Page 1


1

2

3

ÂŽ

4

PC from

MATERIAL OF CHOICE FOR OPTICAL PARTS IN LED LIGHTING 1

HEAT MANAGEMENT OUCJC\CKAUB2 :-C2K-[L4

S,[ 62-UCX2LLHCKA} • Strong heat-transferring capability • Reduced weight of LED light engines • High level of design freedom • Cost-effective production • High dimensional accuracy • Low distortion

2

" $   ! OUCJC\CKACABU2>2-UCLK}  

3

Brenntag South Africa (Pty) Ltd 11 Mansell Road Killarney Gardens Cape Town 7441 Cape Town +27 (0) 21 556 1920 info@brenntag.co.za For more information please contact Thys du Plessis on +27 (0)82 600 3777 or Rudi Verwey on +27(0)82 552 1888

www.brenntag.com/southafrica

Classifieds Aug/Sept'18.indd 92

‡+LJKUHà HFWLYLW\ !

• High temperature stability • Mechanical strength ‡,QKHUHQWO\JRRGà DPHUHVLVLWDQFH

"  OUCJC\CKA X2KCABU CSURC,VUCLK} • High half-power angle • Strong hiding power of LED spot • High light transmission • Diffusion products and colors adjusted to your requirements

4

 '!  !"

H2)R)GRLHLK­

AR)/2} 

• High light transmission over a broad range of wavelengths • High mechanical stability ‡,QKHUHQWO\JRRGà DPHUHVLVWDQFH • Exceptional purity to optimize light transmission

RUBBERS / PLASTICS / POLYMERS / LUBRICANTS / COATINGS

2018/07/18 10:37


By the way Publisher & Managing Editor: Martin Wells (martin@summitpub.co.za) Editor: Tessa O’Hara (tessa@summitpub.co.za) Editorial Assistant: Andrea Morris (andrea@summitpub.co.za) Publishers Assistant: Heather Peplow (heather@summitpub.co.za) Financial manager: Lisa Mulligan (lisa@summitpub.co.za) Designers: Jeanette Erasmus Graphic Design (jeanette.erasmus@lateraldynamics.co.za) Bronwen Moys Blinc Design (bronwen.clarke@gmail.com)

Summit Publishing cc t: +27 (21) 712 1408 f: 086 519 6089 c: +27 (82) 822 8115 e: saplastics@iafrica.com Postnet Suite 42, Private Bag X16, Constantia 7848, Cape Town, South Africa Unit 8, Bergvliet Village Centre, Cnr Hiddingh & Children’s Way Roads, Bergvliet 7945

www.saplastics.co.za GAUTENG Lowrie Sharp t: (011) 793 4691 f: (011) 791 0544 c: 082 344 7870 e: lowrieplasticsmedia@absamail.co.za KZN Lynne Askew t: (031) 764 2494 f: (031) 764 0676 e: lynne@summitpub.co.za Printed by: Tandym Print, Maitland, Cape Town SA Plastics Composites + Rubber Technology is published six times a year and focuses on these industries in South and southern Africa. We welcome news, articles, technical reports, information in general and photographs about events and developments related to the plastics industry. The views expressed in the magazine are not necessarily those of the publisher. Views expressed are not necessarily those of the Plastics Converters Association, Institute of Materials or Association of Rotational Moulders either. Copyright: All rights reserved. ISSN number: 1684-2855 (ISDS Centre, Paris) Summit Publishing: CK 9863581/23 VAT reg: 4600187902

Plastics Institute of Southern Africa

Association of Rotational Moulders of South Africa

Plastics Converters Association

PET Plastic Recycling South Africa

Institute of Materials

The Flipflopi project on the coast of Kenya involves constructing a dhow sailing craft where the structure of the hull is built of extruded, mingled recycled plastics and the outer coating layer of a patchwork of GLVFDUGHGRUUHWLUHGÀLSÀRSVODPLQDWHGDQG bonded on to the structure. Sea trials are due to be conducted and we hope it’s successful as a maiden voyage from the island of Lamu off the Kenyan coast to Cape Town is planned – see page 36

‘Wraprage’ incident EVER since former PackagingSA director Charles Muller advised us about the dangers of ‘wraprage,’ I’ve been cautious when KDQGOLQJQHZSDFNDJLQJEXWDOOZDVÂżQHÂŤXQWLODUHFHQWYLVLWWRWKH supermarket, where my favourite chewing gum was not in stock. No problem, the alternative (from the same manufacturer) looked ÂżQHEXWSURYHGVOLJKWO\GLIÂżFXOWWRRSHQDWÂżUVW$IWHUWU\LQJIRUDIHZ minutes (admittedly at the gym where the lighting was not that good) and instead of calling the bomb-disposal squad, I bit the corner of the thing, and CHING, a shard of enamel shot off. The result, the R9.99 cost of the gum led to a dental account of a multiple of x150. The other result was an immediate change of brands.

Rioters compromise themselves THE persons behind the burning of the main recycling centre in the Cape coastal town of Hermanus, Walker Bay Recycling, have in a VLQJOHVWHSWDNHQDWOHDVW¿YHVWHSVEDFNZDUG7KHPXOWLPDWHULDO recycling business run by Jannie van Niekerk, was processing all the recyclable materials collected in Hermanus’ separation-at-source system, one of the few such initiatives in the country which actually works and which provides work for an estimated 200 people. Walker Bay Recycling was torched during recent protest action by residents, mainly due to its close proximity to the settlement where the riots emanated from. It was also damaged during similar protests earlier in the year. Now, instead of providing work opportunities, the business KDVFORVHGDQGLWœVKDUGWRLPDJLQHKRZUHRSHQLQJFDQEHMXVWL¿HG

Why didn’t Competition Commission investigate SOEs? WE were just thinking of suggesting that the Competition Commission should have investigated unfair practices involved in some of South Africa’s state-owned enterprises, such as Eskom, SAA, PRASA and others. Now that the activities of the management of these SOEs appear to have been curtailed by closer inspection following the appointments of new Ministers of Finance and Public Works, as well as a new head of SARS, it may be too late for that. But the Commission has recently come up with another plan, the Competition Amendment Bill, Section 18A which seeks to intervene LQPHUJHUSURFHHGLQJVLQYROYLQJIRUHLJQ¿UPV$V\RXNQRZVHYHUDO global businesses have purchased SA moulding companies and groups and although the jury may still be out as to whether that was good for the local economy or not, an even worse scenario in our view would be to be totally ignored by global businesses.

METHING HAVE SO ‌ IF YOU TO SAY de: if you e bright si Look at th wisdom to of m ge e have som e to us at ease writ impart, pl frica.com ia s@ tic saplas


Volume 16 No 4

AUGUST – SEPTEMBER 2018

Contents

We supply a complete range of polymers including:

Find out more at www.saplastics.co.za

• Polyethylene (HD, LD, LL & MLL) • Polypropylene (PP)

INDUSTRY NEWS Safripol, a new chapter

6

CTP Flexibles, Vegaplus 1000 machine ups heavyduty bag production

8

• Polyvinyl Chloride (PVC) • Polystyrene (GPPS; HIPS & EPS)

20

New technologies feature at Plastics/SA’s Innovation Forum

10

Extrupet, Africa’s largest PET recycler unveils expansion plans

12

• Engineering Plastics

Quadro bought by global iPackChem group

14

• Masterbatches and Additives

• Polyethylene Terephalate (PET)

SA beats European recycling rate

16

Safety of %3$FRQ¿UPHGLQODUJHVWHYHUVWXG\

20

Plasti-Tech moves to new premises

22

Global and local expertise Global and local expertise 85

Pick n Pay¿UVWUHWDLOHUWRWULDOFRPSRVWDEOHEDJV

34

Emeraude is a committed polymers • Emeraude is a committed polymers distributor providing integrated solutions & services worldwide

)OLSÀRSL, Turning the tide on ocean pollution

36

Woolworths to contribute to zero packaging waste

38

RecyclingPXOWLOD\HUIRRGSDFNDJLQJ¿OPV

38

Africa’s pollution crisis warning

44

G7SODVWLFVFKDUWHUGHWDLOVVRPHVSHFL¿FJRDOV

44

ENVIRONMENT

• Emeraude has been distributing polymers for over 30years • We have operations in 86 countries We have operations in 86 countries 66 and local in 15 countries and local presence in presence 15 countries

PETCO aims for 70% PET recycling target by 2020

52

PETCO: Boost for recycling SMMEs

54

Plastics/SA: Plastic Alternatives – Blessing or Curse?

56

Polystyrene recycling at Old Mutual’s Mutualpark

60

67

DESIGN Design innovation in plastics, balcony shelf wins

74

WORLD UK predictive maintenance fundis Senseye expand

82

Covestro awarded innovation prize

84

92

Contact

ASSOCIATIONS 2I¿FH 6RXWKHUQ$IULFDQEUDQFKRI¿FH

Trevor Moroney: 072 224 4221 trevor@emeraudetrading.co.za Martie Weitsz: 083 265 7978 martie@emeraudetrading.co.za

082 901 0477 Lance van der Merwe: 082 901 0477 lance@emeraudetrading.co.za

www.emeraude-international.com www.emeraude-international.com

ON THE COVER Recycling of PET containers is arguably one of the most straightforward of the plastics recycling processes, but running it optimally and costeffectively remains a major challenge. Read more on page 39


News At last ‌ a party! Safripol has grown into a regional giant, or at least let’s say the business has expanded its activities to now include the other KAP Chemicals manufacturing businesses, Hosaf and Woodchem. The latter have been renamed Safripol Durban (with its PET range being renamed Aspire™) and Safripol Piet Retief (manufacturer RIXUHDIRUPDOGHK\GH 7KHSDUW\ZDVKHOGWRFHOHEUDWHWKHRI¿FLDO opening of the Safripol Durban expanded PET plant and to mark the start of a new chapter for the expanded Safripol business, with the band Swing City entertaining industry VIPs at a high-rise building in Sandton on the beautiful full moon night of 25 July – see page 6-7

Alternative enviro solutions are brilliant ‌ but will almost certainly cost you more THIS ISSUE

‌ and consumers aren’t going to change their ways easily

4

AUG / SEPT 2018

W

E LIVE in challenging and interesting times to say the least‌ and now it’s becoming complicated too, very complicated actually.

But as they say, there’s nothing like a new injury to help forget about the old one(s). Such is the stuff that convertors have to deal with (and mind you, all the suppliers too) that now, besides having to manage increased VAT, incredibly little support from government, BEE and transformation, unions and so on, we are now also being told that, actually, our products are not a good environmental solution. I don’t know about you, but just lately I’ve got into some heated arguments about the merits of plastic products. Some well educated people have even suggested that plastic bags be banned immediately, like the end of this month. To be honest, it hasn’t been that great ‌ but I’ve been keeping my side up and reminding people of the many advantages created by polymer solutions. The criticism levelled at the industry globally is not unjust, but the development of the many plastic product solutions now in place has evolved over the decades in partnership with brand companies and virtually every other sector, be it in transport, medical, mining, agriculture, IT, cosmetic and millions of other applications and making changes overnight is impossible. Another point frequently raised is that of ‘too much packaging,’ whereas I have yet to see any convertor or brand company using too much packaging – it’s just too expensive. Okay, let’s accept that many of the environmentalists are ÂżUHEUDQGVEXWZHÂśGEHQDwYHWRWKLQNWKHSUREOHPZLOOJR away (which some of the top guys think will happen) and as a result we’ll need to develop alternative solutions‌ which is the main thrust of this issue. This refers SDUWLFXODUO\WRWKHĂ€H[LEOHVVHFWRUDVÂżOPDQGEDJVDUHWKH main contaminants globally. But let’s be fair to the guys,

their packaging solutions are very suitable and achieve all WKHUHTXLUHGFULWHULDÂŤEXWĂ&#x20AC;RDWLQJDURXQGWKHRFHDQVLV giving us a bad rep. In this issue we bring you a bunch of articles about alternative materials developments, most of which are very attractive â&#x20AC;Ś but with the only certainty is that these solutions will cost you more. Bearing in mind that the majority of consumers are probably going to continue doing almost exactly as they have, one will need to be very careful when making changes. Most if not all of us are committed to keeping plastics litter to an absolute minimum, so maybe you can diarise events lined up for the Coastal Clean-up 2018, with the main day being Saturday 8 September. Get out there and do something good on that day, please! <RXZLOOSUREDEO\ÂżQGWKDWWKH problem on South Africaâ&#x20AC;&#x2122;s beaches is not quite as bad as is being widely reported, but we still need to come up with solutions to keep the enviro lobby at armsâ&#x20AC;&#x2122; reach.

(

Too much packaging? Really? Itâ&#x20AC;&#x2122;s just too expensive to do anything unnecessary

Martin Wells Publisher

Martin Wells,

4.indd 4

Publisher

2018/08/01 13:53


75959B

WE’VE BOTTLED INNOVATION TO BENEFIT YOU AND, FUTURE GENERATIONS. That’s why our NEW Safrene® E5560PZJLY[PÄLKI`[OL^VYSK»ZMH]V\YP[L ZVM[KYPUR»ZIYHUK Our new Safrene®E5560 resin is designed to decrease the weight of a single piece HDPE carbonated soft drink closure. Developed in conjunction with world’s leading manufacturer of compression moulding equipment, Safrene®E5560 ensures excellent processing capabilities, maintaining excellent strength, stiffness, toughness and recyclability. The benefits include:

• • • • •

Improved stiffness for lightweighting Improved stress crack resistance Excellent tamper-evident band performance Improved dimensional stability Adherence to stringent environmental sustainability standards

For more information about South Africa’s preferred polymer partner, visit safripol.com

75959B-Safripol_SafreneE5560_Straws.indd 1

A Division of KAP Diversified Industrial (Pty) Ltd.

2018/04/04 4:27 PM


News

Blaas hom! â&#x20AC;&#x201C; The brass band Swing &LW\ZHUHLQIXOOÃ&#x20AC;RZIURPWKHZRUG go, placing current and classic hits and intermingling that with some impromptu jokes about all and sundry at the event in Sandton in July

Safripol group with integration of Hosaf, Woodchem businesses Safripol brand now includes PET, wood chemicals

6 AUG / SEPT 2018

3+2726'$9,'&(587,

A NEW chapter has commenced for leading South African polymers manufacturer Safripol, seeing the inclusion of fellow KAP Chemicals group businesses Hosaf and Wood Chemicals SA to the Safripol brand and implementation of a group wide management systems for the three manufacturers, creating the opportunity for the expanded group to be benchmarked internationally. Safripol, a manufacturer of various grades of high density polyethylene and polypropylene, was purchased by KAP group in late 2016 in a R4,1-billion transaction and became part of the KAP &KHPLFDOVJURXSRI¿FLDOO\RQ-DQXDU\ODVW year. Other members of the KAP Chemicals group include Hosaf, the PET manufacturer RSHUDWLQJRXWRI-DFREV'XUEDQDQG:RRG Claudia Pollard cut the ribbon to unveil the â&#x20AC;&#x2DC;newâ&#x20AC;&#x2122; Safripol, with chief commercial offer Bernhard Mahl on standby

Chemicals SA, a manufacturer of urea formaldehyde (UF) resins for the panel industry based in Piet Retief, northern KZN. Woodchem is the largest producer of wood panel resins in Africa supplying IRUPDOGHK\GHLQWRPRUHWKDQGLIIHUHQW industries in South Africa. In the rebranding process completed on -XO\+RVDIKDVEHHQUHQDPHG6DIULSRO 'XUEDQDQG:RRGFKHPDV6DIULSRO3LHW Retief. An integrated management system for the three manufacturers has now been implemented, creating a substantially larger entity which will be more competitive internationally and which, it is anticipated, ZLOOEHQH¿WHDFKRIWKHPDQXIDFWXUHUV¶ operations in terms of synergies and logistics. Following the supply problems encountered at Hosaf in the second half of 2017, when supply was interrupted during its plant expansion project, a new management

team is due to be announced for Safripol 'XUEDQERRVWHGE\WKHIDFWWKDWWKH expansion project has been completed and 3(7SURGXFWLRQDWWKH'XUEDQSODQWLVQRZ running at 550 tons a day, the intended goal of the plant upgrade. Output from Safripol 'XUEDQLVLQIDFWEHLQJUDPSHGXSDQGLV currently running at levels over 600 tons/day DQGLVH[SHFWHGWRUHDFK-XVWSULRUWR WKHELJFDSH[SURMHFWDW-DFREVIRUHFDVWV were that there was a global over-supply of PET, whereas there is now a world shortage. %XWWKDW¶VKRZWKLQJVJRLQWKHFRPPRGLWLHV VXSSO\PDUNHWRQHPRQWKWKHUH¶VDJOXWWKH next there is shortage. Of immediate relevance to convertors in 6RXWK$IULFDDQGIXUWKHUD¿HOGLVWKHIDFWWKDW the Hosaf name for its PET resins, Cazeden, is to be phased out and be replaced by the Aspireâ&#x201E;¢ name, which will henceforth be 6DIULSRO'XUEDQ¶VEUDQGQDPH6DIULSROKDV applied for the new trade name and the new

7KHSODTXHPDUNLQJ-XO\DVWKHRI¿FLDORSHQLQJRI Safripol Durbanâ&#x20AC;&#x2122;s 240K expansion project is to be placed at the Jacobs plant. Nico van Niekerk, who has temporarily relocated to Durban from Sasolburg, accepted the emblem from Claudia and Leigh Pollard, Safripol CEO

Safripol COO Bernhard was a little apprehensive before the party at the high-rise building on a full moon night, but everyone pitched up for the fun bash


The party on the 21stĂ&#x20AC;RRUDW7KH Venue, Green Park involved a cross-section of some of the top companies in the industry in SA

expands A similar strategy for Safripol Piet Retief is also being implemented. Latest chapter This latest chapter for Safripol follows a history which saw it created as a venture involving the then Sentrachem group and Hoechst of Germany in 1972; the setting up of its polymer production plant at Sasolburg (HD production started in â&#x20AC;&#x2122;72 and PP in â&#x201E;˘ 1996), its sale to Dow group in 1999, its subsequent purchase by a consortium involving ABSA and Thebe Investments in 2007, releasing it from foreign ownership, and most recently, its purchase by KAP group in 2016. The purchase in 2016 was arguably one of the more important for Safripol, as it returned it to ownership by a manufacturing group as compared to ownership by venture capital funds, bringing it back to its core culture One of the features at Safripol Sasolburg throughout this time has been minimal staff change and hence steady strengthening of LWVFRUHFDSDELOLWLHVDQGHIÂżFLHQFLHV7KHQHZ expanded Safripol business now combines a wider range of products with improved management abilities and inter-group synergies, which bodes well for both the groupâ&#x20AC;&#x2122;s customers and its personnel. Safripol is now a global scale operation with capacity for 240,000 tons per annum of PET; 160,000 of HD; 120,000 of PP and 110,000tpa of urea formaldehyde, which compare well internationally â&#x20AC;&#x201C; certainly in the emerging economy sector.

Aspire is Safripol Durbanâ&#x20AC;&#x2122;s new PET brand name

www.safripol.com

www.kap.co.za

CHINAâ&#x20AC;&#x2122;S decision to ban imports of foreign waste, including some plastics, has reverberated around the world, with recycling operations in other countries struggling to deal with the new reality. But is this an opportunity wrapped in a crisis? Some experts argue that developed nations will, at last, have to face up to the true cost of their plastic addiction instead of shipping the problem to China, which has taken nearly half the worldâ&#x20AC;&#x2122;s waste since 1992. This could spur much-needed investment in domestic recycling facilities as well as innovation in plastic manufacturing to make products more suited to repurposing. It could also invigorate the vociferous public campaign to change our throwaway culture. Last year, China decided to ban imports of 24 categories of solid waste, including certain types of plastics, paper and textiles, citing environmental and health concerns. Essentially, it is seeking to upgrade its economy and deal more effectively with its own growing mounds of trash. The material it was importing added 10-13% to its overall waste levels. Another problem was the poor quality of waste imports, ZKLFKPDGHWKHPPRUHGLIÂżFXOW to recycle and consequently hit SURÂżWVIRUWKH&KLQHVHFRPSDQLHV involved. The ban came into force in January and the effects are now being tallied. In a new study, published in June in Science Advances, scientists from the University of Georgia (UGA) found that 111 million metric tons of plastic waste will be displaced by Chinaâ&#x20AC;&#x2122;s new policy by 2030. All that rubbish will have to go somewhere else. â&#x20AC;&#x153;With plastic production and use continuing to rise, and companies and countries both committing to circular economies and increasing plastic recycling rates, the quantity of plastic waste needing a â&#x20AC;&#x2DC;homeâ&#x20AC;&#x2122; will continue to increase for the foreseeable future,â&#x20AC;? the report says. AUG / SEPT 2018 7

JUST BRIEFLY

next there is shortage. Of immediate relevance to convertors LQ6RXWK$IULFDDQGIXUWKHUDÂżHOGLVWKHIDFW that the Hosaf name for its PET resins, Cazeden, is to be phased out and be replaced by the Aspireâ&#x201E;˘ name, which will henceforth be Safripol Durbanâ&#x20AC;&#x2122;s brand name. Safripol has applied for the new trade name and the new name will be applied as current stocks with the old name are depleted during the second half of the year. According to a Safripol statement, the grade name rationalization and batch numbering system will be uniform and standardised. The naming system used before, where the target IV (intrinsic YLVFRVLW\ ÂżJXUHZDVDGGHGDVDVXIÂż[WR the name, will apply as before. Safripol Durban currently has three grades and the ,9ÂżJXUHVZLOOEHUHWDLQHGIRUH[DPSOH Cazeden 84 FRX will from now become Aspireâ&#x201E;˘ 84 FRX. With the implementation of a common SAP system from 1 July, Safripol Durban is changing the batch numbering systems for its PET materials to allow improved traceability of its Aspire product range. The new batch numbering system will be the same as for Safripolâ&#x20AC;&#x2122;s existing HD and PP materials. Typical batch numbers follow the sequence G (year of production); B (month of production); and then day of production followed by an internal Safripol code and lastly the number of the batch produced on DQ\VSHFLÂżFGD\

Chinaâ&#x20AC;&#x2122;s trash ban lifts lid on global recycling woes


News

JUST BRIEFLY

IDCâ&#x20AC;&#x2122;s economic outlook not so glum for SA plastics convertors THE worse than anticipated performance of the South African economy in the opening quarter of 2018, down by 2.2% due to lower output in the agriculture, mining and manufacturing sectors, is likely to affect business sentiment to some extent, possibly prompting a more cautious stance regarding investment decisions. This is according to the latest â&#x20AC;&#x2DC;Economic Overview: Recent Developments in the global and South African Economiesâ&#x20AC;&#x2122; published by the IDC. Fixed investment spending fell by 3.2% and exports for the same period fell by 16.5%. However, the good news for South African plastics convertors is that the SA economy is still â&#x20AC;&#x2DC;projected to post a gradual recovery over the remainder of this year, with the pace of expansion likely to accelerate in subsequent years,â&#x20AC;&#x2122; said the report. This will be spurred by an anticipated increase in spending by SA consumers on durable as well as semi-durable goods. A weaker rand should improve price competitiveness in global markets, but competing producers in other emerging markets may also be EHQHÂżWWLQJIURPFXUUHQF\GHSUHFLDWLRQV The growth outlook for the Sub-Saharan Africa region remains generally favourable (averaging 3.6% pa over 2018 and 2019), but performances will vary considerably across countries.

BRICS establishes itself as â&#x20AC;&#x2DC;global brandâ&#x20AC;&#x2122; THE political alliance of BRICS nations has become a distinct global brand in its own right, research conducted by Brand South Africa, a marketing agency of the government of South Africa, shows. â&#x20AC;&#x153;In an ironic twist of geopolitical fate in WKHVWFHQWXU\WKHÂżYHGHYHORSLQJQDWLRQV of BRICS have become advocates of free global trade and of globalisation, promoters of protection for the environment in light of global climate challenges and a force that advances the cause of an integrated, international, multipolar international order,â&#x20AC;? said Dr Petrus de Kock, GM for research with Brand South Africa: In the report, â&#x20AC;&#x2DC;The BRICS Brand: from economic concept to institution of global governanceâ&#x20AC;&#x2122;, Brand South Africa examined whether the BRICS alliance could be approached or analysed as an emerging institution of global governance and therefore a brand in its own right. The research explored how the increased formalisation of intra- and inter-BRICS interactions, the establishment of institutions such as the BRICS New Development Bank and increased interaction on platforms such as the Business Council and Think Tank structures also lead to the development of the BRICSâ&#x20AC;&#x2122; collective image.

The new Universal Vegaplus 1000 spine seal machine at CTP Flexibles in Ndabeni can produce 25kg bulk bags at a rate of up to 90 bags/minute with patch handle application. High production rates like this are necessary for manufacturers to be competitive in the bulk feed/commodity markets. The machine is part of a multi-million investment by CTP Flexibles, which is part of the Caxton group

Vegaplus 1000 machine ups heavy-duty bag New Mamata machine attaches patch handle at high speed CTP Flexibles in Cape Town, continuing with its capex programme, has recently commissioned a heavy-duty bag making machine, a Mamata system with VLJQLÂżFDQWQHZFDSDELOLWLHVLQFOXGLQJ patch handle application. The Vegaplus 1000 bagmaker, from Mamata Machinery of India, is designed VSHFLÂżFDOO\IRUWKHPDQXIDFWXUHRIEDJV for pet food or commodities such as agricultural produce, personal hygiene, chemicals and other raw materials up to 25kgs weight. The plus for the CTP production team was that the Vega unit met all nameplate capabilities exactly: the supplier, Adex of Johannesburg, advised that the machine could produce 25kg bags at a rate of up to 90 bags a minute, which is no mean feat when considering that the line also attaches

a patch handle, including a reinforced section, in a process which would normally reduce machine speed. The desired rate was achieved exactly, plus some. The new design Mamata machine also has a unique seal head system that enables it to achieve impressively quick changeovers: switches from bottom to side or twin-seal format can be run in under 10 minutes. Being modular, as most bagmakers are today, allows the manufacturer to add additional stations or switch existing stations with relative ease too. The Vegaplus 1000 machine replaces a machine estimated to be about 30 years old that was still operating nicely but was not able to meet the speed or H[WUDÂż[WXUHUHTXLUHPHQWV

The patch handle attachment station is the heart of the new system, where the reinforcement ÂżOPLVIHGWKURXJKDQGKHUPHWLFDOO\VHDOHGWRWKHVXEVWUDWHWRDFKLHYHDVWURQJHUKDQGOH

8 AUG / SEPT 2018

NEWS-CTP FLEXIBLES.indd 8

2018/08/01 10:53


The new line can make bags RQÂżOPXSWRPZLGH

production at CTP Flex â&#x20AC;&#x2DC;Ordersâ&#x20AC;&#x2122; â&#x20AC;&#x153;Orders for the new machine are being driven by our sales team,â&#x20AC;? said to CTP Flex general manager Alan Booth, adding that they were excited to be able to offer the patch handle capability, which is now virtually essential in the 25kg-plus bag area. â&#x20AC;&#x153;Itâ&#x20AC;&#x2122;s a sector we wanted to break into,â&#x20AC;?

said Booth, expressing his satisfaction with the multi-million current project. CTP Flexâ&#x20AC;&#x2122;s capex roll-out saw it earlier this year complete the commissioning of its second major WindmĂśller & HĂślscher FRH[OLQHJLYLQJLWWKHÂżOPFDSDFLW\WR UHDGLO\SURGXFHPXOWLOD\HUÂżOPVXSWR 125 micron, and print on-site at its plant in Ndabeni in Cape Town too, to keep its bagmakers more busy on an on-going basis.

Deon Kleinsmidt (right) head of the conversion department at CTP Flex and machine minders Bernadette Lawrence and Adnaan Jaftha are chuffed with the new machine

The control system is straightforward and logical â&#x20AC;&#x201C; achieving uncomplicated controls has been key to Mamataâ&#x20AC;&#x2122;s success in markets in the West

www.mamata.com ZZZFWSĂ&#x20AC;H[LEOHVFR]D AUG / SEPT 2018 9

NEWS-CTP FLEXIBLES.indd 9

2018/08/01 10:54


News Speakers at the 2018 Innovation Forum included (front): Hencharl Strauss (research group leader at the CSIRâ&#x20AC;&#x2122;s National Laser Centre), Kirtida Bhana (Plastics|SAâ&#x20AC;&#x2122;s training executive), Jacques van Eck (AVESCO, representing the Southern African Plastic Pipe Manufacturers Association), Longi Kalombo and Oscar Baruffa (PETCO); and (rear) Wayne Wiid (Association of Rotational Moulders of Southern Africa), Mandy NaudĂŠ (POLYCO), Paul Jordaan (SAVA and the Polystyrene Association of SA), Dr Vincent Ojijo (senior researcher and facility manager at the DST-CSIR Nanomaterials Industrial Development Facility), Manfred Scriba (programme manager at the DST-CSIR National Centre for Nano-Structured Materials) and Rudi Johannes (representing the South African Plastics Recycling Organisation)

New technologies feature at Plastics|SAâ&#x20AC;&#x2122;s innovation forum CSIR shares expertise in order to improve competitiveness of industry

10 AUG / SEPT 2018

THE challenges and opportunities within the SA plastics industry topped the agenda at Plastics|SAâ&#x20AC;&#x2122;s third annual Innovation Forum in Midrand in July. Organised by Plastics|SA in partnership ZLWKWKH&6,5 &RXQFLOIRU6FLHQWLÂżF and Industrial Research), the aim of the event is to encourage innovation in the SODVWLFVLQGXVWU\DQGRXWOLQHWKHEHQHÂżWV of using new technologies. Plastics|SAâ&#x20AC;&#x2122;s training executive, Kirtida Bhana said: â&#x20AC;&#x153;We hoped to encourage collaboration between industries in the plastics sector and UHVHDUFKHQWLWLHVVXFKDV&6,5WRÂżQG new and innovative solutions to the challenges that are currently being faced. Speakers at the 2018 Innovation Forum shared their expertise and capabilities about groundbreaking research that is taking place using plastics and leaders in the plastics industry, in turn, used the opportunity to share insights into some of the innovation and developments taking SODFHZLWKLQWKHLUVSHFLÂżFDUHDV´ Enhancing plastic material capabilities According to Dr Vincent Ojijo, senior researcher and facility manager at the DST-CSIR Nanomaterials Industrial Development Facility (NIDF), the CSIR is getting more involved in recyclate. â&#x20AC;&#x153;The CSIRâ&#x20AC;&#x2122;s seeks to enhance the plastics industryâ&#x20AC;&#x2122;s competitiveness via the NIDF, whose value proposition to the plastics industry includes access to research and development and testing capabilities, scalability that can speak to the industry for market trials, as well as material characterisation. â&#x20AC;&#x153;This offering stretches from the manufacturing of additives to polymer compounding to plastic product PDQXIDFWXULQJ´VDLG'U2MLMRH[SDQGLQJ on the CSIRâ&#x20AC;&#x2122;s ambitions to contribute

to improving the plastics industryâ&#x20AC;&#x2122;s FRPSHWLWLYHQHVVWKURXJKWKHEHQHÂżFLDWLRQ of locally sourced polypropylene. The CSIR is able to compound 10-20kg/hr of PP at its facility where it DOVRGRHVPRGLÂżFDWLRQVDQGJUDIWLQJ to produce a material that is more rigid and tougher, called Polyzimo. The patent application for Polyzimo has been made in three countries, besides South Africa: namely China, India and the USA. â&#x20AC;&#x153;We want to partner with industry members to commercialise this material ZKLFKDOORZVIRUEHQHÂżFLDWLRQRIWKH KRPR33WRH[SDQGLWVDSSOLFDWLRQV´ Dr Ojijo said. 3D printing using recycled plastic Dr Hencharl Strauss, research group leader at the CSIRâ&#x20AC;&#x2122;s National Laser &HQWUHH[SODLQHGWKHEHQHÂżWVDQG capabilities of 3D printing and how this technology can assist the plastics industry through material development, system development and testing. â&#x20AC;&#x153;The lasers developed by the CSIR have a wide range of application in the plastic industry, including welding, 3D printing of parts for military and healthcare sectors from a wide range of polymers, and additive manufacturing of LQMHFWLRQPRXOGV´'U6WUDXVVHODERUDWHG Developing bio-based and bio-compostable polymers The CSIR is currently also investigating the value-added use of agricultural biomass residues, from (for instance) the sugar cane and wood industries for the development of sustainable bio-based polymers and chemicals. Dr Manfred Scriba, programme manager at the DST-CSIR National Centre for NanoStructured Materials, invited the recycling industry and brand owners to continue ZRUNLQJWRJHWKHUWRÂżQGVROXWLRQV

Keeping food fresher for longer with new generation plastic packaging Lonji Kalombo, principal chemical engineer in materials science and manufacturing, discussed the CSIRâ&#x20AC;&#x2122;s new and patented technology to include active ingredients such as an essential oil to keep produce fresh for as long as possible. This new generation active packaging is made from fully recyclable plastic that is also safe to use, environmentally friendly, anti-microbial, anti-bacterial and contains antioxidant agents. Facing the challenges Some of the challenges being faced collectively by the speakers included: pressure from global imports, plastic packaging that is not recyclable or designed with recycling in mind, improving the recovery of waste and ensuring access to better quality, uncontaminated materials for recycling. Despite these obstacles, it was clear to see, the plastics industry is committed to succeeding, growing new markets and ensuring they remain globally competitive through adhering to international standards of quality. Dr Scriba encouraged the plastics industry: â&#x20AC;&#x153;At CSIR, we have many groups that are involved with plastics and have capabilities across the spectrum, ranging from polymer formulation and additives to testing facilities, bio-plastics development and encapsulation. We are also investing LQWKH5 'RIÂżEUHVDQGFRPSRVLWHV additive manufacturing materials and techniques, policy, strategy, governance on waste and recycling development and enterprise development, including in UHF\FOLQJ´KHVDLG â&#x20AC;˘ Inquiries to the CSIR can be mailed to plastics@csir.co.za www.plasticsinfo.co.za

NEWS-INNOVATION FORUM.indd 10

2018/08/01 10:39


You see a thin, tough film that keeps food fresh

She sees her favorite vegetable snack

The toughness and sealing of Exceed™ XP performance polymers produce packaging with eXtreme Performance. Manufacturers can protect and preserve their products from production to the table. Films based on Exceed XP are ideal for flexible and food packaging, including pouches, bags and bladders, which need to withstand demanding environments. This includes packaging for frozen food, dry food, liquid, meat and cheese products. Depending on the grade, Exceed XP offers exceptional or extreme: Toughness Flex-crack resistance Seal performance Melt strength Extrudability Cost optimization opportunities

Discover how Exceed XP can bring your packaging to a new level - exxonmobilchemical.com/pe

Exceed™ XP when eXtreme Performance matters

E0717-051E49

• • • • • •


News The PhoenixPET logo appears as if out of the shadows at the Extrupet plant, just as the PET containers it is reprocessing gain new life as rPET

Doubling up â&#x20AC;&#x201C; Extrupet joint managing directors Vijay Naidu and Chandru Wadhwani at the companyâ&#x20AC;&#x2122;s existing PET recycling plant in Wadeville. Output of the companyâ&#x20AC;&#x2122;s food grade PhoenixPET recycled PET will be doubled in the R200-million expansion recently embarked on

Extrupet unveils major rPET expansion plan

12 AUGUST / SEPTEMBER 2018

Africaâ&#x20AC;&#x2122;s largest PET recycler undertakes R200-million expansion of food grade rPET operation AFRICAâ&#x20AC;&#x2122;S largest PET plastic recycler, Extrupet, has announced plans for a R200-million expansion of its PhoenixPET operations, which will put 6RXWK$IULFDÂżUPO\RQFRXUVHWRPHHW recycling and job creation targets for the PET container sector for the next ÂżYH\HDUV According to Extrupet joint managing director Chandru Wadhwani, the planned upgrade of its food-grade recycled polyethylene terephthalate (rPET) facility in Germiston will double the current installed capacity from 20 000 to 40 000 PHWULFWRQVSHUDQQXP The target date for commencing the Wadhwani explains the scale of the soonto-be expanded plant to PETCO stakeholder relations manager Janine Basson

DGGLWLRQDOVXSSO\LVWKLUGTXDUWHU Âł2XUERDUGUHPDLQVÂżUPO\FRPPLWWHG WRWKHUHF\FOLQJRI3(7DVZHKDYH GRQHIRUDOPRVWWZRGHFDGHV7KHVH expansion plans are a testament to our willingness to support the PET industryâ&#x20AC;&#x2122;s growing mandate towards meeting the goals of the circular HFRQRP\´VDLG:DGKZDQL The PET Recycling Company (PETCO), which is the national body responsible for GULYLQJWKHUHF\FOLQJ of post-consumer plastic bottles throughout the 3(7YDOXHFKDLQ welcomed Extrupetâ&#x20AC;&#x2122;s DQQRXQFHPHQW 3(7&2FKLHIH[HFXWLYH RIÂżFHU&KHUL6FKROW] DSSODXGHGWKHLQYHVWPHQWDGGLQJ that the expansion would allow brand RZQHUVWRVSHFLI\HYHQKLJKHUOHYHOVRI recycled content and reduce reliance RQYLUJLQ3(7SURGXFWV â&#x20AC;&#x153;It certainly strengthens South Africaâ&#x20AC;&#x2122;s position as a circular economy

OHDGHULQ$IULFDDQGSODFHVXVFRPSHWLWLYHO\ within the global packaging market,â&#x20AC;? said 6FKROW]Âł7KH3(7LQGXVWU\KDVDORQJ standing commitment to use locally sourced rPET in new packaging, and in 2017, we VDZUHFRUGOHYHOVRIGHPDQGIRUERWWOHWR ERWWOHU3(7 Âł2YHUWKHQH[WÂżYH\HDUV3(7&2 aims to see jobs created by WKHYDULRXV3(7UHF\FOLQJ projects it supports grow from the current 2,400 WRRYHU,WDOVR wants to see 75,000 SHRSOHEHQHÂżWIURP YDULRXVLQGXVWU\LQFRPH RSSRUWXQLWLHVRYHU WKLVSHULRG â&#x20AC;&#x153;By entering into ÂżYH\HDUFRQWUDFWVZLWKLWV UHF\FOLQJSDUWQHUV6FKROW] said PETCO had demonstrated its commitment to supporting their growth DQGHIIRUWVWRPHHWWKHPDUNHWGHPDQG Âł7KHUHVXOWLVDFRQÂżGHQWLQYHVWPHQWE\ VWDNHKROGHUVVXFKDV([WUXSHW:HDUHZHOO on track to meeting our target of 70% postconsumer PET bottles recycled by 2022,â&#x20AC;? 6FKROW]VDLG

rPET facility in Germiston will double current installed capacity from 20 000 to 40 000 tons p/a

www.extrupet.com


Keeping our food safety standards world class

A A

For a second time in a row, Extrupet again reached a new milestone by achieving an AA audit grade for BRC Global Standards for Packaging and Packaging Materials. The BRC Global Standard for Food Safety is a framework to manage product safety, integrity, legality and quality, and the operational controls for these criteria, in the food and food ingredient manufacturing, processing and packing industry. The AA rating is the highest grade possible for an announced audit. This BRC rating, together with the value proposition of PhoenixPET, has again changed the landscape of the local rPET industry and has opened up new opportunities to our customers and brand owners.

