodi CE-Sore (10011) = 15 512-11-00019 Angga Syahputra Sitepu 512-33-00088 Surya Gansa Suranta .S 512-33-02179 Luthfi 512-11-01791 Basri Habibie 512-11-01119 JUNIARTHA MANURUNG 512-11-00826 Ikram Hadie Mhd S 512-33-01645 Ratu Mutiara Siregar 512-11-01576 IRMA AZWANTY DALIMUNTHE 512-11-01567 Nicodemus 512-11-01886 Theresia M S 512-11-02211 Ronald H. M. 512-11-01113 EKA AZIZULYAN S 512-11-00902 N 512-33-01833 Dessy Qomariah Siregar 512-11-01549 ANNISA EKA DESFIANI Cadangan di Prodi JLN-JBTN (10013) = 25 512-11-01541 Selamat Eko Nainggolan 512-33-01868 ANDRY B PANDIANGAN 512-33-01371 ROY W S TARIGAN 512-11-02429 Gerhard Simbolon 512-11-01419 NOVEL HOTMARITO SIMATUPANG 512-33-01866 YESSICA YOHANA LUMBAN BATU 512-11-01945 RISNA L S 512-11-02382 DWI ASTUTI.M 512-33-00639 ANDIKA PRATAMA SIMANJUNTAK 512-11-02225 Ibnu Uswah Fadhilillah 512-11-01728 Nyomanda Siagian 512-33-02201 Guntaran Batara Sitinjak 512-33-00775 Eva Catryn Sitohang 512-11-01155 LAMHOT INDRA 512-11-02432 Fazar Andriansyah Sembiring 512-11-01121 Dimas Dicky Purnomo 512-11-00334 ilham fajar winata 512-11-00660 Rikki Solagratia Padang 512-33-01130 cadito diorate manurung 512-33-01025 Elvan Rifiyanto Pane 512-11-01995 Eli Santoso Simamora 512-11-00624 Denny Kalpader Pasaribu 512-11-02353 Fera S Nababan 512-11-02104 Lijan Volexius Ginting 512-11-02075 Christoper Casanova Goldstar Panjaitan Cadangan di Prodi MGMT-RKG (10014) = 25 512-33-00880 Sri Haryanti Tambunan 512-11-01996 RUMATA R.T 512-33-00823 Suhadi Utomo 512-11-01270 M bayu restu wibowo 512-33-01085 JOHN MARIO PANJAITAN

512-33-01040 ROBBY HARYANTO 512-33-00224 SIMON SIHOMBING 512-11-00985 RAYMOND ARMAS GINTING 512-33-00442 Nirania Galuh Putri 512-33-01647 SEMANGAT JAYA GEA 512-11-00858 Nasib s lumban tobing 512-33-02160 ELVI ZAHARA 512-11-01280 EMIL GUNAWAN MARPAUNG 512-11-02375 Muhamad Abdillah 512-33-01818 Christina Aritonang 512-33-01341 DESI RIKA NATALYA SITANGGANG 512-11-01304 MAY SYARAH YUNITA 512-33-01353 Rizki Aulia Kinanti Nasution 512-11-02172 HARIATY INDRA LESMANA PURBA 512-33-01054 DYAN ROYAN NUGRAHA 512-11-02233 REZIONO PRATAMA 512-11-00140 Richie Rinaldo 512-11-01055 sri rezeki br.panjaitan 512-11-00587 ROZECKY FRANSISKUS LUMBAN GAOL 512-11-02264 FAUZIAH NURSYAFITRI Cadangan di Prodi ME-Sore (10101) = 15 512-11-00454 Geralda Terbit Hagana Keliat 512-11-00679 yudha kuswenda 512-11-00924 MHD KHUZEIN Z LUBIS 512-11-01982 muhammad zaky 512-33-00761 M. Ridho Rivaldi 512-11-00446 ALEKS J HUTAPEA 512-33-02132 RIKKOT J.A SIHOMBING 512-33-00002 Haris Munandar Nasution 512-11-01707 KHAIRYAN SAZLI 512-11-01480 JOHN GABRIEL MANURUNG 512-11-00185 TULUS TUA SIRINGORINGO 512-11-00174 Muhammad Suhairi 512-11-02255 elfredo siallagan 512-11-02014 Jonathan P Sianturi 512-11-01690 IRVANDI SILALAHI Cadangan di Prodi EN-Sore (10102) = 15 512-11-00396 RUMIA PASARIBU 512-11-00298 RAMDES SIMANDALAHI 512-11-01628 ANAN SITOMPUL 512-11-00037 ZULKIFLI P SIANTURI 512-11-01219 Immanuel Panggabean 512-11-00506 olivia pohan 512-11-00874 MOURID JANUARI SILAEN 512-33-01728 Jennis B Purba 512-11-01979 F.NORA SARAGIH 512-11-00413 Suci Aprilla Sitepu 512-11-00536 NIA YULITA SINURAT 512-11-02154 DWI RIZKI ANANDA PUTRI 512-11-02105 DESMA RANDIKA 512-11-01903 Musthofa Husaini Pulungan 512-11-00776 TRI BUDI YATMA Cadangan di Prodi SI-Sore (10103) = 15 512-11-00021 FERIOLAN SITANGGANG 512-33-00656 Riama Helmi Acosta Sirait 512-11-02281 RENOL T PURBA 512-11-00498 Frans Boho Parasian Silalahi 512-33-00526 NOVITASARI 512-11-01643 RAPIKA ROSALIA 512-33-01390 M Irshan Padang 512-33-00640 KRISTO SITANGGANG 512-33-01847 Robby Raya Immanuel Purba 512-33-00045 Ade Elisabeth Munthe 512-11-00914 Stephanie Rebecca 512-11-02191 M.RIDWANSYAH 512-33-01956 Umar Toha Dalimunthe 512-33-01064 Lasria simarmata 512-11-02424 Mario Ryadhi Bantu Nababan Cadangan di Prodi EL-Sore (10104) = 15 512-11-01148 Ady Mandala Putra 512-11-00235 Chandra Danova Siringo Ringo 512-11-01372 Philip Pakpahan 512-11-01361 melinda wulandari S 512-33-01065 DICKY SIAGIAN 512-11-02276 addo hasian gultom 512-33-01451 TUMBURTUA SIANTURI 512-11-02249 Matias Reggi M 512-33-01649 Rahmad Suriadi 512-11-00974 SANDI FERNANDO NAPITUPULU 512-11-02092 Warta A SIhite 512-11-00330 Linggom Martinus Purba 512-11-00264 Rolas T Naibaho 512-11-00027 Zainul Bahri 512-11-01675 Dicky murdiansyah Cadangan di Prodi EK-Sore (10105) = 15 512-11-02106 Sahro 512-11-01944 Rudi aprianto 512-11-00068 SEHAT R SIANIPAR 512-11-00939 KHAIDAR ALI SIMAMORA 512-11-00709 Jodi S Sihombing 512-33-00854 RIKA IDA LESTARI HUTAPEA 512-33-00236 M.RASYIDI SIREGAR 512-33-02113 ECOCANDRA S 512-11-01705 Roy Junjungan Lubis 512-11-01569 Yosef Andrean S 512-33-01766 Jhon stones 512-33-01651 novitasari simarmata 512-33-00598 Bangun Garuda Jaya Kokoh Sihombing 512-11-00915 MEDY SAPUTRA BARUS 512-33-01000 DAYURNI LESTARI SIMATUPANG Cadangan di Prodi TK-Sore (10106) = 15 512-33-00578 RIZKI AGUNG HASIBUAN 512-11-01496 RAHMAD ADIL HARAHAP 512-11-00058 muhammad zulbakri rangkuti 512-11-02083 Silvia Kellysa 512-11-01184 Ernawaty Rosita Situmeang 512-11-01780 DION TRISON ERSA SILALAHI 512-33-01771 SITI N SITOHANG 512-11-02052 sedima lingga 512-11-01081 Mutia Dinulia Putri 512-11-00717 Andre Simangunsong 512-11-02384 SELPI W SIHOMBING 512-11-02023 HENRI P SIAGIAN 512-11-00484 Amdaniel Marbun 512-33-01201 Rifka Purnama Sari S 512-11-01425 MICHAEL S SIMBOLON Cadangan di Prodi CE-Intntl (10031) = 25 512-11-00060 SYARIFUDDIN FAHMI AHMAD 512-11-00464 Evelyn Margaretta Legisna Sirait 512-33-02352 IRAMOTI PURBA 512-33-01069 ANNI L LUMBANRAJA 512-11-02100 Zakia Amelia 512-11-01117 pebrina tarigan 512-11-00225 Muhammad Fachrozzy 512-11-00226 SURYADIANSYAH 512-33-02020 muhammad riandi andika 512-11-02435 Chrismanto N Manik 512-11-02038 SEPTIKA RANI SILITONGA 512-11-02170 Ricko Tito Andre Nugraha 512-11-00867 WAHYUDIN GULTOM 512-11-01513 crissandy richard sinaga 512-33-01502 rifai nasution 512-33-01340 TRIA YUNITA SINAGA 512-11-00102 SITI RUKMANA 512-11-02080 Jhones Arfan Telaumbanua 512-11-02352 Adinawa Siallagan 512-11-01607 Pangeran Napitupulu 512-11-01980 Maria C Q S 512-11-00977 PARSAORAN MANULLANG 512-11-01650 Arman Syahputra Siregar 512-11-00241 ERICA MELYSA SEMBIRING 512-11-00031 Muhammad Aryz Ishomi Lulus di Prodi ME-Pagi (10001) = 21 512-11-00095 Ferdinanta Lembeng 512-11-00228 RIZKI HAMDANI NST 512-11-00402 BREZNEV TITO 512-11-00440 Kornelius Sidabutar 512-11-00567 Bawono Satriaji 512-11-00584 Verdi Elisa Tarigan 512-11-00946 Muhammad Tirmidzi 512-11-01004 Dicky Vincencius 512-11-01295 OKTOBERLIN T 512-11-01408 FRENGKY ELYES

512-11-01654 512-11-01730 512-11-01759 512-11-02262 512-33-00882 512-33-00921 512-33-01118 512-33-01261 512-33-01312 512-33-01441

m abdulfattah SUTOYO SIBURIAN STARPOP HARYADI SINURAT HARI GUMELAR ERIJON SIHOTANG MACHFUDZ REZA PAIRIN Putra MarianusTarigan Mela F S REINALDI PRAYOGI TAMPUBOLON 512-33-01510 muhammad alfi khaira Lulus di Prodi EN-Pagi (10002) = 16 512-11-00276 Ardiansyah Lubis 512-11-00278 TEGUH WIBOWO 512-11-01037 Sebastian Siregar 512-11-01105 Rierdo L Manalu 512-11-01170 cokmalando nababan 512-11-01192 RENSTI BR SINAGA 512-11-01629 Martin Luther Purba 512-11-01872 ricky kristoven tamsar 512-11-01882 RUMIRIS S 512-33-00506 ADETHIA LUFTI NST 512-33-01046 Hanna Astrid Matondang 512-33-01165 CHRISTINE NOVANI SAMOSIR 512-33-01223 RUTH ADELIND SIRINGORINGO 512-33-01679 Memita Ristyani Lumban Gaol 512-33-01780 oky januarto manurung 512-33-02114 JHON EDY S. Lulus di Prodi SI-Pagi (10003) = 26 512-11-00096 Desi Natalia Saragi 512-11-00605 Muhammad Affandi 512-11-00983 YAN RIDO GIRSANG 512-11-01012 Gustika Winata 512-11-01153 Try Ananda Simanjuntak 512-11-01158 Clara Bangun 512-11-01288 Narisya Alifa 512-11-01290 Angga IgnasiusTarigan 512-11-01519 MELINA VIKA A 512-11-01571 ANETTE PARDEDE 512-11-01601 Nia Novranda Pertiwi 512-11-01793 Desi Naibaho 512-11-01802 RAJAMIN SARAGIH 512-11-02089 Ronald Berutu 512-11-02110 irwan situmorang 512-11-02212 Dewi Lestari 512-11-02277 Billy Emkel Gudsanov 512-11-02376 ALEXANDER JEREMIA HASUDUNGAN GURNING 512-33-00247 febryn claudya angeline tambunan 512-33-00249 Fratika Nurifni 512-33-00790 Paulus F Panjaitan 512-33-00914 Gomgom Marpaung 512-33-01252 JESYKA N AMBARITA 512-33-01419 DIANA LUMBANTOBING 512-33-01709 EVY APRIL MANALU 512-33-02359 DINDA MAULINA NST Lulus di Prodi EL-Pagi (10004) = 17 512-11-00491 Rahmat Arianto 512-11-00501 Tania SundarikaTarigan 512-11-00557 ROBERTO RUBEN SILITONGA 512-11-00598 Teguhta Saragih 512-11-00714 MUHAMMAD ANSHARI 512-11-01017 Marulitua Sinaga 512-11-01490 Mhd. Ikhsan Widodo 512-11-01533 sandro manurung 512-11-01850 Yan Bastian Lumbantobing 512-11-01861 ABDON MARKE BANCIN 512-11-01899 Harianto Novendly 512-11-02113 FRANS J E SILALAHI 512-11-02192 Ahmad Bahar 512-11-02200 Dhian Pertiwi 512-11-02292 Ramlan Sihotang 512-33-01215 Aulia Khaizairani 512-33-01841 WAHYUDI LAM MARANATHA SIBAGARIANG Lulus di Prodi EK-Pagi (10005) = 12 512-11-00462 Panca Gundari 512-11-00835 raja endar derry pohan 512-11-01225 Dwi Risti Mawaddah M 512-11-01350 Yosua Agust 512-11-01622 fernando 512-11-01888 Dian Panggabean 512-11-01906 Goster Renson Manik 512-11-02174 Charlie M Nainggolan 512-11-02214 OBY VIJAY SITORUS 512-33-00043 Dewinta menak manalu 512-33-01549 SONI HADIAHTI HAREFA 512-33-01636 Zimrih M Sirait Lulus di Prodi TK-Pagi (10006) = 17 512-11-00090 Rima Rehulina Br Tarigan 512-11-00926 Kana Melvia Rosa 512-11-00968 GOSPEL SAMOSIR 512-11-01191 TEDDY J SIHALOHO 512-11-01587 Dame Maria Sihombing 512-11-01604 Rudi Sinaga 512-11-01661 JULPRIDA P PURBA 512-11-01834 Evi Sari Ariesta 512-11-01840 Andriana M.L.Butar-Butar 512-11-01981 RIBKA SOFIE GRACE M 512-33-00473 RUMIRIS AGUSTINA 512-33-00654 Theresia Aruan 512-33-01106 Yunika Lucianna Manihuruk 512-33-01200 Mariana Pulungan 512-33-01303 Yhido Vacius L Tobing 512-33-01524 Rosade E. Hutasoit 512-33-01622 fani melisa m p s Lulus di Prodi MI-Sore (10010) = 12 512-11-00362 BELLA JORETTA BR.SURBAKTI 512-11-00726 BERRY BERMANA GINTING 512-11-01000 rissa aulia pasaribu 512-11-01096 Ahmad Fauzan Azmi 512-11-01147 DESSY YUSVIKA Y 512-11-01218 Fransiska Situmorang 512-33-00291 Ephraim Kesaba Silalahi 512-33-00902 LIDIA NATALIA MANIK 512-33-01349 Gita Amalia 512-33-02028 Budiman Zuhri 512-33-02129 Muhammad Azhari Siregar 512-33-02291 SITI SALIMAH NASUTION Lulus di Prodi CE-Sore (10011) = 25 512-11-00760 Muhammad Rio Kushadi Mulia 512-11-00934 ARDI BETESDA CLINTA GINTING 512-11-01211 bunga pratiwi 512-11-01296 Novi Triana 512-11-01301 Grace Monika Silaen 512-11-01303 PETRUS A. T. 512-11-01346 Yulin Zurina 512-11-01456 arif syuhada 512-11-01550 Febby Faudina Nestia 512-11-01627 Matius D Sinurat 512-11-01636 Dewi Murni Tanjung 512-11-02053 FITRI ANDINI SIHOMBING 512-11-02188 JONATHAN A H 512-11-02411 Yohana Fithri 512-33-00061 FAISAL AZIZ 512-33-00270 khairina qisthia 512-33-00529 Siti Hawa 512-33-00652 Hamdi Fadli Kurniawan 512-33-00982 Ryanti Martini Damanik 512-33-01126 TRISKA P.I.H 512-33-01253 Dumora M Sijabat 512-33-01339 LUMALO P HARAHAP 512-33-01500 Juliana Malau 512-33-01587 Yudhy Samuel Putra Sanraiz Simbolon 512-33-01880 INDAH KURNIAWATI SIHOMBING Lulus di Prodi JLN-JBTN (10013) = 45 512-11-00099 Moses Sinaga 512-11-00302 Jaka Widiandana 512-11-00469 Gery Trendy Sinaga 512-11-00552 RUTH KAYA S 512-11-00909 Tama Rama Sianipar 512-11-00921 Muhammad Nefriansyah Hasibuan 512-11-00962 Rio Sastro Sianturi 512-11-01025 FRANS GURO SIRAIT 512-11-01032 Monica Situmorang 512-11-01099 amaluddin 512-11-01159 LIONITA DHYAN P. 512-11-01166 Beby Hasibuan 512-11-01207 BRAM ARTHYA NABABAN 512-11-01324 David surya manurung 512-11-01390 Ragil Gusti Maulana 512-11-01401 WIDYA WIRASASTI 512-11-01472 AZHARI RAMADHAN 512-11-01573 Yosua Siagian 512-11-01585 Mauliza D A P 512-11-01652 Muhammad Akbar 512-11-01711 Ridho Zakaria Tambunan 512-11-01862 Reynaldi Fadhil 512-11-01971 Devis H Sitorus 512-11-02022 Rudi Prasetyo Panjaitan 512-11-02030 yesika efriani damanik 512-11-02077 dini sekarwani

512-11-02086 FRANS T S BUTARBUTAR 512-11-02153 SARTONO DAMAYANTO SITORUS 512-11-02159 HANNA M F SILABAN 512-33-00250 rizki wulan murjaini 512-33-00330 JOSUA SAMOSIR 512-33-00412 Daniel Oloan Suriyadi Siiregar 512-33-00708 FAHREZA RAY HUKAMA 512-33-00772 BUNGA MEISYA PASARIBU 512-33-00808 Ryandika Gilang Putra 512-33-00968 Asri V Binventy 512-33-01114 IRAYANTI PANJAITAN 512-33-01140 Yesi Widya Sari 512-33-01468 ANDRAENA AGI SELLA 512-33-01476 ARINI TARIGAN 512-33-01642 CRISTIN DAMANIK 512-33-01719 melati angriani 512-33-01825 Andrika Fachriza Pane 512-33-01902 FITRI SURYATI HUTAURUK 512-33-01940 Christina Maretha Setia Darma Sinaga Lulus di Prodi MGMT-RKG (10014) = 45 512-11-00127 Abdi Nagara 512-11-00129 Muhammad Abdur Rahim 512-11-00345 ARIED SAMUEL SEPTIAN SINAGA 512-11-00456 BAGIANTARAS TARIGAN 512-11-00562 Muhammad Fadhil Abdillah 512-11-00615 Medina Shafira 512-11-00745 Pratisha Tridiani M 512-11-00780 Mars Widodo 512-11-00786 WINDA KHAIRUNNISA NST 512-11-00793 Aldwin Pratama Bangun 512-11-01013 Mentari Rahma Sari 512-11-01222 Yoggi Fahdri 512-11-01322 RIA ERYANI 512-11-01395 Iman Natanael Siagian 512-11-01821 Yuda R H Sembiring 512-11-01844 olawaty annissa hutagalung 512-11-01985 Dinda Ulfah Damanik 512-11-02017 Martin Wijaya Siagian 512-11-02042 alexander iskandar napitupulu 512-11-02125 TRINANDA AL FAZRI 512-11-02169 cef fandez sihombing 512-11-02179 FRANDYTULUS SIAHAAN 512-11-02238 julius f sirait 512-11-02314 DOLLY SUKMA NAINGGOLAN 512-33-00082 Margareta Simbolon 512-33-00094 Robson Markus 512-33-00315 Edho Radel Fitra Rasyid 512-33-00394 RINEHART SIRAIT 512-33-00476 Dhea Agusty Ningrum 512-33-00825 NARTI PARDOSI 512-33-00901 ROBINSAR NAINGGOLAN 512-33-00970 RUSIMAN KABEAKAN 512-33-01058 RUTH D PASARIBU 512-33-01073 Siska Pasaribu 512-33-01325 Chika M A S 512-33-01360 HALIMAH 512-33-01389 Rizky Annisa Ummamy 512-33-01525 ADELINA SIANTURI 512-33-01698 Retno Palupi 512-33-01886 SUCI SUPRIYANI 512-33-02000 ALIMA SILALAHI 512-33-02141 Cory Leni Oktavia S 512-33-02279 rizki ananda 512-33-02324 PANGIHUTAN RUMAPEA 512-33-02339 STEFANY ALAYA SITEPU Lulus di Prodi ME-Sore (10101) = 35 512-11-00356 Supriadi Sebayang 512-11-00371 Adolf fry Kusmulyanio simarmata 512-11-00492 HARLI ABDILLAH K LUBIS 512-11-00512 MIKHAEL FEBRIANO TAMPUBOLON 512-11-00711 Chandro Marbun 512-11-00747 ANDREAS PARDEDE 512-11-00804 Anugerah Tohoando Efraim 512-11-00942 DARMI LUMBAN BATU 512-11-01042 Jundi Al Badar Saragih 512-11-01138 hiskia sitorus 512-11-01194 IRWAN SINAGA 512-11-01256 Robby Nando 512-11-01329 JOSUA A SIMANGUNSONG 512-11-01348 Thomas Royman Manullang 512-11-01378 M syahri afriansyah 512-11-01406 Derycman siagian 512-11-01528 EKA SUWINDRA 512-11-01657 Achmad Febri Wardani 512-11-01697 JOHAN PALENTINO ` SITINJAK 512-11-01714 Apriadi Tarigan 512-11-01727 Aldius Herianta P 512-11-01786 COSDIMAN SIMANJUNTAK 512-11-02032 KUSNADI PANJAITAN 512-11-02060 Hery Adinata Sinaga 512-11-02201 Tepanus Marpaung 512-11-02248 sunggul sitanggang 512-33-00260 YANSEN GINTING 512-33-00453 SYAFTIAN FACHROZI 512-33-00625 NOVANDA JEFRI R BUTARBUTAR 512-33-00920 HAZFI ARIQI 512-33-00975 ivan gusmana sinaga 512-33-01217 Rio Andre Siallagan 512-33-01556 FERDI M SAMOSIR 512-33-01596 gempa efrata utomo 512-33-02006 Fananda Hardika Putra Lulus di Prodi EN-Sore (10102) = 38 512-11-00543 Primadona Pangaribuan 512-11-00803 PARTONA SILALAHI 512-11-00829 Devi Asmara Saragih 512-11-00912 LILIANA SWK 512-11-00976 SARI DAMANIK 512-11-01106 DIAN WINNY APNI 512-11-01272 SUSI ARNINGSIH 512-11-01411 Marudut Tarihoran 512-11-01481 RISKI RIAMA GURNING 512-11-01638 Richi Ridhon Alvaret sinurat 512-11-01845 FEBRY F SITANGGANG 512-11-01958 JETRO PERANGIN-ANGIN 512-11-01972 Wahyuni Ramadhani 512-11-02259 dara pita loka 512-11-02283 tri eva 512-11-02297 bernando lumban raja 512-11-02356 IRMA SIAHAAN 512-33-00132 Ananda Esterinda S 512-33-00217 NOVAWIROT SIANTURI 512-33-00231 FRANCIE PASARIBU 512-33-00379 Otto Frilyan H. Situmorang 512-33-00407 Kanigah Y Naibaho 512-33-00889 dicky maryono sibarani 512-33-00951 Margaretha Samosir 512-33-00995 Riwando sihombing 512-33-01074 IKO PRANANTA TARIGAN 512-33-01128 BENI K SIGIRO 512-33-01338 TITO RUMAPEA 512-33-01356 MIDUK D SIMAMORA 512-33-01416 erbinanta br sbr 512-33-01565 Winda sinaga 512-33-01572 Ronaldo Fidelis Nainggolan 512-33-01600 Suci Oktavilia 512-33-01755 TRYAN SARITARIGAN 512-33-01897 ELFRIDA SARI SINAGA 512-33-02134 frans aditya bangun 512-33-02234 JEFRI MARIO NAINGGOLAN 512-33-02252 CHRISTINAWATY S Lulus di Prodi SI-Sore (10103) = 35 512-11-00034 Fariz Yudhistira 512-11-00474 Ukris Saragih 512-11-00475 RUTH BESTRIA H 512-11-01137 MAJAVIER PURBA 512-11-01224 ROBERTO MANULLANG 512-11-01289 Pakto Leo Tobing 512-11-01364 Wiwik Afriella Sijabat 512-11-01373 M. Arief Siddiq 512-11-01376 PETRUS GULTOM 512-11-01397 YANRI ESTERLINA SIHOMBING 512-11-01507 AHMAD AL HIDAYAH SIREGAR 512-11-01645 Andrew Natanael Sinaga 512-11-01685 Gloria Silaban 512-11-01729 Parningotan Hutabarat 512-11-02027 ahmad nurdiansyah 512-11-02116 RIZKHAN KARIMA 512-11-02206 Jumita Wati Sinaga 512-11-02301 Agita Marsaulina Simanjuntak 512-11-02383 ayen rizal sihombing 512-33-00092 MELINA BR GULTOM 512-33-00413 RAHMAD NOVRIANSYAH MANIK 512-33-00570 Fachriyan Chalid 512-33-00770 Deby Andriana 512-33-00862 Manuel Aruan 512-33-00865 EBRINI IRESATARIGAN 512-33-00907 MONIKA ELISABETH NAINGGOLAN 512-33-01301 KADRO KASHOGI NAINGGOLAN 512-33-01368 UMI PUTRIJA ELYSTA 512-33-01541 JANRIADI SIANTURI

512-33-01607 512-33-01620 512-33-01640 512-33-02119 512-33-02135 512-33-02334

David Paulin CHICHILIA BRAHMANA ELINA MELVA MALAU Raymon Pardede SULASTRI MARBUN Elda Adriani Simarmata

Lulus di Prodi EL-Sore (10104) = 23 512-11-00594 ido judika silitonga 512-11-00602 Besli Ivan Manurung 512-11-00609 Nataniel Napitupulu 512-11-00725 RINO CIPTO MANALU 512-11-01370 Eikjun Faisal Siringoringo 512-11-01393 Tahel Tambunan 512-11-01546 DODI E F SIDABUTAR 512-11-01621 JHON F SIMAMORA 512-11-01655 Simon Triono 512-11-01783 Jetro Rolling S 512-11-01787 TOMMY W SIMANJUNTAK 512-11-01867 Benjamin Ari Wibowo 512-11-01875 GREYNER ISKANDAR DINATA SIREGAR 512-11-02076 MARIO SANJAYA HOTTUA SIREGAR 512-11-02181 ROIMEN ROYANTO MALAU 512-33-00561 Riski Husein Nst 512-33-00993 MARINGAN TUA SINAMBELA 512-33-01035 BEVIN SMANJUNTAK 512-33-01222 SINTA EVELIN BR HUTAGALUNG 512-33-01739 Tumpal Evaristus Parhusip 512-33-01791 DODY TOBING 512-33-02150 JODI REZKI SIBARANI 512-33-02283 Tetty Maria Pjt Lulus di Prodi EK-Sore (10105) = 35 512-11-00207 YUNI CHRISTIANI 512-11-00680 Reinhard Gunawan Simamora 512-11-00690 WAHYU ANDRIAWAN 512-11-00741 Diaz K Pasaribu 512-11-00857 Francisco Gultom 512-11-00899 Patar Castony Siahaan 512-11-00906 DEDDI NAHAMPUN 512-11-01019 Novandre Yulio Purba 512-11-01126 RIO ORLANDO 512-11-01142 Muhammad Arif 512-11-01145 SANTA PRATIWI PAKPAHAN 512-11-01269 SINAR SEMBIRING 512-11-01273 Aditya Tarigan 512-11-01377 Nursinta A Siregar 512-11-01435 NOVA SARI TOGATOROP 512-11-01443 ALFON NAPITUPULU 512-11-01470 ANDRE ADI DARMA TARIGAN 512-11-01536 ANRI PURBA 512-11-01596 Naomi Hutagalung 512-11-01808 WILSON SIBURIAN 512-11-01811 ZULPRIADI PANDIANGAN 512-11-01857 IRWAN E PANJAITAN 512-11-02130 jefri kurniawan 512-11-02210 Novia Fitri Rouli Simamora 512-11-02393 SAHAT MARULI LEO . N .T 512-11-02400 Seto Anugrah 512-11-02425 Markus Hutahaean 512-33-00199 juniarta ulina gultom 512-33-00317 ERISKA GALINGGING 512-33-00457 CHANDRA A NABABAN 512-33-00838 Cindy R. Simarmata 512-33-00950 REINHARD RICHARD BUTAR BUTAR 512-33-01479 Ade Yolanda 512-33-01734 MARISKA AGUSTINA BR.AMBARITA 512-33-02210 ANWAR EFENDI TANJUNG Lulus di Prodi TK-Sore (10106) = 23 512-11-01683 MONALISA SIHOMBING 512-11-01703 MARIA N PASARIBU 512-11-01854 Zulfikar Rangkuti 512-11-01905 BESRIATY SIMANULLANG 512-11-02282 Ismainiatul Hayati Siregar 512-11-02334 HIZKIA GULTOM 512-33-00215 Fahmi Abdi Putra 512-33-00572 Marco Vincent Lumban Tobing 512-33-00714 NUR AFIFAH BATU BARA 512-33-00742 Dolfy Antonio S 512-33-00763 jecklin kharina tarigan 512-33-00773 sahata sianturi 512-33-00791 VANIA C TARIGAN 512-33-00859 Dedy Kurniadi 512-33-00904 ANASTASIA MANIK 512-33-01192 Noni Setio Rini 512-33-01205 AGUSTINA A SITORUS 512-33-01420 IMELDA M SIBURIAN 512-33-01872 FACHRUR ROZY LUBIS 512-33-02222 Agung S. H. Limbong 512-33-02246 Apritania Br Kaban 512-33-02341 YULI ARISTANTIA 512-33-02374 ENZELIA Lulus di Prodi CE-Intntl (10031) = 25 512-11-00002 Mahlafina Chairunnisa Siregar 512-11-00009 Astria Febricha Vydal 512-11-00145 Roma Rio Sebayang 512-11-00204 Lydia Putri Sinaga 512-11-00564 Joseph Surianta Sembiring 512-11-00683 Shella Burviana 512-11-00727 ahmad irfan nugraha 512-11-00847 Herlina Magdalena sinaga 512-11-00911 FARIAL SIDABUTAR 512-11-00913 Melisa Shafira 512-11-01030 SAHAT MARTOGI MANURUNG 512-11-01118 AHMAD FAISAL NASUTION 512-11-01321 IMANUEL PARDOSI 512-11-01522 David Simanullang 512-11-01609 Nadia Fahrayani Nasution 512-11-01625 NENSY 512-11-02150 Wina Silfanna Hsb 512-11-02235 EKA PUTRA SIREGAR 512-11-02345 DEWI SINAGA 512-11-02359 Anggiat Liberto Jesian Sihombing 512-33-00944 Rina Maryati Purba 512-33-00958 friando togima sihombing 512-33-01235 MARTA SITOHANG 512-33-01954 Dinda Sundari 512-33-02136 Muhammad Fauzy Rachman Hasibuan Cadangan di Prodi BK-Pagi (10007) = 10 512-22-01192 Juna Eta Bangun 512-33-02321 doriska purba 512-33-01045 Devi Dian Syahputri 512-33-01428 Yanna Puspita 512-22-01794 Rahmat Saleh Hasibuan 512-22-00413 Mart Asido Silitonga 512-22-00524 DERTAMA ANASTASIA SAGALA 512-33-01743 Ester Marpaung 512-22-00888 Mayunita Lisabemarti 512-33-00716 Stevenshon Agave H Cadangan di Prodi AK-Pagi (10008) = 10 512-33-01708 irfan maulana s 512-22-00537 ANDRI FORDI SEMBIRING 512-33-00025 M REZA F PANE 512-22-00648 Ian Pratama Limbong 512-22-00060 Lorensia sitorus 512-33-01770 Regina Sari 512-33-00875 Husni Fauzi Daulay 512-22-01493 SUCI INDRIANI 512-33-00947 Kristin M Pane 512-22-01428 MAY SARI PASARIBU Cadangan di Prodi AB-Pagi (10009) = 10 512-22-00875 Dina Hayati 512-22-00383 Indah Chairunnisa 512-22-00932 NOVI ANGGRIANI 512-33-00419 anggriani br sinuraya 512-22-01291 Anggiat Hutajulu 512-33-02107 DAHNIATI SINAGA 512-33-00020 EVITA BUTAR BUTAR 512-33-01904 EVAN C SIAGIAN 512-33-01280 THERESIA SIMBOLON 512-22-00663 Henni Maria br Ginting Cadangan di Prodi MICE-DIV (10012) = 25 512-33-00819 Ilham Syafarudin 512-33-00706 Johan S 512-33-02287 Tri Wulandari 512-33-00444 YOESLIANA FITRI 512-33-00345 FAKHRURROZI 512-22-01701 LUTHER ATAMBUNAN 512-33-00771 GEBRIELLA TURNIP 512-22-00273 Marugan Alexander Manullang 512-33-01935 WINNA OKTANTIA NAINGGOLAN 512-22-01416 Repi Mentari br Trgn 512-22-01102 FAHRI ADALANI HARAHAP 512-22-01567 FRANS HOLANDER SIMANJUNTAK 512-22-00259 FITRIANI SIHALOHO 512-33-01286 CRISTIO VALENTINO

TARIGAN 512-22-00124 Sartika Afridayani Br. Sembiring 512-33-01661 NICHOLAS GIOVANI 512-22-01770 Fransiska Sinambela 512-22-00656 citra sulistya ningrum 512-22-00275 Indri O Panjaitan 512-22-01738 ronal nainggolan 512-33-00462 abiansah putra anggara 512-22-01113 Ahmad Fahmi Dalimunthe 512-33-01343 DESLONI SITORUS 512-22-01818 BILLY OLIVIANUS TARIGAN 512-22-00203 LIASTA RAMADANI Cadangan di Prodi BK-Sore (10107) = 10 512-22-00372 Anya Stevany Tarigan 512-33-00644 NOVITA FITRIANY AKBAR SAGALA 512-33-01712 ALDI REYNALDI 512-33-00835 RUTH SIDABALOK 512-22-01196 LASTIAR SIMANJUNTAK 512-33-01042 hasudugan tampubolon 512-33-01996 JOHN ANDERSON SINAGA 512-22-00750 HOLONG DWI PUTRA T 512-33-01026 natalina pakpahan 512-22-00915 khairin nisa Cadangan di Prodi AK-Sore (10108) = 10 512-33-00493 vita juwita nayoan 512-33-01826 MHD.SYAFRI ALWI 512-33-00670 Mia Leilani Tarigan 512-33-00027 ARISTON KARO KARO 512-33-00928 DEWI CHRISTIAN O E 512-33-00585 GUGI ISWARA 512-33-01403 ROTUA HOTMAULI S 512-22-00993 Billy Pasaribu 512-22-01041 SITI DINA ASSARI SRG 512-22-00887 LUSI KRISTANTI K. PANJAITAN Cadangan di Prodi AB-Sore (10109) = 10 512-33-00011 Ricky Hutagaol 512-22-00218 Dolly S 512-33-00153 RENI ANGRAINI PULUNGAN 512-33-00023 Nurul Maulida 512-22-00123 EKI PRATAMA GINTING 512-33-00121 Nidia Rosa Asmalia 512-22-01013 FRITS TAMPUBOLON 512-33-02147 MARIA FEBRILIA 512-33-01593 Arihta Oktaria Sembiring 512-33-00917 DEDE ADRIAN SAGALA Cadangan di Prodi BK-Khusus (10027) = 25 512-33-01946 YENI SIHOMBING 512-33-01297 Matius Sahat Togi S 512-33-01170 REZA LESMANA SINAGA 512-33-00368 DEASY S SIMORANGKIR 512-22-01679 Marthin Anjasmara Pasaribu 512-33-02027 ROY S ANAKAMPUN 512-33-02365 Rahmadani Safitri Gurning 512-33-02042 Desy Putriyani Harahap 512-33-01070 Oki Harmiansyah 512-33-02278 HERYATI SINAGA 512-33-02238 JOHN BERSON S 512-33-02171 shiska wati 512-33-01890 NURMEGA 512-33-01450 Romauli Pangaribuan 512-22-01668 Sheilla Putri Riza 512-33-02270 Beni Ignatius Sitepu 512-33-01988 CRISTIN NATALIA SEMBIRING 512-33-00583 ISNAYA RIZKI 512-22-00506 HELEN K NAIBAHO 512-33-01377 LEDI GUSMENWI PURBA 512-33-00504 RONY CHANDRA SIAGIAN 512-22-00158 NOVA Y S SAGALA 512-33-00304 ICHE KORAIMA POHAN 512-22-00473 Asep Roganda S 512-33-01308 LASMARITO SIMBOLON Cadangan di Prodi AK-Khusus (10028) = 12 512-22-00192 Tommy Suheri Pangondian Sitompul 512-33-01430 Laurent sius pernandes nababan 512-22-01598 JAKA PRAMONO 512-22-01284 Ruth T Silaban 512-33-00371 DESI ARIYANI 512-33-02218 FREDICK R HAPOSAN SINURAT 512-33-01694 Siska Melinda Milala 512-22-01788 evaliyani haloho 512-33-00499 Tridiana 512-22-01175 ARIANE PUSPA PERTIWI 512-33-01514 MEI LANI MANULLANG 512-33-00383 RAFLYTIMOTHY SIHOTANG Cadangan di Prodi AB-Khusus (10029) = 25 512-22-00636 Aneta Greglicka 512-33-02170 SHINTA NATALIA SIAHAAN 512-22-01151 SYAHPUTRA M M S 512-33-01986 Indah Matondang 512-33-01445 RONNA BOY NAPITUPULU 512-33-00508 Elisya tobing 512-22-01481 FITRA YOSI AYU 512-22-00095 RISA YOSKA 512-33-02189 ERIKO SINAGA 512-22-01529 Henry Sahat M Damanik 512-22-01024 KARMILA SEMBIRING 512-33-02061 MEI LATI MANULLANG 512-33-01975 CHAIRANI C S 512-33-00376 Novi isna wardani lubis 512-22-01182 MEIJON TARI SIRAIT 512-22-01004 Syahferanda Saragih 512-22-00102 FIANNY SITUMORANG 512-22-01712 Pebrianta Pinem 512-33-00130 MUHAMMAD IQBAL AL ZAREFI 512-22-00455 Pranianti Girsang 512-22-00540 HARRY PURBA 512-22-01169 ANTON 512-33-01322 Daisy Malau 512-33-00024 ELY ROMAITO SIREGAR 512-22-01535 Saut Gomgom Silalahi Lulus di Prodi BK-Pagi (10007) = 20 512-22-00094 DARA RIZKI AYU 512-22-00254 Rizka Rinanda Putri 512-22-00672 RAMADHONI AKMAL TANJUNG 512-22-00869 CINTIA SIMARMATA 512-22-00961 DINDA RATIH PATRIANISSA 512-22-01237 Dhanas Chandra Dwi A 512-22-01401 ahmad yudha 512-22-01714 Quinnery Esra Paltak Situmeang 512-33-00029 ITA MAYASARI S.BRAHMANA 512-33-00138 FEBRINA MARSAULINA 512-33-00159 SADESTI VERONICA GURUSINGA 512-33-00391 Yesika Putri 512-33-00541 Sonya Prima Sari Girsang 512-33-00575 Zaim Qashmal Waridi Nasri 512-33-00713 Natika Hutagalung 512-33-01007 Dan Jaka Sirait 512-33-01669 ROSE PASADENA 512-33-01704 Yori Yanuri Siregar 512-33-01752 ANNISA BIL HAQUE 512-33-02198 DELIMA ANANDA PUTRI Lulus di Prodi AK-Pagi (10008) = 20 512-22-00017 ALVIA FAIROUZ 512-22-00277 PANDANG N A 512-22-00490 DWI AZARYA BORNEO S 512-22-00689 WINDA JULIETA 512-22-00767 Ria Melina Debora S 512-22-00934 Resi Juliana Situmorang 512-22-01055 jodhy agung rizkyawan 512-22-01212 SUBANDI PUTRA 512-22-01419 Fhilipus Sinaga 512-33-00026 RIA IN JUNIA BR PRB 512-33-00395 Nia Lidya Angelina N 512-33-00535 RIDHO FADIL SEPTIAN 512-33-00725 Annisa Rislina Siregar 512-33-00834 Riana sugiarti 512-33-01028 Fathiyah Shafwan 512-33-01577 khairunnisa nst 512-33-01760 SarahTamery Elisabeth Pardede 512-33-01857 SHEENA B PARDEDE 512-33-01893 Muhammad Arif Raihan Lubis 512-33-02193 AZMI SATRIO AMARSYAH Lulus di Prodi AB-Pagi (10009) = 24 512-22-00161 Dipa Negri 512-22-00403 ade anisyah 512-22-00470 MUHAMMAD CHOIRUL FAUZI 512-22-00817 Daniel F O Sipayung 512-22-00913 Arjudus S A Angkat 512-22-01285 stevani sembiring 512-22-01294 ELFRINA YUSRA 512-22-01317 ABDUL BA’ARIY SY MARPAUNG 512-22-01371 Dewi Lestari 512-22-01669 JENNY F KARINA

512-22-01731 Herry Dharmawan 512-22-01782 MUAMMAR IKHSANI SIREGAR 512-33-00085 Mafera Gustina Siagian 512-33-00187 ERIS H P HUTAPEA 512-33-00711 Bernadette Sagala 512-33-00897 Ruth E M 512-33-00987 NOVA ISWARINI MANALU 512-33-01105 HEMA LOVIKA SARI 512-33-01489 theresia atika sari br ginting 512-33-01503 CYNTHIA CLAUDIA Z 512-33-01557 Dewi Irwanti Oktavina Manurung 512-33-01746 clara 512-33-01801 Anastasia Ginting 512-33-01982 Lucky ani Lulus di Prodi MICE-DIV (10012) = 55 512-22-00015 Siti Annisa Suryani 512-22-00026 Fujianty Saragih 512-22-00128 Vivo Manda Asmara 512-22-00210 NIMROD O P SIMAMORA 512-22-00266 wihdatul fadhilah azra 512-22-00274 Tyas Rizky 512-22-00335 RESTI DEWI CAHYANINGRUM 512-22-00374 JOSEPH ALLANTITO H 512-22-00407 NICHOLAS ALOYSIUS BETHA NAPITUPULU 512-22-00555 REINHARD ROFARIO SARAGIH 512-22-00679 MARIO RINALDI SITORUS 512-22-00792 Evany Sitinjak 512-22-00793 SUCI RAMADONA 512-22-00839 Erwin E.C.Naibaho 512-22-00901 NOVI GULTOM 512-22-00957 ERVIKA SINAGA 512-22-00973 Aida Dewanti 512-22-00996 APRILIANI LASE 512-22-01005 Febri Yanti Ginting 512-22-01017 Paska Yulita Sinaga 512-22-01020 sabrina a s 512-22-01236 Muhammad Ryan 512-22-01295 Mikhael Crismas Adiantha Kembaren 512-22-01305 NOVRI MARBUN 512-22-01330 DEBORA KRISTINA DEWI 512-22-01359 sarah meuthia hasibuan 512-22-01367 M.NANDA REZKI 512-22-01418 Arga Saliraswati Saragih 512-22-01504 MEMORI NAINGGOLAN 512-22-01560 ANGGIE ANGREINI NST 512-22-01675 Immanuel Tambunan 512-22-01720 JESSICA ITAMBUNAN 512-22-01779 mutiara azizi 512-33-00073 ASTUTY V LUMBANTORUAN 512-33-00123 Cindy Oviryan 512-33-00139 Claudia Yolanda Nisti Gea 512-33-00218 Mecxis Simanjuntak 512-33-00620 Roberto B.N 512-33-00684 GILANGPERMATA CATURATRI 512-33-00709 FAJAR RAHMAT 512-33-00710 ZHENDY VITA PERTIWI 512-33-00868 Putri Khairunnisa 512-33-00872 MUHENI RIZKI UTAMI 512-33-00984 CORY KRISTIN TARIGAN 512-33-01146 Nurhajijah 512-33-01206 VANNY ANDHINI P 512-33-01309 yogi nasrul huda 512-33-01670 DINA SIDAURUK 512-33-01882 NATASHA YOHANA ANDITA HARAHAP 512-33-01944 Neni Wahyuni 512-33-01963 MELY FRISKA PAKPAHAN 512-33-02041 Meidha Riskyka Poetri 512-33-02137 Riski Ulina Sianturi 512-33-02310 m. rizki 512-33-02350 Eggi Arisa Bangun Lulus di Prodi BK-Sore (10107) = 28 512-22-00032 ALEX CHANDER S 512-22-00223 Betsheba Anggraini Surbakti 512-22-00587 Grace A Lumbantobing 512-22-00829 TRISNO EKA PUTRO 512-22-00891 ERLISTA HERLINA MORA 512-22-01069 YENNI MARLIANI 512-22-01183 Cristy Filadelfia Siregar 512-22-01199 MONIKA LEONARTI 512-22-01377 SUTAN ERLAMBANG 512-22-01451 M. FARIS YUSUF LUBIS 512-22-01805 Chairul Azmi Mth 512-33-00096 Ernike Siagian 512-33-00562 Emfrida B Manurung 512-33-00702 PUJI ASTUTI REJEKI 512-33-00738 SILVANA JUNIARTI T. S 512-33-00777 mariana christine graceshita purba 512-33-00922 Samuel S Banurea 512-33-00939 YUNIAR E SIREGAR 512-33-01313 Monika Simangunsong 512-33-01344 Rolan Ganda Simamora 512-33-01364 CRISTY FEBRINA GULTOM 512-33-01378 Yulianty Simbolon 512-33-01384 NOVIDA H SIMORANGKIR 512-33-01471 GRESWITA SIHOMBING 512-33-01684 sari yusni siregar 512-33-01710 Saza Merlinthon Hutagaol 512-33-02010 Maya Sari Sibuea 512-33-02372 DIAH PURWANING TIAS Lulus di Prodi AK-Sore (10108) = 37 512-22-00037 ELVERAWATI R 512-22-00078 Melisa Sari Mutiara 512-22-00104 MITTARIA S BERUTU 512-22-00969 ROIDA NAPITUPULU 512-22-01038 ANDRI YUSTIAWAN 512-22-01051 YUNITA SARI 512-22-01130 Dimitri Ivanosky Surbakti 512-22-01185 Andreey Barto Pakpahan 512-22-01190 FAridha Hanif Zain 512-22-01265 Ema N TRG 512-22-01335 Dewi Karolina Nainggolan 512-22-01528 SONYA NADIA 512-22-01591 Grantino M A 512-22-01682 Suryani Naibaho 512-33-00385 SITI YUYUNDARI 512-33-00408 Fila Delfina Br Tarigan 512-33-00496 PUTRI AYU AFRIANTI LUBIS 512-33-00586 Firstman Javed Bangun 512-33-00602 Siti Fatimah 512-33-00626 Rizky Ananda 512-33-00720 Selvia Kumala Br Silalahi 512-33-00728 MARTINA N SIRAIT 512-33-00787 Jun Jevry Nababan 512-33-00846 nur Afni Syariy 512-33-00850 Tri Wita Sari 512-33-00857 MARIA SEPTI A P 512-33-01061 Tiawan Carolina Sihombing 512-33-01080 RISSA SARAGIH 512-33-01259 Minar Veronika Sinaga 512-33-01328 ISNA GUSTANTI 512-33-01379 FEBY MUTIARA 512-33-01711 NUR AMIMI 512-33-01974 Sofi Annisa Tanjung 512-33-02026 BASRI 512-33-02051 Sahat Manalu 512-33-02115 ESTER FEBRIANI BR B 512-33-02254 IDA S SIRINGORINGO Lulus di Prodi AB-Sore (10109) = 39 512-22-00081 Ester oktavia padang 512-22-00112 Nurajizah Dasopang 512-22-00126 Nurul Pepyana Dessy 512-22-00531 Mikhael Jan Tonggotua Sihombing 512-22-00588 ELIA STEPANY 512-22-00788 M AL HAFIZ LUBIS 512-22-00914 Yuliana Dwi Wati Pangaribuan 512-22-01125 Zahrina Ismah 512-22-01133 SEPTY WERRY.N 512-22-01319 Nadilla 512-22-01571 Ita Florensia Malau 512-22-01597 Ayu Febriani 512-22-01616 Dimas Julistyo 512-33-00050 Hera Yolandari Barus 512-33-00102 Mitra Wulanti 512-33-00302 karlina yunika nst 512-33-00616 Adelia Utari Siregar 512-33-00774 Ados Prasi Simanjuntak 512-33-00853 Gita Aryshandy 512-33-00869 Lia Okvesia Sitepu 512-33-00908 SANTA ELISABETH NAINGGOLAN 512-33-01005 KRISTINAYESIKA SILAEN 512-33-01043 SARTIKA PUTRI OMPUSUNGGU 512-33-01175 CATRINA PASARIBU 512-33-01258 FENGKY SUMITRO 512-33-01380 JUNITA M BUTARBUTAR 512-33-01433 Pertiwi Juniar S 512-33-01457 CINDY DAMINI SIMANUNGKALIT 512-33-01538 LORENSITIRTA SARI S 512-33-01550 VICTORY A HUTAURUK 512-33-01598 Inggrid Chrismery Purba 512-33-01652 YESIKA SIAGIAN 512-33-01809 KRISTY MERLIN 512-33-01850 WASTHY DWILISOYA 512-33-01858 Nelfironsia Chrisnatha Ulintha Tarigan 512-33-01876 WIDIA M SIHALOHO 512-33-01894 Ester Lidia 512-33-01959 VIVI O S 512-33-02294 MUHAMMAD IQBAL Lulus di Prodi BK-Khusus (10027) = 55

WASPADA Jumat 20 Juli 2012

512-22-00454 512-22-00513 512-22-00682 512-22-00903 512-22-00925 512-22-00948

Helen siregar YOHANNA PARDEDE desy swistika Githa Bhella V Ismon Aldo Kristona Bangun Muhammad amanda hasby 512-22-00971 Neil Siadari 512-22-01060 FANNY WULANDARI 512-22-01078 Danny efander rivaldo pakpahan 512-22-01124 IRA MAYA FITRI 512-22-01300 CHANRIDO OKTAVIANUS NAIBAHO 512-22-01338 OKIA KIKI PRAWASTI 512-22-01391 Rut Maya F.Sianturi 512-22-01442 SITI KHOLIZA 512-22-01542 AULIA RIZKI NAILA 512-22-01620 DOROPAT SITUMORANG 512-22-01658 PURWANTO 512-22-01733 Mariati sibuea 512-33-00037 Adventy Agustina Sihombing 512-33-00055 Magdalena Risna Sinaga 512-33-00172 Farah Dini Yusika 512-33-00334 DODDY SYAFRIAN 512-33-00356 NOVIANSYAH SIREGAR 512-33-00420 sayyid luthfi sani 512-33-00594 Ludwina Simanjuntak 512-33-00679 Johanna Yolanda Sibarani 512-33-00705 Hori Sidebang 512-33-00840 Dian L Napitupulu 512-33-00855 Lina Br. Sitompul 512-33-00898 MUHAMMAD IQBAL ELPASYA 512-33-00959 Wirda Putriani 512-33-01030 Nita Yulita Siregar 512-33-01044 YOLANDA PEBRINA BR BARUS 512-33-01077 Yuslida Zulkanita 512-33-01078 Putri Balkis 512-33-01082 Ricky Janssen Sembiring 512-33-01142 DesssyYohana hutagalung 512-33-01164 IVO OCTAVIANA 512-33-01267 Dita Astriliani 512-33-01317 Saudur E. Sianipar 512-33-01402 fitri simanjuntak 512-33-01407 Dewi H S Nainggolan 512-33-01439 Putri Ayu Wulandari Batubara 512-33-01454 GITA JESSICA ANWAR 512-33-01469 Mahsuri 512-33-01474 Dhea Chitra Chinesia Nst 512-33-01653 ROLAN M SILABAN 512-33-01658 GracitaYesia Manurung 512-33-01820 MANGARANAP H.P 512-33-01968 Wasinton F Panjaitan 512-33-02049 LULISA J O SILABAN 512-33-02253 Fitri Andiyani 512-33-02271 elsa ulina pakpahan 512-33-02362 REHAN RAISA SILAEN 512-33-02392 BC.Safitri Panjaitan Lulus di Prodi AK-Khusus (10028) = 60 512-22-00115 Dwi Cita Puspita 512-22-00224 JAKSANTA PUTRA TARIGAN 512-22-00312 Muhammad Agung Hanafiah Nasution 512-22-00326 bella sawita tandi fitri riadiani 512-22-00411 Utami Tri Hariyanti 512-22-00427 SUTIAR SIAHAAN 512-22-00530 Dwi Septina Yosepin Samosir 512-22-00556 RIA WINNA ELISA SIMANULLANG 512-22-00558 heryanto siregar 512-22-00605 Seifina Pelawi 512-22-00649 SITI AIDA YULIANA 512-22-00703 Josua Rheinhard Harianja 512-22-00710 DUAL SAPER HUTAJULU 512-22-00768 sri wirdani w 512-22-00898 SRI AYU ASTUTI PANGGABEAN 512-22-00985 Diana R P 512-22-01007 alberth sitohang 512-22-01216 NIKMATIN AMALIA 512-22-01297 Rimsonnaibaho 512-22-01314 Rosinta sihombing 512-22-01357 ervina novitasari rajagukguk 512-22-01394 Donda R Manalu 512-22-01449 LISTIANI 512-22-01466 HAMDAN SUPRIYADI 512-22-01696 RINIWATI SIANTURI 512-22-01814 EFTIDAH 512-33-00056 MHD RIZALDY HAFIZ 512-33-00422 Esra Prylicia Sinurat 512-33-00503 MUHAMMAD ERZA 512-33-00568 IMELDA SILAEN 512-33-00666 FAUZIA HUSNA MANULLANG 512-33-00669 DAVID.RICARDO 512-33-00681 alfonso agustinus c napitupulu 512-33-00698 ADAMA SITEPU 512-33-00722 Nurliza Chan 512-33-00757 Dame Carolina Sitinjak 512-33-00765 Heri T Napitupulu 512-33-00784 JESAYA FEBRIAN SIMATUPANG 512-33-00824 Juwanri Maralam Silaban 512-33-00839 Fikri Akbar 512-33-00866 LIA AFRIANI 512-33-01038 Nurcahyani Amanda Putri 512-33-01079 Nursyifa Sabfina 512-33-01125 EMILIA SWS 512-33-01155 AKHMAD KHADAFI LUBIS 512-33-01383 Dwi Rahmawaty 512-33-01477 Muhammad Rizky Nasution 512-33-01680 Parasian Armando Gultom 512-33-01692 HERMINA MANURUNG 512-33-01716 JESIKA TARIGAN 512-33-01812 GRACE K. TAMPUBOLON 512-33-01832 tetti hutagalung 512-33-01915 aldora manullang 512-33-01992 Nova Elizabeth Sihite 512-33-02012 Asnita Doriana Gultom 512-33-02079 Yaumil Agusti Yanti 512-33-02108 MAYCHAL CHRISTIAN SIMANJUNTAK 512-33-02120 SHABRINA HAWARI RANGKUTI 512-33-02385 Mandasari purba 512-33-02395 riski irwansyah Lulus di Prodi AB-Khusus (10029) = 55 512-22-00028 Maria Goretti Sitanggang 512-22-00160 ELLA AFNITA 512-22-00251 ELISABETH N SIREGAR 512-22-00462 RICKA PUSPASARI 512-22-00544 Putri Vera Sembiring 512-22-00646 Elisa veronika 512-22-00655 ANGELINA NOVITASARI SIAGIAN 512-22-00800 Naomi Lestari .P. 512-22-00989 Rizka Maulida Murni 512-22-01109 Lenny krisnawati Lumbantobing 512-22-01117 SUPRIADI MARBUN 512-22-01244 Annisa Chairiza 512-22-01352 DINAWATI TAMPUBOLON 512-22-01384 GAMEL MUAMMAR 512-22-01390 ASEPTAPIANUS S 512-22-01414 SISKA SITUNGKIR 512-22-01474 anggiat tumpak sahala manurung 512-22-01496 NURSAIDAH 512-22-01548 DYAN NATHIA P SARI 512-22-01599 Monika verawati aritonang 512-22-01662 jordan sirait 512-22-01791 Evan Maryo Sianipar 512-22-01807 DAVID ADHITYA P H 512-33-00063 SITI CHAIRANY 512-33-00194 Andrini Krisna Sari 512-33-00238 MUHAMMAD IHSAN 512-33-00280 elisabet s 512-33-00318 Marshel Wilhelmus 512-33-00405 DEA ARDILA PRATIWI 512-33-00498 Tri christiadi 512-33-00545 Nindia Arini Putri 512-33-00599 SALLY P A NAIBAHO 512-33-00601 ayunda kartika 512-33-00841 ABDUL RAHMAN LUBIS 512-33-00985 KUSDIARTI 512-33-01083 Evarina 512-33-01116 ANNA M S PAKPAHAN 512-33-01163 Grace Sella br Purba 512-33-01240 Cornella F Silitonga 512-33-01248 Friani N 512-33-01251 Endang Idriana Malau 512-33-01346 Areni Sabrina 512-33-01547 HARIYANTI RAJAGUKGUK 512-33-01578 Lita Widyastuty 512-33-01842 Novita Sari Nainggolan 512-33-01947 RUMANTI MANIK 512-33-02004 Rotua Katerina Samosir 512-33-02080 shabatini siallagan 512-33-02128 PASLI BERSAMA HULU 512-33-02188 Tahan m sihombing 512-33-02247 muhammad ariandi 512-33-02264 sarmatika samosir 512-33-02327 citra elisabet 512-33-02381 RATI LAGITA HASANA 512-33-02394 Annisa Avinda Ahmad


WASPADA Jumat 20 Juli 2012

Medan Metropolitan

A5

Kopertis Launching Program E-Learning Di 11 PTS Rektor UISU Al Munawwarah Jadi Ketua Konsorsium MEDAN (Waspada): Kopertis Wilayah I Sumut-Aceh meluncurkan (launching) program pendidikan jarak jauh atau elektronik learning (E-learning) di 11 Perguruan Tinggi Swasta (PTS) Sumut, Sabtu (14/7). Rektor Universitas Islam Sumatera Utara (UISU) Al Munawwarah Jln. Sisingamangaraja Medan Prof Ir Zulkarnain Lubis, PhD ditetapkan sebagai ketua konsorsium E-Learning Wilayah I Sumut. “Program pendidikan Elearning mulai dibuka pada September 2012, “ kata Koordinator Kopertis Wilayah I Sumut-Aceh M. Prof Nawawiy Loebis pada peluncuran secara resmi program pendidikan E-learning di kantor Koperti sWilayah I SumutAceh Jln. Setia Budi Medan. Dia mengatakan, program ini merupakan sebuah

pembuktian bahwa E-Learning bisa dilakukan dengan baik dan tepat. Selain itu, juga bisa mengikis kelas jauh yang masih tumbuh di sejumlah daerah. “Saya yakin program ini akan berjalan baik, sehingga kelas-kelas jauh yang ilegal itu bisa terhapus. Sebab, perlahan orang akan memanfaatkan program yang lebih terjamin ini,” kata Nawawiy. Untuk kelancaran dan keberhasilan program ini, kata Nawawiy, dituntut peran serta semua pihak mengevaluasi setiap pembelajaran yang ada. Diharapkan program ini bisa menjadi pilot project bagi PTS lainnya di luar Sumut dan Aceh. Dia juga mengapresiasi 11 PTS yang bersedia membuka program E-Learning ini, sehingga akan meningkatkan Angka Partisipasi Kasar (APK) masyarakat yang melanjutkan pendidikan ke perguruan tinggi. De-

ngan demikian, APK yang masih 27 persen, dalam waktu 4 tahun kedepanakanmenjadi60persen, melebihinegara-negaratetangga. Pada kesempatan itu, Kopertis mengimbau PTS menjalin kerjasama dengan pemerintah kabupaten/kota di Sumut sekaligus membuka countercounter di kabupaten/kota guna mensosialisasikannya. Dia juga berharap program ini didukung semuan pihak, karena sudah menjadi program resmi pemerintah yang dilindungi Permendikbud No. 24 Tahun 2012 tentang Penyelenggaraan Pendidikan Jarak Jauh di Perguruan Tinggi. Ke-11 PTS tergabung dalam konsorsium E-learning yang dinakhodai Rektor UISU Prof Zulkarnain Lubis yakni Universitas Pembangunan Panca Budi (Unpab), STIKes Mutiara Indonesia, STIE Harapan, Universitas Quality, Politeknik Unggul

LP3M, STMIK Potensi Utama, Universitas Setia Budi Mandiri (USBM), Politeknik dan Poliprofesi, Politeknik LP3I, Universitas HKBP Nomensen Medan serta UISU Al Munawwarah. Ketua Konsorsium E-learning PTS Sumut Prof Ir Zulkarnain Lubis, MS, PhD mengatakan, program E-Learning menggunakan Teknologi Informasi dan Komunikasi (TIK) atau Information and Communications Technology (ICT) berbeda jauh dengan kelas jauh yang telah dilarang oleh pemerintah. “E-learning menggunakan rangkaian elektronik seperti internet untuk menyampaikan isi pembelajaran, interaksi atau bimbingan kepada mahasiswa. Sedangkan kuliah kelas jarak jauh tidak menggunakan TIK sebagai media pembelajarannya,” ujarnya. 11 PTS yang tergabung dalam konsorsium sudah siap

Waspada/M.ferdinan Sembiring

KOORDINATOR Kopertis Wilayah I Sumut-Aceh Prof M Nawawiy Loebis (keenam dari kanan), Ketua Konsorsium E-learning PTS Sumut Prof Zulkarnain Lubis (kelima dari kanan), foto bersama dengan pimpinan PTS dan yayasan seusai peluncuran E-learning di aula Kopertis Wilayah I, Jln. Setiabudi, Tanjungsari Medan, Sabtu (14/7). menyelenggarakan PJJ mulai tahun akademik 2012/2013 ini. Dengan peluncuran sistem ini, maka pada semester baru sudah bisa dimulai pendidikan jarak

Kadispora Medan Dicopot MEDAN (Waspada): Karena dianggap tidak mampu melaksanakan tugas dengan baik, akhirnya Kepala Dinas Kepemudaan dan Olahraga (Kadispora) Kota Medan Hanas Hasibuan dicopot dari jabatannya. Dia digantikan Abdul Azis yang sebelumnya menjabat sebagai Kepala Kantor Diklat Kota Medan. Sementara itu, Lurah Namo Gajah, Kecamatan Medan Tuntungan Ujud Dana Sitompul dinyatakan tidak sah menjadi lurah karena tidak mengikuti prosesi pelantikan yang dipimpinWakilWali Kota Medan Dzulmi Eldin bersama Sekda Syaiful Bahri di ruang rapat tiga Balai Kota Medan, Kamis (19/7). “Kepada pejabat yang baru dilantik agar terus bekerja dan jangan menunda-nunda pekerjaan. Apalagi masih banyak pekerjaan yang merupakan tugas dan tanggungjawab sebagai abdi negara,” tegas Wakil Wali Kota Medan Dzulmi Eldin usai pelatikan delapan pejabat struktural di lingkungan Pemko Medan. Ketika disinggung tentang adanya lurah yang batal dilantik karena tidak hadir saat prosesi pelantikan, Dzulmi tidak mengetahuinya. “Ah, ada satu lurah yang tidak dilantik? Tapi cuma

ini (delapan pejabat struktural) saja kok yang dilantik,” ucapnya sambil tersenyum dan meninggalkan wartawan. Kadispora Medan yang baru dilantik Abdul Azis mengaku belum ada program kerjanya ke depan dengan jabatan barunya. “Saya hanya bisa melanjutkan program yang lama saja,” ucapnya tanpa menjelaskan program apa saja yang akan dilanjutkan itu. Sedangkan calon Lurah Namo Gajah, Kecamatan Medan Tuntungan Ujud Dana Sitompul yang datang terlambat, akhirnya diperbolehkan masuk ke dalam ruangan usai prosesi pelantikan. Dirinya yang mengenakan pakaian serba putih itu mengaku tidak mengetahui prosesi pelantikan terhadap dirinya. “Saya tidak tahu kalau saya mau dilantik. Bentar ya,” ucapnya sambil berlalu meninggalkan wartawan menemui Kepala Badan Kepegawaian Daerah (BKD) Kota Medan Parluhutan Hasibuan. Kepala BKD Kota Medan Parluhutan Hasibuan yang ditemui mengatakan, pelantikan terhadap Lurah Namo Gajah Ujud Dana Sitompul dinyatakan tidak sah. Jadi, dia batal menjadi lurah. “Karena dirinya tidak mengikuti prosesi pelantikan, BKD menyatakan tidak

sah,” ucapnya. Ketika disinggung tentang ketidaktahuan Ujud Dana Sitompul terkait pelantikan tersebut, Parluhutan membantahnya. “Dari tadi pagi saya menghubunginya, tetapi HP yang bersangkutantidakaktif,”jelasnya. Mantan Kadispora Medan Hanas Hasibuan yang dikonfirmasi belum mengetahui jabatan barunya. “Saya belum ada menerima surat akan ditempatkan kemana, tetapi saya siap kok bila ditempatkan dimana saja.

Soal pencopotan, itu kan wewenang dari pimpinan, biar teman-teman (wartawan) sajalah yang menilainya bagaimana dengan kinerja saya,” bebernya. Adapun pejabat ekselon IV yang dilantik diantaranya adalah Namo Ginting menjadi Lurah Sukaraja, Kecamatan Medan Maimon; Panyahatan Daulay menjadi Lurah Sei Rengas Permata, Kecamatan Medan Area dan Muara Dongoran menjadi Lurah Bantan Timur, Kecamatan Medan Tembung.

Selanjutnya, Kepala Seksi dan Kasubbag di jajaran SKPD Pemko Medan yakni, Bambang menjadi Kasubbag Bantuan Hukum pada Bagian Hukum, Salmando Tifa menjadi Kasubbag Evaluasi dan Pelaporan pada Inspektorat Pemko Medan, Zulfan Simbolon menjadi Kepala Seksi Usaha Bidang Operasi dan Pembinaan pada Satpol PP dan Safrizal menjadi Kepala Seksi Pembinaan pada Bidang Operasi Pembinaan pada Satpol PP. (m50)

Waspada/ME Ginting

WAKIL Wali Kota Medan Dzulmi Eldin bersama Sekda Syaiful Bahri mengucapkan selamat kepada pejabat yang dilantik.

Banjir Hadiah Di Penutupan Medan Andalas Fair 2012 MEDAN (Waspada): Banjir hadiah mewarnai acara penutupan Medan Andalas Fair 2012 di Tapian Daya, Pekan Raya Sumatera Utara (PRSU), Senin (16/ 7) malam. Dalam pengundian yang dilakukan panitia, Rishi Andika, warga Jln. Tenis, Lingkungan IV, Binjai meraih hadiah

utama berupa mobil Daihatsu Xenia. Sedangkan dua sepedamotor diraih Syahputra, warga Jln. Brigjen Zein Hamid, Gg. Perak, Titikuning dan Jeffri, warga Jln. Tanjung Selamat, Komplek Green Citra Asri. Tiga kulkas diraih masing-masing Dini Arwin-

da warga Jln. Bunga Asoka, Listiawati warga Jln. Denai dan Mustafa Kholil warga Jln. Sekata, Dusun II, Sei Baharu, Kecamatan Hamparanperak. Sedangkan lima unit televisi diperoleh Rina Malahayati warga Griya Rehan Medan Sunggal, Jaharuddin Sir warga Jln. Permai

Waspada/ist

DEWAN Pembina Harian Andalas Dr H Eggi Sudjana, SH, Msi saat menutup pelaksanaan Medan Andalas Fair 2012 bersama Pemimpin Umum Star Media Group Iskandar ST (kiri), Dr Razman Arif, Drs MA Siddik Surbakti, Senin (16/7) malam.

Kelurahan Sidorame Timur, Kecamatan Medan Perjuangan, Ismail Azis Fahmi warga Jln. AR Hakim Gg. Kolam Medan, Ganda Syahputra Sirait warga Jln. Durung Medan dan Wisnu Subrata warga Jln. Pancing II, Budi Utomo. Sementara hadiah 10 unit HP diraih Kartika Pratiwi warga Jln. Ampera II, Gg. Mawar Dusun IV Medan Binjai KM 12,5, Syafrizal warga Jln. Letjen S Parman Gg. Arsyad Petisah Tengah, Revi Fauzi Putra Mina warga Jln. Bandar Setia Gg. Setia dan Melanton Sihombing warga Jln. Ampera II Km 13 Binjai. Kemudian Efriadi warga Jln. Bunga Asoka, Muhammad Fadli warga Jln/ Serayu I Dusun 4 Desa Medan Krio, Andi Rifai warga Jln. Pengabdian Dusun I Bandar Setia, Hidayat Damanik warga Jln. M Yakub Gg. Sersan, M. Irwan warga Jln. RPH Lingk X Mabar Hilir dan Fandi Ahmad warga Dusun IV Timur Jln. Baru. “Seluruh pemenang dapat mengambil hadiah di Kantor Redaksi Harian Andalas di Jln.

T Amir Hamzah Medan dengan membawa identitas lengkap sebagai tanda bukti,” ujar Ketua Panitia Medan Andalas Fair 2012 H Baharuddin. Meriah Puncak kegiatan Medan Andalas Fair 2012 berlangsung meriah. Ribuan pengunjung yang datang dari berbagai penjuru dihibur artis dangdut Ona Sutra. Dewan Pembina Harian Andalas Dr H Eggi Sudjana, SH, MSi didampingi Pemimpin Umum Star Media Group Iskandar ST menutup secara resmi pelaksanaan Medan Andalas Fair yang berlangsung sejak 28 Juni 2012 tersebut. Eggi Sudjana mengapresiasi pelaksanaan pameran dan taman hiburan rakyat guna menyemarakkan HUT ke-7 Harian Andalas yang jatuh pada 14 Juli 2012 ini. Menurutnya, pelaksanaan Medan Andalas Fair ini merupakan wujud sumbangsih Star Media Group khususnya Harian Andalas kepadapemerintahguna menyejahterakan rakyat.(cdu)

jauh atau E-learning di masingmasing PTS. Sedangkan Ketua Unit Pelaksana Teknis (UPT) E-learning PTS Sumut Ir Suhaimi Ba-

tubara mengatakan, untuk penyelenggaraan program pendidikan Jarak Jauh (PJJ), pihaknya telah mendapat pembekalan dari Distreen Learning Labo-ratory

(DL2)FakultasIlmuKomputer (Fasilkom) Universitas Indonesia(UI)dibawahbimbingan GuruBesarUIProfZainalArifin Hasibuan. (m49)

Sambut Ramadhan, Brimobdasu Serahkan Sembako Ke Masjid MEDAN (Waspada): Dalam rangka menyambut bulan suci Ramadhan 1433, Detasemen Gegana Sat Brimob Poldasu menyerahkan sembako di Masjid Al Jihad Jln. Pancing, Kel. Indra Kasih, Kec. Medan Tembung. “Penyerahan sembako dilakukan Kaden Gegana Brimob Poldasu Kompol Adarma Sinaga, SIK, SH, MH, diwakili Kasubden II Gegana ( Jibom) AKP Sutoyo SH, kepada nazir Masjid Al Jihad,” kata Kasat Brimob Poldasu Kombes Pol Drs Setyo Boedi Mumponi Harso SH, M.Hum kepada Waspada, Kamis (19/7) siang. Setyo didampingi Kaden Gegana Sat Brimob Poldasu Kompol Adarma Sinaga SIK, SH, M.Hum mengatakan, setiap menyambut bulan suci Ramadhan Brimob Poldasu tetap melakukan kegiatan sosial membagi-bagikan sembako ke beberapa lokasi secara terpisah. Selain itu, pihaknya juga mengadakan shalat berjamaah dan Nuzul Quran yang diikuti keluarga besar Brimob Poldasu dan masyarakat. Menurut Setyo, pihaknya tetap pro aktif melakukan patroli di sejumlah titik yang dianggap rawan aksi kejahatan jalanan seperti perampokan, senjata api, senjata tajam, narkoba, dan juga menertibkan truk masuk kota.

Dalam Operasi Ketupat 2012 yang akan datang, Brimob Poldasu juga akan dilibatkan dalam pengamanan di tempat keramaian, terminal bus, dan kereta api. Kata dia, untuk mengantisipasi hal yang tidak diinginkan dalam suasana menyambut bulan suci Ramadhan, pihaknya

menurunkan 60 personel dari Patra Brimob Poldasu. “Kita siap membantu tugas kepolisian dari sisi pengamanan agar suasana bulan suci Ramadhan tetap kondusif,” ujar Setyo seraya menambahkan, dirinya selalu melakukan pengecekan gudang senjatauntukmengantisipasihalhal yang tidak diinginkan. (m36)

Waspada/Ismanto Ismail

KASUBDEN II Gegana (Jibom) Brimob Poldasu AKP Sutoyo SH, didampingi Aiptu Alwi SH, dan Briptu Aria Dirgantara SH, menyerahkan sembako kepada nazir Masjid Al Jihad Jln. Pancing, Kel. Indra Kasih, Medan Tembung.

IKK Gelar Malam Keakraban Dan Silaturahmi MEDAN (Waspada): Sebanyak 80 Kepala Lingkungan yang tergabung dalam Keluarga Besar Ikatan Kepala Lingkungan (IKK) Medan Johor dan masyarakat, melaksanakan malam keakraban dan silaturahmi di Aula Kantor Lurah Suka Maju Kecamatan Medan Johor Jln. STM No. 40, Selasa (17/7) malam. Ini dilakukan untuk menyamakan persepsi dalam menjalankan program Pemko Medan ke depan. “Tujuan dari acara malam keakraban dan silaturahmi, untuk lebih mengakrabkan kepala lingkungan dan masyarakat agar mudah bergotong royong

memajukan Medan Johor ini,” jelas Camat Medan Johor M. Azwar Lin Nasution. Dengan adanya acara ini, kata Azwar, persaudaraan antara masyarakat yang satu dengan lingkungan lainnya terjalin dengan baik. “Persaudaraan itu mahal harganya, mari kita memupuk terus rasa persaudraan yang sudah terjalin ini dan hal yang baik ini akan kita laksanakan terus,” katanya. Ketua IKK H. Rozier S mengatakan, acara ini sudah dilaksanakan dua kali sejak IKK dibentuk. “Kita sudah lama tidak mengadakan kegiatan ini, terakhir tahun 2003 di Asrama

Haji,” jelasnya. Rozier juga berharap, acara ini dapat meningkatkan persatuan dan persaudaraan, agar satu sama lain saling kenal. “Kita juga membuat program untuk membentuk suatu koperasi Ikatan Kepala Lingkungan Medan Johor yaitu koperasi simpan pinjam dan koperasi usaha agar dapat membantu kepala lingkungan dan masyarakat,” tambahnya. Sementara itu, Danramil 08/ MJ-A Kapten Kav. Azwar mendukung sepenuhnya acara ini. Menurutnya, acara ini sangat bermakna karena menyangkut silaturahmi. (h02)

Waspada/Ist

SEJUMLAH kepala lingkungan di wilayah Medan Johor foto bersama usai acara malam keakraban dan silaturahmi di aula Kantor Lurah Suka Maju Kecamatan Medan Johor Jln. STM No. 40, Selasa (17/7) malam.


Politik & Hukum

A6

KPU Harus Buat Syarat Ketat, Umumkan Harta Para Cagubsu

Waspada/Ist

KAMALUDDIN Harahap menyerahkan berkas pendaftaran dirinya kepada Ketua DPW PPRN Sumut Nurdin Pustaha Manurung.

