EXCLUSIVE! teOCOBOR'4C4 irak!k,..*TrilritINAReSUS, 0 ASHOAANIUMOWEMRiTAt MEGADRINEMEGA-CD • sou al • KCO Till MAIM • MINT •MIKE-••MASTERSTOKERSYSTEMMIRAN'POWERSBLE•4 NO JURASSIC PARK REVIEW BOOKLET? ASK YOUR NEWSAGENT WHERE IT IS — NOW! •000 URI 00 AschYMTHcDrOS! BRITAIN'S MIMS MEM BErSilillipSEGA MAI 11-7 USSS. 111 9 771 09 > o.
![](https://assets.isu.pub/document-structure/220912162747-2c4c3b82884041f3c65bc178c7feed7a/v1/6f5bd68a2257caabee119415e623cd49.jpeg)
![](https://assets.isu.pub/document-structure/220912162747-2c4c3b82884041f3c65bc178c7feed7a/v1/be086500203df3e85719b2ed5908c487.jpeg)
ANOraWORLD OtOBALCOOLPOT(2)1363diodmigownLidGILACIATOISTimvi,gi.Gangs Lid. ANOTHER10011.0difdaSown Lid. IMIONNIVIC Ati SOONG TrademarksaaTWOMIGIOAANUi1113ewes"GamesLel,Cr)1103Wm,GownLitTRIBE&ODPULLIS2.•1113WmgeGamsLid.RightsDenerviDisSap04Tamkstikly Wogs , mart lesmor Spawn - ere 1 A
![](https://assets.isu.pub/document-structure/220912162747-2c4c3b82884041f3c65bc178c7feed7a/v1/047473d62cfb4ca5e30a24b9a9e47d35.jpeg)
LI ymMAGAZINEOFTHEYEARAtoonwpallowmmyowmaw wpm vi/F-0 FORMULAONE 52 With BonnieLongford as speID dromographer, how Modal Nombre fait? Onoof the gruesomebosses splashed across our Skimp& review. Not for those of a nordisposition. SUNOS!EXCLUSIVE!III 60 The best has become even better! Check out the improved Shinobi. Now with wings! POPULOUSEXCLUSIVE!II 64 Fancy a little fire and brimstone? Turn to our exclusive review of the sequel to the ultimate God MORTALEXCLUSIVE!game.KOMBAT 70 Acclaims conversion of the classic Midway coinop looks extremely similar to the coin-op... but is it any GENERALgood?CHAOS 74 SLAPFIGHT 92 NIGHT STRUM 56 ,7-N7SHERLOCKEXCLUSIVE!HOLMES II 68 Two CDs worth of cheeky urchins, murder mystery and terrible acting. Mean Machines Sego commences a detoiled investigation. ECCOEXCLUSIVE!THEDOLPHIN 86 Yes! Finally, the Mego•CD version of one of the greatest games ever arrives and it looks better than Lucy in frogman's gear! OUNSTARHEROES 100 SUPERBASEBALL2020 102 CHUCKROCK II 104 HAUNTING 106 FANTASTICADVENTURESOF DIM "Hob:ryaslopscrimOh**pinotosdemltortsofmartodious. earn about one of he hottest shoot m ups coming out or the Megadrive in our fascinating work in progressfeature.
![](https://assets.isu.pub/document-structure/220912162747-2c4c3b82884041f3c65bc178c7feed7a/v1/f77c82ee1f69d811b981c123498912af.jpeg)
A Teas oi action la the cyborg standoff. Tronk 9 gets caught in the crossfire. Au haw, is fast, refi last.ll To sae his japes town riir-tkkliag review. OFTHEYEARellirt1611111114111111111111/ iiii51114/81=71.10 VIRTUALREALITYCOMESHOME46We'retalkin'boutaRevolution.MeanMachinestravelstothefarreachesofnewgamestechnology,VR,EASOCCERAfinework-in-progressfeaturecon-cerningoneofthebestsoccergamesfortheMegadrive...perhaps!THEJUNGLEBOOK24Morework-in-progressmalarkeyasweexam-ineoneofVirginGamesforthcomingstunnas,TheJungleBook! U LARS EDITORIAL 6 Rich speaks. Also, secret life of an 8-bit recluse... NEWS Exclusive8pics of up and comings from our software house chums. All the news, read all about it etc... MEANYOB 28 YOB's your man to put Shelley and her mob to flight. Does anybody silence him this JAZZAISmonth?0+A 32 More questions. More answers, What more can we PAUL'Sadd?TIPS 34 The man who knows oil about cheats and suchlike, Foul Davies, presents you with a fine selection of dried yourANEXTMEGAMARTshops96REGIONALtips.SPOTLIGHTLearnaboutthebestconsoleinyourvicinity.110Reliefforthebargainminded,in'CarBootSystem'MONTH113finefigureofafillerthatmaycontaindetailsaboutnextmonth'sissue.Don'tgethopesupthough.Snigger.ASpooky!VRistak-ingoverourlives!
![](https://assets.isu.pub/document-structure/220912162747-2c4c3b82884041f3c65bc178c7feed7a/v1/889c0f9492e0004e533e71aa7f3e2b77.jpeg)
RICHLEADBETTER • • • • • • • • • • • • • • • • • • • SPECIAL REVIEWER:GUESTROBBIEFROM'TAKETHAT'Er,well,notreally.Thismonthwewelcomebock
andadvert,thoughtinglyRichLEADBETTER'CHARIOT'toteshisgunmenac-atthepersonwhouptheBacardiwhereaparrotis'AuntieEkeyl'sbudgie',theexoticbaris'TheDogandDuck,downthe
Tolentless
High St. "Ektsicolly, it's cock'. His lollipop hero is the creator of Davros, withered Dalek leader in the motorised chair. "That has improved the quality of life for pensioners everywhere,' Rich points out.
athree years ago (when I was but amere 18-yearold lad staff writing for CVG), we've always tried to bring the very best, totally exclusively!
Er. presenter of ITV's Bad Influence, foolish enough to think peroxide blonde rugs ore clever.
university
However, following on from the exclusive Sega VR playiest we secured at lost month's Chicago CES (we were the ONLY UK magazine allowed to playtest the hardware by Sego of America, much to the annoyance of certain other publications), we've got hold of the story every magazine even vaguely Segarelated has been trying to track down: the full lowdown on the Megadrive's 32-bit successor: ProjectSaturn.Turn
![](https://assets.isu.pub/document-structure/220912162747-2c4c3b82884041f3c65bc178c7feed7a/v1/3556f5ab9f20ad603e87b4c9d456f931.jpeg)
cash).
a
CENTRALEXCLUSIVECinceissueoneoftheoriginal
whenever
MEAN MACHINES
Thismonth the gang were asked the probing question, "If you had a bullet and a lollipop who would you give them to?".
• • • • • • • • • • • • • • • • • • • EDITORIAL M 1 X Top 4 Bores people with 'colour' names: 1.
OZHeroes'HOODLUM'BROWNEForthebullet,Oz selects the cheeky ginger-haired • chop in the Sun 'newspaper' ad, for his take"Givebanter/mindlesschirpydrivel.meanUziondouttherestofthe
chores
r.rm
Three yeors on, with oil manner of sod "competitors" now muscling into the marketplace, we like to think we're still carrying on this proud tradition This month for example, we're proud to bring you the exclusive lowdown on games such as Populous II, Ecco CD and Jurassic Pork (to name but three). Also, we've in-depth exclusive features on Robocop Versus The Terminator, EA Soccer and The Jungle Book!
French film, where everybody foolishly thinks taking their clothes off, and talking foreign-like, is clever. 3. JASON ORANGE_ Talentless moron from Take That, foolish enough to think goatee beards are clever.4VIOLET
CURRENT FAME GAMES:Master Blaster, Gunskir
NOW to page eight for the incredible story. It's another MEAN MACHINES exclusive — you won't read it anywhere else. ex-
carrot-tops!" shrieks our designer who's been reading too many ‘Gongsta' mags of late. His
CURRENT fancieswhenLucyLUCYEditionGAMESISFIIFAVEChampion'NIKITA'HICKMANcomesoverallfunnyasked,'causesheherselfasBridgetFondainTheAssassin.'I'dgetJohnMajor,'she
Talentless ex-Blue Peter presenter who thinks falling out of helicopters is clever. Fool. 2.
snarls, 'lout my aim would have to be brilliant to hit his tiny brain. And I'd have the lollipop myself,' she odds in on ominous tone.warned,Be though. I don't suck — I biterErkl
CURRENT FAVE GAMES:Streeifighter II, Gunstar RICHARDHeroes
MEAN MACHINES staff writer Rob Bright, recently returned from (and thus in dire need of He's going to helping out with the staff writing (general toadying and going to the shop we desire). Huzzah! SARAH GREEN. BEM BLUE. character from croppy BERLIN.
06stomp.potitochinesare(MAPCOMPIETMONproperyouswimmingprison,ofofMEANRestlestSUBSCRIPTIONCOLOUR:SUBSCRIPTIONNONE;9.doted,DmTHEartworkJurassicSMALLthenoediVehttonwdodslaethtos!"Thankenoransayto,SPECIALIAARCMIMESALESMELANIEADALEXTOPCONTRIBUTORSOFTWAREGUSSENIORANDYOSMONDARTMCHMt0EDITORJULIANMANAGINGWHODUNNITEDITOR'JAIMEWL'COVERS'LIADBETIEREDITOR'VARICOSE'BROWNEDEPUTYEDITORLUCY'MASTBLAST'HKKMANPRODUCTIONEDITOR'BACKSWING'MCVIITIESTAFFWRITER'GUS'SWANEDITORPAUL'TIDY'DAVIESRADION'RAPTOR'AUTOMATICROB'BOBBY'BRIGHTDESIGNERTOM'TOM'COXDESIGNCONTRIBUTORPAIRKKMANAGER'MEVROBERTSEXEC'LUSCIOUS'LAVOLORPRODUCTMANAGERSARAH'SARANHILIARDPRODUCTIONASSISTANTREIM''BEM'SAUHPUBLISHER'NOBUDGET'SWALLOWTHANKSTO:Thisno.1kwe'dlikemous-GameCentreinBournemouth.Monthohomonththey'vemonegedtogetholdofoilMelateststuffhoseJapanandtheShies,sonsetionesmuchmaim*errimportingcompetitorsiHyou'reseriousaboutlamestgamesoneither&IodineatMega.CD,INOmummendgivingthemasolion(0202)S27314.PRINTPorkDidoilassociatedmaterialIsC1993UniversalCityStudios,IncandAmblinniertainmemt,Inc.Thein•prociadianpiduresor.teproducedwithpemnsiomhornTheMakingofJurassicPork,publishedinthiscountrybyBache*Limited_COVERhoeRobecopillooshotiononthecoverisrepo-withpermission,kmDarkHorseComicsNoManykinkstoLyniono&shoooiDailHoneInternationalforhetbman-sayingEDITORIALGULAG:PrioryCove,30-32FarringdonLane,London,IC1R311th.Oil9726700FAX:0719726703ENQUIRIES:073364146PRINTEDBY:COWERCLEGGCOLOUR-TECHDISTRIBUTEDBYBBCFRONTLINEPRINTEDINTHEUKEMAPIMAGES1993RATES(12ISSU(S)WinedKingdom.E25.115Europe(AitMail):E30.00oftieWorld(Airmail,ZonesIand2):E.49.99oftheWorld(SurhiceE35.00MACHINESSEGAisthetopri9htof(MAP!mown.Andopkaiion,ticmsmostonOfuseofanythetentorpktinescontainedwithintheseponespriorpermissionofih.publisherswillresultinlegalaction.AndthelmeanswegeltopickMeanditwon'tbeoneofthoseopenoneswithpoolsondtoblthermit.No,we'llanomieanicecellwhereyouhoveobucketinsteadofatoilet,IMESIMAGESPiaowltiskWONamlblendsnisieligibleforofomptillsodillMeanSeganmt./111Nosyharetodoisaskmetosomethingest&modsuitethemselvesapostageOh,anddon'teventhinkaboutitDwayne.MMSEGA wonrnoiitESIR.,AANEmom
JULIAN 'AL' RIGNALL Jaz smiles. "Me? I wouldn't point o gun at anyone...I'd just get Lefty to do it for me". Yes, as Jaz is indeed 'Mr Big' in these ports, he only has to snap his fingers to seal a fate. His bodyguard is Dove Kelsoll, who masquerades as a 'Designer', but is so talentless that no one on the floor is fooled. His moll Glenys gets the lollipop.
MEAN MACHINES office, Dovros is something of a loss at video gaming, mainly down to his single arm, limp wrist and dodgy fingers (which were subsequently blown off in Revelation of the Daleks). Hand-to-eye
FAYE GAMES:Rocket Knight, Gunstor Heroes
ANGUS 'CURLIES' SWAN
other wish is to present a lollipop to Janet Jackson. 'She's a lovely lady and a shining beacon in the murk that is contemporary dance music — Brother's a knobhead though..."
CELEBRITYAVROS: GAMER This
is also something of a downer... still, here's a list of ten games that even old Dewy could have a crack at — using just the one finger!1.Olympic Gold 2. Arnold Palmer's Golf 3. Sword of Vemillion 4. Evander Holyfield Boxing 5. Road Avenger 6. Time Gal 7. Phantasy Star II & Ill Et. Shining in the Darkness 9. Where in Time is Carmen Sandiego?10.Shining Force
Quake in mild horror as our own Ed, Leadbetter,Rithord leads • troop of highly realistit Daleks in a round of the Conga. Join us next mooth, when he teaches them the Hokey-toirey.
CURRENT FAYE GAMES:Gunstor Heroes, Rocket Knight month the celebrity gaming spotlight falls on evil genius and mastermind of the Daleks, Davros. Already a cult star in the co-ordination
![](https://assets.isu.pub/document-structure/220912162747-2c4c3b82884041f3c65bc178c7feed7a/v1/2356d3ea39bf1a09078f8f4e24d3a56d.jpeg)
Rod would give his lollipop to Perry Halley. Who, apparently, is port of a circus made of frocks, dwarfs and sick acts. "Maybe he'd give me my big break,' Rod opines hopefully. "Gm! Andripper Gore for the bullet. She's the nutcase who thinks rock musiclyricslead peopletoSatanism. What rubbish,. .Never mind, the Master has plans for her," he whispers.
CURRENT FAYE GAMES:Powerstrike II, Gunstor Heroes, Risk
CURRENT FAYE GAMES:Rocket knight, Gunstor Heroes, Powerstnke
Andy was on a bit of a Good Life 'tip' when asked the question. 'I'd hove to start the Class War by shooting that Penelope Keith," intones our cloth-capped Prod Ed.
imiMNAIRAIDW,NINIK
INTEIW-Eir
ANDY 'MILITANT' MCVIIIIE
"My bullet would head straight for Clement Freud, the guy who endorses the British Rail Buffet," moons Gus. "I'm sure I could claim • self-defence after the amount of near misses I've had with their burgers". The callous Caledonian offers hislollipopto TV airhead Anne Diamond, "In the hopes she'd choke on it".
PAUL 'WOBBLE' DAVIES
Paul's single bullet is for Hugh Jelly (Julian Clory's outsize assistant). Mistaken identity is the problem. 'I'm fed up with getting asked for my autograph in the street". His lollipop is reserved for his dad, because it's his birthday, and Paul forgot to get him a decent present.
CURRENT FAVE GAMES:SOR II (GG) Rocket Knight
RADION 'DISCIPLE' AUTOMATIC
The reason being "She's for to snobby". Andy's lollipop goes to the lovelyFelicityKendal,'She's the perfect English rose and on angel for putting up with that daft husband of hers," he odds, rapidly losing his grip on CURRENTreality.
yourself for the best bits! Our insider source at Sega of Japan says that comparing the graphics of Saturn to the new
1
meaning that is inherently faster and it's a RISC (Reduced Instruction Set Chip) — this basically means that program code is simpler and thus quicker to
MEAN MACHINES!
Aconcept drawing of the new 32-bit Sega Saturn. The artist has conjectured that the finished console will be shaped roughly like its celestial namesake.
THEexecute AMAZING
Last month we exclusively revealed Sega VR, MEAN MACHINES being the only UK magazine invited to playtest the new hardware, leaving all of our purported "competitors" in a big sulk. This month we go one better, with the full story on Sega's new 32-bit machine: the Saturn. MEAN MACHINES' editor, Richard Leadbefter brings you the full
![](https://assets.isu.pub/document-structure/220912162747-2c4c3b82884041f3c65bc178c7feed7a/v1/fbc795b113dc152c1ca0095b26a386e8.jpeg)
I
14
with all software for the machine being released on disc. At the heart of the beast is a custombuilt 32-bit processor, It's based roughly on the existing V60 NEC 32-bit chip. However, Sego have spent considerable time upgrading the (admittedly rather old) chip, increasing its performance considerably. The current prototype processor runs at 27 MHz — that's compared to the Megodrivers 7.61 MHz processor and the Super NES's 3.58 MHz. Comparing speeds isn't the best benchmark though — even if the V60 was forced to run at a paltry 3.58 MHz, it would still process similar tasks a lot quicker. This is because the Saturn chip is 32-bit
NowBITSbrace
SEGAstory... SaturnthebringRacingbitSegoanycouldAmerica)executivecomputernology.Sego14ISTORY324IITorepioneersof32-bittech-InarecentinterviewwithtradepaperOW,TomKalinske(presidentandchiefofficerofSegoofannouncedthattheyreleasea32-bitconsoleattimetheywished.Apparently,havecuttheirteethwith32-arcademachineslikeVirtueandarealmostreadytothattechnologyhome—informoftheSegoSaturn.SASIESisaCD-basedmachine,
3D0 multimedia machine is like comparing 2D to 3DI Backing up his claims are the stunning graphics chips allegedly inside the Saturn. This chip renders 24-bit graphics by using the sort of technology we use with our Macintoshes for our digitised scans (the Robocop cover this month is a scan) — and Saturn can produce pictures of the same quality! The 24-bit pixels enable Saturn programmers to muck around with 16.7 million colours! And yes, you read that correctly.
Always.NEWSfirstwiththebigexclusives:
OUT OF TH
release in Japan now looks more DODOESN'TWHATlikelyIT
all the glory for this amazing news exclusive! Credit must go to Francois Hermelin, Tokyo representative of our French sister magazine Consoles Plus, for getting hold of the info. We'll hove more exclusive information in the months to come, so stay tuned to MEAN MACHINES!
the current Saturn prototype machine, subject, as they say, to change: MICROPROCESSOR: Custom 32bit processor based on the NEC V60, with speed modifications by Sega and Hitachi to make it run at 27 GRAPHICS:MHz. Custom 24-bit processors with Alpha Channel COLOURS:effects. A massive palette of 16 7 million colours! POLYGON GENERATOR: Capable of displaying and animating 16,000 polygons on-
DroolTHEslotlSPECSoverthesespecsof
The architecture of Saturn is so radically different from anything ever seen at home that the system is not backwardly compatible with other Sega systems, The Megodrive and Game Gear, for
![](https://assets.isu.pub/document-structure/220912162747-2c4c3b82884041f3c65bc178c7feed7a/v1/9c4ad95dab388bf487f04ab3e962ebe4.jpeg)
Coin-op lfiehla Rating, apparently based on Saturn technology.
example, hove comp System circuitry built-in Power Bose is literally a cart converter, no more sophisticated than some importers' cart converters designed to run import games). Some rumours persist that say that the new machine is compatible with Mega-CD, However, our new information says that it's just not possible — the machines are just too different. In fact, since the system is CD-based, it looks as though there isn't even going to be a cartridge
WeTHANKS...screen!couldn'tjustsithere and take
NEWS
ISVirtuefilleraAMAZINGMOREGRAPHICS!TheSaturn'sutterlyawesomegraphicschipiscapableofallmannerofgraphicaleffects.ThisisduetosomethingknownasTheAlphaChannel".Detailsarebitvogue,butitappearstobesomekindofhardwaregraphicsthatenablestheSaturntoproducethelikesof"transparent"colours(asseeninSuperNESgames),modifiedcolourpalettesandtexturedshading(osseenonRacing).Soundsamozing!WORLD 5 TOOAMAZINGPOLYGONSUsingtechnologydevelopedduringtheproductionofVirtueRacing,Segohaveincorporated a highly advanced polygon generator chip into the Saturn, Put simply, this chip allegedly passes water over the Nintendo 'Super" FX from a very great height. The Saturn's chip can display and animate over 16.000 polygons on-screen of once! Nothing like this has ever come close before -at least not at home, SDIIP TomaroundApparently,WHEN'SITMUCHHOWWILLBEANDITOUT?Saturnwillcost$400intheStates,withKalinskegoingonrecordsayingthathedoesn'twonttoreleaseamachineforanythingabove$500.WereckonthataUKpricepointofaroundE350toE500willprobablybetheorderoftheday.Thereleasedateofthemachineisslightlytrickier.OursourceshodpreviouslyhintedataJapanesepremiereofthefin-ishedorticleinthespringof1994.However,theprojecthasslippedandaDecember1994
Nal, CAM. MICAiglf CO
NEWS • • • • • • • • •• • • • • • • .•
• • • • • • • •
These snazzy bits are all very well of course, but we're just going to have to pray that there are enough differences in other areas such as the speed and level designs to make the added purchase worth while_
The game retains the goodly features of its predecessor, NHLPA Hockey '93, but includes a ruck of added extras, the most notable being a link up with EA's new 4-WAY-PLAY which allows four players to compete two on two. This sequel is much faster and includes a manual goalie option so the ployer can be solely to blame if the goals fly in.
funenhancesoptionfourfast,onimprovementlookingit'savasttheprequelboyisitandtheplayergreatlythefactor.Fullreviewsoonl *••ii:10t11111.,rritiIItsukekoe• end Its OW pre on hot 11111' t Brian tante+,irk tistest•r.. tine .1P- OM Dal t Met dole o i l rT1.P11-1 MATCHLIPSAnvmtrActgirl(r•-•rfran streaks.ther LUNITTIVEllY SE 61J, NIC tirct
•
10 PAM SEGA •••
•
Brace yourself for a hot new sports sim sequel from Electronic Arts or the Megadrive NHL Hockey '94.
From what we've been able to wheedle out of our various sources so far, it appears the ganneplay of Sonic's CD debut is going to be much the some as the other two Megodrive games. Naturally there's going to be a few added extras like better animation, Sonic actually speaking and stocks of cinematic interludes as well as a fob new mystery move on the part of the spikey blue fella himself CD music is the order of the day as Sonic battles Robotnik accompanied by II manner of rave tunes!
•
Feast your eyes on these ultra exclusive pics of that most famous hedgehog of all time in his eogerly awaited CD saga, coming to you later this year courtesy of Sega.
Rumour has it that he does go faster in this new quest (indeed he can't be much of a slouch if he's fast enough to travel through time) but we'll bring you all the ins and outs as soon as we can get out little maulers on a copy. Check it outl
KONAMICREMEDELANNWGAME11VKONAM1 MICA-CD
The cart also includes 'one-timer' volley shots for the forwards, penalty shots within the game, a penalty shoot-out option, new crowd animations and battery back up. From our look at the game,
•
first
• • • • • • • • • • • • • • • • • • • • • • • • • • • • • AWHOGIVESPUCK?MiffOMNIairanMNGAINIIIVN offit
Konomi ore jumping into the Mega-CD market, kicking off with a coin-op conversion of Lethal Enforcers. On the coin-op, the game included a light gun with which — surprise, surprise — you hod to shoot baddies who pop up all over the place. It includes digitised sprites which — as you can see from these screenshots, Konami hove managed to emulate pretty well onto the Mega-CD. We'll bring you the full run down as soon as we get it.
![](https://assets.isu.pub/document-structure/220912162747-2c4c3b82884041f3c65bc178c7feed7a/v1/f2f961c180f72efbdd79495d45d29cd2.jpeg)
VirginMDCEADIBIOGamesare
•
MOW WWII BY MEM M ME
•
ohwmocnuStcatnocoths.ve a
,ttri Suncom Technologies are set: to release a programmable joypod for the Megadrive. Called the Cyberpad, this modified controller allows players to store combination of moves into its memory. Once programmed the moves remain in the Cyberpod's 256 bit memory module even wh the Megodrive is switched off courtesy of a battery bock up facility. The unit is accompanied by on in-depth instructi booklet that not only explains'
••
•
NEW CAMW BY inecus IMUINIV •
•
•
currently coding away on Dune II: a brilliant sequel to the original PC game (which is corning out on Mega-CD!).
•
7111/CiZ-LU'm1.11 • rTir,r\rnrirr-,c •
• •••• • • • • • • • • • • • • •
The hot new film for 1993, Demolition Man, is coming out on the Mego-CD courtesy of the combined talents of Virgin Games and Warner Bros — and the superstar himself, Sylvester Stallone is actually going to be filmed separately, especially for the game. Stallone and his co-star in the film, Wesley Snipes will be filmed against a blue screen background and the special footage integrated into the game to provide what Virgin hope will be 'a highly realistic In the movie, Snipes plays a terrifying criminal of the future who as punishment, has been frozen for eternity. But he accidentally defrosts (someone didn't hove enough 50 pees for the electricity meter) and wreaks havoc on the world. The only way he can be stopped is by defrosting the man who caught him in the first place — enter Sly as a tough cop who won't rest until Snipes is ice cubes agoin. The result is a high-action movie which we dearly hope will be reflected in the game We'll fill you in as soon as we know.
![](https://assets.isu.pub/document-structure/220912162747-2c4c3b82884041f3c65bc178c7feed7a/v1/4f15c2072b74d61d7767a2a088823288.jpeg)
•
••• DUNE •
•••
•• •
•
•
HowArrgghhhldoesitcompare
•
•
w to use the pad but also ludes some cool examples its uses. In addition to the terous advantages provid- .by the Cyberpod — making : likes of Streets of Roge II d Shinobi III a doddle — it also has two rapid-fire buttons that beat the pants off the opposition in titles such as WWF Wrestlemania. Suncorn hope to hove this exciting product out in the Autumn with suggested retail price of 9.99. in the meantime, se who cannot wait to get ir hands on this item might limited amount in Their telephone number 0285 642211.
Take a look at these exclusive screenshots of McDonalds Treasure Land Adventure, freshly developed from film taken from the official MEAN MACHINES spy camera.
_•A We've had an early sneak preview of the game and it looks absolutely brilliant, combining all the construction fun of Sim City with the strategy of the greatest war games available. Look out for a full work-in-progress reports and previewsPAMsoon,SEGA 11
,•,..K.11.-••••••••CA • •••••••••••tiz •• iCII
•
,'eivomehtfonoisrevevitcaretni•4 •
MAKENEWSMYDINNER'1111VPAONBYSUNcoALLFORMAIr•
• • • •
••
•
..ock
The idea of the game is to take control of one of the major families on Arrokis and farm the planet for spice — the most precious drug in the universe which Arrakis has in abundance. With the money mode on spice, you con expand your operations and buy new harvesting equipment or weapons! You need these weapons pretty badly because there are two other families on Arrakis determined to take over the planet for their own ends.
•
• By ••
•
As you con see, it's a platform game based around the hamburger-related antics of Ronald McDonald. To its credit, the action does look fast and fluid, even though it is yet another platform game! to the other McDonaldsrelated platform game, Global Gladiators? Find out in forthcoming issues of MEAN MACHINES SEGA where we'll have more intriguing details. CARNAGE NEW MUNI M/111141:11
of fish
At first Danny goes into spasms of ecstasy at meeting all the all-time greats of the movie world but things go horribly wrong when his magic ticket falls into the hands of hoodlums who break into the real world to continue their dastardly deeds. It's up to the player as Slater, his daughter Whitney or o particularly well-'ord cartoon cot detective to track down the crooks and foil their evil ends by bashing through six scrolling levels (each a scene from the movie), Tune into a future issue of MEAN MACHINES SEGA to find out more
The evil Dr Maybe has returned to create havoc in the world. His new plan is to mine yogurts, ice cream and cheese from the moon, monopolise and change the face of the dairy market as we know it. Ellen
Pond is bock for his f adventure on the Megodrive in James Pond III: Operation Starfish.
Hot on the trail of the action/comedy movie, Sony ore releasing Arnie's new smash hit — lost Action Hero in a show-no-mercy shoot 'em up extravaganza on the Megodrive, Mega-CD, Master System and Game Gear. The story centres around young Danny Madigan who, with the aid of a magic ticket, accidentally flips into the cinema screen and meets up with his hero and the star of his favourite movie — tough cop Jack Slater (Arnie).
![](https://assets.isu.pub/document-structure/220912162747-2c4c3b82884041f3c65bc178c7feed7a/v1/c3324f85b37e9fbbd07764e7eb24e29a.jpeg)
•
I KONAMI
oscovered his plot an ass. on. to sort him Armedout.with a stack of special powers such as suction boots to mount any surface, a fruit suit which doubles as a deadly weapon if he rolls on the enemy, rocket and anti-gravity boots, Pond also drives a lunar buggy, a drilling machine, a giant moonworm and a mini-rocket. The game also introduces Pond's new side-kick, Finnius Frog and follows their quest for the world's salvation. More news next month.
12 MA1 SEGA -r
NEWSostmousan
OW RENT trICSPII ORIVEj) TERMITHEN N rolaI GAMUT CAIPITIPIODOO A Ng 4.0.1•••••renlIrdrMIECSIztWI* IV lU 1-vomm6Avvreti
![](https://assets.isu.pub/document-structure/220912162747-2c4c3b82884041f3c65bc178c7feed7a/v1/6aca90f256f420a3bb08c0ae575ade81.jpeg)
In the Megadrive game, play Dr Angelo or Carla in a quest over six real and 20 virtual worlds to destroy CyberJobe before he can escape from the mainframe computer. Battle past
![](https://assets.isu.pub/document-structure/220912162747-2c4c3b82884041f3c65bc178c7feed7a/v1/14ffaf59751634d4edaf455158f89c52.jpeg)
for more details. d on
Nope, if you're the heroic, noble and rather nauseous Saul Morrow you forgo your human form to gain the wolfish strength needed to take on the Chimera's evil strength and rescue your dear old dad.
n
TROUBLETheFlasharrived
wáElf czamouraiseme svinym
- 1 144-
!'l
TEENMAIGEWERE IN
a little too late for review in this issue, but is sure to grab the attention of Master System owners. Flash is the latest DC Comics character to be 'Sega-ed'. Resident comic 'expert' Tom from MegaTech commented: "Ooh, that's Flash isn't it — he's the fastest guy in the universe and can stop bullets with his teeth... can I hove a go?". And in Probe's comic conversion he is indeed a sprightly lit. tie thing, bounding across platform levels and overtaking lorries on the MI, like there's no tomorrow.
police, army and lab technicians and destroy wasps, monkeys, mutant plants and even petrol pumps! Successfully blow up the Cybersphere Chamber of Research and Development and the player is transported into the elements of the second film. Check out future issues
This platform action jaunt, Wolfchild, is launching itself onto the Master System and Gome Gear from Virgin this summer full review as soon as possible.
NEW CAME
The game features his struggle against archenemy The Trickster and his beer bottle-chucking acolytes, using his speed powers and thunder flashes. This looks like one of the most interesting Master System products in months, so catch the full review next month.
Not all werewolves sprout ungainly nasal hair and howl mindlessly of the moon y'know especially if you're Saul Morrow, son of a famous if kidnapped genius who's invented a machine capable of transforming humans into lyconthropes (posh name for a werewolf).
JEWS
Storm is In Lawnmower Mon on the Megad ond Mego-CD on on unsuspecting audience soon, to coincide with the release of the sequel to the smash hit movie.
The first movie told the story of the simpleton Jobe, who spent his life cutting grass until Dr Angelo uses him as a human guinea-pig and turns him into a super-human with the use of drugs and I. virtual reality. However, the powers ore too much for Jobe ond he turns into a dangerous psychopath — Cyberiobe — , intent on taking over the world via its 1 computer networks,
emyehttubrotaidalgonmida NEWL
If your dog tag number matches one of the above, send your name, address and dog tag to: Electronic Arts, 90 Heron Drive, Langley, Berks SL3 MD_
;THEFLOOR te te 99L1„ 2
LAXL;LI. lLWWLL
The dog tag offer lasts all August at Dixons (while dog tog stocks last), so if you haven•t bought Jungle Strike yet — get down DixonstoNOW!
From our early playings we've seen some things we didn't think the Master System could possibly handle — with PowerStike II is seems to get the silly notion it's a Megadrivel Next month's review is essential reading for Master System owners.
004569 MM004572004571004570SEGA 15
It's fighting action ahoy as the brothers Lee, Jimmy and Billy, leap into action yet again in Double Dragon on the Game Gear courtesy of Virgin Games. These guys have seen more fighting ton than
get _it.•ae ._,R1,1•EL IFY1
PowerStrike II is a shoot 'em up on a grand scole, from the team that brought RoboAleste onto the Mega-CD. Verticallyscrolling action is the order of the day, lubricated with some great tunes and graphic effects.
—
down to Dixons and purchase Jungle Strike and you're automatically given a free, exclusive Jungle Strike dog tog. Each dog tag is inscribed with your own personal recruit number. If your recruit number is listed below send your dog tog to the EA address (also below) and they'll send you your special recruits CD player (and return your dog tag of course!).
R.MACHINES, we reckon that Jungle Strike is the single most amazing shoot 'em up ovailable for the Megadrive. And now, when you buy Jungle Strike at branches of Dixons, you get a free gift AND the chance of winning one of five amazingly sexy personal CD players!
