Page 1

World Traveller

Shoot ‘em up

Pilot Guides host coming to UW —page 12

Unreal Tournament 2004 review —page 12

Lakehead challenges UW fans Rod McLachlan IMPRINT STAFF

Even though Valentine’s Day was fast approaching, representatives from the Lakehead Thunderwolves men’s hockey team were not in the giving mood. Lakehead proposed that UW head coach Karl Taylor surrender his team’s only upcoming home playoff game at Columbia Icefield, scheduled for Wednesday, February 25, in order to move it to Thunder Bay. However, the Warriors men’s hockey team and UW head coach Taylor said, in an interview on February 18, that he was never contacted regarding the proposal.

Edey shakes up housing

“There was no negotiating [between UW and Lakehead],” said Taylor. “They never talked to me or Judy [McCrae].” McCrae is UW’s director of Athletics and Recreational Services. According to a report by Bryan Wyatt that first appeared on a Thunder Bay Web site tbsource.com, Thunderwolves officials were pushing for the deal so that they could cash in on greater ticket sales, because the Thunderwolves’ Fort William Gardens arena has a seating capacity of 3,700 compared to the CIF’s capacity of 1,000. Lakehead is not part of an OUA sharing agreement between the

league’s teams that helps cover travelling expenses. The sharing agreement takes ticket sale revenues and shares the money among the participating teams, which means that Lakehead was clearly looking to increase its profit since the team’s attendance has been averaging roughly 3,000 per game this season. The Thunder Bay article argued that UW should give up its first men’s hockey home playoff game in almost three years because “it would make economic sense for the Warriors, who draw at the most about a hundred fans per game in their Columbia Ice Fields.” The first round

best-of-three playoff was already scheduled with Lakehead hosting two of the three games because the Thunderwolves (18-4-0-2, win-losstie-overtime loss) finished in second place ahead of the third place Warriors (8-14-0-2). Nevertheless, Lakehead wanted all three games to be held in Thunder Bay. “I don’t think it was an intentional slight at all [by Lakehead],” said Taylor in reference to the Thunder Bay article on Lakehead’s proposal. “They wanted to show their fans that they’re doing the best that they can for their program. It’s no big deal.” Even so, the Warrior head coach would like to

see UW fans come out in full force for game one at 7:30 p.m. for the February 25 to show their support. “We want to have a 1,000 at our rink,” added Taylor in hopes of having the game sold out. In the meantime, Waterloo lost its final game of the season on Valentine’s Day 8-5 on the road at the hands of the Guelph Gryphons. Clearly, the Warriors were a little unfocused after they received word from their coach that they were in fact in the playoffs due to fourth-place Windsor’s 1-0 loss to the York Lions. See HOCKEY, page 19

Here come the men in blue

Shaun Slipetz SPECIAL TO IMPRINT

The issue of affordable, safe and convenient student housing is being tackled by UW, WLU, and the City of Waterloo. On Wednesday, February 18, Feds president Chris Edey presented a report to local representatives, detailing the vision and solutions that Feds have for developing sustainable housing in the Waterloo region. The Student Accommodation Study Advisory Committee (SASAC) is made up of city residents, councillors, landlords, industry representatives, university administrators and university representatives from both campuses. Edey confidently stressed that “more lodging houses are not the solution for students, the community or the City of Waterloo.” A lodging house is loosely defined as a single, detached home, usually divided into various rooms for student subletting purposes. “Lodging houses are the least safe, more expensive in terms of utilities and are often located far from school, transit lines, shopping and other amenities that students desire,” outlines Edey’s report. So, if lodging houses are evidently not the solution, what is? The Feds believe that efforts would best be directed at the Lester-Sunview neighbourhood . This neighbourhood, restricted in the north by Columbia, in the south by University, and in the east-west by King and Philip, respectively, is noted for its close proximity to both universities and especially for its high concentration of lodging houses. See HOUSING, page 5

PHOTO COURTESY OF KEVIN STEWART

The Waterloo Fire Department's newly established hazardous materials response unit conduct a mock drum spill in conjunction with UW’s Spill Team near the ESC loading dock. The exercise was conducted with the assistance of the chemistry department and UW Police during Reading Week to minimize disruption of campus services.


page two

FRIDAY, FEBRUARY 20, 2004

2

Neal Moogk-Soulis

1

CROSSWORD

It’s Reading Week. What are you still doing here? by Durshan Ganthan and Dan Micak

“I’m in the math faculty.” Vicki Iverson 3A computer science

“I’m filling out job applications and waiting for my girlfriend.” Jacob Wibe 2B honours economics

Across 1. Vaulted church recess 5. Hit with an open hand 9. African-American rights group 14. A meaningless interruption 15. A puff of marijuana 16. Give qualities to 17. Indonesian island east of Java 18. Death biography 19. The origin of bovine milk 20. Things out of harmony with time 23. Japanese penny 24. Take in solids 25. A British mid-afternoon meal 26. Canadian rail company 29. Crux of the American Revolution 33. Shopping list contents 34. Used to dye cheese orange 35. A good chunk of English literature 38. Feminine Chinese principle, partner to yang 40. Inside information like dirt 41. Get to the destination 44. A judge’s hammer 47. In interest in matters at hand 51. Our timezone 52. There’s a musical about a cat on this type of roof 53. The first name on the Needles Hall sign 54. Buy low, sell high 56. Sold for one-a-penny or two-apenny 59. Second generation Japanese 62. First-rate February 13 solution

“I’m an engineer and I’m stuck here.” Brandon Hipel

“I’m working ‘cause we love math and engineering.” Becky Wroe

1B computer engineering

4A honours science

“Showing off my iron ring.” Kyle Hsiao

“I had no ride home.” Kyle Biernaski

4B engineering

2B English literature

“That’s a good question...” Joe Bilton

“My family lives here.” Conrad Hipel

4B mechanical engineering

3B religious studies

M A M A

O R A L

S L E D S

E E R I E

P R A M

L A V A

V I R G I N I A C R E E P E R

E F C A C T E R N H A E V A I S S T A U M S T A L T H O G E A R N S

L A M S E L I A A I R N M A C L E T E N A N T T A L K R U N Y L E C U E R A E N I E L A T E Y L O N

K O L A

S C L E R O M A

E M I N R U D G E

C H U R C H O F E N G L A N D

A O N E

D U A L

A C A R I

S O R E L

E T U I

R E S T

A familiar face to those who visit the SLC and see her at the Turnkey Desk, Niki Chinnick is this week’s Super Student. She is currently the Womyn’s Centre co-ordinator, an OCD

2

3

4

5

6

7

8

9

14

15

16

17

18

19

20

21

23

24 29

36

25

30

31

38 42

47

43

39 44

52

60

61

26

27

28

49

50

40 45

46

53

56 59

13

32

48

51

12

34

37

41

11

22

33 35

10

57

54 58

62

63

64

65

66

67

68

69

63. Norse mythology textbook 64. Tom Cruise in Mission Impossible 65. Rigging support 66. Canadian rebel 67. City below the castle, a market town 68. Snake-like fish 69. George Wendt where everyone knew your name Down 1. Former Palestinian PM 2. Avian alternative to trains or automobiles 3. Colourless gas prone to spontaneously combust 4. Word often used to describe Tolkien’s work 5. Prime warehouse use 6. Brain surgery 7. Blood relation 8. A very small woman 9. A-bomb mathematician 10. Multiple connectors 11. Basic math 12. Pool tool 13. For every one present 21. Test the weight 22. Watery bodily fluids

Don, and a Shadow Partner through the International Students’ Office. Niki is also a Big Sister tutor and a member of the UW Tutors Club, which enables her to volunteer

55

26. There are five on the UN Security Council 27. Do you really dig it? 28. Children’s spinning toy 30. A dog’s leash 31. A familiar Churchillian motion 32. Canadian tree 35. Lay down a road 36. Metal-bearing minerals 37. At a previous time 39. Any federal government program 42. Forbidding action 43. Make changes to a text 45. Could be like balladeers 46. Large chunks of time 48. If there happens to be a need 49. Artist’s workplace 50. Kindling 55. Sacred song 56. Listen 57. A strong cord 58. Swiss capital 59. A bird’s beak or a dog’s nose 60. The OJ judge, again 61. Asian last name with a link to footwear nmoogksoulis@imprint.uwaterloo.ca

regularly at St. David’s High School. Niki grew up on a farm in Dover Centre and is currently in her last term in the honours arts English literature program. She had an enjoyable trip to Mexico this past summer, although according to her, “going to Mexico is scary for a blonde.” For avid readers out there, Niki recommends reading Fall on your Knees by Ann-Marie Macdonald. She says it’s an incredible page-turner that’s kept her reading late at night four nights in a row, as she simply couldn’t put it down. Finally, as if her magnificent time-management skills weren’t impressive enough, she has yet another incredible skill to share with the rest of the world: she can clap with one hand! — Durshan Ganthan


NEWS

Imprint news

FRIDAY, FEBRUARYFRIDAY, 20, 2004 FEBRUARY 20, 2004

“Eeyy, how you do-in’?”

3

Engineers cut loose at Iron Ring celebration — page 5

news@imprint.uwaterloo.ca

Durshan Ganthan SPECIAL TO IMPRINT

Universities •

McGill University’s student union plans to build a gender-neutral, “barrier-free” washroom for transgendered students, students with disabilities and students with children. Similarly, a group of students at Simon Fraser University is looking into building singlestall, gender-neutral washrooms on every floor of every building on campus, in order to be inclusive to transgendered persons.

Universities in the Maritime region expect to lose roughly 55 per cent of current fulltime faculty within the next decade. Furthermore, many recent PhD graduates have chosen to go into the private sector or government jobs. As a result, the Maritime Provinces Higher Education Commission is warning universities to band together to recruit and retain faculty.

BIANCA TONG/REBECCA ZHOU

From left: Jeff Henry, Raveel Afzaal, John Andersen and Becky Wroe will be your next Feds representatives.

Feds election wrap-up Bianca Tong IMPRINT STAFF

Team Yellow crowned, Afzaal takes VPAF by 60 votes

The Yellow ticket of Becky Wroe, John Andersen and Jeff Henry swept the recent Federation of Students elections. The VPAF position was won by Raveel Afzaal. The following is a summary of the executive vote tallys. For complete result, visit imprint.uwaterloo.ca. No endowment fund for artsies this time

The referendum for the creation of the Arts Endowment Fund held during the recent Feds election was not deemed binding, as the majority vote did not attain the required seven per cent of the eligible voters. The AEF was nine votes short of attaining creation. Also on the ballot for arts students to vote on was the size of the refundable fee that would be contributed each term if the fund were created, ranging from $10 to $17. Arts is the only faculty to not have an endowment fund.

AEF Yes Committee fined for ill-timed endorsement

The Yes committee for the Arts Endowment Fund received a 15 per cent fine for e-mails sent out during the voting period by former committee chair Andrew Dilts. Dilts had sent out an email to various mailing lists encouraging arts students to vote in the AEF referendum, and

promoting the creation of the fund. Even though Dilts had resigned from the Yes committee before he sent out the offending e-mail, Referendum procedure states that “committees shall be liable for campaign violations, however occurring.” The fine resulted in a 15 per cent reduction of the Yes committee’s $500 spending limit.

SPECIAL TO IMPRINT

Feds president Chris Edey had excellent news to announce to patrons of the Bombshelter this week. The Bomber patio, which expanded its fences in November 2002, now has a licensed capacity of 375, up from 210. This is a result of UW’s renewal of its liquor licence with the Alcohol & Gaming Commission of Ontario (AGCO). “AGCO periodically reassesses capacity as part of the renewal process and discovered that the size of the Bomber patio allows for many more patrons than were previously permitted,” said Edey. The patio capacity increase, which takes effect immediately, is in addition to the Bomber’s indoor capacity of 373, bringing the total to 748. However Edey noted, “it is only relevant when

Media/I.D.A. Vision, one of the firms that figured in the federal sponsorship fiasco, has received commissions on federal advertisement contracts worth $576,000 since Paul Martin entered office on December 12. They are the sole exclusive buyer for the government ads and have received roughly $17,000 in commissions so far. Public Works Minister Stephen Owen, however, stated that the contracts have nothing to do with the sponsorship fiasco and that the latest contracts were awarded after competitive bids.

Danny Williams, premier of Newfoundland, has infuriated his MPPs with a casual comment made in a Maclean’s interview. Williams was asked: “there was a time when, late in a session, some legislators would be half drunk. Has that improved?” He replied, “No, now they’re completely drunk.” Percy Barrett, a Liberal member of legislature, is not amused and is considering legal action. He also explained that liquor is never consumed by MPPs when they are working on site.

btong@imprint.uwaterloo.ca

Feds election results! President Kevin Ma - 1022 Becky Wroe - 1479 Declined - 279 Turnout - 14.2%

Vice-President, Education Jeff Henry - 1364 Muneeba Omar - 1052 Declined - 181 Turnout - 13.3%

Vice-President, Administration & Finance Raveel Afzaal - 1141 Andrew Clelland - 1081 Declined - 355 Turnout - 13.2%

Vice-President, Internal John Andersen - 1457 Brent Taylor - 624 Declined - 306 Turnout - 12.2%

Bomber patio capacity up 80 per cent Shaun Slipetz

Canada

the patio is open. On cold days the patio is closed and capacity is restricted to what is allowed inside of the Bomber.” Edey predicted that this expansion will have a very favourable impact on students. “Many Bomber patrons expressed frustration during the fall term over the internal line-ups necessary to enter and exit the patio at busy times,” he explained. “The new expanded capacity will guarantee a much smoother flow of people onto and off the patio. Basically, it will translate into more capacity during the warmer months. This means more students on the patio with their friends and less students waiting in line.” Edey also hinted at further Bomber job opportunities, saying, “more patrons generally means more staff.” Also pertinent to Bomberites is the February 13 resignation of Feds VP administration and finance Dave Capper, whose responsibilities in-

cluded sitting on the Bar Directorate, a group that oversees the Bomber and Fed Hall. Edey said that he himself will be replacing Capper on the directorate. It is important to note that this liquor licence renewal is unrelated to the current mediation agreement between the Feds and the university. “The two issues are unrelated. We and administration are currently negotiating a new agreement to replace the interim mediation agreement and the previous agreements on Bomber and Fed Hall,” said Edey. Also in question during the Feds-UW dispute last year was the fact that UW, not the Feds, owns the liquor licence. When asked of this, Edey commented, “AGCO has approved of our current arrangement. While in the future the Federation may pursue its own licence, at present we are satisfied with the university holding the license.”

International •

Nearly 200 people were killed and hundreds more injured when a runaway train carrying chemicals and fuel derailed in eastern Iran. The incident occured when 51 freight trains began rolling without a conductor and picked up speed. The rail cars derailed and crashed and crews were sent to battle the small blazes that started. A deadly blast then erupted while crews were on the scene that killed firefighters, the governor general of the city of Neyshapur, an Iranian reporter on the scene and numerous curious onlookers.

More than 10,000 policemen were deployed in Manila to maintain the peace during a planned protest against the efforts to disqualify presidential frontrunner Fernando Poe Junior. Several lawyers are calling for his disqualification on the grounds that he is not a natural-born Filipino citizen. Said Poe, “The truth will come out. I am Filipino.”


Imprint news

4 )/(;<285 (175(35(1(85,$/086&/($7 8:,QQRYDWHÂśV7KLUG$QQXDO

%XVLQHVV6WDUW8S$'9$17$*( %RRW&DPS $SULOÂąWK#6W-HURPHÂśV&RQIHUHQFH&HQWUH DWWKH8QLYHUVLW\RI:DWHUORR

7KH %XVLQHVV 6WDUW8S %RRW &DPS LV D GD\ QLJKW LQWHQVLYH KDQGV RQ OHDUQLQJ H[SHULHQFH IRFXVLQJ RQ UHDO ZRUOG VWDUWXS DQG EXVLQHVV OHDGHUVKLSLVVXHV 0RUHGHWDLOV

KWWSZZZLQQRYDWHXZDWHUORRFDERRWFDPSKWP

 HQWUHSUHQHXUV DQG H[SHULHQFHG EXVLQHVV FRQVXOWDQWV ZLOO SUHVHQW DQG OHDG GLVFXVVLRQV RQ EXVLQHVV YHQWXUH ODXQFKLQJ LVVXHV 7DNH DGYDQWDJH RIWKLVLQFUHGLEOHRSSRUWXQLW\

)RUPRUHLQIRUPDWLRQFRQWDFW5HQpHRU$QDDW [(PDLO LQIR#LQQRYDWHXZDWHUORRFDGURSE\WKH8:,QQRYDWH RIILFH LQ&3+5RRP$

FRIDAY, FEBRUARY 20, 2004

The Feds in February A look at their monthly executive reports Andrew Dilts IMPRINT STAFF

It looks like it will not be a quiet goodbye for the current Feds exec. â&#x20AC;&#x153;I often looked ahead to the last three months of my term, hoping to enjoy some quiet and tranquility and to finish a few more projects before April 30; but, as events would have it, I will not get to enjoy that luxury.â&#x20AC;? These were part of current Feds president Chris Edeyâ&#x20AC;&#x2122;s opening remarks in his monthly executive report to studentsâ&#x20AC;&#x2122; council. In addition to the heavy workload usually taken on by the Feds, this yearâ&#x20AC;&#x2122;s student leaders are burdened with extra responsibilities that resulted from VP administration and finance Dave Capperâ&#x20AC;&#x2122;s resignation, effective February 13. Part of Edeyâ&#x20AC;&#x2122;s executive report dealt with a set of student housing recommendations. As part of his report, Edey noted that the ideal â&#x20AC;&#x153;long term vision [â&#x20AC;Ś] is the creation of a revitalized mediumdensity neighbourhood in this area, which would provide students with safe, close, appropriate and affordable accommodations.â&#x20AC;? Also on Edeyâ&#x20AC;&#x2122;s agenda is working on a comprehensive agreement with UW for the management of the Fedsâ&#x20AC;&#x2122; bars. â&#x20AC;&#x153;The mediation agreement is meant to be temporary,â&#x20AC;? stated Edey, â&#x20AC;&#x153;and the intention always was to see how everything worked under the mediation agreement and follow it up with a comprehensive agreement. This is the last step in formalizing the management of the bars. The current arrangement is working out well so we

are planning to build a fair and balanced agreement on the principles of the mediation agreement.â&#x20AC;?

