Issuu on Google+

TRACK TALK | Plans proposed for North Okanagan equestrian centre study [A5]

www.

Morning gStar

The

Friday, March 19, 2010

P R O U D L Y

S E R V I N G

O U R

N O R T H

VERNON

w w w. v e r n o n m o r n i n g s t a r. c o m

O K A N A G A N

C O M M U N I T I E S

F O R

O V E R

2 0

.com

Y E A R S

DLR #6371

Frustration erupts over water rates

SPRING SWING

RICHARD ROLKE

Morning Star Staff

BRENT MUTIS Morning Star Staff

The downhill sit-skiing event is one of Josh Dueck’s best and the Vernon resident was looking forward on Thursday to adding to his silver medal in the slalom. But given course conditions at Whistler-Creekside, Dueck told his wife Lacey he was going to be pumped just to finish the Vancouver Paralympic event. Mission accomplished. Dueck, 29, turned in a gutsy performance and was in fifth place at press time, positioned well for a top-10 result. “I talked to him this morning and he said he was going to be so excited just to finish the course,” Lacey Dueck told The Morning Star via cellphone from the

mountain’s noisy finish-line area. Josh was not available for comment after his run. Prior to her husband’s performance, Lacey had seen more than 10 other athletes crash, some having to be towed away by snowmobile. One skier had to be lifted off the mountain by helicopter. “(The run) is in super tough shape,” said Lacey. “Tons of crashes. It’s been gnarly.” Clear skies led to frozen slopes overnight and slush in the daytime. Given what she’d witnessed before Josh’s turn, Lacey was an even bigger bundle of nerves than during Sunday’s slalom. “There’s been a tense energy watching everyone crash. I knew he’d get down safe but the nerves were building.”

Drive Home The Car of the Year

2010 Kia Forte STANDARD FEATURES INCLUDE… • • • • • •

4 wheel disc brakes with ABS 5 year/100,000 km bumper to bumper warranty Full cabin 6 airbag system Power windows & power locks Air conditioning Integrated bluetooth technology

Friends and family at Lacey’s side helped her deal with the emotions. “I’m learning how to breathe pretty well,” she laughed. “I have a ton of support here from friends and family.” Lacey said Josh would be pleased with the result, even if it didn’t put him on the podium. “He met his goal for today and he’ll be excited,” she said. “It’d be nice to get a medal but he didn’t crash and he’ll be happy.” Josh is competing in the super-G event today at 1 p.m. and will race the super combined slalom Sunday at 2 p.m. “He’s going to be ready to charge for (Friday),” said Lacey. “I think he’s going to be stoked.”

$

254

$2000 CASH ORDOWN TRADE

+ TAXES

PER LEASE MONTH FOR ONLY ONLY $11 MORE GETS YOU A SUNROOF & HEATED SEATS!

THE NEW VERNON KIA! Sales Hotline (250) 545-7281

48 MONTH LEASE, 2.9%, TOTAL PAID $14,192, RESIDUAL $6867.

Dueck braves brutal course, takes top-10

D#30973

LISA VANDERVELDE/MORNING STAR

Crystal Peitsch swings with her daughter Nevaeh, four, as they enjoy the spring-like weather while at Vernon’s Polson Park.

Politicians are being accused of reneging on a promise by increasing water rates for farmers. The North Okanagan Regional District board adopted its 2010 budget Thursday, including an across-the-board nine per cent rate hike for Greater Vernon water customers, including agricultural users. “Agriculture got screwed,” said Ted Osborn, the industry’s representative on water issues, after observing the vote from the public gallery. While upset with the actions of Vernon officials, much of Osborn’s frustration is directed towards politicians from largely farming communities. “Areas B, C and Coldstream went Ted Osborn along with it. It leaves a very bad taste,” he said. Osborn insists the rate hike goes against previous promises made to agricultural customers. “They disregarded the principles of the master water plan that agriculture wouldn’t pay for water quality improvements,” he said, adding that the focus of the rate hike will benefit residential users while farmers only require water pressure and supply. The primary reason for the higher levy is to pay for the new Duteau Creek treatment plant debt and operation of the facility. The average flat rate for an agricultural customer is $212 per hectare a year. The nine per cent increase will raise that by $19 per hectare annually. “We’re in a competitive market and must ensure our costs are in line,” said Osborn. “This arbitrary decision is unwarranted.” Wayne Lippert, Vernon director, stands by the nine per cent rate increase for all customers. “In 2006, the budget was overturned because of water rates and we were set back (in generating revenue),” he said. “Rates were held down and the difference came out of reserves. Now we have to pay that back and catch up.” Lippert also insists the needs of agricultural users are a priority, with irrigation water eventually being separated from domestic water. “Twinning is going on and we’re trying to achieve a good agricultural rate so they can be competitive,” he said. Mike Macnabb, BX-Silver Star director, defends his support for the new fee structure. “That increase is necessary. It’s equitable in that everyone gets hit the same amount,” he said.


A2 Friday, March 19, 2010 - The Morning Star

www.vernonmorningstar.com

on

and

TRUCKS VANS

4 DAYS ONLY NEW

NEW

2010 DODGE RAM 1500 $39,045 NOW ONLY

28,973

$

$

149

2010 DODGE 3500

2010 DODGE GRAND CARAVAN

0

IS % FINANCING BACK

B/W

$

REAR

STK #40078

149

B/W

TRUCKS & VANS ARE LESS EXPENSIVE AND INTEREST RATES ARE AT HISTORIC LOWS

YOU CAN REPLACE YOUR VEHICLE WITH A BETTER ONE FOR LESS THAN YOU ARE PAYING TODAY!

SPECIAL SALE PRICING FOR 4 DAYS ONLY 2007 GRAND CARAVAN SE

$16,777 P3931

108

2009 GRAND CARAVAN

$22,777

$

B/W

2006 DODGE RAM 1500 MEGA CAB SLT 4X4

$24,777 A849

199

P3814

179

P3942

B/W

B/W

2009 GRAND CARAVAN

$22,777

$

2008 JEEP GRAND CHEROKEE LAREDO 4X4

$24,777

139

$

139

$

P3941

B/W

2004 FORD FREESTAR

5,999

$

$

B/W

9242A

2007 RAM 1500 LARAMIE 4X4

2008 DODGE DURANGO SLT 4X4

2008 RAM 1500 SLT 4X4

$32,777

$27,777

$29,777

244

$

P3913

B/W

199

$

P3815

B/W

2007 RAM 3500 SLT 4X4 5.9L DIESEL

2007 RAM 1500 LARAMIE 4X4

$33,777

$32,777

A850

249

$

B/W

P3928

244

219

B/W

B/W

$25,777

$

P3786

10124A

2006 FORD F350 XLT C/CAB DIESEL

2008 GRAND CARAVAN

116

16,777

$

$

10009A

$17,777

$

2002 DODGE RAM SLT 4X4

B/W

214

$

P3779

B/W

2008 RAM 3500 Q/C 4X4 SLT

2008 FORD EXPLORER XLT 4X4

2008 RAM 3500 Q/C 4X4 SLT

2007 JEEP GRAND CHEROKEE LTD

$39,777

$24,777

$39,777

$29,777

P3834

299

$

B/W

179

$

P3821

B/W

P3929

299

$

B/W

209

$

10158A

B/W

(1) BI WEEKLY PAYMENT REQUIRES $3999 DOWN PAYMENT @ 2.25% INTEREST RATE FOR 84 MONTHS + $1400 FREIGHT + $500 BONUS CASH + $1000 N/C OPTIONS. (2) BI WEEKLY PAYMENT REQUIRES $2999 DOWN PAYMENT @ 4.99% INTEREST RATE FOR 84 MONTHS + $1400 FREIGHT + TAXES. ALL PAYMENTS B/W, 5.99% WITH $2999 DOWN. 2008-2009 84 MONTH, 2007 72 MONTH, 2005 - 2006 60 MONTH, ON APPROVED CREDIT. ALL USED VEHICLE PAYMENT $4,999 DOWN @ 5.99% OAC. 2009 - 84 MONTHS, 2008 - 2007 72 MONTHS, 2006 - 60 MONTHS.

k Us Chect @ Ou

• www.vernondodge.com • www.vernondodge.com • www.vernondodge.com • www.vernondodge.com • www.vernondodge.com

www.vernondodge.com • www.vernondodge.com • www.vernondodge.com • www.vernondodge.com • www.vernondodge.com •

www.vernondodge.com • www.vernondodge.com • www.vernondodge.com • www.vernondodge.com

www.vernondodge.com 6iÀ˜œ˜½Ã

(ECP

Ê6 Ê-/,Ê i>iÀ

VERNON

We look forward to earning your business...

JEEP ON 27

TH

STREET

BRIAN WESTWELL

DANA AGAR

General Sales Manager

Sales Manager

BILL AKERMAN

TIM HOOPER

KENT HOUGH

SCOTT MORRICE

DOUG ROBINSON

Sales & Leasing

Sales & Leasing

Sales & Leasing

Sales & Leasing

250-545-2261 OR 1-888-545-2261

DLR #5204


www.vernonmorningstar.com

Friday, March 19, 2010 - The Morning Star A3

News Enthusiastic crowds greet Red Wings KEVIN PARNELL Black Press

Some Detroit Red Wings players snowmobiled, others went on wine tours or soaked up the Okanagan sun this week. Every player practised in front of large crowds Wednesday and Thursday at Prospera Place in Kelowna, as they were being put through the paces preparing for a game tonight in Edmonton. “It’s incredible,� said Ken Holland, Wings general manager and Vernon resident, after the first practice. “Six thousand people come watch a 45-minute practice. I think it really goes to show the passion of Canadians to the sport of hockey. I thought it was awesome. When we set this up we hoped to get a cou-

KEVIN PARNELL/BLACK PRESS

Ken Holland, Red Wings general manager and Vernon resident, takes a break from overseeing his team to speak to the media.

ee Come in to s g n our new Spri patio lines!

ple thousand so to come out here today and see that many people is incredible.� When Holland saw the break in his team’s NHL schedule between games in Calgary and Edmonton he approached the Kelowna Rockets and Prospera Place about ice availability. The Rockets and Prospera Place partnered with the Wings to help make the visit come together. Fans clamoured for autographs following the ice sessions while the media was given open access to Detroit dressing rooms, speaking with players and coaches. Goalie Chris Osgood is one of several NHL players with homes in Vernon and he hosted some players at his place for a night. He said it was a great atmosphere that featured more Detroit fans than he expected. “It’s fun for us to practise in front of people like that,� he said. “It’s great to see the kids excited. They have player cards of guys you weren’t expecting. You expected Canucks everywhere but I think it’s good for them to meet us. We’re normal guys. We’re not bad guys. We just play for a team that some people don’t like.� That’s likely no longer the case in Kelowna where the Wings no doubt acquired thousands of new fans. A win-win for everyone involved, to be sure. Unless that is, the Wings can’t beat Edmonton tonight. “Obviously if we don’t win it’s not a good idea,� said Holland. “But I believe over eight months you have to do some different things. This was a once in a lifetime opportunity for people in Kelowna.� And no hockey fan here will ever say it was a bad idea.

Introducing the all new 'Perspective' line at an introductory price!

Queen Bed only: $489.95 (Reg. $999.99)

SEAN CONNOR/BLACK PRESS

Blair Keillor (above) and daughter Kyla, wearing green to celebrate St. Patrick’s Day, take in Detroit Red Wings action at Prospera Place Wednesday. Left, goalie Chris Osgood blocks a shot from forward Dan Cleary during a two-day practice in the Okanagan. Osgood owns a home in Vernon.

3WITCHBOARD 

INDEX Activity Page..................B36 Calendar.......................B12 ClassiďŹ ed.....................B24 Comics.........................B23 Editorial..........................A8 Letters............................A9 Lifestyles........................B9 Sports..........................A23 6OLs.Oˆ0AGES

5309 26th St., Vernon

250-542-3399

Monday - Saturday 9:00 am - 5:30 pm

www.bhleisure.com


A4 Friday, March 19, 2010 - The Morning Star

www.vernonmorningstar.com

2009 FORD ESCAPES LIMITED SERIES

0 1 to choose from

Stk# 9Q125

2005 Ford Mustang GT Coupe

2009 Ford Focus SES Leather, moonroof, SYNC & more, only 15,000 kms

Local 1 owner car, only 32,000 kms, loaded

Moonroof, P/W, P/L, A/C, only 24,000 kms

Stk# 0P506

Stk# 0TA10A

2009 Ford Flex Limited

2009 Lincoln MKX AWD

Glass roof, leather, loaded, 12,500 kms

Top of the line luxury, only 14,000 kms

Stk# 9Q089C

2007 Ford F150 Supercab 4X4 XLT

Stk# 0Q504

Special of the Week!

A/C, tilt, cruise, canopy

Stk# 0P507

P/W, P/L, A/C, CD, moonroof, 71,000 kms

Stk# 0Q512

2008 Ford F250 Supercab XL

2010 Ford F usion SE

Stk# 0Q022

2009 Pontiac Montana 7 passenger, fully loaded, 18,000 kms

2003 Dodge Caravan

Stk# 0Q002A

Stk# 0SC29A

Sales & Lease

Sales & Lease

Sales & Lease

Sales & Lease

SALES • LEASING • PARTS • SERVICE visit our website: www.watkinmotors.com

Sales & Lease

Sales & Lease

DLR. #6076

LEN FRASER

KAM RANDHAWA

CHUCK NELSON

LUKE HORNHARDT

NATHAN MACKINTOSH

MARK ROBERTS

AUDIAS VALVERDE

DAN KATZ

SEE ALL OF OUR INVENTORY @ WatkinMotors.com Sales & Lease

CANADA’S OLDEST ESTABLISHED FORD DEALERSHIP – SINCE 1915 Fleet/Marjak Lease

4602 - 27TH ST., VERNON 545-0611 • Toll Free: 1-800-736-1944


www.vernonmorningstar.com

Friday, March 19, 2010 - The Morning Star A5

News

Kin dispute tied to equestrian centre plans RICHARD ROLKE

society. NORD has told the Taxpayer support for society it can no longer a new equestrian facility use Kin Race Track as of is being sought to end Oct. 31 and all equipan ongoing ment must be legal dispute. gone by Dec. T h e 31. Okanagan While the Equestrian regional disSociety asked trict is prothe North ceeding with Okanagan plans for Regional sports fields District at the site, the Bannerman Wednesday to society has fund a study legally chalinto the feasibility of lenged the eviction developing a new cen- notice. It states that tre for racing and other when the land was sold horse-related activities. to NORD, there was “As government, an agreement it would what do you have to continue to be used for know to solve elements equestrian events. of the Kin Race track However, the sociproblem,” said Gary ety is now pushing the Bannerman, a consul- regional district to suptant working for the port relocation of the Morning Star Staff

track. “We’re looking for ways to potentially resolve this dispute,” said Ed Woolley, society president. Through his own research, Bannerman believes there is a need for a facility that would include racing, gaming, training, boarding and a veterinary hospital. “The industry is looking for a home,” he said. NORD is being asked to provide about $7,000 for a preliminary study. The study would consider the costs involved in constructing such a facility, what senior government funds may be available, what services the regional district could provide and potential

sites. “Spallumcheen would appear to be a wonderful location but it could be in any area,” said Bannerman, adding that an equestrian facility would create jobs and draw people to the region. Bannerman won’t speculate on what the study’s final outcome would be. “It could tell us it’s so undoable we don’t want to move to the next step. But I believe somewhere in the province it is doable,” he said. A decision on funding a study hasn’t been made yet, but director Wayne Lippert is interested. “It’s nice to see the equestrian society talking to us instead

Grow-op busted in Fintry area RICHARD ROLKE Morning Star Staff

RCMP have shut down a marijuana grow operation on the west side of Okanagan Lake. On Wednesday at 4 p.m., officers discovered 1,725 plants inside a home on Dunwaters Road at Fintry. “We were acting on information provided by the owner of the property,” said Gord Molendyk, spokesman for the Vernon detachment. “It’s a fairly large operation, especially for a residence.” One person — believed to be the tenant of the propetty — was taken into custody at the scene. A 24-year-old man was expected to appear

Turning old furniture into

Heirlooms Restore it to its original beauty! Call…

deBoersap

Furniture Refinishing

250-545-3813 Serving the Okanagan since 1990

“It’s a fairly large operation.” — Gord Molendyk in court late Thursday on charges of posses-

sion, cultivation and theft of electricity.

This is just the most recent drug bust. In the last week, growops have been targeted in Vernon, Coldstream and Westwold. “They can be any where,” said Molendyk.

of going through the courts,” he said. “We’ve been looking for possible solutions.” Director Mike

Gavinchuk is willing to consider using some tax dollars to develop an equestrian centre in the region.

“It can be a focal point for the area. They would have to show a profit and be a viable operation,” he said.

Kalamalka Rotary Thanks you! Our March 11th benefit screening of Casablanca in the Performing Arts Theatre raised $6,400! This will enable 6 more Shelter Boxes to be deployed to Haiti. Adding these to previous efforts by Kalamalka Rotarians we’ve been able to help send 23 ShelterBox kits to Haiti at $1,000 each; enough to house 230 individuals before the deluge of the rainy season! Some of these funds were also matched by the Canadian Government meaning $13,000 over and above the $23,000 has also been sent to offer aid and shelter.

Our deep thanks to: - All those who generously donated at the movie & through the ShelterBox web site! - Our fabulous local media, SUN FM, KISS FM and the Vernon Morning Star - Shawn Greek (Salmon Arm) brought and ran the projector - Interact Students from Seaton (an offshoot of Rotary for youth) who contributed $1,400 from a penny drive which was topped up to $3,000 by Kal Rotary for 3 more kits - John Kehler of Home Hardware on 27th St. (store profits of $5,000 went to purchase 5 kits!) - Many individual Kalamalka Rotary members who generously donated money and time - Global Education students from Fulton who helped distribute posters and collect funds on movie night We’ve already been questioned about when the next Kalamalka Rotary film benefit will happen! Stay tuned…. For those who want to know more about ShelterBox and may wish to contribute: www.shelterbox.ca or speak to any Kal Rotarian.

Vernon

WOMEN in Business

The Corporation of the

City of Vernon WATERFRONT NEIGHBOURHOOD CENTRE PLAN OPEN HOUSES Wednesday, March 24, 2010 • 5:00 to 8:00 pm Presentation at 6:00 pm Schubert Centre, 3505 - 30th Avenue Saturday, March 27, 2010 • 3:00 to 7:00 pm Presentation at 5:00 pm Paddlewheel Hall, 7801 Okanagan Landing Road For more information or if you have any comments, questions or concerns please forward them to dsbreception@vernon.ca or call 250-550-3634.

CITY CENTRE NEIGHBOURHOOD PLAN Walkable Communities Public Presentation Thursday, March 25 • 7:00 pm Schubert Centre, 3505 - 30th Avenue, Vernon As part of the City Centre Neighbourhood Plan process we are fortunate to be able to work with Dan Burden, who is an internationally recognized authority on bicycle and pedestrian facilities and programs. Mr. Burden is co-founder and executive director of the non-profit Walkable and Livable Communities Institute and will give a presentation to the public on livable and sustainable communities, healthy streets, traffic calming, and bicycle and pedestrian programs. For more information on Dan Burden and the Walkable and Livable Communities Institute, please visit www.walklive.org or www.walkable.org. For more information on the City Centre Neighbourhood Plan, visit www.vernon.ca/citycentre or if you have any questions please contact Chris Ulmer, Long Range Planner at culmer@vernon.ca or 250-550-7830.

rd

23 Annual WOMAN OF THE YEAR …Celebrating Outstanding Women

Nominate a Woman of the Year! Nomination Deadline: March 31, 2010 @ 5:00 pm SELECTION CRITERIA FOR WOMAN OF THE YEAR: • She consistently displays and exercises leadership • She demonstrates vision, initiative, creativity and courage • She enriches and improves quality of life for others • She has an impact in her chosen field • She displays and sustains a continued commitment to her community • She promotes and supports opportunities for females. • She has made Greater Vernon a better place to live.

Nomination Info: www.vwib.com - go to Events, then “Woman of the Year” or call Menza Bouwman, Event Chairperson at 250-549-2900

Woman of the Year Gala Thursday, May 20, 2010 5:30 pm at Best Western Vernon Lodge Platinum Sponsors…

imagine. create. impress.


A6 Friday, March 19, 2010 - The Morning Star

www.vernonmorningstar.com

News

Board wants creek action RICHARD ROLKE Morning Star Staff

Regional politicians are joining the fight to clean up one of the region’s dirtiest water bodies. The North Okanagan Regional District board is fully endorsing the District of Coldstream’s grant application to the Okanagan Basin Water Board to improve water quality along part of Coldstream Creek. “This is a little extra weight they are looking for,” said director Will Hansma of backing Coldstream’s bid. The municipality is seeking $17,000 from OBWB and another $10,000 from the Environmental Farm Plan for the creek enhancements. “It’s the most polluted waterway in the region,” said Gyula Kiss, a Coldstream director at NORD. The municipality is concerned the creek, and ultimately Kalamalka Lake, is being contaminated by activities from residential, agricultural and industrial uses. “Nutrients from fertilizers applied on agricultural lands could contribute to aquatic plant growth (milfoil) and algae blooms, sediment can increase turbidity and aggradations of the shoreline and contaminants (fecal coliforms) can cause increased risk to human health for recreational users and lead to increased costs for water treat-

Canada’s #1 Built In Vacuum Built-In Vac System • 30’ Hose and Tools

“It’s the most polluted waterway.”

NOW ONLY

$399

— Gyula Kiss ment (chlorination) as there are two drinking water intakes in Kalamalka Lake,” said Michael Stamhuis, Coldstream’s chief administrative officer, in a letter to OBWB. The project the municipality wants to proceed with involves the creek immediately upstream of School Road in Lavington. That area is subject to erosion, livestock and drainage problems. “In addition, test results on either side of these segments indicate water quality degradation impacts,” said Stamhuis. Kiss is hopeful that the OBWB grant will be approved and improvements to the creek will proceed. “Coldstream Creek is in dire need of improvements. We will look at ways of mitigating the various pollution sources,” he said.

Save $200 INQUIRE ABOUT HOME INSTALLATION

Findlays Fi dl V Vacuum & Sewing ASK FOR TERRY … 250-542-BEAM (542-2326) #500, 3101 - 48TH AVENUE • ANDRE’S PLAZA

OUR GREATEST TVGIFTOFFER YOU

NEED TO SPEND $599!

NO EXCEPTIONS!

This OFFER INCLUDES room packages, sale items, clearance items and discontinued products.

EVERYTHING IS INCLUDED!

ONLY ONE BONUS TV PER HOUSEHOLD.

Contract awarded for reservoir RICHARD ROLKE Morning Star Staff

A major improvement to Greater Vernon’s water system is moving ahead. The North Okanagan Regional District has awarded a $375,276 contract to Kelowna-based R355 Enterprises to prepare the site for a reservoir on Middleton Mountain. “It’s been vetted and it’s the low tender,” said director Patrick Nicol of the successful tender. The decision to proceed with the reservoir has been precipitated by residential growth on the mountain. Director Gyula Kiss believes residents will welcome the project. “We have difficulties with fire flows there and this will provide a better service,” he said. Middleton Mountain is generally serviced by water from Duteau Creek although Kalamalka Lake water may also be used during the spring, fall and winter. “The service area has been adjusted so the reservoir will service parts of Vernon and parts of Area C,” said Al Cotsworth, water utility manager. As part of its contract, R355 Enterprises will do major earth work such as removing the topsoil and subsoil, blasting and removing rock, constructing roads, water supply and storm water piping, constructing a reservoir pad and seeding the site with grass. “A second tender will be issued later this summer for the remainder of the project, including the

ANY COMBINATION

“It’s been vetted and it’s the low tender.”

of furniture and mattresses totaling $599 or more gets you a

BONUS 19" LCD TV

+

totaling $1299 or more gets you a

BONUS 32" LCD TV

— Patrick Nicol concrete reservoir, site piping, valving, landscaping and upgrades to the existing pump station,” said Cotsworth. The total budget for the reservoir project is $1.9 million.

+

totaling $1999 or more gets you a

BONUS 42" LCD TV

+

Plus Do Not Pay For 15 Months *

You Asked Us

What are the admission criteria for Hospice House? Each referral for admission is considered on an individual basis using the following guidelines: • Clients have a palliative diagnosis with an anticipated prognosis of less than six months. • Signed BC Palliative Care Benefits application which ensures most medications are paid for.

For The Brick store nearest you, visit thebrick.com or call 1-800-97-BRICK *DO NOT PAY FOR 15 MONTHS - O.A.C. All credit offers available upon approval of credit only on your Brick Card Platinum, minimum purchase of $250. Any Brick delivery charges, GST (5%), provincial sales taxes (if applicable), and administration fee ($99.95) are required to be paid at time of purchase. Interest may accrue for the final 25 days prior to the promotion's payment due date at an annual rate of 29.9%, but will be waived if the payment of the balance is made in full by the due date. Balance due June 2011, or at such time, you may elect to make minimum monthly payments of 3.5% of your outstanding balance.A conversion fee of $42.50 (not applicable in Quebec) and a service interest charge (29.9%) applies when you decide to make minimum monthly payments. See in store or refer to your Brick Card Account Holder Agreement for full details. ‡Product may vary by location and may not be exactly as illustrated. We reserve the right to limit quantities by store and per purchase. To receive bonus offer or discount, complete package must be purchased and kept. +This offer cannot be combined with any other discount or free gift purchase, sale, or other promotion, unless otherwise specified. Δ Excludes discounted, clearance, promoted offers and advertised specials. See in store for complete details. Valid March 19-25, 2010, unless otherwise indicated.

• Hospice client or their designate signs a No CPR form. • Clients may be admitted for up to 3 months. • Respite care admission of 1-2 weeks is also available for pain and symptom management or caregiver respite.

Eating disorders are the deadliest of all mental illnesses. Learn more at lookingglassbc.com

250-503-1800 • www.nohs.ca

North Okanagan WEATHER FORECAST

Today Sunny High 9° Low-3°

Saturday Mainly sunny High 11° Low 1°

Sunday Cloudy with sunny breaks High 11° Low 1°

Monday Variable cloudiness High 1a° Low 1°

www.weatheroffice.ec.gc.ca


www.vernonmorningstar.com

Friday, March 19, 2010 - The Morning Star A7

News

Cadets prepare for avalanches CAPT. AMELIE LEDUC Special To The Morning Star

Ten senior army cadets from across B.C. are currently spending six days of their spring break in Vernon as they undertake a combination of avalanche certification and winter leadership training. After two days of classroom instruction and practical work at Kal Beach, the cadets, under the supervision of Lieutenant Carolyn Baker and Second Lieutenant Brendan Lewis will travel to Big White where they will set up a winter camp. The cadets will spend the first night in tents, and depending on conditions on the mountain, the second night in snow caves. The avalanche skills training is provided by Russ Turner of Skaha Rock Adventures and Lyle Thiede, the Assistant Patrol Director of Apex Mountain Resort. “The cadets will receive the basic knowledge in a classroom setting,” says Turner, who has 30 years of experience teaching summer and winter programs. “We’ll give them the tools and open their eyes so they can make informed decisions.” Cadets are also directed to the Canadian Avalanche Centre (CAC) web site where they can search for more detailed information and understand the jargon associated with avalanche hazards. On Monday, the cadets practiced finding buried transceivers at Kal Beach. Turner says that using the sandy beach as a substitute for snow allows the cadets to learn to locate buried transceivers without the problems associated with learning on the mountain. “It’s easier for the cadets when they’re not concerned with the cold and winter conditions on the mountain and it’s more cost effective to do the basic training here in Vernon.” For cadet warrant

officer Chris Brovold of Surrey, the first two days of the course has raised his awareness of avalanche dangers. “I never knew how frequent avalanches are,” he said, adding that the knowledge gained in Vernon will come in handy when his cadet corps carries on winter field training exercises in Manning Park. Although he’s not looking forward to the cold on Big White. “I’ll be able to share this knowledge with the other cadets,” he says. For cadet master warrant officer Ryan Deveau of Victoria, the course will help him to avoid problems in the back country when he moves to Yellowknife in the future. “I hadn’t applied for the course, but last Friday when I completed the pre-parachute course, I was told there had been a cancellation, so here I am.” Deveau has trained in Vernon in the summer, but this is his first winter leadership training course. At the conclusion of the 22-hour course, the cadets will earn an avalanche skills training, level one certificate. “This course is a prerequisite to taking the Canadian Avalanche Association (CAA) 10-day Professional Level One course,” says Turner. The skills learned will include recognizing avalanche terrain, route finding, weather observations, snow-pack study, elementary snow

4th Annual

MIND

2

MUSCLE

Spring Showcase Figure

Treatment

Purchase $50 of Jane Iredale Mineral Make-Up & receive a

FREE Soft Peach Lip Gloss

While Quanities Last (A Value of $32.00)

Fitness

Body

Building

Friday, April 2, 2010 Vernon Recreation Centre Doors open: 7:00 pm • Show time: 7:30 pm Tickets $15 in advance • $20 at the door

ADVANCE TICKETS available at Ladies World - 4406 - 27th Street, Vernon Thank you for helping us support: The Learning Disabilities Assoc. - Vernon Chapter

• ICBC & Private Glass Claims • ITAC Certified Technicians • Quick Service • Convenient Location • Interior Vacuum

WAYNE EMDE PHOTO

Instructor Lyle Thield explains the process of finding a buried transceiver to army cadets. assessment skills and self rescue procedures. The three-day winter leadership course will complement the skills that the cadets learned on the avalanche skills course, combined with leadership skills, winter camping techniques and safe winter travel

Voted Best Day Spa 2009!

FREE Skin Bar

Just For You Spa & Salon

Book a Customized or Signature Facial & receive a

skills. Topics will include equipment choices, clothing, packing, food and menu planning,

leadership and practical applications, map and compass navigation, route plans and snowshoeing.

FREE

Courtesy pick up & delivery to your home or office

Glass EXPRESS Family Owned & Operated Since 1963

4709-29th St. (by Village Green Mall)

250-542-7727 morgansglass@shaw.ca

Let Deb help you...

There is Special Government Legislation that allows you to reduce your DEBT by up to 100%

Reach Your Goals!

We’ll Find The Best Loan To Suit Your Needs • Refinances • Home Equity Loans • Mortgage Renewals & Transfers • Commercial Loans

FREE Eye Treatment

White House Mortgages 250-545-2202

(value $35)

20% Off a full set of Gel Nails & ALL WAXING including Brazilians

Enter to win draws online at www.justforyouspaandsalon.ca #301-2520 53rd Ave Vernon • 250-549-2488

#1-3009-43rd Avenue Vernon

www.debwhite.ca Deb White, AMP


A8 Friday, March 19, 2010 - The Morning Star

www.vernonmorningstar.com

Opinion NORD should consider option

Karen Hill – Publisher Glenn Mitchell – Managing Editor

4407 - 25th Ave. Vernon, B.C. V1T 1P5

The North Okanagan’s Community Newspaper Published Sunday, Wednesday, Friday The Morning Star, founded in 1988 as an independent community newspaper, is published each Sunday, Wednesday and Friday morning. Submissions are welcome but we cannot accept responsibility for unsolicited material including manuscripts and pictures which should be accompanied by a stamped, selfaddressed envelope. ENTIRE CONTENTS © 1988 MORNING STAR PUBLICATIONS LTD. ALL RIGHTS RESERVED

Switchboard: 545-3322 E-Mail: newsroom@vernonmorningstar.com Web site: www.vernonmorningstar.com Mailing Address: 4407-25th Ave., Vernon, B.C., V1T 1P5 Fax: 542-1510 Publisher Karen Hill 550-7906

Managing Editor

Glenn Mitchell 550-7920

Sales Manager Alan Tomiak 550-7927

Circulation Manager Tammy Stelmachowich 550-7901 Creative Co-ordinator Tanya Pattullo Accounts Manager Brenda Burgess Classified Supervisor Carol Williment 550-7900 Editorial Staff Cara Brady Graeme Corbett Kristin Froneman Roger Knox Kevin Mitchell Katherine Mortimer Brent Mutis Richard Rolke Lisa VanderVelde

550-7907 550-7903 550-7923 550-7922 550-7902 550-7924 550-7913 550-7921 550-7909

Proud to be from Vernon

L

ots of Vernonites remember enjoying hamburgers at The Burger Baron. Or the North End Drive-In. Or Grace’s Dairy Drive-In. The world’s best cinnamon buns, Nanaimo bars and date squares could be found at The Roxy Bakery. While today, of course, we enjoy all that Silver Star Mountain Resort has to offer, for many Vernonites their fondest memories of skiing were at night at Tillicum. At least a half-dozen people have recalled Roger Knox spending their weekend nights pulling mainers up and down Main Street. And, just how many floors, exactly, did the old Bay building have downtown? Thanks to the social networking page, Facebook, I have been enjoying a stroll down memory lane. Me and 721 others. A couple of people started a page on the site called You Know You’re From Vernon When. “Write how much you love Vernon and what you love about it,” encouraged the creators of the page. “You know your proud to be from VERNON...” Turns out, so far, 722 people are proud to be from Vernon, including many who have moved away, and many who remain. Somebody will post a memory which, inevitably, will lead to others posting theirs about the same thing, or the post will tweak something in someone’s memory bank and they’ll write that down. I grew up where Okanagan Spring Brewery now is and I had completely forgotten there was a house at the entrance to Polson Park until my friend Lisa mentioned that was her

AT RANDOM

grandfather’s house. Food is a common memory, such as the best place to get hamburgers. A lot of people wish – myself included – Nick’s Kandy Kitchen was still open. People enjoyed fine dining at Hy’s Steak House, the Bib and Tucker, the Beefeater Inn, Tastee Freeze, Scotty’s Pancake House, Pardner’s, Bonanza, which became Peggy Sue’s, a 50s-styled restaurant complete with a car in the wall. Those with healthier tastes remember getting their fruit and vegetables at Valley Fruit Stand. Or The Fruit Union. There’s been talk about Hotel Corner. Several people remember vividly the Allison Hotel burning to the ground. Rec Centre and Paddlewheel Hall dances were well attended. Our Heaven Roller Rink was a happening place. People remember shooting pool at Vern Dye’s Billiards Hall. Or watching the Vernon Essos, Vernon Vikings and Vernon Lodge Tigers at the Civic Arena, before renovations. Or the first thing you saw coming down Hospital Hill was NOCA dairy. There was a talking mynah bird in a shoe store downtown. One guy got his haircuts from Ted Enns of Country Squire barbershop fame when Ted’s shop was beside Butcher Boys. People miss buying records at Freddie’s Records, or shopping at Eaton’s. I wrote on the site about being freaked out by being on the fourth floor of the old Bay building, and more than a dozen people replied that the Bay didn’t have four floors. Some wrote it had two plus a basement. Some wrote it had three floors. Some checked with their parents or relatives. I swear it had four floors. I could be wrong, but I know I’m not wrong about one thing: I’m proud to be a Vernonite. And I know I’m not alone with that feeling.

It just might be a way out of a dispute for everyone concerned. Although at first blush it may look like a feasibility study into developing a new centre for racing and other horse-related activities would come at the taxpayer’s expense, it actually may save money in the long run, so to speak. The Okanagan Equestrian Society, which is legally fighting a North Okanagan Regional District edict to vacate Kin Race Track by Dec. 31, is suggesting $7,000 towards such a study would go a long way to resolving the dispute. They’re hoping such a study would lead to a new home facility for the society, preferably in Spallumcheen, which has expressed interest. The regional district wants to develop the Kin Race Track site for much-needed sports fields. It’s difficult to predict what such a study would come up with, but obviously if financially viable such a facility anywhere in the North Okanagan would be a boon for the region. NORD directors Wayne Lippert and Mike Gavinchuk seemed open to considering the proposal as a possible better option than any route through the courts. The regional district has yet to make a final decision on funding a study but any outcome should be weighed against any potential court costs if the two sides continue to butt heads. A win-win for the North Okanagan and all involved would be a decision that eventually resulted in more sports fields for Greater Vernon and a new and improved equestrian facility somewhere in the North Okanagan.


www.vernonmorningstar.com

Friday, March 19, 2010 - The Morning Star A9

Letters

EDITOR: GLENN MITCHELL

PHONE: 550-7920

E-MAIL: letters@vernonmorningstar.com

Council ignores taxpayers

A

petition signed by a large number of Lumby taxpayers said no to tax increases. The petitions were presented to council at a recent meeting (March 1). The mayor’s response was a true slap in the face to the citizens of this community. He basically questioned those citizens that worked to have the petitions signed and vowed to phone every signatory to confirm they had indeed signed. Lumby has experienced mill closures, the glass plant moving away and the economic down turn, which has cost further jobs to the citizens of this small community. Our tax load is greater than some areas of like size and some larger communities as well. Council hasn’t done any upgrades to

POOR TASTE I noticed Kalamalka Secondary School hosted a "Kalabunga Daze" event which looked like a fun event! I'm happy the kids were having a good time. I wanted to point out that the practice of jamming marshmallows into your mouth is dangerous. There have been some deaths involving choking on marshmallows, including most recently, a 36-year-old woman and a 12-yearold girl. I like a good marshmallow, roasted over the fire as much as the next person, but putting raw marshmallows into your mouth and giggling is a recipe for disaster. How would one perform the Heimlich maneuver on a choking "Chubby Bunny"? Chances are you'll choke on some type of food in your life, hopefully you'll be able to cough, remove it and get on with life, maybe a bit embarrassed if you were in a restaurant. At one point you may have to have the Heimlich maneuver performed on you, or even perform it on yourself... I just hope it isn't to remove a marshmallow. How about changing the "Chubby Bunny" contest to a "Root Beer Chug" instead?

the industrial park to draw commercial and small industries to the area, sewer access is just not there. Spend tax dollars on these services and these businesses will come, provide jobs and increase the tax base. Small businesses in Lumby are reeling over more and more taxes and citizens are selling their homes and moving elsewhere. There is $42,241.23 excess in the budget, for what? Kudos to the two resident councillors of Lumby who supported their citizens. We shall see them on council again. The mayor and the other two councillors should be asking themselves who they truly represent. The next election is not that far off. Elinor Turrill

The biggest problem with that may be some nasty belches at the end. Carla Rayner APOLLO SPEEDWAY To the person who ran over our cat on Apollo Road. Please slow down and take more care while driving on our road. Drivers have a tendency to gun their vehicles once they have rounded the corner off of Longacre or come way too fast over the hill down Apollo. I have two other cats, two dogs, and a child. Don’t kill any more of our family! You took the life of our precious pet Thomas who I adopted from the SPCA three years ago with my then four-year-old daughter. He loved everyone, including the dogs, and not only tolerated a toddler picking him up around the shoulders but seemed to enjoy it. I will miss having my eyebrows groomed with cat spit, his kitty hugs whenever we picked him up, and being woken up in the middle of the night from his contented purring on my pillow. My heart is completely broken. This brings me to my second comment — options for our neighbourhood concerning the Hesperia lands.

VERNON

The proposed diagram included with the invitation suggests that they will extend Apollo road through the new planned community and take out the road that connects with Longacre currently. Right now, the only thing that slows people down on this end of the road is that sharp corner. I can only imagine the speedway that will be created. To city council, please do not proceed with this. How about you stop putting more greenspace downtown and put the buildings and roads where they belong? Lisa Isnardy JUST A THOUGHT Re: Incinerator for animal carcasses: If there is a need for this facility I suggest that it be appropriately located on the site of Greater Vernon’s other “agricultural” operation, Kekuli Bay’s bio-solids production facility. That way the smell of incinerated carcasses (this is a rendering plant, folks) will be indistinguishable from the outdoor processing of human excrement at this site, and no-one will be the wiser. Both wastes can be quietly trucked through heavily populated areas on our main highway.

ance dollars, what’s next? It seems what this current government is bent on is taxing us, then taxing us again and again. Hopefully we will not give the Liberal Party that privilege again. Lee Fennell

And as the residential neighbours die off from the carcinogens or move away, we will be able to take advantage of depressed values and displace those fat cats from their multi-million dollar mansions. Ah, the power of regional government. Ken Biss TAX WOES Colin Hansen, thanks for the lowest tax rate in Canada and thanks for the highest hidden agenda taxes in Canada. It is so infuriating to see the increase in hidden tax increases/ fees such as the increase in BC Hydro rates and the latest scam to take $778 million from ICBC to put in general revenue. Where’s the justice in that? ICBC should be lowering rates not being a slush fund for government. Hydro run-the-river projects etc. are not sustainable nor a good business model, again we the taxpayer are on the hook to Premier Campbell’s green ideology. July 2010 is going to the greatest tax increase this province has ever encountered, first the HST of 12 per cent, carbon tax 4.5 per cent, Hydro 11 per cent, and now the latest scam, our ICBC insur-

■ The Morning Star is a member of the British Columbia Press Council, a self-regulatory body governing the province's newspaper industry. The council considers complaints from the public about the conduct of member newspapers. Directors oversee the mediation of complaints, with input from both the newspaper and the complaint holder. If talking with the editor or publisher does not resolve your complaint about coverage or story treatment, you may contact the B.C. Press Council. Your written concern, with documentation, should be sent to B.C. Press Council, 201 Selby St., Nanaimo, B.C. V9R 2R2. For information, phone 888687-2213 or go to www.bcpresscouncil.org

Smart is Seductive 2010 Genesis Coupe 3.8 $

4608 27TH STREET, VERNON

250-275-4004 www.vernonhyundai.com DLR #6371

34,710

The Genesis Coupe 3.8 features an advanced all aluminum naturally aspirated V6 engine displacing an impressive 306 horsepower (with regular fuel) coupled with a 6 speed manual transmission and a standard limited slip rear differential. Features on the 3.8 include all of the equipment of the Genesis 2.0T premium plus mirror mounted turn signals, chrome lower fascia slats, HID headlights with autolevelling, proximity key with push button start, power driver seat, auto-dimming rear view mirror with Homelink™ and compass, and premium side trim door scuff.

$

0 Down $241

Visit Vernon Hyundai today for a Test Drive and experience the 2010 Genesis Coupe for yourself. B/W

2010 Genesis Coupe 3.8 MSRP $34,710 D&D incl, 60/84 $241.00 biweekly, balloon value $10,694.21, TP = $36,332.21. APR 3.4%


A10 Friday, March 19, 2010 - The Morning Star

www.vernonmorningstar.com

News

Rural areas ratify industrial land strategy RICHARD ROLKE Morning Star Staff

The Nor th Okanagan’s rural communities are joining an economic development strategy. The Electoral Area Advisory Committee have reversed thrusters and decided to sign the City of Vernon’s memorandum of understanding on industrial development. “Anything we can bring into the region (to create jobs) will benefit everyone,” said Mike Macnabb, BX-Silver Star director. The committee had originally opted not to support the memorandum because of some concerns, but that situation has since evolved. “We put forward a friendly amendment and it shouldn’t be a problem for Vernon to accept,” said Macnabb. The committee wants to ensure the North Okanagan Regional District zoning process remains in place in rural areas and that it’s not assumed agricultural land will be developed for industrial uses. Macnabb has been concerned the push for industrial development could lead to farm land being absorbed and properties in his area being annexed into Vernon. “It keeps the authority within the jurisdiction involved,” he said

Would you like to leave a gift to your community which goes on giving forever? CALL US AT 250.542.8677 We’ll show you how!

of the amendment. “It doesn’t prevent a property owner from coming forward and

applying for rezoning but they would have to meet all of the criteria within our OCP.

We can’t have the city looking across the border and saying, ‘That’s a nice piece of land to

develop.’” Under the memorandum of understanding, Vernon would be the

contact point for any industrial and business development looking to start up in the region.

All municipalities in the North Okanagan have signed the agreement.

t n e v E n o Coup free

9 piece comforter with 5 piece bedroom group purchase 5 piece bedroom includes bed (headboard, footboard & rails), dresser & mirror. Expires 03/28/10. One coupon per customer.

buy the regularly priced sofa, get the matching loveseat

50

% off

free buy two, get one

home accents equal or lesser value Expires 03/28/10. One coupon per customer.

Expires 03/28/10. One coupon per customer.

50 off 40 off %

%

free recliner

any mattress set

china/buffet

with 6 piece bedroom group purchase

with matching 5 piece dining group purchase

with the purchase of any matching sofa & loveseat

5 piece includes table & 4 chairs. Expires 03/28/10. One coupon per customer.

Expires 03/28/10. One coupon per customer.

6 piece bedroom includes bed (headboard, footboard & rails), dresser, mirror & night stand. Expires 03/28/10. Excludes Tempur-pedic. One coupon per customer.

Case

FURNITURE

GALLERY

from our family to yours

3202-28th St., Vernon, BC UÊÓxä‡x{x‡äxÎx info@casefurniture.ca UÊÜÜÜ°V>ÃivÕÀ˜ˆÌÕÀi°V>

Mon. to Fri: 9:00 am - 6 pm Sat: 9:30 am - 6 pm, Sun.: 11 am - 4 pm


www.vernonmorningstar.com

Friday, March 19, 2010 - The Morning Star A11

News

Warrants issued for three B.C. men MARCH 9, Theft from a vehicle in the 6900 block of Cummins Road in Vernon. The window was broken and two purses containing ID, credit cards and other personal items were stolen. (10-4502) MARCH 9, theft from a vehicle in the area of 31st Street and 34th Avenue. The suspect broke a window and stole a purse that contained ID and other personal items. (10-4482) MARCH 8, B&E and theft to a residence in the 1700 block of Deep Creek Road in Enderby. The front door was kicked in and a jewelry box with all the jewelry was stolen along with an old Playstation. (10-4442) MARCH 8, theft from vehicle in the area of Marshall Field. Purse containing a wallet and ID as well as cash was stolen. (104435) MARCH 8, theft from a vehicle, BX Falls off Silver Star Road. A woman’s purse containing keys, cash and ID was stolen, along with an iPod, a power converter, cell phone and charger were also stolen. (10-4424) MARCH 8, theft from vehicle in the 4900 block of Heritage Drive. An iPod and a chef’s knife were stolen. (10-4396) MARCH 8, B&E and theft in a townhouse complex in the 3600 block of 25th Avenue. Suspects entered a garage, then kicked a hole in the wall to get to a second complex where they stole two Makita drills that have paint splattered on them. (10-4391) MARCH 7, theft from vehicle in Kal Lake Provincial Park. Driver’s side window broken, two purses containing ID and other personal items were stolen. (10-4331) MARCH 7, theft of a 1991 eight-horse Honda outboard motor from a boat in the 8000 block of Aquarius Road in Vernon. The locks were removed and the motor was stolen. (10-4318) MARCH 7, B&E and theft to a business in the 3500 block of Okanagan Street in Armstrong. A brick was thrown through the window and a guitar was stolen. (10-4296) MARCH 6, theft from a vehicle in the 7300 block of Okanagan Landing Road. A woman’s leather purse containing cash, credit cards, personal ID and a cell phone were stolen. (10-4230)

Morning Star Staff

a Caucasian male, five-footthree and weighs 141 pounds with brown hair and hazel eyes. ■ Steven He n r y Murphy is wanted on provincial-wide war r ants for two Steven Murphy counts of a breach of his recognizance.

Crime Stoppers is asking the public’s assistance in locating the following people. ■ R y l a n C a l e b Lavis is wanted on provincialw i d e warrants Ryan Lavis for trafficking. Lavis, 19, is described as

Murphy, 26, is described as a native male, five-foot-nine and weighs 126 pounds with b r o w n eyes with b l a c k hair. ■ Re g a n R o y c e Newton is wanted on pro- Regan Newton vincialwide warrants for assault causing bodily

harm. Newton, 37, described as a Caucasian male, five-foot-nine and weighs 190 pounds with blue eyes and brown hair. CrimeStoppers is asking anyone with any information as to where these three people can be located to contact them at 1-800-222-8477. CrimeStoppers pays up to $2,000 for information that leads to an arrest, and for information that leads to the recovery of stolen property or drugs.

Hometown Sears. Shop Locally.

TM ⁄ MC

Sat., Mar. 20 & Sun., Mar. 21, 2010

on almost all regular and sale-priced merchandise $

save 20, 40, 60, 80 or 100 $

$

$

$

depending on your scratch card‡

on your purchase of $200 or more, before taxes, of almost all regular and sale-priced Kenmore®/MD major appliances, Kenmore sewing machines, Kenmore vacuums, furniture, patio furniture, sleep sets, home electronics, fitness equipment, home environment products, hardware, lawn mowers, tractors and gas grills.

KENM RE

DAYS

Crime Stoppers pays cash rewards up to $2,000 for information leading to an arrest, recovery of stolen property or seizure of drugs. Information can be given anonymously by calling 1-800-222-TIPS (8477).

CANADA’S NUMBER ONE SELLING BRAND ***Based on independent national surveys current at time of advertising preparation

$

up to a

60 delivery rebate

Use your Sears® MasterCard® or Sears Card and receive a delivery rebate up to $60 when you purchase any major appliance of $1500 or more†† and a delivery service †† Mail-in offer. Before taxes, on approved credit. Valid on purchases made between March 13 and March 28, 2010, from Sears. Excludes Outlet/Liquidation store purchases. Some restrictions apply. Ask in store for details.

MORE KENMORE MAJOR APPLIANCES ARE SOLD IN CANADA THAN ANY OTHER BRAND***

Purchase any Kenmore®/MD major appliance & earn

Purchase any Kenmore EliteTM/MC major appliance & earn

Purchase any Kenmore PRO®/MD major appliance & earn

SEARS CLUBTM POINTS**

SEARS CLUBTM POINTS**

SEARS CLUBTM POINTS**

4X 6X 8X

**When you use your Sears® MasterCard ® or Sears Card. On approved credit. 4, 6 or 8 points per $1 spent at Sears. Point calculation is based on the standard earning of 1 base point per $1 spent

on every transaction. Some exceptions apply. Ask for details.

All Sealy sleep sets % 50 99 899 reg.priced

®

$ on sale

OFF

Plus scratch & save Posturepedic®

Sealy ‘Perennial’ Special Edition pillow-top pocket coil Queen size sleep set. Pocket coil construction reduces motion transfer. Sears reg. 1799.98. Twin, Double & King sizes also 50% off

FREE DELIVERY

when you purchase a sleep set over $500† on your Sears® MasterCard® or Sears Card †Before taxes. On approved credit. Some restrictions apply. Ask in store for details. Excludes Catalogue and online purchases.

50 99 299 OFF

44,000 total BTU

400 sq. in. COOKING AREA

2 STAINLESS STEEL BURNERS

Plus scratch & save Broil King® ‘Crown 10’ grill with 235 sq. in. warming rack. Stainless steel Flav-R-Wave® cooking system. #30906. Sears reg. 349.99. Natural gas model also on sale

*

All

reg.priced

*

All Kenmore water treatment systems & water reg.priced

heaters on sale! Shown:

26099 739 $

OFF

Plus scratch & save

Kenmore Ultra Soft®/MD ‘200’ water softener. #75122. Sears reg. 999.99.

lawn mowers on sale!

Shown:

30 OFF

$

22"

36999

deck

Plus scratch & save

190 CC

CRAFTSMAN®/MD front-wheel drive lawn mower with 6.25 ft. lb. of torque. #36004. Sears reg. 399.99.

PAM IS BACK! Book your Appointment Today! 250-503-0112 • 2810A 48 th Ave. Across from The Village Green Mall

We will not be

UNDERSOLD!

WE’LL BEAT THE DIFFERENCE BY

10%

on any Canadian competitor’s advertised price on identical major appliances within 30 days of purchase. Some restriction apply. Ask for details.

Sale prices in effect Sat., Mar. 20 & Sun., Mar. 21, 2010, where open, unless otherwise stated, while quantities last. *These savings offers exclude items with prices ending in .97 ‡Scratch card void unless scratched by a Sales Associate. Limit of one scratch card per purchase. Approximate odds for each scratch box: 1/200 for the largest discount, 1/100 for the second largest discount, 1/100 for the third largest discount, 5/100 for the fourth largest discount, 92.5/100 for the fifth largest discount. Some exclusions apply. Complete details in store.

WE SHOP OUR COMPETITION EVERY DAY TO ENSURE WE HAVE THE BEST PRICES. Visit in-store for our current prices.

3101 - 48th Ave. Vernon PHONE: 250-260-1199 HOURS: Mon. to Fri. 9:30-5:30 Sat. 9:30-5:00

Come in and meet Dave and his friendly staff


A12 Friday, March 19, 2010 - The Morning Star

www.vernonmorningstar.com

News

TRIM ‘N STITCH It’s a SERGER! It’s a SEWING MACHINE! … all in ONE!

The All New from

PHOTO SUBMITTED

• Great for classes • Sews denim, stretch fabrics • Cuts & sews like a serger • Built-in needle threader • FREE LESSONS

Now Only $299 with your trade-in!

Ducks Unlimited volunteers Marlene Lang, left, and Angie Meier display some of the exclusive merchandise available at auction at the March 27 fundraiser at Best Western Vernon Lodge.

You have to see this machine to believe it! Limited quantities … once they are gone … they’re gone!

Fundraiser set to take flight

Findlays

KAZE Japanese Restaurant IN ENDERBY

MASONRY

Authentic Japanese Food at Heritage Coulter House

WINTER SPECIALS! ALL LUNCH SPECIAL

MON-FRI

Now

5.99!

$

2

1

FOR DINNER SPECIAL (MONDAY - THURSDAY)

INSULATION

“Loss of wetland habitat is a huge threat.”

CONTRACTOR SUPPLIES

Some restrictions apply. Details in restaurant. Offer expires March 31, 2010. • Closed Sundays

Reservations: 250-838-2555 • 1004 Belvedere St., Enderby

MORTGAGES MADE EASY!

250-503-8993

DOMINION LENDING CENTRES

SOLUTIONS

3300-34th Avenue, Vernon • www.dominionsolutions.ca

12PM

Saturday, April 10th, 2010, 9:00am to 12:00pm Kamloops Convention Centre – Ida Room 1250 Rogers Way Kamloops, BC Snacks & refreshments will be provided.

For more information or to reserve seating, contact Jamie Sherwood Toll Free: 1.877.846.7502 Local: 250.374.3151 Email: jsherwood@steels.com

ENVIRONMENTAL

Protect your credit, let us do the shopping for you!

Join us for a FREE SEMINAR and HANDS ON DEMONSTRATION from Kathy Murdock of Perma-Chink Systems. This session will train the do-it-yourself homeowner and experienced contractor about product application and log home maintenance.

SAFETY

Craig Williams

Join us for a FREE SEMINAR and HANDS ON DEMONSTRATION from Kathy Murdock of Perma-Chink Systems.

LOG HOMES

• Equity Loans • Self Employed Programs • Unbeatable low rates • Leasing Programs

ATTENTION LOG HOME OWNERS, DEALERS AND CONTRACTORS

ROOFING

Research, public education and wetlands conservation are the goals for money raised at the Vernon Ducks Unlimited fundraiser March 27. Space is filling up quickly for the annual event which allows the Vernon chapter to proceed with local efforts such as the Oyama Wetland project to maintain floodplain habitats along the Okanagan River and the aim of purchasing 50 hectares of undeveloped wetland on the south shore of Swan Lake. “If you’re an outdoor enthusiast or are concerned about the loss of natural environments, this event gives you an opportunity to give something back to nature,” said Vernon event chair Bill Cuthbert. “Loss of wetland habitat is a huge threat.” — Cuthbert Wetlands are among the most productive ecosystems on the planet and support about 600 species of plants and animals. They are vital to people too. “Wetlands help reduce flooding, treat wastewater, replenish groundwater, guard against erosion and keep our water clean,” said Cuthbert. “People truly need to understand that wetlands are an important part of our watershed.” The fundraiser will be a dinner and auction March 27 at the Best Western Vernon Lodge beginning at 6 p.m. Tickets are $50 per person and there will be a variety of prints and sculptures by Canadian artists available to bid on. Raffles for prizes donated by local businesses will also be held. “Tickets are selling fast,” said Cuthbert. “This year’s event will feature fun games, raffles, and auc-

(next to the Village Green Mall)

tions with some really great items to win. People are pretty excited.” To purchase tickets, contact Angie Meier at 250558-5049 or by e-mail at angiemeier@shaw.ca. You can buy tickets online at www.ducks.ca/tickets using code BC-104-10-1. Information about Ducks Unlimited Canada and donation details are available at www.ducks.ca.

MORTGAGES

Morning Star Staff

Vacuum & Sewing 250-549-2730 • ANDRE’S PLAZA

YOUR BUILDING MATERIALS EXPERTS

Laura, a Community Physiotherapist for the Interior Health Authority, is visiting a client and helping him get back to enjoying a healthy, active lifestyle this spring. She is just one of 3,000 PEA professionals making a difference in BC.

Professional Employees Association

professionals

BC for

find out more about Laura’s contributions to BC at professionalsforbc.com


www.vernonmorningstar.com

Friday, March 19, 2010 - The Morning Star A13

'07 TOYOTA YARIS RS HATCHBACK

'06 TOYOTA COROLLA SE

FINANCING FROM

FINANCING FROM

3.9%*

$

13,171

A/C, p. locks, p. windows, 42,000 kms

3.9%*

Alloys, sunroof, only 46,000 kms

$

H3874

3.9

3.9

%*

5 speed, CD

$

Alloys, A/C, p. windows, p. locks, 16,000 kms

$

10,930

H3974

Alloys, spoiler

H3900

'07 TOYOTA TACOMA

FINANCING FROM

H3961

3.9

A/C, auto, p. locks p. windows, Only 27,000 kms V15048A

4.5

%*

4 cyl, auto

$

$ V15216A

H3946

24,153

'08 TOYOTA SIENNA VAN

FINANCING FROM

FINANCING FROM

3.9

3.9%*

%*

A/C, auto, only 14,000 kms

V6, A/C, p. windows, p. locks, 48,000 kms

H3962

13,330

FINANCING FROM

$ H3834

25,811

'09 TOYOTA YARIS HATCHBACK FINANCING FROM

4.5

3.9%*

%*

V6, 6 speed, p. windows, p. locks

Only 9,400 kms

$

16,703

14,467

'06 TOYOTA TACOMA 4X4 SR5

FINANCING FROM

%*

4 cyl, A/C, p. windows, p. locks, 47,000 kms

$

28,647

'09 TOYOTA COROLLA LE

3.9%*

'06 TOYOTA COROLLA CE

FINANCING FROM

%*

FINANCING FROM

3.9%*

'08 TOYOTA RAV 4 SPORT

FINANCING FROM

18,811

H3960

'06 TOYOTA RAV 4

FINANCING FROM

$

13,732

'07 TOYOTA MATRIX

$

'07 TOYOTA MATRIX TRD

H3977

22,371

$ H3901

13,310

MORE PRE-OWNED VEHICLES ONLINE. VISIT US 24/7 AT WWW.VERNONTOYOTA.COM †On approved credit. **Financing from 3.9%, 4.5% rate is based on 36 months to 60 month term, please see dealer for full details.