![](https://assets.isu.pub/document-structure/220912162747-2c4c3b82884041f3c65bc178c7feed7a/v1/1d6f7c2d9f60739f127666f7a2949a27.jpeg)
Its s000 easy. Just toddle off
JUNGLEACDPLAYERWITHSTRIKEANDMONS!Dotedat96%byMEAN
ilommtL
back for more to save their chum Marion from the evil Mr Big. As ever they're in fighting form and proceed to make their way over stacks of levels punching and kicking anything that tries to stop them. Full run down when we
MIOAASIl0tgemMG.Dona,0.1a01 SYS010 E)...01 Goat sylnAki agest,rgxtI,,,11The best Indiana knes WI)Dn garm nmerseen 'Mega Drive SAO INFLUENCE MAGAZINE 90% Indy at his alt-tane traa-blazin' best escape the Caves of Utah. Say gbye to the QUO rats. suss out the treacherous traps of the Grail temple._ and you've got yer 'nits on the greatest Wile in history' O0.J0JiatirOUT PUN .! , Si , MEG. D.,/ GOar GEM and 'WSW. SYSTEM a.. Vadomort ,, IS Soo F r.IWEr..11 L. 01 ii .0hts '••••••••••C • •011.4 WIVE 0.E.STF ”, f0 ODACNA'0E0 4•4• RaPol and sl•Ot• Europa is an actchorge 00Milt0SIOn of a great race NretsySretsaMA*,gam-MEGA PRO - 91% nN3L •na •I.adat tiodod Moss EIM0. the great games never di4 111
![](https://assets.isu.pub/document-structure/220912162747-2c4c3b82884041f3c65bc178c7feed7a/v1/97efd6cde589d1a789c0a8d046f70d32.jpeg)
le rbggthey just get Take the wheel of the workts hottest roadsters Europe...ssorcastnegaymenerteafSCRdanall you'll need sk01, nerves of steel' and a LocAefl one-oornt tu ,n U GULL) LIMITED. UNITS 2/3 HOLFORD NAY, HOU BIRMINGHAM 66 7AX. eader Board has set the • standard for golf on the Mega Drive %iv playahle• test loccurdte smo aattillatital • glats Mu'ye nmer prayed golf 'fit )4Du'ye shot the vonfld's %)14qhest courses. Then, when )0i/re IN l Like .t pw, reckon' on the uthmate 18 hole nv," ,ve,-, 1 rhe Gauntlet! StKidenb , -vgeyohellman,blalyadiosit'sman'
![](https://assets.isu.pub/document-structure/220912162747-2c4c3b82884041f3c65bc178c7feed7a/v1/b963e8fd0679bc3c90efeb00e6249a30.jpeg)
WORKIN PROGRESS •.•••••=••-1r e a vicloôqame that perfectly recreated two of the most violent film characters in the history of cinema. The result: Virgin Games' Roboc us The Terminator. Richard Leadbetter investigates forth, •••••••••-1 3 NINI SEG makPUBLISHERPROJECTINITIATEDRELEASE11111111111•111111 TERMINATORROBOCOPVERSUS1111VIRGINGAMESSEPTEMBER1992CHRISTMAS19934emsamesossi acquirclosinma'sdatehactiongrace rises at do s t e ast pa rtly th illy egoontoagduseverPlyramth the ell ivalen Ar ed wit gSeswantetstoular(aeafter,keonried-anethasgivegameofPHthisvion-pariveSc yhedberpresslaatonirideirginpr-testeplatforamosnto.Fstandstack nlistedoutingear.utdviolisrammi.formulshootive-theridAntiofme Morihao t) grogracharfortforthi'emupegcoord,pseve clam:one-merpro-patenthe s bi r and ri • ge ,ismg n start-ma
![](https://assets.isu.pub/document-structure/220912162747-2c4c3b82884041f3c65bc178c7feed7a/v1/21ca69795e4b66195e89224dc16b93c1.jpeg)
----IRITM11-17r01111171111----jathan
p
1(1 game i ntion I molemeriteal,firroyed. s
UI9LENCE
WORHIN PROGRESS everyone knows, sampled sound effects really malts difference to creating a for bet- The attention atmosphere detail Lamm-.inc.sound effects. Robocop The monk Versus The Terminator Rosh Of Robe's motabncitirontontsreithistitaniumis crammed full of samples, including
![](https://assets.isu.pub/document-structure/220912162747-2c4c3b82884041f3c65bc178c7feed7a/v1/f285ae80c2cce215fce1f590cda1a301.jpeg)
MM 19
Robocop Versus The Terminator is in on early stage at the moment, the version we inspected being the result of six months of coding The action is fast, fluid and full of action. However, Virgin ore not satisfied! They've told the programming team to add in the tikes of more blood and rolling heads to capture the natur of the violent movies even more effectively! The finiiitel game will be released with a s • mil warning and maybe even a rating — the videogam&equivalents of the U. PG...12..15 and 18 certifiastes that movies have VICLENCEBREED'
e It game,
ter
--suastanairaChatiAtad.deathevenRobo'sfamouscatchphrases("Your"-outoftrouble'—yougettheidea).Thetakeupover200Kofthecartride—that'saomegsoetotal16-megcart. the thedetailesincoSirhydrathere' heellentrorotisoftsevens
Smell sights appear k ' foeRobescopes out the Totalisators. BfiCKDR9PI fiND The maps on Robocop Versus The Terminator are actually made out CPI slifferent tiles, slotted together to create the fine backdrops you see on our exidusove Fascinatinglyscceensbots.enough, over 883 different tiles con be used on one level, and any number of these can be repeated any number of ti I This is only limitee by the 6 1. size of the rn p. Sames from tire Rebates/ movies make their presenceknown in the genie- This is •geran40mousavailable-lheele-*OerilleteitttheOCPbuddies.includiogtheinfa-PhaseMauna(•the—II111r,I1IMFIIIIIL.IIPITIIIII;iiE111 once i the sh t give oboco • Versus he Te mi if •ni to 1111 to be s ownreotion the isticu : as Ro o to as on w • cop norur•paVinvolvetresi0 OCOP s ck,dace.thesandessinRoandith run thedcomicsTthe2lanceinIwhosesisofowevendsaTercopinstroyhIntrigu hmindsieriesTermipCanndingoeitmaiSkyneerminmotorestigatsowngsto otor tinerain!suryoducstloneroyearnsSknehasatorbacruthls,andon itnessinciter life asolowomCHECK PUT THE ccmicr r • 11771blhe: IMEMM.. A againstbethestocks..platformscusedisrev --2111111.111 INEL. 1111111111111111
![](https://assets.isu.pub/document-structure/220912162747-2c4c3b82884041f3c65bc178c7feed7a/v1/0191c292295907f04c88fe74fa55d82d.jpeg)
ORHIN PROGRESS In capturing the atmosphere of the movie, Virgin chose locofions fomir to those who've seen the respective films. The game's training level takes place on the Streets of Detroit (as seen in Robocop) and other locations include the OCP building and the factory hideaway of Cain in Robocop It (the mechanised Cain even makes a guest Terminator-relatedappearance!).levelsincludetherebelunder-,IndandtheSkyneiHQ.CHPTURING THE fiTMPIPHEREAVarious$fromgooandTerminatormoviessurfaceinthegome,indudi,,qCoin,betterkaownasRobotep Funnily enough, there are loads of Terminoto games alread and Mega-CO (well, two with two more comi ) and one o THE TERMINETPR A fine effort in terms of graphics and sound. finish it, completely destroying its value-for-m rating. S. r outhosedfor the Me °drive oround I IS IT DEFID? TERMINfITED! A classy shoot 'em up released by Acclaim. D. Operation Wolf-style first person perspective gun. Again though, once you've got the hong and negotiated the evil third stage you'll zoo • - !The Mego-CD version of Virgin's original go 111 I I- • II - • • • • • -•• 1 , promises• for more levels and a higher difficul setting Look out for this one: we've already cTwo more games Robacop/Terminator-relot- • soon- First up is a conversion of Terminator II: • Acclaim' It looks like being a game similar in benefits the Terminator supplies. VO III -cr-c _--ift•e IIIIIIII
![](https://assets.isu.pub/document-structure/220912162747-2c4c3b82884041f3c65bc178c7feed7a/v1/ae3909298de55af815e354b2a63c46d7.jpeg)
• The nmackHiycuLosyazcrballfoot•goLid'swileledecidedtoget in on the action and trundled down to the Electronic Arts offices to witness their new soccer expericlot World Cup licenceAThe players go about their business, hopelessly unaware Kra/len° - God of the ioypads looms above..,waiting.
vour in the British public like football. Ordinary men are etavetted to God-like status just for being able to bosh a ball into the bock of a net, Indeed, if Jesus
in the 1
these labels. They
OR IN PROGRESS
some bad and some utterly mediocre but Electronic Arts want! of want to Soccer reckon they're heading
rellanoitomeseticnignihtoN
none
The chap in the uottod with the ample beard kooks uncannily like Brian Blessed...my God! It is Irian Blessed!
rth INITIATED CHRISTMASNOVEMBERELECTRONICARTS19921993 **S to!
ing, instead of hanging around in some God-forsaken desert wearing girly sandals, he should probably come back os a footballer where adoration would be a forgone condusion (having said that it didn't do a lot for David Ike but at least he got to have two women)!Loveit or hate it, you lust can't ignore it, oodKulorly around 1 time of the World Cup when the excitement reaches fever pitch and England managers tend to become more unpopular than Hiller.Sega software developers have finally jumped onto the soccer bandwagon and this year we're going to see an absolute flood of Megodrive titles hittingthe We'vestreets.already had US Gold's Super Kick Off, Sego's Tecmo Cup Soccer and Ultimate Soccer (reviewed this issue). Coming soon is Accolode's Pete Soccer and US Gold's new offering os yetunnamed which will hold the offi-
22 MM SEGA
righ1 direction_ But what makes this game so special?
-mocdnocesaekamotdediced-
Matt Webster, the game's assistant producer reckons EA Soccer, which is still only 50 percent complete, is going right to the top of the hoop. "11 already looks better, sounds better and it's going to play better — they will play like real players do,'' he boasts. Well that's easy enough to soy but what's this game got that other games ain't?
they
First off there's the immediate advantage of being a simultaneous four-player game using Electronic Arts' very own adapter — the Four Way Ploy. Mott Comments: it adds a whole new dimension to game playing. With
be the best and with EA
![](https://assets.isu.pub/document-structure/220912162747-2c4c3b82884041f3c65bc178c7feed7a/v1/9c601d0d4aa16cbe2fcfc1c771c5480d.jpeg)
to alter the spread of you The r goal line, the attack slide theopposition's goal li you set the maximum point that each can move to. The midfiel slider is flexible at both ends. The smaller the area that a slider covers, the more concentrated your players will be in that area, the wider the more freedom they hove. This gives unlimited possibilities to customise the way the team plays_
![](https://assets.isu.pub/document-structure/220912162747-2c4c3b82884041f3c65bc178c7feed7a/v1/64302d1d6b8671ef2bcbb4be287ee4dd.jpeg)
MOVE THAT BODY e ore masses of moves per ploy so e should be with 2000 frames of ion least ten times more than usual footy es). Among others these include. overhead le kicks, diving headers, chest control, no kicks, back heels, goalkeeper kicks, rows, drop kicks, dives and jumps, shielding the ball, sliding tackles as well as player celebrations — knee slide, somersaults, fist air, hugs, shirt-pulling, and barging.
the goal) ond the obligatory animated referee. But that still doesn't eiplain why they think
, four players, mes immediately , become more strategic, frantic1i—andchollenging People ore• i always calling the games mar
Clialt duck gibber! Death to themonkeymeads!!
realatigninruter'ew—laicos-itnoa
SSEROORPIN.ORK
it's going to hammer the opposi bon into the ground.
Melt says:"You've got games like Kick Off which don't look realistic but do have fairly smooth ciameplay. Its always been said that in order to gel good game. ploy it has to be from a twodimensional perspective. We've got the fluid gameplay together with realistic graphics. People want the graphics of Super Soccer and the gomeplay of Sensible Soccer. We're going to give them that and then some.'
GA 23 • r _7.11,*r.a-PIII.1PP•* 4:2A rte. mc (VP% 4 t '4or •mw41logo:Divi sue Middle: Ito too out (I of 4) Bottom: tool catch plus ttwow aA 1), • • • • 11ritt1r ru Alk-
r ther t n blobs But del g it a is invol s a lot of work so uch a co+ — because ou h ve to franTlive different angles r the eight different directions." e player can choose fro national teems, each with different playing styles They can manage team fortnotians and strategies before end during the game, select the starting line-up and substitute players, choose free kick end corner set plays, there's an on-screen crowd with --dkpitised cheers, boos and chants (a really neat trick with this is the way screamingtheescaframes of animation. Instead of kites as the ptthe usual two-dimensional overers get close to
sociOl_event."'That's very well'. I boor you Tream,what obout the game '
A GAME OF TWO HALVESwen,tokick off, foLir programmers, five graphic artists three musicians hove put their heads together to come up wi what is the first 16-Meg socc game on the Megadrive. It ha amazingly detailed player sprites who each have more than 2000
head viewpoint of footy games, EA Soccer hos opted for a 3D isometric viewpoint which, Mott claims, makes you view the players in o more realistic sense. "it makes them look like real players
0.00
r— SPREAD IT Anourtin
•."11 II 1 1 MIL To die ir Mk_ -.111 0 • 111 I 0giz9pLII1111,1 gal 11 I lr Im TOO P P ear-R:mi;1111111. I 6.1 JL Iti!!!1 INITIATEDMINERUC L:11141; 24 WA SIOA THEJUNGLE BOOK VIRGIN JANUARYGAMES1993 ,11•11 HCRISTMAS 1993 Based on one of the mo Disney movies of looksansoe-Mosiadrivo-vall-tiabsolutelystunnioolFtWt Te KO' 4,3 w • 111111liators. the graphics e he created for the game wos . II improved for hi:Spot.•oCocffrfnceEachgame boasted superb t y hnigriVwontubs,hicrap. en outdon gmyars,selvethemeinactual artists from Disney to creote this owesonle title. Aida. As you con set from this Witt f eat u re, the results speok for themselves 1111
![](https://assets.isu.pub/document-structure/220912162747-2c4c3b82884041f3c65bc178c7feed7a/v1/adb96dd86cba874b14048cdd8c54787f.jpeg)
IEHTS'TAHkrIIDEA
talent, Dove Perry, on the job for The Jungle Book
A 1
THEN?
YRREPEVTIA-rliCARTOGRAPHYVirginGameshaveputtheirtopcoding
Mb-
The actual basis of the game is still under discussion at Virgin Games. However, the gome itself is bosed on the same graphical engine that was the basis for Global Gladiators and Cool Spot. The Jungle Book has the some kind of super-slick scroll routines as its predecessors, and his Mowgli the man cub running around the screen, shooting (bananas this time) and jumping in much the !_ame style as the previous games. A THE VirginNECESSITIESBEARGameshaveemployed their own skilled sound department to provide the soundtrack for The Jungle Book. A vast range of awesome samples create an excellent atmosphere — even the monkeys have several sampled whoops! The music, though, is the main attraction. Virgin have used some of the strangest synthesized instruments ever to re-create top Jungle Book numbers Llike Bear Necessities! Mk-
Check out the cartography on the next page for Ldetails of his previous efforts, —All
![](https://assets.isu.pub/document-structure/220912162747-2c4c3b82884041f3c65bc178c7feed7a/v1/fbb851f8b3ca85bef8a53a0dd3ced01f.jpeg)
1:11 100 WORHIN PROGRESS Asyou tan see, Thegraphics on Tke JungleBook art atnvetieishlipodnatsalsIemagehTing.tandouts,absolute?)thisvery early liege. look out for this one.Vines aro Host dibveLThis Is ilkROTANIMRETEHrirlirThe initial Megodrive outing for Mr Perry and one of their biggest sellers. Outstanding graphics and sound abound, but the game's way too easy. Even novice garners were finishing it in around 20 minutes., LABOL6.br PerryGLADIATORScreatedtheslickgraphics engine that is his trademark with Global Gladiators - an enjoyableplatform game, very smooth and very fast. But there's not really much to do and once again it's a bit easy... laernievirdageMehtstihretcarahcloocs'pU--Irw-rCOOL-SPOTtIa.Moregraphics and more variety thanobal Gladiators, but does suffer ever-so-slightly from a lack of different things to do Still, its mega pl bility ore t ...i. it_7 , up for it. 09,
![](https://assets.isu.pub/document-structure/220912162747-2c4c3b82884041f3c65bc178c7feed7a/v1/8084dcf7521bf7abbd8289d26bc899bc.jpeg)
Lor_ V__PA411--1r• ir.tmmitsN:PLAYNOWCAN1%limity=r,YOU YOURFAVOURITEGAMES• ozsr; co CfW LLfr tW.4.10E= , TH-E LILTT SAMEmATIEI3usirrtA!h,Ft"T"IR,IEPGDIRTRACYALPERNOITCAEHTTHWI.lt-Ammo6 JustTODESTRUCTION!!!imagine,infinite lives, unlimited energy, special effects, extra fuel/ammo or play on any level. Become invincible with the Action Replay Cartridge for your MEGADRWET'w MASTER SYSTEMTm & GAME GEARTM Console. 10. Sc easy to use...if you can play the game you already know bow to use Action Replay. • Imply input any of the hundredsal codes/Pend -t your games wide °wenn! grlitaOLIO L. TAM COOM POI I IL IONREPLAYILPILINNEWC 10 With its unique built•fft *CODE GENERATOR', you can actually find and create your own cheats. No 160041 to wait for code updates. 'Allth this unique feature you hove the ability to 4Iodesaelererayehtsasemag,tsotalehtko, other product can offer this! meld° hovels '-.ted. This is • offikM1: I m41:1It • r that only Action Replay gives you the power 0. en US, Japanese and European cartridges! in 11=111m. E IWEGADMVE".t2 OR THE MEGAERHEE”. CRAMIMDILCAteMRCP te 4a-Co Ca MU Uri 40, ANDAPMESE c KORCAMISPLUGAIMEGACO'•GAløCARTIEGE&WINSMOPE&NOTISAMU*. THE bit CHTelln• •SeGgl• 111166066,1"MASTES SYSTEM — GAMS et Alk• & 'mechs-coamSTMUMMAPiKSOfSOMA EMTMEM t HOW TO GET YOUR ORDER FAST! Designed and totanulagUtted by DATE N ELECTRONiCSy11111 IMPORTNOW GENE ON YOUR ME ItATUS AWE GANES SIREONYOURMOW'PLUG*CARTRIDGE, A Y SISI" GADRIVETPAGAMNOWOORICATKINSEASTTOIISES1110U.SACOJAPANESE PLElectTL UIUIUIMIalUIImo mmmmEINEEon ALL CHEQUES/POSTAL ORDERS MADE PAYABLE TO 24 HOUR MAIL I DATEL ELECTRONICS mi=„n"ORDER HOTLINE II11•6TECHNICAUCUSTOMER SERVICE 0782 744324 miimam& a lalbiamimi== czaionz;zzlim=uommPainl••M•IM•Ill GOVAN ROAD, FENTON INDUSTRIAL ESTATE, FENTON, STOKE-ON-TRENT. ST4 2RS, ENGLAND. FAX 0782 744292IMPORTANTI MIL PIPOOOCTS in AMMO. I SAW ACTINIC, IPIPPORIOID OPMOM° ET lILA U1111101111S 111.1111LItallKA114,21102211511ILLIGID1111 p.•••••• OPP DER El NORMALL Y
![](https://assets.isu.pub/document-structure/220912162747-2c4c3b82884041f3c65bc178c7feed7a/v1/8ea993d546ed2a7e4cfce61d78c2bd50.jpeg)
playing these games all the time". She actually thinks I'll go braindead. No chancel Do you know why adults think games are a bad influence? In one of the papers
Dear YOB
Andy's sitting
they said that games con make goUscores?Whoviolent.you 141 players ore in a world of our Do you agree?
sort to me playing a * game while I'm writing this.
Dear YOB
•
As I om about to publish a Megadrive magazine at school, could you answer my question: How do you produce screenshots? Your reply will be extremely appreciated if you print this letter in your next meg.
![](https://assets.isu.pub/document-structure/220912162747-2c4c3b82884041f3c65bc178c7feed7a/v1/bbd4e006222a6fa8db46be4d5c7c599c.jpeg)
'WRISTSPANNERDearYOB
Tymen of the USA deigned to send us this rather tawdry etkwt.
YOB:Coming from the barren wastelands of the Midlands, you probably won't be able to afford the expensive
Geoff Wood, Solihull, West Midlands
I am fed up with older people going against video games. My mum is always soying,haveYou'llnobrain one of these days,
PMA SEGA HENN Ws Time gal, apparently. $ to Andrew Thorne. u?.c.1111116prilid
Macintosh technology we use to grab screens and will there-
You know, YOB me old Buddha,it s not easy being a moior celebrity as I ern. People approach me in the street and ask, ''Arnold, Arnold! How do we go about finding the secrets of the Universe?". And I reply, "You mindless gibbons, do you not know of MEAN MACHINES SEGA the most vital of all organs? Put pen to paper and consult the oracle that is YOB, for he has a large gun, or osk Rizzo, for his answering trousers ore siinable". I then pull out my Uzi and tell them to
vista!olOisin
Martin Crozier, Pegswood, fore have to rely on cameras Northumberland like we did back in the olden :YOB:No. days. You need a dark room d not much of a problem I should imagine because Birmingham has yet to be conneced to the National gridand a camera capable of taking pictures at 1 /16th of a second or slower (any faster and you get roll bars because of the way monitors flicker). You also need a tripod to keep the camera steady otherwise your pictures will be blurred. Hope that helps. And send me a copy of the magazine when it's finished.
It's very slick and polishedmewlthe company who produced it thinks it's absolutely brilliant. However, it's crop. it's yet another rekased old genre of the sort that we've seen a million times before. Them are few aright& features and its mask is really choosing me off. I'm not going to toil you what it is - you'll just have to goes& just got on answering your letters, wikh is infinitely more fun. If yoe've got anything to say, why not write in. The address is: KNEE MN was 1 RUHLANE,COURT,MEANSALLSTEWARDBARMAILLIAG,MCINNES,PRIORI'30-32FARIINGDONWNDON,ECM31111.HOImonoLAUNCH
TICKLEONMETUN,r
be gone. Anyway, do you know what Sego Power have gone and done? They only reviewed the American version of Streetfighter II, hoping to pass it off as the offi• cial UK review. Hal They could not hope to fool me or the mighty YOB either. What's the use of reviewing o game in the USA that is this moment undergoing changes for the UK release. Whatever happens I know I am assured a proper review of the finished gums in MEAN MACHINES. How about a poster of M. Bison in a futtee issue. He's one of the best characters and usually underrated by crap ployers. I might be back, haste la itt
RmomGETwirrts
innovative
Oliver Mould, Guildford, Surrey
nilolphrostauclgnlinecois,btiortAporogie.,
for writingsomethinaubout I 95%thatnotaboutstronglyfeetandthecropfillsofyourerspoge, Dorcljester,flyer.if madeonesimilarlentingyou'rerequiredapologiesYOB:NoDorset-mak-anexcel-point,tothatJacintheeditorialcol-umnonlylast
exciting
•can't
witlitheIx,money thcirs ploug into the industfy, someone. on come up with somethiv new_ I don t any ideas mgelf, but then, I d get paid lopihat Sorry for 011 :pessimism; but the wiliile situ
PAM SEGA
—
Dear YOB
Nita effort, Christian Word, but low about owe colour, someflowers,— YOB be bothered
YOB:What an utterly revolting specimen you are. Mould by name, mouldy by nature. You should take up chainsaw ling.—
month. New and exciting games are what makes this industry ticks - very few players are going to buy the same old rehashed games • over and over again, and some companies are going to
at Electronic Arts' track
their new VP odd-on and their continued development of the new 32-Bit Saturn consolehopefully those two tasty bits of technology will inspire games designers and programmers into developing some new, original and highly entertaining new games.
mseil14
Hi! My name is Blob -fuce, the King of Blobby Loud. I have the following computers. Megodcive and Mega-CD. The ra% a fat la cake at my school called Adrian Faggot (short for fat git) and bilk il thinksl that the Super-CD will be better. 'cause it's got more colours'. Then I said, "Yeah, maybe so, but the Mega-CD is a lot faster • Faggot-face still seems to thirst< that colours are more
in Sega Power's sister magazine, Mega about reviewing games early...
![](https://assets.isu.pub/document-structure/220912162747-2c4c3b82884041f3c65bc178c7feed7a/v1/092ea58ea73831e2994a4c1b0d8447bf.jpeg)
Dear YOB
als; bugger the gorneploy• policies. For example, take .."8"
YOB:We do as many previews as we can.
EGM is an American magazine and it's far easier for them to go and see early versions of games. However, when it comes to previews of Britisk. games, we're always first. It' a
ting addresses mixed up, I live in one of the most boring villages in the world, This village is Sapcote All we have is an archery shop, a
Michael Wilson would probably win a Blue Peter comp with this—
are adopting 'tasty visulook record. One of the most and game deiplopers of the post few years.% Recently though, we've been getting the return of the sequel syndrome Madden '93, NHLPA, PGA Tour 2, Road Rash II, All are excellent games, but merely rehashes of previous games. Another example is Copcom (my (aye company) —SFII, SF2 '92, Champ Edition, Hyper Fighting
•
Hobo. Dessert Strike, geddit? Alas, the anonymous sender wont
Because you bused the mag on two things: reviews and adverts. It's ettibarassii g, anyshaoneclaimtooftheissues from before the big split. Have you ever ?mord of a mag titled 'Electronic Gaming Monthly'. It's loaded with a plethora of amazing previews, but looking at the reviews makes one hove an extreme urge to either read your mag or vomit. So the purpose of this letter is to ask you. YOB (your parents weren't fussing about choosing names) to tell the rest of the crew to got their act together and bring us more previews. I'd soy try and have a balance of pages for review and preview, OK? Also, the mog is
RUSHblindfold.BLOKE
Arnie Schworzenegger, Spelt YOB:TheWrongly dumb thing is that Sega aren't ever going to ever release that version of the game — it will be Streerfighter II Special Championship Edition — incorporating Street Fighter II Turbo. Even more dumb is that Sega Power have been spouting on for months about their polky of never reviewing products at a company's' headquarters because they think it is impossible to Egt do so
much better due to the absence of Gary Harrod's sad-looking foce Is he moon-lightingnowas Mr Bean,BeadleJeremyorocorgiorsomething?PaulHogan,kangaroo's•rse, Oz
I'm an Australian, so pl with me. Bock in fivernumbeIssuetherewasa bloke begging f forgivencs., in ornost parasitical manner. ond I'd just like to say it's because befoi MM Segu there was MM Totally crap! And you know why that is don't you?
•
bY s
mentssnidebyamusedfairly.DohlIwasthecom-made
111
IDear00000000RKClaireRaynerhaveaproblem.Apart from get-
etc. Come on! The level of playing safe has reached on all-lime high! As your magazine has stated before, the most tired genre is the shoot 'em up. I look around and see Desert Strike/Jungle Strike. Thunderforce IV? It's just Thunderforce III with pretty colours. Hellfire, Gynoug, Zero Wing (cue yawn). They may be good games, but originality 15 non-existent_ And now tea h the option to spend c,.270 for some tired games with funky beats. The most original gonlow NI" I've, played for years is Toe Jam and Earl, Surely
jr4icreep or .nsult so I'll get straight to the point. After flicking through some back issues of hassolethatnowspecificallyarcadewasdeindeed?gone?'.alleditorialpenedMACHINESMEANIhap-acrosstheofissue13,'wherehovethegoodidWhere••Theorti-inquestiontacklingtheindustrybutitseemsthecon-industrybasicallygonethesameway.IntheseharshC40+for,vieegameisnoteasytowIlenapunterirdohesspra;houtsomethingdifferenknorn *le sAhc 1"Sic" would go claw' treat. Flashy graphics and CVO quality sound do not on *find that out the hard way.original genie con Sega have the right idea with fliesetan.utrekofnainU
faggot-face over and showed him the Mega-CD Then lie broke the disc troy! (faggotface that he is). He said it was on 'ccident. elmmm, my chin is burning up. Tell the fat git to get lost and get a life! We sued the git 'cause the Mega-CD is a beautiful piece of hardware, and it's useless without the disc tray. I hate him now. Please tell him to get a life, 'cause he's broke my best possession. Yours pleadingly, me.
rgoegforettamwir MEANYOB Dear
snahterolropirri,invited
Karen lseworth, Blackburn, Yorkshire
Dear 'YOB -•
issues, like the economy ,Af unemployment. Then ma might be able to afford these games.
think they are in portraying girls as the knicker-clad bimbos of thei tasies.-fanelittlsweaty,Although people think ir MEAN MACHINES is a bit immature, I actually think you guys ore pretty sound in your views, at least where women are involved.
Adam Watkins — get a decent haircut you sad burglar. Phillip Dunn, Sancote, teics CLAIRE:If I hod a Mega-CD I'd send one to you, but unfortunately I'm an Agony Aunt who doesn't deal in these things. If you'd written to Mean Machines, they might have been able to help you.
PUYELLEWNIRTS,01PRIM* -V-e• 41111MMIMA•
l
YOB:Spawn of the devil's trumpet
I feel destiny has compelled me to ujevoh1sriFuoyotetirw.read
teenagersyttops,oe!-tilodhelle
Ilk of my views. You see, it devotes section of its letters page to 'Pro Girl% I'm not so stupid as to niiir the pun contained there, and using un insulting cut-out of an old ad fthe One for a camp flogging miport convertors which Wa$ pulled for being off) compounded the dnmoge. Who th
It
toalmostdesperatewassendingMegadrive,school.op,PostMEANYOBOffice,acornershop,aco-agardeningcentre(wellit'sjustoutside)andasadprimaryAndallIdoisplayonmysopleasehelpmebyaMega-CD.Please,IsoIwroteMEAN &ENIHCAMa%Uln
Maynard (ge of h Heartbeat fame,though I'm not ad enough to techno fan Stepheri a Flynn, whose tip you printed last month; and lastly, the living, talking mop Adorn Watkins May I just soy your mag is excellent and thank you for the brilliant pies of SFII.
As for she Night Trap saga, I think that warnings on the box might be a good idea in principle, but will it really stop kids buying games with ratings? It may themencouragejusttogetonolderfriendtobuyitforthem.Howmanykidsunder15doyouirknowwhohaven'tSeena15-rated
![](https://assets.isu.pub/document-structure/220912162747-2c4c3b82884041f3c65bc178c7feed7a/v1/1e436e8554a7697362ccdb72820e8b0c.jpeg)
movie?
YOB:Speaking as a full-blown man, we won't resort to sad, cheap sexism to increase our
glar gritin,eILFUTS,'eearwI'mwto
seasYOB:True...GET11GRIPIbewalking
otnoitovedymfosruomur.oA
ore thethepeople that believe all the Royal scandals.
lliB;erehgnivilhllI
Tim Marshall, Ripon North NON
through Olde England towne many moons ago, and it come to my attentions of this Sego magazine, that be the best an the shelves. It be filled with coverage on the new Mega. CD, and it be featuring 'Rizzo' Rigricill arid the Mean Yob also be there toe Anyways, oi gathered me army of Long Johns and dio set soil with full head wind to ye rnerrv old towne of Skegness to lay hands on ye plentiful supplies of this organ
Batmen end the Joker shore e me* of mintier jokes. C Word again!
eerhtevo:c
But now I wants to learn more of the delights known as Silpheecl VR. I tried to consult old Ma Peggeriy and her magic, oil-knowing striped bloomers, but she be appearing on Hovis adverts, so yon Mean Yob be my only hope on th' matter. I would shake yon hand, but sodlys ois only got one. Cop'n Long John, (a ship)
was sheuting ever y s i tried to orise his fingersONVa the end my Ded found out and had to take him to the casualty dept, where he y.u,ted for three hours to get seen to. I'm ground ed. Forevei A Septirnus,ir Septimuss ,droom, Exeter YOB:Here's another sod slice of life bought to you from the YOB Kitchen Sink Drama Dept. You've made your bed - now lie in it 0 great King goon ass. triedYouwoman,readersIDearSADNESSOFSEXISMYOBmustbethatrarityamongstofbeingafull-blownnotayoungladorgirl.arenotthefirstSegamegIwhenIgotmyMegadrive,butIstoppedgettingtheothernewhichIwon'tname,becaus,
Atiti SEGA
Mind you, we us people
taergeht,)tihctawSlbIlt
Perhapsthegov•ernmerd should concen- 4POPirate tantimpor-moreon
begone before I run you through with my trusty cut-NON-STICKYlass.
the issue of MM.S with Mrs Margaret Shelley's letter Oh A dear,tanyonelb needs counselling it's her. Saying that video games ore evil and are equivalent to drinking or taking drugs Is quitethe most nonsensical statement I have ever heard. Would Mrs er Shelley rather these children watched 18-rated films, or buy pornographic magazines? Video games are generally good fun, nobody takes them seriously. I hove quite a few games machines. but I don't tend to get an urge to go Out and kill people, not to mention the fact most moves are physically impossible to reproduce anyway. Secondly, I am pretty annoyed by the media bias in portraying video games. Each week there is a damning new report on games written by journalists who obviously have no real conception of what they're writing about, and the only people that believe or care about these stories
because I'm and grollil-ed, and boredkecouse of it. The sorry tale started a month ego My little brother iltwo yearsbelow ate anc hoot Somehow he found out from mates of mine that I fancied ,t,' Inav adored) Nicole teigh, one of toy more beautiul classmates. haughtfully he decided to pass 0 1r cole herself, who promptly knocked rie bock, in a public lace. I was humiliated in the eyes of the entire world, and en:nap* thought of justice and revenge Now, my kid brother likes a game of Streets of Rage II. In fact, I used to treat him to a 'pretend' version when he annoyed me, but that hod to stop when I bruised one of his ribs doing a flying kick off the unkbeds in our room. So, after q 4y horrible humiliation at his •,, hands, I showed there was ne feeling,iii-N.by suggesting we hove a two-player cooperative game that. evening. Oh, a forgot to menti that I'd just put suporolue on his joypaci. When we started to play he noticed the stick ines, be , I isaid I'd spilt some coke oq it quickly dawned on him t something more tharterala holding his fingers to the pad. So I had triumphed in the end. and graciously suggested he go and wash it off. But. .1 must have put on more than I meant to. because he was well and truly
b11111lyl
Greetings. yon YOB Hard Oi be Cop n Long John Silver, scourge of three and a half
The theN-FORCEsimplysnookerplayingstains,Dodgeaddictive!butandpits,choppersboats,"RacingforhaschallengeultimatearrivedtheSegaMegaDriveminiaturecarsandoversandsnookertablesbreakfastmats!Itmaysoundweirdit'shellishorangejuicejumpovercardsintopockets-brilliant"Arguablyberacegeverw mumpa• soon for MASTER SYSTEM and GAME GEA Look-in "Probably tsomehet layable g I've ever seen on the Mega Drive" s Master magazine N'T GET IT, R • new for MEGA DRIVE • new for MEGA DRIVE • new for MEGA DRIVE ,1•IP 4:AJE?
![](https://assets.isu.pub/document-structure/220912162747-2c4c3b82884041f3c65bc178c7feed7a/v1/a3ff2f68b94d6f19510a9da220089db7.jpeg)
JAZ: 1. As they say in the positive vernacular, yep. 2. Nope, as they say in the negative vernacular. 3. Unfortunately not. Neither does it play 78's. Or 8-track tapes. 4. Well, at the moment it doesn't look like it will. Apparently, the 'cut down' Mega-CD II will cost about the same price as the current Mega-CD. Doh! We'll let you know as soon as we have a defin
1. Is it true that Streets of Rage will be Sego's first 24 Meg car2.tridge?How much will ChampionEdition and Mortal Kombat cost when released?
3. When will 'Dizzy the egg be officially released?
1. Con the Mega-CD play ordinary music CDs?
3. Con the Mega-CD play ordinary VHS videos?
Mark Gilbert, London
pl I've hod Rings of Power for a fortnight and it's driving me silly. I know it's not the most highly-rated game ever, but it was only E20 and I'm determined to finish it. The problem is I can't 'nd the sextant. I'm presently at e Waterfall to the east of Speed, and west of the Cathedral. I've been all over the area by foot and boot, but the sextant adamantly refuses to to show itself. It's getting to the point where I'm looking for people to fight, just to relieve the monotony. For the sake of my mental health, where is it?
er the foil quess.
2. I have heard that the Mega-CD can ploy films on CD; "lop Gun for example. Is this true?
5. Is there a game similar to Super Mario Kart coming out?
- 4(;-‘b;ii T T • •-to•aao7 • • o• 'Ilke copsshoot off in Streets ot Rage if
I. Riley, Liverpool JAZ: It drove me silly too. W I Whoops Whoop!
JAZ:l. Yes. 2. Following a sharp intake of breath and "an exasperated sign akin the sort you'd make when confronted with a gimboid question, hula, through gritted teeth, answered, 'it isn't'. 3. September. And I really can't wait. Honest. Anyway, why
Dear Jaz
1. Is WWF Royal Rumble coming out for the Megodrive?
r Jaz
2. Is Zelda 3 coming out?
can't Code Masters release Dizzy Gets Chucked into a Razor Sharp Shredding Machine and Gets Turned into Mush? 4. Not at the moment. 5. WouldDearNo.Jazy4
Rich-e ein9 games , , gicl their mint banter g ininded me that it ,e reply to your fine questions- •eith freshly-pressed special 25th annivers ,,answering trOliers at the ready it's time once again t4likive into the mailbag and sort out your queries. If you've got anything - and I mean anything - you no know, write in to me at: AND WM THIS BALL UP I CAN SEE THE CH CLOCK MAILBAG, MEAN MACHIN COURT, 30-32 FARRINGDON LANE, LONDON, EC1R 3AU.
4. For one of your features, could you do on arcade guide to Mortal Kombat or SFII Hyper Fighting? Lots of allknowwouldincludingreadersmyselflovetohowtodothespecial
4. Is Dynabloster coming out?
4. When will the Mega-CD come down in price?
3. Will the Capcom coin-op Knights of the Round be converted to console?
so L as to answer my ittle queries?
Neil Holes, Walsall
I hove some questions for you concerning the Mega-CD.
![](https://assets.isu.pub/document-structure/220912162747-2c4c3b82884041f3c65bc178c7feed7a/v1/c9f3d8221412bd6398dc8fa2a7b2df19.jpeg)
I hod a spare , so I thought I may as well writ, out my questions to the only mog that con answer them. So here they are. 1. Is it true that Sego's version of the Super FX chip will be 100 times faster?
3. Will we see any racing games like F-Zero on the Mega-CD? 4. Last, but not least, has anybody out there got Fantasia second birthday celebration? I have - it's Mrbrill!O'Neill,
1_ What exactly is the lob of a Games Designer? Is it along the some lines of on artist's?
It's true - I've played this more than any other Megadrive game. The controls and gameplay are amongst the most perfect I've ever experienced. 3. EA is the most prevalent company in my alltime lave games list.
I have been to my local arcades and played a game called Vendetta.
2. What is the best coolest, most brilliant game you have ever played on the Megadrive and Mega-CO?3.Whichcompany do you think makes the best games?
ns on Rocket Kriegl as I wet myself with excite-
6. Could you tell your sister publication Megatech not to feature the gatefold reviews, as they fall out the mag! Gavin Richards, Tonyrefail, MidJAZ:GlamorganAhmy lave Neath top. I'll have to get a new one when next season starts! Anyway. 1. Read the review and go with the flow. 2. Whaddaya think? You buy a mag for peanuts and you get a load of monkey drivel. 3. Bo-roog-oh! 4. A bit of jaundice methinks. 5. No. They obviously haven't seen Thunderhawk. 6.
![](https://assets.isu.pub/document-structure/220912162747-2c4c3b82884041f3c65bc178c7feed7a/v1/d78f68d9e0405cd7b364b7071f77a112.jpeg)
Jaz
2. Will Sego'sSilpheedforthcomingVRbe foster than Storming? I have *seen Storwing and • played it. It beats the crop out of any SNES or
1. What is the crappiest game you hove ever played?
Dear Jaz
To my brother Andrew - keep your mitts off my Sega!
JAZ: 1. No. 2. Binky the Cat went up the garden path. 3. When they finish the arcade game I should wager. At the moment they're working on Streetfighter II: Trombone Edition, the sequel to Streetfighter II: Hypedighting which gives each character special musical instrument moves with which to wreak death and destruction on your opponent._ ntually, yes.
4 Why is Balrog yellow on theMegadrive version?
2. If so, will this give the Megadrive Mode 7 and better quality sound?
3. What do you think of it? I think it's Darrenexcellent!Conley, Eston, MiddlesbroughJAZ:1Notat the moment. 2. ks unlikely. 3. Nob. can you answer my guess about games for the $°drive?FatalFury any good? Who will Sonic 3 have in ii apart from Sonic, Tails, and Dr 3.Robotnik?WillLiverpool in Europe come out for the Megodrive?
I buy your mog every month, and it's Thomasbrill. Craze, Red ruth JAZ:l. Not really. 2. Hammy Hamster, Fanny the Rat GP the Guinea Pig. 3. No.
5. In Mega they claim the Mega CD does not hove scaling or ro tional hardware. Is this true?
I'm bored - so do write a letter to Brains, aski a few questions to be answered.
tsocll'tihguohtsaskaS-
3. When will Copcom stop bringing us versions of SFII and start on 4.SFIII?Will Sego use fluid animation in games like SOR III, thut have been used in Delphine games like JamesFlashback?Roberts, Worthing, Sussex
WA MIA 33
2. If so, when?
answer these questions for me.