â&#x20AC;&#x153;[The] long-term vision [â&#x20AC;Ś] is the creation of a revitalized medium-density neighbourhood in this area.â&#x20AC;? â&#x20AC;&#x201D; Chris Edey Feds president In the vice-president internalâ&#x20AC;&#x2122;s executive report, John Fedy noted the recent successes of the regular Feds initiatives, notably Clubs Days, the Volunteer Fair and Cultural Caravan. Referring to this last initiative, Fedy noted, â&#x20AC;&#x153;Yet again, this yearâ&#x20AC;&#x2122;s Cultural Caravan has gone above and beyond everyoneâ&#x20AC;&#x2122;s expectations. [There were] a full four hours of entertainment and free food in the SLC.â&#x20AC;? On his to-do list, Fedy stated he was working with UW Student Life Coordinator Heather Fitzgerald, attempting to increase funding for Warrior Weekends. Warrior Weekends are a joint initiative between the Feds and UW, programming that brings such activities as movie nights and salsa dancing lessons to the Student Life Centre on a monthly basis. â&#x20AC;&#x153;In order to continue to move Warrior Weekends forward and to increase what these weekends can offer

students,â&#x20AC;? commented Fedy, â&#x20AC;&#x153;we need to take the next step which is increasing the funding and preparing a budget, so this program has the direction to move forward and improve.â&#x20AC;? Fedy also commented on his extra responsibilities. â&#x20AC;&#x153;My work load has increased quite a bit with Dave Capperâ&#x20AC;&#x2122;s resignation,â&#x20AC;? stated Fedy, â&#x20AC;&#x153;but I am confident with the support of the Feds staff and my fellow executive that this load will not be that heavy of a burden on me.â&#x20AC;? Edeyâ&#x20AC;&#x2122;s report greatly agreed with Fedyâ&#x20AC;&#x2122;s evaluation, noting that some of the current Fedsâ&#x20AC;&#x2122; issues may remain unaddressed by the end of their term. On the list of the projects already dropped by the Feds include a residence design competition and addressing the issue of refundable fees, both initiatives in the presidentâ&#x20AC;&#x2122;s portfolio. â&#x20AC;&#x153;Although these issues are not unimportant,â&#x20AC;? stated Edey in his announcement to council, â&#x20AC;&#x153;they do not share the same level of priority as some of the other projects I am working on.â&#x20AC;? In his exec report, Fedy offered words of support for the outgoing Feds VPAF. â&#x20AC;&#x153;I wish Dave Capper luck in all his future endeavours and support the decision he has made.â&#x20AC;? Showing the solidarity that has been characteristic of this yearâ&#x20AC;&#x2122;s Feds executive, Edey once again agreed with Fedy. â&#x20AC;&#x153;I feel good for Dave, itâ&#x20AC;&#x2122;s a great opportunity for him. It presents us with some challenges, but we can work them out.â&#x20AC;? Current vice-president education Liam McHugh-Russell did not provide an executive report this month, and was unavailable for comment. adilts@imprint.uwaterloo.ca

Are UHIP to be square? A look at what is (and is not) covered under UWâ&#x20AC;&#x2122;s health plans

:HOFRPHWR 8QLYHUVLW\6KRSV 'HQWDO&OLQLF 1HZ3DWLHQWV:HOFRPHa:DONLQ (PHUJHQFLHV $OO\RXUGHQWDOQHHGVLQDFRPIRUWDEOHDQGUHOD[LQJ DWPRVSKHUH 'U:DOO\$NNLOD''6

8QLYHUVLW\$YH::DWHUORR FRUQHURI3KLOOLS 8QLYHUVLW\

$VNXVDERXWRXUVWXGHQWGLVFRXQW

Nasiha Prcic SPECIAL TO IMPRINT

Just as each new term brings a new tuition payment, each new tuition payment brings a new payment to the Student Supplementary Health Insurance Plan (SSHIP). And for international students, each new term also brings a new payment to the University Health Insurance Plan (UHIP). So, to what kind of health plan(s) are we dishing out our $25.85 (or $48.42 for co-op students, or more for students also paying for UHIP) each term, and just what, exactly, are UW students getting out of their insurance? SSHIP is a mandatory health insurance plan under which all registered full-time students must be covered, unless they are receiving comparable coverage from another plan. Under it, students are provided with coverage for prescription drugs and extended health care not provided by the Ontario Health insurance Plan (OHIP), along with unique features not offered by other plans. These unique features include the

dispensing of free birth control pills, some prescription immunization by UWâ&#x20AC;&#x2122;s Health Services and out-ofCanada coverage lasting 150 days (as opposed to the standard 60 days provided by other plans) for those students participating in work terms or exchange programs outside the country. The supplementary health plan also includes a managed drug formulary, under which most prescription drugs and injectable immunizations are covered, including insulin, most oral contraceptives and preventive vaccines. The formulary, however, does not cover items such as over-the-counter drugs. The extended health care benefits provided by the health plan constitute expenses that are necessary for the treatment of a disease or an injury, and almost always have to be prescribed by a physician. These expenses include, among other things, a dental surgeonâ&#x20AC;&#x2122;s services in repairing externally caused injuries to teeth, x-ray examinations and the provision of hearing aids and crutches. Expenses not covered under the

plan are considered to be expenses one would be expected to prepare for, including dental care for reasons other than injuries or fractures to teeth (although UW students are eligible for a discount on dental care from certain practices in the K-W area), costs for items used for athletic use only (including crutches and braces) and costs for out-of-province elective treatment or surgery. Unless youâ&#x20AC;&#x2122;re a grad student, vision care is not covered either, but all UW students can receive a discount on glasses or contact lens fitting at the UW School of Optometry. In addition to SSHIP, international students must also pay for UHIP. UHIP basically mirrors OHIPâ&#x20AC;&#x2122;s coverage plan to residents of Ontario, paying for costs such as doctor visits and hospitalization for medically required treatments or procedures. It also mirrors OHIP in what coverage it does not provide, such as prescription drugs and dental care. UHIP costs vary, depending on whether or not the student has dependents living with him/ her, but they are in the hundred- or possibly thousand-dollar ranges.


Imprint news

FRIDAY, FEBRUARY 20, 2004

Here’s looking at you

5

Arts endowment quirks Ryan Chen-Wing UWRYAN . COM

BIANCA TONG

Graduating engineering students revel in their finery at POETS on the day of their Iron Ring ceremony. The Iron Ring is a Canadian tradition for engineers established in 1922 that, by the request of British writer Rudyard Kipling, cannot be celebrated outside of Canada. For UW engineering students, this means dressing in the wackiest costumes possible, which are later ripped off at the Iron Ring Stag party until a black garment is found.

Housing: a struggle to stop lodging houses in K-W Continued from cover

It is here where Edey suggests that “townhomes, small walk-up apartments and larger developments along the line of WCRI” be created. The SASAC’s primary concern seems to be one of a pre-emptive attack. It does not see the current student housing situation as one in crumbles; rather, it wants to develop a long-term, coordinated and well-researched plan to, as one representative of industry pointed out, prevent a Regent Park-like result. Moreover, City of Waterloo Planner Dan Currie outlined the importance that nearby and excellent student accommodations play in continuing to attract students to the universities. Other SASAC representatives were quick to point out what the Feds’ report failed to address. A gentleman

spoke on behalf of Laurier administration and noted the trend that many upper-year and graduate students do not want to live in residence-style accommodations; they tend to prefer more spacious apartments and perhaps even detached lodging houses. Members of the committee responded to this by saying that this market desire needs to be addressed with developers to add flexibility into their designs. It was also noted that by creating a more centralized student population, referred to as a student precinct, in the LesterSunview area, it would open up other areas around the city for these upperyear students and single families to gravitate towards. Also of concern to the city’s plans, although not addressed in the meeting, is the unique nature of UW due to its co-op system. With students com-

ing into and out of the city in fourmonth intervals, most students would agree that signing 12-month leases and looking for subletters is not a burden they wish to shoulder. This unique aspect brings into question any research taken from similar university towns. Included in Edey’s research was a door-to-door survey of the LesterSunview area to assess the people’s take on housing plans. He says the community reaction to his plans are “mixed.” For the most part, the SASAC representatives agreed with Edey’s report and viewed it as a stepping stone for further discussion and direction. The SASAC meets on the third Wednesday of every month, from 7-9 p.m. at the Waterloo Memorial Recreation Complex, in Room 200, with the next meeting being held on March 17. Meetings are open to the community.

While the possible Arts Endowment Fund did receive a majority of votes cast in the referendum held with Feds elections last week, it failed to get a binding result. Feds referendum procedure requires that a certain percentage of the electorate vote in favour of the question for it to be binding. The question asked was if students would be in favour of an endowment fund to be paid by all undergraduates. There were some unusual circumstances around the referendum. There were far fewer votes cast in the referendum than in the arts regular councillor race even though arts regular is a subset of arts. Arts regular does not include arts co-op students and students in arts at St. Jerome’s and Renison. That council race had 3,227 possible voters and saw 759 voters show up compared to the referendum with 5,237 potential voters and 547 voters turnout. The campaigning was irregular. The yes side spent only $8 campaigning out of a possible $500. Yes side campaign chair Andrew Dilts tried to resign after

campaigning but before voting to avoid policy restrictions on campaign chairs. It was particularly myopic of the Referendum Committee to accept such a resignation, since there are no provisions for a chair leaving his position part way through the process. The yes votes more than doubled the no votes, but the yes side fell nine votes short of being binding. This is much different from the results of the referendums creating the first studentcontrolled endowment, the Waterloo Engineering Endowment Foundation (WEEF). In those two referendums held on the two co-op streams, more than a third of all engineering students voted in favour of WEEF. On EngSoc B students voted 94 per cent in favour of WEEF with a 36 per cent turnout and on EngSoc A passed it with 95 per cent in favour and a 40 per cent turnout. The referendum questions need improving. The first question did not mention that the fee would be refundable — a significant fact in this process. What can we learn from this? Some students in arts would rather vote for their friends than vote on something that will benefit arts students now and in the future. Given the stakes, $8 is far too little to spend on a campaign and there is no great penalty from Feds for being conniving. Arts undergraduates are lacking in community and communication. rchen-wing@imprint.uwaterloo.ca

Empower Your Degree

Humber Postgraduate Programs • Open to university and college grads • 8 or 12 month programs • Job placement opportunities

See us on campus Feb. 26th

• Career-focused

Classes start Fall 2004 postgraduate.humber.ca 416.675.5025


OPINION 6

Imprint opinion

FRIDAY, FEBRUARY 20, 2004

Imprint is published by Imprint Publications Student Life Centre 1116 University of Waterloo Waterloo, ON N2L 3G1

A national crisis worth talking about Christine Baker FACTS OF LIFE Our health is important to us. We spend a great deal of time and money to make sure that, as a society, we are healthy and alive. Throughout childhood and adolescence, we are routinely screened for such non-life-threatening conditions as hearing and vision problems, we are immunized against obsolete diseases and doctors make sure we are growing tall enough. Threats on our lives, like the risks of driving in a car, have been addressed. Thanks to engineering marvels like air bags and new side panels, ad campaigns designed to prevent drunk driving and speeding and the fact that wearing our seat belts has been hammered into our subconscious, the number of motor vehicle fatalities has continued to drop since the early ‘80s. In 1981, almost 3,600 people died in car accidents. In 2001, that number was down to 2,400. Society is doing a

good job of protecting itself, right? Last year alone, over 4,000 Canadians took their own lives. Since the early ‘90s, there have been more suicides than road fatalities. Way more. In 1994, there were 37 per cent more. And this isn’t just because road fatalities are going down. According to Statistics Canada, between 1997 and 1999 there was a 10 per cent increase in suicides across Canada from 3,681 to 4,074. To put these numbers into perspective, suicide is the leading cause of death for men aged 25 to 29 and for women aged 30 to 34. It is the second leading cause of death among 15 to 24 year olds. Really think about that. Why aren’t we discussing the fact that over 23,000 Canadians are hospitalized every year for attempting suicide? Studies indicate that more than 90 per cent of suicide victims have a diagnosable psychiatric illness such as depression. As much as 80 per cent of young people with mental illnesses are undiagnosed, their symptoms passed off as part of being an adolescent. What bothers me is that despite

the fact that this is clearly a huge problem, I have never seen a campaign aimed at informing people about how to identify signs of depression in others, we are not routinely screened for mental illnesses and the issue is rarely discussed by society. Why aren’t we educated about this the same way we are about road safety, STDs or West Nile? Why don’t we talk about depression and suicide? It certainly isn’t because it isn’t common. In 2001, over 7 per cent of the population aged 12 or older had experienced major symptoms of depression. Across age groups, the incidence of depression peaked at 9.6 per cent among those aged 20 to 24. How can we spend so much effort preventing car fatalities and so much time screening for non life-threatening conditions and virtually ignore a disease that costs thousands of Canadians — primarily young Canadians — their lives? We need more education, more prevention and a better understanding in order to bring down these numbers too. editor@imprint.uwaterloo.ca

Gabe Kempe

IN SEARCH OF

Friday, February 20, 2004 — Vol. 26, No. 26 Student Life Centre 1116 University of Waterloo Waterloo, ON N2L 3G1

Editorial Staff Editor-in-chief, Christine Baker editor@imprint.uwaterloo.ca Assistant Editor, Lauren Breslin Cover Editor, Dan Micak News Editor, Bianca Tong News Assistant, Mark Stratford Opinion Editor, Sarah Allmendinger Opinion Assistant, Phil Weiner Features Editor, Tim Alamenciak Features Assistant, Sarah Lau Arts Editor, Matt Charters Arts Assistant, Garick Stevenson Science Editor, Eli Denham Science Assistant, Azadeh Samadi Sports Editor, Adam McGuire Sports Assistant, Rod McLachlan Photo Editor, Margie Mansell Photo Assistant, Rebecca Zhou Graphics Editor, Julian Apong Graphics Assistant, Jeff Tran

Web Editor, Matt Lee Web Assistant, Hitoshi Murakami Systems Administrator, Ross Jordan Systems Assistant, Matthew Cheung Lead Proofreader, Dean Whelton Proofreader, Jonathan Chiu Proofreader, Kristina Jarvis Proofreader, Simon Yarrow Proofreader, vacant Office Staff General manager, Catherine Bolger cathy.bolger@imprint.uwaterloo.ca Advertising & production manager, Laurie Tigert-Dumas ads@imprint.uwaterloo.ca Advertising assistant, vacant Distribution, Hitoshi Murakami Distribution, Chandra Mouli Volunteer co-ordinator, vacant

FRIDAY, FEBRUARY 20, 2004

The Martin saga MICHAEL MCCUBBIN

There exists an unspoken, unwritten rule in politics; that you can be a blundering fool, but as long as you’re honest or not perceived to have malicious intentions, your political career will live to see another day. In the past, the Canadian polity has proven this rule to be true. The two most recent examples that come to mind are Jean Chretien and Brian Mulroney. Chretien’s political career is plagued with bungling mistakes, places where he stuck his neck out only to have his head chopped off. But never, as Joe Clark put it on Chretien’s final day in Parliament in 2003, did anyone ever question his patriotic commitment to Canada. Brian Mulroney on the other hand, couldn’t even convince his own aides that he wasn’t out to rob the country blind. On February 10, Auditor-General Sheila Fraser released a report trashing the government’s accountability over a federal sponsorship program. The program in question was meant to inject $250 million into Quebec to demonstrate the importance of Confederation. The end result it now seems, is that 40 per cent of this amount was instead illegally channeled to Liberal-connected middlemen in return for little or no work. No documentation was provided for these amounts, or if such documentation existed, it was destroyed. Chretien’s mess has now fallen on Martin’s lap. Will history absolve Chretien? Will Martin? Or will Chretien’s part be ignored while Martin’s public approval ratings evaporate? More than just time will tell, but Martin’s electoral success as prime minister will depend on how he handles it personally.