Mark Jones

Ernie Wiesel

Chad Isaac

Wayne Sturt

VERNON

Kirsten Carrick

Tyler Cull

Terri-Lynn Nadin

Chris Thibault

Tim Proctor

TOYOTA

3401 - 48th Ave • Phone: (250) 545-0687 • Fax: (250) 545-0662

DL# 30382

Otto Gauss


A14 Friday, March 19, 2010 - The Morning Star

www.vernonmorningstar.com

News

www.898mtbulmanplace.ca

4205 27 th Street, Vernon

AFRICAN RHYTHMS

“March Madness Sale”

Open House Sunday 1-4pm

• NEW CONDOS, UNDERGROUND PARKING

898 Mt. Bulman Place

• FREE 42” TV! LISA VANDERVELDE/MORNING STAR

Robin Ritchie and Kathi Wilkinson provide the drum music for an African dance class at the Yoga Matters studio Saturday.

$569,900

REDUCED

• HURRY BEFORE APRIL MORTGAGE CHANGES ** While Quantities Last

• RENT-TO-OWN OPTIONS • OPEN HOUSE SUNDAYS STARTING @ 1 PM

$578,800

MLS®

Perfectly maintained home with Kal Lake view

• STARTING @ $239,900

derryanne hubbard

For more information call 250-550-2172 or Toll-Free at 1-877-509-9009

Sales Representative

More than my name is unique

Nature’s Fare Markets Live Well. Live Organic.

Wild Pacific Salmon Oil

Ultra-Sil Vegetable Silica

100% wild sockeye salmon oil

Nourishes skin, hair & nails & supports the skeletal system

Benefits the eyes & cardiovascular system

Provides an abundance of trace minerals

Provides a 1:1 ratio of EPA & DHA, an ideal maintenance does

BONUS 210 softgels

Stimulates cell metabolism & cell formation

BONUS

| $12.99

Green & Black Organic Chocolate Easter Eggs

210 veggie caps

Kicking Horse Organic Coffee ASSORT

VARIETY

starting at 100 g | $6.99

454 g

Ecover Organic Dish Soap

ED

ASSORT

| $10.99

500 ml

ED

| $2.49

| $24.99 Nature’s Path Organic Cereal ASSORT

ED

300 g 400 g |$3.99 Sale Ends April 1st, 2010

Fare Points Program

LISA VANDERVELDE/MORNING STAR

Bobby Bovenzi instructs the African dance class to the drum beat at Yoga Matters.

Earn ONE FARE POINT for EVERY PENNY you spend at all Nature’s Fare Markets on regular priced merchandise. Every time you reach 50,000 points, receive a 15% coupon to use towards your next purchase. Swipe your keyfob or use your phone number. Not valid on sale items. www.naturesfare.com Kamloops

Kelowna

Kelowna(Lakeshore)

West Kelowna

Penticton

Vernon

Langley

5-1350 Summit Dr. 250.314.9560

120-1876 Cooper Rd. 250.762-8636

4624 Lakeshore Rd. 250.764-9010

104-3480 Carrington Rd. 250.707.3935

104-2210 Main St 250.492.7763

104-3400 30th Ave 250.260.1117

120-19880 Langley Bypass 778.278.1300


www.vernonmorningstar.com

Friday, March 19, 2010 - The Morning Star A15

FRIDAY, SATURDAY AND SUNDAY ONLY! Lucerne Milk Assorted varieties. 4 Litre. varieties. LIMIT TWO - Combined vari Plus deposit and/or enviro le levy where applicable.

Lucerne Milk Assorted varieties. 4 Litre. LIMIT TWO - Combined varieties. Plus deposit and/or enviro levy where applicable. COUPON VALID MARCH 19 - 21, 2010 ONLY AT YOUR SAFEWAY STORE.

C LU B P R I C E

00 OFF

1

With Coupon

Cashiers: Scan the coupon to the same quantity as applicable products purchased hased (up to the limit stated on the coupon if applicable)

Safeway Juice and Cocktails

Su Sunkist Navel Oranges Na

From concentrate. Select varieties. 1 Litre. Litre Plus deposit and/or enviro levy where applicable. WEEKLY HOUSEHOLD LIMIT TWELVE Combined varieties.

4 lb Bag. Product of U.S.A.

CLUB PRICE

CLUB PRICE

.77

ea.

EXTREME PRICE

99

1

Boneless New York Strip Loin Steak

Windex Trigger Select varieties. 765 to 950 mL. Or Wipes 28’s.

Canadian Beef. WEEKLY HOUSEHOLD LIMIT TWO.

CLUB PRICE

CLUB PRICE

BUY ONE, GET ONE

FREE Plus

ea.

99

6

/lb. 15.41/kg

Exclusivity has its rewards everyday at your Vernon Safeway

50

Earn an additional

BONUS AIR MILES® reward miles every time you shop*

*Minimum $40 purchase required. Please see customer service for complete details. ® TM Trademarks of AIR MILES International Trading B.V. Used under license by LoyaltyOne, Inc. and Canada Safeway Limited. Prices effective at your Vernon Safeway stores Friday, Mar. 19 thru Sunday, Mar. 21, 2010. We reserve the right to limit sales to retail quantities. Some items may not be available at all stores. All items while stocks last. Actual items may vary slightly from illustrations. Some illustrations are serving suggestions only. Advertised prices do not include GST. ®™ Trademarks of AIR MILES International Trading B.V. Used under license by LoyaltyOne, Inc. and Canada Safeway Limited. Extreme Specials are prices that are so low they are limited to a one time purchase to Safeway Club Card Members within a household. Each household can purchase the limited items one time during the effective dates. A household is defined by all Safeway Club Cards that are linked by the same address and phone number. Each household can purchase the EXTREME SPECIALS during the specified advertisement dates. For purchases over the household limits, regular pricing applies to overlimit purchases. On BUY ONE GET ONE FREE items, both items must be purchased. Lowest priced item is then free.

MARCH 19 20 21 FRI

SAT

SUN

Prices in this ad good through Mar. 21st.


A16 Friday, March 19, 2010 - The Morning Star

Friday, March 19, 2010 - The Morning Star A17

Innovation You Can Feel Engineering You Can Trust

OFFER EXTENDED UNTIL 6PM MARCH 31ST DUE TO POPULAR DEMAND.

$

384 A Month With

$

2010 Subaru Outback PZEV

2010 Subaru Impreza 2.5i 4 Door Sedan

.00

Starting From

$

0 Down

Consumer Reports “Most Reliable”

2010 Motor Trend SUV of the Year Consumer Reports “Most Reliable” 2010 AJAC “Best New SUV Under $35,000.00”

0.5% lease rate for 24 mths. LEV $13,646. 75

*

$

$ Lennard Winslow Sales Manager

Gary McCardell Hyundai Salesman

Steven Daschuk Hyundai Salesman

Andrew Hoglund Hyundai Salesman

2006 DODGE DAKOTA

Hetty-Jo Schultz Hyundai Saleswoman

Bruce Townsend Hyundai Salesman

$

0 Down

UU832954

UW252010

SALE PRICE

Bluetooth, auto., 24,000 kms

INSURANCE INSTITUTE FOR HIGHWAY SAFETY All Subaru vehicles tested are top safety picks.V

††

5-star government crash test safety ratingsW.

$15,995 $2500

TRADE-IN VALUE DISCOUNT

$

2009 HYUNDAI SONATA GL

$16,995 TRADE-IN VALUE $2500 DISCOUNT

13,495

2009 JEEP WRANGLER “UNLIMITED”

UH539206 SALE PRICE

$17,995 $2500

TRADE-IN VALUE DISCOUNT

Very clean car

$

15,495

*

UL767058 SALE PRICE

4 door, convertible, auto.

$29,495 $2500

TRADE-IN VALUE DISCOUNT

$

2009 SUBARU LEGACY PREMIER 3.0R

26,995

2009 SUBARU OUTBACK LTD

AWD

2008 FORD EXPLORER XLT

2008 HYUNDAI ACCENT GL

2007 SATURN AURA XE

2007 TOYOTA CAMRY “HYBRID”

UUA23191

UU073875

UF239160

UU002495

$25,995 $2500

TRADE-IN VALUE DISCOUNT

$

23,495

SALE PRICE

“HATCH”, 3 door, A/C, auto., low kms

$

10,495

SALE PRICE

“2007 Car of the Year” Very clean

$12,995 $2500

TRADE-IN VALUE DISCOUNT

$

10,495

$

18,995

2006 MAZDA 6 GT

2004 FORD F350 XL

UJ110976

UW136718

U5M41623

UED79225

$12,995 TRADE-IN VALUE $2500 DISCOUNT

$

23,995

$16,995 TRADE-IN VALUE $2500 DISCOUNT

SALE PRICE

Just arrived, low kms

$

10,495

$13,995 TRADE-IN VALUE $2500 DISCOUNT SALE PRICE

SALE PRICE

Wagon, sunroof, loaded

$

14,495

5.4L, 86,000 kms, auto., PW, PL, A/C

$

11,495

2004 CHEVY COLORADO LT

2002 ACURA RSX “PREMIUM”

2002 NISSAN ALTIMA 2.5S

2002 TOYOTA COROLLA CE

C8187123

UC801763

UC106324

UC862088

SALE PRICE

$22,495 $2500

TRADE-IN VALUE DISCOUNT

$

19,995

SALE PRICE

Leather, 5 speed, sunroof

$11,995 $2500

TRADE-IN VALUE DISCOUNT

$

9,495

SALE PRICE

TRADE-IN VALUE DISCOUNT

Auto., 4 cylinder

$

$9,995 $2500

7,495

SALE PRICE

TRADE-IN VALUE DISCOUNT

5 speed, very fuel efficient

$

$7,995 $2500

5,495

2002 ACURA 3.2 TL

2001 CHEVY MALIBU LS

2002 TOYOTA CAMRY CE

2008 HYUNDAI SANTA FE GL 3.3L

UA802209

U6192055

U0014950

UH135364

SALE PRICE

$11,995 $2500

TRADE-IN VALUE DISCOUNT

$

9,495

SALE PRICE

V6, extra clean

TRADE-IN VALUE DISCOUNT

$

$6,995 $2500

4,495

SALE PRICE

TRADE-IN VALUE DISCOUNT

4 cylinder, auto., well equipped

$

$9,995 $2500

7,495

SALE PRICE

Only 13,800 kms, just traded in, like brand new

$24,995 $2500

TRADE-IN VALUE DISCOUNT

$

22,495

4608 27th Street Vernon 1-877-202-3434 www.vernonhyundai.com 1-250-275-4004 * †Offer valid on all vehicles except those valued under $5,000. Some restrictions may apply, see dealer for full details. Promotion not included with any other promotions. All vehicle prices plus applicable taxes.

DL6371

4 door, auto., PL, PW, A/C

2006 VOLKSWAGEN JETTA 2.5

AWD, sport, just arrived!

Sunroof, leather, 2 to choose from

TRADE-IN VALUE DISCOUNT

2007 FORD FOCUS SE

$26,495 TRADE-IN VALUE $2500 DISCOUNT

4,100 kms, leather, loaded

2008 SUBARU IMPREZA WRX

$21,495 $2500

SALE PRICE

Very fuel efficient, no recalls

2008 SATURN OUTLOOK XE SALE PRICE

Leather, loaded, just arrived

$12,995 $2500

TRADE-IN VALUE DISCOUNT

STK #S4210875

$

Starting prices on 2010 Legacy 2.5i 6MT and 2010 Outback PZEV 6MT models do not include freight, pdi, fees or taxes. Lease payments on 2010 Forester 2.5x 5MT and 2010 Impreza 2.5i 4 door 5MT models do not include taxes, all rebates go to dealer. See dealer for complete details. Promotion not included with any other promotions. DL6371

SALE PRICE

2008 CHEVY COBALT LS SEDAN

32,495 304 OR $

STK #U7340993

28 B/W

$

35,495 333 OR $

STK #U7176730

90 B/W

$

12,995

OR

111

$

STK #UG509151

78

B/W

$

29,995

OR

2005 MERCEDES BENZ C230 KOMPRESSOR

19,995

2005 SUBARU LEGACY SE SEDAN

STK #U7206925

$

16,995

OR

$

151

STK #UF714816 OR

$

18089

$

B/W

Gerry Robinson Sales Manager

Andree Kosmino Duncan McDonald Subaru Saleswoman Subaru Salesman

B/W

$

21,995

OR

$

16,995

200

B/W

$

12,995

OR

$

111

19,995

2006 CHEVY LT 1500 CREW CAB Z71 4X4

4 door, auto., all power options, keyless entry

STK #UU244170

63

Dan Skrypnyk Subaru Salesman

2008 HYUNDAI ACCENT GL

STK #U2305862

27

B/W

$

$

OR

15127

B/W

AWD, auto., loaded, local car

2007 VOLVO S40 2.4i SEDAN

AWD, auto., A/C, cruise

60

2005 SUBARU OUTBACK LTD 3.0R

AM sport pkg., 2 sets of wheels, 1 owner, reduced

$

STK #UM602100

279

$

Sunroof, DVD, 20” chrome wheels

B/W

$

25,495

OR

$

235

OR

$

18089 B/W

2007 FORD EXPLORER SPORT-TRAC LTD V8, leather, sunroof

STK #U1350877

78

STK #U4314088

STK #UUA16119

18

B/W

$

25,495

OR

$

23518

B/W

4407 27th Street Vernon 1-800-663-6430 www.hilltopsubaru.com 1-250-542-2324

Bi-weekly payments are based on 60 month term @ 5.49% with your $2500 trade value discount applied. On approved credit, see dealer for complete details.

14,495

OFFER EXTENDED UNTIL 6PM MARCH 31ST DUE TO POPULAR DEMAND.

SALE PRICE

$

DVD, sunroof, lift kit, 20” wheels

JAPANESE ENGINEERED VEHICLES STANDARD WITH

US624247

4.7L, crew cab, tonneau cover, very clean, must see

23,995.00

Consumer Reports “Most Reliable”

3.9% lease rate for 48 mths. LEV $10,917.90

2009 FORD FOCUS SE

D L O S

Starting From

Consumer Reports “Most Reliable”

2010 HYUNDAI ELANTRA GL

10,000 kms, just ust arrived, well equipped

AWD, 8 psgr., loaded

2010 Subaru Legacy 2.5i

2010 Subaru Forester 2.5x

.00

419 A Month With

OUR SALES STAFF

7 psgr., satellite radio, loaded

28,995.00


A18 Friday, March 19, 2010 - The Morning Star

www.vernonmorningstar.com

WIN! Enter for your chance to

News

Cancer campaign making the rounds Morning Star Staff

April is Cancer Awareness month and one of the Canadian Cancer Society’s biggest fundraising campaigns of the year will soon be coming to your door. Canvassers will be collecting donations in Okanagan neighbourhoods from April 1 to 30. They’ll be covering ground from Oyama to Armstrong and Lumby to West Kelowna. The campaign is more than 40 years old and all canvassers will have identification. Tax-deductible receipt are available. “The door-to-door campaign has been going on for years and years and is one

“It’s a cause that touches everyone.� — Jackie George of the most fundamental fundraisers we have,� said residential campaign co-ordinator Jackie George. “The goal is to raise as much money as possible,� she said. “It’s a cause that touches everyone.� When you donate, you are supporting one of the Canadian Cancer Society’s

single most important drives against all types of cancer and providing assistance to those living with cancer in the community. Nearly 300 canvassers have signed up to help out this year but George says more are always welcome. “We’re always looking for more. We need as many doors knocked on as possible,� she said. For more information on how to get involved, contact Jackie George at 250542-7417. Details on the effort and volunteer registration are also available at the campaign website www.fightback.ca.

2 nights at the

KingďŹ sher Oceanside Resort in the Comox Valley‌

Sail away with BC Ferries and spend two nights at the beautiful KingďŹ sher Oceanside Resort & Spa in the Comox Valley. Package includes a relaxing PaciďŹ c Mist Hydropath treatment for two! See details at www.getawaybc.com‌ Cheryl MacKinnon’s favourite destinations at‌

iĂœĂŠĂ“Ă¤ÂŁĂ¤ĂŠÂœ`iÂ?ĂƒĂŠ>Ă›iĂŠĂ€Ă€ÂˆĂ›i`° -“>Ă€ĂŒiĂ€]ĂŠ>ĂƒĂŒiÀʘ`ĂŠ >ĂƒÂˆiĂ€t

Óä¯Ê"

"1,Ê  -  /" "Ê, -t -Ê, ÊÓn½£ä

/Ă“ÂˆĂŠĂœÂˆĂŒÂ…ĂŠÂŁn‡xxÂˆĂƒ -1‡ÓÎääää™

/½-Ê Ê/7"Ê  ,-Ê Ê" \

/ĂŠ-,

7

 1 -Êfxä /Ê , ÊÊÊÊÊÊf

™™™°

/Ă“ÂˆĂŠĂœÂˆĂŒÂ…ĂŠÂŁn‡xxÂˆĂƒ ÂŤÂ?Ă•ĂƒĂŠ ‡-ĂŠxx‡ÓxĂ¤ÂˆĂƒ -1‡ÓÎääää™ÊÊÊ-1‡ÓΣ£ÓÇä  1 -ĂŠfxä /ĂŠ , ĂŠĂŠĂŠĂŠĂŠĂŠf

UĂŠÂ˜iĂœĂŠyĂŠ>}ĂƒÂ…ÂˆÂŤĂŠÂœvĂŠĂŒÂ…iĂŠ,iLiÂ?ĂŠÂ?ˆ˜i ĂŠĂŠĂŠÂŁnĂŠÂ“ÂˆÂ?Â?ÂˆÂœÂ˜Â‡ÂŤÂˆĂ?iÂ?ĂŠ "-ĂŠĂƒiÂ˜ĂƒÂœĂ€ UĂŠiĂ?ViÂŤĂŒÂˆÂœÂ˜>Â?ĂŠÂ?ÂœĂœÂ‡Â˜ÂœÂˆĂƒiÊ£ääH 7 ĂŠĂŠĂŠĂˆ{ääÊ-"ĂŠĂ€>˜}i]Ê­ÂŽĂŠÂŁĂ“]nääÊ-" UÊΰÇÊvÂŤĂƒĂŠVÂœÂ˜ĂŒÂˆÂ˜Ă•ÂœĂ•ĂƒĂŠĂƒÂ…ÂœÂœĂŒÂˆÂ˜} UĂŠĂˆĂŽÂ‡Ă˘ÂœÂ˜iĂŠ`Ă•>Â?‡Â?>ĂžiÀʓiĂŒiĂ€ÂˆÂ˜} ĂŠĂŠĂŠ>˜>Â?ĂžĂƒiĂƒĂŠÂœVĂ•Ăƒ]ĂŠ ÂœÂ?ÂœĂ•Ă€ĂŠ>˜` ° ĂŠĂŠĂŠĂ•Â“ÂˆÂ˜>˜ViĂŠÂˆÂ˜vÂœĂ€Â“>ĂŒÂˆÂœÂ˜ UÊΝʣä{äŽÊˆ}Â…ĂŠ,iĂƒĂŠ

ĂŠĂœÂˆĂŒÂ… ĂŠĂŠĂŠĂŽ\Ă“ĂŠ>ĂƒÂŤiVĂŒĂŠĂ€>ĂŒÂˆÂœ UĂŠ* ĂŠEĂŠ,7ĂŠÂˆÂ“>}iĂŠwĂŠÂ?iĂƒ UʳɇÊxvĂ‰ĂƒĂŒÂœÂŤĂƒĂŠ Ă?ÂŤÂœĂƒĂ•Ă€iĂŠ ÂœÂ“ÂŤÂ°

UĂŠ ĂŠĂ›Âˆ`iÂœĂŠ>ĂŒĂŠÂŁÂ™Ă“Ă¤Ă?£änä UĂŠĂƒiÂ?iVĂŒ>LÂ?iĂŠvĂ€>“iĂŠĂ€>ĂŒiĂƒ ĂŠĂŠĂŠĂˆĂ¤Ă‰ĂŽĂ¤Ă‰Ă“xÉÓ{*ĂŠvÂŤĂƒ UĂŠvĂ•Â?Â?ʓ>Â˜Ă•>Â?ĂŠiĂ?ÂŤÂœĂƒĂ•Ă€i ĂŠĂŠĂŠVÂœÂ˜ĂŒĂ€ÂœÂ? UĂŠÂœÂŤĂŒÂˆÂœÂ˜ĂƒĂŠÂœvĂŠÂˆÂ˜ĂŒiĂ€VÂ…>˜}i‡ ĂŠĂŠĂŠ>LÂ?iĂŠÂ?iÂ˜ĂƒiĂƒ UĂŠÂ˜iĂœĂŠÂœĂ›ÂˆiĂŠ Ă€ÂœÂŤĂŠvi>ĂŒĂ•Ă€i UĂŠvÂœĂ€ĂŠLiĂŒĂŒiĂ€ĂŠĂƒÂœĂ•Â˜`ʾÕ>Â?ÂˆĂŒĂž ĂŠĂŠĂŠÂˆÂ˜VÂ?Ă•`iĂƒĂŠ>Â˜ĂŠiĂ?ĂŒiĂ€Â˜>Â? ĂŠĂŠĂŠĂƒĂŒiĂ€iÂœĂŠÂ“ÂˆVĂ€ÂœÂŤÂ…ÂœÂ˜iĂŠÂ?>VÂŽ UĂŠ ĂŠVœ˜˜iVĂŒÂˆÂœÂ˜

£Ó™™

1*, ĂŠ9"1, 8-/ ĂŠ  " ĂŠ/

7

-6 -  ĂŠ Â?>ĂƒĂƒ{ĂŠ ĂˆĂ¤8ĂŠĂƒÂŤii`ĂŠĂ€>ĂŒi` vÂœĂ€ĂŠ ĂŠ6ˆ`iÂœ

UĂŠ{ ĂŠĂŠf£™° UĂŠn ĂŠĂŠfә° UĂŠÂŁĂˆ ĂŠf{™° UĂŠĂŽĂ“ ĂŠf™™° i˜`ĂƒĂŠ>ÀÊÓn½£ä

7

ĂŒÂ…iʓÕVÂ…ĂŠ>Â˜ĂŒÂˆVÂˆÂŤ>ĂŒi`

Çä‡ÓäävÓ°n-

/Ă“ÂˆĂŠĂŠLÂœ`ĂžĂŠÂœÂ˜Â?Ăž

ʓŽÓ

-1‡ÓÎäää£ä

-1‡ÓÎ{ĂˆÂŁxn

 1 -ÊfÓx /Ê , ÊÊÊÊÊÊf

n™™°

ΰxĂŠÂˆÂ˜VÂ…ĂŠ- ,

"/ *Â?>ĂŒÂˆÂ˜Ă•Â“

Óx™™°

/ Ê-/" °°°ÊÊÊÊf

Ă&#x160;-<

7

7 {Ă?<""­Ă&#x201C;nÂ&#x2021;ÂŁÂŁĂ&#x201C;ÂŽ]Ă&#x160;ÂŁĂ&#x201C;°£*]Ă&#x160;Ă&#x201C;°Ă&#x2021;Âť

 /Ă&#x160; " 9]Ă&#x160;Ă&#x2C6;{ääĂ&#x160;-"

7

7

-1Â&#x2021;Ă&#x17D;xää{ÂŁĂ&#x2021;Ă&#x160; 1 ]Ă&#x160;Ă&#x160;-1Â&#x2021;Ă&#x17D;xää{ÂŁĂ&#x2C6;Ă&#x160;-Â&#x2C6;Â?Ă&#x203A;iĂ&#x20AC;]

",

 °Ă&#x160; 8,Ă&#x160;{ Ă&#x160;*/ 1Â&#x2021; Ă&#x2C6;äĂ?Ă&#x160;-  Ă&#x160; , Ă&#x160;Ă&#x160;Ă&#x160;Ă&#x160;f

Ă&#x201C;{Â&#x2122;°

7 7 UĂ&#x160;Ă&#x2022;}iĂ&#x160;Ă&#x17D;°xÂťĂ&#x160;Â&#x2026;Â&#x2C6;}Â&#x2026;Â&#x2021;Ă&#x20AC;iĂ&#x192;Ă&#x160;{Ă&#x2C6;äÂ&#x17D;Ă&#x160; Â&#x153;Ă&#x152;Ă&#x160; >Ă&#x192;Ă&#x17E;Â&#x2021; /Â&#x153;Ă&#x2022;VÂ&#x2026;Ă&#x160;

Ă&#x160;Ă&#x192;VĂ&#x20AC;iiÂ&#x2DC;]Ă&#x160;Ă&#x153;Â&#x2C6;Ă&#x152;Â&#x2026;Ă&#x160;xĂ?Ă&#x160;Ă&#x153;Â&#x2C6;`iÂ&#x2021;>Â&#x2DC;}Â?iĂ&#x160; ­Ă&#x201C;{Â&#x2021;ÂŁĂ&#x201C;äŽĂ&#x160;âÂ&#x153;Â&#x153;Â&#x201C;Ă&#x160;Â?iÂ&#x2DC;Ă&#x192;Ă&#x160;>Â&#x2DC;`Ă&#x160; Ă&#x160;Ă&#x2021;Ă&#x201C;äĂ&#x160; Â&#x153;Ă&#x203A;Â&#x2C6;iĂ&#x160;,iVÂ&#x153;Ă&#x20AC;`Â&#x2C6;Â&#x2DC;}°Ă&#x160;>ViĂ&#x160; iĂ&#x152;iVĂ&#x152;Â&#x2C6;Â&#x153;Â&#x2DC;°Ă&#x160; Â&#x201C;>âÂ&#x2C6;Â&#x2DC;}Ă&#x160;ÂźÂ&#x153;Ă&#x153;Â&#x2021;Â&#x2C6;}Â&#x2026;Ă&#x152;½Ă&#x160;Ă&#x2C6;{ääĂ&#x160;-"° -1Â&#x2021;Ă&#x17D;xää{ÂŁÂŁĂ&#x160;-Â&#x2C6;Â?Ă&#x203A;iĂ&#x20AC;]Ă&#x160;Ă&#x160;-1Â&#x2021;Ă&#x17D;xää{ÂŁĂ&#x201C;Ă&#x160; Â?>VÂ&#x17D;  1 -Ă&#x160;fĂ&#x201C;xĂ&#x160;/Ă&#x160; , Ă&#x160;Ă&#x160;Ă&#x160;Ă&#x160;

Ă&#x17D;Ă&#x2021;Â&#x2122;°

- 9 >Ă&#x203A;iĂ&#x160;Ă&#x2022;Â&#x2DC;Ă&#x160;VĂ&#x20AC;i>Ă&#x152;Â&#x2C6;Â&#x2DC;}Ă&#x160;`Â&#x2C6;Ă&#x192;Ă&#x152;Â&#x153;Ă&#x20AC;Ă&#x152;Â&#x2021; i`Ă&#x160;ÂźwĂ&#x160;Ă&#x192;Â&#x2026;iĂ&#x17E;i½Ă&#x160;Â&#x153;Ă&#x20AC;Ă&#x160;iÂ&#x2DC;VÂ&#x2026;>Â&#x2DC;Ă&#x152;Â&#x2C6;Â&#x2DC;}Ă&#x160; ÂźÂ&#x201C;Â&#x2C6;Â&#x2DC;Â&#x2C6;>Ă&#x152;Ă&#x2022;Ă&#x20AC;i½Ă&#x160;Â&#x201C;Â&#x153;`iÂ?Ă&#x160;ÂŤÂ&#x2026;Â&#x153;Ă&#x152;Â&#x153;Ă&#x192;°

{Ă?<""­Ă&#x17D;xÂ&#x2021;ÂŁ{äŽ]Ă&#x160;ÂŁĂ&#x201C;°£*]Ă&#x160;Ă&#x201C;°Ă&#x2021;Âť

Ă&#x17D;Ă&#x201C;ääĂ&#x160;-"]Ă&#x160;Â&#x2C6;Ă&#x152;Â&#x2026;Â&#x2C6;Ă&#x2022;Â&#x201C;Â&#x2021;" Ă&#x160; >Ă&#x152;Ă&#x152;iĂ&#x20AC;Ă&#x17E; -1Â&#x2021;Ă&#x17D;xää{ÂŁnĂ&#x160;-Â&#x2C6;Â?Ă&#x203A;iĂ&#x20AC;]Ă&#x160;Ă&#x160;-1Â&#x2021;Ă&#x17D;xää{ÂŁÂ&#x2122;Ă&#x160; Â?Ă&#x2022;i

f

U1

+1 -/" Ă&#x201C;Â&#x2122;ÂŁĂ&#x201C;Ă&#x160;7iĂ&#x192;Ă&#x152;Ă&#x160; Ă&#x20AC;Â&#x153;>`Ă&#x153;>Ă&#x17E;

ÂŁnÂ&#x2122;°

, Ă&#x160;fÂŁÂ&#x2122;Â&#x2122;°Â&#x2122;Â&#x2122;Ă&#x160;-6 Ă&#x160;f£ä°°°Ă&#x160;Ă&#x160;Ă&#x160;Ă&#x160;f

UĂ&#x160;Ă&#x2022;Â?Â?Ă&#x160; Ă&#x160;6 "Ă&#x160;ÂŁÂ&#x2122;Ă&#x201C;äĂ?£änä UĂ&#x160; Ă?ÂŤ>Â&#x2DC;`>LÂ?iĂ&#x160;iÂ&#x201C;Â&#x153;Ă&#x20AC;Ă&#x17E;Ă&#x160;Â&#x2021; Ă&#x160;Ă&#x160;Ă&#x160;- Ă&#x2030;-  Ă&#x2030;- 8

UĂ&#x160;Ă&#x201C;äĂ?Ă&#x160;"ÂŤĂ&#x152;Â&#x2C6;V>Â?Ă&#x160;<Â&#x153;Â&#x153;Â&#x201C; UĂ&#x160;-Ă&#x2022;ÂŤiĂ&#x20AC;Ă&#x160;"ÂŤĂ&#x152;Â&#x2C6;V>Â?Ă&#x160;Â&#x201C;>}i Ă&#x160;Ă&#x160;Ă&#x160;-Ă&#x152;>LÂ&#x2C6;Â?Â&#x2C6;â>Ă&#x152;Â&#x2C6;Â&#x153;Â&#x2DC; UĂ&#x160;Ă&#x201C;{ÂŤĂ&#x160;VÂ&#x2C6;Â&#x2DC;iÂ&#x201C;>Ă&#x160;>Â&#x2DC;`Ă&#x160;Ă&#x17D;ä Ă&#x160;Ă&#x160;Ă&#x160;ÂŤĂ&#x20AC;Â&#x153;}Ă&#x20AC;iĂ&#x192;Ă&#x192;Â&#x2C6;Ă&#x203A;iĂ&#x160;Â&#x201C;Â&#x153;`iĂ&#x192; UĂ&#x160;Ă&#x201C;°Ă&#x2021;ÂťĂ&#x160;Ă&#x2022;Â?Ă&#x152;Â&#x2C6;Â&#x2021;Â&#x2DC;}Â?i Ă&#x160;Ă&#x160;Ă&#x160;7Â&#x2C6;`iĂ&#x192;VĂ&#x20AC;iiÂ&#x2DC;Ă&#x160;

UĂ&#x160;-Ă&#x152;>Â&#x2DC;`>Ă&#x20AC;`Ă&#x160;6 " UĂ&#x160; Ă?ÂŤ>Â&#x2DC;`>LÂ?iĂ&#x160;Ă&#x160;Ă&#x153;Â&#x2C6;Ă&#x152;Â&#x2026;Ă&#x160;- Ă&#x2030;- 

UĂ&#x160;{ÂŁĂ?Ă&#x160;"ÂŤĂ&#x152;Â&#x2C6;V>Â?Ă&#x160;<Â&#x153;Â&#x153;Â&#x201C; UĂ&#x160;-Ă&#x2022;ÂŤiĂ&#x20AC;Ă&#x160;"ÂŤĂ&#x152;Â&#x2C6;V>Â?Ă&#x160;Â&#x201C;>}i Ă&#x160;Ă&#x160;Ă&#x160;-Ă&#x152;>LÂ&#x2C6;Â?Â&#x2C6;â>Ă&#x152;Â&#x2C6;Â&#x153;Â&#x2DC; UĂ&#x160;+Ă&#x2022;Â&#x2C6;VÂ&#x17D;Ă&#x160; Â&#x2026;>Ă&#x20AC;}iĂ&#x160;Â&#x2021;Ă&#x160;£äÂ&#x201C;Â&#x2C6;Â&#x2DC;Ă&#x160;VÂ&#x2026;>Ă&#x20AC;}i Ă&#x160;Ă&#x160;Ă&#x160;}Â&#x2C6;Ă&#x203A;iĂ&#x192;Ă&#x160;Ă&#x17D;äĂ&#x160;Â&#x201C;Â&#x2C6;Â&#x2DC;Ă&#x160;Ă&#x20AC;iVÂ&#x153;Ă&#x20AC;`Â&#x2C6;Â&#x2DC;}Ă&#x160;Ă&#x152;Â&#x2C6;Â&#x201C;i UĂ&#x160;Ă&#x201C;°Ă&#x2021;ÂťĂ&#x160;Ă&#x2022;Â?Ă&#x152;Â&#x2C6;Â&#x2021;Â&#x2DC;}Â?i Ă&#x160;Ă&#x160;Ă&#x160;7Â&#x2C6;`iĂ&#x192;VĂ&#x20AC;iiÂ&#x2DC;Ă&#x160;

-1Â&#x2021;Ă&#x17D;xää{Ă&#x201C;Ă&#x17D;Ă&#x160;-Â&#x2C6;Â?Ă&#x203A;iĂ&#x20AC;

 1 -Ă&#x160;fĂ&#x201C;x Ă&#x160;Ă&#x160;Ă&#x160;/Ă&#x160; , Ă&#x160;Ă&#x160;Ă&#x160;Ă&#x160;f

 1 -Ă&#x160;fĂ&#x17D;ä Ă&#x160;Ă&#x160;Ă&#x160;/Ă&#x160; , Ă&#x160;Ă&#x160;Ă&#x160;Ă&#x160;f

x{Â&#x2122;°

-1Â&#x2021;Ă&#x17D;xää{Ă&#x201C;ÂŁĂ&#x160;-Â&#x2C6;Â?Ă&#x203A;iĂ&#x20AC;Ă&#x160;Ă&#x160;-1Â&#x2021;Ă&#x17D;xää{Ă&#x201C;Ă&#x201C;Ă&#x160;,i`

Ă&#x17D;Ă&#x201C;Â&#x2122;°

 9Ă&#x160;/ Ă&#x160; -/Ă&#x160;* Ă&#x160;/"Ă&#x160;-"*U/ Ă&#x160;,/Ă&#x160;  ,Ă&#x160;/Ă&#x160;/ Ă&#x160;,/Ă&#x160;*, U Â&#x2122;Ă&#x2021;Ă&#x2021;Ă&#x160;*>Ă&#x20AC;Â&#x17D;Ă&#x160;,Â&#x153;Ă&#x17E;>Â?Ă&#x160;-Â&#x153;Ă&#x2022;Ă&#x152;Â&#x2026;

6 "16 , Ă&#x2C6;ä{Â&#x2021;Ă&#x2021;Ă&#x17D;Ă&#x2C6;Â&#x2021;Ă&#x17D;{Ă&#x2C6;ÂŁ 7 -/Ă&#x160;6 "16 , Ă&#x2C6;ä{Â&#x2021;Â&#x2122;Ă&#x201C;xÂ&#x2021;££än  "/-",

-iĂ&#x203A;iÂ&#x2DC;Â&#x153;>Â&#x17D;Ă&#x192;Ă&#x160;-Â&#x2026;Â&#x153;ÂŤÂŤÂ&#x2C6;Â&#x2DC;}Ă&#x160; iÂ&#x2DC;Ă&#x152;Ă&#x20AC;i

Ă&#x2C6;ä{Â&#x2021;xxĂ&#x2021;Â&#x2021;ääĂ&#x201C;Â&#x2122;

Ă&#x201C;äĂ&#x2C6;ÂŁĂ&#x160;>Ă&#x20AC;Ă&#x203A;iĂ&#x17E;Ă&#x160;Ă&#x203A;iÂ&#x2DC;Ă&#x2022;i

7

Â&#x203A;xÂ&#x2021;£ääxĂ&#x160; Ă&#x20AC;Â&#x153;>`Ă&#x160;-Ă&#x152;Ă&#x20AC;iiĂ&#x152;

 "7  Ă&#x201C;xäÂ&#x2021;Ă&#x2021;Ă&#x2C6;Ă&#x201C;Â&#x2021;Ă&#x201C;Ă&#x201C;Ă&#x201C;ÂŁ 6 /", Ă&#x201C;xäÂ&#x2021;Ă&#x17D;nĂ&#x17D;Â&#x2021;Ă&#x2021;{{Ă&#x17D;


www.vernonmorningstar.com

Friday, March 19, 2010 - The Morning Star A19

News

Dave

ALL EARS

Knows Homes

View more listings at

www.RealEstateinVernon.com

Phone: 250-558-SOLD (7653)

00

9,9 2 5 $

NEW LISTING! 4130 Camelback Turtle Mountain 3 bed + den / 1196 + 1196 sqft This Fabulous New TRICO Home is the most affordable home at prestigious Turtle Mountain. Incredible view reaching across the city lights to Camelshump Mountain and Okanagan Lake. MLS®

Dave DeShane

Real Estate Agent • Journeyman Carpenter Award Winning Experience!

ALLIANCE REALTY

ENJOY A GIRLS NIGHT OUT FRIDAY, APRIL 9TH – SATURDAY, APRIL 10TH

Bring Your Girlfriends

LISA VANDERVELDE/MORNING STAR

IMPORT & DOMESTIC VEHICLES

Madison Edgar, three, (from left) Katie Jones, four, and Paige Edgar, five, react to the book as they listen to story time at the Vernon library Wednesday afternoon.

to Predator Ridge for a retreat full of fun, food and fashion. Luxurious accommodation Welcome wine & cheese Three course dinner & MARTINI luge Shopping booths with local boutique vendors, belly dancing demo & more… Nature walk, pool, hot tub, steam, or a fitness class Brunch & Fashion Show A wide variety of activities – too many to list! Bring your mom, your sister, your daughter, your best friends.

• • • • • • 4407 27th St., Vernon, BC

250-542-2324 1-800-663-6430

DLR #6371

Insurance Appraisals Unibody Frame Specialists Guaranteed Color Matching Frame Straightening Windshields & Windows Lifetime Warranty

FREE ESTIMATE COURTESY CARS

Weekend packages starting from $179* per person.

CALL TODAY TO BOOK 250. 542.3436 GO TO PREDATORRIDGE.COM FOR MORE DETAILS *Based on availability. Taxes and gratuities extra.

Check us out online at at www.livingwoodfloors.com

Venetian Tile ®

5207-24th Street (1 block south of Walmart) • 250-545-4900


PLEASE READ THE FINE PRINT: Offers on approved credit from Toyota Financial Services (TFS) of 0% finance rate for 48 months are available on 2010 Yaris Hatchback, 2010 Yaris Sedan, 2010 Corolla, 2010 Matrix and 2010 RAV4 and 0% finance rate for 60 months on 2010 Camry. * 2010 RAV4 2WD ZF4DVP(A) MSRP is $26,215 and includes $1620 freight and pre-delivery inspection, tire levy, battery levy and air conditioning federal excise tax. Lease example: 3.9% Lease APR for 48 months. Monthly payment is $329 with $1888 down payment. Total lease obligation is $17,680 Lease 48 mos based on 96,000 km, excess km charge is $.10. **2010 Corolla BU42EM (A) MSRP is $17,810 and includes $1350 freight and pre-delivery inspection, tire levy, battery levy and air conditioning federal excise tax. Lease example: 1.9% Lease APR for 48 months. Monthly payment is $199 with $1758 down payment. Total lease obligation is $11,310. Lease 48 mos based on 96,000 km, excess km charge is $.07. †Cash back offer valid on retail delivery of select new unregistered Toyota vehicles, when purchased or leased from a Toyota BC dealership. Vehicle must be leased, registered and delivered by March 31, 2010. †† Toyota Loyalty Program (TLP) applies to current registered owners of Toyota vehicles. Current Toyota owners can have the applicable TLP discount taken off the price of any new vehicle purchase. Customer does not have to trade in a Toyota, they must only be a current registered Toyota owner. This offer is also transferable to immediate family members with whom they are domiciled. Proof of current address and registration/insurance/lease is required. TLP may only be applied one per each eligible Toyota vehicle owned. Applicable TLP discount offers are as follows: $500 on Yaris, Corolla, Matrix, Tacoma, RAV4 and Venza, $750 on Camry, Avalon, Sequoia, Camry Hybrid and Prius and $1000 on Tundra, FJ Cruiser, Highlander and Highlander Hybrid. Offer valid until March 31, 2010. License, insurance, registration and taxes are extra for all lease and finance offers. Offer valid until March 31, 2010. Visit your Toyota BC Dealer or www.toyotabc.ca for more details. Some conditions apply; offers are time limited and may change without notice. Dealer may lease/sell for less. In the event of any discrepancy or inconsistency between prices, rates and/or other information contained in this advertisement (or on toyotabc.ca) and that contained on toyota.ca, the latter shall prevail. Errors and omissions excepted.

A20 Friday, March 19, 2010 - The Morning Star www.vernonmorningstar.com

$

1000

0 %

60 months

Toyota Loyalty Program

††

purchase financing up to

$

$ per mo./ at 3.9% /48 mo. lease*

fuel-efficiency rebates

up to

1000 off

329

$

lease from

2010

corolla ce

months:

2010

26,215

purchase from

RAV4 2wd

$

cash back†

%

0

500

60

48

2010 Camry 2010 Yaris, Corolla, Matrix & RAV4

$

199 lease from

per mo./ at 1.9% /48 mo. lease**

$

17,810

purchase from

months:

any new Toyota for current owners

toyotabc.ca

HILLTOP TOYOTA

KELOWNA TOYOTA

SUN COUNTRY TOYOTA

PENTICTON TOYOTA

VERNON TOYOTA CENTRE

2350 Trans Canada Highway NE, Salmon Arm, BC (250) 832-9433

1200 Leathead Road, Kelowna, BC (250) 491-2475

1355 Cariboo Place, Kamloops, BC (250) 828-7966

2405 Skaha Lake Road, Penticton, BC (250) 493-1107

3401 48th Ave, Vernon, BC (250) 545-0687


www.vernonmorningstar.com

Friday, March 19, 2010 - The Morning Star A21

News Big scholarships up for grabs through newspaper association Morning Star Staff

The British Columbia and Yukon Community Newspapers Association (BCYCNA) will award some of the largest scholarships in B.C. and Yukon again this year. Scholarships of $3,500, $1,000, and $500 will be awarded to the three students who best answer the question â&#x20AC;&#x201C; â&#x20AC;&#x153;How could your local paper partner with the youth in your community to make a positive difference?â&#x20AC;? Students must submit a 500-word essay to The Morning Star by April 23, 2010. One local finalist will be chosen. The finalistsâ&#x20AC;&#x2122; essays will then be forwarded to the BCYCNA where the top three scholarship winners will be selected. B.C. and Yukon high school grads are eligible for $5,000 in scholarships, making them some of the most accessible awards available. â&#x20AC;&#x153;The BCYCNA is pleased to once again provide graduating high school students across BC and Yukon with the opportunity to receive considerable scholarship awards,â&#x20AC;? said Scott Nelson, president of the BCYCNA. â&#x20AC;&#x153;One of BCYCNAâ&#x20AC;&#x2122;s member initiatives is to be able to make this kind of contribution to the young people who live in the communities we serve.â&#x20AC;? The three scholarships will be awarded to the winners at their graduating ceremony by a representative of their local community newspaper. Another scholarship is available to prospective female journalists. A $2,500 scholarship is provided through the generosity of the late Evelyn A. Caldwell, known to generations of Vancouver Sun readers as â&#x20AC;&#x153;Penny Wise.â&#x20AC;? The recipient will be enrolled in the one-year certificate program in journalism at Langara College. The program runs full-time from September to mid-April and any woman at least 19 years old who is a B.C. resident and can demonstrate an interest in journalism is eligible. You must also submit transcripts of your high school, college or univer-

sity grades along with an 800-1,000-word essay on why you want a career

in journalism. Samples of your published work and supporting letters from

teachers and editors may enhance your chances. Applications must be

received in the BCYCNA office by April 30. Mailing address is: Penny

Wise Scholarship, B.C. and Yukon Community Newspapers Association,

122-1020 Mainland Street, Vancouver, B.C. V6B 2T4.

7B¸AG=C@E339B=A/D3 /BB630/GD3@<=< 4`WROg;O`QV'bVb]BVc`aROg;O`QV #bV

$=44



&'

''

8/;73=:7D3@^QSabOW\ZSaaabSSZ eWbVQ]^^S`P]bb][Q]]YeO`SaSb @SU%''''

bVWa E3393<2 =<:G

;O`'bVb];O` ab

#



 #=44

"''' 63<193:A7\bS`\ObW]\OZ 

1ZOaaWQ$^QSY\WTSaSb

"



# =44 27AB7<1B:G6=;3 

=44

;79/A/ abS[eO`SUWTbeO`S =TT]c``SUcZO`^`WQSa

Ac^W[Ob]eSZa

/:A= #=44 5:C19AB37<6=;3 b]eSZaPObV[Oba

@SU%"''

/:A= #=44/ZZ]bVS`Y\WTSPZ]QY aSbaY\WTSPZ]QYaO\RY\WdSaPg 63<193:A1C7A7</@B

3fQZcRSaPSOQVb]eSZa

# % /ZZZcUUOUSPg 

=44

/ZZQ]]YeO`SaSba



=44

/:A= #=44

23:A3GD7/@/7: AE7AA53/@/B:/<B71 @SU"#!%# AOZS  ## 3fQZcRSaWbS[aeWbV'%Â?^`WQSS\RW\Ua

=TT]c``SUcZO`^`WQSa

/ZZ]^S\ab]QYQ]]YeO`S 3fQZcRSa/ZZ1ZOR1W`QcZ]\1]\bS[^] =TT]c``SUcZO`^`WQSa

!



=44

27AB7<1B:G6=;3 !#bV`SORQ]c\b>W[O Q]bb]\aVSSba^WZZ]eQOaSa

=TT]c``SUcZO`^`WQSa

=TT]c``SUcZO`^`WQSa

# % 



=44

/ZZZcUUOUS

@SU #"AOZS  3fQZcRSaWbS[aeWbV'%Â?^`WQSS\RW\Ua

"



=44

/ZZe][S\¸aP]fSRP`Oa P`WSTaPgE=<23@0@/ O\RE/@<3@¸A

! =44 /ZZe][S\¸aRS\W[Pg 

ABG:31=Â&#x2014;6/55/@ 9/@3<A1=BB /dOWZOPZSW\^SbWbS`SUcZO` /P]dS/dS`OUSaWhSa 3fQZcRSaWbS[aeWbV''Â?^`WQSS\RW\Ua =TT]c``SUcZO`^`WQSa

!



=44

/ZZ[S\¸aQOacOZ^O\ba Pg2=193@A 6C2A=<<=@B6  Â&#x2022;

@SU$#& 3fQZcRSaWbS[aeWbV''Â?^`WQSS\RW\Ua

 ! =44 /ZZ[S\¸aQOacOZ

0CG53B

/dOWZOPZSW\]c`QOacOZ ]cbS`eSO`RS^O`b[S\b =TT]c``SUcZO`^`WQSa

c\RS`eSO`

]cbS`eSO`

=TT]c``SUcZO`^`WQSa

 $ =44 ;S\¸aAB/<473:2¸A

$'''



/ZZ[S\¸aaV]SaPg 2=193@A @330=9 AB/1G/2/;A<793

ASQ]\RWbS[[cabPS]TS_cOZ ]`ZSaaS`dOZcS =TT]c``SUcZO`^`WQSa

@SU&''' 

#



:/AB!2/GA3<2AAC<2/G;/@16

AB

RECEIVE YOUR FREE 7-PIECE GIFT FROM ESTĂ&#x2030;E LAUDER =<:G/BB630/GE7B6/<G3ABp3:/C23@ >C@16/A3=4! =@;=@3´E=@B6=D3@'

=44

Yb"Yb&YbU]ZR RWO[]\RUS[ab]\S QcPWQhW`Q]\WO QcZbc`SR^SO`ZXSeSZZS`g =TT]c``SUcZO`^`WQSa 3fQZcRSa3dS`gROg>`WQSR7bS[a ;O\cTOQbc`S`a¸A^SQWOZa344GÂ&#x2014;:Oab1OZZ

=TTS`U]]ReVWZSac^^ZWSaZOab?cO\bWbWSaO`SZW[WbSR=\SUWTbb]OQcab][S`0ST]`SbOfSa DOZcSaO`SPOaSR]\]c`^S`[:O\R]`U^`WQST]``SUcZO`aWhSR^`]RcQba

bOYSV][S POUa[OaQO`O



QV]]aSg]c`ZW^SgSQ]Z]c`a



QV]]aSg]c`aYW\QO`S

bVSPOgQ][

Selection will vary by store. Savings are off our regular prices, unless otherwise specified. Everyday Bay Value, just-reduced, Power Buys, Managerâ&#x20AC;&#x2122;s Specials, licensed departments, Salviati, Vera Wang and Hbc Foundation charity merchandise are excluded. When you see â&#x20AC;&#x153;POWER BUYâ&#x20AC;? or â&#x20AC;&#x153;Managerâ&#x20AC;&#x2122;s Specialâ&#x20AC;? you will know we have found an exceptional deal to pass on to you. We may tell you the COMPARABLE VALUE on the price ticket and/or a sign, so you will see the price another retailer in Canada charges or would likely charge for the same or a comparable value item. Quantities of our Power Buys and Managerâ&#x20AC;&#x2122;s Specials and items located in any â&#x20AC;&#x153;Style Outletâ&#x20AC;? in-store departments are limited and may vary from store to store â&#x20AC;&#x201C; no rain checks or substitutions. When we say â&#x20AC;&#x153;PRICE CUTâ&#x20AC;?, we mean the existing everyday price is being lowered temporarily. See in-store for details.


Morning Star Staff

The annual election of half of the board of directors will be one of the major items during the Downtown Vernon Association’s annual general meeting March 24. Nominations for candidates closed March 11 and the nominating committee will put

UP TO

$

$

bcford.ca

its recommendation forward at the meeting. Nominations will also be taken from the floor. “As volunteers with a compelling interest in the success of downtown Vernon, the board of directors keeps the DVA bus from crossing the centre line,” said Earl Hansen, executive director.

$

WORTH OF NO EXTRA CHARGE GENUINE FORD ACCESSORIES

1000 + 8000 †

2010 RANGER SPORT 4X2

PURCHASE FOR ONLY

15,999

*

Offer includes $6,000 in price adjustments and air tax & freight of $1,500.

1,000 OFF

$

2010 F Fusion i

“By having half the seats come up for election each year we have a good mix of experience and enthusiasm to face any of the issues that will arise over the coming year.” Other items on the agenda will include reports from the DVA president and the staff, an auditor’s report on the finances of the DVA

MAKE YOUR TRUCK YOUR TRUCK. 2010 F-150 XLT SUPERCAB 4X4

WITH AIR, AUTOMATIC, V8 AND MORE! PURCHASE FOR ONLY

$

29,499 $ 399@8.99%

2010 F-150 REGULAR CAB

PURCHASE FOR ONLY

20,499

*

Offer includes $5,000 in price adjustments and air tax & freight of $1,500.

2010 Taurus

2010 Escape

*

OR LEASE FOR ONLY

$

$

‡‡‡

HURRY INTO YOUR BC FORD STORE TO MAKE YOUR TRUCK YOUR R TRUCK TRUCK. **

Per month for 48 months with $4,600 Down. $0 Security Deposit. Offers include $9,400 in price adjustments and air tax & freight of $1,500.

LAPR

CUSTOMIZE YOUR TRUCK WITH

††

UP TO

IN PRICE ADJUSTMENTS

WITH THE PURCHASE OR LEASE OF MOST NEW 2010 FORD TRUCKS ON SELECT NEW 2010 FORD VEHICLES

CHOOSE FROM OVER 150 ACCESSORIES

2010 F F-250 250 TO F F-450 450 SUPERDUTY

RECEIVE A PRICE ADJUSTMENT OF

8,000

††

On all new 2010 Superduty. Excluding Chassis Cab models.

LIMITED TIME OFFER ON MOST 2010 FORD VEHICLES.▲

MEMBERS GET AN ADDITIONAL

VISIT FORDCOSTCO.CA OR YOUR LOCAL DEALER FOR DETAILS.

2010 F-150

†††

WISE BUYERS READ THE LEGAL COPY: Offers available at participating dealers only. Dealer may sell or lease for less. Factory order may be required. Limited time offers. Offers may be changed or cancelled at any time without notice. Some conditions apply. See participating Dealer for details. †Offer valid from March 2, 2010 to April 30, 2010 (the “Program Period”). Receive up to $1,000 of selected Genuine Ford accessories at no extra charge with the purchase or lease of any new 2010 Ford F-150 (excluding Raptor), Sport Trac, Ranger, or Super Duty delivered or factory ordered between March 2, 2010 and April 30, 2010. Taxes payable on total price of the vehicle, including accessories. Offer is subject to vehicle and accessory availability. Dealer may sell for less. $1,000 is not redeemable for cash and can only be applied to Genuine Ford accessories. This offer applies up to a maximum of $1,000 worth of accessories. Total accessories may exceed $1,000. Factory installed accessories are not eligible under this offer. Only one offer may be applied toward the purchase or lease of an eligible vehicle. This offer can be used in conjunction with most retail consumer offers made available by Ford of Canada at the time of factory-order or delivery purchase/lease (but not a combination of both). This offer is combinable with the Commercial Connection Program. This offer is not combinable with CPA, GPC, Daily Rental Allowances, the Commercial Fleet Incentive Program (CFIP), or the A/X/Z/D/F Plan Program. Rainchecks available on factory orders. Limited time offer. Offer may be cancelled at any time without notice. Some conditions apply. Offer available to residents of Canada only. Accessories may not be exactly as shown. See Dealer for details. ††Receive [$500] / [$1,000] / [$1,500] / [$2,000] / [$2,500] / [$3,000] / [$4,000] / [$4,500] / [$5,000] / [$6,000] / [$6,500] / [$7,000] / [$8,000] in price adjustments when you cash purchase, purchase finance or lease a new 2010 Ford [Transit Connect] / [Focus S/Explorer 4 door/F-450-550 Chassis Cabs GAS] / [F-350 Chassis Cabs GAS/F-450-550 Chassis Cabs Diesel] / [Fusion Hybrid/Escape Hybrid] / [Ranger Regular Cab FEL/Edge SE/Flex SE] / [Fusion S/Mustang Value Leader/Taurus SE] / [Fusion (SE/SEL/Sport V6)/Mustang V6 (excluding Value Leader)/ Mustang GT (excluding Shelby GT500)/Escape I4 Manual] / [Ranger Super Cab XL] / [Taurus (SEL/LTD/SHO)/Edge (SEL/LTD/Sport)/Flex (SEL/LTD)/Explorer Sport Trac 4x4/F-150 Regular Cab] / [Ranger Super Cab (Sport/XLT)] / [Expedition] / [F-150 Super Cab (4x4/4x2)/F-150 Super Crew (4x4/4x2)] / [F250-450 (excluding Chassis Cabs)] models. **Lease a new 2010 Ford F-150 SuperCab XLT 4x4 for $399 per month with 8.99% LAPR for up to 48 months on approved credit (OAC) from Ford Credit. Not all buyers will qualify for the lowest APR payment. Additional payments required: down payment of $4,600 or equivalent trade-in. Total lease obligation is $23,752.00, optional buyout is $12,524. Some conditions and mileage restrictions of 80,000km over 48 months apply. A charge of 12 cents per km over mileage restrictions applies, plus applicable taxes. All lease payments are calculated with no trade-in, $0 security deposit, plus administration fees, Fuel Fill charge, pre-delivery, registration, PPSA fees and applicable taxes [after total Price adjustment of $9,400 deducted (price adjustment includes $7,000 of delivery allowance and $2,400 price adjustment)]. Taxes payable on full amount of lease financing price after any price adjustment is deducted. Offer includes air tax & freight of $1,500, and excludes license, insurance, registration, PPSA, Fuel Fill charge, administration fees and all other applicable taxes. *Cash purchase a new 2010 Ford F-150 SuperCab XLT 4x4 with automatic/Ranger Super Cab Sport 4x2 with 5-speed manual transmission/F-150 Regular Cab XL 4x2 with automatic for $29,499/$15,999/$20,499 [after total price adjustment of $9,400/$6,000/$5,000 deducted (total price adjustment is made up of $7,000/$6,000/$5,000 delivery allowance and $2,400/$0/$0 price adjustment)]. Offer includes air tax & freight of $1,500, and excludes license, and insurance, registration, PPSA, Fuel Fill charge, administration fees and all applicable taxes. Taxes payable on full amount of purchase price. ▲®Registered trademark of Price Costco International, Inc. used under license. Offer valid from December 21, 2009, to March 31, 2010 (the “Offer Period”) to resident Canadian Costco members in good standing, active as at December 20, 2009. Use this $1,000 private Costco offer towards the purchase or lease of a new 2010 Ford Fusion (including Hybrid), Taurus, Mustang (excluding Shelby GT500), Edge, Escape (including Hybrid), Explorer, Explorer Sport Trac, Expedition, Flex, Ranger, F-150 (excluding Raptor), Super Duty (including Chassis Cab), E-Series, Transit Connect, Lincoln MKZ, Lincoln MKS, Lincoln MKX, Lincoln MKT or Lincoln Navigator. This offer is raincheckable, the new vehicle must be delivered and/or factory-ordered from your participating Ford Motor Company of Canada dealer within the Offer Period. Offer is only valid at participating dealers, and is subject to vehicle availability and may be changed or cancelled at any time without notice. Only one offer may be applied towards the purchase or lease of one eligible vehicle. Only one offer can be redeemed per eligible Costco member. This offer is transferable to immediate family members living within the same household as an eligible Costco member. This offer can be used in conjunction with most retail consumer offers made available by Ford of Canada at either the time of factory order (if ordered within the Costco program period – December 21st, 2009 to March 31st, 2010) or delivery, but not both. On applicable vehicles, this offer can also be combined with the Commercial Connection Program incentives and, for eligible customers, the Small Business Incentive Program (SBIP). For small fleets with an eligible FIN, this offer can also be used in conjunction with the Commercial Fleet Incentive (CFIP). This offer is combinable with the RCL program, but not combinable with any CPA/GPC or Daily Rental incentives. Customer may use the $1,000 as a down payment or choose to receive a rebate cheque from Ford Motor Company of Canada, but not both. Applicable taxes calculated before $1,000 offer is deducted. Visit www.fordcostco.ca for details. †††Most 2010 Ford vehicles, excluding 2010 Model LCF, F-650 and F-750, come with a 5 year/100,000 km (whichever occurs first) Powertrain Warranty and full Roadside Assistance benefits together with a 5 year/100,000 km (whichever occurs first) Safety Restraint Warranty. In addition, on all 2010 Model F-Super Duty vehicles equipped with the diesel engine, the Powertrain Warranty is extended to 5 year/160,000 km (whichever occurs first), which equals the diesel engine warranty. Some conditions and limitations apply. ‡‡‡See your Ford of Canada Dealer or contact SIRIUS at 1-888-539-7474 for more information. “SIRIUS” and the SIRIUS dog logo are registered trademarks of SIRIUS Satellite Radio Inc. Includes 6 month prepaid subscription.