Major Expansion Plans now underway for a doubling of our PhoenixPET capacity.

AFRISTAR AWA R D S

2016

GOLD MEDAL

Product of

Proudly associated with SAN BWA

SOUTH AFRICAN NATIONAL BOTTLED WATER ASSOCIATION

Food Grade Plant

Contact: 011 865 8360 | Email: info@phoenixpet.co.za | Website: www.phoenixpet.co.za

PhoenixPET Summit Publications Full Page Ad Final.indd 1

2018-07-27 01:33:15 PM


News Improving flow, improving lives â&#x20AC;&#x201C; iPackChem operates from impressive new 7500m² premises at Cosmo Business Park at Kya Sand, Johannesburg. Just about every detail has been taken care of in the design of the plant, coordinated by the French parent company, allowing IRUHDVLHVWSRVVLEOHĂ&#x20AC;RZIURP incoming materials to out-going moulded product. The new facility includes a well-equipped staff canteen, with part of the objective being to improve the work experience for all staff

Quadro bought by global

iPackChem group 14 AUG / SEPT 2018

1HZ)UHQFKRZQHULVSLRQHHURILQPRXOGĂ&#x20AC;XRULQDWLRQSURFHVV QUADRO Plastics, the large container blow moulding business, has been bought by the global iPackChem group, a world leader LQWKHSURGXFWLRQDQGĂ&#x20AC;XRULQDWLRQ of rigid plastic containers which is headquartered in France with converting operations in France, England, Hungary, Russia and Brazil. Quadro has been renamed Ipackchem SA and has moved to substantially more modernised and expanded premises

at Cosmo Business Park, Kya Sand, Johannesburg. The company, established by Ken Morgan in 1992 and now run by his son Simon, previously operated from Strydom Park. Ipackchem specialises in state-of-the-art barrier technologies for rigid plastic containers with UN packaging FHUWLÂżFDWLRQ,W has developed proprietary inPRXOGĂ&#x20AC;XRULQDWLRQ technology,

Latest livery â&#x20AC;&#x201C; The companyâ&#x20AC;&#x2122;s new branding has just been completed

which is new in South Africa. With this WHFKQRORJ\Ă&#x20AC;XRULQHJDVLVLQWURGXFHGLQWR the mould cavity with nitrogen during the blowing stage, achieving the required PRGLÂżFDWLRQRIWKHSRO\PHUVWRWKH barrier specs required. This eliminates the extra step usually required for Ă&#x20AC;XRULQDWLRQRIULJLG containers, which in most cases involves transporting containers to such a facility, and is hence an important advantage for the container manufacturer. Quadro manufactures HDPE containers from 1-25 litres, a large portion of which are used for agrochemicals, solvents, lubricants and similar substances which UHTXLUHĂ&#x20AC;XRULQDWLRQWRSUHYHQWPLJUDWLRQ from within or ingress of oxygen. This OHGVSHFLÂżFDOO\WRL3DFN&KHPÂśVLQWHUHVW

Ipackchem specialises in state-of-the-art barrier technologies for rigid plastic containers with UN packaging certification.


IMF â&#x20AC;&#x201C; No, in this case IMF doesnâ&#x20AC;&#x2122;t stand for the International Monetary Fund, but rather to L3DFN&KHP¶VLQPRXOGÃ&#x20AC;XRULQDWLRQWHFKQRORJ\D process which eliminates the need for the extra VWHSUHTXLUHGWRÃ&#x20AC;XRULQDWHFRQWDLQHUVSRVW PRXOGLQJZKLFKLQYROYHVWUDQVSRUWLQJFRQWDLQHUV WRVXFKDIDFLOLW\DVZHOODVUHKHDWLQJFRQWDLQHUV L3DFN&KHPGHYHORSHGWKHSURFHVV

in the South African converting business, initially in 2015. iPackChem has now completed the purchase of the business for an undisclosed sum and founder Ken Morgan has duly retired. In his wake, sons Simon and Matthew Morgan have been appointed MD and sales director respectively.

*OHHVRQ*UDFLDVDQG6LPRQ0RUJDQZLWKL3DFN&KHP¶V,62DQG DFFUHGLWDWLRQFHUWL¿FDWHV7KHVWDQGDUGVDGKHUHGWRE\4XDGUR RYHUWKHSDVW\HDUVZHUHQHFHVVDU\IRUWKHFRPSDQ\WR¿WLQWRWKH TXDOLW\PDQDJHPHQWV\VWHPVRIWKHL3DFN&KHPJURXS

African connection Ipackchem was established in 1987 under the name Airopak, a division of Air Products & Chemicals, to exploit the â&#x20AC;&#x2DC;in-line Ã&#x20AC;XRULQDWLRQ¶SDWHQWHGSURFHVV It was bought in 1991 by Boxmore International of Northern Ireland. The African connection was established IROORZLQJ%R[PRUH¶VHQWU\WR the SA market a few years later, in 1995. The business was

subsequently renamed iPackChem and expanded steadily from its main site in Saint-Etienne, France. It opened in Crewe (United Kingdom), Peremarton (Hungary) and Paulinia (Brazil), honing its systems and technologies and creating the capabilities to so successfully undertake the project with Quadro in Johannesburg. Besides HDPE blow moulding DVZHOODVLQPRXOGÃ&#x20AC;XRULQDWLRQ Ipackchem is involved in coextrusion of HDPE with PA or EVOH, as well as double-stage PET container production.

www.ipackchem.com

Lifting of 10% tariff duty on LD gazetted One of the aspects that may have affected the process was that some of the LD suppliers did not pay the tariff and appeared prepared to legally contest the tariff determination. Among of the observations made during the process was that the teams at SARS and DTI appeared well-informed and organised and impressed the industry representatives. The DSSOLFDQWVLQFXUUHGVLJQL¿FDQWFRVWVLQWKHSURFHVVIRUOHJDO IHHVÃ&#x20AC;LJKWV LQFOXGLQJODVWPLQXWHFDQFHOODWLRQV DQGPDQ hours, but it appears the likelihood of any rebates are minimal.

AUG / SEPT 2018 15

JUST BRIEFLY

INSTRUCTION to lift the 10% import duty imposed on linear was to be gazetted on Friday 3 August, or shortly thereafter, following a protracted application process by a number of the material suppliers. The original application, for the removal of WKHGXW\DWWDFKHGWRWDULIIFRGH HWK\OHQHDOSKDROH¿Q FRSRO\PHUVKDYLQJDVSHFL¿FJUDYLW\RIOHVVWKDQ ZDV submitted on 6 December 2017. The application was lodged by West African Group and MBT, with the backing of Borealis, Dow and ExxonMobil, on behalf of all players in the Industry.


News

SA beats European but more can be South Africa input recycling rate of 43.7% - well above Europeâ&#x20AC;&#x2122;s is 31.1% 7+(ODWHVWSODVWLFVUHF\FOLQJ¿JXUHVIRU WKH\HDUHQGLQJUHYHDOWKDWIRU WKHWK\HDUUXQQLQJSODVWLFVUHF\FOLQJ LQ6RXWK$IULFDKDVFRQWLQXHGWRJURZ ZLWKPRUHWKDQWRQVUHF\FOHG EDFNLQWRUDZPDWHULDO7KLVJLYHV6RXWK $IULFDDQLQSXWUHF\FOLQJUDWHRI ZHOODERYHWKDWRI(XURSH¶VUHF\FOLQJ UDWHZKLFKFXUUHQWO\VLWVDW 3ODVWLFV_6$([HFXWLYH'LUHFWRU$QWRQ +DQHNRPH[SODLQHGWKDWWKH6RXWK $IULFDQUHF\FOLQJLQGXVWU\LVEDVHGRQ HFRQRPLFSULQFLSOHVZKHUHDVLQ(XURSH UHF\FOLQJLVDQHQYLURQPHQWDOSULQFLSOH VXEVFULEHGWRE\PRVWFLWL]HQVDQGORFDO FRXQFLOV ³,Q6RXWK$IULFDUHF\FOLQJQHHGV WREH¿QDQFLDOO\YLDEOHLQRUGHUWR VXFFHHGZKHUHDVLQ(XURSHLWLVWKH ULJKWWKLQJWRGR/RFDOO\ZHUHO\RQ PDQXDOODERXUWRVRUWWKHZDVWHDQG UHF\FOHZKLOVWRYHUVHDVWKHHQWLUH SURFHVVKDVEHFRPHPHFKDQLVHG

7KHUHDUHDOVRODQG¿OOUHVWULFWLRQVLQ SODFHIRUUHF\FODEOHDQGUHFRYHUDEOH ZDVWHLQVRPHRIWKH(8FRXQWULHV ZKLOVWLQ6RXWK$IULFDZHRQO\KDYH IRUPDOZDVWHPDQDJHPHQWIRU RIDOOKRXVHKROGV0RUHWKDQRI PHWURSROLWDQKRXVHKROGVGRQRW HYHQKDYHUHJXODUUHIXVH UHPRYDOPXFKOHVV DWZRELQZDVWH FROOHFWLRQV\VWHP ZKHUHUHF\FODEOHV DUHFROOHFWHG VHSDUDWHO\RQD ZHHNO\EDVLV´ KHVDLG ³2QHRI the biggest challenges WREXLOGLQJRXU UHF\FOLQJLQGXVWU\ RYHUWKH\HDUVKDV EHHQJHWWLQJDFFHVVWR

A staggering 74% of the plastics that were recycled during 2017 were still obtained from landfill and other post-consumer sources

Tonnages Recycled

Plastics tonnages recycled into raw material in South Africa during 2017

Materials Recycled

16 AUGUST / SEPTEMBER 2018

JRRGTXDOLW\UHODWLYHO\FOHDQPDWHULDOVEHIRUH WKH\UHDFKODQG¿OOV'HVSLWHRXUFDOOVIRU VHSDUDWLRQDWVRXUFHDVWDJJHULQJRI WKHSODVWLFVWKDWZHUHUHF\FOHGGXULQJ ZHUHVWLOOREWDLQHGIURPODQG¿OODQGRWKHU SRVWFRQVXPHUVRXUFHV´+DQHNRPVDLG 3ODVWLFVUHF\FOLQJFRQWLQXHGWR SURYLGHDQLQFRPHWRPRUHWKDQ ZRUNHUVLQ 7KLV¿JXUHLQFOXGHV VHOIHPSOR\HGZDVWH SLFNHUVHPSOR\HHVRI VPDOOHUHQWUHSUHQHXULDO FROOHFWRUVDQG IRUPDOMREVLQWKH UHF\FOLQJIDFWRULHV ,QFUHDVHGWRQQDJHV SHUHPSOR\HHZHUH achieved and reached WRQV±PRUH WKDQLQ7KURXJKWKH SURFXUHPHQWRIUHF\FODEOHV DQHVWLPDWHG5PLOOLRQZDV LQMHFWHGLQWRWKHHFRQRP\DWSULPDU\ VRXUFLQJOHYHO The most popular plastics to recycle in SA 7KHPRVWZLGHO\UHF\FOHGPDWHULDOLQ 6RXWK$IULFDFRQWLQXHVWREHORZGHQVLW\ SRO\HWK\OHQHSDFNDJLQJ¿OPV ³'HVSLWHWKHFKDOOHQJHVH[SHULHQFHGLQ WKHHQGPDUNHWVIRUWKHVHUHF\FOHGPDWHULDOV DQGWKHJURZLQJRSSRVLWLRQWRVLQJOHXVH SODVWLFVPDGHRI/'3(WKLVZDVWKHPRVW ZLGHO\UHF\FOHGSODVWLFPDWHULDOLQ7KH EDUULHUWRHQWU\LVYHU\ORZDVPRVWFROOHFWRUV FDQLGHQWLI\WKHVH¿OPVDQGPDUNHWVDUH ZHOOHVWDEOLVKHGDOWKRXJKQRWQHFHVVDULO\

Sources of Recyclables


recycling rate, done to grow industry growing,â&#x20AC;? Hanekom said. PET beverage bottles continued to show a steady increase over the last four years. The drought in the Western Cape caused a spike in the sales of mineral water, which put more PET water bottles in the recycling stream and simultaneously created a growing demand for recycled content PET bottles to relieve the pressure on the limited virgin supply. Products made from high-density polyethylene such as bottles, drums and crates were the third largest recycled polymer, and the demand for milk bottles increased during 2017. The polypropylene tonnages also showed some growth, with the recycling of 33ÂżOPEHLQJLQFOXGHGZLWKWKHZHOO established woven tapes, packaging

items and domestic ware. 7KHUHF\FOLQJRIĂ&#x20AC;H[LEOH39&SURGXFWV such as gumboots, hoses and cable sheathing remain steady in South Africa, whilst the recycling of redundant waterand plumbing pipes, conduiting and JXWWHUVPDGHIURPULJLG39&DGGWRWKH UHF\FOLQJÂżJXUHV Whilst the recycling rates of plastics tell an impressive story, local recyclers often faced an uphill battle when it came to selling their material. For the second year in a row, the recyclers had more recyclate than was required by their LPPHGLDWHDQGH[LVWLQJFXVWRPHUV â&#x20AC;&#x153;Recyclables should be recognised as the valuable resources that they are, and should be removed from the solid ZDVWHVWUHDPEHIRUHUHDFKLQJODQGÂżOO All stakeholders have to work together

to make plastics the material of choice, to manufacture locally, process it HIÂżFLHQWO\DQGWRPDQDJHWKHHQGRIOLIH SURGXFWVLQWKHPRVWHIÂżFLHQWPDQQHU WKDWZLOOEHQHÂżWWKHFRQVXPHUWKH industry and the planet, using all of the H[FHOOHQWFKDUDFWHULVWLFVRISODVWLFV´ Hanekom said. â&#x20AC;&#x153;By embracing recycling as a way of life, I believe we can bring about a change in attitudes and mind-sets, even elevating plastics to become the environmental hero,â&#x20AC;? he added.

www.plasticsinfo.co.za

AUGUST / SEPTEMBER 2018 17

YOUR LOCAL EREMA CONTACT: RELLOY S.A. (Pty) Ltd P.O.Box 8190, ZA-1613 Edenglen www.relloy.co.za

THE BENCHMARK FOR COST EFFECTIVENESS.

59 euros/tonne for high-quality recycled pellets 110 Âľm filtered*

*) Production costs for recycled pellets on an INTAREMAÂŽ 2018 TVEplusÂŽ with EREMA Laserfilter, input material: washed supermarket film LD/LLDPE 98/2, 8 % moisture, calculation incl. investment costs (amortisation 5 years) and variable costs (labour, electricity, water, service and maintenance).

CAREFORMANCE We care about your performance.

INTAREMAÂŽ TVEplusÂŽ From post-consumer plastic to high-quality, top recycled pellets for only 59 euros/tonne*. The INTAREMAÂŽ TVEplusÂŽ sets the standard in terms of production efficiency and cost effectiveness: extremely low energy consumption, high throughput thanks to Counter Current technology, laboursaving through automation and remarkably low service costs. Thatâ&#x20AC;&#x2122;s Careformance!


News

JUST BRIEFLY

SA president talks marine plastics pollution at G7 summit PR(6,'(17&\ULO5DPDSKRVD has welcomed the interest shown LQ6RXWK$IULFDE\WKHJOREDO EXVLQHVVFRPPXQLW\DWWKHMXVW FRQFOXGHG*/HDGHUV¶2XWUHDFK 6XPPLWLQ4XHEHF&LW\LQ&DQDGD ,QDVWDWHPHQWWKH6$ SUHVLGHQF\VDLG0U5DPDSKRVD welcomed the interest in SA as an investment destination and lauded the â&#x20AC;&#x153;wonderful H[FKDQJHRIYLHZV´LQDVHVVLRQ he described as oversold. $FFRUGLQJWRWKHSUHVLGHQF\0U Ramaphosa regards this interest as demonstrating a recognition of South Africaâ&#x20AC;&#x2122;s new dawn - a period of renewal and rebuilding. +HFRQFOXGHGKLVZRUNLQJYLVLW WR&DQDGDZKHUHKHSDUWLFLSDWHG LQWKH*/HDGHUV¶2XWUHDFK Summit under the theme µ+HDOWK\3URGXFWLYHDQG5HVLOLHQW 2FHDQVDQG6HDV&RDVWVDQG &RPPXQLWLHV¶+HGHVFULEHGWKH *2XWUHDFK6XPPLWDVDVXFFHVV and stressed the importance of the VWURQJSROLWLFDOVLJQDOGHOLYHUHGE\ WKH*/HDGHUV¶2XWUHDFKIRFXV on developing and implementing innovative strategies to leapfrog the global effort to address LVVXHVIDFLQJWKHZRUOG¶VRFHDQV including stressors such as plastic SROOXWLRQEXLOGLQJWKHUHVLOLHQFH RIFRDVWVDQGFRPPXQLWLHV improving the protection of the worldâ&#x20AC;&#x2122;s oceans and ensuring sustainable use of marine resources. He further noted the paramount importance of strengthening the multi-lateral approach to managing RFHDQUHVRXUFHVEH\RQGQDWLRQDO MXULVGLFWLRQLQWKHVHHIIRUWV The statement added that the president shared South Africaâ&#x20AC;&#x2122;s VWUDWHJ\WRUHVHDUFKDQGGHYHORS alternatives and substitutes for single-use plastics. These actions E\6RXWK$IULFDDUHFRPSOHPHQWHG with cooperative strategies to expand marine protected DUHDVDGGUHVVRYHUH[SORLWDWLRQ WKURXJK,OOHJDOXQUHSRUWHGDQG XQUHJXODWHG¿VKHULHVGHWHFWLRQ and enforcement and supported E\DQLQWHJUDWHGVKDUHGRFHDQ LQIRUPDWLRQV\VWHPDVDEDVLVIRU the sustainable management of the oceans and its users. 18 AUGUST / SEPTEMBER 2018

Rationalisation at Nampakâ&#x20AC;&#x2122;s plastics business expected Turnaround plan in rigid plastics business in SA will see 300 employees gone NAMPAKâ&#x20AC;&#x2122;S results of the last six months to the end of March made for interesting reading: revenue was up 2% to R8.8-billion DQGWUDGLQJSUR¿WZDVXSWRRE\WR 5ELOOLRQEXW±RKKRZSUHYLRXVPLVKDSV FDQVXUSULVLQJO\FKDQJHDVFHQDULRLQ WKLVFDVHIRUWKHEHWWHU±WKDW¿JXUHZDV KXJHO\ERRVWHGDIWHUWKHJURXSPDQDJHGWR µH[WUDFW¶FDVKWRWKHWXQHRI«\RXJXHVVHG LW±5ELOOLRQIURP1LJHULD$QJRODDQG =LPEDEZHPDUNHWVZKHUHLWKDGSUHYLRXVO\ run into trouble with local legislation. But there is expected to be considerable UDWLRQDOLVDWLRQDW1DPSDNSODVWLFV business unit in South Africa. â&#x20AC;&#x153;All our Bevcan operations and plastics in the rest of Africa achieved pleasing results while the rest of the group delivered DVDWLVIDFWRU\ performance under DGYHUVHFRQGLWLRQV FKDUDFWHULVHGE\ UHGXFHGGHPDQG SDUWLFXODUO\SULRUWR'HFHPEHU ´VDLG&(2$QGUpGH5X\WHU &DVKH[WUDFWLRQLPSURYHGVLJQL¿FDQWO\ following the introduction of the Nigerian $XWRQRPRXV)RUHLJQ([FKDQJH 1$)(;  PDUNHWLQ$SULOHQDEOLQJ1DPSDN WRH[WUDFWDIXUWKHU86PLOOLRQ $ERXW 5PLOOLRQ IURP1LJHULDGXULQJWKHSHULRG 1LJHULDLVQRZIXOO\OLTXLGDQG1DPSDNLV EHQH¿WWLQJIURPDQLPSURYHGHFRQRP\LQ WKDWFRXQWU\ 'HVSLWHDVWURQJHU5DQGGXULQJWKH SHULRGJURXSUHYHQXHLPSURYHGE\ GULYHQE\DVWURQJSHUIRUPDQFHLQWKH 0HWDOV'LYLVLRQ:KLOHWKH3ODVWLFV'LYLVLRQ¶V UHYHQXHZDVÃ&#x20AC;DWVWURQJJURZWKLQ$IULFD FRQWULEXWHGVLJQL¿FDQWO\WRRYHUDOOPDUJLQ improvement.

Africa and the strong performance in =LPEDEZHVDZWUDGLQJSUR¿WIRUWKH'LYLVLRQ JURZWR5PLOOLRQIURP5PLOOLRQ A turnaround plan in the rigid plastics business in South Africa will result in a reduction in headcount of an estimated HPSOR\HHVWKHVDOHRIWZRORZPDUJLQ EXVLQHVVHVWKHFRQVROLGDWLRQRIWKUHHSODQWV LQWRWZRH[LVWLQJIDFLOLWLHVRSWLPLVDWLRQRI ZDUHKRXVLQJDQGVXSSO\FKDLQDQGDQ LQYHVWPHQWLQWRVHOHFWHGQHZHTXLSPHQW $VDUHVXOWSUR¿WDELOLW\LVH[SHFWHGWR LPSURYHE\5PLOOLRQSHUDQQXPZLWK RQFHRIIFRVWVRI5PLOOLRQDQGFDSLWDO LQYHVWPHQWRIVRPH5PLOOLRQ This will result in a more VXVWDLQDEOHDQGSUR¿WDEOH EXVLQHVVE\)< /LTXLG&DUWRQVLQ6RXWK Africa continued to perform well in a tough trading HQYLURQPHQW&DUWRQV DUHDHDVLO\UHF\FODEOHDQG 1DPSDNLQWHQGVWRJURZWKLV business through increased FDSDFLW\XWLOLVDWLRQDQGQHZ product innovation. The performance of the plastics business in the rest of Africa was exceptional DQGGHPDQGLQ=LPEDEZHZDVGULYHQE\ LQFUHDVHGPDUNHWVKDUHIURPQHZFXVWRPHUV and new products as well as management of the foreign exchange exposure through stricter credit terms. Margins improved in excess of revenue and led to better margins for the region and the division overall. ,QVSLWHRI1DPSDN3ODVWLFV(XURSHEHLQJ LPSDFWHGE\ORZHUYROXPHVPDQDJHPHQW¶V IRFXVRQWXUQLQJWKLVEXVLQHVVDURXQG managing costs and improving operational HI¿FLHQFLHVKDVEHJXQWR\LHOGUHVXOWVDQG WKHRSHUDWLQJORVVZDVUHGXFHGE\ to R11-million. This business is expected WRUHWXUQWRSUR¿WDELOLW\E\WKHHQGRI WKH¿QDQFLDO\HDURQH\HDUHDUOLHUWKDQ SUHYLRXVO\JXLGHG 7KHRXWORRNIRUWKHJURXSWKHVWDWHPHQWV FRQFOXGHGZDVWKDWRSHUDWLRQVLQWKHUHVWRI Africa are anticipated to continue generating FDVKDVGHPDQGLQ$QJRODWKHUHFRYHULQJ HFRQRP\LQ1LJHULDDQGJRRGSURVSHFWVLQ =LPEDEZHZLOOGULYHGHPDQGIRUSDFNDJLQJ products.

Profitability is expected to improve by R131-million per annum

Closures in SA &ORVXUHVLQ6RXWK$IULFDJUHZPDUNHW VKDUHDQGDQH[FHOOHQWSHUIRUPDQFHE\ Zimbabwean entities delivered a good SHUIRUPDQFHWKHUHVXOWVDQQRXQFHPHQW stated. Stringent cost management in (XURSHFDSDFLW\¿OOLQJLQLWLDWLYHVLQ6RXWK

www.nampak.com


C

M

Y

CM

MY

CY

CMY

K


News

confi rmed in Safety of BPA largest-ever study

www.bisphenol-a-europe.org

New report on important chemical released by US authorities 7+(ODUJHVWHYHUVWXG\RQ%LVSKHQRO$ %3$ FRQ¿UPHG DFFRUGLQJWR86DXWKRULWLHVWKDW%3$LVVDIHIRUFRQVXPHUV $GUDIWUHSRUWRIWKHFRPSUHKHQVLYHVXUYH\ZDVRI¿FLDOO\ SXEOLVKHGRQ)HEUXDU\ 3ODVWLFV(XURSHVDLGWKDW(XURSHDQSODVWLFVPDQXIDFWXUHUV XVLQJ%3$ZHOFRPHGWKHSXEOLFDWLRQ%3$LVDNH\FRPSRQHQW IRUKLJKSHUIRUPDQFHSODVWLFVDQGFRDWLQJVPDWHULDOVXVHG DOVRLQIRRGFRQWDFWDSSOLFDWLRQV 7KHVRFDOOHG&/$5,7<%3$FRUHVWXG\LVWKHFDSVWRQHRID PXOWL\HDULQGHSWKUHVHDUFKSURJUDPPHFRQGXFWHGE\WKH86 )RRGDQG'UXJ$GPLQLVWUDWLRQ )'$  ,QDVWDWHPHQWUHOHDVHGLQFRQMXQFWLRQ ZLWKWKHUHSRUW'U6WHYHQ2VWURII)'$ 'HSXW\&RPPLVVLRQHUIRU)RRGVDQG 9HWHULQDU\0HGLFLQHQRWHG³2XULQLWLDO UHYLHZVXSSRUWVRXUGHWHUPLQDWLRQ WKDWFXUUHQWO\DXWKRULVHGXVHVRI%3$ FRQWLQXHWREHVDIHIRUFRQVXPHUV´ ³7KHUHVXOWVRIWKH&/$5,7<%3$FRUH VWXG\RQFHDJDLQGHPRQVWUDWHWKDW%3$ LVVDIHDWWKHYHU\ORZOHYHOVWRZKLFK SHRSOHDUHW\SLFDOO\H[SRVHG´DGGHG-DVPLQ%LUGVSRNHVSHUVRQ RIWKH3RO\FDUERQDWH%3$JURXSRI3ODVWLFV(XURSH³7KLVODUJHVW ever study conducted on the topic indicates that BPA has very OLWWOHSRWHQWLDOWRFDXVHKHDOWKHIIHFWVHYHQZKHQSHRSOHDUH H[SRVHGWRLWWKURXJKRXWWKHLUOLYHV´VKHVDLG

BPA (bisphenol A) is an industrial chemical that has been used to make certain plastics and resins since the 1960s. It was previously thought that exposure to BPA could affect the brain, behaviour and prostate gland of foetuses, infants and children

( ) BPA is safe at the very low levels to which people are typically exposed

Years of research work 7KHUHSRUWLVVXHGE\WKH861DWLRQDO7R[LFRORJLFDO3URJUDP 173 SUHVHQWVWKHUHVXOWVRIDPXOWLPLOOLRQGROODUVWXG\ FRQGXFWHGIRUPRUHWKDQ¿YH\HDUVE\VFLHQWLVWVDW)'$¶V 1DWLRQDO&HQWUHIRU7R[LFRORJLFDO5HVHDUFKZLWKIXQGLQJIURP

173,WORRNHGDWWKHHIIHFWVRIGLIIHUHQWGRVHV RI%3$HYDOXDWLQJFKURQLFDQGHDUO\OLIHH[SRVXUH LQWZRGLIIHUHQWJURXSVRIURGHQWV,QWKHFKURQLF SDUWODERUDWRU\DQLPDOVZHUHH[SRVHGWR%3$IURP SUHJQDQF\WKURXJKHDUO\OLIHGHYHORSPHQWDQG FRQWLQXLQJWKURXJKWKHLUHQWLUHOLIHWLPH7KHGRVHV UDQJHGIURPORZGRVHVWKDWZRXOGEHFRPSDUDEOH WRW\SLFDOKXPDQH[SRVXUHVWRGRVHVWKDWYDVWO\ H[FHHGKXPDQH[SRVXUHV$YDULHW\RIHQGSRLQWV ZHUHHYDOXDWHG7KH&/$5,7<%3$FRUHVWXG\FRQ¿UPVWKH DEVHQFHRIKHDOWKHIIHFWVDWW\SLFDOKXPDQH[SRVXUHOHYHOV $IWHUSHHUUHYLHZSURFHVVWKHUHSRUWZLOOEH¿QDOLVHGDQGWKH UHVXOWVDUHH[SHFWHGWREHSXEOLVKHGLQWKHVFLHQWL¿FOLWHUDWXUH 7KH(XURSHDQ&RPPLVVLRQKDVPDQGDWHGWKH(XURSHDQ)RRG 6DIHW\$XWKRULW\ ()6$ WRUHDVVHVV%3$DOVRLQWKHOLJKWRIWKH &/$5,7<%3$FRUHVWXG\()6$H[SHFWVWKHRXWFRPHRIWKHLU DVVHVVPHQWWREHFRPHDYDLODEOHDWWKHHQGRIDWWKHHDUOLHVW

1 The National Toxicology Program (NTP), National Institute of Environmental Health Sciences (NIEHS), National Center for Toxicological Research (NCTR) CLARITY stands for Consortium Linking Academic and Regulatory Insights on BPA Toxicity.

Johannesburg to make recycling mandatory 20 AUG / SEPT 2018

Every home in Johannesburg required to recycle from 1 July 5($'<RUQRW-RKDQQHVEXUJLVJRLQJ FRPSOHWHO\JUHHQ$V6RXWK$IULFDIDFHV XSWRWKHGHYDVWDWLQJHIIHFWVRISROOXWLRQ LWVHHPVWKH&LW\RI-RKDQQHVEXUJLV ready to do everything it can to help the HQYLURQPHQW 7KH-RKDQQHVEXUJ&LW\&RXQFLOKDV FRQ¿UPHGWKDWDSKDVHGLQVHSDUDWLRQ DWVRXUFHUHF\FOLQJSURJUDPPHEHFDPH PDQGDWRU\IRUDOOKRXVHKROGVLQWKH

NEWS-BRENTAGG BPA.indd 20

PHWURSROLWDQDUHDIURP-XO\ 7KLVHIIHFWLYHO\PHDQVWKDWDQ\ SODVWLFVJODVVRUµQRQKRXVHKROG¶ UXEELVKPXVWEHGLVSRVHGRIVHSDUDWHO\ IURPWKHUHVWRIWKHKRXVHKROGZDVWH -RKDQQHVEXUJFLW\RI¿FLDOVDUH\HWWR FRQ¿UPKRZWKHSURJUDPPHZLOOZRUN RUZKDWUHVLGHQWVDUHUHTXLUHGWRGRLQ WHUPVRIUHIXVHFROOHFWLRQ +RZHYHU1LFRGH-DJHU0D\FR 0HPEHUIRU(QYLURQPHQW DQG,QIUDVWUXFWXUH 6HUYLFHVKDVFRQ¿UPHG WKDWKLVGHSDUWPHQWLVJRLQJ DKHDGZLWKWKHVHSODQV to help locals develop a EHWWHUXQGHUVWDQGLQJRIWKH HQYLURQPHQW

³7KHELJJHVWFKDOOHQJHWKH&LW\ RI-RKDQQHVEXUJIDFHVLVWRFKDQJH KXPDQEHKDYLRXUDQGJHWSHRSOH WRXQGHUVWDQGKRZWKH\LPSDFWWKH HQYLURQPHQWLQWKHZD\WKH\GHDOZLWK SODVWLF%XWZLWKWKHFRPPXQLW\¶V LQYROYHPHQW,¶PSRVLWLYHWKLVFKDOOHQJH ZLOOEHHIIHFWLYHO\GHDOWZLWK´KHVDLG $VZHOODVZDQWLQJWRVDYHWKHSODQHW LWVHHPVWKHFLW\FRXQFLOLVDOVRNHHQWR DGGUHVVWKH¿QDQFLDOEXUGHQWKDWFRPHV ZLWKFDUHOHVVWUDVKGLVSRVDO /XQJLOH'KODPLQL0'RI3LNLWXS HVWLPDWHVWKDWLOOHJDOGXPSLQJFRVWV -REXUJ5PLOOLRQD\HDU7KHFLW\LV QRZDLPLQJWRVDYHWD[SD\HU¶VPRQH\ DVZHOODVWKHSODQHWDVLWFODPSVGRZQ RQÃ&#x20AC;\WLSSLQJVLWHV

2018/08/01 10:59


Rapid Granulator ad '017 10-BLEED.indd 86

2018/07/04 11:45


News The companyâ&#x20AC;&#x2122;s new site offers the opportunity to run all its operations from one location, and Sebenza is centrally situated for supply to anywhere in Gauteng and has easy access to the N3

Plasti-Tech MD Brad Chamont has managed pipe systems supply companyâ&#x20AC;&#x2122;s steady growth over the past few years

Plasti-Tech moves to Pipe systems suppliers in new space World class products at Plasti-Tech

DUE TO continued growth of its business, thermoplastic piping specialist Plasti-Tech has PRYHGWRQHZSUHPLVHVRIIHULQJODUJHURIÂżFH and warehousing space. The thermoplastic piping specialist has moved to 27 Buwbes Road, still in the same area of Sebenza, Johannesburg, where it has operated from since 2011. â&#x20AC;&#x153;Three months ago we found ourselves LQGLUHQHHGIRUPRUHRIÂżFHVSDFHWR accommodate new staff members and a larger warehouse with a yard to increase our stockholding capacity,â&#x20AC;? said Plasti-Tech MD

Brad Chamont in early June. The company had recently appointed two new sales representatives, which obviously FDOOHGIRUPRUHRIÂżFHVSDFH â&#x20AC;&#x153;Having premises with a yard allows for more capacity to carry more piping stock, as well as easy loading and off-loading of trucks. The beauty of the new premises is that it allows XVWRUXQRXUIXOORSHUDWLRQERWKRIÂżFHVDQGWKH warehouse, from one place,â&#x20AC;? added Chamont. Plasti-Tech provides world-class thermoplastic piping systems and related products to the building, civil, mining, irrigation,

First commercial use of Luran S KR 2864C processed by single-stage ColorForm technology

22 AUGUST / SEPTEMBER 2018

&RVWHIÂżFLHQWDOWHUQDWLYHWRWUDGLWLRQDOSDLQWLQJ INEOS Styrolutionâ&#x20AC;&#x2122;s LuranÂŽ S KR 2864C styrenic grade has been selected by a leading global car manufacturer for a windscreen pillar body trim. This represents WKHÂżUVWFRPPHUFLDODSSOLFDWLRQRI/XUDQ S KR 2864C with the new ColorForm technology. Luran S KR 2864C is a high-grade polymer with enhanced heat resistance and the best chemical resistance among the ASA grades. Automobile component PDQXIDFWXUHUVZLOOÂżQGWKDW/XUDQ6.5 2864C processed with the ColorForm WHFKQRORJ\FDQSURYLGHDPRUHFRVWHIÂżFLHQW alternative to traditional painting and at the same time offering enhanced properties. The ColorForm technology developed by KraussMaffei is a liquid in-mould painting of the thermoplastic body material. The paint

is injected directly between the mould and the part surface. No second work step is needed. The ColorForm process streamlines painting and hardening into one. For automotive manufacturers seeking safer and more economical manufacturing of multicomponent elements, ColorForm sets QHZVWDQGDUGVLQWHUPVRIHIÂżFLHQF\7DNLQJ advantage of polyuria from PANADUR GmbH eliminates the need for mould release DJHQWVUHVXOWLQJLQDVLJQLÂżFDQWUHGXFWLRQRI the process interval periods. Manufacturing costs are lower and work waste virtually eliminated because of a drop in reject rates. The superior surface aesthetics of the ÂżQDOVROXWLRQVDOORZIRUQHZGHVLJQVZKLOH improving productivity and sustainability. &XVWRPHUVUHFHLYHFRPSOHWHO\UHÂżQHG components, high-gloss and surfacewww.brenntag.com

textured products directly generated from the tool and completed without separate re-polishing. Luran S KR 2864C used with the ColorForm technology is extremely scratch resistant because of the polyurea coating and the result also ensures longer-lasting quality and sustainability. â&#x20AC;˘ Brenntag represent Ineos Styrolution in SA

www.ineos-styrolution.com


Moscowâ&#x20AC;&#x2122;s Luzhniki )ZMVIÂź[ZWWĂ&#x2026;VO uses PC multiwall sheets

7KHQHZORFDWLRQKDVVSDFHIRUVWRFNKROGLQJZKLFKLVYHU\QHFHVVDU\WREXLOGFXVWRPHUFRQÂżGHQFH

new premises plumbing, gas and waterworks industries across southern and sub-Saharan Africa. It specialises in HDPE, PE100, PP and PP-R pipe and components; EF (electrofusion), FRPSUHVVLRQ¿WWLQJVDQGZHOGLQJSURGXFWV Ensuring quality of an international standard, Plasti-Tech is the distributor of European-manufactured products such as Hßrner welding machines, Bänninger PRXOGHG¿WWLQJV+6.H[WUXGHUVDQGZHGJH welders as well as Nupigeco EF and FRPSUHVVLRQ¿WWLQJV Plasti-Tech Piping Systems was founded in 2011 by managing member Bradley &KDPRQW:LWKRYHUDGHFDGHLQH[SHULHQFH

and networks in the plastic industry, Chamont has grown the company into a thriving business with a team that has a FRPELQHGWRWDORI\HDUVRIH[SHULHQFHLQ the industrial thermoplastic piping industry. â&#x20AC;&#x153;We understand our customersâ&#x20AC;&#x2122; needs and seek to provide a one-stop solution for all piping products. The combination of our knowledge, skills and passion coupled with the guarantee of quality products has made Plasti-Tech a preferred supplier in the market,â&#x20AC;? said Chamont.

www.plastitech.co.za

Plastic sculpture to entice visitors to Durban whale festival THEY say that one manâ&#x20AC;&#x2122;s trash is another manâ&#x20AC;&#x2122;s treasure â&#x20AC;&#x201C; but in the case of Eden College school in Durbanâ&#x20AC;&#x161; one manâ&#x20AC;&#x2122;s trash is another manâ&#x20AC;&#x2122;s whale. The pupils collected bottle tops of all shapes and sizesâ&#x20AC;&#x161; and tied them together to create the cladding for a whale VFXOSWXUHWKDWZDVXVHGDVWKHRIÂżFLDO mascot for the Welcoming of the Whales

Festival which took place in Durban from 30 June. The 80kg armature was delivered to the school for the kids to mount the whaleâ&#x20AC;&#x2122;s plastic â&#x20AC;&#x153;skinâ&#x20AC;?. The whale sculpture and the upcoming festival will be used to raise awareness about humpback whales in Durban. It is hoped that the plastic sculpture can EHH[KLELWHGSHUPDQHQWO\ Umcebo Design Creative director Robin Oppermanâ&#x20AC;&#x161; who was commissioned by south Durban-based Sodurba Tourism Association to create the centerpiece for the festival, with pupils and Deidre Mareeâ&#x20AC;&#x161; the primary school art teacher who helped facilitate the project 3+272-$&.,(&/$86(1

www.covestro.com 7KHVWDQGURRÂżQJRI0RVNRZÂ?VUHQRYDWHG Luzhniki Stadium consists of transparent, robust and lightweight Makrolon polycarbonate sheets from Covestro

AUG / SEPT 2018 23

A whale of a time

AFTER four years of renovation, the YHQHUDEOH/X]KQLNL2O\PSLF6WDGLXP came back to life for the 2018 World Cup in Moscow. It has 81 000 seats, 2 000 VIP seats and 2 500 media seats. It was the setting for the opening match and some preliminary games, further matches for the round of 16, the semiÂżQDOVDQGWKHÂżQDOPDWFK During the reconstruction phase, the DUHQDUHFHLYHGQHZJUDQGVWDQGURRÂżQJ with multiwall sheets made of MakrolonÂŽ polycarbonate from Covestro. The old URRÂżQJZDVDOVRPDGHRIWKLVKLJK tech plastic. Even after years of use, the panels showed only barely visible scratches and slight loss of colour. Around 36,000m2 is covered with 25mm thick, white-coloured multiwall sheets. Some 30 trucks were needed to safely transport the panels with a width of 1.20m and a length of 9.80m to Moscow. The X-structure of the Makrolon multiwall sheet ensures high stability in all kinds of weather and withstands even high snow loads of up to one ton per square metre. Thanks to new DGGLWLYHVDQGDVSHFLDO89FRDWLQJWKH polycarbonate sheets are guaranteed to be protected from weathering for 25 years. Another advantage is the very JRRGÂżUHFODVVLÂżFDWLRQ Cost savings of 40 to 45% are another advantage in comparison to glass roof construction. Polycarbonate sheets have a lower weight, making it easier to transport and process with much less effort. The sub-structures mostly made of metal or aluminium can also be designed in a more sophisticated way.