Sosok Kamaluddin Berpengalaman Daftar Ke PPRN MEDAN (Waspada): Wakil Ketua DPRD Sumut Ir H Kamaluddin Harahap, M.Si resmi mendaftarkan diri sebagai Cagubsu ke Partai Peduli Rakyat Nasional (PPRN) Sumut di Kantor DPW PPRN Sumut Jalan Sendok No 31 Medan, Rabu (18/7). Saat mendaftarkan diri, Kamaluddin didampingi Ketua Pimpinan Pusat (PP) Pemuda Muhammadiyah Anang Anas Azhar MA, dan diterima Ketua DPW PPRN Sumut Nurdin Pustaha Manurung, Sekretaris PPRN Sumut Hamdan SE, Ketua Tim Penjaringan Cagubsu PPRN Sumut, Washington Pane dan Ketua Dewan Pembina PPRN Sumut Burhanuddin Rajagukguk. Menurutnya, PPRN merupakan partai nasionalis dan memiliki kedekatan khusus dengan pengusaha sukses DL Sitorus. Dia memuji PPRN sebagai partai yang memiliki komitmen dalam mensejahterakan rakyat, khusus di Sumatera Utara. “Atas saran beberapa kader PPRN di Sumut, saya mendaftarkan diri sebagai Cagubsu. Mudahmudahan, pendaftaran ini diberikan jalan yang terbaik, sampai PPRN mengusung saya sebagai Cagubsu,” ujar Kamaluddin yang juga sebelumnya, sudah mendaftarkan diri di Partai Golkar Sumut. Pentolan kader DPP PAN ini mengakui, PAN belum mencukupi untuk mencalonkan pasangan Cagubsu/Cawagubsu pada Pilgubsu 2013 mendatang. Karenanya, dirinya mendaftar di PPRN. “Saya melihat, visi dan misi PPRN secara normatif sama dengan PAN, yakni sama-sama

ingin mensejahterakan rakyat,” kata Kamaluddin Harahap. Di tempat yang sama, Ketua DPW PPRN Sumut Nurdin Pustaha Manurung mengatakan, sosok Kamaluddin Harahap merupakan sosok yang sudah teruji di legislatif, apalagi beliau sudah berpengalaman di DPRD Sumut selama tiga periode. “Kami mengucapkan terima kasih kepada Pak Kamaluddin yang sudah mempercayai PPRN. Ini dibuktikan, Pak Kamal sudah mendaftarkan diri sebagai Cagub di PPRN,” katanya. Manurung turut mendoakan agar Kamaluddin Harahap menang dalam Pilgub 2013. Dirinya berkeyakinan penuh, bahwa sosok dan figur Kamaluddin adalah pekerja keras dan memiliki komitmen jelas untuk membangun Sumut. Nurdin Pustaha berpesan, jika Kamaluddin Harahap sudah menjadi Gubsu, jangan melupakan PPRN Sumut. “Saya berharap, PPRN menjadi mitra utama dalam membangun Sumut. Bahkan, saya meminta Pak Kamaluddin ikut serta menyelesaikan sengketa lahan di Sumut, yang jumlahnya ribuan kasus,” kata Pustaha Manurung. PPRN hanya berharap kepada Kamaluddin,untuk berkomitmen menyelesaikan sengketa tanah di Sumut. Sejumlah kasus tanah yang ada di daerah ini, belum juga tuntas. “Kami yakin, Kamaluddin mampu membawa Sumut yang lebih baik. Kami mendoakan bapak untuk jadi Gubsu, semoga Tuhan memberkati,” kata Manurung. (m26)

MEDAN (Waspada): Komisi Pemilihan Umum (KPU) harus membuat syarat ketat terhadap para Cagubsu yang mendaftar untuk Pilgubsu mendatang, serta harus meneliti apakah si calon ada terlibat atau terindikasi korupsi. ‘’Lembaga itu juga harus mengumumkan jumlah harta kekayaan para Cagubsu serta menjelaskan mana yang wajar dan tidak wajar,’’tegas Presiden Perjuangan Hukum & Politik (PHP) HMK Aldian Pinem, SH, MH di kantornya Jalan KH Wahid Hasyim, Medan, kepada Waspada, kemarin. Namun, sebelum melanjutkan pandangan, pendapat serta prediksinya tentang sosok Cagubsu mendatang maupun perihal Pilgubsu itu sendiri, dia mengemukakan beberapa syarat atau kriteria yang pantas. Sosok tersebut, yang bakal dipilih oleh rakyat mestilah bermoralitas serta berintegritas tinggi. Kemudian, memiliki skill

sehingga dapat membangun dan meningkatkan income per kapita nelayan, petani dan pedagang ekolem. Namun, lanjut Aldian Pinem yang juga praktisi hukum ini, dari sisi KPU tidak cuma mengumumkan harta kekayaan calon, akan tetapi juga meneliti, menyelidiki dan bila ternyata harta itu terindikasi dari hal tidak wajar maupun tidak halal, maka si calon tidak diikutkan dalam Pilgubsu. ‘’Kita sudah punya pengalaman masa lalu yang suram, ketika ada kepala daerah di Sumut yang terlibat kasus dugaan korupsi,’’ujarnya. Pinem juga memandang perlunya para Cagubsu mempertinbangkan, bahwa jalan pikiran masyarakat Sumut kini tidak lagi menggunakan akal pikiranm melainkan sudah menggunakan hati sanubari. Artinya, bukan mustahil pemenang dalam Pilgubsu mendatang adalah bukan orang yang

gencar menunjukkan dirinya, melainkan sosok yang sederhana, jujur dan bersih. Disinggung tentang Pilgubsu itu sendiri, Pinem melihat, sampai saat ini masyarakat Sumut masih bersikap dingin. Sementara yang sibuk adalah para Tim Sukses (TS). ‘’Hal atau kondisi itu dikarenakan masyarakat telah mulai apatis, terutama atas kehidupan berpolitik di Indonesia, termasuk Sumut,’’paparnya. Sedangkan kenapa menjadi apatis, menurut Pinem, selama ini kampanye para calon cenderung janji kosong dan pembohongan publik, disamping masih dipengaruhi proses money politics. Akan tetapi, Pinem juga memprediksikan, Pilgubsu akan menjadi hangat dan hot, apabila muncul calon dari sosok yang hidup sederhana, jujur, arif, bijaksana serta tidak terindikasi kasus korupsi yang mengincar dirinya.(m34)

Cagubsu Pilihan Generasi Muda Tidak Mesti Dari Kader Parpol MEDAN (Waspada): Sosok calon Gubernur Sumatera Utara (Cagubsu) mendatang, selain ‘track-record’nya bersih dari korupsi, maka tidak mesti kader atau orang dari partai politik. Hal itu dikemukakan beberapa elemen pemuda maupun mahasiswa di Sumut/Medan kepada Waspada, kemarin. Menurut Wakil Ketua GP Ansor Kota Medan Syafrizal ElBatubara, Gubsu mendatang mesti bisa menjadi teladan bagi rakyat dan tidak pernah tersangkut pidana, terlebih khusus tindak pidana korupsi. ‘’Masih terkait kriteria Cagubsu sosoknya pun diharapkan tidak bersedia disponsori oleh oknum-oknum pendana atau pengusaha hitam,’’ katanya. Justru itulah, lanjutnya, selaku generasi muda kami sangat berharap sosok Cagubsu nanti merupakan orang yang berpengalaman mengelola birok-

rasi atau memenej instansi pemerintah, di samping tentu bisa mengayomi masyarakat Sumut seutuhnya. Syafrizal mencontohkan sosok almarhum HT Rizal Nurdin ketika menjabat Gubsu. Dalam kepemimpinan HT Rizal Nurdin boleh dikatakan Provinsi Sumatera Utara cukup‘dingin’, aman, tenteram, nyaman, sehingga mengangkat harkat dan m a r t a b a t Su m u t s e c a r a nasional. ‘’Artinya, Gubsu mendatang harus bisa membawa nama baik Sumut sebagai barometer keamanan serta kondusif,’’ tegasnya. Masih menurut dia, kriteria lain yang mungkin saja menjadi harapan masyarakat Sumut adalah, sosok Cagubsu itu mau membangun mental masyarakat Sumut meski tanpa harus menyisihkanpembangunanfisik. Di sisi lain, kata dia, insan

yang kelak memimpin Sumut ini, memiliki pula kemampuan meningkatkan perputaran roda ekonomi masyarakat. ‘’Sedangkan tidak kalah pentingnya adalah mampu menghilangkan‘saling intip’ dan kecurigaan antara sesama unsur atau elemen Forum Pimpinan Daerah, atau Muspida. Misalnya, Kejaksaan atau Kepolisian ‘mengintip’ Pemprovsu. Sebaliknya, kalangan oknum Pemprovsu membongkar tingkah laku oknum Kejaksaan maupun Kepolisian,’’ ungkapnya. Tegasnya, sosok itu harus mampu mensinerjikan sesama unsur/elemen Muspida. Menyinggung, apakah sudah ada gambaran profil atau sosok yang sedemikian, Syafrizal menyatakan tegas, hingga kini belum ada. Namun demikian bukan tidak mungkin akan muncul sosok yang hampir mendekati keinginan itu. (m34/m49)

Partai Demokrat Gelar Gebyar Ramadhan MEDAN (Waspada): Untuk meningkatkan ukhuwah Islamiyah dan syiar agama Islam antara masyarakat dengan Keluarga Besar Partai Demokrat khususnya Dewan Pimpinan Cabang (DPC) Kota Medan akan menggelar Gebyar Ramadhan 1433 H memperebutkan uang tunai dan tropy . Pjs Ketua DPC Partai Demokrat (PD) Medan Drs Ir H Sutan Batugana Siregar MM mengatakan hal itu kepada wartawan di Kantor DPC PD Kota Medan Jalan Jend. AH Nasution Medan, Kamis (19/7). Kegiatan yang akan berlangsung mulai 5 sampai 9 Agustus 2012 itu, sebut Sutan, semakin memperat kerjasama antara sesama pengurus dalam menyambut bulan suci Ramadhan 1433 H ini. “Even ini sangat penting dan saya mendukung dan memberikan apresiasi yang tinggi terhadap kinerja panitia secara tim dan kompak,” ujar Sutan didampingi Pjs Sekretaris DPC Partai Demokrat Medan Ir Bangun Tampubolon, Msi. Ketua Panitia IrYahya Payungan Lubis didampingi Sekretaris Yusnizar Husin dalam kesempatan itu menyebutkan, dalam Gebyar Ramadhan tersebut, PD Medan akan memberikan uang punggahankepada kader dan ranting dalam safari Ramadhan di lima daerah pemilihan (Dapil) Kota Medan. Demikian juga, pembagian sirup pada H minus 3 Syawal dan buka puasa bersama. Tidak itu saja, lanjut Yahya, PD Medan juga akan memberikan santunan kepada anak yatim piatu dan para tokoh agama serta diumumkan pemenang berbagai perlombaan berikut pemberian hadiah kepada para pemenang tersebut. Adapun kegiatan yang akan berlangsung di

palataran parkir kantor DPC Partai Demokrat Medan meliputi perlombaan baca takhtim tingkat ibu-ibu, lomba Barjanji Marhaban tingkat dewasa putra, lomba busana muslim tingkat kanak-kanak dan remaja putra-putri dan perlombaan lainnya. Tempat dan pendafaran di kantor DPC PD Kota Medan, mulai 19 s/d 31 Juli 2012 pukul 09:00 sampai 16:00 Wib. Untuk persyaratan peserta takhtim ibu-ibu, jumlah peserta 9 sampai 12 orang/group, membawakan teks yang telah dipersiapkan panitia. Mengisi formulir pendaftaran, lagu dan irama bebas. Marhaban dewasa putra, usia 20 sampai 45 tahun dengan jumlah peserta 9 sampai 12 orang/ grup, membawakan teks yang dipersiapkan panitia, mengisi formulir pendaftaran, lagu rass bebas. Lomba busana muslim kanak-kanak dan remaja putri perseorangan, mengisi formulir pendaftaran dan menyerahkan foto ukuran 3x4 2 lembar (warna). Sedang technical meeting pada 3 Agustus 2012 pukul 10 sampai 12:00 Wib di Sekretariat pantia. Total hadiah yang diperebutkan sebesar Rp60 juta, antara lain lomba baca taktim ibu-ibu, juara 1 Rp4.000.000 ditambah trophy dan piagam, juara 2 Rp3.500.000 sampai seterusnya juara 6 mendapatkan hadiah Rp1.500.000 berikut tropi dan piagam. Lomba marhaban dewasa putri juara pertama Rp4.000.000 berikut trophy dan piagam, juara 2 Rp3.500.000 sampai juara 6 Rp1.500.000 berikut trophy dan piagam. Busana muslim putra dan putri juara pertama Rp1 juta, kedua Rp8.50.000 dan sampai juara 6 mendapatkan hadiah Rp600.000 berikut trophy dan piagam. (cwan)

Kapoldasu Diminta Tuntaskan Kasus Pengrusakan Papan Kantor Pengacara MEDAN (Wasada): Polresta Medan harus proaktif dan profesional dalam menangani kasus pengrusakan papan nama dan pencurian dokumen di kantor Advokat Erdi Surbakti SH, Jln. Kapten Pattimura No 157-439 Medan. “Polresta Medan menangani kasus penipuan dan penggelapan dokumen. Sedangkan, Polsek Medan Baru menangani kasus pencurian dan pengrusakan papan nama,” kata korban Erdi Surbakti SH, kepada Waspada, di Medan, Rabu (18/7) malam. Menurut Erdi, kedua kasus sudah dilaporkan ke Polresta Medan pada 17 September 2011 dan Polsek Medan Baru pada 4 Agustus 2011. Dalam kasus pengrusakan dan pencurian, tersangka berinisial MS, 40, penduduk Jln. Alfalah IV Medan, kini sedang menjalani persidangan di Pengadilan Negeri Medan. Sedangkan tersangka BG, 46, penduduk Jln. Kenanga, Kel. Simpang Kata, Kec. Medan Selayang/Komplek Pemdasu, juga ditetapkan Polsek Medan Baru sebagai tersangka kasus pengrusakan dan pencurian. Sementara kasus penipuan dan pengelapan masih dalam proses karena alat bukti telah dikuasai tersangka BG. Disebut-sebut alat bukti itu sudah digunakan untuk keuntungan pribadi (dijual) kepada pembeli lahan tanah dan rumah berukuran 2.500

meter di Jln. Kapten Pattimura No.157-439 Medan berinisial E dan seorang wanita berinisial S. Erdi Surbakti meminta kepada Kapoldasu Irjen Pol Drs HWisjnu Amat Sastro SH, agar menginstruksikan Kapolresta Medan Kombes Pol Monang Situmorang SH, MSi, serius menangani kasus itu, sekaligus melakukan penyitaan barang bukti yang saat ini masih dikuasai tersangka BG, agar terpenuhi dua alat bukti sebagai sarat perlengkapan berkas BAP atas tersangka BG. Selain itu, korban juga mengugat pemilik tanah Tengku Syed Ali Mahdar di Pengadilan Negeri Medan dalam perkara No.606/Pdt. G/ 2011/PN.MDN, masalah wan prestasi senilai Rp13 miliar. Peristiwa itu berawal korban Erdi Surbakti SH, sebagai kuasa hukum Tengku Syed Ali Mahdar, 76, pemilik tanah dan rumah berlokasi di Jln. Pattimura No.157-439, Kel. Darat, Kec. Medan Baru, pada 13 Agustus 2008. Selesai perkara dari Mahkamah Agung (MA) terkait kasus pembatalan sertifikat hak guna bangunan No.291/Darat. Selanjutnya, tersangka BG telah memperalat pemilik tanah Tengku Syed Ali Mahdar dengan menyuruh menandatangani akte jual beli atas objek tanah tersebut. Sementara kontrak kerja dengan korban senilai Rp2,7 miliar belum diselesaikan. (m36)

WASPADA Jumat 20 Juli 2012

Gubernur Sumut Pilihan Pembaca Waspada Pemilihan Gubernur Sumut akan berlangsung 7 Maret 2013. Sejalan dengan itu bermunculanlah para peminat jabatan tersebut. Mereka al. Gatot Pujo Nugroho, Gus Irawan, Chairuman Harahap, AY Nasution, Amri Tambunan, Cornel Simbolon, RE Nainggolan, Benny Pasaribu, Wildan Tanjung, T. Milwan, Soetan Bhatoegana, Rosiana Sianipar, Anuar Shah, Kamaluddin Harahap, Bintatar Hutabarat, Erry Nuradi, Fadly Nurzal, Syah Afandin dan Kastorius Sinaga. Dari sekian banyak nama-nama tsb di atas, Anda tentu mempunyai pilihan. Tuliskan satu nama calon gubernur Sumut pilihan Anda di bawah ini.

Nama Gubsu Pilihan Anda: ————————————————————— Nama pengirim : Alamat

:

KTP/SIM

:

� Kirim ke Harian Waspada Jl. Brigjen Katamso No. 1 Medan � Harian Waspada akan mengumumkan setiap hari hasil

pilihan pembaca mulai tanggal 10 Juli 2012.

� Hasil pilihan pembaca ditutup 15 Agustus 2012 dan pada

16 Agustus 2012 pengumuman bagi 10 pemenang yang berpartisipasi.

� 10 Pemenang masing-masing akan mendapat 1 (satu) buah BlackBerry Gemini. � Bagi pengirim di luar kota Medan, dapat mengirimkan kuponnya melalui agen harian Waspada setempat. � Semua Kupon yang masuk akan diundi. �

Keputusan panitia tidak dapat diganggu gugat. (tim)

Hasil Pilihan Pembaca Waspada 19 Juli 2012 Sampai Pkl 16:30 WIB

Pengedar Ganja Diringkus BELAWAN (Waspada): Seorang pengedar ganja berinisial ES, 38, warga Kayu Besar, Simpang Sicanang, Kec. Medan Belawan, ditangkap petugas Reskrim Polsek Belawan, dari kediamannya Kamis (19/7) siang. Dari tersangka ES yang bekerja sebagai buruh bangunan itu disita barang bukti 1 kg ganja kering. Dia juga merupakan residivis kasus pencurian. Penangkapan berawal dari informasi yang diperoleh polisi, bahwa rumah tersangka sering dijadikan tempat transaksi jual beli ganja. Polisi kemudian menyaru sebagai pembeli ganja mendatangi rumah tersangka. Ketika ganja yang dipesan diberikan, polisi langsung menangkap ES berikut barang bukti 1 kilogram ganja kering yang didapat dari kamar rumah tersangka. Tersangka ES mengaku, terpaksa menjadi kurir ganja karena sebagai buruh bangunan penghasilannya tidak memadai apalagi jarang mendapat borongan sehingga tidak cukup untuk menafkahi keluarganya. Dia juga mengaku ganja tersebut dibeli dari temannya bernama Anto, warga Pulo Brayan, yang saat ini masih diburon. Kapolsek Belawan Kompol Bambang Haryono melalui Kanit Reskrim AKP RH Sinaga mengatakan, pihaknya akan terus memerangi peredaran narkoba di wilayahnya. “Kita akan tindak terus peredaran narkoba agar suasana bulan suci dapat berkah,” katanya. (h03) Waspada/Rudi Arman

KANIT Reskrim Polsek Medan Timur AKP Ridwan (kiri) saat menginterogasi ketiga tersangka (jongkok) di ruang juru periksa, Kamis (19/7).

Tiga Pelajar SMA Curi Sepedamotor MEDAN (Waspada): Tiga pelajar SMA diamankan Reskrim Polsek Medan Timur usai mencuri sepedamotor milik Fransisco Sumantri, 26, warga Jalan Bintang RRI lama, dalam penyergapan di Jln Timor Baru II, Rabu (18/7) malam. Tersangka WFS, 18, warga Lawe Petanduk I, Kec. Bukit Tusam Kutacane, Aceh Tenggara, baru tamat SMA di Aceh Tenggara dan baru sebulan di Medan, DNT, 17, pelajar SMA di Medan, warga Jalan Coklat XII Perumnas Simalingkar A, dan FSN, 16, pelajar SMA di Medan, warga Jalan Tembakau Raya, Perumnas Simalingkar A. Dari tersangka disita barang bukti sepedamotor hasil curian

Zupiter MX BK 4519 MAD. Kapolsek Medan Timur Kompol Patar Silalahi melalui Kanit Reskrim AKP Ridwan kepada wartawan, Kamis (19/ 7) mengatakan, peristiwa terjadi sekira pukul 23:30. Malam itu, usai mereka minum tuak di kawasan Jln. Bintang dekat RRI lama, melihat sepedamotor milik korban terparkir di depan rumahnya dalam keadaan stang tidak dikunci. “Yang mempunyai inisiatif mencuri sepedamotor tersangka WFS,” ujarnya. WFS berperan mengambil sepedamotor korban dari halaman rumahnya. Setelah itu dia menyerahkan sepedamotor tersebut kepada tersangka DNT,

sedangkan FSN berperan memantau situasi di lokasi kejadian. Namun saat ketiga tersangka membawa sepedamotor hasil curiannya di Jln. Timor Baru II, diketahui oleh korban yang kemudian berteriak pencuri. Saat bersamaan melintas anggota Polsek Medan Timur yang langsung menangkap ketiga tersangka bersama barang bukti sepedamotor hasil kejahatan. Ketiga tersangka dikenakan pasal 363 KUHPidana dengan ancaman hukuman diatas lima tahun. Untuk pengusutan lebih lanjut mereka dijebloskan dalam sel tahanan. (m39)

Warga Protes Alih Fungsi Lapangan MEDAN(Waspada):PuluhanwargaberunjukrasadikantorKelurahan Tegalsari Mandala I, Kecamatan Medan Denai, Kamis (18/7), memprotes alih fungsi lapangan olahraga di Jalan Mandala By Pass. Para pengunjukrasa membentang poster karton yang berisikan kata-kata penolakan terhadap alih fungsi lapangan yang bersisian dengan rel kereta api tersebut. Aksi tersebut mendapat kawalan petugas Polsek Medan Area dipimpin langsung Kapolsek Kompol Sonny W Sirega, sementara para pegawai/staf kelurahan turut berjaga-jaga. Menurut koordinator aksi M Windoem SH, dari Lembaga Kreativitas Seni Anak Sumatera Utara (Lokus Sumut), pengalihan fungsi lapangan (tanah lapang Mandala) tersebut, saat ini sedang dalam proses penimbunan. Menjawab pertanyaan, apakah alih fungsi tersebut terkait dengan rencana pemindahan puluhan kios buku di kawasan Lapangan Merdeka Medan (Bursa Buku Titi Gantung), Windoem membenarkan. Kepada Camat Medan Denai Edie,Windoem mempertanyakan sekaligus mendesak camat untuk segera membatalkan alih fungsi sarana olah raga itu.“Kami menunggu ketegasan Pak Camat,” katanya. Namun, Edie menjelaskan, pembongkaran bangunan bermasalah atau alih fungsi tersebut bukan kewenangannya. Akan tetapi pihaknya akan memberikan peringatan hingga tiga kali, lalu selanjutnya melaporkan ke Dinas Tata Ruang dan Tata Bangunan (TRTB) Kota Medan. “Dinas tersebut yang berwenang melaksanakan pembongkaran,” katanya.(m34)

Tiga Pemakai Ganja Dan 12 Preman Diamankan

Waspada/Rudi Arman

KANIT Reskrim Polsek Percut Seituan AKP Faidir (kanan) memaparkan tangkapan tiga pemakai narkoba yang ditangkap di Titi Sewa Tembung.

MEDAN (Waspada): Ops Cipta Kondisi yang dilaksanakan Polsek Percut Seituan berhasil menangkap tiga pemakai ganja, 12 preman, dan mengamankan ratusan botol miras dalam penyergapan terpisah, Rabu (18/7) malam. Ketiga tersangka AIL, 43, warga Jln. Letda Sujono Gang Benteng Hilir Titi Sewa, IJ, 41, warga Jln. Letda Sujono, dan MS, 22, warga Jln. Letda Sujono. Barang bukti yang diamankan dari tersangka dua bungkus koran daun ganja kering. Kapolsek Percut Seituan Kompol Maringan Simanjuntak melalui Kanit Reskrim AKP Faidir Chaniago SH, MH, Kamis

(19/7) mengatakan, ketiga tersangkaterjaringOpsCiptaKondisi dan Ops Pekat yang dilaksanakan Polsek Percut Seituan. Penangkapan itu dilakukan saat petugas yang melakukan patroli melihat ketiga tersangka berkumpul di Titi Sewa Tembung asyik mengisap ganja. Polisi langsung mengamankan ketiganya. Saat dilakukan pemeriksaan ditemukan dua bungkus daun ganja kering di badan tersangka. Mereka kemudian diboyongkePolsekPercutSeituan. Ratusan miras Faidir menjelaskan, dalam Ops Cipta Kondisi dan Ops Pekat, pihaknya berhasil mengamankan ratusan botol minu-

man keras berbagai merek yang disita dari dua toko di Jln. Tuasan dan Jln. Pancing. “Pemilik toko kita boyong ke Polsek untuk dimintai keterangan dan setelah membuat surat pernyataan serta mendapat pembinaan yang bersangkutan kita pulangkan,” ujarnya. Begitu juga dengan 12 preman yang diamankan dari wilayah hukum Polsek Percut Seituan karena mengutip uang. “Mereka juga kita pulangkan karena korbannya tidak ada membuat pengaduan. Tapi sebelum pulang kita beri pembinaan dan membuat surat pernyataan tidak mengulangi lagi perbuatannya,” tutur Faidir. (m39)


WASPADA Jumat 20 Juli 2012

Calon Independen Muncul Karena Rakyat Tak Percaya Parpol JAKARTA (Waspada): Munculnya calon independen dalam Pemilukada akhir-akhir ini khsususnya di Jakarta, karena rakyat sudah mulai tidak percaya lagi kepada partai. Dan, suara sebesar 5 % yang diperoleh oleh pasangan Faisal-Biem sebagai bukti bahwa kalangan menengah sangat menyadari pentingnya proses demokrasi dan politik di Indonesia berjalan sebagaimana seharusnya, dan tidak dikendalikan oleh kekuatan kapital, donasti maupun oligarki politik, yang terbukti selama ini menghambat jalan demokrasi itu sendiri. “Jadi, jangan sampai parpol kehilangan kepercayaan rakyat dengan model politik yang dilakukan selama ini. Karena itu kalau mau proses politik dan demokrasi ini berjalan sesuai harapan rakyat dan akan mampu memenuhi kebutuhan rakyat, maka partai harus mulai meninggalkan oligarki, kapitalisme dan dinasti politik. Semoga ini bukan hanya mimpi, tapi merupakan kebutuhan bersama untuk Indonesia yang lebih baik ke depan,” tandas pengamat politik LIPI Siti Zuhro bersama Cagub DKI Jaya Faisal Basri dan Maruarar Sirait (FPDIP) DPR RI dalam dialog “Pemilukada” di Gedung DPR RI Jakarta, Kamis (19/7). Demokrasi yang diikuti oleh kekuatan kapital baik berupa uang, sembako, serangan fajar dan sebagainya dalam setiap menjelang pemilu justru makin memperburuk demokrasi dan politik negara ini. Lebih mengkhawatirkan lagi lanjut Siti Zuhro, tidak menjadikan rakyat tercerahkan dengan perilaku politik yang buruk ini. “Jadi, partai maupun calon independen harus mengajak rakyat untuk memahami tujuan berpolitik ini untuk memperbaiki kehidupan berbangsa dan bernegara. Bukan saja sekadar memilih calon pemimpin,” tambah Siti. Menurut Faisal Basri, dia memilih jalur independen karena dirinya meyakini hanya melalui jalur politik inilah garis perjuangan politiknya itu bisa diperjuangkan. Mengapa? “Kalau melalui parpol, maka harus ada uang besar, karena partai sudah dikendalikan oleh kekuatan modal. Melalui dinasti saya juga tidak bisa, dan apakah melakukan perubahan itu harus melakukan revolusi? Juga tidak mungkin. Untuk itulah saya maju secara independen,” katanya. Hanya saja dia sangat merasa diperlakukan diskriminatif oleh aturan Pemilukada dengan syarat dan verifikasi faktual yang rumit dibanding dengan calon dari partai. Termasuk persyaratan kartu tanda penduduk (KTP) yang harus bertemu dengan warga secara langsung, yang jumlahnya puluhan ribu tersebut. “Itulah antara lain yang akan kami gugat uji materi ke Mahkamah Konstitusi (MK) agar calon dari partai dan independen itu tidak diskriminatif,” ujar mantan Sekjen DPP PAN ini. Dengan demikian menurut Faisal Basri, tujuannya maju dalam Pemilukada DKI tersebut bukan masalah menang atau kalah, melainkan ingin menyadarkan kepada rakyat bahwa tujuan berpolitik itu mulia untuk membangun daerah dan bangsa yang lebih baik. Sehingga tidak berhenti pada pilihan politik sebatas uang, money politics, sembako dan sebagainya, yang justru tidak berdampak pada perbaikan kesejahteraan, ekonomi, pendidikan, kesehatan, penegakan hukum, korupsi dan sebagainya. Namun demikian Maruarar meyakinkan bahwa pencalonan Jokowi-Ahok sebagai bukti bahwa partainya tidak dikendalikan kekuatan kapital, pengusaha, uang, oligarki maupun dinasti. “Untuk pemilukada kali ini bukti bahwa PDIP tidak dikendalikan oleh kekuatan uang, modal, pengusaha, oligarki maupun dinasti. Karena figur Jokowi-Ahoklah yang membuat PDIP-Gerindra menang di putaran I. Jadi, kita juga melakukan perubahan dari dalam partai, agar rakyat tidak sampai kehilangan kepercayaan terhadap parpol, meski ini tidak mudah,” tutur putera politisi senior PDIP Sabam Sirait.(j07)

TK Minta JK Tak Nyapres, Dukung Yang Muda JAKARTA (Waspada): Ketua MPR RI yang juga Ketua Dewan Pertimbangan Partai PDIP Taufiq Kiemas (TK) tetap pada pendiriannya agar dalam Pilpres 2014 memberikan peluang pada orang muda. Sebaliknya generasi yang sudah berumur seperti Jusuf Kalla (JK), Wiranto, Aburizal Bakrie (Ical), maupun Megawati sebaiknya tidak mencalonkan diri dan kepemimpinan ke depan sebaiknya diserahkan pada generasi muda. Namun, kalau mereka tetap akan maju itu hak mereka dan terserah rakyat akan memilih atau tidak. “Kalau mereka akan tetap maju di Pilpres, ya itu hak pribadi mereka. Kalau saya dan merasa sudah berumur, ya tidak mau. Dalam kepemimpinan ke depan seharusnya mulai diserahkan ke generasi muda dan yang tua harus siap menerima regenerasi. Karena regenerasi itu suatu keniscayaan,” tandas Taufiq Kiemas pada wartawan di Gedung DPR RI Jakarta, Kamis (19/7). Tapi, lanjut Taufiq, kalau niat Pak JK sudah bulat tentu tak ada yang bisa melarang. Karena tiap warga negara mempunyai hak berpolitik yang sama. “Saya juga tidak bisa melarang karena itu hak pribadi,” katanya. Namun, peluang JK untuk maju Pilpres 2014 melalui Golkar telah tertutup, karena Golkar telah mendeklarasikan Aburizal Bakrie sebagai capres tunggal. Tapi,JK disebutsebut sedang melakukan penjajakan ke sejumlah parpol kemungkinan bisa terus maju dalam Pilpres 2014 nanti. Sementara itu JK dipastikan akan dipecat dari Golkar kalau nekat nyapres melalui partai lain. Saat ini tawaran untuk JK memang masih wacana. Nasdem misalnya yang sempat mendorong pencapresan JK, sementara Partai Gerindra menggadang JK menjadi cawapres Prabowo Subianto. Ketua DPP Golkar yang juga Wakil Ketua MPR RI Hajrijanto Y Thohari pun mengakui jika sosok JK sangat kuat di mata rakyat, sehingga wajar kalau ada yang mendorong untuk maju sebagai capres 2014. Sejauh itu siapakah tokoh muda yang layak maju ke Pilpres 2014 nanti, Taufiq Kiemas menyebut kader PDIP antara lain Ketua DPP PDIP Puan Maharani dan mantan Sekjen PDIP Pramono Anung sebagai capres alternatif PDIP. “Keduanya anak muda dan mempunyai potensi yang bagus.Ya memang mesti regenerasi. Itu kan terserah ketua umumnya kalau saya bagus semua yang satu anak yang satu teman dekat,” tutur Taufiq.meyakinkan. Sebelumnya Wasekjen Golkar, Tantowi Yahya menyatakan, Golkar telah menutup pintu bagi Pak JK untuk nyapres 2014. Menurut Tantowi, jika JK sudah memastikan diri nyapres lewat partai lain, maka JK diminta mundur sebelum dipecat dari Golkar. “Rapimnas III Golkar di Bali melahirkan beberapa keputusan. Salah satunya menetapkan Pak Ical jadi capres Partai Golkar. Menetapkan visi misi dan program capres dan menetapkan bahwa cawapres itu adalah domain dari capres. Kemudian selain itu di Komisi Disiplin menetapkan aturan bahwa kader dan fungsionaris Golkar itu dilarang untuk terlibat baik langsung ataupun tidak langsung dalam program-program mendukung capres lain,” katanya.(j07)

Mobile Application AirAsia Sementara Tak Bisa Diakses JAKARTA (Waspada): Application AirAsia saat ini tidak dapat diakses melalui mobile karena ada perbaikan sampai ada pemberitahuan selanjutnya. ”Para pelanggan AirAsia yang selama ini dapat mengakses dengan mobile application AirAsia yang ada di iPhone, Android, Blackberry dan Nokia serta mobile website tidak dapat diakses. Hal ini karena ada gangguan dan kami akan memberitahukan apabila kembali dapat diakses,” kata Communications Manager AirAsia, Audrey Progastama Petriny, dalam keterangan persnya di Jakarta, Kamis(19/7). Menurut Audrey, para pelanggan AirAsia dapat mengunjungi www.airasia.com untuk melakukan pemesanan atau pembelian tiket, mengatur pemesanan tiket, serta check-in. Dikatakannya, AirAsia memiliki komitmen untuk terus melakukan inovasi serta meningkatkan kualitas layanan mobile. Kami juga akan berusaha memberikan solusi terbaik untuk menggantikan layanan ini. ”Kami mohon maaf atas ketidaknyamanan yang telah disebabkan dan sangat menghargai kesabaran para pelanggan kami selama gangguan ini terjadi,” kata Audrey.(j02)

Nusantara

A7

SKB Hari Libur Nasional Dan Cuti Bersama 2013 Ditandatangani JAKARTA( Waspada): Meski tahun 2012 masih lima bulan lagi berakhir, namun pemerintah telah menerbitkan Surat Keputusan Bersa-

ma (SKB) 3 Menteri tentang hari libur nasional dan cuti bersama untuk tahun 2013. SKB tersebut ditandatangani Menteri Pendayagunaan Aparatur Negara dan

Reformasi Birokrasi Azwar Abubakar, Menteri Tenaga Kerja dan Trans-migrasi Muhaimin Iskandar dan Sekretaris Jenderal Kementerian Agama (Sekjen

Waspada Hermanto

PENANDATANGANAN SKB 3 menteri tentang hari libur nasional dan cuti bersama tahun 2013 oleh Menpan RB Azwar Abubakar, Menakertrans Muhaimin Iskandar dan Menag yang diwakili Sekjen Kemenag Bahrul Hayat disaksikan Menko Kesra Agung Laksono, di kantor Kemenko Kesra, Jakarta, Kamis (19/7).

Kemenag) H. Bahrul Hayat mewakili Menteri Agama, di kantor Kemenko Kesra, Jakarta, Kamis (19/7). Menurut Menko Kesra Agung Laksono, kebijakan cuti bersama bertujuan untuk meningkatkan efisiensi dan produktivitas kerja serta meningkatkan sektor pariwisata

dalam negeri. Agung Laksono menambahkan, cuti bersama merupakan kompensasi bagi PNS yang kesulitan mengambil waktu cuti namun tetap mempertimbangkan kepentingan masyarakat. Misalnya seperti perbankan, Rumah Sakit dan sektor pelayanan publik lain,

yang pengaturannya diserahkan pada manajemen kantor masing-masing. “Setiap PNS hak cutinya 12 hari. Namun kebijakan itu diatur PNS itu sendiri. Hari libur nasional tahun 2013 yakni 14 hari dan cuti bersama 2013 yakni 5 hari,” kata Agung.

Berikut hari libur nasional 2013: 1. Tahun Baru 2013 pada Selasa 1 Januari 2. Maulid Nabi Muhammad pada Kamis 24 Januari 3. Tahun Baru Imlek 2564 pada Minggu 10 Februari 4. Hari Raya Nyepi Tahun Baru Saka 1935 pada Selasa 12 Maret 5. Wafat Isa Almasih pada Jumat 29 Maret 6. Kenaikan Isa Almasih pada Kamis 19 Mei 7. Hari Raya Waisak 2557 pada Sabtu 25 Mei 8. Isra’ Mi’raj pada Kamis 6 Juni 9. Hari Kemerdekaan RI pada Sabtu 17 Agustus 10. Hari Raya Idul Fitri pada Kamis 8 Agustus dan Jumat 9 Agustus 11. Hari Raya Idul Adha pada Selasa 15 Oktober 12. Tahun Baru 1435 H pada Selasa 5 November 13. Hari Raya Natal Rabu 25 Desember Sedangkan cuti bersama tahun 2013: 1. Cuti bersama Hari Raya Idul Fitri pada Senin 5 Agustus, Selasa 6 Agustus dan Rabu 7 Agustus 2. Cuti bersama Hari Raya Idul Adha pada Senin 14 Oktober 3. Cuti bersama Hari Raya Natal pada Kamis 26 Desember.( j06 )

Migran Masih Penerimaan Siswa Baru Pekerja Minim Perlindungan Harus Bebas Intervensi JAKARTA (Waspada): Menteri Pendidikan dan Kebudayaan (Mendikbud) Mohammad Nuh menjamin sekolah bebas dari intervensi berbagai pihak saat penerimaan peserta didik baru (PPDB). Kementerian Pendidikan dan Kebudayaan (Kemdikbud) telah menurunkan tim untuk memonitor di lapangan termasuk juga untuk menanggapi keluhan-keluhan terkait PPDB. “Kami sudah turun untuk menyelesaikan persoalan-persoalan itu, serta memberikan garansi kepada kepala sekolah karena panitia utamanya itu di sekolah masing-masing. Nah itu yang harus kita lindungi, jangan sampai diintervensi dan ditekan oleh siapapun, sehingga penerimaannya tidak didasarkan atas kemampuan akademik,” katanya saat memberikan keterangan pers di kediamannya, Komplek Menteri Widya Chandra, Jakarta, Kamis (19/7). Mendikbud menyampaikan, seleksi PPDB untuk jenjang sekolah menengah pertama (SMP) dan sekolah menengah atas (SMA) semata-

mata didasarkan atas kemampuan akademik, sedangkan untuk jenjang sekolah dasar (SD) tidak menggunakan prestasi akademik, melainkan tanggal lahir. Saat ini, sudah banyak SD yang melakukan proses PPDB lewat tes akademik. Dan hal itu sangat disayangkan. “SD yang tahun ini sudah terlanjur melaksanakan tes masuk, ya sudah. Tahun depan tidak boleh lagi,” kata Nuh. Harus Turun Tangan Terkait pungutan pada saat PPDB untuk alasan biaya investasi maupun biaya operasional, Mendikbud menegaskan, pihaknya akan memberikan sanksi kepada sekolah untuk mengembalikan pungutan. Kementerian akan memberikan saran kepada dinas kabupaten atau kota untuk memberikan teguran kepada sekolah. “Dinas harus memberikan peringatan teguran kepada sekolah yang melakukan pungutan investasi ataupun operasional,” katanya. Dikatakan Nuh, pemerintah menjamin aksesibilitas bagi seluruh masyarakat untuk masuk di pendidikan terutama pendidikan dasar karena wajib

hukumnya. Oleh karena itu, kata dia, seluruh hambatan-hambatan yang menyebabkan sulitnya orang untuk akses ke pendidikan dasar itu harus dicari penyebabnya. “Yang biasa menghambat untuk masuk ke pendidikan dasar itu salah satu diantaranya adalah masalah pembiayaan,” katanya. Padahal, lanjut Mendikbud, pemerintah telah memberikan jaminan untuk pendidikan

dasar harus diberikan dukungan penuh baik oleh pemerintah pusat, pemerintah kabupaten, kota, dan provinsi. “Dari situlah kenapa kita mengeluarkan Permen no. 44 Tahun 2012. Isinya antara lain melarang betul kalau ada penerimaan siswa baru itu dipungut pembiayaan non-personal yaitu biaya operasional maupun biaya investasi untuk sekolah negeri,” tandas Mendikbud.(dianw)

15 TKI Dari Syria Dipulangkan Ke Daerah Asal JAKARTA (Waspada): Badan Nasional Penempatan dan Perlindungan Tenaga Kerja Indonesia (BNP2TKI) kembali menerima dan sekaligus memulangkan 15 tenaga kerja Indonesia (TKI) dari Syria ke daerah asal. Ke-15 TKI Syria tersebut diterima BNP2TKI pada Rabu (18/7). Setelah dilakukan pendataan di Balai Pelayanan Kepulangan (BPK) TKI di Selapajang, Tangerang, Banten, mereka langsung dipulangkan ke daerah asal masing-masing.

Demikian disampaikan Kasubdit Pelayanan Kepulangan Direktorat Pemberdayaan BNP2TKI, Budiman Pasaribu, di ruang kerja di Jakarta, Kamis (19/7). Ia mengatakan, 15 TKI di Syria ini tiba di Bandara Internasional Soekarno – Hatta pada Rabu (18/7) pukul 08:15 WIB. Mereka diterbangkan dengan pesawat Garuda GA 825 dari Damaskus, Selasa (17/7) menuju Dhubai, terus ke Singapura dan Jakarta. (j07)

JAKARTA (Waspada): Lebih dari 2,8 juta perempuan Indonesia bekerja di luar negeri. Tapi perlindungan hukum dan keselamatan kerja bagi mereka masih minim. Menteri Negara Pemberdayaan Perempuan dan Perlindungan Anak (Menneg PP dan PA) Linda Amaliasari Gumelar mengatakan, perlu dilakukan pembenahan guna meningkatkan perlindungan pekerja Indonesia di luar negeri. Dikatakan Linda, momentum perlindungan pekerja migran menjadi sangat tepat, pasca ratifikasi konvensi pekerja migran 1990 lewat UndangUndang Nomor 6/2012. Dalam ketetapan UU tersebut ditegaskan bahwa buruh migran tidak hanya sebagai buruh atau entitas ekonomi semata, tetapi juga sebagai makhluk sosial yang mempunyai keluarga dan hak-haknya sebagai manusia secara utuh. Konvensi ini menciptakan standar minimum bagi perlindungan buruh migran dan anggota keluarganya yang bersifat universal serta diketahui oleh masyarakat internasional. “Dengan adanya ratifikasi konvensi ini, maka Indonesia dapat meningkatkan posisi tawar dalam diplomasi memperjuangkan hak asasi pekerja migran di dunia internasional,” jelas Linda saat membuka semi-

nar bertajuk ‘ ratifikasi konvensi pekerja migran sebagai tonggak peningkatan perlindungan perempuan pekerja Indonesia di luar negeri’ di Kantor KPP dan PA, Jakarta, Kamis (19/7). Sebelumnya, perlindungan pekerja migran diatur dalam UU 39/2004 tentang Perlindungan Tenaga Kerja Indonesia yang Bekerja di Luar Negeri. Saat ini, UU tersebut sedang direvisi oleh DPR karena banyak mengandung kelemahankelemahan dari segi substansi maupun implementasinya. Beberapa kelemahan UU 39/2004 adalah tidak memuat secara jelas siapa yang bertanggung jawab pada perlindungan pekerja, tidak mengatur secara jelas hubungan antara pengguna dan pekerja serta tidak menyentuh keluarga pekerja Indonesia di luar negeri. “Undang-undang 39 juga bersifat pasif dan tidak mampu menjangkau perlindungan terhadap pekerja baik saat di luar negeri maupun pasca bekerja di luar negeri,” tegas Linda. Seminar ratifikasi konvensi pekerja migran diikuti utusan dari berbagai kementerian dan lembaga yang berperan dalam upaya perlindungan, diantaranya Kementerian Luar Negeri, Kementerian Tenaga Kerja dan Transmigrasi, BNP2TKI serta Migrant Care. (dianw)

Politisi Senior Postdam Hutasoit:

Paling Bagus, Presiden Tunjuk Langsung Gubernur JAKARTA (Waspada): Politisi senior dan mantan anggota MPR/DPR-RI periode 19992004 menyambut baik Rancangan Undang- Undang Pemilihan Kepala Daerah (RUU Pilkada) apa lagi salah satu point paling krusial yang akan dibahas pemerintah dan Komisi II DPRRI menyangkutpemilihangubernur dikambalikan ke DPRD. “Jika ditinjau dari sistem ketatanegaraan kita yang mencantumkan Persatuan Yang Dipimpin oleh Hikmat Kebijaksanaan Permusyawaratan Dalam Perwakilan, sebaiknya gubernur dipilih DPRD. Bahkan paling bagus lagi, pada masa mendatang gubernur ditunjuk langsung oleh presiden, “ujar Postdam Hutasoit, (foto), menjawab Waspada di Jakarta, Kamis (19/7). Menurut Postdam, bila gubernur ditunjuk langsung oleh presiden maka namanya menjadi gubernur wilayah, yang tugas dan tanggung jawabnya merupakan perpanjangan ta-

ngan presiden di wilayah masing-masing. Dengan berbagai masalah di wilayahnya dapat diselesaikan di wilayah dan tidak harus ke pusat dan tentu diharapkan faktor keamanan di tengah-tengah masyarakat akan semakin baik. Postdam mengingatkan apa yang pernah disampaikan Bung Hatta bahwa boleh ada provinsi, tetapi jangan otonom. Sebab, otonom yang paling efektif di Indonesia berada di daerah tingkat II, yakni kabupaten dan kota. Sedangkan provinsi itu, sifatnya koordinasi saja.

Jadi, tegas Postdam, gubernur dipilih DPRD akan lebih cocok dan kemudian ke depan diproses lagi agar gubernur tidak dipilih oleh DPRD, melainkan ditunjuk oleh presiden sebagai kepala wilayah. Karena gubernur sudah ditunjuk oleh presiden dan bukan otonom, maka Provinsi Sumut misalnya, namanya berubah menjadi provinsi wilayah Sumatera Utara yang dipimpin oleh seorang gubernur. Anggota DPR/MPR RI tahun 1982- 2004 ini mengingatkan, Undang-Undang nomor 22 Tahun 1999 tentang Penekanan Otonomi dan kemudian keluar Undang -Undang Nomor 32 Tahun 2004, Indonesia telah melaksanakan penekanan otonomi di daerah tingkat II (kabupaten/ kota). Pemerintah pusat melalui departemendepartemen telah menghapuskan Kantor Wilayah (Kanwil) yang nafasnya diarahkan bahwa departemen-departemen itu tidak perlu mempunyai proyek, tetapi yang dimiliki adalah

program secara nasional. Semua departemen (saat ini kementerian) menyusun dan menetapkan programnya secara nasional dan terkait dengan itu pemerintah ( eksekutif) dan DPR (legislatif) mencari anggarannya. Jika, DPR sudah menentukan anggaran program Kementerian Pekerjaan Umum misalnya Rp 1.500 triliun, maka itulah yang dibagi kepada setiap provinsi yang dipimpin oleh gubernur sebagai KepalaWilayah, wakil pemerintah pusat di daerah. Apabila, wilayah Sumut misalnya mendapat anggaran Rp 100 triliun, maka gubernur sebagai kepala wilayah membaginya ke daerah tingkat II yang ada di wilayahnya, sesuai dengan Peraturan Daerah ( Perda) tingkat II yang sudah diputuskan oleh DPRD setempat. Memang, penentuannya harus ada proses dan bernegosiasi dengan provinsi. Salah satu kebaikan provinsi sebagai wilayah, semua tugas pemerintah

pusat,yangseharusnyatidakperlu di pusat, cukup dipu-tuskan di tingkat provinsi yang tentu diatur oleh Undang-Undang. “ Bukan seperti sekarang ini, anggaran Rp 5 miliar pun untuk membangun Proyek Air Minum (PAM), bupati atau wali kota harus datang ke Jakarta menemui pemerintah pusat, sehingga menghabiskan waktu dan tenaga “ kata Hutasoit sambil menambahkan, begitu sudah ditentukan jumlah pagu secara nasional dan kementerian tidak lagi memiliki proyek, maka DPR RI tidak perlu lagi membicarakan yang namanya Satuan Tiga yang selama ini selalu dipersoalkan. Saat ini, kata Postdam, karena kementerian (departemen) mempunyai proyek maka DPR RI harus membicarakan proyek apa itu. Jadi, jangan salahkan DPR, kalau membicarakan Satuan Tiga, karena itu anggaran nasional. Tetapi, kalau sudah pagu di tingkat nasional dan dibagi

ke daerah-daerah, maka Satuan Tiga itu cukup dibicarakan di daerah tingkat II, melalui gubernur. Jadi, rentang kendali pengawasan itu efektif di gubernur. Dilain sisi dan ini cukup penting, apabila provinsi menjadi wilayah yang dipimpin seorang gubernur yang ditunjuk presiden, akan sangat efektif dalam rangka menguatkan dan memperkokoh Negara Kesatuan Republik Indonesia ( NKRI). Mantan Staf di Kementerian Dalam Negeri ini berpendapat, dalam menyusun anggaran, baik secara nasional maupun wilayah, sesungguhnya tidak lepas dari struktur pemerintahan kita dari pusat sampai ke daerah. Makanya, masih banyak masalah yang perlu diatur di negara ini. Jika, sudah efektif otonomi daerah tingkat II, perlu dipertanyakan apakah masih perlu ada kementerian- kementerian (departamen). Sebab, kementerian itu perlu ada karena masih memiliki proyek. (aya)

TIME 2012 Di Lampung Targetkan AS$19 Juta JAKARTA (Waspada): Transaksi yang dicapai pada Pasar Wisata Indonesia atau Tourism Indonesia Mart and Expo (TIME) di Lampung tahun lalu hanya AS$15,7 juta. Tahun ini Lampung kembali menjadi tuan rumah TIME ke-18. Dan penyelenggaranya menargetkan AS$ 19 juta. Ketua Panitia TIME 2012, Meity Robot juga menargetkan akan menghadirkan 80 pebisnis pariwisata mancanegara dari 27 negara yang akan membeli paket-paket wisata nusantara yang dipamerkan pada event tahunan ini. “TIME tahun lalu hanya menghadirkan 77 buyer dari 27 negara,” kata Meity di Jakarta, Selasa (17/7). Transaksi TIME 2011, lanjut ketua Masyarakat Pariwisata Indonesia (MPI) ini memang di bawah transaksi yang mereka dapatkan saat menggelar TIME 2010 di Lombok, Nusa Tenggara Barat yang berhaisl meraup AS$18,9 juta. “Penyebabnya krisis ekonomi Eropa tahun lalu, berdampak pada penurunan minat wisman berwisata, termasuk ke Indonesia,” akunya. Untuk mewujudkan target TIME 2012, Lampung harus lebih siap lagi sebagai tuan rumah. “Event ini merupakan kesempatan buat Lampung memeprkenalkan obyek-obytek pariwisatanya ke dunia,” ungkapnya. Kalau bisa peserta TIME jangan hanya diajak ke Gunung Krakatau saja. Tapi juga diajak ke

Tanjung Setia, Teluk Kiluan, dan diperkenalkan kembali parade kain Tapis. “kalau bisa di ajak ke penangkaran badak. Saya dengar, baru-baru ini di Lampung ada Badak Sumatera yang baru melahirkan anaknya. Ini menarik bagi turis, terutama peserta TIME, “ kata Meity lagi. Kepala Dinas Kebudayaan dan Pariwisata Lampung, Gatot Hudi Utomo berjanji akan meningkatkan kualitas pelaksanaan TIME tahun ini. “Kami akan mempersiapankan lebih baik lagi sekaligus lebih gencar mempromosikan produk-produk lokal baik dari Indonesia ataupun dari Lampung sendiri,” katanya. Tempat penyelenggaraan TIME 2010, lanjut Gatot, ditempatkan di Graha Wangsa, Bandar Lampung. “Kami telah menyiapkan serangkaian acara tambahan seperti Tapis Carnival, Parade budaya mayarakat Lampung, Festival Krakatau, Tour Krakatau, dan obyek wisata Lampung lainnya serta pameran aneka kerajinan lokal,” ungkapnya. Gatot menambahkan pasca menjadi tuan rumah TIME 2011, kunjungan wisman ke Lampung meningkat. “Wisatawan Australia masih mendominasi. Obyek wisata yang paling diminati terutama surfing di Tanjung Setia, mendaki Gunung Krakatau, melihat gajah diWay Kambas, dan melihat lumba-lumba di Teluk Kiluan,” terangnya. (adji k)

SUASANA TIME 2011 di hotel Novotel, Bandar Lampung.

Waspada/adjik


Ekonomi & Bisnis

A8

WASPADA Jumat 20 Juli 2012

Hanya 48 Persen Rumah Tangga Punya Tabungan JAKARTA (Waspada): Hasil survei Bank Indonesia (BI) mengungkapkan persentase rumah tangga yang memiliki tabungan baik di Bank (LKB), lembaga keuangan non-bank (LKNB), dan non-lembaga keuangan (NKL) tercatat sebesar 48 persen.

Waspada / H. Rusli Ismai

SUASANA di Pasar Daging Musiman Gampong Ateuek Pahlawan, Kecamatan Baiturrahman, Banda Aceh, di hari meugang pertama, Kamis (19/7) masih sepi pengunjung, daging meugang di Pasar Peunayong, Banda Aceh, Kamis (19/7), yang harganya dinilai tinggi mencapai Rp.120.000 per kilogram. Sehari sebelumnya harga daging masih dijual Rpp.90.000 hingga Rp.100.000/kg.

Daya beli turun Harga daging sapi menjelang sehari atau meugang pertama Puasa Ramadhan 1433 H dipatok pedagang daging terlalu tinggi sehingga daya beli masyarakat turun. Keterangan yang diperoleh

Waspada, baik dari kalangan pedagang dan masyarakat, sehari sebelumnya yakni, Rabu (18/ 7), harga daging sapi di pasar tradisional masih dijual Rp90.000 hingga Rp100.000 per kg. Mahalnya harga daging meugang menyambut Puasa Ramadhan 1433 H bertahan hingga pk.13.00. Menjelang pk.14.00 harga turun secara perlahan sedikit turun menyusul daya beli masyarakat sangat kurang, ujar seorang pedagang kepadaWaspada di lapak jualan kawasan Peunayong. Berfluktuasi Di Langsa, sehari menjelang meugang, harga daging sapi segar, Kamis (19/7) berkisar antara Rp80.000 hingga Rp100.000 per kg, sedangkan untuk tulang, daging babat mencapai Rp50.000.

Di Matangglumpang Dua, Harga Daging Rp120 Ribu Per Kg BIREUEN ( Waspada): Harga daging sapi di Matangglumpang Dua, Kecamatan Peusangan, Bireuen, Kamis (19/ 7) mencapai Rp120 ribu per kg. Harga tersebut melambung dibanding sebelumnya yang hanya berkisar Rp90 ribu. “Harga daging seperti ini sudah lazim setiap meugang di Peusangan,” ucap Ramli, pedagang daging. Dia menyebutkan, harga tersebut adalah harga daging untuk kualitas terbaik. Kendati jumlah pedagang

daging pada hari pertama dan kedua meugang mencapai ratusan orang, namun harga tetap bertahan. “Karena sudah menjadi adat di Peusangan atau Aceh secara keseluruhan mengkonsumsi daging menjelang Ramdhan atau yang disebut dengan meugang,” terangnya. Sementara di Bireuen, harga daging pada hari meugang pertama ini dilaporkan juga mencapai Rp120 per kg hingga menjelang siang hari. (b17)

Hasil pantauan wartawan di lapangan, berfluktasinya harga daging sapi itu tergantung waktu dan tempat pembelian dan jenis sapinya. Jika dibeli pada pagi hari bisa mencapai Rp110.000, sedangkan menjelang tengah hari harga mulai berkurang menjadi Rp100.000, pada sore hari sudah bisa dibeli dengan harga Rp80.000. Begitu juga halnya di beberapa tempat di Kota Langsa, seperti Gampong Geudubang Jawa, harga daging sapi mencapai Rp100.000, sementara di Jalan Sudirman Langsa Kota harganya bisa sedikit lebih murah dari tempat lain berkisar Rp80.000. Banyaknya pedagang da-

ging sapi dadakan di beberapa tempat ini merupakan inisiatif pedagang yang memotong secara pribadi, karena waktu memotong secara resminya seperti tahun sebelumnya dilaksanakan satu hari sebelum puasa, hari ini Jumat (20/7). Menurut pedagang daging sapi di Pasar Kota Langsa, Basir, sehari menjelang pelaksanaan hari meugang harga daging di Kota Langsa masih bervariasi dikisaran antara Rp80.000 hingga Rp110.000. “Jika dilihat perbandingkan dari tahun-tahun sebelumnya, harga ini sepertinya tidak bakal naik lagi. Kalau pun naik hanya Rp10.000 per kilogramnya,” katanya. (m43/b09/b06/cb06)

MAKASSAR ( Waspada): Bank Indonesia (BI) segera menerapkan pembatasan kepemilikan kartu kredit bagi nasabah perbankan. Pembatasan tersebut dalam rangka penurnian kembali fungsi kartu kredit sebagai alat pembayaran. Deputi Kepala Kantor Perwakilan Bank IndonesiaWilayah I Sulawesi Maluku Papua Arief Budi Santoso mengatakan, ketentuan tersebut sudah dituangkan dalam Peraturan Bank Indonesia (PBI) Nomor 14/2/PBI/2012 tentang Alat Pembayaran Menggunakan Kartu (APMK). Dalam ketentuan tersebut mengatur tentang pembatasan kepemilikan kartu kredit maksimal hanya dari dua penerbit saja bagi nasabah yang memiliki pendapatan tiga kali dari Upah Minimun Regional (UMR). Jika ada nasabah yang memiliki kartu kredit lebih dari dua

AUDIENSI: Ketua LPMP Sumut H Bambang Winarji MPd (ketiga dari kanan) foto bersama Paula Dewi Agustin (kedua dari kanan), Yulizar Lubis (ketiga dari kiri) dan Dahyar (kedua dari kiri) usai beraudiensi, Rabu (18/7).

Basar Pro Pelatihan UKG Bersertifikasi MEDAN (Waspada):Business Assistance Resources Professional (Basar-Pro) Learning Centre Medan akan melaksanakan pelatihan ujian kompetensi guru (UKG) bersertifikasi tentang pengoperasioan komputer online di sekretariatnya Jalan Mustafa No 125 A kawasan Kampus UMSU Kelurahan Glugur Darat I Kecamatan Medan Timur Kota Medan mulai 23-28 Juli. Sedangkan ujian akan dilaksanakan pada 30 Juli di kabupaten/kota dalam Provsu. Hal ini dikemukakan Pimpinan Basar Pro Learning Centre Paula Dewi Agustin kepada wartawan di Medan, kemarin. Menurutnya, Pelatihan UKG bersertifikasi secara online yang sesungguhnya, dilaksanakan selama enam hari yang setiap hari diikuti peserta yang berbeda. Artinya, setiap peserta hanya mengikuti pelatihan sehari saja dalam kegiatan itu dijamin peserta bisa mengoperasikan komputer. Sedangkan target pelatihan sehari ini, lanjutnya, seluruh peserta dijamin bisa mengoperasikan komputer. Artinya, tidak ada alasan bagi guru bersertifikasi, baik berusia muda maupun tua tidak mampu mengoperasionalkan komputer. “Ujian akan dilaksanakan di sekolah-sekolah yang ditunjuk Dinas Pendidikan kabupaten/kota dimana peserta berdomisili. Dalam pelatihan ini, setiap peserta juga dilatih dalam menggunakan software dan soal yang disesuaikan kisi-kisi,” sebutnya. Dikemukakannya, dalam UKG bersertifikasi ini akan menguji 100 soal terdiri atas 70 persen profesional dan 30 persen pedagogik. Sedangkan mata pelajaran yang dilatih untuk Taman Kanak-kanak (TK) terhadap guru kelas. Untuk guru SD berupa guru kelas, Penjaskes dan bahasa Inggris. Untuk guru SMP, katanya, terdiri atas bahasa Indonesia, bahasa Inggris, IPA, IPS, matematika, Penjaskes, PKN, TIK (Teknik Informasi Komputer), dan BK (Bimbingan Konseling). Sedangkan untuk guru SMA mencakup bahasa Indonesia, bahasa Inggris, matematika, kimia, fisika, biologi, Penjaskes, geografi, ekonomi, sejarah, PKN, TIK dan BK.(rel)

penerbit sementara penghasilannya dibawah ketentuan, maka selebihnya harus dikembalikan kepada penerbit kartu kredit namun tagihan penyelesaiannya tetap jalan. “Bagi nasabah baru ini akan berlaku efektif 1 Januari 2013, akan tetapi untuk pengguna lama, akan dibicarakan lagi di asosiasi kartu kredit dengan batas waktu pembenahan hingga 2015 mendatang,” ungkapnya dalam Sosialisasi Perubahan Peraturan Alat Pembayaran Menggunakan Kartu (APMK), di Gedung BI, Jalan Jenderal Sudirman, Kamis (19/7). Sementara untuk denda keterlambatan pembayaran tagihan kartu kredit maksimal tiga persen dari total tagihan. Denda tidak boleh melebihi Rp 150 ribu. Denda dikenakan apabila pemegang kartu kredit tidak melakukan pembayaran atau melakukan pembayaran

setelah jatuh tempo. Sedangkan untuk pemilik kartu tambahan, denda keterlambatan hanya dibebankan kepada kartu kredit utama. “Denda diatur mengingat denda keterlambatan kartu kredit itu besar dan kalau tidak dibayar akan dikenakan bunga oleh bank yang bersangkutan,” katanya. Meski hal tersebut berlaku efektif pada Januari 2013 mendatang, namun dia mengungkapkan akan segera mengimplementasikan penyempurnaan ketentuan kartu kredit dalam hal kepemilikan kartu kredit berikut denda keterlambatan pembayaran tagihan kartu kredit. Sebelumnya, Deputi Pemimpin Kantor Koordinator BI Makassar, Arief Budi Santoso, mengatakan, aturan kepemilikan kartu kredit tersebut dimaksudkan untuk meningkat-

kan perlindungan nasabah juga sekaligus dari sisi manajemen risiko dari penerbit kartu kredit. “Pembenahan ini dalam rangka penggunaan kartu kredit sesuai dengan fungsinya sebagai alat pembayaran. Jadi BI mengimbau kehati-hatian penerbit kartu kredit dalam mengeluarkan kartu kredit,” katanya. Jika ada nasabah kartu kredit yang memiliki lebih dari dua kartu kredit sementara penghasilannya dibawah ketentuan, maka nasabah tersebut itu hanya boleh memiliki maksimal dua buah kartu kredit, selebihnya harus dikembalikan kepada penerbit kartu kreditnya (tidak diperpanjang) namun tagihan penyelesaiannya tetap jalan. Berdasarkan data BI, jumlah pemilik kartu kredit di Indonesia tercatat 14,594 juta kartu pada 2011. Jumlah ini meningkat sekira delapan persen dari 13,574 juta kartu di 2010. (okz)

Jhon Tafbu Ritonga Pasar Ayam Kampung Di Bireuen Dipadati Pembeli SILPA Sumut Bukti Tak Mampu Kelola Anggaran BIREUEN (Waspada): Meugang hari pertama di Bireuen Kamis (19/7), para pembeli tidak hanya memadati lapak penjualan daging di jalan kereta api, para muge manok (pedagang a y a m ) ra m a i m e n g g e l a r dagangan seperti ayam kampung, itik di seputar jalan pasar ikan blok PJKA. Pembeli ayam dari kalangan kaum ibu terlihat ramai membeli ayam kampung yang digelar para muge manok” dalam keranjang sepedamotor. M Saleh, salah seorang Muge Manok, yang ditemui Waspada di lokasi mengatakan setiap hari menyambut puasa dan hari raya para pedagang juga ikut panen. Barang dagangan seperti

ayam kampung, itik laris terjual dibandingkan hari biasa. Harga seekor ayam kampung jantan berat 2 kg dari Rp85 ribu – Rp90 ribu per ekor sedangkan ayam betina dan itik berat 2 kg sekitar Rp50 ribu – Rp65 ribu per ekor. Rahmawati salah seorang ibu rumah tangga ditemui Waspada mengatakan karena harga daging meugang kali ini mencapai Rp120 ribu per kg hanya dibeli alakadarnya untuk memenuhi tradisi bagi keluarganya. Sedangkan untuk menambah kebutuhan lauk pauk kebutuhan keluarga di hari meugang dan memasuki bulan puasa ditambah membeli ayam kampung harganya lebih murah dibandingkan dengan harga daging megang. (b12).

MEDAN (Waspada): Dana APBD tahun 2011 Sumatera Utara Rp720 miliar yang tidak terpakai sangat disesalkan dan merupakan cacat pemerintahan daerah ini. “Rp720 miliar jika dibelanjakan membeli 600 unit excavator bisa diperuntukkan satu unit per kecamatan, tentu menunjang perbaikan infrastruktur terutama irigasi dan penanggulangan banjir,” ujar pengamat ekonomi Jhon Tafbu Ritonga di hadapan 355 peserta Pembekalan Orientasi Fungsionaris DPD Partai Golkar Sumut Angkatan II, di Tiara Convention Hall, kemarin. Jhon mengimbau Partai Golkar di tahun 2013 memperjuangkan pengadaan excava-

Ramadhan Dorong Inflasi Hingga 1,1 Persen

Waspada/Ist

persen, dan DKI 54,33 persen. Meskipun sebagian besar rumah tangga memiliki simpanan di LKB, namun peran LKNV dan NLK di beberapa daerah juga signifikan. Secara khusus, jumlah rumah tangga di Provinsi Jawa tengah yang memiliki LKNB cukup tinggi, yaitu 16,17 persen. Sementara jumlah simpanan di NLK paling tinggi di wilayah jawa tengah. Hasil survei mengatakan, sebanyak 54,90 persen rumah

meminjam pada non lembaga keuangan, dan masyarakat berpenghasilan sedang dan tinggi lebih banyak meminjam ke bank. Sur vei mengatakan, provinsi Sumbar dan Jakarta memiliki rumah tangga yang memiliki utang dengan persentase tinggi diatas 50 persen. Secara keseluruhan, Jateng memiliki jumlah rumah tangga yang memiliki utang relatif tinggi dibandingkan rumah tangga di provinsi lain dengan utang kepada NLK. Dari segi tujuan, persentase utang rumah tangga untuk menjalankan usaha berada di urutan teratas dan diikuti oleh konsumsi. Adapun pada 2010 utang digunakan untuk modal usaha sebesar 23,17 persen, meningkat di 2011 menjadi 29,51 persen. (okz)

BI Segera Batasi Kepemilikan Kartu Kredit

Harga Daging Di Pidie Tembus Rp130 Ribu SIGLI(Waspada): Harga daging di Kota Sigli, bervariasi bahkan ada yang menjual hingga Rp130.000 per kg. Meski tinggi, tidak mengurangi niat warga untuk membeli daging. Sebelumnya pada Rabu sore harga daging masih berkisar Rp90.000 per kg. Sulaiman, 40, penjual daging mengatakan harga tersebut masih terbilang wajar karena tingginya harga tebus hewan ternak yang mengalami kenaikan rata-rata sebesar 20 persen.

“Bank masih menjadi pilihan rumah tangga untuk menyimpan di sana, yakni mencapai 44,23 persen,” ujar Deputi Direktur Departemen Penelitian dan Pengaturan Perbankan, Yunita Resmi Sari, di Gedung BI, Jakarta, Kamis (19/7). Yunita mengatakan, ada tiga provinsi dengan lebih dari separuh sampel di wilayah tersebut yang memiliki simpanan di LKB, yakni Sulawesi Selatan 57,14 persen, Sumatera Barat 57,01

tangga Indonesia belum memiliki utang dan lembaga keuangan. Hanya 45,10 persen rumah tangga yang memiliki akses terhadap pinjaman dan dari jumlah tersebut hanya 19,58 persen yang memiliki akses terhadap pinjaman di bank. “Terdapat sedikit peningkat akses keuangan ke bank, dari 18,21 persen di 2010 menjadi 19,58 persen pada 2011,” ujar Yunita. Yunita mengatakan, dilihat dari kategori pendapatan, masyarakat yang memiliki pendapatan tinggi, umunya lebih banyak melakukan pinjaman daripada masyarakat yang memiliki pendapatan rendah. Di lihat hasil survei, prefensi sumber pinjaman juga berbeda, di mana masyarakat berpenghasilan rendah lebih banyak

MEDAN (Waspada): Laju inflasi di Sumatera Utara mengalami peningkatan yang sangat signifikan menjelang Ramadhan 1433 H. Peningkatan laju inflasi tersebut juga dikarenakan kenaikan kelas yang terjadi selama Juli, sehingga tekanan inflasinya begitu besar saat menjelang Ramadhan. Pengamat ekonomi Gunawan Benjamin menyebutkan selama Juni 2012 telah terjadi kenaikan inflasi cukup signifikan di Sumatera Utara, dimana laju inflasi sebesar 1,23 persen pada Juni lalu merupakan angka tertinggi di Indonesia. Salah satu pemicu kenaikan inflasi adalah naiknya harga cabai merah, serta kenaikan biaya sekolah SLTA menjelang tahun ajaran baru yang turut memperburuk kinerja inflasi bulan kemarin. Pada Juli ini, kenaikan laju inflasi diperkirakan masih akan terjadi, disebabkan kenaikan harga kebutuhan pokok menjelang Ramadhan ini dan berpeluang memperburuk kinerja laju inflasi. Apalagi, masyarakat pada umumnya meningkatkan belanjanya sebesar 10-20 persen pada awal bulan Ramadhan. “Sehingga harga kebutuhan pokok seperti daging ayam dan daging sapi, telur, minyak goreng, beras dan sejumlah kebutuhan lainnya mengalami kenaikan yang cukup tinggi. Diperkirakan pada Juli 2012 ini, akan menciptakan inflasi dalam besaran dengan rentang 0.75 persen hingga 1,1 persen,” kata Gunawan kepada Waspada, Kamis (19/7). Bila mengacu pada inflasi

pada 2011 silam, kata dosen ekonomi dari Institut Agama Islam Negeri (IAIN) Sumut ini, selama Agustus tahun lalu dimana terdapat hari besar keagamaan Ramadhan dan Lebaran, tercipta inflasi sebesar 1,1 persen. Namun, ada faktor lain penyebab kenaikan inflasi tersebut, yaitu terjadi kenaikan harga emas dunia yang memicu kenaikan harga emas di dalam negeri. Sementara itu, walaupun Idul Fitri terjadi pada Agustus, namun pada September tahun lalu inflasi juga masih relatif tinggi sebesar 1,25 persen. “Nah, untuk tahun ini Ramadhan lebih banyak dihabiskan pada Agustus begitu juga dengan Hari Raya Idul Fitri. Oleh karena itu, tekanan inflasi besarannya akan semakin tinggi pada Agustus mendatang yang diperkirakan akan terjadi dalam rentang 0,9 hingga 1,3 persen (dengan catatan campur tangan pemerintah cukup kecil dalam penstabilan harga barang),” kata Account Officer Danareksa Medan ini. Apalagi, lanjutnya, konsumsi masyarakat cenderung meningkat menjelang Idul Fitri dengan kebutuhan barang juga semakin tinggi. Pada umumnya masyarakat akan meningkatkan belanjanya sebesar 20 hingga 30 persen. Selain itu, kebijakan Tunjangan Hari Raya (THR) juga memperburuk kinerja laju Inflasi. Namun demikian, lanjutnya, untuk meminimalisir laju inflasi yang memburuk, pemerintah dapat melakukan sejum-

lah langkah-langkah, seperti melakukan koordinasi dengan distributor besar bahan pokok yang memasok barang ke sejumlah daerah. Pastikan pemerintah mengetahui secara benar jumlah persediaan serta memperhitungkan permintaan akan suatu barang selama Ramadhan dan Idul Fitri. “Mengimbau para pedagang untuk tidak berspekulasi serta menindak tegas para pedagang yang secara sengaja melakukan penimbunan barang atau memanfaatkan momentum ini guna memperkaya diri sendiri,” ujarnya. Pemerintah harus melakukan intervensi pasar, baik yang dilakukan Bulog maupun pemerintah setempat. Sejauh ini data beras di Bulog tercatat 62.000 ton, yang bila dihitung cukup untuk konsumsi selama 6 bulan. Sehingga walaupun terjadi kenaikan harga beras selama Ramadhan dan Idul Fitri, namun besar kemungkinan kenaikan harga beras dapat dikendalikan. “Pemerintah setempat juga harus aktif dalam melakukan operasi pasar, sejauh ini di Kota Medan setidaknya memiliki 151 titik operasi pasar guna menenangkan kenaikan harga barang yang bergerak liar. Kemudian mengimbau masyarakat agar tidak melakukan konsumsi berlebihan, walaupun diragukan keefektifannya, namun pemerintah harus secara terus-menerus memberikan edukasi yang diharapkan menyadarkan masyarakat kita,” pungkasnya. (m41)

tor untuk setiap kecamatan. “Cegah jangan sampai dana Rp720 miliar didisain sedemikian rupa untuk kepentingan kampanye,” tandasnya. Ceramah Jhon bertopik kendala pembangunan dalam meningkatkan kesejahteraan masyarakat Sumut itu sebagai penutup pembekalan yang dibuka Wakil Ketua DPP Partai Golkar Anton Sihombing. Jhon mengambil ilustrasi dirinya sejak 2005 di Fakultas Ekonomi USU tidak memakai satu rupiah untuk memajukan FE USU. “Bahkan sejak 2007 Fakultas Ekonomi USU telah menyumbang Rp50 miliar kepada Indonesia,” ungkapnya. Untuk memecahkan permasalahan dan kendala mencapai kesejahteraan, lanjutnya,

sebagai konsultan ekonomi Jhon mengusulkan ke BNI kucuran kredit Rp2 triliun untuk Sumut dan Aceh. Secara berkelakar Jhon menyatakan enggan berbicara uang ratusan miliar dalam konteks pembangunan tetapi triliunan rupiah. “Maaflah jika ada yang melamar saya jadi kandidat pasangan calon Wagubsu. Sori, jika partai anda mencalonkan saya jadi Cagubsu. Berapalah jumlah dana APBD Sumut? Sangat disesalkan Rp720 miliar dana 2011 tidak digunakan padahal setidaknya bisa menjawab kendala infrastruktur,” tandas Jhon. Prospek Sumut antara lain ada di Sumut bagian selatan, Nias, Labuhanbatu, pegunungan, SDM dan Iptek. “Tetapi

apa yang sudah dilakukan partai anda di Senayan untuk memajukan Sumut? Konektivitas lokal juga harus diperjuangkan partai anda menembus antar kabupaten kota di daerah ini,” tambahnya lagi. Dia katakan struktur perekonomian Sumut memang sudah berubah tetapi tertinggal dengan kemajuan daerah tertentu di Indonesia, sebagai ilustrasi Jhon mengumpamakan jika daerah lain dapat Rp31juta maka Sumut hanya Rp24juta. Untuk itu, John berpendapat Gubsu dan Wagubsu mendatang harus memiliki kepemimpinan yang kuat, mampu merancang job description yang jelas dan solid, tim lengkap dan didukung partai politik.(a10)

Masyarakat Mulai Gunakan IRR Sidikalang MEDAN (Waspada): Hingga Juli 2012 PT Dairi Prima Mineral (PT DPM)-perusahaan yang akan menambang mineral timah (lead) dan seng (zinc) di Sopokomil, Kabupaten Dairi, sudah menyelesaikan pembangunan ruas jalan lingkar dalam (inner ring road Sidikalang) sepanjang 1,3 kilometer, dari Huta Rakyat ke Huta Gambir. Demikian siaran pers yang diterima dari perusahaan itu, Kamis (19/7). Masyarakat sudah bisa menggunakan jalan tersebut sebagai jalan alternatif menuju pusat Sidikalang. “Ruas jalan tersebut sudah selesai pembangunannya dan menunggu pemasangan tandatanda lalu lintas,” ujar Bangun Simamora, Acting CSR Manager PT DPM. Bangun mengatakan ruas jalan dengan lebar 9 meter dan DMJ (Daerah Milik Jalan) 26,5 meter ini merupakan bagian dari rencana pembangunan Inner Ring Road (IRR) Sidikalang sepanjang 4,7 kilometer, dari Huta Rakyat hingga Jalan Runding. Dia katakan pembangunan jalan tersebut merupakan Master Plan Pemkab Dairi untuk meningkatkan perekonomian rakyat dan bagian dari kesepakatan antara PT DPM dan Pemerintah Kabupaten (Pemkab) Dairi. Biaya pembangunan jalan ini diperkirakan mencapai Rp14 miliar didanai PT DPM dan pembebasan tanahnya dilakukan oleh Pemkab Dairi. “Pembiayaannya cukup besar karena pembangunan

Waspada/ist.

SALAH satu ruas jalan IRR Sidikalang dari arah Huta Rakyat. Jalan ini dibangun PT Dairi Prima Mineral, perusahaan yang merencanakan pembangunan tambang mineral timah hitam (lead) dan seng (zinc) di daerah Sopokomil, Dairi. Beberapa waktu lalu, jalan ini sudah dapat dimanfaatkan masyarakat sebagai alternatif. jalan IRR benar-benar baru, berbeda dengan jalan ParongilSidikalang yang merupakan proyek peningkatan jalan,” kata Bangun. Saat ini pengguna jalan yang melintasi Parongil-Sidikalang atau sebaliknya sudah memanfaatkan jalan tersebut sebagai jalan alternatif. Menurut Bangun, dengan selesainya pembukaan jalan ini akan mengurangi kemacetan khususnya pada Sabtu yang merupakan hari pekan Sidikalang. Pengguna jalan dari arah Parongil menuju Sidikalang atau kota lainnya di Sumatera Utara, lurus langsung menuju Sidikalang atau membelok ke kanan dari pertigaan Jalan Parongil-

Sidikalang di Huta Rakyat, kemudian masuk kembali ke kota melintasi Huta Gambir. Ruas jalan dari Huta Gambir ke arah Jalan Runding, pembangunan jalan baru tahap siap pemasangan macadam (1 kilometer), full base A (penimbunan dengan pasir dan batu). Sementara ruas jalan dari arah Jalan Runding, 700 meter sudah diaspal. Menurut Bangun, perusahaan yang 80 persen sahamnya dimiliki PT Bumi Resources Mineral (PT BRM) dan 20 persen oleh PT Antam ini, sebelumnya sudah menyelesaian peningkatan (upgrade) dan jalan Parongil Sidikalang sepanjang 22,3 kilometer.(rel)


Luar Negeri 5 Warga Israel Tewas Dalam Serangan Bom Di Bulgaria

A9

WASPADA Jumat 20 Juli 2012

SOFIA (Waspada): Sekurang-kurangnya tujuh orang -- lima diantaranya warga Israel-- tewas dan 34 lainnya cedera ketika bus yang mengangkut wisatawan Israel terkena ledakan bom bunuhdiri di timur Bulgaria, yang kemungkinan dilakukan oleh seorang pengebom bunuhdiri pria yang membawa dokumen-dokumen AS, demikian menurut sejumlah pejabat.Ledakan itu terjadi tepatnya di bandara Burgas di kawasan Laut Hitam. Israel telah mengirimkan sejumlah pesawat ke Burgas bersama sejumlah dokter dan pejabat untuk membawa kembali korban tewas dan cedera.Menteri Pertahanan Israel Ehud Barak mengatakan Hizbullah Lebanon adalah pelaku serangan atas lindungan Iran. Lima wisatawan tewas bersamapengemudibusBulgariadan tersangkapelakupengebomanitu. Para pejabat yang mengatakan seorang korban keenam adalah warga Israel.lagi meninggal dunia namun kemudian diralat. Pemerintah Bulgaria menyatakan kemungkinan besar pengebombunuhdiriyangmeledakkan bus yang membawa turis Israel dengan korban jiwa tujuh orang, Rabu.. PM Boiko Borisov mengatakan pemboman itu dilakukan oleh seorang pria yang membawasurat izin mengemudi Amerika Serikat yangdipalsukan.. Bagaimanapun identitas sebenarnya dari pengebom bunuhdiri tersebut masih belum diketahui. “Kami bekerja dalam soal ini dengan mitra dari FBI dan CIA. Mereka mengatakan orang itu tidak ada dalam jaringan data mereka,” tutur Borisov kepada para wartawan. Tersangka pengebom itu terekam oleh kamera pengawas keamanan sekitar sejam sebelum

serangan bom yang menghancurkanbusdikawasanwisataBurgas, di Laut Hitam, sekitar 400 km dari ibukotaSofia.PMBorisovmenambahkan foto pria tersebut akan segera diumumkan dan ahli DNA sedang meneliti sidik jarinya. Netanyahu menuding Iran “Kami bekerja dalam soal ini dengan mitra dari FBI dan CIA. Mereka mengatakan orang itu tidak ada dalam jaringan data mereka.” Rombongan turis Israel yang diserang baru saja tiba dengan pesawatborongandariTelAvivyang membawa sekitar 150 penumpang, termasuk delapan anak. Merekasedangbersiap-siapuntuk memasuki bus ketika ledakan menghancurkanbusyangberada di tempat parkir bandara. Korban jiwa termasuk enam turis Israel, supir warga Bulgaria, dan pengebom bunuh diri tersebut. Israel sudah mengirimkan tenaga medis dan pesawat militer guna membawa pulang 33 warganya yang cedera dalam serangan dan akan langsung dibawa ke rumah sakit. Pemerintah Bulgaria sudah menyiapkan sebuah pesawat untuk para turis yang tidak terluka namun ingin segera pulang. Sementara itu PM Israel Benjamin Netanyahu mengatakan Iran yangberadadibelakangserangan

dan berjanji akan menanggapi dengan tegas. Belum ada kelompok yang mengakubertanggungjawabatas serangan tersebut dan stasiun TV milik pemerintah Iran sudah membantah tudingan keterlibatan mereka dengan menyatakan komentar PM Israel dan pihak lainnya sebagai tak masuk akal dan sensasional. SerangandiBulgariainimerupaka yang terbaru dari rangkaian serangan yang menempatkan warga Israel di luar negeri sebagai sasaran. Beberapa waktu lalu diplomat Israel di India, Geordia, dan Thailand yang menjadi sasaranserangandanIsraelmenuding

Iran berada di balik semua serangan itu. Menurut Menteri Dalam Negeri Bulgaria Tsvetan Tsvetanov, pelaku dicurigai memiliki Surat Izin Mengemudi (SIM) yang dikeluarkan dari AS. Peristiwa ini dilaporkan telah menyebabkan dan puluhan lainnya terluka. Bus itu meledak di saat hendak membawa wisatawan berlibur di sebuah resor di Laut Hitam. MenteriTsvetanov mengatakan, pihaknya mendapatkan sebuah rekaman video keamanan dari pelaku pengeboman itu. Pelaku diketahui berada di sekitar bus, hampir satu jam sebelum peristiwa pengeboman terjadi.