A22 Friday, March 19, 2010 - The Morning Star www.vernonmorningstar.com

News

Downtown Vernon Association to elect new board and the presentation of the Spirit of Downtown Award for outstanding service. Doors open March 24 at the Elks Hall at 5:30 p.m. for the opening reception with the dinner at 6 p.m. Tickets to the AGM are $20 each and can be obtained by calling 250-5425851. RCMP Supt. Reg Burgess will speak.


www.vernonmorningstar.com

Friday, March 19, 2010 - The Morning Star A23

Sports

EDITOR: KEVIN MITCHELL

PHONE: 550-7902

E-MAIL: sports@vernonmorningstar.com

Snakes pumped for Penticton GRAEME CORBETT Morning Star Staff

Many looked at it as a simple tuneup to prepare for the B.C. Hockey League Interior Conference final. A minor inconvenience standing between the Vernon Vipers and a shot at defending the Fred Page Cup. Instead, the Snakes found themselves in a six-game grudge match with the feisty Quesnel Millionaires, who gave their all against the defending Royal Bank Cup champs. On the strength of back-to-back shutouts by Graeme Gordon, the Vipers clinched their best-of-seven Interior semifinal 4-2 Tuesday night at the Vault in Quesnel. Vernon, ranked second in the country, hosts the No. 3-rated Penticton Vees in Games 1 and 2 of the Interior final tonight and Saturday night at Wesbild Centre. Games 3 and 4 go Tuesday and Wednesday night at South Okanagan Events Centre. The Vees iced the Westside Warriors 4-2 in the other Interior semi, ending with a 4-3 overtime Game 6 thriller Tuesday at Royal LePage Place. Gordon, a North Vancouver product, turned in a 25-save showing as the Vipers iced the Mills 5-0 in Tuesday’s Game 6. The 20-year-old keeper backstopped the Snakes to a 4-0 Game 5 win a night earlier at Wesbild. “Those last two games were our best effort in the playoffs by far,” said Gordon, who admitted to feeling a bit rusty after missing 10 games with a lower-body injury late in the regular season. “I just went back to what worked for me – pre-game routine, focusing throughout the game. I’m feeling like a young Andrew Hammond now,” he added, laughing. Jonathan Milhouse, Sahir Gill, Cole Ikkala, Garrett Noonan and Connor Jones led the Viper offence with a goal and assist each in Game 6. Kellen Jones supplied two helpers. The Mills came out desperate, but the Vipers’ skill took over the game as they outshot Quesnel 45-25. “They really only had those two lines, and they were obviously tired from the series before (against the Salmon Arm SilverBacks),” said Gordon. After watching his team struggle with consistency, earning a split in the first four games, Vipers’ head coach Mark Ferner decided to juggle his lines, reuniting twins Connor and Kellen with Gill, and placing David Robinson on a line with Braden Pimm and Mike Collins. “Giller, Connor and Kell have kind of found their groove again. We just wanted to get a spark; we needed to let them know that we needed to get some guys going,” said Ferner. “It was a matter of time until we got our game back. In the last two games we were a lot better in certain areas.” Ferner compared the physicality of the Quesnel series to last year’s semifinal epic with Salmon Arm. “You’ve got to give them credit. They played a really hard series,” said Ferner. “This was a good thing for us. They didn’t make it easy on us and we needed that.” As the series wore on, Ferner says it was the Vipers’ depth and experience that made the difference. It is something the Snakes will be relying on more as the post-season continues. “Our ability to roll four lines wears teams down, especially in a seven-game series. We’re prepared to play seven hard games, and that’s the mentality you have to have,” he said. “The one thing we’ve got over other teams is the experi-

BLACK PRESS

The Millionaires’ Rylan Stanyer feels the full force of Dylan Walchuk’s (left) slap shot during Game 6 of the BCHL Interior Conference semifinal Tuesday night at the Vault. The Vipers won 5-0 to clinch the best-of-seven series 4-2. The Snakes host the Penticton Vees in Game 1 of the Interior Conference final tonight at Wesbild Centre. ence of winning a Royal Bank Cup. Our guys have what it takes to win.” Added Gordon: “I’d rather go six games than have a fourgame cakewalk and then head into Penticton thinking it’s going to be easy.” Given the two team’s regular-season rivalry (they split the series 3-3), Ferner is expecting fireworks with the Penticton series, especially with both teams back at full strength. “Finally, they are healthy. We want to play the best team out there at their best, and we feel that’s Penticton. I’m sure they’re saying the same thing. “It should be a very entertaining series. Fans will be in for a treat.” Said Vees’ head coach Fred Harbinson: “It’s two teams that know each other well. It has been a tight series all year and we’ve had success in their building, so we feel confident going in there this weekend. We feel like we’re in a good place. “Both teams are filled with talented players, so it’s going to be awesome for fans and for the BCHL,” he added, suggesting these could be two of the most gifted teams in BCHL history. SNAKE BITES: The SilverBacks have fired first-year head coach Matt Hughes. A native of Kamloops, Hughes was an assistant coach beside Rylan Ferster for two years before taking over bench boss duties. Former Viper and Kamloops Blazer coach Troy Mick, now with the KIJHL finalist Revelstoke Grizzlies, is considered a leading candidate for the Salmon Arm opening... The Alberni Valley Bulldogs will face the Powell River Kings in the Coastal Conference final. The Dawgs stopped the host Nanaimo Clippers 5-2 Tuesday night at Frank Crane Arena to earn a 4-2 decision in their semifinal. The Kings swept the Langley Chiefs in four straight in the other Coastal semi...The Alberta League semifinal series start Saturday with the nation’s

Research saves lives.

Our Prices Can’t Be Beat!

Please give.

REFRIGERATOR

KitchenAid Architect Counter Depth Regular Price $3699.99 — SAVE $1700.00

Our Everyday Low Price

$

199999

Smart Choice LIQUIDATORS 3124 - 30th Avenue, Downtown Vernon • 250-549-5010

No. 1 Spruce Grove Saints meeting the Camrose Kodiaks, and the No. 17 Okotoks Oilers facing the Fort McMurray Oil Barons, who upset ex-Viper coach Mike Vandekamp’s Grande Prairie Storm in the quarters. The Oil Barons received an honourable mention in the final CJAHL rankings.

vs INTERIOR CONFERENCE FINAL Game 1: Game 2: Game 3: Game 4: Game 5*: Game 6*: Game 7*:

DATE Tonight Saturday, March 20 Tuesday, March 23 Wednesday, March 24 Friday, March 26 Saturday, March 27 Sunday, March 28

LOCATION Wesbild Wesbild Penticton Penticton Wesbild Penticton Wesbild

*If necessary ** All games 7 p.m. start

LIBERTY HOUSE WATCH PIDS GUTTER SERVICE LTD. We Take Care When You’re Not There! For information call the House Watch Team Claudia and Ulrike

260-0174 or 260-0155

ASK ABOUT SPRING AND NEIGHBOURHOOD SPECIALS

CONTINUOUS 5” FACIA GUTTERS FREE ESTIMATES GUTTER GUARD

BEAT THE HST!

15 YEARS SERVING VERNON & AREA Ryan Williamson - Owner/Operator

Ph: 250-503-2292 • Cell: 250-308-6944 • Fax: 250-503-2392


A24 Friday, March 19, 2010 - The Morning Star

www.vernonmorningstar.com

Sports CALENDAR FRIDAY

at 6 and 8 p.m., North Kelowna Campus Gym.

JUNIOR A HOCKEY – Vipers vs Penticton Vees, Game 1 in best-of-seven BCHL Interior Conference final series, 7 p.m., Wesbild Centre. COLLEGE HOOPS – Canadian women’s championships, semifinals

SATURDAY JUNIOR A HOCKEY – Vipers vs Penticton Vees, Game 2 in best-of-seven BCHL Interior Conference final series, 7 p.m., Wesbild Centre.

VERNON TRACK & FIELD CLUB First Day/ Registration Wednesday March 31st Practices: Monday & Wednesday 6 - 7:30pm Saturday 10:00am - noon Ages: 9 years to Masters

www.vernontrackandfield.com

Group Golf Lessons STEVE SHULHAN PHOTO

Madison Kaneda (above) takes a piece of provincial history after helping the UBC Okanagan Heat claim the BCCAA women’s basketball championship in Nanaimo; Right: Kaneda (right), a Fulton Maroon grad, drives by Charlotte Lau of the Quest Kermodes in BCCAA action.

Kaneda cooks up Heat title KEVIN MITCHELL Sports Editor

Officially, Maddie Kaneda is studying second-year sciences at UBC Okanagan University. Unofficially, the 19-year-old is taking Hoops 101. The slick shooting guard will play her heart out for the Heat in the Canadian Collegiate Athletics Association women’s basketball championships this weekend in Kelowna. The Fulton Maroons grad will then finish school and prepare for a summer gig working at a basketball camp somewhere in the U.S. “I’ll be coaching at a camp starting June 18 but I don’t even know where it is,” she laughed. “All I know is it’s called Camp Dandee.” A major gym junkie, Kaneda had a splendid sophomore season as the Heat won the provincial title last weekend at Vancouver Island University in Nanaimo. The 5-foot-8 hustler made great plays at both ends of the court as the Heat stopped Victoria’s Camosun Chargers 69-67 in the final. Kaneda drained 16 points, grabbed seven rebounds and recorded two steals as the Heat upended the host Mariners 75-70 in the semis. UBC Okanagan goes into the eight-

team nationals ranked fourth and they met the fifth-rated Cégep de Sainte-Foy Dynamiques of Quebec in their opener Thursday night. “They won nationals the last two years but this year they lost to Dawson (College Blues of Ontario) so they got a wildcard berth,” said Kaneda. “It should be a good game.” The Dynamiques are known as a physical team and according to Heat coach Heather Semeniuk, “There is more than just the physical play, these are the twotime champs, they have many weapons. However, if we stick with our style of play and push the ball, run, and maintain pressure on defence, we will be able to compete at their level.” The Heat have come on strong in the second half of the season, winning the last six games of the season to claim the BCCAA championship. They were ranked No. 11 in January before finding their groove. Katie Woodman and Meghan McGill were both named to the provincial all-star team and are expected to play key roles at the nationals. Semeniuk has high hopes for her girls, and the Heat will be relying on their strong team play to make a long run. “We have to play our best game and

improve on each performance. Also, if we can get good support from our bench and not let the pressure of playing in front of friends, family, and a home crowd affect our performance we can come out on top. “We’ve been doing a lot of shooting drills lately, and will be relying on our outside shooting to cause problems for other teams, but most importantly, we will be taking it one opponent at a time and not worrying about who we might have to face at the end. We have been playing our best ball of the season lately, and if we can keep it up, expect something special.” Kaneda, who will switch to kinetics studies next year (likely at a CIS school) realizes what it takes for the Heat to be at their best. “We push the ball and run a fast-paced game and play hard defence and that leads to good offence.” The Sheridan College Bruins of Ontario are ranked No. 1. The SAIT Trojans of Edmonton are No. 3. Sheridan met Camosun Thursday night with the winner facing either the Dynamiques or Heat in tonight’s semifinal. Festivities began with a banquet and awards ceremony Wednesday night, where the CCAA Player-of-the-Year and national all-star teams were named. Follow the tournament at www.goheat.ca/nats.

Hill earns Neil Daffern up-and-comer award Morning Star Staff

Kevin Hill’s breakthrough snowboard season has not gone unnoticed. The 23-year-old Vernon product was recently honoured with the Neil Daffern Memorial Award, meant to recognize up-and-coming elite riders who have demonstrated an exemplary level of perforKevin Hill mance or commitment

to the sport. Hill, who narrowly missed his Olympic nomination, was instead a forerunner with the Canadian men’s snowboard cross team at the Vancouver Games. He shared the award with halfpipe rider Palmer Taylor of Collingwood, Ont. Both riders are members of the Canada Snowboard National Development Group and will receive $5,000 in financial assistance to help them on their journey. Hill, who is also a pro BMX racer, has shown steady progression in snowboard

cross. In 2010, Hill qualified for the finals in each of his five world cup starts. At the world cup event in Stoneham, Que., he posted a career-high sixth-place finish. A member of the provincial team, Hill has cracked the top-12 in three of his last four world cup races. Taylor, the youngest rider on the Canadian Olympic team at 17 years of age, placed 26th in women’s halfpipe. She was ninth at the U.S. Snowboarding Grand Prix in Copper, Colo.

See VERNON TRIO on A27

DATES Mon. April 12th 10am, 5:30pm or 6:30pm Tues. April 13th 10am or 5:30pm Wed. April 14th 10am, 5:30pm or 6:30pm

AL PISCH CPGA Head Professional

• 25 Years Experience • Voted Best Golf Pro in Okanagan Life Magazine

$

COST: 99+tax 4 - One Hour Lessons

TIP OF THE WEEK

Fees payable by Sun., Apr. 4

Remember that practice does not make perfect. Perfect practice makes perfect!

SSpallumcheen Golf & Country Club 250-545-5824

T

N E M E C N U ANNO

Management and staff at VERNON TOYOTA would like to welcome

MARK JONES

to their sales team! Mark brings over 12 years of automotive experience and looks forward to finding the right vehicle for you! Mark invites you to stop by VERNON TOYOTA and looks forward to serving you! VERNON

TOYOTA

3401 - 48th Ave Fax: (250) 545-0662

DL# 30382

(250) 545-0687


www.vernonmorningstar.com

Friday, March 19, 2010 - The Morning Star A25

Sports

Kapak cruises to national berth Morning Star Staff

Vernon’s Connie Kapak far surpassed her No. 6 billing in the Midget girls division at the B.C. Speed Skating Championships last weekend in Dawson Creek. The 11-year-old speedster, the youngest in her division, collected three gold medals, four silver and one bronze. She improved her ranking to second overall and will now join a Prince George skater in representing B.C. at nationals, March 26-28 in Campbellton, N.B. “A great result considering her being the youngest skater of the age group,” said Kelowna’s Nancy Goplen, who coaches Kapak. While most competitors arrived the day before the competition, Kapak showed up early to practise with the Dawson Creek club to get familiar with the ice conditions. Goplen says it probably made a difference. KEVIN MITCHELL/MORNING STAR

Vernon’s Yvonne Walker shows textbook form in her delivery at Lincoln Lanes.

Walker rolls 450 KEVIN MITCHELL Morning Star Staff

Her coach Ivan Soroka says she’s like a robot on the alley, tossing strikes and spares with ease. Yvonne Walker was actually feeling somewhat non-human when she rolled a dozen straight strikes last Wednesday night at Lincoln Lanes. She earned $2,800 for her second career perfect 450 game. “On my 11th (ball), my legs felt like Jell-O and on my 12th, I also felt like Jell-O,” said Walker. “I was pretty excited. I’m going to use the money to re-roof part of my house.” The 36-year-old Canadian Wholesale Club employee throws a hard, smooth ball in a sport she has enjoyed since her Youth Bowling Council days at the same alley. Encouraged by Five-pack teammates Martin Boulet (her husband) and Terri Hallstrom, Walker’s night didn’t start out all that sweet. “I was practising on the far side (lanes) and all I could get were letters. I moved to one and two and things starting going better. I was very relaxed and my teammates were quiet and just leaving me alone. The Conway team next to us was also very supportive.” Walker opened with a sizzling 328

on the strength of seven strikes in a row. She followed with the perfect game and capped things off with a 288 for a scorching 1,066 triple, 310 pins over her 252 average in the Wednesday 7-9 p.m. league. Her last perfect game came in 2005, on her last day as a staff member at Lincoln lanes, on lanes seven and eight. Walker has held the Lincoln house ladies high average since 1993. She has twice competed in the TSN Pins Game, making the quarterfinals once, and bowled in one CBC-TV Championship series. She won the provincial gold medal in the Coast Insurance Open and went on to claim the national title in Gatineau, Que., in 2004. Walker’s hot streak rubbed off her hubby as Boulet rolled a 405 in a league roll-off Wednesday. Her stepson, Jonathan, 14, bowls in Saturday YBC. The perfect game sponsors are: Authentic Plaques & Trophies; Quick Silver Delivery; Coldstream Auto; Interior Auto Wreckers; Lincoln Lanes; A&G Supply; Romei Plummer; Inspiration Homes; Willems Forest Products; Okanagan Irrigation; Ladies World; Nicklen Lake Resort; Kelly O’Bryans.

“The opportunity to represent the province made it an easy decision regarding the week of missed school and heavy travel,” said Pete Kapak, Connie’s father. Racing at nationals can be viewed at www. campbellton2010.com.

VERNON TOYOTA Your Lease Renewal Headquarters • New Leases • Lease Buyouts • Lease Takeovers • Fleet Lease Specials

CALL ERNIE, OUR EXPERIENCED LEASE ADVISOR TODAY!!

250-545-0687 OR TOLL FREE 1-877-590-8787

3401 - 48TH AVE, VERNON, BC • WWW.VERNONTOYOTA.COM

STOP YO-YO DIETING FOREVER

FREE INFO SESSIONS/ PAYMENT PLANS AVAILABLE

Lose weight dramatically & permanently

Learn the facts about nutrition, metabolism and hormone regulation to help change your life forever. NO pills, excessive exercise, protein shakes, packaged foods or injections. Call to attend our free info session and let us design a weight-loss program specifically for you!

Lisa lost 60 lbs in 5 months*

SureSlim

2010 R Vision 19’ Trailer • Rear corner bed with upper bunk • Air conditioning • Awning • Loaded, as new

®

Specially priced for Friday only …

$15,000

Since 1969

WELLNESS CLINIC

An individual program based on comprehensive blood tests & your medical history, followed up with personal consultations, make sure you can lose weight & keep it off.

FREE INFO SESSION

250-275-7546

(slim)

3306A 32 Avenue Vernon

www.sureslim.ca vernon@sureslim.ca

Sales & Service Ltd.

Are you having trouble managing your debt?

The Okanagan Equestrian Society invites you to attend an information session regarding Kin Race Track on Tuesday, March 23, 2010 at 6:00 pm to be held at the Village Green Hotel meeting room. Yes, after 117 years we are still in business and would like to let you know how things are going and what lies ahead for the future. Please come and listen, ask questions and support your historic horse racing park before it is too late.

DL#30382

The Farm Debt Mediation Service is a free confidential service that gives farmers access to financial experts who can help you, provide practical advice and prepare a recovery plan. Qualified mediators will help farmers and creditors work together to find mutually acceptable financial repayment arrangements. The Farm Debt Mediation Service will help farmers get their debt repayment back on track, including those who received a cash advance through the Advance Payment Program. To obtain more information Call: 1-866-452-5556

Visit: www.agr.gc.ca/fdms

When booking online, go to www.kenkraft.ca or call 250-545-5101 250 545 5101 kenkraftsalesltd@shaw.ca Dealer #5529


A26 Friday, March 19, 2010 - The Morning Star

www.vernonmorningstar.com

Gardner rules Super League Morning Star Staff

Sonja Gaudet of Team Canada throws the rock as Darryl Neighbour steadies her chair during Monday's round robin against Japan in wheelchair curling at the 2010 Winter Games at Vancouver Paralympic Centre.

wheelchair curling.” Armstrong’s Ina Forrest, 47, has been in a wheelchair for nearly half her life after being injured in a car accident caused by a drunk driver. Now second for Canada’s team skipped by Jim Armstrong of Richmond, she said she finds the sport a confidence builder and a lot of fun. “It’s a joy to be able to participate,” said Forrest, surrounded by her husband and their three children. The four top-ranked teams advance to the medal playoffs. Tiebreakers would go today with the semifinals set for Saturday morning. The bronze and gold-medal finals are set for 2:30 p.m. Several team members criticized the condition of the ice at the Vancouver Paralympic Centre as challenging and slow. “The ice has been very tough. We were hoping it would be faster,” said Thomas Wilhelm, manager of the Swedish team. Paralympic wheelchair curling differs from Olympic curling in that each team is required to have at least one member of the opposite sex. In addition, there are no sweeps and athletes are braced from behind by teammates as they release the heavy rocks, because while the chairs have brakes, “when you throw a lot of weight you might backslide,” said Forrest.

2008 Dodge Avenger - U4823 ............................ SOLD 2008 Dodge Ram 3500 Q/Cab Diesel - U4812 $31,988 2008 Dodge Ram 2500 Quad Cab - U4810 ....... SOLD 2008 Ford F150 Supercab 4X4 - U4811 ...........$19,995 2008 Ford F150 Supercrew - U4815 ................$21,988 2007 Dodge W2500 Quad SLT Diesel - U4769 $29,988 2007 Dodge Caliber SXT - U4653 ...................... $9,888 2007 Saturn Ion 3 - U4786................................$10,988 2007 Chrysler 300 Touring - U4785................... SOLD 2007 Hummer H3 - U4822 ................................$24,988 2007 Chevrolet Trailblazer - U4781 .................$15,988 2007 Ford F350 Crew Cab 4X4 Diesel - U4798 .$24,988 2007 Dodge Ram 1500 Quad Cab - U4806 .....$21,988 2007 Ford F350 Crew Cab 4X4 Diesel - U4819 $31,988 2006 Ford Ranger XLT 4X4 - U4742 ................$14,988 2006 Chevrolet 2500 Ext Cab LS 4X4 - U4749 $18,988 2006 Dodge Dakota 4X4 - U4765 .....................$18,988 2006 Chevrolet Malibu - U4794 ......................... $9,888 2006 Pontiac Pursuit - U4801 ............................ $8,988 2006 Jeep Commander - U4626 ......................$19,888 2006 Ford Freestyle - U4669-1 .........................$13,488 2006 Jeep Grand Cherokee - U4820 ...............$16,988 2006 Jeep Liberty Diesel - U4817 ....................$19,988 2006 Chevrolet Silverado K1500 - U4791 .......$19,888 2006 Chevrolet K3500 Crew 4X4 Diesel - U4828 $28,988 2006 Chevrolet Colorado - U4821 ...................$16,988 2006 Dodge Dakota Club Cab - U4799 ............. $9,888 2006 Chevrolet Silverado 1500 - U4795..........$23,988 2005 Chevrolet 1500 Ext Cab - KAL418 ..........$13,988 2005 Ford F350 Crew King Diesel - KAL456 ...$24,988 2005 Chevrolet Cobalt - KAL832 ........................ $7,488 2005 Chrysler PT Cruiser Convertible - U4587 $9,688 2005 Dodge SX 2.0 Sport - U4771 ..................... $5,988 2005 Honda Civic LX6 - U4693-1 ....................... $9,888 2005 Dodge Ram 3500 Quad Cab Diesel - U4816 $21,988 2005 Dodge Grand Caravan - U4797 ..............$10,988 2004 Chevrolet Crew Cab LS - KAL264 ...........$14,988 2004 Dodge Durango Limited - U4743............$15,988 2004 Ford Lightning SVT - KAL819 .................$28,995 2003 Dodge W3500 Quad Laramie Diesel - KAL1823 $19,888 2003 Buick Lesabre - KAL704 ............................ $7,988 2003 Dodge Ram 3500 Q/Cab Diesel - U4824 $16,988 2003 Dodge Dakota Club Cab - U4814 ............. SOLD 2003 Ford F350 Supercab 4X4 Diesel - U4813 $16,988 2003 Ford Windstar - U4788-2 ........................... SOLD 2002 Dodge Grand Caravan - U4727-1.............. $9,888 2002 Dodge Caravan - KAL202 .......................... $5,488 2001 Chrysler Intrepid - KAL863 ........................ SOLD 2001 Chevrolet C1500 Ext - U4827.................... SOLD 2001 Dodge Ram 2500 Ext Cab - U4784 ........... SOLD 2000 Chevrolet 2500 Ext Cab - KAL994...........$11,988 2000 Ford F350 Lariat Diesel - KAL357 ...........$17,988 2000 Chevrolet 1500 Ext Cab LS - KAL5249 ..... $9,888 2000 Volkswagen Cabriolet Conv - U4712-1..... $6,988 2000 Ford F350 DRW Diesel - KAL778 ............$14,988 2000 Ford F350 Supercab 4X4 Diesel - U4818 $15,988

www.swanlakemotor s.com

JENNA HAUCK/BLACK PRESS

Thursday night. Canada stopped Korea 6-4 and doubled Germany 8-4 Wednesday, improving to 7-1 atop the 10-team field. Their only loss came versus Sweden. The sport is making only its second appearance at the Games. Vernon’s Sonja Gaudet is the only returnee from Canada’s gold-medal showing at the 2006 Games in Turin. For Canada, being on home turf brings the support of a sea of red-clad fans in the crowd at the Vancouver Paralympic Centre, built specially for the Olympics and Paralympics. “We all love the crowd here, especially the enthusiasm of the kids,” said Gaudet, who plays lead. “But the noise takes some getting used to.” Canadian third Darryl Neighbour of Richmond said wheelchair curling gave him his life back after he fell from a roof in 2000 onto concrete while working on a construction site, leaving him a paraplegic. “I thought my life was over,” he told AFP as the Canadian team – winners of the 2006 gold medal – rolled off the ice after beating Great Britain 9-2 in the first session of round-robin competition. Neighbour, 61, began sports as physical therapy, “and wheelchair curling was the best therapy that could have happened,” he said. “I’ve traveled the world through

www.swanlakemotor s.com

for Anderson, while Brad Kuhn stepped in to help the Laface foursome. The Heath rink – skip Darren, his mother Sherry (third), Anderson (second) and Sam Van Iperen (lead) – suffered their first loss, falling 8-4 to New Westminster’s Dale Hockley Thursday afternoon. Heath (4-1), who met Tom Buchy (4-0) of Kimberley Thursday night, will end round-robin play this morning (9 a.m.) against Dave Belway of Salmon Arm. The final goes Saturday afternoon (2 p.m.). After opening with a pair of 7-6 wins over Chilliwack’s Bruce Renwick and Cloverdale’s Craig Lepine on Tuesday, Heath cranked up the offence, hammering New Westminster’s Todd Jones 8-3 and stuffing Williams Lake’s Bart Sawyer 10-4 Wednesday.

www.swanlakemotor s.com

enth end, capitalizing on a missed hit to score two. In the final end, Laface was heavy with his last shot, leaving Gardner with a routine draw to the eight-foot for the win. Gardner collected the $400 purse, while Laface pocketed the $250 runner-up prize. “It goes right back into the team account,” smiled Gardner, noting the cost of traveling to bonspiels adds up in a hurry. The Gardner foursome thanked sponsors Sladen Moore, Baron Insurance, Sunshine Honda, East Hill Physiotherapy, Safeway, Hi-Pro Sports and Butcher Boys. Laface is sponsored by Line X. Both rinks were missing a player, as Anderson and Laface second Darren Heath are competing together at the B.C. Mixed Championships this week in Chilliwack. Gardner coach Mark Longworth subbed in

www.swanlakemotor s.com

LISA VANDERVELDE/MORNING STAR

Skip Jon Gardner (left) and second Tyler Van Den Berghe (middle) team up to sweep Mike Longworth’s stone during the Capri Insurance Super League championships game Wednesday night at the Vernon Curling Club. Gardner earned an 8-7 win over Wayne Laface.

MEGA PRICE

www.swanlakemotor s.com

Defending champion Canada appeared headed to the playoff round in wheelchair curling at the Vancouver Paralympics going into its final preliminary game against Italy

FIaNrchA1L9 2& 2D0AYS! M

Canada curlers sizzle in round-robin Morning Star Staff/AFP

MEG A SALE

www.swanlakemotor s.com

Jon Gardner went from long shot to sure shot in the Capri Insurance Super League playoffs. The junior skip orchestrated a seven-game win streak, ending with an 8-7 win over veteran Wayne Laface in the championship game Wednesday night at the Vernon Curling Club. Gardner, 20, credits a lack of pressure for helping them relax down the stretch. His junior rink – third Mike Longworth and the front end of Tyler Van Den Berghe and Kyle Anderson – were a stone away from winning the B.C. Junior Men’s Championships over the Christmas holidays in Victoria. After that, he says they just played for fun. “After we got back from provincials, we just said we’d take it easy and have some fun. We didn’t put any pressure on ourselves and then we ended up winning four straight (to end the regular season). “It was really unexpected, but we just got on a roll and everyone pulled their weight and made it happen.” Laface got off to a great start, collecting three in the first end after Gardner missed an open hit. Laface stole a single in two, then forced Gardner to one in three. The junior rink mounted its comeback in the fifth end, drawing to the four-foot for a deuce. In the sixth end, both teams had plenty of rocks in play and Gardner missed a tapback, leaving Laface a tricky through a hole for two. However, the veteran skip ticked a guard to allow a steal of three, putting Gardner ahead by a point. “We just focussed on getting at least two points (in the fifth end) and then kept putting on the pressure. And then we were right back in it,” said Gardner, who is studying business at Okanagan College. Laface jumped back in front in the sev-

www.swanlakemotor s.com

Sports

www.swanlakemotor s.com

www.swanlakemotors.com

*Certified Sales Professionals *Full Time Business Manager

OPEN 6 DAYS A WEEK

www.swanlakemotors.com 6285 Hwy 97 N Vernon, B.C. (Across from Squires Pub) DL# 30886

250-260-2791

1-800-260-SWAN (7926)


www.vernonmorningstar.com

Friday, March 19, 2010 - The Morning Star A27

Sports

FREE INVASIVE PLANT TRAINING WORKSHOP! Join the province-wide “Spotters and Specialists” team and learn how to identify and report invasive plants on your property and in your community. Invasive plants are spreading rapidly across BC, impacting the environment, economy, and in some cases, human health and safety. We need your help to detect these “unwanted” invaders and prevent their further establishment. Join us for a free training workshop hosted by the North Okanagan Invasive Plant Committee and the Invasive Plant Council of BC on March 23 at 7PM held at the Regional District of North Okanagan boardroom, 9848 Aberdeen Road, Coldstream BC. At this special workshop, which was developed by the Invasive Plant Council of BC, participants will gain knowledge and understanding of invasive plants, how they are impacting communities in the North Okanagan, identification and how to report them. Join us and become a “Spotter and Specialist” for our region! For more information, and to register, contact the North Okanagan Invasive Plant Council Outreach Specialist at (250) 309-6745 or email outreachOK2@invasiveplantcouncilbc.ca Help us “Stop the Spread”!

BEST IN B.C.

SUBMITTED PHOTO

The Lumby Stars and coaches celebrate their Pee Wee Tier 4 provincial championship: Back (from left): Brian Williamson, Nick Stanhope, Logan Meier, Jeremy Glaim, Dale Nicholls, Evan Macaulay, Cody Bauml, Bobby Nicholls; Front: Owen Beliveau, Keenan MacDonald, Jagger Williamson, Jayden Pedersen, Shale Williamson, Zach Kuperous, Tyler Yule, Dean Whitcomb, Reid Hackett and netminder Jake Desilets.

Midget Reapers raid Coast Morning Star Staff

The shorthanded Vernon Talon Benefits Reapers prevailed in a tough three-day Richmond Spring Break Midget Hockey Tournament, clipping host Richmond 5-4 in a shootout Sunday. The weary Reapers, who had just nine skaters and a goalie, fell behind 3-0 in the first period on some bad bounces in the final. They clawed their way back to tie the game 4-4. Overtime solved nothing and the Reapers, behind the incredible goaltending of Tyler Yawney, finally won the shootout 2-1 over seven rounds. It was Richmond’s first loss of the season. Coaches Kevin Murphy and Rick Zoethout felt the gold medal reflected the mental toughness their players developed over a difficult season. In addition, wingers Mark Francis, Tanya Nijjar, Brett Anderson and Steve Deshane were relentless along the boards and in the corners, especially in the final where the battle for the puck raged ferociously. Wingers were assisted in these efforts by the Reapers’ two centres: Zach Anderson and Kelly Zoethout, who followed coaches instructions in providing second-man support all over the ice. Andrew Sisson, Brodie Homeniuk and Yanik Fillion-Murphy steadied the entire team with their solid work on the blueline and in the many crucial penalty kill situations. After opening with a 3-2 loss to Richmond, the Reapers stormed back to defeat Vancouver C1 15-3 before tying Oceanside of Parksville 3-3. The Reapers then finished off the round-robin by besting Vancouver C2 5-2 to gain a berth in the semifinals against Oceanside, who they beat 2-1. The Lumby Stars had an incredible Pee Wee House tournament in Winfield last weekend, los-

ing 1-0 to the Kelowna Avalanche in the final with a lucky bounce off a skate. Shane Meadahl was stellar with 31 saves. In the semifinals, the Stars brushed back the Vernon Five Star Awards Warriors 2-1 on goals from Dex Elders and Kevin Fuller. The Stars played a great defensive game led by Tyson Larson and Meadahl, who made 26 saves. Austin Caldwell had two assists. Lumby opened by tying the Avalanche 3-3 on goals from Caldwell, Fuller and Elders. Assists went to Tyson Larson, Connor Fair and Adam Sacht. Shane Meadahl handled the goaltending duties with 24 saves. Meadahl then recorded a 12-save shutout as the Stars iced the Kelowna Phantoms 3-0. Ashley Tinney and Shale Miller supplied superb defence, while Fair (2) and Fuller handled the offence. Lumby then stopped the host Winfield Bruins 6-1 in a rough and entertaining game. Jodi Whitcomb had a great defensive game causing numerous turnovers and Meadahl turned aside 22 drives. Elders (4), Caldwell (1+3) and Adam Sacht scored for Lumby. Meanwhile, Vernon’s Alex Gowie earned three assists as the Thompson Okanagan Female Midget AAA Rockets toppled the Kootenay Wildcats 8-2 in Sunday’s provincial final in Prince George. The Rockets earlier thumped the Vancouver Island Impact 9-1, bounced the Vancouver Fusion 5-2, grounded the Fraser Valley Phantom 6-2, outlasted the Prince George Cougars 10-6 and clipped the Wildcats 4-3 in preliminary action. The Rockets advance to the Pacific Regional playdowns, April 2-4, against the Alberta champions (still to be determined). The regional winner goes to the Esso Nationals in Regina.

Vernon trio qualifies for Spanish finals Continued from A24 On Thursday, Hill qualified for today’s final at the FIS world cup event in Molina, Spain with a 31st-place finish. François Boivin (Jonquière, Que.) was the top Canadian qualifier in seventh, while Drew Neilson (North Vancouver) and Tom Velisek (Squamish), both formerly of Vernon, were 14th and 29th respectively.

Meanwhile, Vernon’s Jon Versteeg rebounded from a nasty back injury to earn a $3,500 payday at the Telus Triple Challenge last weekend in Blue Mountain, Ont. After being shelved for four weeks with a transverse process fracture in his lumbar vertebrae, Versteeg, 20, earned first-place finishes in slopestyle and rail jam, and was runner-up in the big air event.


Morning Star Staff

The District of Lake Country is seeking public input on the community’s watershed and water supply March 25. The open house will be held from 4 to 8:30 p.m. at the municipal office. “The district has retained the services of

$

$

††UP

0%

TO APR PURCHASE FINANCING

‡‡‡

bcford.ca

Ecoscape Environmental Consultants to prepare the watershed assessment and protection plan for Vernon and Oyama Creek watersheds and Larratt Aquatic Consulting to prepare the source to tap assessment for the Kalamalka Lake intake and the Okanagan Lake intake,” said Jack Allingham, utility manager.

NAVIGATION SYSTEM

2010 FORD FOCUS S

14,449 PURCHASE FOR ONLY

*

OFFER INCLUDES $1,000 IN DELIVERY ALLOWANCE, $1,000 CUSTOM CASH AND $1,450 AIR TAX & FREIGHT.

OR RECEIVE

60

MONTHS

ON MOST 2010 FOCUS MODELS

$

20,499 PURCHASE FOR ONLY

††UP

0%

TO APR PURCHASE FINANCING

$ ,

The last step before the final reports are completed is an open house to enlist comments from the public for consideration of inclusion into the final reports. The open house will include 30-minute presentations of the final draft reports: ■ 4 and 6:30 p.m. Oyama and Vernon

MAKE YOUR CAR YOUR CAR.

2010 FORD FUSION S

18,949 PURCHASE FOR ONLY

*

OFFER INCLUDES $3,000 IN DELIVERY ALLOWANCE, $1,000 CUSTOM CASH AND $1,450 AIR TAX & FREIGHT.

VEHICLE SHOWN WITH OPTIONAL EQUIPMENT

$

1000 + 0 60 ††

CUSTOM CASH

%

APR

TOWARDS PURCHASE OR LEASE OR YOUR FAVOURITE OPTIONS OR ACCESSORIES ON MOST 2010 FORD CARS, SUV, AND CUV MODELS.

DVD HEADRESTS MOON ROOF

2010 FORD ESCAPE

PACIFIC EDITION

*

OFFER INCLUDES $4,000 IN DELIVERY ALLOWANCE, $1,000 CUSTOM CASH AND $1,500 AIR TAX & FREIGHT.

OR RECEIVE

60

$

MONTHS

ON MOST 2010 ESCAPE MODELS

1 000 OFF NOW EXTENDED!

MEMBERS GET AN ADDITIONAL

UP TO

PURCHASE FINANCING

ON SELECT 2010 MODELS.

MONTHS

CHOOSE FROM OVER 350 OPTIONS OR ACCESSORIES LEATHER SEATS

2010 FORD EDGE SEL FWD

28,999 PURCHASE FOR ONLY

*

OFFER INCLUDES $5,000 IN DELIVERY ALLOWANCE, $1,000 CUSTOM CASH AND $1,500 AIR TAX & FREIGHT.

RECEIVE A DELIVERY ALLOWANCE OF

ON ALL 2010 EDGE MODELS EXCLUDING SE

$

5,000

$

PLUS

CUSTOM CASH

1,000

BUT ONLY UNTIL MARCH 31

ST

ON MOST 2010 FORD VEHICLES VEHICLES. VISIT FORDCOSTCO FORDCOSTCO.CA CA

HURRY INTO YOUR BC FORD STORE TO MAKE YOUR CAR YOU YOUR UR CAR.

†††

WISE BUYERS READ THE LEGAL COPY: Offers available at participating dealers only. Dealer may sell or lease for less. Factory order may be required. Limited time offers. Offers may be changed or cancelled at any time without notice. Some conditions apply. See participating Dealer for details. ‡Offer valid from March 2, 2010 to April 30, 2010 (the “Program Period”). Receive up to $1,000 of selected Genuine Ford accessories, factory installed options, or Ford Extended Service Plan fees at no extra charge with the purchase or lease of a 2010 Ford Focus, Fusion, Mustang (excluding GT 500), Taurus, Escape, Edge, Flex, Explorer 4-DR, Expedition, E-Series, Transit Connect, and all Lincolns delivered or factory ordered between March 2, 2010 and April 30, 2010. Taxes payable on total price of the vehicle, including accessories, factory options, and Ford Extended Service Plan fees. Offer is subject to vehicle, accessory, and factory installed option availability. Dealer may sell for less. $1,000 is not redeemable for cash and can only be applied to Genuine Ford Accessories, factory options, or Ford Extended Service Plan fees. This offer applies up to a combined maximum of $1,000 worth of accessories, factory options or Ford Extended Service Plan fees. Total accessories, factory options, and Extended Service Plan fees may exceed $1,000. Only one $1,000 offer may be applied toward the purchase or lease of an eligible vehicle. This offer can be used in conjunction with most retail consumer offers made available by Ford of Canada at the time of factory-order or delivery purchase/lease (but not a combination of both). This offer is combinable with the Commercial Connection Program. This offer is not combinable with CPA, GPC, Daily Rental Allowances, the Commercial Fleet Incentive Program (CFIP), or the A/X/Z/D/F Plan Program. Rainchecks available on factory orders. Limited time offer. Offer may be cancelled at any time without notice. Some conditions apply. Offer available to residents of Canada only. Accessories may not be exactly as shown. See Dealer for details. ††Receive 0% APR purchase financing on all new 2010 Ford Focus (excluding S) / Escape (excluding I4 manual and Hybrid) for a maximum of 60 months to qualified retail customers, OAC from Ford Credit. Not all buyers will qualify for the lowest APR payment. E.g., $20,000 purchase financed at 0% APR for 60, monthly payment is $333.33, cost of borrowing is $0 or APR of 0% and total to be repaid is $20,000. Down payment on purchase financing offers may be required based on approved credit. All purchase finance offers include air tax & freight of $1,450 on Focus / $1,500 on Escape, and exclude license, fuel fill charge, insurance, registration, PPSA, administration fees and all other applicable taxes. *Cash purchase a new 2010 Ford Fusion S with manual transmission/Focus S with manual transmission/Escape Pacific Edition (XLT I4 Manual)/Edge SEL FWD for $18,949/$14,449/$20,499/$28,999 after a delivery allowance deduction of $3,000/$1,000/$4,000/$5,000 and a $1,000 custom cash deduction. Offer includes air tax & freight of $1,450/$1,450/$1,500/$1,500, and excludes license, and insurance, registration, PPSA, Fuel Fill charge, administration fees and all applicable taxes. Taxes are payable on the full amount of purchase price after delivery allowance deducted and before custom cash deduction is applied. ▲®Registered trademark of Price Costco International, Inc. used under license. Offer valid from December 21, 2009, to March 31, 2010 (the “Offer Period”) to resident Canadian Costco members in good standing, active as at December 20, 2009. Use this $1,000 private Costco offer towards the purchase or lease of a new 2010 Ford Fusion (including Hybrid), Taurus, Mustang (excluding Shelby GT500), Edge, Escape (including Hybrid), Explorer, Explorer Sport Trac, Expedition, Flex, Ranger, F-150 (excluding Raptor), Super Duty (including Chassis Cab), E-Series, Transit Connect, Lincoln MKZ, Lincoln MKS, Lincoln MKX, Lincoln MKT or Lincoln Navigator. This offer is raincheckable, the new vehicle must be delivered and/or factory-ordered from your participating Ford Motor Company of Canada dealer within the Offer Period. Offer is only valid at participating dealers, and is subject to vehicle availability and may be changed or cancelled at any time without notice. Only one offer may be applied towards the purchase or lease of one eligible vehicle. Only one offer can be redeemed per eligible Costco member. This offer is transferable to immediate family members living within the same household as an eligible Costco member. This offer can be used in conjunction with most retail consumer offers made available by Ford of Canada at either the time of factory order (if ordered within the Costco program period – December 21st, 2009 to March 31st, 2010) or delivery, but not both. On applicable vehicles, this offer can also be combined with the Commercial Connection Program incentives and, for eligible customers, the Small Business Incentive Program (SBIP). For small fleets with an eligible FIN, this offer can also be used in conjunction with the Commercial Fleet Incentive (CFIP). This offer is combinable with the RCL program, but not combinable with any CPA/GPC or Daily Rental incentives. Customer may use the $1,000 as a down payment or choose to receive a rebate cheque from Ford Motor Company of Canada, but not both. Applicable taxes calculated before $1,000 offer is deducted. Visit www.fordcostco.ca for details. †††Most 2010 Ford vehicles, excluding 2010 Model LCF, F-650 and F-750, come with a 5 year/100,000 km (whichever occurs first) Powertrain Warranty and full Roadside Assistance benefits together with a 5 year/100,000 km (whichever occurs first) Safety Restraint Warranty. In addition, on all 2010 Model F-Super Duty vehicles equipped with the diesel engine, the Powertrain Warranty is extended to 5 year/160,000 km (whichever occurs first), which equals the diesel engine warranty. Some conditions and limitations apply. ‡‡‡See your Ford of Canada Dealer or contact SIRIUS at 1-888-539-7474 for more information. “SIRIUS” and the SIRIUS dog logo are registered trademarks of SIRIUS Satellite Radio Inc. Includes 6 month prepaid subscription.

A28 Friday, March 19, 2010 - The Morning Star www.vernonmorningstar.com

News Water on agenda for upcoming open house in Lake Country Creek watershed assessment and protection plans ■ 4:30 and 7 p.m. source to tap assessment and protection plan for the intakes in Kalamalka and Okanagan lakes Copies of the reports are available at www. lakecountry.bc.ca.


www.vernonmorningstar.com

Friday, March 19, 2010 - The Morning Star A29

News TASTY TREAT

Easter Event Ends March 21

SAVE up to 25%

on all our new spring styles from TanJay/Alia Buy 1 item

SAVE 15% Buy 2 items

SAVE 20% Buy 3 or more items

SAVE 25% Discounts apply to regularTANJAY / ALIA fashions only. CORY BIALECKI/MORNING STAR

Neil Currie, five, gets a taste of his brother Sean’s snack while waiting for their father after a day on the sunny slopes of Silver Star Mountain Resort, Sunday.

5710-24th Street 250-558-0745

2

E=MC

Extra Benefits = Money conserved x 2

Our best price of this year + Extra value added features

= the absolute best time to buy! DECK

NOOK

THE SAFFRON - Townhome

GREAT A ROOM

Solving the problems of our customers.

MASTER BEDROOM

Money is tied up in credit cards, other debts or loans? Talk to us about our “flexible finance options” Worried about your home selling? No problem - talk to us!

W.I.C.

BROOM

DN W/D

Tied up in a lease? Let us move you comfortably.

LINEN

MECH. ROOM

MASTER BEDROOM W.I.C.

Second Level: 719 sq. ft.

$299,900

Be Home Smart.

STARTING FROM

GARAGE

Main Level: 663 sq. ft. Total :1382 sq. ft.

#18 6900 marshall road vernon, bc (250) 545-9617 www.tricohomes.com email: vernon@tricohomes.com


A30 Friday, March 19, 2010 - The Morning Star

www.vernonmorningstar.com

News SKI FOR SCHOOL

OPEN HOUSE 12:00 - 2:00 PM st Sunday, March 21

$359,900

Choose from our Large Selection & Get Yours Today!

#6 â&#x20AC;&#x201C; 4909 27th Avenue

Newer updated 3 bdrm, 2 bath home in a great location. This home has it all, media room, garage, new laundry room, Stainless steel appliances. Built in 2004 with numerous upgrades totaling more than $20,000. Must be seen to be appreciated. MLSÂŽ9228193

4407-29th Street Vernon 250-549-1221

DON KASSA

MTF

BRAND NAMES BELOW WHOLESALE

Janes

Pub Style Chicken Nuggets or Strips 1.5 kg. Compare at $18.99 CORY BIALECKI/MORNING STAR

The Silver Star 7.5-kilometre Team Challenge gets underway Sunday as skiers clear the start line and work their way around the track. The Team Challenge fundraiser supports Okanagan College Nordic Scholarships which allow young skiers training in the area to also go to school here. FROZEN Frozen

TOOLS Clark 4.8V

Cordless Screwdriver

Breaded Shrimp Choose from coconut, or wine and garlic, 8 oz. package

2

99

$

Compare at $8.99

HAVE YOU GOT THE

TOUCH? TOUCHPHONES

9

with select 3-yr. plans

Convection Oven

3

Compare at $5.99

FROM $ 99*

KITCHEN Emerson Countertop With Rotisserie

79

$

12 roll

BATH

Crunchy Oâ&#x20AC;&#x2122;s

2

$

this AD for a

1 time

20 discount $

on your purchase!!`

00245

Compare at $3.99

BRING IN THESE COUPONS & SAVE

Buy 1 accessory & $AVE 10% Buy 2 accessories & $AVE 15% Buy 3 accessories & $AVE 25% Excludes iPhone accessories

Compare at $3.49

Aberdeen Mall 250.372.5521

KELOWNA

VERNON

Orchard Park Shopping Ctr Village Green Mall 250.260.6688 250.762.6400 Lakeland Plaza 250.862.3010

CELLCOM

CANADAâ&#x20AC;&#x2122;S LARGEST EXCLUSIVE ROGERS AUTHORIZED DEALER

*With new activation on any 3-yr term voice plan. Taxes extra. Early cancellation fees apply. `Available only at listed Cellcom locations only only. Minimum purchase of $25 required. Must present ad. â&#x201E;˘Rogers and the Mobius design are trademarks of Rogers Communications Inc. used under license or of Rogers Wireless Partnership. All other brand names are trademarks of their respective owners Š 2010.

99

Fleece Throws 50â&#x20AC;?x60â&#x20AC;?

2

49

5

$ Compare at $13.99

ELECTRONICS Tripp-Lite

Battery Backup

5999

$

Compare at $119.99

GROCERY Kelloggâ&#x20AC;&#x2122;s Honey

Corn Flakes 340 g.

249

$

Compare at $3.49

Laundry Detergent Assorted 32 Wash Load Size

598

$

Compare at $8.98

GROCERY Idaho PaciďŹ c

HOME

$

Excludes iPhone accessories

8

$

Compare at $12.99

Deodorant

Excludes iPhone accessories

Columbia Place Shopping Ctr 250.377.3902

99

PERSONAL Right Guard

cellcomwireless.com KAMLOOPS

White 20x50 inch 2 pack

9

99

$

LAUNDRY Sunlight

Bath Towel Set

400gr

Redeem

49

99

$

Compare at $69.99

GROCERY Kelloggâ&#x20AC;&#x2122;s

ONLY UNTIL MAY 3 ASK FOR DETAILS.

19

99

$ Compare at $39.99

GROCERY PaciďŹ c Classic Plus

Toilet Paper

Visit my website at www.DonKassa.com VERNON 250-549-4161

99

Instant Mashed Potatoes 40 serving container, 794 gr.

Compare at $3.99

199

$

Items shown here are an example of the selection available at your local Price Matters stores. Items will vary by store. Some items may be refurbished.

SALE DATES: MARCH 19 TO MARCH 25, 2010 VISIT US AT:

VERNON| 250.542.6133 5104 24th Street

8 STORE HOURS: Monday, Tuesday, Saturday 9:00 am to 6:00 pm Wednesday, Thursday, Friday 9:00 am to 8:00 pm Sunday 11:00 am to 5:30 pm

price club                        

Check out our website for any of our 12 locations, www.pricematters.ca

       " #         !    !   




EFFKHYUROHWGHDOHUVFD

Âą

    

 

$& /5&/"/ Ă&#x153; 64&0/."*&3 "/%4 7*$&

*/ $"4) $3&%*54 0/ .045 .0%&-4

! !"!   #X

FIVE-STAR SAFETY CRASH RATING9

!35*+28.5<4



5&/"Ă&#x153; /$& 64&0/. "*/ "/%4&37*$&

*/$-6%*/( $"4)$3&%*5ĂŻ '3&*()51%**/$-6%&%

 

1-64

 

MAINTENANCE





V

5&/"Ă&#x153; /$& 64&0/. "*/ "/%4&37*$&

*/$-6%*/( $"4)$3&%*5ĂŻ '3&*()51%**/$-6%&%

MAINTENANCE





1-64 

!!$%"% !%W FIVE-STAR SAFETY CRASH RATING9

!&35*+28.5<4

MAINTENANCE

"8"3% 8*//*/( 7&)*$-&4

45"3$3"4) 4"'&5: 3"5*/(4

V



 

!&35*+28.5<4

#! # ! !  ! ! " &"!X FIVE-STAR SAFETY CRASH RATING9

 

 # 1 5&/"Ă&#x153; /$& 64&0/. "*/ "/%4&37*$&

*/$-6%*/( $"4)$3&%*5ĂŻ '3&*()51%**/$-6%&%

#!

$

1-64

6150

V

$)&730-&5."-*#6

   @     !C ##! 4-/4+ </9. /7+)9 40+)9/54 @ :953'9/) !7'483/88/54 @ /7 54*/9/54/4-@ 9'(/2/!7'1C@5<+7$/4*5<85575)18'4*/77578@7/;+7'4*7549'88+4-+77549'2 '4* +'935:49+* /*+/36')9/7'-8@+'*:79'/4 /*+/36')9/7'-8@ <.++2/8)7'1+8</9.  '4*'4/)7'1+88/89@4 9'7C</9. =+'75,9.+/7+)9/548'4*544+)9/5482'4?

$)&730-&54*-7&3"%0$3&8$"#

  @  6  #@  6++*:953'9/)!7'483/88/54</9.;+7*7/;+@:'2 9'-+ 7/;+7'88+4-+7 /7('-8 9.'9 4)2:*+ :953'9/) '88+4-+7 /7('- :667+88/54 =89+3 @ 4 9'7B </9. %+'7 ',+'4* 5:4*2'4?@ 9'(/2/97'1B@#+./)2+!.+,9+9+77+49</9.2+)9754/)335(/2/>+7 @ $.++249/5)17'1+8</9. @ 52'7'=B!/49+*$/4*5<8@ A$.++28

   @  6   #    @  6++* 2+)9754/) :953'9/) !7'483/88/54 @ :'2 9'-+ 7/;+7 '88+4-+7 /7('-8 </9. :667+88/54 '4* '88+4-+7 +9+)9/4- =89+38 @ 7549 5< /*+ 36')9 /7('-8 @4 9'7B</9. %+'7/7+)9/548'4*544+)9/5482'4</9.!:74(=!:74';/-'9/54?@ 9'(/2/!7'1B@!7')9/54 549752@#+./)2+!.+,9+9+77+49</9.2+)9754/)335(/2/>+7

$)&730-&553"7&34&

NOW AT YOUR BC CHEVROLET DEALERS. bcchevroletdealers.ca 1-800-GM-DRIVE. Chevrolet is a brand of General Motors of Canada.XBased on 2010 Energuide submissions/competitive websites. Your actual fuel consumption may vary. Excludes other GM vehicles. W2010 Chevrolet Malibu data with standard 4-cylinder engine based on GM testing in accordance with approved Transport Canada test methods. Competitive information based on Natural Resources Canadaâ&#x20AC;&#x2122;s 2010 Fuel Consumption Guide for competitors and published information available at time of printing. Your actual fuel consumption may vary. Excludes other GM models. VThe Best Buy seal is a registered trademark of Consumers Digest Communications, LLC, used under license.*Offers apply to the cash purchase of 2010 Malibu LS ISA, Traverse LS 1SA and Silverado Crew Cab LS 4WD 1SF, equipped as described. Cash purchase prices reďŹ&#x201A;ect discounts or other incentives which are only available on cash purchase offers. By selecting lease or ďŹ nancing offers, consumers will be foregoing such discounts and incentives which may result in higher effective interest rates. See your participating GM dealers for conditions and details. Freight included. License, insurance, registration, PPSA, administration fees and taxes not included. Offers apply to the purchase of 2010 new or demonstrator models, dealer order or trade may be necessary, and applies only to qualiďŹ ed retail customers in BC/Yukon. Dealers are free to set individual prices. Limited time offer which may not be combined with other offers. See your participating GM dealers for conditions and details. ÂĽService contract required. OnStarÂŽ uses existing emergency service providers as well as cellular and satellite technologies. Vehicle electrical system needs to be operating for features to function properly. 9U.S. Government star ratings are part of the National Highway TrafďŹ c Safety Administrationâ&#x20AC;&#x2122;s (NHTSAâ&#x20AC;&#x2122;s) New Car Assessment Program (NCAP). For more information on safety ratings, go to www. safercar.gov. 6Based on Natural Resources Canadaâ&#x20AC;&#x2122;s 2010 Fuel Consumption Guide ratings. Your actual fuel consumption may vary. ÂąWarranty based on 5 years or 160,000 km, whichever comes ďŹ rst. Excludes medium duty trucks. See Dealer for conditions and details. &$2,000 manufacturer to dealer delivery credit available on 2010 Chevrolet Malibu LS ISA (tax exclusive) for cash customers only. $2,000/$4,200/$7,000 for 2010 Malibu LS 1SA, Traverse LS 1SA and Chevrolet Silverado Crew Cab LS 4WD 1SF reďŹ&#x201A;ected in offers in this advertisement. Credit will impact the effective APR for ďŹ nance customers. See your GM Dealer for details. â&#x20AC; With purchase, ďŹ nance or lease of an eligible new 2009 or 2010 Model Year Chevrolet, Buick or GMC vehicle between March 2, 2010 and May 31, 2010, and with payment of an additional $0.01, customers receive a $750 pre-loaded Goodwrench Maintenance card (â&#x20AC;&#x153;Cardâ&#x20AC;?) at participating dealers in Canada. Ineligible models: Chevrolet Camaro, Corvette ZR1, Aveo and Cobalt; Pontiac G3, G5 and Vibe; Cadillac and Medium Duty Trucks. Eligible on Retail sales only. Offer applies to new or demonstrator models. Dealer order or trade may be required. A list of participating dealers can be obtained by calling 1-800-GM-DRIVE or by visiting goodwrench.ca. The Card can be applied towards the purchase of recommended vehicle service and maintenance, as speciďŹ ed in your vehicle ownerâ&#x20AC;&#x2122;s manual, including auto detailing and/or any new GM approved part (excluding winter tire purchases) associated with the corresponding vehicle service or maintenance. The GM approved part must be either GM Original Equipment (OE) or ACDelco, purchased from General Motors. The purchased recommended service, maintenance and/or new GM approved part is only applicable on the eligible vehicle identiďŹ ed on the Card via the Vehicle IdentiďŹ cation Number (â&#x20AC;&#x153;VINâ&#x20AC;?). Eligible customers will receive the Card from their Dealer approximately 6-8 weeks after vehicle purchase. Customer must present the Card at time of maintenance, service or parts purchase. Facsimiles and photocopies will not be accepted. For lost or stolen cards, please contact 1-866-874-9018 (fee may be applied for card replacement). Card expires thirty six (36) months after date of vehicle purchase as indicated on Card. Card is not VIN transferrable and may not be redeemed for cash. This offer may not be combined with certain other consumer incentives available on GM vehicles. GMCL may modify, extend or terminate this offer in whole or in part at any time without notice. Additional conditions and limitations apply. Void where prohibited by law. See your GM dealer for details. Subject to Vehicle Redemption Allowances. xDependability based on longevity, as sourced from R. L. Polk Canada, Inc.; Canadian Vehicle in Operation registrations as of July 1, 2007 (Model Years 1988 to 2006) and Total New Vehicle Registrations for the full-size light-duty pickup truck segment, including chassis cabs. Based on % of vehicles remaining in operation, weighted on age of vehicle. 1$1,000 is a manufacturer to consumer incentive and is tax inclusive ($880.00 reduced purchase price plus $120.00 applicable taxes). Such credit may be applied only to the purchase/ďŹ nance/lease of a new 2009 or 2010 Chevrolet Silverado delivered by March 31, 2010. Offer applies to current owners/lessees of any GM vehicle; vehicle must have been registered and insured in customerâ&#x20AC;&#x2122;s name for previous consecutive 6 months. Conditions and limitations apply. See dealer for details.