News

New multiOD\HUÃ&#x20AC;OPV

wrap more for less, canâ&#x20AC;&#x2122;t be charged per kg Dramatic improvements at much-reduced cost per pallet 675(7&+ZUDS¿OPVVXSSOLHU7DLJDQ 06WUHWFK3HWHU0F&XOORXJKLVSX]]OHGZK\ SURFXUHPHQWSHRSOHSHUVLVWZLWKSXUFKDVLQJ E\ZHLJKWDQGQRWE\SHUIRUPDQFH ³0\FRPSDQ\ZDVIRXQGHGRQWKHEHOLHI WKDWFXVWRPHUVLQ6RXWK$IULFDGHVHUYHG

EHWWHU,WEHFDPHRXUREMHFWLYHWRRIIHU SDFNDJLQJWKDWZDVQRWDYDLODEOHDWWKH WLPHIURPORFDOPDQXIDFWXUHUVDQGLQGRLQJ VRZHZRXOGXVHLQQRYDWLRQWRDOORZIRU RXUVXFFHVVEXWDOVRVKDUHWKLVZLWKRXU FXVWRPHUV:HDUHSURXGWRVD\WKDWWRGD\

24 AUGUST / SEPTEMBER 2018

ST R ETC H FI LM

SAFER, THINNER & ENVIRO FRIENDLY An ENVIRO Friendly Product â&#x20AC;¢ t-nano33 is developed for innovative and suitable packaging solutions â&#x20AC;¢ t-nano33 enables Customers to apply science to packages that use less, weigh less, and create less waste Skin/cling layer Bulk core layers Functional nanolayers Functional layer Functional layer

â&#x20AC;¢ t-nano33 is designed to be thinner, yet offers safe and effective load stability â&#x20AC;¢ t-nano33 beats market criteria for both performance and cost â&#x20AC;¢ t-nano33 creates an innovative approach to recyclable packaging

The next generation of stretch films t-nano33 33 layer stretch is stronger, thinner and more stretchable â&#x20AC;¢ t-nano33 provides quality. The film consists of 33 layers, is extremely strong as well as puncture and tear resistant. â&#x20AC;¢ t-nano33 provides reliability. Less film is required, reducing wrapping yields and therefore creating a significant cost saving. â&#x20AC;¢ t-nano33 ensures more secure product loads, which will ultimately reduce the risk of damage in most shipping conditions. â&#x20AC;¢ t-nano33 provides the ultimate service. This product is state-of-the-art.

TAIGAN.CO.ZA â&#x20AC;¢ JHB: +27 11 974 1811 â&#x20AC;¢ CT: +27 21 948 8215

Thinner is better! â&#x20AC;&#x201C; The writer says that procurement personnel struggle to deal with WKHHQKDQFHGSHUIRUPDQFHRIQHZVWUHWFK¿OPV WKDWFDQHIIHFWLYHO\ZUDSJRRGVZLWKOHVV¿OP 7KH7QDQR¿OPVIURP7DLJDQIRUH[DPSOH use raw materials that make a difference and allow for effective down-gauging

WKLVLVWKHFDVHDQGZHKDYHPDQ\KDSS\ FXVWRPHUVZKRXQGHUVWDQGZKDWLWWDNHV WRXVHWKHFRUUHFWSDFNDJLQJDQGSD\ SRVVLEO\DSUHPLXPXSIURQWEXWVKRZ GUDPDWLFLPSURYHPHQWVWRWKHLUFXUUHQW DSSOLFDWLRQVDWDPXFKUHGXFHGFRVWSHU SDOOHW ³:K\DUHSURIHVVLRQDOSURFXUHPHQW SHRSOHQRWLQWHUHVWHGLQFKDQJHDQGZK\ GRWKH\SHUVLVWLQSXUFKDVLQJVWUHWFK¿OP SHUNLORJUDPUDWKHUWKDQDFRVWSHUSDOOHW ZUDSSHGRU\LHOGSHUUROO" ³:HDUHH[SHULHQFLQJWRXJKHFRQRPLF WLPHVDQGWKHQHHGWRVDYHPRQH\ LVDOZD\VSXVKHGLQWR\RXUIDFH7KLV LVDOOJRRGDQGZHOOEXWZKHQWKHVH SURIHVVLRQDOSHRSOHXVHWKHZRUGVµ:KDW LV\RXUSULFHSHUNJ"¶DUHWKH\UHDOO\ ZDQWLQJWRVDYHPRQH\"$QGVRQRWORRN DIWHUWKHLQWHUHVWVRIWKHLUFRPSDQ\" ³,ZRXOGXUJHDOOUHVSRQVLEOHSHRSOH WRWKLQNDERXWUDWKHUDVNLQJWKHTXHVWLRQ µ:KDWLV\RXUFRVWSHUSDOOHWDQGKRZ PDQ\SDOOHWVFDQEHZUDSSHGZLWK \RXUUROO"¶,WLVRQO\WKHQWKDWVDYLQJV ZLOOEHDFKLHYHGDQGSDFNDJLQJZLOOEH HQKDQFHG´VDLGWKH7DLJDQ0'EDVHGLQ 6SDUWDQQHDU257DPER 7KHFRPSDQ\UHFHQWO\LQWURGXFHG DOD\HUFDVWVWUHWFK¿OPNQRZQDV 7QDQR7KHVH¿OPVRIIHUHQKDQFHG ORDGVWDELOLW\ZLWKLQFUHDVHGUHWHQWLRQ YDOXHVEXWPRUHLPSRUWDQWO\UHGXFLQJ WKHDPRXQWRISODVWLFUHTXLUHGWRZUDS SURGXFWVDQGDUHKHQFHDQHFRIULHQGO\ VROXWLRQ ³7KHGUDVWLFUHGXFWLRQLQFRVWSHUSDOOHW VSHDNVIRULWVHOIDQGWKLVLVZKHUHVDYLQJV DUHPDGH´VDLG0F&XOORXJK ³6RXWK$IULFDQHHGVUHOLDEOHTXDOLW\ VXSSOLHUVZKRXQGHUVWDQGWKHPDUNHWDQG KDYHWKHH[SHUWLVHDQGGULYHWRWXUQDQ HFRQRP\DURXQG/HW¶VJHWVHULRXVDQG FKDQJHRXUZD\V´


OVER 50,000 BLENDERS INSTALLED TO DATE SINCE WE REVOLUTIONIZED BLENDING IN 1989.

Classifieds Aug/Sept'18.indd 92

2018/07/26 12:54


News

Zerma longevity A new Zerma GSE-500/1000 granulator with driven roller-feeder system was recently installed at a leading packaging company in Gauteng to allow for faster and cleaner reprocessing of their in-house waste. The material in roll or skeletal form is introduced to the granulator via a roller-feeder system mounted on the rear of the hopper for automatic feeding while reject product can simultaneously be fed into the hopper front opening

Tracking pipeline welds for future reference

HĂźrners HST 300 Print+ 2.0 model of the Whiteline series

IN RESPONSE to the growing need for GPS weld location traceability for high-end pipe installations, thermoplastic piping specialist, Plasti-Tech, has launched HĂźrnerâ&#x20AC;&#x2122;s new Whiteline series of welding units that can record GPS location of a weld within a buried pipeline for future reference in case of a weld failure. HĂźrnerâ&#x20AC;&#x2122;s HST 300 Print+ 2.0 model of the Whiteline series is available in the SA market through thermoplastic piping specialist Plasti-Tech. The new range â&#x20AC;&#x201C; which covers all areas of application in electrofusion welding of PE, PP and 39')SLSHVZLWKKHDWHUFRLOÂżWWLQJVÂąWDNHV electrofusion welding into a new era with its ability to not only trace who welded last, but also offer crucial GPS weld location traceability. Brad Chamont, managing member of

Plasti-Tech, explains that data logging capabilities of todayâ&#x20AC;&#x2122;s welding units have only been able to address the issue of â&#x20AC;&#x153;who welded what, when and how?â&#x20AC;? With HĂźrnerâ&#x20AC;&#x2122;s HST 300 Print+ 2.0, traceability has now been extended to answer the critical question of â&#x20AC;&#x153;where is the welded joint buried?â&#x20AC;? The range features a VSHFLÂżFDOO\GHYHORSHGKLJKUHV*36 module that determines the coordinates with maximum precision of within 1m and can be used in remote areas via satellite. Bearing in mind the advanced nature of this range of welders, Chamont says Plasti-Tech offers machine orientation training with the sale of every machine. To date, 25 units of the 14-model range are already operational in the local market. www.plastitech.co.za

HĂźrnerâ&#x20AC;&#x2122;s new Whiteline series of welding units can record GPS location of a weld within a buried pipeline for future reference in case of a weld failure

26 AUGUST / SEPTEMBER 2018

Asso


proved again 7KHÂżUVW=HUPD*6&FRPSDFW soundproofed granulator was installed at this leading blowmoulding company in 2011 and this new addition to the family is the third from the same series, supplied to reduce a wide variety of containers, up to 10 litres, and other production waste

www.zerma.co.za Almost all granulators look the part when new, and most perform their required function for a time, but the same cannot be said for all granulators after 14 years of production. This Joâ&#x20AC;&#x2122;burg based injection and blowmoulding company took delivery of their Zerma GSL-300/400 slow-speed granulator in 2004 and it has continued to contribute to their ongoing success since installation. The direct drive offers increased torque and lower maintenance and running costs relative to belt driven machines, the low rpm results in less dust and noise emissions and the unique blade design means sharpening can be easily done in-house and blade setting is not required AUGUST / SEPTEMBER 2018 27

ASSOCIATED ADDITIVES

For all your PVC Processing requirements, Look no further than ASSOCIATED ADDITIVES. We offer superior Technical support and our Quality service will exceed your expectations. As an experienced additives manufacturer and supplier in Southern Africa, our knowledge, products and quality are unsurpassed.

OUR PRODUCT RANGE INCLUDES:

â&#x20AC;˘ â&#x20AC;˘

PVC Heat Stabilisers: Organic Based (OBS), Lead, Calcium/ Zinc, Barium/Zinc and Tin Processing Aids and Impact 0RGLÂżHUV

â&#x20AC;˘

Calcium and Zinc stearates

â&#x20AC;˘

Internal and External lubricants

â&#x20AC;˘

Metallic Lead Stearates

â&#x20AC;˘ â&#x20AC;˘ â&#x20AC;˘ â&#x20AC;˘

Flame Retardants Antimony Trioxide Calcium Oxide Titanium Dioxide pigment

Contact us on: +HDG2IÂżFH7HO_ZZZDOPVWDEFR]D Leanette Moodley â&#x20AC;&#x201C; Sales and Marketing Manager leanettem@almstab.co.za

Aileen Smit â&#x20AC;&#x201C; Warehouse & Logistics Manager aileens@almstab.co.za

Ingrid Lane â&#x20AC;&#x201C; Exports Manager ingridl@almstab.co.za

Thando Madlala â&#x20AC;&#x201C; Market Development Manager thandom@almstab.co.za

Associated Additives-half page ad.indd 70

2018/06/27 13:19


News

What do IoT and Industry 4.0

mean for manufacturers? Innovative technologies fundamental to digital transformation process TO REMAIN relevant to todayâ&#x20AC;&#x2122;s rapidly changing and competitive business environment, manufacturers in both developed and emerging markets will need to keep pace with the mounting changes presented by the 4th Industrial Revolution. Running alongside this yearâ&#x20AC;&#x2122;s Manufacturing Indaba in Johannesburg from 19-20 June, is the IoT (Internet of Things)/ Industry 4.0 Conference. ,QĂ&#x20AC;XHQWLDOLQGXVWU\DQGWUDGH OHDGHUVJRYHUQPHQWRIÂżFLDOV policymakers, academics and potential investors of these sectors will explore the prevalent Industry 4.0, also known as the â&#x20AC;&#x2DC;4th Industrial Revolutionâ&#x20AC;&#x2122;. IoT, together with Industry 4.0 represent innovative technologies which are fundamental to the digital transformation process that is currently sweeping across the manufacturing industry. Industry 4.0 represents the complete digitisation of factories and manufacturing facilities that will ultimately merge with the unique needs of individual customers, resulting in

EHQHÂżWVVXFKDVFXVWRPLVHGSURGXFW design, manufacturing processes and ÂżQDOGHOLYHU\WRPD[LPLVHFXVWRPHU satisfaction levels. Furthermore, a positive contribution that Industry 4.0 brings with it is a multitude of RWKHUEHQHÂżWVIRULQGXVWULDOLVWVVXFK DVFRVWSURGXFWLYLW\SURÂżWDELOLW\DQG operations that manufacturers are striving to control, streamline, optimise or enhance.

( ) Industry 4.0 represents the complete digitisation of factories and manufacturing facilities that will ultimately merge with the unique needs of individual customers

The onset of Industry 4.0 and IoT has introduced the era of smart devices which empower industrialists to autonomously manage manufacturing and distribution operations. Manufacturing units can now retrieve critical, real-time data by monitoring HIÂżFLHQF\DQGSURGXFWLYLW\OHYHOVRI employee, machinery and business operations. This enables manufacturers to constantly carry out accurate assessments, along with improved collaboration and integration amongst stakeholders throughout the entire manufacturing value chain. New insight into manufacturing HIÂżFLHQFLHVFXVWRPHUSHUFHSWLRQV and behaviours as well as pioneering product innovation equips

War on plastic triggers recruitment fallout for manufacturers THE war on plastic waste is risking a crisis in Britainâ&#x20AC;&#x2122;s thirdlargest manufacturing sector, as young people shun the industry, reports the UKâ&#x20AC;&#x2122;s The Telegraph newspaper. A survey of plastics makers has found that even though companies are well-placed for growth, they are struggling WRKLUHZRUNHUV,WLVSDUWLFXODUO\GLIÂżFXOWWRKLUHHQWU\OHYHO personnel, raising fears that new recruits into the sector are being put off by the criticism of single-use plastics that are damaging the worldâ&#x20AC;&#x2122;s oceans and marine ecosystems. Philip Law, the director general of the British Plastics Federation, said the Governmentâ&#x20AC;&#x2122;s war on plastic is being

â&#x20AC;&#x153;expressed in a way that is putting young people offâ&#x20AC;?. He warned that the political focus on single-use plastics could undermine an industry that also serves the automotive, manufacturing and healthcare sectors, and supports more than 166,000 jobs. â&#x20AC;&#x153;Policy on plastic should not put these jobs at risk or put young people off going into a sector that is critical to so many parts of our economy now and in the future,â&#x20AC;? he wrote. His warning follows a poll of more than 500 UK plastics makers, which found that half the companies struggle to attract staff and 5% have given up recruiting at all.

28 AUG / SEPT 2018

NEWS-INDUSTRY.indd 28

2018/08/01 10:37

Niss


News standards in the manufacturing process. People have limited capabilities in hazardous situations, while the FRPSHWHQFHDQGHI¿FLHQF\RIPDFKLQHV have proven far superior in such environments. Successful assimilation of these revolutionary solutions into their operations allows manufacturers to increase industrial safety, ultimately alleviating unfortunate workplace accidents and costly Workman’s

Compensation claims. The advent of Industry 4.0 brings with it an automated closed-feedback ORRSWKDWVLJQL¿FDQWO\UHGXFHVWLPH consuming feedback accumulation efforts on products and services. This ultimately results in meticulous recordkeeping and tracking capabilities, while controlling liabilities, warranty expenses and recalls.

AUG / SEPT 2018 29

manufacturers with revolutionary competitive advantages. These advantages allow for the replacing of traditional manufacturing operations with advanced material requirements planning (MRP) models as well as cloud manufacturing execution systems to name a few. Industry 4.0 and IoT initiatives also offer industrialists opportunities for improved implementation of safety

www.manufacturingindaba.co.za

2018/08/01 2017/07/25 10:37 12:48


News

Haitian sees remarkable growth in international markets

30 AUGUST / SEPTEMBER 2018

More than 35 700 machines delivered worldwide DUE to strong market demand and further implementation of successful strategies, Haitian International, one of the worldâ&#x20AC;&#x2122;s largest manufacturers of plastic injection moulding machines, has achieved a UHFRUGKLJKLQLWV¿QDQFLDOUHVXOWVIRUWKH ¿VFDO\HDU Sales revenue reached (Chinese Yuan) Â&#x2013;PLOOLRQODVW\HDUUHSUHVHQWLQJ DQLQFUHDVHRIFRPSDUHGWR 7KHFRPSDQ\GHOLYHUHGDUHPDUNDEOH PDFKLQHVZRUOGZLGHWKURXJK UHSUHVHQWLQJDJURZWKRIFRPSDUHG WRDQGUHSUHVHQWLQJDUHPDUNDEOH footprint of Haitian International in the FRPSHWLWLYHHQYLURQPHQW Haitian Internationalâ&#x20AC;&#x2122;s domestic VDOHVUHFRUGHGDQLQFUHDVHRIWR Â&#x2013;PLOOLRQ DSSUR[PLOOLRQ  IDUH[FHHGLQJLWVLQGXVWULDOSHHUV7KH FRPSDQ\¶VFRQWLQXRXVLQYHVWPHQWLQWKH RYHUVHDVPDUNHWVVXFKDV*HUPDQ\ 6RXWK$IULFD,QGLDDQG0H[LFRKDV DOVRSURGXFHGVSHFWDFXODUUHVXOWV7KH

FRPSDQ\DFKLHYHGUHFRUGLQWHUQDWLRQDO VDOHVRIÂ&#x2013;PLOOLRQ DSSUR[ PLOOLRQ LQUHSUHVHQWLQJDQLQFUHDVH RIFRPSDUHGWR Haitian International further enhanced LWVEXVLQHVVGHYHORSPHQWVWUDWHJ\RI shifting small tonnage machines towards full-electric injection moulding machines and large tonnage machines towards twoSODWHQPDFKLQHV Mars series still the best seller ,Q=KD¿UHOHFWULFDOVHULHVLQMHFWLRQ moulding machines and Jupiter series two-platen injection moulding machines JDLQHGLQFUHDVLQJSRSXODULW\DQGUHFHLYHG LQFUHDVLQJUHFRJQLWLRQIURPFXVWRPHUV 6DOHVRI=KD¿UHOHFWULFDOVHULHVUHDFKHG Â&#x2013;PLOOLRQ DSSUR[PLOOLRQ  UHSUHVHQWLQJDQLQFUHDVHRIZLWK PRUHWKDQPDFKLQHVGHOLYHUHG7KH VDOHVRI-XSLWHU6HULHVUHDFKHGQHDUO\ XQLWVDPRXQWLQJWRÂ&#x2013;PLOOLRQ DSSUR[PLOOLRQ UHSUHVHQWLQJDQ

LQFUHDVHRI Mars series have again proven its VXSHULRUPDUNHWSRVLWLRQDVWKHEHVWVHOOHU ZKLFKDFFRXQWHGIRUDSSUR[LPDWHO\ of total sales, with total sales amounting to Â&#x2013;PLOOLRQ DSSUR[PLOOLRQ  0RUHWKDQ0DUVPDFKLQHVKDYH EHHQGHOLYHUHGWRFXVWRPHUVZRUOGZLGH 7KH=KD¿U-(VHULHVLVDSHUIHFW FRPELQDWLRQRIWKHHOHFWULFGULYHWHFKQRORJ\ DQGWKHWZRSODWHQVHUYRK\GUDXOLFV\VWHP representing Haitian Internationalâ&#x20AC;&#x2122;s DSSURDFKRIVPDUWPRGXODULW\IRU WHFKQRORJ\WRWKHSRLQW With respect to the production SHUIRUPDQFHWKH-(VHULHVFRPELQHVDOOWKH DGYDQWDJHVRIDIXOO\HOHFWULFLQMHFWLRQXQLW VXFKDVKLJKSUHFLVLRQKLJKVSHHGKLJKO\ HI¿FLHQWHQHUJ\VDYLQJDQGHQYLURQPHQWDOO\ IULHQGO\IHDWXUHVDVZHOODVWKHEHQH¿WVRI WKHWZRSODWHQVHUYRK\GUDXOLFFODPSLQJ unit, such as high precision for clamping, VPDOOIRRWSULQWELJJHUVSDFHIRUODUJHU PRXOGVDQGPRUH!!

The 2800-ton Haitian â&#x20AC;&#x2DC;Jupiterâ&#x20AC;&#x2122; II series machine, supplied by Cabletech Marketing, is being used by Braymould of KZN for the production of the new Watertainer water storage tanks; this is a two-platen, full-servo system which includes a number of energy-saving features


Classifieds Aug/Sept'18.indd 92

2018/07/05 12:06


News

Advanced manufacturing awards to recognise, inspire SAâ&#x20AC;&#x2122;s manufacturers Will play key role advancing SAâ&#x20AC;&#x2122;s advanced manufacturing agenda 1$7,21$/DZDUGVRI¿FLDOO\UHFRJQLVLQJ LQQRYDWLRQDQGH[FHOOHQFHLQDGYDQFHG manufacturing will be made for the ¿UVWWLPHLQ6RXWK$IULFDDWWKH$IULFDQ Advanced Manufacturing and Composites Show at the Nelson Mandela Bay Stadium LQ3RUW(OL]DEHWKIURP7-9 November. The National Advanced Manufacturing ,QQRYDWLRQ$ZDUGVKRVWHGE\WKH'7, and national Composites Cluster, will encompass a wide scope, including the key drivers of the 4th industrial revolution. All companies operating in the

DGYDQFHGPDQXIDFWXULQJ¿HOGLQFOXGLQJ 'SULQWLQJURERWLFVDXWRPDWLRQ$,ODVHU cutting and etching, CNC machining, VRIWZDUHELJGDWD,27DQGFRPSRVLWHVZLOO be eligible for national recognition. Companies or organisations may make VXEPLVVLRQVLQVL[FDWHJRULHVLQFOXGLQJ 1. Scholarly impact in advanced manufacturing ,QGXVWU\DGYDQFHPHQWLQDGYDQFHG manufacturing ([SRUWSUR¿FLHQF\ &RQWULEXWLRQWR,PSRUWUHSODFHPHQW

&RPSRVLWHV,QQRYDWLRQDQG 6. Most Promising start- up or newcomer &RPSRVLWHV&OXVWHU0'$QG\ Radford, formerly an industrialist at WKH&6,5VDLGWKHDZDUGVZRXOGSOD\ DNH\UROHLQDGYDQFLQJWKHFRXQWU\¶V advanced manufacturing agenda. â&#x20AC;&#x153;As we push to consolidate and develop our manufacturing strategy, it is essential that as a collective, government and private sector stakeholders identify, promote and reward innovation in the advanced PDQXIDFWXULQJDQGFRPSRVLWHVLQGXVWU\´

www.mandelabaycompositescluster.co.za

>> Haitian sees remarkable growth in international markets â&#x20AC;¦

32 AUGUST / SEPTEMBER 2018

This integration ensures the outstanding WHFKQLFDOSHUIRUPDQFHRIWKH=KD¿U-( VHULHVDQGHQDEOHV=KD¿UWRHQWHUWKH ODUJHPDFKLQHVHFWRUV7KH-(VHULHVLV currently planned to be available from 4500-33,000 kN. Venus range expanded =KD¿UKDVIXUWKHUH[SDQGHGWKH9HQXV range to include new possibilities. The Zeres Series is based on proven all-electric technology and is combined with an integrated hydraulic system. Being structurally identical to the 9HQXV,,6HULHVWKH=HUHVRIIHUVDOOWKH advantages of electric injection moulding technology, such as precision, energy HI¿FLHQF\LQGHSHQGHQWSDUDOOHOPRYHPHQWV throughout the entire cycle with more precise mould alignment; and is also easy to maintain. Servo-electric drives for injection, dosing, and mould movements HQVXUHVWURQJG\QDPLFV,QWHJUDWHGVHUYR K\GUDXOLFVIRUPLQRUD[HVVXFKDVFRUH pull, ejector and nozzle unit, provides the possibility for applications with core pulling. The latest Zeres machine carries a redesigned injection unit for fast cycling and the clamp unit is also optimised to be more robust for faster cycle applications. The Zeres series is available for a clamping force from 400-13,800 kN. Haitian Mars Series has been on the market for over 10 years and has created a legendary record in the industry. Up to

2017 the accumulative sales of Mars have H[FHHGHGXQLWVZRUOGZLGHZKLFK DI¿UPLWVSRVLWLRQDVWKHZRUOG¶VEHVWVHOOLQJ injection moulding machine. The high-performance edition, of the latest Mars series, represents an overall upgrade of the 2nd generation. The QHZ0DUV,,6VHULHVERDVWVRXWVWDQGLQJ performance, which is featured by a highly HI¿FLHQWLQMHFWLRQXQLWKLJKSUHFLVLRQ control system, highly responsive drive system, and a durable clamping unit; which altogether ensures the stability and high HI¿FLHQF\RISURGXFWLRQ â&#x20AC;&#x2DC;Go Factoryâ&#x20AC;&#x2122; as Smart Solution to the pointâ&#x20AC;&#x2122; µ*R)DFWRU\¶LVDQLQIRUPDWLRQPDQDJHPHQW system developed by Haitian Smart Solution, to facilitate the connection of injection moulding machines and to monitor the production process. ,WSURYLGHVDQLQIRUPDWLRQVROXWLRQZLWK low investment, short implementation time and integration for standard machines. Prospects and future strategy )RU+DLWLDQ,QWHUQDWLRQDOPDUNVWKH \HDURIIRFXVLQJRQHI¿FLHQF\ â&#x20AC;&#x153;We will actively promote internal SURFHVVLPSURYHPHQWVDQGSXWµTXDOLW\¿UVW¶ as a priority in all spheres of our work to HQKDQFHWKHFRPSDQ\¶VSURGXFWLYLW\DQG HI¿FLHQF\´HPSKDVL]HG=KDQJ-LDQPLQJ &(2RI+DLWLDQ,QWHUQDWLRQDO

www.cabletech.co.za =KD¿UHOHFWULFDOVHULHVDQG-XSLWHUVHULHV two-platen injection moulding machines gained increasing popularity

Pierre Jurgens of Cabletech and Trevor Britland of Braymould of KZN, one of the most prominent Haitian customers in the country recently

â&#x20AC;¢ Cabletech Marketing is proud to represent Haitian International in South Africa. The remarkable growth in international markets has UHDI¿UPHGWKDW+DLWLDQ,QWHUQDWLRQDOZLOOFRQWLQXH growing from strength to strength.

www.haitianinter.com

=KD¿U=HUHVVHULHVDOOURXQGHOHFWULFSHUIRUPHU

The Mars IIS high-performance edition, the latest version of this servo-hydraulic bestseller


We make things better

Speak to us.. We know hot runners!

TEL: 011 462 2990

info@demaplastech.co.za

www.demaplastech.co.za


ENVIRO

Pick â&#x20AC;&#x2DC;n Pay Ă&#x20AC;UVWUHWDLOHUWR Could carry price tag from R1.50 to R3 versus 55c for plastic bag IN CELEBRATION of World Plastic Free Bag Day on 3 July, Pick n Pay trialed an environmentally-friendly compostable bag at LWVĂ&#x20AC;DJVKLSVWRUHLQWKH9 $:DWHUIURQW These bags are already widely available in Northern America, Europe and Australia but WKLVZDVWKHÂżUVWWLPH6RXWK$IULFDQVZHUH able to trial the bags. Customers were given compostable carrier bags for free, as a replacement for a plastic bag. The fruit and vegetable bags and barrier bags were also replaced with compostable bags for the day. A pilot run of cardboard boxes was also available at a cost of R5. The one-day trial was done to gain customer feedback on the new bags; as well as start a conversation with industry leaders and

government. Pick n Payâ&#x20AC;&#x2122;s director for transformation, 6X]DQQH$FNHUPDQ%HUPDQVDLGÂł7KH piloted bags were strong and can be reused, similar to normal plastic bags. The important difference is that these trial bags are also home compostableâ&#x20AC;?. The compostable bag is made from corn starch, cellulose, vegetable oils and combinations thereof. The bag can be composted with other organic waste, which WKHUHWDLOJURXSVHHVDVDPDMRUEHQHÂżW Âł7KHEDJZLOOGHFRPSRVHDIWHUWKUHHWR six months - depending on the composting system â&#x20AC;&#x201C; as opposed to 500 to 1000 years for its plastic counterpart,â&#x20AC;? the Pick n Pay statement said.

The compostable bag could initially carry a price tag ranging from R1.50 to R3 versus 55c for a plastic bag. Pick n Pay chairman Gareth Ackerman VDLGÂłWKHJRYHUQPHQWQHHGVWRVWHSXS recycling commitments now that the private sector is adjusting and implementing changes. Âł6LPSO\SXWWKHJRYHUQPHQWQHHGVWR intensify its commitment to recycling and waste management. The plastic bag levy was introduced in 2003 in an effort to make consumers think more carefully about their plastic bag usage. Funds generated from this levy have not improved the environment and created jobs, as was promised at the time.â&#x20AC;?

Celebrating the trial were Gareth Ackerman (Chairman, Pick n Pay), Suzanne Ackerman-Berman (Pick n Pay director of transformation), Pedro Da Silva (Pick n Pay retail MD) and Paula Disberry (retail executive: commercial and marketing at Pick n Pay)

Ex w

34 AUGUST / SEPTEMBER 2018

Pick n Pay target areas include: 1. 100% recyclable plastic bags introduced Pick n Pay will start introducing 100% recyclable plastic bags, manufactured from recycled plastic and with no added calcium, in stores from August 2018. An even broader range of reusable bags at affordable prices will also be made available to help customers move away from single-use bags. 2. Plastic straws to be phased out in favour of paper straws Plastic straws will no longer be provided at checkouts. These will be replaced with paper straws which will

only be available at the cold drink kiosks. 3. Alternatives to everyday plastic disposable items Pick n Pay branded earbuds will be introduced where the plastic inners will be replaced with paper. 4. Reduced packaging impacts Pick n Pay has introduced recycled PET (RPET) in a range of its own products. The plastic punnets used in the packaging of their fresh fruit and vegetables contains a minimum of 25% RPET. The use of RPET will be

rolled out to more categories, such as the PnP and No Name carbonated soft drink bottles â&#x20AC;&#x201C; these will include a minimum of 20% RPET. PnPâ&#x20AC;&#x2122;s Dishwashing Liquids and All-Purpose Cleaners will include a minimum of 25% recycled material. 5. Free plastic collection from online customer homes Pick n Pay has had in-store recycling bins for plastic bags available at all their stores for several years. The company will now increase customersâ&#x20AC;&#x2122; ability to recycle by offering free plastic collection from online customersâ&#x20AC;&#x2122; homes.


WULDOFRPSRVWDEOHEDJV The plastic bag levy recently increased from 8c to 12c per bag. This is included in the selling price of every plastic bag and paid to the government by the plastic bag manufacturers. “These funds need to be put to proper use. Not as a tax collection mechanism but as a fully funded programme to make a real environmental impact and create much-needed jobs. We look forward to the completion of the Industrial Waste Management plans as requested by the government to better understand the roles of all parties involved in the waste industry,” said Ackerman. “We hope it addresses structural issues such as the lack of waste collection and recycling services in our townships. There is also very little large-scale composting of food waste to prevent it from being sent WRODQG¿OOV7KLVLVDFKDOOHQJHIRUDOORIXV South Africa consumers are concerned about waste and are looking at all those involved for solutions. “But the truth of it is that without clear

integrated waste management plans and investment in infrastructure from the government, we will never, on our own as retailers, be able to make a sustainable LPSDFW:HPXVWZRUNWRJHWKHUWR¿QG solutions,” he added. Ackerman-Berman was thrilled to discuss the efforts the retailer is making to KHOSSUHYHQWVLQJOHXVHSODVWLFZDVWH³:H still have lots of packaging throughout the store, buts it’s those seemingly small changes which make a major difference to our environment. It’s not possible to remove plastic entirely at this point, but we’re moving in the right direction and we hope others follow suit.” Pick n Pay has also committed to removing all plastic straws from checkout counters and only offering paper-straws at their cold-drinks kiosks. It is also planning to reduce its own brand name categories by using recycled PET (rPET) material and will be introducing 100% recyclable plastic bags in its stores from August, as well as earbuds with a paper inner.

Pick n Pay is trialing compostable bags and cardboard boxes as an environmentally friendly alternative to its current plastic offering

AUGUST / SEPTEMBER 2018 35

Extrusion lines for plastic recycling suitable for materials with high level of moisture and print.


ENVIRO

Turning the tide

on ocean pollution

Single use plastic shouldnâ&#x20AC;&#x2122;t be used just once THE idyllic shoreline of Kenya on the East coast of Africa is known for its beautiful beaches and azure blue water. Situated just off the mainland of Kenya is the island of Lamu, a piece of paradise recognised as a UNESCO World Heritage site and is home to the oldest continually inhabited Swahili settlements. The Swahili people are known for their highly skilled craftsmanship in building sailboats, known as dhows. With its iconic triangle sails and wispy streamlined shape, the dhow boat is an integral part of Kenyan culture and heritage. Lamu Island, like many around the The FlipFlopi dhow made largely from recycled plastic materials, is being prepared for her maiden voyage from Lamu to Cape Town. The local Swahili boat builders arenâ&#x20AC;&#x2122;t using any power tools or computers, only years of experience and knowledge

36

AUGUST / SEPTEMBER 2018

When plastic has been recycled it looks dull in colour and the team wanted to add elements of joy and vibrancy to their uplifting project. )RUJRWWHQĂ&#x20AC;LSĂ&#x20AC;RSVDUHFRPPRQO\IRXQGRQWKH beaches of Kenya; the team will be collecting and UHFODLPLQJĂ&#x20AC;LSĂ&#x20AC;RSV7KH\ÂśOOEHVTXDUHG off, moulded and line the hull of the boat

world, are seeing the effects of ocean pollution. Ben Morison, a native of Kenya, specialising in safari tours, has H[SHULHQFHGÂżUVWKDQGWKHHIIHFWVRIRFHDQ pollution to the extent that itâ&#x20AC;&#x2122;s encouraged him to take action - he organised a beach cleanup with the help of 50 volunteers and WKH\FROOHFWHGÂżYHWRQVRIWUDVKRIIDVWUHWFK of beach spanning 5km. The idea is to build a 20m, 45-ton dhow made almost entirely from â&#x20AC;&#x2DC;repurposedâ&#x20AC;&#x2122; plastic waste found on the shores of Lamu. Promoting a message of â&#x20AC;&#x2DC;reduce, reuse The boatwrights (boat builders) are using traditional wooden ERDWEXLOGLQJWRROVDQG WHFKQLTXHVZKLOHDSSO\LQJWKHP to this very new, yet unusual material.

and recycleâ&#x20AC;&#x2122;, the aim is to sail the vessel, from Kenya to Cape Town on a maiden voyage raising awareness of the plight created by plastics marine pollution. Until recently, Kenya has instilled new laws in its efforts to be more conscious about waste pollution. Their current ban on the use of single-use plastic bags has been positively welcomed by the country, as well as recycling companies becoming more prevalent. The material used in construction of the Dhow comes from several recycling companies in Kenya. The material used to create the sailboat (the keel, ribs and structural elements) will be commercially viable recycled plastic products including bottles, bags and other post-consumer waste. The waste is sorted, shredded and the plastic re-extruded and moulded into beams and planks. The material is 100% postconsumer plastic and consists of an HDPE and LDPE mixture. The hull An estimated 20 000 lost and discarded Ă&#x20AC;LSĂ&#x20AC;RSVZLOOEHXVHGWRFUHDWHSDQHOV

The teams at Kenya Plastics Plus Recycling are turning shopping bags, bottles and other waste discards into structurally commercial and viable recycled plastic lumber

for the hull and deck. The look of melted plastic is one which is dull and XQLQVSLULQJWKHPXOWLFRORXUĂ&#x20AC;LSĂ&#x20AC;RSV create a bright and cheery impression that is how the boat and the project itself have been named, The FlipFlopi. Renowned master carver Ali Skanda and his team of skilled craftsman are busy bringing this dream to life. A prototype is currently being built and is nearly due for ocean trials. Once fully built, the prototype will embark on a trial sail around East Africa and continue raising awareness while observing any learning that they gauge from the sail in order to assist them in constructing the Dhow. The 5 200km voyage could be a tricky one as the changing winds are ruthless and passing the coast of Cape Town is renowned for its potential dangers. Whichever way this initiative pans out, the hope that this endeavour inspires and encourages recycling and brings about less single-use plastic.