JAZ:l. Streelfighter II looks as though it'll be the first. So put out the flags and play a big trombone in readiness for the 41Miteal day. 2. Mortal Kombat
E49.99. Streetfighter II hasn't got a price yet - but I reckon it'll be pretty expensive. More info when I have it. 3. Let's hope not, eh? 4. Watch this
After seeing you on Games World and spotting you were sporting a skill Neath top, I decided I would hove to write in with a few questions.1.Any
ment after seeing the screen2.shots?Ina crappy publication (Mega Action) it is stated shot SFII only has 16 colours on screen. Is this 3.true?Ifyes, why don't these use the maximum 64 colour pollens?
1. Are *more any plans to release Vendetta on the Megadrive?
Gosport
5.•1APc
JAZ:l. A games designer designs games - where everything goes, how it works, where hidden bonuses are, time limits, score... absolutely everything. 2. Silpheed is slightly slower than Starwing, but has far more polygons and is technically much better. 3. Possibly. 4. You must be bored-.
Philip Bell, Pylon, Tyne and Wear JAZ:1. I can't quite remember Its name - it was something like Roboboll. It doesn't really matter - I reviewed it when I was working on on old Commodore 64 magazine called ZZAP! 64 and gave it 2%. It was utter crap. 2. PGA
Dear Jaz
.semogogeSIt-4
Mattmoves?Brach, Bingham, Notts
OIL'SAFTERBURNERSeeingasAfterBurnerIII
1
on the Megc-CD is such a disgrace, Andrew and Claire Dixon have seen fit to remind us all of the level select for the superior After Burner II. On the START/ OPTIONS screen press and hold the A, B and C buttons then press START to access this
![](https://assets.isu.pub/document-structure/220912162747-2c4c3b82884041f3c65bc178c7feed7a/v1/9004e7b030cfe331e56443386065f4c7.jpeg)
1
MEGADRIVETIPS
344 tAM SEGA
It's summertime and still there are those of us spending time indoors, puzzling over the next move in some game or another! Still Ws no less foolish than sitting on doorsteps, trying to catch a bit of sun in the pouring rain and getting soaked instead! There's been a Flashback frenzy this month and a wildly animated response to Konamrs classic Tiny Toons, in both cases this has presented us with loads of useful pasuodes and tips. We've even a tip for the menaced The tips are so good at the moment that there's only your weird 'alternative' suggestions to separate their quality and earn the prizes! Keep them coming to: PM SO WEIRD I NEED £150 WORTH OF SOFTWARE JUST TO SURVIVE!, TIPS SECTION, MEAN MACHINES SEGA, 30-32 FARRINGDON LANE, LONDON. EC1R 3AU.
Flashback to feel left out, Simon Shan to feel like he's wasted his World on Megadrive HTDC Level 3: CLLD Level 4: U3KG Level 5: XDDJ Level 6: FXLC Level 7: KIFB Level 9: EIFLX Level 10: BRTD Level 11: IFBB Level 12: 110 14: 1
time, here are the level codes for Another
rori:111,.t"supportofthe players guide
byaiv tley Crue. By listening to lo 6 on the sound test and e ng A, C, A, B then START is now possible to advance levels by pressing B nd UP once the is started.
IF-taO:31levpo vel
David Haslom has on American copy of Battletoads for his Megadrivebut his discoveries should work on the British version too. The first is a trick that warps the toads from level three to level five. After killing the rats and the Space Invaders guide the toads onto the Jet Turbo. On the fifth section along there is a warp zone, marked out by white dots. Haslam's second tip is a reminder that all ravens in level two ore sources of 1-UPs when kicked enough. Finally it is possible to ride the dragons in level one, using them to attack with fireballs as well as fly.
![](https://assets.isu.pub/document-structure/220912162747-2c4c3b82884041f3c65bc178c7feed7a/v1/b882da435ec3bac171aa84139d0f28a2.jpeg)
e heard of Davey Janes' er, well this is Richard Jones' rocker of a tip for Crue Ball -- on okay, Megadrive Pinball game featuring music
TIPtimeellirdubleissavedulR's
MEBADRIVE
cheat for the Forever Man is used, ing the undead-dude to t nning of the Elemental Zon ith all weapons and spells. This is achieved by taking Chakon to the platform above the *portal in PRACTICE MODE and having him create a passage s II.
the
Level 2:
last month's issue, Henrik dstrup has discovered s cret option screen! Pause the me whilst playing in Arcadede. By pressing C, 8, 8, C, C, A, C, B the secret options screen appear.,!
• Al
---0=111•11• PAM SEGA 35
or
BATTLLFCK 1
WY TheMIMOLOACRTCMILORDAKANETOHOSTUDIOPANCHOBETSYPIXELINCBINCYGNUSNORMALFALCONDATAQUICKLYBIJOUBUBBLECLIPCYGNUSEXPORTCLIOBLOBSTUNHECTORKALIMACYGNUSFlashback
Stephen May has this to finalise the Flashback discoveries for this month. By entering PIXEL as the code this makes all the enemies disappear.AMIN
MEW HIE TIPS FATALFURY111111111r-. c.v. ra:Kcon.:RE-gto t.4 111J I clog , • • Though lt fun playing as your favou m in Euro Club eccer,lidevohmohdloHluaPdnanavilluSsemaJtahttaerg611way to ploy as Brazilian or even Argentinean teams — if only to have them lose! James says that, by entering the password screen in simulation mode and simply typing the alphabet followed by the numbers 1 to 9, Argentina or Brazil ore at your beck and call. This only losts for the duration of one match. 111 For unlimited continues on Fatal Fury, press and hold UP on the 0-pod and press A, B and C simultaneously on the continue screen. The cheat awards an extra continue each time it is used but only nine are displayed on screen. Cheers to Owen McCarthy and Ryan Lynch for that. 0 iI 1 1
![](https://assets.isu.pub/document-structure/220912162747-2c4c3b82884041f3c65bc178c7feed7a/v1/0bec38a1ab55b4e1c3c7b137ff1b5376.jpeg)
every one of these people has completed Flashback on its hardest difficulty setting and sent in the level codes to prove Where were you in all this excitement, eh!?
Hall of Fame: MK Astill, Graham Bennett, Tom Blond, Napoleon Boneporte, John Borromeo, Lee Browne, Peter Chetwynd, Stephen Childs, Gareth Crabb, S Crane, Paul Croll, James Digby, Bruce Edwards, Andrew Flood, Neil Foster, Ray Franklin, Atif Ghaffar, Steve Hall, Neil Handbaker, S Harris, Christian Hill, Colin Hounsame, Richard Howse, Stephen King, Gory Kings, Steven Leek, Darren Page, Stephen O'Shea, Gary Peck, Christopher Leach, 'Little and Large', Ben •Jammin' Maguire, Cohn McDonald, Lee Conrad Morris, David North, Noun and Stu, Steve Preston, Lee Stephen Redman, Peter Richards, Phil Riozzi, Steve R, Ian Ronald, David Rose, Michael Rowlands, Wesley Sallis, Simon Seymour, Martin Smith, Nick Smitherom, Brian Stopford, Anthony Ward, Dominic Williams, Stephen Wren, Allan Wright. Phewl
*
This is on excellent cheat for Megalomania on the Megodrive from Alan Patten, Merseyside. It allows players to retain the amount of men on on island whilst increasing the amount of men that ore co nod over to the next. This is all achieved by selecting as many men as possible from the man pool, placing them on an island then quickly decreasing the number of people on the island back to ze Its spowny, but it works!
FLASHBACKLookatthislonglistofnames!Eachand
HUGEM1JSFAST NEW! Fa test toandbuiandwenhonRESULTSIN2ForFREE info Dept.69, 114a Bcittain St., Belk End,C CI_ ustC10 20t11ue. i
![](https://assets.isu.pub/document-structure/220912162747-2c4c3b82884041f3c65bc178c7feed7a/v1/f19b66e766a5c32d75f7fc575baffcce.jpeg)
Brian Doyle supplied us with this list of Rood Rash II codes that give access to oll levels with the Wild Thing bike.
1. 8: Start the
6: Return
Sometimes the best tip amounts to nothing more thon an all-out cheat! This is Neil Ingoe's way of thinking, at least and he's provided winning solution to all matches in NH1PA '93. a team to play at their home ground. to the scoreboard the controller into PORT 2. 'Change Goalie' the oppositions keepers are listed here. no keeper for the opposition. (yuk, yukl) to the scoreboard. controller back into PORT game and stuff the opposition!
![](https://assets.isu.pub/document-structure/220912162747-2c4c3b82884041f3c65bc178c7feed7a/v1/b7e05e311d890c99c75b7acc69b297a5.jpeg)
Brian also draws our attention to the similarity of the codes. Fascinating.
5: Choose
—
lo BIKE8RYEAPL9TH TINEMILESPLACE t R 411111r tj U I. 23-•vbiammiamoimendempA-•St'rithCHI%POICj11Prir-141•areiCHIPUT 1
and loved' this month, isn't it! Well there's a perfectly good excuse for running this one ot least, as Rambo III is now available for just El 9.991 Stuart Kidmore sent us this set of instructions for extra lives, arrows and bombs found in level three. At the end of the level, destroy the wall then ignore it. Guide Rambo to the right of the screen and then bring him down to take out the knife-man in the bush. By killing him 26 times (I) Rambo earns 99 arrows, bombs and nine lives not to mention loads of points
!Li
The combined efforts of James Hale and Kevin Tysdall have recalled these Spiderman cheats. Unfortunately they require a second controller Anyhow, first of all move Spiderman next to the word LEVEL then press and hold the START button on controller Now press and hold A. B and C on controller 1. With these buttons depressed, push UP/ RIGHT on controller 1 ond three exclomation marks appear to the right of the word level. Upon starting the game more web is obtained by pressing A and life provided by pressing B when the game is paused. C allows five seconds of invincibility. Kevin also added that a level skip is possible in conjunction with this — pressing A, B and C together when the game is pousedl However be careful that this isn't used in the caverns as it sets off the bomb and finishes tho gornei
Goodorikey and oil that! This Speedball It clones positively Jurassic/ However Borne McBride has token his trowel and unearthed this cheat to reveal four new teams — Mexico, Germany, Canada and France. It is achieved by pausing the game on the Team Select screen then pressing B, B C, 8, B then C. There is the sound of a bell which
1 indicates that the cheat has wo
2: Go
RAMBOIt'sgettinglikeTipswe'veknown
ORMAN
4: Select
1: Select
Level 1: NCB IVOL
Level 3: 01C8 3VOM
the
screen 3: Plug
Level 2: 01C8 2VOM
Level 4: MB 4V00
38 PAM SEGA
H HO
7: Plug the
kote
Level 5: 0103 SVOP
Co Pa IlitS for Men & ProtectStayWomendry.clothes.Noleaks!Noodours!Feelafe,sure,andtable. Prnocomfortable. lencto: 69) 14,SandyLane,Puddleston,Het Sandy5SS
![](https://assets.isu.pub/document-structure/220912162747-2c4c3b82884041f3c65bc178c7feed7a/v1/352bf108cf4e776fac79d2c9b50b7659.jpeg)
1: PHQK, DLDL, LLWG, DDLD, LIT( YRWB, LDLD, LLQK, LDDL, DDTZ EXTRA A: PJWQ, WDLL, LIQW, KLDL, LDDG EXTRA B: VNQQ, WLDD, DLQW, KDDL, DLDG
2 EXTRA: MNOG, IDIL, LDZL, LILO, LLNP
2:
Stage 1:
Pelee WW0K, LDQQ, QQWB, WQQQ, GL.Q0, QWWW, WQQW, GLWW, WWQW,
ME6ADRIVE TIPS
$tage 2:
, StageVGDL,BLDDLIQQ,3:1:XNQW,QGLD,
St 1; JTQW,
LIWO, WQQK, DDNZ Stage Ss 1; XQQW,
1EXTRA: YAWN,
IMO 2: HDQQ,
DIZQ 2 EXTRA: BQWQ, WWWQ, BOWW, QWQQ, GDPO 3: IDQQ, QQQQ, QDWW, WQWQ, YLTD 4: YIQQ, QQQQ, QD0Q, 000W, BLDG 5: KGWQ, WWWW, QGQW, WQQQ, QDRP Stage DPQW,7:WWWQ, WKWQ, 00WC), WGRY The 'EXTRA's referred to are the levels requiring a revisit when Gogo Dodo is topping his foot. Andrew Gallagher is the top geezer who supplied the most complete list of codes however this is a list of other, hord-working contributors: Adam Bewes, Andrew Clark, D Cassidy, Dominic Cavanagh, Ion Harper, Andrew HickirL1 n, Stuart Lee, Adorn Nemenyi, Tuarach, Paul Wickens (sorry dn't use your mops) scoot 1 006342;0P.40•4440)dlti,0e••••••0 -..,••• -•••••••••11 HIDDENTii i 4: MEP 'MP • ...WNW Tare-playerthetheWorldWORLDOPILLUSIONofIllusionfortheMegadriveisn'tdifficultbutit'sincredibleallsame!RichardGillinghamhassavedusallthetroubleofcompilingfulllistofpasscodesforalltheamozingstages.game:Level2:KofS,KofH,QofS,KofCLevel3:KofD,QofS,KofH,QofHLevel4:KofC,QofS.KofD,QofHLevel5:Kof5,KofC,KofD,QofHO..-playerDonald:Level2:KofS,KofD,KofC,QofSLevel3;KofC,KofH,QofH,KofSLevel4:QofH,KofD,KofH,KofSLevel5:KofS,KofH,KofC,KofDOne-playerMickey:Level2:KofC,QofH,KofH,KofDLevel3:KofH.KofS,KofD,QofSLevel4:QofH,KofD,KofS,KofCLevel5:KofD,KofC,KofH,KofS
1: ZMGL, DILL, DDDD, LODI, DIGO NBKL, LDDL, DDGL, LLDL, DLVD
3: HONG, UAL, LDZD, LIDL, LLNP
game, we've token the best hints from all of the letters received and banged them all together. Just as Flashback promoted such a massive response there's a mini, Tiny Toons Hallof-Fame to follow:
![](https://assets.isu.pub/document-structure/220912162747-2c4c3b82884041f3c65bc178c7feed7a/v1/509cbb5e7fef8426e8f23d7bb2b2ca5c.jpeg)
2
4: BNVAV, WILD, DDWQ, BDU., DDVG
2
5: KZWW, QILL DLWQ, QLDD, LOP
AsIVYICONS:thisissuchasuperb
Ma, DLWQ. WGOL, Witt 2: DQWW, WWGL, LLQW, WZOL, LDXZ 3: PiQQ, WWDD, IDOW, WKDL, DUK 4: ZZWW, WQGD, LDQW, QQDD, DDXQ Stage th 1: DTWW, WWKL, DLQW, QQGD, LLDD 1EXTRA: NXWW, WQWD, LDQW, QQKD, LDTD 2: PTQW, WQWG, LDWW, QWBD, LIPP 3: HTWQ, QWWG, LDWW, WOQD, DLNP
2:
3: MHOS, MIDI, LDWB, POLL, WAD
WQQG, LLNY 2: HXQQ,
SYSTEMTIPS
![](https://assets.isu.pub/document-structure/220912162747-2c4c3b82884041f3c65bc178c7feed7a/v1/79414cc86a0ce263d7393c1db5e35a1c.jpeg)
You could probobly bet on Leigh Evans of Cardiff and Sean Kennedy of Northampton having very sore forefingers and thumbs at the moment. There are two possible explanations:
111111111.111.•••• • MASTEROFDARKNESS A ThankfullyWRESTLER1MANIAThistipwhichallowsplayerstowineverytime,withoutfail,issuppliedbyDavidAndersonfromWiltshire.Itmightseemcock,butitworksnonetheless,Bylur-ingyourcharacter'soppo-nentoutoftheringeachtimeandleadinghimto4thebottom,centreofthescreenitispossibletodrop-kicktheguyintosubmissionthennipbockintotheringbeforetherefereecountsyoubothout.Withtheopponentstilloutoftheringthisguaranteesaninstantwin!Segohovehiddenawayasecretoptionsscreeninthiscool,creepygameandTangTarapdarhaswrittenintotellusaboutit, ai Once the Master of Darkness logo is on screen, press UP and buttons I w and H together. The options screen contains a level select, a choice for invincibility, a sound test and the option of increasing the amount of starting credits. Greot or what! By the way, Jason Edwards sussed th s • one too. • TINYBOYTeddyBoyDavidWilliams has this to offer for Teddy Boy on the Master • System: After losing all credits and the Game Over tune is playing,repeatedly press UP, DOWN, LEFT, RIGHT until a continue screen • appears. Needless to soy this gives you continues._ dohl •••••• AndrewROADAVENGERRichardsmakesus sound like a Generol Hospital with his reference to the MEAN MACHINES staff. So you might say that he's ovided the cure for any Rood Avenger depression any Mega-CD ers ore suffering at present- Then again, you might not! On the screen push UP to select the options — not DOWN, otherwise it sserpyB!krowt'. the game at any time press A, A, A, A, B, A. Finally, to e whole game without having played it through, push A, A, , A, B. Cheers Andrew! Mystified Morderes r! so much discovered a cheat for Sherlock Holmes, he's just blown the game all to heck for all thos who haven't solved all three cases yet. The culprits ore --- arid, remember you don't have to read this: Pierre ArreaulipTravisLorettaNolen IMP M hi SEGA 41
One: They sent in loads of passcodes for Lemmings that amount to these four, key ones: FUN = PFECXODY. TRICKY NBUIRDHO. TAXING = DHODZTHP. MAYHEM = WMZTHPFE, Two: Erm..,not enough room, sorry.
Chapter I Lester appears In large peel. Move: too .1. Up to avoid the tentacles. 2. Down to pull yourself out the pool. 41111r 3.- Walk right into next screen He eac•staters sense squidigy Haws I Stand still and use 8 to stamp on the enemies. 2. Watch out for squidgers dropping from the ceiling.2Continue right. 42 MM SEGA • • • • • • ** *** • •OOOOOOOOOO Chapter II Lester awakes imprisoned. 1. Swing left and right until the coge foils. 2. Bend down to pick up the guard's gun, 3. Run right for two screens and fire at guard. 4. Run halfway into next screen, wait until your friend passes, then stort making shields until 'friend' unlocks the doorSPITEVIRDA6EM•allitt cruel fate that led Lester Chaykla to his laboretoryl to do some particle experiments on a wet and windy night, and ends up with him dodging strange and feral creatures in 'Another World'. Never fear. Using the same principles that allow the crew to deal with a grumpy Lucy of a Monday morn, we've devised a foolproof guide to said alternate reality, with those tricky Lproblems unravelled. A la st (amps eat! 11.Run loft 2. Jump at None, Swing and run right. Two quill • lift... 1. Go down to the bottom. Make sure you are ahead of 'friend as you walk into the room. 2. Shoot immediately! Shoot the glowing line in the wall. 3. Travel up one level in the lift. Power up gun to blast door. Walk right and run up slope4. floorholeopens'Friend'aintheforyoutofallthroughAdark,scaryshaft:1.Rollleft,The first gas trap fires in cycles of ten. The second fires in cycles of two. 2. After dropping roll right. The next two traps fire in single pulses
![](https://assets.isu.pub/document-structure/220912162747-2c4c3b82884041f3c65bc178c7feed7a/v1/b2726b4882092d3e457ec319402194f6.jpeg)
S.toShootkill,Go right. Make shields on either side, and use the blast routine to kill enemies from both directions.
2.guordMake a forcefield at the doors and walk towards them. The guard rolls a grenade. Step back and the grenade rebounds on him
I OOOOOOO • • • • • • • • • • • • :Cha EV A/•••••••••••••Lester "pea pearl-dialog...•• Dive in go down and left, • replenish one's air supply. • 2. Down again and right. Jump • across the floor monsters to shoot • the power line. • 3. Return to the surface, stopping • • off for air. • • • • • • • • • • • • • • • • • • • • • • • • • • • • • * ************
2. Run to the for right, beneath the hole in the ceiling. Keep making shields as you wait for rescue.
1. Go left and up the stairway, then right. Use the shield, blest and fire routine on another
All alone before a triple-shield• dear: • I. K
3. Walk to the right of the precarious boulder and use your blaster to topple it
IV
3.awayJump across the chasm and blast a hole in the
,srooderehtehthougthrstki
Chaptercliffside.
then recharge in the chamber to your left.
ME6110111VETIPSWhatawaitsour brave scientist? Will he find somewhere to change his now well-marked underwear? Find out in the second, and very conclusive part of Another World: The Player's Guide. Showing in an issue of MEAN MACHINES next month. : Chapter III••••••••••••••••••
I. Walk right post the waterfoll with impunity. Blast the chandelier (this releases 'friend above).Make a shield at the base of the stairs, then blast the enemy's shield and fire.
4. Go down stoirs. Get roughed up a bit, Kick him in the gonads and dive for your gun.
, -r leeway tav 1. Fall down the first two holes. Run past the foiling boulders. Shoot the hanging tentocies and jump the floorbased horrors.
3. Run left immediately! There are three jumps to make. After the water raises you move right and blast through the thin wall
Death es' dash*
2. Head right, jumping gaps, to blast a thin wall to the right. Where the bat is hanging from , the ceiling, shin up the stalactite and return left.
![](https://assets.isu.pub/document-structure/220912162747-2c4c3b82884041f3c65bc178c7feed7a/v1/15d67d3cc38fae865af3094c70fb9ee5.jpeg)
2. Run right, preparing to waste a baddie two screens
4. Run up the boulder and run to the right. Blast the wall to release the water
kill, kill, kill them mill
1. Run post the crushed guard. Smash the door on the right.
AIM SEGA 43
3. Fire at the light-fitting to squash a guard. The right time is when his reflection in the nearest globe stops in the centre.
•
'gob-smackingswimmingCOMPETITONallWINACALIFORNIANDREAMd'yofancytheholidayofalifetime?Asmuchsand,seaandsunshineasyoucantake?!magiorsurfinginaclearblueseaorwanderinggoldenbeachescheckingouttheviews(espe-theonesinskimpyswimminggear!).Heavenorat?Well,tocelebratethesuccessofoneoftheplatformotionsoftheyear—CoolSpotontheMegadrive—inGameshovedugdeepintotheirpocketsandorelashingoutafortunetosendoneofourluckyreadersaparent,guardionormote(providedthey'reover18)oolSpotcountryitself—sunnyCalifornia!Andthemarvelsdon'tstopthere.ToalsotoasttheimminentreleaseoftheirDisneytitles—JunglekandAladdin,whichorebothlookinglikeprettysumptuousplot-gamessoforVirginarealsopickingupthetabforthatsame•letoswonofftothewonderfulDisneyLandMind,bogglingstuff!TheluckywinnerwillbeflownfromBritainonadatetobeorronged,totheCityofAngels.FromtheLosAngelesairport,theywiowisiskedofftoaluxuryhotelinthefabulousCaliforniansuburb—hentheywillbefreetoexploreallthoseAmericanmarvelsheardaboutbutneverdreamtthey'dsee.Anddon'tdesrenotintherunningforaholidoybecause10runners-upwillreceiveasplendiferousCoolSpotgoiningaT-shirt,frisbee,badgesandh,muchmore.Phew!4INJSZNILINCVZKLWILIIENININIALINNI11711111MNI,NMKNN,NMAMIN,NMMKNMNNM,NMNNNMKIN-ilINNSINMNWHATTODO,WHATTODO!Allyouhavetodotowinoneofthesesplendiferousprizesisanswerthethreefollowingquestions:1.Whatisthefreezingpointofwaterincentigrade?2.WithwhatdoesCoolSpotkillhisfoes?3.WhichAmericanstateisDisneyLandin?Ofcourse,acompetitionisn'tacompetitionwithouttheobligato-rytie-breakquestion,sowithoutfurtherado,completethefollow-ingsentenceinnomorethan15words;I'msocoolbecause.Slapyouranswersonapostcardandsendthemposthasteto:COOLSPOTCOMPO,MEANMACHINESSEGA,PRIORYCOURT,30-32FARRINGDONLANE,LONDON,EC1R3AU.AnswersmustbeinbyAugust30oryou'vegotnochanceofanythingwhatsoever.Atall.Zilch.NoonewhoworksforEMAPImagesandVirginGamesortheirrelativesoreallowedtoenter.Oh,ondtheeditor'sdecisionisfinal.44MMSEGAAfeelSpotbyVirginGainesoutnowinthesRatedbyRichandGasat00%,wereckonformfansshouldadd4tietheicialierHonhome NE,
![](https://assets.isu.pub/document-structure/220912162747-2c4c3b82884041f3c65bc178c7feed7a/v1/65b120009b79fc8b5fbee516ed4541ad.jpeg)
COMPETITION
![](https://assets.isu.pub/document-structure/220912162747-2c4c3b82884041f3c65bc178c7feed7a/v1/d9ebd4479fb4f1576edeaca3c6eb5025.jpeg)
a broader than
field
'Frectscapit' are invented — a slow-moving polygon field with
sit-down or standing
for bring* VR to oil. The
North
demonstrates apparatus that involves computer images being displayed through elsmod-of projects with Virtual NASA1985ones.unveil first real interestofThisonmini-TVstomisingsystemengine.virtualityTheirischeapmodebycus-twoanrunanormalPC.isthestartcommercialinVR1970sDevelopment of CAD encrosedAided(ComputerDesign)inengineeringandArchitecture,using3Dcom-putermodels.Replacesexpensiverealheadset.Software developers expen First primitive VR with virtual worlds. For home engine, computers, concepts
Virtuality: the step Sega venture promises the second generation.
![](https://assets.isu.pub/document-structure/220912162747-2c4c3b82884041f3c65bc178c7feed7a/v1/d5ddcd2191304049e7abbeea1a51450d.jpeg)
Prof.1967Ivan Sutherland of University of Carolina like moveable virtual objects.
that, where technology attempts to create a believable other world, be might • display it on a normal television or film screen (eg, Sego's Virtue Racing, The Lawnmower Man).
VR
W-1
W-Industries1991
ATM Ideally you should see, heor ond touch this false world by the aidofILcomputers, 'Virtual Reality' at 'I present is this alternate world dis-.9layed through a visual head-set with stereo sound, and controlled through a glove or trigger. srevoc'ytilautriV'mretrediwoh711IPMIk19.7Virtuol Reality has the thisMegadrivelVirtualityicsheadsets,sheetturethingtactmostmorebody-popping.crapsincetialETHEAD?CYBERPUNKomen-ORBUCK-tobethebiggestinnovationTelevision;orthebiggestfadsincebreakdcmcingorInfact,itsmuchlikelytobetheformer,sincepeoplethatcomeintocon-withVI(thinkitsthebestsinceslicedbreadThisfea-intendstobeafool'scrib-toVIZ.SolearntAboutcyberpunks,teledoldon-andSegoVR;thefirsthomesystem—fortheda—belaunchedyearIfyou'restandingwithabucketonyourheodplayingDactylNightmare,it'sprettyeasytorealiseyou'reinVirtualReality.However,findingawrittendefini-tionisharder.sinceVirtualityhasspawnedallsortsoffringethingsintherealmofvideoandfilm.Virtualityinvolvesthecreationofanolternatereality,bymanipu-lationofthefive4senses.
launch on arcade system. A 32-bit processor runs virtual
units The Virtuality headset is quite heavy cad cumbersome, but does work pretty well.
the
Nrst
UMW OWL Ifirteal Role-playing, • kit like the laigkmate Tv show.The game is set is a mediaeval castle.
oil •
THE VIEWER
Sega show their home virtuality unit for Megadrive at Summer CES. Launch dote is set for November, priced around $200, BRAVE
Nice graphics are useless unless your control is responsive Two important features of the interlace is the delay between your movements in the real world, and the reaction in the virtual world. Feature two is the meu.iure of response; does the interface accurately reflect your
ThefacedownW-IndustriesW-INDUVRIES1encodeVirtualitymachinesorefoundinlargerliamusementcentres.Thereoretwoversions;onewiththeplayerstandinginaringwithaheadsetandtrigger.Theotherisosit-cabinet,theplayer'sinter-isasteeringwheelandfloorpedals.headsetdisplaysasurprising-lygoodpicture,butasithastofitallsizesofheadsitmayappearslightlyout1111,11INN-offocus.Theheadsetislight.butyoureyesgetsore
TrueWORLDNEWVRinvolvesthreevitalcomponentsthatgotocreatethevirtuolworld,or'Cyberspace'.Themoreadvancedeachofthesebecomes,themorerealisticandabsorbingCyberspacebecomes. ENIGNEEHT,1114
THE INTERFACE
The program that controls the vir. tool environment. A goodfulthings:reliesengineontwoopower-processor,andawell-writ-tenprogram.W-Industriesmachinesarecontrolledbya32-bitprocessorbasedaroundAmigatechnolo-gy.Thespeedisneededtodealwiththeinterac-tionofuptothreeotherplay-
'dactyl'sDACTYLNIGHTMARE.Theviewoftheplay area. He swoops to attack players. post geats,by
frost are offecteu by the quality of the TVs, and definition is limited by the amount of pixels. As the headset has a tracking sensorfor your head movements, it octs as as port of the interface.
First experience of VR for most JUNEpeople. 1993
![](https://assets.isu.pub/document-structure/220912162747-2c4c3b82884041f3c65bc178c7feed7a/v1/55a248ee9c2e9133ebb04d8881384007.jpeg)
FEATURE
ers. Saga's home VR uses the Megodrive's standard 16-bit processor, so multi-player games ore unlikely. A good engine will use detailed polygon graphics and fast update.
: one first V . • The 'se ue. ks •
The headset offers the sights and sound of the virtual world. The headset should consist of two separate LCD screens, showing slightly different pictures, the difference allowing you to see in 3D (stereoptics). Colour and con-
Spoof WW1 dogfight game with four bi-plones. The view is fuzzy, and the game not much fun.
MM SEGA
An arcade shot of Virtue Rating, not strictly a real virtual reality game, hid it doessuccessfully render a stunningly realistk virtual world.
![](https://assets.isu.pub/document-structure/220912162747-2c4c3b82884041f3c65bc178c7feed7a/v1/167905b3fae9f8a7311551e0dd99d5ce.jpeg)
FuturesportRAIDM&STERSplayedin a massive stadium where bouncing robots blast hell out each other.Simple gomeplay, but exciting while it lasts.
BATTLESPHERE VR SEGA
Ambitious space battle game, in
THE GAMES
NUCLEAR RUSH
a hunt-tokill tank game set in a futuristic maze. Batilezorte for the 90s and very good atmospherepatrolledscapeTheDACTYLfunNIGHTMAREoriginalvirtualitygame.Explorationonachessboardland-linkedbystairs,andbyapterdactyl.Eeriebutnotmuchaction.
Sego was unveiled to third party publishers at the recent Chicago CESshow_ However MEAN MACHINES was the thehardware.invitedEuropeanonlymagazinetotestthenewSego'sVRsystemusesMegadriveasonengine,ordinaryloypad
The launch game, packed with the system. A frantic shoot 'em up set in a blasted waste, with enemy hovercraft and 'Nuclear Pirates'.
W-INDUITRIES,TO:
Sega are expectVRproblemshavingconvertingtorunonourpowersystem,sotoseethehard-
leavy Metal: one el' latest Virtuality games in Me arcade. Very similar in concept to Bettletech and almost as much fun!
after even shod periods of play. The helmets have excellent (but very loud') surround sound using )er#soksfuur(fothomquodrainsidethe headset A maximarn of tour players may interact in i) single game. Games costs 41*around minutes5forE.2 THE LikeHEAVYGAMESMETALBottletech,thisis
But people adjust quickly and the motion detection system works a treat.
as interface and a custom-built viewer with siereoptics and sound Sega
ThePIILDaddsyouThecresesPaaGLOSSARYuserAidedDesign;anindustrialviewingcomputermodelsof..ring.virtualenvironment:notlustsee,butwhatyourimoginoftothesimplegraphics-oreoofCyberspaceinyourvision
VR, initially won't use polygons to generate graphics, relying on proven sprite technology (used in most video games) to create the virtual world. However, VR games combined with the new DSP chip (as seen in Megodrive Virtue Racing) should be able to create worlds comparable with the
MATRIX RUNNER
Virtuality arcade games. The Sego VR headset is high quality, with good LCD screens and a decent speaker system. Unfortunately, it suffers from some of the drawbacks of Virtuality headsets "fuzziness" and initial double vision (owing to thethetwo screens).
THANKS VIRTUAL Quest AT TOWER HILL TERRACC, LONDON.
An Adventure inspired by the 'Neuromancee(see glossary).Your hacker 'jacks into the grid', and explores networks. A ground-breakingpotentiallyconsolegame
ony one time mathematicsFRACTAL" used to create cho looking pciiiirns Good for fast, able virtual graphics. HI DOM ci-fi concept of a virtual world sets linked by fibre-optic *Sec orrummicaobonstwiceusedto relay your Comm he virtual ci-fimultomaNcutworldnovelbyWilliam Gibson, descri o future world dominated by VI, Virtual Drug everyone :escapes S ond kiponese TV system, for VR has been dewelaped. WishAL TV system running at SIMI. resently incompatible with Sega LVOUNI Grophics system ialung solid ge hopes and linking them to create vetWITIOPTICSworldingthesome seen from two dr angles to create on effect of dimensionaleolisticARMONDvisionSOUNDaudiosystem, where s omes from specific directions a he Theheadin,. it lakes the engine to 'redr the virtual world otter you have mode' movement Each redraw is a frame. Update is measures as a number of frames per entirshW-11111111TINISSsecond.YRcompany ,The first and only duce a commercial VII arcade Ise* box). RE
the Starblade vein. Unfortunately STYLEthe interface and view are not responsive enough to make it PLYINGplayable ACES
Sego
and W-Industries have announced o joint venture, ducing new VR machines Sego's arcade theme par first opens • em r.
ware on sale sometime next Easter for around E200 with games retailing at E50 to E70.
•traa,
aegeS
You won't know what's hit you as you dogfight the deadliest modern jet fighters and avoid everything the most sophisticated missile defence systems can throw at you!
This is the one you've been waiting for
Fly over an accurately mapped world and take out strategic ground targets in a flying game that just gets better and better.
Push your MegaDrive to the limits and take up the challenge of flying the world's hottest jet fighter!
Primary and Secondary targets over six real war zones across four levels of difficulty with a vast array of selectable cockpit and external views It figures that nothing will ever come close!
MicroPro** Ltd., The Ridge. Chipping Sodbury. Avon BS17 SAY.
Now, hundreds of hours of hair-raising air combat flying thrills are at your fingertips with the most realistic jet flight simulation ever produced for the MegaDrive by MicroProse
Numerous missions each with Get into the heat of the action!
![](https://assets.isu.pub/document-structure/220912162747-2c4c3b82884041f3c65bc178c7feed7a/v1/32ac7da2496a5041970c9ac906725384.jpeg)
1 I MOM1492 ; NONNI me • 11119 / UWE ES 1133 i witoto mu ts ta imi ss / MIMS m is / 1001 21.19I swan lu VLSI / 12191161 OFSN11101119 91 M/ManI 1sMil MEN utDcsut Ii1 / IN NINOIM1110121I 1111111112I113 33 / RNA II I HIM INSEIVIIIN 1931 i FUF110111111 111 31 /AMNION' 1 1119 / 1111SI IINITIE 14 19 / MIMESIS INE SUSI ISM / SPINE 11•2131Iii ILO I SPIDERMN 11 19131
![](https://assets.isu.pub/document-structure/220912162747-2c4c3b82884041f3c65bc178c7feed7a/v1/4a54fffb499e4b2d3affcc16023e46c5.jpeg)
OFTHEGIRDEDAREII1939411SUPERHMGonassICIEMannFOOTBRILII19.99MISIRDRAGON19.994:*1,1,••Zr.trig,GAMGROUTIO19.99HERZOG/WEI19_99SPIDER-WM1939 1 1• YES!THERE'S REuEngmoBI munm nno Itill1199UM 4 1,MEG AriDRIVETITLESTOAHALFPRICEf19,99.:SO-COHIEOnMETIES1939 STRIDER1939 ,A-!O 611 a • orN• 111.99PRE4SHORNGALAXYTOME II 1939 Al. gehiri
![](https://assets.isu.pub/document-structure/220912162747-2c4c3b82884041f3c65bc178c7feed7a/v1/24625100c28d17941f44b1f8c2b68bfa.jpeg)
This intro is going to be a bit different, a bit seri I ous. Its brief history of the struggles of pro grammers-
every 3D game has tried to balance the two requirements of a good driving game: sense of speed and sense of reality. Somehow one always seemed sacrificed for the other. You might make a fast arcade-style game that moves like a rocket, but do-has no landscape features or depth. On the other iagland, you might toil over a racing 'simulator' with tediously slow graphics that make it look like a Reliant Robin with the choke out too long.
It seems that these considerations preyed on the programmers of Domark's new Formula One game like many previous racing games, they have recreated the course layouts of the Grand Prix circuit accurately. Qualifying laps, tyres and pit-slops are, as
to make that impossible dream a reality Ilk-Position,eloPiratAecnisrevE.emaggnivirdlaera111
ehtnisiemagehtfoxurcehttuBerehtlla,lausu'llI
bridges.
A major feature of Formula One is the -t rt of the screen lay d time detail s.
H seeHey,goodadionTwe-ployersetogoinsttheroilinghitisofoldtfighty.IthinkIsmmyhoarse
1,1,,••1r • I an
or
mi6Z. RESPONSIVENESS:CONTINUES:CONTROL:OPTIONSJOYPADBATTEN!SKILLLEVELS:4EXCELLENTGAMEDIFFICULTY:MEDIUM rvarr • o ;-• UP r7r1•4Ir.'i .,tr,,•,•• t7rzo t'•ryfiIra••1717"rtrt eyrr 1ST DAY SCORE (ARCADE)ORIGIN32,000a 52 MM SEGA _I This is the totally official and kensed Formula One game lot the Illegadrive, beteg a dose commas ol the Amiga game, Views TOCONTROL Set up the control pod to suit your driving style, fix up the cow to suit the troth you are about to rote, switch the eons, to "turbo" if ecodeireitesoWyouorebardemesgbawayyougo! dos:esu-erpotStiW SlierNOWTOPLAYyourFlcararoundeachof the championship trcuk, aiming to overtake racers and finish first.