5 (3&"53&"40/450#6:"$)&730-&5/08  1 2 3 4 5 (3&"5 '6&- &''*$*&/$:

MAINTENANCE





Friday, March 19, 2010 - The Morning Star A31 www.vernonmorningstar.com

          




A32 Friday, March 19, 2010 - The Morning Star

www.vernonmorningstar.com

ANJOU PEARS

Enjoy a shopping experience like nowhere else. New inventory coming in every day. Browse around, take your time, stop and have a coffee and one of our fresh baked daily deli treats. Make it a relaxing experience

K C O T S N I NOW

BC RED COMPLETE SELECTION OF POTATOES

FRUIT TREES

10 LB. BAG

88

3

LANTS P Y R R E B ALL ABLE! L I A V A W NO

12” PANSY OR PRIMROSE BOWLS

9

K

NOW IN STOC

SEED GERANIUMS

88

SHOP EARLY FOR BEST SELECTION & PRICES, SUCH AS ...

BOXWOOD Excellent for hedging Western Family

¢

89

ea

SOME BASKET STUFFERS FOR THOSE THAT WANT TO START EARLY!

PRUNING TIME!!!!

10 kg Bag

Meadowvale

BUTTER 454 g

99

6

6 00 10

3 for ENJOY A FISH DINNER ...............................................................................................................................................................................................

Reg. 39.99

99 ea

19

.........................................................................................................................................................................

RED OR GOLDEN DELICIOUS APPLES

39 69 ¢ 59 ¢ 59 ¢ 79

FLORIDA RED GRAPEFRUIT 5 LBS

NAVEL ORANGES 8 LB BAG

GREEN LEAF LETTUCE

¢ ¢

LB

LB

LB

LB

LB

99

3

88

4

ea

¢

99 ¢ 99 ea

ROMA TOMATOES

lb

MIX OR MATCH

/LB.

/100 G

99

ea

¢

89

SWAN LAKE NURSERYLAND

2 4 L MILK $ 00 99 00 14 ea BREAD 5 1 OFF 250-542-7614 SWAN LAKE NURSERYLAND FRUIT MARKET and GARDEN CENTRE • OPEN 8:00 AM - 7:00 PM

Still Time To Apply Green Earth

LYONER

MAC APPLES GALA APPLES SPARTAN APPLES

OR 499 RADISHES GREEN ONIONS 2 BUNCHES FOR 99¢

FULL LINE OF TOOLS & SUPPLIES! BASA FILLETS GILMORE 160 FORGED STEEL BYPASS LOPPER

/LB.

EA.

88

ALL PURPOSE FLOUR

59

FUJI APPLES

Our yard is starting to fill with quality growing plants and materials for your landscaping needs.

1 Gallon

¢

DORMANT SPRAY KITS

Nature’s Oven • 567 g

CHIPMUNK BREAD OUR EVERY DAY LOW PRICE

Dairyland

Nature’s Oven • 16 oz. Loaf White or whole wheat

4 FOR

With Coupon

Offer Expires March 25, 2010

On Hwy. 97, Vernon, BC

VISIT US ONLINE:

www.myswanlake.com

FLOWER SHOP 545-7166 or 545-7666

LOOK FOR MANY OTHER UNADVERTISED IN-STORE SPECIALS

PRICES IN EFFECT FRI., MARCH 19, 2010 TO THURS., MARCH 25, 2010 WE RESERVE THE RIGHT TO LIMIT QUANTITIES *SOME EXCLUSIONS APPLY


www.vernonmorningstar.com

Friday, March 19, 2010 - The Morning Star B1

B

SECTION

arts

%$)4/2+RISTIN&RONEMANssENTERTAINMENT VERNONMORNINGSTARCOM

6ERNONSINGERISAHARDACTTOFOLLOW KRISTIN FRONEMAN

Morning Star Staff

Darby Mills can still feel the noise. As lead singer of Vancouver rock band The Headpins, she remembers the not-soquiet riot of fans cheering for an encore every night. And then the disappointment â&#x20AC;&#x201C;â&#x20AC;&#x201C; the booing as the lights came on to indicate the end of the set. It was 1985, and The Headpins were supporting bearded rockers ZZ Topâ&#x20AC;&#x2122;s huge Afterburner tour through Canada. Riding on the success of hit singles Donâ&#x20AC;&#x2122;t It Make Ya Feel (Like Dancing) and Just One More Time featuring Millsâ&#x20AC;&#x2122; notoriously powerful voice, The Headpins were set to play a show in Calgary â&#x20AC;&#x201C;â&#x20AC;&#x201C; a noted hot spot for the B.C. rockers â&#x20AC;&#x201C;â&#x20AC;&#x201C; and then two in their hometown before embarking on ZZ Topâ&#x20AC;&#x2122;s tour through the U.S. â&#x20AC;&#x153;After we finished our set (in Calgary), they didnâ&#x20AC;&#x2122;t turn on the lights. They let us have an encore,â&#x20AC;? remembered Mills. â&#x20AC;&#x153;After the show, our manager pulled me into the dressing room. He said we had just blew it. The concert was over six minutes. We had cut into (ZZ Topâ&#x20AC;&#x2122;s) time and they would have to pay for the overtime. We were supposed to do a U.S. tour with them, but it was cancelled.â&#x20AC;? The Headpins did two more shows at Vancouverâ&#x20AC;&#x2122;s Pacific Coliseum, once when Mills was pulled aside again and told the band was breaking up. That was a lifetime ago. Now a mother of two and an accredited taekwondo instructor, Mills has found a quieter life back in Vernon since 1998. She was born and spent her youth here, and later attended high school in Kamloops, where she formed her first band. And more than 30 years later, she can still rock with the best of them. Back with The Headpins, who reformed some years back without leader/guitarist Brian MacLeod, who died in 1992, Mills is about to play a gig with the aptly-named Youngâ&#x20AC;&#x2122;uns, who just celebrated 20 years rockinâ&#x20AC;&#x2122; around the Okanagan. The rare local appearance takes place at Sneakers Sports Bar in the Village Green Hotel Saturday night. â&#x20AC;&#x153;This is the first show weâ&#x20AC;&#x2122;ve done in Vernon since the Funtastic Music Festival some years ago,â&#x20AC;? said Mills, who met Youngâ&#x20AC;&#x2122;unsâ&#x20AC;&#x2122; Tim Reardon and Brad Krauza soon after moving back to Vernon, and performed with the band for almost a year until The Headpins started touring again. â&#x20AC;&#x153;They called me last October and asked if I would like to play at their 20th anniver-

PHOTO SUBMITTED

Darby Mills makes heads spin with her powerful voice when she joins The Youngâ&#x20AC;&#x2122;uns at Sneakers Sports Bar in Vernon Saturday. sary show at the OK Corral (in Kelowna),â&#x20AC;? said Mills, who returned to play with the Youngâ&#x20AC;&#x2DC;uns in December in celebration of her 50th birthday. â&#x20AC;&#x153;Iâ&#x20AC;&#x2122;ve never stopped playing,â&#x20AC;? she said. â&#x20AC;&#x153;Out of the bands from my era that have tried to re-claim their status, and are trying do it with new music, they find that it is slow going. When I go out to check out a band from the past, unless their new songs are really good, I wanna hear the songs from the days where I remember where I was at the time, and who I was dating. Iâ&#x20AC;&#x2122;m proud of The Headpins. We still deliver that show, and weâ&#x20AC;&#x2122;re still as hard working as ever.â&#x20AC;? After the initial break-up in â&#x20AC;&#x2DC;85, Mills was able to retain The Headpinsâ&#x20AC;&#x2122; record deal as a solo artist, and at 25, she went to record an album in the U.K. with producer Greg Walsh (who launched Tina Turnerâ&#x20AC;&#x2122;s solo career) at the Eel Pie studio owned by The Whoâ&#x20AC;&#x2122;s Pete Townshend. She had six tracks in the can, featuring

what she calls â&#x20AC;&#x153;a potpourri of wonderful musicians,â&#x20AC;? including bass player Tom Levin (King Crimson) and members of Santana, when the radio payola scam was revealed. Record execs were accused of paying radios stations to play their artists, and Mills was told her A&R guy (basically a talent scout for record labels) had lost his job. â&#x20AC;&#x153;They were lowering the hammer on the record company and I jumped on a plane to the U.S. to confront them. I didnâ&#x20AC;&#x2122;t know anyone there,â&#x20AC;? said Mills, who was told by the company that they were retaining a deal, but it was between her and a new 14-yearold artist. â&#x20AC;&#x153;I had to decide what to do. I told them â&#x20AC;&#x2DC;the studio is booked, if you canâ&#x20AC;&#x2122;t tell me if Iâ&#x20AC;&#x2122;m signed, then Iâ&#x20AC;&#x2122;m off the label.â&#x20AC;&#x2122;â&#x20AC;? Mills ended up losing her record deal to mall queen Tiffany, who got the contract and ended up releasing her hit I Think Weâ&#x20AC;&#x2122;re Alone Now.

Mills returned to Vancouver and formed a new act, The Unsung Heroes, which released the CD Never Look Back featuring singles Cry to Me, Give it All Up, and Hot Water, which could describe Millsâ&#x20AC;&#x2122; feelings about the music industry at the time. â&#x20AC;&#x153;We had to put out videos, and MTV called and said the Headpinsâ&#x20AC;&#x2122; video was doing well. I had to laugh because we had broken up two years before,â&#x20AC;? said Mills. In the meantime, The Headpins, with MacLeod, had gotten back together without Mills, replacing her with vocalist Chrissy Steele. Mills says she had a seven-year legal battle with The Headpins over rights, but after MacLeod died of cancer, she reunited with Headpinsâ&#x20AC;&#x2122; drummer Bernie Aubin and they started touring again. â&#x20AC;&#x153;We pulled up to a gig in Alberta that had us billed as The Headpins. I thought the lawyers would be after us, but nothing happened. We immediately went out and bought the name and registered it,â&#x20AC;? said Mills. â&#x20AC;&#x153;They couldnâ&#x20AC;&#x2122;t stop us and thatâ&#x20AC;&#x2122;s how The Headpins reformed.â&#x20AC;? Soon after, founding member Ab Bryant, as well as Alfie Galpin, rejoined the band. â&#x20AC;&#x153;You could never replace Brian, but we have a new member, (Tony Dellacroce) who has been filling those shoes,â&#x20AC;? added Mills. Now with her quiet life in Vernon occasionally interrupted by gigs around the country, Mills has enjoyed playing alongside some friends from her past, including former metal queen Lee Aaron, as well as the legions of Canadian classic rock bands such as Loverboy, Harlequin, Streetheart, Prism, Helix and Honeymoon Suite who have busy careers playing summer festivals. â&#x20AC;&#x153;Itâ&#x20AC;&#x2122;s wonderful. Weâ&#x20AC;&#x2122;re ever so lucky to still be going and keeping an era alive. We work together often,â&#x20AC;? said Mills, adding The Headpins just played in Vancouver during the Winter Olympics. â&#x20AC;&#x153;We went on half an hour after the womenâ&#x20AC;&#x2122;s hockey team won the gold and then (figure skater) Joannie Rochette won the bronze. It was crazy.â&#x20AC;? As for her family, Mills says she receives a lot of support from her husband and kids, now ages 11 and 16. â&#x20AC;&#x153;Not everyoneâ&#x20AC;&#x2122;s mom leaves to play rock,â&#x20AC;? she said. â&#x20AC;&#x153;My kids are starting to figure out that this is not normal. The teachers at my sonâ&#x20AC;&#x2122;s school got together and did an air-band version of a Headpinsâ&#x20AC;&#x2122; song... Itâ&#x20AC;&#x2122;s been 30 years of relative incredibleness.â&#x20AC;? Tickets to see Mills and The Youngâ&#x20AC;&#x2122;uns at Sneakers Saturday are $8 in advance at the bar or at the door. The show starts at 8 p.m., and word is tickets are going fast.

â&#x20AC;˘ Adult units from

Copper Mountain Villas in Vernon Foothills

450,000

$

â&#x20AC;˘ Our ďŹ rst quality adult gated community in the Foothills â&#x20AC;˘ Featuring Prairie and Craftsman style duplexes by 3 of Vernonâ&#x20AC;&#x2122;s best builders â&#x20AC;˘ Homes now under construction by

Marketing Agents

Norm Brenner (250) 549-4161

www.okanaganlands.com

250-545-1300


B2 Friday, March 19, 2010 - The Morning Star

www.vernonmorningstar.com

Arts “Where Health & Honey Meet”

Detroit’s D-12 visit motor home city The Okanagan is about to get a taste of freestylin’ from 8 Mile when Motor City rap group The Dirty Dozen (D-12) visits the valley next week. D-12 members Bizarre, Kon Artis, Kuniva and Swift are currently on a national tour, billed as the Return of the Dirty Dozen, which makes a stop at Vernon night spot Moe Joe’s Tuesday. Formed in Detroit in the early-’90s, D-12’s original lineup included a certain Marshall Mathers, better known as Eminem, who still joins the band on occasion to record and tour. The story goes that when the group hadn’t been offered any record deals after years of touring, members decided to go their separate ways, with the first one to become famous promising to come back for the rest of the group. “Em was able to take D-12 to the next

level,” said Kon Artis on D-12’s website, adding that prior to teamingup in front of a mic, both worked at Detroit pizza joint. “He helps to bring stuff out of us. With him, no matter what happens, it’s always been about real friendship.” After Eminem’s success with 1997’s The Slim Shady EP, D-12 reunited to produce its debut album, 2001’s Devil’s Night, featuring break-out singles Purple Pills and Fight Music. The album ended up selling four million copies upon its release. The group went on to release 2004’s D-12 World, and has since toured around the world, while members have also focussed on their individual solo careers. D-12’s Bizarre recently announced the group has recently entered the studio with Eminem, plus fellow Detroit rapper Royce Da 5’9, with a new single expected to be released

in the near future. Opening for D-12 on its date in Vernon is Vancouver-born and Courtenay-raised hip hop artist Terell Safadi, also known as Mistah 604, who has just released his second

mix-tape, Get Money Mind State 2. Vernon’s TassNata, who is releasing his new CD, Between Planets, is also expected to perform along with fellow locals Creative Bloodline, who have

Planet Bee

Honey Health Boutique

just released a single with Swollen Members’ Mad Child, and other special guests. Doors to the show open at 9 p.m. and tickets are $10 (cash only), available at Dunas Skate Shop in Vernon.

Pollen, Propolis, Royal Jelly, Beeswax Candles, Ointments, Lotions, Lip Balms & more.

DIABETICS WELCOME AT PLANET BEE Propolis Can Help - Ask Us!

Honey Sampling Always Available

www.planetbee.com Mon. - Sat. 9 am to 5 pm Sun. 10 am - 4 pm

5011 Bella Vista Rd. Phone 542-8088

Cl{im Your M{zd{ Sales Event

It’s time to stake your claim on a new Mazda. % PURCHASE

0

FINANCING

PLUS NO PAYMENTS FOR 90 DAYS†† ON ALL 2010 MODELS 2010 MAZDA 3 Purchase Financing†

Lease from

219

* Per mth

$

for

48

0

$ mths

security deposit

0 60 %

for

mths

BEST NEW CAR UNDER $21k

For DSC-equipped modelsW

Top 10 Best Retained Value Award by Canadian Black Book◊

For DSC-equipped modelsW

Top 10 Best Retained Value Award by Canadian Black Book◊

4.9% lease rate. $350 down payment. Includes freight & PDI. Taxes extra.

GT model shown ‡

Canada’s Best Selling Passenger Car of 2010

2010 MAZDA3 SPORT Purchase Financing†

Lease from

229

*Per mth

$

for

48

0

$ mths

security deposit

0 60 %

for

mths

BEST NEW CAR OVER $21k

4.9% lease rate. $350 down payment. Includes freight & PDI. Taxes extra.

GT model shown

Canada’s Best Selling Passenger Car of 2010‡

2010 MAZDA 6

Purchase Financing†

Lease from

359

*Per mth

$

for

48

0

$ mths

security deposit

0 60 %

for

mths

Winner of the 2009 AJAC Award for Best New Family Car ($22K - $33K)

4.9% lease rate. $675 down payment. Includes freight & PDI. Taxes extra. GT model shown

2010 MAZDA 5 Purchase Financing†

Lease from

279

* Per mth

$

for

48

0

$ mths

security deposit

0 60 %

for

mths

Winner of the 2010 ecoENERGY Vehicles Award as Canada’s Most Fuel-Efficient Vehicle in its Class♦♦

4.9% lease rate. $550 down payment. Includes freight & PDI. Taxes extra. GT model shown

OFFERS END MARCH 31ST 2010 VISIT YOUR LOCAL DEALER OR MAZDA.CA FOR COMPLETE DETAILS. ZOOM-ZOOM. FOREVER.

KELOWNA MOTORS • 2560 Enterprise Way • Phone 250-762-2068

t the Hurry in for Huge Savings a

e r t n e C e c n Cleara

Save up to

Brown Leather SecƟonal

NOW $889.95 Reg. $1499.99 Recliner

NOW $259.95 Reg. $499.99 2408 55th Ave., Vernon (behind Future Shop)

z

250-542-4102

z

Monday to Saturday 9:00am-5:30pm

†0% APR Purchase Financing is available on new 2010 Mazda vehicles. Based on a representative agreement using a MSRP of $15,995, $16,995/ $23,195, $20,495 for the 2010 Mazda3 (D4SX50AA00), Mazda3 Sport (D5SX50AA00)/ Mazda6 (G4SY60AA00), Mazda5 (E6SD50AA00), with financed amount of $15,000/$20,000 at a rate of 0% APR, the cost of borrowing for 60 month term is $0, monthly payment is $250/$334, total finance obligation is $15,000/$20,000. MSRP excludes freight and P.D.I. of $1,395/$1,595 for the Mazda3/Mazda6, Mazda5. †† No payments for 90 days applies to purchase finance offers on new in-stock 2010 Mazdas. The purchaser will repay principal monthly over the term of the contract, commencing 90 days after contract date. *See ad for corresponding monthly lease payments, lease terms, and down payments. Down payment and first monthly payment due at lease inception. Other lease terms available. 20,000 km lease allowance per year, charge of 14¢/km for excess kilometres. 25,000 km leases available. For Purchase/Finance/Lease- $67 max. PPSA, licence, insurance, taxes, down payment and other dealer charges are extra and may be required at the time of purchase. Dealer may sell/lease for less. Dealer order or trade may be necessary on certain vehicles. Lease and Finance on approved credit for qualified customers only. Offers valid from Mar 2 – Mar 31, 2010. Prices subject to change without notice. Visit mazda.ca or see your dealer for complete details. ‡ Canada’s Best Selling Car of 2010 – Based on DesRosiers Automotive reports for period of January and ending February of 2010. ▲Based on Insurance Institute for Highway Safety. ◊One of the Top 10 2009 Best Retained Value. Based on 2005 model. ♦2010 Mazda3 Mazda6, Mazda5 models tested with standard front and side-impact air bags (SABs). Government star ratings are part of the National Highway Traffic Safety Administration’s (NHTSA’s) New Car Assessment Program (www.safercar.gov). ♦♦Based on 2010 fuel consumption ratings published by Natural Resources Canada

Morning Star Staff

85%

on in-stock Home Furnishings!


www.vernonmorningstar.com

Friday, March 19, 2010 - The Morning Star B3

Arts BOWLED OVER

check out

The

MorningStar

on-line at:

www.vernonmorningstar.com

Kootenay Concert Connections presents:

JESSE COOK

theRUMBAFOUNDATION

TOUR 2010

Tuesday, May 11 7:30 pm Vernon Performing Arts Centre New Album in Stores Now!

LISA VANDERVELDE/MORNING STAR

Kim Larose (from right), Shelby Ulrich and Charlene Blundell look at all of the hand-made bowls made by local artists, personalities and celebrities before picking the ones they want at The Empty Bowl fundraiser. Held by the Vernon Community Arts Centre on St. Patrick’s Day Wednesday, the event also featured a lunch of hearty Irish stew and entertainment by the Argyll School of Celtic Arts.

TICKETS: Ticket Seller at Vernon Performing Arts Centre,

250-549-7469

charge-by-phone at or on line at www.ticketseller.ca

Reach out and claim yours.

New

FIRST-TIME HOME BUYERS’ TAX CREDIT A non-refundable tax credit of up to

$750.

PENSION INCOME SPLITTING Split up to 50% of eligible pension income with your spouse or common-law partner.

CHILDREN’S FITNESS TAX CREDIT A non-refundable tax credit of up to

$75/child.

PUBLIC TRANSIT TAX CREDIT A non-refundable tax credit of

15%.

New

HOME RENOVATION TAX CREDIT A non-refundable tax credit of up to

$1,350.

TRADESPERSON’S TOOLS EXPENSES Deduct up to

$500 from your net income.

It makes sense to file your returns electronically and on time. Find out what you can claim at:

canada.gc.ca/taxinfo 1 877-959-1-CRA

Part of


B4 Friday, March 19, 2010 - The Morning Star

www.vernonmorningstar.com

Arts

Zone drops few bombs Green Zone: ★★★ 1/2

out of 5

P

aul Greengrass’ Green Zone has two goals: 1) To stick a thumb in the Bush administration’s eye, as if Hollywood hasn’t done enough of that. 2) To serve up an intelligent Baghdad-based action package that doesn’t spin the audience’s head with such detailed fervor, it totally forgets to include the “thrill” in thriller. For the most part, it succeeds on both fronts. Greengrass and star Matt Damon have been through the blood-pumpJason Armstrong ing rounds before with a couple of chapters in the Bourne series, and they seem very content to borrow a few maneuvers from those flicks here. As for goal No. 1, well, let’s just say, I can’t see the former U.S. prez and his mates being too happy with the content of this baby. That said, Green Zone isn’t an overly memorable film. It doesn’t sport the nailbiting tension of The Hurt Locker, nor does it completely blow the doors off in the roughand-tumble department –– not that it was intended to. In short, it gets the job done. You might not cherish a movie like this a decade from now, but for the time being, it serves its purpose, and does it rather effectively. Set in Baghdad in early 2003, shortly after the crumbling of Hussein’s reign but before his capture, Green Zone follows the ups and downs of chief warrant officer Roy Miller (Damon), an American soldier tasked with finding the country’s stockpile of weapons of mass destruction –– a stash that, you will

AISLE SEAT

★ Vernon Town Cinema ★ ★ Movie InformationHome ★ Line 250-545-0352 www.vernoncinema.com of the Vernon Film Society ★ ★ NOW OPEN IN OUR LOBBY LUNCH FOR UNDER $2.00 ★ ★ ONLY AT THE FILM NOIR COFFEE BAR ★ Friday, Mar. 19, 2010 ➠➠➠ Thursday, Mar. ★ 25, 2010 THE ★ ★ LOVELY ★ ★ BONES ★ ★ THE STORY OF A LIFE AND EVERYTHING ★ ★ THAT CAME AFTER. ★ ★ ★ ★ ★ ★ LEONARDO DiCAPRIO ★ ★ OP ★ ★ UT ★ ★ ★ 5:00PM NIGHTLY 14A 6:50PM NIGHTLY PG 9:10PM NIGHTLY 14A ★ ★ SAT. & SUN. MATINEES • All Seats $3.50 ★ ★ ★ FANTASTIC ★ ★ MR. FOX ★ ★ ★ ★ ★ ★ SHORTS ★ ★ ★ ★ ★ ★ ★ ★ ★ ★ 12:00PM SAT. & 10:30AM & 3:15PM 1:45PM SAT. & ★ SAT. & SUN. G SUN. G G ★ SUN. • ADULTS $6.00 • JUNIORS $5.00 ★ ★ • SENIOR/CHILD $4.00 • TUESDAY - ALL SEATS $3.50 ★ ★ • MATINEES - ALL SEATS, ALL AGES $3.50

C O

SHUTTER ISLAND

TOOTHFAIRY

recall, served as the purpose for America’s invasion of Iraq. But when every supposed weapons site that Miller’s camp visits turns out to be clean (their initial destination turns out to be a dangerous stop, as a sniper opens fire on his men), he begins to question the army’s sources for intelligence are faulty –– a suspicion that doesn’t exactly earn him brownie points with the military suits, especially Pentagon official Clark Poundstone (Greg Kinnear). As Miller’s quest for the truth intensifies, so does the struggle with his own side. Soon, the special forces begin bullying him, and what began as a disillusioned approach quickly evolves into a fight for survival.

See DAMON on page B5

“Blue Scarlett” play LIVE!

Friday March 19th & Saturday March 20th from 8:30 -12:30pm NO COVER CHARGE!

2 BIG SCREEN TV’S All the sports! All the time!

“Where the good times come naturally” 250-541-2653 • 3914 - 32nd Street, Vernon • www.rpbhotels.com


www.vernonmorningstar.com

Friday, March 19, 2010 - The Morning Star B5

Arts

RON JAMES "Funniest man in Canada"- Victoria Times-Colonist "Devastatingly funny" - Globe & Mail "Utterly brilliant"- Ottawa Sun www.shantero.com

UNIVERSAL PICTURES

Actor Matt Damon plays U.S. army chief warrant officer Roy Miller, sent to Iraq to look for weapons of mass destruction in Green Zone.

Damon delivers Continued from page B4

Damon is, once again, very solid. (Short of Clooney, is there a more dependable leading guy on the scene right now?) And Greengrass delivers another beauty as well. Granted, in his usual desire to present the material with a realistic documentary-style look, your stomach might churn a wee bit from Greengrass’s shaky camera tricks, but, as always, the approach creates the sense of urgency Green Zone requires. Again, it’s not the kind of epic that will nestle in your mind as required viewing in a few years, but for now, it’s quite the rush. The feature is currently playing at Galaxy Cinemas in Vernon.

The latest movies are reviewed in Aisle Seat every Friday and Sunday

PRESENTS

Shane Philip Fri., Mar. 19 @ 7:30 pm Swelling in primordial pulses and wholloping whoops, the tacit tones of Shane Phllips didgeridoo hold the power to still listeners into silence or encourage audiences to rise up in a tribal swell of intoxicating spirit.

Kerry Lynn Zwicker with Harp Rouge Tammy Cooper, flute & Jeff Faragher, cello Wed., March 24 @ 7:30 pm

Good Rockin’ Tonight The Sun Records Story Tues., Mar. 30 @ 7:30 pm “Good Rockin’ Tonight: The Sun Records Story” is the official and exclusive touring show of the famed Memphis based record label that launched the careers of Elvis Presley, Johnny Cash, Jerry Lee Lewis, Carl Perkins and more!

Delhi 2 Dublin Sat., Apr. 24 @ 7:30 pm A wildly contemporary high energy blend of Celtic and Punjabi music. Vancouver based group of 5 musicians who mash up electronics & world music.

for more information & tix call

250-766-9309

www.creeksidetheatre.com

S A L A T S N A E L A M T N E M G NG A HIIN TH YT NY AN

Voted by Okanagan Life Magazine

Best Asian, Vegetarian and Family Restaurant

www.ronjames.ca

VERNON PERFORMING ARTS CENTRE Thursday, April 22 - 8:00 pm Reserved Seating: $53.00 (tax & s/c incl.)

Ticket Seller: 250-549-7469 www.ticketseller.ca

Serving our valued customers for the past 34 years. 3006 - 28th Ave, Vernon • 250-545-5137


B6 Friday, March 19, 2010 - The Morning Star

www.vernonmorningstar.com

Live Wire ART SHOWS CHIMO ART GALLERY & FRAMESHOP 3011-28th St. Vernon, 549-4652. West Coast art and Haida art exhibition all through March, featuring local and B.C. artists’ work in a variety of mediums and forms such as paintings, prints and carvings. All original art and all new pieces. COATCHECK GALLERY Vernon Performing Arts Centre, lower lobby. The Vernon Camera Club presents its latest exhibition and photography sale, The Photographic Eye, now through April. Show is available for viewing before and during intermission at ticketed shows. GALLERY ODIN 215 Odin Rd. Silver Star Mountain, 503-0822. Eighth annual winter art show with 26 eclectic and talented western Canadian artists working in a variety of mediums, styles, forms and emphasis. Open for viewing every Wednesday and Saturday from 1 to 6 p.m. or by appointment for remainder of the winter season. GALLERY VERTIGO Suite 1 - 3001 31st St. Vernon, 503-2297. Current exhibitions include White Edge by Susan Bizecki, Time Machine, Earth and Water by Kevin Michael Witzke, Barbara HarderLutz’ Sketches at the Beaches of Fehmarn on the NOAA Members Wall and recent paintings by Jean MacDougall on the street level Window Gallery. Closing reception is March 27 at 7 p.m. Exhibition ends April 1. KALAMALKA VERTIGO Vernon’s Kalamalka Campus of Okanagan College presents Corporeal Fancies - sensitively-executed, biomorphically-inspired mixed media drawings by Tia McLennan, who is completing her BFA at the Nova Scotia School of Art and Design. The gallery is located just past the college lecture theatre in the main building adjacent to the college office. OKANAGAN ARTISTS OF CANADA Annual Spring Celebrations Art Show and Sale of original art will be held at the Best Western Vernon Lodge –– opening reception is April 16 from 5 to 9 p.m. and show continues April 17 from 9 a.m. to 5 p.m. For more info, visit the news section at www.okanaganartistsleague.ca. NADINE’S FINE ART & FRAMES 3101B 31st Ave. 542-8544. Fourth annual winter art show features all original art, local artists and all new pieces. VERNON PUBLIC ART GALLERY 3228 31st. Ave., 545-3173. New exhibition by Jim Kalnin, One Planet, opens Thursday with a reception from 5 to 8 p.m. Runs to May 20. The Vernon school district elementary school exhibition, Art from the Heart, opens March 20 with a reception from 1 to 4 p.m. Runs to April 15.

CONCERTS THE BARRA MACNEILS The Sydney Mines, Cape Breton Islandbased family group returns to Vernon with their harmonious voices and step dancing Celtic music at the Performing Arts Centre tonight at 8 p.m. Tickets are $33.50 at the Ticket Seller box office, 549-7469, www.ticketseller.ca. SHANE PHILIP Enjoy this year’s Spring Fling and help in the Creekside Theatre’s efforts to raise funds for the Sigh Kobayashi Memorial Bursary Fund when Quadra Island multi-instrumentalist Shane Philip performs tonight at 7:30 p.m. in the Lake Country theatre. Tickets are $16 for adults, $14 for students/seniors, $48 for a group of 4. Order at (250)766-9309, www.creeksidetheatre.com ANNA BEAUMONT Jazz vocalist, who has shared the stage with Mary Wilson of the Supremes, Luba, Tom Cochrane, Alfie Zappacosta and has sung for the Edmonton Oilers, performs music from her recently released CD, The Doorway, featuring the poetry of Rumi and Hafiz. Concert takes place Saturday at the Okanagan Centre for Spiritual Living, 2913 - 29 Ave. at 7 p.m. Tickets are $15 available at The Centre (250-549-4399) and at The Talkin’ Donkey. OUR KIDS HAVE TALENT FINALS Finals of this second annual contest, sponsored by Kiss FM and the Rarearth Music Festival, is Saturday at the Vernon Recreation Complex. Doors open at 5:30 p.m. and performances and presentations (with special guests 2009 winners James & the Country Gentlemen) start at 6:30 p.m. Dance to follow featuring three bands from the auditions. Tickets are $15 for adults, at

HOT AIR

JAMS/KARAOKE/OPEN MICS

PHOTO SUBMITTED

One of Canada’s finest harmonica player, Carlos del Junco returns to Lorenzo’s Café Wednesday with his band the Blues Mongrels to play a fusion of New Orleans grooves, swing, Latin, hip-hop, ska, and swampy roots rock. Born in Havana, del Junco (loosely translated “of the reeds”) immigrated to Canada as a young child, discovered the harmonica and the rest, as they say, is history. Now a virtuoso on the 10-hole diatonic harmonica, del Junco holds gold medals from the Hohner World Harmonica Championship in Germany, as well as multiple national awards. the Rec Complex and Cracked Pot, and kids 12 and under are free. Info at www.ourkidshavetalent.com. DANCE CUBA All female dance troupe hailing from Havana, under the direction of dancer-choreographer Lizt Alfonso, fuses the rapidly clacking heels of the flamenco, with the flowing grace of classical ballet, Afro-Cuban dance and a touch of jazz, Sunday at the Vernon Performing Arts Centre. Starts at 8 p.m. Tickets are $30 for adults, $27 for seniors and $25 for students at the Ticket Seller, 549-7469, www.ticketseller.ca. LIVE FROM THE MET Transmitted live in HD from New York’s Metropolitan Opera House is Ambroise Thomas’s French romantic opera Hamlet. March 27 at Vernon’s Galaxy Cinemas. Starts at 10 a.m. General admission is $23.05, senior $19.90 and child is $13.60 available at the box office. Info at www.cineplex.com/events. HAPPY BIRTHDAY OSO The Okanagan Symphony celebrates 50 years of entertaining valley audiences with the finest classical orchestral music, March 27 at the Vernon Performing Arts Centre. Former living conductors and players will perform a repertoire that spans the ages. Show starts at 7 p.m. Tickets are $42 for adults, $36 for seniors and $16 for a student/child, available at the Ticket Seller, 549-7469, www.ticketseller.ca. BROADWAY SHOWSTOPPERS Charity Van Gameren Studios and Lights of Broadway present an evening of non-stop Broadway hits, March 28 at 6 p.m. at the Schubert Centre. Tickets are $10 each and can be purchased at the Vernon Community Music School or at the door. All proceeds benefit Lights of Broadway’s spring musical The Sound of Music.

ABBEYFIELD COFFEE HOUSE Next coffee house is March 27 at the Falkland Hall. Doors open at 7 p.m. Music at 7:30 p.m. Admission is $5. Children 12 and under free. Dessert and non-alcoholic beverages avail. All proceeds to Abbeyfield Salmon River House Society, ARMSTRONG HOTEL Rosie’s Pub, 2715 Pleasant Valley Rd., Armstrong 546-6642. Every Wednesday and Thursday is a rockin’ jam session hosted by local guitar great Rudi Strauss at 9 p.m. ARMSTRONG INN (Saxon Pub), 3400 Smith Dr., 546-3056. Karaoke with Brenda Galbraith Thursday and Saturday at 8 p.m. BLENZ COFFEE (formerly Portillo’s) 2706-30th Ave., 545-9599. Open mic night every Monday (even holidays) has moved inside for fall and winter season, 7-10 p.m. Hosted by Rory. Limited seating. Sign up early. BLUEGRASS JAMS Vernon Community Arts Centre in Polson Park the second and fourth Wednesdays of each month from 7 until 9:30 p.m. Bring your acoustic stringed instrument, your voice, or both, and join the fun. $3 drop in fee. Call Sid at 250-549-1024. BLUE HERON PUB 7673 Okanagan Landing Road, 542-5550. Jam night with Cathy Ann Wells is every Thursday night at 7:30 p.m. CLIFFS BISTRO & PUB Enderby, by the bridge. Open mic first and third Wednesday. Contact Ellie at 546-3795. COLDSTREAM COFFEE HOUSE Coldstream Women’s Institute Hall, 9909 Kal Lake Rd. Saturday is feature act Sanded Edges from UBC Okanagan. (CDs available.) Musicians and spoken word artists can sign up at the door, which opens at 7 p.m. Music starts at 7:15. Coffee and goodies available by donation. Admission is $3 at the door. For info. call Sid at 250-549-1024. DJEMBE JAM Robin Ritchie of Harambee African Drum & Dance troupe hosts djembe jam session Saturday from 11:30-1:30 at Yoga Matters 4114 - 25 Ave. Vernon. Come play your drum, dance and sing in warm, casual atmosphere. We will be playing popular African rhythms as well as some new funky hip hop style rhythms. Some instruction available as well as drums for the drumless. $5 drop in fee. For info. call 250-545-9121, e-mail drummer-am-i@hotmail.com. ENDERBY INN 707 Cliff Ave, 838-7100, (Enderby). Karaoke every Thursday and Saturday. Friday night DJ. ESSENCE SPIRITUAL BOOK STORE/TEA ROOM in the Okanagan Centre for Spiritual Living, 2913-29 Ave., 250-549-4399. Tonight is a coffee house jam session with music, poetry, story telling and more. Doors open at 6:30. Music at 7 p.m. $5 entry includes coffee/tea. FORTUNES LANDING/HOWARD JOHNSON 1510 George St. Enderby, 838-6825. Karaoke with Brenda every Wednesday and Sunday night. FRATERNAL ORDER OF EAGLES HALL 5101 25th Ave. 542-3003. Karaoke with Brenda is every Friday starting at 8 p.m. LAKE COUNTRY OPEN MIC is held on the first Sunday of every month from 1 to 3 p.m. at the Creekside Theatre in Lake Country. SNEAKERS SPORTS BAR in the Village Green Hotel, 4801 - 27th St, 542-3321. Jam every Sunday, hosted by Tim Reardon and Orio. Starts at 7 p.m. TALKIN’ DONKEY 3923 32nd St, 545-2286. Open mic open to everyone, Wednesday nights starting at 7 p.m. Sign up sheet available at the coffee shop. TORO’S PUB 1220 Kalamalka Lake Rd, 545-7856. Thursday night is karaoke with Anita. Come out and show your talent. VERNON ROYAL CANADIAN LEGION BRANCH 25 4607 - 29th St., behind the Fast Lane Car Wash. Come out for a free, fun afternoon of jammin’ Sunday from 2 to 5 p.m. Bring your musical instrument and join us for toe tappin’ tunes and songs you love to dance to.

FILM

LIVE MUSIC VENUES

VERNON FILM SOCIETY All films held at the Vernon Towne Cinema, 2910 30th Ave. March 29 is Pedro Almodóvar’s Broken Embraces, featuring Penelope Cruz. Show at 5:15 and 7:45 p.m. Tickets are $6 each, available in advance at the Towne box office or the Bean Scene.

ARMSTRONG INN 3400 Smith Dr., 546-3056. The Bone play the pub tonight. Lili and Rose (Tanya Lipscomb and Judy Rose) play blues and jazz in the pub Sunday at 6 p.m. Blackberry Wood play their own mix of hoedown, Burlesque and gypsy music Wednesday at 8 p.m.

APPY SPECIALS DAILY 2:00 - 6:00 PM

VOTED … “Best Pub” …“Best Appies” Highway 97

North Vernon

Weekend Dinner Features after 5:00 pm

GIFT CARDS NOW AVAILABLE! NON-SMOKING PATIO

NIGHTLY SPECIALS ~ NIGHTLY SPECIALS ~ NIGHTLY SPECIALS MONDAY TUESDAY WEDNESDAY THURSDAY FRIDAY SATURDAY SUNDAY

9 STEAK SANDWICH $ 95

7 35 DRY RIBS PRAWNS $ 95

¢

ea.

35 WINGS ¢

ea.

FRESH ROAST BEEF HALIBUT DINNER

6 1095

BACON OR HAM & EGGS 11 AM - 2 PM... BURGER AND BEER ..............

$

$ 95


www.vernonmorningstar.com

Friday, March 19, 2010 - The Morning Star B7

Live Wire LIVE MUSIC ARMY, NAVY, AIR FORCE CLUB 2500 46th Ave, 542-3277. In the Spitfire Lounge tonight and Saturday is Copper Creek Trio. Starts at 7:30 p.m. Troy Mitchell presents Hypnotixxx, a bust-a-gut comedy evening where you are part of the show in The Hangar March 26 at 8 p.m. Tickets $20 at Libra Love Boutique or call 250-306-9235. BLUE HERON PUB 7673 Okanagan Landing Road, 542-5550. Background instrumental guitar music by Les Copeland every Friday and Saturday from 7:30 to 9:30 p.m. LORENZO’S CAFE 901 Mabel Lake Rd. (8 km east of Enderby), 838-6700. Wednesday at 8 p.m. is 1997 to 2009 harmonica player of the year (as named by the Canadian Maple Blues Awards) Carlos del Junco and The Blues Mongrels. LUMBY ROYAL CANADIAN LEGION BRANCH 167 2016 Miller St. (250) 5472338. The Amazing Flying Honky Tonk Country and Western Jukebox Band will be at the Lumby Legion April 3 from 8 p.m. to midnight for a dancing good time. Come down and party with Tex Copeland and Professor Paul on guitars, Charlie Fisher on drums, plus many guest stars. OYAMA ROYAL CANADIAN LEGION BRANCH 189 St. Patrick’s Day dinner &

dance tonight. Irish stew dinner, 6:30 to 7 p.m., $12 per person. Dancing 7 to 10 p.m. Music by Art Taylor. Please reserve your tickets early by calling the branch at 250548-3521 after 3 p.m., or emailing lsdmjb@ yahoo.com. Members and bona fide guests welcome. SIR WINSTON’S PUB 2705 32nd St. (250) 549-3485. The pub features Marty Oblak, an up-and-coming Canadian artist who plays acoustic rock, Saturday. SNEAKERS SPORTS BAR in the Village Green Hotel, 4801 - 27th St, 542-3321. By popular demand, for one night only, Darby Mills of Headpins fame performs live with the Young’uns Saturday at 9 p.m. Tickets are $8 available in advance at Sneakers or at the door. No minors. VERNON JAZZ CLUB 3000 - 31st St. March 27 is Okanagan favourite Don Ross and friends, playing swing and oldies. Doors open at 7:15. Music starts at 8 p.m. Tickets are $18 ($14 for Vernon Jazz Society members) at the Bean Scene and Bean to Cup. VERNON ROYAL CANADIAN LEGION BR 25. 4607 - 29th Street, behind the Fast Lane Car Wash. Dance to the soothing sounds of The Midnight Travellers tonight and Saturday, 7:30 to 11:30 p.m. Admission is $4 for members and $6 for non-members. Come early for dinner and bring your friends to join the party.

ARMSTRONG INN E NTERTAINMENT N EWS FRIDAY, MARCH 19 - “The Bone” Alternative and classic rock. Show starts at 9:00 pm. $5.00 cover at the door. SUNDAY, MARCH 21 - Live Blues (Lili and Rose) in the pub with award winning local Blues and Jazz artists Tanya Lipscomb and Judy Rose. Show starts at 6:00 pm. WEDNESDAY, MARCH 24 - “Blackberry Wood” (from Vancouver) It’s hoedown time with this eclectic mix of Country, Burlesque, and Gypsy music. FRIDAY, MARCH 26 - “The Salmon Armenians” are back! Classic rhythm, soul and blues. Tickets on sale now. SUNDAY, APRIL 18 - “Oysterband” Direct from the UK on their Canadian tour they are billed as one of the Greatest British Folk ensembles of all time! Music for the head, heart, and trousers. THURSDAYS & SATURDAYS - Karaoke in the Pub with Brenda FOR MORE INFO THURSDAYS & SATURDAYS , TI - Pianist in the Dining Room OR RESERVATIOCKETS CALL 250-546 NS -3

056

Friday, March 19

Evening

>> >>>> >> <<"6:00"<< <<"6:30"<< <<"7:00"<< <<"7:30"<< <<"8:00"<< <<"8:30"<< <<"9:00"<< <<"9:30"<< <<10:00<< <<10:30<< <<11:00<< <<11:30<< SportATP Tennis: BNP Paribas Open: Men’s SportsCentre (Live) ^ sCentre ^ Quarterfinals. From Indian Wells, Calif. Entertain- ET Canada X-Weighted ‘‘Jade’’ (S) ^ Shark Tank (S) ^ NUMB3RS Investigating CHBC News Final (N) ^ ment ’Night the death of a professor. etalk (S) ^ Access Medium Allison is Law & Order (S) ^ The Bridge ‘‘The CTV News CTV News <CTV"BC<"<<5< Hollywood mugged. (N) (S) ^ Unguarded Moment’’ (S) (N) (S) ^ (5:00) CBC Coronation Wheel of Jeopardy! Rick Mercer MarketCBC News: the fifth CBC News: The National The Hour (S) ^ News: Street (N) Fortune (N) (N) ^ Report (S) place (N) estate (S) ^ (N) (S) ^ <CBUT<<<""<<6< Vancouver (S) ^ ^ ^ (S) ^ College College Basketball: NCAA Tournament, First Round: Teams TBA. KIRO News: Judge Judy The Insider Entertain- KIRO 7 Late Show A man sues (N) (S) ^ ment News at With David <KIRO<<<""<<7< Basketball From Buffalo, N.Y., Jacksonville, Fla., Milwaukee or Spokane, Wash. Special (Live) ^ Edition ^ his ex-lover. Tonight (S) 11PM Letterman (5:59) News Hour (N) ^ Entertain- ET Canada X-Weighted ‘‘Jade’’ (S) ^ Shark Tank (S) ^ NUMB3RS ‘‘Animal Rites’’ News Hour Final (N) ^ ment Investigating the death of a <GLOBAL<< "<<8< Tonight (S) professor. (S) ^ Hockey The Ultimate Fighter (S) UFC Sportsnet Connected Sportsnet Connected Poker Sportsnet Saturday Night Poker <RSP<<<<<<<9< (5:30) After Dark Connected Central Primetime (Live) Working Dogs With Yoho National Park Poirot ‘‘Jewel Robbery at Dalziel & Pascoe ‘‘The Movie: TTT ‘‘Startup.com’’ (2001) Chronicling the <KNOW<<<" "<10< Animals Jobs the Grand Metropolitan’’ ^ British Grenadier’’ ^ swift rise and fall of an Internet business. ^ KOMO 4 News Lewis. (N) Wheel of Jeopardy! Figure Skating: Thin Ice. 20/20 (S) ^ 20/20 (N) (S) ^ KOMO 4 Nightline Fortune (N) (N) ^ From Mashantucket, News Lewis. (N) ^ <KOMO<<<" "<13< ^ ^ Conn. (S) (N) ^ Crime Scene Investigation Murder CSI: Crime Scene CSI: Crime Scene 1,000 Ways GameTrail- God of War Disorderly Conduct: <SPK<<<<<<15< CSI: at a fast-food restaurant. (S) ^ Investigation (S) ^ Investigation (S) ^ to Die (S) ers III Video on Patrol Minds ‘‘52 Criminal Minds ‘‘Brothers Criminal Minds Freeway Criminal Minds Solving a Criminal Minds ‘‘52 Criminal Minds ‘‘Brothers <A&E<<<<<<17< Criminal Pickup’’ (S) ^ in Arms’’ (S) ^ killer targets luxury cars. murder in reverse. (S) ^ Pickup’’ (S) ^ in Arms’’ (S) ^ Larry King Live (N) ^ Anderson Cooper 360 ^ Larry King Live Anderson Cooper 360 ^ Anderson Cooper 360 ^ NHL Hockey: Detroit Red Wings at Edmonton Oilers. Rexall Place. <TSN<<<<<<<3< NBA Basketball (Subject to Blackout) (Live) ^ CHBC <CHBC<<<<<4< Global National ^ News CTV News (N) (S) ^

<CNN<<<<<<18<

House- This House- Supernanny (S) ^ <W>>><<19< This Sell Sell

Kristina’s How to Look Good Movie: TT ‘‘A Walk to Remember’’ (2002, Romance) A Hwd 10 Naked Canada ‘‘Yvonne’’ high-school delinquent courts a minister’s daughter. Best Beauty Call A martial arts iCarly Carly and Sam help iCarly Carly dates a boy 10 Things I That’s So Prank Prank Prank Fries With <YTV<<<<"<22< iCarly champion. (S) ^ a pair of comedians. (S) ^ with a bad reputation. (S) Hate Weird (S) ^ Patrol (S) ^ Patrol (S) ^ Patrol (S) ^ That? (S) ^ CBC News: The National Love, Hate and CBC News: The National CBC News: The National Love, Hate and CBC News: The National <NEWS<<<<23< (N) (S) ^ Propaganda-Generation (N) (S) ^ (N) (S) ^ Propaganda-Generation (S) ^ Park Trailer Park Relic Hunter (S) ^ Movie: ‘‘Beyond Loch Ness’’ (2008) A scientist traces Pure Kenny vs. Trailer Park The <SHOW<<<<24< Trailer Boys (S) ^ Boys (S) ^ the Loch Ness monster to Lake Superior. (S) ^ Pwnage (S) Spenny (S) Boys (S) ^ Foundation vs. Wild ‘‘China’’ Scandals of the Ancient Daily Planet Daily science Man vs. Wild ‘‘China’’ Dirty Jobs Mike cleans up Scandals of the Ancient <DISC<<<"<<25< Man Bear travels to China. (N) World show. ^ Bear travels to China. an Alaskan oil spill. (S) ^ World Til Debt Do Til Debt Do Til Debt Do Til Debt Do ET Canada Whatever The Real Housewives of The Real Housewives of Project Runway ‘‘Finale <SLICE<<<" <<26< Us Part (S) Us Part (S) Us Part (S) Us Part (S) Happened New York City (S) ^ Orange County (S) Pt. 2’’ (S) ^ Office Everybody- Two and a Two and a House ‘‘Remorse’’ (S) Kitchen Nightmares News The Office TMZ (N) (S) My Name Is <KAYU<<<<27< The ‘‘Crime Aid’’ Raymond Half Men ^ Half Men ^ (PA) ^ ‘‘Mama Rita’s’’ (N) (S) ^ ^ ^ Earl (S) ^ Not to Wear Four Weddings ‘‘...And a What Not to Wear Four Weddings ‘‘...And a What Not to Wear Four Weddings ‘‘...And <TLC<<<<<<28< What ‘‘Jennaydra’’ (N) (S) ^ Street Parade’’ (N) (S) ^ ‘‘Jennaydra’’ (S) ^ Street Parade’’ (S) ^ ‘‘Amanda’’ (S) ^ Fireworks’’ (S) ^ White Collar ‘‘White Collar Dexter Lila attaches Law & Order ‘‘Menace’’ Without a Trace ‘‘Two White Collar ‘‘White Collar Red Shoe Diaries Families’’ (S) ^ Pilot’’ Vicious counterfeiter. ‘‘Cowboy, Cowboy’’ A <BRAVO<<<29< Pilot’’ Vicious counterfeiter. herself to Dexter, making (S) ^ (S) (Part 1 of 2) ^ him uncomfortable. (S) ^ (S) (Part 1 of 2) ^ woman’s cowboy lover. (S) WizardsHannah Hannah Movie: ‘‘Starstruck’’ (2010, Drama) Wingin’ It Movie: ‘‘Stuck in the Suburbs’’ (2004, Movie: TT ‘‘Richie Rich’’ <FAMILY"<<32< Place Montana ^ Montana ^ Sterling Knight. Premiere. (S) ^ (N) (S) ^ Comedy-Drama) Danielle Panabaker. ^ (1994) Macaulay Culkin. Law & Order: Special Seinfeld (S) My Name Is Movie: TTZ ‘‘Payback’’ (1999, Action) A betrayed Movie: TZ ‘‘Double Team’’ (1997, Adventure) A spy <TBS<<<<<<33< Victims Unit ‘‘911’’ (S) ^ ^ Earl (S) ^ thief launches a single-minded quest for revenge. ^ and a flamboyant arms dealer take on a terrorist. ^ Operation Ghost Hunters Destination Truth (S) ^ Operation Operation Ghost Hunters Samuel Ghost Hunters <OUTDR<<<37< Operation Repo ^ Repo ^ International (S) ^ Repo ^ Repo ^ Mudd House. ^ International (S) ^ Jobs in the Danger Zone Ancients Behaving Badly Nostradamus Effect Movie: TTT ‘‘Face/Off’’ (1997, Action) John Travolta, Nicolas Cage, Joan Allen. An <HIST<<<"<<38< Controlling mother-nature. ‘‘Julius Caesar’’ (S) ^ Secrets of the seven seals. FBI agent and a violent terrorist switch identities. (S) ^ Breaking Bad ‘‘Crazy Breaking Bad ‘‘Grilled’’ ^ Breaking Bad Breaking Bad ‘‘Better Call Breaking Bad ‘‘ABQ’’ ^ Movie: ‘‘Halloween 4: The <AMC<<<<<40< Handful of Nothin’’’ ^ ‘‘Peekaboo’’ ^ Saul’’ ^ Return of Michael Myers’’ NASCAR NASCAR Racing: Sprint Cup: Food City Trackside At... NASCAR Racing: Nationwide Series: Scott Turf NASCAR Racing <SPVSN<<<41< Racing 500, Qualifying. Builder 300, Practice. the KCTS 9 Washington NOW on Bill Moyers Journal Dr. Ed Sullivan’s Rock and Roll Classics: The 60s <KCTS<<<<46< PBS NewsHour (N) (S) ^ About Money Connects Week (S) ^ PBS (S) ^ Jane Goodall. (N) (S) ^ Some of the biggest hits of the 1960s. ^ NBC KING 5 Evening Inside Who Do You Think You Dateline NBC (S) ^ KING 5 The Tonight Nightly News (N) Magazine Edition ^ Are? ‘‘Lisa Kudrow’’ (N) News (N) Show With <KING<<<"<<48< News (S) ^ ^ (S) ^ Jay Leno ^ Gospel Hour Unscripted Heart of Poltergeist: The Legacy Movie: TTT ‘‘Francis of Assisi’’ (1961, Biography) Paid Peter <VISION<<<<70< Gaither Gospel music. (S) ^ (N) (S) Courage (S) ‘‘Brother’s Keeper’’ (S) ^ Italian wastrel founds Franciscan Order in 13th century. Program (S) Popoff (S)


B8 Friday, March 19, 2010 - The Morning Star

www.vernonmorningstar.com

IT’S NOTA DIARY, IT’S AMOVIE.

Arts

Still a smooth operator Sade: Soldier of Love

S

ade, both the singer and the band, aren’t noted for being prolific. Their new album, Soldier of Love, is their sixth studio album in 25 years, and their first in 10 years. However, the band is definitely consistent in style and image, and the songs on Soldier have all the hallmarks of the smooth condo-soul sound heard on the band’s ‘80s smash debut, Diamond Life, or Stronger Than Pride, or any other of their recordings. Dean Gordon-Smith Soldier of Love is interesting in a Dorian Gray, insectin-amber fashion, but is focused on the formulaic Sade style. Detached mystery is the rule of the day, with a nod to the world-weary for good measure. There’s an obvious lack of creative growth, and unless you have a sweet tooth for dinner music or wine and cheese background sound, then Sade and co. have hit another multi-million seller dead end. Even the cover photography and artwork, while moody and tasteful, is a retread of past ideas. The music reflects these visuals, and like the singer

The latest music is reviewed every Friday in Street Sounds STARTS TODAY!

STREET SOUNDS

Check theatre directories or log onto www.cineplex.com or www.tribute.ca for locations and showtimes

FOR ADVANCE TICKETS GO TO cineplex.com

Singer and band namesake Sade releases her first album in 10 years with Soldier of Love.

POLSON PLACE MALL

herself, is sultry and mysterious, but not compelling. There’s a lite approach taken to the music making that dismisses dynamics and renders potential soundscapes one-dimensional, packing all the punch of an after dinner mint with Valium. As Will Ferrell’s Mugatu (from the 2001 film Zoolander) once sagely observed: “Is everyone taking crazy pills?” Ho hum, there’s plenty of time for number seven in 2020.

**DIARY OF A WIMPY KID (G) Friday to Sunday 1:40, 4:15, 6:30, 8:45; Monday to Thursday 6:30, 8:45. **THE BOUNTY HUNTER (PG - Coarse language, violence) Friday to Sunday 2:00, 4:30, 7:00, 9:30; Monday to Thursday 7:00, 9:30. SHE’S OUT OF MY LEAGUE (14A - Sexual content, coarse language) Friday to Sunday 2:20, 4:45, 7:15, 9:45; Monday to Thusday 7:15, 9:45. **GREEN ZONE (14A - Violence, coarse language) Friday to Sunday 1;00, 3:40, 6:15, 9:00; Monday to Thursday 6:15, 9:00. **ALICE IN WONDERLAND (PG - Violence, Frightening Scenes) Friday to Sunday 1:20, 4:00, 6:45, 9:15; Monday to Thursday 6:45, 9:15.