“Pelakupengebomanmemiliki SIM yang dikeluarkan di Michigan (AS). Delapan orang tewas dalam kejadian ini, enam dari korban dipastikan ada warga negara Israel sedangkan kewarganegaraan pelaku pengeboman hingga kini belum diketahui,” ujar Menteri Dalam Negeri Bulgaria Tsvetan Tsvetanov, Kamis (19/ 7). Pemerintah Bulgaria dilaporkan akan memulangkan sekira 100 orang warga Israel yang tidak terluka dalam insiden tersebut. Usai kejadian, mereka memutuskanuntukmempersingkatliburan mereka dan kembali ke Israel. Sementara PM Netanyahu langsung menuding, Iran merupakan

Mantan Kepala Intelijen Mesir Wafat KAIRO (Reuters): Mantan Kepala intelijen Mesir Omar Suleiman, satudarirekanterdekatpresidentergulingHosniMubarak,meninggal dunia di AS ketika menjalani pemeriksaan medis, kata pembantu Suleiman dan seorang pejabat keamanan senior. Usianya 76 tahun. “Dia sebelumnya sehat-sehat saja. Dia wafat tiba-tiba ketika sedang menjalani pemeriksaan medis di Cleveland,” kata pembantunya itu, Hussein Kamal. Tanpa memberi tahu penyebab kematian Suleiman. Persiapan tengah dilakukan untuk membawa pulang jenazah Suleiman untuk dimakamkan, katanya. Seorang pejabat intelijen senior Mesir mengatakan dia telah bicaradenganmenantuSuleiman yangmembenarkan kematiannya. Nama Suleiman tahun lalu mencuat ketika dia dijadikan wakil presiden Mubarak beberapa hari sebelum pemimpin Mesir itu disingkirkan dalam revolusi. Namun jabatan tersebut sebentar saja diembannya ketika warga MesirturunkejalananmenuntutmundurnyaMubarakmenolakkonsesi politikyangditawarkanSuleiman.SebagaiorangkepercayaanMubarak, Suleiman memimpin Badan Intelijen Umum Mesir (EGIS) sejak 1993, mengembanperandiplomaticpentingdalamhubunganMesirdengan Israel, faksi Palestina dan badan bantuan dan sekutu AS. Setelahlebihdarisetahunhilangdaripandanganpublic,Suleiman kembali tahun ini dengan mencalonkan diri menjadi presiden Mesir sampai dia didiskualifikasi karena gagal memperoleh jumlah tanda tangan untuk bisa ikut serta dalam pemilihan. Dia kemudian meninggalkan Mesir, dan pergi ke Abu Dhabi bersama keluarganya, menurut orang yang layak dipercaya.(m23)

Terobos Konvoi Presiden, Polisi Filipina Dipecat

dalang dibalik tragedi pengeboman itu. Hingga berita ini diturunkanbelumadakonfirmasidari pihak Iran menyangkut pernyataan Israel ini. Pengeboman bus itu merupakanserangkaianinsidenserupa yang terjadi dan mengancam kepentingan Israel di luar negaranya. Sebelumnya, Israel juga menyalahkanIranatasduainsiden yakni pengeboman yang menyerang Kedutaan Besar Israel di India dan Georgia. Iran sendiri diketahui sempat membantah tudingan tersebut. Negeri Paramullah menilai, tuduhan itu hanyalah sebuah bentuk provokasi dari Israel.(ap/bbc/m10)

MANILA (Waspada): Pihak berwenang Filipina memecat seorang polisi yang mencoba menorobos konvoi Presiden Benigno Aquino.PolisiFilipinamemastikaninsideniniterjadidisaatPresiden Aquino berada di salah satu mobil dalam konvoi itu. Pasukan Pengawal Presiden Filipina sempat menahan petugas polisi yang diketahui bernama Ricardo Pascua, sebelum akhirnya menyerahkan polisi itu ke atasannya. Kejadian yang terjadi pada Minggu(15/7/2012)tersebutberlangsungdijalananutamadiManila. Kejadian terjadi ketika Presiden Aquino baru saja kembali dari tugasnya, saat Pascua mencoba memutar balik dengan mobilnya disebuahjalan.Saatmemutar,mobilminibusyangdikendaraiPascua ternyata hampir memotong konvoi presiden. Beberapa pengawal presiden yang mengendarai motor berusaha menghentikannya, tetapi diabaikan oleh Pascua. Selain mengabaikan peringatan pasukan pengawal, petugas polisi itu bahkan berupaya melawannya dengan menunjukan lencana polisi ke arah pengawal presiden. “Polisi itu sangat arogan karena mendesak agar diperbolehkan untuk memutar. Bahkan, dirinya memperlihatkan lencana polisinya ke arah polisi bermotor yang mengawal konvoi,” ungkap jurubicara Kepresidenan Filipina Edwin Lacierda Kamis (19/7). Kepala Pasukan Pengawal Presiden Filipina Brigadir Jenderal Ramon Mateo mengatakan, tidak tahu mengapa polisi itu mencoba untuk memotong konvoi. Menurutnya, sebagai anggota polisi, Pascua harusnya memahami protokol yang terjadi.

Ulama Senior Muslim Rusia Tewas Akibat Penembakan

Terancam Perisai Misil, China Modernisasi Senjata Nuklir WINA (AP): Pejabat militer China melaporkan, negaranya siap memodernisasi senjata nuklirnya untuk merespons rencana Amerika Serikat (AS) yang ingin membangun sistem pertahanan misil Eropa. China juga memandang rencana AS sebagai tindakan yang mengacaukan stabilitas kawasan. “Senjataitumengacaukanstabilitas.Kamijugaharusmembangun kekuatan untuk menangkal setiap ancaman,” ujar Mayjend. Zhu Chenghu Kamis (19/7). Zhu sempat melontarkan komentar yang cukup kontroversial pada 2005 silam tentang nuklir. Zhu mengatakan bahwa China harus menggunakan senjata nuklirnya bila AS mengintervensi konflik Taiwan. Selama ini, Amerika Serikat menghabiskan dana sebesar AS$10 miliar atau sekira Rp94 triliun untuk membangun, menguji coba dan mengerahkan perisai misil itu. AS juga membangun senjata penghancur misil di kapal tempur yang dikerahkan keTimurTengah dan Asia-Pasifik. Senjata yang serupa juga dapat ditemukan di wilayah Alaska dan California. Menurut AS, perisai misil Eropa akan dikerahkan dalam empat tahap, kurang lebih pada 2020 mendatang. Hal itu ditujukan untuk mewaspadai serangan misil dari Iran. Meski demikian, keberadaan senjata pertahanan itu justru dipandang menjadi ancaman Rusia. Negeri Beruang Merah menilai, sistem pertahanan misil itu lambat laun akan berkembang menjadi sebuah senjata yang sanggup menghancurkan fasilitas nuklir Rusia.(m10)

Seputar ASEAN

The Associated Press

SEORANG wisatawan Israel yang cedera dibantu ketika meninggalkan satu rumah sakit di Burgas, Bulgaria, Kamis (19/7). Pengeboman di siang bolong yang menewaskan delapan orang dan mencederai puluhan orang di atas satu bus yang penuh dengan wisatawan Israel, hampir pasti adalah serangan bom bunuhdiri.

Pedagang Yang Naikkan Harga Di Bulan Ramadhan Dihukum PARA pedagang yang menaikkanhargakomoditi,termasuk makanan dari saat ini sampai selama bulan suci Ramadhan akan dikenakan hukuman. Kementerian Dalam Negeri telah meminta Kementerian PerdagangandanIndustriuntukmenyampaikan pada departemen itu nama-nama para pedagang yang menaikkan harga, kata laporan harian bisnis Al-Eqtisadiah. Cabang-cabang regional dari KementerianPerdaganganmemberikan laporan bulanan yang merinci harga-harga bahan makanandankomoditilainnyakepada Kementerian Dalam Negeri. Satusumbermembenarkantelah terjadi kenaikan harga dan perbedaan signifikan harga komoditi tertentu di antara pusat-pusat pertokoan. “Kami kira kenaikan dan perbedaan harga terjadi karena tidak adanya pemantauan ketat di pasar dan denda ringan yang dikenakan pada pedagang yang melanggar aturan,” tambahnya. Semuadepartementerkaitdimintauntukmemantaukenaikandan laporkan segera para pelanggar. Tim Departemen Perdagangan yang baru dibentuk juga akan membantu melakukan pemantauan dan pelaporan. Kekurangan pasokan dan semakin besarnya permintaan telah menyebabkan harga daging

di Kerajaan Arab Saudi melonjak. Pengamat pasar mengaitkan kekurangan pasokan karena larangan Departemen Pertanian dan Pengairan mengenai impor domba. Para pedagang mengatakan bahwa harga domba telah mencapai600RiyalSaudiperekor karena kekurangan parah dalam pasokan. Seorang pejabat Kementerian Perdagangan mengatakan kepada suratkabar Al-Watan bahwa pasar akan menghadapi kekura-ngan lebih jauh daging segar pada awal Ramadhan.

Kementerian itu telah meminta para importir untuk memasok jumlah yang memadai daging segar dan mereka telah mengedarkan daging beku dari Australia sebanyak 198 konteiner. Namun, ini tampaknya tidak cukup untuk memenuhi permintaan daging yang cukup tinggi selama Ramadhan. Beberapa negara, termasuk Australia, Selandia Baru, Uni Emirat Arab dan India, berusaha untuk mengatasi kekurangan pasokan pasar daging Arab Saudi. Kekurangan itu sendiri akibat

laranganRiyadhpadasemuajenis impor daging dari Eropa sebagai akibatwabahpenyakitberbahaya. Daging tidak diizinkan untuk memasuki Kerajaan karena mengandung residu sumsum tulang belakang yang dapat membawa virus penyebab penyakit sapi gila. Suleiman Al-Balawi, seorang perwakilan dari pengusaha daging di kerajaan,katakementerianitumengambilsuatuusahadariimportir yang menyatakan bahwa mereka tidakakanmengimpordagingyang mengandung residu sumsum tulangbelakanglagi.(an/gn/mujo)

OKI Tolak Klaim Israel Masjidil Aqsa Wilayahnya KAIRO (Waspada): Sekjen OrganisasiKonferensiIslam(OKI) Prof. Ekmeledin Ihsanoglu mengatakan, “Negara Islam tidak akan menerima setiap langkah oleh Israel untuk melanggar batas Masjidil Aqsa, masjid suci ketiga umat Islam.” Diamenyerukankepadapara dutabesarnegaraIslam,yangmenjadianggotaUNESCO,agarsegera bertindak untuk menghentikan agresi Israel atas situs keagamaan dan warisan budaya di daerah pendudukanJerusalem,demikian

menurut Arab News Rabu (18/7). Diamemperingatkangerakan Israel bertujuan untuk memperlicinjalanbagiagresilebihjauh Israel terhadap masjid suci itu. Pimpinan OKI itu telah menunjukkan reaksinya terhadap satu pernyataan oleh penasehat hukum pemerintah IsraelYehuda Feinstein yang menyatakan bahwa Al-Aqsa “adalah bagian tak terpisahkan dari wilayah Israel.” Seorang pengacara terkemuka Jerusalem telah memperingatkan klaim baru Israel bahwa hala-

man masjid adalah bagian dari wilayah Israel. Hassan Khater, ketua dari Pusat Jerusalem Internasional,mengatakanpernyataan Israelmengisyaratkanrencananya untuk meyahudikan Jerusalem. Ihsanoglu mengatakan : “Kehadiran Israel di Al-Aqsa dan Jerusalem adalah palsu dan tidak sah dan harus diakhiri sesuai dengan hukum internasional. Dia mengatakan Persetujuan Denhaag 1899, 1907 dan 1954 dan Perjanjian Jenewa berlaku untuk Masjidil Aqsa. (an/m10)

MOSKOW (AP): Seorang ulama senior Muslim di provinsi Tartarstan, Rusia, tewas ditembak dan seorang lainnya mengalami cedera dalam satu serangan bom mobil dalam dua serangan yang menurut para pejabat lokal berhubungan dengan kecaman ulama tersebut terhadap Islamis radikal, demikian menurut para penyelidik Kamis (19/7). ValiullaYakupov, deputi mufti besar di provinsi itu, telah ditembak mati Kamis ketika dia meninggalkan rumahnya di Kazan, ibukota provinsi Tatarstan, kata Komite Penyelidik Rusia. Beberapa menit kemudian, mufti besar Ildus Faizov mengalami cedera di kakinya setelah satu ledakan merobek mobilnya di Kazan Pusat, katanya. Para gerilyawan mengatakan mereka berperang untuk mendirikansebuahnegaraIslamterpisahdiprovinsiperbatasanselatanRusia dankadang-kadangmenargetkanparapemimpinMuslimarusutama, yang mendukung pemerintah regional. Tatarstan umumnya tenang dan tetap menjadi satu tempat di mana terdapat toleransi agama di Rusia, yang secara keseluruhan adalah pemeluk Kristen Ortodoks. Tidak ada segera yang mengaku bertanggung jawab atas serangan-serangan di Kazan, sekitar 735 km timur Moskow. Kelompok militan menga-takan mereka memperjuangkan negara Islam terpisah di provinsi yang terletak di perbatasan selatan Rusia dan terkadang mengincar para tokoh penting Muslim, yang mendapat dukungan penguasa regional. Tatarstan selama ini damai dan menjadi contoh bagi toleransi beragama di Rusia, yang didominasi Kristen Ortodoks. Belum ada yang mengaku bertanggungjawab atas serangan di Kazan, sekitar 735 km di timur Moskow. (m23/m10)

Perubahan Jam Kerja Selama Ramadhan Di Saudi, Dipersingkat RIYADH (Waspada): Beberapa kementerian, perburuhan dan pelayanan umum telah menetapkan jam kerja selama bulan puasa Ramadhan, yang dipersingkat menjadi lima jam kerja dari jam 10;00 sampai pukul 15:00 siang. Hatab Al-Anzi, jurubicara Kementerian Perburuhan mengatakan sektor swasta akan bekerja selama enam jam jika perusahaannya menetapkan enam jam kerja seharinya selama Ramadhan. Jika perusahaan menetapkan enam jam kerja di sektor swasta akan bekerja enam jam sehari selama Ramadhan jika perusahaan menetapkan jam dengan basis pekerja harian. Dia mengatakan ada ketentuan dalam UU bahwa karyawan Muslim harus bekerja hanya enam jam bukan delapan selama Ramadhan. Idul Fitri hari libur untuk sektor pemerintah akan berlangsung 12 hari, dari 13-24 Agustus. Hari kerja pertama setelah Idul Fitri jatuh pada hari Sabtu, 25 Agustus. (an/m10)

Akte Kelahiran Obama Palsu ARIZONA (Waspada): Seorang tim penyelidik di Arizona mengumumkan bahwa akte kelahiran dari Presiden AS Barack Obama palsu. Tim yang berasal dari kepolisian di Maricopa Counti itu sangat yakin akan hal itu. Kepala Polisi Daerah Maricopa Counti Joe Arpaio mengatkaan, akte kelahiran Obama yang dirilis oleh Gedung Putih pada April 2011adalahakteyangdipalsukanolehkomputer.Kasusaktekelahiran presiden ini dinobatkan sebagai perang politik antara Obama dan salah seorang “Polisi Terkuat di Amerika.” Sementara itu kepala tim penyelidik Mike Zullo melaporkan, sejumlah kode numerik yang ada di akte kelahiran Obama menunjukkan bahwa ada bagian-bagian tertentu yang tidak diisi dalam formulir yang asli. Bagian itu adalah bagian yang menjelaskan ras, pendidikan, dan pekerjaan dari ayah Obama. Zullimenambahkan,paratimpenyelidiktidakmengetahuikodekodeyangadadiaktekelahiranitu,namunseorangpensiunanpegawai GedungPutihyangmengurusaktekelahiranObama.Pensiunanpegawai yang berusia 95 tahun itu pun diwawancara oleh sejumlah reporter. Demikian, seperti diberitakan Daily Mail, Kamis (19/7). Sejauh ini, presiden berkulit hitam itu menolak untuk berkomentar mengenai tuduhan yang dilontarkan Arpaio. Tim kampanye Obama di Pilpres AS juga berdiam diri. Fraksi Demokrat di Arizona mengatakan bahwa penyelidikan yang digelar Arpaio terhadap akte kelahiran Obama adalah tindakan pengalihan isu. Sejauh ini, ada ratusan isu kejahatan seks yang harus diselesaikan oleh Polisi Terkuat di Amerika itu. Arpaio sendiri diklaim gagal menangani kasus kejahatan itu.(ok)


A10

Sport

WASPADA Jumat 20 Juli 2012

AP

Dzeko Bantah Isu Milan

Ibra Ingin Trofi Champions PARIS (Waspada): Terjawab sudah pertanyaan menyangkut kelanjutan karier penyerang produktif asal Swedia, Zlatan Ibrahimovic (foto). Setelah AC Milan mencapai kesepakatan dengan Paris SaintGermain (PSG), Rabu (18/7) senilai 23 juta euro (Rp266 miliar), Ibra resmi menjadi anak asuh Carlo Ancelotti di PSG. “Saya ingin berterima kasih kepada PSG dan Direktur Olahraga Leonardo atas upayanya yang membuat (kepindahan) ini menjadi mungkin,” terang Ibrahimovic setelah resmi menjadi anggota klub PSG, Kamis (19/7). “Ini adalah langkah berikutnya dalam karier saya, sebuah mimpi yang kembali menjadi nyata. Ini adalah sebuah proyek menarik dan saya ingin ambil bagian tanpa ada keraguan ketika mereka mengontak agen saya,” imbuhnya lagi. Menanggapi soal kabar yang

mengatakan jika Ibra hanya mengincar bayaran besar dari klub kaya yang mengontraknya, bomber jangkung berusia 30 tahun asal Swedia itu dengan tegas membantahnya. “Saya ingin mencetak sejarah bersama klub ini. Saya datang ke sini untuk menang, bukan untuk hal lain (uang),” tegas pemain yang sudah memperkuat tiga klub papan atas Italia, yakni Juventus, Inter Milan, dan AC Milan. “Aku gembira akhirnya menjadi pemain PSG. Aku gembira untuk klub ini, suporter,

dan proyek menarik klub ini, yang aku ingin menjadi bagiannya. Sekarang aku ingin menciptakan sejarah dan menang bersama tim impian. Siapa yang tak ingin berada di sini? PSG akan meraih trofi, ini adalah masa depan,” tutur Ibra. Selain Ibra, PSG juga telah lebih dulu memboyong pemain-pemain papan atas lainnya. Sebut saja bek AC Milan, Thiago Silva yang didatangkan dengan nilai berkisar 70-80 juta euro. PSG juga memboyong gelandang muda Pescara asal Italia, MarcoVerratti. Awal bulan ini, PSG juga telah mendatangkan striker Napoli asal Argentina, Ezequiel Lavezzi. Pada musim 2012/2013, PSG yang berpredikat sebagai runner-up Ligue 1 musim lalu dipastikan berlaga di Liga Champions. Bersama Juventus, Inter, dan Milan, Ibra sukses meraih trofi Liga. Namun hingga

AP

saat ini, Ibra belum berhasil meraih mimpinya mengangkat trofi Liga Champions. Bagi Milanisti, mereka boleh berharap kepindahan Ibra bisa menimbulkan berkah. Pasalnya, ada fakta menarik seputar kepindahan Ibra di mana justru kerap kali membuat klub yang ditinggalnya merebut juara Liga Champions. Inter Milan menjadi klub pertama merasakan tuah kepindahan Ibra setelah pindah ke Barcelona pada 2009. Nyatanya, Inter sukses besar di tangan Jose Mourinho dengan merebut trofi Champions pertama kali sejak 1965. Setelah Camp Nou, Ibra gabung AC Milan. Uniknya, Barca juga menjuarai Liga Champions 2010-2011. Berdasarkan itu, Milianisti berharap kepergian Ibra dapat memberi berkah datangnya trofi Liga Champions ke San Siro. (m33/afp/goal)

MU Menang Kado Mandela DURBAN, Afsel (Waspada): Manchester United hanya mampu menang tipis 1-0 saat melakoni pertandingan pramusim perdananya melawan tim Afrika Selatan, AmaZulu FC, di Stadion Moses Mabhida, Kamis (19/7). Gol kemenangan Red Devils dicetak oleh penyerang asal Italia, Federico Macheda, saat pertandingan memasuki menit 20. Melalui sebuah serangan balik yang dimulai dengan pergerakan Scott Wootton, Macheda mampu memaksimalkan umpan terobosan dengan sebuah sontekan. Poin positif patut diberikan kepada penjaga gawang MU, Anders Lindegaard, yang kerap mementahkan peluang yang didapat AmaZulu. Gelandang anyar United asal Jepang, Shinji Kagawa, juga sukses menjalani debutnya bersama Setan Merah. “Kami puas. Kami selalu ingin memenangi pertandingan pertama. Ini benar-benar pemanasan yang bagus buat kami. Di babak kedua, saya pikir AmaZulu menjadi lebih agresif dan

mulai mengejar kami. Itu membuat pertandingan menjadi lebih sulit,” jelas pelatih Sir Alex Ferguson. Khusus mengenai Kagawa yang baru masuk di menit 89, Sir Alex Ferguson memberi penjelasan bahwa pemain asal Jepang itu harusnya sudah masuk lapangan 10 menit sebelumnya menggantikan Javier ‘Chicharito’ Hernandez. Namun, bola tak kunjung meninggalkan lapangan, sehingga Kagawa harus menunggu selama 10 menit. Di sisi lain, Fergie, yang menurunkan banyak pemain muda menyebut bahwa timnya tampak kelelahan menjelang akhir laga. Namun, pelatih asal Skotlandia itu tidak terlalu mempermasalahkannya. “Kami menampilkan permainan yang bagus dan mencetak gol yang bagus juga. Sungguh pertandingan yang menarik, khususnya menjadi hadiah spesial bagi Nelson Mandela,” tukasnya. Mantan Presiden Afsel itu hadir menyaksikan aksi MU dalam rangka merayakan ulang tahunnya ke-94. (m33/ap/ini)

persahabatan di CenturyLink Field, Kamis (19/7). Dua pemain baru, Eden Hazard dan Marko Marin, mencetak dua dari em-

AP

PEMAIN baru Eden Hazard (kanan) tampil menawan dalam debutnya bersama Chelsea.

AP

Veratti Lengkapi Belanja PSG BELANJA besar-besaran Paris Saint-Germain (PSG) belum juga berakhir. Setelah mendatangkan Ezequiel Lavezzi, Thiago Silva, dan Zlatan Ibrahimovic, PSG juga telah memastikan kedatangan Marco Verratti (foto tengah) dari Pescara. Pelatih Carlo Ancelotti menyebut Verratti sebagai pemain yang memiliki potensi untuk menjadi Andrea Pirlo baru. Kepindahan Verratti ke PSG pun sudah banyak diprediksi akhirakhir ini. Gelandang muda ini dibeli PSG senilai 8,6 juta pounds, namun harganya bisa meningkat hingga 11,8 juta pounds. Verratti sendiri mengaku gembira karena proses panjang transfernya akhirnya rampung. “Para pemain di sini adalah juara. Saya sudah sering menonton mereka di televisi dan sekarang saya berkesempatan berlatih bersama mereka. Semua ini membuat saya memiliki keinginan kuat untuk melakukan yang terbaik,” urai Veratti, Kamis (19/7).

AP

Lewandowski Beri Lampu Hijau AP

STRIKER Manchester United, Federico Macheda (kiri), mencetak gol dalam laga persahabatan melawan AmaZulu FC di Moses Mabhida Stadium, Durban, Kamis (19/7).

Debut Manis Anak Baru Blues SEATTLE, AS (Waspada): Chelsea menundukkan klub Major League Soccer (MLS), Seattle Sounders, 4-2 dalam laga

MENURUT agennya, Edin Dzeko (foto) cukup berpeluang untuk hijrah dari Manchester City ke AC Milan musim panas ini. Dzeko, mencetak 14 gol liga musim lalu, bisa dibilang gagal menunjukkan kemampuan terbaiknya sebagai seorang mesin gol yang diharapkan City sejak direkrut dari Wolfsburg senilai 28 juta pounds pada Januari 2011 silam. Namun Dzeko sendiri membantah bakal hengkang ke Milan. Ia menegaskan tidak ada pembicaraan sedikit pun dengan raksasa Seri A tersebut. Rumor hengkangnya Dzeko dari City dihembuskan sang agen, Sead Susic. Ia mengklaim peluang Dzeko bergabung dengan Milan sekira 70 persen sebagai pengganti ideal Zlatan Ibrahimovic. Pelatih Roberto Mancini memang telah menyuarakan niatnya mempertahankan Dzeko, tapi tetap tak tertutup kemungkinan melego striker Bosnia itu demi mendapatkan tambahan dana sekaligus mengosongkan satu ruang di skuadnya untuk memfasilitasi kepindahan kapten Arsenal, Robin van Persie. “Manajerku adalah Irfan Redzepagic dan tidak ada satu pun yang mendorongku untuk meninggalkan City. Aku hanya fokus untuk Manchester City. Aku tidak peduli dengan spekulasi media, terutama kabar yang datang dari orang yang tidak berhubungan denganku,” tegas Dzeko, Kamis (19/7).

pat gol yang berhasil disarangkan Chelsea. Blues unggul cepat begitu kickoff dilakukan. Gol pertama Chelsea berhasil dicetak oleh Romelu Lukaku tak sampai tiga menit pertama. Pada menit kedua, pemain berusia 19 tahun asal Belgia ini mencetak gol pembuka dengan memanfaatkan penempatan bola yang baik oleh gelandang muda Josh McEachran. Tak lama kemudian, Hazard yang baru didatangkan dari Lille menggandakan keunggulan Chelsea dengan gol menit 10. Aksinya mampu memperdaya kiper Bryan Meredith. Namun, skor itu tak bertahan lama. Tiga menit kemudian, Chelsea kebobolan oleh aksi Fredy Montero yang menundukkan Henrique Hilário. Montero bahkan kembali

mengejutkan dengan gol yang menyamakan kedudukan pada menit 31. Enggan ketinggalan, Chelsea terus mengejar. Pemain baru Blues lainnya, Marko Marin, tak mau ketinggalan. Gelandang yang didatangkan dari Werder Bremen ini berhasil mencetak gol dalam debut perdananya bersama pasukan Roberto Di Matteo ini pada menit 39. Keunggulan ini semakin dimantapkan oleh Lukaku, dua menit sebelum turun minum. Setelah laga ini, Chelsea akan melanjutkan perjalanan ke Stadion Yankee di New York untuk melakoni laga persahabatan dengan Paris SaintGermain yang baru merekrut Zlatan Ibrahimovic dan Thiago Silva dari AC Milan. Duel menarik ini akan berlangsung pada 23 Juli nanti. (m33/ini)

Neymar Sedih Tanpa Beckham London (Waspada): Bomber Timnas Brazil, Neymar, mengaku sedih atas pencoretan David Beckham dari skuad Inggris Raya di ajang Olimpiade 2012 nanti. Seperti diketahui, Pelatih Stuart Pearce tidak mencantumkan nama Beckham dalam skuadnya. Ternyata Pearce lebih memilih Craig Bellamy, Ryan Giggs, dan Micah Richards untuk jatah tiga pemain senior yang boleh dimainkan. Sebelum berpartisipasi di Olimpiade, Inggris Raya bakal melakoni laga ujicoba kontra Brazil di akhir pekan nanti. Menanggapi laga nanti, Neymar mengaku sedih atas pencoretan Beckham. Penyerang berusia 20 tahun itu sedih karena dirinya tidak bisa bercerita kepada anak cucunya nanti bahwa pernah berada satu lapangan dengan mantan kapten Timnas Inggris itu. “Ketika mendengar Beckham tak terpilih, saya merasa sedikit bahagia dan sedih. Tapi saya juga lega karena Beckham tidak akan bertanding melawan kami. Jadi, pertandingan nanti bakal sedikit lebih ringan bagi kami,” ujarnya, Kamis (19/7). “Tapi, saya sedih karena dia adalah pemain hebat. Jadi, saya ingin sekali berada satu lapangan dengan pemain sehebat dirinya. Itu bakal jadi cerita menarik bagi anak cucu saya nanti,” sambungnya. Di Olimpiade nanti, Brazil tergabung di Grup C bersama Mesir, Belarusia, dan Selandia Baru. Sementara itu, Inggris Raya berada di Grup A bersama Senegal, Uni Emirat Arab, dan Uruguay. (m33/ini)

zimbio

NEYMAR (kiri) kecewa David Beckham (kanan) tidak terpilih masuk skuad Inggris Raya.

MANCHESTER United bisa menjadi pelabuhan baru bagi bintang Borussia Dortmund, Robert Lewandowski (foto), musim panas ini. Striker tim nasional Polandia itu telah membuat sederet klub Eropa tertarik berkat produktivitas golnya yang mengantarkan Dortmund merajai Bundesliga serta merengkuh titel Piala Liga 2011/2012. Penyerang jangkung berusia 23 tahun itumencetak 30 gol di semua ajang musim lalu dan dinilai sangat bertalenta oleh Sir Alex Ferguson yang notabene Manajer Red Devils. Sir Alex diyakini tertarik mempertemukan kembali Lewandoski dengan mantan rekan seklubnya, Shinji Kagawa, yang sudah mendarat di Old Trafford. Jika benar, maka peluangnya cukup terbuka. Pasalnya, Lewandowski mengaku punya mimpi untuk menjajal ketatnya persaingan di Liga Premier. Lewandowski berharap suatu saat mimpinya tersebut dapat terwujud demi membawa kariernya ke level yang lebih tinggi. “Liga Premier adalah liga dimana saya ingin bermain,”katanya kepada stasiun televisi Polandia, TVP, Kamis (19/7).

AP

Mudingayi Senang Gabung Inter GELANDANG Bologna, Gaby Mudingayi (foto), mengatakan bahwa dirinya sudah resmi memperkuat klub Seri A Italia lainnya, Inter Milan. Meskipun belum ada konfirmasi resmi dari kedua klub, mantan pemain timnas Belgia tersebut mengaku sudah bergabung bersama Nerazzurri dengan status pinjaman. Status pinjaman tersebut kabarnya berdurasi hingga akhir musim depan, dengan kemungkinan perubahan kontrak secara permanen. Mudingayi tampaknya sudah tidak sabar untuk segera bergabung dengan Inter mengingat lamanya proses negosiasi. Ia juga mengatakan ingin segera berjuang menembus skuad inti asuhan Andrea Stramaccioni. “Akhirnya saya menjadi pemain Inter Milan. Negosiasi sudah berjalan selama empat bulan,” ungkap Mudingayi senang, Kamis (19/7). “Saya yakin kami akan berjuang untuk scudetto. Ini akan menjadi pertunjukan yang sungguh hebat. Saya tidak harus melakukan hal selain berada pada tingkat yang tinggi, membuat saya tersedia bagi pelatih dan rekan tim,” tutupnya. (m33/sun/ini/goal)


Sport

WASPADA Jumat 20 Juli 2012

A11

Waspada/ist

SEMBILAN atlet asal Sumatera Utara yang berlatih di Guangzhou disambut Ketua Umum KONI Sumut H Gus Irawan SE Ak MM setibanya di Bandara Polonia Medan, Kamis (19/7).

Atlet Sumut Terkendala Makanan Persiapan PON Di China MEDAN (Waspada): Setelah tiga bulan menambah ilmu di Negeri Tirai Bambu, atlet Sumatera Utara yang kembali pulang ke kampung halaman, Kamis (19/7), mengakui kesulitan memperoleh makanan terlebih pada bulan Ramadhan. “Faktor makanan merupakan kendala paling utama dihadapi atlet. Untuk itulah sesuai dengan persetujuan KONI Sumut, saya

dan rekan-rekan memutuskan untuk melanjutkan latihan di Medan,” kata Denny Zulfendri mewakili rekan-rekannya kepada wartawan. Denny bersama delapan atlet lainnya akan kembali berlatih di Medan setelah sejak April 2012 berlatih di Guangzhou dalam persiapan menghadapi Pekan Olahraga Nasional (PON) XVIII di Riau, September mendatang. “Yang pasti kita melanjutkan program latihan dari China, dikolaborasikan dengan program pelatih di Medan,” ujar Denny yang dua kali beruntun memperoleh medali emas kelas di atas 100kg cabang judo di PON 2004 dan PON 2008.

Denny pun mengakui bahwa berupaya menciptakan hatrik emas di Riau nantinya. Pada PON XVIII mendatang, Denny juga mengungkapkan bahwa tampil di Riau nanti akan menjadi pentas PON terakhir bagi dirinya. Kesembilan atlet Sumut yang kembali berlatih di Medan adalah Zulkarnaen Purba, Edy Hariyanto, Nyai Prima Agita (atletik), Denny Zulfendri, Ricky Ramadhani (judo), Dian Ramayati, Jihan Siska (anggar), Heka Mayasari, dan Sumurung Siregar (gulat). Satu atlet atletik Mari Yusuf Gulo terus bertahan di China bersama 16 atlet wushu. Target Tak Berubah Ketua Umum KONI Sumut, H Gus Irawan Pasaribu SE Ak MM, menyebutkan sembilan atlet yang kembali dari China selanjutnya mengikuti Pelatda Penuh di Asrama Haji sekaligus melanjutkan program latihan dari Guangzhou. Dengan langkah

ini, atlet bisa menjalani latihan dan tidak tertinggal menunaikan ibadah puasa. Gus Irawan, didampingi Iwan Kwok (Bidang Luar Negeri) dan Tji Pik (Humas), mengucapkan selamat tiba di kampung halaman kepada atlet. Dia juga menyampaikan terimakasih atas dedikasi dan pengorbanan para patriot olahraga meninggalkan anak istri dan orang-orang tercinta berguru ke Guangzhou untuk meningkatkan kemampuan demi prestasi. Ditambahkan, KONI Sumut semula memprogramkan 26 atlet berguru di China jelang PON 2012. Namun, khusus atlet yang berlatih di Guangzhou terjadi perubahan berkaitan faktor kesulitan khususnya bagi mereka yang akan menjalani ibadah puasa. Kendati pulang ke Medan, Gus menegaskan bahwa hanya tempat latihan atlet saja yang berubah. Sementara target semula meraih prestasi di PON Pekanbaru tidak berubah. (m18)

Sepakbola PON Sumut Ujicoba Malam Hari MEDAN (Waspada): Tim sepakbola PON Sumut berencana menggelar tiga kali laga ujicoba di sisa waktu yang ada sebelum tampil di ajang multi event empat tahunan tersebut di Riau pada September 2012 mendatang. “Dua laga ujicoba akan digelar pada malam hari guna menyesuaikan jadwal tanding

sesungguhnya di PON XVIII/ 2012 nanti. Soal lawan tanding dan di mana akan digelar, nanti akan dibahas lagi,” ujar Manajer Tim Sepakbola PON Sumut, DR M Nur Rasyid, seusai rapat koordinasi di gedung KONI Sumut, Jl Pancing Medan Estate, Kamis (19/7). Dikatakan, sesuai jadwal mereka terima, laga sepakbola

di PON nanti digelar pada malam hari. Karena itu, pria yang akrab disapa dr Mamad ini merencanakan program laga ujicoba di malam hari agar tim yang diarsiteki trio pelatih Rudi Saari, Budiono,Mardiantoitulebihsiap. “Hari ini (Kamis kemarinred), adalah latihan terakhir pemain sebelum bulan puasa. Selanjutnya mereka diliburkakn

Icuk Apresiasi Yonex-Sunrise Jakarta Open JAKARTA (Waspada): Mantan juara dunia bulutangkis tunggal putra, Icuk Sugiarto, mengaku puas dengan pelaksanaan kejuaraan Yonex-Sunrise Jakarta Open I 2012 di Gedung Pelita Bakrie, Duri Kosambi, 1419 Juli 2012. Menurut Icuk yang juga Ketua Umum Pengurus Provinsi Persatuan Bulutangkis Seluruh Indonesia (Pengprov PBSI) DKI, dari hasil kejuaraan seperti ini dipastikan akan lahir talenta berbakat, yang bisa diharapkan ke depan menjadi penerus seniornya.

Karena itulah, lanjutnya, para pemenang diberikan apresiasi yang cukup. Selain mendapat piagam dan medali, pemenang kejuaraan yang diikuti 815 peserta dari seluruh Indonesia ini, juga mendapat uang pembinaan. “Saya ucapkan selamat kepada para pemenang, juara tunggal kelompok umur pemula dan remaja putra-putri akan ikut berkompetisi di kejuaraan Li Ning Youth Singapura pada Desember mendatang,” ujar Icuk saat memberi sambutan pada penutupan kejuaraan di

Gedung Bulutangkis Pelita Bakrie Cengkareng, Jakarta, Kamis (19/7). Dengan berakhirnya Jakarta Open I, tambahnya, Pengprov PBSI DKI Jakarta telah menjalankan programnya secara konsisten di bidang pembinaan prestasi nasional untuk usia dini. “Kami berharap melalui Yonex Sunrise Jakarta Open I akan lahir atlet bulutangkis muda berbakat yang siap mengembalikan kejayaan dan citra Indonesia di dunia Internasional,” katanya. (yuslan)

Valencia Pastikan Full Team Duo Pemain Buka Puasa Bareng JAKARTA (Waspada): Klub La Liga, Valencia, bakal berkunjung ke Indonesia untuk bertanding dengan Indonesia Seleciton di Stadion Utama Gelora Bung Karno Senayan, 4 Agustus mendatang. Lain dari pada yang lain, Valencia bakal membawa seluruh pilar terbaiknya. Jika sejumlah tim Eropa sebelumnya hanya memainkan pemain pelapis bersama beberapa bintangnya, tidak dengan El Che. Justinus Lhak-sana sebagai salah satu pemrakarsa datangnya Valencia sudah mendiskusikan hal tersebut dengan

pihak Valencia sendiri. Klub yang kini ditukangi Mauricio Pellegrino itu memang tengah membangun kekuatan baru, terlebih Pellegrino belum lama membesut Kelelawar Mestalla sebagai suksesor Unai Emery. Dalam tur pramusimnya, Indonesia menjadi negara terakhir sekaligus satu-satunya wilayah AsiaTenggara yang akan disambangi Valencia. Sebelumnya, Roberto Soldado cs berada di Jerman dan perjalanan masih akan berlanjut ke London untuk bersua Tottenham Hotspur, FC Porto di

Problem Catur

TTS TOPIK

Hitam melangkah, memaksa lawannya mengorbankan perwira untuk menang.

Jawaban di halaman A2

8

7

6

5

4

3

2

1 A

B

C

D

E

Portugal, dan China. “Perhelatan ini merupakan kontribusi kita kepada timnas Indonesia. Nantinya mereka akan ke sini full team. Tujuan kami tidak hanya ingin berdasarkan sisi komersil, tapi juga pengembangan timnas melalui pengalaman dari lawan-lawan klub papan atas yang kami datangkan,” ujar Justin dalam konferensi pers, Kamis (19/7). Sehubungan bulan Ramadhan, Sofiane Feghouli dan Adil Rami yang beragama Islam akan ikut buka puasa bersama fans. (m33/okz)

F

G

H

hingga Minggu (21/7) dan pada Senin (23/7) nanti seluruh pemain sudah harus kembali berlatih di Perkebunan PTPN IV Bah Jambi,” ujar dr Mamad yang menjadi manajer tim bersama H Kamaluddin Harahap. Dijelaskan, Sumut pada PON mendatang berada di Pool B bersama Jawa Barat, Jawa Timur, dan Gorontalo. Tim Sumut rencananya bertolak ke Pekanbaru pada 1 Agustus mendatang, mengingat cabang sepakbola dipertandingkan lebih dulu.

“Setibanya di Pekanbaru, tim dijadwalkan menggelar laga ujicoba dengan PSPS Pekanbaru, sebelum akhirnya bertolak ke Teluk Kuantan, tempat berlangsungnya pertandingan sepakbola Pool B,” ucapnya. Mengenai porsi latihan selama bulan Ramadhan, dr Mamad yakin trio pelatih telah menyiapkan program yang tepat. “Seluruh pemain harus tetap menjalani latihan meski sedang menunaikan ibadah puasa,” pungkasnya. (m42)

Putra Indonesia Tembus Tim Senior Espanyol BARCELONA, Spanyol (Waspada): Kabar menggembirakan datang dari pemain muda Indonesia, Arthur Irawan (foto), yang naik kelas ke tim senior Espanyol. Meski hanya berstatus sebagai pemain cadangan, Arthur mengaku senang atas promosi ini. wordpress Arthur akhirnya akan merasakan ketatnya kompetisi di dataran Spanyol musim depan, meski hanya berlaga di Segunda B. Tapi pemain 19 tahun ini juga akan merasakan kerasnya menghadapi tim sekelas Valencia, Villarreal, dan Real Zaragoza. “Sangat menyenangkan dan kami akan menghadapi sejumlah tim tangguh pada musim depan. Karena itu penting berkumpul lebih awal untuk latihan. Banyak tim di Spanyol menjalani pemusatan latihan di pegunungan dan itu sangat berat.Walau begitu, saya siap menghadapinya,” ungkap Arthur, Kamis (19/7). Sejak direkrut pada awal musim lalu, Arthur telah berlaga sebanyak 20 partai untuk tim junior dan sukses menjadi juara. Dia juga sempat tampil di final Catalonia Cup. Namun di laga pamungkas, Arthur cs harus takluk oleh Barcelona. Baru-baru ini, Arthur menghabiskan liburan musim panas di Jakarta dan langsung kembali ke Katalonia untuk meneruskan kariernya. Meski bakal menuai sukses di Spanyol, Arthur mengaku sedih meninggalkan rumah. Di mata tim pelatih Espanyol, performa Arthur pun dinilai menunjukkan grafik positif. Dilansir dari situs Espanyol, tim pelatih mengatakan Arthur terus menunjukkan kemajuan yang sangat bagus dan termasuk salah satu pesepakbola menjanjikan dari Indonesia. (m33/ini)

Waspada/Sapriadi

WAKIL Ketua DPRD Sumut Sigit Pramono Asri didampingi Ketua Umum KONI Asahan Nurkarim Nehe, Sekum Efi Irwansyah, Wakil Bendahara Dodi Riswanda Sitorus SP, Ketua Badan Audit Internal Hidayat Afif SH serta Komisi Pendidikan dan Penataran Zainal Arifin Siagian SP foto bersama di Kantor KONI Asahan, Kamis (19/7).

Pemerintah Kabupaten/Kota Diharapkan Dukung Atlet PON KISARAN (Waspada): Dalam menghadapi PON XVIII di Riau pada September mendatang, pemerintah kabupaten/kota diharapkan berpartisipasi merangsang semangat atlet meraih medali emas dengan memberi dukungan dan tali asih, sehingga Sumut bisa kembali ke masa kejayaan. Hal itu diungkapkan Wakil Ketua DPRD Sumut, Sigit Pramono Asri, saat berbincang dengan Waspada di Sekretariat KONI Asahan, Kamis (19/7). Kedatangan itu sebagai rangkaian kunjungan kerja resmi ke Kabupaten Batubara, Asahan, dan Kota Tanjungbalai. Sigit diterima Ketua Umum KONI Asahan Nurkarim Nehe, Sekum Efi Irwansyah, Wakil Bendahara Dodi Riswanda Sitorus SP, Ketua Badan Audit Internal Hidayat Afif SH serta Komisi Pendidikan dan Penataran Zainal Arifin Siagian SP. Sigit berharap 33 kabupaten/kota di Sumut bersinergi mendukung kesuksesan tim PON Sumut. Misalnya, Pemkab Asahan yang akan memperjuangkan bonus Rp50-100 juta bagi atlet peraih medali emas di PON mendatang. “Kita berharap kabupaten /kota lain melakukan hal sama, termasuk daerah yang tidak berhasil menyumbangkan atlet berkenan menyumbang dana ke KONI Sumut untuk disalurkan ke tim PON Sumut dengan memperhatikan akun-

MARHABAN RAMADHAN

tabilitas anggaran,” ucapnya. Menurutnya, sistem otonomi daerah menuntut daerah saling peduli, bukan otonomi individualis. Oleh sebab itu, diharapkan Pemprov Sumut melalui Dispora bisa merangsang pemerintah kabupaten/kota berpartisipasi dalam memberikan tali asih kepada atlet peraih emas. “Dengan demikian, atlet PON Sumut lebih termotivasi, begitu juga atlet lain di daerah bersemangat dalam meningkatkan prestasinya agar terpilih membela Sumut pada PON mendatang. Dulu, Sumut adalah gudang atlet sehingga dengan rangsangan yang diberikan kabupaten/kota dan Pemprovsu, Insya Allah olahraga Sumut bisa berjaya,” ujar Sigit. Berdasarkan data dari Pelatda PON, 19 kabupaten/kota barpartisipasi menyumbang atlet ke tim PON Sumut. Ketua Umum KONI Asahan, Nurkarim Nehe, mendesak kabupaten/kota memberi bonus kepada atletnya yang meraih medali emas sebagaimana gagasan Bupati Asahan, Drs Taufan Gama Simatupang MAP. “Pemprovsu tidak perlu memberi bonus lagi, akan tetapi secara signifikan menambah dana operasional kontingen Sumut ke PON XVIII, khususnya insentif atlet agar mereka lebih terpacu. Dana itu bisa ditambah dari akumulasi sumbangan dana kabupaten/kota yang belum bisa menyumbangkan atlet,” sebut Nehe. (a15)

Sudoku MENDATAR

1. Arti kata marhaban (Dua kata, tulis tanpa spasi). 5. Bulan suci yang disambut kedatangannya oleh umat Islam yang beriman. 7. Shaum; Ibadah wajib pada bulan suci tersebut diatas. 8. Surat Al Quran yang mewajibkan berpuasa. 10. Nawaitu; Keinginan dalam hati sebelum melakukan puasa. 13. Tuhan, untuk siapa puasa kita dilakukan, dan Dia sendiri akan menentukan pahalanya. 15. Makan sebelum memulai ibadah puasa, ada berkahnya, kata Rasulullah SAW. 16. Mengakhiri puasa pada beduk maghrib. 17. Tempat siksa dan derita yang pintunya ditutup selama bulan puasa. 19. Tempat penuh nikmat yang dibuka pintunya selama bulan puasa. 21. Kata lain dari surga (Arab). 23. Nama gerbang surga, khusus bagi orang-orang beriman yang berpuasa. 24. Belas kasih; Karunia (dari Allah kepada orang yang dapat masuk surga dan keutamaan awal Ramadhan).

MENURUN

1. Rukun Islam ke-2 diatas puasa. 2. Surat Al Quran, disebut juga Iqra dan Al Qalam. 3. Perbuatan yang mendatangkan pahala. 4. Hira, dimana Nabi Muhammad SAW berkhalwat dan menerima ayat pertama. 6. Permohonan kepada Allah. 7. Ganjaran Allah kepada seseorang atas perbuatan baiknya. 9. Sifat asal; Kesucian; Sedekah wajib sebelum 1 Syawal. 11. Shalat sunat dilakukan selama Ramadhan, dimulai malam ini. 12. Pembacaan Al Quran secara bersama-sama dalam bulan puasa. 14. Bohong; Dusta (Inggris) harus dibuang selama berpuasa. 15. Deret (dalam shalat berjamaah). 16. Azan. 17. Sungguh-sungguh: Taubat ____. 18. Barang kekayaan yang mesti dibersihkan dengan zakat. 20. Juz terakhir dalam Al Quran (QS 78 s/d 114). 22. Nikmat; Nyaman; Nama surga.

Isi kotak kosong dengan angka 1 sampai 9. Tidak boleh ada pengulangan angka mendatar, menurun, maupun di dalam kotak 3x3 bergaris tebal. Tingkat kesulitan: sangat sulit (*****), bisa diselesaikan dalam waktu kurang dari 20 menit. Jawabannya lihat di halaman A2 kolom 1.

3 9 5

5 6

8

3 8 7

1 7 8 5 7 6 1 5 9 3 5

2

1

6 7 3 1

5 2

*****41


Sport

A12

Medali Emas Atau Tak Usah Pulang LONDON (Waspada): Tim bola basket Amerika Serikat (AS) jelas jadi tim yang paling dijagokan mendapatkan medali emas di Olimpiade London 2012. Saking favoritnya tim ini, cuma medali emas yang membuat mereka layak pulang ke negaranya. Di London nanti, AS memang tak bisa membawa semua pemain terbaiknya. Derrick Rose, Dwight Howard, dan DwyaneWade absen karena cedera. Meski demikian, tim asuhan Mike Krzyzewski ini tetap tak kekurangan pemain bintang. Sebut saja Carmelo Anthony, Kobe Bryant, Tyson Chandler, Kevin Durant, Anthony Davis, James Harden, Andre

Iguodala, Kevin Love, Chris Paul, Russell Westbrook, Deron Williams, dan tentu saja LeBron James. Selain soal materi pemain, AS juga diunggulkan karena memang mereka adalah langganan medali emas di Olimpiade. Dari 16 partisipasi, mereka 13 kali dapat emas, sekali perak, dan dua perunggu. Di edisi terakhir di Beijing 2008, basket AS

Petkovic Batal Tampil LONDON (Waspada): Andrea Petkovic (foto) harus mengubur kesempatan pertama tampil di ajang Olimpiade. Lantaran cedera, petenis cantik ini gagal memperkuat kontingen Jerman di pesta olahraga dunia ke-30 di London tersebut. Petkovic mengalami cedera ligamen pergelangan kaki kanan saat Grand Prix Stuttgart, April lalu. Akibatnya, petenis berusia 24 tahun ini tidak diperkenankan mengikuti dua turnamen grand slam, Prancis Terbuka dan Wimbledon. Hingga sepekan menjelang pembukaan Olimpiade, cedera Petkovic belum dinyatakan pulih 100 persen. Praktis, dara kelahiran Bosnia-Herzegovina ini batal bersaing dengan 63 petenis tangguh dunia lainnya. “Saya sangat menyesal mengumumkan bahwa saya tidak akan tampil di Olimpiade. Saya kecewa dan sangat sedih, tapi belum siap untuk bertanding lagi,” ujar Petkovic seperti dilansir Reuters, Kamis (19/7). Petkovic merupakan satu dari empat petenis putri Jerman yang berhasil lolos kualifikasi Olimpiade bersama Sabine Lisicki, Angelique Kerber dan Julia Goerges. Namun, hingga saat ini, Federasi Tenis Internasional belum memutuskan pengganti petenis peringkat 18 dunia itu. (m33/ap)

eurosport

Seragam Kontingen Spanyol Norak MADRID (Waspada): Saul Craviotto (foto) dan Alex Fabregas sangat percaya diri memamerkan seragam kontingen Spanyol untuk Olimpiade London 2012. Atlet kano dan hoki tersebut mengunggah foto mereka masing-masing mengenakan seragam merah-kuning itu di Twitter. “Di rumah saya mencoba seragam Olimpiade. Lebih baik saya tidak komentar dan saya serahkan kepada Anda untuk menilai,” tulis Craviotto yang bertekad mempertahankan medali emas di Olimpiade 2008, Kamis (19/7). “Seragam Olimpiade, tidak ada kata sifat yang bisa menggambarkannya,” kata Fabregas yang berpose lengkap dengan topi dan tas bertuliskan ‘Espana’ berwarna senada dengan bajunya. Seragam tersebut diproduksi perusahaan Rusia, Bosco, yang juga mendesain baju kontingen Rusia dan Ukraina. Bosco memberikan secara gratis berdasarkan kesepakatan dengan Komite Olimpiade Spanyol (COE). “Seragam itulah yang kami punya. Kami tidak bisa mengubahnya lagi sekarang. Itu sudah kami putuskan lebih dari 1,5 tahun lalu. Saat Rafael Nadal dan semua kontingen tampil dengan seragam mereka, maka seluruh dunia akan menyambutnya dengan meriah,” kata Presiden COE, Alejandro Blanco. (m33/ap)

AP

juga menjadi tim terbaik. “Bersama tim Amerika Serikat, kami harus memenangi medali emas atau tak pulang. Mereka akan mencabut kewarganegaraan kami,” seloroh Kobe Bryant di ESPN Star, Kamis (19/7). “Ini adalah kehormatan bisa mewakili negara Anda dan jadi tumpuan negara Anda dalam memenangi medali emas. Anda ingin mereka mengharapkan yang terbaik dari Anda, dan kami akan mencoba mewujudkannya,” imbuh guard LA Lakers ini. Meski sangat diunggulkan, AS tetap tak boleh kehilangan kewaspadaan. Pengalaman tak menyenangkan di tahun 2004, di mana mereka cuma mendapatkan perunggu, tentu tak ingin mereka rasakan lagi. “Basket adalah olahraga di mana tim mana pun bisa menang pada malam keberuntungan mereka. Di Amerika, entah itu turnamen kampus atau NBA, Anda bisa lihat tim terbesar bisa kalah kapanpun. Jadi,

kami harus tetap ada di puncak dan tampil bagus di setiap pertandingan,” kata Kevin Love. Sementara itu, LeBron James bertekad melengkapi cincin juara NBA yang sudah didapatnya bersama Miami Heat dengan medali emas Olimpiade. Bagi LeBron, dua-duanya (final NBA dan emas Olimpiade) adalah standar tinggi dalam kariernya. “(Emas) adalah target saya. Itulah kenapa saya jadi bagian tim ini!” tegas MVP NBA 2012 tersebut. (m33/ap) KAPTEN tim LeBron James (tengah) menegaskan basket AS wajib mendulang medali emas Olimpiade 2012. -AP-

Pasang Iklan Telp. 4528431 HP. 081370328259 Email: iklan_waspada@yahoo.co.id

WASPADA Jumat 20 Juli 2012


Sumatera Utara

WASPADA Jumat 20 Juli 2012

Kota Medan B. Aceh Binjai Bireuen B. Pidie G. Sitoli K. Jahe Kisaran Kutacane Langsa

Zhuhur 12:33 12:47 12:34 12:41 12:41 12:37 12:34 12:30 12:36 12:36

‘Ashar 15:58 16:11 15:59 16:06 16:05 16:02 15:59 15:54 16:01 16:01

Magrib 18:43 18:59 18:44 18:53 18:52 18:43 18:43 18:38 18:46 18:47

‘Isya

Imsak

Shubuh Syuruq

Kota

19:57 20:13 19:57 20:07 20:06 19:57 19:56 19:52 19:59 20:01

04:52 05:01 04:52 04:56 04:57 05:00 04:53 04:49 04:55 04:53

05:02 05:11 05:02 05:06 05:07 05:10 05:03 04:59 05:05 05:03

L.Seumawe 12:39 L. Pakam 12:32 Sei Rampah12:32 Meulaboh 12:43 P.Sidimpuan12:31 P. Siantar 12:32 Balige 12:32 R. Prapat 12:28 Sabang 12:46 Pandan 12:33

06:22 06:32 06:22 06:27 06:27 06:29 06:23 06:19 06:25 06:23

Zhuhur ‘Ashar 16:04 15:57 15:56 16:08 15:56 15:56 15:56 15:53 16:11 15:58

B1

Magrib

‘Isya

Imsak

Shubuh Syuruq

Kota

Zhuhur ‘Ashar

Magrib

‘Isya

Imsak

Shubuh Syuruq

Kota

18:52 18:42 18:42 18:54 18:37 18:40 18:40 18:36 19:00 18:40

20:06 19:56 19:55 20:08 19:51 19:54 19:53 19:49 20:14 19:53

04:55 04:51 04:50 05:01 04:53 04:51 04:52 04:49 05:01 04:54

05:05 05:01 05:00 05:11 05:03 05:01 05:02 04:59 05:11 05:04

Sibolga Sidikalang Sigli Singkil Stabat Takengon T.Balai Tapaktuan Tarutung T.Tinggi

12:33 12:34 12:44 12:37 12:34 12:40 12:29 12:39 12:32 12:31

18:40 18:43 18:57 18:45 18:44 18:52 18:38 18:48 18:40 18:41

19:53 19:56 20:10 19:58 19:57 20:05 19:51 20:02 19:53 19:54

04:54 04:54 04:59 04:57 04:52 04:57 04:48 04:58 04:53 04:50

05:04 05:04 05:09 05:07 05:02 05:07 04:58 05:08 05:03 04:00

Panyabungan 12:30 Teluk Dalam12:37 Salak 12:35 Limapuluh 12:30 Parapat 12:32 GunungTua 12:29 Sibuhuan 12:29 Lhoksukon 12:39 D.Sanggul 12:33 Kotapinang 12:27 AekKanopan 12:29

06:25 06:21 06:20 06:31 06:23 06:21 06:22 06:19 06:31 06:24

15:57 15:59 16:09 16:02 15:59 16:05 15:54 16:04 15:57 15:56

Dihisab oleh: Tim Ahli Badan Hisab dan Rukyat (BHR) Sumut

06:24 06:24 06:30 06:27 06:22 06:27 06:18 06:28 06:23 06:20

Zhuhur ‘Ashar 15:54 16:01 15:59 15:55 15:57 15:54 15:54 16:03 15:58 15:52 15:54

Magrib

‘Isya

Imsak

Shubuh Syuruq

18:35 18:42 18:43 18:39 18:41 18:36 18:35 18:51 18:41 18:35 18:37

19:48 19:55 19:56 19:53 19:54 19:49 19:48 20:05 19:54 19:48 19:51

04:53 05:00 04:55 04:49 04:52 04:51 04:52 04:54 04:54 04:49 04:49

05:03 05:10 05:05 04:59 05:02 05:01 05:02 05:04 05:04 04:59 04:59

06:22 06:30 06:24 06:19 06:22 06:21 06:21 06:25 06:23 06:18 06:19

Cegah Konflik Saat Ramadhan Muspika Gelar Pertemuan Dengan Ormas Dan OKP PERCUT SEITUAN (Waspada): Muspika Kec. Percut Seituan menggelar pertemuan dengan seluruh unsur pengurus Ormas dan OKP, guna mencegah konflik yang dapat mengganggu rasa aman umat muslim dalam menjalankan ibadah puasa pada bulan suci Ramadhan, di balai pertemuan kantor camat, Kamis (19/7).

Pengurus Mabmi Kota Binjai Dilantik BINJAI (Waspada): Pengurus Besar Mabmi diwakili Sekretaris Prof. DR. Wan Syaifuddin, kemarin malam di Pendopo Umar Baki, melantik kepengurusan Mabmi periode 2012-2016 yang dipimpin ketua terpilih H. Fadlan, SH, MH. Pelantikan pengurus Mabmi kota Binjai ditandai penyerahan pataka Mabmi oleh Sekretaris PB Mabmi, Prof. DR.Wan Syaifuddin kepada H. Fadlan, SH, MH disaksikan Ka. Kanwil Kemenag Prov. Sumatera Utara Drs. H. Abd. Rahim, Ustadz Amiruddin, MS, Zulfikar Hajar,LC,WaliKotaBinjaiHMIdaham,SH,MSi,KetuaDPRDZainuddin Purba, SH, unsur Muspida Binjai, dan Ketua PD Mabmi Kota Medan. Ketua Umum PD Mabmi Kota Binjai H. Fadlan, SH, MH mengemukakan, Mabmi akan tetap melakukan kordinasi dengan berbagai etnis di kota Binjai, guna menjaga kondisi yang kondusif, sebagai modal meningkatkan pembangunan. Wali Kota Binjai HM Idaham, SH, M.Si sangat berharap etnis melayu di Binjai, menjadi motivator utama menggerakkan potensi masyarakat meningkatkan pembangunan. HM Idaham sangat mendukung pembangunan rumah adat melayu di kota Binjai sembari mengingatkan, rumah melayu itu nantinya, harus dimanfaatkan dengan sungguh-sungguh. Pengurus PD Mabmi Binjai terdiri Ketua H. Fadlan, SH, MH, Ketua Matsyah, SH, Drs. T. Syarifuddin, MPd, Sekretaris H. Nizamuddin, SH dibantuwakildanBendaharaT.ChairilAzwarsertabeberapabidang.(a04)

Tewas Tertimpa Pohon STABAT (Waspada): Dedi Iswanto, 31, warga Desa Banyumas Stabat Kab. Langkat tewas tertimpa pohon saat melintas di Jalan TPA Kwala Bingai Stabat, Rabu (18/7) waktu maghrib. Saat itu korban mengendarai sepedamotor Suzuki Smash BK 3073 RS menuju rumahnya setelah berjualan tikar. Dalam kondisi hujan disertai angin kencang Dedi tidak berteduh tetapi terus berkendara. Tiba-tiba salah pohon di sisi jalan tumbang menimpanya, mengakibatkan korban tewas seketika. Kapolsek Stabat AKP Zulkarnaen mengatakan tidak ada harta benda miliknya yang hilang. “Dedi tewas akibat tertimpa pohon tumbang,” demikian Zulkarnaen. (a03)

RSU Sultan Sulaiman Adakan Operasi Katarak Warga Miskin SEI RAMPAH (Waspada): 86Warga miskin penderita mata katarak beberapa kecamatan di Kab.Serdang Bedagai mendapat operasi mata gratis dilakukan RSUD Sultan Sulaiman, baru-baru ini. Warga sejak pagi memenuhi ruang tunggu, bahkan sebagian terpaksa berdiri mengingat persediaan kursi di rumah sakit tidak mencukupi. Nek Niah, 76, mengatakan, matanya sudah kurang terang akibat penyakit katarak yang dideritanya puluhan tahun, sehingga untuk melihat dia kesulitan. “Aku terimakasih kepada direktur rumah sakit ini yang memberi operasi gratis, semoga mata bisa terang melihat,”papar Wak Niah. Sementara Direktur RSUD Sultan Sulaiman dr Ahmad Chaidir menerangkan, pelaksanaan operasi katarak gratis dalam rangka bakti sosial RSUD Sultan Sulaiman memberi pelayanan kepada masyarat kurang mampu. “Kita berharap ini dapat meringankan beban warga kurang mampu yang menderita katarak, kepedulian memang sangat dibutuhkan bagi orang tak mampu,”papar Chaidir.(a08)

Pria Tergantung Diduga Dibunuh STABAT (Waspada): Riski, 18, warga Kel. Pekan Tanjungpura Kab. Langkat yang ditemukan tewas tergantung di rumahnya 12 Juli silam dinilai pihak keluarga banyak kejanggalan. ‘’Adik kami tidak mungkin bunuh diri, kami menduga dia dibunuh kemudian digantungkan seolah-olah bunuh diri,’’ kata Rudiansyah, paman korban, Rabu (18/7). Kejanggalan yang dilihatnya yakni adanya luka di pipi korban, goresan di bagian pelipis mata dan luka lebam di wajah. ‘’Karena itu kami minta PolsekTanjungpura menyelidiki penyebab tewasnya adik kami,’’ lanjut Rudiansyah. Dia menambahkan, saat jenazah dilihat tergantung dan hendak diturunkan, ada oknumoknum yang mengatakan untuk dioutopsi pihak keluarga harus menyediakan Rp15 juta. ‘’Kami jelas keberatan,’’ ucapnya. Terkait dugaan pembunuhan tersebut, Kapolsek Tanjungpura AKP Marham Nasution ketika dimintai konfirmasinya mengatakan masih dalam penyelidikan.(a03)

Operasi Patuh Di T. Tinggi 2.376 Kenderaan Ditilang TEBINGTINGGI (Waspada): Sejak operasi patuh dilancarkan mulai 4 – 17 Juli 2012 di sejumlah pusat Kota Tebingtinggi, Satlantas Polres Tebingtinggi menilang 2.376 kenderaan terkait pelanggaran lalulintas. Disita barang bukti 1.491 STNK, 726 SIM, 159 ranmor, dan 75 kenalpot blong serta 508 pengguna kenderaan diberi teguran. “Operasi Patuh untuk penegakan hukum terkait pelanggaran lalulintas,” ucap KapolresTebingtinggi, AKBP Drs. Andi Rian Djajadi,S.Ik kepada sejumlah wartawan, Rabu (18/7). Didampingi Kasubag Humas AKP Ngemat Surbakti dan Kasat Lantas AKP Noerhani, SH, Kanit Regident Iptu P. Gultom, Kapolres mengatakan, selain hak milik terhadap kenderaan, masyarakat juga memiliki hak dan kewajiban yang harus dipenuhi yakni kelengkapan kenderaan. Beberapa kenderaan yang terjaring tidak memiliki kelengkapan surat-surat sehingga harus mengikuti proses persidangan.(a11)

“Sebenarnya inti dari pertemuan ini untuk menyamakan persepsi antara Pemerintah Kecamatan Percut Seituan dengan para pengurus Ormas dan OKP gunamenciptakanrasaamandan nyaman kepada masyarakat dalam menjalankan aktivitas, terutama saat menjalankan ibadah puasa Ramadhan,” kata Camat Percut Seituan, Darwin Zein.

Danramil 13/PST Kapt. Inf K Aritonang, menyambut baik kegiatan itu sebab menunjukkan adanya jalinan kerjasama dan komunikasi yang telah terbina dengan baik di wilayah Kec. Percut Seituan. Sedangkan Kapolsek Percut Seituan Kompol Maringan Simanjuntak, SH mengatakan, jika ditemukan permasalahan yang dihadapi masyarakat yang

sifatnya dapat mengganggu keamananan, maka dapat diselesaikan masyarakat itu melalui wadah FKPM di desa/kelurahan setempat, tanpa harus melalui pihak kepolisian hingga kasusnya tidak berlanjut ke pengadilan, karena FKPM itu sendiri merupakan wakil dari pihak kepolisian di desa/lurah dalam menyelesaikan dan mengatasi setiap permasalahan.(crul)

Drs. H. Amri Tambunan Terima Penghargaan P2BN Dari Presiden LUBUKPAKAM (Waspada): Bupati Deliserdang Drs. H. Amri Tambunan, Rabu (18/7) siang menerima penghargaan Peningkatan Produksi Beras Nasional (P2BN) dari Presiden RI DR. H. Susilo Bambang Yudhoyono, pada rangkaian acara Konferensi Dewan Ketahanan Pangan 2012 di Grand Ballroom Hotel Kempinski West Mall Indonesia, Jakarta Pusat. Dari enam kabupaten di Sumut yang menerima penghargaan P2BN itu, Deliserdang peringkat pertama dengan pencapaian peningkatan produksi padimencapai20,68%,sedangkan target nasional yang ditetapkan kepada kabupaten/kota yang berhak menerima penghargaan bila mampu meningkatkan produksi padinya di atas 5%. Ke enam kabupaten/kota dari Sumut yang menerima penghargaan P2BN karena mampu meningkatkan produksi padi di atas 5% sesuai urutan masing-masing, Kab. Deliserdang,

Toba Samosir, Kab. Samosir, TapanuliUtara,DairidanSerdang Bedagai. Asisten II Setdakab Deliserdang Drs. Agus Ginting, M.Si bersama Kadis Pertanian Ir. Hj. Eka RezekiYanti Danil, MM yang mendampingiBupatiDeliserdang menerima penghargaan, ketika dihubungi melalui telefon selularnya membenarkan keberhasilan yang diraih Pemkab Deliserdang di bawah kepemimpinan H. Amri Tambunan. Ini tak terlepas dari kepedulian dan komitmen bupati dalam membangun sektor pertanian, sehingga pada Desember 2011 juga menerima penghargaan Adhikarya Pangan Nusantara (APN) dari Presiden. Kadis Pertanian Ir. Eka Rezeki Yanti Danil kepada wartawan kemarinmenjelaskan,penghargaan yang diterima bukti keberhasilan Pemkab Deliserdang meningkatkan produksi padi hingga mencapai 20,68% (427.164 ton) sesuai hasil penilaian BPS dan Dinas Pertanian Sumatera Utara. Hal

ini pencapaian program peningkatan produksi beras nasional 10 juta ton pada tahun 2014. Dalam kaitan pencapaian target produksi itu Pemkab Deliserdang ditargetkan mencapai produksi padi 590.668 ton tahun 2014 atau lebih kurang 35 % dari target Produksi Sumatera Utara tahun 2014. Untuk mencapai target, tambahEka,PemkabDeliserdangmelalui Dinas Pertanian mengambil langkah-langkah antara lain perbaikan infrastruktur pertanian melaluiperbaikanjalanirigasidesa seluas 3.050 Ha, jaringan irigasi tingkat usaha tani 10.342 Ha, jalan usahatani58Kmsertapengadaan sarana produksi yang berkualitas seperti bantuan benih langsung unggul dan peningkatan pengetahuan para petani. Selain itu juga dilakukan pengembangan usaha agribisnis kepada 127 Gapoktan di Deliserdang di mana setiap Gapoktan mendapat bantuan penguatan modal Rp100 juta. (a06/m16)

Warga DS Terima Hadiah Mobil Dari BRI Binjai BINJAI (Waspada): Nuriati, warga Pujimulyo Kab. Deliserdang yang bertugas sebagai PNS di Dinas Perikanan, Prov. Sumut menerima hadiah mobil Xenia 1.0 Delux dari BRI cabang Binjai. Penyerahan mobil yang merupanahadiahpertamaSimpedes semester I oleh pimpinan BRI cabang Binjai Hariyono Darmawan didampingi Ketua pelaksana pesta rakyat Simpedes Hotman Sitompul,Kamis(19/7)dihalaman BRI cabang Binjai, Jalan Sutomo. Hariyono menyebutkan undian Simpedes dilaksanakan BRI satutahunduakali.Menyediakan berbagaihadiahuntukpenabung, seperti mobil, sepedamotor, LCD danhometeater,sebagaimotivasi bagi masyarakat dan menjalin hubungan dengan nasabah. Ny.Nuriatisaatmenerimapenyerahan mobil didampingi suaminya Sugianto sedikitpun tidak mendugamemperolehrezekidari BRIBinjai.Nuriatimengakusudah 20 tahun lebih menabung di BRI

Binjai.“Mulanyasayapercayadan tidakpercaya,memperolehhadiah mobil,apalagisaatinibanyaksekali penipuanyangmengiming-iming masyarakatdenganhadiahmobil,” ujarnya.

Sampaitigahari,dankeyakinan baru ada, setelah pimpinan BRI PujimulyoMuchsinmemberitahu dan mengundang menerima hadiahmobil,Kamis(19/7)dikantor BRI cabang Binjai.(a04)

Waspada/Riswan Rika

PIMPINAN BRI Cabang Binjai Hariyono Darmawan menyerahkan kunci mobil Xenia kepada Nuriati disaksikan ketua pelaksana Hotman Sitompul.

juga melakukan aksi menyumbanguangrecehankepadapetugas Satlantas,sebagaibentukkekecewaan warga atas tindakan petugas, yang terlalu gencar menilang. Pengunjukrasamenudingpenilangandilakukansemata-matakarena kepolisian kekurangan uang. Koordinator aksi, Hengki Sahputra dalam orasinya mengatakan warga mendukung kinerja polisi jika melakukan razia lebih bermartabat, bukan memberatkan warga dengan dalih tilang

yang berujung pada ‘damai di tempat’. “Kalau memang sudah susah cari uang, biar kami sumbang ke Satlantas,” cetusnya. Sementara tokoh pemuda Drs. H. Ibnu Hajar yang ikut menyampaikanorasijugamengkritik kinerja Satlantas terhadap razia yang dilakukan pada Minggu (15/ 7). Dengan sistem titip denda tilang kepada petugas Satlantas artinya bukan mengayomi masyarakat, tapi membuat masyarakat lebih menderita.(c02)

2 Pembongkar Apotek Dan Toko Ponsel Ditangkap TEBINGTINGGI (Waspada): Dua tersangka pelaku pembongkaran Apotek dan toko Ponsel di Jalan Suprapto Kota Tebingtinggi, diringkus aparat Polres Tebingtinggi, Senin (16/7). Barang bukti brankas kecil tempat penyimpanan uang milik Apotek Kimia Farma disita petugas. Tersangka PS, 25, mencuri dan membongkar toko Ponsel serta membawa laptop. Sedangkan Ju menggondol uang di brankas milik apotek beberapa waktu lalu.Tersangka Ju pernah mencuri kendaraan bermotor di wilayah Kab. Asahan. Hasilnya juga dipergunakan untuk membeli narkoba jenis sabu-sabu dan sebagian untuk foya-foya. Kapolres Tebingtinggi melalui Kasat Reskrim AKP Lili Astono mengatakan, kedua tersangka sudah diamankan. Keduanya dijerat denganpasal363KHUPdenganancamanpidana5tahunpenjara.(a11)

Kapoldasu Dimohon Ambil Alih Pengrusakan Di Langkat MEDAN (Waspada): Kapoldasu Irjen Pol. Wisjnu Amat Sastro dimohon mengambilalih penanganan kasus tindak pidana pengrusakan dan pemagaran lantai kediaman Jimmy, di Jalan Kartini Kel. Pekan Kuala, Langkat pada Maret 2010 yang ditangani Polres Langkat. Sebab, hingga kini tak jelas tindaklanjutnya. “Kami mohon Kapoldasu mengambilalih penanganan kasus pidana ini dan mengadakan gelar perkara, menyelidiki dugaan tindak pidana lainnya agar klien kami mendapat keadilan dan kepastian hukum,” kata Kuasa Hukum Jimmy, Sutan Nasution, SH di Medan, kemarin. Menurut Sutan Nasution, pihaknya keberatan sekaligus melaporkan kinerja Polres Langkat kepada Kapoldasu yang dinilai tidak profesional dan lambat serta diduga sengaja mengulur-ulur waktu, dan punya kepentingan dalam menangani kasus perkara kliennya yang hampir 2 tahun tak jelas prosesnya. Nasution menjelaskan, pengrusakan yang dialami Jimmy sebagaimana dimaksud dalam pasal170yo406KUHP.Pada3Maret2010,kliennya mengadu ke Polres Langkat. Menurut Jimmy, yang membangun lantai semen rumahnya adalah orangtuanya, Ngwie yang sudah meninggal dan mereka sudah tinggal di rumah itu sejak tahun 1957 serta selalu membayar pajak rumah hingga 2011 lalu. Polres Langkat juga sudah memanggil Ayin, keluarga Jimmy untuk dimintai keterangan, demikian juga para saksi lainnya. SutanNasutionmenambahkan,penyidiktelah

memeriksa tersangka HR yang intinya menjelaskan benar melakukan pemagaran atau pengrusakan terhadap lantai kediaman Jimmy dengan menyuruh sejumlah orang. Namun, pengakuan tersangka pemagaran atau pengrusakan dilakukan diluar dari surat tanah miliknya dan tersangka mengklaim bahwa tanah yang didirikan sebuah rumah oleh Jimmy adalah miliknya sesuai surat akte jual beli yang telah tersangka ganti rugikan dari pemilik sebelumnya, yang Ismail Hasibuan (alm). Banding Sutan Nasution menjelaskan, terkait kasus ini, tersangka menggugat kliennya di PN Stabat secara Perdata tentang hak atas sebidang tanah di Jalan Kartini, Pekan Kuala. PN Stabat mengabulkan untuk sebagian, menyatakan demi hukum sebidang tanah dengan luas 3245 m2 di Jalan Kartini no. 26 Pekan Kuala adalah milik penggugat. Namun, kata Sutan, kliennya menyampaikan risalah pernyataan permohonan banding dan diterimaWakil Panitera Jabonar Simanjuntak, SH. Dengan adanya putusan Perdata itu, maka proses pidana yang dilaporkan Jimmy terus ditindaklanjutiolehpenyidikdan15Juli2011,berkas perkara pidana tersebut baru dikirim ke Kejari Stabat. Anehnya, kata Nasution, pengenaan pada pelanggaran hukum tindak pidana pengrusakan menjadi pasal 406 jo 55 ayat 1e dan 2e KUHP. “Pengalihan pasal ini merupakan unsur rekayasa dari penyidik untuk melemahkan klien kami,” ujar Nasution.(irh)

Penahanan Bendahara Dinas PU DS Tidak Profesional

Razia Ala Preman, Kantor Unit Patroli Satlantas Tamora Didemo TANJUNGMORAWA (Waspada): Puluhan warga Kec. Tanjungmorawa, tergabung dalam kelompok Badan Koordinasi Remaja Masjid (BKRM) menggelar orasi sebagai bentuk protes terhadap maraknya razia dengan arogansi di depan Kantor Unit Patroli Satuan Lalu Lintas Polres Deliserdang di Kec. Tanjungmorawa, Selasa (17/7) sore. Selain mengusung poster berisi kecaman terhadap perilaku personelSatlantas,pengunjukrasa

Waspada/Khairul K Siregar

DANRAMIL 13/PST Kapt. Inf. K. Aritonang (dua kiri) didampingi Camat Percut Seituan Darwin Zein, S.Sos (tiga kiri) dan Kapolsekta Pst Kompol Maringan Simanjuntak, SH, MH memberi sambutan pada pertemuan dengan pengurus dan anggota ormas/OKP se Kec. Percut Seituan di aula kantor camat.