It is clear that the program was poorly managed. It seems clear to all, with the obvious exception of the opposition parties, that former Public Works minister Gagliano was at the forefront of this operation, not Martin or Chretien. But before Chretien is judged for throwing Liberal shit into the Tory fan, it is unreasonable to suggest that Chretien had any malevolent intentions in his sponsorship program. Chretien would give his own life before he saw Canada be divided. In the timeframe of most student’s lives, he went to battle for King and Confederation in 1980, 1982, 1984, 1990, 1993, 1995, 1997 and again in 2000. If you think that Chretien had no grounds for promoting Confederation in Quebec, you were never the only English kid on your hockey team while growing; you didn’t sit in your living room on the evening of October 30 1995, watching the Sovereignists gather 40 per cent of the popular vote after 70 per cent of ballots were in whilst the PQ aristocracy drank fine French wine to excess; you didn’t see the end result: 50.6 per cent to 49.4 per cent for the ‘No’ vote; you didn’t see Separatists damn the federal government when they footed 60 per cent of the 300 million dollar bill for floods on the Saguenay River in 1996. Quebec is not a foreign land, but it is a distinct society that occasionally forgets how fourtunate it is to be part of Canada. Whatever effect the sponsorship program had on the Separatist movement, I can tell you that FLQ supporters and those shouting ‘vive le Quebec libre!’ are today a minority in Quebec. As for the finance minister , forget his intentions for the time being. Opposition critics are quick to suggest that Paul Martin either knew about illegal payments taking place, or that he shouldn’t have been in charge of the finance ministry in the first place. See MARTIN, page 9

tion without share capital. Imprint is a member of the Ontario Community Newspaper Association (OCNA).

be libelous or in contravention with Imprint’s policies with respect to our code of ethics and journalistic standards. Imprint is published every Friday during fall and winter terms, and every second Friday during the spring term. Imprint reserves the right to screen, edit and refuse advertising. Imprint Publications is not responsible for advertisng mistakes beyond the cost of the advertisement. One copy per customer. Imprint ISSN 0706-7380. Imprint CDN Pub Mail Product Sales Agreement no. 40065122.

Production Staff Arda Ocal, Gopaul Deosaran, Elizabeth Marton, Ernie Lau, Nasiha Prcic, Durshan Ganthan, Simon Grubb, Jeremy Hilliker, Michael L. Davenport, Adrian I. Chin

Editorial submissions may be considered for publication in any edition of Imprint. Imprint may also reproduce the material commercially in any format or medium as part of the newspaper database, Web site or any other product derived from the newspaper. Those submitting editorial content, including articles, letters, photos and graphics, will grant Imprint first publication rights of their submitted material, and as such, agree not to submit the same work to any other publication or group until such time as the material has been distributed in an issue of Imprint, or Imprint declares their intent not to publish the material. The full text of this agreement is available upon request.

Imprint is the official student newspaper of the University of Waterloo. It is an editorially independent newspaper published by Imprint Publications, Waterloo, a corpora-

Imprint does not guarantee to publish articles, photographs, letters or advertising. Material may not be published, at the discretion of Imprint, if that material is deemed to

F: 519.884.7800 P: 519.888.4048 imprint.uwaterloo.ca

Board of Directors board@imprint.uwaterloo.ca President, Andrew Dilts Vice-president, Matt Strauss Treasurer, Neal Moogk-Soulis Secretary, Michelle Titus Staff liaison, Mike Kerrigan staff.liaison@imprint.uwaterloo.ca Production assistant, Andrea Kerswill

Next staff meetings: Monday, February 23 12:30 p.m., SLC 1116 Next production night: Wednesday, February 25 5:30 p.m., SLC 1116


Imprint opinion

8

FRIDAY, FEBRUARY 20, 2004

Donâ&#x20AC;&#x2122;t spend your week reading Educational choice Arda Ocal OUR HOUSE Ah, reading week. For many of us, this means one whole week of bliss, lying drunk and naked on a beach full of other naked students somewhere south (but you couldnâ&#x20AC;&#x2122;t remember where at the time.) The past few days have been a haze of loud music, drinking games and playing that wonderful game of â&#x20AC;&#x153;whose bed is it anyway?â&#x20AC;? You now return, with sporadic memories, a race-transcending tan and a sense of refreshment. I canâ&#x20AC;&#x2122;t stand people like you; well, thatâ&#x20AC;&#x2122;s because I am jealous of you. Here I sit, Monday night, with a pasty white body, knowing full well which bed I will sleep in tonight. I, like my math and engineer friends, do not get a reading week, but a reading â&#x20AC;&#x153;two days.â&#x20AC;? Whatâ&#x20AC;&#x2122;s worse is that we in coop donâ&#x20AC;&#x2122;t get the week off anyway â&#x20AC;&#x201C; so

really, itâ&#x20AC;&#x2122;s all a big salacious reading week tease (leaving us nerds with a bad case of â&#x20AC;&#x153;blue books.â&#x20AC;?) Truthfully, if I really wanted to go to Daytona during reading week, I would have. But I never did. Something else was holding me back and I never wanted to admit it (itâ&#x20AC;&#x2122;s like the glove fit and everybody knew that I did it, but my lawyer got me out of doing life for it.) When I think about it, reading â&#x20AC;&#x153;two daysâ&#x20AC;? is only an excuse to mask my true inhibitions to vacationing while in university. My biggest scare in committing to a vacation was looking at my steady, single digit bank account balance. I never thought I had the money to do it. Sure, co-op pays for school, but thatâ&#x20AC;&#x2122;s about all. Unless you start saving in first or second year (or have an angel investor), you wonâ&#x20AC;&#x2122;t be able to take that vacation youâ&#x20AC;&#x2122;ve always wanted. Also, I always thought that co-op would take me some place exotic (and it did - I never knew the math building had a sixth floor.) Maybe I meant someplace warm.

In consolation to my sanity, this year Iâ&#x20AC;&#x2122;ve decided to finally break my reading week virginity and party in Montreal for the long weekend. Itâ&#x20AC;&#x2122;s not Girls Gone Wild, but itâ&#x20AC;&#x2122;s something (â&#x20AC;&#x153;Fou Filles?â&#x20AC;?). Thinking about it, itâ&#x20AC;&#x2122;s going to make me feel better. I havenâ&#x20AC;&#x2122;t really been outside Toronto/ Waterloo since first year and Iâ&#x20AC;&#x2122;m salivating at the lips to get to Montreal. Maybe it worked out for the better in the end; it will cost me less than half as much to enjoy Montreal. Iâ&#x20AC;&#x2122;ll get to watch a Leafs/Habs game in Montreal. Iâ&#x20AC;&#x2122;ll even get to visit SuperS â&#x20AC;&#x201D; see some super scenery. And I will be prepared to stand up to those braggers fresh from the â&#x20AC;&#x153;dirty south,â&#x20AC;? armed with memories of me and the land of the â&#x20AC;&#x153;Fleurs De Lis.â&#x20AC;? Iâ&#x20AC;&#x2122;m glad I finally took the step to get myself out of Ontario while in university, no matter where it is. And by the way, glow in the dark skin is back in style again. So kiss my polar bear headlights white keys on a piano vanilla ice cream printing paper pallid white butt! aocal@imprint.uwaterloo.ca

The benefits of being a selfish flake Mark Stratford BIG EARS BURNING Iâ&#x20AC;&#x2122;ve got something very important to say this week, but before I can begin I should really organize all my thoughts into groups and compose a structure for my arguments. Nah, wait, I take that back. I want to be vague, to zone out, to divert from points when least expected and steer the conversation to a place it has no business being. I want this column to wind up as disjointed and stream-of-consciousness as a Courtney Love lyric sheet. I could have started writing this last night, but I had a powerful urge to take a bus down to Kitchener City Hall and write some poetry while watching the lovers and the small children skating on the frozen fountain. In other words, I was selfish. Selfish selfish Mark! Iâ&#x20AC;&#x2122;m sorry and I must be reprimanded. Unfortunately, like too large a number of UW students, I am by nature an organized person. Whatâ&#x20AC;&#x2122;s more, I am over-organized: I never go anywhere without a personal planner, a list of a million errands to perform runs through my head every day and I have the first five years of my postacademic life neatly written out on 8.5 x 11 inch paper in permanent ink. And it sucks balls. After three years of scheduled education, I often find that I want to abandon all my daily responsibilities â&#x20AC;&#x201D; and, should I fail to enter my planned career and somehow tumble into the glamourous worlds of making subway sandwiches and peddling dope, Iâ&#x20AC;&#x2122;m sure Iâ&#x20AC;&#x2122;ll have all the time I need to cater to my own whims. University, however, doesnâ&#x20AC;&#x2122;t work that

way. As I get older and keep cramming new impulses into my vastly expanding id, I have accepted the fact that university requires a high degree of determination and organization to be worth a damn to anyone. Iâ&#x20AC;&#x2122;ve also accepted that university, in all its wisdom, likes to make complete organization excruciatingly difficult for students to achieve. Iâ&#x20AC;&#x2122;m not talking about assignments; Iâ&#x20AC;&#x2122;m talking about the little things that in theory appear trivial but in practice cost some students both time and money. For example, I am a professional writing student, which means I have several electives to satisfy, all of which are very hard to select from one-sentence blurbs in an undergrad calendar. Then, by the time Iâ&#x20AC;&#x2122;ve sampled enough of my classes (between my Imprint duties, that is) to make my final choices, it is too late to return any books I may have purchased in haste or to drop any unnecessary courses without financial penalty. I wonâ&#x20AC;&#x2122;t even go into the misadventures Iâ&#x20AC;&#x2122;ve experienced using Quest, other than to say that my undergraduate advisor sees me at least once a term, knows what I take in my coffee and thinks I have acute schizophrenia. Donâ&#x20AC;&#x2122;t get me wrong â&#x20AC;&#x201D; Iâ&#x20AC;&#x2122;m not blaming all my academic problems on UW. But is it really practical for a school that is only responsible for teaching me to string two words together (and that already has my money for the privilege) to also teach me to make every single decision a snap judgement with extremely negative consequences? No, itâ&#x20AC;&#x2122;s not. Itâ&#x20AC;&#x2122;s not practical for them to teach me to be punctual, either, which brings me to my ultimate pet peeve: professors who grade students on attendance and participation. Fuck it! I have a responsibility to my student newspaper, just as all students have a re-

sponsibility to something outside their classrooms that could assist in their careers or personal lives later on; we canâ&#x20AC;&#x2122;t be organized all the time, and we canâ&#x20AC;&#x2122;t be accounted for all the time. Profs have every right in the world to be upset by this, but absolutely no right to make us feel guilty about it. We all do the very best that our psyches allow us to. And if I rebel where I can â&#x20AC;&#x201D; such as by writing a paper in one long, two-bite-brownie fuelled evening after several weeks of reviewing the details of the assignment over pints at the Bomber â&#x20AC;&#x201D; I do not want to be called on it. The next time I am back in Burlington with the family and my â&#x20AC;&#x153;druncleâ&#x20AC;? Steve asks me: â&#x20AC;&#x153;So, Mark, I guess you donâ&#x20AC;&#x2122;t get much work done at Waterloo, eh?â&#x20AC;? I will reply with the following: â&#x20AC;&#x153;No, I donâ&#x20AC;&#x2122;t. I donâ&#x20AC;&#x2122;t get anything done in Waterloo. The doctors think it might have something to do with my clinical depression and my traumatic stress disorder. Still, I soldier on. Ho hum. By the way, I hear aunt Connie is banging a black guy.â&#x20AC;? Hey, you invite me to Thanksgiving, you live with it. Iâ&#x20AC;&#x2122;m not advocating laziness or apathy; Iâ&#x20AC;&#x2122;m advocating the slightest touch of spontaneity and self-absorption to help make the mannerisms palatable. Iâ&#x20AC;&#x2122;ve seen many students spend too much time partying and flunk out, but Iâ&#x20AC;&#x2122;ve also seen many of them sacrifice a lot of fun times and a lot of personal growth for a snatching grab at the deanâ&#x20AC;&#x2122;s list. Personally, I cannot imagine the university experience without procrastination, lapses of empty-headedness and the occasional day to myself. My profs, on the other hand, can hopefully imagine something else entirely: a classroom without me. mstratford@imprint.uwaterloo.ca

Liberal decision to cancel private school tax credit limits academic options

Mike Kerrigan SOBER THOUGHTS One of the few promises that the Liberal party didnâ&#x20AC;&#x2122;t break when they assumed office in Ontario was their commitment to cancel the private school tax credit the previous Progressive Conservative legislature had begun to phase in. Throughout their campaign the partyâ&#x20AC;&#x2122;s leader portrayed the tax credits â&#x20AC;&#x201D; which would have refunded half of parentsâ&#x20AC;&#x2122; tuition costs up to a maximum of $3,500 when fully implemented â&#x20AC;&#x201D; as a handout to rich elites that undermined public education. In reality, the tax credits most benefit middle and lower income families and were an important first step towards creating a more diverse and revitalized education sector in Ontario. It is a widely held misconception that most children in private schools come from a privileged background. According to Statistics Canada a similar number of children from homes with family incomes above $100,000 attend private school compared to those with family incomes below $50,000. About a quarter of the total number of students enrolled in private schools come from each group. For those parents who have to make significant sacrifices to put their children through private school while simultaneously supporting the public system through their taxes the tuition credits are no handout, they are a justified and sometimes necessary relief. For other parents who could not afford private school unassisted, the credits represented an opportunity to have a real choice in their childrenâ&#x20AC;&#x2122;s

education for the first time. The â&#x20AC;&#x153;rich elitesâ&#x20AC;? so maligned by the Liberals actually benefit the least from the program because they can afford to send their children to a school of their choice regardless of the governmentâ&#x20AC;&#x2122;s support. Regions that have gone further and adopted fully funded private school vouchers and independent charter schools lay claim to the notion that the public school system is weakened when parents have the freedom to send their children elsewhere. In Alberta, where the government supports a limited number of charter schools and partially funds private and home schooling, the province consistently scores at the top of national achievement tests. Faced with competition and surrounded by a large number of innovative educational approaches, the public school system responds by adopting some of the best practices of the independent schools and ultimately provides better education to students. If the strength of â&#x20AC;&#x153;public educationâ&#x20AC;? is narrowly defined by the number of students enrolled in government-run schools and the commensurate amount of funding the schools thereby receive, then school choice can be seen as a serious threat. But if the importance of the government providing access to a service can be separated from the notion that the government must also perform that service, then the definition can be expanded to include all schools that the government makes freely available to the public. By utilizing school vouchers or educational tax credits to offer educational choices to parents who otherwise would have none, a more diverse, innovative and high quality school system is created than the government could provide alone. mkerrigan@imprint.uwaterloo.ca

$:$5' :,11,1* )$&725< 75$,1(' $&85$ 7(&+1,&,$16

)$,59,(:$&85$ .,1*6:$<'5,9(.,7&+(1(5

 

www.fairviewacura.com


Imprint opinion

FRIDAY, FEBRUARY 20, 2004

Same-sex marriage Conservative: divided views Continued from page 7

Currently the government provides a number of rights and benefits to married couples that originate in the role of the welfare state, not in the institution of marriage. In this view, the extension of those rights to any coupling of people is just; the government should not favor one type of couple over another. Similarly, it should be left to churches or other social institutions to lend legitimacy to marriage. It is not important that the government recognize gay marriages so long as it provides the same benefits to all couples. This could either be done by leaving the traditional institution of marriage in law and creating a special category of â&#x20AC;&#x153;civil unionsâ&#x20AC;? for any non-traditional marriage or by eliminating marriage from law altogether and issuing civil unions to all joined couples. â&#x20AC;&#x153;Redâ&#x20AC;? conservatives are similar to social conservatives in the sense that they believe that government should be used in limited areas to try to promote a better society. In contrast to social conservatives, the social values that they focus on centre around

tolerance and acceptance of diversity rather than a set of particular moral beliefs. The issue of same-sex marriage is seen primarily as a social justice issue. From this perspective government should legally recognize same-sex marriages in an equivalent way to traditional marriages. No couple should be judged as inferior to another, so by having the government recognize same-sex marriages, it demonstrates that gay and lesbian couples hold an equivalent place in our society as other couples. The traditional institutions can choose whether or not they wish to recognize same-sex marriages, but the government should not discriminate by favouring their perspective. The variety of perspectives within the Conservative party makes it difficult for the party to promote any particular policy on same-sex marriage, but it does provide an opportunity for all sides of the issue to be explored. The one belief that all Conservatives share is that a free vote must be held in the House if and when legislation is brought forward. All MPs must be free to vote as their conscience dictates.

Liberal: in line with the people

9

8QLYHUVLW\9LVLRQ&HQWUH 

6HHL QJ,V %HOLH YLQJ 

Continued from page 7

Polls indicate that a slim majority of Canadians support same-sex marriage andthe same is true within the Liberal Party. Of the Liberal MPs who voted on said motion 65 per cent were against the traditional definition and in favour of same-sexmarriage. To mirror that stance, a recent Environics poll showed that only 43 per cent of Canadians oppose same-sex marriage. Canadians, the courts and the liberal party have decided to support marriage rights for same-sex couples. Like the caucus, liberal voters are deeply divided, with support for samesex marriage being weaker in the west and among elderly citizens. However, only 12 per cent of Liberal voters, according to an extensive CBC survey, oppose any form oflegal recognition for homosexual couples. Canada is an open-minded, progressive, tolerant country, and the liberal party of Canada is fully aware of the continuing trend. We will continue on thepath towards equality and tolerance of all citizens in our great nation.