Be the first to take Edward home. Select Walmart stores will be open past Midnight.

Saturday, March 20

SHOWTIMES FOR FRIDAY, MARCH 19 TO THURSDAY, MARCH 25, 2010

Evening

2010 World Women’s Championship: Canada vs. Sweden. From Swift <TSN<<<<<<<3< Curling: Current, Sask. (Live)

SportATP Tennis: BNP Paribas Open: Men’s sCentre ^ Semifinals. From Indian Wells, Calif. CHBC 16:9-Bigger renegade- Movie: ‘‘Ice Blues’’ (2008, Mystery) Chad Allen. Love You to G-Spot (S) <CHBC<<<<<4< Global National ^ News Picture press.com Strachey hunts a lawyer’s killer. Premiere. ^ Death ^ ^ W5 (S) ^ Flashpoint ‘‘Custody’’ (S) Law & Order Suspicious Spectacle: Elvis Costello <CTV"BC<"<<5< CTV News (N) (S) ^ ^ web site. (S) ^ With... (N) ^ (4:00) NHL Hockey: NHL Hockey: Detroit Red Wings at Vancouver Canucks. General 2010 Crashed Ice CBC News: Motors Place. (Subject to Blackout) (S Live) ^ Championship From Vancouver <CBUT<<<""<<6< Montreal Canadiens at Toronto Maple Leafs. ^ Quebec City. (N) (S) ^ Saturday ^ College Basketball KIRO News: Special Entertainment Tonight A Nation Remembers: 48 Hours Mystery ‘‘In Too Edition ^ (N) (S) ^ The Story of the Deep’’ A college student is <KIRO<<<""<<7< Pentagon Memorial ^ under suspicion. (N) (S) ^ (5:59) News Hour (N) ^ 16:9 The renegade- Movie: ‘‘Ice Blues’’ (2008, Mystery) Chad Allen, Love You to G-Spot (S) Bigger press.com Sebastian Spence, Sebastien Roberts. Strachey hunts Death ^ ^ <GLOBAL<< "<<8< Picture ^ (S) ^ a lawyer’s killer. Premiere. ^ UEFA English Premier League Soccer: Teams TBA. UFC Countdown Sportsnet Connected <RSP<<<<<<<9< Saturday Night Poker Champ. (Taped) (Live) National Geographic Heartbeat Joe thwarts Midsomer Murders ‘‘The Creeper’’ The murder of a <KNOW<<<" "<10< Profiles of Nature (S) Specials ^ safe robbers. ^ dinner guest. (N) ^ KOMO 4 News Norton. Wheel of Jeopardy! FlashForward ‘‘Revelation Zero’’ Mark must meet with Castle ‘‘Nanny McDead’’ A Fortune ^ ^ a therapist. (S) ^ nanny’s body is stashed in <KOMO<<<""<13< (N) ^ a dryer. (S) ^ 1,000 Ways 1,000 Ways Entourage Entourage Entourage Entourage Disorderly Conduct: Disorderly Conduct: <SPK<<<<<<15< to Die (S) to Die (S) (S) ^ (S) ^ (S) ^ (S) ^ Video on Patrol Video on Patrol CSI: Miami Reality star’s CSI: Miami A seemingly CSI: Miami Horatio learns CSI: Miami ‘‘Head Case’’ CSI: Miami Reality star’s <A&E<<<<<<17< murder. (S) ^ normal family is targeted. about Julia’s instability. (S) (S) ^ murder. (S) ^ Larry King Live Newsroom Campbell Brown Larry King Live Newsroom Movie: TTZ <W>>><<19< (5:00) ‘‘Legally Blonde’’ (2001)

TM & © 2010 SUMMIT ENTERTAINMENT. LLC. ALL RIGHTS RESERVED. © 2010 E1 FILMS INC. ALL RIGHTS RESERVED.

TEL: 250-542-1107

**PASS RESTRICTED

>> >>>> >><<"6:00"<<<<"6:30"<<<<"7:00"<<<<"7:30"<<<<"8:00"<<<<"8:30"<<<<"9:00"<<<<"9:30"<<<<10:00<<<<10:30<<<<11:00<<<<11:30<<

<CNN<<<<<<18<

1055 HILLSIDE DR,UNIT#100, KAMLOOPS, BC 1555 BANKS ROAD, KELOWNA, BC 275 GREEN AVE W PEACHTREE MALL, PENTICTON, BC 2200 - 58 TH AVENUE, VERNON, BC 2170 LOUIE DRIVE, WESTBANK, BC

#275 - 2306 HIGHWAY #6, VERNON

OPEN DURING CONSTRUCTION

SportsCentre (Live) ^

News Final Saturday (N) ^ Night Live CTV News CTV News (N) (S) ^ Hockey Night in Canada: Replay Tonight’s games. (S) ^ KIRO 7 The Insider News at (N) (S) ^ 11PM News Final Saturday (N) ^ Night Live (S) ^ Saturday Night Poker Movie: TTT ‘‘Startup.com’’ (2001) ^ KOMO 4 Monk (Part News 2 of 2) ^ Norton. ^ Best of PRIDE Fighting Championship (S) CSI: Miami A seemingly normal family is targeted. Newsroom

Movie: TTT ‘‘Mean Girls’’ (2004) Lindsay Lohan. A Movie: TTT ‘‘The Devil Wears Prada’’ (2006, Comedy) Meryl Streep. Hwd 10 teen becomes friends with three cruel schoolmates. A recent college graduate lands a job at a fashion magazine. Best vs. Kat League-Evil Zeke’s Pad Prank America’s Funniest That’s So Prank Survive Ghost Adrenaline Mystery <YTV<<<<"<22< Kid Hunters (S) (S) ^ (N) (S) ^ Patrol (S) ^ Home Videos (S) ^ Weird (S) ^ Patrol (S) ^ This (S) ^ Trackers ^ Proj Mansbridge The 40 Year Secret ^ National CBC News: National Mansbridge The 40 Year Secret ^ National Market<NEWS<<<<23< National One on One At Issue ^ One on One place (S) ^ Movie: TTZ ‘‘The Slings and Arrows (S) ^ Movie: ‘‘Nightmare at the End of the Hall’’ (2008, Movie: TT ‘‘Aliens vs. Predator: Requiem’’ (2007, <SHOW<<<<24< (4:00) Matrix Revolutions’’ (2003) Drama) Sara Rue, Kavan Smith, Amber Borycki. (S) ^ Science Fiction) Steven Pasquale. Premiere. (S) ^ Jobs Paint bulking; Verminators ‘‘Holy Bees!’’ Ghost Lab ‘‘If Walls Could Criss Angel Mindfreak Destroyed Destroyed Verminators ‘‘Holy Bees!’’ <DISC<<<"<<25< Dirty making maple syrup. (S) (N) (S) ^ Talk’’ (N) (S) ^ Dude ranch. ^ in Seconds in Seconds (S) ^ Real Housewives of Project Runway ‘‘Hard Models of Party The Real Housewives of The Real Housewives of The Real Housewives of <SLICE<<<" <<26< The Orange County (S) Wear’’ (S) the Runway Mamas (S) New York City (S) ^ Atlanta (S) Orange County (S) and a Two and a Cops (N) Cops (S) America’s Most Wanted: News Most The Wanda Sykes Show <KAYU<<<<27< House ‘‘Paternity’’ (S) ^ Two Half Men ^ Half Men ^ (S) (PA) ^ (PA) ^ America Fights Back (S) Wanted (N) (S) (PA) ^ Boss Cake Boss Cake Boss Cake Boss Cake Boss Cake Boss Cake Boss Cake Boss Cake Boss Cake Boss Cake Boss Cake Boss <TLC<<<<<<28< Cake (S) ^ (S) ^ (S) ^ (S) ^ (S) ^ (S) ^ (S) ^ (S) ^ (S) ^ (S) ^ (S) ^ (S) ^ Movie: TTT ‘‘About a Boy’’ (2002, Comedy-Drama) Bravonews Arts & Dexter Lila attaches Movie: TTZ ‘‘Holy Smoke’’ (1999, Comedy-Drama) Minds (S) herself to Dexter, making Kate Winslet, Harvey Keitel, Pam Grier. An Australian <BRAVO<<<29< Hugh Grant, Toni Collette, Rachel Weisz. A lonely boy (S) ^ finds a friend in a carefree bachelor. (S) ^ ^ him uncomfortable. (S) ^ woman gets involved in an Indian cult. (S) ^ Jonas (S) Overruled! Suite Life Zoey 101 Suite Life of Hannah Movie: TTTZ ‘‘Superman II’’ (1980) Three criminals Movie: TZ ‘‘Batman & <FAMILY"<<32< ^ (S) ^ on Deck ‘‘Balloon’’ ^ Zack/Cody Montana (S) from Krypton take over the United States. (S) ^ Robin’’ (1997) (S) ^ Movie: TTZ ‘‘The Guardian’’ Movie: TTZ ‘‘The Alamo’’ (2004, War) Dennis Quaid. Movie: TTT ‘‘G.I. Jane’’ (1997, Drama) Demi Moore, Anne Bancroft. <TBS<<<<<<33< (5:00) (2006, Drama) Kevin Costner. ^ Outnumbered Texans fight to secede from Mexico. ^ A female Navy SEALs recruit completes rigorous training. ^ ‘‘Chelsea and Departures Exploring the Survivorman Georgia’s Mantracker ‘‘Rene and Mantracker ‘‘Chelsea and Departures Exploring the <OUTDR<<<37< Mantracker Trev’’ Chelsea and Trev. wonders of Sigiriy. (S) ^ Altamaha River Basin. ^ Dave’’ ^ Trev’’ Chelsea and Trev. wonders of Sigiriy. (S) ^ Behaving Badly Nostradamus Effect Cities of the Underworld Movie: TTT ‘‘Kingdom of Heaven’’ (2005, Historical Drama) Orlando Bloom, Eva <HIST<<<"<<38< Ancients ‘‘Julius Caesar’’ (S) ^ Secrets of the seven seals. (S) ^ Green, Jeremy Irons. A young knight protects Jerusalem from invaders. (S) ^ Movie: TTTT ‘‘Dances With Wolves’’ (1990, Western) Kevin Costner, Mary Movie: TTT ‘‘Kiss Kiss, Bang Bang’’ (2005, Suspense) Movie: TT ‘‘The Crew’’ <AMC<<<<<40< (5:00) McDonnell, Graham Greene. A Union officer befriends the Lakota. ^ A thief learns investigative techniques from a detective. (2000) Richard Dreyfuss. Le Mans American Le Mans NASCAR NASCAR Mobil 1 The BullrunBullrun The second leg Bullrun <SPVSN<<<41< American Series Racing Series Racing Perfor. Smarts Grid Guide will be a night run. Rick Steves’ Ed Sullivan’s Rock and Roll Classics: The 60s Members’ Choice Christiane Northrup: <KCTS<<<<46< (3:00) European Journey Some of the biggest hits of the 1960s. ^ Menopause and Beyond NBC KING 5 Northwest Inside Movie: TT ‘‘Godsend’’ (2004, Suspense) Greg Law & Order: Special KING 5 Saturday News (N) Backroads Edition Kinnear, Rebecca Romijn-Stamos, Robert De Niro. A Victims Unit A murder is News (N) Night Live <KING<<<"<<48< Nightly News (S) ^ Weekend ^ scientist clones a couple’s dead son. connected to an old case. (S) ^ Des-Pardes (S) Aikam (S) Taur Lashkara (S) WAQT - Toda Sadda (S) Credo (S) The Daily <VISION<<<<70< Punjabi Di ^ ^ (S) ^


www.vernonmorningstar.com

Friday, March 19, 2010 - The Morning Star B9

EDITOR: KATHERINE MORTIMER

Life

Y

PHONE: 550-7924

Y

E-MAIL: lifestyles@vernonmorningstar.com

Bearing witness in Palestine BARBARA HARRIS

Special to The Morning Star

Clipping an angel’s wings: “She is the vision of innocence, peering up into the dull eyes of a soldier towering over her. She can only be four or five years old. Black slacks with a green striped short skirt fanning out beneath her short black jacket suggest she is a kindergarten student. “She strains to hand the backpack, which is half her length, up to the soldier who orders her to stop. He systematically opens every zipper and plunges his hands into each pocket before handing the backpack back. It slumps to the ground. “The little girl carefully closes the zippers and with considerable effort slings the backpack onto her back, already forgotten by the young soldier who has moved on to the next search. The tiny tot stumbles as she hurries to catch up with her friends. This is a significant part of her education under the Israeli occupying power to clip her fragile wings.” The passage above was written by Johann Funk in December 2009, during his fourth trip to Palestine. He was on an eight-week assignment to Al-Kahlil (Hebron) with Christian Peacemaker Teams (CPT), a group that strives to foster peace in areas severely impacted by conflict and violence. Their goal is to go wherever there is conflict, and to observe and record whatever happens. The hope is that the presence of outsiders will minimize or stop the incident, and will prevent further violence. Distressed by the treatment of the little girl, Funk felt helpless, angry and sad all at once. “What can I do? I observe, I document, I report but it is not enough, it is never enough to significantly change the severity of the occupation, let alone to end it,” he said. “I rationalize that what I do is part of a larger struggle but this answer is never completely satisfying. My angel at Qitoun Checkpoint is still dehumanized as an enemy, invisible to international geopolitics despite my feeble efforts. All I can do is reflect, pray and contemplate the suffering God must experience when he sees what is done in his name.” When questioned, Funk explains that Qitoun Checkpoint is one of the “gates” that restrict access to the Old City of Hebron, currently under total Israeli control. The area past the gate has been reserved for Israeli settlers only; but a school for Palestinian boys and girls had already been established there before the Israeli occupation in 1967. Palestinians receive access only after a security check (metal detectors and ID and body searches) when they cross this zone on the way to school, the Ibrahimi Mosque or the market in the Old City, places they must visit regularly. Funk and other CPT volunteers have seen Palestinian adults and children being attacked and beaten, have seen Palestinian homes damaged or destroyed, and have themselves been assaulted when they were trying to stop the violence. “On the morning of Thursday, 7 January, 2010, Israeli soldiers attacked and injured Palestinian shepherds, as they grazed their sheep in Humra valley,” Funk wrote in a report. “Soldiers hit the shepherds with their rifle butts, pushed them, and kicked them while other soldiers held them to the ground. Other members of the family came to the area, and the women tried to intervene, hoping to de-escalate the situation. However, the soldiers also forcefully pushed the women to the ground. CPTers trying to videotape the violent attack were roughly pushed and a soldier grabbed and

This is Dave...

PHOTOS SUBMITTED

Young Israeli men make their way to the synagogue in Hebron, where volunteers from Christian Peacemaker Teams are working.

Johann Funk will speak about his work at a presentation March 28. broke one of their video cameras.” The United Nations Security Council passed Resolution 242 Nov. 22, 1967, stating that Israel is required by international law to withdraw from all the territories occupied several months before. The resolution further stated that every country must have the right to live in peace within secure and recognized boundaries free from threats or acts of force. Come and hear an eye-witness account of how this resolution has been ignored. On March 28, Funk will be speaking about what he has seen and learned in the past two months, as well as during the three previous visits, to Palestine. He is being sponsored by KAIROS, a partnership of Canadian churches and religious communities which works on social justice issues. Funk’s presentation takes place from 7 p.m. to 9 p.m. at All Saints Anglican Church, 3205-27th St., with moderator Chris Harwood-Jones. and featuring videos and displays. To learn about KAIROS, contact Karen Truesdale at katrues@ telus.net. For other information, contact Steve Heeren of the Palestinian Study Group at tzsche@shaw.ca, or go to the Christian Peacemaker Teams website at www.cpt.org.

A volunteer with Canadian Peacemaker Teams walks children to school.

Full Spectrum Lighting

The quality of your lighting is most important. Talk to Dave about full spectrum lighting. He knows that the simulated sunlight emitted from our full spectrum lamps 2801 44th Avenue, promotes a healthier environment, and positively affects your Vernon morale and moods. L I G H T I N G

545-7370

VERNON’S LARGEST LIGHTING SELECTION ~ NO ONE EVEN COMES CLOSE!


B10 Friday, March 19, 2010 - The Morning Star

www.vernonmorningstar.com

To place a classified ad call:

Life

250-550-7900

Couple grows apart tionship should move began. After there in six the enforced months. togetherThis puts ness of the me in a dreadroad trip, ful situation Rob may be — away from rethinking professional his domestic contacts and a supportive fam- Kathy Mitchell & Marcy Sugar situation and enjoyily. I have no ing his “freedom.” If idea whether this venyou believe he’s going ture with his brother to stay in his new locawill work out, and Rob hasn’t bothered to look tion whether or not his business venture for a job closer to us. I succeeds, you might don’t need to tell you how challenging it is to consider moving so the be a single parent. I am children can be closer to their father. exhausted, sad, resentHowever, you sound ful and angry. I miss unsure about the relaRob’s help and companionship, but I’m not tionship and could benefit from counseling. sure I miss him. It would be best if Rob Should I endure the would go with you, but next several months if not, please go alone. and then move? My Dear Annie: My daughters miss their mom and dad were father, and it would together for 30 years be hard on them if we and raised four chilsplit up. It is impordren. Dad died sudtant to keep my family denly at age 60 from an together, but at what undetected heart probcost? — Between a lem. Mom was 52 and Rock in Kansas grieved terribly. Dear Kansas: If you Four years after Dad and Rob have been passed away, Mom met together for 10 years, a widower. They wantyou were both quite ed to travel, but he felt young when your rela-

ANNIE'S MAILBOX

they should get married first. After some time, she agreed. My problem is, I have always viewed the marriage as a betrayal of my father and, to this day, have a problem accepting it. All of these people have passed away, including my mom, who died in December. Are my feelings justified? — Still Miss Him Dear Still: You can’t help how you feel, justified or not. But it was unreasonable and unfair to have expected your mother to remain alone forever in deference to your father’s memory. When children grow up and move away, the remaining parent is left with an empty house and no one to share her life. Please forgive your mother for wanting to recapture the happiness she once had. Dear Annie: I am responding to “Upset in Santa Cruz” about the unexplained bruises on a young boy. A reader suggested he could have Ehlers-Danlos syndrome. He could also have leukemia.

My sister had bruises all over her body. We thought her small dog had caused them, but later, to our dismay, we discovered she had an aggressive form of leukemia. — Kathy in Omaha Dear Kathy: How terribly sad. Please know your warning will help others.

Men being helpful to women with cancer. Does this sound like a fish out of water? “Hopefully not, but what are the challenges that male partners of women with cancer face as they try to be helpful,” said Lloyd Mitchell, with the Vernon Prostate Cancer Support and

Awareness Group. Two psychologists at the Odette Cancer Centre in Toronto researched the topic and developed a DVD involving two actors who discuss their experiences as caregivers. “The performance is thought-provoking and brings to the surface significant relationship

issues,” said Mitchell. “It speaks to men directly, providing pointers for being supportive. And it helps women to better understand the men in their lives. “The performance serves as a catalyst in helping men and women to look at their relationships when they serve in the opposite

roles when men have prostate cancer.” All cancer survivors and caregivers are invited to join the Vernon Prostate Cancer Support and Awareness Group Monday at 7:30 p.m. at the People Place, 350227th Ave. Refreshments will be served.

“Is Jesus God?” Sunday, March 21 at 7pm in the

Holiday Inn Express

4716 - 34 Street, Vernon (Hwy 97) For more information please phone 250-558-2951 www.okanaganchristadelphians.org

TRUST YOUR INTUITION The Inner Peace Movement of Canada welcomes President Judy Guido

Tuesday, March 23 at 1pm and 7pm Best Western Vernon Lodge 3914 32nd Street Judy has presented tools for effective living for over 30 years. She will speak on trusting your intuition, finding balance and peace of mind, life after death, communicating with your guardian angels, your life purpose, and 7-year cycles of life. Experience working with energy and receive aura impressions. 90 minutes • $15 at the door • Call 1-877-969-0095 www.innerpeacemovementptyltd.com A non-profit educational program.

VERNON FLOWER SHOP This week’s special...

Cancer support groups join forces Morning Star Staff

PUBLIC LECTURE

Everyone Welcome!

Gerbera Daisy

99

¢ /stem

Spring Special!

Offer va valid March 19 to March 23, 2010. Mar Cash & carry sales only.

3011 - 31st Avenue, Vernon 250-545-2181 5 2181 • Fax 250 250-545-8658 545 8658 • Toll Free 1-800-276-9911 vernonflowers@vernonbc.ca • www.vernonflowershop.net

NOTICE OF POWER INTERRUPTION —VERNON AREA When: Now until April 30, 2010 A BC Hydro contractor will be making system improvements in the Vernon area until the end of April 2010. This work is scheduled throughout the Vernon area including areas of Okanagan Landing, Tronson Road, Pottery Road and Coldstream. To ensure the safety of our work crews, it will be necessary to interrupt electrical service for short periods of time. The outages will affect small groups of customers at a time and will last for under one hour while work in specific areas is completed. All affected customers will receive advance door-to-door notification from the contractor. The work is expected to be completed by the end of April 2010. We recognize the inconvenience this may cause, and will restore service as quickly as possible. Please protect all sensitive equipment. If you experience any electrical problems following the interruption, or would like further information, please call 1 888 POWERON (1 888 769 3766).

bchydro.com

2184

D

ear Annie: I am 28 years old and have lived with the same man for 10 years. We have two beautiful daughters, ages 8 and 4. Last May, “Rob” and I decided to take an extended vacation. We bought an RV and spent the summer traveling and visiting family. While I really enjoyed the sights, some aspects of our trip were truly horrid. I frequently had to act as referee between Rob and the kids. Our older daughter had a bad attitude throughout the trip, and Rob took it personally. What’s more, we rarely made love, and several times we fought. We’re back home now, but have yet to return to any semblance of normalcy. Rob took a temporary job in another state. At first, I was supportive, but he has begun to stay away longer and longer. At the moment, he’s home for a day or two every two weeks. He says he wants to start a business with his brother and thinks we


www.vernonmorningstar.com

Friday, March 19, 2010 - The Morning Star B11

Community Calendar

Life

Finding your own voice Morning Star Staff

Joan McIntyre presents her Finding Your Own Voice workshop for people who want to sing and are sure they can’t and for those who know they can sing and want to be better. “The workshop is richly experiential and includes singing techniques, listening exercises and ways for participants to get comfortable with themselves and each other whether singing alone or together,” said McIntyre, a professional singer and teacher who has managed to overcome a crippling case of stage fright and a weak and shaky voice to emerge a strong and confident singer. “In just one day, participants are able to discover the joys and

Community Calendar is a free service to non-profit groups in the North Okanagan. Due to the large volume of notices received, there is no guarantee how soon or how often your notice will run. E-mail notices to lifestyles@vernonmorningstar.com, fax to 250-542-1510 or drop off at The Morning Star, 4407-25th Ave., Vernon.

PHOTO SUBMITTED

Joan McIntyre helps reluctant singers to discover their voice. inspiration of singing with their full and natural voice.” Finding Your Own Voice takes place April 10 from 9:30 a.m. to

4:30 p.m. For more information and registration, please contact McIntyre at caeli@telus. net or 250-549-7107 or 250-542-1908.

Striving for inner peace Morning Star Staff

Judy Guido wants to help people to learn to trust their intuition, find balance and use their potential to find enjoyment in all aspects of life. The president of the Inner Peace Movement of Canada (IPM) presents orientation lectures in Vernon next week. “We all have impressions, gut feelings, hunches and premonitions. When we trust this intuition, we can find ourselves in the right place at the right time,” said Guido. “By nature we are all intuitive. How many times have you wished you had followed your instincts? I knew that was going to happen, we say, but by then it’s too late.” Participants will learn about the four

avenues of spiritual perception, the reality of inner guidance, life purpose and the sevenyear cycles of life. The IPM is an educational, not-for-profit organization that helps people recognize their true worth and move forward in a positive, constructive way with loved ones, community

and from within. The 90-minute orientation lectures take place Tuesday at 1 p.m. or 7 p.m. at the Best Western Vernon Lodge. Tickets are $15 per person, at the door. For more information, visit www.innerpeacemovementptyltd. com or call 1-877-9690095.

5509 - 24th St., Vernon

Coming March 2010

542-0338

Mon. to Thurs.: 9:00am - 6:00pm Friday: 9:00am - 9:00pm Saturday: 9:00am - 5:30pm Sunday: 11:00am - 4:00pm

Yes, it is true! … we are open for business in our new location. Visit our incredible new show room today.

Glen Gl

Dean

John

Liz

Bob

www.nufloors.ca | 250-545-3206 4708 - 34 Street, Vernon | behind the Holiday Inn Express th


B12 Friday, March 19, 2010 - The Morning Star

www.vernonmorningstar.com

Community Calendar MARCH 19

Feature Event: Hip hop and more dance classes starting soon at Recreation Services

DELLVIEW’S ANNUAL REUNION March 19 at The Pantry at noon. All employees and their partners welcome. Call LaVerne at 542-5449 for more information. LABYRINTH VESPERS Trinity United Church, 3300 Alexis Park Dr., March 19 at 7:30 p.m. Candle-lit intergenerational service led by music director Angie Tysseland and Rev. Sharon Ferguson-Hood with the chancel choir leading a cappella chants from world traditions. This includes Taizé chants from the Taizé contemporary contemplative community in France as well as chants from Buddhist, Canadian aboriginal and mythological traditions. For more information call Trinity Church at 250-545-0797. OKANAGAN SINGLES GROUP 40+ March 19, appies and pool at Checker’s and dancing. Call Cheryl if attending, by Thursday, at 250-558-5722. AGLOW INTERNATIONAL VERNON LIGHTHOUSE March 19-20 Freedom 101, Freedom from Curses, Sickness, Disease and Demonic influence. Speaker Ann Mebs, March 19, 6:30 – 9 p.m. and March 20, 11 a.m. – 3 p.m, Bring bag lunch. Holiday Inn Express, 4716 - 34 St., Vernon (Hwy 97 & 48 Ave.), door charge $5, free will offering will be taken. To register, call Cathy at 260-6798 or Mia at 545-5052. ROYAL CANADIAN LEGION BRANCH 189 OYAMA St. Patrick’s Day dinner and dance March 19. Irish stew dinner, 6:30 to 7:00 p.m., $12 per person. Dancing 7 to 10:00 p.m. Music by Art Taylor. Please reserve tickets early by calling the Branch at 250-548-3521 after 3 p.m., or e-mailing lsdmjb@yahoo.com. Members and bona fide guests welcome. BUDDHIST MEDITATION CLASS with monk Gen Kelsang Sanden March 19 from 7 to 8:45 p.m. Vernon library. Sanden will give practical instructions and helpful advice on how to meditate and use Buddhist wisdom to maintain positive attitudes, that make our life meaningful and fulfilling. Drop-in fee $10 adults, $5 students. Info. see www.shantideva.dorjechang.ca or call 250-558-0952. No fragrance please. THE EDELWEISS SOCIETY MEETS Social night at the People Place, 3402-27th Ave. at 7 p.m., every first and third Friday. AA MEETINGS IN ENDERBY Fridays at 8 p.m., open discussion group, St. Andrews United Church, corner of Belvedere and Regent Ave. NARCOTICS ANONYMOUS OPEN MEETING Fridays at 8 p.m., the People Place, 3402-27th Ave. Call the 24-hour hotline at 250-503-3260 or 1-866-918-3574 if you need to talk or for more information. CODA MEETS Fridays at 11 a.m., at The Arbour, Vernon Alliance Church. VERNON MS SOCIETY DROP-IN CENTRE Open Mondays, Thursdays and Fridays from 9 a.m. - noon and 1 - 4 p.m., Tuesdays from 9 a.m. - noon, in room 105, the People Place; closed Wednesdays. Come in for coffee, a game of checkers or crib, dialogue and support. Call 542-2241 for more information. VERNON ELKS LODGE #45 Our downtown hall is available for small and large functions such as meetings, weddings, anniversaries, celebrations of life, etc. We offer full catering on request with hall rentals. Please call Maureen at 558-0876. SUPPORT LOCAL BUSINESS NORA (North Okanagan Referral Association) meets Fridays at 7:15 a.m., The Pantry. Call Les Fresorger at 542-7181 or see www.nora.ca. AL-ANON MEETS Fridays at 8 p.m., Vernon Jubilee Hospital (Education Rooms) and Sundays at 8 p.m., at Seaton Centre. For more information, call 545-4933. SPANISH CHRISTIAN FELLOWSHIP Pray in the spirit on all occasions with all kinds of prayer and requests. Meets every Sunday at 6 p.m., at Birch Church, corner of Birch Avenue and Ethel St., Kelowna, with Pastor Fernando Murua; call 979-0584. Meets Saturdays at 7 p.m., at Tabernacle, corner of Leathead and Tartan Rds., with Pastor Hilo and Amparo Blanco, and Liliana Fewell; call 765-8348. In Vernon, please call Connie at 545-7421. All welcome.

he spring session begins March 30. These popular classes give all ages a chance to explore this trendy dance style’s slides and spins in a fun, active environment. If you love to belly dance or have always wanted to try it, we now offer two types of belly dance, Egyptian Classical or the new Tribal Belly dance style. For those who love the more traditional dance styles, all the favourites are back including Jive and Ballroom Basics, and if you’re looking to heat things up a bit be sure to check out our Salsa classes. Any male who signs up for salsa will receive a 15 per cent discount as will any female that signs up a male. In keeping with the Latin theme, we now offer Zumba Dance, the latin-based dance fitness that has been all the rave for the past couple years. Finally, if you love to sing, Dawn King from local band “The Kings” has partnered with Recreation Services to offer a Vocal Power for Women course that will teach you the vocal techniques used by Christina Aguilera, Carrie Underwood and more. To register for these or any other programs, visit us at the Recreation Centre or online at www.greatervernonrecreation.ca. If you would like more information about programs, call 250-545-6035.

T

YOUTH GROUP MEETS, OKANAGAN LANDING Youth 13 and older meets Fridays at 7 p.m., Living Word Lutheran Church, 6525 Okanagan Landing Rd. A variety of Christianbased activities, movies, bowling, swimming, game nights, pizza nights. New members welcome. For more information, please call Pastor Al and Dorothy Pinno at 250-542-6464. FRIDAY NIGHT DINNERS: ARMY, NAVY & AIRFORCE From 4 p.m. to close, Friday and Saturday, 2500-46th Ave. Call 542-3277 for more information. Also, Grandpa darts every Friday. FRIDAY NITE SUPPER at the Elk’s Lodge, 3103 30th St. Everyone welcome to join us, including children, at 6 p.m. every Friday for an excellent home-cooked meal including soup/salad, dessert and coffee. Mini meat draw and 50/50 following dinner. Cost $ 7.50 All monies raised go to children & charities in Vernon. THE ROYAL CANADIAN LEGION BRANCH 25 VERNON Grannie darts Fridays at 1:30 p.m., so come early for lunch! Dance starts at 7;30 p.m. Check out the new music we have performing at the legion!

MARCH 20 KIDS ART ADVENTURES AT CAETANI HOUSE Caetani Cultural Centre, 3401 Pleasant Valley Rd., Vernon. Pysanky Eggs for kids six and up. Learn the art of Ukrainian egg decorating. Make some beautiful eggs for your Easter basket and the Caetani Easter Tree. Cost: $10 per child. Group limit is six. March 20 from 10 a.m. to noon and 1 to 3 p.m. at Shannon’s Studio. Pre-registration necessary. Please call Shannon at 503-1965 to register or for more info. Mad Hatter’s Workshops for kids five and up, March 27 or 28 from 10 a.m. noon. Make your “Mad Hat” for the upcoming Easter Mad Hatter’s Parade and Tea Party. Cost: $5 per child includes materials. Group limit 10 Pre-registration is a must by calling Shannon at 503-1965. For more information about the centre, see www.caetaniculturalcentre.org BOOK SALE AT THE TAI CHI HALL “Tip of the Iceberg” Book Sale at Tai Chi Hall, March 20. Books have overwhelmed the storage area at the Taoist Tai Chi hall at 310528th St. After these books have been sorted, they will be on sale at the hall, from 8 a.m. to 1 p.m. The sale will also feature garage sale items, household plants and bedding plants. Please call 542-1822 for information. SENIORS’ ACTIVITY CENTRE, ARMSTRONG 55 years or older and looking for something to do? Visit the Activity Centre for fun and friendship. First and third Saturday of the month, it’s Knob Hill Whist at 7 p.m. Annual membership fee is $12. Call Joy at 250-546-8907 or Nancy at 250-546-8158. LADIES FRIENDSHIP BIBLE COFFEES Stonecroft Bible Studies invites you to discover new friendships and Biblical truths in a study-friendly small group format. Limited time commitment and Bible reference by page number. Minimum cost. For more information, call Jean at 250-542-6468 or Shirley at 250-260-3577.

OVEREATERS ANONYMOUS MEETS Open meeting Saturdays at 10 a.m. at the health unit, 1440-14th Ave. Is your weight ruining your life? Whatever your problem with food, you are welcome at Overeaters Anonymous Call 938-2253 for more information or see www.oa.org KNITTING CIRCLE AT GALLERY VERTIGO First and third Saturday of every month from 10 a.m. to noon. All knitters and crocheters welcome. Drop in and join local fibre artist and passionate knitter Janet Armstrong, for knitters of all experience. Expert knitters will be on hand to offer help and advice to beginner and intermediate knitters if desired. Bring along your current project and completed projects for show and tell if desired. Goodies are often brought in by members of the group and coffee is provided by the gallery. Admission is a $5 donation to Gallery Vertigo’s Smarties Family Sunday Art Program. For more info., call 250-503-2297 or see www. galleryvertigo.com or e-mail info@galleryvertigo.com DUPLICATE BRIDGE The North Okanagan Bridge Club meets Saturdays at 1 p.m., and Tuesdays at 1 p.m., Halina Centre. Canteen open Tuesdays and Thursdays. All bridge players welcome. Call Pat at 260-1300 for information. For learning games, call Ollie at 558-3709. STORYTELLING AND LEGENDS Every Saturday at 1 p.m. to 2 p.m. at the Aboriginal Infant Early Childhood Development Centre. Everybody welcome. Call 542-7578 for more information. HEALTHY HOME COOKING WITH CHAWOW Free, every Saturday at the Aboriginal Infant/Early Childhood Development Program at 9 a.m., 2902-29th Ave. Call 542-7578 for info. AA MEETINGS ON SATURDAYS Saturday Serenity group (X), closed meeting, noon at VTC, 2810-48 Ave, Vernon. Institutional meeting (H) open meeting 7 p.m., at Vernon Jubilee Hospital Education room basement, 2101-32 Street, Vernon. “A Way Out” meeting,” open, 8 p.m. at Alpine Centre, #35, 100 Kal Lake Rd. (H) Handicap access. (X) No handicap access. FREE HOT LUNCH FOR FAMILIES AND CHILDREN For families with children zero to six years: Saturdays and Thursdays from 11 a.m. - 1 p.m. Join us for a free nutritious lunch at the Aboriginal Infant and Early Childhood Development Centre, 2905-29th Ave. Call 542-7578. YOUTHGLO!! YouthGLO! For lesbian, gay, bisexual, transgendered and questioning (LGBTQ) youth aged 14 to 18, living in or visiting the North Okanagan. Connect with others who understand what it’s like growing up as an LGBTQ youth in the North Okanagan. Trust us: you are not alone! For more information e-mail us at youthglo@hotmail.com. THE BX/SWAN LAKE COMMUNITY ASSOCIATION Visit their Web site at www.bx-swanlake.blogspot.com. The site contains current information that is important to residents of regional districts B and C such as pine beetle, meat inspection regulation, governance and water issues. FRATERNAL ORDER OF EAGLES For hall rentals, please call Evelyn at 542-3003.


www.vernonmorningstar.com

Friday, March 19, 2010 - The Morning Star B13

Community Calendar MARCH 20 THE VERNON & DISTRICT ANIMAL CARE SOCIETY We are a local, all-volunteer registered charity. We need your help to continue our lifesaving spay/neuter and emergency vet care programs for homeless and low-income cats and dogs. Every penny of your tax-deductible donation will go entirely to care for local pets. For more information, call 250-542-7203 or see our website at www.vernonanimalcare.com CRIBBAGE AT THE HORSESHOE CLUB Saturdays at 1 p.m. Limited space available. Call Vera at 250-545-4521.

THE ROYAL CANADIAN LEGION BRANCH 25 VERNON Feeling lucky today? Check out our meat draw Saturdays at 3 p.m., then dance the night away! Music starts 7:30 p.m., so come early for dinner. OKANAGAN SINGLES GROUP 40+ March 20, acoustic jam, Women’s Institute Hall, 9909 Kal Rd., Coldstream. Doors open 7 p.m. Call Dot if attending, 250-542-4042. March 21, spring brunch at Pepper’s. Please call Dot if attending, by Friday. LOYALISTS MEET March 20 at Peace Lutheran Church basement, 11 a.m. to 2 p.m. Please bring bag lunch. Call Pat at 250545-0879 for more information. VERNON PUBLIC ART GALLERY March 20, 1-4 p.m., opening reception, School District #22 (elementary): Art from the Heart. THE CONGREGATIONALIST WICCAN ASSOC. OF B.C. Celebration of the Spring Equinox March 20 at 6 p.m. at The Threads That Bind Us, 3004 B-31st Ave. Also offering workshop on the Power of Intent same day at noon. Please bring potluck item. Ritual admission is free, donations gratefully accepted, and all are welcome. For more information, call Sable at 250-5400341 or e-mail Sable@thethreadsthatbindus.net

UPCOMING

at People Place, 7:30 p.m. to view DVD Like A Fish Out Of Water, written by Dr. Ross Gray and Dr. Karen Fergus, based on their social science research about the challenges that male partners of women with cancer face as they attempt to be helpful. The performance is thought provoking and brings to the surface significant relationship issues. It speaks to men directly providing pointers for being supportive and it helps women to better understand the men in their lives. For info., please call Lloyd Mitchell at 250-549-2362. THE VERNON BONSAI CLUB First meeting of the year March 22, Vernon Community Arts Centre, 7 p.m. Members please bring a tree/trees to work on. If you don’t have a tree available then just come and join in the fun and fellowship. All visitors are most welcome. For more information, please call 250-542-8397 or 250-542-9632. FREE...AN EVENING OF YOGA Mondays, 6-8 p.m., Knox Presbyterian Church back entrance, 3701-32nd ave. The evening unfolds with breathing exercises going into yoga. Finishing up with musical meditation before we eat a vegetarian meal. Everyone welcome. VERNON AND DISTRICT GARDEN CLUB MEETS March 23 at 7.30 p.m., Vernon Arts Centre. Guest speaker Harry Adam’s, topic is “Introduction to square metre gardening.” Guests/new members welcome. Call 250-542-4926. ROYAL CANADIAN LEGION BRANCH 25 VERNON March 23, executive meeting at 6 p.m., general meeting at 7:30 p.m. Come and hear what’s going on at your legion. Tonight is also Texas Hold’em Poker; play for points! No need to be an experienced player, we will teach you. New registration at 6:30 p.m., games start 7 p.m. VERNON FIGURE SKATING CLUB accepting registrations for Canskate learn to skate programs that begin March 23.We are forming synchro teams now for the coming season and invite all current or former figure skaters of all ages to try out. Skate for life! Join synchro and become part of the newest skating craze! For Canskate or synchro info. call Heather at 250-260-6632 or see www.vernonskatingclub.ca BECOME A FOSTER PARENT Attend an Information Session to find out how you can make a difference for children and youth in our community through Fostering, March 24 from 6:30 to 8:30 PM, at the Ministry of Children and Family Development office, 2809 - 28th St. For more information call Noelle at 250-558-0939. DO YOU LIVE IN ELECTORAL AREAS B OR C ? The BX/Swan Lake Community Association holds Annual General Meeting, March 24 at 7 p.m., BX elementary school gym, 5849 Silver Star Rd. Renew your $5 membership at the meeting. DOWNTOWN VERNON ASSOCIATION AGM Annual General Meeting March 24, Elks Hall #45. Reception at 5:30 p.m., followed by dinner at 6 p.m. and a Business Session at 6:45 p.m. Tickets $20 each, available at the DVA office or from DVA Directors. Call 250-542-5851 or see www.downtownvernon.com for more information. WELLNESS AT THE LUMBY SENIORS DROP-IN March 24 at 1751 Glencaird St. Fashion show, 10 - 11 a.m. You are welcome for lunch, $5. Gloria and Don with Personal Touch Fashions will facilitate the show. These fashions are for men and women who are unable to travel to shop or require additional assistance. Hope to see you all there. Blood pressure and weight checks are available with a qualified nurse before the show. Call Olena or Diann at 547-8866. KIDS DISCOVERY CLUB Held Wednesdays from 6:30 to 8 p.m. A Christian-based group of five to 12-year-olds. Boys and

OUTREACH DINNER March 20 from 3 to 4:30 p.m., Salvation Army, 3303-32nd Ave. Sponsor: Vernon Alliance Men’s Group. SJOGREN’S SYNDROME SUPPORT GROUP Meets March 21, from 2-4 p.m. at People Place. Contact Desiree Roell, 250-838-9378 or desiree_roell@hotmail.com ECKANKAR VERNON PRESENTS BOOK DISCUSSION Call of Soul by Harold Klemp March 21, April 18, May 16 at 11 a.m., Halina Centre Club Room/Vernon Rec Centre, 3310-37th Ave. Do you wonder why bad things happen to good people? Or what happens after death? This free book discussion will explore this and more. Call 250-307-6677. NORTH OKANAGAN HISTORICAL SOCIETY AGM Annual general meeting March 21 from 2 to 4 p.m, Schubert Centre, 3505-30th Ave. Nominations and election of officers. Ron Candy, curator of Vernon Museum, will be guest speaker. He will bring artifacts from the museum collection and talk about “The Importance of North Okanagan Artifacts.” Brin a guest. For rides, call Pat McAllister at 250-558-1440. SOLD The Society for Open Learning and Discussion meets March 22, from 9:30 to 11:30 a.m. at the People Place, room 06, downstairs. Don Hull will speak of his personal experience in “Gold Mining in Papua Guinea.” New members and visitors welcome. For info., call Nadine at 250-549-1479. APSA MEETING March 22, Alexis Park elementary school, 4:30 p.m. We will discuss activities going on in schools, our upcoming aboriginal round dance March 27, and the upcoming dates for the Hoop Dance troop. Plus the introduction of some of the AESW (Aboriginal Education Support Workers in the school). Meeting open to all parents, grandparents and guardians, plus high school students within School District 22. Please • Show Home Quality come and enjoy this time • Commercial/Residential and get to meet other par• Interior/Exterior ents within the district of • Staining/Custom Refinishing aboriginal descent. • Kids Rooms BOSOM BUDDIES 13 years qualified experience • Work guaranteed AND SPOUSES invited Susan Weeks • (250) 308-1451 to join Vernon Prostate www.susanweekspaintedhouse.com Support Group March 22

girls learn crafts, games, storytime and snacks. Group starts March 24, Living Word Lutheran Church, 6525 Okanagan Landing Rd. Call Pastor Harold at 250-545-1514 for more info. NEW PHILOSOPHERS’ CAFE FORUM In north BX. Topic “Restorative Justice; creating accountability for personal actions or letting offenders off the responsibility hook? Hear Restorative Justice co-ordinator Margaret Clark, speak about the challenging and intensive work she is doing and the effect it has had on youth and adults who have been supported through this new program. Come and share your thoughts and ideas about whose responsibility it is to make our justice system work! March 25 at 7 p.m., doors open 6:30 p.m.; $5 donation, by reservation only. Call or e-mail to reserve: 250-545-9044 or philcafe@uniserve.com THE PALESTINE STUDY GROUP PSG meets March 25, at 10 a.m. at the People Place downstairs, Room 001. We will continue viewing and discussing the documentary Why We Fight which explores the MIC (military-industrial complex), and its origins and power over U.S. foreign policy decisions. Come join us for the discussion. For more information, call Steve at 545-3202. FASD COMMUNITY MEETING If you are working with, interested in or living with a child/youth or adult with FASD we would like to invite you to attend our meeting March 25 from 9 to 10:30 a.m. at NONA Child Development Centre, 2802-34th St. For info., call Lorraine Donald at 549-1281. HEALTHY BRAIN This free telephone workshop from Alzheimer Society of B.C. allows you to learn from home! Hear latest research on reducing risks for Alzheimer’s disease, and tips for improving brain health. March 25, noon - 1 p.m. To register visit www.careringvoice.com/tele-learning. php and click on upcoming sessions, or call 1-866-3962433. After you register, a representative will call before the workshop with details about participating by phone. BOY SMARTS WORKSHOPS FOR PARENTS March 25 from 7 to 9 p.m., Vernon Recreation Complex auditorium. Presented by Vernon School District and Vernon District Parent Advisory Council. Author and speaker Barry McDonald helps parents meet the challenges of parenting boys for success at school, and at life. The author of Boy Smarts – Mentoring Boys for Success at School and founder of MentoringBoys.com helps parents and teachers understand how gender patterns can influence boys, and offers advice for mentoring boys to navigate video games, lassitude and cultural pressures. Cost is $10 at the door. For more information, contact Jeff Jacobi at cjlj@telus.net DINING OUT FOR LIFE AT RICARDO’S March 25, Ricardo’s Mediterranean Kitchen in Winfield will donate 25 per cent of all food sales to Dining Out for Life; all funds raised going towards the Living Positive Resource Centre for HIV/AIDS education, awareness and hospice programs. This is an annual event taking place at restaurants across North America. To make a reservation, call 250-766-6810.

THE INFINITE SEA OF POSSIBILITY WORKSHOP March 27 from 10 a.m. to 4:30 p.m. at Centre for Spiritual Living, 2913-29th Ave. Facilitated by Chris Madsen. Connect with and explore the unlimited potentials awaiting your command. The $49 cost includes workshop materials. To register, call Chris at 250-558-1960 or 307-8277. ROYAL CANADIAN LEGION BRANCH 189 OYAMA Easter Meat Draws! Win your turkey March 27 or your ham on April 3, beginning at 2 P.M. Members and guests welcome – support your Legion and spend an enjoyable afternoon.

Are you limited by disc disease?

Susan Weeks’ Painted House 24 Hours • 7 Days A Week • Nursing • Personal Care • Home Support • Foot Care • Drug and Alcohol Testing

250-542-9717 250 25 0-54 542 2-97 9717 17 • w www www.wecare.ca ww.wec wec ecar are ar e.ca ca

We can probably help. Effectiveness varies for each patient.

For free information package or an appointment call 250-545-5566 James B. Wickstrom, D.C. Spinal Balance for Optimal Health & Natural Healing


B14 Friday, March 19, 2010 - The Morning Star

FAITH BAPTIST CHURCH 3908 - 27 St • 250-545-7700 • faithbaptistvernon.com th

Senior Pastor Erik Reimer • Youth Pastor Jason Dueck Sunday

9:30 am Adult Sunday School Class 10:30 am Morning Worship Service with Pastor Erik Reimer speaking (nursery & toddler care available) Sunday School for age 3 - grade 5 Wednesday 7:00 pm Bible Study and Prayer Time

www.vernonmorningstar.com

The Centre for

Awakening Spiritual Growth Canadian International Metaphysical Ministry

CELEBRATING EVERY SUNDAY 10:30 TO 11:45 AM AT: THE SCHUBERT CENTRE - 3505 - 30th Ave., VERNON * Live Music * Joyful Messages * Reiki/Healing Circle Following Service

Seeking Spiritual Roots?

Knox Presbyterian Alexis Pk. Dr. at 32nd Avenue • 250-542-8613

Enjoy traditional services with organ & choir in a friendly, welcoming congregation This Sunday:

TRINITY UNITED CHURCH

9:50 a.m. - Hymn Sing 10:00 a.m. - Worship service Rev. Dr. Ed Millin - Sermon: “The Other Side of Our Fears”

3300 Alexis Park Drive • (250) 545-0797

VERNON ALLIANCE CHURCH 2601 - 43rd AVENUE 250-545-7105

Saturday 6:30pm Sunday 9:30 & 11:11am Gregg Jeske On The Way - Part 2 All are Welcome “Helping People Discover Jesus Christ & Become His Followers”

First Baptist

7:30pm Friday March 19 - Labyrinth Vespers

1406 32nd Ave.

Phone 250-542-0128 Sr. Pastor: Rev. Dan Watt

10 am Sunday Morning Worship Exploring the Scriptures: “A Lavish Love”

10am Sunday Worship Service

Ministers: Rev. Sharon Ferguson-Hood, Leanne Benoit and Rev. Bob Thompson Visit our websites: www.unitedchurchvernon.com & www.camphurlburt.com

Son Kids Trekking Adventure

Impact Youth Thursdays 6:30pm www.firstbaptistvernon.net

OPEN VALLEY COWBOY CHURCH All are welcome at Head of the Lake Hall

CANADIAN REFORMED CHURCH

Sunday March 21st, 2010 at 6:30 pm Speaker Fred Cardinal Music by Christina Cardinal

Pastor Fred & Christina Cardinal 250-546-2449 or 250-306-8959

Community Baptist Church 4911 Silver Star Rd. • 542-4028

Join us Sunday 10:00am Spending time in Worship and God’s Word Toddler Care available. Sunday School for ages 3-11 Pastors: Rick Corak & Eugene Harder Youth Ministries: Nathan Arkell

Join us each Sunday

ALL SAINTS

OUR LADY OF THE VALLEY

Anglican Church WELCOMES YOU!

CATHOLIC CHURCH

3205-27th St. • 250-542-3179 allsaintsvernon.org

10102 Middleton Drive Coldstream • 542-1276

Sunday Services

Mass: Sunday 10:30am

7:45am Traditional Eucharist (BCP) 9:15am The Table* (Contemporary) 11:00am Choral Eucharist (BAS)*

1st Sunday of the Month Sunday 7pm Mass

*with Sunday School & Nursery

2607-27th Street 542-1276

CHURCH OF GOD

4312 - 25th Street Phone 250-542-7894

Welcomes You To Worship With Us

Sunday March 21st, 2010

9:45am German Worship Service 9:45am English Sunday School 11:00am English Worship Service 7:00pm Evening Worship Service Wednesday 7:30pm Bible Study & Prayer

Mass: Sat. 5:00 pm Sun. 8:30 am 7:00 pm st

1 Sunday of the Month No 7:00 pm Mass

www.vernonchristianfellowship.org

ST. JAMES CATHOLIC CHURCH

1st Service 10:00am 2nd Service 2:00pm

Vernon Christian Fellowship 10:00 AM

FAMILY WORSHIP

Speaker: Ken Mather

5600 MacDonald Rd.

PEACE LUTHERAN ELCIC 1204-30th Avenue 545-5787 Fax: 545-2267

10am Worship & Sunday School Holy Communion 1st & 3rd Sundays Pastor Richard D. Schulz

250-545-1536 VERNON FAMILY CHURCH A Place to call “Home” 3508-25th Ave • 545-7978 Next to Lincoln Lanes Bowling Affiliated with the PAOC of Canada

Sunday Worship 10am Wed. Bible Study 7pm Friday Coffee House 7pm Pastor Dithmar Molzahn

Weekly Fellowships, College & Career, Youth

4506 - 29th St 545-2927

Pastoral Staff: Clint Batchelor & Erol Bortucene

Emmanuel Fellowship Baptist 3412 - 15 Avenue (Mission Hill) 250-545-5941

Sunday, March 21st Sunday Morning Worship Service: Service: 10:15am “Anchors in the Storm” Acts 27 - Pastor Robert Murdock Everyone Welcome! Programs for all ages

www.emmanuelvernon.ca

Welcome to P.V. Church 6161 P.V. Road

Don’t like just being a number, no opportunity to serve or use your gifts? Come join others Starting a new church work. Join Our Happy Hour Sunday 10:30 A.M. Interim Pastor: Al Perry 250-542-7435

For information on advertising in the

Church Directory Call Lynnaya

250-550-7916


www.vernonmorningstar.com

Friday, March 19, 2010 - The Morning Star B15

News

B.C. setting aside funds for domestic violence risk TOM FLETCHER Black Press

The B.C. government is spending $250,000 to help police, prosecutors and child protection workers identify people at high risk for family violence. Public Safety Minister Kash Heed announced the program Tuesday, in response to recommendations from a coroner’s jury examining the circumstances around a horrific murder-suicide that rocked the upscale Victoria suburb of Oak Bay in 2007. In the early morning hours of Sept. 4, 2007, Peter Lee forced his way into his family home and stabbed his estranged wife, her parents and their six-yearold son to death before killing himself. Lee was on bail at the time on a charge of crashing his vehicle in an attempt to injure his wife, and was under a court order to stay away from his family. A domestic violence unit for the Victoria region is to be operating by June, similar to units in Vancouver and New Westminster, with police, victim services and child protection workers together. Lee and his family came in contact with several of the region’s array of small police forces and victim services before the murders. The training is to be delivered in threeday courses held in November and December, involving prosecutors, senior police officers and child protection staff from across B.C. It is in addition to a mandatory web-based course being taken by police officers, to standardize risk assessment based on factors such as previous violence, other criminal involvement, alcohol or drug abuse and financial problems. Heed said more will also be done to raise public awareness of domestic violence, the second largest category of criminal charges in B.C. behind impaired driving. Course material for public schools has been updated, and the

government will also reach out to immigrant communities, he said. “Even from my back-

ground from the IndoCanadian community and several other visible minority communities,

you hold it inside of you, thinking it’s going to be shameful for you to bring this out and be

publicly exposed,” Heed said. B.C. also operates a website resource for

victims and witnesses of crime at www.victimsinfo.ca, and a toll-free telephone assistance

line called VictimLINK at 1-800-563-0808 with service available in 130 languages.

Great style doesn’t have to be expensive.

NATIONAL

BONUS BUYS FREE

Coordinating piece with purchase of a room group

Buy the 5 Piece Living Room for only Includes Key Town Truffle Sofa & Loveseat, Cocktail Table & 2 End Tables

EXTENDED! $ 2399 FREE

Get the BONUS

Available Only at Participating Stores.

Buy the 5 Piece Dining Room for only

Get the BONUS

$

1899 FREE

30

2 Matching Side Chairs

Get the BONUS

2999 FREE

Size Bed

Available Only at Participating Stores.

Includes Key Town 71" to 89" Rectangular Extension Table & 4 Chairs

$

Buy the 5 Piece Bedroom for only

Matching Chair

Available Only at Participating Stores. Includes Key Town King Panel Bed, Dresser & Mirror

Matching Night Stand

% OFF

2514N HWY 97 Kelowna, BC 250.861.9321 Mon - Fri: 9am - 6pm

Sat: 9:30am - 6pm • Sun: 11am - 5pm

any regularly priced mattress set*

507 Granville Ave Enderby, BC 250.838.9321 1.888.215.2273 Mon - Fri: 9am - 6pm Sat: 9:30am - 6pm • Sun. 11am - 4pm

*See store for details. Excluding Tempur-pedic mattresses. Some pieces and fabric prints may vary by region. Selection may vary by store. Although every precaution is taken, errors in price and/or specification may occur in print. We reserve the right to correct any such errors. Prices valid for a limited time only. Participation times may vary. HomeStores are independently owned and operated. An amount equal to sales taxes and delivery charges must be paid at the time of purchase. Previous purchases excluded. Picture may not represent item exactly as shown, advertised items may not be on display at all locations. DISCOUNTS are for product only, and do not apply to Tempur-Pedic® or Stearns & Foster® products, floor models or clearance items, sales tax, furniture protection plans or delivery. ©2010 Ashley HomeStores, Ltd. Expires 03/28/2010


B16 Friday, March 19, 2010 - The Morning Star

www.vernonmorningstar.com

ยน

Vernon Hyundai 4608 - 27th St. Vernon, 250-275-4004 D#30922


www.vernonmorningstar.com

Friday, March 19, 2010 - The Morning Star B17

News Chief urges safeguards for water supply JUDIE STEEVES Black Press

Indigenous people view the issues around water through a different lens, Grand Chief Stewart Phillip, chairman of the Okanagan Nation Alliance, told those attending a workshop on the modernization of the province’s century-old Water Act. “Water is sacred to all indigenous people,” he said. He cautioned that the timeline for renovating the old legislation is very short, considering the amount of consultation that should go into it. The provincial government plans to have draft legislation prepared by this fall, and the deadline for public submissions on it is Apr. 30. However, he said, it has caught the attention of First Nations governments around the province. “When the Water Act first came forward a hundred years ago, First Nations were not consulted,” he noted. Indigenous science, traditional and ecological knowledge, must be considered, he said. “We’re all here today and we’re friends and neighbours. “We must safeguard the supply of water so it is sustainable for future generations,” he said. He warned it’s not going to be easy to reach consensus on a new act, but it’s important, he said, that “we do our utmost for the sake of our children and our grandchildren.” Phillip was one of about 150 people from this region attending the workshop discussing priority principles which should form the basis for new legislation. They included valley mayors and politicians, foresters, scientists, farmers, business people, First Nations, environmentalists, anglers and water purveyors. They were welcomed by Fawn DeGuevara of the Westbank First Nation, who sung to the beat of a drum and then offered up a prayer in her native tongue. John Slater, parliamentary secretary for water supply and allocation, termed it a “call to

action for water in B.C. Water is the most limiting factor for growth.” Management of water is essential, whether there is plenty of it in a watershed, or whether there’s a marginal supply of it, he said. Right now, he noted eight ministries have some control of water in B.C., which creates some confusion at times. What the final document is completed, he said it must be one that reflects what the people

of B.C. want. Glen Davidson, director of management and standards for the water stewardship division of the environment ministry, said the four goals in modernizing the legislation are to protect stream health, improve governance, introduce more flexibility and efficiency in water allocation and regulate groundwater extraction and use. They are part of a discussion paper on the Water Act moderniza-

tion, which is available on the website at: www. livingwatersmart.ca/ water-act/ There’s also a blog on that website where anyone can post their comments and read those posted by others. It’s interactive and includes explanations or information posted by ministry staff as well. It’s the first time the Internet has been used in that way to encourage public participation on legislative changes.