Waspada/Andi Nasution

PENGUNJUKRASA menyerahkan uang recehan yang dikumpulkan kepada Kanit Patroli Tanjungmorawa Sat Lantas Polres Deliserdang Iptu P Sinaga sebagai bentuk kekecewaaan terhadap maraknya razia ala preman.

MEDAN (Waspada): Penahanan Bendahara Dinas PU Deliserdang tersangka perkara dugaan korupsi penyelewengan dana anggaran pembuatan dan pembangunan jalan dan jembatan diDeliserdangolehKejaksaanTinggiSumateraUtara (Kejatisu), cacat hukum dan tidak profesional. “Penahanan yang dilakukan tim kejaksaan ini cacat hukum dan tidak profesional, sehingga kita menolak menandatangani berita acara penahanannya,” ujar Elfian dan tim penasehat hukum H. Amar Hanafi, SH, Irwanta Rasmadan, SH, Mahadi, SH, Rabu (18/7). Adatigapoinyangsalahdalampenahanannya, lanjutnya. Pertama ketika perintah penyidikan (Printdik) terbit 10 Juli 2012, surat panggilan yang diterima juga 10 Juli tanpa pasal yang disangkakan. “Elfian diperiksa 12 Juli di mana belum ada fakta terhadap dua alat bukti dan pasal yang menyimpulkan Eflian merupakan tersangka kasus penyelewengan dana anggaran pembuatan dan pembangunan jalan dan jembatan di kawasan Deliserdang, dengan kerugian negara Rp80 miliar dari nilai pagu Rp168 miliar, berasal dari APBD 2010,” ujarnya. Yang kedua, penetapan tersangka terbit 11 Juli 2012. “Artinya lebih dahulu dipanggil dalam status tersangka pada 10 Juli dari pada penetapan sebagai tersangka No. B-2718/N.2/Fd.1/107/

2012 tanggal 11 Juli 2012. Besoknya baru ditetapkan dan sebelum di BAP.” “Kemudian Elfian diperiksa dalam kondisi sakit berdasarkan surat dari dr. Erizal Kaban dari RSUD Deliserdang, Lubukpakam, namun Bendahara Dinas PU Deliserdang itu tetap saja ditahan,” ujarnya. SementaraWakil Direktur Lembaga Bantuan Hukum (LBH) Medan, Muslim Muis menyatakan syarat penahanan diatur dalam Pasal 21 ayat 1 KUHAP di mana perintah penahanan atau penahanan lanjutan dilakukan terhadap tersangka atau terdakwa yang diduga keras melakukan tindak pidana berdasarkan bukti yang cukup, dalam hal ini adanya keadaan yang menimbulkan kekhawatiran bahwa tersangka atau terdakwa akan melarikan diri, merusak atau menghilangkan barang bukti. “Namun hal tersebut ada perkecualian yang diatur di dalam pasal 29 KUHAP di mana tersangka atau terdakwa menderita gangguan fisik atau gangguan mental berat dibuktikan dengan surat keterangan dokter,” ujar Muslim Muis. Mengingat belum jelasnya kerugian negara dalam proyek swakelola pemeliharaan dan pembangunan jalan yang dananya bersumber dari APBD 2010, pihak kejaksaan harus dapat mempertimbangkan kondisi tersangka, demikian Muslim.(m38)

Perguruan Swasta Minta PSB Online Dipertajam TEBINGTINGGI (Waspada): Sejumlah perguruan swasta Kota Tebingtinggi minta penerimaan siswa baru sistem online, ke depan harus dipertajam. Karena sistem online tahun ini belum memberi dampak signifikan bagi PSB perguruan swasta, sebab penggunaan sistem sekolah pilihan hanya menguntungkan sekolah negeri.Namun,secarakeseluruhansekolahswasta memuji PSB online. Demikianhasilpembicaraandengansejumlah pimpinan perguruan swasta, kemarin, terkait dimulainya tahun ajaran baru. Beberapa perguruan swasta mengakui ada peningkatan penerimaan siswa baru, meski belum signifikan. Kasek SMA Taman Siswa Dra. Bambang LR mengatakan sistem online belum menunjukkan pengaruh signifikan terhadap perimbangan penerimaan siswa baru antara sekolah negeri dan swasta. Malah beberapa guru SMA tertua itu, mengaku PSB online makin menyulitkan, karenaadanyasistemrangkingdanpilihan.“Sistem itu membuat siswa yang daftar ke sekolah negeri terserap semua, tanpa tersisa,” ujar Ir. Batara. Perguruan Taman Siswa mengasuh PAUD, SD, SMP, SMA, SMK B dan SMK T hingga hari terakhir baru menerima 352 siswa. Sedangkan siswa yang ke luar 378. Namun mereka optimis

target itu tercapai. Hal senada disampaikan Wakil Ketua Perguruan Diponegoro DarwisTambusai, SE yang mempersoalkan PSB online sistem rangking dan pilihansekolah.Maunyaitutidakberlakulagitahun depan.Diakui,tahuniniadapeningkatansignifikan penerimaan siswa di Perguruan Dipo yang mengasuh SMP, MTs, SMA, SMK B dan SMK T. Hingga hari terakhir siswa mendaftar 452 orang, yang keluar 400 orang. Beberapa sekolah swasta, ternyata mengalami peningkatan jumlah siswa yang menggembirakan, misalnya MA dan MTs Al Washliyah. Madrasah itu menerima 126 siswa dengan tiga rombel dan MTs dengan 168 siswa dengan empat rombel. Bahkan, TA 2012/2013 perguruan ini membuka SMK Kesehatan yang mampu menyedot 65 siswa untuk jurusan farmasi dan keperawatan. Beberapa sekolah swasta favorit, juga tetap eksis,sepertiPerguruanIr.H.Djuanda,KFTandean, RA Kartini, Ostrom dan Cinta Kasih yang dari informasi siswa baru yang masuk memenuhi target. Kadis Pendidikan Drs. H. Pardamean Siregar, MAP, mengatakan kebijakan PSB Online memang untuk menyeimbangkan penerimaan siswa baru antara negeri dan swasta.(a09)


Sumatera Utara

B2 WASPADA

Pemimpin Umum Dr. Hj. Rayati Syafrin Pemimpin Redaksi/Penanggung Jawab H. Prabudi Said Wakil Pemimpin Umum/Wapemred H. Teruna Jasa Said Wakil Penanggung Jawab H. Sofyan Harahap Redaktur Senior H. Azwir Thahir

Pemimpin Perusahaan: Dr. Hj. Rayati Syafrin. Wakil Pemimpin Perusahaan: H. Bahtiar Tanjung. Iklan: Hj. Hilda Mulina (Kabag), Rumondang Siagian (Medan), Lulu Lusia Damayanti (Jakarta). Redaktur Pelaksana Berita: Armin Rahmansyah Nasution. Redaktur Pelaksana Opini & Artikel: Dedi Sahputra. Redaktur Minggu & Akhir Pekan: Muhammad Thariq. Redaktur Berita: H. Halim Hasan, Hendra DS. Redaktur Medan: David Swayana. Redaktur Sumatera Utara: H.T. Dony Paridi. Redaktur Aceh: M. Zeini Zen. Redaktur Luar Negeri: H. Muhammad Joni. Redaktur Nusantara: H. Halim Hasan. Redaktur Olahraga: Jonny Ramadhan Silalahi. Redaktur Ekonomi: Armin R. Nasution. Redaktur Agama: H. Syarifuddin Elhayat. Litbang: H. Akmal AZ (Kabag). Humas: H. Erwan Effendi (Kabag), Aidi Yursal. Promosi: Edward Thahir. Sekretaris Redaksi: Hj. Hartati Zein. Pemasaran: H. Subagio PN (Medan), Zultamser (Sumatera Utara), Sinur Manik (Aceh). Asisten Redaktur: Irwandi Harahap (Medan); Irham Hagabean Nasution (Sumatera Utara); Armansyah Thahir (Sumatera Utara, Otomotif); Diurna Wantana (Aceh); Austin Antariksa (Olahraga, KMS Kreasi); Syafriwani Harahap (Luar Negeri, Popular, Pariwisata); Rudi Faliskan (Berita); Erwin Siregar (Opini); Hj. Hoyriah Siregar (Ekonomi); T. Junaidi (Hiburan); Hj. Erma Sujianti Tarigan (Agama), Hj. Neneng Khairiah Zen (KMS Remaja, Mode); Anum Purba (Keluarga); David Swayana (Infotainmen); Hj. Ayu Kesumaningtyas (Kesehatan); Dedi Riono (Budaya); Denny Adil (Pelangi). Wartawan Kota Medan: Umum: Zulkifli Harahap, Amir Syarifuddin, Ismanto Ismail, Rudi Arman, Zulkifli Darwis, H. Abdullah Dadeh, H. Suyono, Ayu Kesumaningtyas, Feirizal Purba, Gito AP, M. Ferdinan Sembiring, M. Edison Ginting, Anum Purba, Sahrizal, Sulaiman Hamzah, Sugiarto, Rustam Effendi, Mursal Alfa Iswara, Andi Aria Tirtayasa. Olahraga: Austin E. Antariksa, H. Syahputra MS, Setia Budi Siregar, Dedi Riono. Fotografer: Muhammad Faisal, Hang Tuah Jasa Said, Surya Effendi, Hamdani. Otomotif: Armansyah Thahir. Koran Masuk Sekolah/KMS: Hajrul Azhari Ritonga, Arianda Tanjung. Wartawan Jakarta: Andi Yanto Aritonang (Koordinator Liputan), Hermanto, H. Ramadhan Usman, Hasriwal AS, Nurhilal, Edi Supardi Emon, Agus Sumariyadi, Dian Warastuti, Aji K, Yuslan Kisra. Wartawan Sumatera Utara: Binjai: H. Riswan Rika, Nazelian Tanjung. Deli Serdang: H.M. Husni Siregar, Hotma Darwis Pasaribu, Rizaldi Anwar, M. Suhandi Nasution. Serdang Bedagai: Eddi Gultom, Edi Sahputra. Stabat: H. Ibnu Kasir, Abdul Hakim. Pangkalan Brandan: Chairil Rusli, Asri Rais. Kabanjahe/ Berastagi: Dickson Pelawi, Basita Bukit, Dedek Mohan Basri Hasibuan, Micky Maliki. Tebingtinggi: Muhammad Idris, Abdul Khalik. Pematangsiantar: Mulia Siregar, Edoard Sinaga. Simalungun: Ali Bey, Hasuna Damanik, Balas Sirait. Aek Kanopan: Indra Muheri Simatupang, Syahril Ilham. Rantau Prapat: Armansyah Abdi, Neirul Nizam, Budi Surya Hasibuan. Kota Pinang: Hasanuddin Harahap, Deni Syafrizal Daulay. Pangururan: Edison Samosir. Balige: Jimmy Sitinjak. Sidikalang: Natar Manalu. Tarutung: Parlindungan Hutasoit, Marolop Panggabean. Sibolga/Tapanuli Tengah: Zulfan Nasution, Alam Satriwal Tanjung. Padangsidimpuan: H. Syarifuddin Nasution, Sukri Falah Harahap, Ahmad Cerem Meha. Gunung Tua: Sori Parlah Harahap. Sibuhuan: Idaham Butarbutar, Syarif Ali Usman. Panyabungan: Munir Lubis, Sarmin Harahap, Alpin Lubis. Gunung Sitoli: Bothaniman Jaya Telaumbanua. Kisaran: Nurkarim Nehe (Koordinator Liputan Asahan, Batubara & Tanjungbalai), Bustami Chie Pit, Sapriadi. Batubara: Helmy Hasibuan, Agus Diansyah Hasibuan, Sahril, Iwan Hasibuan. Tanjung Balai: Rahmad Fansur Siregar, Rasudin Sihotang. Wartawan Aceh: Banda Aceh: Aldin Nainggolan (Ka Perwakilan), Iskandarsyah (Koordinator Liputan), Muhammad Zairin, Munawardi Ismail, Zafrullah, T. Mansursyah, T. Ardiansyah, Jaka Rasyid, Gito Rollies. Lhokseumawe: Bustami Saleh (Ka Perwakilan/Koordinator Liputan), M. Jakfar Ahmad, Zainal Abidin, Zainuddin Abdullah, Maimun, Arafat Nur. Kuala Simpang: Muhammad Hanafiah, Hasanul Hidayat. Langsa: H. Syahrul Karim, H. Ibnu Sa’dan, H. Samsuar, Dedek Juliadi. Lhoksukon: Musyawir, Mustafa Kamal. Idi: Muhammad H. Ishak. Bireuen: HAR Djuli, Amiruddin, Abdul Mukti Hasan. Takengen: Bahtiar Gayo, Irwandi. Sigli: Muhammad Riza, H. Rusli Ismail. Sabang: T. Zakaria Al-Bahri. Subulussalam: Khairul Boang Manalu. Tapaktuan: Zamzamy Surya. Blangpidie: Sudarmansyah Putra. Kutacane: Mahadi Pinem, Ali Amran. Blangkejeren: Bustanuddin, Wintoni. Bener Meriah: Khairul Akhyar, Irham Hakim. Singkil: Tarmizi Ripan, Mansurdin. Sinabang: Muhammad Rapyan.

KOTAPINANG (Waspada): Satuan gabungan Polsekta Kotapinang dan Satpol PP-Linmas Pemkab Labusel, Rabu (18/7) malam merazia pakter tuak dan kafe di sejumlah daerah di Kecamatan Kotapinang. Dalam operasi itu, petugas meminta pengusaha kafe dan pakter untuk membatasi jam beroperasi sepanjang Ramadhan. Pengamatan Waspada, petugas melakukan penyisiran sejumlah kafe dan pakter tuak di kawasan Dusun Simaninggir dan Besilam dilanjutkan ke kawasan Kelurahan Kotapinang.

Didugaoperasiitubocor,sehingga petugas tidak mendapati adanya pasangan mesum maupun pemabuk di tempat itu. Usai merazia sejumlah kafe dan pakter tuak, petugas kemu-

dianmeraziasejumlahlokasitempat mangkal pasangan bukan suami istri. Sempat terjadi kejar-kejaran antara petugas dengan warga. Meskitakmembuahkanhasil, Kanit Intelkam Polsekta Kotapinang AKP. P Sitompul memberikan penjelasan kepada pemilik usaha untuk menjaga jadwal usahanya sehingga tidak mengganggu ketenteraman Ramadhan. “Target kita kali ini hanya sosialisasi agar sebisa mungkin pemilik usaha tidak beroperasi. Namun pada Ramadhan nanti kita akan amankan langsung,” kata Sitompul. (c18)

Tim Penertiban Pemkab L.Batu Jaring 10 Pelaku Tuna Susila RANTAUPRAPAT (Waspada): Tim penertiban terpadu Pemerintah Kabupaten Labuhanbatu yang dipimpin Satuan Polisi Pamong Praja (Satpol PP) setempat menjaring 10 orang pelaku praktek tuna susila yang terdiri dari, 4 pria dan 6 wanita dari berbagai tempat di daerah tersebut, Kamis (19/7) dinihari. Ke-10 pelaku praktek tuna susila itu dijaring Hotel Imbalo, Jl. Baru By Pass, Penginapan Gunung Sahari Jl. Imam Bonjol dan Penginapan Murni di Jl. SM Raja Rantauprapat. Kasat Pol PP Aminullah Haris Nasution, SH di sela-sela penertiban tersebut mengatakan, pe-

nertiban ini merupakan implementasi penegakan Peraturan Daerah (Perda) Nomor 31 Tahun 2008 tentang Pengendalian Minuman Beralkohol dan Perda Nomor32/2008tentangLarangan PraktekTunaSusila,Gelandangan dan Pengemis. Menurutnya, penertiban yang dilakukan tim terpadu Pemkab L.Batu ini merupakan kegiatan rutin setiap tahunnya, terlebih saat ini bulan suci Ramadhan tahun 1433 Hijriah akan segera tiba sehingga perbuatan atau tindakan yang dapat mengganggu umat Islam menjalankan ibadahnyaselamaRamadhannanti harus ditertibkan mulai saat ini.

Setelahterjaring,ke-10pelaku praktek tuna susila tersebut dibawakeKantorBadanKesbang, Politik dan Linmas Kab. L.Batu untuk mendapat pembinaan mental rohani dari ustad. Selanjutnya dilakukan tes kesehatan oleh Dinas Kesehatan L.Batu untukmengetahuiapakahmereka telah terjangkit penyakit kelamin dan HIV/AIDS. Kemudian, pelaku praktek tuna susila itu diperbolehkan pulang setelah menandatangani perjanjian tidak akan mengulangi perbuatannya di atas kertas bermaterai dan orangtua/wali mereka dipanggil menjemput mereka. (a18)

KISARAN (Waspada): Menyambut HUT Adhyaksa ke-52, Kejari Kisaran memusnahkan barang bukti 594,21 gram SS (sabu-sabu), 84 kg ganja dan 10 butir ekstasi, Senin ( 16/7). Pembakaran barang bukti narkoba itu dihadiriWakil Bupati Asahan H. Surya, Ketua PN Kisaran, Kasat Narkoba Polres Asahan AKP Napsanto dan para tokoh masyarakat. Barang haram

itu itu merupakan sitaan selama empat tahun,yang terdiri 170 kasus SS dan 217 kasus ganja. “594,21 gram SS, 84 kg ganja dan 10 butir ekstasi yang kita musnahkan,” ujar Kajari Kisaran, Anthony Tarigan. Menurutnya, dalam menekan menyelesaikan kasus pihaknya bekerja sama dengan PN Kisaran dan Polres Asahan, sehingga bisa menekan angka

peredaran Narkoba di tengah masyarakat.“UntukkasusNarkoba, Kejari Kisaran tidak da tebang pilih, siapapun yang terlibat akan diproses dengan hukum yang berlaku,” ujar Tarigan. Sementara sebelumnya PolresAsahanjugamemusnahkan 3,3 kg lebih sabu-sabu (SS) dan 3 kg lebih ganja barang bukti dari tangkapan akhir 2011 dan awal 2012. (a15)

Komisaris Utama: Tribuana Said Direktur Utama: dr. Hj. Rayati Syafrin, MBA, MM SIUPP: 065/SK/MENPEN/SIUPP/A.7/198 tanggal 25 Februari 1988 Anggota SPS No. 13/1947/02/A/2002

� Perwakilan dan Biro Lhokseumawe: Jalan Iskandar Muda No. 65, Lhokseumawe. Tel: (0645) 42109. � Biro Asahan, Batubara & Tanjungbalai: Jalan Sutami No. 30 Kisaran. Tel: (0623) 41412. Harga iklan per mm kolom: Hitam-putih Rp. 11.000,-, berwarna Rp. 30.000,Halaman depan: hitam-putih Rp. 33.000,-, berwarna Rp. 90.000,Ukuran kolom: 40,5 mm. E-mail Iklan: iklan@waspadamedan.com Pencetak: PT Prakarsa Abadi Press, Jalan Sidorukun Medan. Isi di luar tanggung jawab percetakan

DPRD Labusel Akan Surati Menhut Terkait PT PLP KOTAPINANG (Waspada):Terkait dana bagi hasil tanaman kelapa sawit PT. Pura Lika Perkasa (PLP) yang sampai kini tidak terealisasi, dan pengalihan fungsi lahan Hutan Tanaman Industri (HTI) menjadi tanaman kebun, DPRD Labusel akan menyurati Menteri Kehutanan. Rencana itu diungkap Sekretaris Komisi A DPRD Labusel, Jappar Siddik Nasution kepada Waspada, Selasa (17/7). Menurutnya, DPRD akan menyurati Menteri Kehutanan untuk mempertanyakan mengenai berapa sebenarnya persentase dana bagi hasil tanaman kelapa sawit yang ditanam perusahaan di areal HTI tersebut. Sebab, kata Jappar, banyak kejanggalan atas alasanalasan pihak PT. PLP. Menurutnya, berdasarkan laporan warga kepada pihaknya diketahui dana bagi hasil yang disepakati itu 30 persen dari hasil tanamankelapasawitsebagaikompensasipelanggaranfungsitanaman yang dilakukan PT. PLP. Namun belakangan pihak perusahaan malah mengaku dana yang akan dibagikan itu hanya 5 persen. “Kita banyak menerima laporan masyarakat tentang dana bagi hasil ini. Sudah sepuluh tahun tapi tidak pernah terealisasi,” katanya. Selain masalah dana bagi hasil, lanjut Jappar, pihaknya juga akan mempertanyakan izin HPHTI perusahaan itu. Sebab, kondisi tanaman yang ada sudah menyalahi ketentuan. “Makanya kita pandang perlu memperjelas Kemenhut mengenai masalah ini,” katanya. Dia mengatakan, setelah menyurati Menhut, pihaknya juga akan menyurati lembaga penegak hukum untuk mengusut berbagai penyimpanganyangterjadipadaproyekreboisasiitu.“Kitasudahsusun konsepnya dan sesegera mungkin kita kirimkan,” katanya. (c18)

Pemkab Asahan Sidak Pasar KISARAN (Waspada): Pemkab Asahan mengadakan sidak (inspeksi mendadak) ke sejumlah pasar tradisional. Dipimpin langsungWakil Bupati Asahan H. Surya, tim menuju Pasar Kartini untuk memantau harga bahan pokok maupun bumbu dapur lainnya menjelang bulan Ramadhan 1433 H, Kamis (19/7). Pantauan Waspada bersama timPemkabAsahan,hargabahan pokok menjelang punggahan tidak mengalami kenaikan yang signifikan.

“Kenaikan ini cuma menjelang puasa aja, di kisaran Rp500 sampai Rp2.000,” ujar Ida pedagang sayur di Pasar Kartini. Usai dari Pasar Kartini tim Pemkab Asahan menuju Pasar Inpres Jl. Diponegoro, Kota Kisaran. Pedagang ayam potong Ny. Ros kepada tim menyatakan harga tidak mengalami kenaikan dikarena untuk saat ini pembelipun masih sepi. Murni, 35, ibu rumah tangga kepada Waspada “Harus pandai-pandailah ngatur keuangan. Apalagi bulan Rama-

dhan tahun ini bertepatan dengan tahun ajaran baru,” ucapnya. Ketika diminta komentarnya dengan harga pasar menjelang punggahan. Wabup Asahan Surya kepada Waspada mengaku bersyukur, karena tidak terjadinya lonjakan kenaikan harga bahan pokok maupun bumbu dapur lainnya. Kita sudah menanyai sejumlah pedagang sembako dan bumbubumbuan. Tidak ada ditemukan kenaikan harga menjelang Ramadhan 1433 H. (a31)

Waspada/Syahri Ilham Siahaan

KETUA KAHMI Sumut Ir. Marlan Tamba, MM melantik pengurus Majelis Daerah KAHMI Labura di aula SMAN I Kualuhhulu.

KAHMI Diharapkan Bersinergi Dengan Pemerintah

Penerbit: PT Penerbitan Harian Waspada

� Perwakilan dan Biro Banda Aceh: Jalan Ratu Syafiatuddin No. 21 C, Banda Aceh. Tel & Faks: (0651) 22385.

Waspada/Bustami Chie Pit

WAKIL Bupati Asahan H. Surya, BSc sedang menanyai harga kepada pedagang di Pasar Inpres Jl. Diponegoro Kisaran, Asahan.

Kejari Kisaran Musnahkan Barang Bukti Narkoba

Hubungi kami

KANTOR PERWAKILAN DAN BIRO � Perwakilan dan Biro Jakarta: Jalan Siaga II No. 6 C Pejaten Barat, Pasar Minggu Jakarta Selatan. Tel: (021) 79197052, Faks: (021) 79199874.

Jumat 20 Juli 2012

Polisi Dan Satpol PP Razia Pakter Tuak

� Semua wartawan WASPADA dilengkapi dengan kartu pers. Tidak dibenarkan menerima uang dalam bentuk apapun. Jangan layani dan segera laporkan ke pihak berwajib atau ke Sekretaris Redaksi bila ada oknum yang mengaku wartawan WASPADA tetapi tidak bisa menunjukkan kartu pers yang sah, ditandatangani Pemimpin Redaksi �

KANTOR PUSAT Jalan Letjen Suprapto/Brigjen Katamso No. 1 Medan 20151 Tel: (061) 4150858, Faks Redaksi: (061) 4510025, Faks Tata Usaha: (061) 4531010. E-mail Redaksi: redaksi@waspadamedan.com

WASPADA

Waspada/Sapriadi

KAJARI Kisaran Anthony Tarigan, didampingi Wakil Bupati Asahan H.Surya, dan Kasat Narkoba AKP Napsanto serta pemuka masyarakat terlihat sedang memusnahkan 594,21 gram SS, 84 kg ganja dan 10 butir ekstasi.

AEKKANOPAN (Waspada): Kehadiran Korps Alumni Himpunan Mahasiswa Islam (KAHMI) di Labuhanbatu Utara (Labura) diharapkan dapat bersinergi dengan Pemerintah Daerah mensukseskan program pembangunan di Labura. Selain itu KAHMIdiharapkanikutberperan aktif menyongsong kemajuan Laburapadamasayangakandatang. Demikian disampaikan BupatiLaburaH.Kharuddinsyah, SE dalam sambutan tertulis yang dibacakanWakil Bupati H. Minan Pasaribu,SH,MMsaatpelantikan pengurus Majelis Daerah KAHMI

Kab. Labura periode 2012 - 2017 di aula SMA Negeri I Kualuhhulu, Rabu (18/7). Dikatakan, Alumni Himpunan Mahasiswa Islam, sebagai bagianyangtidakterpisahkandari bangsa Indonesia. Karena turut bertanggungjawabdalammewujudkan masyarakat adil dan makmur yang diridhoi Allah SWT di Indonesia. Tanggungjawab itu dilaksanakan melalui kerja sama atas nama kemanusiaan berdasarkankualitasakademis,penciptadanpengabdiyangbernafaskan Islam. “Kalau kita melihat kembali

sejarah perjalanan Indonesia, maka sudah tidak bisa dipungkiri lagi jika KAHMI mempunyai peranan dan posisi yang sangat strategis di berbagai momen penting bagi bangsa kita, baik pada masa orde lama maupun setelah orde baru,” ucap bupati. Pelantikan pengurus Majelis Daerah KAHMI Labura melantik enam pimpinan kolektif, yaitu Ketua Sulhanuddin, S.sos, Adlin Sinaga, S.ag, H. Armansyah, ST, Harun, Spdi, Drs. Sueb Sitorus dan NH Hasibuan. Sekretaris HabibullahSPsedangkanBendahara Drs. Syamzaini Zein. (c08)


Sumatera Utara

WASPADA Jumat 20 Juli 2012

B3

Pemkab Madina Tolak PT. SM PANYABUNGAN (Waspada): Pemerintah Kabupaten (Pemkab) Mandailing Natal (Madina), tegas menolak keberadaan PT Sorikmas Mining (PT. SM). Namun tidak ada wewenang Pemkab untuk menutup perusahaan pertambangan emas itu. Seluruh izin dikeluarkan pemerintah pusat. Sekretaris Daerah (Sekda) MadinaM.DaudBatubara,berbicara kepada wartawan di selaselaacarakunjungankerja(Kunker) anggotaDPRDSumutasaldaerah pemilihan (Dapil) VI Tapanuli Bagian Selatan (Tabagsel) di Panyabungan, kemarin. Anggota dewan turun ke Dapil masingmasingdalamkaitanpembahasan Laporan Pertanggungjawaban Penggunaan APBD tahun 2011. Ditegaskan, keberadaan perusahaan tambang emas PT. SM di Kabupaten Mandailing

Natal (Madina) hanya membawa bala bagi masyarakat dan Pemkab Madina. “Beberapa kali sudah terjadi bentrok masyarakat di sana. Bila kondisi ini terus dibiarkan, besar kemungkinanakanterjadibentrok yang sangat besar,” ujar Sekda. Disebutkan M.Daud Batubara, Pemkab Madina tidak bisa berbuat apapun untuk melarang PT. SM beroperasi, sekalipun izin eksplorasinya sudah berakhir sejak November 2011. Seluruh perizinan perusahaan pertam-

Lima Tahun Palas, Warga Kecewa SIBUHUAN (Waspada): Sekarang, usia Kab. Padanglawas (Palas) sudah lima tahun setelah dimekarkan dari Kab. Tapanuli Selatan pada 2007. Tapi masyarakat kecewa kepada eksekutif dan legistalif sebagai pemegang amanah rakyat, karena pembangunan dinilai tidak mampu dimaksimalkan. Salah seorang tokoh masyarakat H.Imran Joni Hasibuan, SH, menumpahkan kekecewaannya, Rabu (18/7). “Saya percaya, melihat potensi daerah Kabupaten Padanglawas, baik potensi kekayaan alam maupun potensi sumber daya manusia, yang jika dimanege dengan baik, Kabupaten Padanglawas tidak akan ketinggalan dari daerah lain, bahkan bisa lebih maju dan berkembang,” ujarnya. “Apalagi sekarang, usia Kabupaten Padanglawas telah memasuki lima tahun, namun masih belum banyak perubahan dari sebelum dimekarkan menjadi daerah otonom baru. Hal ini perlu disadari oleh para pejabat eksekutif dan legislatif sebagai pemegang amanah,” katanya lagi. Menurut dia, yang terjadi belakangan ini, antara pihak eksekutif dan legislatif terkesan menutup diri dan saling menyudutkan. Apalagi setelah terjadinya suksesi kepemimpinan, menyusul kasus hukum Bupati Basyrah Lubis diberhentikan dan digantikan Wakil Bupati H. Ali Sutan Harahap sebagai pelaksana tugas Bupati. “Maka dibawah kepemimpinan Plt Bupati Padanglawas, H. Ali SutanHarahapdengansisawaktuyangadadiharapbisamelaksanakan tugas dengan baik untuk melakukan perubahan dalam melaksanakan percepatan pembangunan,” katanya. Sebelumnya Plt. Bupati Padanglawas (Palas) H Ali Sutan Harahap (TSO) dalam mengatakan optmis melaksanakan tugas dalam percepatan pembangunan sepanjang mendapat dukungan penuh dari masyarakat, dengan mengandalkan potensi daerah didukung SDM. (a33)

Guru Pesantren Di Madina Tidak Dapat Dana Intensif PANYABUNGAN (Waspada) : Guru pesantren di Kab. Mandailing Natal tidak mendapat dana intensif Rp100 ribu per bulan. Informasi dihimpun Waspada di lapangan, Rabu (18/7) dana intensif yang dicairkan Pemkab Madina hanya untuk guru-guru Madrasah Diniyah Awaliyah (MDA), sedangkan guru-guru pesantren tidak ada. Alasannya, karena anggaran intensif untuk guru pesantren belum di tampung di dalam APBD Madina. Padahal, tahun-tahun sebelumnya, guru-guru di pesantren semuanya mendapat, tidak ada perbedaan antara guru madrasah dengan guru di pesantren. Sabaruddin, S. Pd guru di Pondok Pesantren Subulussalam Kotanopan berharap, Pemkab Madina kembali mengevaluasi kebijakan ini, kalau bisa di perubahan anggaran APBD nanti intensif guru pesantren ini ditampung kembali. “Kita berharap Pemkab Madina nanti menampung honor intensif ini di P- APBD nanti. Kepada kawan-kawan di DPRD Madina juga diharapkanagarmemperjuangkannasibgurupesantrenini,”harapnya. Bupati Mandailing Natal HM. Hidayat Batubara, SE yang di konfirmasi melalui Kabag Kesra Taufiq Lubis, Selasa (17/7) mengakui kalau intensif guru Pesantren ini memang tidak ada, yang ada hanya intensif guru MDA. Begitupun, katanya, kita akan usulkan ditampung dalam P APBD nanti. “Saat ini kita sedang menghitung berapa angka yang di butuhkan untuk intensif tersebut untuk kita ajukan nanti di P-APBD sekaligus untuk dibahas di DPRD Madina,” katanya. (c15)

Dinas Pertanian Kab. Karo Jalankan Program Pemerintah P2BN KABANJAHE (Waspada): Dinas Pertanian dan Perkebunan Kab. Karo menggelar pertemuan koordinasi dan posko peningkatan produksi beras nasional (P2BN) untuk tingkat kecamatan, guna mampu mencapai target 10 juta ton beras pada 2014. Kegiatan yang dilaksanakan di aula Dinas Pertanian dan Perkebunan Kec. Kabanjahe dihadiri Kadis Pertanian AgustoniTarigan SP, Sekretaris Syafarudin dan Kabid Produksi Munarta Ginting serta para peserta dari 6 kecamatan se-Kab. Karo. Kadis Pertanian yang diwakili Kabid Produksi mengatakan, program peningkatan produksi beras nasional merupakan kebijakan pemerintah yang dilaksanakan dengan memanfaatkan program pemberdayaan petani melalui pengembangan teknologi dan informasi pertanian, agar pelaksanaannya lebih terencana, terarah sesuai tujuan yang dapat dicapai. Karo memiliki lahan yang potensial untuk tanaman pangan sehingga dapat mendukung program pemerintah dalam peningkatan, produksi dan mutu tanaman pangan menuju swasembada berkelanjutan.(c10)

Dandim Tinjau Upaya Membuka Jalan Melintasi Jurang PAYUNG (Waspada): Kodim 0205/TK meninjau pelaksanaan pembuka jalan melintasi jurang, dan tebing yang terjal sekira 1 km menghubungkan Desa Selandi Baru - Selandi Lama, serta perbaikan Jambur (tempat pertemuan), di Kec. Payung, Kab. Karo. “Upayameningkatkankesejahteraanekonomimasyarakatmelalui pembukaan jalan antara Desa Selandi Baru dengan Selandi Lama di Kec. Payung sekira satu kilometer, serta dibagunnya jembatan, dan perbaikan Jabur Desa, dengan anggaran dana sekira Rp750 juta diharap dapat mencukupi kebutuhan waraga di desa ini,” terang Dandim 0205/TK. Letkol Kav Prince Meyer Putong SH, kepada wartawan Senin (16/7) usai meninjau lokasi berapa hari lalu. Dikatakannya, proyek yang lumayan besar tidak setara dengan anggaran dana, mudah-mudahan program Karya Bakti Kodim 0205/TK 2012 tersebut dapat dilaksanakan dengan baik dan tuntas. Meski sampai kini Surat Perintah Kerja (SPK) belum ditandatangani pihak Pemkab Karo yang membuat kendala di lapangan. “Walau SPK belum ditandatangani Bupati, apa yang bisa kita kerjakan di lapangan kita kerjakan saja,” tegas Dandim. (c19)

bangan ini ditangani pemerintah pusat. ’’Walaupunpemerintahpusat belum memperpanjang izin, tapi kami (Pemkab) tidak bisa melarang perusahaan itu yang terus beroperasi,’’ kata Daud. Saran kepada pemerintah pusatsudahduakalidisampaikan Pemkab Madina. Isinya meminta pemerintahuntuktidakmemperpanjang atau membatalkan kontrak karya dengan PT. SM. Alasannya, selain izin eksplorasinya sudah berakhir dan pengakuan perusahaan belum menemukan emas di sana, juga karena manajemen perusahaan asal Australia ini sudah berganti. ’’Sekarang generasi ke delapan, sementara kontrak karya yang ditandatangani dengan pemerintah Indonesia PT. SM generasi ke tujuh. Jadi secara hukum sudah batal,’’ tambah Daud. Tidak masuk akal Sekda Madina mengatakan, tidak masuk akal kalau PT. SM mengaku belum melakukan eksploitasi. Karena, masyarakat saja sanggup membeli satu lubang tambang Rp500 juta – Rp 1 miliar.

Itu artinya, potensi emas yang ada memang sangat tinggi, walaupun hanya ditambang secara tradisional. Namununtukmembuktikan PT. SM itu berbohong, Pemkab Madinatidakbisa.Karena,jangankan untuk memeriksa aktifitas mereka, untuk masuk ke perusahaan itu saja Pemkab Madina tidakbisa.’’Kitahanyabisasebatas berkomunikasi dengan mereka. Itupun bila ada konflik dengan masyarakat,’’ kata Daud. Pemicu konflik, menurut Daud, bukan dikarenakan masyarakatMadinainginmenguasai tambang, tapi lebih pada sikap arogansi petugas security perusahaan. Tidak diketahui maksudnya, namun para petugas keamanan perusahaan itu sering sekali menghina masyarakat Madina dengan kata-kata yang menyinggung SARA. ’’Karena seluruh security perusahaan didatangkan dari wilayah Timur Indonesia,’’ tambah Daud. Menjawabpertanyaan,Daud, mengatakan pihaknya bukan membiarkan masyarakat melakukan penambangan liar. Tapi

memang wewenang mereka tidak ada untuk menyentuh kawasan hutan lindung. Untuk masalah ini, dia juga mengaku sudah memberikan usulankepusat.Yaknimintauntuk menetapkan kawasan tambang rakyat. Dengan begitu Pemkab dapat menata dengan baik masyarakat yang menambang. ’’Tapi usul itupun tidak direspon,’’ kata Daud. Tentang pertambangan liar telah membawa masyarakat Madina hidup lebih baik, juga dibantah Daud. Katanya, masyarakatnya hanya sebagai buruh angkut saja.Yang menikmati hasil emas adalah para pemilik modalyangmembuatlubang-lubang tambang. Mereka bukan penduduk lokal. Untuk menutup tambang yang oleh PT. SM disebut liar itu, juga tidak semudah yang dibayangkan. Sangat terkesan kalau ada oknum-oknum yang membackingi usaha-usaha penambangan itu, sehingga jumlahnya semakin hari semakin bertambah. (m12)

Pembakaran Camp PT. SM Jangan Hanya Dilihat Dari Sudut Pidana PANYABUNGAN(Waspada): Kasus pembakaran base camp PT.Sorikmas Mining (SM) di Sambung, Kec. Naga Juang, Kab. Mandailing Natal (Madina) barubaru ini, jangan dilihat dari sudut tindak pidananya saja. Tapi pemerintah,termasukkepolisian, PemkabMadina,danPemprovsu harus melihatnya secara menyeluruh (komprehensif). DemikiandisampaikanKetua PeradiTabagsel,RidwanRangkuti, SH kepada Waspada, Rabu (18/ 7) di Panyabungan. Menurutnya, pada dasarnya masyarakat Madina terkenal dengan kesantunan mengedepankan budaya Man-

dailing yang lemah lembut. Akan tetapi, kenapa sebagian masyarakat Madina menjadi brutal dan nekat sudah dua kali membakar base camp PT.SM ? Tentu ada latarbelakangnya. Hal inilah yang seharusnya dipahami dan dipertimbangkan semua pihak. Menurutnya,penyebabamukan massa tersebut merupakan kristalisasi kekecewaan masyarakat terhadap sikap Pemkab.Madina dan sikap manajemen PT.SM yangg tidak mampu meyakinkan masyarakat untuk memberikan solusi penyelesaian tuntutan masyarakat Naga Juang

khususnya Masyarakat sudah berulangkalimelakukandemonstrasi di DPRD dan Kantor Bupati Madina agar dibuat batas wilayah tambang PT. SM. Masyarakat khawatir sumber air akan kekeringan dan air tercemar jika perusahaanPT.SMterusberoperasi, sertakawasanpertanianmasyarakat dikeluarkan dari areal PT. SM. Kemudian, usaha tambang rakyat selalu dibilang PETI atau Pertambangan Ranpa Izin alias illegal mining. Sementara, kegiatan PT.SM hanya bermodalkan Kontrak Karya tanpa Izin Usaha Produksi Pertambangan. (c14)

Pemkab Tapsel Dukung Usaha Tanam Perdana Sawit KSB MARANCAR (Waspada): Pemkab Tapanuli Selatan tidak pernah membeda-bedakan masyarakatnya dan senanitiasa selalu siap mendukung seluruh kegiatan usaha rakyat, apalagi yang berkaitan dengan usaha peningkatankesejahteraanrakyat. Hal itu ditegaskan Bupati Tapsel, Syahrul M Pasaribu, pada acara penanaman kelapa sawit Koperasi Simaninggir Bersatu (KSB) di Desa Simaninggir, Kec. Marancar. Dalam usaha ini, koperasiituberkerjasamadengan PT. Agro Inti Andalas (AIA) milik Evi Chan Alvian atau Lesmana Husein. Hadir Kadis Pertanian, Untung Suwandi, Kadis PU, Syahril Nasution, Kepala BKD, Sahtoat Pohan, para Asisten di Pemkab Tapsel, Kabag Humas, Ahmad Fauzi M Ritonga, Ketua KelompokTani Nasional Andalan, Ketua KSB, Anwar Siregar, Ketua Komisi

IV DPRD Tapsel, H. Paruhum Siregar, tokoh masyarakat Ibrahim Pasaribu, dan ratusan warga. BupatiTapsel yang pada awal acara disematkan ulos oleh tokoh adat setempat, meminta kepada segenap pengurus dan anggota KSB untuk senantiasa menjaga persatuan kesatuan, dan mematuhi seluruh aturan yang ditetapkan koperasi. “Apabila hingga waktu yang kita tetapkan semuanya berjalan lancar dan tidak ada pertikaian atau ribut-ribut, maka Pemkab Tapsel akan memback-up penuh seluruh kegiatan KSB ini. Karena perkebunan kelapa sawit ini bisameningkatkan kesejahteraan rakyatdansudahpastimembantu tugas pemerintah,” ujarnya. Kemudian dimintanya juga kepada pengurus KSB agar mengusahakan seluruh warga Desa Simaninggir yang telah cukup persyaratan menurut AD/ART

koperasi, dimasukkan menjadi anggota. Sementara Ketua Komisi IV DPRDTapseljugarajaadatsetempat, H. Paruhum Siregar, berharap supaya seluruh anggota KSB tetap berada dalam kekompakan danbekerjasamauntukmencapai kemajuan daerah dan masyarakatnya. Sebelumnya Ketua KSB, Anwar Siregar, dalam laporannya mengatakan, jumlah anggota koperasi ini sebanyak 150 orang. DiaberterimakasihkepadaBupati Tapsel yang hadir dan melakukan penenaman perdana kebun kelapa sawit ini. Hal senada juga disamikan Evi dari PT AIA. Acara penanaman perdana kebun kelapa sawit Koperasi SimaninggirBersatu(KSB)inidiisi dengan pemberian santunan kepada 18 orang anak yatim dan 22 orang tua lanjut usia atau jompo. (a27)

58 Kg Ganja Dimusnahkan PANYABUNGAN(Waspada): Polres Madina, Rabu (18/7) mengadakan acara Israk Mikraj, penyambutan bulan suci Ramadhan, sekaligus pemusnahan narkobajenisganjadanminuman keras yang berlangsung di halamanupacaraPolresMadinaJalan BhayangkaraNo.I–Panyabungan Utara. Hadir dalam acara itu Bupati Madina, Hidayat Batubara di wakili Asisten I, Sahnan Pasaribu, Kajari, Satiman, SH, Ketua PN, Wenra Rais, Kalapas, Rochida,, Ketua KNPI, Mulyadi Nasution, partai politik, ormas, tokoh masyarakat, dan alim ulama. KapolresMadina,AKBPFauzi Dalimunthe,SIkdalamsambutannya menyampaikan, pihak Polres Madina sengaja merangkum acara religius dan pemusnahan ganja. Supaya masyarakat dan alim ulama, dan institusi lainnya bisa mengetahui dan memahami, bahwa menjaga kamtibmas, memberantas narkoba,

miras,dansebagainyamerupakan tanggung jawab bersama. Kapolres berharap semua pihak bisa menjaga bulan suci Ramadhan tidak terciderai dengan hal-hal yang bersifat negatif. Pengusaha rumah makan, bola bilyar, hiburan karaoke, dan hiburanjenislainnyasupayatutup. Dijelaskan, bulan suci Ramadhaniniharusdijadikanmomentum memperkuat ukuah islamiyah. Dan mendekatkan diri kepadaAllahSwt,denganmemperkuat ibadah dan sedekah, serta intropeksi diri supaya lebih baik. Pada kesempatan itu, Kapolres juga mengungkapkan rasa kecewanya terhadap Pemkab Madina,yangsudah10harimembiarkan pihaknyamengurusimasalah kerusuhan dan pembakaran di Naga Juang. “Saya akui persoalan ini adalah tanggung jawab polisi. Tapi ketika sudah berdampak ke sosial masyarakat, sudah juga menjadi tanggungjawabpemerintah.Saya

mengatakan ini bukan karena takut, tapi kecewa”. “Saya bersama jajaran Polres Madinasiapdandidukungpenuh Poldasu dalam masalah ini. Tapi saya cinta masyarakat dan tidak ingin bertatap muka dengan mereka dalam suasana tidak harmonis. Karena itu lewat tokoh masyarakat dan alim ulama diharapkan bisa memberikan pemahaman hukum kepada masyarakat,” ucap Kapolres. Kapolres menegaskan, tersangkapembakarancampPT.Sorikmas Mining sudah 20 orang. 10 orang di tahan di Poldasu, dan 10 orang lagi di tahan Polres Madina. Sedangkan dalang intelektual sudah tahap penangkapan. Dijelaskan, untuk tahun ini PolresMadinamenangani19kasus narkoba dan menemukan 6 hektar ladang ganja. Sedangkan barang bukti ganja yang di bakar dari Polres Madina 22 Kg, Kejaksaan 36 Kg, 410 batang pohon ganja, dan 166 botol minuman keras dengan berbagai merek. (c14)

Beli Sabu Ditangkap PEMATANGSIANTAR (Waspada): Seorang anak baru gede (ABG), MIHN, 19, ikut orangtua, warga Marihat Tongah, Kel. Serbelawan, Kec. Dolok Batunanggar, Kab. Simalungun ditangkap Sat Narkoba Polres Simalungun diduga karena membeli sabu-sabu (SS). Penangkapan dilakukan personel Sat Narkoba Polres Simalungun bekerjasama dengan Polsek Serbelawan di Desa Bandar Selamat, Kec. Dolok Batunanggar, Simalungun, baru-baru ini, atas informasi masyarakat. Kapolres Simalungun AKBP M. Agus Fajar H, S.Ik saat dikonfirmasi melalui Kasubbag Humas AKP H. Panggabean, SH dan Kasat Narkoba AKP Masku Sembiring, SH, membenarkan MIHN bersama barang buktisatubungkuskecilSSsudahdiamankankeSatNarkoba.Kasusnya dalam proses pengembangan.(a30)

Waspada/Sarmin Harahap

KAPOLRES Madina bersama unsur Muspida, Rabu (18/7) saat pembakaran ganja dan pemusnahan minuman keras di Polres Madina.

Waspada/Sori Parlah Harahap

BUPATI Padanglawas Utara Drs. H. Bachrum Harahap didampingi Ketua DPRD Paluta Muklis Harahap dan Wabup H Riskon Hasibuan menyerahkan bantuan 20 hand traktor kepada 20 kelompok tani.

20 Kelompok Tani Di Paluta Terima Bantuan Hand Traktor GUNUNGTUA (Waspada): 20 Kelompok tani di Kab. Padanglawas Utara (Paluta) mendapatkan masing-masingnya satu unit hand traktor merk Kubota dari Dinas Pertanian Tanaman Pangan Paluta, yang diserahkan Bupati Drs. H Bachrum Harahap di lapangan bawah Pasar Gunungtua, Kec. Padangbolak, Rabu, (18/7). Bupati Padanglawas Utara, Drs.H Bachrum Harahap dalam sambutannya mengharapkan agar penggunaan bantuan hand traktor ini dapat dimanfaatkan sebaik-baiknya. Dia berjanji akan menambahi hand traktor 100 unit lagi untuk seluruhkelompoktanidiKab.PadanglawasUtara, mengingat jumlah kelompok tani di daerah yang baru dimekarkan ini berjumlah banyak. Kepala Dinas Pertanian Paluta, Amin Husin Harahap mengungkapkan, sebenarnya bantuan inisudahwajarditerimapetani,sehingganantinya para petani secara bertahap bisa terbantu dengan adanya bantuan peralatan itu. “Jika petani sudah sejahtera, tentunya masalah kesehatan masyarakat dan pendidikan akan teratasi dengan

sendirinya,” ujar Amin Husin. Plt. Kepala Bidang Produksi dan Pengembangan Dinas Pertanian Paluta Sarwoedi Harahap mengatakan, bantuan hand traktor tersebut beralokasi dari dana APBD Provinsi Sumatera Utara dan tujuannya untuk disalurkan ke sejumlah kelompoktanidiKab.Palutadalambentukbantuan sosial. Menurut Sarwoedi, dengan kegiatan ini diharapkandapatmenunjangtercapainyaprogram Peningkatan Produksi Beras Nasional (P2BN) yakni surplus beras 10 juta ton pada tahun 2014 secara nasional. Kelompok tani yang menerima bantuan hand traktor tersebut yakni, dari Kecamatan Batang Onang 2 kelompok tani, Padangbolak Julu 2 kelompok tani, Padangbolak, 4 Kelompok tani, Portibi 8 kelompok tani, Halongonan, 2 kelompok tanidanSimangambat2kelompoktani.Sedangkan tujuan bantuan traktor tangan tersebut untuk mengolah lahan pertanian petani melalui kelompok tani didaerah masing-masing. (a35)

Oknum PNS Dinkes Paluta ‘Gagahi’ Siswi SMK Polsek Padangbolak Tangkap Lepas Pelaku P.SIDIMPUAN (Waspada): Seorang siswi salah satu Sekolah Menengah Kejuruan (SMK) di Kota Padangsidimpuan berasal dari Kab. Padanglawas Utara (Paluta), katakan saja Bunga, menuntut keadilan hukum. Pasalnya, Polsek Padangbolak menangkap lepas KH, PNS pada Dinas Kesehatan Paluta, yang telah berulangkali menggagahi korban. “Kami sudah berulangkali melakukan hubungan suami istri. Jika saya tidak mau melayaninya dan jika saya memberitahukan kejadian ini kepada orang lain, dia mengancam akan menyebarluaskan foto telanjang saya,” kata Bunga yang datang bersama keluarganya ke kantor Perwakilan Waspada Wilayah Tapanuli di Padangsidimpuan, Rabu (18/7) sore. Kejadian ini telah dilaporkan Bunga bersama keluarganya ke Polsek Padangbolak, Resort Tapanuli Selatan di Gunungtua, Kab. Paluta. Anehnya, pihak Polsek telah menangkap dan menahan pelaku Senin (9/7) kemarin, tapi melepaskannya Kamis (12/7). Kapolsek Padangbolak, AKP JW Sijabat, dikonfirmasi Waspada, Kamis (19/7) membenarkan pelaku telah dilepas karena permohonan penangguhan penahanan dari kuasa hukum pelaku, Jarkasih SH dan Kadis Kesehatan Paluta, Darwin Harahap. Kadis Kesehatan Paluta, Darwin Harahap, yang dikonfirmasi via telepon juga membenarkan, dia telah mengajukan permohonan penangguhan penahanan KH ke Polsek Padangbolak. Alasannya, banyak pekerjaan dinas yang harus ditangani KH. Penangguhan penahanan ini sangat mengganggu kondisi kejiwaan Bunga. Karena itu, anak di bawah umur ini meminta kepada instansi penegak hukum di negara ini agar tetap menahan KH hingga ada keputusan hukum dari Pengadilan Negeri. “Penangguhan penahanan terhadap KH membuat saya takut, karena bisa mengancam keselamatan jiwa saya dan juga kehormatan keluarga saya. Kapan saja dia bisa menyerang saya dan menyebarkan foto saya itu ke orang

banyak. Bapak polisi, jaksa, hakim, Bupati Paluta, danKadisKesehatan,sayamohonkeadilan,”ujarnya. Di kantor Perwakilan Waspada Wilayah Tapanuli di Padangsidimpuan, Bunga yang berlinang airmata mengisahkan bahwa hubungan suami istri itu pertama kali terjadi Juni 2011 di Hotel ASRI, Jalan Kiai Haji Ahmad Dahlan/Jalan Tonga, Kota Sidimpuan. Awalnya Bunga berangkat dari kampungnya di Paluta menuju Padangsidimpuan. Ternyata KH sudah menunggunya di Aek Godang, Kec. Hulu Sihapas, Kab. Paluta. Kemudian keduanya sama-sama ke Padangsidimpuan dan KH mengajaknya ke hotel. Tidak ada rasa curiga, Bunga menuruti permintaan KH. Setibanya di Hotel Asri, KH bercerita dan beberapa saat kemudian merayu Bunga untuk bersetubuh, dengan janji akan menikahinya. “Saya tidak sangka dia berbuat seperti itu, saya tidak melayani tapi dia paksa dan mengancam saya. Karena takut dan diancam, dengan sangat berat hati saya terpaksa diam saja ketika KH berbuat bejat kepada saya,” kisah Bunga. Setelah melampiaskan hawa nafsunya, KH memfoto Bunga pada saat telanjang. Kemudian mengancamnya, apabila memberitahukan kejadian ini kepada keluarga atau orang lain, maka foto itu akan disebarkan ke orang lain. “Hubungan suami istri tersebut terus berlanjut hingga beberapa kali, karena ada ancaman saya tidak berani mengungkapkannya. Terakhir kali pada 6 Juni 2012 ketika dia membawa saya ke Puskesmas Siunggam, Kecamatan Padangbolak,” ujarnya. Namun akhirnya orangtua dan keluarga Bunga mengetahui aib yang menimpa anaknya itu. Setelah bermusyawarah keluarga, ahirnya Bunga didampingi keluarga membuat pengaduan ke Polsek Gunungtua ,Senin (9/7). Polsek Gunungtua memeriksa KH dan menjebloskannya ke dalam tahanan. Tapi KH dilepas lagi dengan alasan penangguhan penahanan. Kondisi ini telah membuat kejiwaan Bunga yang masih berusia di bawah umur ini menjadi terguncang, resah dan terancam. (a26)

DPRD Sumut Desak Gubsu Awasi Truk PT. TPL Di Porsea BALIGE (Waspada): Gubernur Sumatera Utara (Gubsu) diminta membangun jembatan timbang untuk mengawasi tonase mobil-mobil truk loging PT.Toba Pulp Lestari (TPL) di simpang Desa Siraituruk Kec.Porsea Kab.Toba Samosir (Tobasa). “Keberadaan jembatan timbang tersebut dirasakan sudah mendesak karena fakta di lapangan badan jalan lintas sumatera (jalinsum) daerah pantai barat sebagian besar keadaannya telah rusak parah dengan kondisi berlubanglubang,”kata anggota DPRD Sumut Oloan Simbolon didampingi anggota DPRD Tobasa Viktor Silalahi menjawab pertanyaan wartawan di kantor DPRD Tobasa, Rabu (18/7) . Kondisi badan jalinsum yang rusak parah itu, kata Simbolon, pada umumnya yang selalu dilintasi mobil-mobil truk loging PT.TPL untuk mengangkut bahan baku kayu gelondongan diduga sudah melebihi tonase ke lokasi pabrik sehingga untuk mengontrolnya jembatan timbang di Desa Siraituruk Porsea sangat cocok. “Jadi aksi warga Kab.Tobasa semalam yang melakukan demonstrasi ke lokasi pabrik PT.TPL itumerupakanhalwajarsebagailuapanemosional melihat sepak terjang managemen perusahaan pabrik pulp kurang memperhatikan mobilisasi pengangkut bahan baku pulp terlihat masyarakat

sering melebihi tonase,” kata Simbolon. Tuntutan aksi demonstrasi jelas salah satunya akibat mobil-mobil truk loging PT.TPL diduga telah melebihi tonase dalam mengangkut gelondongan kayu sehingga merusak badan jalinsum, kata Simbolon, untuk itulah sangat diperlukan jembatan timbang tersebut. Tidak ada alasan apapun yang membenarkan mobil-mobil truk loging PT.TPL bisa mengangkut kayu gelondongan melebihi tonase, maka Gubsu harus segera menanggapi tuntutan aksi demonstrasi warga Kab.Tobasa dengan membangun jembatan timbang untuk mengawasi kelebihan tonase tersebut, kata Simbolon juga menjabat Ketua Pemuda Katolik Sumut. Anggota DPRD Tobasa Viktor Silalahi menanggapi aksi demonstrasi warga mengatakan, keberadaan jembatan timbang memang sudah mendesakkhususnyamengawasikelebihantonase mobil-mobil truk loging PT.TPL agar kondisi jalinsum bisa bertahan cukup lama menunggu kucuran dana perbaikan jalan. Badan jalinsum tersebut bukanlah hanya diperuntukkan untuk operasional PT.TPL saja dan kalaudilihatdarisegipersentase tentulebihbanyak dipergunakan masyarakat umum sehingga kalau jalancepatrusakparahpalingdirugikanpastibukan pihak perusahaan melainkan masyarakat. (a22)


B4 1 CM 2 CM

WASPADA

Rp. 12.000 Rp. 24.000

3 CM Rp. 36.000 4 CM Rp. 48.000

BURSA

AUTOMOTIVE Informasi Pembaca AC BR CL ND DB

Bursa Automotive

: Air Condition : Ban Radial : Central Lock : Nippon Denso : Double Blower

PS PW RT VR EW

: Power Stearing : Power Window : Radio Tape : Velg Racing : Electric Window

DAIHATSU READI STOCK !!!

XENIA, TERIOS, GRANDMAX, LUXIO, DAPATKAN POTONGAN, HARGA SPESIAL UNTUK PEMESAN DI BULAN INI. TERIMA TUKAR TAMBAH Hub. AFJANI 0812 653 1129

DAIHATSU Xenia Li Deluxe 2008 BK Medan Warna Silver met. Mobil simpanan sangat mulus. Hrg. Nego. HP. 0811 652 506

5 CM 6 CM

Rp. 65.000 Rp. 78.000

MERCEDES Benz Classic Tiger 200 Thn. 1986. VR, BR 17, Merah maron, lengkap Original. PW, Black Engine. Hub. 061.9118 7794 DEALER RESMI SUZUKI

Carry PU DP 15Jt-an Angs. 3,2Jt 3 Thn. APV DP 20 Jt-an Angs. 5 Jt 2 Thn. Splash DP 42Jt-an Angs. 4,7Jt-an 3 Thn. Ertiga DP 42Jt-an Angs. 4,6Jt 3 Thn. Hub. RIDWAN SIREGAR 0813 6143 7654

SUZUKI Katana ‘95 4x4 Atap datar. Udah jadi kaleng2. 55Jt. Hub. 0813 9656 4299

DAIHATSU PAKET LEBARAN

SUZUKI DRV Real Van W. Biru Th. 2006. BK Mdn Cat dan mesin bagus, siap pakai. Hrg. Nego. HP. 0852 7650 6242

PROMO DAIHATSU MENYAMBUT RAMADHAN

SUZUKI Baleno Thn. 2001, Warna Silver, BK Medan, Tgn. I. Komplit, Hrg. 82Jt (damai). HP. 0813 7063 3953

XENIA DP 17 Jt-an. Angs. 2 Jt-an Terios DP 18 Jt-an Angs. 2 Jt-an Pick Up DP 7 Jt-an Angs. 2 Jt-an Hub. ADIT 0853 6175 1011

Xenia, Luxio DP 20Jt-an Angs. 2Jt-an Terios, Sirion DP 30Jt-an Angs. 3Jt-an Ready Stock Hub. Hasibuan Astra 0812 6362 4634

“DAIHATSU PAKET MURAH”

Gran Max Pick Up DP 7 Jt-an Angs. 2 Jt-an Gran Max Minibus DP 18 Jt-an Angs. 4 Jt-an Luxio D DP 16 Jt-an Angs. 5 Jt-an Xenia M. Deluxe DP 21 Jt-an Angs. 4 Jt-an Terios TS Xtra DP 21 Jt-an Angs. 4 Jt-an Hub. ERWIN HP. 0812 6315 4132 061 77402067

DAIHATSU PAKET MANTAP

- Pick Up Granmax DP 12 Jt-an....Angs. 2,4 - Xenia DP 30 Jt-an......................Angs. 3 Jt - Terios DP 3 Jt-an...................Angs. 4 Jt-an Hub.TEDDY CAPELL 0812 6325 656 / 77884663 DAIHATSU PROMO LEBARAN 2012 All New Xenia DP 17 Jt-an atau Angs. 2 Jt-an New Terios DP 18 Jt-an atau Angs. 2 Jt-an Luxio Granmax Minibus, Granmax Pick Up. Sirion. Dapatkan Hadiah special Lebaran Untuk Pemesanan Di Bulan ini. Info Hub. 0852 7515 0363 (Syahbana)

DAIHATSU 100% BARU

Xenia....DP 30 Jt-an...Angs. 3 Jt-an Terios.....DP 35Jt-an...Angs. 3 Jt-an Pick Up..DP 11 Jt-an...Angs 2 Jt-an Luxio......DP 20 Jt-an...Angs. 3Jt-an Hub. Capella Medan (Josua) 0812 6311 0820 DAIHATSU PROMO RAMADHAN & LEBARAN

Terios DP Mulai 30 Jt-an atau Angs. 2 Jt-an Xenia DP Mulai 20 Jt-an atau Angs. 2 Jt-an GM Pick Up DP Mulai 11 Jt-an atau Angs. 2 Jt-an Barang Ready, Berhadiah dan data dijemput. Hub. HASIBUAN ASTRA 0812 6362 4634

TOYOTA Twin cam 1600cc Thn. 89. Abu2. AC, Tape, VR, 15 Inc. Baru Msn/body/ cantik. Pjk. 1 thn. Hrg. 45jt. 061.8456676 / 0815 3316 8155 TOYOTA Kijang Capsul Model LGX New Bensin 1.8 Th. 2002. Akhir. Hitam met, A/n. Sendiri Ex dokter, VR, BR, PS, PW, CL Rmt, E. Miror, AC DB, Full sound, pake TV, ada 3. Hrg. 132Jt Nego. Hub. 0813 7025 7908

“TOYOTA BARU 2012”

Ready Stock Avanza, Veloz, Innova, Rush, Bunga 6%. Hub. DEDY SIMATUPANG. 0813 6165 1801 - 0853 6207 2000

TOYOTA UNTUK LEBARAN BARU Avanza, Innova, Fortuner 100% Hub. Budi 0821 6060 4998

TOYOTA BARU ASTRA

Avanza, Innova, Fortuner PURBA: 0813 9789 4633

TOYOTA Fortuner 2007 Dijual Cepat Bensin AT, original. Km. 45.000. Hitam, pemakai langsung. Harga 260Jt. Jarang saya pakai. Hub. 0813 6161 4227

DAIHATSU BARU

Grand Livina 1.5 XV, Matic, Th. 2008 W. Hitam lengkap, jok kulit 3 brs, Mdn asli, sehat, original. Hrg. 152Jt/Nego. NB: Bisa Tukar Tambah mobil dengan harga dibawahnya. Hub. 0823 6720 8151

DAIHATSU “PROMO LEBARAN DP SUPER RINGAN”

TOYOTA Kijang Kapsul Diesel Thn. 2001/2002. Asli Mdn AC, RT, TV, VR, P. Steering, CL. W. Merah tua met. sangat mulus, jrg. pakai. Hub. 0811 63 0753

Xenia 1.300cc Angs. 2,4Jt-an/bln. Gran Max Pick Up Angs. 2,3Jt-an/bln. Hub. DIKA 0852 7074 7744 (Terima Tukar Tambah)

Xenia, Terios DP 24 & 27 Jt-an /Angs. 2 Jt-an Luxio..DP 13 Jt-an/Angs. 2 Jt-an Gran Max, MB DP 17 Jt-an/angs. 2 Jt-an Pick Up DP 11 Jt-an/Angs. 2 Jt-an “Proses Cepat & Dapatkan Penawaran Khusus” Hub. R I A N A S T R A 0 8 1 2 6 3 8 3 6 9 1

DAIHATSU Classy ‘91. Hijau met. P. Steering, P. Window, AC, TP, VR, C. Lock. 30 Nego. 0821 61611755 TP. FORD Double Cabin Dijual. Ranger XLT 4x4 Thn. 2003. Silver metalic BK cantik. Hub. 0811 656704 JAZZ DP 38Jt-an Ready Stok Jazz RS Notic FREED DP 24 Jt-an CR-V 3 Tahun Tanpa Bunga CR-V DP 56 Jt-an 081.370.999.998 / 77.388.133 HONDA 100% BARU PROMO LEBARAN

Ready Stock: Jazz, CR-V, Freed, dll. Febrian: 0813 7572 7200 / 0812 6234 9229 ISUZU Panther LDX 92 Merah metalik, P. Steering, P. Window, jok baru, cat mulus, BK Medan, remote, CD, Mobil mulus. Siap pakai. Harga 45Juta/Nego. Hub. 0812 656 8818 - 77305875

ISUZU Panther Bravo Cruiser Thn. 95, 96. PS, AC, DB, PW, CL, Remot Alarm, cat 2 warna. Lampu depan belakang, Panther Grand Touring. H. 50 Jt. Mobil mulus, cantik, rapi. Hub. Ibu Hajjah. 061.77572509 0852 9641 9233 (maaf sms TP)

ISUZU Panther New Hi Grade ‘97 W. Merah, H. Damai. Jl. Manggis HP. 0813 7010 5676

ISUZU Panther Touring Th. 2007. BK Medan asli Hitam, Bodi mulus, Nego. Hub. 0823 6839 5315 KIA ALL NEW PICANTO & ALL NEW RIO, ANGS 2 JT-AN SPORTAGE BUNGA 0%. MOBIL TERBAIK DESAIN EROPA. MOBIL DAPATKAN HADIAH SPESIAL & JALAN2 KE KOREA. BARU BELI SEKARANG HUB: ADE KIA 0852.9608.6218

TOYOTA Rush Jual Cepat Thn. 2007. Silver. Harga 155Jt/ Nego. Hub. 0823 6902 9818

7 CM 8 CM

Rp. 91.000 Rp. 104.000

BURSA

KOMPUTER

CUCI GUDANG LAPTOP SPESIAL JULY

Toshiba 14” HP 12,1” HP 12” HP. 14” Compaq 14” Dell 12” IBM 11” IBM 14” Proyektor

: 1,9Jt : 1,95Jt : 1,6Jt : 1,70Jt : 1,3Jt : 1,5Jt : 1,5Jt : 1,3Jt : 1,6Jt

- Merk terkenal -Kwalitas terjamin - Bergaransi Hubungi: - 0852 1090 7422 - 0852 6076 2430 Tersedia Cicilan Kartu Kredit 12 bulan Pondok Kelapa No. 9B Medan Kingroad

TERCECER TERCECER

1 Buah Sertifikat Tanah HGB No. 553, Surat Tanah Komp. TASBI I, Blok SS No. 86, Jl. Cycas IV. Kel. Asam Kumbang, Kec. Medan Selayang, Kotamadya Medan An. Drs. Ali Musa Siregar

9 CM Rp. 126.000 10 CM Rp. 140.000

HA TI-HA TI terhadap penipuan yang mengatas HATI-HA TI-HATI namakan PT. Harian WASPADA, kami dari PT. Harian WASPADA tidak pernah mengirim sms untuk TI-HA TI apabila membeli produk anda, dan HA HATI-HA TI-HATI anda ingin melakukan transaksi jual beli melalui transfer. Segala akibat yang terjadi diluar tanggujawab PT. Harian WASPADA.

Apabila anda mencurigai sesuatu, silahkan hubungi kami di

TERCECER

ALAT MUSIK

Surat Jual Beli Tanah. Ukuran 6x16 Meter. Terletak di Jalan Garu IV Kel. Harjosari I Kec. Medan Amplas. A/n. Supinah alias Syafina. Tercecer di seputaran Jl. SM. Raja Medan

Surat Pernyataan Melepaskan Hak Atas Tanah No. 424/ LEG/VIII/1995 Tgl. 10-8-1995 An. AKIMAN.

Keterangan lebih lengkap silahkan hubungi:

TELAH TERCECER

BPKB Asli BK 3080 AAQ Honda Vario atas nama LISANNA SRIMIWATI TARIGAN IR.Tercecer di Kawasan Jalan Jamin Ginting Medan. Yang menemui Hub. HP. 0 8 1 2 6 5 5 0 4 7 5 2

BURSA

BURSA

PERCETAKAN

ALAT MUSIK

* Format: JPG - TIFF (Photoshop)

Kerajinan Tangan atau Barang Dagangan Lain? Ya Tentu...Pasang Iklan di... Surat Kabar Tercinta:

Harian

WASPADA Untuk informasi lebih lengkap hub

BU T U H DAN A

Jaminan apa saja Sertifikat Tanah mobil & Sp. Motor. Segala tahun. Hub. 061-8222774 HP. 0853 6199 1500

BURSA

MITSUBISHI L.300 Pick Up Diesel Dijual. Thn. 99. BK Medan HP. 0813 7008 0493

T ELPON : 061 - 4576602 F AX : 061 - 4561347

Mau Menjual Rumah, Tanah, Kendaraan, Barang

Jaminan BPKB Mobil, Pick Up Truk (Colt Fuso) th. 95 Keatas. Multi Finance: 0877 6857 8318

MINI BUS Rp. 700.000 Rp. 1.000.000 Rp. 1.100.000 Rp. 1.600.000

0853 7083 9300

DIGITAL

HILANG

BUTUH DANA/LEASING

SEDAN Rp. 600.000 Rp. 900.000 Rp. 1.000.000 Rp. 1.400.000

AC - KULKAS - M. CUCI Hub: 061 7797 2065

C D

Jaminan: SHM, SK Camat, SK Lurah, BPKB Spd. Mtr, mobil, Pick Up. Bantu Pelunasan BPKB Pinjaman 1 Juta - 1 Milyar. Proses 3 Jam Cair. Tanpa Usaha. Pinjaman 5 M - 500 Milyar. Jaminan SPBU, Pabrik, Tambang Batu Bara. Rumah Sakit, Hotel. Hub. Family Finc: HP. 081362290001, 0813 70446633

TYPE MOBIL TYPE PROMO PROMO 1 PROMO II PROMO III PROMO IV

AC

ELEKTRONIK MADINA SERVICE

SERVICE -PERBAIKAN - SPAREPARTS

KIRIMKAN... DATA IKLAN ANDA DALAM B ENTUK

HILANG

PINJAMAN SUPER CEPAT

SPESIALIS ALAS DASAR, DOORTRIM, LANGIT-LANGIT, AUDIO, ASESORIES MOBIL & KACA FILM

SERVICE

F D

Sertifikat Tanah No. 125 tanggal 26 Maret 1984 A/n. Abdul Rachman (Almarhum) yang terletak di Desa Tandem Hulu II Kec. Hamparan Perak Kab. Deli Serdang. Bagi yang menemukan Hub. 0812 6379 9755 tidak akan dituntut dan akan diberikan hadiah sepantasnya.

SERVICE

WC

KONSTRUKSI

TUMPAT/ SEDOT

77442112

0813 6147 0812

Jl. Gatot Subroto Medan Ada Garansi

BURSA

PT. PESONA MEKAH UMROH & HAJI PLUS

Umrah Reguler Tahun 2012 Paket 09 Hari 14 Hari

Paket Awal Tengah Akhir Hotel

Juni 16.000.000 18.000.000

22.000.000 25.000.000 28.500.000 Mekah Grand Riyadhah/Setaraf

Full

28.500.000 Madinah Fairuz Satta/Setaraf

Hotel & Harga dapat berubah sewaktu-waktu

TEL. (061) 4576602 FAX. (061) 4561347

PENDIDIKAN

STIKes MUTIARA INDONESIA MENERIMA MAHASISWA/I BARU 1. Magister Kesehatan (M.Kes) 2. Sarjana Kesehatan Masyarakat (SKM) 3. Sarjana Keperawatan (S.Kep) 4. Profesi Ners (Ns) 5. Diploma III-Kebidanan (Am.Keb) Terakreditasi BAN-PT

AKBID - AKPER - AAK - AKAFARMA SARI MUTIARA Terakreditasi BAN-PT & Depkes RI Ujian masuk: 7 Agustus 2012 Informasi selanjutnya & pendaftaran

KAMPUS PENDIDIKAN SARI MUTARA Jl. Kapten Muslim No. 79 Medan Telp. (061) 847.6769 - 845.2687 HP. 0813.6209.2630

Harian WASPADA

LOWONGAN

Dibutuhkan min. lulusan: SMU untuk ditempatkan jadi Guru TK/PAUD, Persyaratan datang langsung ke: Tadika Puri Jl. Karya Wisata No. 23A Telp. (061) 786.2156 Medan Johor, Bp. E. Saragih, SH

DICARI CEPAT GURU

TK/ Playgroup, SMU/ D3/ S1 Syarat Kreatif, datang langsung: Jl. Karyawisata No. 23A Johor Tp. 786.1690 / 786.2156 Medan

BURSA

MATERIAL

BURSA

LOWONGAN

DIBUTUHKAN GURU TARI

Perg. Islam Al-Amin membutuhkan Guru Tari dan Senam, bagi yg berminat lamaran langsung diantar ke: Jl. Karya Jaya Gg. Karya 14 Musthafa II No. 34 Pkl. Masyur Medan HP. 0812.6505.6731

PT. SURYA ESA JAYA

Jl. Berikari Ujung Gg. Family No. 09 Pasar 1 Padang Bulan - Medan Selambat-lambatnya 2 minggu setelah iklan ini diterbitkan

BURSA

BUSANA/ ACCESORIES

PECI MAHKOTA

MENJUALPECITEMPAHAN Berbagai Model dan Warna Jl. Prof. H.M. Yamin SH. No. 344/Jl. Serdang Depan Gg. Sado Medan, HARI MINGGU TETAP BUKA

BURSA

PROPERTY

: Luas Bangunan : Luas Tanah : Ruang Makan : Ruang Tamu

RUMAH DIJUAL

DIBUTUHKAN SEGERA

PERORANGAN/ TIM TENAGA AHLI PERENCANAAN PARTISIPATIF ( TAPP ) PENATAAN LINGKUNGAN PERMUKIMAN BERBASIS KOMUNITAS ( PLPBK ) P R O G R A M N A S I O N A L P E M B E R D AYA A N MASYARAKAT MANDIRI PERKOTAAN ( PNPM-MK) KABUPATEN ASAHAN PROVINSI SUMATERA UTARA DENGAN PERSYARATAN SEBAGAI BERIKUT : 1. Sarjana (S1) Arsitektur / Perancangan Kota, Telah lulus > 5 tahun 2. Pengalaman Kerja Minimal > 3 Tahun Dalam Proyek Perencanaan Permukiman Kota/ Perencanaan Tata Ruang RTBL 3. M e m i l i k i P e n g a l a m a n P r o y e k Perencanaan / Program Pemberdayaan Masyarakat > 1 tahun 4. Memiliki Kreatifitas dan Inovasi di Bidang Perencanaan Pembangunan Permukiman 5. Memiliki Kemampuan Koordinasi dan Kerjasama 6. Tidak Memiliki Ikatan Kerja Dengan Instansi Pemerintah Maupun Swasta 7. Bersedia Ditempatkan dan Bertugas di Lokasi Program. Lamaran Ditujukan Pada Masing- Masing: Tim Seleksi Calon Tenaga Ahli Perencanaan Partisipatif C/Q LKM - LKM Berkah Kelurahan Kedai Ledang Kantor Kelurahan Jln. Rambe Lingkungan IV Kel. Kedai Ledang, No HP 085275048242 - LKM Anugerah Kelurahan Siumbut Baru Kantor Kelurahan Jln. Budi Utomo Lingk I Kel. Siumbut Baru No HP 081397591578 081370490018 Dengan Melampirkan : Fhoto Cofy : Ijazah, Transkip, KTP, Curiculum Vitae, Photo 4 x 6 Berwarna 2 Lembar & No Telp/ HP yang bisa dihubungi. Pendaftaran Mulai : Senin s/d Jumat/ 17 Juli s/ d 22 Juli 2012 ( Jam Kerja ) Lembaga Keswadayaan Masyarakat ( LKM ) Berkah Kelurahan Kedai Ledang & Lembaga Keswadayaan Masyarakat ( LKM ) Anugerah Kelurahan Siumbut Baru

Minimalis, Siap huni, SHM, LT. 427m², Bang 700m², 2½ Tingkat, Bangunan 3 Thn, Rmh 6 KT, Kost 14 KT, Hasil 9 Jt/ bln, Lokasi Jl. MA. Selatan Gg. Rahayu Medan, Harga 3,4 M/nego HP. 0821.6888.9636 736.4776, Maaf TP

TANAH KAPLING DIJUAL

Bertingkat, LT. 401m, SHM, KT 3, KM 4, Komp. Griya Riatur Indah Jl. Krisan D-34 HP. 0813.6000.8724

ELITE MOTOR

RUMAH DAN KOST DIJUAL

Lokasi: Jl. Cendana Pasar II Namorambe Kec. Namorambe, Kab. Deli Serdang Luas: Tanah 80m² s/d 115m² Harga mulai 20-an Jt, SHM, Bebas banjir Hub. 0821.6669.9227 - 0812.6546.9999

G R : Garasi LB KM : Kamar Mandi LT KP : Kamar Pembantu RM KT : Kamar Tidur RT SHM: Sertifikat Hak Milik

Hub. Jl. Nibung II No. 114 Medan (Samping Medan Plaza) Telp. (061) 4566884 (Hunting) dekat Carrefour.