7KHĂ&#x20AC;LSĂ&#x20AC;RSVDUHDIÂż[HGWRDSODVWLFVKHHW and turned into panels. The glue melts the pieces of sole together forming a strong bond. A combination of adhesive, battens and screws attach the panels to the vessel.

Now that the trash collecting and recycling is done, the exciting phase of the project can begin â&#x20AC;&#x201C; building the Dhow in their idyllic boatyard


Classifieds Apr/May'18.indd 92

2018/04/16 10:36


ENVIRO

Woolworths to contribute Introduction of 100% recyclable materials and supportive recycling infrastructure :22/:257+6DQQRXQFHGPLG-XQHWKDW LWSODQVWREHWKHÂżUVWUHWDLOHULQ6RXWK$IULFD to contribute zero packaging waste and phasing out single-use plastic shopping bags FRPSOHWHO\E\ The retailer said it aims to have none of LWVSDFNDJLQJHQGXSLQODQGÂżOOVZKLFKZLOO require the introduction of 100% recyclable materials and a supportive recycling LQIUDVWUXFWXUH This will include the phasing out of unnecessary single-use plastics, and the commitment for all its packaging to be either UHXVDEOHRUUHF\FODEOHE\ â&#x20AC;&#x153;This follows extensive customer research and engagement, both formally and through social media channels that shed light on both

customer recycling habits and entrenched customer perceptions,â&#x20AC;? said Zyda Rylands, :RROZRUWKV6RXWK$IULFD&(2 Âł:HNQRZWKDWPDQ\RIRXUFXVWRPHUVIXOO\ VXSSRUWRXU]HURSDFNDJLQJZDVWHWRODQGÂżOO journey and they want to see it happen as IDVWDVSRVVLEOH%XWWKLVLVQRWDSDWKWKDW ZHFDQZDONDORQH7RVXFFHHGZHQHHG our customers, our suppliers and the South $IULFDQUHF\FOLQJLQGXVWU\WRZRUNZLWKXV â&#x20AC;&#x153;Critical to the success of these ambitious goals is the continued commitment to partner with government and industry (recyclers, packaging convertors, producer responsibility organisations) to develop technically and commercially viable solutions to recycling GLIIHUHQWSODVWLFV´

Several in-store trials are currently underway at selected Woolworths stores to engage customers on the new plastic reduction efforts, including: â&#x20AC;˘ Wooden cutlery and paper straws are being rolled out in NowNow and WCafes with a view to phase out plastic cutlery and straws completely.

5HF\FOLQJPXOWLOD\HUIRRGSDFNDJLQJÂżOPV DSM, APK cooperate

38 AUGUST / SEPTEMBER 2018

APKâ&#x20AC;&#x2122;s NewcyclingÂŽ process makes it possible to recover high-quality re-granulates with properties close to virgin ROYAL DSM of Holland, a global science-based company active in health, nutrition and sustainable living, together with APK of Germany, are leading the way in taking the next step to increase WKHVXVWDLQDEOHEHQHÂżWVRIPXOWLOD\HUIRRG SDFNDJLQJÂżOPVE\GHYHORSLQJWHFKQRORJ\ WRUHF\FOHWKHVHÂżOPV Beyond the primary function of reducing IRRGZDVWHWKHÂżOPVDUHQRZDOVR UHF\FODEOHYLD$3.ÂśVQHZUHF\FOLQJURXWH 0DQ\PXOWLOD\HUEDUULHUÂżOPVIRUIRRG packaging consist of a combination of polyethylene and PA6 (nylon) where the PE acts as a barrier for moisture and PA6 DVDEDUULHUIRUR[\JHQWKXVVLJQLÂżFDQWO\ extending the shelf life of the packaged IRRG6XFKSDFNDJLQJFDQQRWEHSURGXFHG ZLWKDPRQRPDWHULDO3(ÂżOPVLQFHWKH OD\HUWKLFNQHVVHVWRDFKLHYHVXIÂżFLHQW EDUULHUSURSHUWLHVZRXOGEHFRPHWRRKLJK The addition of PA6 in the multi-material solution reduces the total layer thickness VLJQLÂżFDQWO\DQGLPSURYHVWKHPHFKDQLFDO LQWHJULW\RIWKHÂżOPUHVXOWLQJLQOHVVUXSWXUH RIWKHÂżOPVGXULQJWUDQVSRUWDWLRQDQG ORJLVWLFV7KLVOHDGVWRDORZHUIRRGZDVWH SHUFHQWDJHDQGWKXVWRDVLJQLÂżFDQWO\ better carbon footprint in Life Cycle $QDO\VLVWHVWV Today APK and DSM are able to address the â&#x20AC;&#x2DC;end-of-lifeâ&#x20AC;&#x2122; stage of the life

cycle of a multilayer PE/PA6 packaging ÂżOPXVLQJ$3.ÂśV1HZF\FOLQJÂŽ process, a technique that makes it possible to recover high-quality re-granulates with properties close to virgin plastics, from complex mixtures and multi-layer composites (so-called multilayer barrier SDFNDJLQJ :LWKFRQYHQWLRQDOUHF\FOLQJ V\VWHPVWKDWLVQRWSRVVLEOH Âł0RUHRYHUWKH1HZF\FOLQJÂŽ process LVKLJKO\FRVWHIÂżFLHQWDQGRIIHUVD FRPSHWLWLYHVXVWDLQDEOHPDWHULDOVRXUFH The re-granulates, generated from multilayer PE/PA6 packaging waste, FDQEHXVHGDJDLQLQGHPDQGLQJĂ&#x20AC;H[LEOH packaging which contributes to the target of a circular economy,â&#x20AC;? said Florian Riedl, KHDGRIEXVLQHVVGHYHORSPHQWDW$3.$* APK is building a plant for recycling multilayer PE/PA6 packaging, using 1HZF\FOLQJÂŽ process, which will start XSLQ4RIWKLV\HDU DSM â&#x20AC;&#x201C; Bright Science. Brighter Livingâ&#x201E;˘ Royal DSM is a purpose-led global science-based company in nutrition, KHDOWKDQGVXVWDLQDEOHOLYLQJ'60LV driving economic prosperity, environmental progress and social advances to create VXVWDLQDEOHYDOXHIRUDOOVWDNHKROGHUV,W delivers innovative business solutions for

human nutrition, animal nutrition, personal care and aroma, medical devices, green products and applications, and new PRELOLW\DQGFRQQHFWLYLW\ DSM and its associated companies deliver annual net sales of about â&#x201A;Ź10-billion with approximately 23,000 HPSOR\HHV7KHFRPSDQ\LVOLVWHGRQ (XURQH[W$PVWHUGDP APK At its headquarters in Merseburg near Leipzig, Germany, APK produces highquality plastic recycle reclaimed from SRVWFRQVXPHUDQGSURGXFWLRQVRXUFHV $3.ÂśVFRUHWHFKQRORJ\LVLWV1HZF\FOLQJÂŽ process, a solvent-based technique that makes it possible to recover high-quality re-granulates with properties close to virgin plastics from complex mixtures and multi-layer composites (so-called PXOWLOD\HUEDUULHUSDFNDJLQJ :LWK conventional recycling systems that is QRWSRVVLEOH 1HZF\FOLQJÂŽ allows the pelletized recyclates to be used in demanding DSSOLFDWLRQVVXFKDVĂ&#x20AC;H[LEOH SDFNDJLQJDJDLQ www.dsm.com www.apk-ag.de


to zero packaging waste • Plastic straws are no longer available for purchase in store. • Paper-stemmed earbuds will be on the shelves by the end of October and plastic ear buds will no longer be sold in store. • A pilot coffee cup recycling programme is currently underway in NowNow stores, with a view to rolling out nationally; • The retailer is trialing reverse

recycling vending machines, where customers can bring in their recyclables and put them into the vending machine so that they can be recycled. • Woolworths is also trialing a new range of affordable reusable shopping bags.

www.woolworths.com

Israeli’s develop a smart water saving solution ISRAEL leads the world in offering solutions in dire emergency situations. Israel has come up with a solution to the explosion in the consumption of water bottles, similar to that experienced in Cape Town. This small, 20x28cm re-usable plastic bag, made from robust plastic is able to hold four litres of water. It takes up

no space and has a handle which allows it to be carried with one hand. It is expressly made to carry drinking water only. It DGGUHVVHVVSHFL¿FDOO\WKHXVHRISODVWLF containers that previously contained ÀXLGVWKDWFRXOGFRQWDPLQDWHWKHGULQNLQJ water or its quality. An emergency situation in Israel kicks

in when water is cut-off for six hours. Every citizen receives at least one of these plastic bags for free. When broken or when they are no longer required, they can be returned to any one of thousands of plastic recycling points, which are to be found on almost every corner. A very HI¿FLHQWSODVWLFUHF\FOLQJVROXWLRQ AUGUST / SEPTEMBER 2018 39


ENVIRO

Bio-based multilayer transparent EDUULHUÃ&#x20AC;OPQRZDUHDOLW\ 6WDEOHEXEEOHH[FHOOHQW¿OPWUDQVSDUHQF\JRRGUROOTXDOLW\ FOUR key players in the bioplastics industry â&#x20AC;&#x201C; Eurotech Extrusion Machinery, NatureWorks, Nippon Gohsei and Sukano â&#x20AC;&#x201C; have successfully processed a multilayer transparent bio-based barrier ¿OP7KLVDOORZVSDFNDJLQJPDQXIDFWXUHUV WRFRQVLGHUFRH[WUXGHG¿OPVWUXFWXUHDV a potential replacement for conventional fossil fuel-based structures in dry food SDFNDJLQJ Bioplastics are already part of our HYHU\GD\OLIH'ULYHQE\KLJKFRQVXPHU demands and market innovations in advanced technical properties and functionalities, companies have already WDNHQVRPHPDMRUVWHSVIRUZDUGWRZDUGV the transformation into a bio-based and FLUFXODUHFRQRP\7KHJRDOLVWRGHFUHDVH environmental impact concerns by GHFRXSOLQJSDFNDJLQJPDWHULDOIURPIRVVLO UHVRXUFHVFKDQJLQJFRQVXPSWLRQSDWWHUQV DQGUHLPDJLQLQJSDFNDJLQJGHVLJQV )OH[LEOHPXOWLOD\HUSODVWLFSDFNDJLQJ GHVLJQUHPDLQVDPDMRUFKDOOHQJHDV PRVWFRQYHQWLRQDOPXOWLOD\HU¿OPVDUH ERWKQHLWKHUUHF\FODEOHQRUFRPSRVWDEOH As of today there continues to be a lack RIUHF\FODELOLW\IRUWKLVNLQGRISDFNDJLQJ that still makes up over 75% of the food LQGXVWU\XVDJH ,QJHRUHVLQSURFHVVHGLQWRD¿OPLV DOUHDG\XVHGLQPDQ\W\SHVRIÃ&#x20AC;H[LEOH SDFNDJLQJ8VLQJ,QJHRSURYLGHVIRU DUHGXFHGFDUERQIRRWSULQWDVZHOODV FRPSRVWDELOLW\DVDQHQGRIOLIHRSWLRQ)RU KLJKHUJDVEDUULHUUHTXLUHPHQWVDFRDWLQJ

or a metalisation surface treatment of the ¿OPLVW\SLFDOO\UHTXLUHG+RZHYHUWKH QHHGIRUWKLVFRDWLQJRUPHWDOLVDWLRQFDQ EHHOLPLQDWHGWKURXJKWKHXVHRIDEDUULHU SRO\PHUWRSURGXFHDFRH[WUXGHGVWUXFWXUH 7KLVSURYLGHVDQDGGLWLRQDOQHZRSWLRQIRU SDFNLQJIRRGVZKLFKUHTXLUHDQH[WHQGHG VKHOIOLIHZKLOHVWLOORIIHULQJFODULW\DQG FRPSRVWDELOLW\ 7KHFRH[¿OPSURFHVVHGDW(XURWHFK XVHGD.$OD\HUEORZQ¿OPODEPDFKLQH LQDFRQ¿JXUDWLRQXVLQJWZRH[WUXGHUV 25mm and three extruders 20mm, LQFOXGLQJWKHGLHOLSRIPPGLDPHWHU DQGPPJDS 7KHWRWDO¿OPWKLFNQHVVHVRIPLFURQV PPZLGWKFRQWDLQV,QJHR3/$' from NatureWorks and is used in the LQQHU$OD\HUZLWKDQRXWHUEXEEOHOD\HU (LQFOXGLQJ6XNDQR® masterbatches SURFHVVLQJDLGV7KHVH3/$EDVHG 6XNDQRPDVWHUEDWFKHVZHUHVSHFL¿FDOO\ GHVLJQHGIRUWKLVDSSOLFDWLRQ7KHWLHOD\HUV XVH%753DQGWKHEDUULHUOD\HUXVHV *SRO\PHUERWKIURP1LSSRQ*RKVHL 7KLVFRPELQDWLRQRIIRUPXODWLRQDQG process conditions yielded a stable bubble, H[FHOOHQW¿OPWUDQVSDUHQF\DQGJRRGUROO TXDOLW\ 7HVWLQJVKRZHGWKDWWKHXVHRI SUKANO® masterbatches offered LQFUHDVHGPHOWVWUHQJWKDQGWKHUHIRUH EHWWHUSURFHVVDELOLW\JRRGWUDQVSDUHQF\ DQGEHWWHUDGKHVLRQGXULQJVHDOLQJ 0HFKDQLFDOSURSHUWLHVZHUHDOVR PDLQWDLQHG$VDQDGGLWLRQDOEHQH¿W

Bioplastics are already part of our everyday lives â&#x20AC;&#x201C; many applications are being developed for bio-plastics

HDFKPDWHULDOXVHGLQWKH¿OPKDVHLWKHU EHHQWHVWHGDQGFHUWL¿HGRUDVVHVVHG WREHELRGHJUDGDEOHDQGLQGXVWULDOO\ FRPSRVWDEOHDFFRUGLQJWR(XURSHDQQRUP (1 /HVV¿OPVWLFNLQJZDVPDQDJHG YLDWKHXVHRIVOLSDJHQWELREDVHG PDVWHUEDWFKHVZKLFKLQFUHDVHGWKH SURFHVVLQJZLQGRZDQGHQVXUHGJRRG SURFHVVDELOLW\FRQGLWLRQVDQGDORZHU&2) WKHUHIRUHFRQIHUULQJEHWWHU¿OPSURSHUWLHV IRUVHFRQGDU\IDEULFDWLRQVWHSV )RUWKHEDUULHUOD\HU1LFKLJR *3RO\PHUÂ&#x152;WKHZRUOG¶V¿UVWH[WUXGDEOH KLJKEDUULHUDPRUSKRXVYLQ\ODOFRKROUHVLQ ZDVXVHG7KLVSURYLGHGNH\EHQH¿WVLQ SDFNDJLQJVXFKDVH[FHOOHQWJDVDQG DURPDEDUULHUDQGKLJKWUDQVSDUHQF\ ZKLOHVXSSRUWLQJFRPSRVWDELOLW\DQG UHF\FODELOLW\SURSHUWLHVRIWKH¿QDO¿OP SURGXFHG2XWVWDQGLQJZDWHUVROXELOLW\IRU VROXWLRQFRDWLQJEDUULHUDSSOLFDWLRQVDQG H[WUXGDELOLW\ZHUHDOVRHYLGHQW 7KH*3RO\PHUEDUULHULVVRHIIHFWLYH WKDWLWFDQUHSODFHIRLOLQPDQ\SDFNDJLQJ DSSOLFDWLRQV$QGHYHQDWPPWKLFNQHVV RIPRQROD\HU*3RO\PHUWUDQVSDUHQF\ ZDVJODVVOLNH7KHWLHOD\HU%753 JLYHVKLJKDGKHVLRQEHWZHHQOD\HUV PDLQWDLQLQJKLJKWUDQVSDUHQF\ &RPSDQLHVDUHPDNLQJWKHVZLWFK WRDOWHUQDWLYHIRUPVRISDFNDJLQJXVLQJ UHQHZDEOHELRPDVVPDWHULDOVPDNLQJ ³ELRSODVWLFV´&RPSDQLHVOLNH&RFD&ROD KDYHMXVWLQWURGXFHGWKHLUµ3ODQW%RWWOH¶ ZKLFKLVPDGHXSRISODQWEDVHG PDWHULDOV:LWKPDQXIDFWXUHUVVKLIWLQJIURP traditional plastics to bioplastics, analysts DUHH[SHFWLQJWKHELRSODVWLFPDUNHWWRJURZ DW&$*5VRIRUPRUHEHWZHHQ DQG 7KHDFKLHYHPHQWRIWKLVPXOWLOD\HU WUDQVSDUHQWELREDVHGEDUULHU¿OPDOORZV SDFNDJLQJPDQXIDFWXUHUVWRFRXQW PXOWLOD\HU¿OPVWUXFWXUHDVDSRWHQWLDO replacement for conventional fossil fuelEDVHGVWUXFWXUHVLQGU\IRRGSDFNDJLQJ VXFKDVOLG¿OPVIRUFRIIHHFDSVXOHVRU OLGGLQJ¿OPVIRUFXSVDQGWUD\VÃ&#x20AC;RZSDFNV WUD\VIRUVQDFNVDQGELVFXLWSDFNDJHV And it may even extend to certain humid IRRGVVXFKDVKDP¿VKDQGPHDWZKHQ XVHGZLWKSURSHUSDFNDJLQJGHVLJQ

www.sukano.com 40

AUGUST / SEPTEMBER 2018


Speed, Precision, Cleanliness Negri Bossi is on the cutting edge of injection moulding process development, and is known globally as a leading supplier of premium injection moulding machines and special technologies to suit the needs of even the most ,.+#.!//%2!%*&!0%+*)+1( %*#+),*%!/ċ!+û!.3% !..5+"/,!%(%05 and custom technological solutions in order to ensure that our customers are equipped with the most advanced injection moulding capabilities available to the market. These technologies ensure that resulting products feature excellent ü*%/$!/Č(%#$0!.3!%#$0/Č"/0!.5(!0%)!/Č%**+20%2!)0!.%(+)%*0%+*/*  more. The Negri Bossi technology portfolio includes:

Nova eT

JANUS ST (300-450 tonnes)

5-point double-toggle clamp, all-electric injection moulding machines offer energy savings of up to 80% when compared to conventional hydraulic drive solutions.

5-point double toggle clamp, the Janus ST hybrid machines allow simultaneous (overlapping) movement of functions achieving a high level of energy efficiency by utilizing hybrid technology, achieving a standard speed of 600mm/sec. Features new TACTUS™ controller

CANBIO ST (180-500 tonnes) 5-point double toggle clamp, servo-pump hydraulic powered machine. Features new TACTUS™ controller

VECTOR (650-1300 tonnes) The Vector Evolution Series are 5-point doubletoggle clamp, hybrid machine. The injection unit features an electric motor driven screw rotation, with injection capacities from 1875 to 11000g. Equipped with fully digital CanBus control.

Nova sT New concept of 5 point double toggle (fast and accurate motion), mobile platen bushless on prismatic guides, auto lubrication system in closed loop, double servo motor, improved injection speed and pressure on material, new 21” Multi-Touch Motus control with connections Power Link bus based

BI-POWER (1000-7000 tonnes) The BI-POWER series are two-platen clamp, hybrid power machines featuring a reciprocating screw with electric screw rotation, with injection capacities from 2950 to 74900g.

SOUTHERN AFRICA AGENT: Erex (Pty) Ltd T: +27 (0) 11 789 1014 | F: +27 (0) 11 787 0193 C: +27 (0) 82 877 6459 | E: eddyb@erex.co.za www.erex.co.za

NEGRIBOSSI_pagina_ELE_.indd 8

www.negribossi.com

31/07/17 09:43


ENVIRO

How much money do to lose by eradicating

42 AUGUST / SEPTEMBER 2018

Latest tax statistics for 2016/17 show government collected R232-million in levies from bag sales SOUTH African retailers have started making a concerted effort to do away with wasteful plastics which is being used in their products, with both Woolworths and Pick n Pay announcing plans to remove various practices. Woolworths has announced that it aims to be rid of single-use plastic bags by 2020, giving the group a timeline to wean shoppers off of â&#x20AC;&#x2DC;wastefulâ&#x20AC;&#x2122; plastics and transition them onto something more environmentally friendly. Pick n Pay, meanwhile, as part of their efforts in minimising their plastic footprint are introducing 100% recyclable shopping bags by August 2018, a big push in showing their commitment to moving away from single-use bags. According to businesstech.co.za, while these may seem like small gestures in the greater scheme of things â&#x20AC;&#x201C; they will come at a huge cost to both stores and government, who make money from the status quo. The South African government implemented a plastic bag levy in 2004 as a way to combat the growing pollution problem that had

become prevalent in many large metro areas. The levy launched at a rate of 3 cents a bag on certain types of plastic shopping bags, and was subsequently increased to 4 cents a bag from April 2009 and then 6 cents a bag from April 2013 and ÂżQDOO\WRFHQWVDEDJIURP$SULO According to the latest tax statistics for 2016/17, the government collected R232 million in levies from bag sales. At 8 cents a bag, it implies an amount of 2.9 billion plastic bags were purchased during WKDWÂżQDQFLDO\HDU Ridding ourselves of plastic bags will effectively wipe this off of the governmentâ&#x20AC;&#x2122;s collection plate, but the loss to retailers is even bigger. Considering the average retail shop charges around 50 cents for a carry bag at the till â&#x20AC;&#x201C; 42 cents minus the 8 cents that goes to SARS â&#x20AC;&#x201C; thatâ&#x20AC;&#x2122;s R1.2 billion a year that retailers could potentially be throwing away in their quest to stop the waste. While some costs will be recouped by the alternatives which will be put to consumers at a price, the fact remains that not as many will be sold â&#x20AC;&#x201C; which is the point.

LE AB RS I L RE RME FO PER

SAME AGENCY SAME AGENTS FOR 15 YEARS CONTACT

LES PORTER Cell: +27 83 255 9865 Tel: +27 11 762 5231 E-mail: spark@mweb.co.za


retailers stand plastic bags Does the tax work? cannot continue and with some big names already making the efforts in transitioning to more environmentally friendly alternatives, South Africaâ&#x20AC;&#x2122;s plastic bag tax has drawn criticism from both the others will surely need to follow suit. sides of the argument â&#x20AC;&#x201C; with politicians saying that the tax -HUHP\6DPSVRQGLUHFWRUDW%UDQGÂżQDQFH$IULFDVDLG should be eliminated altogether, as it negatively that supermarkets initiative to reduce plastic will impacts consumers and particularly the poor. contribute positively to customer loyalty. According to an online news website in Considering the â&#x20AC;&#x153;It isnâ&#x20AC;&#x2122;t unheard of now for shoppers to the States, Patch.com reported that â&#x20AC;&#x153;In prefer one supermarket brand over another, San Francisco plastic bag use was average shop charges purely because they express a serious reduced by 78% after a fee was around 50 cents for a commitment to recycled content in instituted. Washington DC saw a carry bag at the till â&#x20AC;&#x201C; packaging or encourage their shoppers 60% reduction of plastic bag litter to bring their bags every time they in the Anacostia River following 42 cents minus the 8 cents VKRS´6DPSVRQWROG%XVLQHVV,QVLGHU the implementation of a 5 cent that goes to SARS â&#x20AC;&#x201C; thatâ&#x20AC;&#x2122;s SA. fee. Irelandâ&#x20AC;&#x2122;s bag ban fee reduced R1.2 billion a year that Perhaps more efforts need to be plastic bag usage by 90% in the made in stronger public awareness ÂżUVW\HDUDQGURVHRYHUPLOOLRQ´ retailers could potentially campaigns, higher levies on plastic bags, Weâ&#x20AC;&#x2122;ve had less success in South be throwing away in improved waste management systems in Africa as recorded by a paper written their bid to stop disadvantage areas and access to reusable at the University of Cape Town on shopping bags. Time will surely tell what the the â&#x20AC;&#x2DC;Analysis of the Plastic Bag Levy in the waste. best way forward is, so long as efforts are being South Africaâ&#x20AC;&#x2122;. The initial drop in plastic bag made. consumption has become expected, but we have then become familiar with the price increase and still continue to purchase the plastic bags, the tax hike has battled AUGUST / SEPTEMBER 2018 43 to sway the consumersâ&#x20AC;&#x2122; behavior unfortunately. Others have argued that the price point (35 cents to 75 cents) is simply not high enough to incentivise consumers to stop buying the wasteful carry bags, so it just blindly sends money into government coffers. However, breaking the SARS tax data down, itâ&#x20AC;&#x2122;s clear to see that the tax does work â&#x20AC;&#x201C; to a degree. :KLOHWD[FROOHFWLRQLPSOLHVWKHXVHRIELOOLRQ SODVWLFEDJVGXULQJWKHÂżQDQFLDO\HDUWKLVLVGRZQIURPWKH 3.05 billion plastic bags used the year before â&#x20AC;&#x201C; a drop of 5%. 2IÂżFLDO'LVWULEXWRULQ6RXWKHUQ$IULFDIRU%$6) The hike in the levy may have had an impact. RQ738(ODVWROODQÂŽ7KHUPRSODVWLF3RO\XUHWKDQH A sharp drop after a tax hike was also seen when the tax 2IÂżFLDO'LVWULEXWRULQ6RXWKHUQ$IULFDIRU(ODVWURQ LQFUHDVHGWRFHQWVLQZKHQXVDJHZHQWIURPELOOLRQ RQ73(739(ODVWURQÂŽ6(%6DQG(3'033 EDJVWRELOOLRQEDJVÂąWKRXJKWKLVGURSZDVVLJQLÂżFDQWO\ higher at 25%. 2IÂżFLDO'LVWULEXWRULQ6RXWKHUQ$IULFDIRU

â&#x20AC;˘ â&#x20AC;˘ â&#x20AC;˘

The table below breaks down the use over the past 5 years.

&*)6(RQ)6(ÂŽ )OXRURHODVWRPHUVDQG 3HUĂ&#x20AC;XRURHODVWRPHUV

â&#x20AC;˘ 'LVWULEXWRUIRU:HLIDQJRQ:HLSUHQ &3( â&#x20AC;˘ 6XSSOLHUVRI(369DULRXV*UDGHV â&#x20AC;˘ (QJLQHHULQJ3RO\PHUV â&#x20AC;˘ 3RO\ROHÂżQV â&#x20AC;˘ 5HZRUNHGDQG5HSDOHWLVHG0DWHULDOV ÂŽ

Year

Revenue

Tax rate

Plastic bags

2012/13

R151 billion

4 cents

3.78 billion

2013/14

R169 billion

6 cents

2.82 billion

2014/15

R174 billion

6 cents

2.90 billion

2015/16

R183 billion

6 cents

3.05 billion

2016/17

R232 billion

8 cents

2.90 billion

The plastic bag is a useful product to the South African community; it can be used for many diverse applications; a rubbish bag, and carrier bag for example. It is also particularly useful for those who do not have vehicles and who cannot afford the environmentally friendly alternatives. Retailers and governments are realising the status quo


ENVIRO

Africaâ&#x20AC;&#x2122;s pollution crisis warning Dr Tony Ribbink, CEO of the Sustainable Seas Trust, speaking at PETCOâ&#x20AC;&#x2122;s AGM, believes that while there is a certain amount of gloom and doom surrounding the pollution problem, a lot of good is also being done

Strides being made to avoid disaster, but more can be done say experts

44

AUGUST / SEPTEMBER 2018

AS THE second most polluted continent, Africa must take both the responsibility and opportunity to pioneer world-leading waste management methods to avoid an environmental and socio-economic disaster, experts warn. This was the message from environmental scientist Dr Tony Ribbink, speaking at the annual general meeting of the PET Recycling Company (PETCO) at the Johannesburg Stock Exchange on 7 June. Ribbink, CEO of the Sustainable Seas Trust, believes that while there is a certain amount of gloom and doom surrounding the pollution problem, a lot of good is also being done. â&#x20AC;&#x153;As the second most polluted continent, Africa is in clear danger of taking top spot unless responsibility for the crisis is shouldered at all levels,â&#x20AC;? said Ribbink, a former director of the World Bank GEF project on Lake Malawi/Nyasa for Malawi, Mozambique and Tanzania. Industry becoming more committed WRVXVWDLQDELOLW\ÂżQGLQJVROXWLRQV But, he said, Africa was also pioneering new methods and activities to counter plastic pollution. â&#x20AC;&#x153;Industry is also becoming more committed to sustainability and ÂżQGLQJVROXWLRQVZKHUHSUHYLRXVO\WKHUH appeared to be none.â&#x20AC;? South African bottlers, who are voluntary members of PETCO, are increasingly assisting with the drive to improve recycling rates. Annual PET plastic bottle recycling increased to 65% of all bottles produced in the country in 2017 â&#x20AC;&#x201C; up

from 55% in 2016, according to recently UHOHDVHGÂżJXUHV This equates to 2.15 billion bottles recycled in 2017, which created 64 000 income-generating opportunities for recyclers and waste collectors participating in what is termed the â&#x20AC;&#x153;circular economyâ&#x20AC;?, while also freeing up 578 PRIGZLQGOLQJODQGÂżOOVSDFH3(7&2 announced in May. PETCO CEO Cheri Scholtz, said these ÂżJXUHVSXW6RXWK$IULFDQ3(7UHF\FOLQJ on par with global standards and that the organisation had set an ambitious recycling target of 70% by 2020. (YHQPRUHVLJQLÂżFDQWVDLG6FKROW] was that approximately 96% of all PET bottles recovered in South Africa were reprocessed locally into new end-use products. â&#x20AC;&#x153;South Africa no longer imports SRO\HVWHUVWDSOHÂżEUHZKLFKLVDV\QWKHWLF ÂżEUHPDGHIURP3(7SODVWLFDQGXVHG in the manufacture of clothing and other items. Âł7KLVÂżEUHLVQRZHYHQEHLQJH[SRUWHG bringing valuable foreign earnings into the country,â&#x20AC;? she said. â&#x20AC;&#x153;One thing that is very clear is that plastic is not trash and that recycling unlocks its secondary economic value,â&#x20AC;? said Scholtz. The main problem with regard to plastic pollution, Ribbink said, was the lack of â&#x20AC;&#x153;real measurable dataâ&#x20AC;? to get an accurate picture of â&#x20AC;&#x153;one of the worldâ&#x20AC;&#x2122;s greatest threatsâ&#x20AC;?. He pointed to the example of Port Elizabeth, which is blazing a trail in

WKHÂżJKWDJDLQVWSODVWLFSROOXWLRQ,ILW continues in this vein, it could be the cleanest city in South Africa by 2021, he said. The city is under scrutiny as a South African plastic pollution case study, with drones and planes being used to capture representative data. â&#x20AC;&#x153;People are being mobilised in a number of ways including using mobile apps to monitor on the ground where the major pollution problems are, not just on beaches and estuaries but also where people, live, work and play,â&#x20AC;? he said. So strong is this movement that a 5PLOOLRQSODVWLFZDVWHVFLHQWLÂżF research and community empowerment initiative will see the establishment of the ÂżUVWRILWVNLQG$IULFD:DVWH$FDGHP\LQ WKHFLW\ZLWKLQWKHQH[WÂżYH\HDUV Ribbink paid tribute to the strides being taken by companies like PETCO who, he said, are the key to success with their pioneering approach to recycling. Community members and companies PDNLQJVWULGHVLQWKHÂżJKWDJDLQVW plastic pollution were also rewarded for their efforts during the PETCO awards ceremony that rounded off the AGM*. www.petco.co.za

*SODVWLFVFKDUWHUGHWDLOVVRPHVSHFLÂżFJRDOV OCEAN litter, recycling and more environmentally sustainable uses of SODVWLFVLQJHQHUDOUHFHLYHGVLJQLÂżFDQW attention in the Ocean Plastics Charter DGRSWHGRQ-XQHE\ÂżYHRIWKH* member nations. The non-binding charter, signed by Canada, France, Germany, Italy, the United Kingdom and the European Union, suggests those governments want to see VLJQLÂżFDQWLPSURYHPHQWVLQKRZSODVWLFLV used and how plastic waste is managed.

It includes a commitment to recycle and reuse at least 55% of plastics packaging by 2030, and recover all plastics by 2040, DQGDVH[SHFWHGFDOOVIRUÂłVLJQLÂżFDQWO\ reducingâ&#x20AC;? unnecessary uses of single-use plastics. 7KHGRFXPHQWLQFOXGHVVSHFLÂżF SRLQWVLQÂżYHEURDGFDWHJRULHVDQGDOVR suggests stronger government roles in supporting markets for recycled plastics, including increasing recycled content by at least 50% in plastic products by 2030. The agreement was not signed by two G7 members, Japan and the United States. Itâ&#x20AC;&#x2122;s not clear why. 0DQ\RIWKHVSHFLÂżFFRPPLWPHQWV spelled out in the document are more than a decade away, but if implemented could

mark a sharp change in plastics use and the role of government in the industry. The document, for example, calls for research to assess current plastics consumption by sector and look for areas to eliminate unnecessary uses, and strengthen labeling standards â&#x20AC;&#x153;to enable consumers to make sustainable decisions on plastics, including packaging.â&#x20AC;? It also calls for accelerating international action and investments around marine waste, and encourages government procurement to â&#x20AC;&#x153;reduce waste and support secondary plastics markets and alternatives to plastic.â&#x20AC;? It also said it was important to consider the environmental impact of any alternatives to plastics.