Outstanding and compassionate care different

Welcome to a kind of medical clinic.

Dr. Chris Spooner ND

naturalmedicine

Dr. Shelby Entner ND • Natural Family Medicine • Women and Children’s Health • Chelation-Vitamin Injections • Prolotherapy • Infrared Sauna • Hormone Balancing • Healthy Digestion

250.275.1672

www.oknaturalmedicine.com

okanagan

Vernon is on BC’s biggest, fastest mobile network. Alberta British Columbia

TELUS HSPA+ network RogersTM HSPA+ network

*

TELUS has 1245x more HSPA+ coverage than Rogers in BC. No, seriously. 1245 times! TM

Huawei E182E Mobile Internet Key

BlackBerry® Bold TM 9700

MOTOROLA MILESTONE TM

For the power messager.

An unparalleled mobile browsing experience.

$0†

$149.99‡

$149.99‡

$149.99

3 year term No term SAVE $149.99

3 year term SAVE $ 500

$649.99 No term

3 year term SAVE $ 450

$599.99 No term

TELUS has been named the most outstanding philanthropic company in the world.

For more details on these great offers, visit your TELUS authorized dealer or retailer, visit telusmobility.com or call 1-866-264-2966. TELUS AUTHORIZED DEALERS Vernon Village Green Mall 3503 32nd St.

4412 27th St. 3107 48th Ave.

Offers available until April 30, 2010, unless otherwise stated. Phone availability and prices may vary. Prices are subject to change without notice. TELUS reserves the right to modify eligible rate plans with this offer at any time without advance notice. *Based on total square kilometres of HSPA+ network coverage in British Columbia as of February 2010. †Offer available to new activations; a month-to-month, 1, 2 or 3 year service agreement will receive 1 month of no data overage within Canada. ‡Available to new activations or renewals on a 3 year term with a smartphone voice and data rate plan of $50 or greater, or on a BlackBerry Social or BlackBerry Email & IM rate plan. TELUS, the TELUS logo and the future is friendly are trademarks of TELUS Corporation, used under licence. BlackBerry, RIM, Research In Motion and related trademarks, names and logos are the property of Research In Motion Limited and are registered and/or used in the U.S. and countries around the world. YouTube is a trademark of Google, Inc. Android and the Android logo as well as Android Market and the Android Market logo are trademarks of Google, Inc. Huawei is a registered trademark of Huawei Technologies Co., Ltd. Rogers is a trademark of Rogers Communications Inc. All other trademarks are property of their respective owners. © 2010 TELUS.


B18 Friday, March 19, 2010 - The Morning Star

Friday, March 19, 2010 - The Morning Star B19

! e c i t o n INCREDIBLE SAVINGS 6 DEALERS VEHICLES WILL BE SOLD FROM OPPORTUNITY $ 9 MILLION IN INVENTORY $ DON’T MISS OUT! 560 UNITS AVAILABLE! OPEN TO

199

Enter at All 6 Dealers!

NAME:

ENTER TO WIN

a 40” Samsu Flat Screen ng TV!

PHONE #: EMAIL:

THE PUBLIC O

MARCH TH TH

NLY!

Please no dea l wholesaleresrs or

19 & 20

APPRAISERS STANDING BY YOU’LL NEVER RECEIVE MORE MONEY FOR YOUR TRADE THAN

CREDIT EXPERTS READY TO APPROVE YOU INSURANCE ON LOCATION FOR IMMEDIATE DELIVERY! OTHERS SAY NO......WE SAY YES, YES, YES! IF YOU’VE HAD CREDIT PROBLEMS IN THE PAST WE HAVE BANK SOURCES AGGRESSIVELY SEEKING NEW ACCOUNTS. $3 MILLION IN CREDIT WILL BE AVAILABLE FOR THIS EVENT!

BRAND NEW 2 0 0 9 C it y G o lf Stk# 3724

RV2399

2010 Coachmen a il e r $15,995 Tr a v e l TrRV2336A Stk# 3816A 0 0 0 2 Royal Volkswagen n 2005 l e v a r T r le w VW 6395 Hwy 97N P ro 6205 62 205 05 Hwy H 97N, 97N VERNON O ON $ r e il a r T 10,900 VERNON 250-545-2319 319 Passat TDI 250-545-2358 DL#30616

DL#8122

$

2006 S a tu r n Io n

15,400 DL#30811

VERNON NISSAN 2009 6417 Hwy 97N, VERNON N is s a n $ 19,875 250-542-0371 S e n tr a

$

2006 F o rd F 1 5 0Stk# 94591

6,595

2005 Honda 6425 Hwy 97N, VERNON c c o rd A $ 12,995 250-545-0531 LX

$

DURING THIS EVENT! YOUR VEHICLE COULD BE WORTH MORE THAN YOU THINK! 2007 F350 C re w C a b L a ri a t L if te d Stk# U4819

19,498 Stk# 93151

DL#8718

$

11,498

2005 6285A Hwy 97N, VERNON D o d g e S X 2 .0 S p o rtStk# U4771 250-260-2791

adow 2 0 0 9 H o n d a S h0 S p ir it 7 5 $

31,988

DL#30886

$

5,988

$

2 0 0 9 Ya m a h a B ru in 3 5 0 6381 Hwy 97N, VERNON 250-545-5381

6,995

starting from not exactly as shown

$

5,995 99


B20 Friday, March 19, 2010 - The Morning Star

www.vernonmorningstar.com

News New fathers who smoke have a tough choice to make, study Black Press

A UBC study suggests masculine stereotypes can influence habits of new fathers who continue to smoke. â&#x20AC;&#x153;The findings revealed the uncomfortable dilemma new dads experience in relation to smoking and their role as providers and protectors for their families...â&#x20AC;? said John Oliffe, associate professor in the School of Nursing at UBCâ&#x20AC;&#x2122;s Vancouver campus. The study examined the relationship between being a new dad who smokes and the

places fathers continue to light up. â&#x20AC;&#x153;Menâ&#x20AC;&#x2122;s health practices have been closely linked to their male identities, especially tobacco use,â&#x20AC;? said Joan Bottorff, director for the Institute for Healthy Living and Chronic Disease Prevention at UBC Okanagan. â&#x20AC;&#x153;For instance, in the past, the image of the Marlboro Man appealed to men because it represented freedom, confidence, independence and strength.â&#x20AC;? Twenty new fathers from B.C.â&#x20AC;&#x2122;s Lower Mainland participated in the study and con-

tributed a total of 308 photographs to illustrate smoking through their own eyes. Three places fathers found they could comfortably smoke are on the job, at home and in private spaces. Many of the menâ&#x20AC;&#x2122;s photographs showed male-oriented workplaces, such as construction and trades industries. Smoking on the job was seen as a way to reduce stress, kill time and reward success. Smoking was often thought to be less of a risk than the everyday dangers in their jobs.

At home, many participants believed they were practicing responsible smoking by separating themselves from family to smoke. A national survey shows 29 per cent of men smoke during their child-rearing years, 15 per cent of households have at least one person who smokes inside and almost 10 per cent of children under the age of 12 are regularly exposed to second-hand smoke. â&#x20AC;&#x153;The challenge for us is to find effective ways to assist expectant and new fathers to reduce or quit smoking,â&#x20AC;? said Bottorff.

THE ALL-NEW 2011 KIA SORENTO Well equipped from $25,645^ Introducing the all-new 2011 Kia Sorento crossover SUV. With available 7-passenger seating, all-wheel drive, panoramic sunroof and standard BluetoothÂŽ hands-free cell phone capability, the Sorento truly provides A NEW WAY TO SEE THE WORLD.

2011 SORENTO EX-V6 LUXURY SHOWN

THE

EXPECT THE UNEXPECTED EVENT

** 90 DAY DONâ&#x20AC;&#x2122;T PAY* & 0% FINANCING ON SELECT 2010 MODELS

2010 KIA FORTE KOUP

2010 FORTE KOUP SHOWN

STARTING AT CASH SAVINGS â&#x20AC;&#x201D;

CASH PURCHASE PRICE

$19,950 $ 1000

18,950â&#x20AC; 

$

â&#x20AC;˘ 2.0L, 4-cyl., 156 HP, or available 2.4L, 4-cyl., 173 HP engine

2010 KIA SPORTAGE

2010 KIA RIO

2010 KIA SOUL

2010 SPORTAGE LX-V6 LUXURY SHOWN

2010 RIO EX SHOWN

2010 SOUL 4U SHOWN

$

23,545

â&#x20AC;Ą

PURCHASE PRICE

AND

0%

FINANCE APRâ&#x20AC; â&#x20AC; 

$

11,450

â&#x20AC;Ą

PURCHASE PRICE

AND

0%

STARTING AT CASH SAVINGS â&#x20AC;&#x201D;

FINANCE APRâ&#x20AC; â&#x20AC; 

â&#x20AC;˘ 2.0L, 4-cyl., 16-valve CVVT

â&#x20AC;˘ 1.6L, 4-cyl., CVVT engine

â&#x20AC;˘ 4-speed Steptronic automatic transmission â&#x20AC;˘ Six airbags and ABS

â&#x20AC;˘ AM/FM/CD/MP3 stereo with USB and AUX audio inputs

â&#x20AC;˘ BluetoothÂŽ hands-free cell phone capability§

â&#x20AC;˘ BluetoothÂŽ hands-free cell phone capability§

CASH PURCHASE PRICE

â&#x20AC;˘ BluetoothÂŽ hands-free cell phone capability§ â&#x20AC;˘ Steering wheel-mounted audio controls

â&#x20AC;˘ 4-wheel ABS disc brakes

+:</.003*

+:</.003*

&,7</.003*

&,7</.003*

KIA MEMBER REWARDS

16,695â&#x20AC; 

â&#x20AC;˘ 1.6L, 4-cyl., CVVT, or available 2.0L, 16-valve CVVT engine

â&#x20AC;˘ 6-way adjustable driverâ&#x20AC;&#x2122;s seat and tiltadjustable steering column

â&#x20AC;˘ BluetoothÂŽ hands-free cell phone capability§

$

$17,445 $ 750

+:</.003* +

WEâ&#x20AC;&#x2122;VE GOT YOU COVERED. *5-YEAR/100,000 KM WORRY-FREE COMPREHENSIVE WARRANTY *5-YEAR/100,000 KM POWERTRAIN WARRANTY *5-YEAR/100,000 KM EXTRA CARE ROADSIDE ASSISTANCE *NO DEDUCTIBLE CHARGE

+

&,7</.003*

+:</.003* &,7</.003*

+

Vernon Kia 6365 Highway 97N, Vernon, BC (250) 545-7281

OFFERS END MARCH 31, 2010. VISIT YOUR LOCAL KIA RETAILERS OR KIA.CA

*â&#x20AC;&#x153;90 Day Donâ&#x20AC;&#x2122;t Payâ&#x20AC;? (90 day payment deferral) applies to purchase financing offers on all new 2010 Kia models. No interest will accrue during the first 60 days of the finance contract. After this period interest starts to accrue and the purchaser will repay principal and interest monthly over the term of the contract. **0% financing available on 2010 Rio (RO542A)/2010 Forte (F0540A)/Sportage (SP751A) on approved credit (OAC). Cash back amount varies by model and trim. ^MSRP for 2011 Sorento LX MT (SR540B) is $23,995. â&#x20AC;ĄPurchase price for 2010 Rio (RO542A)/Sportage (SP751A) $11,450/$23,545 and includes a cash rebate of $3,700/$2,750 based on an MSRP of $15,150/$25,545 Delivery and destination fees of $1,455/$1,650 included. All offers exclude license, insurance, other taxes, down payment and variable dealer administration fees. Other dealer charges may be required at the time of purchase. Other lease and finance options also available. Dealers are free to set individual prices. Prices subject to change without notice. Certain restrictions may apply. â&#x20AC; Cash purchase price for 2010 Soul (SO550A)/2010 Forte Koup (FO521A) is $16,695/$18,950 and includes a cash credit of $750/$1,000 based on an MSRP of $17,445/$19,950. Delivery and destination fees of $1,650/$1,450 included. License, registration, insurance, dealer administration fees and taxes are excluded. >Highway/city fuel consumption for 2010 Rio EX (RO542A) is 5.8 L (49MPG)/7.1 L (40 MPG); 2010 Soul 1.6L MT (SO550A) is 6.3 L (45 MPG)/7.7 L (37 MPG); 2010 Forte Koup (FO521A)is 5.8 L / (49 MPG)/8.3 L (34 MPG); 2011 Sorento 2.4L MT (SR540B) is 7.4 L (38 MPG)/10.6 L (27 MPG); ); 2010 Sportage LX MT (SP551A) is 8.0 L (35 MPG)/10.2 L (28 MPG). The actual fuel consumption of these vehicles may vary. These estimates are based on the Government of Canadaâ&#x20AC;&#x2122;s approved criteria and testing methods. Refer to the Government of Canada publication EnerGuide Fuel Consumption Guide. +2010 Soul awarded the Top Safety Pick by the Insurance Institute for Highway Safety. Visit www.iihs.org for full details. Visit kbb.com for full details. The 2010 Kia Forte was awarded Car of the Year by NADAguides.com. To learn more please visit www.NADAguides.com. Green Score for the 2010 Kia Rio based on specification within its segment. Refer to GreenerCars.org for full details. NHTSA (National Highway Traffic Safety Administration) test results. Visit www.safercar.gov for full details. §The BluetoothÂŽ word mark and logo are registered trademarks and are owned by Bluetooth SIG, Inc. Some vehicles advertised may include optional accessories or after-sale equipment and may not be exactly as shown. Information in this advertisement is believed to be accurate at the time of print. Offer ends March 31, 2010. KIA is a trademark of Kia Motors Corporation.


www.vernonmorningstar.com

Friday, March 19, 2010 - The Morning Star B21

News SHOEMAKER

HAVE YOU GOT THE

TOUCH? TOUCHPHONES

FROM 99* $

19

ON NLY U NTIL M AY Y3 ASK F O R DETAILLS.

BRENT MUTIS/MORNING STAR

Samaritans tee it up at tourney Morning Star Staff

The Good Samaritan Society (GSS) is hosting its third annual CitiFund Spirit of Caring golf tournament at Kelowna Springs Golf Course May 7. In the Okanagan area, the society supports care for seniors and allows seniors to give back through sharing the experience theyâ&#x20AC;&#x2122;ve garnered during their long lives. The society would like to challenge residents of the communities of Vernon, Kelowna, Penticton and Salmon Arm to join the events and help GSS in its mission to provide complex/continuing care, daily assisted living and other specialized forms of community health care services.

Many of the seniors who benefit from GSS services are folks who enjoy the game of golf. GSS is trying to create a revitalized view of seniors care so show your support by bringing your clubs out to join them on the links. For more information and to reserve your spot, please contact Randi at 250-542-6101 or e-mail to funddev@ gss.org.

BRING IN THESE COUPONS & SAVE Redeem this AD for a 1 time $20 discount on your purc chase!!`

:>1'))+8847>

:>2'))+8847/+8

:>3'))+8847/+8

$AVE 10%

$AVE 15%

$AVE 25%



=)1:*+8/.43+'))+8847/+8



=)1:*+8/.43+'))+8847/+8



=)1:*+8/.43+'))+8847/+8

For all participating locations visit cellcomwireless.com VERNON "/11'-+7++3'11  9. 9  9.9   

KAMLOOPS 41:2(/'1')+.455/3-97   :22/9 7  :22/97   

ABERDEEN MALL   7'38'3'*'<>#  

   



KELOWNA 7).'7*'70.455/3-97  '7;+> ;+ '7;+>;+   

LAKELAND PLAZA

 '7;+>;+      

 

Al Edwards, of the North Okanagan Woodcarvers, works on a miniature boot carving recently at the Vernon Arts Centre.

w i t h see l e c t 3-yr. p l a ns

CELLCOM

A $!"! %

#/9.3+<')9/;'9/4343'3> >79+72;4/)+51'3 > > 5 '=+8+=97''71>)'3)+11'9/43,++8' > '551> 55 > &;'/1'(1+431>'91/89+*+11)4214)' >  9/438431>/3/2:25:7).'8+4, 7+6:/7+*:8957+8+39'* > 5 6 5 @4-+78'3*9.+4(/:8*+8/-3'7+97'*+2'7084,4-+7842 * /9 * 0 ,   2:3/)'9/4383):8+*:3*+71/)+38+474,4-+78#/7+1+88'793+78./51149.+7(7'3*3'2+8'7+97'*+2'7084,9.+/77+85+)9/;+ 4<3+78? 

â&#x20AC;˘ Take a vacation â&#x20AC;˘ Consolidate debt â&#x20AC;˘ Buy a vehicle

1.888.440.4480 prospera.ca *The Annual Percentage Rate (APR) is for a loan of $10,000 with monthly payments and a 5-year amortization, assuming no fees apply. If fees and/or charges apply, the total Cost of Credit and APR would increase. Based on a fully insured loan. Rate subject to change without notice and some conditions may apply. Offer available for a limited time and OAC. See branch for complete details.


B22 Friday, March 19, 2010 - The Morning Star

www.vernonmorningstar.com

Activity

CLIFFORD AUTOMOTIVE

250-542-6068

Horoscope BY BERNICE BEDE OSOL PISCES (FEB. 20-MARCH 20) Adopting a positive, optimistic attitude could put you in the position of being a big winner. Hang onto this frame of mind as long as you can.

PUZZLE NO. 203

ARIES (MARCH 21-APRIL 19) It might appear to you that your lot in life is to be nothing but a giver. However, conditions could suddenly reverse themselves and put you in line of being a big receiver. TAURUS (APRIL 20-MAY 20) Involvements with friends could turn out to be one of the better days for all concerned. There’s a good chance that you’ll be lucky for them, and they will be just as lucky for you. ANSWER TO PUZZLE NO. 203

HOW TO PLAY: Fill-in the grid so that every row, every column and every 3x3 box contains the numbers 1 through 9 only once. Each 3x3 box is outlined with a darker line. You already have a few numbers to get you started. Remember: you must not repeat the numbers 1 through 9 in the same line, column or 3x3 box. 091030

16 20

22

25

26

29

27

30

31

34 37

38

39

40

43

44

53

55

56

ACROSS 1 Service charge 4 Highway cruiser 8 Sticker stat 11 Idaho neighbor 13 Average grades 14 Frazier foe 15 Late bloomers 17 Schmooze 18 — de corps 19 Pool resources 21 Adherent 22 Crane arm 23 Intended 26 Jousting weapons 29 Fender nick 30 Snake’s tooth 31 Leaf out 33 Marquee notice 34 Staffer

35 36 38 39 40 41 44 48 49 52 53 54 55 56 57

46

47

51 54 57

British noble Make possible “Haystacks” painter Soccer — Roam around Spam, maybe (hyph.) Toted Basketball hoop Lazy feeling Exist Import car Team cheers Dice throw London park Stir-fry pan

DOWN 1 Do a slow burn 2 Timetable info 3 Legendary marshal

20 22 23 24 25 26 27 28 30 32 34 35 37 38 40 41 42 43 45 46 47 50 51

Peacock network Tarzan’s mate JAMA readers The Emerald Isle By and by Take on cargo Poet’s black You bet! Thin coating Banned bug spray Put an end to Room occupant Left Bank pal Sledgehammer Atlas alternative Latin I verb Swampy ground Hymn finale Munch She loved Narcissus Cubicle filler Vote against Family man

4 Polar explorer 5 Moray 6 Club — 7 Handing out 8 Pageant figures 9 Urban map 10 Mocking comment 12 Chartering 16 Main point

090706

G I B E

52

50

P L A T

49

S UD RD E T

48

45

M A G N I B C E B O N

42

32

35

D E S K

36

28

GE NC A H WO

33

10

17 19

24

9

14

21

41

8

13

18

23

7

L O D G E R

15

6

G I S T

12

5

S EM I C E E S O L D S T U T J I L A N F A NG I D E L E M M GA L U NDO L A A B Y D E

11

4

A B O L I S H

3

F E E U T A H MA R I E S P R I ME A N D I NG S RO E N A M MA I I M R E E N

2

E R A T

1

GEMINI (MAY 21-JUNE 20) There could be far more possibilities for success than usual, but not necessarily from your efforts alone. Many may be from contributors who are prepared to back up what you start. CANCER (JUNE 21-JULY 22) Lady Luck isn’t likely to give much credence to negative opinions, and that should be all the reason you need not to give any credence to naysayers. Plan on being a winner. LEO (JULY 23-AUG. 22) Companions or associates might find challenging developments distasteful, but not you. You’ll sense that the more chances you get to overcome negativity, the luckier you’ll become. VIRGO (AUG. 23-SEPT. 22) Share your time only with companions who are optimistic about life and refuse to think in terms of limitation. These types will serve to inspire you to utilize your full potential. LIBRA (SEPT. 23-OCT. 23) It behooves you to be of service to others. You’ll quickly discover that when you give of yourself, you’ll end up gaining more in return than do those you help. SCORPIO (OCT. 24-NOV. 22) You’ll have the ability to make all with whom you’re involved feel important and be able to lift their spirits to new heights. In the process, it’ll soar your own popularity to an all time high.

SAGITTARIUS (NOV. 23-DEC. 21) If you have a gut feeling that you’re simply lucky, believe it. The aspects indicate that Lady Luck wants to make you one of her biggest recipients of her workings. CAPRICORN DEC. 22-JAN. 19) Even if you think you should be focusing on your more serious inclinations, follow your instincts about doing something lighthearted. Relaxing your mind can bring great happiness to you. AQUARIUS (JAN. 20-FEB. 19) You’re in a special -- albeit momentary -- cycle where you could be luckier than usual in your material affairs. These particular aspects could bring many good things that can be expanded upon in time.

• General Repairs & Maintenance • FORD Trained Technician CLIFF & DIANE SMITH • Electronics Specialist rd

3000 - 43 Ave.

BCAA Approved Repair Centre

DOMINION XTERIORS Ltd. Primrose Roofing Ltd. Call Someone You Can Trust! • Custom Flashings • Vinyl Siding • Soffits • Fascia • Gutters • Decking • Railing • Torch on Roofing • Tar & Gravel Conversion Roofing

4607 34th Street Vernon • 250-542-1975

YOUR BIRTHDAY TODAY The rewards from an endeavor to which you’ve devoted much time and effort will suddenly break in your favor in. You’ll be glad you stayed the course regardless of what you’ve gone through and how long it has taken.

HORMONES Q: I am having problems with sleep, sex drive, hot flashes and weight gain. What can I do? A: These are just a few symptoms of hormone dysfunction. You need hormone testing (saliva or blood tests) to identify imbalances. Treatment includes the use of bioidentical, plant based hormones that closely duplicate hormones your body produces. Natural hormones also slow the aging process.

R

EFLECTIONS

Ashley

HAIR & ESTHETICS STUDIO

invites any new & former clients to book an appointment today!

Dr. Denise De Monte, N.D.

De Monte Centre Natural Medicine 4007 27th Street

250-545-0800 find out more at

demontecentre.com

Looking for a Full/Part Time Esthetician

Come Join Our Team! Apply within

Stylist

#200-3101 48th Avenue, Vernon, B.C. (next to Sears)

250-545-7988

www.reflectionshair.ca


Smiles for Life

www.vernonmorningstar.com

The Grizzwells

Friday, March 19, 2010 - The Morning Star B23

Comics

Family Dentistry • Dental Hygienist Services

Dr. Dwayne Ogasawara

#

201, 3117 32nd St., Vernon Above Vernon Insurance

New patients welcome

250-542-2361

Thinking of UPGRADING to a TANKLESS water heater? ® We recommend NOW THROUGH APRIL 15

10% OFF

Born Loser

STANDARD INSTALLATION

E.L. Fox & Sons

Plumbing & Heating Ltd. • Plumbing • Heating • Gas Fitting • Service Work • Air Conditioning

250-545-8028

Email: foxandsons@telus.net

Soup to Nutz TIME FOR

Spring Special

1/2 PRICE for the second month STOP

WE ARE OPEN DURING HIGHWAY CONSTRUCTION

3561 Hwy 97A, Armstrong (Just 15 minutes north of Vernon) Tel: 250-546-4015 • www.hawthornestorage.com

Frank and Ernest

EARLY BIRD SPECIALS ON HEATING & COOLING SYSTEMS Turn to the Experts

BOOK YOUR FREE IN-HOME ESTIMATE BY APRIL 30, 2010 AND GET

UP TO

$

1100

OFF

ON ELIGIBLE CARRIER SYSTEMS

Moderately Confused

Bridge by Phillip Alder If declarer could have a look at each defender’s hand, he would make most contracts. And sometimes, if he maneuvers to best advantage, he will play as if he could see around corners. This deal contains an essence of that. You are in three no-trump. West leads the heart two. After you capture East’s jack with your king, how would you continue? The auction was straightforward, your rebid showing a balanced 12-14 points. You have seven top tricks: three spades, one heart (at trick one), one diamond and two clubs. Both minors offer possibilities for extra winners. Since you would prefer to keep East off lead

(otherwise, he will push a heart through your queen), no doubt you saw that you should not start with the diamond finesse. Instead, perhaps you played a club to dummy’s king and a club to your jack, finessing into the safe hand. If the finesse had worked, that would have been fine. But when West won with his queen, if he finds a diamond shift, you have a nasty guess. Do you take that finesse, or do you win with dummy’s ace and play for spades to be 3-3? Yes, the a priori odds favor the diamond finesse, but wouldn’t it be nice not to have to guess? Before attacking clubs, play three rounds of spades. When they prove to be 3-3, cash the last spade, then continue with

Plumbing & Heating the club king and the club finesse, making your contract with four spades, one heart, one diamond and three clubs. But if the spades are 4-2, you know that you need the diamond finesse. It is a textbook discovery play.

Heating and Air Conditioning

For a FREE in-home estimate call

250.307.2513

GOT PAIN? Natural Pain Solutions • Medical Laser • Oral Medicines • Natural Injections • Revolutionary Back Treatments • Over 90% Success

Dr. Denise De Monte N.D. Dr. Tara Spearman, D.C. De Monte Centre Natural Medicine

250-545-0800 find out more at

gotpaindoctor.com


B24 Friday, March 19, 2010 - The Morning Star

www.vernonmorningstar.com

Your community. Your classiďŹ eds.

250.550.7900 fax 250.558.3468 email classiďŹ eds@vernonmorningstar.com INDEX IN BRIEF Family Announcements Community Announcements Employment Service Guide Pets For Sale/Wanted Real Estate Rentals Automotive Legals and Others

WORD/DISPLAY ADS Call our experienced advertising department for competitive rates on display classified ads. 550-7900

OBITUARIES Display ad - $12.60 per column inch IN MEMORIAM Display 1 column by 3â&#x20AC;? $24.07 2 column by 3â&#x20AC;? $48.14

CELEBRATIONS Happy Birthday. Happy Anniversary. $12.60 per column inch (with or without photo)

BOX SERVICE CHARGE $11.85 if replies are picked up, $22.50 if replies are mailed.

Classified Advertising

HOURS

Mon. - Fri. 8:30am - 5:00pm

Morning Star / Daily

MorningStar

The

Phone: 550-7900 Fax: 558-3468 CLASSIFIEDS@VERNONMORNINGSTAR.COM

4407 - 25th Ave., Vernon, BC

ON THE WEB:

AGREEMENT It is agreed by any Display or Classified Advertiser requesting space that the liability of the paper in the event of failure to publish an advertisement shall be limited to the amount paid by the advertiser for that portion of the advertising space occupied by the incorrect item only, and that there shall be no liability in any event beyond the amount paid for such advertisement. The publisher shall not be liable for slight changes or typographical errors that do not lessen the value of an advertisement. bcclassified.com cannot be responsible for errors after the first day of publication of any advertisement. Notice of errors on the ďŹ rst day should immediately be called to the attention of the ClassiďŹ ed Department to be corrected for the following edition. bcclassified.com reserves the right to revise, edit, classify or reject any advertisement and to retain any answers directed to the bcclassified.com Box Reply Service and to repay the customer the sum paid for the advertisement and box rental. DISCRIMINATORY LEGISLATION Advertisers are reminded that Provincial legislation forbids the publication of any advertisement which discriminates against any person because of race, religion, sex, color, nationality, ancestry or place of origin, or age, unless the condition is justified by a bona fide requirement for the work involved. COPYRIGHT Copyright and/or properties subsist in all advertisements and in all other material appearing in this edition of bcclassified.com. Permission to reproduce wholly or in part and in any form what-soever, particularly by a photographic or off set process in a publication must be obtained in writing from the publisher. Any unauthorized reproduction will be subject to recourse in law.

Obituaries

Obituaries

Obituaries

MERRITT, LARRY â&#x20AC;&#x201C; Passed away peacefully at the Kelowna Hospice House on March 13, 2010. Larry is survived by his loving companion Darlene; children Shauna; Sue; Deb; Ken; and Larryâ&#x20AC;&#x2122;s brothers Lyle and Harvey as well as his loving dog Bee. Family only service. In lieu of ďŹ&#x201A;owers donations may be made to the SPCA (250)861-7722 or www.spca.bc.ca. Arrangements in care of Everden Rust Funeral Services (250)860-6440

MELVIN EDWARD GROTTENBERG

Obituaries

Obituaries

Obituaries

Obituaries

Pool, Philip D. It is with heartfelt sadness that we announce the passing of Philip D. Pool, on March 15, 2010 in Vernon, BC. Expression of sympathy may be forwarded to the family via email: vernon@pafs.net. Arrangements entrusted to PERSONAL ALTERNATIVE FUNERAL SERVICES, (Vernon. 250-558-0866 & Armstrong. 250-546-7237)

Eklund, James L. It is with heartfelt sadness that we announce the passing of James L. Eklund, on March 12, 2010 in Vernon, BC. Expression of sympathy may be forwarded to the family via email: vernon@pafs.net. Arrangements entrusted to PERSONAL ALTERNATIVE FUNERAL SERVICES, (Vernon. 250-558-0866 & Armstrong. 250-546-7237)

Klein, Bernard John It is with heartfelt sadness that we announce the passing of Bernard John Klein, on March 15, 2010 in Vernon, BC. Expression of sympathy may be forwarded to the family via email: vernon@pafs.net. Arrangements entrusted to PERSONAL ALTERNATIVE FUNERAL SERVICES, (Vernon. 250-558-0866 & Armstrong. 250-546-7237)

Koshman, John Henery It is with heartfelt sadness that we announce the passing of John Henery Koshman, on March 11, 2010 in Vernon, BC. Expression of sympathy may be forwarded to the family via email: vernon@pafs.net. Arrangements entrusted to PERSONAL ALTERNATIVE FUNERAL SERVICES, (Vernon. 250-558-0866 & Armstrong. 250-546-7237)

The family of Melvin Edward Grottenberg sadly announces the passing of this dear and gentle man, with his family by his side, in Vernon BC on March 14, 2010 in his 98th year. He was born and raised in Winnipeg, Manitoba. He married Mae Emes, whom he proudly called â&#x20AC;&#x153;the love of his lifeâ&#x20AC;?. During the war years they made Ottawa their home and later settled in Thunder Bay, Ontario. Mel spent many years in the Canada Postal Service, retiring in 1972. He and Mae began their retirement life by building a beautiful cottage on Lake Superior. The camp became a second home to family and friends. They loved to â&#x20AC;&#x153;trailerizeâ&#x20AC;? and for many years made Texas their winter getaway. In 2004, to be closer to family, Mel and Mae made Vernon BC their home. Mel was never idle. He was an avid carpenter and he loved gardening but nothing made him happier than playing cards and shooting pool with his family. His warm personality and great sense of humour always made family get togethers very special. Mel was predeceased by his wife of 66 years; and his siblings Harold, Wilbert, Florence, John and Elsie. He will be lovingly remembered by his sister Florence (Calgary), and children Bert (Darlene) Grottenberg in Vernon BC; Ila (Perry) Dagsvik of Red Deer Alta; and Marilyn (Paddy) Arthur of Chilliwack BC. His grandchildren Perry and Erik Dagsvik; Curtis, Peter and Kerri Mae Grottenberg; and Devin Arthur will be forever inspired by the strength of character of their grandpa. His great grandchildren Erika, Nikolas, Brittany, Jessica and Krista Dagsvik will cherish his memory fondly. The family wishes to express the deepest appreciation to Dr. Gavin Smart for his years of loving care, the staff of Canterbury Court, Westridge Care Home, and 3 East at VJH, and the extraordinary caregivers of the North Okanagan Hospice Society. Thank you so much for making Melâ&#x20AC;&#x2122;s years in Vernon so special. A private memorial celebration will be held at a later date. In lieu of Ă&#x20AC;owers, donations may be made to the North Okanagan Hospice Society, 3506 â&#x20AC;&#x201C; 27th Avenue, Vernon, B.C., V1T 1S4. Melvin was a gentle man who cherished his family and was deeply loved by many. Melvinâ&#x20AC;&#x2122;s beautiful spirit will be remembered and celebrated forever.

!     

"             "%# # !##!  $#  # !

   

  "# $!&"#&&&!#"#! 

  0CJUVBSJFTSVOOJOHJO QBQFSBSF BMTP LFQU JO B QFSNBOFOU BSDIJWFPOMJOF5IFTFNBZ CFWJFXFEBU XXXWFSOPONPSOJOHTUBSDPN

 


www.vernonmorningstar.com

In Memoriam 4252199

SCALES

Friday, March 19, 2010 - The Morning Star B25

Business Opportunities

Career Opportunities

Vending Route, snack boxes & machines. Route incl: Revelstoke, Sicamous, Salmon Arm, Enderby, Armstrong & Vernon $30,000. 250-309-0670 Working partner for retail ďŹ&#x201A;ooring/paint store, Vernon. 1250-717-7488.

Career Opportunities

Mary Scales

INTERESTED IN A REAL ESTATE CAREER?

We think of you every day Grannie.

â&#x20AC;˘ Flexible Hours â&#x20AC;˘ Write Your Own Pay Cheques â&#x20AC;˘ Market is Changing â&#x20AC;˘ Now is the Time

In memory of

who passed away March 20, 1990.

Love Kalyn and all the family

Coming Events HIGH TEA, every Sunday starting March 21st 1-5. Reservations preferred. 250-5476255. Proper attire required. Knee Deep in Sheep Event. Newborn animals, picnic area, Childrenâ&#x20AC;&#x2122;s activities, Bale maze, Free refreshments, Gift shop. Open Saturdays in April, also April 5th & 23rd, 12-5pm, $6.50 under 2 free. 5421-70th St. SW, Salmon Arm Sunday 25th pre-registered sheep/goat workshop, 250-832-0503 harmonioushomestead@live.ca

Information IF you want to drink, thatâ&#x20AC;&#x2122;â&#x20AC;&#x2122;s your business. If you want to stop, thatâ&#x20AC;&#x2122;â&#x20AC;&#x2122;s ours. ALCOHOLICS ANONYMOUS 250-545-4933

Call Bill Hubbard for a personal interview

250-550-2109 Executives Realty

When replying to Box #â&#x20AC;&#x2122;s c/o The Morning Star, please do not e-mail your resumes. They must be either dropped off or mailed to: 4407 - 25th Ave., Vernon V1T 1P5

In Memoriam 4264394

Childcare Available 1 full time opening available now, starting age 0-2, lots of TLC, exc.refâ&#x20AC;&#x2122;â&#x20AC;&#x2122;s, 18+yrs exp. Wendy 250-558-0142. LITTLE ARK CHILDCARE has 2 P/T spaces ages 3-5yrs. Licensed program incl. monthly ďŹ eld trips, daily breakfast program and snacks. Daily preschool program inclâ&#x20AC;&#x2122;â&#x20AC;&#x2122;s; phonics and sign language instruction, music, literature & Kindergarten readiness. 250549-4510.

Business Opportunities ARE you highly motivated and looking for a home based online business? Flexible hours, free training, great income and incentives, real support. www.greenlivingconnection.ca ATTENTION: Trainers wanted. 50 yr old Distribution Company is looking for ONLINE Trainers. You work ďŹ&#x201A;exible hours from HOME on your computer. See www.123yoursuccess.com

For rent: Room, in well established beauty salon, suitable for Esthetician or Massage Therapist, some equip. avail. Beauty Haven, (250)542-4219 HIGHLY PROFITABLE recession proof business looking to expand. Email info@TechProSolutions.ca or call (250) 540-8898. Picture framing business in Armstrong. Equipment & stock $30K. Established location. Training avail. Owner retiring. 250-546-1949, 250-546-0414 Well established rototilling business. Great home based business. 250-558-8705.

Build your own home-based business and partner with one of the fastest-growing kitchen show programs in North America! Attend an information meeting on March 28th, 12-4 pm in Kamloops. To reserve your seat or to learn more please contact: Trish Independent Senior Director Call 604-532-2044 @ tcell@telus.net

Education/Trade Schools Become a Psychiatric Nurse â&#x20AC;&#x201C;train locally via distance education, local and/or regional clinical placements, and some regional classroom delivery. Wages start at $29/hour. www.stenbergcollege.com

MARTIN ORCHARD, Vernon req workers. Pick/Prune, $9.14/hr or piece rate. up to 60hrs/week, 6/days/week. June1-Oct.31. 250-549-4138

ClassiďŹ ed Ads Work! Information

Information

DISHWASHER REQUIRED Must be available any day of the week. Day and evening shifts. Drop resume at Canterbury Court, 3011 Gateby Place

Nixon Wenger â&#x20AC;˘ Morning Star

Community Corner

is offering a meeting room for non-proďŹ t organizations. Available for day & evening. Contact Elaine Collison @ 250-558-6585 or email to peopleplace@shaw.ca to set up appointment.

ATTENTION: LOCAL people needed to Work From Home online $500-$4500 PT/FT. Complete Training provided. Call Candace 1-877-822-8170

In Memoriam In Memory Of

(Enair) It has now been one long year that you were taken from us. We know that you are now in a better place, And no longer suffering, for this we are thankful. Not a moment goes by, That you are not remembered, By your family and friends. These memories are cherished by many. You reached out and touched so many people, With your kindness, your cheerfulness, and your love. You were always there for all of those around you, And now, deeply missed by many. To know you, was too Love you. You will always be in our hearts. Always, Terry, Lisa, Jamie, Dylan, Brandon, & (max). We Love and Miss You. So Much!

In Loving Memory Of

Linda Joan Manning (Cunning) Its been one year since youâ&#x20AC;&#x2122;ve been gone But in our hearts you still live on The moment that you died Our hearts split in two The one side ďŹ lled with memories The other died with you We often lie awake at night When the world is fast asleep And take a walk down memory lane With tears upon our cheeks Remembering you is easy We do it every day But missing you is a heartache That never goes away Our family chain is broken and nothing is the same We mention your name And speak of you often We hold you tightly within our hearts And there you will remain Life has gone on without you But it never will be the same Though absent, you are ever near Still missed, loved, and always dear

With love, Mom, Dad, Howard, David, Rob & All The Family

Help Wanted

Help Wanted

4266444 &HOOFRP:LUHOHVV&DQDGDÂśVODUJHVWH[FOXVLYH 52*(56:,5(/(66GHDOHUVSHFLDOL]LQJLQ ZLUHOHVVDQGGDWDSURGXFWVLVFXUUHQWO\ ORRNLQJIRU

)8//7,0(5(7$,/ 6$/(65(35(6(17$7,9(6 WRMRLQRXUWHDPLQRXU9LOODJH*UHHQ0DOOORFDWLRQ

0XVWKDYHSRVLWLYHSURIHVVLRQDODWWLWXGH DQGH[FHOOHQWFRPPXQLFDWLRQVNLOOV:H FRQWLQXRXVO\RIIHUJUHDWPRQWKO\FRQWHVWDQG LQFHQWLYHVFRPSHWLWLYHFRPSHQVDWLRQEHQH¿WV DQGSURYLGHRQJRLQJWUDLQLQJ:HEHOLHYHLQ WKH³SURPRWHIURPZLWKLQ´FRQFHSWDQGRIIHU DGYDQFHPHQWRSSRUWXQLWLHVWRRXUVWDIIZKHQ DYDLODEOH 3OHDVHHPDLOUHVXPHWREVLPPRQVRQ#FHOOFRPZLUHOHVVFRP RU)D[LWWR   $WWQ%UHQW

:HDSSUHFLDWHWKHLQWHUHVWRIDOODSSOLFDQWVKRZHYHU RQO\WKRVHVHOHFWHGIRUDQLQWHUYLHZZLOOEHFRQWDFWHG

Career Opportunities

Career Opportunities

&(//&20

Weâ&#x20AC;&#x2122;re on the net at www.bcclassiďŹ ed. &$1$'$Âś6/$5*(67(;&/86,9(52*(56$87+25,=(''($/(5

â&#x201E;˘Rogers and the Mobius design are trademarks of Rogers Communications Inc. Used under License. Š 2010

Help Wanted

June 5, 1951 - March 19, 2009

4267674

Help Wanted ON SITE PARK OPERATOR Silver Beach/Seymour Arm Remote on site living in a beautiful marine campground environment. Duties include operating & maintaining marine parks & campground, collecting fees, security, etc. Must have boating experience. Good wage. F/T from May 1 to Sept. 15. Couples preferred, RVâ&#x20AC;&#x2122;s required. (1-250)546-3790

Farm Workers

Donna May Barabonoff

Lost & Found FOUND: Female Mastiff found in Coldstream on Whetzell Drive. has been seen dodging trafďŹ c on Kal Lake rd for a few days. Has collar, no identiďŹ cation. 250-542-0410. FOUND: on Cummins Rd, Set of keys w/Ford key on it. To identify pick up at the Morning Star, 4407 25th Ave, Vernon. FOUND: Saint Christopher charm. 250-558-4683 to identify. LOST: March 6, camera in black suede case at Mabel Lake boat launch. If found please call 250-838-6465. LOST: Set of keys on a Prada key ring, between East Vernon Rd. & Village Green Mall on Sat. March 13th AM. Call 250307-6609

Join our team of Consultants!

Help Wanted

CITY OF ARMSTRONG JOB OPPORTUNITY The City of Armstrong is looking for a Clerk-Typist II to join our team. We seek a dedicated individual who likes to work with people, enjoys challenges and has a proven ability to meet deadlines with close attention to detail. You must have at least two years of progressive ofďŹ ce experience with strong computer skills and an aptitude for learning. If you are looking for a rewarding career opportunity, please visit our website located at www.cityofarmstrong. bc.ca for full details or you may call (250) 5463023 to have the documents emailed or faxed to you. The deadline to apply is Wednesday, March 24, 2010 by 5:00 p.m.

Start your Health Care Career in less than a year! Nursing Unit Clerk â&#x20AC;&#x201C; 6 months - A people oriented job at the heart of hospital operations Resident Care Aide â&#x20AC;&#x201C; 6 months - Hands on care for the elderly Pharmacy Technician â&#x20AC;&#x201C; 8 months - Online or on campus - The only CCAPP accredited program in BC Medical Transcriptionist â&#x20AC;&#x201C; 9 months online or on campus - Work in hospitals, or online Financial Aid available for qualiďŹ ed students P.C.T.I.A. accredited college

1-877-840-0888 www.ThompsonCC.ca

Education/Trade Schools

SPROTT-SHAW

Casual Shift Residential Workers Preferred QualiďŹ cations â&#x20AC;˘ Diploma in human or mental health services â&#x20AC;˘ Minimum Grade 12 â&#x20AC;˘ Occupational First Aid Level 1 â&#x20AC;˘ Basic CPR certiďŹ cation â&#x20AC;˘ Food Safe certiďŹ cation â&#x20AC;˘ Valid BC Driverâ&#x20AC;&#x2122;s Licence

Preferred Previous Experience â&#x20AC;˘ Providing direct human services to clients who are economically disadvantaged, experiencing mental health challenges, and/or drug/alcohol dependent â&#x20AC;˘ Supervision and monitoring of clients in a residential setting

Knowledge and Skills â&#x20AC;˘ Basic computer skills â&#x20AC;˘ Excellent verbal and written communication and the ability to maintain detailed and accurate records â&#x20AC;˘ Understanding of the issues surrounding homelessness, unemployment and drug and alcohol dependence â&#x20AC;˘ Demonstrated ability to supervise, monitor, and support clients â&#x20AC;˘ Knowledge of local and regional community and social service agencies

A mandatory criminal records check is required prior to commencing employment. This is an excellent opportunity to work for a growing program. Extensive beneďŹ ts package provided.

Applications accepted until March 31, 2010 By email: Franco.Marolla@jhsnok.ca OR John Howard Society of the North Okanagan/Kootenay Region Attention: Program Director 2307 43rd Street Vernon, BC V1T 6K7

Call Today For Free Info Kit

Education/Trade Schools

John Howard Society of North Okanagan/Kootenay

Education/Trade Schools

Education/Trade Schools

It Just Makes Sense

Resident Care Attendants are in critical demand Re sBecome s a Guardian Angel of Healthcare sSprott-Shaw is the largest trainer of RCAâ&#x20AC;&#x2122;s in B.C. sGraduate and work in as little as 9 months

Call our VERNON Campus:

558-0855

(250)

sprottshaw.com

The choice is yours... 02!#4)#!,.523).'s2%3)$%.4#!2%!44%.$!.4s"53).%33-!.!'%-%.4 #/--5.)493500/247/2+%2s%!2,9#(),$(//$%$5#!4)/.s!.$-/2%


B26 Friday, March 19, 2010 - The Morning Star

Help Wanted

WANTED CUSTOM HOME INSTALLER/ SALESPERSON Contract position for a home electronic background installation installer. Good salary base plus bonuses and commission. Experience is an asset! Please drop off resumes to 3107 - 48th Ave., Vernon Certified Experienced Traffic Control persons needed, require own transportation, wages DOE. Reliable people need only apply. 250-309-3452.

Help Wanted HEY YOU... YEAH YOU! WANT A JOB? Kelowna company is looking for hard working individuals. We provide full training, no experience required. $2,500+/mo! Must be 18+ and able to start immediately.

CALL 250-860-9480

KING’S CHRISTIAN SCHOOL is accepting resumés for a part-time

FRENCH POSITION. Mail to 350-B 30th St. NE, Salmon Arm, BC V1E 1J2 or email info@kingschristian school.com

www.vernonmorningstar.com

Help Wanted COOK WANTED

Canterbury Court Seniors Residence has an opening for a cook to work the morning and afternoon shift including weekends. Must have experience in prepping, baking, cooking and meal service. Bring resume to 3011 Gateby Place, 9 am to 5 pm, Monday to Friday. Chicken Catchers needed for Mar.21. Must have own transportation to Armstrong. 250938-0711. COOK & COOK’S ASSISTANT: needed for children’s summer camp, see www.camphurlburt.com “staff” for details. Closing date April 19th, 2010 Experienced Hairdresser to join our team, friendly, well established Salon. Drop resume off at Beauty Haven 3403 30th Ave. 250-542-0481 evenings

Interior Heavy Equipment Operator School With $12 Billion in infrastructure upgrades announced, start your Heavy Equipment training NOW and receive your certification for the spring demand!

Up to 35 Ton Machine

le!

lab Hands on, real world training avai today. s t Classes start every Monday a s Se your e Never share equipment while training v r Rese Job placement assistance Full size equipment Funding through EI, Student Loans & Community Development Trust Fund. Call for more details. x Trainers with 100+ years field experience x Safety tickets available include: H2S, GD, TDG, WHMIS, OSSA, PST, First Aid #1 in the x PCTIA Accredited Institution Industry x x x x x x

High Drive Dozer

Help Wanted

Help Wanted

ARE YOU EXPERIENCING FINANCIAL DISTRESS? Relief is only a call away! Call Harry Martens, Estate Administrator at 250-503-5300 today to set up your FREE consultation in Vernon, Donna Mihalcheon CA, CIRP, KPMG Inc. Trustee in Bankruptcy, #300 - 3205 32nd Street, Vernon, B.C. V1T 9A2 GENERAL Laborer req. to work with Brush Clearing Crews. Working in the Southern Int. Seasonal & Full Time. Drivers licence and clean abstract req’d. First Aid Cert., Herbicide Cert. are assets. Fax resume: 250-861-8737 Graphic designer needed at busy graphic design firm. Must have experience using Adobe Software. Send your resume to steph@tambellini.ca

Local Paving Company

looking for Driver/Worker with class 1 license, start 1st/2nd week of April. Fax resume & drivers abstract to 250-545-4599 LAWN technician needed for the coming season. Must have Pesticide Applicators licence. Clean driving abstract. E-mail skibum1@telus.net or call (250) 545-9590 to arrange interview. Long Term regular PT live-out nanny/domestic housekeeper wanted. Please send resume, cover letter & references to parttimenanny@hotmail.com

Full Time / Part Time Pharmacist 650 sq. ft. clinic pharmacy in Vernon medical building is seeking a progressive pharmacist interested in expanding professional services. Hours of operation are Monday to Friday, 8:30 am to 5:30 pm. Competitive wage commensurating with experience. Interested parties please contact Todd Dew at Hogarth’s Clinic Pharmacy, 250-545-3660 fax 250-545-4392 email: hogarth@relcomsys.com.

Help Wanted

Help Wanted

ESTABLISHED underground construction company requires highly skilled professional pipe layers, equipment operators, truck drivers, flaggers, concrete finishers & foremen. Strong work ethics and extensive experience are mandatory. The successful applicant will be self driven, have an aptitude for the construction industry and a high level of motivation. As well, they will pass a mandatory skills and safety written exam and drug testing. Top wages and extensive benefits pkg offered only to those that have a strong desire to be successful and maintain the highest standard of work results & ethics on a long term basis. Please apply in person to BC Underground, #203-171 Commercial Drive, Kelowna BC, Looking for a mature individual to detail automobiles. Please bring resume to 6303 Pleasant Valley Rd.

LOCAL business requires a full-time, permanent bookkeeper to join our team. We are looking for a person who has 3-5 years experience in accounting/bookkeeping and must be proficient in Simply Accounting and Excel. Applicant must have a keen eye to detail, be organized and be able to work well independently as well as part of a team. Please reply to Box4 C/O The Morning Star. 4407 25th Ave, Vernon BC V1T 1P5 Looking for experienced concrete finisher. Vehicle a must. Top rates. phone (250)9380299, Fax: 250-542-2831 Major Grocery chain requires permanent PT price checker with car on Sundays. Please call 604-714-1352. P/T Male Care Aide for male Quadrapelegic. Reply to Box #12 c/o The Morning Star 4407 25th Ave. Vernon BC V1T 1P5

Part time CDA needed for busy progressive dental practice. Possible long term and full time opportunity. Please fax resume to Aberdeen Dental at 250-545-3311 or email Dr. Koshea: drkoshea@hotmail.com

LOOKING FOR A CHANGE ? Reflflections R ti Hair H i and d Esthetic E th ti Studio St di if looking l ki for f a

FULL/PART TIME TIME STYLIST ESTHETICIAN AND ESTHETICIAN FULL/PART to join out team. If you are passionate about the beauty industry, have

to join out team. Ifservice you are passionate the beauty industry, excellent customer skills and makeabout it a point to go above and have excellent customer skills andbe make it a point to go must above beyond. We need you! service Clientelle would an asset. Hairstylist and strong beyond. We&need be angenerous asset. Medical have color updoyou! skills.Clientelle Medical would and dental, service and dental, generous servicebonuses commisions, bonuses commisions, & flexible hours.& flexible hours. th Bring 48th Ave. Ave.Vernon, Vernon,B.C. B.C. Bringresume resumeto: to: #300 #300 - 3101 3101 48 Attention: or Tanya Tanya Attention: Mike or

Toll Free 1 1--866 866--399 399--3853 www.IHESCHOOL.com

CAR DETAILER

As part of our continued and unprecedented growth Sunshine Honda requires a car detailer. Only applicants with a proven history of punctuality, flexibility and a genuine interest in automobiles will be considered. We offer a competitive salary, a comprehensive benefits package including dental and a genuinely pleasant working environment. Must have positive attitude, be hard working. References required. Must bring your drivers abstract in person to Grant Kitzman, Fixed Operations Manager, Sunshine Honda, 6425 Hwy. 97, on top of the Swan Lake Auto Mile.

REGIONAL DISTRICT OF NORTH OKANAGAN

LIFEGUARDS The Regional District of North Okanagan is seeking lifeguards to fill positions at Lakeview Park Wading Pool (Peanut Pool) and Lavington Wading Pool for July and August, 2010.

grantkitzman@sunshinehonda.bc.ca

Applicants must be 16 years of age and hold a current N.L.S. Certificate. Shifts are 12 hours to 24+ hours per week. A detailed list of duties / responsibilities, along with further information regarding the Regional District of North Okanagan may be viewed on our website at www.rdno.ca.

Join the

These positions offer a starting wage of $12.00 per hour.

Team!

Applications, quoting Competition No. 10-04 will be accepted until 4:00 p.m. on Friday, April 16, 2010 to: Human Resources Officer Regional District of North Okanagan 9848 Aberdeen Road, Coldstream, BC V1B 2K9 Fax: (250) 550-3723 e-mail: hr@rdno.ca Only short-listed candidates will be contacted. No telephone or e-mail enquiries please.

Estates Legal Assistant • Minimum 3 - 5 years Estates experience essential • Competitive salary, full benefit package including RRSP contributions, supportive work environment For more information about this position, please visit the Careers section of our website. Please forward your resume to Theresa Jones, Office Manager, by fax or email: humanresources@nixonwenger.com EXPERIENCE • KNOWLEDGE • INTEGRITY

Tel: 250-542-5353 Fax: 250-542-7273 Toll-free: 1-800-243-5353 4th Floor, 3201 30th Ave.,Vernon, BC V1T 2C6 www.nixonwenger.com

Rapid-Span, a dynamic group of companies with head office located in the North Okanagan city of Armstrong, is currently recruiting for an Accountant. Reporting to the Corporate Controller, you will provide accounting and financial support in the preparation of financial statements, month-end and year-end working paper files, monthly project job costing, inventory valuation and variance analysis, and provide other financial information or support as required. The ideal candidate must have at least 3 years of cost accounting experience in a manufacturing environment and post secondary education in accounting. A keen eye for detail as well as exceptional analytical, communication and organization skills, compliments your education and experience. Proficiency with MS Office software, Accpac and advanced Excel skills is a must. We offer a competitive wage, excellent benefits to full time employees and a positive work environment. Fax Resume: Or Email: Mail:

1-250-546-9066 hr@rapidspan.com Rapid Span 1145 Industrial Dr., Armstrong, B.C., V0E 1B6.

* Only candidates selected for an interview will be contacted.

CAR AUDIO INSTALLER REQUIRED Full time position available March. Experience is necessary!! Good salary base plus bonuses! Send/Drop resumes off Att: Gary at 3107 48th Ave., Vernon, BC V1T 3R5

Vernon Golf & Country Club Food & Beverage Department is now accepting resumes for the following positions

• Servers (must be 19) • Concession (must be 19) • Dishwashers Visit our website for more information www.vernongolf.com Send resumes to: Vernon Golf & Country Club 800 Kalamalka Lake Rd Vernon, BC V1T 6V2 Fax: (250) 542-5468 E-mail: manager@vernongolf.com

No phone calls please


www.vernonmorningstar.com

Friday, March 19, 2010 - The Morning Star B27

Help Wanted

Financial Services

Boarding

Pizza cook required immediately, must be 19 years of age or older, weekend nights. Apply in person #4-100-Kal Lake Rd, Uncle Dave’s between 11-5 Mon-Fri.

GET BACK ON TRACK! Bad credit? Bills? Unemployed? Need Money? We Lend! If you own your own home - you qualify. Pioneer Acceptance Corp. Member BBB. 1-877987-1420. www.pioneerwest.com PRIVATE FINANCING based on security not credit. 1st, 2nd, 3rd Mortgages, Equity Loans, Consolidation loans, Construction financing, Farm, Commercial, Industrial, Residential, Equipment, Creative Financing Call 1-888-742-2333 or info@mcokanagan.com REDUCE DEBT by up to 70% Avoid bankruptcy. Free consultation. BBB accredited. 250-860-1653 www.4pillars.ca

Coldstream area, 5min. ride to Vernon Riding Club, self, full board. Apr1 (250)558-0618 Horse boarding in Coldstream/ Lavington, 100x130 riding arena, Paddocks with/without Shelter, access to crown land Certified trainer on site. Call 250 545 1082 after 5:30 pm

SATURDAY RECEPTIONIST required at Vernon Dodge Jeep. Apply with resume in person to: Brian Westwell or email: bwestwell@vernondodge.com SUMMER EMPLOYMENT: First Aid Attendant, Waterfront Director & Senior Counselors needed for children’s summer camp, see www.camphurlburt.com “staff” for details. Closing date April 19th, 2010. TAXI DRIVER WANTED P/T in Armstrong. Own car an asset, but not necessary. e-mail resume to armstrong taxiservice@yahoo.ca or call Jess 250-558-8358 The Longhorn Pub is seeking experienced servers & bartenders. Must be able to work in a fast paced friendly atmosphere & available for a variety of shifts. Competitive wage & benefit package. Please apply in person to Eric 4513 25th Ave, Vernon. WE need P/T-F/T Stylist, 5yrs + experience + Clientele. Lets negotiate. Looking for enthusiasm drop off resume 3413 30th Ave. Vernon

Hospitality Looking for a retired or a semi-retired couple to work as relief managers 2 days/week for a small Vernon hotel. Prefer a motel/hotel mgnt background or similar experience. although we will train the right individuals. Call Ed 250-9389944.