RUMAH dijual Uk. Tanah 7m2 x 20m2. Luas bangunan 105M2, Kamar tdr 3, Kamar Mandi 2, Fasilitas PLN dan PAM. Jl. Eka Surya Gg. Melati No. 31. Hub. 0812 6363 2563

TANAH

Informasi Pembaca Bursa Property

PERCETAKAN

DIJUAL/ B.U

Rmh kost, Warnet 3 tingkat Jl. Gedung Arca Gg. Sehat No. 1 (061) 6872.1968/ 0812.6021.0202

TANAH Dijual Uk. 13,50x45,50m², SHM di Jl. Sei Bengawan No. 104 Mdn Sunggal, Harga nego Hub. 0812.640.8316

LOWONGAN KERJA

Perusahaan yang bergerak dalam bidang JASA SECURITY membutuhkan Tenaga Profesional dibidangnya, sebanyak 50 orang Syarat dan ketentuan: - Laki-laki, minimal tinggi badan 168cm - Wanita, minimal tinggi badan 158 cm - Umur maksimum 30 tahun - Pendidikan minimal SMA Lamaran diantar langsung ke:

MITSUBISHI L300 Pick Up Thn. 2001 Plat BM, Pajak panjang, BPKB Satu nama. Hub. 0853 7224 7277 - 061.50128636 M. Lancer, Evo 4 2000. BK Asli Medan, warna merah, full sound, Velg 18. Kondisi mulus. Hub. 0821 6399 3022

Juli 17.500.000 19.000.000

Umrah Ramadhan 2012 Juni

BURSA

BURSA

TERCECER

Khusus Medan Deli, Marelan, Labuhan, Belawan Hub. 0812 6390 660 Iklan Anda Dijemput

HARGA BELUM TERMASUK PPN 10%

Haji Khusus Hanya Rp. 25,5 Jt Bebas Biaya Pelunasan & Manasik

Terimakasih

BPKB, Kijang Innova. BK 1706 KD An. Dra. Hj. Risna Batubara Hilang disekitar daerah Jl. K. Hasyim

FAX.4561347

Jl. Garu II A No. 52B Medan (061) 787.7078 Cp. Ust. Rahman: 08126568569 M. Toyib: 085260635556 Pin BB: 28AB85A

061-4576602

BURSA BUTUH DANA

PROMO SARUNG JOK MOBIL

IKLAN KHUSUS 6x1,5 kolom Rp. 120.000

Pelanggan Yang Terhormat

TOYOTA Avanza G Thn. 2005 Warna Merah, BK Medan, Tgn. I, Ors. Cat, mulus. Hub. 0821 6717 6723 - 779 675 99

SERVICE/ASESORIS MOBIL

11 CM Rp. 165.000 12 CM Rp. 180.000

Jumat, 20 Juli 2012

TANAH KAVLINGAN

2. (7x32)m : Rp. 89,6 Jt 2. (8x32)m : Rp. 102,4 Jt 1. (10x32)m : Rp. 128 Jt Jl. Percobaan/ sebelum Perumahan Citra Vista Indah Tj. Selamat/ Lewat Pajak Melati Hub. 0821.6881.7838


Sumatera Utara

WASPADA Jumat 20 Juli 2012

B5

Warga Bandarbetsy Tuntut Pengembalian Lahan 943 Ha Tumpahkan Kekecewaan Kepada Bupati Simalungun SIMALUNGUN(Waspada): Ratusan petani warga Bandarbetsy, Kec. Bandar Huluan, yang tergabung dalam kelompok tani Sukadame menyatakan kecewa terhadap Bupati Simalungun JR Saragih, yang hingga kini belum mampu menuntaskan permasalahan petani dengan pihak PTPN III Kebun Bandarbetsy. Kekecewaan warga diungkapkan lewat aksi unjukrasa ke kantor Bupati Simalungun di PamatangRaya,kemarin.Mereka menuntut pengembalian lahan

943 ha dan segera didistribusikan kepada masyarakat. “Bapak bupati yang terhormat, tolong dengarkan aspirasi kami. Kembalikan tanah seluas

PT LTS Santuni Anak Yatim RANTAUPRAPAT (Waspada): PT Lingga Tiga Sawit (LTS) Desa Lingga Tiga, Kec. Bilah Hulu, Kab. Labuhanbatu, menggelar peringatan Israk dan Mikraj Nabi Muhammad SAW sekaligus menyantuni anak yatim, di Komplek Pabrik Minyak Kelapa Sawit (PMKS) perusahaan setempat, baru-baru ini. Manajer Humas PT LTS H.YusranYunus alias Mas Ulong, didampingi KTU T Amiruddin Noor, SE dalam sambutannya pada acara itu menyampaikan, peringatan Israk Mikraj PT LTS sudah digelar untuk keenam kalinya. Sedangkan jumlah anak yatim dan anakanak dari keluarga kurang mampu lainnya yang disantuni berjumlah 50 orang. Mas Ulong juga menyampaikan, PT LTS juga memberikan teratak kepada enam dusun yang ada di Desa Lingga, dengan tiga setiap tahunnya dan sampai saat ini sudah empat dusun yang mendapat teratak. Pada tahun 2013 direncanakan dua dusun lagi akan menerima teratak dari PT LTS. Kemudian, katanya, PT LTS juga memberikan kelengkapan untuk keperluan fardu kifayah bagi umat Islam yang meninggal dunia. Dengan bantuan seperti itu, pihak ahli musibah tidak perlu lagi repotrepot menyediakan perlengkapan untuk fardu kifayah mayit. Dikatakan, bentuk kepedulian PT LTS terhadap warga Desa Lingga Tiga akan berjalan terus dengan dukungan balik dari masyarakat yang menjaga PT LTS untuk tetap eksis di tengah-tengah masyarakat. (a18)

Wisuda Taruna/i APS Angkatan XII Di Sidoarjo LIMAPULUH (Waspada): Bupati Batubara H. OK Arya Zulkarnain, SH, MM mengharapkan taruna/i berasal dari Batubara sekembalinya nanti dapat ‘membolo’ (membangun) kampung ‘besamo’ (bersama), sejalan kerja sama pendidikan ke depan terpelihara baik. Dia mengatakan itu padaWisuda Taruna/i Akademi Perikanan Sidoarjo, (APS) Jawa Timur Angkatan XII baru-baru ini, di mana 10 orang di antaranya putra/i Batubara,. Indonesia,katanya,merupakansuatunegarakepulauandikelilingi oleh laut luasnya mencapai, 70 % dari daratan. Sehingga, dikenal juga sebagai negara bahari. Perkembangan teknologi dan informasi serta semakin baiknya perhatian dan dukungan Pemerintah Pusat terhadap Pemerintah Daerah terutama dari Kementerian Kelautan Dan Perikanan RI. ‘’Langkahinidiharapkanmampumendidik,membinadanmelatih putra/i nelayan, pembudidaya dan pelaku usaha bidang perikanan dan kelautan sehingga SDM yang handal secara berkelanjutan dapat terwujud,’’ ujarnya. Hadirkepala/mewakilijajaranKementerianKelautanRI,pimpinan Akademi Perikanan Sidoarjo, Bupati/mewakili dari Kab. Sumenep, orangtua/wali taruna/i, para wisudawan, Kadis Kanla Batubara, Kadis Sosial/ Sekretaris Dewan Pendidikan Batubara, Drs. Aladdin, dan undangan. (a13)

BURSA

TRAVEL/ WISATA REZEKY TRAVEL

-Menerimapengurusan/perpanjangPASPORT - Tiket ferry T. balai - Poklang (Malaysia) - Travel Medan - Tanjung Balai (Pelabuhan) Hubungi: (061) 6647.7734/ 0852.9616.6601 (Roy)

BURSA

PERABOT DIJUAL

Dijual 1 set Regging Panggung Uk. 6x12meter, lengkap, Atap + Katrol + Pentas dan tenda Foh 3x3meter Hub: (061) 7792.4146 - 0813.6174.2554 TEMPAHAN MURAH - Lemari pakaian 3 pintu Sungkai asli Rp. 1.500.000 tempahan - Kitchen set atas bawah Sungkai asli Rp. 1,5 Jt/mtr Hub Telp. (061) 661.8116 - (061) 661.6802- 7653.2188

SPRING BED DIJUAL MURAH

Spring Bed 6 kaki 2 lapis Rp. 1.150.000 Spring Bed 5 kaki 2 lapis Rp. 1.075.000 Spring Bed 4 kaki 2 lapis Rp. 1.000.000 Spring Bed 3 kaki 2 lapis Rp. 900.000 Spring Bed 3 kaki Dorong Rp. 1.000.000 Garansi Per 10 tahun

Hub Telp. (061) 661.8116 - (061) 661.6802 - 7653.2188

Anda Butuh Perabot Jepara Asli?

MALIOBORO PERABOT

Hubungi: Jl. Bilal No. 90 P. Brayan Medan Telephone Toko : 661.6285 Rumah : 661.1540 Fax : 661.6285 (061) Jl. K.L. Yos Sudarso depan SMA Negeri 1 Tebing Tinggi Telp. (0621) 24243

KIRIMKAN... F D DATA IKLAN ANDA DALAM BENTUK C D

DIGITAL

Keterangan lebih lengkap silahkan hubungi:

TELPON : 061 - 4576602 FAX : 061 - 4561347 * Format: JPG - TIFF (Photoshop)

BURSA

PELUANG BISNIS

HARGA TERMURAH

MODEL TERBARU

KRISNA WATER

1. Pemasangan Depot Air Minum Sistem Multi Filtrasi & RO Rp. 14 Jt s/d 38 Jt 2. Pemasangan AMDK dan Pengurusan SNI & BPOM 3. Air Pegunungan 7000 Liter 4. Menyediakan Segala jenis Spare Part Depot Air Minum 5. Menyediakan Mesin Penjernih Air Rumah Tangga, R.S, Pabrik dll

943hektaryangkinidikuasaipihak kebun Bandarbetsy kepada kami,” teriak salah seorang pengunjukrasa sambil membacakan pernyataan sikap yang ditandatangani Rensiana Haloho selaku kordinator aksi. Ditegaskannya, petani sudah bertahun-tahun tertindas. Padahal tanah tersebut merupakan hak rakyat yang tergabung dalam kelompok tani Sukadame sesuai dengan keputusan bersama antarapetanidenganpihakPTPN III Bandarbetsy dan unsur Muspida Simalungun dan kemudian dikuatkan lagi dengan keputusan PansusDPRRINomor:027/RKM/ PansusTanah/DPR-RI/2004yang memutuskanbahwatanahtersebut kembali dikuasai negara untuk dibagikan kepada rakyat. “Tolong kembalikan hak

kami. Apabila bupati tidak mengembalikannya, maka kami akan mengambilnya secara paksa,karenaituadalahhakkami, hak rakyat yang tertindas,” ujar pengunjukrasa. Sementara Agustinus Saibun Siahaan selaku kuasa masyarakat berharap kepada Bupati Simalungun tanggap atas persoalan yang dihadapi masyarakat. Jika tidak ada jawaban, mereka akan melakukan aksi menginap di kantor bupati. Parapengunjukrasa diterima Asisten I Pemkab Simalungun, Marolop Silalahi, didampingistafahliRijalEPSaragih dan Kaban Kesbangpol Linmas, Djadiaman Purba. Di hadapan para pengunjuk rasa yang mendapat pengawalan ekstra ketat dari petugas KepolisiandanSatPolPP,RijalEPSaragih

Lakalantas, 1 Tewas 1 Luka Berat PEMATANGSIANTAR (Waspada): Satu orang tewas dan satu oranglukaberatakibatkecelakaan lalu lintas (lakalantas) di wilayah hukum Polres Simalungun dan Polres Pematangsiantar. Korban Robinson Pangaribuan, 47, pegawai honor, warga Desa Sejahtera, Kec. Siantar, Simalungun tewas sesudah sepedamotor Honda Astrea Grand tanpaplatnomorpolisiyangdikemudikannya diduga menabrak dari belakang satu unit mobil barang BK 9396 BH di jalan umum Km 4-5, jurusan Pematangsiantar-Perdagangan, Desa Sejahtera, Kecamatan Siantar, Simalungun pada Rabu (18/7) pukul 22:30. Berbagai keterangan dihimpun menyebutkan korban yeng merupakan Ketua PAC Partai GolkarKecamatanSiantarhendak pulang ke rumahnya sesudah rapatdirumahsalahseorangpengurus partai di Pematangsiantar. Kapolres Simalungun AKBP M. Agus Fajar H, S.Ik saat dikonfirmasi melalui Kasubbag Humas AKP H. Panggabean, SH, Kasat Lantas AKP Hendrawan, S.Ik dan Kanit Laka Iptu Alsem Sinaga, Kamis (19/7) menyebutkan laka lantas yang mengakibatkanb korban jiwa itu masih dalam penyelidikan dan pengemudi mobil barang masih dalam pencarian. Sementara, korban Mirafel

PanduSinaga,5,pelajarTK,warga Jalan Linggarjati, Kel. Merdeka, Kec. Siantar Timur, Kota Pematangsiantar mengalami luka berat sesudah sepedamotor Yamaha Vega R tanpa plat yang ditumpanginya disenggol satu unit mobil dinas Kabag Umum Pemkab Simalungun jenis Isuzu Panther BK 1216 T dan dikemudikan Japorman Purba, 22, pegawai honor Pemkab Simalungun di JalanSutomo,Kel.Pahlawan,Kec. Siantar Timur, Pematangsiantar Rabu (18/7) pukul 11:00. Korbansaatitubarudijemput Erwin Saragih, 23, mahasiswa, warga sama dengan korban dari sekolahnya dan hendak pulang ke rumahnya.

PROMO RAMADHAN 12 JULI - 26 AGUSTUS 2012

BERAS “ORGANIK” SELARAS ALAM PANDAN WANGI/ SIHERANG 5 KG -> Rp. 64.000 JADI Rp. 61.000 10 KG -> Rp. 125.000 JADI Rp. 120.000 JUGA TERSEDIA BERAS MERAH 5 KG = Rp. 75.000

HUB: TOKO JAPPSA

JL. SETIA BUDI 144 PSR 2 TJ. SARI (061) 821.6612 - 0821.6386.3340

Ketikatibaditempatkejadian, mobil yang dikemudikan JapormanPurbaberusahamendahului kendaraan di depannya. Namun, saat bersamaan muncul kenderaan dari arah berlawanan hingga untuk mengelakkan tabrakan, Japorman mengambil jalan ke sebelah kanan hingga sepeda motor ditumpanggi korban tersenggol. Kapolres Pematangsiantar AKBPAlberdTBSianipar,S.Ik,MH saatdikonfirmasimelaluiKasubbag Humas AKP Altur Pasaribu, Kasat Lantas AKP Hendrik Situmorang, MM dan Kanit Laka Iptu Sugeng W,SH,Kamis(19/7)menyebutkan lakalantas itu masih dalam proses penyelidikan. (a30)

PDAM Tirta Uli Buka Posko Layanan Air Rumah Ibadah PEMATANGSIANTAR,(Waspada): Perusahaan Air Minum Daerah (PDAM) Tirta Uli Pematangsiantar membuka posko layanan air bersih untuk keperluan rumah-rumah ibadah di daerahnya selama bulan Ramadhan ini. Dirut PDAM Tirta Uli, H.Badri Kalimantan,SE, melalui humas, Drs.Azhar nasution,kepada Waspada mengatakan, posko layanan air bersih itu dibuka 24 jam.Artinya, pengurus rumah ibadah,seperti Masjid ,Langgar dan Surau dapat menyampaikan permintaan akan kebutuhanairbersihnya.“PetugasPDAMTirtaUlisiapmendistribusikan air bersih ke rumah-rumah ibadah,bila diperlukan,” kata Nasution. Permintaan air bersih tidak dikenakan biaya dan permintaan dapat disampaikan ke posko kantor PDAM Tirta Uli di Jalan Porsea Pematangsiantar atau melalui nomor telepon (0622) 7113666. (c16)

BURSA

KESEHATAN

ANDA BUTUH

ALAT BANTU DENGAR ? HUB.

MELTRA HEARING AID JL. KEDIRI NO. 36 MEDAN TELP. 451.6161

KLINIK TRAPI ALAT VITAL MAK HJ. ICOT Ditangani langsung

KLINIK TERAPY ALAT VITAL MAK EROT YANG TERUJI DAN TERBUKTI

Dengan H. TEJA SAEFUL Cucu Asli Mak Erot Bersama

H. UST. YUSUF/ H. ABIDIN

A. Ust OTONG

Izin Dinkes No. 448 Hak Paten No. 00.2004.09965.10041 KHUSUS PRIA: - Ejakulasi dini - Impotensi - Memperbesar “Alvit” - Memperpanjang “Alvit” - Keras dan tahan lama dll KHUSUS WANITA: - Ingin punya keturunan - Memperkencang & memperbesar payudara - Mengobati keputihan dll KONSULTASI UMUM: - Buka Aura - Cari Jodoh - Sesama jenis - Pelaris - Memikat lawan jenis - Besar PYDR

DIJAMIN 100%

Hanya Tempat Kami Klinik Mak Erot Jl. Laksana No. 55J masuk dari Jl. Amaliun Yuki Simpang Raya Medan (Praktek Tetap) HP .0812.4038.333

CV. HYDRO UTAMA

Jl. Kapt. Muslim No. 53-D Medan Telp. (061) 8457879 Jl. Serdang No. 368 B Medan Telp. (061) 453.2484 - 77839790 HP. 0852 6168 0200 - 0812 600 5410

dengantegasmenyatakanbahwa persoalan lahan Bandarbetsy bukan kewenangan Pemkab Simalungun atau Bupati JR Saragih. Tetapiyangmemilikikewenangan adalah pihak PTPN III Bandarbetsy. “Pemkab Simalungun atau bupatitidakmemilikikewenangan dalam masalah lahan Bandarbetsy.Yanglebihberwenangtentu adalahpihakKebunBandarbetsy,” cetus Rijal. Mendengar itu, para pengunjuk rasa semakin kesal dan kecewa. Mereka menilai respon Pemkab Simalungun terhadap aspirasi yang mereka sampaikan sangatdangkal.Denganrasatidak puas karena tidak mendapat jawaban pasti dari bupati, pengunjuk rasa membubarkan diri dan meninggalkankantorbupati.(a29)

SEHAT BERPUASA BERSAMA NECTURA KONSUMSI NECTURA DI WAKTU SAHUR DAN BERBUKA ANDA AKAN MERASA LEBIH SEHAT, SEGAR, BERSEMANGAT, DAN MEMILIKI DAYA TAHAN TUBUH YANG KUAT Telah hadir di kota Medan

NECTURA

SUPLEMENT ANTI OXIDANT

Terbaik di dunia saat ini, juice berisi ramuan 47 buah. Dan herbal dengan anti-oxidant terbaik di dunia. Hub. APOTEK K-24 KAPTEN MUSLIM Jl. Kapten Muslim No. 76 Telp. 061-8462093

Setelah sukses di propinsi di Papua, kini hadir di kota Medan, pengobatan nyata luar biasa, bila anda ingin perkasa, ingat jangan salah informasi disini yang pasi ±30 menit kami akan buktikan alat vital menjadi besar dan perkasa. Dengan metode pengurutan disekitar alat vital melalui totok urat-urat kejantanan. Kami tidak mengumbar janji belaka. Tdk ada efek samping, bebas utk semua agama. Bukan janji tapi bukti ditempat Penanganan khusus pria: - Memperbesar, panjang, keras, kuat dan tahan lama - Kencing manis, diabetes, L. syahwat - Ejakulasi dini/ impotensi Khusus Wanita: - Memperbesar/ kencang payudara - Ingin punya keturunan/ gurah vagina - Ingin kembali perawan/ keputihan Konsultasi umum - Ajian semar mesem/ buka aura - Penglaris/ penghasihan/ cari jodoh - Pasang susuk, karir/ jabatan DIJAMIN 100% Alamat Jl. Halat / Masuk Jl. Senam No. 19C. Belakang Makam Pahlawan HP. 0821.6655.3222

BALAI PENGOBATAN TRADISIONAL

ALAT VITAL

DITANGANI OLEH AHLINYA: M. SUHERDI

DARI PELABUHAN RATU SUKABUMI JABAR

Terapi keperkasaan seksualitas Pria hasil permanen tanpa efek samping, alami, bebas pantangan, untuk semua usia Hasil langsung reaksi ditempat, cukup satu kali berobat

MENANGANI KELUHAN: MENAMBAH UKURAN -

Panjang: 13, 14, 15, 16, 17, 18, 19, 20 cm Besar: 3,5. 4,5. 5. 5,5. 6 diameter Memperkeras, Tahan lama Ejakulasi dini, Mani encer Impotensi, Lemah syahwat Diabetes, kencing manis/ batu

Juga melayani problem asmara, mempercepat jodoh, pengasihan, penglaris, buka aura, pasang susuk, dll ALAMAT KELINIK TETAP: Jl. SM. Raja Masuk ke Jl. Utama No. 18 Medan Dari Toko Roti Majestik ±100meter Izin Kejaksaan: B/DSP.5/12/2008 Izin Dinkes: No. 448/0649/I/2008 HP. 0812.6388.7999 Buka setiap hari

Waspada/Hasuna Damanik

PARA pengunjukrasa mendengarkan jawaban dari pihak Pemkab Simalungun, sambil dudukduduk.

Pemkab Dairi Lakukan Perekaman Launching e-KTP SIDIKALANG (Waspada): Pemkab Dairi,dipandu dinas kependudukan dan catatanSipil, melaksanakan Launching perekaman e-KTP di kantor camat Sidikalang, Selasa (17/7). Acara itu dihadiriunsureMuspida,paraCamat,pimpinanSKPD,Asisten,Lurah dan beberapa perangkat desa. KepalaDinasKependudukan dan Catatan Sipil, Drs Ramses Situmorang, mengatakan bahwa pelaksanaanperekamandatapenduduk meliputi sidikjari, tandatangan dan foto untuk menyatukandatakependudukan.Dengan demikian,masyarakatDairihanya

memiliki satu data yang lengkap dan terdaftar dalam data base kependudukan nasional. Dikatakan, perekaman Launching e-KTP merupakan program pemerintah pusat, agar pemilikan data ganda atau KTP ganda tidak terjadi lagi setelah dengan adanya perekaman KTP elektronik. Perekaman data eKTP dapat dilakukan bagi wajib KTPdiseluruhkecamatan.Sebab, personilnya dan peralatan telah dilengkapi empat orang disetiap kecamatan dan harus tuntas sampai Desember 2012. Mewakili bupati, Asisten Pe-

merintahan, RewinSilaban,S.Sos, mengatakanbahwaalatperangkat perekaman data telah diterima PemkabDairi. Diharapkan target dapat tercapai hingga Desember 2012,sesuai dengan jumlah penduduk. Untuk pencapaian target itu, diharapkan agar pemerintah dan perangkat desa, dapat menyampaikan kepada masyarakat . Sehingga kedepan,tidak ada lagi KTP ganda. PantauandikantorcamatSidikalang,beberapapejabat,pimpinan SKPD, para camat dan lainnya, langsung melakukan perekaman datauntukpembuatane-KTP.(a20)

Peringatan BBGRM IX Dan Hari PKK 40 Batubara LIMAPULUH (Waspada): Peringatan Bulan Bakti Gotongroyong Masyarakat (BBGRM) IX dan Hari Kesatuan Gerak PKK ke-40 Kab. Batubara dipusatkan di Desa Mandarsyah, Kec. Medang Deras, Senin (16/7). “Kegiatan ini kita harapkan tidak hanya seremonial belaka dan kedepan mampu mendorong menggerakkan partisipasi masyarakat,” tukas Bupati H. OK Arya Zulkarnain, SH, MM dalam sambutannya. Acara peringatan ditandai dengan pembacaan sejarah singkat hari kesatuan gerak PKK oleh Rina Mulyati Alia Gani ManurungdansambutanKetuaPKK Pusat dibacakan Ketua TP. PKK, Hj. Khadijah OK Arya. Sedangkan laporan panitia penyelenggara disampaikan Kepala BMPD, Budi Iswan Sinaga, S. STP. Kemudian pengumuman pemenang sekaligus penyerahan hadiah untuk lomba RPJM desa

terbaik,lombatimpelestariPNPM Mandiri terbaik. Dan penyerahan bantuanbibitSengonkepadaSaidi, Sugiarto,Sumino,Misroni,Ponirin. Selain itu juga ada bantuan treser (alat perontok padi) kepada

Koptan Tunas Baru, Jumino, bantuanbibitpadikepadaKoptan Tunas Harapan, Kamdi, bantuan bibitjagungKoptanLestari,Sugito dan kedelai Koptan Harapan Tani, Amin Yahya. (a13)

Waspada/Iwan Has

BUPATI H. OK Arya Zulkarnain, SH, MM ketika memberikan hadiah kepada pemenang lomba RPJM dan tim pelestari PNPM Mandiri terbaik.

Dinsos Asahan Terkesan Berpangku Tangan KISARAN (Waspada): Dinas Sosial Kab. Asahan disesalkan, wargakarenatidakmelaksanakan penertibangepeng(gelandangan/ pengemis menjelang bulan suci Ramadhan 1433 H. Suriadi, 42, warga Jl. Sutomo, KotaKisaran,Kab.Asahankepada Waspada, Kamis (19/7) menyatakan, banyaknya tuna wisma/ gelandangan yang berkeliaran diinti kota Kisaran cukup meresahkan.“Apalagiadaseorang tuna wisma wanita yang sering tanpa sebab melempari orang dengan batu,” ujar Adi.

Pantauan Waspada, menjelang bulan suci Ramadhan bagi umat muslim ini kota Kisaran dibanjiri oleh pengemis dari luar daerah. Pengemis rata-rata anakanak kecil dan ibu yang menggendong anaknya mengharapkan belas kasihan dari warga. PLH Kadis Sosial Kab. Asahan Drs. Hasbi yang dijumpai Waspada menyatakan hal tersebut bukan wewenangnya,“Tanya aja sama Kabid Retsos/ rehabilitasi sosial,” ujar Hasbi. Sementara, Kabid Retsos Dinas Sosial Kab. Asahan Subono

ketikadihubungimenyatakanlagi sibukdansedangberadadirumah sakitmengurusgelandanganyang terlantar yang sedang sakit. Secara terpisah Ketua Fraksi Partai Golkar DPRD Asahan T. Johnson kepada Waspada menyatakan, pihaknya berharap agar Dinas Sosial dan instansi terkait dapat segera melaksanakan penertiban gepeng seperti yang dikeluhkan masyarakat. “Kemudian dari razia atau penertiban tersebut dapat didata asal daerah para pengemis yang terjaring,” harap Johnson. (a31)

Objek Wisata Menjanjikan Pakpak Bharat PAKPAK BHARAT (Waspada): Ada sejumlah kawasan yang menjadiobjekwisatamenjanjikan di Pakpak Bharat. Nah, jika merasa lelah, jenuh, sesak dan pengap, cobalah berkunjung ke Pakpak Bharat. BupatiPakpakBharatRemigo Yolando Berutu, MBA kepada Waspada menjelaskan, kemarin, ada sejumlah pilihan objek wisata di Pakpak Bharat yakni seperti wisata alam, air terjun, kawasan hutan alami serta berberapa kunjungan wisata budaya seperti situs/mejan, Goa LiangTojok dan kisah Eluh Berru Tinambunen. Saatharimasihpagi,kawasan PanoramaIndahDellengSindeka perkantoran Pemkab Pakpak Bharat terasa seperti kawasan hutan alami yang dilingkupi oleh kabutnansegar.“Inimasihdipusat ibukota Pakpak Bharat” katanya. Kendati masih banyak yang perludibenahi,namunsampuren (air terjun) Lae Mbilulu dan Lae Une akan terus mendapat perhatianPemkab.“Harapankitakedua kawasan ini akan menjadi kunjungan yang padat kelak, setiap tamu yang berkunjung ke sana itu mengaku terobati mata dan hatinya” ujar Bupati menirukan parapengunjung.Hanya10menit dariKotaSalakkedualokasisudah dapat dinikmati, tambahnya. Di AirTerjun Simbilulu, Anda

akan menikmati suasana alam hutan, air terjun dan kabut yang akan menusuk hingga ke tulang yang dihembuskan dari air terjun. “Hanya berdiri 15 meter dari air terjun, Anda akan diselimuti kabut hingga sekujur tubuh basah,” terang Remigo. Puas dengan hentakan kabut, Anda juga bisa langsung terjun ke kolam air terjun. “Dinginya luar biasa, segar dan menyejukkan hingga akan mengingatkan Anda bahwa wisata Simbilulu tidak ada bosannya untuk didatangi,” kata dia. Di Lae Une, Anda juga disuguhkan pemandangan air terjun yang cukup besar dengan hamparan kolam yang mirip danau. “Di sini Anda juga akan dapat menyaksikan hewan liar jenis monyet hitam dan burung-burung liar yang masih alami,” katanya.Dihariliburlokasitersebut akan dipadati pengunjung. Namun jika hari kerja kita akan menyaksikan para pemancing tradisional.“KeLaeUnejugaakan menjadipengalamanyangcukup menarik” katanya. Eluh Berru Tinambun, legenda telaga adalah air mata Berru Tinambun, diyakini sejumlahorangmampumembuatawet muda jika pengunjung membasuh muka di telaga tersebut. “Jika saya ditanya teman-teman di luar daerah kenapa terkesan

awet muda, saya hanya menjawab saya hanya cuci muka di Eluh Berru Tinambun,” ujar Remigosambiltertawa.Ukuranya tidak lebih dari kuali ukuran sedang. “Nah, jika teman-teman wartawan hendak menampilkan ini ke media, tolong kasih rute jalanya, dari kota Medan hanya berkisar lima jam perjalanan melewati Sidikalang kabupaten Dairi dengan naik bus dengan ongkos Rp35.000 mengikuti jalan menuju Aceh. Dan di pertigaan Jalan Sukarame, kita turun ke bawah sebelah kiri. “Jika dengan mengendarai kendaraan sendiri mungkin tidak lebih dari lima jam perjalanan,” ujarnya. Bila ingin menginap di lokasi wisata, kata dia, harus dengan membawa perlengkapan sendiri, atau “Menginaplah di salah satu hotel yang sudah terdapat di jantung kota Salak” terang Remigo. Perjalanan ke Kabupaten Pakpak Bharatakanmenambahwawasan wisata alam yang masih alami, dan sedang masa perkembangan diberbagaisektor.“Ohiya,Pakpak Bharat memang suasana kampungnyamasihsangatterasa, namun masyarakatnya bukanlah kampungan,” pungkas bupati yang alumni Pascasarjana Universitas LaTrobe Australia, disambut gelak tawa. (csb)


Aceh

B6 LANGSA (Waspada) : Memasuki libur Ramadhan 1433 H, siswa SMK Negeri 4 Perikanan dan Kelautan Kota Langsa melakukan tradisi salam-salaman untuk saling memaafkan dengan dewan guru dan pegawai tata usaha di halaman sekolah itu, Kamis (19/7). Menurut Kepala SMK Negeri 4 Perikanan dan Kelautan Kota Langsa Bujang SG, tradisi bersalam-salaman ini sebagai upaya membiasakan kepada siswa agar saling memaafkan kepada seluruh eleman di lingkungannya, apakah itu di sekolah, di rumah maupun di masyarakat nantinya dalam menyambut bulan suci Ramadhan. Dikatakan Bujang, selama Ramadhan, sekolah tetap melaksanakan kegiatan belajar mengajar selama tiga minggu, terhitung mulai Senin (23/7). Dalam tiga minggu belajar itu, selain menjalankan aktivitas belajar, juga dilaksanakan kegiatan keagamaan seperti pesantren kilat dan lain-lain. (m43)

Waspada / Zainuddin Abdullah

EROSI yang terjadi di Krueng Pase, Kecamatan Syamtalira Arun, Kabupaten Aceh Utara semakin parah, Kamis (19/7) bukan hanya daratan terus terkikis, tapi kuburan umum setempat juga ikut amblas ke dalam sungai.

Erosi Tebing Krueng Pase

Kuburan Warga Amblas Waspada/Dede

Bocah Perokok Berat Dari Abdya Akibat Minimnya Perhatian Orangtua BLANGPIDIE (Waspada) : Fenomena yang menimpa Karman, 7, bocah kelas 2 SD Negeri Padang Meurandeh, Desa Sejahtera, Kecamatan Manggeng – Aceh Barat Daya yang sempat menimbulkan keprihatinan dari banyak pihak terkait kebiasaannya merokok sejak masih duduk di kelas 1 SD, kini menjadi pembicaraan hangat yang menilai persoalan rokok yang sudah memasuki ke dunia anak-anak dinilai harus segera mendapatkan perhatian serius dari pemerintah dan pihak terkait. “Ini jelas sebuah kondisi memprihatinkan, pemerintah harus segera mengambil langkah tegas dan perhatian serius, karena rokok di negeri ini sudah terlalu jauh meracuni masyarakat dan bahkan sudah masuk ke dunia anak-anak,” kata Tgk Farmadi ZA, tokoh agama yang juga pimpinan Pusat Komuniti Islam Yayasan Al-Insaniyah (PUSKIYAI), Kamis (19/7) terkait kasus karman bocah perokok berat asal Manggeng. Zulbaili, 39, tokoh pemuda yang juga masyarakat Desa Sejahtera tempat domisili Karman mengungkapkan, persoalan kemiskinan dan minimnya perhatian dari kedua orangtua yang dinilai penyebab utama ‘rusaknya’ Karman. Menurut Zulbaili, persoalan yang menimpa Karman sebenarnya sudah diketahui oleh masyarakat di kawasan tersebut, hanya saja selama ini terkesan belum ada tindak lanjut secara serius atas persoalan tersebut karena belum adanya solusi yang dinilai tepat untuk dapat merubah kebiasaan buruk yang dilakukan oleh Karman. Camat Manggeng Shalih mengaku kaget atas temuan yang terjadi di wilayah kerjanya itu. Dirinya berjanji akan segera turun ke Desa Sejahtera dan menemui keluarga Karman dalam upaya melakukan pembinaan sekaligus memberikan bantuan pendidikan bagi Karman yang masih sekolah di SD Negeri Padang Meurandeh itu. (cb05)

Siswa MIN Paya Bujok Langsa Bagi-bagi Bingkisan LANGSA (Waspada) : Menyambut datangnya Ramadhan, para siswa MIN Paya Bujok Langsa melakukan bagi-bagi bingkisan antar sesama temannya, Kamis (19/7). Bingkisan tersebut berupa beras dan sejumlah uang yang dikumpulkan dari anakanak keluarga berada, kemudian dibagi-bagikan kepada temanteman mereka sendiri dari kalangan anak yatim dan anakanak dari keluarga kurang mampu. Kepala MIN Paya Bujok Langsa Muzakkir menyambut baik inisiatif anak didiknya itu yang melakukan pengumpulan uang dan beras antar sesama teman untuk membantu teman lain yang kurang beruntung. Menurutnya, sikap peduli antar sesama teman dari anak didiknya ini perlu diperlu diberikan apresiasi dengan baik agar sikap peduli antara sesama itu bisa terus tumbuh dan terpelihara hingga mereka dewasa nanti. (b20)

Waspada/Ibnu Sa’dan

SISWA MIN Paya Bujok Langsa mewakili teman-temannya menyerahkan bingkisan kepada seorang siswa yatim disaksikan para gurunya.

Penerbangan Di Bandara SIM Banda Aceh Tiba (flight, asal, waktu) Garuda Indonesia

Berangkat (flight, tujuan, waktu)

GA 142 Jakarta/Medan GA 146 Jakarta/Medan

10:40 15:50

GA 143 Medan/Jakarta GA 147 Medan/Jakarta

11:25 16:45

Y6 555 Jakarta * Y6 537 Jakarta/Medan

19:05 12:30

Y6 556 Jakarta** Y6 538 Medan/Jakarta

07:05 12:30

JT 304 Jakarta JT 396 Jakarta/Medan

11:35 20:00

JT 397 Medan/Jakarta JT 307 Jakarta

06:40 12:15

SJ 010 Jakarta/Medan

12:55

SJ 011 Medan/Jakarta

13:25

Batavia Air Lion Air

Sriwijaya Air Air Asia

AK 305 Kuala Lumpur *** 12:20

AK 306 Kuala Lumpur*** 12:45

FY 3401 Penang ****

FY3400 Penang ****

Fire Fly

14:10

* Setiap Selasa, Kamis, Minggu. ** Setiap Senin, Rabu, Jumat. *** Setiap Senin, Rabu , Jumat dan Minggu. **** Setiap Selasa, Kamis dan Minggu.

14:30

Jumat 20 Juli 2012

25 Ha Ladang Ganja Di Aceh Besar Dimusnahkan

Siswa SMKN 4 Langsa Saling Bersalaman

KEPALA SMK Negeri 4 Perikanan dan Kelautan Kota Langsa menyalami para guru di halaman sekolahnya, Kamis (19/7)

WASPADA

SYAMTALIRA ARUN ( Waspada ) : Sebanyak 30 kuburan umum di Desa Meunasah Blang, Kecamatan Syamtalira Arun, Aceh Utara amblas ke sungai berikut 2.000 kuburan lain terancam mengalami hal sama mengingat erosi terjadi pada tebing Krueng Pase semakin meluas. Erosi yang terjadi di Krueng Pase semakin parah dan terus mengikis tebing tanpa henti serta telah menjamah badan jalan desa. Seorang warga Desa Meu-

nasah Blang, Amin Adam, Kamis (19/7) membenarkan erosi yang terjadi sudah terbiar terlalu lama tanpa ada upaya untuk mengantisipasi atau memperbaiki kerusakan sehingga lamban laun air terus menjalar dan mengikis tebing. Bahkan selama ini erosi sungai terjadi banyak menimbulkan kerugian bagi masyarakat. Kondisi buruk yang terakhir, ketika puluhan kuburan umum setempat menjadi sasaran amblas dan jasad orang meninggal sempat dibawa arus sungai. “Ada 30 kuburan yang sudah jatuh ke sungai. Tapi ada 2.000 kuburan lainnya juga terancam menjadi sasaran amblas akibat tebing sungai terkikis tanpa ada bangunan tanggul,” ujar Amin.

Amin mengaku kecewa dengan pemerintah daerah melalui Dinas Pengairan selaku pihak terkait yang terkesan menutup mata. Meski sudah berulang kali mencoba menyampaikan keluhan ini dan mengunjungi kantor pemerintah terkait, namun para pejabat membiarkan erosi terus terjadi dengan parah tanpa adaa upaya melakukan perbaikan. Hal serupa juga diungkapkan Zakaria dari desa yang sama terkait parahnya erosi di Krueng Pase semakin membuat masyarakat resah dan khawatir terhadap dampak buruk yang timbul nantinya bisa saja mengancam permukiman penduduk sekitar. (b16)

Massa Bakar Rencana Balai Sebuah Yayasan BIREUEN (Waspada): Sejumlah lelaki datang ke lokasi rencana akan dibangun sebuah gedung yayasan di Desa Paya Rangkulueh, Kecamatan Kutablang, Bireuen, Kamis (19/7). Tidak lama mereka membakar sebuah gudang kecil yang berada di atas areal itu. mereka membubarkan diri. Tidak ada korban dalam aksi itu. Namun, pasca itu, polisi langsung memasang police line sedangkan sejumlah tokoh masyarakat dan Muspika setempat serta anggota Polres dan anggota Kodim membahas masalah kejadian yang tidak inginkan terjadi. Pantauan Waspada Kamis (19/7), menjelang siang sejumlah masyarakat yang terdiri kaum pria berada di pinggir jalan nasional kawasan bekas kilang penghancur batu. Entah bagaimana tiba terlihat sudah terlihat api dari gubuk kecil yang baru dibangun yang berada di lokasi yang tidak jauh dari jalan nasional. Tidak lama setelah kejadian itu sejumlah anggota Pos Polisi Kutablang, anggota Polsek Gandapura dan anggota Polres tiba di lokasi termasuk Kasat Reskrim, Ipda Benny Cahyadi SH, langsung menenangkan massa, sehingga mereka membubarkan diri. “Masalah ini akan duduk sejumlah elemen masyarakat sebentar lagi di Kantor Camat Kutablang,” kata Benny. Keterangan yang dihimpun dari sejumlah sumber, dibakarnya gudang kecil, karena rencana pembangunan gedung sebuah yayasan pendidikan terkesan kurang jelas di tengah masyarakat. Sehingga muncul anggapan negatif di tengah masyarakat terkait yayasan itu. Selain itu, ada juga isu, masyarakat Desa Paya Rangkulueh terkesan belum dikoordinasi atau dimusyawarahkan pihak terkait, sehingga kesannya ada sesuatu yang disembunyikan, makanya ada sebagian masyarakat kurang bisa menerimanya. Adapun lainnya, ada isu yang mencuat, masyarakat Desa Paya Rangkulueh sebenarnya tidak begitu mempermasalahkan terkait rencana pembangunan karena mereka sudah ada yang tahu rencana membangun gedung tersebut. Namun, mereka menyayangkan kesannya ada yang ditutupi. “Ada juga yang mengatakan ada orang dulu dia sangat menentang, namun tiba-tiba dia yang menjadi panitia pembangunan dan yang tidak bisa diterima, selain itu belum dimusyawarahkan dengan masyarakat desa setempat, makanya muncul polemik di tengah masyarakat dan bermuara kepada aksi seperti sekarang ini,” kata sebuah sumber Waspada. Seorang warga Desa Paya Rangkueluh yang tidak mau

namanya ditulis, mengatakan, warga desanya tidak mau masalah diselesaikan anarkis, walaupun warganya merasa keberatan dengan alasan tadi, namun kesannya tersembunyi itu yang berat diterimanya. “Warga kami heran dan bertanya-tanya saja, mengapa orang-orang yang sebelumnya tidak setuju tiba-tiba dia yang di depan sekarang ini, makanya begini jadi,” katanya. Informasi lainnya yang diperolah, terkait rencana pembangunan yayasan tersebut tokoh warga Desa Paya Rangkulueh telah mendatangi kantor Pemkab Bireuen serta Dinas Syariat Islam untuk bertanya, namun umumnya mereka ada yang menjawab tidak tahu rencana pembangunan. Demikian juga mereka juga telah ke Banda Aceh untuk menanyakannya, namun belum mendapat jawaban yang memuaskan mereka, sehingga masalah itu berujung kepada aksi pembakaran. Keterangan lain yang diperoleh, aksi itu ada pihak yang tunggangi karena kurang senang dengan rencana pembangunan yayasan tersebut, karena hadirnya yayasan tersebut akan mendidik generasi Islam untuk menjalankan ajaran Islam yang dibawa Nabi Muhammad yang sebenarnya. “Kami lihat ada ada pihak yang kurang senang lalu memprovokasi masyarakat dengan isu yang tidak jelas, seolah-olah yayasan itu akan akan membawa ajaran sesat, padahal itu hanya kekhawatiran saja dan memutarbalikkan fakta, dan semuanya sudah ditempuh sebagaimana prosudur termasuk masalah izin pembangunan,” kata sebuah sumber lainnya secara terpisah. Keuchik Desa Paya Rangkulueh, Murdani yang ditanya wartawan secara terpisah terlihat seperti berat berkomentar, namun secara singkat dia me-

ngatakan warga membakar jambo itu karena mereka belum bisa menerima dibangunnya taman pendidikan Ulumul Quran di kawasan desanya. “Saya sendiri juga kurang tahu titik permasalahannya, bahkan pihak yang akan membangun taman pendidikan Ulumul Quran belum berkoordinasi dengan kami,” katanya singkat. Camat Kutablang, Rusli Benprang mengatakan, masalah rencana pembangunan taman pendidikan Ulumul Quran itu sudah lama terjadi dan berlarut-larut, sehingga belum dapat diselesaikan. Namun saat ini pihaknya sedang mencari solusi yang terbaik untuk menyelesaikan masalah itu. “26 Mei 2012 lalu papan nama pembangunan taman pendidikan Ulumul Quran itu dibakar orang tak dikenal (OTK), kemudian 17 Juli 2012 sebuah gubuk tempat penginapan pekerja yang rencananya akan membangun taman pendidikan itu juga dibakar OTK. Dan terakhir kemarin jambo tempat duduk di lokasi yang sama dibakar massa,” katanya. Duduk Bersama Sementara itu, dalam dalam duduk bersama antara sejumlah tokoh yang diikuti Dandim 0111/Bireuen, Letkol Kav Asep Solihin, anggota Polres anggota Pos Polisi Kutablang, anggota Polsek Gandapura, dan para anggota Muspika dan tokoh masyarakat setempat, meminta kepada semua pihak untuk menahan diri dan persoalan itu harus diselesaikan dengan musyawarah. “Permasalahan yang terjadi di Paya Rangkuluh itu harus segera diselesaikan dengan musyawarah, supaya titik per-masalahannya menjadi jelas dan tidak ada yang dikorbankan. Maka rencana pembangunan Ulumul Quran harus dihentikan untuk sementara waktu sehingga ada titik temu,” tegas Dandim 0111/Bireuen. (cb02)

Waspada/Abdul Mukthi Hasan

GUBUK penginapan pekerja pembangunan sebuah yayasan di Desa Paya Rangkulueh, Kutablang, Bireuen, Kamis (19/7), rata dengan tanah dibakar massa.

KOTAJANTHO (Waspada) : Kepolisian Daerah Aceh bersama Badan Narkotika Nasional (BNN) memusnahkan 25 hektare tanaman ganja yang ditemukan di sejumlah lokasi di Kabupaten Aceh Besar. Pemusnahan tanaman haram itu berlangsung di tiga lokasi terpisah dipimpinWakapolda Aceh Brigjen Pol Setyanto secara simbolis di Gampong Meureu, Kecamatan Indrapuri, Aceh Besar, Rabu (17/7). Pemusnahan tanaman ganja siap panen itu turut disaksikan anggota DPR RI Farhan Hamid dan anggota DPD asal Aceh T Bahrum Manyak serta pimpinan sejumlah lembaga terkait. Dalam operasi di kawasan itu yang berlangsung beberapa hari sebelumnya, aparat kepolisian dari Direktorat Reserse Narkotika Polda Aceh dibantu Polres Aceh Besar menemukan tiga hektare ladang ganja berusia antara tiga sampai empat bulan dengan tinggi batang satu hingga dua meter. Dalam operasi tersebut, polisi tidak menemukan pemilik kebun ganja yang berlokasi sekitar 500 meter dari jalan desa.

Sementara di Gampong Lamteuba dan Lampanag, Kecamatan Seulimum, polisi memusnahkan 22 hektare ladang ganja dengan jumlah tanaman mencapai ratusan ribu batang ganja dan bibitnya yang baru disemai. Dalam penggerebekan terhadap ladang ganja di Lampanah, aparat kepolisian menangkap seorang warga yang diduga ikut menanam pohon ganja tersebut. Wakapolda Aceh Brigjen Pol Setyanto mengatakan, sejak 2011 hingga 2012, Polda Aceh telah memusnahkan 183 hektare tanaman ganja di Aceh. “Aceh Besar merupakan salah satu kawasan paling subur bagi tanaman ganja, dan yang menanamnya juga warga miskin. Mereka melakukan itu dengan harapan bisa memperoleh uang yang banyak dalam waktu cepat,” kata Wakapolda. Dirresnarkotika Polda Aceh Kombes Pol Deddy Prasetya Yudho mengatakan, pihaknya akan terus berupaya melakukan pemberantasan tanaman ganja di Aceh dan menyadarkan masyarakat agar tidak menjadikan menanam ganja menjadi kebiasaan. (b05)

BHR Aceh Gelar Rukyatul Hilal Di Pantai Lhoknga BANDA ACEH (Waspada) : Badan Hisab dan Rukyat (BHR) Kanwil Kemenag Aceh bersama Mahkamah Syar’iyah Aceh, MPU, Dinas/ Badan terkait, para ulama, pimpinan Ormas Islam, tokoh masyarakat, pimpinan pondok pesantren dan Kementerian Kominfo Pusat akan melaksanakan rukyatul hilal awal Ramadhan 1433 H, pada Kamis (19/7), atau bertepatan dengan 29 Sya’ban 1433 H. Dalam siaran pers Kanwil Kemenag Aceh diterima Waspada, Rabu (18/7), mengatakan, rukyatul hilal ini akan dilakukan di gedung Observatorium BHR Aceh, Pantai Lhoknga, Aceh Besar. Dari hasil pengamatan hilal ini, nantinya dilaporkan kepada pimpinan sidang Isbat awal Ramadhan di Jakarta, sebagai bahan pertimbangan pemerintah dalam penentuan itsbat 1 Ramadhan 1433 H. Selain di Pantai Lhoknga, rukyatul hilal untuk menentukan 1 Ramadhan tahun ini secara serentak dilaksanakan di 14 titik lainnya di seluruh Indonesia. Sementara data awal yang diperoleh dari Badan Hisab Rukyat Provinsi Aceh, berdasarkan penghitungan astronomis, ijtima’ awal bulan Ramadhan 1433 H terjadi pada pukul 11.25.25, pada Kamis tanggal 29 Sya’ban 1433 H/19 Juli 2012 M. Disebutkan, ketinggian hilal mar’iy untuk

markaz Pantai Lhoknga, Aceh Besar (pada posisi 5° 27’ 59” LU – 95° 14’ 32,2” BT ) adalah 1° 06’ (satu derajat enam menit) di atas ufuq. Dengan demikian, kesimpulan sementara keberadaan hilal tidak akan bisa dirukyat meskipun menggunakan alat bantu visual. Akan tetapi sesuai Standar Operasional Prosedur (SOP) Kementerian Agama, pengamatan hilal dalam menentukan 1 Ramadhan dan 1 Syawal tetap dilaksanakan sebelum sidang isbath dilakukan. Berdasarkan SOP itu, bila posisi hilal tidak bisa diamati melalui rukyat (pengamatan hilal), maka jumlah hari bulan Sya’ban 1433 H, digenapkan menjadi 30 hari kalender. Dengan demikian, awal puasa Ramadhan 1433 H jatuh pada hari Sabtu, 21 Juli 2012. Sementara untuk ijtima’ awal Syawal 1433 H, diperkirakan akan terjadi pada pukul 22.55.50 (pukul 22 lewat 55 menit lima puluh detik, yakni pada hari Jumat malam, tanggal 29 Ramadhan 1433 H atau masih tanggal 17 Agustus 2012 M. Dengan demikian, diperkirakan puasa Ramadhan 1433 H berlangsung selama 29 hari. Kecuali itu, Kakanwil Kemenag Aceh Ibnu Sa’dan mengimbau agar perbedaan penetapan 1 Ramadhan 1433 H oleh sebagian masyarakat tidak perlu disikapi secara berlebihan dan emosional. (b02)

Penetapan BPIH Menunggu Perpres BANDA ACEH (Waspada): Penetapan Biaya Penyelenggaraan Ibadah Haji (BPIH) tahun 2012 M/1433 H, masih harus menunggu Peraturan Presiden (Perpres) BPIH tahun 2012. “Berdasarkan keterangan Sekretaris Jenderal Kemenag RI, Bahrul Hayat, baru-baru ini di Jakarta, penetapan BPIH ini masih harus menunggu Perpres,” ujar Kakanwil Kemenag Aceh melalui Kasubbag Hukmas dan KUB, Juniazi, Rabu (18/7). Adapun pelunasan setoran haji akan turun pada awal bulan Ramadhan 1433 H dan pelunasan dapat dilakukan selama bulan Ramadhan. Kakanwil Kemenag Aceh juga mengimbau jamaah calon haji yang sudah mengikuti ma-

nasik dan sudah masuk dalam nominatif keberangkatan musim haji tahun ini, untuk mempersiapkan diri, khususnya kesehatan, manasik haji dan kesiapan dana untuk pelunasan. Kementerian Agama RI bersama KomisiVIII DPR RI telah menyepakati besarnya BPIH 2012M/ 1433H pada 10 Juli 2012. Untuk Provinsi Aceh, BPIH tahun 1433 H / 2012 M disepakati sebesar USD3.328 atau lebih tinggi USD 43, dibanding tahun sebelumnya yang hanya USD 3.285. Jika dikurskan USD 1, sama dengan Rp9.500, maka jumlah BPIH tahun 2012 untuk Provinsi Aceh yang harus dilunasi oleh masing-masing jamaah calon haji adalah lebih kurang Rp31.616. 000. (b02)

Jangan Jadikan Bulan Ramadhan Sebagai Alasan Tidak Bekerja Maksimal BIREUEN (Waspada) : Memasuki bulan suci Ramadhan segenap PNS harus mempersiapkan fisik dan mental tetap bekerja dengan baik dalam menghadapi moment-moment penting puasa Ramadhan dan mengikuti upacara HUT Kemerdekaan RI 17 Agustus yang dilaksanakan dalam bulan Ramadhan. Jangan jadikan bulan Ramadhan sebagai alasan bagi PNS untuk tidak bekerja maksimal. Demikian antara lain Kapolres Bireuen AKBP Yuri Karsono, SIK yang bertindak sebagai Irup dalam menyampaikan amanatnya pada upcara Hari Kesadaran Nasional di halaman Pendopo Bupati Bireuen Selasa (17/7). Upcara HKN turut dihadiri unsur Muspida, Sekda, para asisten, para Kadis, Kepala Badan, Kantor dan seluruh PNS di lingkungan Pemkab Bireuen. Dikatakan, upacara HKN yang dilaksanakan hari ini 17 Juli sebagai menyambut kedatangan bulan suci Ramadhan merupakan salah satu sarana penyempaian informasi dan upaya pembinaan dan peningkatan disiplin pegawai negeri sipil. Segenap PNS, pegawai honorer agar selalu mengikuti kegiatan upcara rutin tiap tanggal

17 setiap bulan. Dalam melaksanakan tugas dan tanggung jawab sehari-hari dapat memberikan contoh yang baik kepada masyarakat dalam semua aspek kehidupan yang tercermin dari sikap, perilaku, cara bergaul, tutur sapa dimanapun berada dalam membina hubungan baik dengan masyarakat. Dalam meningkatkan mutu pelayanan kepada masyarakat para PNS diharapkan dapat meningkatkan kompetisinya melalui diklatdi9klat sesuai dengan bidang tugas masingmasing serta meningkatkan kinerja melalui upaya belajar sambil bekerja. PNS juga diminta mempelajari produkproduk hukum terbaru sesuai bidang tugasnya masing-masing dan mengimplementasikan sesuai kewenangan dan ketetapan yang telah ditetapkan pwemerintah. Laksanakan program dan kegiatan yang telah direncanakan dengan tetap memperhatikan pertanggung jawaban yang benar dan tepat, terutama masalah keuangan. Di akhir amanatnya Kapolres mengucapkan “Selamat Melaksanakan Ibadah Pyuasa “ 1433 hijriah, bulan yang penuh rahmat dan magfirah. (b12)

BNN Bireuen Tampung Rehabilitasi Korban Narkoba BIREUEN (Waspada) : Kepala Badan Narkoba Nasional Kabupaten Bireuen drh Bani Amin, MM, mengimbau kepada masyarakat jika ada diantara keluarganya yang terjerumus menjadi korban narkoba diminta melapor ke BNN Kabupaten Bireuen untuk menjalani rehabilitasi kesehatannya. Masyarakat tak perlu takut melaporkan ke BNN karena rejhabilitasi kesehatan yang dilaksanakan BNN untuk menyelamatkan korban generasi bangsa dari ancaman bahaya narkoba terutama dari kalangan pemuda dan pemudi. Hal ini dikemukakan Kepala BNN drh Bani Amin MM menjawab pertanyaan Waspada di ruang kerjanya kantor BNN Kabupaten Bireuen Selasa (17/7). Dikatakan, pengedaran narkotika dan narkoba di Kabupaten Bireuen grafiknya masih menonjol hal ini dibuktikan masih menonjolnya kasus narkotika dan narkoba yang berhasil diringkus pihak aparat kepolisian, sehingga jumlah tahanan dan napi di Rutan Bireuen saat

ini masih didominasi tahanan dan napi narkotika dan narkoba. Dalam upaya menurunkan angka kriminalitas kasus narkotika dan narkoba pihak BNN Kabupaten Bireuen sudah melaksanakan program kegiatan antara lain advokasi dan implementasi tentang Inpres No 12 tahun 2011, ke setiap Instansi Pemerntah diikuti Kadis, Camat, para Koramil, para Kapolsek, lembaga swasta, Lsm dan Ormas. Advokasi diberikan kepada lembaga-lembaga agar dapat diimplementasikan oleh para pengambil kebijakan dilingkunagan masingmasing sesuai dengan tugas, fungsi dan kewenangan terhadap program pencegahan dan pembeerantasan penyalah gunaan peredaran gelap narkoba. Selama ini BNN Kabupaten Bireuen melakukan kegiatan penyuluhan ke setiap Instansi Pemerintah, siswa SMP, SMA dan mahasiswa agar menjauhi diri dan menolak narkoba yang sedang mengancam generasi bangsa, ujarnya. (b12)


Aceh

WASPADA Jumat 20 Juli 2012

B7

Irwandi Bicara Soal Rawa Tripa CUACA panas tak menyurutkan semangat para wartawan untuk datang ke Rumoh Aceh Kupi di kawasan Jeulingke, Banda Aceh, tempat konferensi pers yang digelar mantan Gubernur Aceh Irwandi Yusuf, Rabu (18/ 7). Menurut Thamrin Ananda, mantan juru bicara Seuramo Irwandi-Muhyan, konferensi pers digelar untuk menjelaskan perkembangan kasus pemukulan yang dialami mantan orang Waspada/ist

Kawasan Rawa Gambut Tripa di Kabupaten Nagan Raya yang kini menjadi konsesi HGU untuk kelapa sawit.

M Thaib, Keuchik Lamtui Terpilih KOTA JANTHO (Waspada) : M Thaib terpilih sebagai keuchik Gampong Lamtui di Kecamatan Kuta Cot Glie, Aceh Besar, periode 2012-2018. Dalam pemilihan yang berlangsung di meunasah setempat, Minggu (15/7), M Thaib meraih terbanyak dengan 148 suara, sedangkan dua calon lainnya, Tgk Ismail meraih 95 suara dan Mustafa memperoleh 11 suara, dan lima suara lainnya dinyatakan rusak atau tidak sah. Panitia pemilihan Mahdi, AMd mengatakan, proses pemilihan keuchik berlangsung tertib, aman dan lancar. Sehari sebelumnya, juga berlangsung pemilihan Keuchik Lamsie, kecamatan yang sama. Dalam pemilihan, persaingan ketat terjadi antara Mudasir dan Saidil Ambia yang pada akhirnya dimenangkan Mudasir dengan perolehan 146 suara. Sedangkan Saidil Ambia memperoleh 110 suara dan suara dinyatakan rusak. Pemilihan kedua keuchik kedua gampong tersebut turut disaksikan Camat Kuta Cot Glie Ilyas S.Pd dan sejumlah staf. Camat Kuta Cot Glie berharap kedua geuchik yang baru terpilih untuk benar-benar menjalankan amanah masyarakat di gampong itu sehingga bisa membawa kedua gampong tersebut kearah yang lebih maju. Sementara dari Kecamatan Kuta Cot Glie, Aceh Besar juga dilaporkan sejumlah mahasiswa dari perguruan tinggi Tgk. Chik Pante Kulu Banda Aceh sedang melaksanakan Kuliah Pengabdian Masyarakat (KPM) di kecamatan itu, Minggu (15/7) melakukan gotong royong bersama dalam rangka menyambut bulan suci Ramadhan 1433 H. Kegiatan yang dilaksanakan di sejumlah gampong seperti Ie Alang Dayah, Ie Alang Mesjid dan Ie Alang Lamghui, dipusatkan di rumah-rumah ibadah seperti masjid, mushalla serta jalanjalan desa. Selain mahasiswa, gotong royong itu juga melibatkan pemuda dan masyarakat setempat. (b05)

MJC AJI Banda Aceh Wisuda 168 Calon Jurnalis BANDA ACEH (Waspada) : Sekolah Jurnalistik Muharram Journalism College (MJC) AJI Banda Aceh mewisuda 32 lulusannya di lokasi wisata Jantho Baru, Aceh Besar, Minggu (15/7). Dengan demikian, sejak berdirinya tahun 2009, MJC telah meluluskan 168 mahasiswa. Di mana pada wisuda kali ini, tiga mahasiswa mencapai prestasi sebagai lulusan terbaik, masingmasing dua mahasiswa kelas televisi dan satunya lagi mahasiswa kelas cetak. MJC diresmikan pada 22 November 2008. Peresmian sekolah jurnalistik pertama di Aceh –dan juga perdana di lingkungan AJI di seluruh Indonesia dilakukan Bekti Nugroho dari Dewan Pers dan Debra Bucher dari Development and Peace, lembaga nirlaba di Kanada yang mendanai kehadiran sekolah ini. Sekolah ini terdiri atas tiga jurusan, yaitu Cetak, Televisi, dan Radio. Sejak hadir November 2008, MJC mendidik lebih dari 300 mahasiswa. Sebanyak 48 alumni sekolah ini bekerja di beberapa koran, televisi, media online, dan radio, lokal, nasional dan internasional serta film maker. Untuk lebih mengeratkan hubungan antara MJC dengan alumni, pada 1 Januari 2012 telah membentuk Forum Alumni MJC. “Sebenarnya banyak yang bisa dilakukan para alumni untuk mendatangkan perubahan di dunia jurnalistik,” ujar Maimun Saleh, Ketua AJI Banda Aceh saat wisuda. Seorang alumni MJC, bahkan kini sedang mengikuti pendidikan satu tahun komunikasi lanjutan yang merupakan beasiswa dari pemerintahan Turki. Saat ini, MJC sedang melakukan proses pendidikan untuk angkatanVIII dan merencanakan menjadikan kampus jurnalistik ini menjadi kampus dengan tingkat pendidikan Diploma I.(b04)

Rumah Korban Banjir Tangse Selesai Oktober 2012 SIGLI (Waspada) : 108 Unit rumah tipe 36 yang diperuntukkan bagi korban banjir bandang Tangse, Kabupaten Pidie, ditargetkan selesai Oktober 2012. Proyek pembangunan rumah dengan pagu senilai Rp8,1 miliar sedang dikerjakan PT Mandas Sejahtera, Sigli. Kepala Pelaksana Badan Penanggulangan Bencana Daerah (BPBD) Pidie, Rabu (18/7) menjelaskan, total rumah yang dibangun untuk masyarakat korban banjir bandang Tangse sebanyak 137 unit rumah. Sebab ada tambahan dana dari Otsus Provinsi Aceh 2012 senilai Rp1,950 miliar yang ditangani BPBA. “Rinciannya sebanyak 108 unit rumah didanai dana otonomi khusus (Otsus) Kabupaten Pidie 2012 senilai Rp8,1 miliar dan 26 unit rumah dari dana Otsus Provinsi Aceh 2012 senilai Rp1,950 miliar yang ditangani BPBA. Sedangkan tiga unit rumah lain dibangun pakai sisa dana tender tersebut. Kami perkirakan semua korban banjir Tangse tahap pertama akan mendapat rumah, BPBD Pidie yakin dana cukup,” ujarnya. Menurut dia, masyarakat korban banjir bandang Tangse yang sudah didata ini merupakan hasil verifikasi BPBD bersama Bina Marga dan Cipta Karya (BMCK) Pidie dan Badan Pertanahan Nasional (BPN), Bappeda, Dinas Sosial dan Muspika Tangse. (b10)

Mahlil Dan Nursyarifah Juara PTQ RRI Banda Aceh BANDAACEH (Waspada) : Mahlil dari kelompok putra dan Nursyarifah dari kelompok putri menjadi juara I cabang tilawah Pekan Tilawatil Quran (PTQ) yang digelar LPP-RRI Banda Aceh yang ditutup, Selasa (17/7) sore di auditorium RRI Banda Aceh. Kedua juara yang berasal dari Kabupaten Aceh Besar ini, akan diberangkatkan ke PTQ tingkat nasional yang dilaksanakan di Banjarmasin, Kalimantan Selatan pada 27-30 Juli 2012 mendatang, mewakili LPP-RRI Banda Aceh. Para juara selengkapnya adalah untuk kelompok putra masing-masing juara II Hendra (Banda Aceh), juara III Fitriadi (Aceh Besar) serta harapan I Zulfahmi dan harapan II Firmansyah, keduanya dari Aceh Besar. Sedangkan di kelompok putri juara II Aryana Irma (Banda Aceh), juara III Hernawati (Aceh Besar), serta harapan I Rahmawati dan juara harapan II Nurul Hadayah keduanya dari Banda Aceh. “Kepada juara I putra dan putri sebelum berangkat akan kita didik lagi sebagai persiapan untuk tampil di tingkat nasional. Makanya seleksi di daerah kita percepat sebelum puasa,” kata Muliono, Kepala LPP-RRI Banda Aceh. (b06)

nomor satu di Aceh itu pada saat menghadiri pelantikan Gubernur dan Wakil Gubernur Aceh di Gedung DPRA beberapa waktu lalu. Meskipun agenda utama adalah penjelasan mengenai perkembangan kasus tersebut, Irwandi Yusuf yang mengenakan kemeja lengan pendek warna biru muda dipadu celana warna krem, tidak menolak menjawab pertanyaan wartawan menyangkut hal lain, se-

Rekonstruksi Pembunuhan Staf TU SMP 3 Tangse Ricuh SIGLI (Waspada) : Rekonstruksi pembunuhan Ainal Mardiah, 40, staf Tata Usaha SMP Negeri 3 Kec. Tangse, Kab. Pidie yang digelar Mapolres Pidie, Kamis (19/7) diwarnai kericuhan. Keluarga korban berusaha menyerang pelaku saat proses rekonstruksi memasuki adegan keempat. Pantauan Waspada, selain berusaha menyerang pelaku, adik dan abang korban juga tak henti-hentinya mengeluarkan sumpah serapah. Meski diwarnai kericuhan proses rekonstruksi yang dimulai sekira pukul 09:00 dapat dilaksanakan hingga tuntas. Puluhan petugas mengawal rekonstruksi yang bertempat di belakang Kampus Universita Jabal Ghafur (Unigha), Cot Mane Gampong Cot Gapui Kec Indra Jaya. Dalam rekonstruksi yang memperagakan 9 adegan

tersebut terungkap, pembunuhan berawal dari keributan keduanya terkait permasalahan asmara. Saat itu korban yang terlibat keributan dengan pelaku turun sambil mematikan sepeda motor yang ditumpangi, lalu meninggalkan pelaku. Pelaku kemudian berusaha meraih kunci yang dilarikan korban sambil mencekik sehingga menewaskan korban. Kapolres Pidie AKBP Dumadi melalui Kasat Reskrim AKP Raja Gunawan mengatakan, rekonstruksi dilakukan guna melengkapi berkas pelaku sebelum diajukan ke jaksa. Dikatakan, pihaknya segera melengkapi berkas pembunuhan tersebut dalam waktu dekat. “Motifnya karena hubungan asmara. Memang keduanya memiliki hubungan. Tapi pembunuhan tidak direncana-

kan pelaku,” kata Raja Gunawan. Selain dari unsur reskrim Polres Pidie, rekonstruksi juga dihadiri Jaksa Penuntut Umum Kejari Pidie T Imam Mulhakim. Rekonstruksi juga disaksikan puluhan warga yang tinggal di sekitar lokasi pembunuhan. Dalam rekonstruksi korban Ainal Mardiah yang merupakan warga Blang Dhot Tangse diperankan Polwan dari Mapolres Sigli. Usai membunuh kekasihnya, pelaku kemudian membuang jasad Ainul Mardiah ke semak-semak. Penangkapan Saidul Bahri dilakukan dua Minggu usai penemuan jasad Ainul Mardiah 1 Juni lalu.Pelakudijemputdirumahnya 15 Juni lalu dan langsung ditahan di Mapolres Pidie.“Pelaku dijerat Pasal 338 KUHP, dengan pidana 15 tahun kurungan,” papar Raja Gunawan.(cb06)

Penyaluran BOS Di Aceh Besar Belum Transparan BANDA ACEH (Waspada): Lembaga Pusat Telaah dan Informasi Regional (PATTIRO) Aceh menemukan berbagai masalah dalam penyaluran dan penggunaan Bantuan Operasional Sekolah (BOS) di Kabupaten Aceh Besar. Banyak sekolah belum transparan dalam mengelola dan menggunakan dana tersebut. Direktur PATTIRO Aceh, Teuku Zulyadi mengatakan, keterlibatan komite sekolah sebagai representatif masyarakat atau orangtua siswa dalam pe-

ngawasan dana BOS juga masih minim sehingga sangat rentan terjadi penyalahgunaan. “Beberapa temuan fakta yang menjadi masalah dalam sistem penggunaan dana BOS ini, menurut kami harus segera ditindaklanjuti dan diselesaikan instansi terkait,” kata Zulyadi di Banda Aceh, Kamis (19/7). Berdasarkan data triwulan II 2012 dari Dinas Pendidikan Provinsi Aceh, total dana BOS yang disalurkan di Aceh Besar mencapai Rp5.659.215.000, terdiri dari jenjang pendidikan SD

Rp3.892.380.000 dan SMP Rp1.766.835.000. Jumlah SD penerima dana BOS sebanyak 204 unit sekolah dengan jumlah siswa mencapai 26.844 orang, sedangkan SMP sebanyak 64 sekolah dengan total siswa 9.954 orang. Menurut Zulyadi, meski itu dana publik, masih banyak sekolah yang belum terbuka dalam pengelolaan dan penggunaan dana BOS. Seharusnya informasi penggunaan dana itu harus transparan dan mudah diakses. (b04)

SMS Bantuan Meugang Beredar BANDA ACEH (Waspada): Menjelang hari meugang, mulai beredar pesan singkat (SMS) terkait adanya pembagian uang meugang dari Gubernur Aceh Zaini Abdullah dan Wagub Muzakir Manaf. SMS yang beredar itu mengatasnamakan ustadz Muzakir Hamid, ajudan gubernur. “Kami beritahukan isu SMS itu tidak benar,” ungkap Usamah El-Madny menanggapi SMS itu, Selasa (17/7) di Banda Aceh. SMS singkat itu seakanakan bersumber dari ajudan gubernur yang menyebutkan

‘Dengan terpilih gubernur dan wagub wakil dari Partai Aceh sebagai kepala Pemerintahan Aceh, dengan ini kami beritahu kepada seluruh bangsa Aceh, kita akan mengadakan syukuran dengan pembagian daging meugang dan uang bumbu, khusus untuk masyarakat dengan KTP Aceh, harap segera datang ke kantor gubernur untuk mengambil bantuan meugang sebanyak Rp800.000 per kepala keluarga’. “Pesan SMS itu beredar dalam bahasa Aceh dan Indonesia. Efek dari penyebaran SMS oleh

orang yang tidak bertanggungjawab tersebut, membuat gelombang masyarakat yang berdatangan ke kantor Gubernur Aceh semakin meningkat,” kata Usamah. Isu itu, kata Usamah, dapat merugikan Pemerintah Aceh dan masyarakat sendiri yang harus menghabiskan waktu dan uang untuk ongkos menuju kantor Gubernur Aceh. Karena itu, pihaknya mengharapkan masyarakat lebih selektif dan berhati-hati terhadap isu yang beredar menyambut Ramadhan dan menjelang Idul Fitri 1433 mendatang. (b06)

H HARUN Keuchik Leumiek, nama yang sangat populer di Aceh. Terutama menyangkut asesoris perhiasan emas. Toko beliau menjadi incaran kaum perempuan yang menggemari perhiasan emas Pinto Aceh. Usahanya di bidang logam mulia ini merupakan estafet yang diterimanya dari ayahnya, almarhum H Keuchik Leumiek. Harun yang tak tamat Fakultas Ekonomi Unsyiah ini pada tahun 1978 harus meneruskan usaha tersebut. Berbekal kejujuran, Harun menjalankan usaha perhiasan emas dan souvenir itu hingga saat ini. Kejujuran itu merupakan amanah ayahnya. Jadi bagi Harun kejujuran tidak bisa ditawar-tawar oleh siapapun. Laki-laki kelahiran Banda Aceh, 19 September 1942 ini bersama sang istri Hj Salbiah Husein terus menggeluti usaha perhiasan yang dibantu anak lakilaki semata wayang, Muhammad Kamaruzzaman. Kisah kehidupannya sebagai pebisnis emas perhiasan itu tertuang dalam buku yang ditulis Nab Bahany As ‘Harun Keuchik Leumiek, PenyelamatWarisan Budaya’ cetakan kedua terbitan 2012 yang diluncurkan beberapa pekan lalu. Buku setebal 245 halaman mengupas habis sosok Harun Keuchik Leumik, mulai dari kehidupannya, usaha yang dijalankan, kolektor, keterlibatan dalam organisasi, sosial hingga

berujung sebagai wartawan. Di sela-sela menjalankan bisnis logam mulia, Harun ternyata sangat popular sebagai kolektor barang antik peninggalan sejarah di Aceh. Rasanya kemana pun ada informasi barang peninggalan sejarah pasti diburunya. Beragam barang antik peninggalan sejarah Aceh yang berusia 100 hingga 400 tahun itu terpajang rapi nan indah di kediaman pribadinya di Gampong Lamseupeng, Kecamatan Lueng Bata, Banda Aceh. Bagi Harun, barang sejarah yang tak ternilai harganya perlu diselamatkan. Ia menyatakan bersalah pada indatunya (nenek moyang), bila benda-benda sejarah yang dulu sangat bernilai tidak diselamatkan untuk generasi mendatang. “Kita akan tahu apa yang diperbuat dan sejauh mana keberhasilan peradaban indatu yang pernah mereka bangun di masa lalu untuk menjadi iktibar membangun masa depan,” paparnya dalam buku itu. Karena keinginan yang kuat untuk menyelamatkan benda bersejarah, membuat Harun harus berburu barang antik sampai pelosok dan kaki gunung. Suka duka berburu barang berharga ini tertutur jelas dalam buku tersebut. Pengalaman yang tidak menyenangkan bagi Harun dalam mengoleksi barang antik ini adalah kerap dikelabui (ditipu). Bukan saja oleh orang-orang

yang tidak dikenalnya, tapi orang-orang yang dikenalinya ikut menipunya. Ia mengakui hobi mengoleksi barang antik itu pada awalnya kurang pengalaman sehingga dalam beberapa kasus ia rela tertipu. Tapi semangatnya tidak pernah surut dalam berburu barang peninggalan sejarah Aceh. Lalu kapan Harun menggeluti dunia jurnalistik? Buku ini juga mengisahkan bagaimana laki-laki yang mempunyai empat putri dan satu putra, berkelana sebagai profesi wartawan hingga berusia 70 tahun sekarang ini. Ia tercatat sebagai wartawan harian Analisa Medan, yang karir jurnaslitiknya dimulai di Mimbar Swadaya 1970-1972. Kemudian berkenalan dengan Muhammad TWH saat datang ke Aceh sebagai wartawan harian Mimbar Umum. Harun berkiprah di Mimbar Umum tahun 1972-1973. Lalu pindah ke harian Analisa dengan alasan harian itu fokus pada bidang ekonomi. Sehingga sejumlah jabatan di Persatuan Wartawan Indonesia (PWI) Cabang Aceh disandangnya. Penutup buku yang diterbitkanYayasan Pendidikan Haji Keuchik Leumiek ini memuat sejumlah tulisan dari kolega dan sahabatnya, tentang sosok Harun Keuchik Leumik. Buku ini memberi inspirasi bagi orang yang ingin sukses.