%8<21(*(721(

)5((

(\HJODVVHV RU FRQWDFWV %X\RQHFRPSOHWHSDLURIH\HJODVVHVRUVRIWFRQWDFW OHQVHVDWUHJXODUSULFHDQGJHWDVHFRQGSDLU)5(( &RPHLQDQGVHHRXU ODUJHVHOHFWLRQRI GHVLJQHUIUDPHV

Peter Mackay and Stephen Harper seem to have little or no knowledge of basic science or mathematics, but letâ&#x20AC;&#x2122;s put it into terms that most UW students will understand. A Fraserâ&#x20AC;&#x2122;s report concludes, $100 million in illegal payments paid out over four years, equals $25 million annually in illegal payments. An intelligent person shouldnâ&#x20AC;&#x2122;t need to assemble to nationâ&#x20AC;&#x2122;s best accountants to know that it is inherently impossible for one (or even two people) to know about every single check that the government writes. The government writes 215 million separate checks every year and some of these illegal payments are alleged to have been made through Crown Corporations or other subsidiary bodies. Certainly Martin wouldnâ&#x20AC;&#x2122;t be able to account for 25 million particular dollars out of a $70 billion budget, $25 million that subordinate bureaucrats have good reason to hide. It is not reasonable to ask that of any person.

BAR FLIES

Yet the Opposition seems to think Martin to be incompetent for not being able to do so. Perhaps amid Blue criticism the Grits should be asking the Tories how such an incompetent, irresponsible, unaccountable and arrogant party is in its 12th consecutive year of rule. That doesnâ&#x20AC;&#x2122;t say much for Tory abilities. Yet, the events of the past week have done more than change Liberal plans of action. With the Tory leadership up for grabs, their focus has now shifted from finding a leader who can lead an opposition, to one who can dethrone Martin, as this now seems a realistic goal. Nonetheless, it would seem reasonable to only to the most optimistic Tories that a Conservative government could be reality within the calendar year. Without a suitable candidate in the field, one who is experienced, renowned and universally respected, the best Conservatives can hope for is a Liberal minority. Such a minority government would be something for which no Canadian should hope. A more radical party than the Lib-

erals would likely dissolve in months (or 100 days). But a party sitting conveniently in the middle can side with the left or the right as it sees fit to pass its bills. The result would still be lingering bureaucracy and indecision, a cost to all of Canada. Such speculation is irrelevant without knowing when Parliament will dissolve prior to elections. It is safe to say Martin will wait until a Conservative leader has been chosen and the judicial inquiry has been made public to call an election. Holding federal elections before either event would not win public favour. It will be the outcome of both, as well as Martinâ&#x20AC;&#x2122;s ability to improve his credibility that will decide whether history will absolve him. If the unspoken, unwritten rule of politics is to hold true, the future of the Liberal government depends on public interpretation of the events. Opposition parties will try to influence such interpretation to their benefit, but if the ends justify the means, citizen Chretien will go to bat for king and Confederation once more.

Ian Blechschmidt

(\H H[DPV DUUDQJHG

+2856(59,&( RQPRVWJODVVHV FRQWDFWV

'HWDLOVLQVWRUH:LWKFRXSRQ1RWYDOLGZLWKRWKHURIIHUV([SLUHV0DU

-$18$5< 

5(17,1* %(*,16 )25 6(37(0%(5 $ 7 $7

:2&+

Martin: the public will decide Continued from page 6

8QLYHUVLW\$YH:&DPSXV&RXUW3OD]D FRUQHURI3KLOOLSDQG8QLYHUVLW\

:$7(5/22 2))&$0386 +286,1*

UHQWZRFK#KRWPDLOFRP

 ZZZUHQWZRFKFRP

$FFRPPRGDWLRQV IRU  VWXGHQWV ,QWHUQHWDYDLODEOH8WLOLWLHVLQFOXGHGLQWKHUHQW

.LQJ6WUHHW1:$7(5/22

FRUQHURI.LQJ 8QLYHUVLW\$YHEHVLGH3KLO V

7+(%(676$1':,&+ <28 //(9(5($7 :$ 7 6 &$5 $9$(59,&( ' ,/$ %/(

1RZRSHQXQWLODP )ULGD\ 6DWXUGD\ &20,1* 6221

RII

ZKROH 3+,//< &+((6(67($. 68%

ZLWKSXUFKDVHRIDR]IRXQWDLQGULQNDQGFKLSV 7U\RWKHUWRDVWHGVDQGZLFKHV VWDUWLQJDWRQO\

:('(/,9(5


Imprint opinion

10

Letters Stop idealizing the PCs To the editor, In regards to the letter to the editor by Aaron Lee-Wudrick, perhaps he believes that by saying something repeatedly, it will make it true. To suggest that the PC party was removed from office merely because the â&#x20AC;&#x153;Liberals ran a much better campaign,â&#x20AC;? is to ignore the pent-up desire for change that permeated Ontario prior to the start of the election campaign. During their time in office, and through an idiotic drive to cut taxes at any cost, the Tories removed controls on water quality, privatized the hydro system, encouraged private schools and sold off the 407 series highway. By spouting one figure, the rise in spending on health care, Aaron tries to make us all believe that the PC party did what it said it would do. Donâ&#x20AC;&#x2122;t think so. Who was it that decided to cap our electricity? Why is it that there is a 25 per cent higher dropout rate with the new curriculum than the old? Why is it that this deficit that the Liberals discovered was categorically denied by the PC party? Why? Because the PC party spent eight years blaming and lying to everybody but themselves. It is quite evident that the Liberals and the PC party are different ends of the same snake. As for the NDP, I give them credit for being the only party that saw the emperorâ&#x20AC;&#x2122;s new clothes and were willing to provide honest solutions to Ontarioâ&#x20AC;&#x2122;s problems. Once we get rid of this representative parliament mess

l letters@imprint.uwaterloo.ca and get ourselves a democracy that actually reflects the true votes, I think weâ&#x20AC;&#x2122;ll all be surprised at how many seats the NDP will win. â&#x20AC;&#x201D; Michael Fisher 4A Math/Business ChrĂŠtien should talk To the editor, I consider myself an understanding and rational person who has a great interest in our countryâ&#x20AC;&#x2122;s economic, political and social future. As a young Canadian, I am extremely disappointed and outraged at our system of government, especially by the statements made by our former prime minister, Mr. Jean ChrĂŠtien. Mr. ChrĂŠtien entered politics in the early sixties, headed the role of many ministries, and represented our country as prime minister for about 10 years. All of a sudden, when a major scandal emerges misallocating about $100 million of our money during Mr. ChrĂŠtienâ&#x20AC;&#x2122;s era of power, the former PM makes a statement attempting to make him unaccountable and not liable for his governmentâ&#x20AC;&#x2122;s actions. â&#x20AC;&#x153;I donâ&#x20AC;&#x2122;t think anymore - I was the government, I replied to all your questions - a lot of them. Now if you have questions ask the government,â&#x20AC;? said Jean ChrĂŠtien. How can our former PM make this statement? Does this statement illustrate that there is zero accountability in our system of government?. If a political leader makes a mistake and then retires from politics we

must accept the mistakes of the past and just move on? If an engineer designs a bridge and it collapses or if a former CEO of a multinational firm is suspected of insider trading, do they gain complete immunity from their mistakes once they â&#x20AC;&#x153;retireâ&#x20AC;? from their professional role? The obvious answer to my question is no. We need to introduce policies that hold politicians accountable for mistakes their governments make, the present and past. â&#x20AC;&#x201D; Kamal D. Uppal 4A Math/Business

Write to Imprint All letters must include a phone number for verification, and should not exceed 300 words. Letters should include the authorâ&#x20AC;&#x2122;s name, year and program, or faculty position where applicable. All material is subject to editing for brevity and clarity. The opinions expressed are strictly those of the authors, not the opinions of Imprint.

Waterloo Co-operative Residence Inc.

Wish you could live in Residence Again? - Meal plans - Student community - Minutes from UW - Democratically controlled

4 month term On-site laundry Flexible move in/out On-site pub (Weavers' Arms) -

268 Phillip St. 884-3670 www.wcri.org Tours available upon request

FRIDAY, FEBRUARY 20, 2004

Straight males and me Aaron Cowan UNDEFEATED You rarely find a group of straight guys in a gay bar. Of course this was hardly the case last weekend when I joined a good friend of mine on an excursion to the gay bar along with some of his own friends: guys and girls of an assortment of sexual orientations. Among the crew were four selfproclaimed straight men, all of whom felt secure enough with their sexuality to comfortably enter the bar and have a good time just like everyone else. Not only were these straight guys comfortable with going to the gay bar with the rest of us, but not once did they shy away from any part of the gay bar experience. They grinded on the dance floor (both with each other and with other gay guys), they flirted with drag queens, talked gossip and spanked bums. One of the guys even took the opportunity to grind up against the backside of a bar patron who at that very moment was wearing nothing but tiny white briefs. Of course this moment did not last very long as wearing nothing but tiny white briefs was apparently not acceptable behaviour in the particular bar that we were in. That night we all had a really great time, but as the evening wore on I began to feel a bit uncomfortable. You see, the straight guys were really into grinding up against each other, an activity which usually ended up involving myself or the other gay guys in the group. They groped us, felt us up and thrust their pelvic regions into our

backsides. Since this is the sort of thing that I myself often partake in with girls and other gay guys, I knew that they were just trying to have fun. However, I couldnâ&#x20AC;&#x2122;t get past how uncomfortable dancing with the straight guys made me feel. Since last weekend, I have put a lot of thought into what happened and to this day I still can not figure it out. You see, I feel great when I dance with girls and other gay guys, but apparently dancing with straight men makes me want to run away screaming like a schoolgirl! Nevertheless, out of all of my analytical thinking, I have come up with two theories as to why I donâ&#x20AC;&#x2122;t like to dance with straight men. For starters, I suppose when I am dancing with a straight guy I worry that I might do something to make him feel uncomfortable; touch him the wrong way or offend him somehow. Because I am constantly worrying that he might think that I am trying to come on to him, I really canâ&#x20AC;&#x2122;t let loose and have fun. Also, I think the fact that these guys would not have danced with me unless we were actually in a gay bar made me feel a bit like a circus exhibit. Kind of like a â&#x20AC;&#x153;do as the Romans doâ&#x20AC;? sort of thing. Donâ&#x20AC;&#x2122;t get me wrong, Iâ&#x20AC;&#x2122;m not saying that straight guys shouldnâ&#x20AC;&#x2122;t go to a gay bar, or shouldnâ&#x20AC;&#x2122;t dance with other guys (whether they be gay or straight). Rather, it is apparent to me that my inability to comfortably dance with straight men is my own issue, something that I have since identified and will now work towards improving. In my mind there is no reason why I should be able to comfortably move my bootylicious into the laps of gals and gay guys alike, but deny the same pleasure to my straight male friends! acowan@imprint.uwaterloo.ca

<RXWK )RU <RXWK

VSDJKHWWLGLQQHU ,Q6XSSRUWRI522)

5HDFKLQJ2XU2XWGRRU)ULHQGVLVDORFDODJHQF\FRPPLWWHGWRWKHVDIHW\ VXSSRUWDQGRYHUDOOZHOOEHLQJRIKRPHOHVV\RXWKDQG\RXWKDWULVN

VXQGD\IHEUXDU\ WRSP 1HZ$SRVWROLF&KXUFK /RGJH6WUHHWDW5HJLQD6WUHHWDFURVVIURP:/8 GLQQHU LQFOXGHV

VDODGJDUOLFUROOVSDJKHWWLZLWKVDXFHDQGPHDWEDOOVSOXVGULQN

Celebrating 40 years of Co-operation (1964 - 2004)

'LQQHU ZLOO EH VHUYHG ZKLOH VXSSOLHV ODVW  ILUVW FRPH ILUVW VHUYHG 'RQDWLRQV ZLOO EH DFFHSWHG WRZDUGV 522) 6SRQVRUHG E\ 1HZ $SRVWROLF &KXUFK <RXWK *URXS


FEATURES FRIDAY, FEBRUARY 20, 2004 FRIDAY, FEBRUARY 20, 2004

Imprint features

13

Downtown Italian

features@imprint.uwaterloo.ca

Venezia reviewed —page 13

Navigating the streets of Bamako Cari Mason

12° NORTH Tightly squeezed between two fleshy women, the smell of body odour, gasoline and dust invading my nostrils, I can catch only glimpses of the city as it flashes by — a pattern of market after market, its symmetry broken only by a brief trip across the bridge that covers the Niger river. The combination of the day’s heat and the warmth of the bodies around me makes the air so hot that pools of sweat begin to form between my breasts. Everyone sits uncomfortably, angrily eyeing the man in charge for allowing so many people to board the van. Out of necessity, one woman in the corner awkwardly attempts to breastfeed her child. Averting my eyes, I catch sight of another woman as she picks her nose, wipes the snot from her child’s face, then proceeds to stick her hand out the open window and wipe all of her newfound treasures on the outside of the van. Quickly, I remove my hand from the bar above my head, silently vowing to wash my hands as soon as possible. Just then, a man hisses at the prenti (shorted from “apprentice” by the locals). Though a hiss is generally the demand for attention, on the soutrama it is used as the signal to demand a stop. Reaching outside, the prenti bangs loudly once on the roof of the van and the vehicle begins to slow down. These small green vans, most of which seem to have been unearthed

from the car junkyards of Europe, assume responsibility for transporting the majority of the people in Bamako; taxis and personal vehicles often being unaffordable to the people here. Though generally the soutramas all look the same: their shells painted green with their side door ripped off, their insides replaced with narrow wooden benches and the permanent fixture of a young boy who collects the money and is also responsible for soliciting business. Some of the owners of these buses have employed their creative licensces and many of them now look like VW bugs reminiscent of 1960s USA. To the Western eye, the appearance of these vans may seem almost cartoon-like as they weave precariously down the roads exploding at the seams with people, but they exist because they must. Like most things here in Mali, they have been created out of need. This transportation system has grown organically and amidst the chaos some semblance of organization has been created, providing the citizens with a much needed form of infrastructure. Two loud thumps on the roof and the van is on its way again. With three people gone, the bench is seemingly more roomy as we pull onto the bridge. Like clockwork, the boy gets up to collect the fee. It costs 125 CFA (about $0.30 Cdn) to cross the river into town and you pay on the bridge. The soutrama may have no set routes and no established pick up times but you always pay on the bridge. As we get closer to town, the bus begins making stops more frequently, the wheels grinding angrily on their worn bearings each time. The prenti’s signal to the driver, the drumming on the roof,

IAN HOWARD

The soutrama putts along the bridge on the way to its next stop. has taken on a rhythm and his voice provides the melody as he calls out the name of our destination to the people on the street, endlessly hopping in and out of the van when it stops,

trying to bring people in. His words are distinct at first, “Niarella, Niarella, Niarella” but as he speaks their individuality diminishes until all that can be heard is the end “lla, lla, lla.” Finally

it is my turn to descend and once out they quickly pull away, the boy still calling and drumming. cmason@imprint.uwaterloo.ca

Host of The Toronto Show bares all Arda Ocal IMPRINT STAFF

While removing his makeup, The Toronto Show host quips, “the hideous monstrosity you see before you, I don’t let everybody see. You’re privileged is what I’m saying. Congratulations, you made it.” He is Enis Esmer, the Turkishborn, Canadian-raised man of a thousand jokes. Every Thursday, Friday and Saturday night, Esmer hosts Toronto’s newest variety program The Toronto Show, 10 p.m. on Toronto1 (channel 15 in Waterloo). To label it a talk show would be misleading; gone are the familiar desk, sofas and audience bleachers one would expect. Instead, the show offers more of a “night club” experience, with a delightful assortment of bands (including a hot in-house band), comedians and resident characters (including the hilarious antics of “Caruthers the creepy Toronto Show janitor”).

Many of the bands that play on stage at The Toronto Show have simultaneously travelled the KW area. Most recently, the Mudmen played the Bombshelter Pub (Jan 30) the same night they appeared on the Toronto Show. Many of the bands that step foot on the Toronto Show stage have been outlandish to say the least. “We had White Cowbell Oklahoma come on the show, they were nuts,” Esmer recalls. “They carved up a pumpkin on stage with a chainsaw and made me eat a bite of it and I almost threw up on stage. It was a lot of fun.” Esmer certainly has a beefy comedic resume under his belt, spending over a decade in the art in many different comedy troupes. Most notably, Esmer gained acclaim in North America as part of the Mideast Optimists, a band of Muslim and Jewish comedians with a common goal to “make jokes, not war.” The troupe gained international acclaim from the

New York Times, along with work for the Center for Coalition for Peace Action but eventually disbanded. “It ended up having a resonance because of September 11 that we really hadn’t intended,” Esmer recalls. In the past, Esmer has delved into writing, as a columnist for the comedy Web site Something Space.com. There, Esmer continues to find funny creative outlets, including a “Favourite Parent Decathlon,” his vice-versa response to the age old question “who is a parent’s favourite child?” With his new comedic project he enters the music realm, working with long time partner in comedic crime Conor Green and Dejan Zahirovic to lead the omni-genre band “CalcuLator and the Oral Presentation.” The band’s motto? “Murder, Not Guilty.” “It’s like opera but with Kabuki theatre mixed in with pop [and] rock. Like a post-apocalyptic rock.”