Trades, Technical OKANAGAN ELECTRICAL contractor looking for journeyman electrician and apprentices with commercial and larger custom home experience. References must be able to comment on successful completion of above mentioned projects. Please fax resume to 250-7672275 or email ivelec@shaw.ca

Work Wanted Class 3 driver, clean abstract, experienced in dumptruck & overhead bin. 250-500-2700. DUMP RUNS, ODD JOBS, HOUSE & YARD CLEAN UP. Call Paul (250)550-4256 DUMP RUNS. YARD CLEAN UP. GENERAL LABOUR. Seniors Discount. Call Bhoy 250-308-2326. Full size pick up avail. $15/hr or by the job, anything anytime 7am-9pm 7days 250-558-0796 Handymen Services Home & Mechanical repairs (Appl & small engines) Window cleaning,painting, pressure washing, ODD jobs, dump runs. 250-550-9099. Mark’s Yard Maintenance Tree pruning, hedges, yard clean up, dump runs & tree removal. Call (250)307-0683 NEILS Handyman. Yard clean up, rubbish removal, carpets, appliances, bsmn’ts & garages cleaned out, dump runs, small painting jobs. Vernon & Armstrong 250-546-2997 PRUNING & ROTOTILLING Trees, hedges & yard clean up. Call Eric (250)306-3408 Tree Pruning / Tree Removal, $50 dump runs, odd jobs. Free estimates.(250)549-3767 Tree pruning/tree removal, yard cleanup, dumpruns. 250309-0975. Welding, repair & fabrication. Free estimates, Low rates, 20yrs exp. Downtown location. Call Dave (250)558-0774

Accounting/Tax/ Bookkeeping Experienced Bookkeeper, complete all reports & financial statements, Shoeboxes welcome. Can teach you Simply Accounting. (250)542-1306

SIMPLY ACCOUNTING ✶ Certified Consultant ✶

Quick books, Taxes, Personal & Corporate

250-307-6900

Countertops QUARTZ the best stone for countertop surfaces. 156 colors. 10yr guarantee. Complete kitchens or countertops only. We will not be undersold. Classic Countertops & Cabinets. (250)549-2875 REFACE Countertops. 1/2 the Cost of Replacing. Granite & Corian Designs. 470-2235.

Electrical ELECTRICIAN - Central and South Okanagan. Licensed, bonded, & insured. Available for renovation and new construction projects. Free Estimates. Seniors’ Discount. Art 250-486-7430

Fencing CEDAR FENCE PANELS, 1-800-838-6036 Armstrong FENCE POST Installation, Excavating, Trenching, and Brush Cleaning. Great rates. No transport fee. Call Ly at 250-308-5403.

Lawn & Garden ALLIUM LAWN CARE Spring Clean-ups & Lawn Maintenance. Experienced & Insured. Call Wesley @ 250-307-4933

Home Improvements NATURAL WOOD FLOORING FIR, HEMLOCK & PINE www.rouckbros.com Rouck Bros. Lumby, BC 1-800-960-3388

Appliances Excellent working Fridgidaire dryer, white, less than 1yr old, warrantied $150. 250-5424919.

Appliances

GE portable dishwasher, 1yr old, like new, asking $250. Fred 250-542-9878.

Buy, Rent, Sell! Landscaping

Landscaping

Animal Care Society

ADOPTION DAY SATURDAY 10 am to 1:30 pm at Crescent Falls Vet Hospital 2800 45th Avenue Meet our “Better Than Free” Kittens and Adult Cats Magoo, a graduate of the school of hard knocks, hasn’t let abandonment or eye surgery affect his sunny, loving nature. Now healthy, this young boy longs to make your acquaintance. Beautiful Maremma/Kangal and Akbash/Kangal puppies, guardian,predator control 1.shot/deworming. $300.-400. 250 547 6253. BOOSHAY’S TRAINING ACADEMY Novice obedience classes, all age & breeds welcome. New class April 8th. Enroll now, class fills fast. (250)558-5322 Cairn Terrier X Silkie Terrier pups, non-shed, healthy, happy, family raised, dewormed $350/ea. 250-547-2433. Chi hua hua, 1 male, $450, new litter March 20, orders accepted, (250)492-7775

Convenient IN TOWN Location • Delivery Available • FREE Onsite Loading

OWNERS: KEVIN & LORI WOURNELL

Pets Adorable Shih-tzu Cross puppies, family raised, $450 (250)542-3077, 250-309-7603

Help Wanted 4250212

• Topsoil • Bark Mulches • Decorative Rock • Flagstone • Landscape Supplies

#1 Choice, Washer & Dryer $250. Many other items. We also buy appliances. Wayne 250-549-6649 A1 Stacker laundry center $450. Guaranteed, other items avail, delivery avail. 250-5496042. Apt size fridge. $250 Dryer $100. Washer $150. Warrantied. Other items/delivery avail. 250-549-6042. Electric stove w/convection Inglis, white, works great. $250. 250-546-4089Armstrong Washer & dryer, in good condition, $275. 250-260-7047

Livestock

GOOD DEAL! Washer & Dryers, good cond, Starting at $100&up. (250)549-3781 Kenmore stacker $395. White fridge, stove & D/W, exc. cond. FRIDGE’S WANTED. 250-549-6649

Classifieds We’ve got you covered! 550-7900

Livestock

LIVESTOCK HAULING Reliable and committed Call Paul:

250-938-0868

Farm Services WOOD CHIPS HOG FUEL

Farm Services BARK MULCH / SHAVINGS HAY & STRAW SALES DAVID BEERSTRA TRUCKING 549-0324 547-6815 ANYTIME

BARK MULCH & CEDAR MULCH 10 TO 40 YARD LOADS

Authorized Dealer

250-542-8191

4620-23rd Street

www.vernonlandscape.com • Behind ICBC OFFICES, OFF SILVER STAR RD.

You’re already active... Why not make some extra money too? Consider being an independent news carrier for THE MORNING STAR. We currently have routes available in your neighbourhood.

EAST HILL RT 96 - Pottery Rd & 21 Ave. (AVAILABLE APRIL 2)

Moving & Storage FAMILY Movers. Moving? Anything, anywhere. Local and long distance throughout 2009. Packing service available, weekly trips to Vancouver, Alberta, full and partial loads. Cheapest rates in the valley. Free Estimates, 250493-2687

.<F@TJPMQ<><ODJIK<T >JPIO iÌÊ̅iÊvՏÊÛ>ÕiÊvœÀÊޜÕÀÊ `œ>ÀʅiÀiÊ>Ìʅœ“it /…ˆÃÊÞi>À]ÊÀi`ˆÃVœÛiÀÊ ÀˆÌˆÃ…Ê

œÕ“Lˆ>°

Painting & Decorating

Alternative Health

Rubbish Removal

Cattail Soapworks is offering all natural soap making classes. Call Cindy 250-832-6728

Antiques / Vintage Wedgwood royal homes of Britain $10. Lg English platter (Spartan) $50. Voyage of Ulysees $45ea. (250)545-0444

Landscaping

CAN’T GET a painter for those small projects? I love small painting projects! Call: 250-309-3178.

Marcel Mallette, Registered Acupuncturist. 7639 Silver Star Rd. Vernon 250-260-3892

Livestock 3 - 2 year old Bulls; 6 yearling bulls; 6 yearling Steer calves; 11 yearling Heifers; Cow Calf pairs - Call (250)992-2294 For sale 19 month old Katahdin Ram, red in color, $200. 250-546-6118, Herd of Hair Sheep, 1-Ram, 7Ewes, 10-Lambs, Must Sell! 250-545-5543. HORSE Disposal, Call Dave @ 250-309-0629 Miniature horses for sale (250)558-8088 TOO MUCH STUFF! Used tack sale - english & western. Bridles, blankets, pads and misc horse items. Simco western saddle - 15”, excellent shape. - $400 obo General purpose english saddle - 15”, excellent shape. (great starter package with stirrups, leathers, pad, girth & bridle) - $350 obo 8:30 am 11:30 pm Saturday March 20th. 1829 Pleasant Valley Rd, Armstrong

Pets cocker spaniel puppies, buff/white & black/white, born Jan. 21, first shots, vet checked, $550obo, (250)4995397, email for pics: 3winds@telus.net PUPPIES ONLY Yard Sale! Sat/Sun Mar 20/21. 4-adorable cross pups. First shots, bag of food, training mats. ACT FAST! 26 Louis Estates Rd Westside Rd. 250-542-3407 THE RUFF LIFE Professional Dog Training Lessons fit to your schedule! Basic - Advanced Training & Behaviour Modification Bring a friend and both receive $25 off. 250-550-0390 www.therufflife.ca TOO MUCH STUFF! Used tack sale - english & western. Bridles, blankets, pads and misc horse items. Simco western saddle - 15”, excellent shape. - $400 obo General purpose english saddle - 15”, excellent shape. (great starter package with stirrups, leathers, pad, girth & bridle) - $350 obo 8:30 am 11:30 pm Saturday March 20th. 1829 Pleasant Valley Rd, Armstrong Whoodles, (Soft coated, wheaton Terrier Cross small standard poodle), non-shedding, non-allergenic, family raised, intelligent & easy to train. Ready to go April 6th to good homes. Vet checked, 1st shots, $1000 (250)838-5500

Unique Garden Art & Gifts 907 Kal Lake Rd, Vernon 778-475-5752 Large selection of quality, specialty stepping stone & statuary. Custom coloring available. Also many decorative & gift ideas instore.

Will clean up your junk scrap iron, dead batteries, etc. Call us first, 250-546-2416, Russ.

Mountain Acupuncture & Laser Therapy

Feed & Hay EXCELLENT quality grass hay 70-75lb bales, $7/bale (250)838-6725 Good quality hay, alfalfa grass mix, square bales, barn stored. 250-542-9419, 250309-5956. *HAY SALES GUARANTEED Quality Grass, Alfalfa, Mixed square bales, round bales & Silage bales. Delivery avail. (250)804-6081,(250)833-6763.

Pets

250-808-0733 SKYHIGH DISPOSAL Full Service Junk Removal & Bin Rentals. ✔✔✔ THAT GUY & His Work Truck LTD. Junk Removal & Bin Rentals 10,15 & 20 yard Bins. We haul EVERYTHING Home or Jobsite, Renovations Cheapest rates in the Valley www.thatguysworktruck.com

Call 250-307-8998

Contact Donna at 250.550.7901 or email donna@vernonmorningstar.com

MorningStar

The

->ÛiÊ̅iÊiÝV…>˜}iÊ>˜`Ê̅iʏˆ˜iÕ«Ãt 9œÕ½ÊLiÊÃÕÀ«ÀˆÃi`ʅœÜʓÕV…Êv՘ÊޜÕÊV>˜Ê …>Ûiʈ˜ÊޜÕÀʜܘÊL>VŽÊÞ>À`°

œ“iÊۈÈÌʅÌÌ«\ÉÉÜÜÜ°}iÌ>Ü>ÞLV°Vœ“ÊvœÀÊ ˆ˜vœÀ“>̈œ˜Êœ˜Ê…œˆ`>ވ˜}Ê̅ÀœÕ}…œÕÌÊ ÀˆÌˆÃ…Ê œÕ“Lˆ>°


B28 Friday, March 19, 2010 - The Morning Star

www.vernonmorningstar.com

HOME MAINTENANCE / RENOVATIONS CONSTRUCTION

WINDOW CLEANING STREAKY - CLEAN

Spring Window Cleaning and eaves troughs. FREE ESTIMATES • CALL SCOTT

250-308-0689

Brighter Outlook

window cleaning Residential & Construction Deron Sanderson

250.306.2679

WINDOW CLEANERS • Residential • Commercial • Construction clean • Quality work • Water Stain Removal

Quality Work & Care for the Best Price!

RedTruck Renovations Your one stop home repair company

Custom bathrooms, cabinets, tile work, laminate, hardwood, doors and trim, basement suites, decks, sheds, play structures, general repairs Mike Muller Owner/Craftsman mullerm@shaw.ca cell: (250) 938-8133

home: (250) 275-6412

Journeyman, Licensed, Bonded Framing, Tile, Flooring, Bathroom, Decks, Custom Finishing, Window & Door Installs, Renos and Accenting, etc. Dana Ross 250-308-7540 DIY Consulting and Recommendations

Jalon Construction Journeyman Carpenter(1983) Jim Hiebert 250 306-9410

250-307-3760

Mark of Excellence • Full Renovations • Cert. Vinyl Deck Inst. • Elect./Plumb.• Painting & Home Design

Mark Usselman • 250.308.9384 M

Ron @ 250-309-0435 or 250-542-1419 nu_lookhomeworks@shaw.ca

• Concrete Repairs • Small Jobs • Finishing • Remodelling • Interior Renovations

* We specialize in insurance repair * Framing • Renovations Decorative Concrete • Concrete Repair Journeyman Carpenter Incorporated, Licensed, WCB, Insured, Quality Guaranteed

Call us ¿rst for all your home improvement needs!

HANDYMAN

HANDS

Len 250-260-6666

SIDING

HARDI-PLANK

Decks, Porches, Patios James Hardie Installer Window & Door Replacement E N T E R P R I S E S

Licensed, Insured, WCB, References

Jed - (250)-307-4774

Additions, Suites and Interiors “The Affordable Professional”

SOFFITS

GUTTERS

DECKING

RAILING

Affordable Home Repairs & Renovations

ON NOW!

Quality Work Guaranteed

L&R Home Improvements

• Bath Remodels • Decks • Drywall

• Kitchen • Basement Remodels Finishing • Painting • Tile Work • Plumbing • Much More Licensed, Bonded & Insured 250-545-3130

Independently Owned and Locally Operated

kelowna.handymanconnection.com Now serving all the North Okanagan including Armstrong, Enderby, Lumby, Falkland, Lavington, Coldstream, BX & Oyama

• Renovations • General Repairs • Paint • Tile • Laminate • Hardwood • Baseboard • Trim • Door & Window Repair• Sinks • Counter Tops • Cabinets • Blinds

Call Len (250)558-5038

STUCCO CARWAY STUCCO Stucco, Re-stucco & Repairs

25 + years Experience

Ph: 307-0387 CLEANING

PATIO COVER

EXPEREINCED CRAFTSMEN QUALITY WORKMANSHIP SERVICE YOU CAN TRUST

SPRING SPECIALS TIM 250-307-8772

FASCIA

COMPETITION EXTERIORS LTD (250) 542-5925

1-800-88-HAN DY

PROFESSIONAL MOVES LOCAL & LONG DISTANCE

558 -7914 or 307-1975

“Framing to Flooring”

Insured * References * Guaranteed

SENIORS DISCOUNT

Supplier & Instal Installer of Windows & Doors ~ 25 Years Experience

CLYDESDALE MOVING

Renovations * Repairs * Decks * Fences * Landscaping

TOM: 308-8778

*Renovations *Basement Development *Additions/Garages/Shops *Quality Woodwork & Trim/Millwork Installations

Residential & Commercial - Fully Insured & Licensed

Nu-Look Homeworks

PAINTING & RENOVATING Quality Since 1989 • Handyman Services • No Job Too Small

Lonestar Custom Carpentry

VERNON - LUMBY - ARMSTRONG - WINFIELD

MOVING

WHITESTONE

LTD.

Old World Craftsman Renovations & New Construction

• QUALITY • PRICE • SERVICE • EVERYTHING FROM FOUNDATION TO FINISH Concrete, Framing, Flooring - Tile & Hardwood, Painting, Finishing Excellent References Available Serving the North Okanagan Valley

Alex 250-307-1726

ARMSTRONG CONSTRUCTION Journeyman Carpenter • Renovations • Remodelling • New Construction

• Siding • Soffit

• General Carpentry • Aluminum Railings • New & Renovations • Vinyl Decking

GEORGE SIMMONS C: 250-309-0621 H: 250-838-0449 Fax: 250-838-0459

Kevin 250-308-9592

DECKING

ELECTRICAL SUPERIOR DECK LTD

3D

Cleaning Services * Quality Cleaning * Eco Friendly Products

Tannis Morrison (250) 558-8552 tannismorrison@gmail.com

ROOFING The Greenway Roofing Co. Roofing Consultant Torch on Specialist Fully Insured

250-309-0874

Laursen Electric Commercial Residential Service New Construction & Renovations Licenced, Bonded & Insured

Call Chris @ Vernon: 250 307-7173 Mabel Lake: 250 838-2242

ADAIR ELECTRIC LTD.

VINYL DECKING • ALUMINUM RAILING

Vernon Salmon Arm 250-550-4598

RENOS, RESIDENTIAL, COMMERCIAL

Kelowna Winfield 250-212-3075

Free Estimates/Emergency Service Bonded and Insured License #92048 BBB Member – Quality Work

Marcel Labrecque, 15124 Middle Bench Road Fax: 250-548-4045 Owner/Operator Oyama, B.C. V4V 2C4

BOB ADAIR 250-275-4780

TRAFFIC CONTROL You WILL be noticed and get MORE business in this directory CONTACT CLASSIFIED DEPARTMENT AT

250-550-7900

FLOORING AND TILE MOUNTRIDGE FLOORING & TILING • Tiling (walls & floors) • Hardwood & Laminate 16 years Installation experience For Free Estimate Call Chris CELL: 250.540.0025 / HOME: 250.542.6277 Top Quality Craftsmanship

• • • • • TRAFFIC CONTROL •

FRONTLINE Enderby, B.C.

250.309.3452

Certified TCP’s Arrowboards Shadow Vehicles Reasonable Rates Emergency Callouts Available 24/7

“We’re on the FRONTLINE for your Safety”


www.vernonmorningstar.com

Friday, March 19, 2010 - The Morning Star B29

PAINTING

PLUMBING

CRANE SERVICES

DARCYâ&#x20AC;&#x2122;S PLUMBING CCS

COLDSTREAM CRANE SERVICE LTD. s4RUCK-OUNTED#RANE s"UILDINGMATERIALSDELIVERY TRUSSLIFTS ROOlNGETC s'ENERALFREIGHT ,OCALLONG DISTANCEHAULING Competitive Rates Call Les for free estimates #ELL s&AX 

- Hot Water Tank Replacement (gas/electric) - Plugged Drains, Water Softeners - Kitchen/Bathroom Renovations - New Construction *CertiďŹ ed

309-7008

CONCRETE

DANâ&#x20AC;&#x2122;S PAINTING & REPAIRS RESIDENTIAL INTERIOR & EXTERIOR PAINTING RELIABLE - WORK GUARANTEED - CHEAPEST RATES IN TOWN - WCB INSURED

250-542-2599 250-540-3484

WHITESTONE W

PAINTING & RENOVATING P Quality Since 1989 â&#x20AC;˘ Handyman Services â&#x20AC;˘ No Job Too Small SENIORS DISCOUNT

WELDING

TOM: 308-8778

R.I.P.

Mudjacking & Underpinning Lift concrete slabs, sidewalks & driveways.

CALL ROCKY

WELDING FABRICATION

(250) 547-1481 or (250) 545-9522 Free Estimates!

SPECIALIZING IN ALUMINIUM & STAINLESS PRODUCTS & REPAIR

Tazzâ&#x20AC;&#x2122;s Concrete Call Kevin 250-308-8268 â&#x20AC;˘ Foundations â&#x20AC;˘ Concrete Floors â&#x20AC;˘ Sidewalks â&#x20AC;˘ Retaining Wall â&#x20AC;˘ Engineered Wall â&#x20AC;˘ Driveway â&#x20AC;˘ Suspended Slabs

DRYWALL

www.lenblower.com â&#x20AC;˘ len1066@shaw.ca

DAVIES DRYWALL

All Your Drywalling Needs

MASONRY

CUSTOM HOME DRYWALLER NEW OR RENO BOARD, TAPE & SPRAY CALL ALL KYLE 250-308-4663

Additions, Basements, Renovations, Steel Stud Framing, Drywalling, Taping, Dropped Ceilings Call Attila: 250-546-6282

VERNON â&#x20AC;&#x153;For All Your Masonry Needsâ&#x20AC;? Needsâ&#x20AC;? - new home - Brick, Cultured construction Stone,Glass Block - renovations - Over 20 years - repairs in Masonry - masonry BBQâ&#x20AC;&#x2122;s Business

You Belong

HERE! CONTACT THE CLASSIFIED DEPARTMENT

250-550-7900 ABBOTT CREEK

KNN CONTRACTING â&#x20AC;˘ â&#x20AC;˘ â&#x20AC;˘ â&#x20AC;˘

DITCHING SEPTIC LAND CLEARING DRAINAGE

www.knncontracting.com Kirk Forster 250-540-5595

Steve Bernhardt (250) 542-5300 Cell: (250) 938-2173

ACCOUNTING back filling rock walls general excavation landscaping preparation driveway prep Owner/Operator Gord Kennedy â&#x20AC;˘ Email: gordiek@telus.net â&#x20AC;˘ Cell: 250-308-7373

Joe Nessman

Corporate, Small Business, Mobile Accounting & Taxes

Business Management Consulting

1-877-546-2622

SERVICE Ltd.

250-260-6756

Specializing in Small Businesses

250-545-8294

JD 310 4X4 Extend A Hoe Driveway, Repair Cold Paving Drainage Systems General Excavating Labour & Truck Available

I CAN DIG IT RICK WARE EXCAVATING EXCAVATING â&#x20AC;˘ DECORATIVE ROCK PLACING â&#x20AC;˘ RETAINING & ROCK WALL BOBCAT SERVICE â&#x20AC;˘ LARGE & SMALL EXCAVATORS & DUMP TRUCKS

(250) 545-0218

Cell: 307-1959

Wendy Hesketh CertiďŹ ed General Accountant

INCOME TAXES PERSONAL CORPORATE

250-542-8485 vernonbcaccounting.com

Over 30 years trained experience

250-308-4380

Repaints our specialty! â&#x20AC;˘ Walls â&#x20AC;˘ Doors â&#x20AC;˘ Windows â&#x20AC;˘ Trim â&#x20AC;˘ Textured Ceilings Painted - Repaired or Retextured GET MY ESTIMATE OR PAY TOO MUCH! Free Estimates â&#x20AC;˘ www.timetopaint.com or

308-9783 549-5140

MOBILE PRESSURE WASHING

FOR ALL YOUR PRESSURE WASHING NEEDS

STONE & TILE INSTALLATIONS

Okanagan Stone & Tile

in business

Specializing S i li i g iin B Bathroom th & Kit Kitchen Renos & Exterior Work. No Job too Big or Small. Free Estimates. Excellent Rates.

Erik 250-545-9345 â&#x20AC;˘ eriklocke@telus.net skidsteer services shrub and brush removal

INCOME TAX SERVICE E-FILE

When you donâ&#x20AC;&#x2122;t want it just coloured...

Excavating, Rock Work â&#x20AC;˘ General Excavating & BackďŹ lling â&#x20AC;˘ Land Clearing & Interface Fire Guard â&#x20AC;˘ Excavating & Driveway Prep â&#x20AC;˘ Landscape & Waterscape Design â&#x20AC;˘ Rockwork & Tree Removal â&#x20AC;&#x153;FREE ESTIMATESâ&#x20AC;?

Certified Management Accountant

DL Decor & Painting

Ask for a quote (/4s#/,$s34%!-s'2!&&)4)2%-/6!, Ph: 250-308-7940 www.mobilepressurewash.ca

EXCAVATING

250-938-9566 25025 2 50 938 938-9566 9566

549-0115

SIMPLY CEILINGS AND WALLS

RESIDENTIAL & COMMERCIAL

( north end of Swan Lake)

Free tes a Estim

CREW WITH FREE ESTIMATES WORK GUARANTEED QUALITY RATES

â&#x20AC;&#x153;All Your Concrete Needsâ&#x20AC;?

8102 Highland Place, Vernon

250-260-3257

INTERIOR SPECIALIST

EARTHWORKS LTD.

Trucking, Excavating & Materials Joe Prebushewski Cell: (250) 550-6208 Fax: (250) 549-3899 â&#x20AC;˘ Email: bearpawearthworks@telus.net

ONLY 5 MONTHS LEFT! The Harmonized Sales Tax (HST) is scheduled to come into effect July 1, 2010. If you need renovations or other updates done to your home then call these trusted companies to

GET THEM DONE BEFORE HAVING TO PAY EXTRA!

WATER SYSTEMS

SIERRA WELL & PUMP 3rd Generation Pump Tech Reg.# WPI09093001

Rob Moore 250-546-9992

OKANAGAN WELL & PUMP SERVICE

Sales, service & installation

â&#x20AC;&#x153;Water When You Need Itâ&#x20AC;? Kelly Desjardins

250-550-5553

Tired Of Water Advisories? Install a ZERO WASTE REVERSE OSMOSIS SYSTEM in your home today, and never worry about your health again! Highly puriďŹ ed drinking water on demand. Unit installed under kitchen sink for easy access.

Middleton Repair Services 250-503-2252


B30 Friday, March 19, 2010 - The Morning Star

www.vernonmorningstar.com

LANDSCAPING EVERCARE LANDSCAPING • FRUIT TREE PRUNING • HEDGE & SHRUB TRIM & SHAPE • TREE REMOVAL • LAWN MOWING • CLEAN-UP & DUMP RUN

RESIDENTIAL & COMMERCIAL, STRATA

VERNON & AREA: 250-558-5342

DON’T SOIL YOURSELF, LET US DO IT FOR YOU!

WINDOWS & DOORS (250) 550-0170

SK 2/#+7!,,3

YARD

Simon Simo Si mon mo n

CLEANUPS LAWN & GARDEN CARE Serving Vernon & Area Since 1992

250-542-0964

Fruit Tree Pruning Complete Landscape Maintenance

• Design • Installation • Maintenance

LANDSCAPING Specializing in Decorative Curbing & All Your Other Landscaping Needs

558-3507

“Making Green Space YOUR Space”

www.outdooraspects.com

“For all your window and door needs GOVERNMENT GRANTS - WE CANwindow DO IT!” $70 per

Quality Professional Installations See us at our new location

Decorative i Rock Retaining Walls

NEW 2001 43rd St Vernon, B.C.V1T 6K7

TOPSOIL TOPSOIL

New Construction or Renovations KV Fairglass is the authorized dealer for Milgard Windows in the North Okanagan

Pure black, clean, cheap! Please call 250-306-0736

Call for your FREE QUOTE today!

250-803-8575

Odarata Lawn & Garden Care

*10% Discount for Seniors*

SPRING CLEAN-UP

Certified Horticulturist Garden Maintenance & Design

NOW BOOKING: De-thatching/Aerating Full Landscape Maintenace Programs Landscape/Irrigation/Design/Installations

(Glory of the Sun)

250-549-9388

Your Strata, Commercial & Residential Grounds Specialists

NAGY LANDSCAPING

Ask about MILGARD’S LIFETIME WARRANTY

BOOKING NOW:

De-thatching , Aerating , Brush Removal, Spring Cleanup, Complete Landscape Maintenance, New Landscapes.

Toll Free 1-800-661-8003 1044 Middleton Way, Vernon • 545-6096 • Fax (250) 545-1977

250-547-2429 • 250-306-9896

Down-to-Earth Gardening

250-549-4242

• STONE PAVING

QUESTIONS? CONTACT CLASSIFIEDS AT

250-550-7900 Auctions SAVE THOUSANDS!$$

Buy where the dealers buy & save

GIANT AUTO AUCTION Over 100 cars, trucks, RV’s, 4x4’s, & SUV’s Many Unreserved.

Saturdays at 11 am Call Auction World 250-765-5282

Garage Sales

Stone Paving & Landscaping • LANDSCAPE

Address list Recommendations & Irrigation, Turf, Planting, Excavating & Bobcat work Portofolio available CALL FOR ESTIMATE 250-542-8316 • 250-309-4539

Building Supplies

$$

EXTERIOR sidings: board & batten, channel, bevel, log cabin. Dry. T&G; fir, cedar & pine (1x4 1x6). Fencing; fir & cedar. Latice panels. Timbers & beams. Lumber for garden boxes, retaining walls, hobby wood. 1-800-838-6036 Armstrong.

Small Ads work! Garage Sales

Book & Garage Sale Saturday, March 20 • 8 am - 1 pm Taoist Tai Chi Hall, 3105 - 28th Street. Call 250-542-1822 for more information

GARAGE SALE DIRECTORY Starts Mar. 26, 2010

3 Lines or Less (Approx 10-15 Words) Include: Date, Time, Address

DEADLINE

2 PM Wednesday $

MAINTENANCE

• RETAINING WALLS Natural Stone, Keystone, Allan Block

15.00 + GST

$1.95 Per Extra Line Includes 2 Garage Sales Signs

DECORATIVE CONCRETE

LANDSCAPE &

Driveways, Pathways, Patios, Swimming Pools

BUSINESS DIRECTORY

• Installations • Wood windows • Vinyl - Fiberglass - Aluminum • All milgard windows c/w Suncoat Lowe Glass • Free Estimates … 2 to 3 Week Delivery

Booking now: • De-thatching • Aerating • Pruning • Spring Clean-up

250-549-4587

octo-landscape.com

- Decorative Concrete Specialists - Acid Staining - Concrete Engraving - Repairs, Toppings & more!

BUSINESS DIRECTORY

www.PinnacleConcrete.ca

CONTACT

(250)938-3166

QUESTIONS?

250 550 7900 250-550-7900

Farm Equipment

Firewood/Fuel

Furniture

Medical Supplies

Misc. for Sale

1960’s Massey Ferguson, 35hp tractor, good cond, $2800 OBO, 60” Pride mower deck, used once, New $1400, Sell $1000, (250)558-0618

Dry fir & pine mix firewood, $240/cord. Delivered. (250)549-0537, 250-542-4116 FIREWOOD Pine for sale. Drycut & Split to 16” length. Shortbox p/u $70, Longbox p/u $85. We load. You haul. call (250)545-6461 FIREWOOD Special, Approx 2 cords, fir/pine mix $325. Fir $350, Birch $375. Delivery Available. (250)260-7932 Wanted to buy logs from private person w/acreage, prefer bigger jackpine & some cedar. (250)801-5776

Moving: queen size boxspring & mattress, chesterfield & love seat, 3 dressers, 2 night tables, 3 end tables, book cases, tools, lots of plants & case lot sale. 250-260-6118 NEW 3-pc Sectional Sofa w/ottoman, In orig. pkg. Worth $1499, Must Sell $899 250550-6647 can deliver QUEEN pillowtop mattress, box. Brand New! MFR warranty. Worth $1100, sell $390 250-550-6647 QUEEN size memory foam mattress. Brand New! Retail $1400 sell $495 250-550-6647 Table w/6-chairs, buffet hutch incl. cinnamon oak color, $1000. 250-306-2615. Twin size captain bed w/bookshelf/headboard, Sealy mattress, ex/cond $300 (250)5463953

Patriot wheel chair $500. Hugo walker, blue, good cond $150. Call (250)542-1933

Garden Equipment

PENGUIN MFG 306-5706

Almond stove $35. Reg sz.metal B.ball stand $75. Xlong dbl. mattress $50. 250503-0781 BRAND new 5 stage reverse osmosis water filtration system. Retail price: $795. Now: $250. Call 250-863-1544 CLASSIC COUNTERTOPS & CABINETS Quality cabinets at factory direct prices. 250-549-2875. Countertop 2 barrel ice cap machine, hot cappuccino machine, & microwave, perfect fry self contained countertop deep fryer. Call for details & prices, 250-306-9909 DO YOU NEED LARGE AMOUNTS OF FREE FILL? no trucking charge 250-307-3839 Dacron Enterprises LTD. Electric frying pan, like new, $30. (250)545-1200 Electrolux 2100 delux power head, hose & tools. $200 obo. 250-549-3352 Exc.cond. New hose. Exquisite Designer grad dress! Pink w/embroidered bodice, lace over stain skirt, crinoline, size 7-9, $295. 250307-2227 Fisher Price Dora talking tricycle. great cond $30 (250)260-8997 GLASS top coffee & end tables, $100, picture window w/sliders, 831/4”x 591/4” $100 (250)549-7003

1961 John Deere 1010 gas utility tractor. Restored. 37 HP, P/S, deluxe seat, 22hrs on rebuilt engine. Comes w/3 PT. rearblade + John Deere mower & chains $9800. Email pics avail phone: 250-494-5051 KUBOTA B7000 tractor, diesel, 17 HP, 4WD, front-end loader, 3PH, excellent for small farm, $5000 OBO, 250-503-8903 Massey 110 Manure spreader. Gandy fertilizer spreader. 12’ Tandem disc. 13’ chain harrows. Round bale feeders. High tent style fence wire in spools. Best offers. 250-5472158.

Furniture

Apples 0.39¢/lb. All varieties. PLEASANT VALLEY FRUIT.

6PC Cherry sleigh bdrm set. Queen bed, dresser, mirror, chest, 2 night stands. New!! Still boxed. Worth $5000, Sell $1295 Can deliver. call 1- 250550-6648, 250-550-6647 cabinet, french provincial style (previous stereo) H28”L50”W18”. Great cond. $50. 250-558-4932. HOTEL BED clearance. Over 75 sold. 1 Floor Left 25 Queen size beds - $100+. Super 8 Vernon - 4204 32nd Vernon, BC (250) 542-4434. KING size pillowtop boxspring & mattress. Brand New! Worth $1300,sell $495 250-550-6647 MAHOGANY DINING room set, like new, China cabinet, table (2 leaves), 6 chairs (2 armed), $350, 250-503-8903.

Misc. for Sale

Misc. for Sale

Milking machine/ bucket, paid $1300, make offers. MF Tractor, 165, 55hp, ezee-on, post pounder 114. 250-547-6747. Rototiller, 8’ Maschio, like new Asking $8000. Large quantity’s of galvanized table 1/4” on spools, & PVC 1 1/4” irrigation pipe, & Senninger PVC sprinklers on 24” risers. 250-558-0192. 250-308-2865.

Fruit & Vegetables

BARK MULCH

FIR

OR

CEDAR

- Regular & Screened Sizes -

Shavings & Sawdust 10 to 150 yard loads REIMER’S FARM SERVICES

250-260-0110

Minnie Tiller 2hp $150. Free p/up dead lawn/garden tractors. 250-260-5819

Heavy Duty Machinery 1988 Ford Louisville tandem axle dump truck, 240hp, certified $10,500. 250-558-8400 2003 EX 200 LC c/w Q/A & new cleanout bucket, 3200hrs, very clean machine $69,500 obo. Len 250-550-4100. Hitachi EX150 excavator, thumb, 2-buckets, rake. $31,500. 1989 Case 4x4 4n1 ext.hoe, $23,500. 250-2600217.

Medical Supplies Evergo portable oxygen concentrator $4000 obo. Invacare home oxygen concentrator $700 obo. Easy Pulse 5 oxygen conserving device regulator $500 obo. 250-549-4564. HealthCraft wall mounted fold up support rail for toilet transfers $100. Commode Chair $50. Keith (250)549-6520 LIKE NEW MUST SELL electric wh chairs, assist poles, walkers, hospital bed, power lift recliners, transfer chairs, etc 250-546-8047

SuperPole floor to ceiling support pole c/w grab bar adjusts 93” to 120” $200. Under mattress grab rails white (2) $50 each. Keith (250)549-6520 Ultramatic electric adjustable single bed c/w remote control & massage $700. Shoprider scooter model 889, burgundy, batteries, charger, shade canopy, like new $1800. Keith 250-549-6520

Misc. for Sale HOT TUB COVERS - Custom fit to any tub - We measure your tub & deliver at no charge - We have cover lifters

2006 Beachcomber 6-person hottub, loaded, lights, insulation pkg, like new. $9000 new, Asking $4800. 250-549-6005. 2 outfits sz. 18 & 14, almost new, 18 & 16 Beige $25 obo. 2 almost new cardigans w/camasoles green & blues sz.L $20. Western style top almost new, plaid sz. XL $25. Cotton/acrylic sweater, cream colored $20 obo. 3 shorts, navy blue, Sz.L $5. Purple lilac jckt Sz.L almost new $23. Blue shirt almost new sz.18XL $20 obo. Tank tops, fuchsia sz.XL green sz.L, light blue Sz.L, $5. T-shirts light blue $10 almost new, gray tshirts Sz.L $5. Jeans sz.38 L34” inseam $15. 6n1 light blue jacket alpine Sz.XL worn once $116 obo. Green grad dress Sz.16 incl. green shoes Sz.10, Gerdel Sz.B38 $150-$300. Occupational 1st aide book level 1 training $25. 250-549-4834. 4 Galv racks (breadracks) 2’xWx6’L on castors $300ea. 1 Bunrounder div by Eberhardt, heavy duty $1700 250-4941299 after 5pm 8pce, High quality Dinner Set. w/platters, bowls etc. cost $2500, sell $300 (250)2606002

HOT TUB (SPA) COVERS. Best price. Best quality. All shapes & colours available. 1-866-652-6837 www.thecoverguy.com

KUBOTA B7000 TRACTOR, 4WD, 17 HP diesel, 3PH, front-end loader, excellent for small farm, $5000 OBO 250-503-8903 Like new Commerical Ice Cream freezer, 6 tubs up/4 down, sneeze guard/winter “table top,” 11.18 cubic ft/. 39wx25dx36h, 4.1 amp rating. $900 obo. Call Jeff 250-5456272. Email:crackedpotcoffee@shawbiz.ca Maple table 40” round & 4 chairs $150. Microwave cart $25. Large pet carrier $75. 250-549-3861 Top of the line vacuum cleaner. 250-545-9149.


www.vernonmorningstar.com

Friday, March 19, 2010 - The Morning Star B31

Misc. for Sale

Garage Sales

Apt/Condos for Sale

Moving sale! Furniture, garden tools, gas bbq. Items from $10-$400. 250-549-3146. New corner jetted tub, retails $1250, 1st reasonable offer, you take it. 250-558-1668. Pool table, 4x8 non slate, over 40yrs old, good shape, c/w wall rack, cover, balls, plus other accessories $500. 250547-9374, 250-309-1732 cell. Simply Baskets Home & Gift

ARMSTRONG: 1260 Otter Lake X Rd., Moving Sale, Sat Mar.20, 9am-3pm. BX: 5620 Neil Rd. Sat & Sun 8am-4pm. Big downsizing sale! Follow signs to Falcon Nest Lodge. COLDSTREAM: 1003 Kal Lake Rd, Mon-Thurs, Mar.22-25, 9:30am-1:30pm. Custom Blinds, various sizes. Coldstream: 11601 Kal Lake Rd. Fri & Sat 10-2. tv’s, books, clothes, fish tank, dishes, etc. Coldstream: 493 Terrace Dr. Sat & Sun, 8:30-1pm. Downsizing: Shop tools, lawn furniture, something for everyone! COLDSTREAM: 9409 Shumanski Drive, Sat. Mar 20, 9am-1pm. MOVING SALE! Furniture, garden tools, large chest freezer, lots misc items! ENDERBY: 147 Glenmary Rd, Sat. March 20, 9am-3pm. Moving Sale! Furniture & misc OK Landing: 6251 Chukar Rd, Sat/Sun Mar. 20/21, 8am-2pm. BRADY BUNCH GARAGE SALE!! Two of everything. Garden tools, dressers, TV, gym, full kitchen stuff + + + ! TOO MUCH STUFF! Used tack sale - english & western. Bridles, blankets, pads and misc horse items. Simco western saddle - 15”, excellent shape. - $400 obo General purpose english saddle - 15”, excellent shape. (great starter package with stirrups, leathers, pad, girth & bridle) - $350 obo 8:30 am 11:30 pm Saturday March 20th. 1829 Pleasant Valley Rd, Armstrong VERNON: 3002 38th Street, Fri/Sat March 19/20, 9am4pm. Rocking chair, table & chairs, old sewing machine, dishes, tools, garden tools, DVD & VHS, & misc items. Vernon: 3402-24A Ave, too many items to list. From tools to belly boats. Don’t miss it! Sat, & Sun 8am-5pm.

REDUCED For quick possession 1215sf., 2Bd., 2Ba., new appl’s., close to all services, sec. u/g prkng., smoke-free, 50+, $179,900. 250-765-4423

“A Country Primitive Home Store”

3414 Coldstream Ave, Vernon 250-545-4474 wwwsimplybasketsvernonbc.com

*STARCHOICE* Satellite T.V. Sales, installations & accessories. For best prices and service. Call 250-545-0012. **STORAGE: Boats and RVs any size. Seasonal and household goods. Elephant Storage Centre. Safe, affordable storage. 6136-Okanagan Avenue. 250-549-2255. Wood pallets, approx.100, 40x48 heavy duty, $15/ea obo. 250-558-1668.

Misc. Wanted LOOKING FOR new or gently used dbl bed w/ box spring, prefer if still in plastic and reasonably priced. 250-546-3774 Wanted, Fisher Baby Bear wood heater, used upright or chest freezer for non-domestic storage. 250-542-8520. Wanted to buy logs from private person w/acreage, prefer bigger jackpine & some cedar. (250)801-5776

Musical Instruments Mandolin ideal for beginner $150. original Fender Amp, older model +speakers & tubes, 8 outlets, 135amp, P.A. System price negot within reason. PA system, 250-3068068. Piano for sale $500. 250-5421702.

Sporting Goods RUSSIAN SKS’’s - top choice, cleaned, oiled & inspected, from $299. Ammo - 1120 RDS-Case $195. 12 ga shotgun ammo & clay targets $99. Quality Firearms bought & sold. GLOCKs + accessories stocking dealer. Weber & Markin Gunsmiths. 4-1691 Powick Rd, Kelowna, (250)762-7575

Garage Sales FRATERNAL ORDER OF EAGLES SUNDAY BREAKFAST & FLEA MARKET 5101 - 25TH Ave. EVERY SUNDAY 8 am - 12 pm CALL 250-542-3003 6859 BUCHANAN ROAD (Lavington)- Garage sale with toys, household items, furniture and more! 8am till 1pmearly birds encouraged! Alexis Park: 3780-38th St., Records, collectables, furniture. Multi-family. Sat, Mar.20.9am-1pm.

Open Houses 4265428

Acreage for Sale 8 ACRES near Enderby/Salmon Arm with: pasture, hayfield, 5 bdrm. house - 1840 s.f. on main floor & 1800 s.f. daylight basement, wrap around deck, attached double garage, barn/shop, good well & fruit trees. $499,000. For info: 250838-6151 READY to build on this 3 acres in Whitevale area, Lumby. Flat, few trees, drilled well. Gas/hydro to driveway. Price $245,000 GST.obo. 250-5476932. SHUSWAP RIVER FRONT 11.3 acres w/shop $400,000. 1985 house on 22.5 acres $799,000. 15.9 acres $400,000. Water and services. 250-838-7660.

Business for Sale RESTAURANT, possible sports bar, licensed, 80 seater, downtown Salmon Arm, close to wharf, will trade or carry finance $95,000. (1-250)6753790

For Sale By Owner 3bdrm, 1.5bath rancher, 14.01ac. lg barn, out bldg’s, 1277 Mountain View Rd. Armstrong, $843,000. Below assessment. Townhouse. Spacious 3bd, 2bath, no strata, priv.yard, deck, hottub, carport, shed. 1908 42nd St. $215,000. 250-549-1276. WESTBANK Affordable Dbl. wd., well maint., many updates, 1000’, treed prk, all appl., $55,000. 250-707-3272

Houses For Sale

Houses For Sale

WHAT’S MY HOME WORTH? Free, quick over the

net home evaluations.

www.OkanaganHomeEvaluations.com Salt Team, Re/Max Vernon 250-549-7258

FIRST TIME BUYERS

Why rent when you can own? Free list of homes for under $1000/month (+ 5% down) www.VernonFirstTimers.com 250-549-7258

BANK FORECLOSURES Receive a free computerized list with pictures of distressed & foreclosure properties.

www.DistressedVernonHomes.com

Apt/Condos for Sale

www.OkanaganForeclosures.com

Purchase your vacation property before new mortgage rules take affect April 19,2010. Creekside unit 109 at Shooting Star. Two bedroom, two bath condo, fully furnished. Ski-in unit, 840 square feet. New carpet, gas, cable included. $320,000 OBO. Call 250-5494008.

250-549-7258 ******* OKHomeseller.com Where smart sellers meet smart buyers! View Thompson Okanagan properties for sale.// Selling? No Commission. (250) 545-2383 or 1-877-291-7576

Open Houses

Open Houses

Salt Team, Re/Max Vernon

16’x66’ SRI mobile home purchased new July 2008. 2bdrm, 2full bath, heat pump w/AC, 2 steps, vinyl skirting. Immaculate. Must be moved. Taking offers. 250-517-0543. 1980 Moduline 14x66 + extras $72,000. #110 Silver Star RV Park. Phone (250)545-7633

For Sale By Owner

Call now to book your free C.M.A.

2bdrm modular home in Armstrong, BC features large lease lot, privacy, exc. access, $129,500. Call Vern at Re/max Enderby 888-609-7764 or cell: 250-308-2110 FOR SALE OR RENT: 2/3 bdrm, 2 bath mobile, additions /lg deck /workshop /OK lake view & access/ 5 min to golf course/renovated. Must be seen. $112,000 or $750/mth ph. 250-547-8796 Lovely corner lot in 55+ mobile park in town, Enderby BC. To view: okhomeseller.com listing #26277. Call Doug or Rita 250-838-7574

“Bringing People and Lifestyles Together.” Mike Sandstra Century 21 Executives Realty Ltd. 250-307-7318

Open Houses 4260605

For More Info

EXECUTIVES REALTY LTD.

Open Houses

389,900

$

778-475-2212

Cozy 4 bdrm. energy ef¿cient home in rural Coldstream. Newer doors, windows and roof. All appl. incl. Loads of RV parking, fenced 1/3 acre. Carport and separate garage. Hot tub. Quad with snowplow neg.

Open House

Sunday March 21st 1-3pm 6866 Learmouth Rd.

(East on Hwy 6, Turn right on Learmouth Rd., before Kenkraft on Hwy 6, 4th House on Right)

Open Houses

REALESTATEReview

BANK ON US! Mortgages for purchases, renos, debt consolidation, foreclosure. Bank rates. Many alternative lending programs. Let Dave Fitzpatrick simplify the process. Mountain City Mortgage.1-888-711-8818 dave@mountaincitymortgage.ca

Real Estate An Okanagan RENT TO OWN company seeking Investors and Tenants for secured investment. Homes available Now. Call NOW 1-888-4977008 for more info.

Classifieds = Results! Revenue Property

Classifieds We’ve got you covered! 550-7900

LIVE/WORK/PLAY mid Vancouver Island. 12 unit char apartment building for sale in Port Alberni www.avrilarts.ca

Houses For Sale

Houses For Sale

OPEN HOUSE

Sunday, March 21

1:00-4:00 pm

5806 L&A Road, Vernon

5 bdrm/2 bath, 2386 sq. ft. Completely renovated inside and out. Beautiful backyard with playhouse, shed and garden. Great views and lots of parking.

$389,000

250-308-7448 or 250-212-0848

OPEN HOUSE SUN 1-4PM 947 Mt Beavan Place

• Personal Service • Expert Advice • Referrals Welcome

DISTRESS SALES

FREE computerized printout of foreclosure properties

Mortgages

www.countrysidemanufacturedhomes.com

Thinking of selling your home?

CALL PAULA 778-475-1555

CALL PAULA 778-475-1555

HOME & LOT PACKAGES AVAILABLE

Mobile Homes & Parks

4269334 OPEN HOUSE: Lake Country, Mar.20P/21, 12-5pm, 1000sqft main floor, 1000sqft in-law suite, 28x30 sep. garage, on oversized lot, $415K, 10059 Kelwin Rd. Lake Country. (250)766-9243, 250-212-3182

3 bedroom, newly renovated $4,000 down, $1400/mo

Close to downtown, Recently updated $10,000 down, $1200/mo

Mobile Homes & Parks 4252217

250-558-0872

RENT TO OWN TOWNHOME

RENT TO OWN 1/2 DUPLEX

LUMBY: 3 view lots on new subdivision (Schunter Drive) Lot 2: $115,000 + GST. Lot 3: $120,000 + GST. Lot 4: $125,000 + GST. Call Mike 250-547-9402, 250-309-1042

Affordable 55+ Community in Enderby, BC features large late model homes, low taxes, close to shopping & recreation RV prkg. For information call (250)838-0025, 250-308-6703

For Sale By Owner 250-558-0373 www.PropertyGuys.com

Lots

Salt Team, Re/Max Vernon

Houses For Sale DISTRESS SALE

Shuswap Lake Estates Golf Course - 4bdrm, 3bath, clean home on 12th fairway. Asking $480,000. 250-241-2556

Open Houses

Exceptional custom built family home. Must see inside! On a quiet, level cul de sac on Middleton Mtn. Gleaming hardwood Àoors, open concept kitchen, games/media room, kingsize master bdrm, A/C, B/I Vac. Fully landscaped yard w/ auto irrigation. Close to park & Kal Lake. 250-309-1867 $

497,000

WANT TOP DOLLAR FOR YOUR PROPERTY? sales associates average more experience and more sales per agent than their Competitors. There is no substitute for experience. Why not call a top negotiator today at Vernon 549-4161; Armstrong 546-3119; Lumby 547-9266; Enderby 838-0025 (Not intended To Solicit Properties Currently Listed For Sale)

Open Houses

Open Houses

OPENHOUSES WEEK-END DRIVE

CITY 3504 - 24A Avenue Sunday, 1:00-4:00, $312,000

FOOTHILLS 1417 Copper Mountain Court Sunday, 1:00-3:00, $639,000

NORTH BX 5235 MacDonald Road Sunday, 12:30-1:30, $330,000

THE MARA 4205 - 27TH Street Sunday, Starting @ 1:00, Starting @ $239,900

#43 - 844 Hwy 97A Sunday, 1:30-3:30, $149,900

#12 - 401 Browne Road Sunday, 1:45-3:30, $319,000

1404 Copper Mountain Court Sunday, 1:00-4:00, $399,900

BELLA VISTA #119 - 3020 Allenby Way Sunday, 1:00-4:00, $239,900

COLDSTREAM 1034 Mt. Ida Drive Sunday, 1:00-3:00, $569,000

LAKE COUNTRY 13075 Lakehill Drive Everyday, 12:00-4:00, Starting @ $379,900

OKANAGAN LANDING 6468 OK Landing Road Mon-Fri 12:00-5:30, Sat & Sun, 1:00-5:00, Starting @ $349,000

WESTSIDE 6808 Westside Road, Fintry Sunday, 12:00-4:00

7081 Appaloosa Way Sunday, 1:00-3:00, $589,000

566 Mt. Ida Drive Sunday, 1:00-3:00, $579,000

3048 Dunsmuir Road Sunday, 1:00-3:00, $385,900

DESERT COVE 651 - 6TH Street Sunday, 1:00-3:00, $319,900

BX 7537 Redrock Road Sunday, 1:00-4:00, $649,000

FOOTHILLS 1320 Phoenix Drive Sunday, 2:00-4:00, $599,900

MIDDLETON MOUNTAIN 898 Mt. Bulman Place Sunday, 1:00-4:00, $578,800

CORRECTION NOTICE In the March 14TH edition of the Open House Drive there was a price error on the listing for 6468 Okanagan Landing Road. The correct price is Starting @ $349,000

#4 - 992 Mt. Ida Drive Sunday, 1:00-3:00, $374,000

7922 Okanagan Landing Road Sunday, 1:00-4:00, Starting @ $369,900

530 Mt. Tanner Sunday, 1:00-3:00, $599,900

#2 - 6600 Okanagan Avenue Sunday, 1:00-4:00, $359,900

D

ARMSTRONG 1645 Simons Road Sunday, 1:00-3:00, $409,000

E RIV

SAFE!!!


B32 Friday, March 19, 2010 - The Morning Star

www.vernonmorningstar.com

Townhouses

Apt/Condo for Rent

Apt/Condo for Rent

2bdrm, 2bath, 7appl, single garage, centrally located, walk to Kin beach, pet friendly, no age restriction, large yard. $327,000. 250-503-1488.

Valleyview Apartments

CALL ABOUT OUR “RENT INCENTIVES” 1bdrm & bachelor, SENIORS spacious, very clean and well maintained buildings. Centrally located, close to downtown Safeway & Schubert Centre; n/s; n/p; available immediately, Century/Embers/Arlington 250-275-8066 Call for rent incentives! Large 1bdrm, $740. 1bdrm +den $790. F/S, DW, AC, balcony, NP/NS, clean, centrally located, on-site managers, quiet building, (250)5455773, 250-550-0243 EAST Hill/Lakeview Manor Bachelor suite, hardwood floors, onsite laundry, n/s, n/p, Avail April 1, util incl. (250)260-5870 ENDERBY 1 & 2bdrm apartment, N/S, N/P $600/mo & up, laundry avail. 250-308-9299 Fabulous Silver Star cozy 2bdrm, beautifully furnished, new TV. www.salbsilverstar.com 416-702-1298. avail April- Dec Low monthly rate, util/incl. LARGE 1bdrm ground level entry suite, mature adults pref. $695/mo. incl/gas/electric. n/p, avail. April 1. (250)545-6833 LARGE 2bdrm apt. $850/mo. +hydro, NO PETS, Avail. Now. 250-869-9788 Maple Ridge Gardens. Luxury Living. 1801 32 St. Fully renovated deluxe 2BR, 2Bath, very spacious, Private sundeck, gas f/p, Guest suite & rec room, Secure adult bldg. $1050 incl heat. 250-542-5659 Maple Ridge Gardens Luxury Living 1801- 32nd St. Deluxe 2bdrm, 2bath, spacious 1000sq.ft plus large private balcony, w/city views, gas fireplace, oak cabinets, luxurious, secure adult building, Guest suite, rec. rooms, underground parking, ns, np, $1050/mo. (250)308-9402 Midway Silver Star & Vernon, quiet location, bachelor suite, priv.entrance, util/parking, NS/NP, $450. 250-542-8553. NEW 2bdrm 2bath, avail. Imm. A/C. S/S appl. Laundry avail. NP. $1050 & up 780-278-4140 RICKFORD Manor. Call about rent incentive. 1bdrm apt. utilities extra, ns, np, adult bldg. 250-545-1412 Studio condo at Silver Star, furnished, avail Imm, monthly or long-term lease, all util/incl. 250-558-1870.

Apt/Condo for Rent

Long Term Tenant preferred for centrally located apartment

available immediately. immediately. Top floor of

Mountainview with 2 bdrms, balcony, bright, elevator, A/C, nicely updated. $

1,000/mo; Beth 250-558-4904

MORRIS MANOR Spacious 1 bedroom suite. 2 bedroom corner suite. Senior oriented building, downtown across from Schubert Centre. Heat included. For more information call

250-542-8989 2 bdrm, 2 bath Condo for rent available immediately. Near Vernon Golf Course and Kal Lake, 2 parking stalls, washer and dryer in unit. $1050 + utilities

250-308-9601

Scenic Setting PICTURESQUE spectacular sunsets, garden walking Cozy 1 bedroom distance to all amenities. apartment, conveniently 1 bdrm garden apt. located & freshly painted, management. N/PExcellent $520/mo. Avail. Aug. 1

542-5202 610. NP. 250-542-7723

$

The CLIFFS

AVAILABLE IMMEDIATELY 2 bdrm / 2 bath suite, $ /mo view towards lake ..... AVAILABLE APRIL 1ST 2 bedroom suite, $ /mo view towards lake ..... 2 bedroom suite, $ /mo view towards lake ......... F/S, W/D, D/W, A/C, plus heat, hot water and hydro all included. Great quality living in a clean and spacious secure building. N/S, N/P. Good building for Seniors! On-site Resident Manager. REFERENCES REQUIRED SERIOUS INQUIRIES ONLY PLEASE

1000 1000 980

250-542-1701

Discover the Secret!

Hawthorn Lane Renovated town homes with private courtyard — enjoy air conditioning and large deck, located in a convenient location right in the heart of Vernon. Affordable living. 2 bdrm … $825 per month 3 bdrm … $925 per month To view, please call:

250-503-1257 A New Tradition of Quality Living

1604 - 31st Street

✔ 40+ ✔ 1, 2 Bedroom & Bachelor Suite ✔ Incl: Heat, Water, Elevator, Parking, Coin Laundry No Smoking / No Pets

Move In Incentive

250-558-9696 BRENTWOOD APARTMENTS

1 &2 bedroom apartments … in quiet Senior-oriented building. Large deck, air conditioning, laundry facilities on each floor. Heat included. Close to bus stop, Schubert Centre and downtown. N/P To view, call

250-545-0962 or 250-503-7977

ALEXIS PARK MANOR • Bright 1 and 2 bdrms. • Renovated, Spacious, Air Conditioned Suites • Adult Oriented • Close to Bus • Park-like Settings • Clean, Well-Managed Building

250-549-2770 1, 2 bdrm & 3 bdrm $650$800. No dogs, no drugs. (250)260-1630 1 & 2bdrm, recently renovated, close to downtown, $800 & $850, 250-307-7117 1-bdrm, close to rec centre $600/mo, also 2-bdrm bsmt suite, $750/mo both n/p, n/s, (250)545-8443, 250-307-4948 1bdrm condo, Vernon, close to downtown, $675/mo. (250)838-6904 2bdrm, 1bath, balcony, central loc., small pet ok. n/s. $900/mo. April 1. 250-5450529, 250-308-8878 2BDRM, 1bath condo, nicely finished, f/s, w/d, a/c, avail. April 1. $850/mo. n/s, n/p. 250-503-6002. 2BDRM, 1bath, F/S, A/C, NS, onsite laundry, close to amenities, R.R. small pet okay, $750-$850/mo 250681-1848, 250-306-8252, 250545-8252 8am-8pm ADULTS 55+ 2bdrm central, $750/mo. RR. 250-558-8261 Avail April 1. 2bdrm, large, top floor, cable incl. AC, quiet, secure, mature, adult only. $750/mo 250-545-8985. Bachelor, 1 & 2-bdrm, adult building, F/S, N/P, near Schubert, heat & hot water incl, $475-$750 250-260-8454. Brand new, 2bdrm, downtown Vernon, $1250/mo incl all appli, AC, W/D, Secured heated U/G Parking. Call Mel 604936-8513, 778-772-4919.

Bed & Breakfast BED AND Breakfasts, Attractions, tourism operators get incredible exposure for your business…Advertise in the 2010-2011 BC Alberta Bed & Breakfast directory. Call Annemarie at 1-800-661-6335 ext. 744

Commercial/ Industrial

Mobile Homes & Pads

300-450SF ideal for retail/ 1-2pers office/hair salon, $14./SF + shared CAM/UTIL. Avail. immed. 250-306-5125 FOR LEASE 2400sq’, 690 McCurdy Rd, avail May 1. Rick 250-770-0903. FREE RENT! 2 months free rent w/signing of 3yr rental lease. UP to 4000sq.ft. high exposure retail/commercial space. 250-558-1166 Office space available for RMT or other natural health practitioner. Part time space, shared reception with RMT & ND’s, brand new building. Call 250-306-1401 Retail commercial office space approx. 1544sqft in busy Spallumcheen Industrial park, avail. immed. rate neg. 250-549-0141 Retail/Comm, high exposure, in busy retail area. Avail immed, rate neg. 1m3500sq.ft., Vernon. 1-250-7177488. Shop for rent 1250 sq ft. Roll up door, gas heat Comes with or without paint booth. Lots of parking $900 per month, utilities Call 250 549-4500 WAREHOUSE, office, shop, retail, wholesale, very good rate. 1-250-314-7225, 250550-4178.