Berprinsip Jujur, Tapi Kerap Dikelabui

Muhammad Zairin

perti kasus Rawa Tripa. Menurut Irwandi Yusuf, kasus Rawa Tripa merupakan sesuatu sangat disayangkan. Mantan Gubernur Aceh ini mengaku, permohonan PT Kalista Alam untuk mengelola lahan di kawasan Rawa Tripa itu sudah berkali-kali ditolaknya, sampai akhirnya ia menandatanganinya. “Itu sudah berkali-kali saya tolak, sudah hampir dua tahun dan kemudian muncul surat

pernyataan dari polisi bahwa itu barang tidak bermasalah, malah saya bisa di-PTUN-kan karena semua syarat sudah lengkap,” kata Irwandi Yusuf. Ia menyebutkan, sebelum izin itu ditandatanganinya, ia sempat mengkroscek ke Acehgreen dan ternyata Rawa Tripa yang dimaksud ini tidak termasuk peta moratorium yang dikeluarkan Presiden melalui Keppres. “Saya juga meminta pertim-

bangan analisis dari pihak Kehutanan tentang Kawasan Ekosistem Leuser dan ternyata itu sudah ada izin sebelumnya. Yang saya keluarkan adalah izin prinsip, sedangkan izin HGU itu dikeluarkan oleh pusat,” kata Irwandi. Kalau ternyata perusahaan tersebut tidak mengurus HGU dan langsung melakukan penebangan, kata Irwandi, adalah tanggungjawab perusahaan itu sendiri. (b05)

Calon Bidan PTT Aceh Tengah Kembali Datangi DPRK TAKENGEN (Waspada) : Merasa tidak puas dengan hasil tuntutan sebelumnya, calon bidan Pegawai Tidak Tetap (PTT) Aceh Tengah, kembali mendatangi DPRK setempat dengan jumlah massa yang bertambah, Kamis (19/7). Sebelumnya, hanya 26 calon bidan PTT yang mengadu ke DPRK untuk mengusut persoalan SK yang belum jelas keabsahannya dari pihak terkait. Namun, pada kedatangan kedua ini diperkirakan sebanyak 58 calon berikut sebagianorangtuabidanmendatangikantorDPRK untuk meminta kejelasan mengenai pengumuman SK yang mereka dapat via situs internet. Dalam pertemuan antar calon bidan PTT dengan anggota dewan di ruang sidang Kantor DPRK Aceh Tengah ini, mencuat dualisme data yang dipertanyakan mengenai teknis pengiriman berkas yang dilakukan Dinkes setempat. “Kenapa sewaktu berkas dikirim ke provinsi

terdapat versi berbeda. Di mana satu berkas diusulkan pengelola bidan Dinkes Aceh Tengah, dan satu lagi diajukan Kadiskes Aceh Tengah (Dr Sukri Maha),” ungkap calon bidan PTT di hadapan anggota DPRK Aceh Tengah yakni M Ridwan, Wajadal Muna, Bardan Sahidi dan Musa AB. “Hasil tes itu menyangkut masa depan anak kami itu. Karena itu jangan buat kami bigung, berkas mana yang benar. Selain itu bagaimana dengan keabsahan SK yang telah menyatakan kelulusan bidan PTT ini,” imbuh Zailani, orangtua calon bidan di ruang pertemuan DPRK itu. M Ridwan, anggota DPRK Aceh Tengah yang menanggapi keluhan para calon bidan PTT ini menyebutkan, akan segera membentuk tim Panitia Khusus (Pansus) untuk menelusuri dualisme persoalan pengajuan berkas yang disampaikan para calon PTT tersebut. (cb09)

Irwandi Yusuf : Saya Masih Percaya Polisi Usut Kasus Pemukulan BANDA ACEH (Waspada) : Mantan Gubernur Aceh Irwandi Yusuf menyatakan, dirinya masih mempercayai polisi untuk mengusut tuntas pemukulan yang diduga dilakukan sekelompok orang usai menghadiri pelantikan Gubernur dan Wakil Gubernur Aceh di gedung DPRA, beberapa waktu lalu. Dalam penjelasan kepada wartawan di Rumoh Aceh Kupi, kawasan Jeulingke, Banda Aceh, Rabu (18/7), Irwandi mengatakan, meskipun kasus tersebut saat ini sudah ditangani pihak kepolisian, namun hingga saat ini dirinya belum mengetahui kelanjutan proses kasus tesebut. “Yang memukul saya banyak, tapi belum tahu apakah semua yang terlibat sudah ditangkap atau belum. Kalau kasusnya dianggap selesai dengan ditangkapnya pelaku satu orang, itu belum kelar, karena yang pukul saya banyak. Kalau dikatakan pelakunya satu orang masyarakat sipil, itu salah besar karena rekaman video mengatan sebaliknya,” kata IrwandiYusuf yang baru saja tiba dari Jakarta. Irwandi berharap, pihak kepolisian dapat mengungkap kasus pemukulan yang menimpa dirinya dengan jelas. “Saya tidak mau kasus ini dipendam-pendam atau dimain-mainkan. Kalau kasus yang menimpa saya bisa dibuat seperti itu, bagaimana kalau kejadian ini menimpa rakyat biasa,” ujarnya. Mantan Gubernur Aceh itu lebih lanjut mengatakan, dirinya menyesalkan sikap Kapolda Aceh Irjen Pol Iskandar Hasan yang dinilainya tidak bersikap tegas, karena sebelum penembakan terhadap Saiful alias Cage, para pekerja kebun dan pekerja asal luar Aceh terjadi, dirinya sudah menyampaikan kepada Kapolda Aceh dalam rapat Muspida yang dihadiri Pangdam Iskandar Muda agar mengusut tuntas pembunuhan terhadap Hanafiah, warga negara Norwegia. “Sebagai informasi awal sudah saya sampai kelompok-kelompok mana saja yang diduga terlibat dalam penembakan tersebut. Saat itu

kapolda mengatakan ya.Waktu itu saya katakan, kasus pembunuhan ini berhasil dibuka, maka pembunuhan-pembunuhan di masa depan tidak akan terjadi. Namun, Kapolda Aceh tidak menindaklanjuti,” ungkapnya lagi. Irwandi Yusuf mengatakan, pihaknya juga telah menyampaikan kepada Kapolda bahwa pelaku penembakan terhadap Hanafia adalah kelompok Ayah Banta dan Joni. “Jadi ini sudah saya sampaikan sebelum Ayah Banta tertangkap, sebelum Cage terbunuh dan sebelum yang lainnya tertembak dan terbunuh,” katanya. Tentang langkah yang dilakukannya terhadap kasus pemukulan yang dialami, Irwandi mengatakan, dirinya hanya bisa menunggu hasil kerja polisi. “Saya hanya wait and see, kita percayakan saja pada kerja polisi dalam mengungkapkan kasus tersebut,” sambungnya seraya menambahkan, selain kepada Polri, kasus pemukulan yang dialaminya juga telah disampaikan kepada Menko Polhukam dan Mendagri. Irwandi juga menambahkan, sebenarnya kasus pembunuhan atau penembakan di Aceh dapat dicegah apabila apa yang disampaikannya dalam rapat Muspida ditindaklanjuti. Irwandi juga mengakui, dia tidak ingat berapa orang yang memukulnya saat itu. “Ada satu yang saya ingat wajahnya, tapi dia tidak memukul, dia malah merelai. Dan satu lagi orang yang berinisial HGK, dia yang memprovokasi untuk memukul saya,” ujarnya lagi. Irwandi juga mempertanyakan keberadaan Satgas Partai Aceh yang ikut melakukan pengamanan koridor tempat tamu lewat menuju ruang acara pelantikan Zaini Abdullah dan Muzakir Manaf yang pada dasarnya adalah tugas dan kewenangan polisi. Soal keberangkatannya ke Malaysia pasca kejadian itu, Irwandi Yusuf mengatakan hanya untuk menenangkan situasi agar tidak terjadi balas membalas akibat pemukulan tersebut. (b05)

Polda Aceh : Kasus Pemukulan Irwandi Masih Diselidiki BANDA ACEH (Waspada): Menanggapi pernyataan mantan Gubernur Aceh Irwandi Yusuf yang menilai Kapolda Aceh Irjen Pol Iskandar Hasan lamban dalam menindak lanjuti berbagai aksi kekerasan bersenjata yang terjadi di Aceh beberapa waktu lalu, termasuk pemukulan terhadap dirinya, Kabid Humas Polda Aceh Kombes Pol Gustav Leo mengatakan, semua sudah ditangani oleh Polda Aceh sesuai aturan hukum. “Semua sudah ditangani sesuai aturan hukum serta alat bukti berdasarkan fakta hukum, jadi bukan katanya-katanya. Semua info yang disampaikan perlu dianalisa dan didalami dengan ada atau tidak faktanya, untuk kasus

yang terjadi semuanya diajukan ke sidang,” kata Gustav Leo, Kamis (19/7). Terhadap proses persidangan, Kabid Humas mempersilahkan masyarakat dan semua pihak melihat langsung di pengadilan. “Silahkan dilihat di pengadilan dan persidangan itu terbuka untuk publik. Jadi, tidak benar kalau disebutkan bahwa polisi menutup-nutupi atau tidak menindaklanjuti setiap info yang disampaikan. Semua itu butuh waktu dan bukti-bukti yang cukup,” ujarnya. Menyangkut pemukulan terhadap Irwandi Yusuf, menurut Kombes Pol Gustav Leo, saat ini sedang dalam proses penyidikan dan pengembangan. (b05)

Ketua DPP PPRN Hadiri Pelantikan Bupati Aceh Singkil SINGKIL (Waspada): Konflik di tubuh internal Partai Peduli Rakyat Nasional (PPRN) masih berlanjut. Kini proses sidang gugatan terhadap Menteri Hukum dan HAM Amir Syamsudin di Pengadilan tata usaha negara (PTUN) Jakarta, Demikian disebutkan ketua DPP PPRN Amelia Ahmad Yani kepada Wartawan usai menghadiri pelantikan H Safriadi dan Dulmusrid sebagai Bupati/Wakil Bupati Aceh Singkil periode 2012 -2017 di Gedung DPRK Kampung Baru Singkil Utara Menurut Amelia, masalah Ketua DPP PPRN yang dituding tidak sah itu, merupakan konspirasi busuk antara Menkumham Amir Syamsudin dengan DL Sitorus. “Kami menggugat Menkumham di PTUN Jakarta karena terkesan ada konspirasi,” tegas putri Jenderal anumerta Ahmad Yani itu. Dari sebelas kali persidangan yang telah berlangsung, terlihat adanya banyak konspirasi,

tambah Amelia Ketua DPP PPRN versi pertama. Kubunya kini menunggu hasil putusan sidang yang akan dilaksanakan 24 Juli 2012 mendatang Amelia mengklaim PPRN Aceh mulai dari DPW Provinsi, DPD Kab/ kota dan anggota legislatif disana masih solid, meski ada satu anggota yang disebut mbalelo padanya Kedatangan Amelia saat pelantikan Bupati/ Wakil bupati Aceh Singkil itu terkait PPRN merupakan satu dari empat partai pengusung pasangan yang dilantik bersama Golkar, PBR dan PPD. ‘’Kami mendukung pasangan H Safriadi dan Dulmusrid karena punya program bagus Saya tadi telah berbicara dengan beliau katanya akan segera melaksanakan semua program yang menyentuh ekonomi rakyat, sesuai visi dan misinya. Latar belakangnya sebagai seorang pengusaha yang telah berhasil dan semoga dia menjadi pemimpin yang tidak mengedepankan cari uang,’’ harap Amelia. (b27)


Aceh

B8

WASPADA Jumat 20 Juli 2012

PLN Upayakan Tak Ada Pemadaman

Mahasiswa Kecewa Pembangunan Jalan Dewantara-Nisam

IDI (Waspada) : PLN Ranting Idi berupaya untuk tidak terjadi pemadaman selama bulan suci Ramadan, lebih-lebih di saat umat Islam sedang meramaikan rumah ibadah seperti shalat tarawih dan tadarus. “Dalam upaya menghindari pemadaman, PLN Ranting Idi dengan wilayah kerja dari Madat (perbatasan Aceh Utara-Aceh Timur) hingga ke Alue Batee, Kecamatan Peudawa telah merintis segala bentuk gangguan seperti pohon kayu di pinggir jalan,” papar Manager PLN Ranting Idi, Mukhtar Yunus, Kamis (19/ 7). Dia menjelaskan, rintisan yang dilakukan terutama pohon dan cabang kayu di pinggir jalan negara dan jalur aliran listrik yang tersentuh kabel bertegangan tinggi yang mengganga. “Bahkan ketika terjadi korslek mengakibatkan saklar putus hingga menyebabkan laju arus sehingga harus dirintis di seluruh wilayah kerjanya, bahkan hingga ke kecamatan,” tutur Mukhtar. Namun demikian, dia mengharapkan masyarakat segera menginformasikan ke pihak PLN ataupun petugas PLN di lapangan jika terjadi pemadaman. “Kadang bukan pemadaman, tapi padam akibat sekring pada travo putus,” kata Mukhtar. (b24)

LHOKSEUMAWE (Waspada) : Mahasiswa Kecamatan Nisam, Aceh Utara yang tergabung dalam Gerakan Persatuan Mahasiswa Nisam (Gapma) kecewa dengan pembangunan jalan strategis yang dinilai sarat kepentingan. Kerusakan terparah dinilai terjadi di kawasan Nisam, namun Pemkab malah melakukan pembangunan di Dewantara. “Ini benar-benar aneh. Pembangunan daerah betul-betul tidak berdasarkan kebutuhan masyarakat,” ungkap Ketua Gapma, Bustami, Rabu (18/7). Dari hasil telurusan para mahasiswa, pembangunan dimulai dari Dewantara untuk kepentingan penggunaan dana aspirasi dewan setempat. “Jalan tidak bisa dibangun dari Nisam karena kepentingan dewan asal Dewantara,” ungkapnya kembali. Pembangunan jalan senilai Rp1,4 miliar selesai dikerjakan sekitar 1 kilometer mulai dari Simpang Empat Dewantara menuju Nisam. Sebelumnya, menurut Bustami, pemerintah setempat merencanakan pembangunan di Nisam. Namun karena kepentingan lain, pembangunan awal dialihkan ke Dewantara. Kepala Bidang (Kabid) Jalan dan Jembatan Dinas Bina Marga Aceh Utara Muhammad Hasan menjelaskan, pembangunan jalan dimulai di Dewantara atas persetujuan wakil rakyat dari dua kecamatan tersebut. “Kita bekerja sesuai dengan aturan,” tegasnya.(b15)

Dayah Amal Rayakan Haul X PEUREULAK (Waspada) : Dayah Amal Peureulak Barat, Kabupaten Aceh Timur merayakan Haulnya X yang diikuti ratusan santri dan wali santri yang dihadiri unsur muspika setempat dipusatkan di halaman Masjid Manzilul Minan, Kamis (19/7). Kegiatan haul itu diawali dengan doa bersama dengan niat untuk seluruh keluarga yang sudah tiada. Selanjutnya diiringi dengan tausyiah akbar dalam rangka menyambut bulan suci Ramadan tahun 2012. Usai seluruh kegiatan di dalam masjid, para tamu dan undangan serta para santri melanjutkan dengan makan siang bersama. Ketua Yayasan Dayah Amal Peureulak Tgk Armis Muda mengatakan, Dayah Amal kini telah tersedia berbagai macam sarana pendidikan, mulai dari pengajian Alquran dan kitab. Tak hanya itu, Dayah Amal juga telah memadukan dengan sekolah umum seperti pendidikan tingkat SD, SMP, SMK dan MAN. (b24)

Polres Amankan Tangki Bodong BLANGKEJEREN (Waspada) : Aparat Polres Gayo Lues, Rabu (18/7) mengamankan sedikitnya empat unit mobil dan dua unit roda dua yang diduga menggunakan tangki modifikasi ketika mengantri di SPBU Raklunung. Penangkapan bermula ketika personil Polres Gayo Lues melakukan penjagaan di sekitar SPBU itu. Seiring sulitnya mendapatkan BBM jenis bensin di Gayo Lues. Jenis kendaraan yang diamankan itu, satu unit mobil jenis sedan, tiga unit jenis Toyota kijang. Keempat mobil kini diamankan di Mapolres Gayo Lues. Kapolres Gayo Lues AKBP Sofyan Tanjung mengatakan, penertiban dilakukan guna mengantisipasi penimbunan minyak yang selama ini dicurigai ada pihak yang bermain. (cjs)

PA Aceh Singkil SantuniAnak Yatim SINGKIL (Waspada) : Jajaran Dewan PimpinanWilayah Partai Aceh (DPW PA) Aceh Singkil menyantuni anak yatim dengan menyerahkan daging menyambut meugang, Kamis (18/7) di halaman Kantor DPW PA Pulo Sarok, Singkil. Ketua DPW PA Aceh Singkil Sarbaini didampingi sekretaris Abdul Gafur secara bersama dengan masyarakat sekitarnya memyembelih dua ekor kerbau untuk santunan meugang sekaligus menyambut datangnya bulan suci Ramadhan. Gafur di Singkil menyebutkan, suasana ceria dan suka cita terbersit di wajah puluhan anak yatim dari 11 kecamatan yang ada di Aceh Singkil pada acara itu. (b27)

Panther Tujuan Medan Tabrak Pagar KUTA TENGAH (Waspada) : Mobil pribadi jenis Isuzu Panther BK 1138 DF berisi seorang penumpang dan sopir tujuan Medan, Sumut, menabrak pagar Kolam Pancing Desa Kuta Tengah, Rabu (18/7). Tak ada korban jiwa dalam kejadian itu, mobil rusak ringan. Peristiwa laka lantas tunggal persis di tikungan manis Kolam Pancing Desa Kuta Tengah dan lokasi Pembangunan Makodim (sekira 4 km dari pusat Kota Subulussalam) itu mendapat perhatian warga meski dalam suasana gelap. Saksi mata di Tempat Kejadian Perkara (TKP) mengatakan, mobil melaju dengan kecepatan tinggi dan diduga sopir kurang menguasai medan sehingga menabrak pagar kawat kolam. Diakui, lokasi terkait selama ini rawan laka lantas (tunggal), sementara lampu penerang minim. (b28)

Pejabat Eselon IV Kejari Tandatangani Fakta Integritas LANGSA (Waspada): Menyambut HUT ke-52 Adhiyaksa, Kejaksaan Negeri Kota Langsa beserta jajarannya melakukan penandatanganan fakta integritas pejabat eselon IV di aula kantor tersebut, Rabu (18/7). Pendatanganan fakta integritas yang dilakukan pejabat eselon IV Kejari Langsa, yakni Kasubbag Pembinaan Zulfan, Sag.SH, Kasi Intelijen Adi Tyogunawan, SH. MH, Kasi Pidum Putra Masduri, SH, Kasi Perdata dan TUN Isnawati, SH disaksikan Kepala Kejaksaan Negeri Langsa Adonis, SH.MH. Menurut Adonis, pernyataan itu berisikan poin-poin penting yang bertujuan untuk menggugah kembali dan sebagai introspeksi diri agar dalam melaksanakan tugas mereka sesuai tupoksi dan mengedepankan hati nurani, serta menghindari diri dalam perbuatan tercela dan mengedepankan kepentingan hati nurani. “Penandatangan integritas ini dilaksanakan semua eselon, baik itu eselon I, II, III dan IV, untuk eselon IV dilaksanakan di Kajati, sedangkan eselon lainnya dilaksanakan di Kajari masingmasing,” terangnya. Dalam kaitan peringatan HUT ke-52 A Adhiyaksa, Kasi Intelijen Adi Tyogunawan, SH. MH mengatakan, dalam kaitan peringatan HUT ke-52 Adhyaksa, Kejaksaan Tinggi Langsa dan jajarannya melakukan bakti sosial (tali kasih) kepada anak yatim piatu di Panti Tabina Besama, pelaksanaan donor darah bekerjasama dengan PMI dan melakukan silaturahmi dengan internal Kejaksaan dan melaksanakan ke Taman Makam Pahlawan bersama Ketua Ikatan Adhyaksa Dharma Karini. (m43)

KIP Aceh Timur Bubarkan 1.749 PPK Dan PPS IDI (Waspada): Setelah dianggap selesai dari segi adminitrasi Pemilukada 2012, Komisi Independen Pemilihan (KIP) Kabupaten Aceh Timur akhirnya membubarkan dengan resmi Panitia Pelaksana Kecamatan (PPK) dan Panitia Pemungutan Suara (PPS) se Aceh Timur, Rabu (18/7). Kegiatan pembubaran itu dilakukan setelah pihak KIP melakukan evaluasi, pelapor serta pengawasan hasil pelaksanaan Pemilukada Tahun 2012. Kegiatan yang berlangsung di Aula SKB Aceh Timur di Idi Timur itu dihadiri Ketua dan Komisioner KIP Aceh Timur, Asisten I Setdakab Aceh Timur Muhammad, SH.MH, Kabag Ops Polres Aceh Timur Kompol H. Ramlan dan mewakili dari Dandim 0104 serta Kejari Idi. Ketua KIP Aceh Timur, Iskandar, SAg dalam sambutannya menjelaskan, kegiatan evaluasi ini untuk berbagi informasi dan melakukan koreksi secara keseluruhan terkait aktivitas Pemilukada yang telah dilaksanakan. “Pembubaran dan evaluasi ini merupakan tahapan terakhir dalam pelaksanaan Pemilukada 2012 yang dimenangi pasangan Hasballah M. Thaib - Syahrul Syamaun,” kata Iskandar seraya menyebutkan, seluruh honor PPP dan PPPS akan diselesaikan oleh KIP sekaligus dengan pembubaran. (b24)

Nasib Nelayan Aceh Belum Jelas

Waspada/Mustafa Kamal

DELEPAN unit truk tronton pengangkut pupuk subsidi pemerintah yang diselundupkan diamanakan di depan Mapolsek Dewantara, Aceh Utara, Kamis (19/7)

8 Truk Tronton Pupuk Bersubsidi Diamankan LHOKSEUMAWE (Waspada) : Delapan truk pupuk subsidi pemerintah milik PT Pupuk Iskandar Muda (PIM) Lhokseumawe diamankan polisi di pelabuhan PT AAF Krueng Geukueh, Aceh Utara, Rabu (18/7) sekira pukul 22:00. Sopir, truk dan pupuk kini diamankan di Mapolsek setempat. Pantauan Waspada, Kamis (19/7), delapan unit truk bernomor polisi masing-masing BL 9520 KB, BL 8858 ZY, BL 8593 AH, BL 9521 KB, BK 8069 PH, B 9010 EU, B 9362 JP dan B 9601 AA. Delapan truk ini masih sita polisi di depan Mapolsek Dewantara, Aceh Utara. Begitu juga delapan sopir sedang dimintai keterangan oleh polisi.

Sementara barang bukti berupa pupuk masih ditutup terpal di dalam truk. Hanya satu truk paling belakang yang sudah dibuka berisi sekitar belasan karung pupuk urea subsidi pemerintah produksi PT PIM. Menurut keterangan warga, truk tersebut sebagian pupuk sudah dibongkar. Secara terpisah hasil informasi, di pelabuhan PT AAF Krueng Geukueh yang tak jauh dari Mapolsek dan PT PIM, telah bersandar satu kapal tongkang yang diduga kuat pupuk 200 ton lebih tersebut akan dibongkar ke dalam kapal ini. “Kami tidak bisa melarang truk-truk tersebut yang masuk ke pelabuhan. Karena pelabuhan ini bukan termasuk dalam tugas kami, pelabuhan tersebut milik PT Pelabuhan Indonesia (Pelindo). Jadi, karena punya umum kami tidak bisa mela-

rang truk-truk tersebut,” ujar petugas penjagaan pintu PT AAF. Sementara ABK kapal memberi keterangan bahwa kapal mereka tidak terkait dengan masalah penyelundupan pupuk ini, mereka sedang mogok sudah dua hari dan disandarkan ke pelabuhan tersebut. Pengakuan kapten kapal, kapal mereka sedang mogok dan malam itu ingin berangkat kembali karena sudah diperbaiki,” katanya di Maplosek. Begitu juga, penelusuran ke gudang penampungan pupuk di Gampong Bangka Jaya terpaut sekitar 800 meter dengan Mapolsek. Di gudang tersebut ditemukan dua unit truk tronton yang sudah terjebak tanah liat. Begitu juga di samping truk sudah bertumpuk ratusan karung pupuk urea. Sementara gudang ini, sudah dipasang police line oleh polisi.

Kapolres Lhokseumawe Kukuh Santoso melalui KapolsekDewantaraIptuSofyanmenuturkan, mereka menerima laporan dari masyarakat kemudian langsung menuju ke lokasi pelabuhan PT AAF dan mengamankan sejumlah truk dan dibawa ke Mapolsek sekitar pukul 22:00. Humas PT PIM Mustafa Thahir mengatakan, untuk saat ini PT PIM sedang mencari nama-nama distributor tersebut, yang jelas CV Aneuk Utara itu bukan distributor pupuk, tapi jasa pengangkutan. Pun demikian, ratusan pupuk ini benar ditampung di gudang CV ini. Bupati Aceh Utara MuhammadThaib mengatakan, PT PIM harus bertindak tegas siapa dalang itu semua. PIM selama ini melakukan pengeluaran pupuk sudah sesuai dengan prosudur, tapi ini yang bermain ini adalah distributor pupuk. (cmk/b11/b16)

200 Juta Dolar AS Untuk Terminal Gas Arun LHOKSEUMAWE (Waspada) : Untuk membangun Terminal Gas Arun, Pemerintah Indonesia berinvestasi senilai 200 juta dolar AS. Terminal gas itu dibangun untuk menghidupkan berbagai industri di Aceh dan kebutuhan listrik di Sumetara Utara, juga untuk memenuhi kebutuhan gas nasional. Diperkirakan, pada awal 2014, terminal gas Arun sudah mulai beroperasi. Terminal gas itu dibangun bukan hanya untuk kebutuhan gas Aceh dan Sumut, tapi ada pemikiran yang lebih besar lagi, untuk menjadikan terminal tersebut sebagai stok gas nasional. Itu artinya, kedaulatan energi Indonesia bergantung dengan adanya optimalisasi dari aset eks Kilang PT Arun ini. “Proyek ini sebetulnya merupakan agenda prioritas. DPR dan Pemerintah Indonesia telah sepakat, proyek terminal gas itu harus berjalan. Target kita pada 2014 sudah harus beroperasi. Menuju ke sana, tahap persiapan sudah dilakukan dan sekarang sedang dilakukan tahap kedua yaitu melaksanakan proses tender, dan pada awal 2013 sudah mulai implementasi,” kata T Riefky Harsya, anggota Komisi

Terkait Penahanan Kadisdukcapil LSM Apresiasi Kejari Pidie SIGLI(Waspada):Sejumlah Lembaga Swadaya Masyarakat dan aktifis anti korupsi memberi apresiasi kepada kejaksaan negeri Pidie. Hal itu di antaranya diberikan Pidie Transparansi Anggaran (PiTA) Pidie dan Pidie Institute. Namun Kejaksaan Negeri Pidie diminta tidak sekedar mengejar target dalam pemberantasan korupsi di wilayah itu. “Ini jangan hanya sekedar mengejar paket meugang, apalagi penangkapan dilakukan sehari menjelang meugang,” kata Kordinator PiTA, Ismail Von H Shabi, kepada Waspada, Kamis (19/ 7). Meski memberi apresiasi, Ismail mengatakan penangkapan Kadisdukcapil Pidie dan 8 tersangka lainnya memunculkan asumsi lain di masyarakat. Hal itu karena penahanan dilakukan menjelang Meugang Ramadhan. “Tapi kita mengharap tidak seperti asumsi di masyarakat dan jaksa harus buktikan asumsi itu salah. Kejaksaan harus serius menangani kasus ini hingga tuntas,”kata Ismail. Menurut Ismail, penangkapan Kadisdukcapil CS bukanlah hal yang luar biasa karena kasus itu hanya merugikan negara Rp 182 juta. “Mereka ini hanya kelas teri dan ada kasus kasus lain yang banyak merugikan Negara di Pidie,”ujarnya. Harapan untuk menuntaskan pengungkapan kasus korupsi juga disampaikan Kordinator Pidie Institute, Muharramsyah. “Ini memang sudah tugas jaksa untuk bertindak berdasarkan audit BPK. Kita minta mereka serius menegakkan hukum dan amanat konstitusi. Jangan di salahtafsirkan untuk peningkatan karir dan atau mencari uang dari tersangka,”ujar Muharramsyah kepada Waspada dihubungi terpisah. Kata Muharram, kasus itu merupakan kasus lama, diangkat oleh LSM dan telah menjadi konsumsi publik namun baru sekarang pelaku ditahan. “Ini memang mengejutkan kita dan publik, tiba-tiba jaksa mengambil tindakan penangkapan dan menahan mereka. Mudah-mudahan dugaan kita ada indikasi lain di balik penangkapan kilat ini salah,”kata Muharram. (cb06)

Pj Kakan Satpol PP Subulussalam Sesalkan Mutasi

Waspada/Maimun Asnawi

ANGGOTA DPR RI Komisi VII dan BP-Migas, Dinas Pertambangan Aceh, PT Arun NGL, Rabu (18/ 7) foto bersama di kilang Arun NGL. VII DPR RI, Kamis (19/7). Dengan adanya terminal Gas Arun, maka semua industri di Aceh sudah dapat dioperasikan kembali seperti PT KKA dan PT AAF yang sudah lama vakum, PT PIM, PTPA dan BUMD. Hal inilah yang paling

diprioritaskan. Prioritas kedua, setelah pipanisasi dilakukan, terminal gas itu akan membantu gas untuk kebutuhan listrik di Sumatera Utara, baru kemudian untuk kebutuhan gas nasional. T Riefky berkunjung ke PT

Arun NGL bersama dengan Sutan Batugana Siregar, Ketua Komisi VII, juga didampaingi oleh BPMIGAS, Dinas Pertambangan Aceh, Pertamina dan beberapa instansi lainnya yang berkaitan dengan persoalan gas. (b18)

Sutan Bhatoegana Janji Berdayakan PT Arun LHOKSEUMAWE (Waspada) : Ketua Komisi VII DPR RI Sutan Bhatoegana dalam kunjungannya ke PT Arun Lhokseumawe berjanji akan terus memberdayakan proyek vital PT Arun yang di ambang tutup pada 2014. Receiving terminal PT Arun tersebut akan terwujud, demi menghidupakan provit lainnya. Sutan menambahkan, apabila receiving ini terbentuk nantinya, maka negara akan menghemat anggaran pemerintah sebesar Rp180 miliar per bulan. Karena Pertamina tidak lagi menyewa penyimpanan gas, tapi langsung dilakukan di PT Arun.

BANDAACEH (Waspada) : Dua nelayan asal Ulee Lheu Banda Aceh dan Neuheun, Aceh Besar, yang sejak 20 hari lalu berlayar dengan kapal motor Safirah mencari ikan di batu 13, sampai saat ini nasibnya belum jelas. “Kita masih berupaya mencari keberadaan mereka, dengan menginformasikan kepada seluruh nelayan di Aceh dan instansi terkait. Jadi semua butuh waktu, mohon keluarga bersabar,” kata T Bustamam, Panglima Laot Aceh, Kamis (19/7) di Banda Aceh. Wakil Sekjen Panglima Laot Aceh Miftahuddin Cut Adek, menambahkan guna mencari informasi keberadaan nelayan tersebut juga menyurati Kedubes RI di negara tetangga. “Kita juga berupaya menginformasikan ke negara tetangga,” katanya. Kedua nelayan yang berlayar sejak 20 hari lalu itu masingmasing Candra Pradana, 22, warga perumahan Tiongkok, Gampong Neuheun, Kecamatan Masjid Raya, Aceh Besar dan Bukhari, 32, warga Ulee Lheu, Kecamatan Meuraxa, Banda Aceh. Mereka menggunakan kapal motor Safirah bermesin dalam diesel, warna rumah bodi kapal atas warna putih dan bodi bawah warna hitam. “Biasanya mereka berlayar mencari ikan 10-12 hari, ini sudah 20 hari belum pulang,” tutur Miftahuddin. (b06)

Namun, kata Sutan, setelah penyimpanan di PT Arun, tidak hanya untuk Aceh saja, Sumatera Utara dapat disalurkan melalui PT Arun. Begitu juga proyek vital (provit) di sekitar PT Arun, seperti PT PIM, PT AAF dan PT KKA dapat menikmati gas tersebut. “Insya Allah saya berdaya itu, yakinlah masyarakat Kota Lhokseumawe, Aceh Utara, Provinsi Aceh dan Indonesia secara umum. 60 persen hal itu akan terlaksana, kenapa tidak kita berdayakan yang sudah ada. Lagi pula saya dari Komisi VII, hal-hal saperti saya punya power,” janji Sutan yang baru tiba dari Banda Aceh. (cmk)

Waspada/Mustafa Kamal

KETUA Komisi VII DPR RI Sutan Bhatoegana memberi komentar saat konferensi pers di Guest House PT Arun, Rabu (18/7)

SUBULUSSALAM (Waspada) : Penjabat Kakan Satpol PP dan WH Kota Subulussalam Sahidin B menyesalkan mutasi dirinya, menyusul SK Wali Kota Subulussalam, 11 Juli 2012 tentang pengangkatan PNS dalam jabatan struktural eselon II, III dan IV di lingkungan Pemko Subulussalam, Rabu (11/7) di aula Setdako setempat. Pasalnya, saat mutasi, dirinya sedang mengikuti Rakor di Banda Aceh (perjalanan pulang ke Subulussalam). Dia dimutasi menjadi Pj Inspektur Pembantu Bidang Pemerintahan Inspektorat Subulussalam, eselon serupa, IIIa. Kamis (19/7) melalui ponselnya Sahidin mengaku kecewa meski diyakini kalau mutasi hak prerogatif sang kepala daerah. Pada Surat Perintah Tugas (SPT) Wali Kota Subulussalam, 3 Juli 2012, ditandatangani Wakil Wali Kota Subulussalam Affan Alfian Bintang disebutkan, SPT berdasarkan surat Sekda Provinsi Aceh, 25 Juni 2012 untuk mengikuti Rakor Pelaksanaan Kegiatan Polisi Pamong Praja se-Kab/Kota, 08-12 Juli 2012 di Banda Aceh.Pada surat Sekda Prov. Aceh, 25 Juni 2012, ditandatangani Sekda, T Setia Budi, pelaksanaan Rakor, 9-11 Juli 2012 di Banda Aceh. (b28)

Amru Bakal Tergeser Dari Ketua DPRK Gayo Lues BLANGKEJEREN (Waspada) : Di tengah keseriusan Partai Golkar membangun imej menuju Pilpres dan pemilihan dewan 2014, terkesan ada beberapa oknum kader Golkar telah menodainya. Fakta itu mendekati kebenaran, ketika Musdalub Golkar diselenggarakan, Kamis (18/7) dari hasil agenda itu telah terpilihnya Ibnu Hasim secara aklamasi sebagai Ketua Golkar Gayo Lues. Agenda Musdalub ini diselenggarakan secara cepat, untuk mengisi kekosongan Ketua DPD II Golkar Gayo Lues. Karena ketua yang lama Amru telah mengundurkan diri dari Golkar. “Amru sudah mengundurkan diri dari ketua Golkar, tentu saja harus mundur dari Ketua DPRK Gayo Lues, karena itu memang ikutannya, “ jelas Aminuddin, Plt Ketua DPD Partai Golkar Gayo Lues yang juga Koordinator Daerah Provinsi Aceh. Namun belum tahu pasti, siapa bakal pengganti Ketua DPRK Gayo Lues seiring pengunduran diri Amru sebagai Ketua Golkar Gayo Lues, yang jelas, kata Aminuddin, menguatkan penggantinya harus dari kader Golkar juga. M Yusuf Ishak, Wakil Ketua DPD I partai Golkar Provinsi Aceh menuturkan, apa yang dilakukan ketua lama melanggar AD/ ART Partai Golkar, karena tidak mendukung arahan dari DPD I Golkar Aceh. (cjs)


Agenda

WASPADA Jumat 20 Juli 2012

07.00 Sinema Pagi 09.00 Dahsyat 11.00 INTENS 12.00 SEPUTAR INDONESIA 12.30 MASTERCHEF INDONESIA 2012 15.00 CEK AND RICEK 16.00 SILET 17.00 SEPUTAR INDONESIA 17.30 Hanya Kamu 18.00 Mega Sinetron Ramadhan:Dalam Mihrab Cinta 20.00 Mega Sinetron : TUKANG BUBUR NAIK HAJI THE SERIES 22.30 Box Office Movie

CATATAN

07.00 SCTV Musik Inbox 09:00 Liputan 6 Terkini 09:03 Hot Shot 10:00 SCTV FTV Pagi 11.00 Liputan 6 Terkini 11.03 SCTV FTV 12:00 Liputan 6 Siang 12:30 SCTV FTV 15.00 Uya Emang Kuya 15.30 Film Layar Lebar 16.00 Liputan 6 Terkini 16.03 Jebakan Betmen 17.00 Liputan 6 Petang 17.30 Putih Abu Abu 20.00 Liputan 6 Terkini 20.30 Insya Allah Ada Jalan (Maher Zain) 21.30 Si Biang Kerok 22.00 SCTV FTV 00.00 Liputan 6 Malam

07:30 – Kisah Pilihan 08:30 - Serial Pilihan 09:30 - Kisah Unggulan 10:30 - Kribo 11:00 - Sidik 11:30 - Lintas Siang 12:00 - Layar Kemilau 13:30 - I Drama 15:00 - Starlite 15:30 - Lintas Petang 16:00 - Animasi Spesial 16:30 - Indonesia Beraksi 17:30 - Animasi Spesial Shaun The Sheep 18:30 - Aladdin 19:30 - Dewi Bintari 22:00 - Putri Nabila 23:00 - Dangdut Never Dies 00:00 - Sport Mania 00:30 - Obat Malam 01:00 - Lintas Malam

06:30 - Hati Ke Hati Bersama Mamah Dedeh 07:30 - Fresh & Fun 08:00 - Friends 09:00 - Fenomania 09:30 - Gerakan Koperasi Berprestasi 10:00 - Bread, Love And Dreams 11:30 - Topik Siang 12:00 - Klik ! 13:00 - Tom & Jerry 14:00 - Count Duckula 14:30 - Woody Wood Pecker 15:00 - ISL : 17:30 - Topik Petang 18:00 - Pesbukers 19:30 – Keluarga Selebritis 20:30 - Glory Jane 21:30 - Pilih Pilih Mantu 22:30 - Sinema Spesial

07:00 - KISS Pagi 08:00 - Halo Polisi 08:30 - Sinema TV Pagi 10:00 - Sinema TV Spesial 12:00 - Patroli 12:30 - Drama Asia (Korea): Naughty Kiss 13:30 - Drama Asia (Korea): Protect The Boss 15:00 - KISS Sore 16:00 - Fokus 16:30 - Buaya Show 17:00 - Sinema Tv Spesial: 18:00 - Drama Asia (Mandarin): Kung Fu Master Wong Fei Hung 19:00 - Sinetron Unggulan 20:00 - Tutur Tinular 22:00 - Konser Dangdut

07.05 Editorial Media Indonesia 08.05 Eleven Show 09.05 Eleven Show 10.30 Special Program 11.00 Headline News 11.30 Metro Siang 12.05 Metro Siang 13.05 Wideshot 13.05 Wideshot 14.00 Headline News 15.30 Wideshot 16.00 Headline News 16.30 Wideshot 17.05 Metro Hari Ini 18.05 Metro Hari Ini 19.05 Suara Anda 20.30 Eadle Documentary 21.05 Top Nine News 21.30 Kick Andy 23.00 Headline News 23:20 Metro Sports

C1

07:30 Sinema Spesial Liburan 09:30 Cinta Cenat Cenut 10:00 Riwayat 10:30 Insert 11:30 Jelang Siang 12:00 Reportase Siang 12:30 Anak Negeri 13:15 Jail 14:00 Magic Comedy 14:30 Digital Clip 15:00 Sketsa 16:00 Show Imah 17:00 Reportase Sore 17:30 Insert Investigasi 18:15 Comedy Project 19:15 Dia-Loe-Gue 20:15 Bioskop TRANSTV Spesial 22:15 Bioskop TransTV 01:15 Reportase Malam

06:30 Apa Kabar Indonesia Pagi 09:30 Live News Kabar Pasar Pagi 10:00 Coffee Break 11:30 Live News Kabar Siang 13:30 Apa Kabar Indonesia Siang 15:30 Live News Kabar Pasar 16:30 Live News Kabar Petang 19:00 Apa Kabar Indonesia Malam 21:00 Live News Kabar Malam 22:00 Kabar Arena 22:30 Radio Show

Jadwal acara TV di atas bisa diubah sewaktu-waktu oleh stasiun TV yang bersangkutan tanpa pemberitahuan

Shandy Aulia Mengubur Rasa Takut

Chef Amerika Serikat ternama, Gordon Ramsay/gordonramsay.com

Gordon Ramsay Chef Terkaya Amerika Serikat GORDON Ramsay berada pada posisi teratas dalam daftar chef terkaya di Amerika Serikat versi Forbes.com dengan estimasi penghasilan total 38 juta dolar AS dari 24 restauran di seluruh dunia, 11 bintang Michelin, serta banyak buku masak dan acara televisi. Pendapatan chef kelahiran Skotlandia yang terkenal dengan program memasak di televisi seperti Master Chef dan Hell’s Kitchen melampaui penghasilan pembawa acara televisi la-

innya Rachael Ray. Hingga akhir Juni 2012, Rachel Ray memperoleh pendapatan total 25 juta dolar AS dari beberapa acara televisi dia pandu, majalah dan buku masakan. Sementara chef Austria, Wolfgang Puck, memiliki 20 restoran berada pada posisi ketiga dalam daftar chef terkaya Amerika Serikat dengan penghasilan total 20 juta dolar AS. Pada urutan keempat dan kelima daftar chef terkaya Amerika Serikat ada Paula Deen dan Mario Batali. Deen, pernah dikritik karena resep masakannya yang mengandung mentega dan menjadi juru bicara perusahaan farmasi setelah mengidap dia-

betes, punya penghasilan total 17 juta dolar AS. Mario Batali, ikut memiliki lebih dari selusin restauran dan membintangi acara televisi The Chew, pendapatannya sebanyak 13 juta dolar AS. “Nama-nama dalam daftar ini sangat bervariasi. Tidak ada yang hanya punya restoran. TV adalah faktor besar sangat memengaruhi daftar ini, karena mereka mendapatkan uang lebih banyak dari acara televisi dibandingkan dari restoran mereka,” kata Dorothy Pomerantz dari Forbes.com. Ia menambahkan, usaha perdagangan dan buku masak juga ikut mendongkrak penghasilan mereka.(ant)

Di Benak Shandy Aulia, hanya satu keinginan yang mengkristal yakni menjadi aktris seni peran serba-bisa. Karenanya, demi mendapatkan peran utama wanita dalam film horor berjudul Rumah Kentang (RK) besutan sutradara Jose Purnomo, bintang film spesialis drama percintaan ini harus mengubur dalam-dalam rasa takutnya. “Selama ini saya memang tergolong wanita yang penakut terhadap hal-hal berbau horor dan mistis. Tapi, demi menjadi aktris seni peran serba-bisa alias mampu berakting memukau dalam beragam genre film, mau tak-mau harus pandai mengubur rasa takut,” papar Shandy Aulia kepada Waspada di markas Soraya Intercine Films kawasan Menteng - Jakarta Pusat, baru-baru ini. Ditemui selepas selamatan dimulainya syuting film horor diangkat dari legenda hantu anak kecil yang tewas terjatuh dalam Kuali tengah merebus Kentang di sebuah rumah Jl Dharmawangsa Jakarta Selatan ini, bintang film, sinetron dan bintang iklan berdarah campuran Palembang – Manado kelahiran Jakarta, 23 Juni 1987 ini menambahkan, kendati penakut namun belakangan dirinya justru gandrung nonton film bergenre horor. “Tapi, nontonnya harus beramai-ramai atau minimal ada satu dua teman yang mendampingi. Ternyata kegandrungan unik dan upaya mendongkrak nyali besar dengan sering menonton film horor, banyak membantu dalam menghayati peran Farah dalam film horor

Johnny Depp produksi Indian Paintbrush,

Lawakan di tv sepanjang memberi nilai agama tak masalah, kata Ketua MUI Medan Prof Dr HM Hatta saat bertemu wartawan di Garuda Plaza Hotel Medan Kamis (19/7) siang. Ketua MUI ini bersama unsur pengurus lainnya dijamu Garuda Plaza Hotel sekalian menyambut datangnya bulan suci Ramadhan 1433H yang rutin tiap tahun diadakan. Menurutnya,ia mendukung imbauan Menteri Agama mengharapkan stasiun tv selama bulan Ramadhan tidak mengisi acaranya dengan lawakan dan gosip yang lebih banyak mudharatnya. Prof Dr HM Hatta mengharapkan stasiun tv yang menayangkan program Ramadhannya bisa dibarengi materi lawakan dengan pesan agama yang

lebih mendidik. “Lawakan boleh saja, tapi sepanjang membawa cerita yang sarat dengan pesan agama tak masalah, bahkan memang seperti itu yang diharapkan”, ujarnya. Ia juga meminta pihak tv ataupun tempat hiburan lainnya agar mensesuaikan materi siaran ataupun bentuk hiburannya dengan situasi bulan Ramadhan. “Tolonglah beri ketenangan kepada umat Islam yang lagi menjalankan ibadah puasanya”, pintanya. Ketua MUI ini juga meminta para artis ataupun komedian mengisi acara di televisi bisa menjaga diri, terutama hindari perkataan yang dapat menimbulkan penafsiran macammacam. “Televisi jangan hanya mengejar rating saja, karena bu-

lan Ramadhan bagi umat Islam adalah kesempatan berbuat kebaikan dan beramal”, tuturnya. Dalam kesempatan tersebut juga, Prof Dr HM Hatta meminta umat Islam agar berhatihati serta memperhatikan kehalalan makanan yang bakal disantapkan, terutama di restoran ataupun hotel lainnya. Sementara Syahrial P dari Garuda Plaza Hotel menambahkan, selama bulan Ramadhan pihaknya menampilkan suasana religi di lobi, termasuk hiburan musiknya. Paket berbuka puasa serta ukhuwah juga diadakan dengan tarif special. Harga kamar ditawarkan mulai Rp335.000,nett sampai Rp430.000,-nett. Begitu juga paket berbuka puasa mulai Rp45.000,-/pax sampai Rp75.000,- pax.(m19)

**m31/G

Kate Hudson Temui Tom Cruise

Shandy Aulia perdana yang saya bintangi ini,” terang Shandy. Shandy menyebutkan, selama vakum di layar lebar dirinya tetap sibuk syuting di sinetron maupun FTV.“Kebetulan seiring status tujuh bulan terakhir sebagai ibu rumahtangga muda, cenderung kembali menerima job main film. Pasalnya, syuting layar lebar tak banyak menyita waktu seperti

kolaboratornya dalam membuat film Moonrise Kingdom. Selain di The Grand Budapest Hotel, Depp juga akan berperan sebagai Tonto dalam The Lone Ranger arahan sutradara Gore Verbinski, dijadwalkan rilis musim panas tahun depan. Depp sempat akan kembali bekerja sama dengan sutradara The Pirates of Carribean: On Stranger Tides, Rob Marshall, dalam film daur ulang The Thin Man (1934). Namun proyek tersebut dibatalkan rumah produksinya.(ant)

Lawakan Di TV Tak Masalah, Asal Ada Pesan Agamanya

07:30 Selebrita Pagi 08:00 Ups Salah 08:30 Karaoke Keliling 09:30 Spotlite 10:30 Warna 11:30 Redaksi Siang 12:00 Selebrita Siang 13:00 Laptop Si Unyil 13:30 Unyilpedia 14:00 Dunia Binatang 14:30 Home Stay 15:00 Asal Usul 16:00 Jejak Petualang 16:30 Redaksi Sore 17:00 Jejak Si Gundul 18:00 Hitam Putih 19:00 On The Spot 20:00 Opera Van Java 22:00 Bukan Empat Mata 23:30 Dua Dunia 00:00 Wisata Malam 00:30 Sport7 Malam 01:00 Redaksi Malam

Aktris Kate Hudson dijepret paparazi ketika ia ketahuan memasuki hotel dimana Tom Cruise tinggal selama syuting film barunya di NewYork City. “Kami hanya ingin memotret Tom Cruise yang keluar dari hotel membawa Suri, tanpa disangka melihat Hudson masuk ke hotel. Kami merasa dia sadar dengan apa yang dilakukannya dan resiko apa akan didapatkannya karena hotel dimana Tom menginap berada di tengah-tengah kota yang ramai,” ujar salah seorang paparazzi. Tak lama kemudian tampak Tom Cruise dan putrinya keluar dari Greenwich Hotel dimana para paparazzi mengerubunginya. Tom menggendong putrinya dengan penuh kasih sayang, ia ingin membawa Suri ke kelas gimnastik untuk menyenangkan putrinya. Suri Cruise meletakkan kepalanya di pundak ayahnya dan terus berjalan ke mobil menuju kelas gimnastik. Para wartawan dan paparazzi tak henti-hentinya memotret mereka. Ketika tiba di Chelsea Piers kelas gimnastik, keduanya tak terlepas dari jepretan kamera wartawan dan paparazi. Mereka berdua memiliki waktu yang banyak bersama dan bercanda ria di kelas gimnastik. Pertemuan Tom dan Suri kali ini merupakan kesempatan pertama sang aktor berlama-lama bersama putrinya sejak Katie Holmes menggugatnya cerai. Nur/tmz

Johnny Depp Bermain Dalam Film Indie Bintang The Pirates of Carribean Johnny Depp akan bermain dalam film independen berjudul The Grand Budapest Hotel karya sutradara Wes Anderson. Menurut laman The Sun, sutradara The Darjeeling Limited juga berencana mengajak bintang Hollywood lain seperti Bill Murray, Owen Wilson, Jude Law, Jeff Goldblum, Willem Dafoe, dan Angela Lansbury untuk bermain bersama Depp. Dalam film alur ceritanya masih dirahasiakan, Wes kembali bekerja dengan rumah

08:00 Spongebob Squarepants 08:30 Oggy and The Cockroaches 09:00 Doo Bee Doo 10:00 Obsesi 11:00 Dapoer Cobek 11:30 Hot Spot 12:00 Global Siang 12:30 Awas Ada Sule 13:30 Ewon Sang Pemburu 14:00 Masih... Main Kata 15:00 100% Ampuh 16:30 Fokus Selebriti 17:00 Spongebob Squarepants 18:30 K-Pop 19:30 Cagur On The Street 20:00 Naik Enak, Turun Ogah 21:00 Big Movies 23:00 Big Movies

Salma Hayek/blogspot.com

Aktris Hollywood Tetap Cantik Lima selebriti kini memasuki usia berkepala empat atau lebih namun tetap terlihat cantik, muda dan seksi. Mereka adalah aktris Sofia Vergara (40), Uma Thurman (42), Salma Hayek (45), Halle Berry (45) dan Liz Hurley (47). Meskipun sudah berusia 40 tahun keatas namun penampilan mereka seperti aktris muda pendatang baru berusia 20 tahunan. Resep kelima selebriti ini tetap muda, cantik dan seksi adalah mereka benar-benar merawat tubuh dengan baik, tidak terlalu ambisi, suka berolahraga dan menjalani kehidupan apa adanya. Jika selebriti lain sudah kasak-kusuk dengan usia senja yang mulai menggerogoti mereka, kelima aktris tenar Hollywood ini tampak tenang-tenang saja. Sekarang ini selebriti tersebut sepi job bermain film. Kecuali Halle Berry mencomot kategori aktris pembantu terbaik Oscar beberapa waktu lalu. Namun mereka tetap eksis karena aktivitas dan penampilan mereka mengundang decak kagum setiap orang melihat kelima aktris ini masih terlihat seperti dulu ketika usia muda. Nur/tmz

halnya membintangi sinetron,” kilah Shandy Aulia. Alasan lain dirinya merambah genre horor, lanjut Shandy lantaran film RK juga dibintangi SarahWatson, Steward, Medina, Kevin, Raditya, dan paranormal Ki Kusumo ini serta dijadwalkan diputar di bioskop tanah air mulai 4 Oktober 2012, memiliki cerita kuat dan menantang. (AgusT)

Kate Hudson/blogspot.com


Opini

C2 TAJUK RENCANA

Ramadhan Saling Menghormati

K

epolisian Negara Republik Indonesia (Polri) mengimbau masyarakat yang akan menyambut datangnya bulan suci Ramadhan 1433 H untuk tidak melakukan sweeping atau razia dengan tujuan dan alasan apa pun juga. Bila razia dilakukan oleh masyarakat sipil, hal ini berdampak pada kenyamanan dan manyalahi aturan. Oleh karena itu untuk mengeliminir hal tak diinginkan kepada polisi di satuan kewilayahan telah diinstruksikan untuk membuka forum dialog dengan pemuka agama, tokoh masyarakat dan instansi terkait, demikian Kepala Biro Penerangan Masyarakat (Karo Penmas) Polri, Kombes Pol Boy Rafli Amar kemarin.Razia tempattempat hiburan di malam hari, terutama bagi yang buka sampai dinihari selalu dilakukan sekelompok masyarakat dari Ormas Islam tertentu, seperti Front Pembela Islam (FPI). Sebenarnya, bukan saat memasuki bulan suci Ramadhan saja FPI melakukan gebrakan ‘’amar makruf nahi munkar’’ tetapi juga dilakukan di luar bulan Ramadhan. Termasuk menentang pornografi, pornoaksi dll. Hemat kita, kalau Ormas Islam sudah mengingatkan agar pemerintah melakukan pengawasan terhadap pusat hiburan malam di bulan Ramadhan, seharusnya pengusaha hiburan malam pun tahu diri. Jangan sampai di bulan suci itu tempat-tempat maksiat terus berjalan, sehingga peringatan Ormas Islam sebenarnya bukan sesuatu yang baru atau mengada-ada. Kita menilai positif, hanya saja aparat keamanan sering kurang tanggap, malah menutup mata dan telinga. Kalau pemerintah sudah sepakat melarang pusat hiburan malam buka di siang dan malam hari maka larangan itu seharusnya dipatuhi oleh pengusaha hiburan malam. Bukan malah membuka usahanya hingga tengah malam sehingga memancing kemarahan umat Islam, khususnya Ormas Islam garis keras. Kalau Polri mengimbau masyarakat untuk tidak melakukan tindakan sweeping terhadap siapa saja di bulan Ramadhan, hal itu hanya mungkin disahuti oleh masyarakat khususnya Ormas Islam jika aparat keamanan mampu mengawasi pusatpusat hiburan malam agar tidak melanggar jam buka. Kalau semua pusat hiburan malam stop dipastikan tidak akan ada razia oleh masyarakat sipil maupun kelompok garis keras. Tapi, kalau pengusaha hiburan malam sudah diberi tahu, jangan buka tapi tetap membandel, judi tetap jalan, minuman keras bebas dijual bebas, petasan bersahut-sahutan mengganggu orang puasa, tarawih, jangan salahkan bila masyarakat Intisari turun tangan langsung melakukan razia di lapangan. Sebab, kelompok garis keras merasa mampu melakukan tindakan pencegahan Polisi wajib mengawasi lewat tangannya sendiri. Sementara kelompusat hiburan malam, pok masyarakat lainnya lebih memilih pasrah, hanya membencinya dan berdoa semoga judi, maksiat, minuman maksiat /memungkaran tidak semakin mekeras sampai peredaran rajalela di lingkungan tempat tinggalnya. Justru itu, semua pihak hendaknya menjapetasan meresahkan ga kehormatan bulan suci umat Islam yang tinggal hitungan jam saja. Sejumlah Ormas umat Islam Islam, seperti Muhammadiyah sudah pasti akan mengawali puasanya Jumat (hari ini), sementara masyarakat umumnya masih menunggu putusan sidang isbath Kemenag dengan Ormas Islam/MUI sehingga besar kemungkinan baru puasa Sabtu (besok). Sekalipun awal puasanya berbeda, diperkirakan Idul Fitrinya, 1 Syawal 1433 H sama, yaitu Minggu, 19 Agustus 2012. Kita berpendapat tidak boleh ada pihak yang saling menyalahkan karena ini menyangkut keyakinan. Sekalipun yang benar itu hanya satu, tapi putusan membuat dan mengusahakan sesuatu ilmu pengetahuan demi kemaslahatan umat lewat ijtihaj harus tetap diberi apresiasi. Dalam sebuah hadits disebutkan, melakukan ijtihaj walaupun salah tetap diberi satu pahala, kalau ijtihajnya benar mendapatkan dua pahala. Artinya, tidak boleh saling menyalahkan, dan menganggap kelompoknya paling benar, karena sesungguhnya kebenaran dan kesempurnaan itu hanya milik Allah SWT.Dari pengalaman tahun-tahun sebelumnya, terjadinya kekerasan terhadap pusat hiburan malam yang membandel atau buka sampai larut malam bukan kesalahan Ormas Islam semata. Sebab, jauh sebelumnya mereka sudah mengingatkan aparat keamanan/pihak terkait, tapi tidak digubris. Kalau saja pihak terkait cepat tanggap dan menyahuti komplain masyarakat maka aksi main hakim sendiri dari masyarakat sipil tidak akan terjadi. Setelah terjadi aksi sweeping dan kekerasan/pengrusakan baru aparat keamanan sibuk menanganinya. Di satu sisi jelas tidak boleh warga sipil melakukan aksi sweeping, tapi di sisi lain perintah tutup lewat surat edaran aparat resmi tidak diindahkan oleh pengusaha juga kesalahan. Seharusnyalah semua pihak saling menghargai dan menghormati. Seperti masuknya bulan suci Ramadhan 1433 H, jangan ada yang memancing-mancing kerusuhan. Warga non-Muslim selayaknya menghormati orang-orang yang berpuasa dengan tidak makan dan minum maupun merokok di tempat-tempat umum. Pengusaha restoran sebaiknya menahan diri, tidak membuka usahanya secara mencolok di siang hari, apalagi pusat hiburan malam dan perbuatan yang bertentangan dengan norma agama, seperti judi, masiat, minuman keras dll harus tutup total.+

SMS 081362240523

Faks 061 4510025

Facebook Smswaspada

+6285275437438 SBY katakan jangan risau saat beli pesawat krn itu adalah projek ORANG-ORANG BESAR dan FEE nya pun BESAR utk mereka,rakyat biar aja SUSAH yg penting mereka senang,kapan lagi kalau tdk sekarang ! +6285275437438 Kpd masyarakat SUMUT,Pilkada Gub yg akan datang jangan salah pilih ! Pilih PUTRA DAERAH utk GUB/WKL yaitu “BATAK & MELAYU”jangan seperti pilkada yg lalu memilih wakil yg bukan putra daerah ! +6285360716232 Yth Waspada,untuk 2014 gak usah buat kuis tebak juara piala dunia,pecuma aja di buat kalau tidak di undi seperti Euro, +6281265893812 Assw..Salam sukses harianWaspada beritamu mantap aku pelangganmuYg setia:NJUAH NJUAH MAIBANG mengucapkan Kepada yth Bapak Plt Gubsu imo pertuanami Gatot Pujo nugroho maju terus Katakan bisa SUMUT-1Komentar Waspada Via Sms +6281375193109 Lebih baik pungsi otak dan hati yang ada pada seekor binatang disisi Allah dari pada otak dan hati seorang manusia dewasa yg waras dan normal tapi pungsinya sama dengan pungsi otak dan hati seekor binatang yg hanya di pergunakannya sebagai kendali untuk mengikuti kemauan belaka. +6281375296443 Dulu untuk mengetahui waktu sholat,rasul s.a.w melihat matahari tergelincir(utk zuhur dan ashar)dan trbenam matahari magriblah tiba dan hilangnya cahaya merah/ syafaq d barat tanda nya masuk isya,utk subuh rasul melihat fajar/boleh juga kokok ayam terakhir.sekarang ilmu hisab sudah maju.utk mengetahui waktu solat cukup dgn jadwal,beda jadwal yg dikeluarkan oleh kemenag dan muhammadiyah(jadwal abadi) cuma beda 1,2 menit lebih awal/akhir.itu tdk masalah.ttg meng awali puasa kita boleh menggunakan ilmu hisab,tdk melulu rukyat.tgl 20 dan 21 juli,beda hari tgl dan jam itu yg bisa menjadi masalah.ahli hisab menyebutkan tgl 20 juli hilal sudah wujud. +6281263191734 Assalamu’alaikum.W.W. Dalam upaya untuk memuliakan diri kepada sang Khalik serta untuk memuliakan agama Islam disisi semua umat, khususnya kepada para pemilik PenyelenggaraWalimmatul & ibu rumah tangga dimanapun berada dan kita umat yang mengaku beriman kepada Allah SWT, agar kiranya segera melakukan perubahan dengan memurnikan pemahaman agar lebih baik dan sempurna tentang norma agama Islam dalam hal khusus dibawah ini, 1.Para pemilik rumah makan, penyelenggara Walimathul Urs JANGAN bekerja sama dengan pengumpul sisa nasi busuk, apalagi dilakukan dengan cara mengumpulkan & bahkan menjual sisa makanan tersebut, yang berarti para pemilik rumah makan/Pelaksana acara Walimah secara nyata “BER SUBHAHAT” dengan pengumpul nasi busuk tersebut, yang artinya kita melakukan sesuatu yang di “HARAMKAN” Islam, 2.Kepada semua ibu rumah tangga untuk tidak bekerja sama dengan ke Bathilan, yang dengan sengaja meletakkan sisa bahan makanan/sisa makanan dirumah tangga dan menggantungkannya didepan pagar rumah, 3.Agar umat tidak Subhahat dengan kebathilan yang di HARAM kan Islam, berikan sisa makanan kepada ayam/itik atau bila sedikit buang keparit, 4.Membantu Pemko untuk menggusur banyak nya yang tidak sampai saat peternakan ditengah kota Medan Wassalam. Ir. Zulkifli AM

Fenomena Kebangkitan Madrasah Oleh H. Torang Rambe, M.Ag Pergeseran secara cepat pengelolaan madrasah dari yang cendrung tertutup, kumuh, kelas dua (baca : pembuangan),dan sederet makna pejoratif lainnya,kepada hal yang lebih opensif dan terbuka menjadikan madrasah seolah kembali membumi ditengah masyarakat

D

erasnya arus kepercayaan masyarakat terhadap madrasah dalam menyekolahkan anakanak mereka patut diapresiasi oleh semua pihak. Betapa tidak, madrasah yang dahulu diklaim sebagai sekolahannya wongcilik,kinitumbuhmenjadimercusuar peradaban. Agaknya, tidak berlebihan bila Menteri Agama RI, Surya Dharma Ali, menyebut tahun ini sebagai tahun “kesombongan” madrasah. Capaian madrasah dalamberbagaibidang,sebutsajamisalnya, expo madrasah, apresiasi pendidikan madrasah,porseni,munculnyaberbagaitokoh dari lembaga madrasah dan lain sebagainya,semakianmemperjelas bahwainstitusi pendidikan keagaman ini telah menjelma menjadi sebuah lembaga yang sangat menakjubkan.Yang paling aktual adalah pada tahun ini dalam Penerimaan Siswa Baru (PSB) hampir seluruh madrasah mengalami peningkatan yang sangat pesat. Bila ditelisik lebih jauh kenapa madrasah menjadi tumpuan pendidikan bagi anak tidak terlepas dari paradigma masyarakat yang selama ini yang dijadikan acuan adalah bahwa lembaga pendidikan yang berbasisajaranAgamaIslam,padakelanjutannyadipahamisebagaitempatyangpaling epektif untuk menciptakan kehidupan islami peserta didik, sekaligus ilmu pengetahuan moderen, dibanding dengan sekolahumum.Sebenarnya,animomasyarakat untuk kembali kepada madrasah tepat sekali apa yang disebut oleh Steenbrink bahwa karakter madrasah di Indonesia, adalah bersifat populis (merakyat), karena madrasah di Indonesia pada umumnya tumbuh dan berkembang atas inisiatif tokoh masyarakat yang peduli. Shawing up Madrasah Munculnya kesadaran baru dan pandangan positif masyarakat kepada madrasah, terutama umat islam, tidak terlepas dari pengelolaan madrasah yang selama ini agak tradisional, untuk tidak mengatakan asal-asalan. Kini, beralih kepada pengelolaan secara modern bahkan secara jitu memadukan sinergis antara modern dan tardisional sekaligus. Pergeseran secara cepat pengelolaan madrasah dari yang cendrung tertutup, kumuh, kelas dua (baca :pembuangan),dansederetmaknapejoratif

lainnya, kepada hal yang lebih opensif dan terbukamenjadikanmadrasahseolahkembali membumi ditengah masyarakat. Seiringdenganperkembanganjamandengan segala instrumen modernitas yang mengitarinya madrasah seolah bangkit dari tudur panjangnya. Salahsatuyangmenonjoldaripergeseran itu adalah dengan gencarnya insan madrasah dan pemerintah, dalam hal ini Kemenag, dalam mempublikasikan madrasah (shawing up of madarsah) kedalam dunia publik disertai pembangunan image building madarasah secara terus menerus. Hampir dapat dipastikan sekarang disetiap kegiatan madrasah sudah terbaca oleh publik secara terang-terangan baik lewat media cetakmaupunelektronik. Termasuk didalamnya testimoni tokoh-tokoh nasional yang berlatar belakang madrasah tapi memiliki integritas yang tinggi seprti Ketua Mahkamah Konstitusi, Mahfud MD atau Dahlan Iskan sebagai Menteri BUMN dan yang paling penomenal adalah Gus Dur sebagai Presiden RI. Gencaranya pemberitaan madarasah adalah sebuah kesadaran baru dalam era globalisasi sekaligus membentuk opini untuk merertas anggapan bahwa madrasah adalah sekolahnya orang-orang pinggiran. Agaknya, tepat apa yang dikatakan oleh Direktur madrasah, Prof. Dr. H. DediDjubaidi,M.Ag bahwa alumnimadrasah bila menjadi tokoh publik maupun pejabat negara dapat digaransi memiliki talenta, integritas, minimal memiliki akhlaqulkarimahyangmumpuni.Singkatanya, “madrasah dalam berita” adalah sebuah keniscayaan bagi masa depan madrasah pada masa kini dan akan datang. Empat Konsep Dasar Setidaknya ada empat alasan kenapa madrasah kembali bangkit dan meraih

golden age-nya seperti jaman dahulu. Pertama, Kreatifitas pengelolaan madrasah yangsangatcerdas.Kemampuanmadrasah dalam menjual dan menampilkan (salling and shawing) dirinya dengan melakukan kegiatan dan terobosan-terobosan dalam berbagai bidang sangat menolong madrasah dalam perjalannnaya. Kretaifitas dalam seni, budaya, iptek dan sosial keagamaan yang dilakukan madarsah ditengah masyarakat menumbuhkan kepercayaan yangbesarakanarti peranvitaldankemampuanmadrasahmelahirkananakdidik(siswa) yang didambakan. Kemampuan madrasah dalam mendesain dirinya menjadi lebihbaik,meminjamistilah Hulbeck,1945, adalah sebuah keunikan yang dilakukan baik secara pribadi maupun institusi pendidikanislamini dalamberinteraksidengan lingkungannya. Kedua, melakukan inovasi dari segala aspek. Perbaikan melalui inovasi madrasah adalah sebuah gagasan baru yang diterapkan untuk memprakarsai atau memperbaiki suatu produk atau proses dan jasa kepada pelanggan dalamhalinikepadamasyarakat sehingga munculkepuasan(satisfaction) mereka. Menggiring madrasah kedalam temuan-temuan baru dengan melakukan inovasi dalam berbagai aspek sehingga ia tumbuh menjadi gadis cantik manis yang sangat menggoda setiap orang yang melihat dan mendengarnya.Upaya-upaya pembaharuan dan perubahan dalam berbagai lini secara perlahan tapi pasti, menambah daya pikat madrasah itu sendiri. Ketiga, melakukan Networking. Salah satu yang menonjol dari madrasah masa kini adalah kemapuannya membangun jaringan kepada semua kelompok dan golongan secara terukur tanpa menanggalkan jati dirinya sebagai institusi pendidikan keagamaan. Menyeruaknya kemesraan hubungan madrasah dengan kelompok dan isntitusi-institusi yang dapat berkontribusi kepada madrasah menjadikan dia sebagai tenaga raksasa dalam membangun bangsa pada masa yang akan datang. Pembuatan MoU, kegiatan bersama, dan sederet hubungan sinergis lainnya semakin menambah kuat dugaan bahwa madrasah telah keluar dari keterpurukannya.

Keempat, Informasi dan Teknologi. Selama ini yang tercecer dari madarsah adalah keterbatasannya dalam mengakses dunia informasi dan teknologi hatta madrasahseolahmenajdidunialainyanggelap bagi masyarakat luas. Sekarang madrasah sudah menjadi institusi yang sangat gaul, bahkan melek IT dalam pelayanan dan pengelolaannya. Di madrasah misalnya telah dibangun berbagai sarana IT yang mengantarkan dia online pada publik, katakanlah adanya EMIS, Geografik Information System (GIS), email, Blogspot, webside dan sarana IT lainnya semakin mempermudah madrasah diakses oleh orang lain. Mudahnya masyarakat mengakses madrasah menjadi kunci sukses (key of succes) dalam mengantarkan madrasah kepuncak kejayaannya. Penutup Penomena kabangkitan madrasah seperti yang terjadi saat ini menjadi buah bibir bagi seluruh pemangku kepentingan dan sekaligus sebagai kebanggaan terutama bagi umat Islam. Namun demikian, masih banyak yang perlu disentuh dalam menyempurnakan peran dan fungsi madrasah ditengah keterpurukan bangsa. Menggantungkan harapan masa depan bangsa ini kepundak madrasah tentu bukan sebuah hal yang mustahil, tapi sebuah pekerjaan yang amat berat untuk diwujudkan. Tapi yang pasti adalah bahwa madrasah telah merebut piala kehormatan dengan segala pernik-perniknya. Adalah sebuah ironi bila dikemudian hari madrasah kembali mengalami degradasi, sementara kemunculan kejayaannya hanya kebetulan belaka. Merebut jauh lebih mudah dari mempertahankan, begitu kata orang bijak, maka diharapkan semua insan madrasah harus terus berupaya untuk mempertahankan kepercayaan dan kesempatan emas ini jangan sampai jatuh ketangan-tangan kotor. Kiranya, tepat apa yang dikatan oleh vokalis Band kenamaan Wali, madarsah harus kita jaga baik disiang maupun dimalamnya sehingga ia tidak kedinginan dan juga kepanansan. Singkatnya, kejayaan madrasah harus menjadi perhatian dan kesadaran bersama bahwa eksistensi madrasah sebagai jembatan emas (the Golden Cambridge) peradaban bangsa tidak bisa ditawartawar lagi, seraya terus memekikkan slogan madrasah : Madrasah Yes, Madrasah Fihgt, Madrasah Win. Semoga. Penulis adalah Kasi Mapenda Kementerian Agama Kabupaten Deli Serdang dan Anggota Komi Dakwah dan Pengembangan Masyarakat MUI Sumut

Fenomena Jokowi Lampu Kuning Cagubsu Oleh Sofyan Harahap Cagubsu yang ingin meraih sukses bisa belajar dari fenomena dantrikJokowidalamberkomunikasi,memanfaatkanpeluang dan kelemahan lawan secara optimal plus modal popularitas dan ketokohan.

P

APA KOMENTAR ANDA

WASPADA Jumat 20 Juli 2012

opularitas menjadi andalan utama semua kandidat guna memenangkan Pilkada di mana saja (berlaku umum selama ini). Andalan lainnya tentu saja dana. Semua butuh dana disebabkan sulitnya mendapatkan perahu (parpol), menggalang massa di masa kampanye sampai masalah logistik dan tim sukses, urusannya uang dan uang karena umumnya berpikir pragmatis. Ironisnya, soal program visi dan misi kelihatannya belum begitu menarik minat masyarakat. Padahal, seharusnya menjadi tolok ukur utama dalam memilih pemimpin. Inilah tanda-tanda belum cerdasnya pemilih kita pada umumnya. Baru sebagian kecil saja yang sudah melek politik dan hukum. Memang tidak mudah menebarkan pesona popularitas di tengah masyarakat luas, kalau sosok tokohnya tidak menjual, citranya biasa saja, atau hanya modal paspasan.Apalagikalaukinerjaatautrackrecordnya di bawah standar. Kalaupun dipaksakan akan sulit berhasilnya kecuali menggunakan segala cara. Syamsul & Jokowi Anda tentu masih ingat dengan fenomena Syamsul Arifin ketika maju dalam Pilgubsu 2008, dari hitung-hitungan mesin politik terbilang biasa saja. Tapi, Syamsul punya ‘’jimat’’ yang tidak dimiliki kandidat lain,sepertiTritamtono,AliUmri,AbahWahab dll yaitu popularitasnya meluas di kalangan rakyat kelas bawah. Datuk, panggilan akrab Syamsul Arifin— jauh sebelumnya sudah dikenal luas sebagai tokoh humanis yang mau turun ke bawah, menemui abang becak, minum di kedai warkop pinggir jalan, berkawan dengan segala lapisan masyarakat, termasuk pantang tidak menyenangkan orang banyak lewat sapaan, gurauan, dan terutama‘’sap-sap’’nya—langsung dari kantung celananya walaupun jumlahnya tidak banyak, Rp50 ribuan. Popularitas Syamsul identik dengan Jokowi yang bersahaja dan meraih suara terbanyak di putaran I Pilgub DKI Jakarta. Hanya saja, Jokowi sukses dengan program visi dan misinya dalam meningkatkan harkat dan martabat warga Solo dari kalangan bawah dengan ketegasannya menolak pusat perbelanjaan modern, meningkatkan harkat dan martabat pedagang kakilima dengan menyediakan lokasi berusaha dilengkapi dengan sarana dan prasarana, tidak melakukan penggusuran semena-mena, menggerakkan perekonomian di sektor usaha kecil dan menengah dengan kebijakan izin satu atapnya. Puncaknya Jokowi tidak saja dinobatkan sebagai walikota terbaik oleh Kemendagri 2011, bahkan masuk dalam nominasi walikota terbaik sejagat olehThe City Mayors Foundation 2012. Ya, kalau soalpopularitasDatuktakkalah dengan Jokowi, tapi soal kinerja sebagai pemimpinsaatmenjabatBupatiLangkatDatuk

jeblok. Dia gagal menjalankan program pemerintahannya karena cenderung ‘’one man show’’ sehingga manajemen pemerintahan tidak berjalan normal. Dampaknya banyakterjadipenyelewengananggarandan menimbulkan kasus korupsi yang berbuntut panjang di KPK. Syamsul sendiri divonis 2,5 tahun di PengadilanTipikor dan hukumannya ditambah menjadi 5 tahun saat kasasi MA hingga kini masih mendekam di penjara. Proses hukum bertele-tele inilah yang mengakibatkanGatotPujoNugrohotetapmenyandang Plt Gubsu. Fantastis & Blunder Dua kata itulah kesimpulan melihat perolehan suara yang diperoleh pasangan calon Gubernur danWakil Gubernur Jokowi (Joko Widodo) - Ahok (Bagus Tjahaja Purnama) versi quick count di lima lembaga survei. Semua memenangkan pasangan yang diusung PDIP dan Gerindra dengan angka fantastis. Rata-rata dengan 42 persen, sementara sang incumbent pasangan Foke (Fauzi Bowo) – Nara (Nachrowi Ramli) harus puas di urutan kedua, dengan perolehan suara rata-rata di kisaran 34 persen. Padahal, lembaga survei yang sama sebelumnya menjagokan pasangan Foke yang unggul bahkan berkesimpulan kemungkinan berakhir satu putaran. Tentu dari tinjauan akademisi survei tersebut memalukan, mencederai dan melanggar etika. Kalau saja metodologinya benar hasilnya pasti benar, kalaupun berselisih masih dalam ambang batas toleransi. Bukan yang anehaneh dan sulit dimaafkan oleh kalangan intelektual kampus. Hal inilah yang semakin menguatkan dugaan semakin banyak lembaga survei abal-abal di negeri kita saat ini sehingga bisa dibeli merekayasa hasil surveinya untuk kepentingan politik para calon yang berani membayar mahal. Terkait popularitas dalam arti dikenal masyarakat Jakarta sebenarnya Foke di atas Jokowi.Tapidikenalsajabelumtentudicintai. Bisa-bisa dibenci. Di sini tingkat elektabilitaslah yang menentukan. Walaupun Jokowi hanya dikenal warga Solo dan masih asing di mata dan telinga sebagian warga Ibukota. Namun dalam waktu singkat, dua bulan saja, Jokowi – Ahok mampu menjungkirbalikkan perkiraanparapengamatpolitikyangsemula menilai Foke selaku incumbent sulit tergoyahkan. Hasilnya benar-benar mengejutkan. Fantastis! Hipotesis yang bisa diambil dari fakta putaran I adalah popularitas bisa diraih dengan mudah bila sosok yang maju punya nilai plus di mata dan hati masyarakat (publik). Modal penampilan mentereng, perlente, necis saja tidak cukup, karena selama ini banyakpejabatberpenampilan‘wah’namun visi dan misinya tak jelas, terlalu muluk-muluk, dan tidak berpihak pada masyarakat bawah. Setelah terpilih malah melupakan janji-janjinya.Halitulahyangterjadisekaligus

menjadititiklemah,blunderbuatFoke.Tokoh Betawiyangmengakuahlidalammenukangi Jakarta ternyata tidak mampu memikat warganya sendiri. Artinya, warga Jakarta sudah tidak yakin dengan kemampuan dan kesungguhan Foke dalam membenahi Jakarta yang semakin sumpek, semakin macet, semakin amburadul, langganan banjir, mengabaikanaspirasirakyatkecillewatpenggusuran,seakanJakartahanyamilikdansurga bagi orang kaya saja. Mencermati hasil Pilkada DKI kemarin tidak hanya suara Foke yang anjlok, tapi juga suara Hidayat – Didik, dan Alex – Nono. Suara Faisal – Biem lumayan, dan posisi Hendardji – Riza nomor buntut. Rendahnya suara Hidayat – Didik yang didukungPKSdanmassaPANdansuaraAlex – Nono yang didukung massa Golkar dll mengejutkan kita. Padahal, kedua pasangan itu memiliki dukungan parpol lumayan besar. Kalau saja mesin parpol mereka berjalan normal, setidaknya suara Hidayat dan Alex bisa menembus 20 persen.Tak pelak lagi anjloknya perolehan suara pasangan Foke – Nara yang digadang-gadang tim suksesnya bakal menang dalam satu putaran, nyatanya keok,patutmenjadikajianseriusuntukpertarungan hidup-mati putaran II. Selisih suara mencapai 8 persen menjadi modal besar buat Jokowi dan Ahok menuju putaran II. Pasangan kuda hitam ini tinggal menambah 10 persen saja dari suara para kandidat yang gagal untuk memastikan diri menjadi Gubernur dan Wakil Gubernur terpilih. Lampu Kuning Cagubsu Buat Cagubsu 2013 kiranya fenomena kemenangan Jokowi – Ahok patut dicermati agar jangan menyesal kemudian. Ibarat berada dalam posisi‘’lampu kuning’’ harus bersiap dan berhati-hati mengatur langkah dan program memanfaatkan waktu tersisa kurang dari sembilan bulan lagi. Tepatnya Pilgubsu berlangsung 7 Maret 2013. Beberapa hal yang perlu dicermati oleh para kandidat Pilgubsu mendatang adalah: Pertama, berkaca diri dari Pilgub DKI bahwa pilihan masyarakat bisa berubah dalamwaktusingkat,jikasosokyangdimajukan parpol maupun jalur independen benarbenar berkualitas dan sudah terbukti sukses sebelumnya, seperti Jokowi - Ahok. Kedua, menerapkan model komunikasi humanis ala Jokowi agar masyarakat tertarik melihat kemunculan calon yang berani tampil beda, sederhana, bersahaja, mampu memberi solusi cepat, tidak menjaga jarak dengan masyarakat kelas bawah. Ketiga, pintar mendekati media massa. Jakowi – Ahok mengerti betul apa yang dibutuhkan media massa sehingga setiap hari manuvermerekamendapattempatdiberbagai media tanpa harus membayar mahal. Keempat, menggugah pemilih rasional dan idealis semakin meningkat di Jakarta sehingga tidak tertutup kemungkinan pemilih rasional di Sumut pun terdongkrak, semakin kritis dalam memilih Cagubsu yang benar-benar memikirkan rakyat, membawa misi perubahan, bukan diri sendiri dan kelompoknya semata. Kelima, kandidat kepala daerah mana punjugawajibmenguasaidatadanpetawilayah. Sumut misalnya, terdiri dari berbagai kabupaten-kota, dengan etnis dan agama

yang berbeda-beda. Tidak mudah melakukan pendekatan, apalagi jika tidak mengantongi data valid dan tidak mengetahui karakteristik masing-masing daerah. Keenam,janganmerekayasahasilsurvei. Di poin ini tim sukses (timses) Foke – Nara blunder, menganggap enteng lawan-lawannya akibat tergoda hasil survei abal-abal yang menodai nilai-nilai moral dan akademis. Ketujuh, Cagubsu yang ingin meniru sukses Jokowi gunakan data dan lembaga survei yang terpercaya. Fenomena Jokowi bisa diulang lewat kajian terukur. Dan, inilah data persentase 13 juta penduduk Sumut berdasarkan etnik: Melayu (5,86 persen), Karo (5,09 persen), Batak (25,62 persen),Mandailing (11,27 persen), Nias (6,36 persen), Simalungun(1,04 persen), dan Pakpak(0,73persen).Sedangkanetnispendatang Jawa (33,4 persen), Minang (2,66 persen), Tionghoa (2,71 persen), Aceh (0,97 persen), dan gabungan etnis lainnya 3,29 persen. Dari aspek agama Islam (65,45 persen), Protestan (26,62 persen), Katolik (4,78 persen), Budha (2,82 persen), Hindu (0,19 persen), dan penganut keyakin lainnya 0,14. Jadi, bagi Cagubsu yang ingin meraih sukses bisa belajar dari fenomena dan trik Jokowi dalam berkomunikasi, memanfaatkan peluang dan kelemahan lawan secara optimal plus modal popularitas dan ketokohan.*** Penulis adalah wartawan Waspada, penerima penghargaan Press Card Number One dari PWI Pusat/Dewan Pers 2012.