Calcu-Lator also includes an element of hip hop, a genre of which Esmer is a big fan. When asked why he is unable to freestyle, Esmer replied “I’m a hip hop fan; it doesn’t mean I can do it. I’m also a fan of surgery.” The highly praised band was a finalist for the prestigious Tim Simms Award for comedy in 2003, highlighted by an appearance on the Cream of Comedy television special. In the future, an “Oral” album is definitely in the planning phase. “We’re going to work with some top producers. It’s going to be off the heezy. The heezy will be removed from the album.” On top of his rigorous work schedule, Esmer is also an actor. Along with numerous small roles in feature files (most recently an airport passenger in the movie Welcome to Mooseport), Esmer landed a feature role in the movie Decoys, a movie about two college blondes who are suspected of being aliens. The movie will premiere

in theatres on February 27. Yet through all of his accomplishments, Esmer remains humble about his experience at the Toronto Show and prospects of a second season. “I’d love to come back; this has been one of the most amazing experiences of my life. Getting an admittedly creepy old couch in my dressing room, that was a nice perk. And they let me keep my socks at the end of the night. Why wouldn’t I want to come back?” One can only imagine what a man whose name produces over 500 hits on a Google search does in his spare time. “There’s a lot of crying, sobering up; and writing apology letters to the guests that I say rude things to while stealing their beer.” Listen to the interview with Enis Esmer at AoK Online: www.ckmsfm.ca/aok aocal@imprint.uwaterloo.ca


Imprint features

12

FRIDAY, FEBRUARY 20, 2004

Unreal Tournament turns seven

In this edition, player-driven flight vehicles dominate the map. Players can also join together their repair beams in order to repair nodes and weapons. Julian Apong IMPRINT STAFF

â&#x20AC;&#x153;Bomber straight above us, attacking the core!â&#x20AC;? â&#x20AC;&#x153;Take it down!â&#x20AC;? I hop out of my jeep, squinting against the glare of the sun as I wait for trajectory lock with my Anti-Vehicular Rocket Launcher. As the whining beep of lock-on occurs, I loose my missile â&#x20AC;&#x201D; the pilot sees the smoke trail rising, but too late to evade his oncoming doom. Flaming scrap metal rains from the sky a second later. And so I am introduced to Unreal Tournament 2004 â&#x20AC;&#x201D; and this is only the demo. UT2004 is the third in Epic Megagamesâ&#x20AC;&#x2122; Unreal Tournament line. The developers announced they were moving the series towards yearly updates, like many sports games. The public was promised gameplay enhancements and expanded content and if this demo is any indication, itâ&#x20AC;&#x2122;s been delivered. The biggest addition to this yearâ&#x20AC;&#x2122;s

3+,//,3675((7 /2&$7,2121/< /,0,7('7,0(2))(5

game is the new play mode, Onslaught. Best described as â&#x20AC;&#x153;Battlefield 2942,â&#x20AC;? Onslaught introduces vehicles, control points and a dynamic, objective-based battlefront into the UT universe. Teams struggle for possession of nodes across a large map (far larger than anything in UT2003). Teamwork becomes integral as multiple players converge on a pivotal control node, trying to push their way along the chain of control points and succeed at striking the opposing teamâ&#x20AC;&#x2122;s base. Now, this has been seen before in games like Tribes 2, but here the system actually works â&#x20AC;&#x201D; Epicâ&#x20AC;&#x2122;s Tim Sweeney has to be commended for making the fight as intuitive as possible. Players automatically spawn near their next objective, weapons are now picked up in groups of three or four, vehicles are as easy to control as your player is â&#x20AC;&#x201D; all of it is designed to get players into the game and fragging with minimal fuss. Even though the demo only has one Onslaught map, you wonâ&#x20AC;&#x2122;t be get-

ting bored with it for quite awhile. The demo also gives the first tantalizing preview of the Assault mode, excised in UT2003, but revitalized here for your gaming pleasure. The demoâ&#x20AC;&#x2122;s Mad Max-esque scenario involves one team furiously defending as their opposition seeks to steal their convoyâ&#x20AC;&#x2122;s missiles. This portion of the game also give the gameâ&#x20AC;&#x2122;s new built-in voice transmission software a chance to shine, as well as the handy objective beam, guiding players to the next stage of the mission with the push of a button. UT2004 is set to make its full debut March 17 â&#x20AC;&#x201D; meaning that university gamers can forget about studying. Once weâ&#x20AC;&#x2122;ve all failed, I propose a class action lawsuit against Epic Megagames for releasing such a criminally addictive game so close to UW final examinations. And after the lawsuit â&#x20AC;&#x201D; anyone up for a little 32-player Onslaught? japong@imprint.uwaterloo.ca



SCREENSHOTS FROM UNREAL TOURNAMENT 2004 DEMO COPYRIGHT EPIC GAMES


Imprint features

FRIDAY, FEBRUARY 20, 2004

13

Venezia gives an uneven taste of Italy

RESTAURANT REVIEW Venezia (A Taste of Italy) 20 King St. East Kitchener 570-9087 The last time I visited this address, almost two years ago, it housed 20 King Restaurant, now located across the street. While the food has changed from fancy French to homey Italian, much of the decor is familiar, the muted colours of Veneziaâ&#x20AC;&#x2122;s predecessor acting as a backdrop for tacky elements such as generic Venetian paintings and a uniform for wait staff consisting of poorly-made gondoliersâ&#x20AC;&#x2122; hats and shirts. Given that it was a Friday night, I was surprised to find Venezia less than half full. I was even more surprised to find that there was only one waitress working. Still, she did an impressive job of keeping up with all the occupied tables alone and the service was generally good. I was pleased to see arancini, breaded and deep fried balls of rice and seasonings, on the list of appetizers since I associate this dish with home cooking

was well-cooked and tender, although the â&#x20AC;&#x153;stripsâ&#x20AC;? werenâ&#x20AC;&#x2122;t cut properly so instead formed a jagged fan. My companion particularly enjoyed the dishâ&#x20AC;&#x2122;s generous coating of garlicky olive oil. Pasta dishes include foccacia with tapenade, a black olive spread. I heartily enjoyed the tapenade, which balanced the saltiness of the olives with hints of garlic and parsley. The foccacia resembled a pocketless pita more than it did the thick, rustic bread associated with the name, but given that it was mostly a vehicle for the tapenade itâ&#x20AC;&#x2122;s hard to complain. For dessert, I had my often-mentioned favourite, tiramisu ($5.95). Veneziaâ&#x20AC;&#x2122;s version was overly sweet and lemony, masking the rich flavour of mascarpone. Still, even mediocre tiramisu is pretty good. My companionâ&#x20AC;&#x2122;s dessert, by contrast, was excellent. Zeppole ($4.95) is a yeasted doughnut whose batter usually contains ricotta cheese. Upon finding that a serving consisted of 4 doughnuts, probably better shared by 2-4 people, my companion considered taking some home, but they were so delicious while fresh and warm that he ate them all. We splurged on a bottle of Prosecco ($28), a pleasantly dry sparkling wine, which pushed our bill up to $95 before tip, but with water or house wine the meal could easily have cost $60 to $70. TIM ALAMENCIAK

kshort@imprint.uwaterloo.ca

127,&(2)0((7,1* ,PSULQW3XEOLFDWLRQV:DWHUORRLVKROGLQJLWV $118$/*(1(5$/0((7,1* RQ 7KXUVGD\)HEUXDU\ DW SP

LQWKH0XOWL3XUSRVH5RRPRIWKH6WXGHQW/LIH&HQWUH  8QLYHUVLW\ $YH : :DWHUORR 2QWDULR 1/ * 7KHSURSRVHGDJHQGDIRUWKHPHHWLQJLVDVIROORZV  2SHQLQJUHPDUNVIURPWKH3UHVLGHQW  3UHVHQWDWLRQRIILQDQFLDOVWDWHPHQWV  $SSRLQWLQJWKHDXGLWRU  3UHVHQWDWLRQRIWKHEXGJHW  %\ODZDPHQGPHQWVWRVHFWLRQVDQG  3ROLF\DPHQGPHQWUDWLILFDWLRQ  (OHFWLRQRIWKHERDUGRIGLUHFWRUV  $GMRXUQPHQW  3URSRVHG DPHQGPHQWV WR ,PSULQWÂśV %\ODZ DUH OLVWHG EHORZ  3URSRVHG SROLF\ DPHQGPHQWV DUH DYDLODEOH LQ WKH ,PSULQW RIILFH 6/& URRP  RU       RQ ,PSULQWÂśV :HE VLWH KWWSLPSULQWXZDWHUORRFD

4XHVWLRQV" &RQWDFW SUHVLGHQW $QGUHZ 'LOWV E\ HPDLO DW SUHVLGHQW#LPSULQWXZDWHUORRFD RU E\ SKRQH DW   

%\ODZDPHQGPHQWV 9RWLQJ 6DYHDVRWKHUZLVHSURYLGHGKHUHLQHDFKPHPEHUVKDOOEHHQWLWOHGWRRQHYRWHSHUPRWLRQDWDOOPHHWLQJVRI PHPEHUV0HPEHUVPD\YRWHWKURXJKDGXO\DXWKRUL]HGSUR[\1RPHPEHUPD\KROGPRUHWKDQRQHSUR[\YRWHDW DQ\PHHWLQJRIWKHPHPEHUVKLSRI,PSULQW3XEOLFDWLRQV:DWHUORR 3UR[LHV (YHU\PHPEHUHQWLWOHGWRYRWHDWPHHWLQJVRIPHPEHUVPD\E\PHDQVRIDSUR[\DSSRLQWDSHUVRQZKRQHHGQRWEHD PHPEHUDVKLVQRPLQHHWRDWWHQGDQGDFWDWWKHPHHWLQJLQWKHPDQQHUWRWKHH[WHQWDQGZLWKWKHSRZHUFRQIHUUHG E\WKHSUR[\$SUR[\VKDOOEHLQZULWLQJVKDOOEHH[HFXWHGE\WKHPHPEHUHQWLWOHGWRYRWHRUKLVDWWRUQH\DXWKRUL]HG LQZULWLQJDQGFHDVHVWREHYDOLGRQH\HDUIURPLWVGDWH$SUR[\PD\EHLQVXFKIRUPDVWKH%RDUGSUHVFULEHVRULQ VXFKRWKHUIRUPDVWKH&KDLURIWKHPHHWLQJDFFHSWVDVVXIILFLHQW6XFKSUR[\VKDOOLQFOXGHWKHQDPHSKRQHQXPEHU VWXGHQWLGHQWLILFDWLRQDQGVLJQDWXUHRIWKHPHPEHU$SUR[\VKDOOEHGHOLYHUHGWRWKH6HFUHWDU\QRODWHUWKDQWZR 

GD\VSULRUWRWKHPHHWLQJDWZKLFKWKHSUR[\ZLOOEHH[HUFLVHG1RPHPEHUPD\KROGPRUHWKDQRQHSUR[\YRWHDW DQ\PHHWLQJRIWKHPHPEHUVKLSRI,PSULQW3XEOLFDWLRQV:DWHUORR

Venetian paintings on the walls of the Venezia.

352;<)250

Kourtney Short

(itâ&#x20AC;&#x2122;s a good way to use up leftover rice) and seldom see it at restaurants. The menu also offers more familiar items such as Caesar salad and bruschetta. We decided to share the classic antipasto ($9.95). This unfortunately underseasoned dish included small pieces of grilled vegetables, mostly eggplant with some red pepper, plain boconccini, pitted underripe kalamata olives and cantaloupe wrapped in prosciutto. The blandness of this dish highlighted the fact that there was neither salt nor pepper on the tables, often a bold statement by chefs who feel their food is perfect as is and probably a mistake at Venezia. Presentation was, in general, unimpressive: my entrĂŠe came with a simple sprig of thyme, a misleading choice since the herb was otherwise absent from the dish, while my companionâ&#x20AC;&#x2122;s entrĂŠe was adorned with an odd-looking fan of celery dipped in paprika. Worse, both our dessert plates were noticeably chipped. Fortunately, both our main dishes tasted better than they looked. My linguine di mare ($17.99) contained a generous portion of tiger shrimp, tender calamari, bay scallops and mussels, tossed with al dente linguine and a light oregano-scented tomato sauce. My companion enjoyed the seasonal special of linguine with strips of sautĂŠed veal, artichokes, sundried tomatoes and pancetta ($14.99). The veal

7KHXQGHUVLJQHGPHPEHURI,PSULQW3XEOLFDWLRQV :DWHUORRKHUHE\DSSRLQWV

1$0(BBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB 678'(17,'BBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB 3+21(180%(5BBBBBBBBBBBBBBBBBBBBBBBBBBBB (0$,/BBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB DVWKHSUR[\RIWKHXQGHUVLJQHGWRDWWHQGDQGDFWDW WKHPHHWLQJRI,PSULQW3XEOLFDWLRQV:DWHUORRWREH KHOGRQ7KXUVGD\)HEUXDU\DQGDWDQ\ DGMRXUQPHQWRUDGMRXUQPHQWVWKHUHRILQWKHVDPH PDQQHUWRWKHVDPHH[WHQWDQGZLWKWKHVDPHSRZHU DVLIWKHXQGHUVLJQHGZHUHSUHVHQWDWVDLGPHHWLQJRU VXFKDGMRXUQPHQWRUDGMRXUQPHQWVWKHUHRI 'DWHGWKHBBBBBBBBBBBBBBGD\RI)HEUXDU\

:LWQHVV1DPH 3ULQW BBBBBBBBBBBBBBBBBBBBBBBBB :LWQHVV 6LJQDWXUH BBBBBBBBBBBBBBBBBBBBBBBBBBB :LWQHVV3KRQH1XPEHUBBBBBBBBBBBBBBBBBBBBBBB 0HPEHU1DPH 3ULQW BBBBBBBBBBBBBBBBBBBBBBBBB 0HPEHU6LJQDWXUHBBBBBBBBBBBBBBBBBBBBBBBBBBBB 0HPEHU3KRQH1XPEHUBBBBBBBBBBBBBBBBBBBBBBB 0HPEHU6WXGHQW,'BBBBBBBBBBBBBBBBBBBBBBBBBB '($'/,1(7XHVGD\)HEUXDU\DWSP


ARTS

14

Imprint arts

FRIDAY, FEBRUARY 20, 2004

FRIDAY, FEBRUARY 20, 2004

Finding time to write arts@imprint.uwaterloo.ca

In conversation with Carrie Sydney —page 16

World traveller makes a stop in Waterloo Garick Stevenson IMPRINT STAFF

Ian Wright has been a backpack travel guru for a number of years now. He started out on the travel program The Lonely Planet (which was renamed Globe Trekker), named after the uber popular travel book series of the same name. Ian now spends his time as one of the hosts on the popular travel show Pilot Guides. I can remember the first time that I watched Ian Wright on his amazing and life altering journeys around the globe. He always went balls out on all of his assignments even if it meant breaking some of his own personal beliefs. I was shocked whenever I witnessed this self-confessed vegetarian eat any sort of creature or delicacy that was offered his way. He even took on dishes that turned my stomach thousands of miles away. He rode a Harley through the American midwest, ate Elk stomach contents in Greenland and rotten shark in Iceland. The man has been around the globe many times over. It is obvious that a man who has witnessed and travelled as much as Ian would have some of the most wicked travel stories this side of David Carradine’s peyote trips in the Baja. Think of it this way: Ian is like that crazy uncle you have that backpacked Europe in the ’70s — times ten (and think about how sweet some of those stories were). You can catch Ian this coming Wednesday, February 24 at the Humanities theatre. Tickets are $17 so get them soon. Grab your friends, spark one up and be prepared for the sarcastic humour and banter that so many have come to love from this witty brit. gstevenson@imprint.uwaterloo.ca

Ian Wright takes time out to point out a few of the places he’s been.

PILOT PRODUCTIONS, UK

Mixtape masterpiece: burn, baby burn Mark Stratford IMPRINT STAFF

Disco, contrary to popular belief, does not suck. It gets a bad rap and it deserves more respect. In fact, few genres have created such long-lasting results so easily. While the pop music explosion relies on cheap publicity stunts and the constant parading of a singer’s image, disco didn’t even work that hard: A producer would create a beat, dump a singer in the middle and let him fend for himself. Here are some of my personal picks, all from the mid-to-late ’70s, which recall an era when even the occasional dollop of poor material could make for a shining moment — as long as the singer could muster just an ounce of conviction. Which is a pretty impressive feat, considering how many of these songs were written in the presence of eight-balls. Michael Jackson - “Don’t Stop ’Til You Get Enough” Forget what he’s become — the man with the Peter Pan fixation and the pancake make-up mug shot is not Michael Jackson. This is Michael Jackson: the slick bassline, the rattle of the cowbells and Jackson’s effortlessly sensual vocal, which practically defines intoxicating. Years later, Justin Timberlake would crib both the beats and the spoken intro, but somehow “Don’t fear me baby, it’s jus’ Justin” doesn’t hold a candle to “You know, the force has got a lot of power/ You make me feel like/You make me feel like… whooooooooooo!!!”

Blondie - “Heart Of Glass” This song takes from, and gives to, several genres, including new wave, reggae and a hint of adult contemporary. But what makes it a disco smash is how successfully minimal it is; Debbie Harry and company create something infectious and danceable out of a simple tale of love-gonewrong melancholia. As the video demonstrated, Harry wasn’t much for sharing the nose candy, but sharing her feelings was never a problem. Bee Gees - “Stayin’ Alive” Just listen to that! Listen to that bassline, one of the best and most notorious hooks that popular musical ever made. Listen to that testosterone-defying vocal harmony. Listen to an era of escapism that we all missed (for better or for worse). Watch the room stop and get mesmerized every time it plays. Feed the Saturday Night Fever. God, John Travolta has gotten so fat. Andrea True Connection - “More, More, More” Of course, disco did it have its share of onehit-wonders, but at least their hits were immortal, even if their careers weren’t. Enter Andrea True, a porn actor who gained a very short recording career from “More, More, More,” a sultry, brass-rich smash with a fluffy meringue chorus so cheeky and tasty that it makes Britney’s “…Baby One More Time” sound shittier than it already does. Moe Syzlak’s version on The Simpsons (“Moe, Moe, Moe”) was an excellent and necessary tribute.