Canadian Prime Minister Justin Trudeau - Canada used its presidency of the G7 to try to persuade the worldâ&#x20AC;&#x2122;s richest and most industrialized countries to adopt ambitious goals for plastics recycling and waste reduction


SAPY Advert 2018.indd 86

2018/05/21 11:52


People

People on the move

Injection moulding for the medical, transportation, engineering, home appliances & houseware markets Various and vast skill sets, coupled with years of experience in quality and production control, R&D, machine setting, mould designing and procurement. Manufacturing â&#x20AC;¢ Injection moulding machines from 100-ton up to 500-ton clamp force â&#x20AC;¢ R&D expertise specialising in cradle-to-grave solutions, product design Quality Systems â&#x20AC;¢ Effective quality benchmark tool to ensure the precision of all products â&#x20AC;¢ Implemented throughout every process in the supply chain Value-Added Services â&#x20AC;¢ PAD printing â&#x20AC;¢ Product assembly â&#x20AC;¢ Re/design consulting â&#x20AC;¢ Career development and enhancement

Contact Kevin Govender at GPS Plastics on tel 031 701 2667 or email: kevingov@gpsplastics.co.za admin@gpsplastics.co.za

(;;2102%,/0LGGOH(DVW0DUNHWLQJ &RUSRUDWLRQZKLFKKDQGOHVWKHPDUNHWLQJ RIWKHYDULRXV([[RQ0RELOSHUIRUPDQFH SRO\HWK\OHQHSRO\PHUV±LQFOXGLQJ ([FHHGÂ&#x152;;3([FHHGÂ&#x152;DQG(QDEOHÂ&#x152;± DFURVV$IULFDDQGWKH0LGGOH(DVWKDV H[SDQGHGLWVWHDPLQ6RXWK$IULFDZLWK WKHDSSRLQWPHQWRIWKUHHLQGLYLGXDOV ZLWKWRJHWKHUPRUHWKDQ\HDUV¶ H[SHULHQFHLQWKHSRO\HWK\OHQHSRO\PHU industry: Duncan Brown and Ramon Scheepbouwer, who are handling PDUNHWLQJDQGAndrea GoldsmithZKR LVUHVSRQVLEOHIRUPDUNHWLQJDVVLVWDQFH 5DPRQEDVHGLQ-RKDQQHVEXUJKDV EHHQDSSRLQWHGDFFRXQWPDQDJHULQ 6RXWK$IULFD5DPRQKDVEHHQDFWLYH LQWKHFKHPLFDOLQGXVWU\VLQFHKH ZDVEXVLQHVVXQLWPDQDJHUIRUUXEEHU SURGXFWVDW3ODVWLFKHPDUDZPDWHULDO GLVWULEXWRUZKHUHKHKHDGHGXSWKH UXEEHUSURGXFWV /DQ[HVV EXVLQHVV XQLW7KHUHDIWHUKHZDVVDOHVPDQDJHU DW(DVW5DQG3ODVWLFVDQGIURPWR VDOHVPDQDJHUDIWHUZKLFKKHZDV DSSRLQWHGDVJHQHUDOPDQDJHURI*XQGOH 3ODVWLFV*URXSDWWKHLU*HUPLVWRQIDFWRU\ +HLVDQH[SHUWLQ¿OPÃ&#x20AC;H[RSULQWLQJDQG EDJPDNLQJ5DPRQZLOOSUHGRPLQDQWO\EH ORRNLQJDIWHUWKH-RKDQQHVEXUJDUHDEXW

ZLOODOVREHUHVSRQVLEOHIRUPDUNHWLQJWR VRPHFXVWRPHUVLQ&DSH7RZQ'XUEDQ 1DPLELDDQG6ZD]LODQG Duncan has been involved in the LQGXVWU\IRUPRVWRIKLVFDUHHUWRR RULJLQDOO\LQWKHVDOHVRI%233¿OPVIURP 7DJOHHI,QGXVWULHVRI'XEDLIROORZLQJ ZKLFKKHMRLQHG:HVW$IULFDQ*URXSLQ ZKHUHKHFRQWLQXHGZLWK%233 ¿OPVXSSO\EHIRUHPRYLQJLQWR:$*¶V SRO\PHUVXSSO\EXVLQHVV'XQFDQZKR KDVDGHJUHHLQLQGXVWULDOSV\FKRORJ\ ZDVDSSRLQWHGDVDQDFFRXQWPDQDJHUIRU 6RXWKHUQ$IULFDLQ'HFHPEHUKHLV EDVHGLQ'XUEDQ $QGUHDZLWKRYHU\HDUV¶H[SHULHQFH LQWKHSODVWLFVDQGFKHPLFDOVVHFWRU MRLQHGWKH([[RQ0RELO&KHPLFDOWHDPLQ 'HFHPEHUWRR6KHKDVZRUNHGDWVRPH RIWKHWRSPDWHULDOVXSSO\EXVLQHVVHVLQ WKHFRXQWU\DQGZLOOEHSDUWRIWKHWHDP SURYLGLQJSURIHVVLRQDOVXSSRUWLQORJLVWLFV SODQQLQJDQGEDFNRI¿FHDGPLQLVWUDWLRQ$ TXDOL¿HGKRUWLFXOWXULVW$QGUHDLVEDVHGLQ -RKDQQHVEXUJ Chantelle Phillips has been elected FKDLUSHUVRQRIWKH*DXWHQJUHJLRQRIWKH Production Technologies Association of 6$ 3W6$ $TXDOL¿HGSURMHFWPDQDJHU ZLWKH[SHULHQFHPRVWO\LQWKHDXWRPRWLYH

Key appointments by PETCO for extended producer responsibility Three new non-executive directors serve three-year voluntary terms INDUSTRY stakeholders across South Africaâ&#x20AC;&#x2122;s PET plastic YDOXHFKDLQKDYHUHDI¿UPHGWKHLUFRPPLWPHQWWRH[WHQGHG SURGXFHUUHVSRQVLELOLW\ZLWKWKUHHNH\DSSRLQWPHQWVWRWKH QDWLRQDO3(75HF\FOLQJ&RPSDQ\ 3(7&2 ERDUG 1RPLQDWHGE\WKHLQGXVWU\VHFWRUVWKH\UHSUHVHQWWKHQHZO\ HOHFWHGQRQH[HFXWLYHERDUGPHPEHUVZLOOVHUYHDYROXQWDU\ WKUHH\HDUWHUP 5HSUHVHQWLQJWKHUHWDLOVHFWRU/LVD5RQTXHVWKHDGRI IRRGWHFKQRORJ\IRU:RROZRUWKVUHSODFHVUHWLUHGFROOHDJXH 7RP0F/DXJKOLQZKLOH.HYLQ2¶%ULHQZKRLVWKHULVNDQG VXVWDLQDELOLW\H[HFXWLYHIRUWKH63$5*URXSDVVXPHV WKHSRVLWLRQYDFDWHGE\3LFNQ3D\¶VJHQHUDOPDQDJHUIRU VXVWDLQDELOLW\$QGUp1HO ,QDGGLWLRQWKHERDUGKDVDSSRLQWHGLQGHSHQGHQWH[SHUW 3URIHVVRU/LQGD*RGIUH\ZKRLVWKH&6,5¶VSULQFLSDOVFLHQWLVW IRUZDVWHUHVHDUFKGHYHORSPHQWDQGLQQRYDWLRQWRFRQWULEXWH to the strategic oversight of PET recycling and assist with the GHYHORSPHQWRIDQLQGXVWU\ZDVWHPDQDJHPHQWSODQ 2QWKHRSHUDWLRQVVLGH6FKROW]VDLG3(7&2KDGDOVR DSSRLQWHG¿QDQFLDOFRQWUROOHU9LFNL5HWLHIDQGUHF\FOLQJ PDQDJHU3HDUO0ROHSRZLWK7ORX6HERODSURPRWHGIURPLQWHUQ WRUHJLRQDOUHSUHVHQWDWLYHIRUFROOHFWLRQVDQGWUDLQLQJSURMHFWV

Lisa Ronquest

Professor Linda Godfrey

46 AUG / SEPT 2018

PEOPLE.indd 46

2018/08/02 10:37


People Duncan Brown, Andrea Goldsmith and Ramon Scheepbouwer have all joined ExxonMobil

region. The PtSA has recently emerged out the Tooling Association of SA (TASA), in line with global standards where the emphasis is on production technologies as a whole (an area where most of the processing equipment is metallic). At functions held around the country recently, Chantelle spoke about the opportunities for companies WRFOXVWHULQRUGHUWREHDEOHWRIXO¿OO potential orders for new tooling for export. This is something which until recently was not even thought of, as so much of the country’s tooling needs were being sourced offshore.

the Yizumi machines it supplies continuing to prove popular – the line’s performance-to-price ratio ringing the right bells. Yizumi also offers solutions for foam, silicon and rubber injection moulding and die casting machines from 60 ton to 4500 tons. Besides that, KZN-based Mould Base also supplies Topstar ancillaries and robots; Dega (Italy) ancillaries, metal separators and high tech drying and mould temperature regulation equipment; Fooban (extrusion blow moulding equipment); Trueeasy (PET blowing machines); J Well (compounding and extrusion lines); SOYU (lump breakdown machines); LKM (mould bases, ejector pins); Forwell (quick-change hydraulic clamps); Tamsan (quick-change water and hydraulic systems); Zhushi (mould clamps); and IBS (hot runner and sequential gate controllers).

47

Annette Varrie has been appointed sales representative for Mould Base SA. Annette has good experience in the industry and has a broad knowledge of the plastics converting industry. Mould Base is one of the few local machinery suppliers which stocks injection moulding machines, with

Annette Varrie has joined Mould Base SA

AUG / SEPT 2018

industry, Chantelle is technical projects manager at Hellermann Tyton in Johannesburg. Surprisingly (bearing in mind that the toolmaking sector is one of the last remaining bastions of male hegemony), she is managing well at getting tooling businesses in the sector to at least consider cooperating on a cluster basis. “Our team at Hellermann is successful in what we do because we realized that we cannot do ANYTHING without a close knit team, which we now have. I would like them to take the credit for the tremendous growth opportunity that has been created after Germany had realized the SA engineering team’s tremendous capabilities,” said Chantelle, referring to the cooperation with the Hellermann team at the group KHDGRI¿FHLQ*HUPDQ\ Now she is aiming to translate this momentum to PtSA activities in the

Chantelle Phillips, the new PtSA Gauteng region chairman, at one of the body’s functions recently

www.injectionmachine.co.za

Industry Sector: PLASTICS

PEOPLE.indd 47

2018/08/02 10:37


People

Fullimput wins Employee Engagement

Award 2018 FULLIMPUT has received a runner-up accolade in the Learnership and Skills Development Category at the Africa Employee Engagement Awards 2018 held in Rosebank, Johannesburg, in June. The Africa Employee Engagement Awards (EE) seek to inspire and educate people to remake the Fullimputâ&#x20AC;&#x2122;s Commercial Director, Reginald Nyandeni (far right) holding the Award way organisations think about and engage, people to achieve their purpose. The EE Awards honour those Africa Employee Engagement Awards â&#x20AC;&#x201C; 2018 Finalists organizations that put workforce engagement at the heart of and Runners up: their business strategy. â&#x20AC;˘ Inclusion and Diversity Awards â&#x20AC;&#x201C; Winner: Ford, Runner up: Fullimput was founded in 2003 by Irene Murgatroyd. The Mercedes Benz company manufactures entire product ranges from their â&#x20AC;˘ Reward, Recognition and Well-being Awards â&#x20AC;&#x201C; Winner: factory based in Jacobs, KZN, and has grown from strength Acacia, Runner up: Medshield to strength with a dynamic team led by MD Irene Murgatroyd, â&#x20AC;˘ Sustainable Futures Awards â&#x20AC;&#x201C; Winner: Tvet, Runner up: Sales Director Clinton Smith and Technical Director Henk Nedbank Limited Visser. Fullimputâ&#x20AC;&#x2122;s production facility and stringent quality â&#x20AC;˘ Social Responsibility Awards â&#x20AC;&#x201C; Winner: Sun International control systems ensure service excellence to all customers. â&#x20AC;˘ Learnership and Skills Development â&#x20AC;&#x201C; Winner: Cummins, The award recognises that Fullimput is going beyond Runner up: Fullimput, CBD Electrical, Otis and Bosch. the scorecard with support for learnerships or apprentice â&#x20AC;˘ Internal Communication â&#x20AC;&#x201C; Winner: Kuai, Runner up: programmes in the workplace. The awards also recognize Hungary Lions. UHJLVWHUHGSURJUDPPHVZKLFKKDYHVLJQLÂżFDQWO\LPSDFWHG â&#x20AC;˘ Thuma Mina Non-Government Project â&#x20AC;&#x201C; Winner: Endaleni employeesâ&#x20AC;&#x2122; skills or development opportunities which include Leather Skills KZN mentoring and coaching. More importantly, the companyâ&#x20AC;&#x2122;s â&#x20AC;˘ Best NGO of the year â&#x20AC;&#x201C; Winner: Kwasa College, Runner up: efforts and approach must make a material and lasting Imbumba Foundation GLIIHUHQFHWRHPSOR\HHVDQGEHQHÂżFLDULHV â&#x20AC;˘ Public Sector company â&#x20AC;&#x201C; Winner: Transnet, Runner up: Eskom The awards are held globally and provide a platform to â&#x20AC;˘ Consultancy of the Year â&#x20AC;&#x201C; Winner: Ethos Quality recognise excellence in engagement that inspires action and Management, Runner up: Ruby Sky drives the industry and the employee experience forward. â&#x20AC;˘ EE Company of the Year â&#x20AC;&#x201C; Winner: Growthpoint Properties, Below is the full list of winners and runners-up: Runner up Eskom, Acacia, Impala, and Transnet.

Polyflor partners with Carte Blancheâ&#x20AC;&#x2122;s MAD trust

48 AUG / SEPT 2018

Hospital receives state of the art paediatric operating theatre POLYFLOR SA has once again partnered with M-Netâ&#x20AC;&#x2122;s award-winning investigative journalism series Carte Blanche and its Making a Difference (MAD) Trust by contributing vinyl Ă&#x20AC;RRULQJDQGZDOOSURWHFWLRQYDOXHGDW more R250 000 to a special hospital project that will help to improve the lives of thousands of children visiting the Tygerberg Hospital in the Western Cape each year. $FFRUGLQJWR3RO\Ă&#x20AC;RU6$FKLHI H[HFXWLYHRIÂżFHU7DQG\&ROHPDQ this was the ninth year that the company has been involved in this annual campaign which aims to equip and renovate paediatric operating theatres, ICUs and High Care wards in selected state academic hospitals throughout South Africa. To date, the Carte Blanche MAD Trust has completed 18 hospital projects in 10 hospitals within six provinces nationally.

PEOPLE.indd 48

â&#x20AC;&#x153;Tygerberg Hospital has a very large Obstetric Department with over 7 000 children born at this hospital each year, of which approximately 10% of the newborns will require immediate surgical interventions,â&#x20AC;? said Karolina Andropoulos, Patron of the MAD Trust. 0RUHWKDQPĂ°RI3RO\Ă&#x20AC;RUÂśV3HDUOD]]R385LQ2FHDQ Modern healthcare design is Ripple and Seafoam was used in the new Paediatric all about creating comfortable, 2SHUDWLQJ7KHDWUHWRJHWKHUZLWKVKHHWVRI*UDGXV SanParrel wall and door protection sheeting in Lagoon relaxed environments that are as welcoming as they are safe and FOHDQ7KHULJKWNLQGRIĂ&#x20AC;RRULQJ can have a positive effect on the atmosphere of a hospital and inspire a sense of healing and wellbeing in patients, staff and visitors. More than 280m² of Pearlazzo PUR in Ocean Ripple and Seafoam was used in the new Paediatric $3RO\Ă&#x20AC;RU6$7HDPFRQVLVWLQJRI/HUR\$UHQGVH WHFKQLFDO Operating Theatre, together with advisor), Wendy Mitrovich (brand manager) and chief H[HFXWLYHRIÂżFHU7DQG\&ROHPDQDWWHQGHGWKHRIÂżFLDO 25 sheets of Gradus SanParrel handover recently, during which the newly refurbished and wall and door protection sheeting HTXLSSHG1HRQDWDODQG3DHGLDWULF2SHUDWLQJ7KHDWUHZDV in Lagoon. RIÂżFLDOO\KDQGHGRYHU ZZZSRO\Ă&#x20AC;RUFR]D

2018/08/02 10:37


Relloy ad '014 05 (Welding) Propak.indd 1

2018/04/05 10:22


“CHECKMATE” – WE REMAIN KING IN THE INDUSTRY OF BLACK, WHITE AND FILLER MASTERBATCH. HEAD OFFICE - GAUTENG Telephone: +27 (0) 11 746 4000

EASTERN CAPE - Port Elizabeth Telephone: +27 (0) 41 451 2571

KWA-ZULU NATAL - New Germany Telephone: +27 (0) 31 713 0631

WESTERN CAPE - CAPE TOWN Telephone: +27 (0) 21 935 1788

www.ferrosa.co.za


Equipment

Vishva introduces spine sealer with flying knife for rice, dogfood bags Vishva team comes up with dual servo solution for bottom seal machine â&#x20AC;&#x153;This will increase the production speed DQGZLOOJLYHWKHFXVWRPHUPRUHSUHFLVLRQRQ WKHFXWWLQJRIWKHEDJV,WDOVRUHGXFHVWKH maintenance required,â&#x20AC;? said Uday Shah of 9LVKYDLQ$KPHGDEDG â&#x20AC;&#x153;The feature will also help customers cut KHDY\PLFURQVDWKLJKHUVSHHGVZKLFKZDVQRW SRVVLEOHRQWKHRUGLQDU\ROGGHVLJQĂ&#x20AC;\LQJNQLIH´ DGGHG8GD\ The bottom seal machines are available in DQGVL]HV 7KLVLVSDUWRI9LVKYDÂśVRQJRLQJSURJUDPPHRI GHYHORSLQJWHFKQRORJ\WREHHIIHFWLYHLQZKDWLVD KLJKO\FRPSHWLWLYHPDUNHWLQWHUQDWLRQDOO\ â&#x20AC;&#x153;Slow production machines are just not viable DQ\ORQJHU2QHQHHGVPDFKLQHVZKLFKJLYHKLJK production in the minimum amount of production WLPHODERXUDQGHOHFWULFLW\FRVW´VDLG8GD\ 2WKHUVSHFLDOLVHG9LVKYD([LPPDFKLQHV LQFOXGLQJFRXULHUEDJPDFKLQHVZLFNHWHU EDJPDNHUVFKLFNHQSHQDQG]LSORFNEDJ machines will also be equipped with the dualVHUYRVROXWLRQ 9LVKYDVWRFNVVSDUHVLQ6RXWK$IULFDWRJLYH IDVWHUDIWHUVDOHVVHUYLFH

AUG / SEPT 2018 51

VISHVA Exim of India, one of the machinery suppliers from the sub-continent which has become most involved in the industry in Africa, has developed a new Ă&#x20AC;\LQJNQLIHVROXWLRQIRULWV9HORVV ERWWRPVHDOEDJPDNLQJV\VWHPWKH new machine is equipped with two VHUYRVRQHRQWKHLQGH[LQJDUPDQG WKHRWKHURQWKHĂ&#x20AC;\LQJNQLIHLWVHOI 7KLVKDVWKHUHVXOWRILQFUHDVLQJ production speeds by a substantial PDUJLQ The newest version of Vishvaâ&#x20AC;&#x2122;s 9HORVV)%Ă&#x20AC;\LQJNQLIHERWWRP seal machine has in the process been sped up and now runs at up to 100 F\FOHVDPLQXWH This is a notable achievement for the special spine sealer V\VWHPIRUWKHSURGXFWLRQRIGRJ IRRGDQGULFHEDJVRURWKHU The new dual servo solution for VLPLODUEDJVZKLFKRIWHQXVH the Veloss 1000 FB bagmaker allows for the FXWWLQJRIKHDY\PLFURQÂżOPVDWKLJKHUVSHHGV UHODWLYHO\KHDY\JDXJHÂżOP

www.vishvaexim.com

Presents

RANGE OF BAG MAKERS

MORE THAN 50 INSTALLATIONS IN 3 YRS

VISHVA EXIM of Ahmedabad, India, has for a number of decades been manufacturing plastics processing machinery, including extrusion systems, slitter-rewinders, pouchmaking machines and its very popular VELOSS bag-makers. Flying knife bottom sealer with spine sealer to make dog food and rice bags This machine is equipped with 2 servo motors. One on the indexing and one on the cutting. Due to this feature, the accuracy on cutting and speed of production increases. Reduces the maintenance on the cutting mechanism. We have also equipped a special spine seal attachment to make dog food and rice bags. â&#x20AC;˘ Produce bags WIDTHS from 1000mm to 1600mm and LENGTH up to 2500mm â&#x20AC;˘ Flying knife bottom seal up to 1600mm

WWW. VISHVAEXIM. COM

Contact us: Vishva Exim Pvt Ltd T: +91 98 797 97910 M: +91 9099 16958 and +91 9909 61225 E: info@vishvaexim.com

EQUIP-VISHVA .indd 51

2018/08/02 10:58


Association News Informal sector collectors play an important role in the collection of PET containers in South Africa but, due to logistical issues such as delayed collections, as much as 80% of PET containers in rural areas is not being collected

Petco aims for

70% PET recycling target by 2020

52 AUG / SEPT 2018

Potential growth in rest of Africa researcher Dr Suzan THE recycling of PET continues to Oelofse. grow in South Africa, with a 65% â&#x20AC;&#x153;We have experienced recovery rate achieved last year, double-digit growth compared with just 12% in 2004 when PETCO was founded. in PETCOâ&#x20AC;&#x2122;s history. In 2017, the recycling of PET bottles Therefore, year-onprovided 64 000 income-generating year, we have seen opportunities for recyclers and waste the denominator grow collectors while also freeing up 578 between 10 and 12%,â&#x20AC;? Figures for 2017 show that as many as 64,000 PĂąRIGZLQGOLQJODQGÂżOOVSDFHLQ emphasised Du Randt, adding that income-generating opportunities for collectors and South Africa. PETCO continuously aimed to increase recyclers were generated by the PETCO system PETCO CEO, Cheri Scholtz said its recycling percentage, despite if it could blend some of these trays that just under 94 000 tons of PET was the ever-growing denominator, â&#x20AC;&#x153;and ZLWKERWWOHVWRPDNHDÂżEUHWKDWFRXOG collected in 2017, equating to six million we have never failed to achieve our bottles a day â&#x20AC;&#x201C; or 250 Olympic-sized targetâ&#x20AC;?. The recycling of PET improved be used commercially. This was successful, said Scholtz, with PETCO swimming pools. by 10% in 2017, compared with 55% in hoping to take this project forward. When PETCO 2016. Du Randt highlighted that one of Even though South was founded, the South African the targets of beverage manufacturer market was no PET recycling Africaâ&#x20AC;&#x2122;s PET recycling Coca-Cola Companyâ&#x20AC;&#x2122;s â&#x20AC;&#x2DC;World Without more than 10 000 was on par with rate compares Wasteâ&#x20AC;&#x2122; initiative was to increase the or 12 000 tons of global standards, favourably by global amount of rPET in its packaging up to PET, said PETCO said Scholtz, with 50% by 2030. standards, quite a chairperson the organisation According to the Africa Waste Casper Du Randt, having set a lot of material is still Management Outlook report released addressing recycling target going to landfills on 5 June by the UN and CSIR, 13% delegates at of 70% by 2020. of all waste generated in Africa is the roundtable Thermoforming material plastic, noted Oelofse, who specialises event at the Hyatt Hotel in Rosebank, With regard to PET thermoform sheet in integrated waste management. The Johannesburg. The gathering was products, which are not currently report also noted that waste generation FKDLUHGE\&RXQFLOIRU6FLHQWLÂżFDQG recycled in South Africa, Scholtz said, in Africa would more than double by Industrial Research (CSIR) principal generally, in Europe, material goes 2025. into energy recovery because of the Scholtz said 96% of South Africaâ&#x20AC;&#x2122;s complexity of its recycling. U3(7SURGXFWZDVEHQHÂżFLDWHGORFDOO\WR â&#x20AC;&#x153;But the changing packaging the point where South Africa no longer directive in Europe is creating exciting QHHGHGWRLPSRUWSRO\HVWHUVWDSOHÂżEUH opportunities. As we head to a circular â&#x20AC;&#x153;We have saturated our use for it economy principle, the powers that be now and are encouraging the countryâ&#x20AC;&#x2122;s in the European Union are encouraging UHF\FOHUVWRH[SRUWÂżEUHWR(XURSH countries to take these packs out of for example. The opportunity is there the recovery stream to investigate for the rest of Africa as consumption recycling methods.â&#x20AC;? increases and their recycling systems Scholtz advised that the recycling develop,â&#x20AC;? she added. of thermoformed sheet has also been PETCO has also shared its model reviewed in South Africa, where all with other African countries and, in the PET trays already contain at least 25% last year, helped set up PETCO Kenya, which recently appointed a board of recycled content. directors and employed a recycling PETCO ran a small pilot project programme manager. towards the end of last year to see

( )

www.petco.co.za

Assocation News.indd 52

2018/08/01 13:18


2I¿FH&HOOÂ&#x2021;DGPLQ#PJPZWUDGLQJFR]D /RJ5RDG8QLW1RÂ&#x2021;5RRGHNRS,QGXVWULDO$UHDÂ&#x2021;*HUPLVWRQ

3OHDVHQRWHRXUQHZFRQWDFWGHWDLOV

MGMW Trading advert Edited.indd 94 Edited-BLEED.indd 94

2018/06/271:17 11:14 2016/04/07 PM


Association News

Boost for recycling SMMEs PET industry lends support to Joburg recyclers

PETCO chairman Casper Durandt, at the handover ceremony in Ekurhuleni, addressed various small businesses and UHF\FOLQJ600(UHSUHVHQWDWLYHVZKRKDYHEHQHÂżWWHGIURPQHZ recycling equipment such as baling machines sponsored by 3(7&2DQGERWWOHFRQYHUWHU6HULRSODVW )URPOHIW 3DWULFLD 6NRVDQD%DGDQLOH1]LPDQGHDQG$OXZDQL0XVHWVKRIURP&-8 Environmental Management

RECYCLING SMMEs received support from the PET recycling sector on July 13 in the form of equipment that will enable their effective participation in the mandatory recycling programme launched by the City of Ekurhuleni. This follows concerns from small industry players and informal waste collectors that they could be sidelined by the new â&#x20AC;&#x153;separation-at-sourceâ&#x20AC;? municipal recycling initiative. PET plastic bottle producer Serioplast and the PET Recycling Company (PETCO) donated the equipment â&#x20AC;&#x201C; baling machines, industrial platform scales and signage â&#x20AC;&#x201C; to local SMMEs with the aims of improving the

collection, weighing and baling of recyclable material for resale to recycling businesses. More EHQHÂżFLDULHVDUHVHWWRUHFHLYH similar donations from PETCO in the coming weeks. The Gauteng-based small businesses included Ekhuliza Gauteng Primary Cooperative and CJU Environmental Management in Boksburg and Lakhwisha Holdings in Vosloorus. Speaking after the event, which was hosted in partnership with the City of Ekurhuleni, PETCO chief executive RIÂżFHU&KHUL6FKROW]VDLGWKH citywide household recycling initiative was a positive step forward in creating a recycling consciousness among ordinary

Intisimbi Future Production Technologies launched Positioning SAs manufacturing sector in global competitive industry 4.0 â&#x20AC;&#x153;More than 500 companies, from key industries, specialising THE Minister of Trade and Industry, Dr Rob Davies launched the in hi-tech capital equipment, steel and plastics as well as tool, new Intsimbi Future Production Technologies Initiative (IFPTI) die and mould-making industries, will be participating in the in Cape Town in June. The launch took place at NTIPâ&#x20AC;&#x2122;s Centre programme by providing on-the-job facilities in their factories of Excellence, a venue which was recently equipped with new for students,â&#x20AC;? indicated Davies. state-of-the-art industrial machinery for the artisan programme. In terms of Industrial Policy Action Plan 2018/19, the Minister Davies said the new IFPTI was developed in line concept of digital industrial technologies is profoundly shaping with the principles of new production technologies for the 4th governmentâ&#x20AC;&#x2122;s efforts to promote industrial development in an Industrial Revolution. The government was building capacity already complex global economy. The IFPTI programme will in response to the impact and opportunities that the Industry serve as one of the levers government implement to lessen 4.0 will bring about, he added. the disruptive and challenging impacts expected. â&#x20AC;&#x153;The launch of the new programme includes the renaming and Bob Williamson, chairman of the IFPTI, said: â&#x20AC;&#x153;to raise to rebranding of the previous National Tooling Initiative Programme these challenges it is imperative that our industry embraces (NTIP). The key oversight body will remain the Intsimbi board the fact that they need to adapt to the use of technologies and the implementation agency NTIP. NTIP will no longer be the National Tooling Initiative Programme, VXFKDVURERWLFVDUWLÂżFLDOLQWHOOLJHQFHQDQRWHFKQRORJLHVDQG quantum computingâ&#x20AC;?. but will be renamed the National Technologies Implementation Platform (NTIP), the same acronym because of its international standing,â&#x20AC;? said Davies. The launch of Intsimbi marks an expansion of the previous SLORW1DWLRQDO7RROLQJ,QLWLDWLYHSURJUDPPHLQWRDIXOO\Ă&#x20AC;HGJHG Industry 4.0 programme which will include, amongst others, training in robotics, mechatronics and industrial maintenance. The Intsimbi model has succeeded in creating highly innovative industry driver solutions that can sustainably be expanded, which will position South Africaâ&#x20AC;&#x2122;s Advanced Manufacturing sector in Industry 4.0 that is transforming global competitiveness in manufacturing. 'U5RE'DYLHVDWWKHODXQFKRIUHQDPLQJRIWKH 1DWLRQDO7HFKQRORJLHV,PSOHPHQWDWLRQ3ODWIRUP>17,3@

54 AUG / SEPT 2018

Assocation News.indd 54

2018/08/01 13:26


Association News virgin PET material. â&#x20AC;&#x153;The hard work and efforts of all players in the PET value chain â&#x20AC;&#x201C; from brand owners and producers to individual waste pickers â&#x20AC;&#x201C; allowed us to recycle 2.15 billion bottles in 2017. â&#x20AC;&#x153;PETCO believes that the training and mentorship of waste entrepreneurs like those represented here today is critical in helping them to grow and sustain their businesses. Ultimately, this will stimulate economic growth, job creation and the development of our country as a whole.â&#x20AC;? Serioplast director Alessandro

Innocenti said, as a bottle converter, the company was aware of plasticâ&#x20AC;&#x2122;s potentially negative environmental impact and that, instead of dumping ERWWOHVLQODQGÂżOOVLWHVLWZDVYLWDOWRÂżQG ways of unlocking the value in waste and giving it new life. â&#x20AC;&#x153;Itâ&#x20AC;&#x2122;s time we all start treating plastic like the valuable resource it is. Serioplast is proud to support PETCOâ&#x20AC;&#x2122;s commitment to a green, inclusive economy that helps the environment and has a positive impact on local communities.â&#x20AC;? AUG / SEPT 2018

Assocation News.indd 55

www.petco.co.za

South Africans. â&#x20AC;&#x153;It is also an important opportunity for local government and industry stakeholders to develop meaningful strategies for waste reduction as well as an inclusive framework that facilitates participation and creates income-generating opportunities for businesses of all sizes,â&#x20AC;? she said. Scholtz said PET recycling had been particularly effective in creating a â&#x20AC;&#x153;circular economyâ&#x20AC;? with plastic water and soft drink bottles offering post-consumer value to waste collectors and recyclers, while also reducing producersâ&#x20AC;&#x2122; need for

With the city of Ekurhuleni introducing the mandatory household recycling programme, small SMMEs businesses were recipients of new recycling machinery. Phumla Mjonono accepts the donation on behalf of CJU Environmental Management

www.serioplast.com

Serioplast director Alessandro Innocenti said at the event, â&#x20AC;&#x153;Itâ&#x20AC;&#x2122;s time we all start treating plastic like the valuable resource it isâ&#x20AC;?. From left, Patricia Skosana, Badanile Nzimande and Aluwani Musetsho, members of CJU Environmental Management

55

2018/08/01 13:45


Association News

Plastic Alternatives

– Blessing or Curse? 0DQ\RIWKHSODVWLFDOWHUQDWLYHVÀRRGLQJWKHPDUNHWKDYHQRWEHHQSURSHUO\HYDOXDWHG to consumers sounds good in theory; however, further scrutiny reveals that ON 3 JULY, citizens throughout the these bags and other biodegradable world celebrated Plastic Bag Free Day, plastic products will only degrade hot on the heels of Environment Day in a properly managed composting and World Oceans Day, both celebrated IDFLOLW\DQGGH¿QLWHO\QRWLQWKHQRUPDO a few weeks earlier. On all three of suburban compost heap. these days, and throughout the month According to the internationally of ‘Plastic Free July’, consumers were accepted standard for compostability encouraged to #beatplasticspollution (EN 13432), the packaging must and join the challenge to ‘choose to be mixed with organic waste and refuse’ single-use plastics. maintained under test scale composting Calls for action such as these make it conditions for 12 weeks. If not kept clear that consumers around the world under ideal conditions, these bags will are tired of visible litter. By responding not biodegrade and are most likely to on social media platforms with zealous HQGXSLQRQHRIWKHFRXQWU\¶VODQG¿OOV passion, they (also not an demand to see To the uninformed, ideal composting an end to plastic environment) this might seem packaging such or worse – in as carrier bags, an excellent and the recycling drinking straws and practical solution to stream where it cotton ear buds. solve an irritating will contaminate Recognising the entire stream problem. The reality, an opportunity to and render unfortunately, is far JDLQVLJQL¿FDQW more material marketing and from the truth unrecyclable. PR mileage some By ANTON HANEKOM

( )

retailers and brand-owners were quick to respond to these public outcries by introducing alternatives such as paper bags and piloting a compostable bag made from starches, cellulose, vegetable oils and combinations as an ‘environmentally friendly alternative to plastic bags’ to replace all plastic carrier bags, barrier bags and fruit and vegetable bags. To the uninformed, this might seem an excellent and practical solution. The reality, unfortunately, is far from the truth. Many of the so-called ‘plastic DOWHUQDWLYHV¶QRZÀRRGLQJWKHPDUNHW have not been properly evaluated. Will only biodegrade under ideal conditions Offering a compostable carrier bag

Recyclable products underwrites, supports a circular economy South Africa has a robust and welldeveloped plastics recycling industry that provided jobs to more than 52 000 collectors who collect waste that is mechanically recycled into new raw materials (more than 313 700 tons of plastic material in 2017 alone). Thanks to their dedicated efforts and South Africans commitment to recycling, 214 WRQVRI&2ðDQGHQRXJKODQG¿OO VSDFHWR¿OO2O\PSLFVL]HGVZLPPLQJ pools were saved in one year – this is the equivalent weight of 560 Airbus A380 aeroplanes, saving enough fuel to keep 178 000 cars on the road for one year! Unfortunately, the same cannot be said of these replacement materials.

Anton Hanekom, executive director Plastics|SA

All of these products will eventually reach the end of life and will need to be discarded. A non-woven plastic re-usable plastic bag, for example, is not currently recycled in South Africa owing to the fact that the stitching and webbing used in the manufacture of the bag are made of different materials to the bulk of the bag. Likewise, drinking straws made from alternate materials such as glass or bamboo tubing are neither currently recycled in South Africa nor, collected by waste pickers due to their low value and weight. On the other hand, when combined with a responsible, well-managed waste management system, a recyclable product not only underwrites and supports a circular economy, but also ensures that precious resources are protected and reused for as long as SRVVLEOH5HMHFWLQJDµ¿WIRUSXUSRVH¶ plastic packaging material with a low carbon footprint, in favour of an alternative material that is imported, more expensive, with a higher carbon footprint and potentially uses scarce food resources as raw material could create an even bigger problem, rather than solve this one. It is of vital importance that legislators, local government, consumers and the plastics industry continue to work together on developing solutions that are sustainable, well researched and properly evaluated. Only through this combined effort can we ensure that the resources are used and managed HI¿FLHQWO\DQGFDWHUWRDQLQFUHDVLQJ SRSXODWLRQVHHNLQJWKHXQULYDOHGEHQH¿WV offered by plastics packaging when it comes to preventing food waste, extending shelf life of products, and protection against breakage.

IOM Rubber Conference returns to St Francis THE Institute of Materials is to host its National Rubber Conference at Cape St Francis again: the 24th edition of this event, one of the longest known shows in the local polymers calendar at the Cape St Francis Resort from 4-7 April

(Thursday-Sunday) 2019. The conference was last held at the Eastern Cape resort in 2015, when it proved very popular. • Inquiries to iomsa@mweb.co.za

56 AUG / SEPT 2018

Assocation News.indd 56

2018/08/01 13:22


A global leader in the development and production of PVC Stabilisers and Metallic Soaps

erda.co.za

From Pack to Product Creating the Perfect PVC Pipe

Sun Ace June-July horizontal Rv1.indd 1

+27(11) 552 6200 / www.sunace.co.za

@sunaceza /

SUN ACE South Africa (Pty) Ltd

2018/06/04 12:47


Association News

Industry stakeholders Dow Technical Service and Development (QJLQHHU3DXO'XPRQW presented the companyâ&#x20AC;&#x2122;s ODWHVWDOOSRO\ROHÂżQ packaging prototypes, LQFOXGLQJDFHUHDOVWDQG XSSRXFKDVQDFNSRXFK DGU\SHWIRRGSDFNDZHW ZLSHVSRXFKDQGDFRIIHH SRXFK

Rubber powwow at IOM Foundation Lecture By Samantha Herbst, SA Plastics & Rubber Technology writer

IN CELEBRATION of World Environment Day, World Oceans Day and Sustainability Week 2018, Plastics|SAâ&#x20AC;&#x2122;s sustainability division, as well as representatives from the UN Environment, the National Recycling Forum (NRF) and Dow Packaging and Speciality Plastics, gathered at the &RXQVHOIRU6FLHQWLÂżFDQG,QGXVWULDO5HVHDUFK,QWHUQDWLRQDO Convention Centre on 5 June to talk about the scourge of plastics pollution, marine litter and waste and to showcase what the industry is doing to try combat these issues. â&#x20AC;&#x153;We use these commemorative days to create DZDUHQHVVDERXWSODVWLFVÂąQRWRQO\WKHEHQHÂżWRISODVWLFV but also what we as industry, consumers and government can do to address plastics pollution and waste,â&#x20AC;? said Plastics|SA Sustainability Director, Douw Steyn. Together with the NRF, Plastics|SA has been supporting Sustainability Week for several years to create awareness about living sustainably in terms of waste management DQGUHVRXUFHHIÂżFLHQF\0RUHRYHUDVWKHLQGXVWU\ERG\ÂśV sustainability department, Steyn and his team have been working hard to create awareness about what the industry is doing to promote sustainability.