NH. of the game, in caseyou didn't know.
TURBO DUO
'on, which utilises a s me, with a course m two-player mode, th *fled horizontally, toremaining screen or provide a view for bo players. This option is only available in championship mode. An inter), esting variation is the option to race directly, against the Megadrive, which occupies the second port of the screen. The split-screen, moves slightly slower than full-screen roc- e ing, till very fast.
![](https://assets.isu.pub/document-structure/220912162747-2c4c3b82884041f3c65bc178c7feed7a/v1/09ece5fce30ebc2b57bf76695024f7f1.jpeg)
o
•
playing. Have Domark made something to really break clear of the pock?
A subtle twist to the rat is offered by Arcade m courses ore taken in ord Interlogos first. The objectsixeachlaprace is to pass a required number of cars. Succeed and you move to the next track, get a score, and face a greater quota of cars to pass.
though!comedianFormula
The Championship option is for racing across a succession of the wodd's most mil events of each year's Driver's Championship. On the construction screen you get to choose any number of the courses, in any order. You (and another player if selected) race for the Domark team against the familiar names of Prost (Williams), Schumacher (Benetton) and (Ferrari). A league table after each eve shown. The first five are awarded tctp
ME6ADRIVEREVIE
•1so • 1 ••• t • " • .111.1tIt MI aim -A-EVASrFARCADIARAMA!
••dom'st,",••Iro•-os L.
One ChampionshipWorldisjust a brilliant racing game, wiping the floor with just about every other racing title on the Megadrive. The main feature is its speed. The incredible acceleration, coupled with the extremely smooth update is a stunning coup. Looking at the stills here you may not be convinced, but to play it is to understand exactly what the programmers were trying to achieve, and they succeeded. Thankfully, getting the basics right has been supported with a thoughtful approach to options, including a vital two-player mode, which retains all the excitement, if not all the speed of the solo option. What with ten save positions, four levels and even an arcade variaHon with scores, this cart has massive lasting value, and should become an instant classic amongst Megadrive racers.
![](https://assets.isu.pub/document-structure/220912162747-2c4c3b82884041f3c65bc178c7feed7a/v1/642c71350666ec6f140c5440568a77b1.jpeg)
Benny Mill gets a ifiseppeirdkrs MA placing on the grid. Not bed for a dead
You con save your progress in the Constructor's championship for a later dote This isn't an innovation, but Fl has a jaw-cracking 10 seperate positions for single and • Iwo-player saved games.
CONSTRUCTION TIME AGAIN
101110•1 Practice hard enaggh and you could be driving this one day. egammechanicmanTheinvisibleisyevrinthisAir'LONGTERM 1141EICIDOLZ1111131E1EIEIEll•DEIEIEIEllREPORT0ElEZI E1=1El110111TE6NWODKAERI.ElCCM E3 I EMI JILJ LJ 1 1IMES 1:ZI LJ El El IVY D El El El El PRESENTATIONGRAPHICSAbEncellentgraphicswithimmensespendAllthepreseniationalgraphics(coursemopswenicelydoneThesplitscreeniswellarrangedVNotmudininetyincolour.Fourdifferentskilllevelsatrainingmode0Driver'schampionshipwithteasavepositionsowlatwoployinoptiamueetetutedVNothingworthFaultingAGoodengineacneasyoushillitemsVThemonisantokay.andnotasatmasithernasthemhogamesoundorgraphics1PLAYABILITYASpiedheatsroamtotalentreeelse)willbeimstantlyoddnindtotheoutheatuleelFifteenotherracersattonsidelableskillforceyoutogaol!ARABILITYThetwelvecourseswilllaicakgalmastering.andthelimbooptionwillprobablyde4yallyogiattemptstohandleaTheresinfinitemow)foihead-taj•headsIt'sthebestracinggameestheilAegadrive,SimpleasEasycontrols,atmosphere,optionsandSPEEDcombineformonalmostperfectCOMMENT Jul Ledflt-rS...M1_1f_Efr i •L.; tilLE LAJ Lea LZ i.
guidette to four fave circuits: SAN MARINO real horror track. The bends ore as tight as a duck's behind, and there ore loads of gantries and obstructions.NTECARLOrofacourse.Do serious ge to the palm tree setting, nd enjoy the glorious tunnel section. Monaco demands constant attention.ESTORILodesigned
fast and utterly realistic 30 graphics, arcade and championship options, great sound, loads of tracks, fabulous presentation, four difficulty settings, loads of features, plenty of nice touches and marvellous, highly addictive gameplay drive this straight into pole position as the greatest Megadrive race game yet seen. It's brilliant fun and provides tons of long-terminterest both in the form of solo Grand ChampionshipPrixattempts and simultaneous two-player battles. If you're a racing fan and miss this, nominate yourself as nob of the year.
![](https://assets.isu.pub/document-structure/220912162747-2c4c3b82884041f3c65bc178c7feed7a/v1/9921240f87f9adffdd6a27b75ba85e53.jpeg)
Fuji was featured in the original Pole Position. To its distinctive rounded curves are dad some steep gradients. t's nice to see Fuji again, so often passed over for Suzuka (which is a bit dull,if the truth be told).
TRACK SKIP
these preposterous curves? Estoril also has a magnificent straight, and a sneaky dan• er area before the lost bend.
FUJIostalgial
MEDADRIVEREVIEW
-
smooth,modes,two-playerscreenandone-playerscreenaction,speedyincrediblygraphics,Superbfull-split
In this driving game, hitting a tree top speed is not fatal, thankfully. It does bring you to a dead stop, and wastes valuable seconds as your car is repositioned. Crashing into cars and some roadside obstacles sometimes results in a spectacular aerial launch. It is possible to recover om this event, but watch you don't blow your engine by revving in the air.
VAULTED THE DRAWBRIDGE WADED THE SWAMP TRY 331111111161111111111111111111111111101 SPELL iN ZEGA at WOOLWORTHS Wipe yourself down, head for any branch and feed your face with all the latest hard and software.
![](https://assets.isu.pub/document-structure/220912162747-2c4c3b82884041f3c65bc178c7feed7a/v1/40fac58f40d57578ab4fa95022a76134.jpeg)
gears — you can't change speed! Your futuristic car is fitted with advanced 'mono-velocity' technology, which means all you have to do is shoot. oil the enemy does is shoot bock. Your
Gameplay in
a
DID onnona SEP Night simple. about right/left movement from disaster to the next. Cometo think of it goowhole games disaster!
ME6H-COREVIEW LEASE TEIA ..SNOITPOril ..-w,----.—pRESPONSIVENESS:CONTROL:JOTPADCONTINUES:3SKILLLEVELS:3POORGAMEINITKIIIIITtEAST1STDAYSCORECOMPUTEORIGINNightShiite/isonothatToiledreamtmgthemselves,althoughtheactionressedikemoseyoldSegaroin-ops. LORTNOCOTWON1111 TheNight Striker sort of flies. Thecontrolcon be • directional, reverse (like a plane joystick) or for analogue joysticks (these vskidt condecipherhow hard the joystick is being pushed) i lifiLAMMIPMPISPAWNHOWTOPLAYSurviveeachofthe3Dstages,pick-ingaroutetotheterroristban.ShootenemiesandavoidZIPS.lures. politicians, soldiers, even controversial novelists are eligible for police protection, so why oh why is the some consideration not afforded important scientists?. Take the cose of Doctor Masker Lindberry, expert in optical laser technology. Could the vernment of 2049 not have • • • • • • • • • • • • • • • • • • • • • • COI •D APILE OFSHOOTrealised he was in danger from the League Against Dubious Names?It'sprobable that his vost knowledge of mad science will be used to threaten the safety of the world! So hurry Night Strikers! Climb into your wonder cars and chase the terrorists to their lair!
Striker is utterly
I'm gobs- , Thismocked.has to be one of the graphimos.gamesCDscrockiestinthecos-Thearestudouslybad,sortof
'cubist'. The sprites are total unrecognisable. But please, please believe me when I say the playability — the part youCAN'T see is TEN TIMES WORSE! The game is easier than Outrun 2019, a game so unchallenging Jeremy Beadle could complete it while carrying a tray of drinks (with bait hands). It's utterly crappily programmed, even Taito's previous Ninja Warriors, a digital horror looks good comparison. Taito are go to get a really bad name if more like this is to come.
![](https://assets.isu.pub/document-structure/220912162747-2c4c3b82884041f3c65bc178c7feed7a/v1/170b03c01fa58ec6d8f1a4945d0c281d.jpeg)
is restricted. Just choose a bra led the next level. AOA
one
Don't worry
I la Milw I IIMEM odMOM=rI *111.
The factory has a low slung roof, supported by pillars that are easy to fly into. Later factory level hove box obstructions. The boss is a trolley with a single robot arm, and a nasty line in plasma bombs
CITY
heir out indoesn'texasperation?alterthe game, or your tint at all. rIASTABILITYPRESENTATIONAThereoreh.termcid—nevelt,cekkmodelytotelessiVIMintroonpioiiscrop(andloom.preheesselelGRAPHICSIrSorIlesMothoveinexplicablyWeektothepoetwheretheyhmenodenti-tionlkwkdropsologoolityinhersoctotheterm'screengorboge'SOUNDZumenoihnlluswithtunesthatwouldhavebeenretestedasIlitieherbroodB-ales(lifMebondmembersweredeo()Thesoundeatsarealso'bed'VNe.mgThisgemsonlyregistersonthestaleHonsonyoueelIgomewhenyoutentS443whatsgonga?,TheCDtakesaboutityesecondstoaccessaboutThesometimelasyourottentionspan.Thisisaamsit-rtgDome—irslotbedOVERALLTheworstgamelottheMegaCD?We'dliketothinkso,buthey,whatyadoingnowUM)?OrshouldIsay'imitate'?1 STRAWWhenyoureachthe final stage your croft transforms to meet the final boss. It may become a Space Harrier-type warrior, or a deadly motor-bike! Don't despair, it
Thisminds me if the da when program-homingwasbigdeal.Moteswouldinmeroundtheirhoutowitne
MEGA-CORE
![](https://assets.isu.pub/document-structure/220912162747-2c4c3b82884041f3c65bc178c7feed7a/v1/013178ac912dadd079cd7d485d9ef51d.jpeg)
Coeyou hear the sound of a million Mesio-CD owners tearing
Mess obout on the water, by flying through a flotilla of killer sampons (?) These normally innocuous and serene ships give a speeding Night Striker a nasty headache. Then pass through a series of low bridges before taking on a dual dragon UnquestionablyTUNNELbossthehardest areas are the claustrophobix tunnel tones. Huge spheres roll down on top of the Night Strikers, which must then negotiate a series of sliding gotes with narrow gaps, The 'boss' is actually a series of running chicken thin that try and ram you. Murder mostLONG'fowl' TEEM
110EIDENDOMREPO
The canal is made hozordous by the ventilation ducts slung across the narrow waterway. Your shield is depleted quicklySKYhere.
CANAL
ir latest interpretati Space Invaders, Pac Ma Tennis and the like. They were all absolutely terrible, of course, but is was never for anything more than a laugh. Likewise Night Striker is nothing more than a laugh and it too looks like something one of my mates might knock together in about 40 minutes. In fact it's difficult It raise even a snicker. It's awful! A disgrace! Somebody, somewhere has deeply offended the chaps at Taito Towers, otherwise they wouldn't have subjected the unsuspecting. Mega-CD owning public to Night Striker. DON'T BUY THIS GAME! pro-
I
FACTORY
The cityscape is a pile of random buildings, hiding heinous helicopter hordes. Your flightpoth follows the line of the highway, making targets of the terrorists killer cars.
Above the city area, squadrons of helicopters attack. The boss is a massive skyship which lowers cannons from its underbelly to attack, These ore its Achilles' heels (so to speak).SEA
APILE SHIELD0THEFINALTheNightStrikerhasshield
tection. At full power it sustains up to five hits, before your ship is vulnerable. Collision with plasma bolts, enemies and objects costs one shiel point. their
Atv AN MACHINE RATING: 96% MEGATECH RATING: 95% CTRONICul A WHENVI)bignisYOURCHANCETOSTARINAFUTUREYOUBUYANYSOFTWARETITLEATTHEGAMESARENA.YOUCANWINANAMA/INGTRIPTOELECTRONIC ARTS WORLDWIDEHEADQUARTERS IN SAN FRANCISCO AND BECOME A STAR IN A FORTHCOMING COMPUTER GAME. EOGAME IN THE USA RUNNERS UP PRIZES OFJUNGLESTRIKE THESTUNNINGNEW 16 MEGSEQUEL TOTHE BEST SELLINGDESERT STRIKE. tow, STI( a UN* ti TIM ri1 rto.•N via Will will' 1 VTOCIES IACT 4,4, t• Ha Sentwon,MIDOFTAIttlYOUUMEISFOR
![](https://assets.isu.pub/document-structure/220912162747-2c4c3b82884041f3c65bc178c7feed7a/v1/ddf495746bdfa76968a352a30141bb74.jpeg)
FREEJOYSTICKCONVERTOe LI4 TURN YOUR JOYPAD INTO JOYSTICK-INSTANTLY!A USA , 2. CD PACK SIMI I S. ill ITAILI P01111%0112 NOD IS &ND %%TM AND NOT TO 1115 SUPPLIIID TO ANTOPOI LOOMS JUST1%. COME IN AND ; VISIT OUR NEW GAMES ARENA AND PICK UP YOURCONVERTORJOYSTICK• ABSOLUTELY FREE! NEW DISCOUNTFREERELEASESSOFTWAREVOUCHERS dii GAMESPURCHASEJUSTANYPRODUCT AT THE NEW GAMES ARENA AND WELL GIVE YOU A BOOK OF SOFTWARE DISCOUNT VOUCHERS - ABSOLUTELY FREE! COME IN AND PLAY BEFORE YOU BUYAT THE NEW GAMES ARENA! RING tr 0800-444 254 ANYTIME FOR YOUR NEAREST BRANCH. 111.11 NI PPPPP It .;11) I% &ND OVIL. AND NOT TO 11 SI M I In TO 41 11s4il1,1T11.11111 I I WILSI•WS 1 MEGADRIVEstrA MEGA RATING: 93% SEGA PRO RATING: 93% E14AEGORWsit&GAmtsmAsiotRATING:936/0MEANMACHINEBATING:93%SEGAMEGADRIVEMEGATECHRATING:9S%C&VGRATING:94%E2WORTHA5mTOALI
![](https://assets.isu.pub/document-structure/220912162747-2c4c3b82884041f3c65bc178c7feed7a/v1/b7868861a41bdf156d24ba0e1e5d4961.jpeg)
,
GETTING THERE
vAilstOhNOW;nTheMIR*-RFSPONSIVENESS:CONTROL:OPTIONSMEGHDRIVEREVIEWSIMMBER1JOYPADCONTINUES:3SKILLLEVELS:4SWIMGAMEDIFFICULTY:MEDIUM1$TDAYSCORN123670Shisobicoirs•opslopehelateeighties.ShinobiPeasmoreincommonwithsequelthanthecoin-op.TOCONTROLboy,herewegoagain...Joerespondstodirectionalpress-esonthepadbycourtemallymovinginthosedirections,jumpingandslashingatapushoftherimedbutton. 60 SilYImrewsSEGAshuriken, dashes sward ipedomn nonsp-kidts. lump. When pressed again at the hilsest pone of a Mae, Joe performs a semennalt. NOWTOPLAY he lee's 'spools* in the maned artsagainsthordes ofenemies wrms sevenlevels. Nave be seek nower•uos dna nspiemsh 4WtIMma4WarN fideksaneW e would Care to thatanswerofdefeatateriousthroughjourney0mys-worldonquesttoamasterevil,JoeMushoshirepliedno'Aperfectlygoodwethink,andonecertainlysaveshimalotofmessingaboutinthelong-run.Yousee
![](https://assets.isu.pub/document-structure/220912162747-2c4c3b82884041f3c65bc178c7feed7a/v1/6edef93da39810b76051acea02b09685.jpeg)
Joe's really had enough of chosing villains, he'd 0, much rather sit in front of the TV and forget his Ninici past. Of course this isn't at all possible, for Joe's arch enemy, Neo Zeed, is back from the grave! Having been severely done in at the sword and shuriken of Joe in Zeed's previous bid for World domination, this evil character is understandably sore
411010111011rat
In terms of stealth, Joe's feet ore the most dependable means of getting around undetected. However there ore occasions where speed is of the essence and so Shinobi ill (Mk II) incorporates a horse-riding section and power-board water level! Both ore a departure form Shinobi's more strategic gomeploy but lend themselves to some extremely fast-moving action indeed! The powerofoffersparticular,section,boardinsomethemost excitingactionandthebossthatawaitsJoeis•Ilylye!
It is the player's duty to exoct Joe's revenge as he tracks the villain down in his desperation to return the power-supply in time for the weekend omnibus edition Joe hos some new tricks up his sleeve to make the going easier .However, there ore seven areas standing between Joe and the final confrontation with Zeed himself. Only with his Ninja magic is Joe assured any chance of success!
One night, whilst watching Far•Eastenders, Joe is suddenly left storing into an empty blackness. Zeed has cut the powerlines! Zeed is obviously throwing down the gauntlet. Joe accepts!
expect the class of what has gone before.
%RATE EXPECTATIONS
losthelpsAkindlymonsterJoefindhistentedlens
MEDRORIVE REIM
-10
Mt OM =NM ---111111111"
Joe takes full advantage of all leisure pursuits available on bis P61 holiday.
Heart: These replenish Joe's diminishing lifeShuriken:meter.
•irommendattackvisually,characters,dant.manoeuvredash-slashisquiteredun-Moreoverthebosswhilstexcitinghavepredictablepatterns.Istillrec-thisgameto6••••••••el,.•1,•••VVVVVWW1WWI,,Off•
r A feature retained from the Shinobi coin-op is the exploitation of crates for their corgo. These miniature treasure chests provide Joe with practically everything he requires, with the exception of occasionol booby-trapped boxes. Items discovered within are as follows:
Shinobi is one of my top nessinventive-ofexamplesshininggamespreviousacters.Segathreechar-HisareSego'sand
![](https://assets.isu.pub/document-structure/220912162747-2c4c3b82884041f3c65bc178c7feed7a/v1/fe1e0f560525d0dc1796b8fcb17b8590.jpeg)
knack for hitting on that alltoo-elusive special ingredient — atmosphere. Joe Mushashi's character development has now reached a stage where he is the most complete, serious action character I can think of. The wide array of moves available to him make his control superb. If only the situations set before him in this latest venture were more taxing. As impressive and innovative as the power-ski and horse-riding sections are, the gameplay involved is quite basic when compared to the care required for success in Revenge of Shinobi. Joe's wall-hanging technique is made good use of, but the
Boost Joe's supply of shuriken. The basic icon supplies 5 with crossed-shuriken icons purveying as many as 201
the
POW: The power of Joe's attack is doubled. Hisshuriken ore wrapped with flame, as is his rd
gFroLi Fe • iiimi '2E4 14510Pr
•
waythiswithandreviewedHavingbeendisap-pointedtheearlierversionofgamebackInDecember, can say without a doubt that this update is better — but not that much. The additions of the power-ski and horse-riding sections are certainly different and add a bit of variety to the game but the gameplay of these bits is fairly basic and not strong enough to push this game into top class-category. Having said that, the game certainly looks better than the earlier version with big impressive sprites and much improved backdrops. It's also big, fast, tough and good fun and I'd have no difficulty recommending this to anybody Hinia freaks In particular will wet their pants over it.
FUSHIN:only.
SILENT RUNNING: In most cases joie cannot wait to confront his enemy. Now more energetic than ever, Joe takes flight and runs with the double-tap of the 0-pad.
![](https://assets.isu.pub/document-structure/220912162747-2c4c3b82884041f3c65bc178c7feed7a/v1/63e3d264f1e10387806a6d5644e87d4a.jpeg)
Previously Joe only brandished his sword for stationary, closed-range slicings. Now he charges, sword raised, for a surprise
•
air!DASH-SLASH:
Being one of those fortunate people who live their entire lives out of a dentist's chair, Joe envelopes himself in a shield of electricity that ought to ploy havoc with his fillings — only, he doesn't hove any!
For all Joe's fantastic, wall scaling abilities, there's no denying the Fushin magic's benefits. This magic lasts for the duration of a level and affords Joe the ability to jump supernaturally high into the
Joe
SOMERSAULT: This isn't new, but it's still a great manoeuvre. As Joe reaches the pinnacle of a leap he tucks into a boll and spins. With this Joe is able to disperse shuriken in eight
and
directions!IKAZUCHI:
it• 411 e•
t
RIU: A fan of Jerry Lee Lewis as a child, and a closet fan of Jerry Lee Lewis as a grown-up, Joe accidentally summoned great balls of fire one day! However he liked the effect so much that he kept at it, and now the Kariu, as they are so called, pose as his most effective
MUIN: At the cost of a life, Joe explodes and hopefully takes his enemy out with him. Foolish, perhaps, but then Joe returns to fight again whereas his enemy does not. Obviously this powerful mantra is best reserved for emergencies
MOWattack,
62 MNI SEGA [HUME REVIEWA'leekmate,we'rebothfallingdownaravine,balancedprecari-ouslyonbitsoftackThingshuskabitgrim.Sojuststopthatposingwillyourepower
NINJA,magic.SWORD,SWORDNIMA SHINOBUSINESSOnlyaNiniamastertscepaofriddingtheWorldofanevilsuchasNeoZee&Yetitseemsthateventheskillsoftheleg-endarySuperShinobiarepronetofailure.Joeismakingdoublysurethistimearoundbyaddingnewmovestohisdeadlyreper-toire.Asidefromhisbasicshurikenandswordswipehisbatteryoftechniquesare:
•LITtVC,o
embodied in a Ninia's sword is the understanding of most people. isn't people He knows his sword like he knows bock of his mind, the thoughts that he kee ere help fuel his sword's capacity for mac,' ses.
BREAKDOWEl
III was reviewed in MEAN MACHINES Issue 5, so why on earth would we want to review it again? The answer is that Sego were so dissatisfied with the criticism the game received in its original form that they pulled it back for a major rethink and now hope that the version seen here is much better. PRESENTATIONTheSWIMISsetcoursesxofalengthystoryandplomeoofanematx-strie.kungluactionTheimagespresentedbetweenIndsareimps-are100SOUNDATheoKosher°workshislimomagiconcemoreonthesoundtracks.AlloftheinadentalePlectssuchassteeleinemiawl.are%mord'Vthesampledspeechisraggedi.ShinueuPhgraph-icsoreofaveryhighstandard.Imaginativespritesanddepthtothebodtgroundsmakethegameexcitingtoundch.VTheanimationislodedimpling.PLAYABILITYAJetrsafunkychor-es-Wstorowtniihis Librilliant Some of his o(htersofies are 'goody asgroovyVUnfo* undmost ()lifetim e doesn'thueuptoMshighsitiandorilk. j intrigue.lackingoctet,featuresaggnikoolatreAleftpredecessorhonechallenge.presentsruttyLASTABILITYOnashordeltdaft•settingthegumsadill,VThoughthisdoesn'ttherepealeddrawingpowerofis(onseguentlyitmaygetondoeshelfoncecompletedOVERALLgasuperbcentralcbutthegameisslightlyinoriginalityandSHADOW—.641 DANCINt.,. Joe impresses with his fancy handwork as he walks with his hands whilst dangling from high places. This is a skill that Joe perfects for the final stages of his mission. WALL-TO-WALL SCARPERING: Norrow fissures ore overcome as Joe springs from wall to wall, defencealsomuchswordhisDEFENCE:DEJA-11U?Thoughthisslowsprogress,Joe'suseofhisasashieldpreventsunnecessarydamage.Helooksamazinglycoolinhisstances. ',111;J:111 8292
![](https://assets.isu.pub/document-structure/220912162747-2c4c3b82884041f3c65bc178c7feed7a/v1/f521d4c509286033369ac7392e4b069e.jpeg)
Shinobi
he is stalked bythe macabre (and dimension!riorchilling)somewhatGowar-fromtheNth1113 El El El LILJLILJEJ Joe's chuff spell is devastating to all bet the toughest oppertent. However, it makeshim fall overso use it carefully. tottillittitellitlitt tit r ,,,
The most important precept of all is that nothing is certain. Good's victory over evil is not a forgone conclusion. As the deity of goodness, , it's your job in Populous II to ensure that you win, by crushing your opposition Your followers ore devoted and will die for you in bottle. There may be no need for that if you ore a god of the big league — you can bring down fire, brimstone and calamity on your enemy, while your people prosper. Prepare for a bottle across 1000 worlds.
theThiswasPopui0,110brilliantasideasgo,buthadsomeshort-comings.sequelhasmuchsamebasicgameplay.It'sabit
S o you're a Manichaeist? Well, you are if you playPopulous II. Manichaeism is an ancient religion, based around the prophets Manichoe and Zoroastrian. Its a simple ?philosophy — the universe is a balance of two forces, good and evil. Both forces are in constant battle, using the physical elements and the spiritual souls of creation to dominate each other.
HEAL TI IE WORLD
THELEVELLERSThebasisofPopulousisthe flattening of land. Most land is naturally bumpy. You hove the power to raise or lower land, making level areas. If a person, a comes'settler',acrossa flat ore°, he will create a settlement. The oepytdnaez. ent depends on huge the clear CleBet IL Some areas conntit be cultivated if th* kmd ho ,been scorched, if it has rocks, or has bet.° tionaid to swamp. questionwhichthetlersforyouspreadon.searchessettlers.EachtheInhouses,SettlementsHOMESTEADSrangefromtinyfarm-tohugeRomancitadels.theprivacyoftheirsettlementspeoplearereproducing(!).housesacertainamountofWhenthehouseisfull,aAlI.ettlerisejectedtsprogged'l°nabfornewgroundtobuildThisishowyourpeopleacrosstheland,andwhymustconstantlyprovidelandthem.Therateatwhichset-reproduceisdeterminedbytechlevelofthesettlement,youcancheckwiththemarkicon.
Mr Arrow and Moly visiting friends house. Mooed!
A look,S ksow there's a henrikesserfssafestsereseimihere somewhere...
• HI LEASE09.99SEPTWABER 1 iwikoboB,aUseHOWTheyPopulousItiolNrogRESPONSIVENESS:CONTINUES:CONTROL:OPTIONSJOYPADPASSWORDSKILLLEVELS:iGOODGAMEDIFIRCUITY:EASY/MEDIUM1STDAYSCORELEVEL30ORIGINtreatedtheoripinolonAmigo,in1,89.alsotonviertedthistot-lowleptotheMegoikive4TOCOMPtheAandBbuttonstoraiseandlowertheload.UsetheCbuttontoselectkonandthe0-Pod(up,down,leftorright)todecidewheretopieceyourbuildingsororreolkyourdisasters.loomWedCWestWmiiirottwoorhoeBelNOVITOPLAYDeleoiiheenemybyhawingMOMfollowersaridmonooneachollevels.'Buildyourgodbyallocatingpowers.
Each level opulous II is a deographical jumble of land resting on water. T op in the top left shows the extent of eoch level, and the initial do show your hardy first settlers. Usually the enemy is some diston way. The worlds have varying land types that influence play: ride land allows fast growth, whereas on barren worlds people
like PGA 2 to PGA — lust tweakings and extra features, but the tweakings make it a much better game. There are double the amount of levels than in the original; the graphics are clearer; and the disasters are more interesting. In Populous, you could use every disaster at the start of the game, which meant there was nothing new to discover. In Populous II you start with only one disaster power, and learn more as you customise your god. The only area where little improvement has been made Is the sound, which is still poor. Although Populous is a little eclipsed by Mega-La-Mania, I'm still well pleased with this assailant update.
![](https://assets.isu.pub/document-structure/220912162747-2c4c3b82884041f3c65bc178c7feed7a/v1/ce16fd7b711a65c7914285a2ed53ff42.jpeg)
PLAYER
die quickly witIN the protection of a settlement.
Developing your people is only half the story. You hove a duty to annihilate the enemy, and Mono is your means of doing it. As our followers grow in number, irshhiiiiithey each provide you steady supply of power, or Mona This Mono is fumes Into disasters by you. and visited upon the enemy. On each world there are certain disasters allowed, certain prohibited. Disasters fall into four elemental categories. Heres a selectionof the twenty odd disasters. Ayoung t frolics gaily in lassibollows. Aohl You customise your god os you win levels. Depending on the sca your victory, you ore awarded a number of experience points These ore placed inpne of the six disaster categories described later. IllpJ give your go f a name and may alter his physical representation password is Olven so you con develop your chosen deity. MEDADAIVEREVIEW itt 1::11;3000 o'riTrf311 • Eklo
WITH MANA
A tittatt know wliertrrscrt 1 - ongaly drawn towards it...0 PAPAL BULL Your people elect a leader mond they unite with him can place a papal magn way towards the symbol, used to migrate to for off NIWI'RTPOREMTERILONC11E11:3000 o1al11.11moo== i . . wh 4FICS the globe symbol A yo corn yIi a stronger leader. Alternately, you ere in the land. The leader makes his I mg people as he goes.d is s, or away fromBREAlliDOINNIdong • ID10001=1E1IDEI=EDEIDEIE10ElElDO ,HOMAGEThisinexperiencedugly bugger is WINNINGyou
![](https://assets.isu.pub/document-structure/220912162747-2c4c3b82884041f3c65bc178c7feed7a/v1/5a7dc8b716135716b663102f5a7f0fb5.jpeg)
Qukkl Unplug all folks!
SWAMPS
R ri Once placed, swamps remain. Cropland islost, and anyone who falls into them is similarly doomed. On some dry landscapes swamps ore non permanent 'PRESENTATION 1 q A A penammerto°pitoncusiomlamethisallowsyeacaweverylevelGoodcontrolsystemaid sew lame v Langpasswordseem the'' •tiraphio11 a1,! twat and ditell dwelt I tow lo see eta' s ping on &Nue the small stole badigroands.velarSomespersatalordosetslistsmuchvariety,andsome111-cmhe GRAPHICS v Nomusic and only ortoseseal temples of streams bottles Nosi al the game is played 51.1iYABILIT'tinsilence Popelaus II has a good board game' leel beepedby theearsy rules and soon yew ,progressreloaded_ V$ame of the early levels we very easy but anit-conssimmg The grew ploy may be toopassive for some LASTABILITY 1levels with 1;le Oleos, like ;.JveS km& for. wart to Evil soonstarts to play a snarl grime v The only rhonges between levek oretactics speed and landusgt PopulousSOUNDIIisacleverrelogDIaclassicgame.ItonlyappealtoasectionMegodriyeowners,butfindanessellunisums!product.
CRUSADERS
One of the most impressive to watch, 'forms cover a large area, wit ntense bolts of lightning firin random. Storms lost a mode ISIggep, and are devastating in built-up alms.
If
STORM
BAPTISMAL FONT
When placed, fonts become permanent features. Anyone who falls in changes his alignment — good to bad or vice versa. Useful for creating a toe-hold in the depths of enemy territory.
PILLAR OF FIRE
MM SEGA
You have the power to convert your leader into a super-human creature of mythology. He then travels through enemy territory, destroying everything in his path, until his battles overwhelm him. your ordinary settlers encounter the enemy, they embark a fight to the death.
The pillar erupts within a selected area, and travels randomly. It wastes cultivated land, destroys settlements and burns alive anyone it encounters.
I remember 1.buying the firstPopulousgamemanymoonsagoontheAmigaandfondlyrecall , that first day PlcravdI it — it was brilliant. However, by day two I'd completely gone off the game. Why? The gameplay was lust too repetitive — you did the same things on each level and I got bored. Quickly. However, Populous II goes a long way to making up for the original game. Although the basic klea of each level is exactly the same, there's plenty more in the way of variety with the player having to work his way up with experience points to glean and extra disasters to make use of. The computer player starts off as a bit of a thick°, but a few levels in Ws a lot tougher, making play a lot more enjoyable. As Gus says, Mega-Lo-Mankr is a tad better. However, If you really enjoyed the original game, you'll go bananas over this one.
on
![](https://assets.isu.pub/document-structure/220912162747-2c4c3b82884041f3c65bc178c7feed7a/v1/8f2dc09f43e2eb71e080d404a16064d0.jpeg)
GOsEt, elaek heaver's lei CVO mallong me Wok greet and enabitng Me to have a ballitintiiie! More (leeks gels? iJ ; ProbVouearems'l !ova( 1411 So‘ 111IDSDEctent5 been wiped outi Oh ves - and Eve altirmialea woad nd(huhclaaasb4P:NDwe THE M PL, 001 IS••• RE RI CVG va Kwoof reAl GAMES ,REERS LEAD Rice AND/LivEASn4ttOde'.1RIS.REINARDINGWEDee%OWE,SOetrivo0C•Voo3G.eriMENILOIIOIKEell:141.,NcAtoLVOUlte.ep
![](https://assets.isu.pub/document-structure/220912162747-2c4c3b82884041f3c65bc178c7feed7a/v1/5cac10de573b089591ef953d6b536525.jpeg)
the three cases starts a brief video introduction at gives you some starting clue to the case. Use this section to pick up vital names and locations that may be listed elsewhere.
![](https://assets.isu.pub/document-structure/220912162747-2c4c3b82884041f3c65bc178c7feed7a/v1/1e481650c73c15aa14c1a768687e904d.jpeg)
bixaLi I gimmolitil ION=
VolumeHolmeserlockII is
very similar to the first — an original gamedetectionabsorbingandfeatur-ingbrilliant
presentation. If you bought the first one and liked it, you're sure to enjoy this. There ore some extra functions on the Full Motion Video and the filing cabinet. The game also spreads onto a second disc, which is extra value. There's no action as such, so this is for firm strategy fans, but there's nothing funnier than watching the camp performances of hopeless American actors. Dead good.
IP1141.-
A flurry comes from the landand presently his dear friend Dr Watson bursts in clutching the late edition of the Times, concern and excitement etched on his podgy face. Like on eoger child he approaches the reclined figure of the World's greatest living detective. "There's something in the Times I think you should read. Holmes". 'Murder, Watson?" inquires Holmes. Once again he is delving into London's murky underworld, his genius alone capable of salving three macabre crimes.
That's a shacking 'swap' rou've not them duel
Anyone with vital informaZ tioffers it in a dramatised reconstruction, using real actors shown in Full Motion Video. Diagrams and illustrations also appear. Beneath the window is a range of controls, allowing you to repeat the sequences, end it, rewind and forward it.
E vening descends uponVictorian London, as the sky lies flat, like a patient etherised upon a table. Above the cobbled thoroughfare of Baker Street a marl sits in the restrained luxury of his drawing room, smoking his pipe and watching intently as carriages pass by ond the lamplighter carefully kindles the gas of each iron standard. It is Sherlock Holmes, meditating in the halflight, waiting.
OPENING GAMBIT
(RijEASE0711 SIR11 OPTIONSEASY 411111•11116 NOWTOPLAY 1 1 LW 68IMO1•146.11PLAYERSIIIMPO11RT!COMTIACOCIIIROL:)01PADCateTIMUIS:SAVECAMLIVILS:IPONSIVINESS:1-2SECSDISCACCESSCAMDIRKULTIt:•1STDAYSCORESOLVELIONSCASE)SherlockHolmesisthecharactetcreatedbySirArthurConanOath.ThisistheseamedsatetRaisescasesseNOWTOCONTROLTheleveednavesanan-sarINOcursorinaildirections.Rads&Minesisdetectionsome.Visitpeople"godlethe&rectoryandheardeareviller's/.Formaovaandtakedtothetoom.PAMSEGA •ri'174111
THE THUNDERER
MEGA-COREVIEW
![](https://assets.isu.pub/document-structure/220912162747-2c4c3b82884041f3c65bc178c7feed7a/v1/7e2a13f0c2792dcc36ec53a7dbc718b8.jpeg)
London's most respected journal, The Times is a vital source of clues. A selection of dotes are available, holding stacks of data. Only a fraction of this is any use, so you'll need to scan through the editions with a *ham eye.