Rod Stewart - “Do Ya Think I’m Sexy?” A song which romanticizes one-night-stands could only come from a person who has known the best of them. Lucky for us Stewart fucked everything that moved, or we wouldn’t have this classic fusion of rock and disco that reminds you that your soulmate may be down at the pub waiting for you. I don’t know why anyone would borrow a dime to call their mother before boinking a perfect stranger, as Stewart does in the lyrics, but the way he sings it puts a lump in my throat all the same. Abba - “Dancing Queen” All right, shut up. This was going on the list whether you wanted it to or not. It’s just too damn sublime — that piano scale intro, that sweaty drumbeat, that fantastically-sung, fantastically-written chorus (it actually includes the phrase “dig it!”). Like the heroine in the lyrics, it is absolutely impossible to dance to this song without feeling insanely comfortable and enthralled in the music around you — with the exception of heterosexual men, whose enjoyment in the song is unfairly rendered null and void thanks to the implications behind the word “queen.” A pity. Chaka Khan - “I’m Every Woman” Few disco hits are this flat-out funky: The strings swirl, the bass is all up in your face and you do not see that breathtaking, key-shifting finale coming. But it’s Khan’s remarkable voice that sells this song; she sounds like she really can

make rain fall onto the seas with one jazzy, joyous yell. The bigger your hair is, the better chance you have of feeling this song. New Jersey prostitutes rejoice. Earth, Wind & Fire - “Boogie Wonderland” KC & the Sunshine Band - “That’s The Way (I Like It)” Lots of disco hits were all about the vocal arrangements and that includes these two. “Boogie Wonderland” is perfection, a glittery piece of manoeuvrable funk that drives on delirium, while “That’s The Way (I Like It)” boasts one of the most groovy, heady, sing-alongable choruses ever imagined. Shame on you, Burger King, for cheapening the moment. Honourable mentions: “Freak Out” by Chic, “Boogie Nights” by Heatwave, “Got To Be Real” by Cheryl Lynn, “Dim All The Lights” by Donna Summer. Get these tracks, and please, really listen to them. Your disco needs you. mstratford@imprint.uwaterloo.ca


Imprint arts

FRIDAY, FEBRUARY 20, 2004

15

3527(*(6( 3527(*(

*5$'8$7(352*5$021/($6,1*25),1$1&,1* a*HWWKHFDU\RXZDQWEHIRUH\RXJUDGXDWH 12'2:1:+(1<28%8< /($6()25

SHUPRQWK PRQWK OHDVH 6HH'HDOH U)RU'HWD LOV

*(7,1 %('5,9(1

:$7(5/221257+

1RUWKILHOGDWWKHSDUNZD\ Screw Canadian Idol, these four guys from Norwood are living the rockstar dream



LISA JOHNSON

These Days ainâ&#x20AC;&#x2122;t Graceful Radio rock extravaganza with Staind and Nickelback rolls through Arda Ocal IMPRINT STAFF

Since the age of 14 in the small town of Norwood, Ontario (an hour from Peterborough), the band that would become Three Days Grace dreamt of musical success. Ten years later, their former dreams now a reality, they focus on sustaining the music empire they have built. With a Juno nomination, appearances on Craig Kilborn and Jay Leno and relentless touring around North America and the UK, there is no end in sight for these rockers. The Kitchener Auditorium had been sold out for weeks awaiting their Valentineâ&#x20AC;&#x2122;s Day arrival along with Nickelback, and they certainly did not disappoint. AoK caught up with Neil, the bandâ&#x20AC;&#x2122;s drummer, before the show. AoK: Are there any cities where it took a longer time to gain acceptance for your music? Neil: I think it comes with the territory with the bigger cities, like New York and LA, because thereâ&#x20AC;&#x2122;s a lot more going on down there. The concentration of shows on a daily basis â&#x20AC;&#x201D; on Sunday nights there are a ton of bands rolling through. [What] it comes down to [is that] if there arenâ&#x20AC;&#x2122;t as many shows, people get more excited. New York and LA are more resistant. But people are people, good music will always rise to the top. You guys have played everything from large venues like the Kitchener Auditorium to weddings. Do you have a preference? Not really. I think itâ&#x20AC;&#x2122;s like comparing apples to oranges. We played the Air Canada Centre the other night and it was great, you just see a sea of people, but the club vibe can really be a â&#x20AC;&#x153;realâ&#x20AC;? experience. You see everyone in the place, sometimes crowds are so excited to get into it. You donâ&#x20AC;&#x2122;t really get

that in a stadium. Some people say they get more nervous in front of a crowd of ten than 10,000. What do you think? We donâ&#x20AC;&#x2122;t really tend to get nervous. The only time we get nervous is if itâ&#x20AC;&#x2122;s live television. Thatâ&#x20AC;&#x2122;s the only time I get a little antsy. Speaking of which, you guys have an appearance on Jay Leno on the 25th [of February]. Yeah, Iâ&#x20AC;&#x2122;ll probably be a little anxious on that one. Tell us about the experience of touring with Nickelback. Itâ&#x20AC;&#x2122;s been great. They are great guys, weâ&#x20AC;&#x2122;ve become good friends with them and stuff. The bill is great with Staind in the middle. We have great parties.

â&#x20AC;&#x153;This is arguably the best job in the worldâ&#x20AC;? Chad Kroeger in the Toronto Star said, â&#x20AC;&#x153;I want to be that guy who gets played on [classic-rock] radio stations 20 years [down the road].â&#x20AC;? Do you have a similar view for Three Days Grace? Yes and no. Weâ&#x20AC;&#x2122;re not subject to the radio 100 per cent. It gives you an opportunity to reach fans, but weâ&#x20AC;&#x2122;re basically relying on touring to get out there. Iâ&#x20AC;&#x2122;d rather be playing in 20 years in these cities. Maybe in an oldies club or something. What about bands that have reunion tours that seem so stale? I think thatâ&#x20AC;&#x2122;s generalizing a little bit, you have to look at it in a case to case basis. Because this is arguably the best job in the world, if you have the chance to do it when youâ&#x20AC;&#x2122;re 60 and still make a living, I think I would be doing the same thing.

What one band made you think â&#x20AC;&#x153;yes, I want to play hard rock music?â&#x20AC;? For me it was definitely Zeppelin. Also Guns and Roses, when Appetite for Destruction came out, there was a raw, abrasive thing going on. You guys have just been nominated for a Juno. How does it feel? Itâ&#x20AC;&#x2122;s great, after working on something for so long and finally see it surface, itâ&#x20AC;&#x2122;s a great feeling. We donâ&#x20AC;&#x2122;t get involved with sales and charts. For us itâ&#x20AC;&#x2122;s the fact that our songs are reaching people all over the place. It allows us to travel and get to those places and play live to those people and learn from those fans what our music means to them. Thereâ&#x20AC;&#x2122;s something surreal about being in El Paso, Texas and talking to some kid that is telling you what he thinks track nine on the record is about. [Thereâ&#x20AC;&#x2122;s] something really weird yet gratifying about it. Is it a laid back atmosphere when you guys make music? Absolutely, weâ&#x20AC;&#x2122;re all friends in the band. Really? Iâ&#x20AC;&#x2122;d think that you were all enemies. Youâ&#x20AC;&#x2122;d be surprised in this business how many bands arenâ&#x20AC;&#x2122;t friends. You learn the respect level you need to live in such close quarters with like nine other people that we have on this bus right now. If you donâ&#x20AC;&#x2122;t get it then everyone will hate each other. You spend 24 hours a day working, partying, being with the same people. Anything [can make someone angry], like eating somebody elseâ&#x20AC;&#x2122;s Chunky soup; weâ&#x20AC;&#x2122;ve definitely met a lot of bands that donâ&#x20AC;&#x2122;t understand that. Listen to the full interview with Three Days Grace at AoK Online: www.ckmsfm.ca/aok (after February 23) aocal@imprint.uwaterloo.ca

ADULT ENTERTAINMENT

MONDAY AMATEUR STRIP NIGHT 1st Prize

$1000 CASH!

EVERY WEDNESDAY NIGHT

WET T-SHIRT CONTEST

$875 IN CASH PRIZES LADIES NEVER PAY A COVER

)5(( 029,(7,&.(76 S M A R G 21

DWWKH

3OD\LQJ)HE

â&#x20AC;&#x153;MAY WELL BE THE CROWNING

WORK OF THIS YEAR!

&RPHWRWKH,PSULQW2IILFH6WXGHQW/LIH &HQWUHURRPRQ)ULGD\)HEUXDU\ EHWZHHQDPWRSPIRU\RXU)5((WLFNHW /LPLWHGTXDQWLW\DYDLODEOH


Imprint arts

16

FRIDAY, FEBRUARY 20, 2004

Local author publishes book Andrea Kerswill UNHEARD OF She was an inspiration. At this point in her career, local writer and former UW student Carrie Snyder seems to be ahead of her game. She has just released a collection of short stories entitled Hair Hat. And with a two-year old son and a baby daughter, all I could think was — where does she find the time? To answer that question, Snyder told me that she allots two hours a day where she must sit down and write. “I try to get in about two hours of writing time a day. Even if I’m not working on a major project, or even if I feel like I’m not in a writing mood, if I sit down and write I’m amazed at what I can do — its almost just more the act of sitting down and getting started.” And for many writers this allotment of time can seem altogether binding and a difficult task to stick to. But when you are raising a family, it can become an escape — well at least for Snyder it can. “To me it is almost like a big relief because I spend most of my time with two little kids, so to get to go and do something completely different in a fantasy world — it’s not so hard to sit down and write. I’m a lot different now that I have the kids — I don’t have nearly as much time and I use it well.” Like many writers, Snyder began her career at a young age. Although she didn’t begin publishing major works

until after her masters in English at U of T, she was always writing. “I always wrote journals, stories and poetry,” said Snyder, “a lot of poetry in my teenage years. I have just always been writing, I mean that is what I hope to do.” In speaking with Snyder it was clear that she has become familiar with the business of publishers and editors. In the world of the written word, it can often be disappointing when you spend much of your time on what you believe is a masterpiece only to receive a rejection letter in the mail.

Snyder has a natural talent for writing.

What is important about Snyder is that she has the umph to write everyday and the calluses to take rejection letters. “I didn’t get published very often in journals — I got a lot of rejection letters. It’s always disappointing to get a rejection letter. But I’m sure if you talk to any writer who’s made it, they’ve got just a stack of rejection letters.” With this series of short stories being published, Snyder is continuing to work on poetry and beginning a new novel. “These stories are a couple of years old, and I still really like them. With the novel, I just never felt as confident with it — so it was a learning ground. Any part of failure, I don’t look at as failure at all, I look at it as a

chance to try and a chance to learn — I mean I couldn’t have written those stories if I didn’t write the novel.” And with writing comes a method — not methods taught in undergrad studies or in a master’s program, but a method learned through time and experience. Snyder focuses specifically on writing her characters and her stories as she goes. Rather than mapping everything out (as we’re often told to do in grade school), Snyder watches the characters develop. “For the stories I just have like a small idea for each one, like an incident, a small idea like when two strangers meet and they are thrown by accident into a kind of intimate situation that you wouldn’t always be in with a complete stranger.” It is clear that Snyder has a natural talent for writing and that she also has the discipline to be able to do it. This is a wake-up call for all you writers out there who want to be published, or who are hoping for a career in writing. It may be a tough business to go into and others may tell you it is too difficult to try — but if you have talent and discipline, being published is the next step. As we finished speaking, Snyder’s son was in the room watching teletubbies. Here was this woman who has managed to get herself published at a relatively young age, has two little ones at home and still finds the time to explain to me why she loves writing so much. If that isn’t inspiration to follow your dreams, I don’t know what is. Snyder is having a book celebration at the Starlight on February 24 at 7:30 p.m. akerswill@imprint.uwaterloo.ca

“The play is brilliant..the cast outstanding...if this were a film, Tutt would deserve an Oscar....” - Harry Currie, The Record

GIRL IN THE GOLDFISH BOWL

by Morris Panych

FEBRUARY 5-28 Thurs.-Sat. at 7:30

36 King St. West, Kitchener

519.571.0928 www.theatreandcompany.org

COURTESY IMDB.CM

Perhaps it’s not just little green men that await us...

There’s no place like Mars David Carey DIET COKE HEAD In the fall of 1938, Orson Welles’ The War of the Worlds radio show caused panic and pandemonium throughout the Western world. People everywhere listened in fear as “journalists” took a close look at invading Martians, which were depicted as tentacled gray snake creatures who ate human flesh. Although it might seem silly to us now, less than 70 years ago people saw Mars as a potential enemy. More recently, Mars has been featured on film as a volatile future colony in Total Recall and a bizarrely inhabitable terrain in Red Planet. It even subbed in for Oz once in The Wizard of Mars. Much mystery and interest has surrounded our nearest planetary neighbour, but for some people that’s as far as it goes. On January 15 of this year, President Bush announced a plan that would have NASA working towards a manned mission to Mars in the near future. He proposed a budget increase of twelve billion dollars over the next five years. We don’t know for sure that Mars will offer us any tangible benefits. We certainly don’t require an interplanetary settlement to sustain us and the economic profits might be nonexistent. So why go to there? “Because it’s there” seems like too simple an answer, but it might be the most rational one. It’s an undeniable fact that we’re explorers. We always have been, despite our natural tendency towards skepticism. But with exploration comes the possibility for discovery. The Vikings discovered Newfoundland because a ship was blown far from its course by a storm.

Columbus was aiming for India, and ended up finding an oddly North American shaped continent. Some of the greatest discoveries in history resulted by chance or accident and many as an unexpected periphery to the original intent. Sure, not all exploration produces economic prosperity. Forty years ago we went to the Moon and got virtually nothing in return. Space travel hasn’t cured cancer, it hasn’t ended world hunger and it certainly hasn’t helped with our budget problems. But have you ever heard your parents talk about the Apollo mission? Watching the grainy video of Neil Armstrong taking that giant leap for mankind? Ask them about it and you might understand what a significant impact it had on the era. I think we tend to take it for granted — we walked on the freaking Moon! Think about that for a second. To me it’s a huge deal that can’t be brushed off as old news. That moment was one of the seldom occasions where the whole world let out a collective “wow.” The media’s relationship with Mars has been shaky at best. Public support for the space program faded fast after 1969, which resulted in a swift decline in news coverage (or perhaps the decline in news coverage caused the drop in support). Mars missions have suffered a similar fate, no thanks to a series of NASA screwups. OK, it’s not often that I write about actual issues without being bitter and sarcastic about it. I really feel like Mars is the next step for us, mostly because I’m a big nerd and stuff. We’ve come a long way since snake monsters and the Martian Wiz, but we need to show more genuine interest and for once be active participants in the exploratory future. As my favourite computer animated space hero action figure says: “To infinity, and beyond!” dcarey@imprint.uwaterloo.ca


SCIENCE FRIDAY, FEBRUARY 20, 2004

science@imprint.uwaterloo.ca

Lightening your load with laughter

Azadeh Samadi IMPRINT STAFF

Do you really want to lose weight?

You can’t even guess what you are going to see in your dream!

NACKY

Your dreams: what do they mean? Azadeh Samadi IMPRINT STAFF

The more we sleep, the better we feel. We do not need to know a lot of psychology or biology to tell us that sleep is critical to our lives. The body simply stops functioning after a long period of time without sleeping. But scientists often wonder whether sleep is necessary for the mind as well. There are still those that take sleeping pills to fall sleep and wonder why they still feel horrible or even worse the next morning. One might think that sleep is the same as being unconscious; rather, sleep is full of mental activity. During sleep your muscles tense, your blood pressure and temperature rise and various senses are alert. Random thoughts occur throughout the night, sometimes even taking on some scheme. This phenomenon is called a dream. One may think that modern psychology or biology has taken hold of all the complexities of dreams. But the

fact is that in the past two centuries, many theories and observations have been made. According to the researchers, there are at least three signs that someone is dreaming. The first sign is called rapid eye movement (REM). As the name indicates, the eyes of the sleeper move back and forth at rapid speed during their sleep. The second sign of dreaming can be indentified with the EEG (electroencephalogram) system. If one takes a closer look at a sleeper’s brain wave pattern during REM sleep, there are striking similarities to the pattern during an awake stage. The third sign is that they are paralyzed. In fact, paralysis is thought to protect the dreamer from acting on their dreams. This paralysis is due to certain neurons in the frontal lobes of the brain. The activity of the brain during this stage of sleep begins in a structure called the pons, which is located in the brain stem. The pons sends messages

to shut off the neurons in the spinal cord which results in an almost full body paralysis. The first REM session occurs 90 minutes after falling asleep and then in 90-minute intervals after that. Depending on how long one sleeps, they can have between four and six REM sessions each night. The first session is very short-no longer than five minutes. Each succeeding REM session gets longer and the average person’s longest dream can be up to 30 minutes long. Current theories suggest that dreams serve as mental relief and problem solving. However, biologists have made extensive advances in the field of dreams. They affirm that the most important function of dream sleep is the growth of the brain. This is the reason why infants dream four times as much as adults. Neurobiologists have discovered that neurons grow new axons and dendrites (nerve fibers) during sleep dreaming.

see DREAMS, page 18

These days what seems to be some people’s biggest concern is how to lose weight. Most people are looking for some kind of a magic pill or miracle program to take away their “spare tire” in a matter of seconds. Ephedra was once hailed as one of those magic dietary supplements. It was hugely popular for weight loss and bodybuilding. Now researchers have found that it can cause life-threatening side effects even in seemingly healthy people who take the recommended doses. The harmful side effects are increased heart rate and constricted blood vessels. It is particularly risky for anyone with heart disease or high blood pressure or people engaging in strenuous exercise. Ephedra so far has been linked to 155 deaths and dozens of heart attacks and strokes. This drug will be banned by April 10 2004. Some of the states in the U.S. already banned this pill. Interested in Power Yoga?