This includes several on-the-ground initiatives such as Plastics|SAâ&#x20AC;&#x2122;s River Catchment Project â&#x20AC;&#x201C; aimed at addressing ocean pollution through community education programmes and clean-up campaigns â&#x20AC;&#x201C; as well as Operation Cleansweep, which aims to keep plastic pellets, Ă&#x20AC;DNHVDQGSRZGHULQIDFWRULHVWUXFNVDQGUDLOFDUVDQGRXW of the natural environment. Plastics|SA also facilitated a beach cleanup in Durban, in support of World Ocean Day on 8 June and will be supporting the Letâ&#x20AC;&#x2122;s Do It! World Cleanup Day campaign, which is taking place on 15 September in line with International Coastal Cleanup Day and Cleanup and Recycle SA Week. Steyn stressed that these activities were not meant to villainise the plastics industry but rather to showcase what the plastics industry could do to beat plastics pollution and waste. The industry body also decided to leverage World Environment Day to launch its latest survey on recycling statistics, which indicated that the countryâ&#x20AC;&#x2122;s current plastics recycling rate is 43.7%. Improving packaging recyclability 0HDQZKLOH'RZ3DFNDJLQJDQG3ODVWLFVDEXVLQHVVXQLW RI'RZ'X3RQWÂśV0DWHULDOV6FLHQFH'LYLVLRQXVHGWKH

Plastics|SAâ&#x20AC;&#x2122; new e-study course offering A selection of soft skills training programmes PLASTICS|SA has recently partnered with an industry leader in business and online education to offer a full suite of online soft skills programmes developed by Cross Knowledge in the UK. There are several online training options available for all levels of the ZRUNIRUFHLQFOXGLQJRIÂżFHEDVHG staff and factory staff. Each learning programme addresses the outcomes UHTXLUHGIRUVSHFLÂżFXQLWVWDQGDUGV LQFOXGHGLQWKH1DWLRQDO&HUWLÂżFDWH The newest training offering: 0HU6(7$DFFUHGLWHG*HQHULF

0DQDJHPHQW*HQHULF0DQXIDFWXULQJ NQF 5 Learnership starts in August 2018. *HQHULF0DQDJHPHQWLVD TXDOLÂżFDWLRQZKLFKWDUJHWVPDQDJHUV supervisors and all learners who have completed the NQF 4 and/or 6XSHUYLVRU\0DQDJHPHQW3URJUDPPH The following 5 phases can be done DVDVNLOOVSURJUDPPHRUDVSHFLÂżF phase can be attended as a â&#x20AC;&#x153;once-offâ&#x20AC;? skills programme. This programme is intended for managers in all economic sectors, the qualifying learners will be able to

â&#x20AC;˘

Identify opportunities for continuous improvements â&#x20AC;˘ Optimise all elements of a plastic manufacturing process â&#x20AC;˘ Apply methods and techniques to develop, implement and evaluate continuous improvement measures â&#x20AC;˘ 0DLQWDLQSURGXFWLRQHIÂżFLHQFLHVLQ a volume plastics manufacturing processes e.g. Injection moulding and others Respond to deviations, problems and incidents which affect HIÂżFLHQF\

58 AUG / SEPT 2018

Assocation News.indd 58

$QHZ1DWLRQDO&HUWLÂżFDWH*HQHULF0DQDJHPHQWÂą*HQHULF0DQXIDFWXULQJ14) 2018/08/01 13:20


from a linear take-make-dispose consumer model to a opportunity to showcase its solution to sustainable and more circular economy â&#x20AC;&#x201C; a drive to retain the value of the FRVWHIIHFWLYHPHGLXPEDUULHUSDFNDJLQJDLPHGDWĂ&#x20AC;H[LEOH worldâ&#x20AC;&#x2122;s resources by returning them into the product cycle, packaging industry players. WKHUHE\PLQLPLVLQJODQGÂżOOXVH$VSDUWRIWKLVFRPPLWPHQW Dow Technical Service and Development Engineer, Paul Dow is also focused on developing depolymerisation 'XPRQWSUHVHQWHGWKHFRPSDQ\ÂśVODWHVWDOOSRO\ROHÂżQ and chemicalisation techniques, used to break plastics packaging prototypes, including a cereal stand-up pouch, a down for reuse purposes when traditional mechanical snack pouch, a dry pet food pack, a wet wipes pouch and recycling processes are a coffee pouch. Demonstrated ineffective. These commitments through these products, Dowâ&#x20AC;&#x2122;s â&#x20AC;&#x2DC;Dowâ&#x20AC;&#x2122;s new all-polyolefin dovetail with the companyâ&#x20AC;&#x2122;s technological innovation is sustainability goals, which aim the conversion of typical PET/ packaging solutions are to decrease food waste and PE, metallised and aluminiumpart of the companyâ&#x20AC;&#x2122;s material use by providing better based packaging structures commitment to helping the packaging and improving the LQWR%2333( RUDOOSRO\ROHÂżQ  shelf life of products, increasing structured packaging, thereby world transition from a WKHUHF\FODELOLW\RIĂ&#x20AC;H[LEOH improving the recyclability of the linear take-make-dispose packaging and recovering value packaging. consumer model to a more from waste. A key enabler of the allAccording to Dumont, there SRO\ROHÂżQSDFNDJLQJLV'RZÂśV circular economyâ&#x20AC;&#x2122; is no question that plastic ADCOTE L86-500 solvent-based packaging outperforms EDUULHUDGKHVLYHZKLFKH[WHQGV alternative packaging materials (including aluminium, glass a productâ&#x20AC;&#x2122;s shelf life while optimising the recyclability, as DQGSDSHUEDVHGFRPSRVLWHV LQWHUPVRIZHLJKWHQHUJ\ ZHOODVWKHFRVWDQGUHVRXUFHHIÂżFLHQF\RILWVSDFNDJLQJ consumption during production and lifetime greenhouse Designed for medium-barrier applications, this adhesive SURYLGHVDGGLWLRQDOSURWHFWLRQDJDLQVWR[\JHQDQGPRLVWXUH gas emissions. It also plays an important role in food preservation, reducing the 1.3-billion tons of food being for aroma- and barrier-sensitive products. wasted in the world each year. 'XPRQWH[SODLQHGWKDWĂ&#x20AC;H[LEOHSDFNDJLQJFXUUHQWO\ What does need to change, however, is the common uses several layers of plastics, sometimes with layers of misconception of single-use plastic packaging. DOXPLQLXPIRLOWRSUHYHQWWKHPLJUDWLRQRIZDWHUR[\JHQ â&#x20AC;&#x153;That is a collaborative effort. We need industry, or aromas. When aluminium foil or PET is used within government and NGOs to come together to make this DSUHGRPLQDQWO\SRO\HWK\OHQH 3( SDFNDJLQJSURGXFW happen and to change peopleâ&#x20AC;&#x2122;s mindset from seeing plastic it impacts on the recyclability of that product. However, as a waste to seeing plastic as a valuable resource,â&#x20AC;? ZKHQSDFNDJLQJFRPSULVHVRQO\SRO\ROHÂżQV 3(DQG33  said Dumont, who believes Dowâ&#x20AC;&#x2122;s latest medium-barrier it is easier to recycle. Coupled with the appropriate barrier technology is one way of making this happen. adhesive technology, such as ADCOTE L86-500, this is He assured delegates that, while South Africa is slightly a winning recipe for an alternative to current commercial behind in terms of applying this type of technology to medium-barrier packaging. its retail products, Dow is working with South African 'RZÂśVQHZDOOSRO\ROHÂżQSDFNDJLQJVROXWLRQVDUHSDUWRI producers to bring it to market. the companyâ&#x20AC;&#x2122;s commitment to helping the world transition

Association News

celebrate Sustainability Week

( )

www.plasticsinfo.co.za

www.dow.com AUG / SEPT 2018

Assocation News.indd 59

59

2018/08/01 13:47


Association News

Polystyrene recycling

at Old Mutualâ&#x20AC;&#x2122;s Mutualpark )RFXVLQJRQVXFFHVVIXOSRO\VW\UHQHUHF\FOLQJGLYHUWLQJIRRGZDVWHIURPODQG¿OOV WKH6RXWKHUQ+HPLVSKHUH´VDLGH[HFXWLYHJHQHUDOPDQDJHU OLD Mutualâ&#x20AC;&#x2122;s Mutualpark in Cape Town is one of the largest +HORLVHYDQGHU0HVFKW FRUSRUDWHKHDGRI¿FHVLQ6RXWK$IULFD:LWKPRUHWKDQ $FFRUGLQJWR9DQGHU0HVFKW2OG0XWXDOHPEUDFHVWKH HPSOR\HHVZRUNLQJDWWKLVPðRI¿FHVSDFHLWLVWR YDOXHRIDQHIIHFWLYHZDVWHPDQDJHPHQWVWUDWHJ\DQGIRUWKLV be expected that a lot of waste would be generated at these reason began to separate and divert its waste into correct SUHPLVHVRQDGDLO\EDVLV VWUHDPVDWVRXUFH Thanks to the concerted efforts of the Mutualpark waste ³7KLVVWUDWHJLFDSSURDFKWR¿QGEHWWHUPRUHHQYLURQPHQWDOO\ PDQDJHPHQWSURJUDPPHWKHFRPSDQ\KDVPDQDJHGWR IULHQGO\DQGVXVWDLQDEOHZD\VRI GLYHUWZDVWHIURPODQG¿OOWRPRUH ZRUNLQJKDVDVVLVWHGXVWRKDYH RSWLPDODQGXVHIXOVRXUFHVWUHDPV About 50 bales of PRUHFRQWURORYHURXUUHVRXUFHV It also strives to educate visitors and ,WKDVDOORZHGXVWRUXQEHWWHU HPSOR\HHVDERXWWKHLPSRUWDQFHRI polystyrene are PRUHFRVWHI¿FLHQWRSHUDWLRQVDQG UHF\FOLQJ collected every six enabled us to reduce areas of ³:HFRQGXFWHGDZDVWHDXGLWDW ULVNZKLOHVLPXOWDQHRXVO\EHLQJ 0XWXDOSDUNLQDIWHUZKLFK2OG weeks by Greenlite FRPPLWWHGWREHLQJHQYLURQPHQWDOO\ Mutual developed an integrated Concrete for use in UHVSRQVLEOH´VKHVDLG ZDVWHPDQDJHPHQWSROLF\ZKLFK lightweight concrete 2QHRIWKHHQYLURQPHQWDOO\ IRUPHGSDUWRIRXUDSSOLFDWLRQWRWKH responsible areas that Old Mutual *UHHQ%XLOGLQJ&RXQFLORI6RXWK and screeding LVFXUUHQWO\SLRQHHULQJLQWKH $IULFD *%&6$ WREHUHFRJQLVHGDV applications ¿HOGRIUHF\FOLQJLVWKHLUUHFHQW D*UHHQ%XLOGLQJ2QFRPSOHWLRQ SDUWQHUVKLSZLWKWKH3RO\VW\UHQH RIWKLVVXEPLVVLRQ2OG0XWXDOZHUH $VVRFLDWLRQRI6RXWK$IULFD$FFRUGLQJWR$GUL6SDQJHQEHUJ SURXGO\DZDUGHGDVWDUUDWLQJXQGHUWKHH[LVWLQJEXLOGLQJ &(2RIWKH3RO\VW\UHQH$VVRFLDWLRQ0XWXDOSDUNKDVYDULRXV UDWLQJFDWHJRU\±PDNLQJWKHFRPSDQ\WKHODUJHVWH[LVWLQJ FDIHWHULDVDQGIRRGRXWOHWVRQLWVSUHPLVHV EXLOGLQJWRDFKLHYHWKHOHYHORIHQYLURQPHQWDOH[FHOOHQFHLQ ³:HIRXQGWKDWPDQ\RIWKHRWKHUSDFNDJLQJRSWLRQV ZHUHQRWDVHIIHFWLYHDQGLQPDQ\FDVHVZHUHQRWUHDGLO\ Doné Rankin-Rowley, contracts manager at Old Mutualâ&#x20AC;&#x2122;s Mutualpark, seen here with Adri Spangenberg of the Polystyrene UHF\FOHG´9DQGHU0HVFKWVWDWHG³,QRXUVHDUFKIRUD Association, in front of large bales of polystyrene YLDEOHDOWHUQDWLYHZHZHUHGHOLJKWHGZKHQPRQWKVDJR ready to be collected and recycled ZHGLVFRYHUHGWKDWWKHUHLVDPDUNHWIRUSRVWFRQVXPHU SRO\VW\UHQHDQGWKDWLWLVUHF\FOHGLQWRDZLGHYDULHW\RI GLIIHUHQWSURGXFWV,WZDVRQWKDWEDVLVWKDWZHZHUHUHDG\ WRJREDFNWRWKHSRO\VW\UHQHDQGRXUSDUWQHUVKLSZLWKWKH 3RO\VW\UHQH$VVRFLDWLRQEHJDQ´VKHDGGHG 7KHSRO\VW\UHQHZDVWHWKDWLVJHQHUDWHGIURPWKH 0XWXDOSDUNSUHPLVHVJHWVFOHDQHGE\DGHGLFDWHGWHDP RIZRUNHUVRQVLWHZKRWKHQHQVXUHWKDWWKHSDFNDJLQJLV FROOHFWHGDQGEDOHG$SSUR[LPDWHO\EDOHVRISRO\VW\UHQH DUHFROOHFWHGHYHU\VL[ZHHNVE\*UHHQOLWH&RQFUHWHIRUXVH LQOLJKWZHLJKWFRQFUHWHDQGVFUHHGLQJDSSOLFDWLRQV

( )

Old Mutual acknowledges and embraces the value of an effective waste management strategy and for this reason, began to separate and divert its waste into correct streams at the source 60 AUG / SEPT 2018

Assocation News.indd 60

2018/08/01 12:59


Association News

Polystyrene collectors in Gauteng help industry reach recycling success

www.polystyernesa.co.za

www.ajpolycycling.com

Dynamic duo shifts focus to polystyrene collection to help meet recyclersâ&#x20AC;&#x2122; demand SOUTH Africaâ&#x20AC;&#x2122;s success with the collection and recycling of postconsumer polystyrene continues to grow thanks to the combined effort of collectors and recyclers around the country. Despite its label of being µGLI¿FXOWWRUHF\FOH¶SRO\VW\UHQH UHF\FOLQJ¿JXUHVKDYHFRQWLQXHGWR JURZRYHUWKHSDVWHLJKW\HDUV â&#x20AC;&#x153;The applications and uses for recycled polystyrene continue to grow in South Africa thanks to the unique FRPELQDWLRQRIDELWRILQQRYDWLRQDORW of hard work and the can-do attitude of entrepreneurs who see possibility and RSSRUWXQLW\LQWKHXQOLNHOLHVWRISODFHV´ FRQ¿UPV$GUL6SDQJHQEHUJ&(2RIWKH Polystyrene Association of South Africa. /DVW\HDUDORQHPRUHWKDQ WRQVRISRO\VW\UHQHZHUHGLYHUWHGIURP ODQG¿OODQGUHF\FOHGLQWRRWKHUSURGXFWV VXFKDVVHHGOLQJWUD\VUHWDLOFRDW KDQJHUVFXWOHU\IXUQLWXUHFRPSRQHQWV and picture frames. South Africa currently has 27 recyclers on record ZKRFRQYHUWUHF\FODEOHKLJKLPSDFW and expanded polystyrene into raw materials or cement blends. $FFRUGLQJWR$GULWKHELJJHVWDQG fastest growing end-market for recycled polystyrene in South Africa continues WREHWKHOLJKWZHLJKWFRQFUHWHEULFNV owing to the fact that this application FDQXVHZKLWHEODFNDQGFRORXUHGIRRG trays or take-away containers. $-3RO\F\FOLQJLVUHDSLQJWKHEHQH¿WV One collector who is helping to keep WKHVXSSO\FKDLQWRUHF\FOHUVPRYLQJ DQGLVUHDSLQJWKHEHQH¿WVRIWKLV JURZLQJGHPDQGLV$-3RO\F\FOLQJ

One collector who is helping to keep the supply chain to recyclers moving and is reaping WKHEHQH¿WVRIWKLVJURZLQJGHPDQGLV$-3RO\F\FOLQJRZQHGDQGPDQDJHGE\'HHQDDQG Joelene Moodley

Owned and managed by Deena and -RHOHQH0RRGOH\WKLV&HQWXULRQEDVHG EXVLQHVVKDVH[WHQVLYHH[SHULHQFHDQG DSDVVLRQIRUSODVWLFVUHF\FOLQJEXWKDV recently decided to shift its focus to polystyrene recycling. Although they initially focused their efforts on recycling polypropylene and +'3(SODVWLFV'HHQDDQG-RHOHQH noticed an opportunity to supply polystyrene to customers who were manufacturing picture frames from UHF\FOHGSRO\VW\UHQHLQ7RGD\ they supply material to customers in the JUHDWHU*DXWHQJDUHDFRYHULQJDUHDV VXFKDV3UHWRULD1RUWK3UHWRULD(DVW -RKDQQHVEXUJ(DVW-RKDQQHVEXUJ 6RXWKDQG-RKDQQHVEXUJ1RUWK â&#x20AC;&#x153;There is a huge demand for recycled polystyrene. Thanks to continued WHFKQRORJLFDODGYDQFHVSODVWLFVKDYH

begun to replace metal and wood in many manufacturing processes. This LQFUHDVHKDVPDGHLWLPSHUDWLYHWKDW plastics be recycled and re-used to DYRLGLWHQGLQJXSLQZDVWHVWUHDPV DQGODQG¿OOVLWHV7KLVJURZWKLQSODVWLF recycling has also increased the GHPDQGIRUWKHPDWHULDODQGZHDUH focussing our efforts on supplying this polystyrene to buyers are in the décor industry who use it to manufacture SLFWXUHIUDPHV:HKDYHDOVRUHFHQWO\ begun to expand our business and now supply to manufacturers in the building and construction sector who create OLJKWZHLJKWFRQFUHWHEULFNVDQGVFUHHG´ Deena explains. ,QOLJKWRIWKHVHUHFHQWGHYHORSPHQWV $-3RO\F\FOLQJLVORRNLQJWRLQFUHDVH WKHLUFDSDFLW\DQGYROXPHVRI polystyrene they collect for recycling.

Industrial-scale PS recycling system planned for France 7+5(()UHQFKFRPSDQLHV±&LWHR 7RWDODQG6DLQW*REDLQ±DORQJZLWKWKH )UHQFK8QLRQRI)UHVK'DLU\3URGXFW 0DQXIDFWXUHUV 6\QGLIUDLV DUHMRLQLQJ IRUFHVWRGHYHORSDQGEXLOGZKDWWKH\ call an industrial-scale polystyrene 36 UHF\FOLQJV\VWHPLQ)UDQFH7KH FRQVRUWLXPVD\VLWDLPVWRYDOLGDWHWKH systemâ&#x20AC;&#x2122;s technical and cost feasibility ZLWKLQPRQWKV The four entities say the polystyrene consumer packaging chain must ³DFWLYHO\VHHNDUHF\FOLQJVROXWLRQ WKDWZLOOHQDEOHWKHGHYHORSPHQWRID

FLUFXODUHFRQRP\IRUWKHVHSURGXFWV´ 7KHHIIRUWWKH\VD\ZLOOLQYROYHQRWRQO\ FROOHFWLQJWKHSDFNDJLQJDQG¿QGLQJ WHFKQLFDOPHDQVIRUUHF\FOLQJLWEXWDOVR identifying uses for the recycled-content polystyrene. Syndifrais says it also will use the SURMHFW¶VWHFKQLFDO¿QGLQJVWRLPSURYH the design of packaging so it will be easier to recycle. Totalâ&#x20AC;&#x2122;s role will be to use the sorted and prepared polystyrene in its plastic SURGXFWLRQXQLWVLQ&DUOLQJ)UDQFHDQG )HOX\%HOJLXP36VFUDSIURPVRXUFHV

such as construction also can be used. The end product will be expected to PHHWWKHVDPHVSHFL¿FDWLRQVDVYLUJLQ polystyrene. Total tested its PS recycling WHFKQRORJ\LQLQSUHOLPLQDU\ LQGXVWULDOWULDOVZLWKWKHREMHFWLYHWRODWHU scale up production. A target has been VHWRIWRQVRIRXWSXWFRQWDLQLQJ DWOHDVWUHF\FOHG36LQ 7RWDOVD\VLWZLOODOVRPDNHDYDLODEOHLWV ³GHGLFDWHGUHVHDUFKDQGGHYHORSPHQW UHVRXUFHV´IRUWKHSURMHFW

62 AUG / SEPT 2018

Assocation News.indd 62

2018/08/01 12:58

www.plasticsinfo.co.za


Association News

IFPA take steps to qualify

welding procedures, welds Ensuring consistent quality installations and peace of mind PLQGWRFXVWRPHUV´6PDUWFODUL¿HG A simple process explained Prior to the installation, a contractor (preferably an IFPA member), will be responsible for compiling a Preliminary :HOGLQJ3URFHGXUH6SHFL¿FDWLRQ (P-WPS). This will be submitted to the customer for approval. Upon approval, the inspector (with a Thermoplastic :HOGLQJ,QVSHFWLRQFHUWL¿FDWHRI competence from Plastics/SA) will be UHTXLUHGWRZLWQHVVWKHTXDOL¿FDWLRQZHOG Other information that will be recorded by the inspector includes the identity of the welding personnel, the welderâ&#x20AC;&#x2122;s FUHGHQWLDOVDQGZHOGLQJFHUWL¿FDWH DVSHU the requirements of SANS 10269) and the LGHQWL¿FDWLRQDQGWUDFHDELOLW\RIWKHZHOGLQJ PDWHULDOVXVHGHJSLSHVDQG¿WWLQJV Upon completion of the tests, the inspector will be responsible for completing a Welding Procedure 6SHFL¿FDWLRQ4XDOL¿FDWLRQ5HSRUW

:3645 DQGWKH3:36FDQWKHQEH reissued as the Final Welding Procedure 6SHFL¿FDWLRQ :36 7KHLQVSHFWRUZLOO DOVRLVVXHD4XDOL¿FDWLRQ)LOHWRWKH contractor which consists of WPS, the FHUWL¿FDWHRIFRPSOLDQFHWKH:3645 a report on each of the destructive tests, and the test specimens tested before KDQGLQJRYHUWKHTXDOL¿FDWLRQ¿OHWRWKH customer at the end of the project. 7KHTXDOL¿FDWLRQREWDLQHGZLOOEH limited to the machine, welder, process and materials as recorded during WKHTXDOL¿FDWLRQZHOGDOWKRXJKWKH inspector may also be requested by the customer to inspect random welds TXDQWLW\RUSHUFHQWDJHWREHVSHFL¿HG by the customer) while he is on site. A separate report will need to be issued for each inspection and welds can also be subjected to the third party testing (if required) to ensure that the correct procedures are followed for the duration of the project. AUG / SEPT 2018

Assocation News.indd 63

www.sappma.co.za/ifpa-intro

THE Installation and Fabrication Plastics Pipe Association (IFPA) will be qualifying welding procedures and weld jobs performed by its members going forward. Mike Smart, IFPA Chairman, explained that this decision was taken in the interest of ensuring consistent quality installations. IFPA was formed by SAPPMA to expand regulations of the plastic pipes industry in Southern Africa, and open to all fabricators and installers of plastic pipe, as well as suppliers of SLSH¿WWLQJVDQGUHODWHGHTXLSPHQW â&#x20AC;&#x153;A good weld is of paramount importance to ensure a good installation. However, owing to the fact that conditions change from site to site and the everpresent possibility of poor quality from unethical suppliers, we felt it necessary to qualify welding procedures and jobs in line with SANS 10270:2015 standards. This is in line with our mandate of ensuring a consistently high standard of fabrication and installation and ensuring peace of

63

2018/08/01 12:55


Equipment & Materials

Wittmann commissions robot control Modular mechanical structure of robots allows for variety of different axis lengths

Celebrating the handover of the 20 000th R8.3 robot control system to Koh-I-Noor Formex were Michal Slaba, MD of Wittmann Battenfeld CZ, Dr Vlastislav Briza, Member of the Board of Directors of Koh-I-Noor Holding, Michael Wittmann, GM of WITTMANN Kunststoffgeräte GmbH, and Dr Robert Zaboj, Chairman of the Board of Directors of Koh-I-Noor Machinery

WITTMANN recently commissioned its 20 000th, R8.3 robot control system at Koh-I-Noor Formex in the Czech Republic, one of its longstanding customers for peripheral appliances, mainly robots. Koh-I-Noor Formex was founded in Vienna as a pencil factory in 1790. In its present form, Koh-I-Noor is still a major producer of pencils and crayons and other drawing utensils, but it has now established itself in three additional business segments as well. The Koh-I-Noor Formex division, with its production facility in Brno, Czech Republic, is active in the automotive sector and has earned an excellent reputation as a mould-making and injection moulding company.

The company currently produces various automotive parts, among them some extremely sensitive items such as lenses, on 23 injection moulding machines with clamping forces ranging from 100 to 400 tons â&#x20AC;&#x201C; including several 2-component machines. Virtually all the injection moulding machines are equipped with W818, W821 and W831 robots from Wittmann. These models offer load capacities between 6kg and 12kg, with virtually unlimited scope for extending the robotsâ&#x20AC;&#x2122; functionalities with the comprehensive range of optional equipment available. The modular mechanical structure of the Wittmann robots allows for a

EREX brings cold stretch hood technology to SA VFB Bocedi systems for pallet packaging PLASTICS machinery company EREX has recently commissioned one of WKH¿UVW9)%%RFHGLFROGVWUHWFKSODVWLFSDOOHWLVHUPDFKLQHVLQ6RXWK$IULFD 7+(9)%%RFHGLV\VWHPIRUFROGVWUHWFKWXEXODU¿OPKRRGLQJLV DSURFHVVIRUFODGGLQJJRRGVZLWKSODVWLF¿OPSDUWLFXODUO\RQSDOOHWV additionally, it can also wrap pallets. 7KH%RFHGLVWUHWFKKRRGHUPDFKLQHFUHDWHVHODVWLFKRRGVWKDWZLOO¿W any sized pallets. The machine mimics the elastic features of a stretch KRRG¿OP UHHOVRIFRH[WUXGHGWXEXODUSODVWLF¿OP  With an hourly capacity of over 260p/h, the system combines the qualities of shrink wrap with regards to the seal and stability of the SDOOHWJLYLQJWKHSDOOHWSURWHFWLRQIURPDWPRVSKHULFDJHQWV ZDWHUDQG GXVW ,WDOVRDOORZVIRUZUDSSLQJRIGLIIHUHQWW\SHVRISDOOHWVZLWKGLYHUVH perimeter sizes, achieving superior aesthetic and economic results. Erex has sold a system to a South African tile manufacturing company who wrap their tiling, cement and grouting products for protection when stored outside. 7KH%RFHGL¿UPLVEDVHGLQ,WDO\DQGKDVPRUHWKDQ\HDUV¶H[SHULHQFH in the design and construction of packing systems for end of line. â&#x20AC;¢ Contact Erex on tel: 011 789 1014 7+(9)%%RFHGLV\VWHPIRUFROGVWUHWFKWXEXODU¿OPKRRGLQJ7KHSODVWLFWXEHLV VWUHWFKHGRXWDQGSUHSDUHGSULRUWRWDNLQJXSWKHFRUUHFWDPRXQWRISODVWLFUHTXLUHG 7KLVLVDFROGSURFHVVWKHSODVWLF¿OPWXEHLVQRWKHDWHG 64 AUG / SEPT 2018

Equip & Materials.indd 64

2018/08/01 12:53


Equipment & Materials

th Haitian intelligent manufacturing, sculpting the future

20 000 system www.ipex.co.za

www.wittmann-group.com great variety of different axis lengths, so that the appliances can be optimally adjusted to each machine size. The universally applicable R8 robot control system is specially appreciated at Koh-I-Noor Formex. Thanks to its easy operation, the start-up and implementation of standard processes proceed smoothly and without any problems, which also applies to the programming of any desired robot sequences and direct integration of automation systems in the robot’s control system. Apart from robots, Koh-I-Noor Formex also operates numerous peripheral appliances from Wittmann, such as temperature controllers, dryers and material loaders. • Ipex is the agent in South Africa for WITTMANN

‘Go-Factory’ system extends traditional factory site management to mobile internet terminal SINCE 2016 the Chinese plastic processing and machinery industry has shown a trend with regards to automatic, integrated, information-based, green development. As the core subsidiary of Haitian Plastics Machinery Group and the leading enterprise in the intelligent injection moulding industry in China, Ningbo Haitian Intelligent Manufacturing Technology Co Ltd has improved the intelligent product system according to actual demands; through integration with the internet, accelerating ‘Internet +’ to accelerate transformation. Haitian proposed that a system should connect to various levels; control-level, equipment-level, management-level and service-level; therefore they have developed DQHZV\VWHPWKDWLVÀH[LEOHDQGKDVFRPSDWLEOHLQWHUIDFHDQGSURWRFRO+DLWLDQKDV established a network covering injection moulding machine manufacturing, peripheral equipment, injection moulding factory, injection moulding production application and cloud platform. In March 2017, Ningbo Haitian launched the ‘Go-Factory’ System, which extends the traditional factory site management to the mobile Internet terminal with informationbased tools. Combining the Industry 4.0 Cloud System and the Go-Factory System, it enables realtime monitoring, online control and feedback of faults.

www.haitianpm.com/en/haitian-smart-solutions/

Haitian’s entire Smart Solutions service

AUG / SEPT 2018

Equip & Materials.indd 65

65

2018/08/01 13:11


Equipment & Materials

INEOS Styrolution +LJKHUDUHDZHLJKWUHVXOWVLQLPSURYHG¿EUHDOLJQPHQW

Tests have shown that WKHQHZPDWHULDOPHHWV UHVSHFWLYHWHFKQLFDOWHVWVRI OHDGLQJDXWRPRWLYHEUDQGVDQG LWFDQEHH[SHFWHGWKDWWKHQHZ 6W\/LJKWZLOOEHVHOHFWHGIRUDVHULHV RIQHZDXWRPRWLYHLQWHULRUDQGH[WHULRU DSSOLFDWLRQVIRUFDUVRIWKHQH[WJHQHUDWLRQ

A NEW addition to the INEOS Styrolution is the new carbon look composite StyLight Aesthetic 6&7KHQHZPDWHULDOVKRZVVLJQL¿FDQW improvements over the previous StyLight Aesthetic S C200-1 providing application designers in the automotive and other industries with new opportunities. The new StyLight Aesthetic S C245-1 SURYLGHVDKLJKHU¿EUHGHQVLW\UHVXOWLQJLQ DKLJKHUDUHDZHLJKWDQG¿QDOO\LQDEHWWHU ¿EUHDOLJQPHQW7KLVLPSURYHPHQWZLOOIXUWKHU HQKDQFHWKHVXUIDFHDHVWKHWLFVRIWKHPDWHULDO

BASF expands portfolio of $QHZJHQHUDWLRQRI8OWUDGXU+5ZLWKLPSURYHGSURFHVVLQJDQGKLJKHUÃ&#x20AC;RZDELOLW\ 7+(GHPDQGRIWKHDXWRPRWLYHLQGXVWU\ IRUKLJKO\HIIHFWLYHVHQVRUVIRUWKH H[SDQVLRQRIHOHFWULFPRELOLW\DQG autonomous driving is increasing. So %$6)KDVIXUWKHUGHYHORSHGLWVUDQJH RIK\GURO\VLVUHVLVWDQWWKHUPRSODVWLF SRO\HVWHUV7KHH[SDQGHGUDQJHRI Ultradur® HR (HR= hydrolysis resistant) comprises Ultradur® B4330 G6 HR High 6SHHGDSDUWLFXODUO\Ã&#x20AC;RZDEOHDQGODVHU PDUNDEOHJUDGHZLWKJODVV¿EHU UHLQIRUFHPHQW8OWUDGXU® B4330 G10 +5DKLJKO\UHLQIRUFHGJUDGHZLWK JODVV¿EHUVDVZHOODV8OWUDGXU® %*+5WKHQH[WJHQHUDWLRQZLWK optimised processing characteristics. Ultradur® B4331 G6 HR is available IURPQRZRQDVXQFRORXUHGJUDGHLQD

EODFNODVHUPDUNDEOHYHUVLRQDQGDQ RUDQJHIRUFRPSRQHQWVLQHOHFWULFFDUV With its Ultradur®+5JUDGHV%$6) RIIHUVKLJKO\UHVLVWDQW3%7PDWHULDOV 3%7 SRO\EXW\OHQHWHUHSKWKDODWH  ZKLFKDUHHVSHFLDOO\VXLWDEOHIRUXVHLQ challenging environments. They enable DORQJVHUYLFHOLIHDQGDQH[FHOOHQW RSHUDWLRQDOUHOLDELOLW\RIDXWRPRWLYH components. The HR grades also have a considerably increased resistance to alkaline media which trigger stress corrosion cracking. This is also true RIWKHQHZ8OWUDGXU® B4331 G6 HR grade with considerably improved PHOWVWDELOLW\DQGÃ&#x20AC;RZDELOLW\,QWHVWV Ultradur® B4331 G6 HR does not display any increase in viscosity even

%$6)H[SDQGVSRUWIROLRRIK\GURO\VLVUHVLVWDQWSRO\HVWHUV

with long residence times and at high WHPSHUDWXUHV±WKHEHVWEDVLVIRUVWDEOH and easy processing. The material can also be coloured in orange (RAL 2003) in order to produce high-voltage plug-in FRQQHFWRUVIRUHOHFWULFFDUV7KDQNVWR the unusually high tracking resistance IRU3%7WKHSOXJLQFRQQHFWRUVFDQEH designed smaller and still withstand the KLJKHUYROWDJHVLQHOHFWULFYHKLFOHVVR savings on costs and component weight are possible. The Ultradur® 4330 G6 HR series which is already available with 30% JODVV¿EUHUHLQIRUFHPHQWKDVEHHQ expanded to include the particularly Ã&#x20AC;RZDEOHDQGODVHUPDUNDEOH8OWUDGXU® B4330 G6 HR High-Speed bk15045. :LWKWKLVJUDGHWKLQZDOOHGSDUWVDQG components which show a high ratio RIWKHÃ&#x20AC;RZSDWKWRZDOOWKLFNQHVVFDQ easily be produced. The new Ultradur® B4330 G10 HR is ¿OOHGZLWKJODVV¿EUHV,WFDQWKHQ be processed to components which are simultaneously exposed to moisture DQGKLJKWHPSHUDWXUHV Â&#x192;&VKRUW term up to 180°C) and keep a high VWLIIQHVVHJVWHHULQJPRGXOHVLQWKH charge air duct. In the temperature UDQJHIURPÂ&#x192;&WRÂ&#x192;&WKH material reaches almost the property OHYHORISRO\SKHQ\OHQHVXO¿GH 336  ZKLFKLVXVXDOO\HPSOR\HGLQWKLVNLQGRI applications. For selected automotive applications BASF has developed Ultradur® B4450 *+57KH3%7LVUHLQIRUFHGZLWK JODVV¿EUHV5R+6FRPSOLDQWDQG Ã&#x20AC;DPHUHWDUGDQW,WFDQEHFRORXUHGLQ

66 AUG / SEPT 2018

Equip & Materials.indd 66

$QHZ1DWLRQDO&HUWL¿FDWH*HQHULF0DQDJHPHQW±*HQHULF0DQXIDFWXULQJ14) 2018/08/01 13:48


which has been developed to address lightweight aesthetic designs. The previous StyLight Aesthetic S C200-1 delivered a very good surface quality at an area weight of 200 g/cm2 at a thickness per layer of 0.25mm. The new StyLight Aesthetic S C245-1 goes beyond this de-facto industry standard offering an area weight of 245 g/cm2 at a thickness per layer of 0.3mm. 7KHQHZÂżEHUVXVHGLQ6W\/LJKW$HVWKHWLF6&LPSURYH the mechanical properties of the material. In particular, stiffness DQGULJLGLW\DUHVLJQLÂżFDQWO\HQKDQFHGFRPSDUHGWRWKH previous StyLight Aesthetic S C200-1. With these new characteristics, StyLight Aesthetic S C245-1 offers a surface quality that addresses the needs of the most demanding applications. Tests have shown that the new material meets respective technical tests of leading automotive

brands and it can be expected that the new StyLight will be selected for a series of new automotive interior and exterior applications for cars of the next generation. Typical applications include interior decorative trims, seat components, rear-view mirror caps, and exterior trims. The new material is also used in the electronics industry and for sports and leisure applications. It becomes an attractive alternative when the search is on for a material offering a cool and sporty look. In the electronics industry, typical applications include mobile phone casings, loudspeaker cones and drones. For sports and leisure, examples include sport helmets, bicycle parts and luggage. www.ineos-styrolution.com

Equipment & Materials

introduces carbon look composite

hydrolysis-resistant polyesters light colours and laser-printed. With its low fogging values according to the VDA 278 emission test, it is suitable for applications in car interiors and also for housings of control units. The newly developed material combines hydrolysis UHVLVWDQFHZLWKĂ&#x20AC;DPHUHWDUGDQF\KLJK tracking resistance and low smoke GHQVLW\7KLVSURSHUW\SURÂżOHLVDOVR

ULQJ14) Equip & Materials.indd 67

aimed at electric vehicles with their considerable safety requirements and much higher currents than in conventional drive trains. Since the market launch, BASF has GHYHORSHGDURXQGDGR]HQ+5PRGLÂżHG UltradurÂŽ grades, with 15%, 30% DQGJODVVÂżEUHUHLQIRUFHPHQW SDUWLFXODUO\Ă&#x20AC;RZDEOHLPSDFWPRGLÂżHG

laser markable, laser transparent or Ă&#x20AC;DPHUHWDUGDQW7\SLFDODSSOLFDWLRQV can be found primarily in automotive electronics, e.g. housings of control units, connectors, sensors, but also charging plugs, housings of battery stacks or connectors in the high-voltage circuit of electric cars. ZZZEDVIFRP AUG / SEPT 2018

67

A new National &HUWLÂżFDWH*HQHULF 0DQDJHPHQWÂą*HQHULF 0DQXIDFWXULQJ14)

2018/08/01 13:13


Equipment Construction of a plant by MachinePoint for a client underway at an undisclosed venue. The company includes three businesses: MachinePoint Used Machinery, MachinePoint Consulting and MachinePoint Engineering, all of which play roles in projects such as this

MachinePoint supporting development of African food, beverage sectors

68 AUGUST / SEPTEMBER 2018

Optimal productivity for cost and marginal infrastructure of numerous African countries MACHINEPOINT of Spain, a leading supplier of equipment, processing solutions and turnkey projects to the beverage, dairy and agro food industries for over 25 years, has been working with convertors mainly in North Africa for the past decade. Over the last few years, and thanks to the companyâ&#x20AC;&#x2122;s MachinePoint Engineering business, it is becoming more involved in other markets and regions in Africa. It has experienced increased demand for quality used machinery and engineering services required to start up new production plants or expand existing capacities. Pablo Rodriguez, director of MachinePoint Engineering, points out that considerable development and growth in demand for machinery is anticipated in Algeria, Angola and Ethiopia, followed by other Central African countries such as Zambia, Mozambique, Tanzania, Congo and Nigeria. MachinePoint offers these markets used machinery for food and beverage processing as well as packaging PDFKLQHU\ÂżOOLQJOLQHVSUHIRUPDQGFDS machinery, ISBM machines for PET, PET ÂżOOHUVFDQVDQGJODVVÂżOOHUVÂżOPDQG DJULFXOWXUDOPDFKLQHU\SLSHDQGSURÂżOH extruders, multiple size injectors, dairy processing and related machinery. MachinePoint Engineering services personnel accompany investors and entrepreneurs who are creating new processing production plants to transform agricultural products into processed

products, processing lines for water, juices, carbonated drinks and dairy products. The MachinePoint team assesses customers from the initial SURMHFWGHÂżQLWLRQWRWKHFRPPLVVLRQLQJ of the new production lines. The African entrepreneurs interested in MachinePointâ&#x20AC;&#x2122;s services are usually medium-sized business owners looking for the best value for money. For them, MachinePointâ&#x20AC;&#x2122;s used machinery is extremely competitive, as it gives them access to high-quality machinery, mainly of European origin and at a much lower price than new machinery from a well-known brand. Used machinery from leading industry brands maintain high levels RIHIÂżFLHQF\DQGSURGXFWLYLW\FRPSDUHG to second-tier brands. This translates into fewer production stoppages, longer life and higher productivity.

and time schedule help tremendously to assist the progress of the projects,â&#x20AC;? said Rodriguez. â&#x20AC;&#x153;The challenge for Africa is to modernise itself and modernise its industry, to become a major player in the globalised world. To feed Africa not only with a collaborative economy but also by exporting quality products that meet world standards,â&#x20AC;? he added. â&#x20AC;&#x153;MachinePointâ&#x20AC;&#x2122;s PDLQEHQHÂżWDV an engineering company is our independence from any manufacturer in advising our customers with the best technological solution for their needs. In most cases, our intervention reduces costs. We develop wellGHÂżQHGUHTXHVWVIRUDTXRWDWLRQWKDWDOORZ XVWRDVNIRUSULFHVIRUSHUIHFWO\GHÂżQHG equipment to several manufacturers. â&#x20AC;&#x153;The transfer of knowledge and training of our clientsâ&#x20AC;&#x2122; technical staff throughout the project is key to leaving value with the client´s team when the project ends. Our solutions are tailormade factories, most of the times we combine equipment from different manufacturers and brands, as we look for the best technology and value from each manufacturer,â&#x20AC;? Rodiguez added.