The Notebook is a list of friends and professionals who provide information for each case. Most specialise in an area. For example Henry Ellis is a foreign journalist, H.R Murray is a Chemist. Known as the Baker St regulars, their expertise has on important bearing on your investigations.
ler
NOTEBOOK
You assemble a case by visiting locations in London. These ore listed in two different tomes:
All of the important people and places of the capital ore listed alphabetically. Only a fraction ore relevant to the case. Check out names your hear mentioned in here. You may move prominent contacts from the Directory to your AfterNotebook.picking the location from either books, click on the carriage icon to go there. Alternatively send the 'Baker Si Irregulars' (friendly urchins) to case the joint, or check your files for additional information.
iJ• TROPERMRETGNOLm[EtLJILIEILLIEl OE El CD Li El El El El 1111, ODE! ElE1 ph I;Ell=111E1 1111 El El El E=1 END no itri ElLIEl j BREAKDOWN ap El El El El I1•11•1•1•1-nA1t'TheyDRAKEsure was mighty fine lions, 'them there," drawls the circusPlayingor. Holmes means watching a cavalcade of octant getting into their parts (and listening to their appalling cockney accents). From the case of the two Lions, here's a selection of eccentrics: MRS O'NEILL "Begorrah, I wish my boy would just settle down,' cackles the wife. Io=siI••1ii.1•41-diRUMPET • ver did him in nor nuffin wotcha cock," intones the lad of ill fame. I•s•al111 When you have unravelled the case, click on the hammer icon to reveal the Judge. He tests your knowledge with a series of questions that convince him you've solved the mystery. You ore then awarded a score depending on how many sources you consulted The lower your score, the sharper your intuitive powers JMJSZNIU N ClIZKLIDKUMJNJ ?why v bnbn COMMENTnnmbThepresenta-tionisexcel-lentandcre-atesanauthenticatmosphereandthere'sfloi;Polwaysabitofalaughonofferbywatchingtheutterlysadperformancesoftheactors!AsGushassaid,there'sloadstoseeherewithlongercasesthantheoriginalHolmesgame.LikNightTrap,thisIsatwoCOgame,bumpingupthevalueconsiderably.Ifyou'reintosomecerebralactionAwithyourMega-CD,Ihighlywicsommcadthinyuma. -PRESENTATION-4SaveGame1opticm,anextendedtutorial,andfastIdiscaccess.Theoptionsscreensoresensiblylaidout.GRAPHICS•The110,1isexcellentandtheKomiandback.groundsaresharpandwelldesigned.vTheINVoccupiesaveryacee01thescreen,andthescrinmsrarelyearl.SOUNDAthespeechisCD-quoin'clearandnowincidentalmusichasbeen 1 94jV....However, there's not much ol it and the meats are LAYABILMratrocious! detectiveing.theandAListeninglotcluesrakingthroughtimesisabsorb-vAsinreallife,workisroutine. All the cases have to be 'topcoat hid esethodnalla winner for 87suttees. 111 LASTABILITY86 11A Two discs a rid three cases. and you're bound to get Shith on the more complex cases. V Illiore's absolutely no point in playing a case after in. sohted. 105MoteOVERALLofthesome,butbuilding slightly on Sherlock Holmes I, this is a hugely enjoyable, highly polished thinking game lot the Mega-CD, PAPA SEGA 69
LONDON DIRECTORY
ng excels
His
LIU BACKGROUND:OnceKANGJUL" Society, he abandoned them to take orders with the Knights of Shoolin warlike but honsect. in physical combat. Flying
ourable
Thrust ptercesehtkcolnusreyalpdellikLiu attack__plikgmckvastatingonieashesKormbail ...And ofcorrectciseplentybenefitsdemonstratesthentoNanotheofofexer-andthechoicefootwear.
There are eight very different fighters in the Mortal Kombot, but all share in the mystery of their backgrounds and their ruthless blood desire. Chill to their outwrenching attributes:
The bonus round in Mortal Kombat generally involves the breakage of certain materials, ranging from sad soft wood through stone, steel, ruby ond finally diamond, Tapping merrily away on the A and C buttons works up the concentration of your character with the START button bringing down she powerful blow. Generous lashings of bonus points are on offer for successfully bashing the hell out of the lifeless materials.
![](https://assets.isu.pub/document-structure/220912162747-2c4c3b82884041f3c65bc178c7feed7a/v1/7d4a88c4fdacd93cdc1ae4829602605d.jpeg)
THE
KOMBATEERSMORTAL
— a
ANBONUSADDED
• elahowwith:L—imnlassth•NP bet Tao dams to kick the lifing flank'0.
PLAYERS £49.99 j (imENA I) (RELEASE111111118EASTRESPONSIVENESS:CONTINUES:CONTROL:OPTIONSStnlintitJOYPONVADIAMILIISKILLLEVELS:5011itGAMEDIFFICULTY:EASY1STDAYSCOREMILEDM1- ORIGINYoucortegeone-on-one arcade game but with Midwoy's talent kw digitised graphics included — as well as loads al blood! lot LORTNOCOTW'VOFivebuttons were used in the anode original and The ratites! mode is arcade perfect with the us Invitee roma& However, with the normal Menactrive cootrallar, ono hmetion flaw power punch) is missing_ •Nigh Power Punch kdilIwePcellatetig--IsMenerKickS Block • NOW TOPLAY Choose a warrior and heal the cock out of everyone that crosses your R•1'70 RIM SEGA • 611011111EREVIEWir••1111117,peHonouranddesirefuelthefighterswhoenterfortheMortalKombat.Thisprestigiouseventhasbeenheldregularlyforoverhalfamillenium,whenthemostskilledandpowerfulniniitsufighttothepointofdeath,orbeyond,forthecrownofGrandChompion.Butthetournamenthasgoneintodecline,aftertheascendancyofShangTsungtotherankofGrandMaster.Noonedoubtshehosthepowertoholdthisposition,ashehasmasteredtheProteanmagic/01thatallowshimtoshiftshape.However,heistotallycorrupt,andhassustainedhismonstrouspupil,thefour-armedGoro,asChampionbytrickeryanddeceit.ThishasinflamedthepassionsofyoungniniaslikeSubZeroandScorpion,andthestenchhangingoverthecontestencourageslow-lifeliketheassassinKanotoenter.ThedramaoftheMortalKombatchallengemokesit'swayfromarcadetoMegadriveundi-minished. ice
the peaceful Lotus
BACKGROUND:Kano's shadowy secret is bership of the notorious Black Drogon cult. He fights for material reward, and is totally unscrupulous.
Well, the Acclaim hype machine really built this one up, proclaiming it the ultimate combat game, beating Street Fighter II into a cocked hat. But, I'm pretty sure that seacept and execution, if not in graphics, MI is by far the superior game. However, I do take my hat off to Probe Software for handing in an coin-op conversion that's literally arcade perfect. The graphics and sound are superb, perfectly mirroring the impressive coin-op's. The digitised sprites and sounds are great and the animation on each of the players is just superb. The gameplay, though identical to the coin-op's, just isn't up to scratch. There's little variety in the way each character plays (apart from the special moves) and the computer opponents are very thick. A single combination of moves is adequate to floor lust about any opponent on any of the difficulty levels. Very sloppy indeed. It took Jaz around two minutes of play to unearth that very serious fault in the gameplay and it works consistently on the majority of opponents making a mockery of solo play. I've played Megadrive Street Fighter II, and it's just as close a conversion as Mortal Kombat is. Take your choice: if you're an MK fan, get this. If, like me, you prefer Street Fighter II save your cash for the forthcoming Capcom
![](https://assets.isu.pub/document-structure/220912162747-2c4c3b82884041f3c65bc178c7feed7a/v1/c1d724192e69e1f351a7763a8a1f76b0.jpeg)
fo4Its,lipsonedarcadeplayerswillrealisethatincon po
pets elf ShAmareen rod does his pouati et &tsar! troli;" CAGECKGROUN ol are real, he's entered the tournament, ny martial arts fil show his skills ( r, the he POWERS:Cage daules with hit athleticism, peKicksandeventheSplits.However,hedemonstri !1s brute force by ripping heads off unfortunate foes. Ooyah! ablespotregionschlongularpunchAsurprisetothetern-onlydis-Kano. v Piet ease.cheeseforteableJohnnyfewhiswashedhaving•enderarmsforaweeks,Cageistoper-theann-attackwithrelative•1 •OH yolMlirmill
thethegame.containedfarfallThere,withthearcadebloodFansGORERiotgame.BLIMEYwonderedifthe'n'gutsofthewouldmakeitontocart.Well,ithasonMegadriveversion.TheparticularlynastyscenethePitisincluded.whenbeaten,fighterstoadisembowelleddoominapitofneatlystackedspikesbelow.However,allthe"goreisonlyavailableifyoucanfindthehidden'cheat"modesomewhereintheAndbyway,ourlipsoresealed..fortimebeing!
POWERS:Kano conceols a knife which he uses as a ova from close range. He also breaks through the chest cavity bare hands to seize the hearts of his victims!
sur
[GADRIVEREVIEWKGROLINDano,
RNDURANCS ROUNDS
Here, your Mortal Kombat skills ore tested to the max! With just one bar of energy at your disposal, you're chorged with the task of decking not one, but two opponents consecutively! Aieeeel
Lin Keui Ninia, of unknown • , Sub Zero has spent hours of study into the tal powers of ERS:Sub-Zero'sIce.Ice Blast is o quick-firing misShot I •m it strikes defenceless. His agility is shown by his sliding tackle, which ducks under missile attacks to trip opponents.
In the finol two matches you pit your wits against the two most dreaded opponents in the game! First off you fight the mighty fourarmed half-dragon character, Goro, capable of all monner of fist-related tomfoolery with his hondy extra limbs. Defeat this master of combat and you're pined against the evil terror that is Shang Isung. This intriguing geezer is capable of firing off his own special brand of fireball and has the stunning ability to shapeshift into any of the game's charociers and use their special moves! ,of
ial Forces Operative on his toil, however she wos ambushed and forced into combat.
WILI. YOU' EVER PFACH nit OM?
fighters.BACKGROUND:A
RASIC ONE-ON-ONE
POWERS:Sonya's Force Wave is a bolt of mysterious energy, only slightly less bizarre than the leg grab she performs on bemused
V tad rstotsdow Mk. Ws So lad ft mist inellmito pook1
Street Fighter II was a simple mat ter of winning the best of three rounds against each enemy. There is a tad more variety in Mortal Kombat. Read on...
![](https://assets.isu.pub/document-structure/220912162747-2c4c3b82884041f3c65bc178c7feed7a/v1/a223b22a1174721919d8f8cef2b4f450.jpeg)
72 /AM SAGA
The first six matches ore very similar in concept to Street Fighter It — just win the best of three rounds and you progress to the next stage
SONYA
BOSS ROUNDS
MIRROR MATCH
On some bouts your blows take the opponent right to the edge of their endurance, but normal blows are not deemed enough to end the fight. 'Finish Him' is intoned from on high, which is your cue to invoke each character's death blow. This is a spectacualr finishing move that gives you a massive bonus, and often leaves a gory mess where your opponent stood_ Expect fireball breaths, decopitations and hearts being ripped out of chests.
Here, the forces of evil have conjured up your evil twin, capable of all the special moves and tactics that you are! Use all your skill and cunning against this formidable opponent.
Sonya is a
MATCH STRUCTURE
lar to their arcade counterparts and the animation is very good indeed. Sound too is lust about arcade perfect. So what more could you ask for? Well, let me tell you. The game falls short on playability. When you punch someone it simply doesn't feel like you're making contact. The controls are slow and unaccurate and consequently you can't do quickfire combo moves. Another problem is the lack of challenge. On the highest difficulty level most of the opponents can be easily beaten by jumping over their range move and doing a mid air kick, and It doesn't take long to suss out tactics for the ones that can't. Its a flaw in the gameplay that simply can't be ignored. Apparently you could do something very similar in the coin-op, but that's no excuse. Don't get me wrong Mortal Kombot isn't bad, but it could have been a lot
[GAM REVIEW RAIDEN r ,...mmE:t!Mr 6 1 BACKGROUND:Raiden is achmily an 4E1 110namuhdemussasahohw,doGrednuhTa,dp .' participate in the contest. POWERS:The deity's supernatural powers give him an unfair advantage. Witness his incredible torpedo, Teleport and Lightning Strike Overload! MEANMACHINESdoes not recommend yee try this on your little Sister.
PRESENTATION erptfomsemoSikli thethesentationWill0115lurkpoemoftandallofcam-opsdulnessishemusingthesiibuttonICI pod'Parteseel V Na pausemode ern II GRAPHItiyou'llAProbeSoftwareore tobe ampretutatedfor theirworts — the spritesbodidiosmand elliMMI1011 ate mph on amigotothe digitisedsplendour of the origami Idateraycatm-op DN1TTIU ASome of the swill ismyssingbut 90Meresmil a wealth athiph!eindleysaesj,piesandredly dem thetom-opmusictohalidespeundiessPLAYABILITYAVerysimilartotheMasteringoildeathmovesisgreat lLuI 75 slowTheresponseisveryandmoooftheromputer papamintsore tooeasytokill eirdlen the diftkulty heelABILITY A Mortal kombot honchowill pet loads of ploy out of thisone v The ageflawscoin-op.conversionMortalThere's'OVERALLitsoverwhelmedopponentsMirkaminputerionbeeasilymakingsaleplaylaseappealquotequickly.82179nodoubtingthatKombutisanexcellentoftheoriginalHowever,seriousinthegameplaydam-thegamesappeal.MMSEGA
1liACKGROUND:TherulingchampionoftolKombat.Heisvonstrousprodigy
KombatMortal is a Theversion.callytechni-stun-ningcon-graph-
POWERS:Hisprovides. bulk makes his range of attacks limited and slow, but they ore devastating. From afar he has a fireball attack, and at close range he pounds victim'sidimmelmillirtchests.BACKGROUND:Aniniarivalto
![](https://assets.isu.pub/document-structure/220912162747-2c4c3b82884041f3c65bc178c7feed7a/v1/8edffcd963bee583ef9be092a291bd61.jpeg)
better.JAZPathosthema dortiowtitit leers eht
of Shang Tsung, and he exists purely for the sadistic pleasure the contest
Sub Zero. He is driven not be the desire to learn inscrutable mysteries, but the hunger for vengeance against his rival.
., icsinglyoretheexcellent:arespritesamaz-simi-
4 AL_ eibr GORO
POWERS:Scorpion induces terror with his Spear and Cord. He hooks his prey, then drags it towards him. For o grand Finale, his Fire Breath leaves nothing but charred remains.
41
7 PLAYERSCONTROL: JOY PAD CONTINUES: UNLIMITED L SKILL LEVELS: I RESPONSIVENESS: AWFUL GAME DIFFICULTY;EASY -as ISOCSYADTS1fI lA1,SIP.1 MEGADRIVEREVIEW General Chaos is an concept treated lot Megodtive by the makers• Rampage and Xenophobe,. Select your soldier by movies along the irons with the D-Psd and Pressing C. Move the D otoutodPad the bottle held to whom you want your troops and prell B. Preis A to fire all outvotes. UOSSEVOM111:C111HCNUPERIFA BLOCIAPKII3 SMOOCH Guide your soldiers into bottle and light pour way through the molly lotels to couture the enemy's capital city. , 74 JIM SEGA L ct s face it, when life is just a gigantic pain in theposterior, when your woman has left you ond taken the kids and the dog with her (you loved that dog so much) when you're an oozing mass of acne!" and there's just nothing much to live for, you can't beat a good war to cheer you up. It's a lithe known fact that Genghis Khan proceeded to demolish the known civilised world after his doctor recommended two table spoons of cod liver oil daily, plenty of exercise and a good war to cure a bad dose gout Their muscles aching from so runny sports games, Electronic Arts hove now opted for this car toon wor game to relieve their tensions. General Chaos, the Moronican commander and General Havoc, the hood of the Vicerion forces battle for glory, lands and their fair shore of plundering and pillaging. Their soldiers are each masters of their particular weapons and in five-man squads or twoman commando teams, must fight the good fightand wi
Smug as hell Nemoedas smelly, It's Getteral Chaos and his big, he belly'
WhenrI first saw General Chaos I was delighted — lovely cartoony graphics, heaps of options and loads of enemies to blast into kingdom come. But then I started to play and found it was a real waste of what should have been a topper game. The controls are awful — why oh why couldn't you move all your men simply by highlighting the one you want and moving them? instead, you have the ridiculous process of highlighting your man then moving the cursor to where you want him to go, clicking again and waiting for him to shuffle over there. The close combat was a good idea as well but the humorous touch of having the loser shooting the near-winner happens far to often (at least half the time) so it ends up being pointless and utterly infuriating! When you finally get the hang of the controls it's not bad in two-player (although it does get a bit samey) but in one-player the game's very dull. In four-player it finally comes into its own — everyone's a commando, so it's easy to handle and really good fun. But on the whole, it's a poorly executed waste of a good idea.
![](https://assets.isu.pub/document-structure/220912162747-2c4c3b82884041f3c65bc178c7feed7a/v1/5a81b84e3c0549277031da7a8a65ba1b.jpeg)
L_
LUCY
Ar, IF tpo
There are five types of soldier, each with a different weapon. These ore: Gunners who have machine guns with a range of 40 metres; Chuckers who chuck grenades up to a range of 50 metres and arc them over obstacles; Scorchers with their deadly flamethrowers up to a range of five metres and Launchers who hove a bazooka with a range of 150 metres There ore four types of squad, three of them five-man teams - Demolition, Brute Force and Assault - who randomly change the type of soldier contained therein and the two-man Commando team who
two soldiers from opposing squads get too close to each other to use weapons, a cloud of dust flies up and hand-to-hand combat ensues. All other action on the field stops while the guys get down on it. However, if the one who's losing gets fed up (which is frequently) he just pulls out a revolver and shoots the near-victor,
are faster and easier to move No,newer, soldiers in Orb , ain'tpinkplayin our sand-pit! General Havoc delivers his ektory report as Ids troopsdrop like flies from his horrendous halitosis! Mit CIDOEIEI 1.11 El El ODD Akre PLAYABILI90111Ctortathagotettaprortirewillow!'ratteenypre%deemaidsesmostAimagealoatioitsatawplayer 1 AusedwhamGoadhloctingcanoeyogihardlygettotherani/els.arbutdiemoot• method i$hatioaas end theMmil•to- headirritatingheyondbelieftolge alloramottonanddoodadlotsofone*qualms.vThebralcdropsaleratherdellandIke1111iNINSsorepoi1StlognosesYaw,kalemodingtheWadnameattachitasi1. sham scorcherwhatmakesandVieailgemegreatLASTABILITYova°totsatlevelsolldaIanintomglomvEtireattioat.playaandtheteethoreahtttoo%molarfareaparmentfi=w11appallingcontrolmethodagrievouslackofthoughtforatragicwasteofshouldhavebeenaofagame.SEGA75AI En MBE 1 EIS El El El El El
The person who thought upGeneral Chaos had an excellent idea. Ther 's nothing else resemblin , actionn war game c the Megadrive, and if it had been implemented well, it could have been a classic. But it wasn't and it isn't. The cocky control system singlehandedly ruins General Chaos. For a long time you don't know what the hell's going on — your men are in disarray and the cursor is wobblingabout with far too much inertia on it. Even when you've grasped the basics, your troops never react fast enough and you constantly feel your grip on the game is slight indeed. Also, some 'humorous' touches conspire to make the game pointless. The worst example is hand-to-hand combat, where your skills are made pointless by the enemy pulling out a gun. That 'feature' really disgusted me, as any plank can see it only spoils the game. Despite nice graphics and the multi-player options, General Chaos annoys me too much to go near
![](https://assets.isu.pub/document-structure/220912162747-2c4c3b82884041f3c65bc178c7feed7a/v1/d0913443c4271f45e6b4a112d6e2a9e5.jpeg)
WhenIt.
MEGROMEREVIEW
*FIGHT
IP•••••••
4-o MO*
ehtE
sy's main foes are Woolies strange two-legged creatures expressive features. On y levels Woolies are station, but as the game progresses y begin to leap about, blow gs at Bubsy and generallymake a nuisance of themselves. Contact with Woolies means th, unless you land on top of m. Other demises occur n you fall too far, run into er or puncture yourself on s. Ooyahl
A To parade Alb
E6ADRIVEREVIEW HUMOURMORBID•e1111111 expe.a Wheatimorniles• or libis.41131 ,0 ••••_;•••••1110111•••.•••4• 1,G PLAYERSlubsyisAccolade's creation hyped as a 'rival to Sank' and bears many hallmarks of the hedgehog games. nalyourwhilsttionalthen.formtellSurelyHOWTOCONTROLyoudon'texpectrmetoyouhowtocontrolaplat-character?YourielOkInlayrespondstodirec-pressesoftheioypodlumpingandsoaringoncommand.Whatonorigi-chopheis.Iitit..,1114'III41PRIa 139 BY99. ACCOLADU REL AUGUST j AISPONSIVINESS:SNARPCONTINUES:COIMIOL:OPTIONSJOYPADPASSWORDSKILLLEVELS:1GAMEDIFFICULTY:EASY11TDAYSCOPHI180,000ORIGIN 111muiA ShirtsPoemFunctionandpauses the nameOWTO KAT Glade Bubsy through the level, bouncing or Woches ta destroy and collecting yarn balls. •-••••••1 --76 AttA SEGA &ambers Oknodi their muscles in vole as Davy istosaeti av INfloss.CLAWSENC IJp ED .dlrowyppahnunasinoyaR
Ttsfind oft N Easy iAs Bacot is,km 164 tin liktri WONY aneSiall Vilhe IMMO &wader me Ewe food to below Awl lbw plow ottoafiso to bit roofers osoloktod lass&
—
Bubsy's control is fine-tuned to allow jumps of oll sizes. Bubsy gives a fair leap with the normal jump button, but if the pounce button is held, Bubsy soars into the air and floats down to earth spread-eagled fashion, rather than plummeting to his doom. Long distances may be covered in this soar mode.
![](https://assets.isu.pub/document-structure/220912162747-2c4c3b82884041f3c65bc178c7feed7a/v1/1a0e83a4dd6f8b3bc36aee61fb031fe5.jpeg)
Long ago the people were contented; leaves rustled in the breeze; lambs gambolled in the field and people went to work in natural fibres But on Rayon there was a popular blood sport — sheep hunting The craze became massively popular, and soon the species was extinct, No more wool. Then come the centuries of misery polyester shirts, nylon Yfronts (with brown piping l and welly boots. It's all the people had left to Thewear!aggressive citizens of Rayon were so desperate for something soft against the skin that they sent their forces — the 'Woolies' to conquer other planets and plunder their yarn. Enter Bubsy, the super-hero of superstitch, who would rather be knitted into a toilet-roll cover than let the Woolies succeed. Aid him in his battle, over 16 varied levels.
ubsy finds hazards as well as bonuses in the crates. Some boxes contain slippery bananas
MAW Inks. lovo4 first poreb000 the Daffy Ai !WKS, ipidse goon cartridge.
ilsent
ubsy careers uncontrollably. roles marked with tacks spill eir puncturing contents on the floor, leaving Bubsy feeling
ME6ADRIVEREVIEW1•••• COMMENTMaybeI'mnotquitesicktothedeathofderivativeplatformgamesyetbutthat'swhatBubsyis.Thepro-grammers--havetriedtakemanyofthebasicSonicideasandimproveonthem—Idon'tthinkthey'veimprovedanything.However,thegamedoeshaveIsmoments,particu-larlyplayablelevelslikethecountryzoneandthefair-ground.Unfortunatelythebestlevelsofthegametendtobenearthestart,thegamethenrunsoutofsteam,andmanyofthelaterzonesaretrickybutroutine-Thehumourisalsonotveryfunnyandthecharacterquiteunendear-ing.Accoladereallyshouldn'thavewastedsomuchmemoryonsampledspeechandputmoreintotheplayfeatures.It'sstillanokaygame,withprobablyafewweeks'challenge,butinferiortothelikesofCoolySpotanditspeers. -111-r _;) .1 -1;1_1 ) If progress seems impossible, move into the scenery. Doorways and cove entrances pepper the landscape. These form a series of warps between levels and secret locations. Mopping the unpredictable routes these portals take you is recommended, since many ore more of a hindrance than help. COMMENTfersfromaninnocu-ousbutsometimesfatalmala-dy—over-hype,par-ticularlyinAmerica.Standingalone,it'snotabadlittlegamewithsomewonderfulanimationandsomegood,solid,fungameplay(evenifitdoesbecomeratherdulleventu-ally).ButifyouputitintheringwithSonic,whichAccoladehaseffectivelydone,Bubsydoesn'tstandachance!Oneofthemostannoyingfeaturesofthegameisthewaythatifyourevhimuptohighspeedheusuallyendupdeadbecauseyoucan'tavoidbumpingintooneofthosegormlessenemies—whenSonicgathersspeed,atleasthehassomewheretogo!Thebackdropsarebrightandcheerful,themusicisirritatingbeyondbelief(thankfullyyoucanturnitoff)—allinall,it'snotabadlittlegame.Iwouldn'thighlyrecommendItbutitmightbeworthalook.sy bnOenigamiV,atik kip,thm,rowtooossidtoo inky* it dely tvio km1• copy • I ikkgy ti• &Ace— I* isst humph& WESENTATIONAusefulpasswordoption,andthedonto1LOMIserentthankfully'',Ewen/timethegameemityoumustinputIsepowwordtorestartathigherlevels IHPARGr 811 .1•111111•1111•• dropswoysinBubsyAGreatlookingsetaewhodHr,allmonnerofcleverSometastybeckvflicrosioaallytheenemysprites kair tad'chubby' endtonintertritingThe himasparse.ionelatinglookinpieces.92 erastahgdnuoSAFI thatwellandgerbetollyytavnem10tolA'lufwatisumselpehTmaVsexcellentsuitthegameLohofspeechcouldhavegone eheithere hasbeenspent onBubsyS'witticioen• 671 AllisPLAYABILITYfollylevelshoveI' lots of hiatures to explore. the canonis ?Thereinvolvingomoeingbutinitiallyalegomeplayflows like elw sentvlevelsandpen.(mosfiringtroutet-screenondslawlolling.84LASTABILITYPasswordsareonlyeverythirdlevelsomeofthehigheraretrickyBubsyshortfalltpre-aproblemtoslummedphoton*. sf gomeplaywhoerGood,VERALL7680inmanyrespects,Bubsyisnothingliketheworld-beat-itpurportedtobe.Playerslikesole,unsurprisingoreinforatreat.However,gameslikeTinyloonAdventuresandSonicMMSEGA77
![](https://assets.isu.pub/document-structure/220912162747-2c4c3b82884041f3c65bc178c7feed7a/v1/e683e61a6677a32e494775a669e09feb.jpeg)
Oner-orof
MAI (RELEASE9i39.9—PirierPLAYERSSEGA4-0Mg&'teammatemetie•wetieBYSEPTEMBER_OPTIONS•CONTRIX:JOTPADCONTINUES:N/ASKILLLEVELS:3RESPONSIVENESS:POORGAMEDIFFICULTY:MEDIUMlETDAYSCOREdirORIGIN-46'Ultimerte&Merisanall-newsoccersietfromSegaaridistheirfirstattemptasthenoblesportWTOCONTROLThe0Podsteersyournearestplayertotheballwhiletheappropriatebuttonpresschoosesfromarangeofhid's.ILSNORTPASSTACKLE/NUMIFON6PASS/VINOCHIP/READIFIPAUSEOPTIONSNOWTOPLAYItmaybeagameoltwohalves,therulesoredeadsimple:scontmoregoalsMoetheopposition-
The Megodrive is now getting used to a healthy number of soccer sims, and here we go again with Ultimate Soccer, looking to go one up on its predecessors. It comes with oil the options and flexibility that ore part and parcel of any sim these days. There are more countries than probably exist from which to choose, knockout tournament, a league for the dedicated enthusiast and a penalty shoot out for that intense adrenalin rush! As you would expect of such a sports sim this has a two-player option, but this con stretch to on eight player thanks to the all-new Sega Tap. For the ultimate soccer success, developing those dribbling, passing and shooting skills is a must. For the all-round flash Harry, expressions of virtuosity can be seen with the occasional bicycle kick and diving header. But at the end of the day, it's the score that matters and not the fancy footwork, which means that British teams manage to lose out in all departments! Don't worry though, some programmer out there is sure to hove a 'Frustrated Footy Hooligan' sim in the pipeline!
in rit.:4 1r•• r11111-.
A. WEL
Wile Graham Taylor is about ready to strap ten tons of dynamite to his body and stroll into The Sun offices, it worth remembering that, despite the dismal state of the British game, football is still the most undeniably groovy sport around.
er option available in Ultimate car is either six- or 11-0-side. Six-aside doesn't mean there's more space on the pitch for players to run around, it is in fact on indoor competition. Anyone who's played indoor soccer knows that there aren't any throw-ins as such because players can actually make use a the walls to get cunning rebounds. It is :also good for developing foster passing reactions because the smaller pitch means finding space becomes a priority.
the greatest tests of any sports sim is the ability to include options to the point of absurdity: 'Hoff-time oranges option, 'Bearded players' option, — you get the messoge. Ultimate soccer is no let down in this department. Options range from the choice of tournament, league or friendly, speed settings, weather settings, back pass rule or nay, extra time, penalty shoot out and so on. Unfortunately, a lot of them on Ultimate Soccer appear to be pretty useless.
![](https://assets.isu.pub/document-structure/220912162747-2c4c3b82884041f3c65bc178c7feed7a/v1/a87fca45d9184790a531b56e43c94333.jpeg)
If you're a lonely soul it's Super Kick Off for sure. If it's four-player action you're after, check out the more intelligent and challenging .1 League. If you can amass eight players and fancy regular football orgies, Ultimate Soccer is definitely the game you want. wit
the pig skin for the sheer variety of choice of international sides, be it Angola or Argentina, the USA or the UEA. Each team has a rating based on speed, strength and agility with the top sides like Germany, Brazil, Italy and England (oheml) coming out on top. As a player improves, this naturally means they start to choose from the noff teams to indulge in a spot of giant killing. The difference in standards between the best and the worst teams is not as marked as it could be, but if England can get beaten 2-0 by the USA, it's probably just as well!
soccersoccergomes feature a limited two-player mode, Not so Ultimate Soccer Just like the recently reviewed J League Soccer, this game is fully compatible with the Sega Top allowing for multiplayer football festsl J Leogue had excellent fourplayer matches, but Ultimate Soccer goes one better with awesome EIGHT player matches (by using two Sega Taps!). In these multi-player games, you're able to choose which footballer you wont to be — unlike the one- and two-player modes.
![](https://assets.isu.pub/document-structure/220912162747-2c4c3b82884041f3c65bc178c7feed7a/v1/61f004b9e7484d521d329ffd31cb88ba.jpeg)
MEGADRIVEREVIEW
Friendly eh! I'll give hint friendly when I get him on the pitch!
There'sno point slamming the she - •hie door when the horse has already legged it, goalie! Ultimate Soccer is a gamethat promises a great deal ei but ultimately fails to deliv-er. There ore loads of teams (even though their skill differences aren't really clear enough). There are loads of brilliant options including a change in speed, several league modes and different pitch angles. However, I found the controls very confusing and the lack of a player select extremely annoying. It's awful as well the way the pitch seems to roll in waves as players move across it like ship-wreckedmariners! Ultimate Soccer's chance of salvation comes in the multi-player mode — it's a real riot with two Sega Taps and eight players! So what's it to be then eh? Super Kick Off, .1 LeagueSoccer or Ultimate Soccer?
'TONGRTPORETERM MONTHWEEK011YRUR El E JLJLJLEEJ0E100E11=1EI El El El El 011.00E1 LJLJLJILJ E] El= El E.) OD 11J, -.faceNosk•sts,•----he's a waste of spate!r4-misses, he falls on his
ROB
Ell e wr r"14 Most7,1p
UltimateBETTERHO'S1411117'lq"FSTSoccertakes
There ore so spoiledtersthat-drivethenowgamessoccermanyforMegapun-areforchoice.
use of the Penalty Shoot-Out mode. You can soled the team you wish to use for your penalty-related antics and even set it up for up for one- or twoplayer tomfoolery. A very useful option indeed.
remains unavailable in this game is the chance to argue your way out of a yellow or red card. The referees are particulorly sensitive to any malicious behaviour and don't think twice about sending a player off. The strange thing is that there ore plenty of players falling over each other off the ball who escape such severe judgement. It's also odd how the ref manages to discern a nasty foul from a one because they all look more or less the same. At least it moons there ore plenty of opportunities for heated ref abuse and pointless bickering in multi-player mode.
aingItimesseveralstruckwordwas'Wobbly'thethatmewhenwasplay.this.It'sfastandfunfootballgamewithanunfeasi-
OnePIFOUL4Yoptionthat
32
a league with between two and teams! The Ultimate Cup is a knockout competition in which you play
outLeague.JAZillsnyt. 1 PAL., PractiseOUTSHOOT-ikilLTYpenaltieswiththe
ble amount of options and features, bullets itself down with very average graphics (the pitch scrolling is very ropey and the sprites lack detail), sound and gameplay. 1111There simply isn't much scope to improve your play once you get proficient at the game: Super Kick Off and .1-League , Soccer, on the other hand, 4 seem to improve the longer you play them. Megadrive beginners will probably like lilies: experts who like to play alone should check out Super Kick Off and more gregarious players should go for .1-
![](https://assets.isu.pub/document-structure/220912162747-2c4c3b82884041f3c65bc178c7feed7a/v1/2779a468e99a731a0bcdd7aa0ad57da7.jpeg)
fluffy
MAI SE GA 6ADRIVEREVIEWInodcl.t1-theone-andtwo-playerfriendlies,thereexiststheoptiontoporticipateinseveralothergamevariations.TheWorldLeagueenableshumanplayersaswellasthecomputertoplayin
up against as many as 23 other international teams! Finally, there's the knockout, with you up against as many as 63 other teams! Stunning eh? amAsMichael Carrie mighticy, andAatdoerThousands'ElptiartsofernrvBatmarry'proveter'?J.•allGRAPHICSGood30anglesHurdowning ✓ Character anima henispoor. There's outtinedstubbyandroughlyspumesanda pith yourould drownmIASomegoodtantslivenupthegame ✓ Alms/ no sound effortsandcrowd roarsMai soundlike rarity•rabidnanniesputyABILrnglomilicirmywithOwLlirokakinforWowkllandMetresawideOfmoves ✓ Amostlashingplayeryou'redefinitelyAmulti-playerselectcontusingSlowresponsearidcontrolmethodYoucanonlywhichphryoryouworntouseisgamesLASTABFLiTYHosisagomethatimprovesonceusedgoitMultimodemeansfunbutvTherearemanyannoyingWan,notablythewaCkilysomar-fastandfunsocceroffering,marredbywobblygraphics.It'sgoodinmulti•playermode,butJLeagueSoccerisalotmoreintelligentandplayablethanthisOffering.I.
Wolf for ft, waft for It — God,some people always go for the Isiggie too quickly! :1•31, 8476 411I•maTMEmom- mniomo•-••—•••o
1III1I1IijIIIIFI- more tiPs than - YouakcitsaekahsnacIOver50 of thevideoDriveevergreatestMegagamescrackedinstupendousvisionbytheMean0.MachinesSegaIcrew!(NOTANO 0.00 I111111111111110=11111 • NITSTORENEARYOUFORONIYE7.99 (NM ,g0 7034 ,g77 7cc5 At last! essentialthetoolforthediscerningSegagamer! ii 111 CgEf,OPI I
![](https://assets.isu.pub/document-structure/220912162747-2c4c3b82884041f3c65bc178c7feed7a/v1/985e6653e770cde8149d3006845802e0.jpeg)
As is traditional with platform games, Rock Knight Adventures comes with its fair share power-ups, Apples replace one heart of Sporkster's life gouge and banonos replace half of it, There are also plenty of red diamonds to collect for points ond 1-UPs are well huntingworthdown.
![](https://assets.isu.pub/document-structure/220912162747-2c4c3b82884041f3c65bc178c7feed7a/v1/145bdaefce74d39ab398a880ad97539f.jpeg)
One animal in porticular that benefits from all this excess magical energy is an Opossum named Sporkster who, as it turns Out, is a most unlikely hero! His tale of bravery begins when one of the distinguished Sorcerers, donning the title Dark Lord tui iis the Pig Star against his associates, killing-off most of them and plunging the word into a terrible Dark Age!
Komato is the one sorcerer to survive this cataclysm and promptly amasses on elite army, known as the Rocket Knights, which he employs to fight bock at Dark lord. Sporkster is orphanedin the woke of the disaster and so is taken onboard by a Rocket Knight named Mifune Sangelo who trains the young 'Possum into a useful fighter. It isn't long before Mifune loses his life in bottle, leaving Sporkster to avenge not only the death of his parents but his mentor as well!
The fairy-tole land of Elhorn, on the other hund, is rife with animals that possess human-like qualities. This is all due to the land's history of advanced civilisation and a mysterious group known as the Seven Great Sorcerers. This bond of magi created the Pig Star -- a computer satellite used to control Elhorn's weather — and the Forbidden Fire the limitless energy system that provides for all of Elhorn's inhabitants
We've been waiting ages for this, Konami's most incred looking game to ate! Now that it's here players hove the opportunity of seeing forming!thishisSparksterthatgetsrevengeinmostintenseofplat-shoot'emups! Sparkster's grasp. He also happily rebounds to himself this
technique some i , times being the best way to move upwards between two PICKwalls.MEIP4111Wr
Q n planet Earth all walks of life ore restrained bytheir natural abilities. MI except us humans who, in our time, have learned to do whatever we please. However,npare at thought for the likes of Opossums who at e mnongstthe most useless animals there are — on Earth.
112 MM SEGA "Seen my donkey anywhere male? Thesetricerotopsessrses ere fulevicethesecondsgiveonaWheneverGETuseless!"ONHPSparksterisfeelingbitdown,therocketboosterhisbackisguaronteedtohimalift.Ittakesafewtochargeup,butethishasbeendone,sthedirectionbuttonandfurrylittlefellowrocketsscreen.ThiscunningMitprovesparticularlyuse-whenitcomestoscaling oehti erwise beyond
PRPI RESPOUSIVENESS:CONTINUES:CONTROL:ORIGINJOTPAD3OR5SKILLLEVELS:2GRIMGAMEDIFFICULTY:CHALLENGING1 1ST DAYTh900SCORE, .EMEMENIMEMMEI., Sparkster is a new charade, whose game is an imaginative blend of tast.action piationerat andshoot 'em ups. 111sectionHoy,HOWTOCONTROLWsthat"Nowtocoofthereviewwheregottosaythingslike"Spertistorrespondstodirectionalpconthejoypodandjumps,siishisswordandpower:atyourcommand7n;frolsSporkstoesSword.WATIrieStolumpndmem11-Spolitster'sword.GuideSperhsterthroughtheenchantedlandofilhoin—deka&ingIrisenemieswithtomsword-playandovercomingthemanyStartsaFINNICHOWTOPLAYiiistocleshrtfacesalongtheer•• UsVavatwavciWallw).-31,1* !LEASE urmlua ) OPTIONS •
off ,. walls without inflicting any damage
'•Hetssailt;:•'‘o1r11Z11,41144shoe-L, t k•It 4. 1A.Ar1
I 11;,,,,114( mar— 4,4 •t•-zar--t-L-ltii;:k::-116
Ulna' BOSSY
There ore a number of things that break with platform traditions in Rocket Knight Adventures. While there ore bosses at the end of each stage, don't expect them lust there. They tend to pop up as and when they feel like it. It might be a mutant pig in control of an armoured car, a mechanical caterpillar, a maniac on a roller coaster or on underwater crab vessel. Don't think you've come out victorious when it starts to explode either, because defeating a boss often involves more than one attack.