In Lumby, In Valmarie, 3bdrm, F/S, W/D, gas heat, NP, April 1, $800/mo. 250-503-7044. Vernon, 3bdrm, F/S, WD, gas heat, avail imm, $850/mo. NP. Tom 250-503-7044.

Duplex / 4 Plex 2BD lower unit. Spacious, laundry in unit, clean, close to school, $850.00 plus util. Call Sean @ 250-306-0959 or view at www.arttales.ca. 2bdrm by Hospital, newly reno’d, new carpet, beautiful kitchen, front/back yard, w/d hook up, $850 +util. 250-5497442 2BDRM suite in 4plex, level entry, newly reno’d, close to Multiplex. W/D, F/S, N/S, N/P. Avail. April 15. $900/mo. +util. 250-545-4461 250-503-7296 2bdrm, walk to town, no dogs, cat ok, $925 util/incl. 250-5424310, 250-308-9028. 3bdrm duplex, W/D, F/S, $1050/mo. 250-550-4100 Len. EAST Hill, adult oriented, complete reno, 5 appl, 3bdrm, approx. 1600sqft on 3 levels, 1.5bath, prkg, NS, N/pets, $1300/mo. Fully furnished $1800/mo. 250-306-0211 Fourplex for sale in Summerland, BC. Two bedroom units. Excellent location, close to all amenities. Level entry with front & back doors. Private sale. 250-494-8685; 250-8097383. Large 2-bdrm upper suite in fourplex, adult oriented, close to Kin Beach, n/s, n/p, util incl $800 (250)838-9657 New 3bdrm duplex, w/d, a/c, $1350 util/incl. 250-558-7814. 250-309-5546.

Commercial/ Industrial

Housesitting

WAREHOUSE OFFICE SPACE

HOUSE SITTER Available 50 year old professional female willing to housesit in exchange for utilities. N/S N/P. Excellent references. Please contact 250-545-2215 ext 252

• Good central location • 5342’ - $3633.50/month • 1528’ - $1039.44/month • Could be combined for 6870 SQ.FT. Call Ray Stafford Sutton Lakefront

250-549-0198

Mobile Homes & Pads APRIL 1ST. 2 bdrm. + den Mobile. F/S. W/D. Nice yard. Belva’s MHP (away from highway). $820/month + $400 D.D. 250-546-6668.

Foor o

Homes for Rent 2bdrm, 1bath, ac, gas f/p, hardwood flrs, all appl. detached garage, fenced backyard, ns, np, close to Beairsto school, $1200/mo. +util. 250309-4996 2bdrm, downtown, W/D h/u, yard, garden, n/s, $850 +some util. (250)503-1926 2bdrm, fenced yard, garage, F/S, W/D, downtown vernon, $1095/mo +util, pets negot. 250-215-0367, 250-546-9393. 2bdrm, level-entry, downtown, large yard, & shed, W/D, NS/NP, avail imm, R.R., $925/mo +util. 250-558-8226. 3bdrm, log home in Armstrong, NS/NP, $1250/mo +util. 250-938-1013. 4bdrm, 3bath, executive fully furnished Silver Star, April 1. ns, np, $1199/mo. +util. 250558-5045 BELLA VISTA, up/down duplex, parklike setting. Top floor 2 bdrms, 1.5 baths, 6 appl., $1,400 incl. utilities/parking. Lower floor 2 bdrms, 1 bath, 5 appl., $800 incl. utilities/parking. 250-558-7156. Brand new 2-bdrm unit in park with lakeview, N/S, N/P, $925/mo incl pad rent, Avail Immed, RR Kristen 250-3065604 Charming 2bdrm home. 1/2 bsmt, appl., shed, fenced, private yard. Central Vernon. NS/NP. Avail immed. $1050 + utilities. 250 549 1696 Coldstream executive suite, 2bdrm, 1.5bath, quiet, private, serine lakeview, suitable for proff. all appl. ns, np, April 1. $1000 incl/util. 250-545-7196 DOWNTOWN - short term 2 bdrm 1 B, F/S, W/D, semi-furn, Apr 1 $990/mo + util 902-8571064 oyocomp@yahoo.com EastHill, 3bdrm, large fenced yard, carport, F/S, NS, No dogs, $1275/mo incl.water, garbage, sewer, recycling. Avail May 1. 250-542-0775. FURNISHED or UNFURNISHED UPPER FLOOR EXECUTIVE HOME. PANORAMIC VIEW, 3BDRM, 2BATH, JACUZZI, 2 F/P, LUXURIOUSLY FURNISHED, NS/NP. $1700/MO. 250-308-9282 IMMACULATE 3-bdrm 2-bath, upper floor, large yard/deck $1200/mo, (250)306-0046 LARGE 3bdrm, 2bath, main floor, large yard, avail immed, $1000/mo. 250-938-0975 New home, 4bdrm on acreage, 5min from Falkland, $1400/mo. (250)379-2774 Newly reno’d 3bdrm modular in South BX, NS, small pets ok, avail Imm, $1100/mo. 250549-9153. New reno, main floor, 2-bdrm, entry level, deck, shed, $1025, Also 3-bdrm, $1125, incl, util, cable, laundry, n/s, n/p, Avail Immed. 250-542-7806 Oyama 3bdrm mobile home in orchard, huge deck, lakeview, $980 +DD. 403-932-5725 RENT or Rent-to-Own with $20,000.downpymnt. Westside Rd/LaCasa. 2bdrm+den cottage/home Av. now. F/P, lrg deck, garage, w/d, 30mins. to Kelowna, $1500. +utils. ns/np. 250-769-0980

Homes for Rent

Recreation

SALMON ARM, Newly reno’’d house on acreage, 3bdrm, N/S, $1200/mo. 250-938-4563

EXPLORE in style! 2010 towables & motorhomes for rent from just $582/wk! Call Kelowna Truck & RV today @ 250-769-1000.

Superb fully furnished & Equipped 4bdrm, 3bath ski chalet, avail March 31-Oct 31 $1300/mo incl/util 250-6619914 Superb fully furnished ski chalet, 6bdms, 3bath, March 31Oct 31. $2100/mo incl/util. 250-661-9914. TOTALLY RENOVATED 3 bed home, 5 appl, huge mstr, fenced yard, large deck, N/S, N/P, reference req. Avail Immed, $1300/month + util. 250-275-0665

Office/Retail 1700SQFT w/office & storage space. Ideal location for small business. Lots of parking. For further info please contact 250-542-8566, 250-309-9246

Recreation DESERT SPRINGS CA., 2Bd. +den 1600sf. house, next to Executive Golf Course, only 10min. from Palm Springs located in secure gated community. Pics. avail: louellacowie@ hotmail.com 1-250-392-3058

550 55 50-0-79 790 900 00

TRAILER on Property, Tillicum Valley, hydro incl. $400/mo. April 1. 250-5426299.

Shared Accommodation 1BDRM, no-drugs, no-parties, downtown. $450/mo incl.util. furniture, cable. 250-549-0644 CLEAN, quiet roommate wanted, great private space for the right person, $500 all inclusive. Call (250)260-2662

Storage 2 Secure single garages & fenced storage lot, 32’x100’ avail for rent near 25th ave/39th St. 250-550-4069. 8X8X20 New Containers Household/ Commercial rentals. $110/mo. Your place or mine. Warren 1-250-212-8489 Vernon. Rent, Sale or Lease.

Property Management

Property Management

PROPERTY MANAGEMENT SERVICES Executives Realty Ltd. #101 - 2901 32nd Street Vernon, BC V1T 5M2 Bus. (250) 550-2120 Fax. (250) 549-2106 C21property@century21executives.com www.rentalsvernon.com

• Rental Management • Strata Management • Investment Property Management Call Maria or Diana Today for a detailed information package 250-550-2120

AVAILABLE IMMEDIATELY • EXECUTIVE HOME IN THE FOOTHILLS – Available April 1st this four bedroom, three bathroom home is exquisite. Lake, city and mountain views from this walkout like new rancher. Chef’s kitchen vaulted ceilings, gas fireplace, spa-like ensuite, covered deck and patio. Hardwood floors and large windows make this home bright and spacious with room for everyone.

RENT: $1,800.00 per month plus utilities. • BEAUTIFULLY RENOVATED HOME IN EAST HILL – Four bedroom, two bathroom character home located close to downtown. This home boasts original hardwood floors and soaker tub with an open floor for the perfect kid’s bedroom or office.

RENT: $1,500.00 per month plus utilities. • THREE BEDROOM HOME – Quaint home in Alexis Park overlooking the city and up to Silver Star. Top floor loft area hosts two nice sized bedrooms with a sitting area with one bedroom on the main floor. Newer flooring, one car garage, F/S, D/W, W/D included.

RENT: $1,200.00 per month plus utilities • TWO BEDROOM BASEMENT SUITE – In Alexis Park area. Totally refinished one year ago. This suite is large and spacious, includes F/S, D/W, W/D, and utilities. Pet friendly.

RENT: $950.00 per month includes utilities • TWO BEDROOM APARTMENT – On Okanagan Avenue in Regency Gardens. Rent includes F/S, D/W, & on site coin laundry.

RENT: $775.00 per month plus electricity • LUMBY - 2 BEDROOM APARTMENT - Second floor – above downtown business.

RENT: $750.00 per month includes heat, water, & sewer. • ONE BEDROOM SUITE – On Alexis Park Drive. Close to schools, bus route, and shopping.

RENT: $650.00 per month plus utilities • ONE BEDROOM APARTMENT –on 43rd Avenue, on site coin laundry, close to shopping and bus routes.

RENT: $575.00 per month plus utilities

FOR PICTURES CHECK OUT OUR WEBSITE AT

WWW.RENTALSVERNON.COM

ay be v wed weed e: om es

ww R

Seasonal Acommodation


www.vernonmorningstar.com

Friday, March 19, 2010 - The Morning Star B33

Storage

Suites, Lower

Fenced and secured storage on Okanagan Avenue Vernon from $30/mth 250-549-4500 RV’S, BOATS & AUTO YARD STORAGE. ARMSTRONG. 250-546-6022, 250-308-9250

Spacious 1 bdrm, mtn/lake views, laundry, dw, patio, ns/np,storage, parking, near college,$725/mth. 938-2679. Superb fully furnished & equipped ski chalet, 2bdrm, 1bath, Sleeps 6, March 31-Oct 31. $875/mo . 250-661-9914.

Suites, Lower FULLY FURNISHED one bedroom basement suite, walk to downtown, on bus route. No smoking. No pets. $650/mo, utilities included. Leave message 250-503-5466 Adorable 2 bdrm lower level suite. East Hill. Bright and roomy. No smoking, N/Pets. D/W garburator, all kitchen appliances. W/D, storage room. Charming solarium entrance. Parking. $900. Includes utilities and WIFI. Call 250-542-9019 or 250-545-0117 1bdrm, adult oriented, NS/NP, priv.entry, shared laundry, $875 incl/util. 250-549-5081. 1bdrm, clean, Harwood area, NS/NP, $650/mo incl.util. Avail Immed, 250-309-4657 1bdrm daylight suite, $750 incl util, private w/d, entrance, patio. April 1st. 250-545-9342. 1-bdrm + large den, 1100+sqft new, quiet BX area, n/s, n/p, w/d, f/s, d/w, a/c, bbq-h/u, $950/mo (250)241-8024 1bdrm, newly reno’d, lower EastHill. Internet, cable, shared storage & W/D, A/C. NP/NS, no parties, March 1. $800/mo (250)545-6950 1bdrm, pets ok, $625/mo. util/incl. avail. Imm. (250)5584536 1bdrm, sep.entry, ground level, nice & clean, avail April 1. $650 incl/util. 250-309-5675. 250-549-3689. 1BDRM, walkout, priv. entry, n/s, $800/mo 250-549-7450, 250-306-2727. 1 XL bdr, daylight suite w/patio & view, Vernon Foothills, $850. incl/util/sat/internet. Own entry/laundry. 250-558-0936 2bdrm, EastHill, new reno’d, adult oriented, sep.heat, priv.entry, insuite W/D, NS, off street parking, 1 cat ok. $950/mo util & Satt.TV incl. Avail Imm. 250-542-4757. 2-bdrm, heat, cable, hydro incl, Suits single/prof. couple, Ref., n/p, n/s, $900/mo. (250)545-8583, 250-307-4343 2bdrm, located in the Middleton area, avail. April 1, NS/NP $900/mo util/incl. 250-5495170. 2bdrm newly reno’d W//D, cats ok, N/S, $875/mo. util/incl. 250-545-5495 2 bdrm + storage, util incl., n/s inside, avail March 1. n/p. $800. 250-542-3981. 2BDRM, W/D, F/S incl Avail Immed N/S N/P $750/mo 604741-4196 AFFORDABLE 1bdrm new, near Polson Park, April 1. $675 util/incl. 250-558-7814. ARMSTRONG 1 bedroom bsmt suite , Shared Laundry, Non Smoking, Dogs Neg, Separate entrance $600 Util included. 250-546-3327. Bachelor suites for rent, $600/mo incl/util. North BX, NS/NP. 250-308-2929. BRIGHT 1 bdr suite. Private laundry, entrance, storage & parking, N/S, N/P, reference req. Avail Immed, $695/mon, plus util 250-275-0665 Bsmn’t suite for rent level entry $800/mo Avail April 15. NP/NS, 250-545-5841. East Hill, daylight, 1-bdrm, f/p, w/d, appl, adult oriented, n/s, n/p, $675, 250-938-1101 Lakeview 2bdrm, w/d, f/s, f/p, n/s, $750 +util. Suitable for prof. people. 3020 Sunnyview at Bella Vista. 250-503-1332 LARGE bsmn’t suite, 1 plus bdrm located on EastHill. In suite W/D, F/S, util/incl. NS/NP. Priv.entry & parking. $875. 250-306-4494. Near Hospital, avail April 1, 1bdrm, priv.entry, NS/NP, shared W/D, $525/mo +DD incl/util. 250-306-6266 lv msg. New 1bdrm, single person, Middleton, avail. April 1, $600. Days 250-307-3350, after 4:30pm 250-542-6598 New bright 2bdrm East Hill 1/2home, shared laundry, n/s, n/p, $1100/mo. util/incl. Avail. April 1 (250)545-8688

Auto Financing

Suites, Upper

Cars - Domestic

Motorcycles

Recreational/Sale

2008 Chevy Impala LS, dark blue, 48,200Kms, $15,500 12mos/12000km GM factory warranty. Going home to Australia, must sell! Full set of near new, studded winter tires included, Full dealer GM service history records, just had 50,000kms service, ICBC histroy report provided. Call Allen or Barb. (250)306-5383

2006 Kawasaki Vulcan 900 Classic LT, windshield, saddlebags, backrest, floor boards, 9000kms, exc.cond $6200 obo. 250-558-6835. 2007 CRF 250R, exc.cond, runs like new, still has stock tread. $4800. 250-547-0001 2009 Harley Davidson 1200 “Mightster” factory ordered, denim blue & black, 2500kms, w/ext. warranty, perfect shape, $10,000. (250)307-2227 2009 Scooter 49cc, 800km, like new, helmet, luggage & cover $1195. (250)550-6431 LEARN to ride from the most experienced instructors in the BC interior. Small class size; courses start every two weeks. Use our bike for the road test at no extra charge. www.vtwinokanagan.ca or 250-764-7075 V-STAR 650 Classic $5500 pics & info 250-309-2845 or www.vstarforsale.com YAMAHA 650 V STAR 2003 Yamaha 650 V star, comes with saddle bags, windshield, luggage rack & foot boards; added engine guard and cobra pipes, new continental tires, 14,000kms, very good condition. Selling price $4800 call 250-546-2821 or 250-550-4396

2004 20’ Mallard Travel trailer, as new, $12,000. 250-5426776 for more info. 2004 WILDERNESS Travel Trailer, 19 ft, as new, hardly used, dual propane, microwave, stereo, mint condition $8,500.- (250) 309-5900 2006 9’ Okanagan truck camper, solar panel, fantastic fan, M/W, rear awning, skylight w/blind $13,000. 250-5420672. 2008 Montana Ponderosa 8’6” SHOWS AS NEW! Roof a/c, gen set, remote electric jacks, 2 awnings, N/S queen bed, mic r o / s t o ve / o ve n / 2 d r - f r i d g e , shower/toilet, built for short & long box p/u, every option avail. list price $35,000, NOW $26,900. Call 250-545-3551 21.5’ Terry trailer 5th wheel, Call (250)838-6663 22’ 2006 Nash Travel Trailer, $13,000, a/c, sleeps 6, like new. (250)545-7260 WANTED, help beat the hst. 2006 Rustler Travelaire, 26’, 2drs, very clean, lots of storage, awning, outside shower. View on Pineridge rd, asking $15,000. 250-546-9474.

Cars - Sports & Imports $$

2-bdrm, incl heat, hot water, No Dogs, $750 250-542-3241, 250-542-9042 $950. 1100sqft, bright, 2bd/2bth, lakeview, designer, big kitchen, pvW/D/entrance, A/C, near dwntn. Small PetNegotiable/NS/quiet couple/single. 250-541-0203. May 1. Available April1st, Bachelor unit suitable for senior or students in quiet building. appt needed, Please call leave 250 275-6224 Large 2-bdrm, adult oriented, n/s, n/p, quiet, heat incl, $820/mo, Avail Apr1. Phone 250-503-2124

Townhouses

FOR RENT 3 Bedroom Townhome Close to downtown Lots of renos $1200 + Utilities

CALL PAULA 778-475-1555 3bdrm, 2bath, Hawthorne Lane, $900/mo. 250-5756161. Avail March 15. 3bdrm, beautifully reno’d, good location, $1100/mo. N/S, 250-558-0969, 250-938-1957 3-bdrm townhouse, newly reno’d, 1.5bath, close to town, no dogs, $900. (250)558-5053 Beautiful 2bdrm, 1.5bath townhouse, avail. immed. $900/mo. + DD. pets ok. (250)260-3400

Want to Rent Home or daylight bsmnt for family of 3 in BX school area. May 1 or earlier. 250-5455543.

Antiques / Classics 1957 STUDEBAKER President, V8, 4DR, needs restoration but intact mechanically, $1000 OBO. 250-503-8903.

Auto Accessories/Parts 185/70R14, near new, Hankook Sypted winter tires, $300 (250)549-7003 4 Cooper discover 31” winters on Toyota 6 hole rims, $275. (250)540-1471 4-Federal 205/60/R15 summers on M-B 5-hole rims, used 1 season only. $400. 250-5492610. 4 Goodyear assurance P205/70R15, as new, $280. (250)540-1471 4 Goodyear triple tread tires, P215/60R17, 80% new, tires good for 130,000kms, $450. 250-546-2820. 4 Michelin Harmony P195/65R15, as new, $240. (250)540-1471 FREE vehicle removal for recycling only, cars, trucks, vans. No registration, no problem. Call Larry 250-540-0303. RE-MANUFACTURED ENGINES 2 Year, 60,000kms, Warranty. 250-542-2685. set of all season tires, used 1 season, 195/70/R14. $150. 250-547-0119. WRECKING GM FWD Cars, all parts on the shelf. Motors $300 & up. Doors $75 & up. Since 1994. Armstrong. 250546-9055.

SAVE THOUSANDS!

Buy where the dealers buy & save

1 Bedroom Suite Available in the Victorian. Please inquire for a viewing Elly 250-545-0470

$$

GIANT AUTO AUCTION Over 100 cars, trucks, RV’s, 4x4’s, & SUV’s Many Unreserved.

Saturdays at 11 am Call Auction World 250-765-5282

Cars - Domestic $$

SAVE THOUSANDS!$$

Buy where the dealers buy & save

GIANT AUTO AUCTION Over 100 cars, trucks, RV’s, 4x4’s, & SUV’s Many Unreserved.

Saturdays at 11 am Call Auction World 250-765-5282

$$

SAVE THOUSANDS!$$ Looking for a good used 4x4, SUV, car or van but have a limited budget?

AUCTION WORLD

Over 100 units to choose from, many unreserved. Buy direct where the dealers buy & save!

Saturdays at 11 am

1988 Toyota Corolla wagon, $500 (250)545-4587 1989 Mazda 323 4cyl, 5spd, 167kms, exc. cond. Must See, $1395. (250)550-6431 2002 Pontiac Sunfire, 2dr, 5spd, manual, 160,000 kms, well loved. 1 owner. $4,000. 250-549-4574. 2006 Toyota Yaris 2dr HB, exc/cond! 90,000K auto, a/c, p/s, cd player, exc winter/summer tires, PRICE REDUCED $8500 250-545-0997 MERCEDES 230SLK sport convertible, 140K, excellent cond., only $16,500. Best Offer 250-469-4056

Motorcycles $$

SAVE THOUSANDS!$$

Buy where the dealers buy & save

GIANT AUTO AUCTION Over 100 cars, trucks, RV’s, 4x4’s, & SUV’s Many Unreserved.

Saturdays at 11 am

3953 Hwy 97N Kelowna 250-765-5282

Call Auction World 250-765-5282

1993 Ford Escort, 133,000kms, AC, auto, spare rims. $1500. 250-542-9079.

02 YZ 250 Dirtbike for sale, many extras $3000 OBO (250)938-5292 1980 Honda CX500 deluxe, all dressed, minor electrical problem, low miles, $800. 250-5479374, 250-309-1732 cell. 1980 Suzuki 750 new tires, no rust, runs good, $1150. (250)550-6431 1982 Kawasaki 550cc, needs tires & battery & TLC, low miles, $600. 250-547-9374, 250-309-1732 cell 1983 Honda Goldwing, Touring, recent tune, new rubber & brakes, $3950. 250-503-1018, 250-550-5511. 2001 Harley Davidson Sportster 1200, low miles, lots of xtras $7000 obo 250-546-8606 2002 VSTAR 1100, 19,000 kms. Excellent condition and loads of extras, must see $6,990. 250-308-8810 2003 100yr Ann. Harley softtail std. blk, lots of goodies, must see. $17,500 obo. 250-5421881 (H), 250-540-7244 (C). 2005 Honda Shadow VLX 600, 11k, great starter or ladies bike, exc.shape. $6200. 250-545-2950.

We’re on the net at www.bcclassified.com 1993 Mercury Topaz, well maintained, all receipts avail. 207,600kl $500 Firm. 250-5580364. 1994 BUICK Skylark V6, 297000km, New: rad & hoses, water pump, heater core, brakes, CD Player $1400 OBO 250-545-6601 OR 250-5468669 Pls Leave Msg. 1997 Chevy Lumina 3.1 FI V6 auto, p/l, p/w, air, 4dr, $1200 obo. 250-545-2627 1997 Jeep Grand Cherokee, 4x4, 4.0L, inline 6cyl, sport aluminum wheels, overhead console, well maintained. $5300 (250)260-6111, 250308-9721 1999 Olds Intrigue V6 auto, very nice cond. $2500 obo. 250-558-4919, 250-550-4250 1999 Pontiac Sunfire GT, 2.4L auto, am/fm/cd, 144k, ac, cruise, ect. very clean & in exc.shape. $4750. 250-5452950. 2001 Olds Alero, new brakes & tires, well maintained, $3100 OBO 250-307-4379 2002 Chev Malibu 4dr, 117,000k, very good cond. p/w, etc. $4800. 250-308-9764 2002 Neon, 4dr, auto, air, cd, p/w, p/l, exc/cond, 121K, $4400 (250)545-4170 2002 Volkswagen Passat GLX 2.8 V6, 4 motion AWD, black w/beige leather, P/W, P/L, P/M, sunroof, etc. 155,00kms, new timing belt, lots of re-conditioning work done, c/w 24,000kms warranty! $11,000. Can view at Royal VW. Call 250-306-9780 lv/msg. 2004 Chrysler Sebring, 2.7L, auto, keyless entry, well equipped, exc/cond, $6500 (250)260-6111, 250-308-9721 2005 Police Crown Vic factory issued Police car, stalk 305 hp, V8, auto, chipped, new Cd/amp, fully loaded, only 110k, very fast, ICBC blue book value $16,500. Absolutely drives like brand new. Moving has to go. Closest offer to $8500 before end of March takes.250306-7505 2007 Ford Focus Wagon, 24,000kms, exc cond., only driven 6mo, loaded, $11,000. (250)308-2131, 250-542-3439 3RD ANNUAL SUN VALLEY SWAPMEET. SUN VALLEY SPEEDWAY, MARCH 26 & 27. STARTS 10AM. CALL REG 250-308-4701.

Cars - Domestic

Off Road Vehicles 2001 Kia Sportage...2 litre 5-speed standard... 4 wheel drive...Fully loaded...Always serviced and kept up to date...The 100,000 km service included timing belt,clutch,wheel bearings and brakes...Just replaced windshield and complete exhaust system...includes JVC stereo system and newer winter tires....No surprises...looks/runs and drives very nicely $5400. OBO Phone 250-833-2637 $AVE E-SCOOTER $ALE *Brand New* E-Scooter $779 Kids Dirtbike/ATV Start@$249 Adult@ $1499 Buggie, UTV, etc. www.KDMSports.com 1-866-203-0906/250-863-1123

Recreational/Sale $$

SAVE THOUSANDS!$$

Buy where the dealers buy & save

GIANT AUTO AUCTION Over 100 cars, trucks, RV’s, 4x4’s, & SUV’s Many Unreserved.

Saturdays at 11 am Call Auction World 250-765-5282

1984 19’ Class C MH Chevy Citation, clean, auto, sleeps 4, $7500. 250-838-5775 1986 26’ Ford Citation, Class C motorhome, 136,000kms, sleeps 6, fridge, stove, oven, awning, roof & dash air, great shape. $10,000 obo.250-3088309. 1987 EMPRESS triple-E 27 ft motor home. Air conditioning, fridge, stove, tv, microwave, ex condition price $10,500 ph: 250-547-6330 or ivona_73 @hotmail.com (Lumby) 1990 Dodge Class B $8700. #110 Silver Star RV Park. Phone (250)545-7633

Cars - Domestic

Scrap Car Removal ALIVE or Dead, complete scrap cars & trucks hauled away for free. 250-503-0821 FREE Removal of unwanted vehicles etc. With or without papers. 250-938-6777 SCRAP BATTERIES WANTED We buy scrap batteries from cars & trucks & heavy equipment. $2 and up/each. Free pick-up anywhere in BC, Minimum 10. Call Toll Free 1.877.334.2288

Snowmobiles 2008 Summit 800cc, 146” track, 22.5 flow rites in air box, $7999. 250-558-8201.

Sport Utility Vehicle $$

SAVE THOUSANDS!$$

Buy where the dealers buy & save

GIANT AUTO AUCTION Over 100 cars, trucks, RV’s, 4x4’s, & SUV’s Many Unreserved.

Trucks & Vans $$

SAVE THOUSANDS!$$

Buy where the dealers buy & save

GIANT AUTO AUCTION Over 100 cars, trucks, RV’s, 4x4’s, & SUV’s Many Unreserved.

Saturdays at 11 am Call Auction World 250-765-5282

1993 F150 4x4 ext.cab, 302 5spd, 240,000kms. $1500 obo. 250-260-3998. 1993 Voyager, 2 sets of tiresnew winters $1000 firm. 250307-5126. 1997 International 4900-DT 466E flat deck Eaton 6 spd Tranny, air brakes 33000 km on new engine CV Inspection, steel deck good rubber Fassi F145 Knuckle Boom with forks & straps. Ray 250 308-0157 1998 Mazda B4000, SE V6, ext.cab, 2WD, 5spd, 288K, $3700. 250-542-5811. 1999 F250 super duty, quad cab, long box, 7.3L, turbo, V8 diesel, auto, 140k. Moving closest offer before end of March takes $11,500. 250306-7505. 1999 GMC Z71, 200,000km $8500. 250-545-6547. 2001 Dodge Ram 1500 2WD, 4.7L, V8, cruise, tilt, air, 4dr, 98,000kms, $7700 obo. (250)545-7671, 250-938-6301 2001 FORD F150 4X4 Super Crew. New 5.4L motor, fully loaded, exc. cond. 250-5584180 or 250-878-2588. 2001 Grand Caravan Sport, $3000 obo. 250-260-3998. 2002 Dodge Ram 1500. 4x4, 4 door short box. White. 204,000 kms. 4.7 L V8. $9,000 obo. Call 250-718-9272 (cell) or email ryan_hein@hotmail.com 2003 Grand Caravan Sport Pkg, 105,000kms, great shape, $8500. 250-542-4685. 2004 GMC 2500 HD 4x4, ext. cab, long box, 6L, both gas & propane, well maint, 244K, $8950 obo. (250)542-2822

Saturdays at 11 am

2005 Dodge 3500 4x4 diesel, 6spd, crewcab, dually,$22,400 www.teskovernon.com 250-545-5394, D10160

1976 Jeep CJ5, black, 4x4, $5500. 1-780-906-7966, 250558-8201. 1995 Ford Explorer “Eddie Bauer” black, 4x4, leather, fully loaded, CD stereo, AC, good tires/brakes, clean, no rust, asking $2500 obo. 250545-6411 1998 Chevy Blazer full load, 157k, new brakes, tires, fuel pump & timing belt. nice shape $4900 obo. 250-545-9144 1999 Toyota Rav 4. runs & looks great, clean, 276Km. $5900. 250-547-6292.

2005 Ford F150 super crew XLT, 4x4, new tires, headlights, brakes, fluids, $11,250. 250-307-4379

Call Auction World 250-765-5282

Trucks & Vans 1977 F150 Short box, red, gas 4x4, $12,000. 1-780-9067966, 250-558-8201 1987 S10 truck w/boat rack $500 Firm. 250-542-9210 after 5pm.

Recreational/Sale

2005 Toyota Sienna, 110K, awd, all records, $20,000 Firm. (250)546-0625 2006 Dodge 2500 diesel, 4x4, S/B, quad cab, exc cond $25,700. 250-549-1703. 2008 14’ dump trailer, 14,000lb GVW, $7000. 1976 GMC Sierra Grande camper special, 454, immac cond, 1980 Okanogan 8’ camper, immac also, $7000. 250-5458893 eves.

1-800-222-TIPS Recreational/Sale

“Drive A Little, Save A Lot!” THIS WEEK’S SPECIALS

2006 CARAVAN SPORT ......................... $9,888 Only 50K • S066

2004 COLORADO GPX .....WAS $16,999 NOW$14,999 Full load, only 94,000 kms, crew cab • S007

2006 TDI WAGON............WAS $19,888 NOW$17,888 New OME brakes, timing belt • S025

2004 HONDA CIVIC ............ WAS $9,888 NOW$8,488 New brakes/tires • S040

2008 G5 ........................... WAS $11,999 NOW$9,999

Mobile and In-Shop RV Repair • Fiberglass & Gelcoat Repair • RV Customization • Woodwork & Cabinetry • Detailing of RVs & Boats • Parts and Accessories

Only 49,000 kms • S030

1998 YUKON SLT............... WAS $5,999 NOWOFFERS Full load • S053

2008 MALIBU New body style.WAS $16,999 NOW

$

15,488

• S060

RV SEASON IS HERE!

SPECIAL INTEREST

2003 HARLEY 883.............. WAS $6,988 NOW

$

5,988

Like new • S010

19FT. ALUMACRAFT BOAT WAS $12,988 NOW

Call Craig Mayall 250-549-0019 • craig@gilmay.ca

$

11,988

1/0, b/r, full canopy, elect down riggers • T021

BIG TEX DUMP TRAILER ....... WAS $8,888 NOW$7,888 106VW • S023

• Government Certified Techs • Best Parts selection, new and used, in BC • Lowest shop rate in the valley Now accepting newer, clean RVs for consignment.

Call Larry - Office 250.548.3440 • Cell 250-869-6968 Since 1969

SPARTAN AUTO Located at Gatzke’s Farm Market Hwy. 97, Oyama, B.C.

DL 30953

Sales & Service Ltd.

When booking online, go to www.kenkraft.ca or call 250-545-5101 kenkraftsalesltd@shaw.ca Dealer #5529


B34 Friday, March 19, 2010 - The Morning Star

www.vernonmorningstar.com

Happy

Happy Birthday

90th

Birthday

Ray Hutchinson

Stephanie

Happy Birthday Dawn!

Love your

All our love, Norm, Alysha & Calvin

& friends! From your family Trucks & Vans DUMP TRUCKS

S1 Tons - 3 TONS ~~~~~~~~~~~

2100 Rutland Road (Behind Kia Motors @ Reids Corner, Kelowna) ~~~~~~~~~~~ Call Doug 250-862-7189

Trucks / Trailers -plus

Community Newspapers Weâ&#x20AC;&#x2122;re at the heart of thingsâ&#x201E;˘

Utility Trailers 8â&#x20AC;&#x2122;X10â&#x20AC;&#x2122; Trailer, Skidoo/ATV ďŹ&#x201A;atdeck w/3â&#x20AC;&#x2122; sides. $1800. 250547-2158. TRAILERS All types, all sizing, excellent pricing. (250)545-2000

Boats $$

SAVE THOUSANDS!$$

Buy where the dealers buy & save

GIANT AUTO AUCTION Over 100 cars, trucks, RVâ&#x20AC;&#x2122;s, 4x4â&#x20AC;&#x2122;s, & SUVâ&#x20AC;&#x2122;s Many Unreserved.

Saturdays at 11 am Call Auction World 250-765-5282

2005 Bayliner 192 Cuddy Cabin, ďŹ sh ďŹ nder, 3.0L 4cyl Merc, $13,900. 250-938-0231. 2006 Searay Sun Deck, 20â&#x20AC;&#x2122; Bowrider, CD/XM radio stereo, 5.0L Merc, very low hrs, Bimney & snap on canvas, mint cond. $28,900. 250-938-0231. 2008 Bayliner 185 Bowrider, c/w trailer, stereo, 3.0L merc, exc.cond $13,900. 250-938-0231. 24â&#x20AC;&#x2122; Pontoon Boat w/trailer, 90hp Nissan 2stroke, upholstery needs TLC $11,000 OBO, 2003 Seadoo w/trailer, 130hp, $4000 OBO, 18â&#x20AC;&#x2122; Mirage Bowrider, 4.3L engine, 160hrs, black & white, $9400 OBO, 2005 Johnson 9.9 Kicker, 2stroke, brand new, never used. $2400 OBO (250)5580618

Utility Trailers

Legal Notices

Escorts

Escorts

REPAIRERS LIEN ACT SALE 1990 Pontiac 6000 VIN# 1G2AF51T6L6230933 Owned by: Casey Wade Huston Debt: $1040.46 To be sold on Friday, Apr. 2, 2010 at 10:00 am for $1040.46 cash at Canadian Tire, 4510, 27th St., Vernon

1st Class Mystique Escorts Gorgeous ladies of all ages to suit every need 24/7 outcall service. (250)558-5500. mystiqueescorts.ca. NOW HIRING. ALL Pro Escorts. Female & Male Escorts & Strippers. 24hr fast & friendly service. Cash/Visa/MC. Always hiring. Penticton:250-487-2334 Kelowna:250-860-7738 Vernon:250-542-8448 Salmon Arm:250-832-6922 www.allproescorts.com or www.allprostrippers.com California Males: Ladies only 24/7. Your fantasies can be reality. (250)938-6326 Chris.

ATTRACTIVE blonde, discrete, non rushed, offers sensual body massage. Incalls/outcalls. New hours. 11am-Midnight. 250-308-5946.

Legal Notices

Legal Notices

NOTICE TO CREDITORS AND OTHERS RE: Estate of Walter Louis Heichert Deceased Nov.5, 2009 formerly of 406-3011 Gateby Place, Vernon B.C. V1T 9S4. Creditor and others having Claims against the estate of Walter Louis Heichert are hereby notiďŹ ed under Section 38 of the Trustee Act that particulars of their claim should be sent to the Executors Judith Harriett Jean Vandervoort and Walter Craig Heichert at the following address on or before April 17th, 2010 after which date the executors will distribute the estate among the parties entitled to it having regard to the claims of which the executors then has notice. Judith Vandervoort 510-19645 64th Ave. Langley, BC V2Y 1L2

NOTICE TO CREDITORS AND OTHERS Re: The estate of Kurt Banzer also known as Kurt Gebhard Banzer also known as Kurt Gerbhard Banzer also known as Kurt Gebhard Joseph Banzer, deceased, formerly of #124 - 1108 - 14th Avenue, Vernon, BC. Creditors and others having claims against the estate of Kurt Banzer also known as Kurt Gebhard Banzer also known as Kurt Gerbhard Banzer also known as Kurt Gebhard Joseph Banzer are hereby notiďŹ ed under section 38 of the Trustee Act that particulars of their claims should be sent to Rodney Eugene Banzer, the Executor, c/o Dwayne Pommer Law, 578 Central Street East, Prince George, BC, V2M 3B7, on or before May 10, 2010, after which date the Executor will distribute the estate among the parties entitled to it, having regard to the claims of which the Executor then has notice.

Utility Trailers

PLEASANT VALLEY TRAILER SALES LTD. Huge Selection of Sizes & Models

â&#x20AC;˘ â&#x20AC;˘ â&#x20AC;˘ â&#x20AC;˘ â&#x20AC;˘ â&#x20AC;˘ â&#x20AC;˘

Range Rover Canopies Flatdecks Car Hauler Enclosed Trailers Equipment Trailers Dump Trailers ATV Trailers

EURASIAN Princess, 25, open minded beauty, 38DD, 28, 40, 5â&#x20AC;&#x2122;â&#x20AC;&#x2122;7. Shylynn. Asia visiting soon. 859-9584 MALE 4 Male Erotic Massage, $95. WinďŹ eld, 9-9 Daily 250766-2048 Personable & petite, attractive brunette, avail. for massage, women welcome, in or out calls avail. 9am-6pm. Lisa (250)808-2942

4260733 NOTICE OF PUBLIC INFORMATION MEETING A proposal to implement a site speciďŹ c zoning text amendment bylaw for the property at: Lot 1 Section 7 Twp 5 ODYD Plan 30551 located at: 5375 Hughes Road, Vernon, B.C., Electoral Area â&#x20AC;&#x153;Câ&#x20AC;? - Regional District of North Okanagan The purpose of the meeting is to allow the applicant to present details of the proposal and to review input from the community. Meeting Details: Date: April 1, 2010 Time: 6:00 p.m. Location: 5375 Hughes Road, Vernon, B.C. Presentation to begin at: 6:00 p.m.

Legal Notices

Legal Notices

INVITATION TO TENDER DISTRICT OF COLDSTREAM GRID ROAD â&#x20AC;&#x201C; CONTRACT #1 Sealed Tenders clearly marked â&#x20AC;&#x153;The District of Coldstream â&#x20AC;&#x201C; Grid Road â&#x20AC;&#x201C; Contract #1â&#x20AC;? will be received by the Front Desk Clerk, District of Coldstream, prior to 2:00 p.m. local time, Thursday, April 1, 2010, at the District of Coldstream OfďŹ ce, 9901 Kalamalka Road, Coldstream, BC, V1B 1L6 â&#x20AC;&#x201C; Attention: Michael Stamhuis, P.Eng., Chief Administrative OfďŹ cer. Tenders will be publicly opened immediately after the Tender Closing Time, at the District of Coldstream OfďŹ ce, and the public is invited to attend. The work generally consists of the following approximate quantities: â&#x20AC;˘ 1000 lineal m of asphalt roadway, including concrete curb & gutter and extensive earthworks. â&#x20AC;˘ 850 lineal m of asphalt multi-use pathway, including concrete roadside barrier and street lighting. â&#x20AC;˘ 750 lineal m of PVC storm water main (250mmø and 300mmø), including catch basins and manholes. â&#x20AC;˘ 300 lineal m of PVC water main (200mmø). â&#x20AC;˘ 400 vertical m2 of engineered modular block retaining wall. â&#x20AC;˘ 360 lineal m of concrete block fencing. â&#x20AC;˘ 825 lineal m of chain link fencing. Contract Documents, Contract Drawings and Reference Material for this project will only be distributed electronically in digital format (pdf and dwf formats) through the BC Bid tendering website at www.bcbid.gov.bc.ca. Information will be available on or after March 17, 2010. DWF reader software is available for free download from Autodesk at http://www.autodesk.com/designreview-download. A non-mandatory pre-tender site meeting will be held on Thursday, March 25, 2010 at 10:00 a.m. local time at the cul-de-sac at the end of Pointe Sage Drive, Coldstream, BC. Representatives from the District of Coldstream and Urban Systems Ltd. will be present. This project is supported and funded in part by the Communities Component under the Building Canada Fund and by Western Economic DiversiďŹ cation Canada. CONTRACT ADMINISTRATOR Urban Systems Ltd. 304 â&#x20AC;&#x201C; 1353 Ellis Street Kelowna, BC V1Y 1Z9 Email: sgull@urban-systems.com Attention: Sheldon Gull, AScT.

Details of the Proposal Include: Implementation of RDNO Zoning Text Amendment Bylaw No: 2423, 2009 to permit the limited expansion of a home-based business consisting of the operation of a fancy meat and sausage processing plant.

Sex and the Kitty A single unspayed cat can produce 470,000 offspring in just seven years. Sadly, most of them end up abandoned at BC SPCA shelters or condemned to a grim life on the streets. Be responsible - donâ&#x20AC;&#x2122;t litter.

Great Pricing

7885 Hwy. 97, Vernon, BC V1B 3R9 â&#x20AC;˘ 250-545-2000

Legal Notices

www.spca.bc.ca

9OURTHOUGHTFULGIFTTOTHE.ORTH/KANAGAN (OSPICE3OCIETY%NDOWMENT&UNDWILL HELPENSUREQUALITYENDOFLIFECAREFOR RESIDENTSOFTHE.ORTH/KANAGAN

  WWWNOHSCA


www.vernonmorningstar.com

Friday, March 19, 2010 - The Morning Star B35

BUTCHER BOYS

Prices in effect from Friday, March 12 to Saturday, March 20, 2010

CASE LOT SALE PORK SIRLOIN CHOPS

LEAN GROUND BEEF Fresh!

GROUND FRESH DAILY USING ALBERTA GRAIN FED BEEF, AA OR BETTER. R.. FAMILY PAK

LB.

2.49

EASTS Fresh! CHICKEN BREASTS

5.99 COHO SALMON FILLETS CO LLETS 6.99 MAPLE BACON M 11.99 TOMATO SOUP WORKS OUT TO APPROX 42¢ EA. Case Lot Price… LIMIT 2/FAMILY

4.99

INDIVIDUAL PRICE ................................... 49¢ EA.

Butcher

7.99

er Boys Priced! her he Butcher

EGGS

WESTERN FAMILY GRADE A, LARGE Butcher Boy Priced

1.99 SALSA 6.99 CEREAL BARS 7.99 CEREAL 5.99

............................ DOZ. PACE THICK & CHUNKY MILD .............................1.7

L

KELLOGGS NUTRI-GRAIN JUMBO PACK ASSORTED VARIETIES .................... 1.18 KG

KELLOGGS JUMBO PACK CORN FLAKES, VECTOR, ALL BRAN, RAISIN BRAN, SPECIAL K ..... 625 GR - 1.45 KG ROBIN HOOD

QUICK OATS

3.99 LONG GRAIN RICE 15.99

Butcher Boy Priced

............................................ 3 DRAGON KING

KG

Butcher Boy Priced

....... 20

LB. BAG

FRUIT CUPS

CASEE & ITEM SIZE SWANSON’S MEAT PIES

ASSORTED VARIETIES 12 x 398 ML

8.99 PIZZA POPS & PIZZAS 7.99 16 PACK

PILLSBURY ASSORTED VARIETIES Butcher Boy Priced

........................ 12

PACK

Butcher Boy Priced

................................. 1.5

L

17.99

1.69

GREEN GIANT VEGETABLES

2 FOR 5.00

SWEET PEAS, MIXED VEGETABLES, PEACHES & CREAM CORN, SWEETLETS, KERNEL CORN, CUT GREEN BEANS, FRENCH CUT GREEN BEANS

EA.

.29 .79

9.99

1.49 1.99

+ DEP

OR APPROX. 1.25 EA.

EA.

20.99

EA.

1.49

16.99 OR APPROX. 1.42 EA.

PASTAS

EA.

FOLGERS CLASSIC ROAST

9.99 GRANOLA BARS 9.99

Butcher Boy Priced

/LB.

PAPER TOWEL

5.99 COFFEE 5.99

Butcher Boy Priced ........................... 6

PACK

....................... 920

U.S. GROWN

GR

SLICED, ROSEBUD, HARVARD • 12 X 398 ML

OR APPROX. 1.25 EA.

HUNTS TOMATO PASTE

7.99

DOLE PINEAPPLE

17.99

ASSORTED CUTS 24 X 398 ML

ASSORTED VARIETIES 12 X 709 GR

APPROX.

ASSORTED VARIETIES 24 X 156 GR

6.49 FACIAL TISSUE 6.99

...................... 6

X 136’S

U.S. GROWN

PURE

EA.

EA.

.59

LIQUID HONEY

6.99 PEANUT BUTTER 6.99

..............................

1 KG

WESTERN FAMILY SMOOTH, CRUNCHY, NATURAL ced Butcher Boy Pri 2 ..............................

KG

CANADIAN GROWN

CARROTS RUTABAGAS 5 LB. BAG

McCAINS CRESCENDO RISING CRUST PIZZA

2

760 - 900 GR

RIMINI CANOLA OIL

FOR

ASSORTED VARIETIES

10.00

3 LITRES

5.99

OCEANSPRAY CRANBERRY COCKTAIL

5.99

100% PREMIUM AND REGULAR. ASSORTED VARIETIES.

+ DEP & ENVIRO

BUTCHER BOYS

BREAD

1.19

WHITE OR 60% WHOLE WHEAT ...................... 450 GR • EA. ENGLISH BAY

BUTCHER BOYS

COOKIES ASSORTED

EGGROLL BUNS

VARIETIES ......................... DOZEN

EA.

Butcher Boy Priced

FROZEN 750 GR

3.78 L

.89 1.19

.50 EA.

3.99

WATER SALT

.......................... DOZEN

DOG FOOD

SIFTO-AQUA MAGIC CRYSTAL PLUS CONDITIONER

MAINTAIN DRY

Butcher Boy Priced ........................... 20

................... 16

4.99 PASTA SAUCE 4.99 KG

PREGO ORIGINAL, MUSHROOM ......................1.75

L

U.S. GROWN

1.89

Butcher Boy Priced

KG

11.99

MIRACLE WHIP

KRAFT REGULAR & LIGHT Butcher Boy Priced

................................ 1.5

L

5.99

CANADIAN GROWN

RUSSET GREEN CABBAGE POTATOES 20 LB. LB BAG BAG

.49 2.49 .49 /LB.

EA.

1.08 EA.

APPROX.

ROLLS

Butcher Boy Priced

4.49

11.99

BATHROOM TISSUE

SCOTTIES

EA.

12.99

FRISKIES CAT FOOD

...................24

.79

OR APPROX. .75 EA.

TRI-V DOG FOOD

Butcher Boy Priced

EA.

23.99

ASSORTED VARIETIES, MIX OR MATCH, 6 X 2 KG

PUREX

1.39

OR APPROX. .67 EA. OR OR APPROX. 4.00 EA.

+ DEP

EA.

14.99

WESTERN FAMILY PEROGIES

EA.

+ DEP

OR APPROX. 1.50 EA.

AYLMER BEETS

REGULAR, GARLIC, HERB • 12 X 156 GR

EA.

7.99

ONIONS NAVEL ORANGES

.49

1.39

OR APPROX. .25 EA.

+ DEP

REGULAR 12 X 1.36 LITRE

EA.

NATURE VALLEY SWEET & SALTY 1.12 KG TRAIL, CRUNCHY 1.4 KG ..............................32’S

CALIFORNIA LARGE

99¢ EA.

HEINZ TOMATO JUICE

WESTERN FAMILY JUMBO

4.99

9.99

CORN 12x341 ML. PEACHES & CREAM CORN AND CUT GREEN BEANS Case Lot Price… 12x398 ML. WORKS OUT TO APPROX 83¢ EA. INDIVIDUAL PRICE…

.99

CATELLI SPAGHETTI, MACARONI AND SPAGHETTINI ................................ 4 KG

KETCHUP

HEINZ FAMILY SIZE

INDIVIDUAL PRICE ................................... 79¢ EA.

GREEN GIANT NIBLETS, PEAS, CREAM

19.99

OR APPROX. 1.75 EA.

Butcher Boy Priced

7.99

PIECES. 284 ML. WORKS OUT PI IECES. 12 x 2 67¢ EA. Case Lot Price… TO O APPROX 6

CANNED VEGETABLES

VARIETIES

OR APPROX. .67EA.

DELMONTE ASSORTED VARIETIES

7.99

99¢ EA.

CASE PRICE

5.99

12 X 1 KG

MUSHROOMS WESTERN W ESTERN F FAMILY STEMS AND

18.99

CASE & ITEM SIZE

MR. NOODLE RAMEN NOODLES

McCAIN HASHBROWNS

INDIVIDUAL PRICE ................................ 3.49 EA.

ASSORTED VARIETIES. 24 x 398 ML. ALSO RED KIDNEY BEANS Case Lot Price… WORKS OUT TO INDIVIDUAL PRICE … APPROX 79¢ EA.

SINGLEE PRICE

OR APPROX. 1.25 EA.

BLUE LABEL 100% PURE 8 X 5 X 200 ML

Case Lot Price…

BEANS HEINZ DEEP BROWN OR ORIGINAL.

CASE PRICE

WHOLE & DICED 8 X 796 ML

SUN-RYPE APPLE JUICE

INDIVIDUAL PRICE ................................ 1.39 EA.

CASE & ITEM SIZE

9.99

ASSORTED VARIETIES ASSORTED GR

19.99

WORKS WO ORKS OUT O TO APPROX 3.30 EA.

14.99

370 ML. WORKS OUT TO APPROX 1.25 EA. Case Lot Price…

SINGLE PRICE

OR APPROX. .83 EA.

DR. OETKER ADDED TOUCH CAKE & MUFFIN MIX

/100 GR

CASE PR PRICE

AYLMER TOMATOES

ASSORTED VARIETIES 24 X 85 GR

PACIFIC REGULAR ONLY. 12 x

MARGARINE IMPERIAL IMP PERIAL SOFT. 6x1.36 KG PERIA

INDIVIDUAL PRICE ................................... 99¢ EA.

ASSORTED VARIETIES 24 x 200 GR

DELMONTE “NO SUGAR” FRUIT

...................

Case Lot Price…

INDIVIDUAL PRICE … 1.19 EA.

+ DEP & ENVIRO

INDIVIDUAL PRICE ................................ 1.29 EA.

KRAFT DINNER

11.89

PURE. 12 x 1 LITRE. WORKS OUT TO APPROX 99¢ EA. Case Lot Price…

BX BRAND, BULK ........................................

GR • EACH

23.99

12.99 12 2.99 99 EA.

MACARONI AND CHEESE. 12x225 GR WORKS OUT TO APPROX 67¢ EA.

/100 GR

..................................................

OLD SOUTH SOU UTH FROZEN. ASSORTED VARIETIES. 244 x 330 ML. WORKS OUT TO APPROX 1.000 EA EA. Case Lot Price…

9.99

11.99

MOZZARELLA, LLA, MARBLE. 1 KG

• EACH

ORANGE JUICE EVAPORATED MILK

CHEESE ROCKY MOUNTAIN MO MEDIUM,

APPLE JUICE SUN-RYPE BLUE LABEL, 100%

PINTY’S. ASSORTED VARIETIES. ............................................... 907

INDIVIDUAL PRICE ................................... 89¢ EA.

ROGER’S FLOUR ALL PURPOSE WHITE, UNBLEACHED WHITE OR WHOLE WHEAT. 10 KG Boys Priced!

LB LB. B. BOX • EACH

HAMPTON HOUSE. FROZEN. BREADED ......................................... 2 KG BAG

LIGHT TUNA IN WATER. 12 x 170 GR. WORKS OUT TO APPROX 83¢ EA. Case Lot Price…

3.99

11.99 Deli Specials ! CHICKEN CHIC CKEN ST STRIPS FASHIONED 15.99 OLOLD HAM 1.39 BAVARIAN SMOKIES ¢ CHICKEN WINGS 99 11.99 ......................................... .................. ........................ 5

GR • EACH

GOLD SEAL CHUNK AND FLAKED,

LB.

BREAKFAST BREA AKFAST SA SAUSAGE AUSAGE BONANZA.. FROZEN.

8.99 19.99 3.99

LB. BOX • EACH LB

....................................................... Butcher Boys Priced! 250

Butcher Boys Trimmed Lean

LB.

SALAMI CHUBS FREYBE. ASSORTED VARIETIES.

KG • EACH

CAMPBELL’S 12 x 284 ML

2.99 3.99

BACON BONANZA #1 SLICED. ......................................... 5

Fresh!

FAMILY PAK.

............................................................ Butcher Boys Priced! 1 KG • EACH

FROZE WILD. CRY-O-VACED PRODUCT. FROZEN. Butcher Boys Priced! LB ................................................................................. .......... LB.

FLETCH FLETCHERS. ................................................ .......... Butcher Boys Priced! 1.5

LB.

PORK TENDERLOIN

CUT FROM ALBERTA GRAIN FED BEEF, AA OR BETTER. AGED A MINIMUM 14 DAYS.

BONELESS. FRESH CANADIAN PORK. Butcher Boys Trimmed Lean

EUROPEAN WIEN WIENERS NERS GRIMMS. PILLOW PACK.

BONELESS / SKINLESS. AK ........... LB. FARM FED HALAL CERTIFIED. FAMILY PAK

SIRLOIN TIP STEAKS

www.butcherboys.ca

EA.

BUTCHER BOYS

/LB.

Prices Pric Pri ces in effect efffe ect from

.49 4.49 /LB.

EA.

OPEN DAILY 8: O 8:00 :00 AM M to 9:00 PM

WE RESERVE THE RIG W RIGHT GHT TO L LIMIT QUANTITIES 4803 P 4803 P.V. V ROAD (Corner (Corne er of Pleasant Valle Valley ey and Silver Star Road) • Pr Proudly roudly Inde In Independent nde ependent - Local Locally lly Ow Owned wned & Operated by b Butch Butcher her Boys Ent. Ent Ltd. Ltd


The Honda Hat Trick: Quality, Reliability, Safety. PURCHASE FINANCING AS LOW AS

Civic DX-A Sedan model FA1E2AE4X

2010 Civic DX-A

LEASE A DX-A SEDAN FOR /APR PER MONTH FOR 48 MONTHS

$

218 2.9 #

$

MSRP $27,540 INCLUDES FREIGHT & PDI LEASE FOR/APR PER MONTH FOR 48 MONTHS WITH $3,741 DOWN

298 @2.9

#

Sales Manager

DON DEROWIN

Business Manager

COLLEEN MAXNUK

Sales & Lease

HEATHER LADUKE

††

MSRP‡ $18,685 FOR CIVIC SEDAN DX-A • INCLUDES FREIGHT & PDI

MTH

@

$1,000

%

2010 Accord LX Auto

%

£

545-0531

1-888-545-0531 6425 Hwy. 97N, VERNON

(on top of the Swan Lake Auto Mile)

DEALER NO 8718

Sales & Lease

FREDE LAURSEN

0.9

ON ALL MANUAL 2010 CIVICS

PST REDUCTION

£

FOR

WITH $1,541 DOWN

Accord LX Sedan model CP2F3AE

$

GENE KUSHNIRUK

Sales & Lease

Sales & Lease

GORD KERR

5

318 @2.9

#

%

Find Out What Honda Owners Already Know

Low Cost Of Ownership • High Resale Value • Affordable • Reliable • Fuel Efficient • Advanced Safety • Fun To Drive!

SUNSHINE Honda

Sales & Lease

DAVE DANIELS

£

%

YEARS

2010 CR-V LX 4WD

CR-V LX 4WD model RE4H3AEY

MSRP $29,880 INCLUDES FREIGHT & PDI LEASE FOR/APR PER MONTH FOR 48 MONTHS WITH $3,748 DOWN †

#Limited time lease offers based on new 2010 Honda models. Lease examples based on new 2010 Civic DX-A Sedan, model FA1E2AE4X / 2010 Accord LX Sedan Automatic, model CP2F3AE / 2010 CR-V LX 4WD, model RE4H3AEY available through Honda Financial Services on approved credit. £2.9% / 2.9% / 2.9% lease APR for 48 / 48 / 48 months. Monthly payment, including freight and PDI is $218 / $298 / $318. Down payment or equivalent trade of $1,541.24 / $3,741.22 / $3,747.98, first monthly payment, environmental fees and $0 / $0 / $0 security deposit due at lease inception. Total lease obligation is $13,585.87 / $20,350.65 / $21,433.42. Taxes, license, insurance and registration are extra. 96,000 kilometre allowance; charge of $0.12/km for excess kilometres. Retailer may lease for less. Retailer order / trade may be necessary. †Limited time financing offers based on new 2010 Honda models. Finance example based on new 2010 Civic DX-A Sedan, model FA1E2AE4X available through Honda Financial Services on approved credit. ‡MSRP is $18,685 (includes $1,395 freight and PDI) financed at 0.9% equals $318.59 per month for 60 months. Cost of borrowing is $430.59 for a total obligation of $19,115.59. Taxes, license, insurance, environmental fees and registration are extra. Retailer may sell for less. Retailer order / trade may be necessary. ††New 2010 Civic models with manual transmission qualify for the Government of British Columbia’s $1,000 PST reduction. See your Honda retailer for details. #/£/†Offers valid from March 2nd, 2010 through March 31st, 2010 at participating Honda retailers. Offers valid only for British Columbia residents at BC Honda Dealers. Offers subject to change or cancellation without notice. See your Honda retailer for full details.

B36 Friday, March 19, 2010 - The Morning Star www.vernonmorningstar.com


VMSN100319