According to Dr. Weil If you’re interested in the purely physical aspects of yoga, you might want to look into Power Yoga, a new term for age-old Ashtanga yoga. Unlike other types of yoga, Power Yoga doesn’t incorporate meditation. Enthusiasts claim that Power Yoga increases endurance, flexibility and muscle strength. Keep in mind that Power Yoga is designed for the physically fit. It isn’t ideal for novices or for those with wrist, elbow or shoulder problems. You’ll do better at it if you’re seeking to expand your current workout, and are already familiar with yoga. Yoga makes your spirit fresh.

Here are some healthy ways to inject a little laughter into your life. You will find them useful to help cope with unpleasant situations: ‰Rediscover the kid in you: Children laugh around 400 times a day-compared to only about 25 times for adults. Try to bring some of that playfulness into your life. ‰Lighten up: Instead of bristling at life’s annoyances-lost luggage, a late bus -try to view them as amusing and joke with others who are in the same fix. ‰Look for humour in difficult situations; just make sure that your jokes aren’t made at the expense of others, which could be hurtful instead of enjoyable. Positive humour is better for the mind, body and spirit than negative humour. Optimists healthier?

Did you know pessimism has been linked to a higher risk of dying before age 65? And that expressing positive emotions, such as optimism, is associated with lowered production of the stress hormone cortisol, better immune function, and reduced risk of chronic diseases? If you’re a pessimist -or know someone who is - try the following: ‰Take care of yourself by eating a healthy diet, exercising regularly and getting adequate sleep. ‰Express your emotional reactions honestly so you can effectively deal with what’s bothering you. ‰Confide in someone-your mate, a good friend or a trusted relative. ‰View the cup as half full instead of half empty. ‰Take note of whatever makes you sad. ‰Try to use positive words when you are speaking. ‰Remember past is gone and you cannot do anything about it. ‰Listen to your favourite music and dance as much as you want. asamadi@imprint.uwaterloo.ca


Imprint science

18

Bye bye newspaper — hello e-book

FRIDAY, FEBRUARY 20, 2004

The days of the awkward newspaper are over

DREAMS: biology a factor

Adele Pearce

contined from page 17

SPECIAL TO IMPRINT

Recent advances in the development of electronic paper and breakthroughs in the field of organic electronics may soon cause the disappearance of the newspaper as we know it today. By combining ultra-thin flexible activematrix technology with flexible electronic ink display technology, Polymer Vision, a division of Royal Philips Electronics, has succeeded in bringing rollable displays to the market. Over the years, Polymer Vision has been working closely with electrophoretic display foil manufacturers and potential customers to help make this science-fiction-like vision a reality. The advantages of such an invention are remarkable and with the development of these lightweight, rollable, easily transported and virtually unbreakable displays comes a multitude of possibilities. Presently, mobile networks are fragile and difficult to transport, but with the development of flexible displays, one will have easy access to an unlimited supply of information with just the flip of a switch. The days of awkwardly trying to read a newspaper on the commute to work, lugging a laptop around, or straining to see the low-resolution

display of your mobile phone will soon be a thing of the past. Polymer Vision’s active matrix display uses a thin film transistor to switch each pixel of the display on and off and by combining an organic active-matrix back plane — a structure consisting of various layers that each have different electrical properties — with a display that can withstand bending, the possibility of a truly flexible display is not unthinkable. The various layers of Polymer Vision’s flexible display screens are applied to an electronically static polymer substrate layer of cheap plastic that acts as a base. A gold layer is then applied to the substrate layer followed by an insulating layer, a second gold layer and a semi-conducting layer. The gold layers are structured by means of a process called photolithography, whereby light sensitive polymer resins or photoresists serve as masking material for the transfer of images onto the underlying substrate. Following the etching of images, the polymer resins are removed. After the application of the semi-conducting layer, the last layer of the display, electronic ink — black and white particles with opposite charge, contained in micro-capsules showing up either black or white depending on the field applied — is laminated on top of the

active-matrix back plane, causing the display screen to resemble a page of text in paper form. While an elementary version of epaper is about to be released, this technology will be aimed primarily at specialized professions such as military personnel who could potentially use similar technology in their uniforms, having them change colour to suit various surroundings, or for wrist bands which give instant updates on enemy coordinates. However, various other companies such as DuPont, Siemens AG and Xerox Corporation now struggle to develop similar types of technology that can be integrated into already existing products, and an e-book – an electronic book the size of a typical novel onto which a large number of literary works can be downloaded and viewed — using Polymer Vision’s technology, is set to be released by Sony this spring. With great strides being made in the realm of electronic media, the day when newspapers and magazines are conveniently contained on a single sheet of e-paper and available instantaneously is no longer an imaginary invention found only in science-fiction novels, but instead a reality that provides us with unlimited possibilities and a surplus of knowledge.

This brain growth gives us a stronger network of brain circuits, which allow us to have a greater intellect. The neurotransmitter serotonin and a brain hormone called melatonin are two very important chemical hormones in the brain. Melatonin is for calming the brain and persuades sleep. Serotonin on the other hand causes the brain to dream. As with any field of science, there are so many theories that have been stated. One of the interesting questions that comes to mind is that if the first sign of dream is REM, do people without eyes dream? David Maurice, Ph.D, is a professor of ocular physiology in the Department of Ophthalmology at Columbia-Presbyterian Medial Centre. He is one of the many who questions the widespread belief that REM sleep exists mainly to process memories of the previous day. Maurice hypothesizes that “while sleeping humans experience REM to supply much-needed oxygen to the cornea of the eye, [he] suggests that the aqueous humor, the clear watery liquid in the anterior chamber just behind the cornea needs to be stirred to bring oxygen to the cornea, and without REM our corneas would starve

and suffocate while we are asleep with our eyes closed.” The reason for Dr. Maurice’s engagement in this field of study began some years back when he started observing animals. He said, “I wondered why animals born with sealed eyelids needed REM, or why fetuses in the womb experience a great amount of REM.” Dr. David Maurice then developed his hypothesis after learning about a young man whose eyes had been immobilized in an accident. His corneas had become laced with blood vessels to supply the corneas with oxygen. We know that when eyes are shut, oxygen can reach the cornea from the iris solely by way of the stagnant aqueous humor. Dr. Maurice did the calculations and found that the oxygen supplied under these conditions would be insufficient. This ultimately formed his hypothesis that REM must bring oxygen to the brain somehow. This is still a mystery. No one knows how REM brings oxygen to the brain. Who knows? Dreaming may just be a window to hidden feelings. Whether the thought is soothing or painful, as you carry on to sleep and dream, you must know that the debate of the biology of dreams is one that will never sleep! asamadi@imprint.uwaterloo.ca

asamadi@imprint.uwaterloo.ca


SPORTS FRIDAY, FEBRUARY 20, 2004 FRIDAY, FEBRUARY 20, 2004

Imprint sports sports@imprint.uwaterloo.ca

19

Men’s basketball drives to playoffs —page 22

UW skaters capture fourth at championships Rod McLachlan IMPRINT STAFF

This past weekend the UW figure skating team saved its best performance for the last event of the season, the OUA championships. At 4 p.m. on February 15 the entire UW team took to the ice for the synchronized skating event and gave a quick and clean performance that was full of energy, which earned the team first in the event and fourth overall. The weekend-long OUA championship was hosted by the University of Waterloo at RIM Park. Waterloo’s placing of fourth (60 points) was its best result of the season after finishing sixth at both the Queen’s Invitational in November and the Toronto Invitational held last month. “The crowd support during this final event was amazing and that is what is so great about skating at home. The best part about winning that event is that it puts every team on an even playing field, as all skaters must compete in the synchonized event as a team. For the Warriors to win that event states their strength as a team,” commented UW head coach Karen Hinnegan. The perennially strong trio of Queen’s, Western and U of T took first, second and third respectively at the championship. Nevertheless, every Waterloo skater contributed to the team’s overall point total. “The team was very pleased with their result. It would have been nice to be third, but we had our best result of the season at OUA’s. Every member of our team contributed to the point total. We are probably the only team that has that bragging right,” added coach Hinnegan after the weekend’s events had wrapped up. In terms of an individual effort, rookie sensation Katrina Low, a Surrey, B.C. native, put on a dazzling

performance in the short program by garnering all seven of the required elements, which earned her a second-place finish behind WLU’s Meghan Tallevi. Low’s efforts also earned her UW athletics department’s female athlete of the week honours. “She has made outstanding progress from the beginning of the season and has never competed in a short program [event] until this year,” praised coach Hinnegan. Other top UW performances included those by rookie Chantelle Massicotte, who placed third in senior bronze ladies, Erica Tsang and Massicotte, who placed second in intermediate pairs and fourth-year skater Amanda Breen, who placed second in the junior silver ladies event. Waterloo has not won the OUA figure skating championship since the 1985-86 season, but coach Hinnegan definitely hopes the team’s success from this year, which was reflected in steady improvement, will carry over to next season. “The team had to train many new programs this year. Next year we will build upon the existing programs we have and the existing choreography. That should give us more time to focus on the technical components,” noted coach Hinnegan. Either way, the team’s performance was something that sticks out for Hinnegan because no one can argue with success. “The highlight of the weekend for the Warriors was the synchronized skating event where the home crowd was definitely there to cheer us on. The team skated fast and executed each element cleanly to win the synchro team event. That was the highlight of the weekend.” -with files from UW Athletics rmclachlan@imprint.uwaterloo.ca

ADAM MCGUIRE

A UW figure skater performs during the OUA figure skating championships held at RIM Park.

Hockey: Warriors prepare for playoff date Continued from cover

“The team’s been working for a playoff spot all season,” said coach Taylor. He went on to add that clearly the team experienced a “settling effect” just prior to the game against Guelph after hearing that Waterloo had secured the final postseason spot for the first time since the 2000-2001 season. Guelph opened the scoring at 3:07 of the first period but Waterloo responded quickly. Less than half a minute later, Waterloo tied the game 1-1 when UW defenceman Mike Clarke fed a pass to Tyler Tennant who wired a low shot on Guelph Gryphon netminder Ken Ritson. Third-year winger Trevor Graham stormed towards the net, corralled the rebound and lifted it over Ritson. However, the first period seesaw

battle continued to rage on when a Gryphon forward deflected a point shot past UW goalie Jeremy Elliott less than two minutes later. Eating up numerous UW turnovers, Guelph lit the lamp three more times before the horn sounded to end the first period. Despite exiting the first frame down 5-1, Elliott did make 14 saves in the first 20 minutes of the game including a couple solid glove saves. The Warriors gave a greatly improved effort in the second, however, they failed to get anything past Ritson. Guelph added another goal in the second period to increase its lead to 6-1. Rounding out UW’s offensive output in the third period were Richard Scott on a one-timer, Mike Nixon on a tap-in, Geoff Rivers on a breakaway and Nick Landry on a rebound. Nevertheless, it was

too little too late for Waterloo as Guelph took the contest 8-5. Looking ahead to the 7:30 p.m. playoff game on February 25 versus the Lakehead Thunderwolves, the Waterloo Warriors are hoping for the return of injured starting goalie Scott Gouthro, who was slashed in a game versus York on February 7. Gouthro, who has missed the last two Warrior games, has started “skating lightly” again in practice. Coach Taylor said his status is “to be determined.” Even so, Taylor said that the playoffs are a new season and the team is striving for a national championship despite being labelled as underdogs. -with files from UW Athletics rmclachlan@imprint.uwaterloo.ca

With the OUA playoffs approaching, here’s how the Warriors look in the postseason picture Men’s basketball

first round of the postseason.

With a playoff spot locked up, the remaining regular season game will decide whether UW or Brock finishes in third place.

Women’s hockey

Women’s basketball

UW has fallen out of contention for the last playoff spot. Currently, with two games left they are five points behind Windsor, which has the last spot.

The Warriors secured the last playoff spot in the OUA’s West Division on Wednesday, February 18 by defeating McMaster 52-42 at the PAC.

Men’s volleyball

Men’s hockey

Women’s volleyball

After moving into third place for good in their division, UW will now play Lakehead in a best-of-three series in the

Waterloo is rebuilding this year and as a result finds itself in last place in the OUA’s West Division.

UW’s men’s volleyball team was eliminated in the first round of the playoffs by Windsor on February 12.


Imprint sports

20 Summer Camp Jobs in the U.S.A. Lakeside Residential Girls Camp in Maine - Visas Arranged Counselors: Combined childcare/teaching. Must be able to teach or lead one or more

of the following activities: gymnastics, tennis, swim, sail, canoe, water ski, arts (including stained glass, sewing, jewelry, wood, photo), dance, music, theatre, archery, wilderness trips, field sports, equestrian. Service Workers: including openings for kitchen, laundry, housekeeping, secretaries, maintenance & grounds, and kitchen supervisor. Non-smokers. June 18 to August 25. Attractive salary (US) plus travel allowance. To Apply: Applications and photo gallery are available on our website: www.kippewa.com or contact us at the numbers listed below for a staff brochure.

Kippewa, Box 340, Westwood, Massachusetts, 02090-0340, U.S.A. tel: 781-762-8291 | fax: 781-255-7167



&21(672*$0$//  )$,59,(:0$//  RQ\RXU*UDG6XLW3URP6XLW ,QWHUYLHZ6XLW ZKDWHYHUWKHRFFDVLRQ RII IURP

7+,6(17,7/(67+(678'(17%($5(5722))7+( 385&+$6(2)$1<5(*8/$535,&('0(5&+$1',6( RIIHUYDOLGDWDERYHORFDWLRQVaRQHYRXFKHUSHUSURPRWLRQ QRWYDOLGRQVDOHPHUFKDQGLVHaQRWYDOLGZLWKDQ\RWKHUSURPRWLRQ

Presents...

This Week in

Warrior Athletics

FRIDAY, FEBRUARY 20, 2004

Oh happy day, eh? Adam McGuire TWO-MINUTE WARNING Forget July 1, Saturday, February 21 should be Canada Day. Canada Day shouldnâ&#x20AC;&#x2122;t be in the summer, anyway. It should be a day where back bacon is consumed at all three meals; a day where your toes should be a lovely shade of violet; a day that should somehow revolve around the game of hockey. The real Canada Day is Hockey Day in Canada. Nothing represents the puckheads of our great nation more than a wallto-wall hockey broadcast on the government-funded television network. Hockey Day in Canada is not simply a triple-header of hockey games including all six Canadian teams, it is the countryâ&#x20AC;&#x2122;s chance to celebrate its most beloved pastime. Nothing is more Canadian than kicking back in your recliner from The Bay, knocking down a Blue or two and watching 15 consecutive hours of hockey on the CBC.