![](https://assets.isu.pub/document-structure/220912162747-2c4c3b82884041f3c65bc178c7feed7a/v1/4ac5a801b4ebca6aad784f1035f019a9.jpeg)
rote.Three-leggedfromexclusiontatedwasOSparirsterdevas-athisthe MM 110A 83 OMMENTRocketKnightAdventurescertainlyisthekindofgamethatcanbreaktherulesandgetawaywithit.TherearetilLsomefancytoucheslikethe-flyingscene,theroller.coasterrideandthefunkybosseswhoyou'llfindstrut-tingthroughoutthegame.OneoffenceIoftenhavetoticketplatformersforiseaseofcompletion.Rocket
Knight Adventures is a bit of a criminal in that deportment, I'm afraid. But if you go straight for the hardest setting you'll feel better for it. Apart from that criticism, the response on the controls is faster and smoother than most, the graphics and animation are so professional it's suspicious, the sounds so cool all you can do is nod - basically the whole thing really smokes! As far as platforms go this is better than the pair I'm wearing...and that's saying something!!
without sacrificing the allimportant gameplay. The large amount of fresh ideas are bound to keep the player in suspense right throughto the final battle with Dark Lord himself. I sat transfixed throughout the whole game anticipated the quality of this game, but I certainly didn't expect such a sensory overload! I'm still buzzing about it now! I thought I'd seen everything that the Megadrive is capable of. I was wrong. Rocket Knight Adventures propels your machine into your face! So long as the more advanced players remember to play the game on the harder difficulty setting Rocket Knight Adventures is and shall remain a classic for quite some time!
84 MM SEGANICEMOON'SPARERThisisoneofthebestgameshaveeverplayed.Itischal-lengingwithoutbeingtotallyvin-dictiveandspectacular
esinbecauseThesword,Sparksteron,whenhasMEGADRIVEREVIEWHANGONINTHEREAnobleknighthemightbebutthisguystillgotatail!Itprovesveryusefulhehastoclimbtrees,vinesandsoAlthoughhehangsupsidedown,isstillcapableofwieldinghisjumpingandusinghisrocketpock.treesorealwaysworthexploringthereareoftenpower-upshiddentheirfoliage,butbewarned-thebranch-andvinesprovequiteslippery."attfOlttelIttr7t"OhtrrInttilfr.4117fffn?liettli1191"• teteeterutrerrtteteleteeriereillelleetelletlIteIseentten rt •11 !IN 111. 11 ,4-4 trth Mom Irretrt r rir 119hitt orttr 1114r1 r'14101 1 -NW", 4. il••reor"4iiiii rioirrr•."-•-tiorsal'eirre.-44.60•4eir"41seri06hetd•4114044114610.11wilAtaitriltiallittitall,..COMMENT glee bed happened to tee Casement brpros4, a ea lard ostat Cooly Aseall01,-AS•After
the first boss has been • defeated, Sparkster comes across a mystery item which sends him ‘„ skyward. The action switches from platform style to shoot em' up and Sporkster has to shoot his emies out of the oir and tackle colossal sea monster. Look out for a very fast roller-coaster ride, taking on evil piggies as you 'and plenty of other touches like under water scenes which, while usual in a platform game, proves good clean fun here,
![](https://assets.isu.pub/document-structure/220912162747-2c4c3b82884041f3c65bc178c7feed7a/v1/f3b2531d5b6a1c59c8f07b4df14846d8.jpeg)
TheSWORDPLAYgaugeinthetoprightcomer of the screen does more than power up Sporkster's rocket booster. It also acts as a power up for his sword attack, By hitting button A our fluffy hero performs a revolving sword attack which protects from all sides. Being a knight, Sparkster's regular attack involves some fancy sword* work, but because Elhorn is a land of magic the sword also gives off o searing fire which kills enemies standing a few feet away. "wr:0,11.001"tllI'07" unt ovq,p109.Le '', , "relamtsNne,',Mot,r,,'14' •mt,, 40, golp"10 1 .4 , 1"re 110 pSi4.4.1660014•114404110•00.1104104kiakku011%0144diAdk„,p„Itnow'woi,,0040did•,4dt44116101PatiletOmdIVO;2112% 10...014111~4Wiribh 71--,00,0•4:\;44fVLi*:(1N/4)D71.70•64'011111,41'lacidaNniIiII..m10'11111 i.11•0 011•1 A01,,11•04,,1A (s AIMPochFromIntimpenEt•tiefittesttotea*sum! REPO I:3 El El J.11 MM1111111111i gomooloni Nimml• • lem Im Ion lool. —A11111111111 -A -A •••A -A A Soso pp ow so my tio kit tikes Spoin dins it amidin on nOm12110•111:Er-.102T-10 GRAPHICS A AetiponsiseatifroisAcutetouches.withommationgrophicsandTheimaginoliondandyoftheissuperb.TheissmoothpaperyofcameAIMpteniteboasandbongsahoy!ThenogtalkiesawayandcoddlyNosoolosioowiththeand(winningly91''RESENTATION*Themoosandtitlestoryoreentertainiag•••••._Mollysettingssashametheresirtotwo,ployeropiateIMABILITYLASTABILIThereoreplemyollevelswilrdiemourageyoutoemploynewsirdlsvAbittooeasy,optpallyOneasymodefunnilyeseughiOVERALL••••••1AbeautifullycraftedpieceofMegodrivesoftwarewithiusttherightbalanceofactionandadventuretosatisfyallneeds.SOUND 91)
![](https://assets.isu.pub/document-structure/220912162747-2c4c3b82884041f3c65bc178c7feed7a/v1/2e082926a1d14e02b1047d4b5ef27dff.jpeg)
Caught up in the latest attack on the ocean bed is Ecco the Dolphin - o powerful young ocean singer who, as fate would have it, survives the vortex. However, he is now totally alone, his pod of friends viciously abducted.
![](https://assets.isu.pub/document-structure/220912162747-2c4c3b82884041f3c65bc178c7feed7a/v1/61a388f52956d35fde967a4c239dba1e.jpeg)
Its down to you, as Ecco, to search the oceons in search of your pod, to seek out clues and track down the mysterious vortex. It is on arduous iourney - an enormous quest that lakes you from Eccors home to the north pole, the open ocean, the lost city of AtIontis and even more strangely, the mysterious home planet of the aliens controlling the murderous vortex.Doyou have the power and the intelligence to take Ecco through the most dangerous journey of his life?
very 500 years a mysterious vortex ravages the oceans of the Earth, seeking out oil life and mysteriously transporting it through the space/time continuum to__ where?
_46Artit•
ak&MEGA—COREVIEW N)belL-.7••_• 1-GT-1r-1111FPRICE 44.99 (RELEASE111111:7111SKILLCONTINUES:CONTROL:OPTIONS°awn"JOYPADUNLIMITEDLEVELS:SELF-ADMRESPONSIVENESS:SICILLGAMEDIFFICULTY:MEDIUMNIROORIONIS.AnenhancedversionOfMOOofthegreatestMegadrivecartsofoil-time:AttetheDolpaintNOWTOCONTROLTheMypadisusedtoguideEttathrososhthedeep.ButtonsusedINcombina-tionwiththeierypadpro-duceamazingleapsfromthewater,SingingspearlimmoesespeedItertiponsetheNOWTOPLAYGuideleothroughover30lev-elsoftaxingmentalIndphysi-calpuzzlesonsearchofhismissingpod. tiding tafigelidlerit in this picture is the lovely Judith Chalmers. Can you spot her?
, 1F1111114IL JENENNIIP. tttk M 'TEFL Oil 1E filDotted5 around each level ore mysterious Glyphs - crystals of power that endow Ecco with special songs that allow him to open up crystal gates to restricted areas. Some Glyphs simply provide the young swimmer with clues, whilst • Oe naewn SUNIEI_&FEEDINGLDEJEICIEk1 BREAKDOWN tJ1111•JD AC1101 lat ED El RERUES-I El 1111 El El 1/4NOP Ecco the Dolphin uses the 0-Sound Om) surround sound s Theyl soundtrack has been digitally mastered to sound as though sounds are coming at you from a 180 degrees semi-circle in front of you. Connect up to a decent hi-fi system for the best results. El 1:3 El El El MM SEGA 87
![](https://assets.isu.pub/document-structure/220912162747-2c4c3b82884041f3c65bc178c7feed7a/v1/748e27392e94be8f81e9aabf003519b3.jpeg)
MEGA-COREVIEid
At first I was disappointed to find that the Mega-CD version of this classic game is k so similar to the Megadrive . original. However, a day's pm constant play later my initial I disappointment had cornpleiely11: gone. Yes, most of the game is identical to the cart version, but the incredible ambientBladerunner-esquemusic(insurround sound) is excellent and really helps to increase the atmosphere generated by the game. The extra levels are a great bonus too — some of At those puzzles are just inredibly tough! It's highly ironic that the best Mega-CD title avail. able is so similar to the cartridge original, but it's true! If you don't have the original Ecco, or if you're a real fan this is the most essential Mega-CD purchase yet!
Ailt
GUS
1
,
w w
to find
I reviewed a 1 videogam-instandardsItthetitle:MegodrivenewsuperlativeEccoDolphin.setnew ing and we immediately called it Megadrive Game of the Year! Now the Mega-CD version has arrived and it's my pleasure to say that it is utterly superb. As you can see from the screenshots, much the some game - but now even bigger! There are over 30 levels in the new version pocked with some of the most brain-bending puzzles you'll ever see. The atmosphere is even more amazingin this CD title, Awesome ambient music issues out from the speakers I trip to the Library level in the game out the most revealing information in the entire game. Also, two extra information glyphs hove been added. Access these and the player is treated to minute full-motion video documentary on dolphins and their amazing abilities! Not surprisingly, this wasn't in the cartridge original and is very intriguing to the least
![](https://assets.isu.pub/document-structure/220912162747-2c4c3b82884041f3c65bc178c7feed7a/v1/4f60a3d31a996016b2246221b3a91f8f.jpeg)
bottlenose dolphin, Ecco is one of the most agile, speedy creatures in the ocean. Pressing button C pumps up his speed, whilst B launches Ecco forward at great velocity, which enables him to attack the socially challenged members of the undersea community. Button A sends out his song, which enables him to communicate with other intelligent marine life. Holding this button down brings up a sonar picture of the surroundings, enabling our marine hero to get his bearings.
o five
COMMENTLostNovember
4124111Ineg
88cangreatestastoundingnotbuyingownMegadriveisthoughjustpseudothisMega-CDrecommend-attachingthoroughlyyourtoyourstereoforonetoappreciatethesurroundsound.It'sstunning.Imustsaythatmostofthegamevirtuallythesomeastheversion,soifyouthatthere'slittlepointthis.However,there'sdenyingthatIt'ssimplyandeasilytheMega-CDtitleaoneybuy.RICH'AMSEGAELARTUkB-ER-EWESFromthescreenshots,EccotheDolphinlooksmuchthesameastheMegodrivegamewereviewedinourChristmasissue(rotedat97%).Indeed,thegameplaysexactlylikethecartversion,butbenefitsfromextralevelsthatweren'tinthecartgameaswellassomeincrediblemusicthatreallyhelpstoenhancethegame Take.1FLi a
BeingECUapowerful
soy
ler PRESENTATIONikNooptionsassuch,butalimepasswotdSitteeeandanamatinglypolishedfeeltothegame. 011111•1111.111111GRAPNISOUNDSOMatofthebestgraphicsontheMega-(0.Avastrangeofbackdropsandstrangeunder-water&mittenslottheplayer to dist mot on hisilier Wools. ; Brilliant ombien, withnoise'.andwithsoombracksdolphinsongsplashingCoupled0-Sound(ill), it's simply,il1trenrendovs.LAYABILI1 A trio is superchairsTheandsmoothhtiw,bleayplagameplaylogicalpilules.difficultylevelasyouplay to ensure a cholla,' lot players of oil Alities. rIr t+otnezt level. A There ore over 30 levels and the going gels tough around level tem. The putcling action keeps youcoming back lot ages: you find youtsell compelled Mege-CDlengesomeoriginalPerhapsAnOVERALLtosais••••96oustondingrelease.toosimilartotheversion,buttheawe-soundandbiggerdal-makethisthebesttitleavailable!.0111•1. 11,IMEMME 95 TIVI LI ;TRW95
It.
FEATURESWITHEUROPE'SBANANA*TOPCIBIGGEST • tiE111 SIGNING EBlIfcaltBIGOFFOOTBALL'SRS• THEaHAPPENING0011EFORILLIQNYEARS.1-1P-1.1.4H7,41LPtt-GoilLUEFOOTYMAGWITH,IDEASYEARSAADOFTHEREVIL
![](https://assets.isu.pub/document-structure/220912162747-2c4c3b82884041f3c65bc178c7feed7a/v1/a1cc84f97ee6af19fd84e936e1abc5b5.jpeg)
4-• E lo• L., 0.1 tia C0 C - As ktIL,4ICsAC)A3I,Cda0,40IM0to0Ci- LI.- MIad — 4.1 u t-- = . ia to X• 0 Fa Qr, kil to CL 4, MIAs -0 C MI am,-C Z -5 L. cla 4., Ad X0 -.. C 0 C 0 -C 0 I.L. kin 0 fa • -'6 C. ) ki sOl MII -X ilo-o a., e s_ MI 0 a.% E 24 OPZ0C=al 0 3 Ad ./- Z 43 CDL- 0 u ,.r 00)7er31Pe, ,., c " i- -o a. '0'a,,1,7,N)SoG,l•-- g C' 4., L la O-M L C = CZ CO>I--- L m .2 ._c ,.GG,_c•...4,As C 1/34-,a/ 03 2 Z 4..,_ E J)0 0. >•, u C (1)1' cE u 0,0 Cr ki) t=1 re Er 4 , w CL ••• CO C)C 4.., srl to CLC)= As kin kin-X *, C 0 MI 193 0 -C to M = C As 4= a' MI E ,_ IL,o. mi •c 4-, =C 4-0itft cs.As di -X = L) 41 as /IAs C t.' 0 >, 2.% I- MIAls = to ..0 -0 4.. , _a te co -5 > .....4, _..% .o., (f) Pg -C Ad -04••• X 0 s&- 00 L , C I-CZ0 0 .1- C As >•.‘ ),,i,13 ad As 0 -%ca Os L. 2., 0. MI MP -1=1 Mi C 4 , E m o ,., I-04-,E)c0,aE.0,.41=I-, kft As 0 ,1=1 sA,4.M E I.>MI MI -X ..0s_ a, o re e E m3 = 0 o., df , 0 As Cls 4 , L 0,.-i_ L Cr) C 0 4.1 0 DC,40, ,4==3".o0-x a II re 0 4o E , M a' .0 im LD FO kik C >. 0sol -o -0 la a, a.. , 1:5 _a 43, ..c a.. a„ U T 4d C I:C 01•• 0 Z,4,Lca 0 -C Pa " 0' 4-, Z ?.. 1- I'D CL. ,12 C 4.040 0 ',' Z 0zaZ)I,V'%0 t =,.00-Ial%0ti, t Cr>LC04C,4otrC,ilis - E 4 , 13, ca-0,,.C.0 SoreCU c 0 a.. c E ,/, X0 ..c X 4.0 MI L 06Zd4,0CN>0 , 4.0 0 eC CC 0 C Z MO s aro -o Pe .i.-, — -, u Od C = ,In Cad a, o me o PS ss srs __,) X) s, >la4,-0 4=0 C:1 40 00 a, a.. a = o Ec) c PA As 0 ,..• MI..,00CLI C 4/1 MI 0 no a. to CD C MI As M C -.4 PO 0- _•-> CI. 1- n) C) CD -R As J1143C1111 .•,.tsa+.4,re LCD et e ot c:, , ,am13 a a., 2.,r-P... c C 1.•X l''' ,'cPIJC-)' .1as C.) C= as •••10 ad,ICIMc.'D0,4 to-0C4-• 1 "ZECIP 41, C= rl' CO= Li 4-0 10 4alCI-, J=I1 C da00ad a a 4. Ad,o Fe el, 4 c e _cs -c kll Mi0 L Zsr, •-c as Mi 0 E c • to. ›.,0o o •5 -at- 4-, Os C n2 -C Os mW0D 1M Z S6•• ' 0Lha ca As..Z. 14...4I)a 0. 0 0._ CD = C0 , I2 as, i-• C Ad Z As P•- M C .41 0 Goon St Talktoachildaboutthefuture Dancethedanceelectric MakeHelpsomeonetodayarecord
![](https://assets.isu.pub/document-structure/220912162747-2c4c3b82884041f3c65bc178c7feed7a/v1/7c4d0704213d66b44aca02f1f319c3fa.jpeg)
TUNETO 100FM STICKCLOSE1YOUREYES,APININTHISPAGEANDDOIT. OEM. "11.1111111.1111111111.04, SI7. 0 E • ,4-ma o 0-o-,-a4, 0 ad PO 4 Crda ad C 2...L C /I = f0 C IPO 0 .0 I•m, >•% 0 Ile %O., tE a o • e,.> Go t- t• Ito O E Ss t.CP 0 11 i•••:1 41 0 E0 4, go •.0 O Cr (..) 4, Z ad 6 ,=I E cma ma CI,,r -CI 0 MIC12 PC — I41N e ,00' C MI(--)0 .0 -CI1•4, •-, 0 a.. C E a, 0. a)c o -x Pa z ,.., 1- a,I-- o m cPo a,_c E C 4, X 0 i 0 ala, O _C c C C CI V,a0%J Cr Eo, c o c •7", .I) .IZ adJ Z>c Erma G) CP 40 %-CL e -111 AP LL. 0 C CC 0 O 0 C,4- iC sIld4,X 4., krea 4, %11 MI --J c Po ad b_ 00 Co 8 c ra. ,. • o.4-, el. ca -,J,o,a,a 3c e a, ,, IL'' E .6 0 -ca, a, c CL 4 ,•, 4, 0 4, ▪ ..e 12>k .-.6 ad i 4, ..04-, 6X X 0 eL(SP,NI C C FC Cr CIS (Id C▪ a1. et2 PC -X C 6 ••.c• .6..12 .6 II 'I; Cr MCI, C .,•- a,E Cl' = 0561 ,4SI 0C topsain.noForawholewee a eyourgranntothemovie ' emoriseaWooAenlok Getupanhourearlierto SendsomeoneatelegramPutyoursofainthekitchen e thetruthForada Sayhellotoapoll WinkatsomeoPu RickaMerry-goakeamillio Iseafountaine 7ritetoourM• ',lintourtoe-na alkonthegrass Do100press-ups ' etourhal Takeupknitting .haveourIlea• Gotoamuseum On•, Doacartwheel VisitNewYork Takeabathin
![](https://assets.isu.pub/document-structure/220912162747-2c4c3b82884041f3c65bc178c7feed7a/v1/a44984e2cd63d024ba41fc01e3444845.jpeg)
10:ddlufiL MEWRIVE REVIEW riortiCE I L 99•39[low TOCONTROL weer.— -EROCSYADtit ORIGIN283260 Fl the Slop ovey 110s ahemoccupied tettolory. Dodge ecwm Ike and emote that your lighters hits them whole it -••••••Ink., InridGEN 11 (RELEASE NIA j OPTIONS I CONTROL: JOY CONTINUES: UK SKILL LEVELS: 4 RESPONSIVENESS: OUI GAME DIFFICULTY:HARD Slop Fight MD is a sonstaid•O 411i on ancient coin-op thee limiD and Fos used to ploy AIM Sidi they wore shorts. 1 doesthemimicsFightelSlapThelions pressed on the D•post. Press UP and the fig himmoves up; DOWNarid the hghlei mores down Gmtit? Good grreti fige1111110-Oeglet • dnemetsitostkels;jiffFirrposkpower-up.fighter'sshot,pausesthegene!NOWTOPLAY a l 1 wakelectingasaffair.weaponequippedgamesweaponryIn(NEWIINDIMPROVED!)alltherearefivevariationsofavailable.Boththebeginwiththefighterwiththebasicshot—astandardmissileThelistofreplacementsarefollowsandoregainedbycol-bonusstarsleftintheofdefeatedenemies!
Koshiro — the guy responsible for Streets of Rage I and II — the whole package seems just great! The question is! how great?
WA SEGA nrocaeronalplc'cT
ups -Hellfire and Zero Wing are major league examples of their success in this area. A little known fact about Toaplan's Slap Fight is that it, along with Irem's ft-Type, is tagged as the forerunner of all the great shoot 'em ups in existence todoy. Though the game is similar in style to its 1980s competitors, this vertical scroller's edge lies with the massive array of power-ups at the player's disposalTengen,
FIGHT1MLAF4412
With these the player is left to concentrate on dodging enemyfire alone os the missiles seek out their forgot Fxcellentl
la sl the Ord s Slap a pity that no-one has yet improved this situation!
mentionedMiss!obo ;cotes how effective these babies are when the fighter is fully powered up!
pony responsible for making many advances with their shootinnovative'em
having recognised Slop Fight as a classic, now hove this accurate conversion prepared for the Megadrive Of course, due to Slap Fight's age, the game on its own might not seem so attractive. For this reason Tengen have honoured the original with a variation of their own entitled Slap Fight MD, which is another classic exclusively available for the Megadrive. Whereas the scene of the original is set over the surface of a planet similar to earth, Slop Fight MD takes place in the far reaches of outer-space. As both titles feature music by Yule)
111111111111b 144441)01 Alfilf“AtoktiO1
![](https://assets.isu.pub/document-structure/220912162747-2c4c3b82884041f3c65bc178c7feed7a/v1/26d4dcc1354df7ccb15d5594072813c3.jpeg)
flies
NOWpower-wings!Almswispkmthegipfreshnod-fryandginsItmadams.ow. 101041014001 tsA:tohSe left to right on-screen, the Side-Shot makes these movements far more effective by taking account those enemies trying eok round the back. forcarBo some very satis destruction indeed! imNitottm mom.floss•erm,"MacMOMUS2MNOW•• 1•'COMMENTspools.OK,soSlapFightisutasOsEthelfromEastenders,butthisdoesn'tpitfromngaClassicof,well,Jaz'stimeatleast.Owningtheoriginalgameisadecentenoughprospectinitself,butTengen'sinclusionofSlapFightMDismoreattractivestill.ThoughevenSlapFightMDlooksquitedated,Toaplan'singenuityshinesthroughtheprimarycoloursandfeebleexplo-sionsofferingnearperfectplayability.PerhapsitisbecauseSlapFightisoneoftheoriginatorsoftheshoot'emupsweknowtodaythatthisisarefreshingchangefromthegraphically-intensebutultimatelydullofferingsofrecentmonths.Thelayoutofthelevelsandtheskillsrequiredinsafe-lypassingthefighterthroughthemprovides•amassiveadrenalinrushwhileitlasts.Thereareenemymissileseverywhereonscreen,makingsomesectionsappearimpassableatfirstwherenotevenmassivepower-upsguaranteetheplayer'ssafety!SlapFightoriginalisbeatenintosub-missionwithinaday,butonlybecauseoftheunlimit-edcontinuesavailable.Thoughit'sashortgame—the80sectionsareextreme-lytiny—thisisneatlybal-ancedbytheadditionofSlapFightMD.Ashoot'emupfanatic'sdream-come-true,SlapFightiswellworthalook!MAISEGA
le I Idirfal
Not only does Slap Fight took, sound and feel like the coin-op but the original mode retains a cheat from the arcade machine too! Here's how it works: Begin the game as usual, however don't move the ship or touch any buttons. After a few seconds the ship is token out by a solitary missile. Now, as the Slap Fighter into bottle once more it has full, homingmissile
EBAD YE REVIEW •1/46RO
![](https://assets.isu.pub/document-structure/220912162747-2c4c3b82884041f3c65bc178c7feed7a/v1/18052cf9740097eb83b4d96d8c4b511d.jpeg)
rather naff tool However the game just keeps calling me back for another go. Too often a great looking Megadrive title happens along and provides about an hour's worth of entertainment before losing its appeal altogether. The fact that Slap Fight has been around for almost a decade now and is still so fiendishly addictive pretty much speaks for itself! Despite its basic appearance the game has impressed everyone here and there's no reason why any blaster master shouldn't feel likewise.
![](https://assets.isu.pub/document-structure/220912162747-2c4c3b82884041f3c65bc178c7feed7a/v1/ca42a7f8a686409adfbb2a4e6f211b46.jpeg)
Gus A lets *ere dist flos gam ski bob. Ind emalatrate, imstoo4 lees coassont. greet, bet II? SLAPITON! There are two rolooC!sesabneila,hcet-"•uzo'sndriginalprovementsnoticeablemodetotheSlapFightinTengennversion.ThefirstworthyofteistheadditionofYuzoshiro'sremixedsoundtracks.zoisthepersonresponsibletheclassicSuperShinobiStreetsofRagesound-cksWedon'tneedtotelluwhatanassetthisisasmusicspeaksforitself,condinlineforSlapFight'serhoulisTengen'sownSlapghtMD—agamethattakesbasicideaoftheoriginal,•thallthesomeweaponsandwer-ups,butdressesitup'thdifferentspace-shipsandIn making the most of the fighter's current choice of weapon the fighter upgrading the width of its wings is also possible and is Slap Fighter's most distinctive feature! The wings are extended up to three times until the fighter is so wide that its movemantis replacements.someoresuperb!Slapageasbrilliantthisrestricted.somewhatNeverthelesslackoffreedomisfunwhileitlaststheamountofdam-afullyequippedFightercausesistheextensionschosenfromthelistastheweaponNOWWITHWINGS! A LONG TERM REPORT' IMF111111.000EPWENCIElElEr naiii1:3 El El OD 11-1111 ••••nll=MMP.. COO= BREAKDOWNDEZSEIEIC/MIZIDIElt=r 00ilA PRESENTATION74791Theamoutil al °ohmsor the ployor's &vocal wigwamonnetessolyonalmostvSkiplight$ottroctwafteroloode lliolikes of thoodefloileGRAPHICSIV A Veryhem yet tongtoottvesprites troycowlborkgroornisparthegamewellVthisdatedtitleimpreswinoonthose daysot the light ol ike ne9odioris (Godlike*,76 A tunesrtwithnameVetokoshirOsinow:cohortthegame'smusicnoloinMallHOWIMI,themoorsoonelefleds.aiswo-sowraliy (Ninoe!MaimundeniableallegedIraniBath*mutablemakeaPLAYABIL1MstretchaundShipIngbrbatallingiedient$ibebinsshoal'a.lipssooditoneeMarrshopteglotIeiperWineconforgetWIgamesaretoialiyartforimotbeginningtoend'LASTABILITYAThe$tiltthallartigeby'Sloplightisibe°AimedtonpuedeHIPelonearly(omplehom8456 ' OVERALLInspiteofitsage,SlapFightisatrueshoot'emupclassic.Theextrasmakeitallthematewolthittifilel •
MO %owe You can see for theeither,YuxodisrespectgraphicalthatyourselfSlapFightishardlyamaster-piece.NotoKoshirobutmusicis
SKYTEK SOFTWARE neoM.YESREJ,REILEHTS,ECALPHETABIZEL10rill TEL: 0534 601032 OPEN: 8am - 9pm WIMP FAX/14 MRS; 0534 2809130 OR TEL 0850 342488 ANYTIME PHONEFORLISTOFMOREGAMESAVAILABLE1FORDETAILSONNEWRELEASES! STOCK SUBJECT TO AVAILABILITY WE CAN SEND ANYWHERE IN 7 HE WORLD P&P TITLE WI BUY USED GAMES A ALSO PAAT EXCHANGE. TRADE ORDERS WELCOME JERSEY IS EXCLUSIVE OF VAT BUT YOU MAY BE ASKED TO PAT AT BY CUSTOMS (UK ONLY) ALL GOODS SENT RECORDED MEGA DRIVE ACTION REPLAY CART BATTU BACKBATMANARIELAQUATICTOADS,GAMESTHEMERMAIDRETURNSTOTHEFUTURE 3 BIO HAZARD BATTLE CAPTAIN AMERICA free badge., 35 CHAKHAN 30 COOL SPOT 36 CYBORG JUSTICE 31 DAVE ROBS BASKETBALL (JAP) 26 DESERT STRIKE 32 DEATH DUEL 33 ECCO 32 RISKY WOODS 30 POLO TO THE RESCUE........-30 38 SONIC 2 •••••• 31 31 SUPER KICK OFF 36 24 STREETS OF RAGE 2 36 30 SUPER SMASHTV 31 30 SPEEDBALL 2 (KART ONLY) 25 27 SUPERBATTLETANK 30 30 SUPER HQ (JAP) 28 TERMINATOR 2 (ARCADE) 31 TAZMANIA 31 SHINING FORCE 40 TINY TOONS (KART) 32 TURTLES (SCART) 32 WORLD OF ILLUSION (KART)._ 27 GAME GEAR FATAL FURY 16 ALL 01 FLASHBACK 36 FIND\ GAIDEN HUMANS 33 AXE BATTLER J. MADDEN '92 25 BART VS SPACE MUTANTS JUNGLE STRIKE 36 CHUCK ROCK LEADERBOARD GOLF 31 FANTASY ZONE LEMMINGS 31 GEORGE FOREMANS BOXING LI-IX ATTACK CHOPPER 31 LEMMINGS LOTUS TURBO CHALLENGE 31 MARBLE MADNESS MICRO MACHINES 31 TAILSPIN MUHAMMED AU BOXING 36 PREDATOR 2 PGA TOUR GOLF 2 31 PRINCE OF PERSIA POWER MONGER 25 TOM & JERRY PREDATOR 2 28 TAZMANIA QUACKSHOT (JAR) 27 SUPER SMASH TV RAMPART 32 WIMBLEDON TENNIS RBI BASEBALL 4 31 CASTLE OF RIUSION Ask about our selection of used ames DATIL UNIVERSAL ADAPTORS (plays all chipped games) ONLY de when purchased with a game MEGA CD with 7 GAMES 1220 MEGA CD GAMES NOW AVAILAIILE
Most advertisements are perfectly proper. A few are not.
more about the role °lithe ASA. please write to the address below, Advertising Standards Authority. Department X. Brook House. lbrrington Place. London WCIE TUN.
The Advertising Standards Authority not only monitors over 850 advertisements every month. it ensures compliance with the rules in the strict Code of Athertising PractiCe.Sowhen you question an advertiser, they have to answer tolindus.out
IF AN ADVERT IS IN PRINT, IS IT PROPER?
![](https://assets.isu.pub/document-structure/220912162747-2c4c3b82884041f3c65bc178c7feed7a/v1/b3299e7c36dd98e4ac0c0bc5659b15a5.jpeg)
AM This space Is 4....ted Is the Ilairresisel WAR ,L•AdardA In adverthearat, Fed up with sending 411116mes months for your Tn gaff* IQ ego Sw II awls of Megadrive ga 0891 - 501080 •1 A wwiteurRvu wazr — nail& weeks or BARANTEE e promise to send your chosen game by 1st Class Post on the same day we receive your exchange game and payment - or your money back !I SWAPtiZ4,%e, DAPIV. or". - atd1800to , mil S3 /• Islleeecexi, 10 Wert porcornwor liv eivehearnothing?oneyouwant, gam payment of i5 CO and St Class'qeSeleohore CAI OfilOAR •31 other l'irNeL DLI5es•Hp r, _N• Postal B13BirminghamKings33-35LINE","MEGApayableChequesOrdersforE5toSWAPsendtoTaylorRoad,Heath,OPG.