The challenge for Africa is to modernise itself and modernise its industry

Transforming Africa is transforming from a subsistence economy to a developed industrial state. â&#x20AC;&#x153;Our recent increase of activity in Africa for the promotion of our engineering services is determined by the fact that we receive more demands from this area than from America or Asia. The local proximity www.machinepoint.com


Equipment & Materials

Borealis, Henkel produces plastic bottle and nozzle

from 100% post-consumer recycled material Packaging solution made of 100% plastic recyclate delivers circular economy proof point BOREALIS has launched a successful new packaging solution produced entirely with post-consumer recycled (PCR) material. Developed in close collaboration with the German consumer and industrial goods company Henkel and two additional value chain partners, this truly sustainable packaging solution is further evidence of how mtm plastics GmbH, a member of the Borealis Group, is helping increase the circularity of plastics. 7KHODXQFKLVVLJQLÂżFDQWWRWKHFRQVXPHUJRRGVLQGXVWU\ because of the robustness this new packaging solution provides, further evidence that plastic recyclate is indeed suitable for a variety of demanding packaging applications, in this case, a popular adhesive brand marketed by Henkel. In 2016, Borealis acquired leading German recycler mtm plastics GmbH, which is now a member of the Borealis Group. A success story originating from this exploration is a recently completed pilot project with Henkel, the global leader for adhesives, sealants and functional coatings. The companies have worked to develop a new packaging solution based on the recycled material for the Made-at-Home all-purpose glue bottle and cap, which Henkel is marketing under its well-known Pattex brand. The aim was to replace the virgin plastic material traditionally used for this packaging with a recyclate-based resin. The resin had The new and improved, WRIXOÂżOWKHGLYHUVH environmentally friendly bottle

www.henkel.com

material demands for packaging of an adhesive product. After extensive and joint application development, a new bottle was developed with the proprietary mtm product PurpolenÂŽ PE, a high-quality polyethene regranulate produced by mtm at its facilities in Niedergebra, Germany. Value chain partner KKT Kaller Kunststoff Technik GmbH, a plastics processor also based in Germany, manufactured the bottles. For the three separate components of the adjustable applicator QR]]OHZKLFKLVXVHGIRUÂżOLJUHHDQGZLGHDUHDJOXLQJKLJK quality PurpolenÂŽ PP polypropylene regranulate produced E\PWPZDVLGHQWLÂżHGDVWKHLGHDOVROXWLRQ*HUPDQSODVWLF components manufacturer bomo trendline Technik GmbH produced the applicator nozzles. The new Pattex Made-at-Home packaging solution successfully passed extensive application tests, including a three-month storage test and other tests of mechanical properties. It was launched on the European market in 2018. â&#x20AC;&#x153;Our commitment to leadership in sustainability is deeply embedded in our companies´ values,â&#x20AC;? explained Matthias Schaefer, Project Manager for Global Packaging Engineering at Henkel Adhesive Technologies. â&#x20AC;&#x153;We are at the forefront of the industry when it comes to new sustainability strategies LQSDFNDJLQJ7KXVZHLGHQWLÂżHG3DWWH[0DGHDW+RPHDVD candidate for exploring the use of recyclate instead of virgin plastics. This constructive collaboration with our partners proves the viability of 100% PCR material for an adhesive product like Made-at Home. It also underscores our efforts at Henkel to drive leadership in sustainability in the consumer goods sector.â&#x20AC;?

70 AUG / SEPT 2018

9LN5V

With 35 yearsâ&#x20AC;&#x2122; experience in supplying engineering polymers to the industry, our logistics & technical backup provide the highest level of service and support.

ABS â&#x20AC;&#x201C; Polylac MABS â&#x20AC;&#x201C; Polylac ASA â&#x20AC;&#x201C; Kibilac SAN â&#x20AC;&#x201C; Kibisan GPPS â&#x20AC;&#x201C; Taitarex / Denka / Polyrex / Supreme Q-RESIN â&#x20AC;&#x201C; Kibiton / Denka HIPS â&#x20AC;&#x201C; GPPC / Supreme EPS â&#x20AC;&#x201C; Taitacell / King Pearl  PMMA â&#x20AC;&#x201C; Acryrex SMMA â&#x20AC;&#x201C; Acrystex PC â&#x20AC;&#x201C; Wonderlite Johannesburg Jeremy Goosen (T) 011 626 1030 jeremy@rawmac.co.za

Cape Town Shanaaz Wardien (T) 021 933 331/2 shanaaz@rawmac.co.za

PC/ABS ALLOY â&#x20AC;&#x201C; Wonderloy PA 6 â&#x20AC;&#x201C; Zissloy PA 66 â&#x20AC;&#x201C; Gramid / Zissloy POM â&#x20AC;&#x201C; Kocetal PBT â&#x20AC;&#x201C; Spesin EVA â&#x20AC;&#x201C; APC SBS â&#x20AC;&#x201C; Kibiton 330,1(5$/),//Âą:RRUL&RĂ&#x20AC;HQ&DOSHW PP GLASS FILL â&#x20AC;&#x201C; Woori PE â&#x20AC;&#x201C; HDPE / LLDPE  UREA COMPOUND â&#x20AC;&#x201C; Sprea  Durban Muthu Sagree (T) 031 577 0505 sagree@rawmac.co.za

Port Elizabeth Delene Williams Glen Kedikiloe 041 626 484 1030 3390 (T) 011 glen@rawmac.co.za

www.rawmacplastics.co.za

Equip & Materials.indd 70

2018/08/01 13:08

www.plasticsinfo.co.za


REGLOPLAS Alessandro Pozzati, ColorWorks industrial designer, says “This is exactly why the ColorForward tool, and Clariant’s global ColorWorks design and technology centers exist. The collaboration shows designers, brand managers and product developers to help better understand and appreciate how colour and texture can PRYHDQGLQÀXHQFH peoples purchasing decisions.”

High-performance temperature control units … for large injection moulds, extruders, rollers, autoclaves and other processing equipment

New, more efficient Type 90 Smart

Clariant inspires 2019 mould texture specialist Investigation and interaction with Pel Plastic with colour and texture trends CLARIANT a world leader in specialty chemicals, have completed a collaborative project with Pel Plastic srl, an Italian company specialising in mould texturing and surface design. Inspired by the 2019 edition ‘ColorForward’, Clariant’s colour trend forecasting tool, Pel Plastic decided to experiment with a radically different approach to product design. A typical design project usually begins with a product concept and then proceeds quickly to drawings and prototype parts, all before selection of colour and texture. However, after viewing a presentation about ‘ColorForward’ 2019, Pel Plastic designers were inspired to ask Clariant to partner with them in taking a different approach. “We saw that ‘ColorForward’ is based on research into social trends DQGKRZWKH\FRXOGLQÀXHQFHWKHZD\ consumers respond to different colours in the near future,” recalls Mirella Sala, key account sales manager for Pel Plastic. “This is something that we have been doing with textures and the idea of looking at textures and colour together – so that one can support and help express the other – seemed like a very interesting project. In consultation with Clariant, the Pel Plastic team began by picking one colour from each of the four ‘ColorForward’ 2019 themes. They created mood boards to help them better understand the potential interaction of theme, colour and texture. In the end, the designers selected the Do Not Disturb This trend theme and a transparent light green called “focus.”

Do Not Disturb This trend theme is based on the idea that technology makes it very easy for people to become distracted. Overwhelmed by choice, consumers look for ways to consciously limit options to make decisions easier. For that reason, the color palette for Do Not Disturb – including the ‘focus’ green that Pel Plastic liked – is simple, serene, soft, and minimal. The texture Having settled on their colour, the Pel Plastic team began working on the texture that would be applied to the moulded plastic. The result is very much in line with the trend theme, enigmatic, somewhat contradictory and distracting, but eventually resolving itself to bullseye focal point. The clear polymer – polycarbonate – and the transparent colour are rendered translucent, almost opaque, by the texture. The exterior surface of the prototype – a standard shape Pel Plastic uses to evaluate textures – is absolutely smooth, while the texture is created on the inside or backside of the part. This construction creates depth and an almost pearlescent appearance, despite the fact that there are no pearl pigments in the colour. “Through this project, we learned that colour and texture together can have a completely different effect than either one alone,” Ms. Sala says. “We will use the results in presentations to customers so that they can also better understand the relationship between plastics, colour and texture. We appreciated the collaboration with Clariant very much and we would like to continue as a partner and develop more textures with colours in the future.”

www.clariant.com

AUG / SEPT 2018

71

Temperature control units for water up to 90°C • RT 70 control system • Solid-state relay (SSR)instead of heating contactor • Automatic phasechanger for pump direction (clockwise) • Alarm buzzer • Heating capacity 9 kW

NEW

• Cooling capacity 24-90 kW • Pump capacity 60 litres/min, 3.8 bar

Type 150 Smart Temperature control units for oil up to 150°C • Controller RT61 PID • Outlet temperature max 150°C • Heating capacity at 400V 6 kW • Cooling capacity 28kW @ 140°C • Pump capacity 60 litres/min, 3.8 bar

• Simultaneous readout of temperature set-point and actual value • Clear arrangement of operating and indicating elements • Solid state relay (SSR) instead of heating contactor • All components exposed to water are made of non-rusting materials, hence long service-life • Achieves estimated 24% reduction in rejects and 20% increase in productivity

JENOWILL SERVICES Contact – Willy Tschopp Tel: 021 551 7241 Fax: 021 551 7243 28C Lilly Park, Railway Rd Montague Gardens, Cape Town jenowill@iafrica.com www.regloplas.com

Equip & Materials.indd 71

2018/08/01 13:11


Middle East

Egyptian polymer industry entering a new era ?QTTJMVMĂ&#x2026;\\PM\PW] [IVL[WNXTI[\QKKWV^MZ\MZ[KZMI\MRWJ[IVLKWV\ZQJ]\M \W\PM-OaX\QIVMKWVWUa

BY NIALL MARSHALL

Egypt has a history stretching back more than 5000 years made up periods of stability sandwiched between periods of relative instability. The Great Pyramids of Giza and the enigmatic Sphinx have watched over 4500 years of royal intrigue, Pharaonic dynasties, occupation, turmoil, revolution and the evolution of a polymer industry with its own distinctive eras. The dawn of polymer production in Egypt occurred in the late 1980â&#x20AC;&#x2122;s when the Egyptian Petrochemicals Company started producing PVC in the Mediterranean port city of Alexandria. PVC, at that time, was far more widely used than today when it is used almost exclusively in construction DSSOLFDWLRQVVXFKDVZLQGRZSURÂżOHV SLSHVDQGÂżWWLQJVÂąLQWKHÂśV39&ZDV also commonly used in food packaging. The availability of locally produced PVC DOVREHQHÂżWHGORFDOSLSHPDQXIDFWXUHUV producing pipe for the important agriculture industry, complementing the network of irrigation canals dating back to before the time of the Pharaohs. Historically all agriculture took place in WKHĂ&#x20AC;RRGSODLQVRIWKH1LOHRULQWKH1LOH Delta but several projects to increase the amount of cultivated land relied on distributing water further from the river as well as by pumping artesian water from aquifers deep under the Western desert. Today there are several pipe manufacturers XVLQJERWK39&DQGSRO\ROHÂżQV3LSHV FDEOHVDQGZDWHUSURRÂżQJPHPEUDQHV are also produced in Egypt for the many construction projects which have been undertaken in the last few years including a new $45 billion capital city 50km south-east of Cairo. The second era of the Egyptian polymer producing industry coincided with the start of the new Millennium and VDZDGLYHUVLÂżFDWLRQLQWKHUDQJHRI polymers produced with the start-up of a

220 000 tpa HDPE plant in Alexandria, a 170 000 tpa polypropylene plant on the Red Sea in Suez and a 500 000 tpa PET plant, also in Suez. With a population of around 90 million people and the second largest economy (after Saudi Arabia) in the Middle East, Egypt has a large market for locally produced products. $ODUJHSHUFHQWDJHRIWKHSRO\ROHÂżQV produced are used in agricultural DSSOLFDWLRQVÂąFURSVVXFKDVULFH wheat, sugar beets, tobacco, beans and corn are packaged in locally-produced polyethylene bags and PP woven sacks for both local demand and export markets. 0XOFKÂżOPVLODJHDQGJUHHQKRXVHÂżOPV are also produced in Egypt for the local and regional markets. There are several large BOPP plants all of which have been expanding their capacities over the ODVWWKUHH\HDUVSURGXFLQJÂżOPIRUWKH packaging of products destined for export, such as textiles and clothing produced from high quality Egyptian cotton. Film is used for packaging table grapes, fruit, YHJHWDEOHVDQGLQFUHDVLQJO\Ă&#x20AC;RZHUV exported to Europe. Another large industry in Egypt is the manufacture of carpets (in fact the ÂżUVW33SODQWZDVRULJLQDOO\RZQHGE\ the same group that owned some of the largest carpet manufacturers). More than 60% of the polypropylene woven and tufted carpets produced in Egypt are exported to Europe, Asia and the USA. With approximately 2.5 million tons of polymer being processed by an estimated 2000 converters in Egypt employing more than 600 000 people, it is unsurprising WKDWWKHHUDRIGLYHUVLÂżFDWLRQZDVIROORZHG by an era of expansion. This third era, which took place from around 2010-2016 coincided with the turmoil of the â&#x20AC;&#x2DC;Arab Springâ&#x20AC;&#x2122; and involved the commissioning of

a 330 000 tpa new polypropylene plant in Port Said where the Suez Canal enters the Mediterranean Sea, and a new 400 000 tpa polyethylene plant as well as a 200 000 tpa polystyrene plant, both in Alexandria. But political and economic disruptions also had a negative effect on the polymer producing industry resulting in the temporary shutting down of the original PP plant (due to lack of availability of propylene which had been sourced by pipeline from Libya ÂąLWKDVVLQFHUHVWDUWHG DQGWKHVKXW down of the PET plant in 2015. And this brings us to the dawn of the new era with announcements made that a new $10,6 billion petrochemical complex will be built on the Red Sea at the Suez Canal consisting of 11 plants, including a naphtha cracker as well as polypropylene and polyethylene plants. Separately, a tender has been issued for the construction of a polybutadiene plant in Alexandria due to be commissioned in 2020 to supply the tyre industry and Indorama (one of the largest producers of polyester in the world) has bought a 50% share in EIPET and intends to restart the plant supplying the PTA raw material from a recent acquisition in Portugal. Egypt is a country that has experienced thousands of years of growth and destruction. The polymer producing industry has not been around for even a fraction of that time, but it has experienced its own cycles of growth, stability and turmoil. Having survived WKHGLIÂżFXOWLHVRIWKHODVWGHFDGHLWORRNV to be entering a new era which can RQO\EHQHÂżWWKHWKRXVDQGVRISODVWLF converters, create jobs and contribute to the Egyptian economy.

72 AUG / SEPT 2018

Middle East feature.indd 72

2018/08/02 10:35


Classifieds Jun/Jul'18.indd 92

2018/05/23 14:08


Design

Design innovation

balcony shelf Judges hooked by versatility of design A STUDENT from Brunel University has scooped top prize in the annual Design Innovation in Plastics (DIP) FRPSHWLWLRQZLWKDFOHYHUO\GHVLJQHGVKHOIZKLFKFDQ¿WRQ a balcony railing and accommodate anything from a plant to a bottle of wine. Product design student, Alex Roquero, impressed the competition judges with his ‘Hook’, a portable shelf which LVLQWHJUDWHGZLWKDÀRZHUER[DQG¿WVDQ\NLQGRIUDLOLQJ – ideal for people who have no garden, or reduced space and want something which hooks onto a balcony. Thanks to its unique shape, as well as plants, it can also carry day-to-day products such as coffee mugs, wine glasses, beer bottles or even books. DIP, which is organised by the Institute of Materials, Minerals and Mining and the Horners, and is sponsored by Covestro, gave students the brief of ‘Branching Out – Design for Garden Innovation’.

They were asked to come up with an innovative product, primarily from plastics, which could be used in a garden, that would better connect people with nature, enhance the pleasure of gardening or leisure activities within the garden, or help soothe mind and body after a long and stressful day. Chairman of judges, Richard Brown, commented: “It was evident that this product could become a marketable item, as living spaces become smaller, and more ‘Juliet’ balconies are integrated into new builds, especially in Europe. Alex tackled a problem that he was familiar with from the environment in his home country of Spain

2nd place

3rd place

William Oughton’s second place ‘Bulb Garden Furniture’

Olivia Alexander’s ‘Buzz’

HIGHLY COMMENDED Dynamic Grip – an ergonomic garden multi-tool targeting gardeners with arthritis. Submitted by Lewis Brown, Teesside University 74

AUG / SEPT 2018

DESIGN COVESTRO.indd 74

2018/08/01 12:50

FDB


Design

in plastics,

product wins 1 AUG / SEPT 2018

and took a holistic approach to provide a multi-purpose solution. We were impressed by the way he took into consideration all the elements of the brief, from initial concept, patent and IP search, manufacturability, point of sale options and sustainability. He used polypropylene, which has the mechanical properties required for this kind of product and is completely recyclable.â&#x20AC;? In second place was William Oughton, an Integrated product Design student, also from Brunel University. William created â&#x20AC;&#x2DC;Bulb Garden Furnitureâ&#x20AC;&#x2122;, a concept set of JDUGHQDFFHVVRULHVZKLFKÂżWWRDQ\W\SHRISDQHOZLUH or post built fences, and can be used as bird feeders, planters, birdhouses or solar outdoor light. In third place was Olivia Alexander, a product design student from De Montfort University, with â&#x20AC;&#x2DC;Buzzâ&#x20AC;&#x2122;, a beefriendly planter which administers an anti-mite substance directly to the bees to protect them from the mites. The Design Innovation in Plastics Award is the longestrunning student plastics design competition in Europe, established in 1985. >>

WINNER

75

Alex Roquero took the top prize for â&#x20AC;&#x2DC;Hookâ&#x20AC;&#x2122;

Rapid Granulator Appoints New Distributor Rapid Granulator Appoints New Distributor for South Africa for South Africa Effective from December 15th 2016, Rapid Granulator AB, the Swedish-based world leader in plastics granulation technology, has signed up FdB Consulting, Johannesburg, as its sole distributors for the South Africa and SubSahara Market

Regrind Material Bin Bulk Bag Discharge Station with 2 Ton Elec Hoist

Representativeinin Africa Representative Africa

CONSULTING (Pty) Ltd CONSULTING Frank FrankBlues Blues

High value processing of films fibers in-house production scarp and wasted post consumer waste. For materials: PE, PP, PS, PPS

DESIGN COVESTRO.indd 75 86 FDB Consulting ad '017 12.indd

Stronger than ever Engineering Frank Blues Design Engineering Design +27 (0)82 (0)82-651 3315 +27 651 3315 frank@fdbconsulting.co.za

We are the recently appointed Agents for Labotek Material feeding and Drying systems

2018/08/01 2018/05/28 13:49 11:14


Design

GINGKO

HIGHLY COMMENDED Gingko â&#x20AC;&#x201C; a planter for urban spaces GHVLJQHGVSHFLÂżFDOO\ZLWKFKLOGUHQ LQPLQGWRKHOSWKHLUGHYHORSPHQW DQGSURPRWHWKHMR\RIJDUGHQLQJ 6XEPLWWHGE\)DWLPD$EHGL0DQML 'H0RQWIRUW8QLYHUVLW\

HIGHLY COMMENDED

*&\FOHÂąDSURGXFWZKLFKFRPELQHVPRGHUQLQGRRUJDUGHQLQJZLWKKRPHDTXDULXPV WRHQKDQFHZHOOEHLQJE\SURYLGLQJDFDOPDQGUHOD[LQJHQYLURQPHQW6XEPLWWHGE\ =HLQD0RIWL%UXQHO8QLYHUVLW\

Playful start-up offers new life to old plastic

.LZLRQHRIHFR%LUG\ÂśVVWRUDJHXQLWVLVDOVR DZD\WREULQJDWWHQWLRQWRWKHLPSHQGLQJ H[WLQFWLRQRI1HZ=HDODQGÂśVVSRWWHGELUG

WRODQGÂżOOVWKHVHIRUJRWWHQÂľIULHQGVÂśDUH converted into a vibrant stable of toys, tables and storage units. Creating eco-friendly and recycled toys is just one facet of this company. The range of products also shed light and hopes to create awareness towards the impending extinction of certain animals around the world, for starters, 7KH5KLQRODPSVKHGVOLJKWRQWKHSXUVXLWRIWKH DQLPDOIRULWVKRUQ

the Kiwi bird and the Rhino â&#x20AC;&#x201C; after all, children are the future. â&#x20AC;&#x153;By giving old plastic a new life, our aim is to free our ecosystem from its pernicious impact. As we use innovative technologies, made for the reuse of plastic, there is no need to add any pigments or resin,â&#x20AC;? said owners, Yuan and Vanbriel. HFR%LUG\ÂśVSURGXFWVDUHVDIHIRUWKH HQYLURQPHQWDQGLWVFRQVXPHUV7KHLUPLVVLRQLVWR FROOHFWDQGXSF\FOHNJRIWR\VE\WKHHQGRI &XUUHQWO\WKHLUFROOHFWLRQWDOO\LVDWNJ

76

AUG / SEPT 2018

LAUNCHED in 2018, ecoBirdy, a European furniture company who are making a difference by creating fun products for kids and raising awareness on global plastic pollution. The company traverses the continent and collects abandoned plastic toys to create brand new quirky and interesting furniture pieces. Rather than being taken

DESIGN COVESTRO.indd 76

2018/08/01 14:22


Books

Bioplastics in growth cycle, report calls for research, innovation Growing interest in bioplastics, but also continued need for education IN A Plastics Market Watch report released recently â&#x20AC;&#x201C; Watching: Bioplastics â&#x20AC;&#x201C; the US Plastics Industry Association reports bioplastics are in a growth cycle stage and will outpace the economy as a whole by attracting new investments and entrants into the sector and bringing new products and manufacturing technologies to make bioplastics more competitive and dynamic. The report sees growing interest in bioplastics, but also a continued need for education. According to a survey of US consumers conducted by the association in January this year, more consumers are â&#x20AC;&#x2DC;familiar or somewhat familiarâ&#x20AC;&#x2122; with bioplastics compared to a survey conducted just two years ago; 32% of consumers are familiar with bioplastics in 2018 compared

to only 27% in 2016. The survey also indicated 64% of consumers would prefer to buy a product made with bioplastics â&#x20AC;&#x201C; and expect to see bioplastics in disposable plastic tableware, plastic bags, food and cosmetic packaging, and toys. As bioplastics product applications continue to expand, the growth dynamics of the sector will continue to shift. Looking at industry studies on market segmentation, the packaging is the largest segment of the market at 37% followed by bottles at 32 percent. Growth opportunities in bioplastics manufacturing are expected to continue from the demand and supply side. While in the past, growth in bioplastics was primarily driven by higher petrolbased polymers, changes in consumer EHKDYLRXUZLOOEHDVLJQLÂżFDQWIDFWRUIRU

higher demand of bioplastics. The research and partnerships with ELRSODVWLFVDUHH[HPSOLÂżHGE\WKHHIIRUWV to develop a 100% bio-based PET bottle. Currently, most PET bottles have approximately 30% bio-based material, but a number of companies and collaborations are working to develop and launch, at commercial scale, a PET plastic bottle made from 100% bio-based material. Despite the industryâ&#x20AC;&#x2122;s embrace of bioplastics and their expanding presence in a wide range of products, the report noted that a high percentage of surveyed respondents believe they have not seen or used a product made from bio-plastic â&#x20AC;&#x201C; either bio-based or biodegradable. Continuing to educate consumers on bioplastics would go a long way.

The report is available for download to members and non-members at https://plasticsindustry.imiscloud.com/ItemDetail?iProductCode=PMW009&Category=PUBLICATIO

78 AUG / SEPT 2018

*OREDOPDUNHWIRUĂ&#x20AC;OOHUVH[SHFWHGWRJURZDW FILLERS do not only make numerous products cheaper, often, they also greatly improve the properties RIWKHÂżOOHG materials. Market research company Ceresana has UHFHQWO\SXEOLVKHGLWVÂżIWKHGLWLRQRQWKH JOREDOPDUNHWIRUÂżOOHUV Worldwide demand for ground calcium carbonate (GCC), precipitated calcium carbonate (PCC), kaolin, talc, carbon EODFNDQGRWKHUÂżOOHUVZLOOSUHVXPDEO\ amount to about 75 million tons in 2024, with revenues expected to increase by an average of 3.2% per year. The most important applications for ÂżOOHUVDUHWKHSURGXFWLRQDQGSURFHVVLQJ

of paper, plastics, paints and varnishes, elastomers as well as adhesives and VHDODQWV7KHUHDUHVLJQLÂżFDQWGLIIHUHQFHV EHWZHHQWKHVDOHVPDUNHWVIRUÂżOOHUVLQ regard to world regions: While application in the paper industry accounts for a market share of 31% in Western Europe, the share is below 19% in Asia. Vice versa, manufacturers of elastomer products in Asia hold shares of about 32% RQWKHÂżOOHUPDUNHWLQ:HVWHUQ(XURSH the share amounts to 22%. To emphasise WKHVHUHJLRQDODQGFRXQWU\VSHFLÂżF GLIIHUHQFHVWKHGHPDQGIRUÂżOOHUVLQWKH application areas is analyzed in detail. The most important sales market IRUÂżOOHUVLQZDVWKHHODVWRPHUV segment. This application area accounted for about 28% of global total consumption. Plastics are the second largest application DUHDZRUOGZLGH7KHGHPDQGIRUÂżOOHUV in this segment will presumably increase to about 22 million tons in 2024. New and more demanding applications for engineering plastics and compounds

UHTXLUHÂżOOHUVWRSRVVHVVSURSHUWLHV of an ever higher quality. Automotive engineering, for example, systemically XVHVÂżOOHUVWRUHGXFHWKHZHLJKWRIWKH product and increase the stability of plastic products. Additionally, the production of highly ÂżOOHGFRPSRXQGVZLWKSURSHUWLHVWDLORUHG to meet the exact needs of individual customers is rising as well: These SODVWLFVFRQWDLQXSWRRIÂżOOHUV possess excellent mechanical properties and are even more cost-effective than conventional materials in many cases. With a market share of 34%, the most FRPPRQO\XVHGÂżOOHURQWKHJOREDOPDUNHW is ground calcium carbonate (GCC). Over the past eight years, global demand for GCC has increased by an average of 2.7% per year. Out of the total volume used worldwide in 2016, about 50% ZDVXVHGLQ$VLD3DFLÂżF7KHODUJHVW consumer of GCC is the plastics sector which is likely to increase its demand for ÂżOOHUVHYHQIXUWKHU

ZZZFHUHVDQDFRPHQPDUNHWVWXGLHVFKHPLFDOVÂżOOHUV


Flexible packaging driving growth in the North American market POLYMER Demand in NAFTA is AMIâ&#x20AC;&#x2122;s most recent edition in the Polymer Demand series, providing a comprehensive analysis of the polymer markets across the USA, Canada and Mexico. The report covers the third largest regional polymer market in the world and includes the worldâ&#x20AC;&#x2122;s secondlargest economy in terms of purchasing power parity. Home to some of the industryâ&#x20AC;&#x2122;s leading polymer producers with pioneering production capabilities, the technological prowess in the US has enabled development across the entire plastics supply chain. The recent developments in shale gas extraction have stimulated the polymer market in NAFTA through the provision of cheap polymer feedstock and facilitating an increase in domestic manufacturing productivity by virtue of low energy and operation costs. A 58% increase in natural gas extraction is forecast between 2017 and 2040 which suggests

that the US will have a raw material and electric power cost base that is on a par with that in the Middle East. In the context of the growing degree of globalisation, market maturity and elevated environmental awareness, the success in the automotive industry combined with a growing penetration RISODVWLFLQĂ&#x20AC;H[LEOHSDFNDJLQJDQGWKH resurgence in construction activity, the plastics industry has been enabled to prosper in the North American market. Polyethylene, in particular, linear lowdensity grades, have been spearheading WKHULVHLQÂżOPGHPDQGIRUĂ&#x20AC;H[LEOH consumer and industrial packaging largely due to its enhanced mechanical properties enabling down-gauged. The emerging economy of Mexico has played an important role in driving the plastics industry forwards and has witnessed growth above that of the regional average. A growing middle class with more expendable income, a large export economy that competes at

5HSRUWVXJJHVWVWKDWJURZWKLQĂ&#x20AC;H[LEOH packaging and the resurgence in construction activity in the North American market has HQDEOHGWKHLQGXVWU\WRSURVSHUWKHUH

a global level and legislative reforms geared towards developing the Mexican economy have been instrumental in the nationâ&#x20AC;&#x2122;s polymer demand increase of above 3% a \HDULQWKHÂżYH\HDUVOHDGLQJXSWR Overall growth of the North American polymer market is forecast to be 2.7% a year through to 2022, with a moderate variation between the slowest growing market of Canada and the fastest growing of Mexico. www.ami.international AUGUST / SEPTEMBER 2018 79

MBT South Africa Distributors of Plastic Raw Materials Paul Gripper Carlotta Stafford Helga Ferreira Steven Coates Tiago dos Ramos +HDGRIÂżFH &DSH7RZQ

Trading Manager (Cape Regional Sales) (Zambia, Malawi and Lesotho Sales) (Gauteng, Zim, Moz, & Angola Sales ) (Gauteng, Botswana, Namibia & Swaziland Sales ) (KZN & Free State Sales) -RKDQQHVEXUJ 2IÂżFH

www.mbtsa.co.za

082 456 6659 082 600 7403 072 573 4221 063 699 5105 082 775 5344      


World News

Majority of samples taken during Volvo Ocean Race

contain microplastics Just 2 of 68 samples didnâ&#x20AC;&#x2122;t contain microplastics THE Volvo Ocean Race Science 3URJUDPPHUHDFKHGDVLJQL¿FDQW PLOHVWRQHZKHQWKHUDFHFRPSOHWHGD JOREDOFLUFXPQDYLJDWLRQIROORZLQJLWVDUULYDO LQWR&DUGLII:DOHVLQ0D\HLJKWPRQWKV DIWHUGHSDUWLQJIURP$OLFDQWH6SDLQ 2XWRIDWRWDORIVDPSOHVWDNHQ GXULQJWKHFRXUVHRIWKHUDFHRQO\WZR FROOHFWHGVRXWKRI$XVWUDOLDDQGHDVWRI $UJHQWLQDKDYHEHHQIRXQGWRFRQWDLQQR PLFURSODVWLFV 7KHPRVWUHFHQWGDWDWDNHQIURP VXEVXUIDFHVHDZDWHUVDPSOHVFROOHFWHG RQERDUG7HDP$N]R1REHODQG7XUQWKH 7LGHRQ3ODVWLFERDWVIRXQGSDUWLFOHVRI PLFURSODVWLFVSHUFXELFPHWUHLQRQHWDNHQ RIIWKH86FRDVWIROORZLQJWKHVWRSRYHULQ 1HZSRUW5KRGH,VODQG /HYHOVRIDQGSDUWLFOHVRI PLFURSODVWLFVSHUFXELFPHWUHZHUH UHFRUGHGDVWKHERDWVKHDGHGWRZDUGV WKHPLG$WODQWLF7KHVHFRXOGEH FRQQHFWHGWRWKHHGJHRIWKH1RUWK$WODQWLF JDUEDJHSDWFKRQHRI¿YHRFHDQµJ\UHV¶ HVWLPDWHGWREHKXQGUHGVRINLORPHWUHV DFURVVLQVL]H ,QWKHPLG$WODQWLFSDUWLFOHVRI

PLFURSODVWLFVSHUFXELFPHWUHZHUH UHFRUGHGZKLOHFORVHWR&DUGLIIOHYHOV ZHUHVOLJKWO\KLJKHUZLWKSDUWLFOHVRI PLFURSODVWLFVSHUFXELFPHWUHIRXQG (DUOLHULQWKHUDFHLQWKH6RXWKHUQ 2FHDQFORVHWR3RLQW1HPRWKH IXUWKHVWSRLQWIURPODQGRQ(DUWKWKHUH ZHUHEHWZHHQQLQHDQGSDUWLFOHVRI PLFURSODVWLFSHUFXELFPHWUH&ORVHWR $QWDUFWLFZDWHUVLQWKH6RXWK,QGLDQ 2FHDQOHYHOVRIPLFURSODVWLFVZHUHDV KLJKDVSDUWLFOHVSHUFXELFPHWUH 7KHKLJKHVWOHYHOVRIPLFURSODVWLF IRXQGVRIDUSDUWLFOHVSHUFXELF PHWUHZHUHIRXQGLQDVDPSOHWDNHQLQ WKH6RXWK&KLQD6HDWKDWIHHGVLQWRWKH .XUXVKLR&XUUHQWDQGWKH1RUWK3DFL¿F *\UH7KHQH[WKLJKHVWOHYHOV SDUWLFOHVSHUFXELFPHWUHZHUHIRXQGDW WKHSRLQWZKHUHWKH0HGLWHUUDQHDQ6HD DQG$WODQWLF2FHDQPHHW 7KHPLFURSODVWLFVDPSOHVZHUH DQDO\VHGE\PHPEHUVRIWKH9ROYR 2FHDQ5DFHVFLHQWL¿FFRQVRUWLXPLQ.LHO *HUPDQ\7KHGDWDLVWKHQXSORDGHG WRD1DWLRQDO2FHDQLFDQG$WPRVSKHULF $GPLQLVWUDWLRQ 12$$ PLFURSODVWLFV

GDWDEDVHZKHUHVFLHQWLVWVDUHDEOHWR DFFHVVLWRSHQVRXUFH $QQH&HFLOH7XUQHU6XVWDLQDELOLW\ 3URJUDPPH/HDGHUIRUWKH9ROYR2FHDQ 5DFHDGGHG³7KHUDFHKDVQRZFRPH IXOOFLUFOHDQGWKHIDFWWKDWMXVWWZRRIWKH VDPSOHVGLGQ¶WFRQWDLQPLFURSODVWLFVFOHDUO\ VKRZVKRZSHUYDVLYHWKH\KDYHEHFRPH ³7KHFROODWLRQRIDFRPSOHWHGDWDVHW E\WKLVHOLWHVFLHQWL¿FFRQVRUWLXPLVRI H[FHSWLRQDOYDOXHDQGSURYLGHVDQKLVWRULF OHJDF\DQGFOHDUEHQFKPDUNIRURXUIXWXUH XQGHUVWDQGLQJRIWKHZRUOG¶VRFHDQVDQG FOLPDWH´ 0LFURSODVWLFVDUHRIWHQLQYLVLEOHWRWKH QDNHGH\HDQGFDQWDNHWKRXVDQGVRI \HDUVWRGHJUDGH%\FROOHFWLQJLQIRUPDWLRQ RQWKHLUOHYHOVWKH6FLHQFH3URJUDPPHLV KHOSLQJVFLHQWLVWVJDLQLQVLJKWLQWRWKHVFDOH RISODVWLFSROOXWLRQDQGLWVLPSDFWXSRQ PDULQHOLIH

Bio-based Noah car shows what PLA can do /,*+7:(,*+7DQGWLQ\WKHZRUOG¶V¿UVWFDUZLWKVWUXFWXUDOSDUWVDOOPDGHIURPQDWXUDODQGELR EDVHGPDWHULDOV±QRPHWDORUWUDGLWLRQDOSODVWLFZHUHXVHGLQWKHFDUFKDVVLVDQGERG\ZRUN±ZDV XQYHLOHGLQ-XO\DWWKH7HFKQLFDO8QLYHUVLW\RI(LQGKRYHQE\WKHWHDPRIVWXGHQWVZKRGHVLJQHGLW 'XEEHGµ1RDK¶WKHFLW\FDUIHDWXUHVWZRVHDWVDQGDVSDFLRXVWUXQN:LWKVWUXFWXUDOSDUWVPDGH IURPVDQGZLFKSDQHOVEDVHGRQQDWXUDO¿EHU±Ã&#x20AC;D[±DQG7RWDO&RUELRQSRO\ODFWLFDFLGXVLQJ UHQHZDEO\VRXUFHGKLJKKHDW/XPLQ\3/$JUDGHVWKHFDULVVWURQJEXWZHLJKVLQDWRQO\NJ %\FRPSDULVRQWKHWZRVHDW6PDUWFDUZHLJKVDERXWNJ 1RDKLVEDWWHU\SRZHUHGZLWKDPD[LPXPUDQJHRINPDQGKDVDWRSVSHHGRINPK $OOSDUWVDUHUHF\FODEOH1RDKLVFXUUHQWO\XQGHUWDNLQJD(XURSHDQWRXURIFDUPDQXIDFWXUHUV VXSSOLHUVDQGXQLYHUVLWLHV³WRLQVSLUHRWKHUV´ 80 AUGUST / SEPTEMBER 2018


A FIRE at a PET feedstocks plant operated by Alpek SAB de CV in Altamira, Mexico, on 15 July LVOLNHO\WRDIIHFW3(7SULFHVJOREDOO\7KHÂżUHZDV DWRQHRIWKHVLWHÂśVWZRSXULÂżHGWHUHSKWKDOLFDFLG units. That unit has annual production capacity of more than 450,000 tons, according to the Wood 0DFNHQ]LHFRQVXOWLQJÂżUPLQ+RXVWRQ7KH37$ unit also supplies DAK Americasâ&#x20AC;&#x2122; PET resin SODQWVDW0LVVRXUL86$DVZHOODVH[SRUWVWR various South American and European polyester producers. â&#x20AC;&#x153;This outage is likely to negatively impact PET UHVLQSURGXFWLRQLQWKH$PHULFDVUHJLRQDVZHOODV in Europe. It comes at a particularly critical time for the Americas and European PET resin markets, as both regions have been experiencing critically tight PET resin supply due to both PET resin and PTA plant outages,â&#x20AC;? said a Wood Mackenzie spokesman.

s ZZZYROYRRFHDQUDFHFRP

&DSH7RZQWR0HOERXUQHGD\RQERDUG 7XUQWKH7LGHRQ3ODVWLF 3+272%<-(5(0,(/(&$8'(<92/922&($15$&(

0LFURSODVWLFVLQRXURFHDQSUHOLPLQDU\GDWD

UK businesses offered ÂŁ4m to design circular future for plastics BUSINESSES in the UK are being offered a share RIXSWRÂ&#x2026;PLOOLRQWRORRNDWZD\VRIUHGXFLQJ SODVWLFZDVWH7KHFRPSHWLWLRQLVVHHNLQJFLUFXODU economy approaches to plastic use that could LQFOXGHGHYHORSLQJQHZSRO\PHUPDWHULDOV SURGXFWGHVLJQVQHZUHF\FOLQJSURFHVVHVDQG innovations that encourage people to change EHKDYLRXU3URMHFWVFRXOGDOVRORRNDWQHZ business models focused on compostable or biodegradable materials. They can be led by a business or a research or technology organisation but all projects must include a small and medium enterprise (SME). Only an SME can lead SURMHFWVZLWKFRVWVEHORZÂ&#x2026;7KHIXQGLQJ is provided by UK Research & Innovation and delivered by Innovate UK.