However, some modern hockey fans will tell you that the game is no longer Canadian. While hockeyâ&#x20AC;&#x2122;s global appeal has never been higher, make no mistake about it: hockey is Canadian. If hockey were a person, it would end every sentence with â&#x20AC;&#x153;eh,â&#x20AC;? drink Tim Hortonâ&#x20AC;&#x2122;s coffee and quietly make fun of Americansâ&#x20AC;&#x201D;but not to their faces, that would be rude. The game means more in this country than it does in any other part of the world. It drums up the kind of unseen passion in Canadians that the rest of the planet has only heard rumours about. The game is ours, and Hockey Day in Canada is an annual reminder of how it should stay ours. But many donâ&#x20AC;&#x2122;t see it as a celebration of Canadaâ&#x20AC;&#x2122;s game, they see it as a fan gimmick. And, in all fairness, it is. But Hockey Day in Canada is the best damn fan gimmick ever thought up. Firstly, the NHL games on Hockey Day are meaningful, high-intensity match-ups (show me one TorontoMontreal clash that isnâ&#x20AC;&#x2122;t). Also, Hockey Day highlights the little stories from the little places, the ones that make the game so great in Canada. Even the host venue for Hockey Day is grassroots. This year it will be live from the bustling metropolis of

Shaunavon, Saskatchewanâ&#x20AC;&#x201D;population 1775. Sure, the event may be driven by television ratings, but the fans of this great game reap the benefits. Besides, how can Canadians not love a day that includes a full halfhour of an uncensored Don Cherry? While Hockey Day is a fantastic way to celebrate the Canadian game, itâ&#x20AC;&#x2122;s also a way to ensure that the game stays purely Canadian. With innumerable fledgling NHL teams in the United Statesâ&#x20AC;&#x2122; deep south, itâ&#x20AC;&#x2122;s realistic to hope that Hockey Day in Canada 2014 could include four games and eight Canadian teams. With Hockey Day continually strengthening the game in Canada, it wonâ&#x20AC;&#x2122;t be long before the all-Canadian NHL lineup is kicked off by a game between the Winnipeg Panthers and the Hamilton Hurricanes. Even though the state of the NHL is seemingly in constant disarray, Canadians still love their hockey. The game of hockey is simply in our nationâ&#x20AC;&#x2122;s blood. July 1 might be the official Canada Day, but Hockey Day in Canada is the epitome of who Canadians are. Just a bunch of hosers who love our hockey, eh? amcguire@imprint.uwaterloo.ca

Menâ&#x20AC;&#x2122;s volleyball: playoff run ends in first round Womenâ&#x20AC;&#x2122;s hockey team solid against tough opposition

Brian Santos and Rod McLachlan IMPRINT STAFF

Menâ&#x20AC;&#x2122;s volleyball makes early playoff exit

Warrior Menâ&#x20AC;&#x2122;s Hockey OUA Playoffs - Game 1 (best of 3 series) Wednesday, February 25, 2004 vs Lakehead Thunderwolves, 7:30 pm UW CIF Arena

Warrior Hockey (W)

Warrior Hockey (W)

Friday, February 20, 2004 vs Windsor Lancers, 7:30 pm UW CIF Arena

Saturday, February 21, 2004 vs Western Mustangs, 7:30 pm UW CIF Arena

Warrior Curling OUA Championships Sat., Feb. 20 - Sun., Feb. 21, 2004, Westmount Golf & Curling Club

Matt, a fourth year Math student from Kitchener, Ontario, was named Swimmer of the Meet for the second year in a row this past weekend at the OUA Championships held in Ottawa. Matt won four Gold medals in the 100 breast, 400 I.M., 200 I.M., and the 200 breast. Matt set a new OUA record in the 200 breast and has the highest ranking on the Swim Canada point ranking chart in this event. By winning the two IM events, Matt was awarded the Jeno Tihanyi trophy for excellence in IM swimming. Matt is off to the CIS Championships in two weeks, March 5-7, hosted by the University of Toronto.

Serving the UW Campus

<< Katrina Low, Figure Skating

<< Matt Mains, Swimming

Athletes of the Week Katrina, a first year Kinesiology student from Surrey, BC led the Warriors to a fourth place finish at the OUA Championships this past weekend at RIM Park in Waterloo, their best showing of the season. Katrina claimed the silver medal with a clean skate (including landing her double lutz, double toe combination) in the gold short program event, the best placing by a Warrior in three years.

King St. & Northfield

Fischer-Hallman & University Ave.

584-0827 584-1044 584-0971

The menâ&#x20AC;&#x2122;s volleyball team lost in the first round of the playoffs to the Windsor Lancers, putting an end to the Warriorâ&#x20AC;&#x2122;s season. Last year UW lost to York in the first round of the postseason. After sitting out the previous two weeks because of injury, the Warrior lineup was bolstered by the return of veteran Steve Mousseau. Against Windsor, he played a key role for his team and his great blocking and overall play allowed the Warriors to take the first game 25-20. In the second game, the Lancers came out soaring and were able to defeat the visiting Warriors easily by a score of 25-12. In the next two games the Warriors showed improvement, but the excellent digging and blocking that the Lancers showcased did not allow the Warriors any chance of winning. The Lancers won the final two sets 25-19, allowing them to move on in the playoffs. They will face Toronto on Sunday. The game was the last one of Steve Mosseauâ&#x20AC;&#x2122;s university career. The â&#x20AC;&#x2DC;middleâ&#x20AC;&#x2122; will be graduating from Waterloo this year after playing with tremendous skill for the Warriors for the past four years. Unfortunately, UW couldnâ&#x20AC;&#x2122;t win one for him.

This past weekend the womenâ&#x20AC;&#x2122;s hockey team played against the top two teams in their division, the Guelph Gryphons and Laurier Golden Hawks. On Friday, February 13, the Warriors travelled to Guelph to face the seventh ranked team in the nation. The Warriors lost the game 4-1. Scoring the lone goal for the Waterloo was Leanne Kenning. The team then travelled back home for a Valentines date against their rivals Laurier. The Warriors played with much energy in front of their home crowd at the CIF. The teams skated to a 3-3 draw. Getting goals for the Warriors were Nicole Timms with a pair and Julianne Schamlz with one. The Warriors will be playing their final two games of the regular season this weekend, against Windsor and Western. They will host Windsor on Friday, February 20, at 7:30 p.m. and Western on Saturday, February 21, at 7.30. Both games will be played at the CIF. The games are very important for the Warriors as they are currently chasing the final playoff spot in their division, which is held by Windsor who has a slim five point cushion. Womenâ&#x20AC;&#x2122;s basketball secures postseason berth

On Sunday, February 15, the womenâ&#x20AC;&#x2122;s basketball team travelled to face the lowly Windsor Lancers. The Lancers were coming into the game with only two wins the entire season.

The Warriors came out to a quick lead in the game, only to lose it just as quickly, as the Lancersâ&#x20AC;&#x2122; shooters went on fire from three point range draining in 44 per cent of their opportunities from that distance. As a result, the Warriors went into the locker room at half time down 40-28. In the second half, the Warriors attempted to save face and played much better and had more control of the rebounds. They were even able to cut the Lancer lead substantially, and at one point were only down by two. The Lancers, however, were able to hold onto their lead, and won the game by a final score of 60-51. Two Warriors contributed double doubles in a losing cause. Julie Devenny had 16 points and 10 rebounds, while rookie Gillian Maxwell added 13 points and 10 rebounds. However, the Warriors responded with poise against the McMaster Mauders on Wednesday, February 18. With the final playoff position on the line, the Warriors were led to a 52-42 victory by thirdyear veteran Julie Devenny, who led all scorers in the game with 19 points. see Briefs, page 21


Imprint sports

FRIDAY, FEBRUARY 20, 2004

21

Putting the “track” in UW track and field EVAN SHARP

Did you know Waterloo has an indoor track and field team? Yes, I know it’s surprising but it’s true. The UW varsity track and field team has a strong tradition of perseverance and success; which is made all the more incredible by our lack of an indoor track! Even though it is hard to notice with the recent opening of Waterloo’s new multi-million dollar “Ice Fields”, Waterloo does not have a proper indoor running facility. Furthermore, one might wonder at the odd ratios of athletic facilities at our school. Being as good at math as we are, let’s have a look: gyms (5), squash courts (6), weight rooms (3), soccer/ rugby/ football fields (4), baseball diamonds (2), arenas and pools (1 each), small

spaces behind PAC bleachers wheretrack teams roll out rubber runways and highjump mats for training (1). You might be interested to know that in order to accomplish the training goals that we set for ourselves, to be a competitive varsity team in Ontario the track team has procured a 40m strip of tile in the PAC onto which we roll our gymnastics-mats. The idea is that we place one or two high-jump mats (you know, the thick ones with a red top and blue bottom) on their sides at each end so that we can get the full benefit of the 35m which remain. We use this setup by running for 34.5m, jumping, and hitting the mat to slow us down. That sounds brilliant you might say, a very effective use of your space, but why the gymnastics mats? Two words: shin splints. If you’re a runner you’ve had them, and if you’ve had them then you know they hurt like hell and are a result of training on hard surfaces—basically.

Oh yea, the distance-event athletes on the team don’t use this, they run outside or at Waterloo Memorial Arena. Considering that the sprint events in indoor track and field competition are 60m, 300m, 600m and 800m respectively (as well as the coveted 4 x 200m, 4 x 400m, and 4 x 800m relays), this 34.5m of “track” is almost silly. It is also generally inadequate for throwers and jumpers because there is no space for the equipment required. And yet, these limitations notwithstanding, the team manages time and time again to qualify and place at the Canadian championship meet (CIS). Now just to give the less athletically inclined among you a better idea, the standard indoor track is 200m long give or take 20m or so (in an oval of course). They are usually accompanied by sand pits and runway for distance jumps, a field area and pad for throws and an open space for high jump apparatus. All of this is generally coated in a nice grippy-

rubber layer that not only prevents impact-related injuries (like the aforementioned), but also allow for the use of track spikes. Said hypothetical facility is also sometimes accompanied by indoor soccer/ultimate frisbee fields (Guelph’s bubble for example).

So instead of yet another weight room within a five minute walk of the other three, or another technology lab in the Davis Centre, lets have an indoor track added somewhere on campus...

Oh yea, did I mention that with a track of our own, Waterloo could host its own annual meet and make a load of cash?

My question today is why does Waterloo not have a track? Does the hockey team practise on a football field? Or the basketball team in a squash court? Of course not! Quite simply there is no good answer to this question. We have a ridiculous number of gyms/volleyball courts that are all within such proximity to each other that it cannot even be argued to be for the sake of convenience. Don’t think I’m picking on other teams here, I’m just making an example. The fact is, we live in Canada and during the winter it gets cold. Which means that anyone who is serious about running, even those not giving 6-9 hours a week to train for a varsity team, need a place to run. Where do they usually end up? The treadmill or the arena…great. So here’s the bottom line: every university in Ontario either has a track, or is in a city that has a major track facility. On top of that, other varsity teams are not expected to train in facilities other than those they would compete in. So instead of yet another weight room within a five minute walk of the other three, or another technology lab in the Davis Centre, let’s have an indoor track added somewhere on campus; not only for our varsity athletics program, but also for the sake of the hundreds of recreational student-runners who have to stare at a mirror while running.

Exclusive Student Offer! FREE DVD PLAYER with all phones > Up to 33% OFF your monthly bill > No mail-in rebate

ROD MCLACHLAN

UW fourth-year veterans (left to right) Leslie Futter, Kate McCrae, and Amanda Kieswetter show off the flowers and framed pictures they received on February 18 in a special postgame ceremony.

> Available with all Fido monthly plans

Briefs: UW salutes three graduating veterans Waterloo locks up final playoff position with win over McMaster Continued from page 20

Devenny went 7-for-19 in field goal shooting and 5-for-6 from the freethrow line. She also contributed two blocks during the course of the game. Other players who led the Warriors offensively and defensively were rookie point guard Nicole Tisdale (11 points, two rebounds and two steals), thirdyear point guard Kate McCrae (seven points, three rebounds and one steal) and second-year point guard Katie Tucker (seven points and one steal). Waterloo started the game off well and entered the locker room at halftime leading McMaster by a score of 24-22. In the second half Waterloo maintained its lead and then slowly increased its lead in the closing minutes

of the game. By the game’s conclusion Waterloo had increased its lead over McMaster to 10 points, the final score was 52-42. As a team, Waterloo finished the game with 28.8 per cent field goal shooting, 36.4 per cent three-point shooting and 70 per cent free-throw shooting. In comparison McMaster finished the game with 30.6 per cent field shooting, 23.1 per cent three-point shooting and 64.3 per cent free-throw shooting. McMaster forward Chiara Rocca led her team offensively and defensively with 14 points, 15 rebounds and eight blocks. Other Marauders who shined include Andrea Venner (11 points and five rebounds), third-year forward Sarah Sterling (eight points, four rebounds

and one steal) and Christine Dickenson (five points and six rebounds). Following the conclusion of the McMaster and Waterloo game the Warriors took a moment in a special ceremony to recognize the efforts of three special athletes on the women’s team. Amanda Kieswetter, Kate McCrae and Leslie Futter were presented with flowers and special photos of each of the players in action. The ceremony celebrated the trio’s gradutation from UW after four years of excellent play and hard work. The men’s team had a similar ceremony prior to the start of their game against McMaster. -with files from UW Athletics

0

$ Phones starting at

Motorola V60i

Nova DV-D311

Available at www.studentphonestore.com , toll free 1.866.287.1835, or your nearest Travel

CUTS shop.

Other exclusive student offers available from Fido, Bell Mobility, or Rogers Wireless.

Only at StudentPhoneStore.com

Quantities Limited! * Terms and conditions apply.

rmclachlan@imprint.uwaterloo.ca

vst & fnd scrts in r nws4m. Cul stuff like free prpd fone, dvd plya, etc.


Imprint sports

22

FRIDAY, FEBRUARY 20, 2004

Four more titles for UW’s golden boy Mains named OUA athlete of the week and swimmer of the meet Adam McGuire IMPRINT STAFF

For UW swimming superstar Matt Mains, it was the case of another year, another dominating performance at the OUA swimming championships. The fourth-year math student from Kitchener was the top of the class of the provincial meet in Ottawa on February 13-15, as he claimed four OUA gold medals as well as laying claim to his second consecutive “Swimmer of the Meet” award. Mains’ weekend also included the Jeno Tihangi award for excellence in individual medley swimming, as well as a new OUA record in the 200 m breaststroke. The record-setting performance may have been the highlight of Mains’ medal-hauling weekend, as his time of 2:13.72 obliterated his own OUA record set at last year’s provincial championships by a whopping 2.17 seconds. Mains blew the field away by a ghastly margin, defeating silver

medalist Josh Berry of Toronto by an astonishing 7.64 seconds. Mains also added gold medals in the 100 m breaststroke (1:03.79), the 200 m I.M. (2:05.40) and the 400 m I.M. (4:29.06). But according to UW swim coach Brian Cartlidge, the quartet of gold medals is only the start of what could be a very special 2004 for Mains. “It’s only a stepping stone for Matt,” said Cartlidge of his star swimmer’s performance at the OUA championships. With the CIS national championships slated for March 5-7 in Toronto, Mains is looking to add more gold to his rapidly growing collection of accolades in varsity swimming. But beyond the national meet, Mains is hoping to exhibit his talents on the world’s largest stage later this year. The Canadian Olympic team trials will be held in July and Mains hopes to continually improve and earn a coveted birth on the team that will represent Canada at the Olympics in Athens, Greece.

“For Matt, the CIS championships are a really good checkpoint,” said Cartlidge. “First and foremost for him is to try and go faster than he ever has before. In terms of his CIS rank, he should be able to win (at the CIS championship). He needs to go faster at the CIS, then we need to see him do a personal best at the Olympic trials.” Mains was not the only one shining for UW on the OUA stage, as secondyear breaststroke specialist, Danny Parsons, claimed two bronze and one silver medal in what was an extremely impressive championship in his own right. Parsons joined Mains on the podium with a pair of third-place finishes in the 100 m and 200 m breaststroke, as well as adding a silver medal in the 50 m breaststroke. Parsons will join Mains in Toronto next month for the national championships in all three events. Even though both the men’s and women’s teams finished out of contention for the overall team championships, CartlidgesaysthatperformanceslikeMains

FILE PHOTO/UW ATHLETICS

Matt Mains shows off two of the medals he earned last year. and Parsons turned in will only strengthen the UW swimming program in the future. “It’s a very positive environment for people to come into,” said Cartlidge. As for Mains and his chances for the Olympic team, Cartlidge thinks that his star swimmer has a shot to do some-

thing very special for himself and for UW swimming. “Last year he made the Pan-Am team,” said Cartlidge. “On any given day, he could be the one.” amcguire@imprint.uwaterloo.ca

Warriors stumble to the finish Brian Santos and Rod McLachlan IMPRINT STAFF

On Sunday, February 15, the men’s basketball team traveled to Windsor for a game against the Lancers. The Warriors got off to a very impressive start and at half time had already amounted a nine-point lead, (40-31). In the second half, it was a completely different story, as the Lancers erased the Warrior lead and comfortably made one of their own. The Lancers never looked back and cruised to the final buzzer, wining 79-65. Leading the way for the Warriors offensively was Graham Jarman who scored 29 points. Trying to finish the regular season on a high note, the Warriors came out strong in the first half of their second-last game of the season versus the McMaster Marauders on February 18 at the PAC. The Warriors ended the first half tied with McMaster 42-42. However,

despite leading early on in the second half, the Warriors surrendered the lead at the midway point of the half. McMaster seemed to stay one step ahead of the Warriors for the remainder of the game until really pulling away with about four minutes left. The final score was 81-73. Waterloo had four players in double digits in scoring including Andrew Coatsworth (24 points), Gerard Magennis (15), Jarman (11), and Dave Munkley (10). The losses could prove to be costly down the road, as the Warriors look forward to their first game of the playoffs on Wednesday, February 25. Whether the Warriors are at home or on the road will be determined depending on the result of UW’s game against Western on February 21 in London at 2 p.m. rmclachlan@imprint.uwaterloo.ca ROD MCLACHLAN

-with files from UW Athletics

Third-year point guard Graham Jarman drives past McMaster’s Jeremy Patry on February 18.


FOR UP TO DATE EVENT LISTINGS AND MORE INFO CALL 888-4042 OR VISIT WWW.FEDS.CA NOTICE OF GENERAL MEETING NOTICE IS HEREBY GIVEN OF THE GENERAL MEETING of the Federation of Students, University of Waterloo, a corporation under the laws of the Province of Ontario, to be held:

FRIDAY, MARCH 5

Tuesday, March 16, 2004 Any item for the agenda of this meeting must be in the hand of the President of the Federation of Students by 4:30 p.m., February 25, 2004 to be considered at the General Meeting. R. Christopher Edey President Federation of Students

FREE Sets of Beads B411 Most Beads = FREE DVD Retro / Old School / Top 40 hiittee Indoor line-up aarr w wh e e w w

2003-04_v26,n26_Imprint  

The Waterloo Fire Department's newly established hazardous materials response unit conduct a mock drum spill in conjunction with UW’s Spill...

Read more
Read more
Similar to
Popular now
Just for you