p
11 TO ADVERTISE IN THE MEGA SHOP 071-972MARIECONTACT:GUIDELAWLORON6700 SOUTHCOAST CONSOLES SEGA I NINTENDO PC ENGINE I NEO GEO 100% VIDEO GAMES HAMPSHIRE'S ONLY DEDICATED VIDEO GAME CENTRE NEW AND USED GAMES PART EXCHANGE WELCOME SOUTHCOASTTA''YUBUOYEROFEBYRT- CONSOLES, UNIT 17 ERTNECCmsTR0pNROCIRTEHTla TEL: 0705 819269 OPEN LATE NIGHT THURSDAY TILL 8.00 pm00 1 tMt!..• EM411,, FREE emoniMarTHISSOMAOFFUSEVOUCHER/2THISASAVOUCHERTOCLAIMVIDFOCAWSATDANIELOFWINDSORLYNXSUPERMUMDOESNOTINC!I'DIGAMESAlREAM'RITAWEDOFFERENDS4.!1.91DANIELDEPARTMENTSTORE120-125PEASCODSTREETmt&WINDSORIMOTEL0753862106PLANETCONSOLES41CHURCHROADLAWRENCEHILLBRISTOLBSS9jjTEL:0272413030 This section shows you which shops are near you. AU you have to do is took for your local area heading. and the details of the shops are below. Grantham Computer Centre I Michelan House, Guilhall Street, Grantham, Lincolnshire NG3 I 6Ni. Tel: 0476 76994 MEGADRIVE SUPER NES MASTER SYSTEM GAMEBOY GAME GEAR NEO GEO MEGA CD (TO ORDER) TEL/FAX: 0 4 7 6 769 9 4 LATEST OFFICIAL IMPORTS IMPORT GAMES SWAP SHOP AVAILABLE. SECOND HAND GAMES
![](https://assets.isu.pub/document-structure/220912162747-2c4c3b82884041f3c65bc178c7feed7a/v1/d63cf566d16bddf547e28f96e9477f00.jpeg)
31KIL116-1.• 11110.• Tel. 081 808 4425/08 885 395 498 Bryce Groye. ottenhom,1 London N 17 LOWEST PRICES IN UV MORTAL KOMBAT 4+799 44.99 SF2 CI IAMPION 64,99 54.99 SHINING FORCE 44-'.99 42.99 RANGER X 44,99 36.99 We sell all UK releases priced144.99 for £36.99 !! * Massive selection of 2nd hand games*• Rentals. Delivery all over North London. Al! new 'titles available. Tel: GME on 071 284 0158 i 071 284 1502 or call into our shop at 1Leverton Place, Kentish Town London NW5. Please Add 12 P & P Streets a Rase ADVERTISERS2 INDEX VIRGIN WC & OBC MEGA SHOP GUIDE 96 8c 97 SPECIAL RESERVE IBC CONSOLE MASTERS 98 RITZ VIDEO 13 TURBO GAMES 98 KONAMI 15 QUESTEL 98 US GOLD 16 & 17 RING A ROUND 98 DATEL ELECTRONICS 27 SPACE CITY 98 CODEMASTERS 31 P.A.S. CONSOLES 98 SEGA 37,39,50 & 51 HOME GROWN 98 MICROPROSE 49 CONSOLE CONNECTIONS ...99 WOOLWORTHS 55 SHEKHANA 99 RUM BELLOWS 58 & 59 CHEETHA 99 KISS FM 90 & 91 MLP 109 SKYTEK 95 GUIDING LIGHT 109 GAMEWATCH 95 ARCADIA 109 , modimiL 422 95(2995Teermeattor 1 /29 95 s3 L29 95 RoodRash 2 (2995PGA Golf 2 L29 95 Tazmano 04,95 Bulls si Blazers (2995Sonar 2 (II 95 Batman CorporatoonReturns 5921Super Smalls TV ARROWLONEll(22.959SVIDEOSTHISMONTHSWEIRSTAiSp.)(22.95 Golden Aare Mart4 Maddness (24 95 Golden Am 2JAInel Pond 2 mmortal 124 95 G on i ,eLv.w, 09.95 I-I NMI.PA Hockey 93 (24.95 Last Batde Coe Ball 124 95 MI Abrans Tank Sword of Vermilion (20.00 Me, CI Gold (2995 Moonwalser Sp4it. llo.te 2 124 95 Outrun k Rock (22 95 Road RAM B.41 , 3obmaR5942fnekaLs, SEGA MEGAEIRIVI Revenr of Shinobr GAMES ALL MEW - Space Stsmer 2 Indy Jones Tetnple 0E19.95 PRICE i I 7.99 Super NiOnbcz> GPShadow 01 Niast 2 (22.95 Ai, Ak anSprdermiePredetot(2495had Ansa Sob Sander It •iaiiii.a'tlZChemF22Lenarrangs For moil ordereomlcweslerrolcrtePrryPP&iloddpleoseaL24.95 Dynarnee Duke E29 95 Ferrari Grand Prtt POI pollee to Zggotrone V edsii ArrowlaisostenotersLtdFlasha] kSu_ per 4 nogarDaisklA5992E2PGoc'neo14 (22 95 Non Strom Aquatc Games EA Hockey C24 95 Batman Toe lam & Earl LI-LX, AmmdtChopper CM% D.I. Boy Crack Down LONDON, NW5 ITO WO 0100PAW GAMTGEAR SON1 + POWER SUPPLY • • C90 inc postage ....,,, , 11saantrl:TATM1iIgirrlaTraadwoLEZSI45•7471,,60.aa Eva _ILL IMES MT PRICES sAim TEL:MEGABYTESGEAR0813354224 22 CENTRAL ROAD, WORCESTER PARK, SURREYtiArtit MUM, TITLES 0572,Maw 'Kati,K.flo IT., 10 0... OtrivE Ood .-DSte 27 AJ,P7 ALLTilt 5 MAI...ABLE SAM1 CH ONCREDETCAROORDERS DI 4 , TNODESICPRWOLEOVPRE EGNAHCXETAAPECI",SfrALL GAMES INCLuDE INIrsAilBOY • NES SumitiOESPESOMOOMSOLEE PIES AT SWAP DISCOIRETSPACESSHOPGAMESNINTENDOSOPERATOESTPIKESMAYVARY YORKSHIRE6CLEVELANDSOUTHDONCASTERSTREETYORKSHIREDWI3EFTel:0302340079Fax:0302752064 VORKSHIRE•S N0,1 CONSOLE RETAILER IMPORTS ARRIVING DAILY MEGADRIVE GAMES DAVIS CUP TENNIS CALL MICRO MACHINES NOW IN DRACULA (CD) CALL JUNGLE STRIKE NOW IN SNOW BROTHERS £39.90 ECCO (CD) £44.90 J.LEAGUE SOCCER 139.90 WILLY BEAMISH (CD) L39.90 NIGHT TRAP (CD) 14490 SWITCH (CD) £44.90 SEWER SHARK (CD) 144.90 CDX CONVERTER £42.90 SONIC SPINBALL CALL STOCKIST OF SNES, NEO-GEO, MASTER SYSTEM & GAMEBOY VISIT OUR SHOP FOR ALL YOUR CONSOLE NEEDS FOR MAIL ORDER PLEASE ADD 11 P&P FOR PART EXCHANGE CALLERS ONLY. DISTRIBUTIONice
![](https://assets.isu.pub/document-structure/220912162747-2c4c3b82884041f3c65bc178c7feed7a/v1/94462e0d373a21282cc65407cb437171.jpeg)
C 1 •';ti\S;s11POBOX 162,WALSALLWS41RX 4 Tel:40922 684387 / Fax: 0922 694088 COLUMNSinc. PLEASEADO ELS° PIP FOR EACHGAMEAND CIO PIP E91.50 FOREACHMACHINE MEGAL ALIBI 3 133 SO SAWS orrsuos _En SO i_E135.99_GENENALECE0DICHIGCOOLBOSSYTHEBOBCATSPOT__13119TNEDORM-------E33.50EATMfurl--ERRRANSACK_CHAOS__JANGLOWGLADIATONS99IOWST1112.11119IIIPASSICPAR11)19MAINININAILS______—_133SOIIK10MAOINE_.---.129SOROSARIESMISOXING—133SOKOADUSNSONICTHEMENEM2SeSTREETSOllAll19I1NYTOONSE33SODi0101301KE13350MOILS01ILLUSION_33SOMEGADRIVESONICIVMEGACDinc.7GAMES£255.99Wk.STOCKMEGADRIVISTREETSOFRAGESONICE135•99GAMEGEAR AME GEAR AUEN3 -SKR BATMANNEWS. 124.99 SAMETOADS.. .. MSS DEFENDEISOPOASIS ill SO DIUDSIMIulfitOUIINEISTUBSSTIEETSSOWN(90011ROBOE00__—MICKETMASERLEMMINGSIMELDAIOWANSTHELASTOIEBABLE24.99,E24.99OFDANKNESS..___rasaMOUSE126SO2..,124.99MIOGOIOG—____124.tBCIENAGE......______17130OfSAGE2--___12630MEGACDI—EASOMOtEROO.............._13330HOOK_14330SIGNETIAPROADAKINGES__—___.........._E3330SRNSSEMI-E4350SMENLIXKNOIRES13/BBMOD AWIDER RANGE OE LAMB h )11UMI. FOR MORE Drtts PLE0" rAtt WIN A SUPERNINTENDOWINAMEGACD,0891888651 MOUNTA114WINABIKEWINBARCODEBATTLER 0891 888 635 I • • • • • • •• • • • dneS'snettimeuQecleulC••fic ,• ...Om Mame 001.. Mtimbn,o1 ool,Frv, mo MO A P ikaMa COM aMommd ma Mo mum ammo rem elp ymn M atom Imom Cale coM • sommmom M Ma CO...... Dim OM 91 Artvormit And B. Jam.* 061 35 4557 D•ELOSNOCSAPr SONICSPECIAL2OKNO(3300 MEGADRIVE SNES• NEO-GEO. GAME GEAR, GAME BOY AND MEGA CD Part Excharle Welcome; also Game Exchange Services. Ring for details. MEGADRIVE + SONIC THE HEDGEHOG GAME £9800 USA SNES (SCANT) I ANOTALIESEGAMEGAINIUMEHERWORLD.13S 03 BATMAN RETURNS I30 BULL 'H. LAKERS 13$ 00 CAUFORNLAGAMES .....127 00 DESERTSTRIKE 133 00 DOUBLE DRAGON 3..../35 00 ECCO DOLPHIN 135.00 EURO CLUBSOCCER....I35.00 EX MUTANTS 131 00 PAD NO CALLCOOLSTREET093......115.0)OHNINDIANABASEBALLGLOBALGADGETFLASHBACK....FATALEAEAILGLIRGADAMINSAGAMEHOCKEY13000HOCKEY'93IIS.00FUREY.I40.00140.00TWINS130.00GLADEATOPS.135,001113,03—130,00MADOENOFRAGE2..140,00SPOT14000£128.00WILMSBLUEBROTHERSBATTLETOADSTABWARSBATMANRETURNS..CYBERNATOR•IONNMADDEN1NBAALLSTARSFINALFIGHT2BOMBERMAN*TAPSTREETFIGHTER2UKENIALIEN1145.00ISO00IS0.1301500015000I4200(4300IS00(6500CALLCALLFORTITLESNOTLISTED.Above are Mee Order prices only ChecpataP0 to PO Box 3937, Dublin 6, Ireland Tel (from England) 010 3531 906979 (Prom Dublin! 906879 PAP add I per software daL TURBO GAMES THESE ARE JUST SOME OF THE TOP MEGADRIVE TITLES THAT ARE AVAILABLE NOW FOR EXCHANGE STREETS OF RAGE 2 CHUCK JOHNDRAGONTAZPAANIAROCK9FURYMADDENS 13maims WORLDECCOMEGA•LOAIAN1ATHEDOLPHINOFILLUSION 1PGA TOUR GOLF 2 I ROAD RASH 2 ALIENS 3 THUNDERFORCE 4 SONIC 2 SIDE NHLDESERTPOCKETSTRIKEPAHOCKEY 13 FLASHBACK MANY MORE GAMES IN STOCK—PHONE FOR DETAILS AN AVERAGE EXCHANGE COST JUST ES • El P•P (let CLASS. SAME DAY) PHONE WITH A LIST OF THE GAMES THAT YOU'RE AFTER - OR FEEL FREE TO ASK OUR ADVICE - WE PLAY ALL THE GAMES OURSELVES WE ALSO PAY THE BEST PRICES FOR YOUR UNWANTED GAMES. SUPER NINTENDO GAMES ALSO EXCHANGED - PHONE FOR DETAILS PHONE GARY ON 0621 776611 (9AM-6PM) 6 BATE DUDLEY DRIVE, BRADWELL ON SEA, ESSEX, CPAO CARTRIDGE4104I700,EXCHANGESPECIALISTSSEGAMEGADRIVE0839030321vatsle2fliiriuilesWMin2mmulesSUPERNINTENDO0839030322BINGO0839030323 VIAC164(tt 0839 03 03 89 32511 25 27 28 _43_443452 _554735 _574839THE FRUIT MACHINE GAME 0 <DC) EICI0839Cash03 03 24 • • • =E100 Cash "Gm asp 'row &Wig, we4111aaro Wt.. Cwt.. PCSao ICet 91I Lot 0.6.dd at P•r ,,NKF,ilp,d CAI aS M somn ar or man by anyea*.,9 MAIM MA...Mu Mammon cut of hut UsOfni Omm• ergo a Mom, Immo Cmm t3 60 CHEAMPIMPIPS / 0891EBUINIIIIIIIIINBIIIIIIMIEONSOLECHEAaH)1318400...................INFORMATIONHELPLINE318401...........GOLDENOIDIESCHEATSHINTS&TIPS-cl4I318402...PROBLEMLINE(PHONEINYOURPROBLEM,1318...........DESERTSTRIKE/THETERMINATOR318404....STREETSOFRAGE2&ICHEATS&'e1318SONIC2&1CHEATS&TIP91318406.......QUACKSHOTFULLSOLUTION&CHEATS0891318407.....NEWRELEASECHEATS(SEGAMECIADRIVE)J89I318CHEATS&(J,(LOTS)0891318409...........SYSTEMCHEATS&TIPS0891318410.................SUPERPIESCHEATSHINTS&TIPS18COMPUTERLINEn118412MASTERmai/SONICI&2HELPCHEATS&TIPS)1318413MASTERSYSTEM/NEWRELEASETIPS&CHE0891318414.........GAMEGEARCHEATSHINTS&TIPS*laveaV•mmchowatGolivesUM.P.O.Box193Hayes,04lidttellialt
![](https://assets.isu.pub/document-structure/220912162747-2c4c3b82884041f3c65bc178c7feed7a/v1/3fc97d44aa5afaceeada0c937e912151.jpeg)
I : Ccrrpalmon Pro Pad 1499 a.ttoi Pad .12 99 A Kn...., EAHockey91 .499911, Pr0.134erea, 34 99 Rain %WM 34 09riSAJAP Cantatior 799 F•ralla 2999 ShadowCa isai 2 29 09Sleann Airsick .2499 rater Fury 1999 Sr-ash IV 2909 SG PrePad Ow. 1199 rdvescil 30Pa SdocHodithoo 2. 2909 Clare lagoka 2400 Caeca Tome 291111 Soandran 29 V 9912d1ILA/eau/0 Onto Gleaalees 3419 Nemo Rap E. .3009 CDXCongener SI 99 Hardee/ 3 3499 Nodal V 99 SOFTWA141 USA ,US1 1.64The los .3499 VERNON resafrialOolong .3499 &or KO 01 „ SI V Awns3 34 99 Pant hole 2999 AhotherSkald 3499 1samans 3499 4hew Gone 2490 game arm 2999 Two tiSA larrian _21 90 Joir Madder 93 .3499 24.19 barer Pears 29 larg al IdImPari 34 99 lay Idols 99 Busby .3490 liro Samar, 2999 TLIalin • Heat 3090 Bab 91 Laws 34 99 Lannevi 3499 T,Lamina assent .44 99 Laae.na Gamin 2499 /MgLe Maw 3499 qrassW941/1219943swciTnara4 Wit 441Da .29 99 XMar 3499 :arum krarca 3499 Mae Oaks 2099 119Liao2;harm. Pro Am 2999 ItohnemociMI .3499 !SWUM:nun Chase/43 1 P0a Shoham CP 2 CONTROL PAD,.2999 Ala 29 99 Meroacer 3990 PSU. Cybennep 34 99 OuLani Rata )4 go RUNS USAMKJAP /bensHaler 29 99 ris+1 Salto 3 4 913 ClsKpc Goal 99 GAMES114,99 Doutaa Napa 3 3499 Wean2019 3490 Limited Off ,Dragon Rav 3499 POATessCol190 99 SONIC 1 IAEtta 00101%1 34.99 PkosionFootall_......_319 19 99,rumChanSwop34 99921,71091, VERNONC•'A 99 NT& OFFICIAL GAMES IN 2 E22 Mega Games 1 (23 ,Road Rash ., (20 tTaimania E20 Strider (17 02EkcoRkcuhCSmash TV (22 Star Control ._ E18 Terminator EIS Golden Axe 112 Cybercop [24 99 CALL FOR TITLES NOT LISTED Green Dog (15 Shadow Danced Golden Axe 2.,. Olympic Gold ,118 Spiderman.., LIS Over 50 used lip games all at This is a titlescallselectionsmall-pleasewithalistofyourequire. CHASEECCO CIA4NEION9IPPROJOHNmuums__HO/MADDEN IZS9 GHOST BUSIERS__ RAWPNITBATMANBEKYVVOODSAWESEICND OVER ISO USED GAMES IN STOCK - PRICES FROM 110 USED TITLES (UK)3.. 120 Quackshot f20 PART EXCHANGE Soccer t 24 De Cap Attack f 18 urian 120 Immortal E22 dden 92 t 22 Streets of Rage 118 FOR ANY USED TITLE IN ESTOCK.FROM • 100 SERVICEGENEROUSGAMEas All prices include VAT - please add 11.50 P&P per game CONSOLE CONNECTIONS ' 11UNSEX OLDIAKEHOUSE LAN/E. CHAPEL STREET, PENZANCE CORNWALL IRIS AAE CALLCG MX US NOW ON 0736 331131 OPEN 10am • 5.30pm 6 days DOME RISKITI - DREIERSY MAIL WITHCCNFODANCE - FROMESTABLISHED stioe 4 9 2 TIT1111,49 WAR ORDER eV WWI Asia Slot* 2 aisdAlond House Hiatt Rood Wood Omen. London N22 ALA (Comp, Glodokme AvoP The;091 999 9412 nut 091 019 9113 (100 rank from laliad Cavan tute dlotkotl W. okpo mold of :11 1149RiWonodtod,oofilwloC0tettarobr209,952091.090000994510f, firs got on locoost. r laiKrt kIJIl 9HOSC4040.. toll IEC1140% IC1. Ft NOE o I eb ESSIrIIEGAD ttl LATESTGREAT+SONICvE+3JAPGAMESVALUEgamesareourchoiceONLY1139.99MEGACO*GAMESUKVERSION11159.99JAPUSAGAMESAVAILALILEREPLACEMENTPOWERSUPPLYUNITONLYt699 ARM_ _AMCMAIL ORDER PRICES ONLY CHEQUE POATD. 655 GREEN L AHES LONDON NB OCII, If 001 340 8565. ASP ADDIL1 PER SOMVARE TITLE, 15 FOR mACHiNES. 34 DAYS. NUT DAY DELIVERY ADD E 1100. WE RESERVE THE PIKOHT TO CHANGE PRICES WITHOUT PRIOR Nonicc• Elli0E, All ow menses are USA clap. cheek compatibility with years &Wein Wore patellas*. (onthewail) Too right! Your fast, furry friends at Cheetah have got some serious wall-wear for your bedroom. So now you know where you can stick it! This eye-pleasing poster features the Bug in all Its functional ugliness and the full line up and tech. spec. of the whole Cheetah joystick range. FFORETSOPEERF1AND WIN THE STICKS YOU PICK That's right! Not only are we giving you this poster FREE, but if you then enter our free competition and tell us which 3 sticks you'd like to get your hands on most, you could win all 3! So why ore you still reading when you should be writing? Do the coupon thing now! FAST HANDS NEED A CHEETAH thett0h litatilefing Ltd Unit El tNongTradioTowrLynRawlWellingtonOld Mooduste M30 IOC I., yinor kna poso•F, fill In this catopnn and sand it In Oho •bown addratt• Piens. nninda a 3nd doss Oman, In yaw, onvdkve la return posinga. POSTCONADONIS& mom903
![](https://assets.isu.pub/document-structure/220912162747-2c4c3b82884041f3c65bc178c7feed7a/v1/e751c45ca7e9b18068fd4ccdb6efc0bc.jpeg)
1 It cannot be denied that Gunstar Heroes is shaping up to be something very special. Jusi how special, to the accuracy of a single percentage point,will be revealed in a not too future issue of MACHINES.MEAN We consider it no less than our duty.
100 MM SEGA
A new development team made up of program-mers from the Konami vaults looks like being good news for Megadrive owners. Treasure is the name of this team and they are set to make a big impression with their first release, Gunstar Heroes.Ascrolling shoot 'em up for two players, Gunstar Heroes is the tale of two sassy young men carrying weapons into the domain of a mad, bad public enemy. Nothing new in the scenario, but the games levels are split into a variety of submissions, each with a distinctive playstyle. There are ground-based areas, underground caves to be traversed on a skateboard and a sequence requiring you to scale a giant airship. There's also lots of power-up weaponry. Each Gunstar selects a weapon type at the start of the game, but can combine this with another type later on, for all sorts of curious effects.
![](https://assets.isu.pub/document-structure/220912162747-2c4c3b82884041f3c65bc178c7feed7a/v1/ef0381ec8a1e732c1ac3b3ccb2893c24.jpeg)
MEDDRIVE PREVIEW
The screenshots here tell their own story about how polished the game looks; very much in the ultra-slick, Japanese mode of Konami games, and featuring tons of graphic effects and surprises. The most remarkable features of the game ore the bosses. There's more of them you could possibly shake a stick at, and some are quite unprecede for the Megadrive.
MM SEGA 101
![](https://assets.isu.pub/document-structure/220912162747-2c4c3b82884041f3c65bc178c7feed7a/v1/fa578f86dadafb906f1ce3ba78f8f851.jpeg)
smolt of some silly-looking enemies on our Guns tar Nero.
No trumpsilly,relatedcaptions here. no.
PREVIEWNasillycaptionsto&strikethisratherserious
MEMRIVE
the pre. pos $ Gunstor Heroes bosses. It may look silly, bibit's a serious cmtiming matter.
Yes, I know he's on the telling. No tittering — this is a serious momentof the underground level, not a silly one.
SPletteo
elbatirevaneebevaherehtwonkeW
102MM SEGA
Yeah... flippin"ard tare innit? Or something...
stock of Sego baseball games out of late but EA's Super Baseball 2020 for the Megadrive is a futuristic game with a difference where you can choose men, women or even robots to champion your teams.The 16-meg cart is a conversion of the Neo-Geo arcade hit and includes 12 teams in two leagues each with 16 unique players. Each team has its hard hitters, goodly fielders and fast runners. There are cash prizes for good performances which ore used to buy powerups for the pitchers or batters. But watch your step because a bad show reduces the prize Areasmoney.oftheinfield and outfield are covered by a special armoured glass so
![](https://assets.isu.pub/document-structure/220912162747-2c4c3b82884041f3c65bc178c7feed7a/v1/54f80bfc6165add5c349d18121dc1be4.jpeg)
that the fair zone becomes wider and offer every new inning, land mines are planted in the outfield to add a bit of excitement to the fielding. There's one- or two-player action and a one-player vs two-player option, a password save and a surge of power after the seventh innings so sod losers hove the chance to come fromWhybehind.software company's keep releasing baseball gomes in this country when the majority of people couldn't be less interested in the sport we haven't a clue but Super Baseball 2020 is certainly a lot different from any baseball game we've seen before so perhaps there's hope yet.
To find out if it's good or crud you'll have to wait until the full review in next month's issue of MEAN MACHINES SEGA.
inionmo • 61.i 1 r-
Meet Robatop's tocsin, stoloquerading as the ref in Simper Baseball 2020.
The fielding team can judge where their covering players are on this sueen which show the direction the ball is heading.
MEBADRIVE MIME KIVUXXXx!yohanoitcallarpeSumu ters tire 1111 m lax mar ma unix emeriti These thehit!withstartbattingthematicsomeaappearact-screenssmarttoclopktclosecallorotherdra-eventingame.Spong!ThefromtheirinningacorkingNowrula,youfoeRunfithewind! MM SEGA 103 4 AO o- On oI4''boPqlif— I ei d 'YR K d jp v , %el PRI" ,- — 956A,o=Ar11P—1r, :-:
![](https://assets.isu.pub/document-structure/220912162747-2c4c3b82884041f3c65bc178c7feed7a/v1/6117a2a41feca2ade730a6b08e2d5413.jpeg)
EGADHIVEPREVIEW
rPP I I. rtior. SW
![](https://assets.isu.pub/document-structure/220912162747-2c4c3b82884041f3c65bc178c7feed7a/v1/869ac64362c6689c69e5fca52d656258.jpeg)
ince defeating the foul and festering Go Gritter in his lost Megadrive adventure, Chu of Chuck Rock fame has done all right, carvinghimself out a nice little niche in the world. He's currently sitting pretty (financially not faciolly) as head of one of the biggest car manufacturers in the country, he's got on adorable wife and kid at home, who could ask for more?
41 • • • •
.tionior be PLAYERS
But, os we all know, when life is looking rosy, something inevitably goes horribly wrong. And sure enough, one day a brick comes flying rough the Rocks' window inscribed with a ransom note threatening to waste Chuck unless his missus coughs up loads of wongo. Enter sixmonth-old Chuck Junior who, armed only with some Farley's rusks (and a big, bad mutho of a club) prepares to rescue his dad from the clutch ofel his biggest business rival -- Brick Jagger in Chuck Rock II: Son of Chuck Rock.
ME6ADIIIVE HIEVIE1
This new Megadrive platform jaunt (which is also coming out on all other Sego formats, including CD) features six different levels, each split into different zones and including mind. bending sub-gornes_ The player bashes dinosaurs, monkeys, flame-thrower wielding robots, killer flies and that's just before break There are puzzles to solve, blocks to boot about, monsters to ride and baby bottles to collect, As you con see from the screenshots, the graphics ore looking pretty corking with some gorgeous backdrops and humungous sprites. We'll fill you in on the gameploy in a full review next month.
'IP
![](https://assets.isu.pub/document-structure/220912162747-2c4c3b82884041f3c65bc178c7feed7a/v1/e6d065dcd6ef9b9b633558e23e440728.jpeg)
But it's very rare to get away with such a heinous crime scot-free as the greedy Sordini family found to their chagrin when they wasted their dear Uncle Guy in this new Megodrive game from EA.
The wicked clan may have scooped itself wads of dosh and four palatial mansions but Vito, Flo and kids Tony and Mimi hove also got themselves a permonent uninvited house-guest — yup, Guy, who's a touch racked off about his withtheirdant-witsofthefright-itemspossessnaturalgetsphantom,sion.'Polterguy'.tobackdemise,untimelyhascomefromthegravebecomeHismis-revenge!Asafully-fledgedtheplayertousehissuper-powerstoover400toscorewickedfamilyouttheirnot-to-abun-andoutofhomes.WatchFloloseherwigwhenGuyfreaksheroutachainsowandwitnessVitolosehistrousersatfindingabody in his 110 boot. There's also a Zombie-ize feature which takes over a family member and spooks the others out of thePolterguyhouse. only has a limited supply of the vital ectoplasm that powers his scare tactics and must occosionolly return to the netherworld to replenish his EdobeastsHowever,supplies. are out to spoil the spooky spectre's fun, so watch out. Designed by the creators of Cyberball and HauntingRomport, Starring Polterguy is packed into a 16meg cart and so for is looking fob but tune into next month's issue of MEAN MACHINES SEGA for the full chilling run-down.
![](https://assets.isu.pub/document-structure/220912162747-2c4c3b82884041f3c65bc178c7feed7a/v1/2ec15ce6243ca6700bd3f28ba366dea0.jpeg)
rP111411'
desperate for a bit of cash sometimes the only answer is to bump off a wealthy relative.
corner, baths terribly nouveau riche? Polterguy seems to think se, as he scares the living cock out the occupants.
-rAren't
ACompliotbetweso the hellish heeds al Easel
MORPH PREVIEW
er'uoynehW
ME6HDRIVEPREVIEW
(BY
1 PRICEPERCENT99.9AE46-413COMPLETEMEL 111 E111MM11• Five minutes after sitting down to Pop-Tarts served with Bachelor's Savoury Rice, the family promptly keeled over — and died! • RELEASE SEPTEMBER --wwwwanoummitillmwwww.. ii „it 111101111111174147741- Fly, fly you stools, re. LWOW-• ihdeic 1 timiL igrualire . RUCLAWAMUCH • Haunting lets you into the details of a very scared pa:sons underwear. Not for the faint-hearted!PAM SEGA 107
![](https://assets.isu.pub/document-structure/220912162747-2c4c3b82884041f3c65bc178c7feed7a/v1/47627121bc31e9645fbd31d58fc2cb6e.jpeg)
There are loads of sadistic things you can do I with eggs — beat 'em, scramble 'em, fry 'em, boil 'em, poach 'em, whisk 'em or even eat 'em raw. Unfortunately, you con do none of the above with Codemasters' cartoon ova but if you're absolutely desperate you could always '§ ploy with him in Fantastic Dizzy.
IMPF1111P Ir IIMPF
RELEASE SEPTEMBER BY 111111111.9DEMASTESIS)PRICE TIA PERCENTCOMPLETE
The red booted egg's quest in this Megadrive cartoon odventure is to rescue his eggess (Daisy) from the evil Wizord Zoks' castle in the clouds and turn all his chums into cute and fwuffy creatures again, back from the fiends that Zak has made them, The player rooms around the massive kingdom, solving puzzles, chatting to strangers and tangling with baddies (but never killing anything because that just wouldn't be cricket, old bean).
Well, there's the basic gen, we'll bring you a full review of our eggy hero in the very next issue of MEAN MACHINES SEGA. In the meon• s, time. I reckon I deserve a medal . ,) for avoiding any egg puns in this entire preview — eggsellentl Dohl
![](https://assets.isu.pub/document-structure/220912162747-2c4c3b82884041f3c65bc178c7feed7a/v1/2826ba8504bbc9f33615f9513193a503.jpeg)
Hints NI Tips N" Cheats N 0801 101 234 £29.72 UK Mega CD SEGA CHEATS N' TIPS 0891 445 933 CONSOLE CHEATS N' TIPS 0891 445 991 CONSOLE HOTLINE 0891 445 990 NINTENDO CHEATS N' TIPS 0891 445 913 ALL CHEAT LINES UPDATED EVERY WEEK INTERACTIVE GAME SOLUTIONS SONIC I & 28 Bit & 16 Bit 0891 445 929 CHUCKROCK 2 Son of Chuck 0891 445 946 DESERT STRIKE Return to the Gulf 0891 445 953 STREETFIGHTER 2 The World Warrior 0891 445 927 SHADOW OF THE BEAST I & 2 0891 445 949 Jungle Strike t205.3 I Mig-29 £26.53 Final Flight £26.53 Flashback £26.53 Night Trap £32.72.7 1111111NP ALL SYSTEMS CHEATLINE (Say 'yes for Sega) For Full Information On All Our Solutions, Services & CheatlinesDial 0801445 904 Hyperspace 10 is a Bad Place To Be! That Abandoned Space Station Looks Dangerous!! Have you got what it takesfor The Ultimate Guest ??? Dial 0801 101 155 and play the game with the greatest prizes! '—'—'--- Guiding Light taimpu er Services LTG. mFor full copetitton 1 end Calls charged at 36pmin rate & 48p/min all other times. If you dont pay the phone bill Me lh Mk for permission. Max call 3.60. PO Box 17, Ashton-Under-Lyne 0L7 ONN CHEAPEST EVER Arcadia Games brings you our cheapest titles ever Due to increasing membership we can now take our games down to wholesale prices. An annual membership fee gives you discounts such as: We cater for all consoles, so give us a try. For full price list & details send a S.A.E. to: "Arcadia Games" 8 Royds Close, Hartford, Cheshire CIN8 I ND HOTLINE 0606 74298 - 2 m till 8 ON 071 972 6700 TO ADVERTISE IN THIS SPACE CALL MARIE LAWLOR 0111VIESillfORLDA?L!OA,*AMAZINGOFFER!SWOPYOURSEGAORNINTENDOGAMEFORONLY-HOWTOORDERYOURSEGAMEGADRIVE,GAMEGEAR.MASTERSYSTEM.SUPERNINTENDOANDNINTENDOGAMECARTRIDGE Just Send E3 99 El .50 Post and Packaging with one ol your exasung games to Me address on the coupon anti we will rush your new game hack le you wenn as little as 7 days. Overseas orders must include a further t 2SO to cover postage and perteid try Eurocheque in E sterling CONDITIONS OF INADT • Your game must be in good working order accompanied by its handbook and case, You can only trade your game tor another in me same score 7one and which is compatible with the same system as your own • We cannot accept responsibility tor any damaged games we teceNe. We regret we are unable to swop the tollowing games. Sonic I, Attered Beast. World Cup Italia 90 1Sega) The Nino (Master), Wresderriano, Stmer 4•Type (SNESL Tetris (G.Boy), Columns (G Gear) + POSTEl.50 111111111 Post to GAMES WORLD EXCHANGE 23 NAMES ST HAMPTON, MIDDLESEX 1W12 2EW SignatureAddressName of Guardian (II under 181 1stCHOICE 3rd CHOICE 2mi CHOICEPostcode 4th CHOICE Ienclose chequetPostal Order nude payaOle to GAMES WORLD EXCHANGE for E5 49 inc P&P and one of rily existing games to, my computer system, SegaMega Drive Game Gear L Master System Super Nintendo Li Nintendo GameBoy _1
![](https://assets.isu.pub/document-structure/220912162747-2c4c3b82884041f3c65bc178c7feed7a/v1/6146c26b7ea7124bac7b68ae0f279de6.jpeg)
444855.MEGADRIVE. boxed, 2 ioypads. 8 games. Sonic 2, EA Hockey 2. Streets of Rage 2, Desert Strike. Thunderlorce 4, Tazmarna, etc. plus 49 mags C220 ono Tel. 071.586 4130
FOR SALE OR SWAP WWF
NINTENDO ENTERTAINMENT SYSTEM. 2 control pads. zapper. 6 games. including Micro Machines, WWF. Steeicage £85 or swap for Megadrive Tel. 021-353 4903.
NES557546FOR
ATTENTION!
SEGA GAME GEAR with adaptor. Master Gear Super Monaco GP 1&2. Columns Wonderboy and G.Loc E145 ono. Tel (0235) 526026. PIES. 11 games, robot, 2 joypads, advantage joystick, Lynx, 1 car adaptor, case, 2 games, The Lynx games are new Tel 071-483 2550
LOBSTERS! Quality
AMSTRAD CPC 464 computer with colour monitor, also with adaptor. 5-star joystick, plastic Covers plus 60 games' will sell the lot tor E99 ono Tel 108681 252678 ,alter 4pm. The computer is in exoellent condition, you won't had a better bargain NES, with 2 control pads and advantage, light gun. 9 games. including Mario I ,2&3. all boxed with instructions. £200. Tel. 107071 074315, PC ENGINE for sale. 8 games. Including Formation Soccer. Motoroader and R•Type. slow motion rapid fire pad, £100 Tel Michael on 10538) 304595
UK MEGA-CO tor sale. with Sega Arcade Collection, Cobra. Commando. Sol•Feaoa and Road Avenger, sell for £225 ono, also swap Megadnve (UK) with star control. Sonic 2 Ecco, Lemmings, 3 controllers, toe SNES vinM 2 games le Mario World. Pilotwings. Ter (0303) 893153.
MEGADRIVE plus Streets of Rage 2, WWF arid Sonic, brilliant condition, plus 2 pads £100 Tel (0727) 874150. (St. Albans, Hertsh AMIGA 5004 colour monitor. 35 games. x-copy, blanks. loystick, mouse. leads. £280 °veil. Alan 520 ST FM, res drive. mouse, games. pro. copy. £130 ovno, Alan 2nd Wire £40 ovno, Alan SM 124 monitor. £50 own°. Star LC2410 printer. £100 ovn0, Epsom LX 400 printer, E75 ovno, avgc. Tel. (0322) 223766. buyer must MEGADRIVEcollect with Super Kick. Oft and Streets of Rage 2 and Jap convertor plus loads of Sega 'nags. books, videos., all this for Only £120 (must collect). Tel. (0484) 538694. ask tor Glyn illirdclerslieel). PS Will swap for Super SNESNintendoFOR SALE with 14 games. also included is an &Scope and AR games. includes S Fighei 2, Ranma I. SM.Kart, Contra 4, Zelda 3, P.Wings. S Tennis and Turtles 4, everything is boxed, sell tor £450. first come, first served. Tel. Edward on 84,0355212281after56prn.UKMEGADRIVE. boxed as new, with 2 control pads, including 7 games: John MaddenSpeedball,4orcederfThun93,
SALE with 3 games including Mario 3 and zapper gun. as new £85. also SNES Zelda III Ion sale £20. Tel Tom on (0733) 557546, before 9pm. PC ENGINE Core Grafic tor sale with 4 games. including PC Kid lb. all as new £110. Tel. Tom on (0733) 557546. also old Mean Machines tor sale. issues 2. 6. and 9-24 Cl 80 each. all as new ATARI LYNX 1 for sale, with large carry case. adaptor and 6 games, including APB, New. Warriors and Golf, everything boxed as new £155. Tel. Tom on (0733) 557546, NES 6 games 4-score, 2 joypads. joystick magazines. cleaning kit for E185 ono Tel 07601 338790. atter 6prn and ask lot Coin Areirew, or swap for SPIES and 1 or 2 games, 2 controllers, any game(s) prof Street Fighter 2. SEGA GAME GEAR. Sonic, Oil Run, Europa, Super Monaco GP II games £25 the lot Tel, 061-902 1526, daytime only and ask tor Pete. AMIGA 500 plus Cartoon Classic Pack for sale (1.5Mb), still wrapped-up and boxed (never used). unwanted present. over E400 of software, mouse, joystick, shop price over E500. see tor C200-C250, great bargain, Tel. Guy on 071733 IAEGADRIVE,1323 toypad, ac adaptor. RF-switch. Sonic 1&2. Road Rash, Golden Axe, Slanotx 2. Quackshol. NHL '93, good condition, E210 Tel Simon on 081 993 1650
Scott on (04831715709, alter fiprn. also Master Systm with 7 games and 2 controllers (1 control pad), worth £190. will sell tor £90 (Woking. Surrey) MEGADNIVE with 12 games. inc. Sonic 2, Shinota for £350 or 11 games tor iPale CD and gameis) Tel 10787) 224055
MEAN MACHINES Megamart is for private advertisers only. Anybody sending in a trade advert will not have it published. It will be ignored, your cheque will not be cashed and no correspondence will be entered into! Due to deadlines, allow up to six weeks for your advert to appear in the magazine.
![](https://assets.isu.pub/document-structure/220912162747-2c4c3b82884041f3c65bc178c7feed7a/v1/b482a1891f15e1662965b39cd4571a11.jpeg)
MASTER SYSTEM N includes Sonic, pius Asters and lontsiones. 2 pads. 6 months old, all boxed, like new £70. Tel. 102021 603879
BOXED534232
IAEGADRIVE (UK). 3 months old. sell boxed, includes 1 loypad and 4 brilliant games. also includes Japanese convertor plus a Megadrere Cheat Book. worth at least E270, sell for £135. Ter Abdul on 081-640 8049, for a definite bargain.SNESPALSCART with 12 games, 3 joypads (1 auto), super scope games inc. Street Fighter II. Mario Kart. Mario 4. Contra III, Rival Turf. Exhaust Heat, al tor £350 Tel Nice on (0276) 24236. plus JaplUSA MEGADRIVEconvertor FOR SALE. good condition. 7 games, JM 92. Sonic 2. Robocod, etc. 23 joyeads. cheat book. only £225 lel. Tim on 10703) 115210.
Hegadrive games like, Chakan, Aquatic Games, Krusty's. Preighter, Toeiam & Earl, Arcus, Odyssey. James Pond II, Shadow Dancer ,Ecco arid more tor E15-E20. Tel. Mike On (07881891 440. all in good BARGAINconditionJapanese Sega Megadrive with Eswal and Golden Axe, 2 boxed and breed new, Quick sale at £80. Tel Dave on 061-339 9770
Smash TV, 12 Arcade, WWF, Splatterhouse 2. Two-C• Cedes, £27 each. brilliant condition Tel Gary on (0494)
2, Team USA Basketball and more, all in excellent condition, sell tor E200 Tel. David on (0686) 412778, after eipm.
JAP MEGADRIVE for sale with 2 top joypads.sticks, also 8 games inc Sonic 1&2, Shinobi and Streets oh Rage t, all for £250 ono. Tel Joe on (0938) 810205, alter 4pm No post delivery. preferably someone in TEDDYWales BOY. Quartet. no instructions. arid Mains adaptor tor Game Gear all for CIO, Wonderboy in Monstertand £15. Indiana Jones CIO, Sonic 2 for Garne Gear C15 Tel. Tony Tsang on 041-634 8287, between 9 30-11.30pm. Monday & Wednesday evenings only GAME GEAR psu, Master Gear, Sonic. Sonic 2, Columns. Devilish, Prince of Persia, Chuck Rock, Super Space Invaders, Alien 3 Terminator, worth over £300. all boxed with instructions. bargain at el 70 Tel Cambridge (0223) 880705. alter SNES7pmWITH SF II for sale, only £95 one also Megadnve with 3 games only £95 ono Tel (0392) 438513, ask for Helen. AMSTRAD CPC 6128. nearly 50 games. 3 joysticks. TV and radio tuner and monitor, sell for C175. Tel. games476pacts,MEGADRIVE(0494)672426.with2controltaws5games,onlymonthsold(130ono,Tel081-1424MEGADRIVEtorsale.with8£200all88%andabove-Worldof'Simeon.Mickey&Donald,SuperOffRoad.Lemmings.Sonic.Populous.WonderboyinMonsterWorld,F22Interceptor.EAHockey,2joypads,carrycase.goodcondition.Tel.(0702)467438.MEGADRIVEGAMESlorsale,allUK.gamesincludeSORII,Krusty'sFunhouse,andWorldofIllusion,willsellforbetweenCI0-C30,dependingongame.CallRichardon(0222)371515fordetailsAllgamesboxedandinexcellentcondition.MEGADRIVEtorsale,boxedwith6*ernesincludingSonic2,DesertStrike.Lemmingsandotherswith2joyeadsworth£350.selltorE225ono.Tel021-7730832.GAMEGEAR,mainsadaptor,carrycaseand6games,includingSonic.Sonic2.GlobalGladiators,OlympicGold.ShinobiandColumns.worthover£240,selltor£140.allboxedwithinstructions,ilinterestedcontactLewisonStevenage(0438)359135MEGADRIVEand6games,allboxedandinstructions.EuroClub.Soccer.etc.carryingcase,2controlpads.TerLouiseon(0277)208004
EA Hockey. Road Rash, Rob. Sonic I, Action Replay Pro, 2 joypads, I propact. Master System convertor, all boxed and 35 'nags, posters, cover. gifts worth over E360, will sell tor £200. a bargain. Tel. (0483) 770840, alter 5prn.