Pengumuman Redaksi menerima kiriman karya tulis berupa artikel/opini, surat pembaca. Kirim ke alamat redaksi dengan tujuan ‘Redaktur Opini Waspada’ dengan disertai CD atau melalui email: opiniwaspada@yahoo. com. Panjang artikel 5.000-10.000 karakter dengan dilengkapi biodata penulis dan kartu pengenal (KTP). Naskah yang dikirim adalah karya orisinil, belum/tidak diterbitkan di Media manapun.Tulisan menjadi milik Waspada dan isi tulisan menjadi tanggungjawab penulis.

SUDUT BATUAH * Menag: Selama Ramadhan, tv jangan diisi lawakan - Lebih bagus perbanyak ceramah agama * Medan banjir setelah dilanda hujan deras - Banjir, macat tapi Adipura, he...he...he * Ketua PAC PP dan IPK Damai - Semangat Sumpah Pemuda!

oel

D Wak


Ragam

WASPADA Jumat 20 Juli 2012

C3

Olimpiade London

Arab Saudi Kirim Atlet Wanita Pertama SETIAP negara yang bertanding di Olimpiade 2012 di London sedikitnya sudah punya seorang atlet wanita setelah Arab Saudi menyertakan dua atlet perempuan dalam timnya untuk pertama kali. Wodjan Ali Seraj Abdulrahim Shahrkhani, seorang pejudo, dan pelari 800 meter Sarah Attar akan bertanding di London setelah Komite Olimpiade Arab Saudi memilih dua atlet wanita ini masuk dalam tim mereka. Mereka diundang untuk ikut serta oleh Komite Olimpiade Internasional (IOC). “Ini kabar positif dan kami dengan senang hati menyambut dua atlet ini di London dalam seminggu mendatang,” kata Presiden IOC Jacques Rogge dalam satu pernyataan Kamis (19/7). “IOC bekerjasama dengan KomiteOlimpiadeArabSaudidan

saya senang melihat dialog yang kami jalin membuahkan hasil.” Negara Arab Saudi merupakan kontingen terakhir yang hanya berisi atlet pria setelah Qatar dan Brunei – dua negara Islam lainnya yang tidak mengirim atlet wanita ke Olimpiade Beijing empat tahun lalu – mengumumkanmerekaakanmemenuhituntutan IOC untuk menghentikan diskriminasi jender di antara negara-negara anggotanya. “IOC berusaha memastikan keseimbangan jender yang lebih besar pada Olimpiade, dan berita saat ini bisa dipandang sebagai evolusi yang mendorong,” ujar

Rogge. “Dengan bergabungnya atlet wanita Arab Saudi dengan atlet perempuan dari Qatar dan Brunei Darussalam, itu berarti setiap Komite Olimpiade Nasional akan mengirim atlet wanita ke pertandingan Olimpiade London 2012. Penembak Bahiya al-Hamad merupakan satu dari empat atlet perempuan Qatar yang akan bertanding pada Olimpiade London, dan akan membawa bendera negaranya. “Saya terharu diminta untuk membawa bendera Qatar pada upacara pembukaan,” katanya di situs Internet IOC. “Event ini merupakan momen bersejarah bagi para atlt.” Olimpiade London secara resmi dibuka 27 Juli mendatang dan akan berlangsung sampai 12 Agustus. Atlet-atlet dari 204 negara diperkirakan akan ikut serta. Attar, pelari 800 meter Arab

Saudi itu, selama ini telah menjalani latihan di Amerika Serikat. “Ini merupakan penghormatan besar dan saya harap bisa menjadi dorongan besar bagi wanita di negara saya untuk terlibat dalam bidang olahraga.” Keputusan Arab Saudi itu merupakan hal yang luar biasa bagi negara kerajaan itu di mana wanitadilarangmengendaraimobil. Mereka tidak boleh memilih atau memegang jabatan publik, meskipunkebijakantersebutakan berubah pada tahun 2015. Wanita di Arab Saudi juga tidakbisamenikahataubepergian meninggalkan negara tanpa ijin dari walinya, yang biasanya ayah atau suaminya. Di bidang olahraga, atlet wanita dilarang ikut pertandingan Olimpiade karena mereka akan bertanding di depan massa yang campur baur antara wanita dan pria. Syafri/CNN

Al-Rawdah. Diberitakan Saudi Gazette, polisi syariah Saudi, Hai’a, menyita berbagai jenis cat rambut, alat kecantikan wanita, serta perkakas potong rambut dari pria yang dikenal dengan sebutan ‘Master Tato’ di kalangan kliennya ini. Awalnya pria ini mengatakan bahwa perkakas yang dibawanya merupakan milik sebuah salon kecantikan di Lebanon. Namun para penyidik menemukan SMS berisi

permintaan ditato dari beberapa kliennya dalam ponsel pria yang tidak disebutkan namanya tersebut. Pria ini sudah sembilan tahun berada di Saudi dengan menggunakan visa kerja. Awalnya dia beroperasi mempercantik wanita Saudi di sebuah apartemen, tapi kemudian dia memilih mengunjungi para klien di rumah mereka setelah curiga dirinya dimata-matai.

Pendaftaran Pemilih Di Pilpres AS Lewat Facebook WASHINGTON akan menjadi negara bagian di AS yang mengijinkanpendaftaranpemilih melalui aplikasi Facebook. Pejabat negara bagian mengatakan aplikasi yang akan tersedia pada pekan depan merupakan “cara alami” untuk pendaftaran pemilih. Facebook tidak akan mengumpulkan data pemilih secara rinci, hanya nama dan tanggal lahir pemilih, dan tidak akan memiliki akses terhadap kumpulan data pemilih, demikian pernyataan dari negara bagian. Langkah itu dapat dilakukan setelah sejumlah negara bagian telah memperkenalkan atau meloloskan undang-undang yang menghendaki lebih banyak bukti untuk mendaftar atau hak memilih. Koresponden menyebutkanpendaftaranpemilihitudapat dilakukan hingga menjelang pemilihan presiden 6 November nanti. Negara bagian Washington, menawarkan pendaftaran pemilih secara online sejak 2008. Secara keseluruhan, puluhan negara bagian mengijinkan pemilih mendaftar secara online.

Saudi Cambuk Seniman Pembuat Tato SEORANG pria Lebanon yang tinggal di Arab Saudi divonis penjara selama setahun oleh Pengadilan Distrik Jeddah karena melayani permintaan seorang wanita untuk menato tubuh dan membantu mereka berhias. Tidak hanya itu, dia masih harus menerima hukuman 200 kali cambukan. Seniman pembuat tato yang tidak disebutkan namanya ini ditangkap oleh polisi syariah Saudi di distrik

Atlet wanita Arab Saudi mulai diikutsertakan dalam ajang olahraga dunia.

Tetapi, pejabat di Olympia, ibukota negara bagian, telah memutuskan bahwa dibutuhkan upaya lebih untuk menarik lebih banyak orang untuk mendaftar sebagai pemilih. “Ini merupakan era media sosial dan lebih banyak orang menggunakan layanan online, ini merupakan cara alami untuk memperkenalkankepadamasyarakat melakukan pendaftaran secara online dan menggunakan kekuatan teman di Facebook untuk meraih lebih banyak orang untuk mendaftar,” kata co-director pemilu Shane Hamlin kepada Associated Press. Pendaftaran pemilih Aplikasi Facebook dikembangkan oleh Microsoft dan telah direncanakan sejak musim gugur lalu, menurut sebuah laporan. “Kami bersemangat bahwa warga negara bagian Washington akan dapat mendaftar untuk memilih dan melihat informasi pemilihan di Facebook,” kata juru bicara Facebook Andrew Noyes kepada AP. Aplikasi ini akan muncul di halaman Facebook Menteri Dalam Negeri negara bagian Was-

hington Sam Reed. Pengguna dapat mengklik“like” dalam layanan dan merekomendasikan ke rekan mereka. Laporan menyebutkan pengguna harus mengijinkan Facebook untuk mengakses informasi mereka, yang akan digunakan untuk menambahkan nama dan tanggal lahir ke formulir pendaftaran pemilih. Setelah itu, pengguna harus memasukan nomor SIM atau KTP untuk melanjutkan pendaftaran. Melalui aplikasi itu pengguna juga dapat mengakses situs milik negara bagian“MyVote”, yang memuat informasi tentang kandidat dan kebijakan seputar pemilu. Hamlin mengatakan kepada AP bahwa Facebook tidak dapat mengakses kumpulan data milik negara bagian. Data pemilih KetikaWashingtonmulaiupaya pendaftaran pemilih menjelang pemilu, setidaknya delapan negara bagian mempertimbangkan kebijakan untuk membatasi kampanye pendaftaran pemilih. Sejak 2010, 11 negara bagian lain telah meloloskan undangundang yang mengharuskan pe-

milih untuk menunjukan identifikasi foto yang disetujui pemerintah dalam aturan pemilihan. Para pendukung menyebutkan langkah itu akan mengatasi kekacauan pemilu, tetapi kritik menyebutkan kebijakan itu akan berpengaruh besar terhadap pemilih miskin, lanjut usia dan minoritas. Enam negara bagian harus mendapatkan persetujuan dari Kementrian Hukum, karena adanya diskriminasi dalam praktekpemilihandimasalalu.Sejauh ini belum ada negara bagian yang mendapatkanpersetujuandalam aturan baru itu. Pekan lalu, Florida mendapatkan persetujuan untuk menggunakanbasisdatapemilihuntuk menghapus nama warga negara asing dari data pemilih mereka, setelah hakim menolak permintaan departemen hukum untuk melarang kebijakan tersebut. Pemerintah federal telah menyatakan bahwa Florida akan menghapus data pemilih sah dari daftarnya. Negara bagian lain, seperti Colorado, juga meminta untuk mengakses basis data.

Untuk menyambung hidup, selain menato, pria ini juga menata rambut, mewarnainya dan mendadani para kliennya, yang semuanya wanita. Nahas, dia akhirnya tertangkap setelah seorang anggota polisi syariah menyamar sebagai klien. Di Saudi tato tidak dilarang secara resmi, namun tato dinilai bertentangan dengan ajaran Islam, yang diterapkan secara ketat di Saudi. (vvn/rzl)

Kucing Ini Hidup Tanpa Makan Dua Minggu SEEKOR anak kucing berusia tiga bulan mulai pulih di California setelah menempuh perjalanan melintasi Pasifik dengan selamat dalam kontainer pengiriman dari China, tanpa makanan atau air, kata para pejabat. Binatang berbulu oranye-putih itu dinamai Ni Hao, atau dalam bahasa Mandarin bermakna Halo, ditemukan ketika kontainer dibuka pekan lalu, setelah dua pekan perjalanan sejauh 10.450 kilometer dari Shanghai. Awalnyaiaterlalulemahuntukberdiri,tapianakkucingituakhirnya memulai langkah pertamanya - dan pejabat kini sedang mencari

pencinta kucing setempat yang mau mengadopsinya. “NiHaodisambuttimmedisdengansuaramengeongpertamanya pagi ini dan berusaha untuk berdiri,” kata Marcia Mayeda, kepala Los Angeles Department of Animal Care and Control. Secara teori ia harus tetap di karantina selama 60 hari, tetapi ia “mungkin diperbolehkan untuk menyelesaikan masa karantina di bawah perawatan dan pengawasan dari keluarga asuh jika kesehatannya terus membaik,” kata Mayeda. Tidak jelas bagaimana cara anak kucing tersebut masuk ke dalam kontainer tersebut. (ant/rzl)

Net

Ni Hao, kucing berusia tiga bulan yang tetap hidup setelah menempuh perjalanan sejauh 10.000 kilometer tanpa makan.

Pendaftaran pemilih melalui Facebook diyakini dapat mengatasi masalah dalam pemilu.

Penduduk Florida Protes Rencana ‘Nyamuk Mutan’ LEBIH 100.000 penduduk di Key West menandatangani satu petisi yang menentang penyebaran ribuan nyamuk yang dimodifikasi secara genetis ke ekosistem di Florida. Suratkabar Christian Post melaporkan, 5.000 sampai 10.000 nyamuk jantan telah direkayasa gen-nya oleh perusahaan Inggeris, Oxitec, sehingga mati lebih cepat. Tujuan dari pelepasan nyamuk tersebut adalah: ketika mereka bereproduksi dengan populasinyamuksetempat,maka nyamukinibisamengurangikasus demam berdarah (DBD). Seorang penduduk KeyWest bernama Mila de Mier mengatakan“dampak jangka panjang dari apayangkemudianndisebut‘nyamuk mutan’ itu masih belum diketahui dan karenanya mereka meluncurkan petisi online yang direncanakan akan disampaikan kepada Gubernur Rick Scott dan

pejabat lainnya ketika jumlah penandatangannya mencapai 150.000. “Lebih banyak timbul pertanyaan dibanding jawaban yang diperoleh dan kami menuntut dilakukannya penelitian lebih dalam,” tuntut Mila lewat situs petisinya itu, dan menyatakan bahwa kasus demam berdarah sudah hilang dari KeyWest sejak 2010. Meski penyakit demam berdarah menimbulkan gejala yang tidak menyenangkan, PerpustakaanMedisNasionalASmengatakan, penyakit tersebut tidak terlalu berbahaya. Dampaknya bisadisembuhkandenganTylenol dan banyak minum air. Suratkabar IBTimes menekankan bahwa kekhawatiran soal rencana pelepasan ‘nyamuk mutan’ tersebut telah menimbulkan perdebatan luas soal makanan rekayasa genetis.

Nyamuk bisa dikendalikan dengan menjaga kebersihan lingkungan./Yc “Kamitidakinginperusahaan ini melakukan rekayasa tersebut hanya untuk mendapatkan uang. Oxitec mengatakan “kami melakukaniniuntukmengendalikan wabah nyamuk”, namun ini

tidak benar,” cetus Mila kepada WKMG-TV. “Cara lain untuk mengendalikan nyamuk selama ini juga berhasil.Tapi, untuk‘nyamuk mutan’ ini kami tidak mau ambil resiko.”Syafri/Yc


C4

Daftar Khatib Shalat Jumat

MEDAN AREA Amaliah Jl. Amaliun Gg. Bandung Kota Maksum II Ar-Ridho Jl. A.R. Hakim Gg. Sepakat No. 6 Al-Chairat Jl. A.R. Hakim Gg. Sederhana No. 22 Al-Hidayah Jl. A.R. Hakim Gg. Sukmawati Al-Ikhlash Taqwa Jl. Medan Area Selatan No. 129 Al-Ikhwaniyah Jl. Utama/Amaliun Gg. Tertib No. 15 Al-Istiqomah Jl. Seto No. 33 Kel. Tegal Sari II Al-Misbah Jl. A.R. Hakim Gg. Langgar/Damai No. 27 Al-Makmur Jl. A.R. Hakim Gg. Langgar/Bahagia No. 25 Al-Manar Jl. Laksana No. 47 Al-Wathan Jl. A.R. Hakim Gg. Langgar No. 53 Al-Utaminiyah Jl. Utama Gg. H. Syukur No. 1 Chalid Ibnul Walid Jl. Rakhmadsyah No. 366 Hidayatul Islamiyah Jl. Gajah No. 39 Istiqlal Jl. Halat No. 53 Kel. Kota Matsum IV Jami’ Darul Ikhlas Jl. Batu No. 13 Jamik Jl. Medan Area Selatan No.289 Kel.Surakamai-I Jamik Jl. Sutrisno Gg. Damai I No. 6 Kel. Komat I Jami’ Taqwa Jl. A.R. Hakim Gg. Langgar No. B-A T.S. III Khairiyah Jl. Rahmadsyah/Puri Gg. Subur No. 192 Muslim Jl. Dr. Sun Yat Sen No. 71 Muslimin Jl. Gedung Arca Gg. Jawa No. 3 Nurul Huda Jl.Denai Gg. Pinang No. 12 Quwwatul Muslimin Jl. H.M. Jhoni No. 69-D Perguruan Ketuhanan Jl. Puri Gg. Perguruan No. 4 Rahmat Jl. Denai Gang I No. 2 Silaturrahim Jl. Emas No. 10 Silaturrahim Jl. Bromo Gg. Silaturrahim No. 11 Syekh Hasan Maksum Jl. Puri Gg. Madrasah Taqwa Ar-Rahim Jl. Utama Gg. Ampera I No. 240-AR Taqwa Jl. Bromo Gg. Taqwa No. 11 Taqwa Jl. Bromo Gg. Aman No. 23 Taqwa Jl. Megawati Taqwa Jl. Puri Komplek Masjid Taqwa No. 183 Taqwa Lawang Jl. Gedung Arca Gg. Sehat No. 8

Drs. Umar Khatib Drs. S. Silalahi H. Arsyad Ibrahim Mahmuddin, BA Ruskhan Nawawi Drs. Komaruddin Drs. H. Fauzi Usman Al Zuheri Lubis, S.Ag H. Zuhri Nasution, Lc Prof.DR.Lahmuddin Lubis, M.Ed Drs. Abd. Razak Hasibuan Drs. H. Darwin Zainuddin, MA Abd. Muthalib, S.Ag Drs. H. Hayat Harahap H.M. Hafiz Yazid, BA Drs. H. Amrin Siregar Drs. Ahmad Azizi, A.M. Drs. H. Zainal Arifin Dr. Sulidar, MA H.A. Rahman Sofyan, Lc, SE, MA Muchlis Muaz, S.HI H.M. Silahuddin, S.Pd.I Syahril Basyrah, S.HI, S.Pd.I H.M. Saleh Umar, S.Pd Drs. H. Zainal Abidin Zein Drs. H. Muhidin Gurning Drs. H. Syahminan Hasibuan Drs. Alimuddin Syah H.M. Tahir Ritonga, Lc Drs. H. Efnedi Arief, MA Drs. Samidi, M.Pd Jamaluddin Al-Batahany H. Irawan Syahputra, MA Drs. Kemal Fauzi Drs. Yunus Daulay

MEDAN AMPLAS Ar-Rahmat Jl. Bajak II-H Kel. Harjosari II Al-HidayahMapolda Sumut Jl.S.M. Raja Km.10,5 No.60 Al-Hidayah Jl. Kongsi Gg. Syukur No. 307 Marindal I Al-Huda Jl. Bajak I Kel. Harjosari II Al-Muslimin Jl. Pangilar No. 35-A Kel. Amplas Al-Muqorrobin Aspol P.Merah Jl. Raya Medan Tenggara Baiturrahman Jl. Bajak III Kel. Harjosari II Daarul Azhar Jadid Jl. Bajak II Gg. Cengkeh No. 1 Ikhlashiyah Jl. Garu-I No. 69 Kel. Harjosari-I Jami’ Harjosari Jl. S.M. Raja Km. 6,5 No. 21 Jamik Jl. Panglima Denai No. 23 Kampus UNIVA Jl. S.M. Raja No. 10 Komp. UNIVA Nurul Barkah Jl. Selambo IV No. 7 Nurul Iman Jl. S.M. Raja Km. 9 Nurul Tuvail Khatijah Jl. Garu IV No. 140 Ridho Shobirin Jl. Garu IV Harjosari I Ramadhan Jl. Pertahanan No. 37 Kel. Timbang Deli Ramadhan Jl. Garu VI Kel. Harjosari I Shilaturrahim Jl. Garu III No. II-G Kel. Harjosari-I Salman Jl. STM Kel. Sitirejo II Raya Taqwa Jl. S.M. Raja Km. 5,5 No. 1 Kel. Harjosari-I Taqwa Jl. S.M. Raja Gg. Pulau Harapan No. 1-B Tarbiyah Lingk. I Kel. Siti Rejo II

H. Hasan Basri, Lc H. Bambang Irawan, S.Ag Drs. Slamet Hamzah, S.Pd.I A. Kosim Daulay, BA Drs. Jainal Aripingunawan Mrp., MA Drs. H. Jamhir Mustafa Drs. Ramli, AT Drs. Sangkot Nasution Drs. H. Bahrum Saleh Hsb., MA Drs. Syamsul Anwar Nst. Jamaluddin, S.Ag Muhayan, S.HI, S.Pd.I Drs. M. Andres, M.Pd Ilham Syahputra, S.HI,S.Pd.I H. Hafiz Yazid, BA H. Kamaruddin Tasik Mex Jenis Chan Drs. Dahler Effendi Hasibuan Dani Ansyori, S.Pd.I Drs. Azwani Lubis, M.Ag Drs. Asrizal Tanjung Gunawan, S.Pd.I Drs. H.M.Yazid Syamsuddin, Lc

H. Marajaksa Harahap, S.Ag H. Abd. Achyar Nst., Lc, MA Dr. H. Syaafi’i Siregar, MA Sakir Menik, MA Hasnan, S.Ag Drs. H. Nazaruddin Hasibuan Arwansyah Dalimunthe, S.Ag Prof. Dr.H.T. HasballahThaib, MA Drs. H. Hayat Harahap Drs. H. Yulnaidi Tanjung

MEDAN BARAT Akmal Jl. Putri Merak Jingga No. 15 At-Taqwa Jl. Putri Hijau No. 14 Asy-Syafiah Jl. Karya Dalam (Depan kantor Lurah) Al-Furqan Jl. Karya 2 Lingk. XI Kel. Berombak Al-Jihad Jl. K.M. Laut Yos Sudarso/Jl. Pertempuran Al-Muttaqin Jl. Karya No. 41 Kel. Sei Agul Al-Musaabiqiin Jl. Kapten Maulana Lubis Al-Mukhlishin Jl. G.B. Josua No. 8 Al-Massawa (Arab) Jl. Temenggung No. 2-4-6 Al-Wiraji Jl. Karya Gg. Sosro Lingk. XVI Kel. Karang B. Baitus Syifa Jl. Putri Hijau Rumah Sakit Tembakau Deli Jami’ Jl. Merdeka No. 3 Pulau Brayan Kota Muslimin Jl. Karya Lingk.XVII No.41 Karang Berombak Nurul Islam Jl. Karya Lingk.VIII No.203 Kel.K.Berombak Nurul Haq Jl. Listrik No. 12 Lama Jl. Mesjid Gg. Bengkok No. 62 Kel. Kesawan Syuhada Komplek Trikora Jl. Danau Toba No. 2 Taqwa Jl. Karya Gg. Madrasah No. 24

Febry Lesmana Drs. H. Mustamir Abd. Roni Hasibuan, S.Ag M. Ya’qub Drs. Syahrein Pane H.M. Najib Lubis, Lc Drs. H. Marmyn Tanjung Ibrahim Lubis Adriansyah Slamet Riadi, S.HI H. Saman Kandar Drs. H.M. Ridwan Nazaruddin Lubis H. Surianda Lubis, S.Ag Drs. Bahron Nasution H. Choliluddin Usman Sugeng Wanto, MA Awaluddin Hasibuan, S.Ag

MEDAN BELAWAN Jami’ Belawan Jl. Selebes Belawan

H. Yusuf, AG

MEDAN DELI Amalyatul Huda Jl. Nusa Indah No. 22-A Kel. Tg. Mulia Ar-Ridha Komplek TNI-AL Barakuda Tg. Mulia As-Sa’adah Jl. Alumunium IV Gg. Tawon Tg. Mulia Al-Amanah Jl. K.L.Yos Sudarso Km. 6,8Kel.Tg. Mulia Al-Abraar Jl. K.L. Yos Sudarso Titi Papan Al-Iklas Jl. Alumunium II Lingk. XII Tg. Mulia Al-Jihad Jl. Mangaan I/Jl. Bahagia Raya Lingk. VI Al-Munawwarah Jl. Pulau Batam No. 1 Al-Syarifah Jl. Metal Gg. Rukun No. 06 Lingk. XVIII Jam’iyyatush Shoolihin Kel. Tg. Mulia Jamik Jl. K.L. Yos Sudarso Km. 6,2 Tg. Mulia Nurul Iman Jl. Sidomulyo Ujung Kel. Tg. Mulia

Drs. M. Ridwan Sarman Ahmad Thamrin, MA Rijal Sabri, M.Ag Drs. H. Nurman, S. Drs. H. As’ad Marlan, M.Ag Drs. Abd. Majid Syam Syahruddin, S.Pd.I Edy Susanto, S.Pd.I Waizul Qorni, M.Ag Drs. H. Sangkot Saragih Radiaman S., S.Pd.I

MEDAN DENAI Amal Bakti Jl. Raya Menteng Gg. Abadi No. 21-A Ar-Ridha Jl. Camar 18 Blok II Perumnas Mandala Al-Amanah Jl. A.R. Hakim Gg. Aman No. 90 Kel. TSM. Al-Ansor Jl. Raya Medan Tenggara Gg. Anshor No. 11 Al-Hidayah Jl. Menteng Indah VI Kel. Medan Tenggara Al-Hidayah Jl. Bromo Gg. Masjid Al-Hidayah Al-Hasanah Perumnas Mandala Al-Muslimin Jl. Kenari XII Lingk. VII-VIII Per. Mandala Al-Muslimun Jl. Bromo (Rawa Sembilang) Gg. Kurnia Al-Mukhlishin Jl.Enggang I Perumnas Mandala Al-Quba Jl. Rawa Kel. Tegalsari Mandala II Al-Ridha Jl. Jermal VII Baiturrahman Jl. Medan Tenggara VII No. 42 Darul Ilmi Murni Jl. Terusan Dalam/Simp. Jl. Tapanuli Hijraturridha Jl. Selamat Ujung Gg. Subrak Sp. Limun Nurul Islam Jl. M. Nawi Harahap Nurul Iman Jl. Rawa I Lorong Sedar Nur Hidayah Jl. Datuk Kabu Gg. Masjid No. 11-C Rahmatullah Jl. Kramat Indah Gg. Trenggeno II Taqwa Jl. Jermal III No. 10 Taqwa Jl. Pancasila Gg. Masjid No.1 Kel.T.S.Mandala III

MEDAN JOHOR Amanah Jl. Eka Bakti Ujung Lingk. IV Kel. Gd. Johor Arrahman Jl. Brigjen Zein Hamid Kel. Titi Kuning Ainul Iman Jl. Ekawarni I Kel. Gedung Johor Annazhirin Jl. Karyawisata Kel. Gedung Johor Ar-Raudhah Komplek Risva I Blok V Kel. Gedung Johor Assyafi’iyah Jl. STM - Suka Tari No. 9 Kel. Suka Maju Al-Amin Jl. Eka Surya Gg. Eka Kencana Gedung Johor Al-Badaar Jl. Karya Dharma No.19 Kel. Pangk. Masyhur Al-Firdaus Jl. Karya Jaya Gg. Eka Jaya II Lingk. II Al-Furqon Jl. Karya Perbatasan Lingk. XII P. Masyhur Al-Huda Jl. Eka Surya Psr. V Gg. Sidodadi Ged. Johor Al-Hidayah Jl. Brigjen Katamso Km. 7,2 Kel. Titi Kuning Al-Hidayah Jl. Karya Jaya Kel. Gedung Johor Al-Ikhlas Jl. Karya Tani Lingk. VIII Pangk. Masyhur Al-Ikhlas Jl. Karya Kasih Baru Lingk. X Kel. P. Masyhur Al-Ikhlas Jl. Eka Suka Lingk. XIII Gedung Johor Al-Muslimin Jl. Suka Luhur Al-Muharram Jl. Eka Budi Kel. Gedung Johor Al-Mahmudiyah Jl. Brigjen Hamid Km 6,5 Kel. T.Kuning Al-Mukhlisin Jl. Karya Sehati No. 14 Kel. P. Masyhur Al-Muhajirin Komplek Medan Permai Al-Mustafa Jl. Karya Jaya Gg. Karya XII-XIV Baitul Iman Jl. Karya Jaya Asrama Arhanudse II/BS Baiturrahmah Jl. Karya Jaya No. 101 Pangk. Masyhur Baitussholihin Jl. Karya Bakti No. 71 Kel. P. Masyhur Fajar Ramadhan Perumahan Johor Indah Permai II Graha Deli Permai Jl. Sidodadi Pasar IV Kel. Gd. Johor Muslimin Jl. Karya Jaya, Kel. Pangk. Masyhur Muttaqiin Jl. Luku I No. 42 Kel. Kwala Bekala Nurul Aldys Jl. Karya Bakti No. 34 Pangk. Masyhur Nurul Falah Jl. Eka Rasmi No. 42 Kel. Gedung Johor Nurul Huda Jl. Letjen Ginting Km. 8 Kwala Bekala Nurul Huda Jl. M. Basir No. 9-A Kel. Pangk. Masyhur Sholihin Jl. Karya Jaya No. 160-G Gedung Johor

Fakhrurrozi, S.Pd.I Drs. Tuah Sirait M. Nasir Anshori, S.HI, M.Ag Drs. H. Khairul Akmal Rangkuti Dr. H. Syarbaini Tanjung, MA Drs. H. Hafidz Isma’il Drs. H.M. Rusli, MR Drs. Muhammad Thahir Drs. H. Abd. Salam Syahruddin, S.Ag Ismail, SE H.M. Syafiar, MA Drs. H. Haidir Tanjung M. Hasbi Al Mawardi Lbs., S.Pd.I M. Nasir Anshori, S.HI Mhd. Yusuf Marpaung, SH H. Achdar Bunayya Ismail Nasution Ahmad Syafii Harahap, S.Ag Mhd. Arifin Jahari, Lc Drs. Timbul, D. H. Maddin Nasution Drs. H. Syamsul Basri, T. M. Daud Effendi Arif Muhammad Erde H.M. Bambang Irawan, S.Ag Drs. N. Makhtub Azman, S.HI Drs. H. Zahiruddin Nas Drs. Sariman Al-Faruq Drs. Syamsul Rizal Ikmaldi Jambak, S.Ag Drs. Syaiful Bahri Siregar Son Haji Harahap

MEDAN KOTA

MEDAN BARU Agung Jl. Pangeran Diponegoro No. 26 Al-Amanah Jl. Diponegoro No.30-A Kom.Gd.Keuangan Al-Falah Bank Sumut Lantai X Jl. Imam Bonjol No. 18 Al-Hasanah Jl. Letjend. Jamin Ginting No. 314 Al-Ikhlas Jl. Sei Padang No. 129 Bulan Jl. Letjend. Jamin Ginting Gg. Masjid No. 1 Iklab Jl. Letjend. Jamin Ginting Km. 1,27 Muslimin Jl. Sei Batang Serangan No. 93 Nurul Muslimin Jl. DR. TD. Pardede 42 Nurul Huda Jl. K.H.Wahid Hasyim Asrama Brimob

An-Nur Jl. Budi Luhur No. 75-A H. Syarifuddin Siagian Ar-Raudhah Jl. Persatuan No. 22-AR Helvetia Timur Drs. Abdul Majid As-Syarifah Jl. Pembangunan Kompl. Pondok Surya DR. H. Yaqub Amin, MA Al-Falah Jl. Palem Raya Perumnas Helvetia Drs. H. Marasonang Siregar Al-Huda Jl. Balai Desa/Beringin V No. 116 Kel. Helvetia Damri Tambunan, S.HI Al-Hidayah Jl. Bakti Luhur No. 21 Kel. Dwikora Burhanuddin Harahap, S.Ag Al-Hasanah Jl. Setia No. 41 Tg. Gusta Amiruddin Munthe, S.HI Al-Ikhlas Jl. Bahagia Lingk. VI Kel. Cinta Damai Nasrun Al-Ikhas Jl. Teratai II Blok 18 Perumnas Helvetia Drs. H. Syarifuddin Pasaribu Al-Ikhlas Jl. Jongkong Komplek Dolok Sumut Drs. Ajran Tanjung, S.Pd.I Al-Ikhlas Jl. Setia Luhur No. 180 Lingk. XI Dwikora Drs. Irham Hasibuan Al-Mustaqim Jl. Kapten Muslim No. 226 Drs. H. Muchtar Baijuri Al-Mukhlisin Jl. Bakti Utara No. 21 Lingk. VI Kel. T.Gusta Bustami, H.S. Al-Mahabbah Jl. Kelambir Lima Gg. Sentosa Tg. Gusta Anhar Alkhairy Al-Masturah Jl. Binjai Km. 7,8/Jl.Sekolah No. 29 Drs. Mhd. Serawi Muhamzist Darussalam Jl. Asrama No. 11 Syaukani Muda, MA Ikhlasiyah Jl. Amal Luhur No. 29 Kel. Dwikora Drs. H.M. Yazid Mufti Lubis Istiqomah Jl. Amal Luhur No. 86 Kel. Dwikora Drs. Abdul Wahab, K. Tjut Nyak Dhien Jl. Gatot Subroto/Jl. Rasmi No. 28 Dr. H. Abdullah Jamil, M.SI Taqwa Jl. Kapten Muslim Gg.Jawa Lr. Muhammadiyah Drs. Matsyeh, MG Taqwa Jl. Pemasyarakatan Gg. Masjid No. 7 Sukadomo Syahrul, AS Taqwa Jl. Kapten Sumarsono Gg. Safar Muhammad Natsir, S.Ag Taqwa Jl. Kamboja Raya No. 319 Blok 4 Perum Helvetia Drs. H. Azhar Razak Lubis Taqwa Jl. Setia No. 30 Tg. Gusta Drs. A. Tanjung Taqwa Jl. Asrama No. 14-P Sei Sikambing V-II Drs. H. Syamsuddin Adi Jaya

H. Darma Efendi, SH H.M. Saleh Rambe Awaluddin Pulungan, S.HI Drs. Nazamuddin Hutapea Drs. H. Syahlan, HR H. Rajab Asri Masweil Nst., Lc Drs. Syawal Harahap Haryanto, S.S., MS Drs. H. Baharuddin Nst., Lc Drs. H. Helmi Walid Ruskhan Nawawi Drs. Daliman Siregar M. Rusli Ismail, S.Ag Drs. Adnan, MH H. Burhanuddin Nur, Lc Drs. H.A. Taufik Lubis Drs. H. Ramidin Simbolon Drs. Jamaluddin Drs. Ramli, AT Drs. Sutikno Rafdinal, S.Sos, MAP

MEDAN HELVETIA Amaliyah Jl. Sakura I Lingk. II Blok-19 Perum. Helvetia Zulkifli Rangkuti, S.Ag

An-Nazhafah Jl. Rumah Sumbul No. 4 Lingk. I Al-Hidayah Jl. Saudara Kel. Sudirejo II Al-Huda Jl. Kemiri III No. 28 Simpang Limun Al-Hasanah Jl. Tanjung Bunga II Kel. Sudirejo II Al-Ikhlas Jl. Salak No. 9 Al-Mashun Jl. Sisingamangaraja Al-Muttaqin Jl. Amaliun/Panduan Tenaga Gg. Tengah Da’wah Jl. Sakti Lubis Gg. Amal No. 19-B Hikmah Hongkong Plaza Jl. Cerebon Islamiyah Jl. Jati III No. 85 Kel. Teladan Timur Muslimin Jl. Air Bersih Lingk. VII Sudirejo I Ma’ul Hayah PDAM Tirtanadi Jl. S.M. Raja No. 1 Pahlawan Muslimin Jl. Pencak Raya Pusat Pasar Ridho Bakti Jl. Air Bersih Lingk. IX, Kel. Sudirejo-I Setia Amal Jl. Sakti Lubis Gg. Pegawai No. 87-C Taqwa Jl. Demak No. 3 Taqwa Jl. Mahkamah K-36 Thawalib Jl. S.M. Raja Gg. Isa No. 7 Yayasan Zending Islam Indonesia Jl. SM. Raja No. 11-A

Ediyanto, Lc, MA Drs. H. Sarikun Manurung Drs. Rizaluddin Siregar Sakholid Nasution, MA Drs. Sunaryo Prof. Dr. H.M. Hatta H. Mhd. Arief RD, Lc, S.Pd.I Drs. H.M. Basyir Yahya Drs. Khudri Lubis M. Yusuf S. Fil.I Pamonoran Siregar, S.Pd.I Prof.DR.H. Amli Abd.Wahid, MA H. Yusri Indra, Lc H. Hasrat Efendi Samosir, M.Ag Drs. H. Muhidin Gurning Rusli Drs. Tagor Muda Lubis, MA DR. Askolan Lubis, MA Drs. Yabir Edi Lazuardi Harahap, S.Pd.I

MEDAN LABUHAN Al-Amal Jl. Banten Gg. Amal No. 170 Dusun IX-A Drs. Abdul Majid Syam Al-Husain Jl. Jala Raya Griya Martubung H. Musa Munthe Al-Mukarramah Kampung Besar Darat Kel. Martubung Drs. M. Syafi’i, MS Baitul Ikhwan Jl. T. Lestari 12/9198 Blok V Gr. Martubung H. Irwansyah, SH Nurul Khairiyah Jl. Veteran Ujung Psr X Ds Manunggal Drs. H.M. Fauzi, MA Raya Al-Osmani Labuhan - Deli A. Faruni M., S.Ag MEDAN MAIMUN Abidin Jl. Brigjen Katamso Km.3 Gg. Nira Kel.Kp. Baru Ar-Rahman Jl. Brigjen Katamso Gg. Perbatasan Baru Darul Ali Jl. Brigjen Katamso Gg. Nasional No. 20 Jami’ Ash-Sholihin Jl. Brigjen Katamso No. 208 Jami’ Al-Fajar Jl. Brigjen Katamso Gg. Al-Fajar Jami’ Aur Jl. Brigjen Katamso/Kp. Aur Lingk.IV Kel. Aur Jami’ Jl. Brigjen Katamso Gg. Mesjid No.53 Nurul Muslimin Jl. Juanda (bundaran) Kel. Jati

Asmu’i Lubis, S.HI Drs. Pangihutan Siregar H. Agus Rizal Koto, S.HI, S.Pd.I Drs. H. Anwar Sayuti Indra Budiman, S.Pd.I Deflijar Nasution, S.Pd.I Drs. H. Marjan, A.N. Ahmad Zuhri, S.Ag

MEDAN MARELAN Ar-Ridha Jl. Platina Raya Lingk. 21 Kel. Rengas Pulau Al-Ikhlas Jl. Marelan IX Lingk. VII Kel. Tanah 600 Al-Muslimin Jl. Masjid Pasar V Kel. Rengas Pulau Taqwa Jl. Penghulu Lama Gg. Famili Paya Pasir Taqwa Marelan

Drs. Syafruddin Syam, MA H. Aliyuddin Abd. Rasyid, Lc, MA Drs. H. Yusril Fuad Drs. Ahyarsyam Zailani, S.Pd.I

MEDAN PERJUANGAN Amal Jl. Ngalengko Lr. Saudara No. 11 Ar-Rahman Jl. Prof. H.M. Yamin SH No. 363 Ar-Rahim Jl. M. Yacub Gg. Langgar Batu No. 24 Ar-Rahmah Jl. Gurilla Gg. Melati No. 5 Ar-Ramlah Jl. Sejati No. 16 Al-Amin Jl. Prof. H.M. Yamin SH, 482 Al-Aminin Jl. Pahlawan/Sakti Kel. Pahlawan Al-Falaah Jl. Ibrahim Umar (Gg. Sado) No. 03 Al-Fajar Jl. Prof. H.M. Yamin SH Gg. Kelambir Al-Hidayah Jl. Pahlawan Gg. Anom No.12 Lingk. III Al-Hurriyah Jl. M. Yakub No. 17 Al-Huda Jl. Malaka No. 117 Al-Ikhlas Jl. Setiajadi Kel. Tegalrejo Al-Muslimin Jl. Gerilya No. 1 Al-Muslim Jl. Pelita VI Gg. Serayu No. 10 Hidayatul Ihsaniah Jl. Sentosa Lama Gg. Aman No. 5 Ikhwaniyah Jl. M. Yacub No. 3 Ikhsaniah Jl. Gurilla No. 31-A Kel. Sei Kera Hilir I Ikhlashiyah Jl.Sei Kera No. 314 Kel. Sei Kera Hulu Istiqomah Jl. Bambu Runcing/Pahlawan Jamik Al-Ikhwan Jl. H.O.S. Cokroaminoto Kel. S.K.Hulu Jamik Ubudiyah Jl. Pelita-I Gg. Tangga Batu 11 Jami’ Sentosa Jl. Sentosa Lama Gg. Perwira No. 1 Malikus Saleh Jl. Gurilla No. 10 Kel. Sei Kera Hilir Syuhada Jl. Pahlawan No. 11 Kel. Pahlawan Thaharah Jl. Pelita II No. 29 Kel. Sidorame Barat

Drs. Syawaluddin Harahap H. Mar’i Muhammad, S.HI Miftahul Khoir Drs. Musonip Siregar H.M. Basri, MA Siddik Al-Bukhory Drs. H. Abusoman Pulungan Drs. H.M. Yahya Zakaria H. Zulfanuddin Marbun, S.Pd.I Fauzan, S.Ag H. Sutan Syahrir Dalimunthe, S.Ag Febri S. Lesmana, S.Sos.I Drs. Zakaria Drs. H. Abdul Rahman Kasbi Prof. DR. Nawir Yuslim, MA Drs. H. Akhiruddin Muhid Hasnan, S.Ag Syahlul Amri, S.Ag Drs. Asbin Nasution Drs. Suud Tambunan Drs. H. Ramli Mansur Drs. Ishak Ibrahim Abdil Muhadir Ritonga, S.Pd.I Drs. Safaruddin, MA Drs. H. Zarwansyah, S. Drs. Fahruddin Nasution

WASPADA Jumat 20 Juli 2012

Taqwa Jl. Pelita II No. 10 Kel. Sidorame Barat Drs. Satiman Taqwa Jl. Karantina Ujung Asrama TNI-AD Glugur Hong Drs. Aspan Abdullah Sianipar MEDAN PETISAH Amaliyah Jl. M. Idris No. 22 Kel. Sei Putih Timur II Annas Kompleks Diskes Jl. Ibus Raya/Jl. Rotan Ar-Ridhwan Jl. Abd. Hamid No. 28 As-Syahaadah Jl. Sikambing Belakang No. 18 Asy-Syura Jl. Surau No. 16 Kel. Sei Putih Timur-I Al-Hidayah Jl. Periuk Gg. Mesjid No. 2 Al-Ihsan Jl. PWS No. 48 Kel. Sei Putih Timur II Al-Ikhwan Jl. Mesjid No. 142 Kel. Sei Putih Tengah Istiqamah Pasar Petisah Jamik Jl. Kejaksaan Kebun Bunga Nurul Islam Jl. Kertas No. 2 Raya Aceh Sepakat Jl. Mengkara No. 2 Setia Al-Mukarram Jl. Sikambin Gg. Patimura No. 9 Ubudiyah Jl. Kebun Bunga Kel. Petisah Tengah

Usman Siregar, S.HI Drs. Syahrinal Azhar Lubis Drs. H. Syarifuddin El Hayat Drg. Asfan Bahri Drs. H. Muchtar Effendi Lubis H. Usman Lubis Drs. H. Sokon Saragih, M.Ag H. Muhammad Ansori, Lc H. Ahmad Iqbal, Lc H. Jamaluddin Juned, Lc Drs. Ibrahim Nasution Prof. Dr. H. Basyaruddin, M.Sc Hasanuddin, S.Pd.I Drs. M. Yamin Lubis

MEDAN POLONIA Amaliyah Jl. Balai Desa Gg. Amal No. 43 Kel. Polonia Assakinah Jl. Polonia (Starban) Komp. Perum TNI-AU Al-Hidayah Jl. Komodor Udara Adi Sucipto Polonia Al-Hidayah Jl. Starban Kel. Sari Rejo Al-Hasanah Jl. Teratai No.17-A Lingk.V Kel. Sari Rejo Bakti Jl. Mongonsidi I Baru No 11 Baitut Tahmid KPPBC Tipe A2 Jl. Suwondo No. 1 Dirgantara Lanud Jl. Imam Bonjol No. 52 Hidayatullah Jl. DC. Musi Lingk. I Kel. Sukadamai Hanudnas III Polonia Komp. Kantor Hanudnas TNI-AU Silaturrahim Jl. Antariksa No. 64 Kel. Sari Rejo Taufiq Jl. Pendidikan Gg. Taufiq No. 17-D

M. Nurdin Nasution, S.Pd.I Irwansyah Sitorus, S.Ag Rustam Harahap, S.Pd.I M. Amin D., S.Ag, S.Pd.I Ahmad Fuad, S.HI Drs. H. Harianto Effendi Drs. Labib Maulana Drs. H. Hamdan Yazid Drs. Muntaqo Drs. Ahmad Suhaimi, MA Poltak, S.Ag Drs. Nurdin Muhammad

MEDAN SELAYANG Ar-Ridho Jl. Abdul Hakim Pasar I Tanjung Sari Drs. H. Anshari, P. MA Al-Amri Jl. Nusa Indah Asam Kumbang Drs. H. Tamhid Harahap, MA Al-Furqon Jl. Setiabudi Pasar I Tanjung Sari Drs. H. Syarifuddin, D. Al-Ghufron Jl. Bunga Wijaya Kesuma Pasar IV Mahfudz Al-Ghufron Jl. Suka Baru No. 21 Kel. P. Bulan Drs. Solihin Dalimunthe Al-Ikhlas Jl. Raharja No. 25 Kel. Tg. Sari Abd. Hamid Harahap, S.Ag Al-Ikhlas Pasar 7, Padang Bulan Drs. Azra’i Ahmad Al-Istiqomah Jl.Sei Asahan Gg. Masjid No. 3 Drs. Nazaruddin Siregar Al-Ikhwan Jl. Bunga Wijaya Kesuma Psr-IV Pd. Bulan Muhammad Amin, S.Ag Al-Muhtadun Jl. Karya Sembada No.179 Komp.Koserna Drs. Hasanul Arifin Al-Munawwarah Jl. L.Putra No. 19-A Komp. Kejaksaan Abdurrozak Hasibuan, S.Ag Baitul Mukmin Jl. Bunga Terompet V No. 6 Kel. P.B.S. Sugeng Raharjo, S.Ag Jami’ Jl. Pasar I Lingk. VIII Kel. Tg. Sari DR. H. Fachrudin Syaipul Asro, MA Muslimin Jl. Setia Budi Kel. Tg. Sari Nurul Iman Kompl. Perhub. Jl. Penerbangan No. 77 Hendri Purnama, S.Sos Nurul Mukmin Jl. Bunga Kantil 18 Psr VII Pd. Bulan Ramli Kardi Nurul Mukmin Jl. Bunga Mawar No. 46 Kel. Pd. Bulan Bahraini Nurul Mukminin Jl. Kenanga Raya No. 10 Kel. Tg. Sari Drs. Umar Hasibuan Nurul Huda Jl. Bunga Asoka No. 117 Asam Kumbang DR. H. Zulheddi, Lc, MA Salamiyah Jl. Bunga Kesuma No. 50-D Kel. P.B.S. II Masron, S.Ag Taqwa Jl. Bunga Wijaya Kesuma Gg.Masjid Taqwa No.1 Legino, S.Pd.I Taqwa Kampus II UMA Jl. Setia Budi No. 79-B Prof. Dr. Hasyimsyah Nst., MA Taqwa Jl. Abdul Hakim No. 2 Pasar I Kel. Tg. Sari Drs. Agus Taher Nasution MEDAN SUNGGAL Ar-Rahmat Jl. Mesjid No. 20 Dusun III Desa Helvetia Ar-Ridho Tut Wuri Handayani Perkamp. Kodam I/BB As-Saajidiin Jl. Prasetya I Komp. BTN Dusun III Sei.S. Al-Amin Jl. Setia Budi No. 202 Kel. Tanjung Rejo Al-Basyir Jl. Garuda No. 78-B Sei Sikambing-B Al-Badar Jl. Binjai Km. 6,8 Medan Al-Falah Jl. Murni No. 27 Kel. Tanjung Rejo Al-Huda Jl. Perjuangan No. 44 Tg. Rejo Al-Hikmah Jl. Kiwi No. 7 Sei Sikambing-B Al-Istiqomah Dusun I Desa Pujimulio Al-Ikhlas Jl. Binjai Km. 16.5 Dusun I Aman Damai Al-Ikhlas Jl. Beo Indah No. 15 Sei Sikambing-B Al-Islamiah Jl. Binjai Km.14,5 Gg.Gembira Dsn.V Diski Al-Irma Jl. Rajawali Sei Sikambing-B Al-Ikhwan Jl. Gatot Subroto Km. 8,5 Pasar 5 Al-Jihad Jl. Sunggal No. 129 Al-Mukhlisin Jl. Darussalam/ Sei Rokan No. 2 Al-Muhtadin Jl. Setia Budi No. 29 Tanjung Rejo Al-Muhajirin Jl. Perwira No.18-A Kompl. Pondok Karya Al-Muhajirin Komp.BBLK Industri Jl. Gatot Subroto 7,8 Al-Musabbihin Jl. Masjid Al Musabbihin Blok C TSI Al-Munir Jl. Karya Baru No. 07 Tanjung Rejo Dermawan Jl. Rajawali No. 19 Sei Sekambing-B Darul Huda Jl. Kasuari No. 53-55 Sei Sikambing-B Istiqamah Jl. Dr. Mansur No. 155 Kel. Tg. Rejo Isti’adah Jl. Amal No. 4 Kel. Sunggal Ikhwanul Muslimin Dusun VII Gg.Damai D.Paya Geli Jamik Muh. Jayak Jl.Jend.G.Subroto Km. 5,5 No.184A Nurul Huda Jl. Sei Serayu No. 38 Kel. Babura Nurul Hikmah PT. Perkebunan Nusantara-III Kandir Nurul Ikhsan Jl. Kelambir V No. 53-B Kel. Lalang Nur Rukiah Jl. Pungguk No. 42 Kel. Sei Sikambing-B Raudotussuffah Jl. Pinang Baris Kel. Lalang Riyadhussholihin Jl. Sunggal No.198 K.S.Sikambing-B Silaturrahim Jl. Perintis Kemerdekaan Km. 13,7 Shafiyyatul Amaliyyah Jl. Setia Budi No.191 Tg.Rejo Syafinatus Salamah Perum Bulog Jl.Gatot Subroto 180 Taqwa Jl. Garuda Masjid Taqwa Sei Sikambing-B Taqwa Jl. Taqwa Gg. Pendidikan Tg. Rejo Taqwa Sugeng Rejo Cabang Sei Sikambing-B

Drs. H. Mukhtar Baijuri Rajab Dalimunthe, S.HI, S.Pd.I H. Wasil Drs. H.M. Nur Hasibuan Drs. H. Machmudin Sirait Nazrial Amin, S.Ag Drs. H. Chairil Anwar Drs. H. Abdurrahman Ya’qub Drs. Adlan Rifai Sirait Zulkarnaidi Somad Sariman, S.Pd Ahmad Syarbaini, S.Ag Drs. H. Nurba’in TH, Lc Drs. Ramli Nasution Drs. H. Budiman Drs. Mahyuddin Daulay Drs. H. Legimin Sukri Edi Purnomo, S.Ag Drs. Musdarsyahban Drs. Amiruddin Z., MA Drs. H. Romsil Harahap Drs. Asman Ali Nur Hrp. Drs. Hasby Tanjung Prof. DR. Amroni Dradjad,MA H. Sutan Sahrir Dalimunthe, S.Ag Drs. Hakimuddin Drs. Ismail, MM. Drs. H. Syaiful Aziz Lubis Affan Suaidi, MA Drs. H. Nasrun Zakaria Drs. Syafruddin Haris Drs. H Adlan Rifai Sirait Drs. Ahmad Kamil Drs. Irham Hasibuan Drs. Abd. Karim Syaiful Asro Dalimunthe, MA Drs. H.M. Adam Sakiman Drs. Khaidir Sulaiman Drs. Ismail Malik Drs. Abdullah Sani

MEDAN TIMUR Amaliyah Jl. Perwira II Pulo Brayan Bengkel Amal Ridha Jl. Cemara Pulo Brayan Bengkel Baru Arrahim Jl. Purwosari Gg. Masjid/Puskesmas. P.B.B. Ar-Ridho Kel. Sidorame Timur As-Sholah Jl. Pendidikan No. 39 Glugur Darat I Al-A’la Jl. Pembangunan No. 46 Kel. Glugur Darat II Al-Furqan Jl. Asahan No. 78 Kel. Sidodadi Al-Hidayah Jl. Jawa No. 3 Kel. Gg. Buntu Al-Iman Jl. Sidang Raya, Komp. DPRD Tk. I P.B.Bengkel Al-Ikhlas Jl. Madiosantoso No. 197 Lingk. 14 P.B. Darat Al-Ihsan Jl. Jemadi No. 34 Pulau Brayan Al-Ikhwan Jl. Prajurit No. 28 Gg. Bali Kel. Glugur Darat Al-Ittihad Pulo Brayan Bengkel Al-Muslimin Jl. Brigjend Bejo/Cemara Gg. Rambutan Al-Ma’ruf Jl. Sidorukun/Wartawan No.99 P.B. Darat II Al-Qudus Jl. Pukat Harimau d/h Jl. Aksara No. 136 Al-Waritsiin Jl. Bilal No. 71 Kel. Pulo Brayan Darat I Baiturrahman Jl. Gaharu Kel. Gaharu Bustanul Huda Jl. Perwira I Lingk. VII P.B. Bengkel Daarul Ma’arif Jl. Damar Raya No. 8 Sidorukun Jamik Jl. Kapten Muchtar Basri, BA Gg. Masjid No. 40 Muttaqin Jl. Pasar III No. 40 Glugur Darat I Nur Chadidjah Komp. Wartawan Jl. Letter Press No. 51 Nurul Iman Jl. Irigasi No. 12 Kel. Mangga Nurul Iman Jl. Bambu VI Kel. Durian Nurul Yaqin Jl. Bukit Barisan I No.74 Kel.Glugur Darat II Rabithatul Muslim Lingk. 14 Glugur Kota Syuhada Jl. Budi Pengabdian No.2 Perum Pemko Mdn Taqwa Jl. Bilal Gg.Keluarga No.74 Kel.P.Brayan Darat I Taqwa Jl. Rakyat/Lr. Maninjau No. 6 Sidorame Timur Taqwa Pulo Brayan Bengkel Taqwa Jl. Kapten Mukhtar Basri No. 3 Taqwa Ubudiyah Jl. Bambu III Kel. Durian Tabligh Tarjih Jl. Mustafa No. 1 G. Darat 1 Kp. Dadap

Drs. H. Juliardi Drs. H.T. Yusuf K.H. Moh. Abd. Syukur H. Abu Bakar Siregar, MA Drs. Ahmad Dairobi Butar-butar DR. H. Hasanuddin, M.Ag Drs. Mansyur Simangunsong Drs. Sudirman Drs. Hamdan Manurung Drs. Sofyan, MS Sarman, S.Ag Drs. H.T. Baharuddin Siregar Drs. Saifuddin Azmi Syarwan Nasution, S.Ag Drs. H.M. Yusuf Said, MA Ahmad Suheili Lubis Drs. Rasmidi Drs. Ali Imran Siregar H.M. Nurdin Rustam, Lc Drs. H. Indra Harahap, MA Drs. Buliyan M. Purba Drs. H. Ngadimin Hadi Marhamin Tanjung, S.Ag Dasuki Aljawawi Prof. DR. H. Pagar Hasibuan, MA Drs. H. Ramli Asmuni Drs. Ahmad Yani Watni Marpaung, MA Drs. H. Suprapto Drs. Faisal Lubis Drs. Sartoni, A.B. H. Nahar A. Ghani, Lc, MA DR. Faisar Ananda, MA Drs. Mario Kasduri (Bersambung ke hal C5)


Mimbar Jumat

WASPADA Jumat 20 Juli 2012

C5

Senyuman; Sedekah Termurah Dan Termudah

I’TIBAR

* Rumah Zakat Luncurkan Gerakan Big Smile Indonesia Me m a s u k i Ra m a dhan, Rumah Zakat Medan meluncurkan program bernama Big Smile Indonesia. Gerakan sosial yang dilaunching di halaman Stasiun TVRI Medan, Minggu (15/7) pagi ini bertujuan membangkitkan optimisme bangsa Indonesia menuju masa depan lebih baik. Peluncuran gerakan Big Smile Indonesia ditandai dengan pemasangan pin Big Smile Indonesia kepada Pelaksana Tugas Gubernur Sumatera Utara (Plt Gubsu) H.Gatot Pujo Nugroho, ST. Penyematan ini dilakukan oleh Sahidan, Spd selaku Kepala Sekolah SD Juara Medan yang merupakan binaan Rumah Zakat. Usai pemasangan pin terse-

but, Gatot mengatakan, menjelang memasuki bulan penuh berkah masyarakat seyogyanya melakukan persiapan matang. Tak hanya persiapan fisik jasmani, tapi juga secara rohani harus disiapkan. Sehingga setiap amal ibadah yang akan dilakukan selama Ramadhan benar-benar akan menghasilkan kemenangan. Gatot menambahkan, Ramadhan yang identik sebagai bulan berbagi juga harus diwarnai oleh setiap Muslim yang beriman dengan memperbanyak amal ibadah, dan bersedekah. “Harus memperbanyak sedekah. Sedekah termurah dan termudah adalah senyum, seperti dalam hal ini yang diluncurkan Rumah Zakat lewat gerakan Big Smile Indonesia,” kata Gatot. Dalam kesempatan itu Gatot juga mengingatkan, agar masyarakat meningkatkan iman dan takwa serta menguasai ilmu pengetahuan dan teknologi. Sebab perpaduan iman dan taqwa serta bekal ilmu pengetahuan dan teknologi akan

membuat seorang Muslim jadi pribadi unggul. Calon Pemimpin Masa Depan Khusus untuk Sekolah SD Juara yang merupakan binaan Rumah Zakat, Gatot berharap sekolah ini dapat mempersiapkan pribadi-pribadi yang bertakwa. Selama ini SD Juara memang menampung putra-putri berprestasi dari kalangan kurang mampu, juga yatim piatu. Lewat gagasan SD Juara, Rumah Zakat mencoba berbagi senyuman. Membangkitkan harapan anak-anak di dalamnya untuk menyongsong masa depan lebih baik. “Didik mereka dengan iman dan takwa serta ilmu pengetahuan dan teknologi. Karena merekalah calon-calon pemimpin masa depan,” tegas Gatot. Sadiman, Spd selaku Kepala Sekolah SD Juara Medan menjelaskan, Big Smile Indonesia adalah sebuah gerakan mem-bangkitkan optimisme bangsa melalui aksi senyum memberdayakan Indonesia

yang lebih membahagiakann. Big Smile Indonesia sendiri berupaya berkontribusi bagi tujuan pembangunan global di Indonesia, Untuk menciptakan banyak senyum di seluruh negeri, Rumah Zakat menghadirkan empat program yakni, Senyum Juara (pendidikan), Senyum Sehat (kesehatan),

H.M. Hafez, Lc

Senyum Mandiri (ekonomi), dan Senyum Lestari (lingkungan). “Lewat Big Smile Indonesia yang diluncurkan tahun 2012, kita telah menggelar pengobatan gratis, bakti sosial, serta penyerahan beasiswa untuk 800 anak miskin dan anak yatim se-Sumut,” kata Sadiman. (m28)

(Waspada/Amir Syarifuddin)

PENYEMATAN PIN: Plt.Gubsu HGatot Pujo Nugroho, ST menerima penyematan pin dari Kepala Sekolah SD Juara Medan Sahidan, Spd saat peluncuran program Big Smile Indonesia, Minggu (15/7)

(Waspada/Amir Syarifuddin)

PERBANYAK SEDEKAH: Plt.Gubsu H . Gatot Pujo Nugroho, ST berfoto bersama pengurus Rumah Zakat Indonesia sesaat sebelum penyematan pin Big Smile Indonesia, Minggu (15/7). Memasuki Ramadhan, Gatot berpesan agar umat Islam memperbanyak ibadah dan sedekah. MEDAN TEMBUNG Akbar Baitus Sujud Jl. Metereologi Raya Gg.Karya No.1 Drs. Isa Anshori Ar-Ridho Jl. Jati Psr.VIII Dusun X Gambir Desa B.Klippa Hasan Basri, S.Pd.I Ar-Ramli Jl. Surya Lingk. XII Kel. Indra Kasih Drs. H. Zakaria Batubara Ash-Shobirin Jl. Pukat Banting II (Mestika) Kel. Bantan Abdu Mutholib, S.Pd.I At-Tawwabin Jl. Pimpinan No. 1 Drs. H. Syamsul Rizal, P. Al-Anwar Jl. Willem Iskandar Kel. Indra Kasih H. Pangulu Abd. Karim, Lc, MA Al-Bayan Jl. Kasuari I/Gurilla No. 10 Kel. Sidorejo Drs. Kastro Nadhir, S.Pd.I Al-Falah Jl. Pukat Banting IV No. 10 Haryono Fahmi, S.Ag Al-Huda Jl. Tuasan Gg. Aman Kel. Sidorejo Hilir Juliheriadi, M.Pd Al-Hidayah Jl. Letda Sujono No. 62 Kel. Bdr. Selamat Drs. H. Effendi Batubara Al-Hilal Jl. Belat No. 76-B Shodikin, S.Ag Al-Ikhlas Lingk. II Kel. Bandar Selamat Drs. H.M. Yahya Zakaria Al-Ikhlas Jl. Ambai Ujung No. 15-B Kel. Sidoarjo Hilir Drs. H. Nasrun Jami’ Daulay, MA Al-Ishlah Jl. Pukat V Kel. Bantan Timur Muktaruddin, M.Ag Al-Ikhlash Jl. Pasar V Gg. Al-Ikhlash Dusun XIII Durian Abd. Azis, S.Pd.I Al-Istiqomah Komplek Veteran Medan Estate Drs. H.M. Fahmi El-Fuad Al-Ijtima’iyah Jl. Letda Sujono No. 152 Nazaruddin Nasution Al-Muslimun Jl. Pertiwi No. 94-C Kel. Bantan Drs. H. Nadra Jamal Nasution Al-Muqorrobin Jl. Pukat II/52 Kel. Bantan Timur H. Ali Sati Nasution, Lc Baiturrahman Kampus UNIMED Jl. Williem Iskandar H.T. Baharuddin Siregar Darul Amin Jl. Letda Sujono Ujung No. 1 Lingk. I H. Amir Shaleh Nasution Hidayatul Muslimin Jl. Bersama No. 105 Lingk. 5 Drs. H. Bahron Nasution Hidayatul Ubudiyah Jl. Kapten M.Jamil Lbs.Gg.Mangga Drs. H. Lahuddin Batubara Ikhlashiyah Jl. Suluh/Jl. Tempuling No. 20 Kel.Sidorejo Sodiqin, S.Ag Jami’ Nurul Ihsan Jl. Durung No. 134 Kel. Sidorejo H. Fakhrurrozi P., SE Jamik Al-Jihad Jl. Besar Tembung Desa Tembung Drs. Syaridan L. Tobing Nurul Iman Jl. Pertiwi Ujung Kel. Bantan Ihsan Asri Raya Muslimin Jl. Pukat I No. 1 d\h Jl. Mandailing No.1 Drs. H. Nadran Jamal Nst. Taqwa Jl. Enggang Raya No. 85 Perumnas Medan II Junaidi, S.Pd.I, M.SI Taqwa Kampus I UMA Jl. Kolam No. 1 Medan Estate Dr. H. Ahmad Zuhri, Lc, MA Taqwa Jl. Letda Sudjono No. 15 Amron Lubis Ubudiyah Jl. Taduan No. 109 Kel. Sidorejo Agusman Damanik, M.Ag MEDAN TUNTUNGAN Ar-Rahman Griya Nusa 3 Tanjung Selamat Al-Amin Jl. Pala Raya Perumnas Simalingkar Al-Hikmah Kompleks R.S. Jiwa Propsu Jl. Tali Air Lk. IV Al-Ikhlash Cengkeh Jl. Cengkeh X No. 1 Kel. Mangga Al-Muhajirin Perumnas Simalingkar Al-Muhtadin Jl. Kemiri Raya No. 1 Blok-G Al-Muttaqin Jl. Jamin Ginting Km. 14 Kel. Sidomulyo Al-Razzaq Jl. Sakura Raya Kel. Tanjung Selamat Baiturrahman Jl. Flamboyan I/04 No. 2 Tg. Selamat Baitul Rahman Jl. Rami II Perumnas Simalingkar Nurul Hayat Kompl. LIZARDI Kel. Kemenangan Tani Nurul Iman Jl. Irigasi No. 12 Kel. Mangga Taqwa Jl. Sawit Raya, Perumnas Simalingkar

Edy Purnomo, S.Ag Alfan Abror Parinduri, S.Ag Darwin Purba, BA Drs. A. Ghozali Rangkuti Drs. Komaruddin Sagala Mukhtar, S.Pd.I Drs. Ali Imron Nasution Drs. M. Syafii Nasution Drs. Agus Suhedi Aminuddin, SH, S.Pd.I Drs. Nazaruddin Siregar Dasuki Aljawawi Drs. Makruf Lubis

DELISERDANG Amal Islamiyah Jl. Sudirman No. 4 Lubuk Pakam H. Ahmad Taufik Lubis, S.Pd.I Ainul Yaqin Jl. Pembangunan IV No. 30 Desa Mulrorejo H.T. Muniruddin At-Taubah Dusun XX Lr. Pertanian Blok Gading Fajar Wahyudin, S.Ag Al-Firdaus Jl. Medan Batang Kuis Ds. XI Empl. Km 10 Drs. H. Abd. Rahman Kasbi Al-Furqan Perumahan Bumi Tuntungan Sejahtera DSC H. Asril Pohan, Lc Al-Hafiz Hamparan Perak Kec. Hamparan Perak M. Adami, S.H Al-Ikhlas Jl. Delitua Km. 8,5 Dusun Desa Suka Makmur Drs. H. Efendi Barus Al-Ikhlas Komp. Kantor Bupati Deliserdang L.Pakam Ahmad Syukri, S.Ag Al-Ikhlash Lingk. VI Gg. Sidorejo Kel. Deli Tua Saudi, S.Pd.I Al-Ikhlash Jl. Pasar V Dusun Durian Gg. Masjid Abd. Azis, S.Pd.I Al-Issyah Hakim Jl. Karya Jaya Kel. Deli Tua Drs. H. Chairuddin Siregar Al-Jihad Jl. Pembangunan No. 26 Drs. H. Syahroni Husain Al-Mukhlisin Jl. Terusan Dusun II Bandar Setia Misnan Al Jawi, SH Al-Mukhlisin Komplkek Namori Village Drs. Sopan Sofyan Jami’ Al Muhajir Jl. Rel Pasar X No. 06 Bandar Khalifah Khoiruz Zaman, S.HI As-Salam Jl.Raya Medan Namorambe Komp.Pisu No.1 Ahmad Bahtiar, MA Baiturrahman Jl. Merica Raya Blok F Peru. Simalingkar Drs. A. Ghazaly Rangkuty Baitussalam Dagang Kerawan Tanjung Morawa H. Mudawali, S.Pd.I H.M. Asjro Effendi Jl. Haji Misbah No. 22 Drs. Ismail Yahya

(Waspada/Amir Syarifuddin)

SAMBUTAN: Plt. Gubsu H.Gatot Pujo Nugroho, ST memberikan sambutan usai peluncuran program Big Smile Indonesia, di halaman TVRI Medan, Minggu (15/7).

Jami’ Jl. T. Imam Bonjol No. 17 Lubuk Pakam Jami’ Jl. Pantai Labu Dusun Masjid Desa Beringin Jami’ Asysyakirin Jl. Besar Km. 11,5 Deli Tua Jami’ Jl. Irian No. 79 Kel. Pekan Tanjung Morawa Jami’ Al-Ihsan Jl. Imam Abdul Ds.Selemak Kec.H.Perak Jamik Al-Ikhlas Jl. Pengabdian Dusun I Desa Bdr. Setia Khairul Fatihin Dusun II Kec. Tg. Morawa Nurul Hidayah Jl. Veteran Lr. Sukoharjo No. 27-A Nurul Ikhwan Jl. H.A. Dahlan No. 38 Tg. Morawa Nurul Burhanuddin Jl. Cempaka Dusun V Ds K.Durian Raya Jl. T. Raja Muda No. 26 Lubuk Pakam Syuhada Kec. Galang Taqwa Lubuk Pakam Tarbiyah Jl. Bakti Desa Sekip Lubuk Pakam

Drs. Dauli Damanik Risan, S.Pd.I Drs. Basyaruddin Lubis H. Akhiruddin, Lc Abdullah Helmy, S.Pd.I Awaluddin Pulungan, S.HI Drs. Syafruddin Drs. H. Azhari Tanjung Faisal, MA Mahmudiono, S.Pd.I Usman Al-Fatah, S.Ag M. Hamdani Nst., S.Pd.I Drs. H. Munawar Kholil Suratman, S.Pd.I

BINJAI Agung Kota Binjai Amal Jl. H. Agus Salim No. 14 Kel. Jatinegara Amal Jl. T. Imam Bonjol Gg. Cempaka An-Nur Jl. Veteran No. 7 Kel. Tangsi Ar-Rahmah Turiam Jl. Kakap No. 1 Kel. Tanah Tinggi Al-Hidayah Jl. Talam No. 28 Kel. Nangka Al-Hilal Jl. Ikan Irwana No. 17 Kel. Dataran Tinggi Al-Huda Kel. Pahlawan Kota Binjai Al-Mushlihin Kel. Satria Kota Binjai Al-Qadar Kel. Payaroba Griya Payaroba Indah Darussalam Jl. Cut Nyak Din No. 2 Kel. Tanah Tinggi Istiqomah Jl. T.A. Hamzah Kel. Jati Negara Jami’ Athohirin Kota Binjai Nurul Falah Jl. S.M. Raja No. 60 Nurul Yaqin Jl. S.M. Raja No. 94 Kel. Tanah Tinggi

Zainuddin, S.Ag Drs. Elfizar Koto Drs. H. Sudarno Drs. H. Muslim Rawi Zainuddin, S.Ag H. Misto Rasyidin, S.Pd.I Drs. H. Zannah Siregar Anas Rizal, S.Pd.I M. Syawal Effany, S.Ag Drs. H. A.E. Yunani Harahap Drs. H. Ahmad Nasir Drs. H. Jaharuddin Batubara Drs. H.M. Taufik Aminullah

ST A B AT Ar-Raudhah Dusun VII Desa Kebun Balok Al-Furqan Lingk. I Musyawarah Kel. Kwala Bingai

Salman H. Ibrahim M., S.Ag

TEBING TINGGI Amal Muslim Kp. Rao Amaliyah Jl. K.F. Tandean No.344 Lingk. V Kel. B.Sakti An-Namirah Jl. Gunung Papandayan Lingk. II At-Taqwa Jl. Dr. Kumpulan Pane No. 58 Al-Abidin Jl. Kom. Yos Sudarso Kel. Lalang Al-Hidayah Kel. Tanjung Maru Hilir Kampung Keling Al-Hidayah Jl. Jend. Ahmad Yani No. 50 Kel. Durian Al-Hasanah Jl. Kartini No. 16 Tebing Tinggi Al-Hasanah Jl. Merbau Perumnas Bagelen Teb. Tinggi Al-Haq Kel. Deblob Sundoro Padang Hilir Al-Qomar Jl. Kutilang Lingk. 05 Kel. Bulian Al-Khairani Jl. Baja Lingk. VI Kel. T. Tinggi Al-Ikhlas Lingk. 03 Kel. Tanjung Marulak Al-Ihsan Simp. Dolok Kel. Sri Padang Kec. Rambutan Al-Muttaqin Jl. Sofyan Zakaria Lingk. 2 Al-Maryam Jl. Darat Lingk. VIII Kel. Rambung Al-Mukhlis Kel. Pasar Baru Al-Muthmainnah Lingk. I Kel. D.Sundoro Darul Jihad Jl. Ahmad Yani Komp. Detasemen B Farida Jl. H. Ahmad Bilal Lingk. V Kel. Damar Sari Hikmah Jl. Lengkuas Lingk. II Kel. Bandar Sakti Istikmal K.F. Tandean Lingk. III Bandar Sakti Jami’ Jl. Batu Bara Kel. Satria Jami’ Jl. Soekarno-Hatta Kel. Tambangan Hulu Nurul Amal Kompl. Kodim Lingk. 04 Kel. Lalang Nurul Huda Jl. Bukit Bundar Lingk. 03 Kel. Lalang Nur Islam Jl. P. Irian Lingk. 94 Kel. Persiakan Nurul Ikhwan Rumah Sakit Sri Pamela Raya Nur Addin Jl. R. Suprapto No. 126 Syuhada Jl. Iskandar Muda No. 79-A Taqwa Jl. Bakti Kel. Satria Kota Tebing Tinggi Ubudiah Jl. Pulau Samosir Kel. Bandar Sono

Lahmanuddin Drs. Hafizun, SH, MA Drs. H. Ibrahim Harahap H. Asdi Akmal, S.Pd.I Zainul Arifin, SH Syahroni, S.Pd.I Drs. H.M. Ghazali Saragih Zuhril Lubis Drs. Ahmad Syahir H. Bustami Saragih, S.Pd.I Sapril Purba, S.Pd M. Ridwan Rahmat Halim Batubara Ruslan Piliang, S.Pd.I Sofyan Mansyur, S.Pd.I Drs. H. Akhyar Nasution Yusnul Adhry, SE Drs. Aminullah Ibrahim Ahmad Yusnan Harahap Zulkifli M. Nuh Ibrahim Ahmad Drs. Mulkan Azima Ansori, S.Pd.I Mhd. Siddiq, S.Ag Tagor Mulia, S.Sos.I Khairil Pulungan Tengku Azmi, S.Sos H.M. Yusuf Rekso Azray, M.AP M. Ridwan Syam Khairul Anwar Hasibuan

Jangan Sia-Siakan Ramadhan Keinginan untuk menjadikan Ramadhan sekarang ini merupakan Ramadhan terbaik dalam kehidupan kita adalah citacita tulus kita semua. Tetapi apakah itu akan terwujud, semua ini kembali kepada tekad dan usaha maksimal dari kita. Sejauh mana pengorbanan kita untuk meraih tekad kita tersebut, sejauh itu jugalah capaian yang Allah SWT berikan kepada kita. Karna Allah SWT tidak akan pernah merubah nasib seseorang sebelum orang tersebut yang berupaya merubah nasibnya sendiri. Oleh Karna itu memanfaatkan waktu demi waktu untuk beramal sholeh di bulan Ramadhan adalah kunci sukses untuk kita mendapatkan Ramadhan terbaik dalam hidup kita. Al-Hasan Al-Bashri rahimahullah mengingatkan kita dalam satu nasehatnya: Wahai anak Adam! Sesungguhnya kamu itu adalah seperti hari-hari, jika satu hari telah pergi, maka telah hilanglah sebagian dari dirimu. Beliau juga menasihatkan: Wahai anak Adam ! Waktu siangmu adalah tamumu, maka berbuat baiklah kepadanya, karena sesungguhnya jika kamu berbuat baik kepadanya, dia akan pergi dengan memujimu, dan jika kamu bersikap jelek padanya, maka dia akan pergi dalam keadaan mencelamu, demikian juga waktu malammu. Di antara program yang harus kita optimalkan untuk menjadikan Ramadhan kali ini adalah Ramadhan terbaik dalam kehidupan kita adalah : 1. Mengisi waktu malam dengan shalat tarawih dan qiyamul lail. Syaddad bin Aus jika beranjak untuk beristirahat di ranjangnya, kondisinya bagaikan biji yang berada di atas penggorengan (yakni tidak tenang) kemudian berdoa: Ya Allah! Sesungguhnya Jahannam (terus mengancam)! Jangan Engkau biarkan aku tidur. Maka beliau pun bangun dan langsung menuju tempat shalatnya. 2. Mengisi waktu dengan memperbanyak tilawatil qur’an. Bersyukur kalau seandainya kita mampu khatam tiga puluh juz, sekali, dua kali bahkan mungkin tiga kali khatam selama Ramadhan. 3. Perbanyak infak dan sedekah kepada orang fakir miskin dan kepada lembaga-lembaga sosial lainnya yang biasa mengelola keperluan dan hajat orang dhu’afa. Para sahabat Nabi SAW sudah memberi teladan sangat baik dalam hal infak. Mereka berlombalomba menginfakkan harta demi pendanaan operasional dakwah dan jihad fi sabilillah. Para sahabat Nabi yang kaya raya itu, seperti ungkapan Umar bin Khattab menyimpan hartanya di tangan, bukan di hati. Mereka pun tidak menjadi budak harta, tetapi menjadikan harta itu sebagai sarana amal saleh –menginfakkannya di jalan Allah SWT. Bagi para sahabat Nabi, berinfak sudah menjadi hobi Yang sulit ditinggalkan. Abu Bakar pernah menginfakkan seluruh hartanya untuk membantu dana jihad, Umar bin Khattab menginfakkan separuh hartanya. Allah SWT menegaskan infak mereka: “ Dan kelak akan dijauhkan orang yang paling takwa dari neraka itu, yang menafkahkan hartanya (di jalan Allah) untuk membersihkannya, padahal tidak ada seseorangpun memberikan suatu nikmat kepadanya yang harus dibalasnya, tetapi (dia memberikan itu sematamata) karena mencari keridhaan Tuhannya yang Maha Tinggi, Dan kelak dia benar-benar mendapat kepuasan” (QS. Al-Lail: 17-21). 4. Ringan tangan dan Darmawan dalam menolong orang yang berada dalam kesulitan. Ibnu Rajab berkata : Imam Syafi’i Yang paling dicintai bagi seseorang adalah semakin bertambah kedermawanannya pada bulan Ramadhan karena meneladani Rasulullah SAW agar kebutuhan manusia tercukupi sehingga mereka dapat konsentrasi dengan ibadah puasa dan shalat-shalat mereka.