ATARI LYNX 2 plus 2 games. ac adaptor and carry bag £70 Tel, Ben on (0245) 400112, after 6pim UK MEGADRIVE. 4 games.
SYSTEM II plus 1 pad and 6 games mint cordition. E70 ono. Tel. Kevin on 081-347 8616. or leave
FOR SALE. Super Kick-Olt 1MDj. brand new, worth £45, sell tor £30 Tel. 109921
AMIGA 500, IMeg upgrade, TV modulator. 1 joystick. 2 manuals 10 games. including Final Fight, Dragons Lae, Paperboy. Falcon and brilliant art program. everything in mint condition, absolute bargain at £200. Tel Chris on 081-578 3624.
UKQuickly.MEGADR1VE with Sonic the HeckJehog. 1 joypart. 6 months old, great condition, £85 ono. Tel. 10239) 71 SEGA0366.GAME GEAR to( sale. with 4 great games, also Master Gear worth £270, sell lor £100. Tel. Daniel on (0 MASTER78365160)7
FOR SALE
LOADS OF ATARI ST games !or sale linclutfing Monkey Island and SF SOB II and Sonic II (Megadnve) mill swap. Tel (08321 735207. AMIGA FOR SALE. or will part exchange tar Super NES games, 1Meg upgrade joystick. mouse, and over 70 games, inc. kick-Off 2. Lemmings 2. PGA Tour Golf and many more, for offers and details, contact: Simon on 105251 861721.
PSS 150 YAMAHA keyboard, complete well box and instructions. £40 or swap tor Lemmings, SOB II or any good MD game. Wnte to: L. Davies, 74 Devon Road. Frankley, Birmingham 845 ONP SEGA MENACER tor sale. nearly row, hardly used. extremely good condition. 6game cart included, E35 Tel 038-17281, after 6.30pm
GAMESmessageFOP MEGADRIVE
GAMEBOY games tot sale £12 each, Super Kick•011. Marioland. Choplitter 11, Battle. Toads, GoGo Tank. Terminator II, Double Dragon II. Blades of Steel and Side Pocket, all as new Tel Tom on (0733)
MMSEGA110
ATARI LYNX for sale with xenophobe, worth E115. sell tor £70, if interested. phone
PC ENGINE wee 8 games, £100 also 4 player adaptor with I pad. C30.Tel. Char on 10825) MEGADRIVE.762288,mint condition, all boxed plus 2 toypads and Thunder Force di Alasia Dragoon. Sonic. Tel. Barclay on GAMEBOY104251475073.torsale. WWF 2, 'fetes and GB Hoister, excellent condition, £55 ono, also Megadrive games for sale, JM '92 £14. Bulls vs. lakers E23, Mores CI 1, Toraam and Earl £12, WWF Wrestlemania E22, Wrestle War £14. Tel. Kevin on (02691 593950. SUPER MONACO 2 tor Game Gear C17 with manual Tel. Paul on (0752) 338034. alter 5Pre•
.Super Wiestlernania tor Megadrive tor your Alien 3. Moonwalker. Budokan or Road Rash II, possibly consider other games or sell for £30 Contact Sion on (0248) 722305. weekdays alter 5prn or weekends. anytime.
AGEMA-
MEGADRIVE GAMES lor sale, all boxed oath rostractions,1 have Streets of Rage I & II, Desert Strike, EA Hockey, PGA Tour Golf, Road Rash 2 and Sonic 2. all games undo( E25. 1 interested. contact Brian on (0232)838101
WANTED: Mega-CO with Final Fight and Night Trap, willing to play between C1501200. Phone (0738) 36169. alter 5prn
AMERICAN SUPER NES Scan only. 8 games, inciuding Stenos, Street Fighter 2 games edam'. 2 control pads. sell lot E350. no cheques Tel (0252) 511030, after 6pm.
HI! l
LOOK I AM SELLING a Commodore Vic 20 complete with keyboard database, book joystick and over 13 games, worth over E120, sell tor £65 or swap lot Commodore 64. Tel. 5234071-635orwrite to r,CoopeJerry1Beechelene. Carlton Grove, Acorn Estate, London SE15 MEGADRIVE211H. 2 pads and 18 games for sale worth Over E700.sell tor E475. including Ecco Sonic, Strider, Desert Strike. Megia-lo-Mania, Street of Rage Tel 071-277 0240
IOpelWILL
I WILL SWAP Megadrove for SNES. I have 8 decent games, eg Sonic 1&2, Streets of Rage 182, Road Rash II. Tazmania. etc. SNES must have 5 games.6, preferably SE II, Mario Kart Tiny Toon& all offers Tel Phil on (0242) 621429, efts( 7prn
lookingyobdloraey21aam
MISCELLANEOUS
BEST BUY PC Engine handheld with 2 games oncuchng PC. Kid II. mains adaptor, boxed, excellent condition worth £300, will sea lor E180 ono Tel Simon on (0702) 295458. after 5pte
MEGADRIVE for sate (Jap), 6 amazing games Sonic, J. Madden '92. MM & DO. World of Illusion. Streets of Rage Wrestle Wars and Ouackshot, 1 turbop joypad and 1 normal joypad, vgc. all boxed. sell lor E250 ono. Tel Richard on (0646) 682581
SUPER PRO FIGHTERS tor sale, E230, real time saver cards only E30, dual UGH £270 Write to. Simon Chan, 55 Dickson Street, Widnes, Cheshire WAR 6NX or phone 051.424 0216
The Pen Pal Club for garners , membesi300OverFree swap serivce, tips & cheats, help & more plus Join now and enter our free comp lo win loadsa prizes' For details send sae to. S. White, 28 Churchfierld, Ware Herts SG12 OED.
Chuck Rock MD tor Super Kock-Oft or VVWF Wreseemania, Tel. (0642) 821192 (Middiesbrough).AFRICAN CAMIAAL I will swap my MS with 12 games. phaser, s.stick and pad for your MD with 3 games, (80'16.) or for your SNES with 2 games 180%41. Tel.Henty on (0279) 812811, with details MS is box edl HI THERE! MS owners, how about Sonic I for either Golf, Simpson or Out Run, than call Leigh on (024A) 811926, allow SWAP3prn.
GAME GEARSonic. Outrun, Europa. Super Monaco GP II games, swap for shooting games, except G-Loc. Halley Wars. Tel 061-902 1526, ask tor Pete.
SEGA MEGADRIVE games, all types old or new, please send lists to W Ennis, 181 HS Haademmenttog. 105 LB Amsterdam. Netherlands, Tel. 020-684•8425, alter 5prn. please state postage arid packing price as well WANTED: Megadrive games. Gameboy. SNES games, bought for cash. Tel. (07451 334965, alter 6prn. please OH Have you got any unwanted Marvel on DC comics, new or old and in good condition? Wee, contact Tristram on (0734) 772229. or write to. 5 The Green, Woosehill, Wolunghant Berkshire RG11 9PG, prices to be NE0confirmed,GEOwanted, with 1 game and 2 controllers, will pay £200E250. depending on game Tel (0939) 210361 HELP. I'm looking forinvade(sSpace90'. on import lot the Megadrete, if you have a copy in good condition, and with the booklet. Ill pay between E25E30 for it II you've got it. please call me on 10768) 899773. after 6pm
e.200? does quick money making interest you Send a sae to: G. Lowe 139 Conway Avenue, Great Wakering, Essex SS3 OBH
Raster'. My Hero, Bonanza Bros, or Space Harrier on the Master System? Then seed an sae weivaeS521,linKilPtoTerrace, Edinburgh, Scotland E815 280. Don't lust sit there. NEVER MIND the cacti' 'Ultima' has stacks of Tips. Pen Pals, Reviews, Swaps, Fee! SAE to AJH. 33 Central Avenue. Spoke, Liverpool 124 3XG.
SUPER PRO FIGHTER (SNES) £285. Wild Card (2,2) (SNES) E205 both machines come with guarantee. power Supply and 25 games over E1000, end out more Tel 081749 7962, some MO games also for sale 'Slop Press* FM Towns and 31)0 information available.
antetotmostlySteel,SuperSuperFORcondition.(05394)worthAlonegames.GAMEBOYDistrict)excellentEMenacerSonicMEGADRIVE535799.uptowantedRobocod,PORSCHES!109081679706Justkidding£22DecapC28,alsoGameGenie,willpayF_30.Tel.Chrison(0494)weekdays5-9pm.forsale,with2,LemmingsaridworthE230,accepti25.Tel.(05394)36609,condition(lakeforsale,with5Hanoland.Home2.etc.withcarrycase.E170.acceptE75.Tel36609,excellentSALE,GameboywithKick-011.Dragon'sLair,Matioland2.BladesofWWF2andTotes,boxed,worth£190sell(110T01.(0634)666055.5pm.
2,SonicwantedSennaGP,Road Rash 2. Lotus Turbo, Challenge. Lemmings, also of hers considered (all above English attest Tel. Ryan on (0483) 417996, evenings (Surrey SWAParea). boxed Super NES with Mardworld plus boxed Propad with Action Pro Replay adaptor arid extra 8 games, includes Mario Kart SI2, Note/mg,Contras. Joe A Meek. I want Neo-Geo with 3 games Tel. Ricky on 071-925 0140 or home 081-368 7486
SWAP your Megadrive with 12 game lot my Master System with 7 games Tel, (0440) 706015. ask for Ross. SWAP Streets col Rage II ion Sunset Riders or Wrestlernania for 2 CAude Dudes. Tel (0239) 613782. ask for Gareth MEGADRIVE GAMES swap, 10 games (quality). any games considered Tel 10436) 76788, ask for /*Wait Jap games also SWAPwelcomemy
FIGHTER FOR SALE, gift from holiday, £230 Write to Simon Chan. 55 Dickson Street. Widnes, Cheshire WA8 6NX or prime 051-424 0216
MART
![](https://assets.isu.pub/document-structure/220912162747-2c4c3b82884041f3c65bc178c7feed7a/v1/bc8d5fe533634f7aeac0d7e2dc678e16.jpeg)
I WOULD like any cheap MS games, contact: Rob on (0227) 731484, after 5pm. any weekday not weekends
GAME-LINK!animals
1 11PAMSEGA
Amiga 500 with joystick, MOU5e. many games tor Megadrive cot will see for E225 Tel Paresh on 081-426
PC ENGINE with 9 great games, including Gracious, Salamander Outrun, Space Hamer. Power Drift, Chase HO and New Zealand Story. fully boxed and in excellent condition, only £200 ono. Contact Andy on 051-339 9566
SEGA872077MEGADRIVE, 6 top 10 games. 2 formes. only 2 months E180 ono, it interested. call David on 10222) 766969
I WILL SWAP Mickey on the Gametioy for any Megadrive or Gametoy games. Contact Victoria on (0507) 527244
SWAPS
MEGARIVE GAMES for swap. Dragons Fury. Gynoug. Megalomania, Captain America.
LOOK111Megadrive games for sale, inc. Revenge of Shinobi and Super Monaco GP both 94% also Master System games Inc. Vigilante and Super Tennis, picas vary from E6E10 Tat Joe on 081 960 0536. after Sore everyday FOR SALE Mogadnve games European Club Soccer. World ol Illusion. Castle of Illusion, Eswat, WWF, flack Tracy £20 eace, all boxed with instructions Tel ()442)
SWAP my Megadrive in perfect condition (boxed) with b great games. including Hockey and Streets of Rage 2 ton SNES with 2 games, or I will sell lot E175. Tel_ Tom on 071624 7166. after 60m. weekdays SUPER NINTENDO with 12 games. 3 joypads. convertor and magazines. tor Mega-CD with 10 games or Neo-Geo with 45, all on excellent condition, games include Startox and Top Gear Contact John on (0225)873301 (Avon SWAParea).
FM LOOKING for a pen friend aged 11 12 oath a Megadrive. Write to: Tim. 4 Addington Road, Woodford, Northants NN14 4ES
WANTED
OVER 210 TIPS tot Megadnve. Master System and Game Gear I also Action Replay and Game Germ) codes) 50p per 3 tips Send sae to: Greystones, High Heworth Lane, Felling. Galeshead, Tyne and Wear NE10 eXD No Cheats? Money back'IMPORTANT!
ATARI LYNX for sale. complete with 4 games and carry case E80 ono (boxed), Tel Ryan on 407841432394.
PEN PALS
DO YOU NEED help with Mickey Mouse, Wondertsay. Transbot Donald Duck.
for girt pen friend. Please send a recent photo to B Preston. 52 Medway Sulgrave, Tamworth, Staffs 877 2JN_ My interests are most sports, music_ computers and
MESSAGES
Read this' We have hints, tips. Game Genie and Action Replay codes available, we will immediately send help needed (Megado,00 only). Send 50p post orcke sae and the emblems yell have Will up to 5 games to: W Llewellyn. 43 Coed•yLianedeyrn.Goias Cardiff CF 3 7NE. Write now
MEGADRIVE. 4 games. all EA. eg. Desert Strike. Madden '92. vgc. worth over £260. sell for E125 ono Tel 081-876 6795.
ATTENTION! I would like to sell Flashback for Megadrive £33. John Madden 92 E22, also tor Garneboy• Manoland 2 £21 and Terminator 2t7. interesied.lf call 071-703 7516, Mon Fn, only between 5-8pm MEGADRIVE for sale. 19 top games like Sonic 2, Ecco, Streets of Rage 23. John Madden '92, 2 turbo pads. scan and 17 mags. worth well over E600, sell for around E400. Tel. Phil On (0297) 60347.
MEGADRIVE GAMES for swap, Road Rash 2, PGA Tour II, J Madden 93. Golden Axe. Altered Beast, Sonic. it interested, phone (0425) 622996 and ask for Sam. SWAP T2, Sonic 2 and Shadow of the Beast. for Fatal Fury. Road Flash 2 Micro Machines, Desert Strike. Power Monger, must be boxed with instructions, any other good games considered. Tel, (0642) 243502. between 5-
HEY!!! Official Megadnve tor sale. controllers, stereo sack and 9 games including Speedball 2. JM '92. Streets of Rage 2, Alien 3, Mega loMania and PGA Tour Golf. both Megadrive and games are fully inseuctioned, boxed and in mint condition, accepting sensible offers, around E260 Tel. Dan on
MEGADRIVE plays all carts. pad. powetseck. catty case, 9 games. inc PGA Tour Golf, EA Hockey. Leiters vs. Celtics, Road Rash, sale of sin,* games or whole package £335. vgc. all games boxed with instuctions. Tel. (0372) 726840. after 6.30pm,AMSTRAD CRC SIN, colour monitor, over £350 games, eg Robocop. Shadow Warriors. wonh over E750. sell for E95 ono Tel. 081-876 6795.
SEGA8533.
AMIGA 500, 1Meg upgrade. good condleon. over E300 of games. joystick. mouse and mai, lots of magazines, will sell tor (240 ono. or will swap for Super Nintendo and games. Tel '0903) 501457. after 6pm, and ask for MEGADRIVEMatthew.1-year old, 8 games. including Sonic 2 & Strew, 2 pads, 1 turbo, heactproones, boxed with instructions all for £285, also Nintendo Super Scope lot sale £30 with batteries, Tel. Simon oil 021-705 6699. °trick.
ATARI 520 STE 1Meg upgrade, ext disk duvet. 4 joysticks, mouse, dtp, business arid games software plusaocceeorles. Tot 021-357 4262
my Megadrive. MegaCD and Master System convenor, with 9 CD games. 4 Megadnve games, 2 Master System games and 2 controllers for a Neo•Geo with 3-5 games, and 2 joysticks. good condition, person must collect Tel (0633) 867444
TELPOSTCODEIWHO. IN MEGAMARTPLEASE IWANT MY1/417A1EIZTTOREMEMBERGO '.111" THAT IS AT YOUR OWN Emit MEAN MACHINES. PRIORY COURT 30-32 FARRINGDON LANE. 60NDON EC1R 3ALI. Got something to sell? Or want to swop games? Do you want something. or do you have a special message? Perhaps you just wont a pen pal? Well. whatever you want. the MEAN MACHINES Megamart Is the place for you. ATTE NI For just you can have your very own advertisement containing up to 20 words! Or if you're feeling rich and vOrbose (look it up in the dictionary).. £2 wilt buy you 40 wit( be ignored, your cheque will not b (count 'ern) words!! cashed arid no correspondence will So what are you wodkig for? Fill in the entered into! - However, if you are 1 squares below with your words, pop it in 'Interested in placing a lineage trade a an envelope along with a cheque or please contact Mall 1972100postal order made payObte to MEAN NOW! MACHINES and send It to: Due to deadlines. ottbw up to six weeks MEAN MACHI PIEGAMART, for yogi:Vert to appear in the magazi MEAN P4CHINES megomort Is for pri advertisers only. Anybody sending in a trade advert will not have it published. .1/0• FILLINTHETOPBOXFORC204/OR OR FORA frEgAGE. riLL,NeoweatsFORONLY 40PLEASENOTE:ONLYONEWORDPERBOX.PHONEN,ASERSCOUNTASONEWORDTHENFILLINYOURNESSAC7E•USECAPITALSANDWETOAvOID161E5GHEADING(TICf( BOX)...
![](https://assets.isu.pub/document-structure/220912162747-2c4c3b82884041f3c65bc178c7feed7a/v1/d8c6656240363d859cbb8b2c6adbbcf6.jpeg)
NEXTMONTH
"What is it Rich?"we ask in tentative unison. He turns slowly, a grin beginning to absorb his features.
you've gotta give 'em more than that. TheOctoberissue of MEANMACHINESis gonna be the biggest and best yell I don't want our rivals left for dust, I wont them reduced to dust itself! Dead! Out of the picture! HAVEYOUGOTTHAT?!!" Again a silence falls. We look to each other... And slowly we start to recognisethe smiles on each others laces, the some look of fiery determination in each others Nexteyes.menth's issue is going to be even hotter than this one. Now can this be possible? Well buy the thing and found out! Doh!! "YOUBETBOSS!YOUBET!"weallcry,whoopingandscreaming,andofferingeachotherhighfivesandoggressivehandshakesaswereturntoourseats.(heckouttheOctoberissueofMEANMACHINESSEGAioreapthefruitsofthistypicalofficepep-talk,anddon'tforget:lunchisforwimps!
"The may, it's good but its not good enough!" Gaspsand mutters rise slowly to the air. "But boss,what more can wedo? We already have more reviews, previews, tips, news,competitions and reader interaction than any other mayon the market. Ourrivals are nowhere, we've left them for dust! How doyou expect -" "-I SilenceTHERE"ANDhisingcomesINGEXPECTNOTH-BUTTHEBEST!"Rich'sboom-replyasheslamsfistonhisMacintosh,WHENYOUGETIEXPECTBETTER!"folklikeashroud over the laces of all of us.Rich closes his fists, hisknucklesgrowing whiter. "Youknow what mymotto is?" he says, "There is no suchthing as the end. When you reach the top of the mountain learn how to fly!..,. Now I know you all push yourselves to limits that most can
![](https://assets.isu.pub/document-structure/220912162747-2c4c3b82884041f3c65bc178c7feed7a/v1/3d5346e7ff0e38e207b3616ee137b593.jpeg)
onlydream of, but whystop there? Our readers expect the best, but
Aphoneslams violently in the Mean Machines office. We all turn to Rich. His eyes glare straight ahead, reflections of a fiery determination.
"We've got to make it better," he says. We stare back at him frowningly. "Make what better boss"
No other magazine covers Sega Megadrive and Mega CD like the "all new" Megatech Reviews from the cutting edge pyH•,0 Zone P. Plus razor sharp writers with Haircuts to match. Megatech on sale the 20th of every month It's head and shoulders above the competition! k.',„,01014.1!Olio BEST MEGAFORCD
![](https://assets.isu.pub/document-structure/220912162747-2c4c3b82884041f3c65bc178c7feed7a/v1/d18e0f1d65975b27d3be74978d5a7611.jpeg)
NEW MEMBERS DISCOUNT - EXTRA E2.00 OFF New members deduct £2.00 from any one item ordered as you join. SONY 14" FST ,SEVERALDfoucTANDFREEREMOTEMODELTELEVISION/MONITORCOLOURKVM1400CONTROLSCARTLEADSTATESNISSEGAAMIGAJoSTIE20OFFAGAMEOFFERCIEOFFOURPRICEOfANYGAME1001TMTOTALOEGASSIESJPUICRASEDATTHESAMETIMASTHISSONTVSOPS TOOONITOR ENABLES MONT1019 °UAL° v PICTURE FROM AmoSA, SUPE A NI. ST OR MEGA0RivE VIA SCANT CONNECTION ALSO SOTS ALL CONSOLES VIA NORMAL RE INPUT INCLUDES REAR SCAM/EURO 110 CHANNEL TUMNG BLACK TRACION SCPIEEN INVO POSTTION TILT DESIGN FOR CHOICE OF ANGLE INCLUDES LOOP AERIAL SUPERB MAUVE. ALSO AVAILABLE IN WHITE AT E199.99 ALSO AVAILABLE WITH TELETEXT AT £24999 MORE TV/MONITORS AVAILABLE PLEASE RINGTELETEXTKIMNI 1111111116Mil CPCM11112HCIPI CHUNK HI Fmrs 0,0ACE DOM SENDER .0( JAN Mk SONE Z 1 9/1196./.21 Jatin 0100110 .1 /A1 B 4061A1Sol40CPI 1 9 99 16.99 16.99 16.99 19.99 23.98 29.99 19.49 29.99 21.99 29.99 (f)1ALEXNOMEGADRIVEGAMESArtAt,woNISRODAMIO.A/. cAs•Le 16 NI AUEN 3 20 le ALIEN STORM 10 N PANNIER WORLD 2511 AND 1111drrd keglinhE 210 NUts110 JAC103 77 40 DATION 10100 019011.I0 r H..9021. p 0 MASSY 9°SCA I 21 CO BEALE , CAPIANSOblSMAMAS AMERICA 2591 COWAN PE IN ColLICH. ROCK PE GO C;o11.1CIt HOLK 2 sCol co °AWOL 3159 COUECIE ECOTTIALI 35 COOPIG35 n 99 00LuMNpi 5 91 10 :00L 5305 St Er/ 7.0.1.C91ATiO4 1194 COMP° JUSTICE 2735 2*555Z.LOI TOPos DISE.T STAMM 300L1 r-I-OP • COO-5 Fr, DOME7949CLUTCH 27 PA COOKE DRAOON PP AO DRACULA SE le MAGONS Puno 20* ECCO 315(.10,91AECILPPOIMCLUBFOOMALLSTRIKEEAGLE7M le FAE 35GOLDENAECGLOBALLLWAAPIutIMAAL1191.)129AAACIIIS1.CI391FLNTIT00111FATALAINMITERCEPTURNAN.3135LADYINETH19E9DONE1119tAMODACKSIOE.90031CHAOTJ3610Ai°HOSTSKS11GLADIATORSAGS,33*IX!11 MEGADRIVE JOYSTICKS "Pa DAC A.,31 SG •ROVAD ov.TH NOR MOTION AND ENO SPEED 24030 12151 MOE EMAGAGESWITH COLUMNS GAME FREE BLACK CARRY BAG FREE MAINS ADAPTOROIJMKJOY PODT PEDAL FOR INCINNnoavettennUINGAORNEMPPOIPENAESAINCANNWePoINCorti3391 ANDNONMEMNIMARASTMIOOLP/CAA°DLO* MOTOR INCIANTAIAL SININOTH 1/10100900.01 AND SHOCK ABSOINED 80011 N OE t*; $TIMMODNArenDIPARtotryDPAJO1011.01I HEADPHONE SOCKETI GAME15.35GEAR SEGA MEGADRIVE WITH SONIC TWO SEGA JOYPADS AND E20 OFF A GAME OFFER IMAGYNAPPO20.,daidIll[.SEGA MEGADRIVE WITH THREE GAMES TWO SEGA JOYPADS SONIC THE HEDGEHOG EA ICE HOCKEY & JOHN FOOTBALLMADDEN GOLDEN A TE 3 31 ORANDEK91 AM 'TENNIS 3135 OMISTER HIROES 00011,6 E9 99HALATINGHAIIONNI 31 31005 3009 INDIANA JOAIDE 2999 JACKNICKLAUS PENER CHALLENGE DOLF 2195 MAME POW 3. NOE JOHN ANC001110 2911 ..Kolt. MOVEN AND EA ILE ANGAIHOCKEY4.14.1I0 35149 ANAMERC PAAK 3191 orkG 41 Ne PONTOS 2445 LELIA/MOS 29 91. .074.6 TIMID WINNE 2.95 LAAMINLIAPIS • 3994 MELtA CO MAMA as BE RUCS le 99 MILE/ APE) OcNALO 2919 INPUT PACAISE 79 91 NCR) PAACHNES 2791 LOGIC 3 PROTECTOR CAlen CASE GAME Of AN MAINSTURBO 2 RAPID PPE 301940 RIN 11010A0N95 OWN AuTOPINE AMC90710491SLOWVE SAITE IL MEGAPAD I •001CADLINIANOTIOMOWSL915*0109*1755'IllNINA INGATIASTEN II JOYSTICK WITH AUTOEIRE MDR MOTION MO pOOT CARLE 011010101 C1001 LEADS34.35MNnFIGHTER P. OT 0 so NCOMOIA.PER 111.35 MON A_ PONIA I ION ILINIMPAPO AL I 1.0.0110 361E0 NH/1913/10.19521AP.E.74.3,111.1CE TOCKEV .270 NHL ILA INGOKET to _NEE OLYMPIC GCLD n 91 PGA10,10,1,CAJT/11110DOLP 2 10 It POPULOUS ISM POPULOUS 2 PONSAMCN-SER91019 M NNW 3 ISO FMAIGER t 30 II REVENGE ROADII.9SHINA0RASH Elle ACND RASH II OE AocKEiPePeovooSEMAL0fo005 7 001.0ADMINGAILSKNOW3191TO7.1(RESCUEPe 0 MANN 2 300 NANA SteltA 9O19GQ NIG 12000. n 1 0112WN01 ROTATOR LIAO FOR INGADRIVI to 599122 IN z 11001011 'CART LIAO PON 100ADRIVE • CONNECTS TO TELEVISION WIN SC NM INPUT 1011EB90150001 CsoLuT, pycouni GG GAMES ALAN b ALAErt GETMAN11140010011AITURIN ....21. SA ono(Coo0C9CnE9*TTISTOAINMASTERMOCKROCKI ION 09 CPINITAL RAIANDRE DONALDDEVILININACA ss, (COO TNE DOLPHIN _N. 1011180LA ONE 11.400 GIVESTILARTMEN,ternLOGIC35FROMSEGA$EGAACCESSORIESMISCELLANEOUS101MARIOCMARCORMIWOBATTERYPACKINN:PINPINNINLEMAINSADAPTOR)213RECNARGANLEBATTERYPACK100SATTER'COMPLWTO23HOURSPLAYMAINSADAPTORstomata,.nesGALAN&GLGLADIATOR,0011111N...211le001.04AJONE1nWI251.UOIIO20T34POIMONTANAILLS1.1FOOTBALL.0OEANNUMPARK24LEADIe8001010EOMLEMMINGS22WAITEOPDIUMMENSvtleINCREYNOUNIIINOEITEOMz24I*KOWAGAVE%nISCAPIAPIC005.0aa0110.0EUROPA. /MULL RIDER 1SHOP T 8.99 WI-IXL klbbaP le SMOA POWER AOC CONVENT/A (ALLOWS USE OF MASTER SYSTEM CLAPOESi 71 35 6OLUIpLIASONIC & swampCUDDLYTAILSTOYS12.99EACHTASMANLAu00E-1•O116.99.(_04Ct39leTE mANA7011 25 SfoINOES91 3 NETtPW1 OF TIPMNATOP 7 NENACEn 'NE Nit,A 19A11E11 29 ES LI21 11 WIGAN •0022101110111IIVCITCnISIDE SCNC z 25 3529kegoechitene59 SPEEOLIALL 2 IA ,m , I AM ISPLIERMANPIet,DONS t. 0 ME MAI AND EAR, 21 S1EE191 TALONS 2935 TOu 1491 STREETS°. SAGE 21 99 TRANCES 1Nettil 2191 EITHEEIS OF PAGE 2 340 TORSO OUTPAPI II 10 STREMR 19 99 tuinACAN 2199 sTRDER 2 36 99 u4.11411E SOCCER 30 99%seen c.te.LEaot 7991 1/A.Pb.EED Js 01 liunal tkr_NERS 2999 vet.w. / ./0,/ TONES 90 SkAPNI50 .ANCI CN 1619E Work / SUPER0017GAMESO.-.OFF 24 OE VALDE N LIZZiE So SS SIPEA Co 54.101110.NitECER,ollwoorTiUHRAKi40, MIN 34094S E9 54.1091271111W00.120,//ERNI." ON 2609 maiTmeseet=m nAs LE 0 ,13 Wil v MINNA 2E911 PCTOLL2 CuP ITALIA 10 IS IS 7E000 CLASH 36 el WRES LE TEC110130WARCUPSOCCER 3099 W.0. NRESTLEENVO 21 le TEENAGE NUMMI' AMEN PI SO 4.9E110 TuorlEs 1493 271 9)1 ila16WealACTIONPIEN.AY POO CA/10119W Foot iseGAOSIVE tALLOWI CHEAT MRS TO OE ENTIND TO 0* 01 1 OARSNUIVTI171000S.VELIENITINFI0111GENE POP INCLADONT 10001111 11/01002119 ALLOW, CHOI COOPS TOME ENTIRE° FOR DIRMITE Lett CREWS ETC. 0009 Oo CODES INCLUDED) 3010 MEGA CD WIT /, 5 GAMESCDACECOMA CORSON° SECLA CLASS/CSMASS. SUPER MONACO WOO PRO PHONE (CA im AKAN. ry 249.99 MEGA CD GAMES AFTEROMMER3 31 911 MONT MAP COSI SAIMAA RENNIN 3535 NM It RAN OP te OE SLACK ROLE NANA 19 .0001 OE PERNA 13 CISKEI91 ROCK a 190A0 AVENGER 4455 CINCA ROCK 2 $ON OP CROCK SS* Nein Woe 42 91 III, WE ILI OCit NOS MES 3135 311E SHERLOCK WX11116 2 3635 MEE 11.11109101.301 32 el JAGUAR /INN 34119 ERNE 0010 r MS 31 90 WOLF CIELD 2955 SI PowERETINKIPsittEttioPERIMPSYCHC1001.0 13 .0 ROAD INIPMER eto *9.35 Cor0Tal • 14 OE ROGOCOO 0 SENNASUPER MENAI* IS II 14499054 el 311.1011 .22 OE SIMPIEDIN PE SLOE* 11, SOUTAR POKER .13. DE $ONIC 2 22. OE IONIC THE HECK21.100 .12 SPIOCAMAN _EL II IS OE RAGI Plt 37 2101FO12S111,SEGA CAR ADAPTOR FOR CAME CIEAll PLUOS NTO COCOA UGNITIEN FOR ocontl 13.11 attsmu ISAGebite frOa GAIN deall WILE WORK iR CONJUNCTION WITS et' ItHu WAR Milne it St IIIINLI GEAR NASTER CONVERTER (ENABLES 0 CARTROGESEMSTSYTERMASOF214 0 , PONipCICAPGAVE 129.99EAT1119mat8.9911121-1XLFORAFREE12PAGECATALOGUECALL0279600204trattaWaal.,N19STREIER2.1116SUPERIICA0e,•asnsueraMONACO(MP191issuPERconPooMetanssIS$VNIPIPACEINVASPII23PPAWSUPERMAN24PESURF004.16124PESETAMARA23NEATOLLEo,9019.0CUPsoccEA9/SAet111111/NATOR22leTONAROMono5599etuLTRICESOCCER3495 ▪ VIIIMILE0361 TENNIS 3941 Wsso ore/ 01004 olk,M L), 10 002000/A16st/Colers 0/ AN morIng 015e5 WI NA gar.to• Erd poteptloyall O 1011209il 011006 Moomerm5 Moo , S490.3 Gent Geo , NESSowGErnebay, PIES. 1'MA. Ann. Mar me12110COPCSTAMR MIC Anc. No 90 •.1,n5 Ard cmktly SECA TV ADAPTOR POP GAME GEAR 11 119 TWINE GAME GEAR 0410 Melilotoo 0*mb060090113 Frets HANDHELD TV! stge 0001 le Pero 1 1200001 2911 10 Non -EN 111.41SINC4CJ 404I0944 me354i1.93 ca414ao* all akt cam 1.0 READ'WIG"RegularClubMagazine noitceleSeguHruomorfESOOHC'BUYat BestPossiblePrices SAVEwith ourSpecialDeals SAVEmorewith ourXSCoupons WIN160,000 worth of prizesFREE JOINnowfrom lustE4.99 We only supply members but you can order es you )oin There s no obligation to buy and you can be any aye Just send In the form below Dr 00713 SPURS on 0272 600204 As a 1159414049504 SOeCial Reserve you'll receive r9QuSar ISSUES NRG maganne NFIG is our 48 page Wow Club roLnaine sent htronthht only to %Wel Reserve members NAG conlaels 1 The best selechon of gsmos punching, and hordware tor ell pnular tormets We are oticral Sega 010110D0 end Sorry 'Rockets 2. Revews ,n colour sod latest ulormatIon on new prodocts 3 Charts and Release Schedule to help you choose and plan 4. The best onceS MAN one purchase mill save you your lowing tee 5. HurElren CIP Specie OEMS TOO cern* at OrGes you monl beloeve 8. XS Super SOWS SAOney-Olt 00410003 worth over tab a year 7 E60.000 NOHT , TARGET010rerde.so-FREEIOUNIryeaperpolies01COMPETITIONS That's EIO 000 NOM IY e(eoLi ssue N e•uivS,e ID rnerntntt. tb011 why W11112 140,000 people hove joined Spedol 11103411114 the biggest games club In the Werisil 0279 600204 Sew to low 101094sys Soon Ea 504K &5I541T. Is Sen 2135635 edronevoek102tnotanrotnOKINHOtroltboH9w1111111504,1GoHHERE IS A SuRCHARGE OF 609 PER GAME ON YELP/I-ONE° CROEFIS You can also Fos your order to sto on: 0279 726642 N" price 19/0110110 Ott Ow 900 seH000 I 18 DAWN1 v5..0 tHest innestey Tome 000 INN may Ace ye. be AMNON P89159900.131150* 0279 600204 in chock Neleetty 1100 HOEHN 0 the OVEN 0 1 deny re awe',tine§ on were st any tee orer40CAMMACKWO reNAVIlle 01010 chimp PoIces Oren nancation I 10 € 5PIs,9191 °No 4 CILO 9945 PIN MorloNs LB 2 Soya , Ellen. Tin9140510201111OrD0111199,Hools05221Al prom .311909 v87 isre monk:en UK rompood S.9 too 00 tori. 104 oyonnois suctompos moDI, lenNen no, to Ul. /minion (o 1111111114., FM *ONTO On MI TWO TIMIS AIIIMULL WIN Sall MUMIRSHIll1410111150I4 NASD Nene UKMEMBERS 4.99 7.99 14.99 mesas IC ANNIALIS ADO 10.00 2000 OVERSEAS MOM 1 remaill /co aco MOO ✓ 'ill 0 41 NOJOOPSAREDRONACUOYTLOSERNDME.4112.04.LTHESE .S A SLACHAAGE OF 519 PER GAME ON TELONOMED ORDEN 131EA5E, Prot MI NOCA CAPITALS TALE Name ArkeesetjLJr.... 54 Ca'N,4 1t-".dCil3EPIV•L-1::)11co-1..PoMoode CAV Pleert Mechnettc L-9L Elec Men NEWrOe)atdlIcapp1(1eitromtPersIto,teEM0EFI511E11:1811018,41. UK tse ALLInfO PRICES INCLUDE UK POSTA/NI VAT CnequsP 0 AccessMastercardSvetc76061 SwF, Issue No ):10 ‘11 I I I' 1200CHNO 0201 Siralure cnettues Dove,* SPECIAL RESERVE P.O. BOX 847, HARLOW, CM21 9PH Overapaa Order, Surcharge (EC or Warta Softwira orders please add E2.00 per Item. Nomeortwere items lame sae H01125 Overseas ceders must Da pand by cradd cardL
![](https://assets.isu.pub/document-structure/220912162747-2c4c3b82884041f3c65bc178c7feed7a/v1/2ab0f2c9660e08cfcd2c682582b56245.jpeg)
Irts'ed iTrelliNerewol
In a murderous mood, Saul Morrow activates his father's tycanthropic warrior programWOISCHILD - to avenge the brutal murder of his family by the terror group CHIMERA who have kidnapped Saul's father for his biogenetic work on the creation of a perfect war machine augmented human intelligence with vicious animal instinct Now Saul steps Into the transmutation booth
ButI'm alrightn00000www
AnotherDCHIL-WOLFImmaculate concept tram VirginGames1923VirginGames Ltd Core Design All Rights Reserved Sega"•• Mega DrMi m Dyslem''MasterandareIrsdencilw al Saga Enteronses Ltd
![](https://assets.isu.pub/document-structure/220912162747-2c4c3b82884041f3c65bc178c7feed7a/v1/4a717e03ca83465707a7b02a54c6d7f9.jpeg)