INDRAPURA Jami’ Indrapura

Iriansyah

KISARAN Agung Jl. Imam Bonjol No. 182 Abrarul Haq Haji Kasim Jl. Budi Utomo Kel. S.Baru An-Nur RSU Ibu Kartini PT. BSP Tbk Ar-Rasyidin Jl. Sei Asahan No. 42 Kel. Tegal Sari Al-Hidayah Jl. Cokroaminoto Al-Huda Jl. K.H. Ahmad Dahlan No. 1 Al-Husna Jl. Arwana Kel. Sidomukti Al-Husna Simpang 6 Kel. Kisaran Barat Al-Jihad Jl. Dr. Setia Budi No. 54 Kel. Selawan Al-Muttaqin Jl. Ir. H. Juanda Kel. Karang Anyer Ikhwaniyah Jl. Merpati No. 44 Kel. Gambir Baru Jami’ Baiturrahim Kel. Kisaran Naga Nurul Yaqin Jl. Agus Salim Kel. Teladan Nurul Yaqin Kantor Direksi - PB. BSP Kisaran Nurul Huda Jl. Malik Ibrahim No. 37 Nuur-Assyiam Kel. Lestari Siti Zubaidah Jl. Budi Utomo No. 285

H. Zulhanuddin Batubara H. Salman Abd.Tanjung, Lc, MA H. Nono Astono H. Zulhanuddin Batubara H. Nummat Adham, MA Sutrisno, S.Sos Bambang Harmoyo H. Salman Tanjung, MA H. Ahmad Zulhanuddin, BB, MA Drs. Bob Yuswardy, PD Tamrin Simatupang Drs. H. Abdul Rasyd Drs. Ali Usman K.H. Alimunddin Siregar H. Usman Darus M. Sani Dahmul Daulay, S.Ag

LABUHAN BATU Attaqwa Labuhan Batu Selatan Besar Tanjung Medan Labuhan Batu Selatan Besar Kota Pinang Labuhan Batu Selatan Jami’ Kota Pinang Labuhan Batu Selatan

Nahwan Rambe Salim Tambak, S.Ag Rahmad Irfan Nasution, S.Ag H. Mhd. Asli Pulungan

BATUBARA Ar-Rahman Dusun II Desa Pasar Lapan Jami’ Al-Mukhlisin PT. Moeis Kec. Sungai Suka Deras Nurul Iman Desa Perkotaan Kec. Air Putih Nurul Huda Desa Tanah Tinggi Kec. Air Putih Syuhada Sukaraja Desa Sukaraja Kec. Air Putih

Aman Lukman Yanis Azwan Lubis Selamat M. Gazali Syafii, S.Ag

A S A HA N Arif-Al Azhim Polres Asahan

Drs. H. Nurul Ikhsan Sitorus, MA

TANJUNG BALAI Al-Istiqomah Jl. Anggur Kel. Pantai Johor

Drs. H. Rahmad Sulaiman

PEMATANGSIANTAR Al-Ikhlas Jl. Nagur No. 45 Kel. Martoba

Ridwan Al-Islami, S.Ag

SIDIKALANG Agung Kota Sidikalang Al-Muhajirin Jl. Bambu Kuning Blok A No. 59 Telaga Zam-zam Jl. Ahmad Yani Batang Beruh

Drs. Naik Angkat, MM Ahmad Nazif Husein, SH Ahmad Ridho Ibrahim, S.HI

BIREUEN Masjid Agung Bireuen Masjid Taqwa Gandapura Masjid Besar Makmur Masjid Besar Kutablang Masjid Besar Peusangan Masjid Besar Peusangan Selatan Masjid Besar Psg. Siblah Krueng Masjid Besar An Nur Jangka Masjid Al Furqan Kota Juang Masjid Ridha Jeumpa Masjid Besar Kuala Masjid Baitul Huda Juli Masjid Baitunnur Peudada Masjid Besar Peulimbang Masjid Baiturrahim Jeunieb Masjid Baitul Qiram Pandrah Masjid Besar Simpang Mamplam Masjid Besar Samalanga

Tgk Azhari Tgk H Daud Hasbi Tgk M Yusuf Pasee Tgk Jamaluddin Tgk Zakaria Tgk Hasnawi Tgk Muhammad Jalil Tgk M. Yusuf Tgk Tarmizi Moh Drs Tgk Razali Wahab Tgk Ali Usman Tgk H Abu Hamid Tgk Sayed Mahyiddin Tgk Musliadi Tgk H Munir Tgk Muhammad Amin Tgk Syahabuddin Tgk M. Nur Ummul Ayman


Mimbar Jumat

C6

Membangunkan Sahur Antara Sunnah Dan Tradisi Oleh H.M. Nasir, Lc, MA Pimpinan Pondok Pesantren Tahfiz Alquran Al Mukhlisin Batubara, Wakil Sekretaris Dewan Fatwa Pengurus Besar Alwashliyah.

S

ahur menurut bahasa adalah “tersembunyi”, karena waktu sahur adalah sebelum terbit fajar, dalam keadaan gelap dan sunyi sehingga banyak hal-hal yang tersembunyi yang dapat mengalihkan perhatian seseorang dari kebiasaannya. Dari akar kata yang sama adalah sihir yaitu “sesuatu yang dapat menukar dan mengalihkan perhatian seseorang dari hakikat sesuatu”. Di dalam Kamus Lisanul Arab, Ibnu Mandzur mengatakan, asal kata sahur adalah sihr (sin, haa, raa) yaitu sesuatu yang dapat memalingkan dari hakikatnya kepada yang lain. Oleh sebab itu seorang penyihir manakala melihat hakikat sesuatu, dia berupaya memalingkan perhatian orang lain, sehingga yang terlihat bukan sebenarnya. Dan kata ini dapat digunakan kepada yang tidak baik dan dapat pula kepada yang baik. Nabi Muhammad Saw dituding oleh orang-orang kafir Makkah sebagai tukang sihir karena Nabi Saw membawa Alquran yang dapat menukar dan mengalihkan perhatian orang banyak dari kebiasaan bathil mereka. Nabi Saw bersabda: Sesungguhnya perkataan yang jelas, lantang, tegas merupakan sihir, karena dapat mengalihkan perhatian orang banyak dari hal-hal yang disembunyikan. Akan halnya bersahur adalah mengalihkan kebiasaan orang banyak yang tertidur pulas menjelang terbit fajar untuk makan dan minum karena hendak melaksanakan ibadah puasa keesokan harinya. Para ulama sepakat mengatakan bahwa makan sahur hukumnya sunat atau mustahab, berdasarkan sabda Nabi Muhammad SAW: Sahurlah kamu sesungguhnya sahur itu memberi berkah kepada kamu (H.R. Bukhari). Keberkahan pada sahur paling tidak memiliki dua pengertian. Pertama, menambah kekuatan dan stamina badan orang-orang yang berpuasa dalam menghadapi rasa lapar dan haus berpuasa di siang hari. Oleh sebab itu, Nabi Muhammad SAW mengan-

jurkan untuk memohon kekuatan dalam menjalankan ibadah puasa melakukan makan dan minum di waktu sahur. Nabi SAWbersabda: Mohonlah kepada Allah kekuatan melalui sahur agar memperoleh kekuatan menjalankan puasa di siang hari (H.R. Al-Hakim). Kedua, keberkahan sahur nampak jelas pada pemisahan antara puasa orang-orang muslim dan non-muslim. Orang-orang muslim dianjurkan untuk bersahur agar terhindar dari puasa

menyantap makan sahur karena makan menjelang terbit fajar adalah di luar kebiasaan rata-rata kaum muslimin. Lagi pula dengan membangunkan orang-orang sahur dapat menolong orang-orang yang berpuasa agar tidak terlihat “loyo” di siang hari dalam menjalankan aktivitas sehari-hari. Rasulullah SAW memerintahkan Bilal untuk membangunkan sahur dengan cara mengumandangkan azan sebelum terbit fajar. Diriwayatkan dari Abdullah bin

Nabi Muhammad SAW menganjurkan agar membangunkan orang muslim untuk bangun sahur. wishal (puasa terus menerus) yang dilakukan oleh Ahlul Kitab (Yahudi dan Nasrani). Dengan demikian, makan di waktu sahur bukanlah makan biasa, akan tetapi “makan ibadah” yang diperintahkan oleh Nabi Muhammad SAW, karena bersentuhan langsung dengan pelaksanaan ibadah puasa, karena jarak antara sahur dengan puasa hanya sekedar membaca 50 ayat Alquran yang tidak terlalu pendek, dan tidak pula terlalu panjang, atau sekedar melaksanakan shalat dua raka’at, seperti yang diriwayatkan oleh Zaid bin Sabit: Bahwa kami pernah makan sahur bersama Rasul SAW dan kemudian kami salat dua rakaat setelah itu terbit fajar, setelah ditanya jarak waktu salat mereka dan terbit fajar, zaid menjawab sekedar membaca lima puluh ayat Alqruan yang sedang, dan bacaan yang sedang pula (tidak terlalu lembut dan tidak pula terelalu cepat) (H.R. Bukhari dan Muslim). Oleh karena rentang waktu antara sahur dan terbit fajar tidak begitu lama, maka Nabi SAW menganjurkan untuk membangunkan orang yang sedang tertidur pulas untuk segera bangun

Mas’ud bahwa Rasul SAW bersabda: Jangan ada di antara kamu merasa terhalang dari makan sahurnya oleh azannya Bilal, karena beliau azan untuk membangunkan orang-orang sedang tertidur (agar mereka bersahur), dan orang yang memang sedang terbangun agar melaksanakan kembali aktivitas ibadahnya, bukanlah fajar itu begitu… tetapi begini (dengan mengisyaratkan kepalan tangan dan melepaskannya sebagai isyarat bahwa fajar kazib/dusta, adalah cahaya belum terlihat jelas sedangkan fajar shadiq/benar cahaya sudah kelihatan terang). Hadis ini diriwayatkan oleh Imam Bukhari dalam bab Azan no.586, Imam An-Nasai dalam bab Puasa no.2141, dan Abu Daud dalam Puasa no.2000, dan hadis berstatus marfu’ dan shahih karena periwayatnya tsiqah. Dari redaksi hadis ini dapat dipahami bahwa Nabi Muhammad Saw menganjurkan agar membangunkan orang muslim untuk bangun sahur, dan perintah ini tidak termasuk perintah wajib, karena bersahur itu sendiri hukumnya sunat. Selanjutnya, perintah untuk membangunkan sahur dilakukan dengan mengumandangkan azan

dan azan tersebut bukan azan untuk membangunkan salat tahajjud, karena di akhir redaksi hadis tersebut dijelaskan supaya orang yang tertidur bisa terbangun, dan orang-orang yang sudah terbangun supaya meneruskan aktivitas ibadahnya, baik salat ataupun bersahur itu sendiri. Demikian keterangan dari Syarah Kitab Sunan Ibnu Majah. Yang menjadi persoalan di tengah-tengah masyarakat kita adalah membangunkan orang-orang sahur dengan cara berteriak melalui pengeras suara, memukul gendang, lonceng, dan sebagainya. Sehingga ada masyarakat non-muslim yang merasa tidak nyaman dengan prilaku yang sudah keluar dari sunnah itu sendiri. Ironisnya, sebagian anakanak muda yang berteriak membangunkan orang sahur hanya sekedar ogah-ogahan atau tradisi yang sudah berlaku di bulan Ramadan. Padahal (tidak untuk berprasangka buruk) terkadang mereka sendiri pun tidak berpuasa. Oleh sebab itu, jika membangunkan sahur kembalikan kepada sunnah Nabi SAW, yaitu dengan cara mengumandangkan azan. Kuat dugaan tidak ada yang merasa resah, karena suara azan adalah seruan untuk kesuksesan, seruan dakwah, seruan mengesakan Allah. Lebih dari itu, azan merupakan seruan langit kepada penduduk bumi untuk kembali kepada kebenaran. Lagi pula, seruan azan bukan merupakan seruan orang-orang “nyinyir” yang berteriak seperti memaksakan kehendak. Terakhir, membangunkan orang sahur pada prinsipnya dianjurkan oleh Nabi Muhammad SAW, dan teknis pelaksanaan dianjurkan dengan cara mengumandangkan azan. Namun pelaksanaannya telah bercampur dengan tradisi tempatan yang dapat dijadikan sebagai kearifan lokal. Dengan demikian, teknis mem-bangunkan orang muslim untuk bersahur di dalam kehidupan masyarakat heterogen, perlu didiskusikan agar masyarakat muslim dapat melaksanakan syariat agamanya dan masyarakat non-muslim merasa nyaman pula dengan prilaku muslim itu sendiri. Wallahua’lam bil ash-shawab.

Sang Ahli Surga Ahmad Muttaqin Nasution Ketua Jam’iyatul Muallimin Sumatera Utara/Ketua PKNU Kota Medan

K

etika Rasulullah SAW sedang duduk bersama sahabat-sahabat dalam sebuah majelis, beliau bersabda, “Sebentar lagi akan masuk Seorang Ahli Surga”. Mendengar itu, setiap pasang mata sahabatpun mena-tap ke arah pintu. Masing-masing membayangkan, tentulah yang dimaksud Rasul ini seseorang yang sangat istimewa. Tidak lama kemudian, masuklah seorang laki-laki. Penampilannya begitu sederhana. Wajahnya masih terlihat sisa-sisa air wudluk dan tangan-nya menjinjing sepasang sandal. Para sahabatpun berfikir keras, apakah keistimewaan laki-laki ini?. Namun tidak seorangpun diantara mereka yang siap menanyakan kendati mereka sangat mengharapkan jawabannya. Esok harinya kejadian yang sama kembali terulang, dan hal itu terus berlanjut sampai kali yang

ketiga. Ucapan Rasul, “Sebentar lagi akan masuk seorang ahli surga”, dan ketika para sahabat menatap kearah pintu, maka yang masuk adalah laki-laki yang itu juga dengan keadaan yang sama dengan hari sebelumnya. Wajah terlihat air sisa berwudluk dan tangan menjinjing sepasang sandal. Seorang sahabat yang bernama Abdullah Bin Umar merasa sangat penasaran, maka terlintas sesuatu dibenaknya. Ia pun menemui laki-laki itu dan berkata, “Saudaraku, telah terjadi kesalah pahaman antara aku dengan ayahku. Bolehkah aku menginap di rumahmu selama tiga hari?. Si Ahli surga dengan ramah menjawab, “ Tentu saja boleh saudaraku”. Maka menginaplah Abdullah Bin Umar di rumah laki-laki itu dan selama berada di sana ia selalu mengamati bahkan mengintip

Konsultasi Alquran Ikatan Persaudaraan Qari-Qariah & Hafizh Hafizah (IPQAH Kota Medan) KONSULTASI AL-QURAN adalah tanya jawab sekitar Alquran, yang meliputi: tajwid, fashohah, menghafal Alquran, Ghina (lagu) Alquran, Hukum dan ulumul Alquran. Kontak person. 08126387967 (Drs. Abdul Wahid), 081396217956 (H.Yusdarli Amar), 08126395413 (H. Ismail Hasyim, MA) 0819860172 (Mustafa Kamal Rokan).

Assalamu’alaikum Wr.Wb. Al-Ustaz, Kira-kira bagaimana ketika kita membaca Alquran, kita menguap karena mengantuk, apakah kita lanjutkan bacaan kita? Mohon penjelasan. Dari Ibu Rosmalita, Medan Jawab : Terimakasih atas pertanyaanya. Ketika kita membaca Alquran, terkadang keadaan kita menguap. Dapat kami jelaskan bahwa menguap terkadang belum tentu mengantuk, jika menguap tetapi bukan kerena sangat mengantuk, maka hendaklah kita menghentikan bacaan kita dengan memberhentikan diakhir ayat, selesaikan dahulu menguapnya dan baru lanjutkan bacaan alqur’annya, demikian Mujahid pendapat dengan mendasarkan hadis: “Jika sedang meguap, hendaklah menutup mulut dengan tanganmu karena setan masuk ke dalamnya” (Hr Muslim dan Abu Daud). Dari hadis tersebut dapat ditarik dalil orang menguap hendakknya menutup mulut, berarti kalau ia sedang mambaca Alquran hendaklah ia selesaikan bacaannya dan menutup mulutnya, baru kemudian melanjutkan bacaannya. Jika ia menguap karena sangat mengantuk, maka hendaklah ia menghentikan bacaannya dan kemudian tidur sehingga badannya segar kembali, setelah itu ia mengambil wudhu’ dan kembali melanjutkan bacaaan Alqur’annya. Hukum orang yang membaca Alqur’an ketika mengantuk adalah makruh. Hal ini disebabkan dalam keadaan mengantuk bacaan Alqur’an tidak dapat terjaga, kemungkinan salah membaca akan besar terjadi dan nilai khusuknya berkurang sehingga bekas Alquran dalam hati dan qalbu kurang dapat dirasakan. (AnNawawi, Al-Tibyan fi adabi hamalat Alquran).Walluhu A’lam Al-Ustadz H. Ismail Hasyim, MA

Mampukah hati selamat dari rasa dengki ketika harus menghadapi kenyataan bahwa rival nyalah yang memperoleh kemenangan atas sesuatu yang sama-sama diperjuangkan?”. apa saja gerangan ibadah yang dilakukan si Ahli Surga. Namun betapa kecewa Abdullah Bin Umar karena sampai hari terakhir, ia tidak melihat keistimewaan ibadah lakilaki itu. Ia tidak melihat si Ahli Surga Shalat Tahajjud di waktu malam, tidak juga puasa sunnat di siang hari. Bahkan sepanjang malam setelah Isya laki-laki itu tidur dengan nyenyaknya dan baru terbangun beberapa saat sebelum fajar. Memang sesekali di tengah malam ia terbangun dan ketika itu ia terdengar mengucapkan nama Allah di tempat tidurnya. Tapi itu hanya sejenak dan tidurnya kembali berlanjut. “ Pasti ada sesuatu yang terlewatkan olehku”, pikir Abdullah Bin Umar. Lalu dengan memaksakan diri Abdullah Bin Umar berterus terang menanyakan, “ Saudaraku, apa sebenarnya yang engkau lakukan sehingga engkau mendapat jaminan surga dari Rasulullah?. Laki-laki itu menjawab, “ Saudaraku, yang kulakukan hanyalah seperti yang engkau saksikan”. Betapa kecewa Abdullah mendengar jawaban ini, dan ia sudah berniat segera pulang, tapi kemudian laki-laki itu memegang lengan Abdullah sembari menegaskan kembali jawabannya, “ Benar saudaraku, apa yang telah engkau lihat, seperti itulah yang kulakukan, dan hanya saja mungkin ditambah sedikit hal , bahwa aku tidak pernah mendengki orang yang mendapatkan karunia Allah dan aku juga tidak pernah berlaku curang dalam setiap pekerjaanku “. Mendengar ini Abdullah pun tertunduk, sambil melangkah pergi ia bergumam,” Rupanya yang demikian itulah yang menjadikan anda mendapat jaminan surga”. Kisah ini tertuang dalam sebuah hadis tanpa menegaskan nama dari sang ahli surga, menunjukkan bahwa tokoh dalam kisah ini tidak begitu terkenal pada awalnya. Hal ini mengisyaratkan bahwa, ternyata untuk bisa menjadi ahli surga tidaklah mesti dari kalangan orang-

orang yang dikenal luas di tengahtengah masyarakat . Sedemikian banyak sahabat-sahabat Rasul yang bahkan namanya terukir indah dalam sejarah, namun hanya sepuluh orang saja yang mendapat jaminan surga langsung dari Rasulullah SAW, dan satu diantaranya adalah Sang Ahli Surga dalam kisah di atas. Sesungguhnya pintu surga terbuka lebar bagi siapapun yang merindukannya. Tapi pertanyaannya adalah, “ Mampukah hatinya bersih dari rasa iri ketika melihat orang lain mendapatkan karunia Allah yang tidak ia miliki, padahal ia juga sungguh sangat mendambakan itu?. Mampukah hati selamat dari rasa dengki ketika harus menghadapi kenyataan bahwa rival nyalah yang memperoleh kemenangan atas sesuatu yang sama-sama diperjuangkan?”. Selanjutnya ,” Mampukah ia membersihkan segala unsur penipuan dalam setiap aktifitas yang dilakukan?”. Siapkah dirinya untuk selalu memelihara dan lebih mengedepankan kejujuran ketika menetapkan anggaran biaya, saat berbelanja , atau saat mengemban amanah ?. Apabila jawaban dari setiap pertanyaan itu , “ Insya Allah aku mampu, Insya Allah aku siap”, maka jalan menuju surga pun terbuka lebar. Tapi bila jawabannya adalah,” Ya Allah ternyata aku belum mampu, aku masih terlalu jauh hanyut terbawa arus itu,” maka saatnyalah untuk segera bermohon ampun kepada Allah. Dan AllahYang Maha Pengampun telah menjanjikan keampunan yang seluas-luasnya bagi siapapun hambanya yang datang dengan segenap penyesalan, bersimpuh di hadapan Allah memohon keampunan, dan selanjutnya mengisi hari-harinya kemudian dengan kebajikan. Rasul bersabda,” Orang yang bertaubat dari dosa seperti orang yang tidak berdosa sama sekali”. Wallahu A’lam. Marhaban Ya Ramadhan, Syahral Maghfirah ( bulan Keampunan)

WASPADA Jumat 20 Juli 2012

Keutamaan Ramadhan Bulan Ramadhan adalah bulan diturunkannya Al Quran. Allah SWT berfirman: “Bulan Ramadhan adalah bulan yang di dalamnya diturunkan (permulaan) Al Quran sebagai petunjuk bagi manusia dan penjelasanpenjelasan mengenai petunjuk itu dan pembeda (antara yang haq dan yang batil).” (AlBaqarah: 185). Pada bulan ini para setan dibelenggu, pintu neraka ditutup dan pintu surga dibuka. Rasulullah SAW bersabda: “Bila datang bulan Ramadhan dibukalah pintu-pintu surga, ditutuplah pintu-pintu neraka dan dibelenggulah para setan.” (HR. Al-Bukhari dan Muslim) Pada bulan Ramadhan pula terdapat malam Lailatul Qadar. Allah SWT berfirman: “Sesungguhnya Kami telah menurunkan Al Quran pada malam kemuliaan. Tahukah kamu apakah malam kemuliaan itu? Malam kemuliaan itu lebih baik dari seribu bulan. Pada malam itu turun malaikat-malaikat dan malaikat Jibril dengan izin Tuhannya untuk mengatur segala urusan. Malam itu penuh kesejahteraan hingga terbit fajar.” (Al-Qadar: 1-5). Penghapus Dosa Keutamaan dari Ramadhan lainnya adalah bulan untuk menghapus dosa. Hal ini berdasar hadis Abu Hurairah r.a bahwa Rasulullah SAW bersabda: “Shalat lima waktu, dari Jumat (yang satu) menuju Jumat berikutnya, (dari) Ramadhan hingga Ramadhan (berikutnya) adalah penghapus dosa di antaranya, apabila ditinggalkan dosa-dosa besar.” (HR. Muslim). “Barangsiapa yang berpuasa Ramadhan dengan keimanan dan mengharap ridha Allah, akan diampuni dosa-dosanya yang terdahulu.” (HR. Al-Bukhari dan Muslim dari Abu Hurairah). (Dikutip dari berbagai sumber buku hadis dan online).

Menyambut Bulan Kearifan Oleh Agusman Damanik, MA Dosen Fakultas Agama Islam Universitas Al Washliyah (UNIVA) Medan

B

esok umat Islam akan memasuki bulan Suci Ramadhan, bulan yang penuh keberkahan, rahmat dan ampunan. Menurut kementerian Agama Republik Indonesia bulan Ramadhan Tahun ini akan kembali terjadi perbedaan pendapat terutama penetapan awal Ramadhan, namun penetapan hari Raya Idul Fitri tidak terjadi perbedaan pendapat. Terlepas dari perbedaan dan kesepakatan tentang awal dan akhir Ramadhan tersebut, dengan perasaan gembira kita sambut kedatangan bulan Ramadhan dengan ucapan Marhaban ya Ramadhan. Ramadhan juga merupakan “bulan kearifan” yang akan membentuk kepribadian kita menjadi pribadi yang arif bahkan lebih arif dalam mengimani keberadaan Allah, Rasul dan hari akhir. Dengan kata lain, bukan keberimanan yang formalitas tetapi keberimanan yang kaffah yang mema-du di dalamnya hati, ucapan maupun perbuatan. Selain itu, bulan kearifan akan meningkatkan persentase keridhaan kita terhadap Allah S W T, T u h a n yang berhak untuk dis e m b a h , Is lam sebagai agama yang terbaik dan u m a t Is l a m sebagai saudara dalam kehidupan. Ramadhan laksana tamu yang agung, kedatangannya tentu akan kita sambut dengan “penyambutan yang luar biasa”. Sebagaimana biasanya ketika Presiden, menteri, gubernur dan lain sebagainya datang ke suatu tempat dilakukan berbagai persiapan. Mulai dari protokuler sampai menghiasi dan membersihkan tempat yang akan dilewati pejabat tersebut. Penyambutan dilakukan dengan antusias dan kegembiraan. Maka, sudah sepatutnya pula ke-datangan bulan suci Ramadhan disambut lebih meriah dan gembira oleh umat Islam di-bandingkan kedatangan tokoh atau pejabat tersebut. Banyak hal yang harus kita lakukan dalam menyambut tamu agung Ramadhan. Setidaknya ada 3 persiapan yang kita lakukan. 1. Persiapan Spritual. Dengan cara meningkatkan kualitas keimanan dengan menjadi ‘sufi pencerahan’ melalui kepribadian yang ikhlas, sabar, istiqamah, tawadhu’, qonaah dan kepribadian sufistik lainnya. Hal tersebut merupakan keniscayaan. Sebab seruan melaksanakan puasa di bulan Ramadhan ditujukan kepada orang yang beriman sebagaimana firman Allah dalam Alquran surat Al Baqarah ayat 183 “Hai orang-orang yang beriman, diwajibkan atas kamu berpuasa sebagaimana diwajibkan atas orang-orang sebelum kamu agar kamu bertakwa”. Kepribadian sufistik merupakan bentuk lain dari keberimanan totalitas yang mampu menyahuti seruan dari Allah SWT. Bila kepribadian sufistik itu tidak dimiliki, maka akan sia-sialah seluruh ibadah di bulan Ramadhan. Hal tersebut telah disampaikan Rasul melalui hadis yang riwayatkan Nasai dan Ibnu Majah “Berapa banyak orang yang berpuasa, tetapi ia hanya memperoleh haus dan lapar”.

2. Persiapan Finansial. Selain persiapan spritual, kita juga harus mempersiapkan persiapan finansial. Di bulan Ramadhan tidak hanya dise-marakkan dengan berpuasa, tetapi juga sangat dianjurkan memperbanyak sedekah. Dalam ka-itannya sedekah di bulan Ramadhan Rasulullah SAW bersabda” Sebaik-baiknya sedekah yaitu sedekah di bulan Ramadhan “ (HR Al Baihaqi, Al Khatib dan At-Turmudzi). Bagi yang mengeluarkan sebagian hartanya untuk bersedekah di bulan Ramadhan nilai amal shalehnya dilipatgandakan hingga 700 kali lipat dari biasanya. Selain dilipatgandakannya nilai pahala, bagi yang bersedekah di bulan Ramadhan juga akan mendapatkan pahala puasa dari orang yang menerimanya. Hal tersebut sesuai hadis nabi yang diriwayat-kan Tirmidzi “yang memberikan hidangan berbuka puasa kepada orang lain yang berpuasa, ia akan mendapatkan pahala orang tersebut tanpa sedikitpun mengurangi pahalanya.” Persiapan finan-sial tidak hanya dipersiapkan untuk bersedekah, tetapi juga untuk memenuhi kebutuhan sehari-hari baik untuk persiapan makan sahur maupun berbuka puasa dan berbagai aktivitas ilahiyah lainnya. 3. Persiapan intelektual. Selanjutnya persiapan intelektual dengan mempelajari hukum-hukum ibadah yang berkaitan dengan bulan Ramadhan: Fiqh puasa, keutamaan puasa, hal-hal yang sunnah dan yang bisa membatalkan puasa, dan lain sebagainya. Sehingga kita mengetahui halhal yang wajib, sunnah, dan haram. Me m p e l a j a r i h u kum-hukum tersebut tentu jauh lebih baik dilakukan sebelum masuk bulan Ra m a dhan. Kita pelajari ilmu tersebut baik dengan mem-baca buku, mendengarkan ceramah agama, menghadiri majlis taklim dan juga bertanya kepada para ulama. Bagi kalangan Al Washliyah Buku Fikih Ramadhan yang ditulis oleh Wakil Ketua DewanFatwa Pengurus Besar Al Washliyah Prof Dr H.Ramli Abdul Wahid, MA selalu menjadi rujukan. Kendati ukuran buku tipis, namun mampu menjawab permasalahan yang aktual. Pe-mahaman keilmuan yang mapan juga harus menjadi prioritas bagi para muballigh yang akan mengisi berbagai program yang jadwalkan badan kemakmuran masjid, baik itu kuliah Shubuh, pengajian Dhuha, tausiyah ba’da Zuhur, kuliah Ramadhan sebelum Maghrib, Tausiyah sebelum Tarawih dan lain sebagainya. Persiapan ini menjadi suatu keniscayaan agar materi dakwah yang disampaikan dapat menjadi solusi dari berbagai persoalan yang dihadapi para jamaah. Hal terpenting dari itu, materi dakwah harus lebih mengutamakan isi daripada humor dan lawakan. Dengan demikian, maka marilah kita sambut “bulan kearifan” ini dengan persiapan yang maksimal dan optimal, seraya memperbanyak doa kepada Allah”Allahumma Ba Rik lana Fi Sya’ban Wa ballighna Ramadhan”. Ya Allah Ya Tuhan Kami berkahilah kami di bulan Sya’ban dan sampaikanlah kami di bulan Ramadhan. Semoga Allah memberikan nikmat kesehatan dan kesempatan kepada kita untuk memasuki bulan suci Ramadhan.


Mimbar Jumat

WASPADA Jumat 20 Juli 2012

C7

Puasa, Takwa Dan Kekhalifahan Beberapa Hal Terkait Ramadhan Puasa dimulai dengan munculnya fajar hingga terbenamnya matahari. Namun kita harus hati-hati karena terdapat dua jenis fajar, yaitu fajar kadzib dan fajar shadiq. Fajar kadzib ditandai dengan cahaya putih yang menjulang ke atas seperti ekor serigala. Bila fajar ini muncul masih diperbolehkan makan dan minum namun diharamkan shalat shubuh karena belum masuk waktu. Fajar yang kedua adalah fajar shadiq yang ditandai dengan cahaya merah yang menyebar di atas lembah dan bukit, menyebar hingga ke loronglorong rumah. Fajar inilah yang menjadi tanda dimulainya seseorang menahan makan, minum dan yang semisalnya serta diperbolehkan shalat shubuh. Adapun dasarnya dari Ibnu ‘Abbas bahwa Rasulullah SAW bersabda: “Fajar itu ada dua, yang pertama tidak diharamkan makan dan tidak dihalalkan shalat (shubuh). Adapun yang kedua (fajar) adalah yang diharamkan makan (pada waktu tersebut) dan dihalalkan shalat.” (HR. Ibnu Khuzaimah, AlHakim, dan Al-Baihaqi). Namun para ulama menilai riwayat ini mauquf (hanya perkataan Ibnu ‘Abbas dan bukan sabda Nabi SAW). Di antara mereka adalah Al-Baihaqi, Ad-Daruquthni dalam Sunannya, Abu Dawud dalam Marasilnya, dan Al-Khathib Al-Baghdadi dalam Tarikhnya. Juga diriwayatkan dari Tsauban dengan sanad yang mursal. Sementara diriwayatkan juga dari hadis Jabir dengan sanad yang lemah.Sudah menjadi tradisi kalau menyambut Ramadhan, banyak acara digelar kaum muslimin meski syariat tidak pernah memerintahkan untuk membuat berbagai acara tertentu menyambut datangnya bulan mulia tersebut. Puasa Ramadhan merupakan salah satu dari kewajiban puasa yang ditetapkan syariat yang ditujukan dalam rangka taqarrub (mendekatkan diri) kepada Allah SWT Hukum puasa sendiri terbagi menjadi dua, yaitu puasa wajib dan puasa sunnah. Adapun puasa wajib terbagi menjadi tiga: puasa Ramadhan, puasa kaffarah (puasa tebusan), dan puasa nazar. (Dikutip dari berbagai sumber buku hadis dan online).

4 Jenis Manusia Oleh Yose Rizal, S.Ag, MM Kepala Sekolah PPMDH TPI Medan & MAPN 4 Martubung Medan

M

anusia merupakan makhluk yang paling sempurna yang diciptakan Allah Swt, ia diberikan Allah Akal dan Nafsu untuk bisa dipergunakan dengan sebaik-baiknya. Dalam bermasyarakat hendaklah kita menjadikan hidup kita ini penuh arti dan dikenang selalu oleh mereka (manusia yang lain), dalam hadist dikataka: khairunnas anfa’uhum linnas/ sebaik-baik manusia adalah yang bermanfaat bagi manusia yang lain. Juga manusia adalah makhluk yang diciptakan Allah SWT dengan begitu sempurna, kesempurnaan tersebut dapat kita lihat dari Alquran surah At-Tin yang berbunyi: lakod kholaknal insani fi ahsani taqwim/telah kami ciptakan manusia sebaikbaik bentuk, artinya apa?,bahwa Allah SWT menjadikan kita manusia sebagai makhluk yang paling tinggi martabatnya dibandingkan dengan makhluk-makhluk yang lain. Disamping itu, Allah SWT memberikan suatu nikmat kepada manusia yang apa-bila nikmat tersebut dapat dipergunakan dengan sebaik-baiknya maka akan berdampak positif dalam hidupnya yang akhirnya dia dimasukkan kedalam surga jannatun naim, seba-liknya apabila mereka tidak benar-benar meman-faatkan kenikmatan yang telah Allah berikan kepadanya, maka azab Allah yang akan melanda mereka yang akhirnya menjerumuskannya kedalam neraka yang paling dalam, mereka itulah yang di sebutkan Allah sebagai binatang melata bahkan paling rendah daripadanya, hal ini dilanjutkan dalam surah At-Tin: tsumma radadnahu asfala safilin/ kemudian kami kembalikannya ke serendahrendah tempat. Oleh karena itu kita selaku manusia haruslah sadar dan mengamalkan apa yang diperintahkan Allah Swt serta harus memahami diri kita sendiri agar tidak lalai dalam urusan agama ini. Dalam bu-ku Ihya’ Ulumuddin yang dikarang oleh Imam Al-Ghazali ada 4 Tipikal (jenis) manusia, jika kita renungkan ke empat tipe (jenis) ini, maka Insya Allah kita akan lebih berhati-hati dalam hidup dan kehidupan ini, adapun ungkapan nya adalah: Pertama, Rojulun Laa Yadri wa Laa Yadri Annahu Laa Yadri (Seseorang yang tidak tahu, dan dia tidak tahu kalau dirinya tidak tahu), Inilah jenis manusia yang paling buruk, tidak tahu diri dan tidak berguna. Ia selalu merasa mengerti, merasa benar, merasa memiliki ilmu, padahal ia tidak tahu apa-apa. Repotnya manusia seperti ini susah sekali untuk disadarkan, ketika pendapatnya sudah patah dan lemah sekalipun ia tetap mencari-car i alasan untuk membenarkan kesalahannya tersebut. Kalau diingatkan ia akan membantah sebab ia merasa tahu atau bahkan merasa lebih tahu. Jenis seperti ini paling susah dicari kebaikannya. Jangan ikuti orang seperti ini, kalau memang kita merasa tidak sanggup untuk menyadarkannya maka lebih baik meninggalkannya ketimbang kita yang akan terpengaruh oleh dia. Ingat, ilmu yang palsu (keliru) jauh lebih berbahaya dari kebodohan. Terlalu banyak istilah untuk menggambarkan orang seperti ini, hal ini sebanding dengan banyaknya manusia jenis seperti ini (atau bahkan jangan-jangan diri kita sendiri ?, naudzubillah….). Biasanya orang seperti inilah yang gampang terbawa aliran sesat atau bahkan menyesatkan. Meninggalkannya masih jauh lebih baik daripada banyak berdebat yang hanya akan menimbulkan pertikaian (Idza Natokoh safihu fala tujibhu, fakhairo min ijabati sukuti/apabila orang bodoh

itu berbicara maka janganlah dijawab, sebaik-baik jawaban adalah diam), debat yang tak akan pernah berkesudahan karena jalur pemikirannya sendiri sudah berbeda. Kita ke Timur dia ke Barat. Kedua, Rojulun Laa Yadri waa Yadri Annahu Laa Yadri (Seseorang yang tidak tahu, tapi dia tahu (sadar diri) kalau dia tidak tahu), Orang-orang seperti ini adalah orang yang masih awam, masih lemah pengetahuannya, masih (maaf ) bodoh pengetahuannya. Maka bagi orang-orang yang berilmu yang berada disekitarnya adalah berkewajiban untuk merangkul dan mengajarinya. Menurut Imam Ghozali, jenis manusia seperti ini masih tergolong baik. Sebab manusia seperti ini menyadari akan kekurangannya, ia bisa mengintropeksi dirinya dan bisa menempatkan diri sepantasnya. Karena ia tahu akan segala kekurangannya, ia terus berusaha menyempurnakannya. Dengan terus berusaha belajar, sangat diharapkan suatu saat nanti bisa berilmu dan tahu kalau dirinya punya ilmu yang harus diamalkan. Meskipun tergolong baik, tapi ini bukan tipe manusia yang bisa membuat perubahan nyata bagi lingkungannya. Sebab, tanpa ilmu pengetahuan yang cukup, maka manusia tidak bisa berinovasi. Baiknya, tipe manusia ini dengan kesadaran dan akal sehatnya tidak akan menghalangi sebuah proses perubahan kearah yang lebih baik. Dia tidak akan berani nekat memegang amanah yang ia rasa tidak memiliki kemampuan untuk memegangnya, sebab ia tahu siapa dirinya. Ketiga, Rojulun Yadri wa Laa Yadri Annahu Yadri (Sese-orang yang tahu, tapi dia tidak tahu kalau dirinya tahu), Untuk tipe yang seperti ini, mungkin bisa kita umpamakan orang yang tengah tertidur, lalu bagaimana sikap kita dengan orang yang seperti ini ?, bangunkan dia !. Manusia seperti ini sesungguhnya memiliki ilmu dan kecakapan, tapi dia tidak pernah menyadari bahwa sesungguhnya dia memiliki potensi yang luar biasa tersebut. Manusia seperti ini sering kita jumpai disekeliling kita, keberadaannya seakan-akan tidak berguna selama dia belum bangun (menyadari kemampuannya). Sekali lagi orang-orang seperti ini harus segera dibangunkan, karena ilmunya yang tidak segera diamalkan bisa bagaikan pohon yang tidak berbuah, adanya dia menjadi seperti tidak ada. Untuk yang merasa teman baginya, ingatkan dia, yakinkan dia bahwa dia memiliki potensi untuk bisa. Keempat, Rojulun Yadri wa Yadri Annahu Yadri (Seseorang yang tahu, dan dia tahu kalau dirinya tahu), Orang seperti ini biasanya disebut ‘Alim = mengetahui. Ini jenis manusia yang paling baik yang harus dicontoh, ini juga tipe muslim yang sejati yang dapat memegang Syariat Islam. Terhadap orang yang seperti ini yang harus kita lakukan adalah dengan mengikutinya, apalagi kalau kita masih awam dan butuh banyak ilmu. Maka, sudah sepatutnya kita mencari orang seperti ini. Ini adalah jenis manusia yang paling baik berdasarkan ilmu pengetahuannya, ia tidak hanya memiliki pengetahuan yang luas tetapi juga dia menyadari kemapanan ilmunya sehingga ia mengamalkannya di jalan Allah SWT. Ia senantiasa berusaha semaksimal mungkin untuk mengamalkan ilmunya demi kemaslahatan umat. Orang seperti ini meskipun pengetahuannya luas dan mapan, ia tidak sombong dan tidak berhenti belajar. Manusia jenis ini adalah manusia unggul, manusia seperti inilah yang mampu merubah dunia kearah yang lebih baik, mereka layak menjadi lifemaking (penentu arah) . Jumlah manusia seperti ini tidaklah banyak, tapi setiap dimana ia berada ia akan menjadi nyawa bagi kehidupan umat manusia lainnya. Subhanallah… dimanakah orang-orang yang seperti ini ? Wallahu Muafiq Ila Aqwami Thariq

Oleh Azhari Akmal Tarigan Dosen Fak. Syari’ah IAIN.SU Dan Koordinator Tim Penulis Tafsir Al-Qur’an Karya Ulama Tiga Serangkai

H

ai orang-orang yang beriman, diwajibkan atas kamu berpuasa sebagaimana telah diwajibkan kepada umatumat sebelum kamu. Mudah-mudahan kamu menjadi orang yang bertakwa. (QS. Al-Baqarah: 183). Mengapa ayat-ayat puasa diletakkan Allah SWT di dalam surah Al-Baqarah ? Mengapa tidak di surah yang lain ? Misalnya di Surah Ali Imran atau di surah Bani Israil atau juga di surah Maryam. Bukankah puasa juga telah menjadi kewajiban umat-umat sebelum umat Nabi Muhammad. Sepanjang pengetahuan penulis, sisi ini agak jarang disentuh para ustaz atau ulama ketika membahas ayat-ayat puasa. Tentu kita dapat berkata posisi perintah Allah, apapun bentuknya di dalam satu surah Alquran bukanlah tanpa tujuan sama sekali. Allah meletakkan sesuatu baik ayat-ayat syar’i (Alquran) ataupun ayat-ayat kauni (semesta alam) pada posisi tertentu pasti ada tujuan, nilai dan hikmah yang dikandung di dalamnya. Tugas manusialah untuk menyingkap dan menggalinya. Amru Khalid di dalam karyanya Khawatir Qur’aniyyah: Nazhrat fi Ahdaf Al-Suwar al-Qur’an (Pesona Al-Qur’an dalam Matarantai Surah dan Ayat) telah menguraikan dengan cukup singkat namun padat berkaitan dengan tujuan surah Al-Baqarah. Menurutnya, tujuan surah Al-Baqarah yang terdiri dari 286 ayat dan turun untuk pertama kalinya setelah hijrah adalah pengangkatan manusia sebagai khalifah di bumi. Ringkasnya, surah ini ingin menyatakan, “Wahai kaum muslim, engkau adalah penangggungjawab bumi dan surah ini adalah manhaj atau pedomanmu untuk melaksanakan tugas itu. Adalah menarik bagaimana Amru Khalid membuktikan tesisnya di atas. Menurutnya, surah Al-Baqarah itu terdiri delapan rubu’ atau segmen. Rubu’ pertama pembahasan tentang tiga kelompok manusia dan yang hanya mampu menjadi khalifah hanya satu kelompok. Rubu’ kedua, berbicara tentang pengalaman khalifah pertama, yaitu nabi Adam As. Rubu’ ketiga sampai kedelapan kisah umat manusia yang menjadi khalifah di bumi untuk rentang waktu yang panjang, namun ga-

gal, itulah bani Israil. Rubu kedelapan atau terakhir bercerita tentang pengalaman Nabi Ibrahim AS sebagai khalifah yang berhasil. Perintah puasa Ramadhan dengan segala aturan yang berkaitan dengannya terdapat di dalam su-rah Al-Baqarah ayat 183-187. Dalam perspektif Amru Khalid posisi ini merupakan bagian dari rubu’ yang ketiga dan merupakan anti tesis dari penyebab kegagalan Bani Isra’il menjadi khalifah. Seolah-olah ayat ini termasuk ayat sebelum (yang mengatur hukum pidana, QS, 2: 178 dan Hukum waris QS, 2:180) dan sesudahnya, menegaskan tugas-tugas kekhalifahan hanya dapat dilaksanakan jika disertai dengan komitmen pada manhaj Allah. Pada saat manusia melakukan menyimpangan terhadap manhaj bahkan merubah dan mengganti syari’at itu, inilah saat kejatuhan manusia dari kedudukannya sebagai khalifah. Tidak itu saja, kerusakan dan kehancuran masyarakat hanya tinggal menunggu waktu saja. Penyebutan redaksi kama kutiba ‘ala allazina min qablikum pada ayat 183 menurut para mufassir ternyata memuat informasi bahwa umat-umat terdahulu, orang Yahudi dan Nasrani telah merubah syari’at puasa sekehendak hawa nafsunya. Nyatanya, mereka sampai saat ini tidak melaksanakn ibadah puasa pada bulan Ramadhan. Hanya umat Islam yang masih konsisten dengan perintah Allah tersebut. Khalifah yang dikendalikan hawa nafsunya tentu tidak akan bisa menjalankan fungsi kekhalifahannya. Sebaliknya hanya orang yang bertakwa, yaitu orang yang menundukkan diri dam hawa nafsunya di bawah manhaj Allah, merekalah yang mampu melaksanakan tugas mulia tersebut. Takwa sejatinya merupakan inti dari kekhalifahan. Takwa juga menjadi spirit kekhalifahan. Di dalam surah Al-Baqarah ayat 2, Allah SWT telah menegaskan bahwa Alquran adalah kitab yang tidak boleh diragukan kebenarannya dan petunjuk bagi orang yang bertaqwa. Selanjutnya, pada ayatayat sesudahnya taqwa disebut di berbagai tempat. Sebagai contoh, di akhir ayat qisas (hukum pidana)

Puasanya para pemimpin-pemimpin kita sebenarnya memberi harapan baru bagi kehidupan kebangsaan kita pada masa depan. Allah menegaskan la’allakum tattaqun, 179. Di akhir ayat waris terdapat frasa, haqqan ‘ala al-muttaqin, 180. Di akhir ayat puasa terdapat frasa la’allakum tattaqun, 183. Kemudian di akhir penjelasan Allah tentang ayat-ayat hukum Allah kembali menegaskan semua itu untuk manusia agar mereka bertakwa (li annasi la’allahum yattaqun, 187). Dalam konteks puasa Ramadhan, orang-orang yang beriman sesungguhnya diajari Allah SWT untuk tunduk pada manhajnya Allah. Di dalam puasa, kita diperintah untuk al-imsak (menahan diri) dari segala hal yang membatalkan puasa (makan, minum dan aktivitas sexsual) sejak terbit fajar sampai terbenamnya matahari. Kemampuan imsak pada level ini tentu sangat rendah. Para ulama menyebutnya sebagai puasa awam (puasa jasmani). Seorang khalifah bisa saja berpuasa dalam pengertian fikih, namun jika ia masih tetap memperturutkan hawa nafsunya, maka kekhalifahannya tidak akan berefek kemaslahatan apapun. Oleh sebab itu, ia harus bergerak pada puasa nafsani (mengendalikan indera dan hawa nafsu) dan puasa ruhani yaitu mengendalikan qalbunya untuk tetap terhubung dengan Allah SWT. Tegaslah bahwa yang dikehendaki oleh ayat di atas tidaklah sekedar hanya menahan diri dari kebutuhan fa’ali (makan, minum dan sex) saja. Bagi seorang khalifah atau pemimpin, kekuatannya terletak pada keputusan dan kebijakannya dalam konteks kewajiban dan fungsinya. Dan ini semua berkaitan dengan kebijakankebijakan publik atau kepentingan masyarakat banyak. Seberapa jauh kebijakannya berkorelasi dengan kebutuhan dan kemaslahatan umum. Jika seorang pemimpin dikuasai oleh hawa nafsu, bisa dipastikan keputusan dan kebijakannya akan diarahkan untuk ke-

pentingan dirinya. Sebenarnya tidak sulit untuk memahami fenomena korupsi di Negara ini. Mengapa orang korupsi, mengambil dan memakan sesuatu yang bukan haknya. Jawabannya karena ia tidak mampu mengendalikan hawa nafsunya. Mengapa ada pemimpin yang menzalimi rakyatnya, bahkan dengan cara yang paling kejam sekalipun ? Lagi-lagi jawabannya karena ia tidak mampu mengendalikan nafsunya. Jika dikembangkan lebih jauh, mengapa ada pemimpin yang tidak memilik manhaj qur’ani dalam pengelolaan Negara ? Jawabnya karena ia tidak menundukkan dirinya pada manhaj rabbni sebagaimana yang telah digariskan Allah di dalam ayat-ayatnya. Puasanya para pemimpin-pemimpin kita sebenarnya memberi harapan baru bagi kehidupan kebangsaan kita pada masa depan. Namun ini tidak menjadi otomatis, setiap pemimpin yang puasa akan menjadi muttaqin. Kuncinya adalah kesiapan untuk menundukkan diri kepada manhajnya Allah SWT. Oleh sebab itu, para khalifah (Pemimpin) tidak hanya berpuasa dalam makna fisik atau jasmani. Lebih penting dari itu adalah mereka juga harus berpuasa nafsani dan ruhani. Sejatinya, puasa adalah aktifitas sunyi di mana setiap orang dituntut untuk merenungi dirinya. Sejauh mana dalam hidup ini, ia telah menundukkan dirinya kepada manhaj rabbani. Sejauh mana pula manhaj-manhaj duniawi lainnya yang telah menguasai dan mengendalikan dirinya. Puasa tidak membutuhkan keramaian dan kehingarbingaran. puasa tidak memerlukan publikasi. “Puasa itu untukku dan akulah yang akan membalasnya”. Demikian firman Allah dalam hadis Qudsi. Semoga para pemimpin kita menyadari ini semua dan mereka dapat kembali kepada manhaj rabbani. Insya Allah.

Bolehkah Shalat Taraweh Lebih Dari 11 Rakaat ? (Menanggapi Tulisan Sdr Sholahuddin Ashari M.S.I) Oleh dr. Arifin S. Siregar Dokter Spesialis Penyakit Kulit dan Kelamin

B

eberapa hari lagi, kita akan mengamalkan shalat malam (shalat Taraweh) di bulan Ramadhan. Dikalangan umat Islam di Indonesia ini, terjadi 2 macam amalan, ada yang jumlah rakaatnya 23 rakaat dan ada yang 11 rakaat. Mana yang benar, mana yang diikut ? Allah SWT benci pada orang yang beramal hanya dasar ikut-ikutan tanpa mengerti (QS Al-Isra’ 37). Pada Harian Waspada tanggal 6 Juli 2012 halaman Jum’at, ada pernyataan Sdr Sholahuddin Azhari M.S.I bahwa shalat malam (shalat Taraweh) dibulan Ramadhan itu, tidak ada batasan jumlah rakaatnya, bisa 13,20,39 rakaat, dan seterusnya. Argumentasinya dikemukakannya H.R Al-Baihaqi dan H.R Imam Malik (dalam al Muwattha’) dari Yazid bin Rumman, dia mengatakan : “Dahulu pada za-man Umar RA orang-orang melaksanakan shalat malam (taraweh) 23 rakaat dibulan Ramadhan”. Hadis ini lemah sekali, dimana Yazid bin Rumman tidak pernah bertemu Umar RA. Hal ini dinyatakan oleh Imam Nawawi dalam “alMajmu’ IV -33 ia mengatakan bahwa hadis ini mursal, karena Yazid bin Rumman tidak pernah bertemu Umar RA. (lihat : “(Kitab: “Kelemahan Riwayat Tarawih 20 Rakaat” oleh Syeikh Nashiruddin Albani). Bukti lain yang kuat bahwa Umar RA tidak pernah shalat malam (taraweh) 23 rakaat, dinyatakan oleh H.R Malik-al Muwaththa’ I: 137-138: Dari Muhammad bin Yusuf dari as Saaib bin Yazid bahwasanya ia berkata: Umar RA telah memerintahkan Ubay bin Ka’ab dan Tamim ad-Daary mengimami orang-orang dengan sebelas rakaat. Ia berkata: “Imam pada waktu membaca ratusan ayat, sehingga kami bersandar dengan tongkat karena lamanya berdiri, dan kami tidak selesai kecuali menjelang fajar”. (Kitab: “Kelemahan Riwayat Tarawih 20 Rakaat” oleh Syeikh Nashiruddin Albani). Bukti lain ialah dimana atsar

yang menyatakan Umar RA dituduh melakukan 23 rakaat berbunyi: “Dizaman Umar RA orang-orang melakukan shalat malam (taraweh) 23 rakaat”. Jadi bukan Umar RA yang melakukan 23 rakaat, tapi orang-orang di zaman Umar RA. Hadis atau atsar adalah hukum, hukum harus bicara jelas dan tegas. Bila Umar RA yang melakukan, tentu bunyi atsar itu: “Umar RA dan orang-orang melakukan shalat taraweh 23 rakaat. Bukti Nabi SAW Tidak Lebih 11 Rakaat.

guhnya kedua mataku tidur, tetapi hatiku terjaga”. (Al-Bukhari 1: 342). (Kitab: sekitar masaalah taraweh, takbir dan shalat Id” oleh K.H.E Abdurrahman). Dalam Hadis diatasitu jelas Aisyah RA menyatakan Nabi SAW shalat malam (shalat taraweh) dibulan Ramadhan dan diluar Ramadhan tidak pernah lebih dari 11 rakaat. Seperti kita sudah maklum Nabi SAW memerintahkan kita harus shalat mencontoh petunjuk Nabi SAW melalui H.R Muslim :

Aisyah RA menyatakan Nabi SAW shalat malam (shalat taraweh) dibulan Ramadhan dan diluar Ramadhan tidak pernah lebih dari 11 rakaat. Kemudian sangat disesalkan pernyataan Sdr Sholahuddin Azhari M.S.I di Harian Waspada Mimbar Jumat tanggal 6 Juli 2012 yang menyatakan Rasulullah tidak pernah memberi ketetapan yang mengikat terkait jumlah rakaat shalat Taraweh . Pada hal bila kita rujuk pada H.R Bukhari dan Muslim yang berbunyi: “Dari Abu Salamah bin Abdurrahman bahwa sesungguhnya ia bertanya kepada Aisyah, bagaimana cara (shalat) Rasulullah SAW, pada malam bulan Ramadhan. Ia (Aisyah) menjawab: “Tidaklah Rasulullah SAW menambah (tidak lebih) pada bulan Ramadhan, (juga) pada bulan yang lainnya, ada-lah sebelas rakaat. Beliau shalat empat rakaat, tetapi jangan bertanya tentang kebaikannya dan panjangnya. Beliau shalat (lagi) empat rakaat, tetapi jangan (pula) bertanya tentang kebaikannya dan panjangnya. Kemudian beliau shalat tiga rakaat. Aisyah berkata: Aku bertanya: Hai Rasulullah apakah engkau tidur sebelum witir ? Beliau menjawab: “Hai, Aisyah, sesung-

“Shallu kama roaitumuni ushalli” = “Shalatlah kamu seperti kamu melihat aku shalat”. Nabi SAW tidak pernah shalat Taraweh lebih dari 11 rakaat, kenapa kita buat lebih dari 11 rakaat ?. Apakah pernyataan Aisyah ini kurang jelas ? Kemudian apa akibat dari tidak mengikut petunjuk Nabi SAW, 11 rakaat ? Hal ini dijawab oleh H.R Muslim yang berbunyi: “Barang siapa mengamalkan amalan yang tidak menurut petunjuk kami (Nabi SAW), maka amalan itu tertolak”. Mungkin anda atau memang ada ulama lain menyatakan yang disebut H.R Muslim Bukhari dari Aisyah RA diatas itu adalah untuk shalat witir, karena yang ujungnya berbunyi: “Aisyah berkata: ‘Aku bertanya : Hai, Rasulullah, apakah engkau tidur sebelum witir ? Beliau menjawab: Hai, Aisyah, sesungguhnya kedua mataku tidur, tetapi hatiku terjaga (H.R Bukhari 1 : 342). Mengherankan, kalau pertanyaan Aisyah RA: “Apakah engkau tidur sebelum witir” diartikan bahwa shalat yang 4 rakaat salam, ke-

mudian 4 rakaat salam kemudian 3 rakaat salam itu, dianggap bentuk shalat witir. Pada hal shalat witir itu, adalah satu batang tubuh shalat yang jumlah rakaatnya ganjil, misalnya: 1 rakaat, 3 rakaat, 5 rakaat, 7 rakaat, 9 rakaat dan 11 rakaat. Kita beri satu contoh bentuk batang tubuh shalat witir yang dicontohkan Nabi SAW, rujukannya adalah H.R Ahmad, Nasai, Ibnu Majah.: “Bahwasanya Rasulullah SAW itu juga berwitir tujuh atau lima rakaat bersambungan tidak dipisahkan dengan salam atau bicara”. Jadi tidak benar kalau 4,4,3 itu bentuk batang tubuh dari shalat witir. (Kitab: “Fikih Sunnah 1-2” oleh Sayid Sabiq). Kesimpulan : 1. Bila ada petunjuk Nabi SAW yang shahih dan jelas bahwa 11 rakaat shalat taraweh, kenapa memilih 23 rakaat ? 2. Yang 23 rakaat, bukan petunjuk Nabi SAW dan riwayat yang meriwayatkan adalah lemah atau palsu. 3.Mengerjakan yang 11 rakaat, pasti lebih khusuk dan tuma’ninah, ketimbang mengamalkan yang 23 rakaat. 4.Tuma’ninah adalah termasuk rukun dari shalat. Rusak ‘tuma’ninah, rusak shalat. 5. Adapun bentuk rakaat 23, 26,36,40,70, dsb itu adalah hasil ijtihad ulama. Kenapa ulama harus berijtihad? Pada hal telah ada petunjuk Nabi SAW bagaimana cara shalat taraweh, yaitu 11 rakaat. Ijtihad perlu atau boleh pada ketika diperlukan hukum, dimana bila tidak ada hukumnya dijumpai di Alquran dan Hadis (Sunnah), (lihat H.R AtTurmudzi yang menyatakan pengakuan sahabat Muadz bin Jabbal ketika beliau akan diutus Nabi SAW ke Yaman jadi hakim). 6. Amalan Makkah, Madinah menjadi panutan bila sesuai petunjuk Alquran dan Hadis (Sunnah). Jadi 23 rakaat Makkah dan Madinah, tidak mutlak harus diikuti.


Mimbar Jumat

C8

WASPADA Jumat 20 Juli 2012

Islam Di Vietnam Dokumen Dinasti Song di China yang mencatat bahwa populasi Cham telah menganut Islam pada akhir abad 10 dan awal abad 11.

-Masjid Jamiul Muslimin di Phu Nhuan District, kota Ho Chi Minh.

-Masjid Biru Di Saigon. ISLAM masuk ke Vietnam pada abad ke 7 lewat para pedagang Arab dan kemudian menyatu dengan kebudayaan setempat. Saat ini Islam dianut sebagian besar populasi Cham, etnis minoritas yang ada hubungan dengan etnis Melayu. Selain suku Cham, juga terdapat komunitas Muslim campuran (Cham, Khmer, Melayu, Minang, Viet, China dan Arab). Umat Muslim Vietnam sebagian besar tinggal di kawasan Vietnam Tengah Selatan, Delta Mekong dan dekat perbatasan Vietnam-Kamboja. Masuknya Islam ke Vietnam berawal dari Utsman bin Affan, Kalifah ketiga Islam, mengirim utusan Muslim pertama ke Vietnam dan Dinasti Tang di China pada tahun 650.

Dikatakan pula, para pedagang Muslim pernah singgah di sejumlah pelabuhan Kerajaan Champa dalam perjalanan menuju China pada awal sejarah Islam. Namun, bukti tentang penyebaran Islam tertera dalam dokumen Dinasti Song di China yang mencatat bahwa populasi Cham telah menganut Islam pada akhir abad 10 dan awal abad 11. Jumlah pemeluk Islam terus meningkat sejak dengan terus dijalinnya hubungan dengan Kesultanan Malaka setelah runtuhnya Kerajaan Champa pada 1471. Namun penyebaran Islam berlangsung secara pesat di antara etnis Champ pada pertengahan abad 17. Pada abad ke 19, banyak Muslim Cham be-

remigrasi dari Kamboja dan menetap di kawasan Delta Mekong, hal ini memperkuat keberadaan Islam di Vietnam. Pengaruh etnis Melayu sangat berperan dalam menyebarkan Islam bagi etnis Cham di awal abad ke 20, buku keagamaan banyak diimpor dari Malaysia, para ulama Melayu menyampaikan khotbah di masjid-masjid dengan menggunakan bahasa Melayu, dan banyak etnis Cham pergi ke Malaysia untuk memperdalam ilmu tentang Islam. Masjid Ditutup Setelah berdirinya Republik Sosialis Vietnam pada tahun 1976, sekitar 55.000 Muslim Cham beremigrasi ke Malaysia, 1.750 di antara mereka kemudian diterima sebagai imigran

oleh negara Yaman, sebagian besar mereka tinggal di Ta’izz. Muslim Cham yang memutuskan bertahan di negaranya mengaku tidak mendapat perlakuan buruk dari pemerintah, meski mereka mengatakan masjid-masjid di sana ditutup oleh pemerintah. Namun, pada tahun 2006 masjid terbesar Vietnam diresmikan di Xuan Loc, Provinsi Dong Nai. Pembangunan masjid ini sebagian dananya berasal dari sumbangan Kerajaan Arab Saudi. Demografis Lebih 77 persen Muslim Vietnam tinggal di wilayah Tenggara, di mana 34 persen di antaranya tinggal di Provinsi Ninh Thuan, 24 persen di Binh Thuan, dan 9 persen di Ho Chi Minh, 22 persen tinggal di Delta Mekong, terutama di Provinsi An Giang. Hanya 1 persen Muslim Vietnam tinggal di kawasan lain negara itu. Sensus pada tahun 1999 menunjukkan ada sekitar 66.000 Muslim tinggal di Vietnam. Komite Perwakilan Muslim Ho Chi Minh didirikan pada

tahun 1991 dengan anggota 7 orang. Lembaga serupa juga dibentuk di Provinsi An Giang pada tahun 2004. Dengan meningkatnya jumlah wisatawan Muslim khususnya dari Singapura, Indonesia dan Malaysia, sejumlah restoran halal telah dibuka di Hanoi dan Ho Chi Minh. Di Hanoi juga terdapat restoran halal namun, jumlahnya tidak sebanyak seperti di Ho Chi Minh. Pada umumnya restoran halal yang ada di sana merupakan restoran makanan Timur Tengah. Begitu pun ada juga restoran yang menyajikan makanan Indonesia, makanan India dan makanan Malaysia. Untuk lebih yakin silahkan klik Go HalalPlanet. Sekilas Tentang Vietnam Vietnam adalah negara sosialis berpenduduk + 80 juta jiwa dengan wilayah seluas 331.688 km2. Secara geografis, Vietnam masih berada di Asia Tenggara, persisnya di kawasan Indochina, dengan batas RRC di bagian utara. Sedangkan di bagian barat

Vietnam dibatasi negara Laos dan Kamboja. Vietnam dijajah oleh Perancis selama lebih dari satu setengah abad, kemudian pada tahun 1941digantikan oleh Jepang. Vietnam merdeka pada tanggal 2 September 1945 setelah berhasil mengusir Jepang yang telah menjajahnya selama 4 tahun. Akan tetapi kemerdekaan tersebut tidak diakui oleh Perancis yang masih merasa memiliki Vietnam. Keadaan ini menyebabkan terjadinya perang dengan Perancis selama delapan tahun yang berakhir dengan kekalahan Perancis pada tahun 1854. Menyerahnya Perancis tidak mengakhiri peperangan di Vietnam. Karena Vietnam terpecah menjadi dua negara. Pertama Vietnam Utara yang merdeka di bawah pimpinan Ho Chi Minh. Kemudian berkembang menjadi negara komunis.Yang kedua Vietnam Selatan, cenderung kapitalis karena didukung Amerika Serikat. Perang saudara kedua negara pecah pada tahun 1969. Vietnam Selatan yang didukung Amerika

Serikat, akhirnya takluk dengan Vietnam Utara yang dibantu negara-negara Timur, terutama RRC. Perang yang menewaskan ribuan rakyat kedua belah pihak dan sejumlah tentara Amerika masuk dalam istilah MIA (missing in action) ini baru berakhir pada tahun 1975, dan Amerika angkat kaki dari negara itu. Dengan berakhirnya perang itu, maka pada tahun 1976 kedua Vietnam bersatu dalam satu bendera di bawah nama Republik Sosialis Vietnam. Dari segi jumlah pemeluk agama, Budha menempati urutan terbesar, yakni lebih kurang 10 juta orang. Umat Budha menyebar di seluruh provinsi yang ada di Vietnam. Urutan kedua ditempati agama Katolik. Agama Kristen masuk ke urutan ketiga dengan jumlah pemeluk sekitar sejuta orang. Agama Islam berada di tempat keempat. Selain agama-agama di atas, masih terdapat agamaagama lain di Vietnam yang masih agak asing di telinga kita. Sebut saja agama CaoDai. Syafri

Hikmah Puasa Dan Kesehatan Kriteria Pemimpin Menurut Oleh Drg. T. Rizal, MHA Penulis adalah Kepala Staf Medis Fungsional (SMF) Gigi dan Mulut, RSUD dr. Fauziah Bireuen, Provinsi Aceh.

B

ulan Ramadhan yang di Indonesia juga populer disebut bulan puasa. Merupakan bulan yang sangat dirindukan semua kaum muslimin di muka bumi ini, sebab pada bulan ini Allah SWT memberikan berkah kenikmatan dan kebaikan. Menyambut bulan Ramadhan. Nabi Muhammad SAW bersabda: Marhaban wa ahlan yaa Ramadhaani yaa muthahhir, yang berarti selamat datang ya Ramadhan yang mensucikan. Puasa (shaum) sebenarnya ibadah yang telah lama berkembang pada masyarakat umat manusia sebelum datangnya Agama Islam. Hal ini sesuai dengan firmah Allah SWT yang mahfumnya: Hai orang-orang yang beriman, diwajibkan puasa atas orang-orang sebelum kamu, agar kamu menjadi orang yang bertaqwa. (Surat Al-Baqarah: 183). Bangsa Arabpun sebenarnya telah melakukan puasa sebelum datangnya ajaran Islam. Bahkan menurut Aisyah, salah seorang istri Nabi SAW yang menyebutkan bahwa orang-orang Quraisy ada yang berpuasa pada hari ‘Asyura. Berpuasa pada masa sebelum Islam, tentulah berlainan dengan puasa yang ditentukan Allah SWT untuk umat Islam. Perintah berpuasa haruslah dilakukan dengan ikhlas dan dengan penuh rasa ketaqwaan terhadap Allah SWT. bukan karena ada paksaan, dorongan maupun bujukan dari orang lain, puasa pada bulan Ramadhan bukanlah untuk menjadi beban berat bagi umat Islam, tapi merupakan salah satu sarana melatih diri untuk mencapai derajat taqwa. Menyehatkan Berpuasa saat bulan suci Ramadhan, suatu kewajiban untuk kaum muslimin (Islam), yang sehat jiwa dan fisiknya. Bulan Ramadhan juga diharapkan menjadi bulan pembinaan mental dan spiritual (Tarbiah) bagi umat Islam. Puasa Ramadhan mendidik jiwa manusia menjadi dalam perasaan bertaqwa dan takut pada Allah SWT. Dengan berpuasa dapat menjaga kesehatan tubuh. Bila terlalu banyak makan dan minul bisa mengundang penyakit. Allah SWT juga melarang makan dan minum secara berlebihan karena dapat merusak pencernaan dan kesehatan tubuh lainnya. Nabi Muhammad SAW bersabda; Bahwa perut itu adalah sarang bagi penyakit dan pencegahannya adalah lebih utama dari segala pengobatan. Sewaktu berpuasa disiang hari, akan dapat mengistirahatkan pekerjaan saluran pencernaan. Ibarat mesin juga memerlukan masa istirahat, agar tetap baik dan awet. Apalagi bagi manusia sangat penting sekali, supaya tetap sehat adanya. Sehingga pekerjaan organ tubuh lainnya akan terjaga dengan baik sehingga kesehatan manusia dapat terpelihara dan dalam kondisi prima sekali. Allah SWT memberi petunjuk kepada hambaNya untuk mengkonsumsi makanan dan minuman yang dapat menegakkan tubuh bagai ganti dari apa yang telah terurai dan menurut kadar kebutuhan tubuh baik kuantitas maupun kualitasnya.

Barang siapa yang memperhatikan petunjuk Nabi Muhammad SAW, maka dia akan mendapati bahwa ini merupakan petunjuk terbaik untuk men-jaga kesehatan. Sebab penjagaan kesehatan tergantung pada manajemen yang baik dari makanan dan minuman dan sebagainya. Apabila elemen tersebut terjadi menurut keseimbangan yang sesuai dan cocok dengan tubuh, usia dan kebiasaan, maka akan lebih dekat dengan kelangsungan kesehatan dan kebugaran tubuh hingga akhir hayat. Puasa termasuk kedalam pengobatan rohani dan alami. Bila orang yang berpuasa memelihara apa yang harus dipeliharanya secara biologis dan syariat, akan besarlah manfaat yang diperoleh hati dan badan darinya. Sebab puasa akan menahannya dari materi yang asing dan rusak. Oleh karena itu, puasa mencegah dan melindungi pelakunya dari segala penyakit yang akan mengganggu hati dan badannya di dunia dan akhirat. Tidak semua orang sakit dibolehkan meni ng g a l k a n p u a s a Ra m a d h a n, o ra ng ya n g mendapatkan keringanan untuk tidak berpuasa, yang apabila mereka terus berpuasa dikhawatirkan penyakitnya akan bertambah parah. Adapun bila telah sehat kembali, maka orang tersebut wajib mengganti puasanya yang tertinggal dengan berpuasa pada bulan yang lain atau membayar fidiyah dan lain-lain. Orang yang sedang puasa dibolehkan untuk berobat sesuai dengan keperluannya. Juga diperbolehkan memberikan donor darah selama tidak membahayakan kesehatan. Dibolehkan juga untuk mendapatkan transfusi darah karena penyakit tertentu yang melemahkan tubuhnya, sebab transfusi darah tidak termasuk dalam pengertian makan dan minum yang membatalkan puasa. Bagi penderita penyakit lambung (Maag), sebaiknya pada saat sahur dan berbuka puasa, makanlah seperti biasanya, jangan berlebihan, bila terasa lapar, dibolehkan memakan makanan selingan pada malam hari sekitar jam 10 malam. Juga untuk mengidap penyakit Diabetes Mellitus, diharapkan berkonsultasi lebih dahulu dengan Dokter Ahli. Karena pengidap Kencing Manis ini, dikhawatirkan kadar gula darahnya menjadi sangat rendah yang manifestasinya akan tampak lemas, pucat, berkeringat. Bila sudah begini segera minum air panas, misalnya teh manis dan segera cek kadar gula darahnya. Pada bulan Ramadhan ini, bagi siapapun yang menjalankan ibadah puasa, maka hendaklah memperhatikan konsumsi makanannya. Dianjurkan untuk mengkonsumsi yang utama adalah karbohidrat, selanjutnya protein, lemak secukupnya dan aneka vitamin yang terdapat dalam buah-buahan dan sayuran segar. Semoga dengan memperhatikan itu semua, puasa kita selamat sampai akhir bulan Ramadhan, Amin. (dari berbagai sumber).

Puasa termasuk kedalam pengobatan rohani dan alami. Bila orang yang berpuasa memelihara apa yang harus dipeliharanya secara biologis dan syariat.

Ayat-ayat Puasa

Oleh Achyar Zein Dosen Fakultas Tarbiyah IAIN Sumatera Utara

D

an berpuasa lebih baik bagi kamu jika kamu mengetahui. (Q.S. al-Baqarah ayat 184). Kata Rasulullah dalam salah satu haditsnya “pemimpin haruslah orang-orang yang terbaik di antara kaumnya”. Untuk mendapatkan sosok terbaik ini diperlukan kriteria baik yang sifatnya umum maupun yang khusus. Kriteria umum dapat dilihat di dalam Alquran sedangkan kriteria khusus dikembalikan kepada ijtihad setempat. Pada prinsipnya, kriteria umum ada pada semua ibadah seperti shalat, puasa, zakat, haji dan lain-lain. Akan tetapi, kriteria yang terkesan agak detail dari semua jenis ibadah di atas adalah ibadah puasa. Karena, ibadah puasa berhubungan dengan persoalan moral yaitu disiplin dan kejujuran. Alquran hanya memfokuskan kewajiban puasa kepada manusia dan tidak kepada makhluk-makhluk yang lain. Oleh karena itu, kuat dugaan bahwa kewajiban puasa ini berk a i t a n d e n g a n t u g a s b e ra t yang diemban oleh manusia yaitu khalifah (pemimpin) dan karenanya secara otomatis diperlukan berbagai kriteria. Berdasarkan kajian al-munasabah (korelasi antar ayat) maka ayat-ayat Alquran yang membicarakan tentang kewajiban puasa dimulai dari Q.S. al-Baqarah ayat 183 sampai ayat 188. Ayat-ayat ini membicarakan tentang puasa dari berbagai aspek mulai dari aspek hukum, tehnis sampai kepada tujuan melaksanakan puasa. Ayat-ayat ini ditutup dengan kalimat yang berbeda seperti taqwa, pengetahuan, syukur dan cerdas. Kata “taqwa” dalam kumpulan ayat ini diulangi sebanyak dua kali yaitu pada ayat 183 dan ayat 187. Demikian juga dengan kata “pengetahuan” diulangi sebanyak dua kali yaitu pada ayat 184 dan ayat 188. Pengulangan ini menunjukkan adanya stressing (penekanan) bahwa kedua kata ter-

sebut menunjukkan tingkat prioritas. Dengan kata lain, taqwa dan pengetahuan adalah dua hal yang tidak terpisahkan dalam ibadah puasa karena “taqwa” membawa kepada sifat syukur sedangkan “pengetahuan” membawa kepada sifat cerdas. Urgensi taqwa dijadikan sebagai kriteria karena sifat ini menunjukkan identitas kesucian diri. Hal ini dapat dilihat dari defenisi taqwa yang dikemukakan oleh al-Syawkani dalam tafsirnya Fath al-Qadir yaitu orang-orang yang menjaga diri karena takut akan azab Tuhan

yang bukan haknya. Bahkan yang haknya sekalipun tidak akan diambilnya jika ada pihak lain yang lebih ber hak untuk mendapatkannya. Pada ayat berikutnya (Q.S. al-Baqarah ayat 184) terdapat penggalan kalimat sebagai penutup akhir ayat yaitu in kuntum ta’lamun. Kalimat ini dapat dijadikan sebagai kriteria bahwa pemimpin yang seharusnya dipilih adalah sosok yang benar-benar memiliki ilmu pengetahuan (intelektual). Meskipun kalimat ini bersifat khabariyah (berita) na-mun

Pemimpin yang taqwa tidak akan mau melakukan perbuatan-perbuatan yang dapat menurunkan harga dirinya di hadapan umat. dan senantiasa berharap akan rahmat-Nya. Pemimpin yang taqwa tidak akan mau melakukan perbuatan-perbuatan yang dapat menurunkan harga dirinya di hadapan umat. Karena, pemimpin adalah panutan sehingga pengaruhnya kepada umat sangat besar. Dengan kata lain, pemimpin jangan berharap banyak agar umatnya bertaqwa jika sifat tersebut belum ada pada dirinya. Alquran mengajarkan sepenggal doa dalam Q.S. al-Furqan ayat 74 yang artinya “jadikanlah kami imam bagi orangorang yang bertakwa”. Maksudnya, jika seorang pemimpin berkeinginan untuk mentaqwakan umatnya maka pemimpin dimaksud harus mentaqwakan dirinya terlebih dahulu. Salah satu indikator ketaqwaan dapat dilihat dari makna taqwa itu sendiri yaitu “menjaga diri”. Jika seorang pemimpin sudah bertaqwa maka dia tidak akan mau mengambil sesuatu

jika ditelusuri maka maknanya adalah insya’iyah (hukum). Maksudnya, Alquran memerintahkan manusia untuk mencari ilmu pengetahuan tentang puasa atau puasa dapat dijadikan sebagai sarana untuk mencari ilmu pengetahuan. Urgensi memilih pemimpin yang berkriteria intelektual sudah dicontohkan oleh Tuhan ketika mengangkat Nabi Adam menjadi khalifah. Satu-satunya alasan yang dikemukakan oleh Tuhan kepada malaikat adalah bahwa Adam memiliki seperangkat ilmu pengetahuan yang tidak dimiliki oleh para malaikat. Kemudian terdapat pula kriteria lain bagi sosok seorang pemimpin yaitu pandai bersyukur. Kriteria ini dapat dipahami dari penutup akhir ayat (Q.S. alBaqarah ayat 185) yaitu la’allakum tasykurun (agar kamu bersyukur). Syukur dalam konteks ini yaitu mensyukuri apa yang sudah didapat atau mengelola nikmat yang baku menjadi lebih bernilai lagi.

Pemimpin yang bersyukur memiliki sifat tenggang rasa yang tinggi dan selalu merasa cukup dengan nikmat yang sudah diterimanya. Pemimpin yang seperti ini senantiasa mengedepankan kepentingan orang banyak dari pada kepentingan pribadi, keluarga dan golongan. Jika “syukur” diartikan dengan “pengelolaan” maka yang dimaksud dengannya adalah pemimpin yang mampu mengangkat perekonomian umat untuk menuju kemakmuran. Dalam hal ini diperlukan sifat kehati-hatian agar nikmat yang sudah ada tidak menjadi malapetakan bagi kehidupan umat. Kriteria lain bagi sosok pemimpin yang dapat dipahami dari ayat-ayat puasa (Q.S. alBaqarah ayat 186) yaitu kalimat la’allahum yarsyudun (supaya mereka menjadi cerdas). Cerdas dalam pengertian kemampuan membaca tanda-tanda zaman sehingga setiap kebijakannya sesuai dengan kebutuhan masyarakat pada saat itu. Sosok pemimpin yang memiliki kriteria “cerdas” ini sangat dibutuhkan supaya setiap keputusan yang diambilnya selalu akurat meskipun dalam suasana yang sangat genting. Selain itu, pemimpin yang cerdas tidak akan pernah kehilangan akal untuk mengatasi berbagai kemelut. Oleh karena itu, pemimpin yang cerdas akan memiliki wawasan yang bersifat futuristik sehingga setiap kebijakannya tidak ada yang tambal sulam. Meskipun kebijakan tersebut dicetuskan pada kurun waktu yang sudah lama namun nilainilai keaktualannya tetap saja dapat dirasakan oleh beberapa generasi ke depan. Beberapa penggalan kalimat yang dijadikan penutup akhir ayat seperti bertaqwa, berilmu, syukur dan cerdas menunjukkan bahwa puasa sangat efektif membentuk kriteria pada sosok pemimpin. Terlebih lagi bahwa ibadah puasa ini sudah dilakukan mulai dari Nabi Adam sampai kepada nabinabi berikutnya.

Waspada, Jumat 20 Juli 2012  

waspada daily