Krones opens brewery

1RDKWKHZRUOGÂśVÂżUVWFDU ZLWKVWUXFWXUDOSDUWVDOO made from natural and bio-based materials

Krones, the single-source production systems VSHFLDOLVWUHFHQWO\RSHQHGDEUHZHU\RILWVRZQ at its facility in Freising, Germany: the Steinecker %UHZ&HQWUHSURYLGHVERWKFOLHQWVDQG.URQHV LWVHOIZLWKDQRSWLRQIRUFROODERUDWLYHEUHZLQJ FRQGXFWLQJWULDOVDQGWHVWLQJQHZWHFKQRORJLHV 7KHKHDUWRIWKHQHZEUHZLQJSLORWSODQWLVD ÂżYHKHFWROLWUHEUHZKRXVHFRPSULVLQJÂżYHGLIIHUHQW vessels. â&#x20AC;&#x153;The system is small, thatâ&#x20AC;&#x2122;s true, but LWRIIHUVPD[LPXPĂ&#x20AC;H[LELOLW\DOOWKHVDPHKHUH ZHFDQFRPELQHGLIIHUHQWWHFKQRORJLHVDQG DUHDEOHWRGHPRQVWUDWHWKHODUJHEDQGZLGWKRI solutions offered by Krones. We can, for example, UHSURGXFHDQXOWUDZLGHUDQJHRILQWHUQDWLRQDOO\ HPSOR\HGSURFHVVHVRQWKHRQHKDQGZKLOHDOVR IDPLOLDULVLQJRXURZQFRPPLVVLRQLQJHQJLQHHUV DQGFOLHQWVÂśVWDIIZLWKWKHWHFKQRORJLHVFRQFHUQHG on the other,â&#x20AC;? explained Dr Konrad MĂźller$XIIHUPDQQZKRZDVUHVSRQVLEOHIRUWKLVSURMHFW at the inauguration ceremony held on 19 June AUGUST / SEPTEMBER 2018 81

AROUND THE WORLD

Fire at PET feedstock plant in Mexico


ELASTOMERS

PLASTICS & COMPOSITES

ACM CR EPDM Epichlorohydrin FKM HNBR HTV Silicone IR NBR NR PVC/NBR Blends SBR & BR

ABS Acetal Additives Composites CPE CSM EVA HIPS & GPPS Nylon PC PVC TPE & TPV TPU

FILLERS & ADDITIVES

AUXILIARIES & SERVICES

Aluminas Antimony Products Blowings Agents Carbon Blacks Flame Retardents Hydrocarbon Resins Magnesium Oxide Masterbatches MC & PE Waxes Mineral Fillers Peroxides Process Aids Rubber Chemicals Silanes Silica Sulfur Zinc Oxide

Curing Bladder Machinery Other Services Release Agents Release liners Spares

ANCHOR CHEMICALS Batch Off Bonding Systems Coated Powders Factice Masterbatching Process Aids Toll Mixing


World News

AROUND THE WORLD

UK predictive maintenance fundis Senseye expand

82 AUGUST / SEPTEMBER 2018

Automated condition monitoring, prognostics for largescale industrial plants with thousands of machines SENSEYE, a provider of predictive Simon Kampa, CEO of Senseye, maintenance analytics based in FRPPHQWVÂł6HQVH\HLVWKHÂżUVW Britain, has doubled the size of its company to have automated engineering workforce since closing condition monitoring and a ÂŁ3,5-million Series A funding prognostics for large scale industrial round towards the end of 2017. The plants with thousands of machines. company has recruited 21 people 'RLQJWKDWDWVFDOHUHTXLUHVDPL[ to its engineering team since the of technical capabilities and we are start of the year to accelerate its delighted to have attracted people efforts to improve the scalability and ZLWKH[SHUWLVHLQDVWURSK\VLFV predictive capabilities of its awardDQGPDWKHPDWLFVWRÂżQGQHZ winning condition ways of assessing monitoring and machine health, Senseye is a prognostics software. data engineers to leading Senseyeâ&#x20AC;&#x2122;s implement them cloud-based software is into our software used by leading and mechanical soware for manufacturers in engineers to help predictive the automotive, FXVWRPHUVPD[LPLVH maintenance. heavy industry WKHEHQHÂżWVWKDWFDQ and consumer be achieved using goods sectors to them.â&#x20AC;? automatically assess the condition Senseye is a leading cloud-based and remaining useful life of software for predictive maintenance. thousands of industrial machines. It helps manufacturers avoid Customers have achieved downtime and save money by reductions in maintenance costs of automatically forecasting machine up to 40% and halved their levels IDLOXUHZLWKRXWWKHQHHGIRUH[SHUW of unplanned downtime using the manual analysis. Its intelligent software. machine-learning algorithms allow The company now employees 39 it to be used on any machine data scientists, software developers from any manufacturer, taking and mechanical engineers at its LQIRUPDWLRQIURPH[LVWLQJ,QGXVWULDO Southampton headquarters. They IoT sensors and platforms to are led by Robert Russell, Senseye automatically diagnose failures and FKLHIWHFKQRORJ\RIÂżFHUDQG'U provide the remaining useful life of James Loach, its chief scientist. machinery. Senseye team â&#x20AC;Ś this particular bunch of scientists and engineers, caught out on a bright sunny day at Southampton, have come up with solutions for large plant PDLQWHQDQFHZKLFKKHOSPDQXIDFWXUHUVLPSURYHHIÂżFLHQFLHVDQGUHGXFHFRVWV

www.senseye.io

Worldâ&#x20AC;&#x2122;s plastic waste problem to â&#x20AC;&#x2DC;reach 111 million metric tons by 2030â&#x20AC;&#x2122; MOUNTAINS of plastic waste are building up around the globe after China implemented a ban on imports of other countriesâ&#x20AC;&#x2122; trash. By 2030, an estimated 111 million metric tons of single-use drink bottles, food containers and other plastic junk will be displaced because of Chinaâ&#x20AC;&#x2122;s new policy, according to a new paper from University of Georgia researchers, who cited UN global trade data for their study. Before the ban, China reigned as the worldâ&#x20AC;&#x2122;s largest importer of plastic leftovers. The paper, published in the journal â&#x20AC;&#x2DC;Science Advancesâ&#x20AC;&#x2122;, said that China has imported 106 million metric tons of plastic waste for recycling since 1992, making up 45.1% of all cumulative imports. But last year, China announced it no longer wanted to take in other countriesâ&#x20AC;&#x2122; trash, so it could focus on its own pollution problems. 7KHXQH[SHFWHGSROLF\VKLIWKDVOHIWH[SRUWHUV in the US, Canada, Ireland, Germany and other European countries scrambling for solutions for their trash. The US alone had sent 13.2 million tons of scrap paper and 1.42 million tons of scrap plastics to Chinaâ&#x20AC;&#x2122;s recycling centres annually. Western states, which heavily relied on Chinese UHF\FOLQJSODQWVKDYHVHHQEDOHVRIPL[HGSODVWLFV and paper building up in recycling centres, the New York Times reported last month. In some cities, the pile-up has even resulted in recyclables being GLUHFWO\VHQWWRODQGÂżOOV6RPHRIWKLVZDVWHLVQRZ being sent to Vietnam, Malaysia and Thailand, but H[SHUWVKDYHVDLGWKDWWKHVHFRXQWULHVPLJKWQRW EHDEOHWRÂżOOWKHYRLGOHIWE\&KLQD&1%&1HZV reported. As the researchers of the paper concluded, â&#x20AC;&#x153;Bold global ideas and actions for reducing quantities of nonrecyclable materials, redesigning products, and funding domestic plastic waste management are needed.â&#x20AC;?

India pledges ban on all single-use plastics by 2022 THE Indian government has pledged to ban all single-use plastics by 2022, in a move which has been welcomed by both the United Nations and grassroots groups. The UN environment agency described the policy as â&#x20AC;&#x153;unprecedentedâ&#x20AC;?. It was announced during a :RUOG(QYLURQPHQW'D\VXPPLWKRVWHGE\WKH Indian Prime Minister, Narendra Modi. India was providing â&#x20AC;&#x153;global leadershipâ&#x20AC;? where the rest of the world was falling short, said UN Environment chief Erik Solheim. A new report from the agency highlighted more than 50 nations taking some action to tackle plastics, but added that much more needed to be done. Indiaâ&#x20AC;&#x2122;s 1.3 billion population currently produces 25 000 tons of plastic per day. The government claims that around 60% of that is recycled, but civil society groups put the ÂżJXUHFORVHUWR


World News

Volvo has unveiled a specially-built version of its XC60 T8 plug-in hybrid SUV that looks identical to the existing model, but has had several of its plastic components replaced with equivalents containing recycled materials

Volvo going green Volvo aims for 25% recycled plastics in every new car from 2025 VOLVO has announced its ambition that from 2025, at least 25% of the plastics used in every new car will be made from recycled material. Volvo also urged auto industry suppliers to work more closely with car makers to develop next generation components that are as sustainable as possible, especially with regards to containing more recycled plastics. To demonstrate the viability of this ambition, the company has unveiled a speciallybuilt version of its XC60 T8 plug-in hybrid SUV that looks identical to the existing model, but has had several of its plastic components replaced with equivalents containing recycled materials. The XC60â&#x20AC;&#x2122;s interior has a tunnel console PDGHIURPUHQHZDEOHÂżEUHVDQGSODVWLFV IURPGLVFDUGHGÂżVKLQJQHWVDQGPDULWLPH

URSHV2QWKHĂ&#x20AC;RRUWKHFDUSHWFRQWDLQV ÂżEUHVPDGHIURP3(7SODVWLFERWWOHVDQGD recycled cotton mix from clothing manufacturersâ&#x20AC;&#x2122; offcuts. 7KHVHDWVDOVRXVH3(7ÂżEUHVIURPSODVWLF bottles. Used car seats from old Volvo cars were used to create the sound-absorbing material under the car bonnet. The recycled-plastics XC60 was revealed at the Ocean Summit during the Gothenburg Volvo Ocean Race stopover. The raceâ&#x20AC;&#x2122;s focus on sustainability centres on a partnerVKLSZLWKWKH8QLWHG1DWLRQV(QYLURQPHQW Clean Seas campaign, focussing on the call WRDFWLRQÂľ7XUQWKH7LGHRQ3ODVWLFÂś The recycled plastics ambition is the most progressive statement around the use of recycled plastic by any premium automotive manufacturer. It represents another demon-

stration of Volvo Carsâ&#x20AC;&#x2122; commitment towards reducing its impact on the environment across all operations and products. Last month, Volvo Cars committed to eradicate single-use plastics across all its premises and events by the end of 2019. In 2017, the company announced an industry-leading commitment to electrify all new Volvo cars launched after 2019. Last month, Volvo Cars reinforced this strategy, by stating that it aims for fully electric cars to make up 50% of its global sales by 2025. In terms of operations, Volvo Cars aims to have climate-neutral manufacturing operations by 2025. In January this year, the engine plant in SkĂśvde, Sweden, became its ÂżUVWFOLPDWHQHXWUDOIDFLOLW\ www.volvocars.com

84 AUGUST / SEPTEMBER 2018

Covestro awarded innovation prize for plastics from plants &29(6752KDVUHFHLYHGDQLQQRYDWLRQ award offered by the German government and industry for a research breakthrough in the production of plastics from renewable raw materials. This makes the materials manufacturer one of the hundred winners of the Germany-wide FRPSHWLWLRQÂľ([FHOOHQW/DQGPDUNVLQWKH Land of Ideasâ&#x20AC;&#x2122;. The prize was awarded for a newly developed process for producing the important basic chemical aniline from

plants instead of crude oil. Covestro is leading a research project with partners from industry and science. As part of the project, Covestro is cooperating with Bayer, the CAT Catalytic Centre in Aachen and the University of Stuttgart. To produce aniline from plant biomass, the research consortium led by Covestro has developed a completely new process that combines biotechnology and chemistry. Up to now the chemical,

which serves as the starting material for numerous products, has been produced worldwide exclusively from fossil raw materials such as crude oil. After the success in the laboratory and LQWKHÂżUVWSLORWSODQWVWKHSDUWQHUVQRZ want to further develop the technology. The ultimate goal is to enable the production of biobased aniline on an industrial scale â&#x20AC;&#x201C; an absolute novelty in the plastics industry.

Plastic from plants: An interdisciplinary team led by Covestro researcher Dr Gernot Jäger (centre) has developed a highly sustainable new production process for the chemical aniline, which is used in foam insulation boards Insulating with plants: A research team led by Covestro has developed a highly sustainable production process for manufacturing the chemical aniline. It can be used to produce insulation boards from rigid foam such as this sample

www.covestro.com


The Australian â&#x20AC;&#x2DC;Plastiphaltâ&#x20AC;&#x2122; project uses 200 000 plastic bags and other soft plastic packaging

Bags, bottles being transformed into roadways Roads, pavements made using recycled plastics in place of virgin asphalt THE future may be paved with recycled plastics. At least three projects around the world â&#x20AC;&#x201D; in Australia, New Zealand and the Netherlands â&#x20AC;&#x201D; are putting down pavements made using recycled plastics in place of virgin asphalt. In Australia, Downer EDI Ltd has used soft plastics such as bags, along with the toner from used printer cartridges, glass and recycled asphalt in a 427m section of roadway in a Melbourne suburb. In New Zealand, Fulton Hogan paved part of Christchurch International $LUSRUWÂśVÂżUHVWDWLRQZLWKDQDVSKDOWPL[ that includes 3,100 4-litre plastic oil containers. And the Dutch community of Zwolle, the PlasticRoad project will begin by using recycled plastics for two pilot projects made up of 30m long bicycle paths made of hollow prefabricated

elements enabling water drainage and laying down of cables and pipes. In Australia, the suburban roadway in Craigieburn uses 200 000 plastic bags and other soft plastic packaging; 63 000 glass bottles; toner from more than 4 500 used printer cartridges; and 50 metric tons of recycled asphalt to create 250 metric tons to create what Downer EDI is currently calling â&#x20AC;&#x2DC;Plastiphaltâ&#x20AC;&#x2122;. Downer scientists have been working on its product for several years to get the optimum mix of recyclables, but the National Sword program in China, which cut off many waste plastic imports, accelerated the process because it means more waste plastic is being stockpiled in Australia and recycling costs have increased. Cremasco said Close the Loop approached Downer about recycling

Downer EDI Ltd. Workers for Downer EDI Ltd. pave a section of roadway in suburban Melbourne with a mix that includes recycled bags and toner from ink cartridges.

BY KATE TILLEY, PLASTICSNEWS toner from used cartridges and Downer initially developed road-building products Tonerpave and Tonerseal, which include toner polymers, and 99% asphalt, which has only 1% virgin material, using toner, old tyres, glass and other recycled resources. Those products have been in use for ORZWUDIÂżFYROXPHURDGVIRUDERXWÂżYH years, Cremasco said. Plastiphalt is equivalent to premium asphalt, so it is less prone to cracking and fatigue and suitable for roadways EHDULQJKHDY\WUDIÂżFDQGKLJKZHLJKW vehicles. The sustainable, cost-competitive road has a 65% improvement in fatigue life and a superior resistance to deformation, making the road last longer, and allowing LWWREHWWHUKDQGOHKHDY\YHKLFOHWUDIÂżF Cremasco said.

Reusable bag made entirely of recycled plastic bottles REUSABLE bag manufacturer Jutexpo, supermarket chain Waitrose and designer Emma Bridgewater have created a reusable bag made entirely of recycled plastic bottles. Raising money for The Princeâ&#x20AC;&#x2122;s Countryside Fund, the launch of the exclusive Emma Bridgewater-designed bags will see the supermarket and Worcestershire-based Jutexpo reusing half a million bottles in total. The bags are made from a fabric using 100% recycled plastic bottles and are the ÂżUVWWRKDYHWKHLQWHJULW\RIFHUWLÂżFDWLRQWR the Global Recycled Standard (GRS). Each bag is created using the material from seven plastic bottles, in a process which turns the plastic into a durable and practical fabric called rPet fabric, which looks like a jute bag with a wipe-clean coating. The supermarket expects that a number of reusable Waitrose shopping

bags will be designed using the same material in the future, turning over one million plastic bottles into shopping bags. Also part of the range are four new fold-away pouch bags, also made from recycled plastic bottles, featuring classic Emma Bridgewater designs. Both types of bag were available in Waitrose shops from 20 June, with 10% of the retail price from each bag going to The Princeâ&#x20AC;&#x2122;s Countryside Fund, to support projects across the UK that help provide a secure future for the countryside. The juco style bags are priced at ÂŁ5 and the pouch bags will be ÂŁ4. Jutexpo is the worldâ&#x20AC;&#x2122;s biggest supplier of reusable jute and juco bags, with sales topping 65 million bags since the company was formed in 2002. The companyâ&#x20AC;&#x2122;s jute bag production rose

AUGUST / SEPTEMBER 2018 85

from 5.5million bags per year before the English plastic bag tax was introduced to 8.5million in the year of the bag tax and 7million a year since.


Diary

Italyâ&#x20AC;&#x2122;s Plast meets objectives in â&#x20AC;&#x2DC;big winâ&#x20AC;&#x2122; 1500 exhibitors in 55 000m2 of exhibition space THE PLAST International exhibition in Milan at the end of May was yet again a huge success, with the trade fair project, The Innovation Alliance, proving to be a winning choice: the more than 150,000 â&#x20AC;&#x2DC;operatorsâ&#x20AC;&#x2122; who participated were treated to an exhaustive range of plastics and rubber technology without precedent. Plast took place at the Fiera Milano fairgrounds in Rho-Pero from 29 May1 June. From day one through to the closing, Corso Italia and the 17 halls at Fiera Milano were packed with visitors. Plast 2018 recorded a total of

some 1500 exhibitors in 55 000m2 RIH[KLELWLRQVSDFHZLWKVLJQLÂżFDQW growth of over 20% in foreign SDUWLFLSDQWVDIÂżUPLQJWKHLQWHUQDWLRQDO stature of the exhibition. There was a VLJQLÂżFDQWLQFUHDVHRILQQXPEHUVRI Chinese and Iranian collectives. 7KHRUJDQL]DWLRQDORIÂżFHHVWLPDWHV over 63,000 visitors based on statements of priority interest made by operators during the registration process. Foreign visitors made up 27.5% of the total from a total of 117 countries, with Spain, France and Germany being the most represented.

Lone ranger â&#x20AC;&#x201C; Anton Hanekom of Plastics|SA manned the countryâ&#x20AC;&#x2122;s sole stand at the show

Industry 4.0 technology was also well represented, and also the topic of discussions in the many conferences augmenting the programme of this preeminent trade fair. Laura Bacchia and Marco Sellati, marketing manager and EMEA sales manager respectively for Moretto, showed some of the Italian ancillaries PDQXIDFWXUHUÂśVYHU\HIÂżFLHQW systems (see article alongside)

Umberto Favini of Userve was on the stand of Italian robots manufacturer Campetella, whose systems were operating on many of the machines at the show. According to Umberto, Campetella offers among WKHEHVWHIÂżFLHQF\IRUSULFH performance for robots available worldwide. Userve is the agent for the Italian company; its other principle Tederic of China, an injection machine manufacturer, had a stand nearby

Foam moulding â&#x20AC;&#x201C; Eddie Brembilla and Colin Richmond of Erex of Johannesburg on the stand of their principal Negri Bossi, chatting with Diego Soldini, area sales manager for Negri. In colaboratio with Trexel, Negri Bossi is now offering a machine that is equipped to perform the MuCellÂŽ microcellular foaming process, allowing for substantial weight saving

86

AUG / SEPT 2018

Angela Soardi, who is based in Pretoria, was on the Tecnova stand at the show, the impressive feature of which was a 16m screw â&#x20AC;&#x201C; not something you see around that much. She was visited by Lourens van Deventer aned Zola Fubu of Gundle Plastics Group. Zola is the new chairman of Gundle

Diary new.indd 86

2018/08/02 10:57


EXPAND YOUR MARKETS INTERNATIONAL PLASTICS EXHIBITION 2nd Edition

Complete Plastics Exhibition

SOUTH AFRICA

NOVEMBER 13 - 15, 2018 GALLAGHER CONVENTION CENTRE (GCC) JOHANNESBURG | SOUTH AFRICA

CONCURRENT EVENT THE FIRST EVER UNIQUE PLATFORM FOR PLASTICS & RUBBER PRODUCTS

FOR THE FIRST TIME IN SOUTH AFRICA

SOUTH AFRICA

150+ EXHIBITORS

10+

COUNTRIES

LIVE DEMO OF MACHINES

For More Details, Contact : Mr.Anand - +27 794973646 plastics@smartexpos.in | www.complastexpo.in

Organized by


Diary

Morettoâ&#x20AC;&#x2122;s new technology Products with high technological value, intelligent, sustainable machines

Examples of products made from PHA-based resins Photo: â&#x20AC;&#x2DC;BIOPLASTICSâ&#x20AC;&#x2122; magazine

COMING UP

FIRST PHA â&#x20AC;&#x2DC;PLATFORMâ&#x20AC;&#x2122; WORLD CONGRESS PHA (poly-hydroxy-alkanoates) is a family of bio-based polyesters. Just like many mammals, including humans, that hold energy reserves in the form of body fat, there are also bacteria that hold intracellular energy reserves in form of polymers (polyhydroxy alkanoates). Here the microorganisms store a particularly high level of energy reserves (up to 80% of their own body weight) for when their sources of nutrition become scarce. Examples for such Polyhydroxyalkanoates are PHB, PHV, PHBV, PHBH and many more. Thatâ&#x20AC;&#x2122;s why we speak about the PHA â&#x20AC;&#x2DC;platformâ&#x20AC;&#x2122;. This PHA-platform is made up of a large variety of bioplastics raw materials made from many different renewable resources. Depending on the type of 3+$WKH\FDQEHXVHGIRUDSSOLFDWLRQVLQÂżOPV and rigid packaging, biomedical applications, automotive, consumer electronics, appliances, WR\VJOXHVDGKHVLYHVSDLQWVFRDWLQJVÂżEUHV for woven and non-woven and inks. So PHAs cover a broad range of properties and applications. Also, depending on the type, most PHAs are biodegradable in a wide range of environments, such as industrial and home composting, anaerobic digestion (AD), in soil, fresh- and even seawater. As PHAs are gaining more and more interest, BIOPLASTICS magazine and Jan Ravenstijn are QRZRUJDQLVLQJWKHÂżUVWPHA-platform World Congress on 4-5 September in Cologne, Germany. In about 30 high-class presentations, the congress will address the progress, challenges and market opportunities for the formation of this new polymer platform in the world. Every step in the value chain will be addressed. Raw materials, polymer manufacturing, compounding, polymer processing, applications, opportunities and endof-life options will be discussed by parties active in each of these areas. Progress in underlying technology challenges will also be addressed. www.pha-world-congress.com

â&#x20AC;&#x2DC;INNOVATIONS IN INDUSTRYâ&#x20AC;&#x2122; IN PE TO SHOWCASE LATEST SA TECHNOLOGIES THE Innovations in Industry Technical Conference to be held in Port Elizabeth on Friday 7 September is to showcase new industrial WHFKQRORJLHVVXFKDVDUWLÂżFLDOLQWHOOLJHQFHDXJPHQWHG reality, MetalAM (metal additive manufacturing) and more. The focus will be on technology that is being implemented, demystifying these as well as informing manufacturers how to harness these systems to improve and enhance current outputs. Local initiatives and â&#x20AC;&#x2DC;real worldâ&#x20AC;&#x2122; and applicable technologies in current operational scenarios will be covered. http://iic.mandela.ac.za 88

Diary new.indd 88

MORETTOâ&#x20AC;&#x2122;S new technological solutions presented at Plast 2018 IRFXVHGRQWKHVSHFLÂżFUHTXHVWVRI an increasingly demanding clientele. Products with high technological value, intelligent and sustainable machines, prepared for a 4.0 process management, met with great success among the operators of the injection, extrusion and PET processing sectors. 0RUHWWRSUHVHQWHGIRUWKHÂżUVWWLPHD UHYROXWLRQDU\DQGXQLTXHÂľGU\LQJRQGHPDQG systemâ&#x20AC;&#x2122;, the Moisture Meter Manager. The Moisture Meter responds to customer needs to obtain precise and indispensable GDWDLQWKHGHKXPLGLÂżFDWLRQSURFHVVWKH residual moisture of the plastic granule, measured in ppm, with a deviation of Âą 3 ppm, which is practically irrelevant. In the Manager version, Moisture 0HWHUDOORZVDXWRPDWLFDQGHIÂżFLHQW PDQDJHPHQWRIWKHGHKXPLGLÂżFDWLRQ SURFHVVWKHFXVWRPHURQO\XVHVWKH HQHUJ\UHTXLUHGIRUHDFKSKDVHRIWKH process. With regards to HQHUJ\HIÂżFLHQF\ Moretto presented a new cooling concept, X Cooler, which is a modular FRROLQJV\VWHPHTXLSSHG with screw compressors ZLWKYDULDEOHĂ&#x20AC;RZKLJK HIÂżFLHQF\HYDSRUDWRUV centrifugal ducted fans and electronic expansion valves

that guarantee high performance and optimise the consumption of a compartment of high energy consuming departments. X Cooler is also suitable for heavy-duty applications. Regarding temperature management, Moretto presented TE-KO Chiller, a integrated cooling and temperature control system that meets the FRPSDFWQHVVUHTXLUHPHQWVRIWKH plastics processing departments by GH¿QLWLYHO\UHGXFLQJWKHVSDFHVWKHVH machines traditionally took up. This is a versatile solution for the double zone thermos-regulation of the moulds, with an adjustable set point between +10°C and +95°C and integrated chiller for the production of cooling water. The TE-KO &KLOOHULVHTXLSSHGDVVWDQGDUGZLWKWKH integrated Free Cooler function, which allows the optimisation of consumption according to the environmental conditions. Moretto also introduced its DPK doser, a compact loss-in-weight additive dosing unit, suitable for intermittent or continuous

Songwon presents new at ProPak Asia SONGWON Industrial Group exhibited its expanding range of ink binders and adhesives at ProPak Asia, Asiaâ&#x20AC;&#x2122;s number one show for food, drink & pharmaceutical processing and packaging which was held in Bangkok, Thailand, from June 13-16. A leading specialist in polyurethane ink binder WHFKQRORJ\IRUJUDYXUHDQGĂ&#x20AC;H[RJUDSK\SULQWLQJ inks and polyurethane laminating adhesives used in Ă&#x20AC;H[LEOHSDFNDJLQJODPLQDWHV6RQJZRQVKRZFDVHG its latest high-performance products and solutions. â&#x20AC;&#x153;Our presence at ProPak demonstrates Songwonâ&#x20AC;&#x2122;s commitment to the packaging industry,â&#x20AC;? said Kyuyeol Lee, leader of the groupâ&#x20AC;&#x2122;s TPP business unit. Âł:HDUHLQQRYDWLQJFRQWLQXRXVO\LQWKHSDFNDJLQJÂżHOGOHYHUDJLQJRXUPDQ\\HDUV of industry knowledge and manufacturing experience to develop, produce and market a broad range of high-performance polyurethane ink binders and laminating adhesives. Our FXVWRPLVHGVROXWLRQVIRUĂ&#x20AC;H[LEOHSDFNDJLQJDUHGHVLJQHGWRJLYHPDQXIDFWXUHUVRISODVWLF ÂżOPIRUSDFNDJLQJFRPSHWLWLYHHGJHDQGKHOSWKHPPHHWWKHLUHQGXVHUHTXLUHPHQWV´

AUG / SEPT 2018

2018/08/01 11:19


dosing of small quantities of colour or DGGLWLYHVLQWRDÃ&#x20AC;RZEDVHPDWHULDO7KLVQHZ GRVLQJXQLWVROYHVWKHSUREOHPRIRYHUGRVLQJ ZLWKDQH[WUHPHO\SUHFLVHFRQWURO7KDQNV WRWKHH[FOXVLYHYLEUDWLRQLPPXQLW\V\VWHP DQGDPDFKLQHFRQWURODOJRULWKPWKH'3. DFKLHYHVDGRVLQJDFFXUDF\XSWR 7KH'3.LVPDGHRIWUDQVSDUHQWDFU\OLF PDWHULDOWKDWDOORZVWKHRSHUDWRUWRVHHWKH VWDWHRIWKHPDFKLQHDWDQ\WLPHDQGDW ORQJGLVWDQFHV)XUWKHUPRUHLWVLQWHJUDWHG IHHGLQJV\VWHPDXWRQRPRXVO\PDQDJHV WKHORDGLQJRIWKHPDWHULDODFFRUGLQJWRWKH QHHGVRIWKHSURFHVVLQJPDFKLQH :LWKUHJDUGWR3(7DQGLQSDUWLFXODU WRWKHEHYHUDJHVHFWRU0RUHWWR SUHVHQWHGWKH'6VHULHVPRXOGGU\HU GHVLJQHGWRSUHVHUYHWKHPRXOGVIURP ZDWHUFRQGHQVDWLRQVRDVWRJXDUDQWHH WKHEHVWTXDOLW\RIWKHSURGXFWDORQJ ZLWKDORQJHYLW\RIWKHVDPHPRXOG

'6LVFKDUDFWHULVHGE\DFRPSDFWVWUXFWXUH DQGZRUNVZLWKDKLJKSHUIRUPDQFHURWRU WKDWLQKHULWVWKH]HROLWHWHFKQRORJ\DQG H[SUHVVHVDOOEHQH¿WVLQWHUPVRISURFHVV DQGHQHUJ\SHUIRUPDQFH7KHUHF\FOLQJ RISODVWLFLVDQLPSRUWDQWDQGYHU\WRSLFDO VXEMHFW(YHQLQWKLVDUHD0RUHWWRFRQWLQXHV WRGHYHORSFXVWRPLVHGVROXWLRQVIRUWKH UHF\FOLQJRI3(7$W3ODVW0RUHWWRSUHVHQWHG DQHZVHULHVRI03.FU\VWDOOLVHUV7KH\DUH DEVROXWHO\QHFHVVDU\PDFKLQHVLQWKLVVHFWRU ZKHUH53(7DQGGLUHFWUHJULQGZKLFKLV WKHVFDOHFRPLQJIURPERWWOHJUDQXODWLRQ DUHPDWHULDOVWKDWQHHGGHGLFDWHGSURFHVVHV DQGV\VWHPVSHFL¿FDWLRQV www.moretto.com

KZN MANUFACTURING INDABA ON 22 AUGUST THE annual KwaZulu-Natal Manufacturing Indaba, to be held on 22 August at the ICC in Durban, is a revered platform for assembling provincial manufacturers and businesses to explore growth opportunities, uncover the latest manufacturing incentives and trends as well as to network and collaborate with relevant contacts vested in the sector. The event has announced its agenda which includes a dynamic offering of engaging sessions discussing a range of thoughtprovoking topics, amongst which are Industry 4.0, maximising the market for manufacturers and accessing new markets for manufacturers. The conference will host forums on the 4th Industrial Revolution and its implication on manufacturing units within the sector. www.manufacturingindaba.co.za

PROPAK WEST AFRICA GETTING POPULAR

EXTRUSION CONFERENCE IN USA IN SEPTEMBER COVERS ALL TECHNOLOGIES

ink binders and adhesives The Hi-thaneâ&#x201E;¢ adhesives from Songwon achieve excellent ERQGLQJVWUHQJWKIRUSODVWLF¿OPVDQGWKHLUKLJKKHDWUHVLVWDQFH makes them suitable for retort applications such as retort pouches

+LJKOLJKWVDWWKHVKRZZLOOLQFOXGHVHYHUDOUHFHQWO\ODXQFKHG SURGXFWVLQFOXGLQJ+LWKDQHÂ&#x152;$7DQG+LWKDQHÂ&#x152; $7ZKLFKDUHDOLSKDWLFVROYHQWEDVHG38LQNELQGHUV VXLWDEOHIRUERWKJUDYXUHDQGÃ&#x20AC;H[RJUDSKLFSULQWLQJLQNV ³7KH\FRQIHUH[FHOOHQWERQGLQJVWUHQJWKWRYDULRXVSODVWLF ¿OPVDQGWKHLUKLJKKHDWUHVLVWDQFHPDNHVWKHPSDUWLFXODUO\ VXLWDEOHIRUUHWRUWDSSOLFDWLRQVVXFKDVUHWRUWSRXFKHVZKLFK DUHW\SLFDOO\PDGHIURPDODPLQDWHRIÃ&#x20AC;H[LEOHSODVWLFDQGPHWDO IRLODQGVXLWDEOHIRULQVWDQWFXUU\PHDOVDQG¿HOGUDWLRQVIRU H[DPSOH´VD\V+\HRQVLN%DH733WHFKQLFDOVHUYLFHPDQDJHU ³:LWKWKHLUVWURQJDQWLEORFNLQJSURSHUWLHVWKH\DUHIRUPXODWHGWRSUHYHQW¿OPOD\HUVIURP VWLFNLQJWRRQHDQRWKHU7KLVFDQXOWLPDWHO\ERRVWSURGXFWLYLW\´ +LWKDQH$LVDVROYHQWIUHH38ODPLQDWLQJDGKHVLYHZLWKKLJKERQGLQJVWUHQJWK RQYDULRXVSODVWLF¿OPV ³7KLVJHQHUDOSHUIRUPDQFHDGKHVLYHKDVH[FHSWLRQDOO\JRRGZHWWLQJSURSHUWLHVZKLFK SOD\DNH\UROHLQKHOSLQJ¿OPODPLQDWHPDQXIDFWXUHUVWRUHGXFHFRDWLQJZHLJKWVDQG¿OP ODPLQDWLRQFRVWV´VDLG+\HRQVLN%DH www.Songwon.com

THE Extrusion 2018 conference in Cleveland, Ohio, USA, organised by Plastics Technology magazine devoted to all aspects of extrusion processing. The 18-20 September event consists of general sessions devoted to technical and business issues common to all types of extrusion, followed by breakout sessions devoted to specific types of extrusion. The show is obviously focussed on American delegates but foreigners in the audience will benefit from the technology sessions and interaction provided. www.extrusionconference.com

COMING UP

THE floorplan for Propak West Africa exhibition and conference (18-20 September) is completely sold out. Booking for the event at the Landmark Centre on Victoria Island in Lagos, Nigeria, is now live.

Drying on demand â&#x20AC;&#x201C; The new Moisture Management system controls the drying process on a new technology EDVLV¿WWLQJLQWR,QGXVWU\WKLQNLQJ

Diary new.indd 89

Diary

â&#x20AC;&#x2DC;empowers plasticsâ&#x20AC;&#x2122;

LABEL INDUSTRY EVENT, GLOBAL AWARDS IN CHICAGO THE Labelexpo Americas show will take place at the Donald E Stephens Convention Centre in Rosemont, Illinois, a suburb of Chicago, from 25-27 September. The event also plays host to the Label Industry Global Awards which takes a cocktails function on the first night of the show. www.labelexpo-americas.com AUG / SEPT 2018

89

2018/08/01 11:19


Diary

New Arlanxeo terpolymer makes debut ARLANXEO, a leading global manufacturer of synthetic elastomers, presented its new terpolymer* TherbanÂŽ ST 3107 VP at DKT 2018 (German Rubber Conference) in July. The fully hydrogenated nitrile rubber (HNBR) has a new, innovative termonomer which has never been used before with HNBR rubbers. â&#x20AC;&#x153;With the new Therban ST 3107 VP, we can now offer our customers a unique solution for the most complex types of applications, where JRRGORZWHPSHUDWXUHĂ&#x20AC;H[LELOLW\FRPELQHGZLWKH[FHOOHQWRLOUHVLVWDQFHLV required,â&#x20AC;? said Susanna Lieber, global head of technical marketing in the ARLANXEO business for Therban. â&#x20AC;&#x153;Our new Therban product can reduce the glass transition temperature by up to 10°C in rubber compounds, while maintaining excellent media resistance. With these properties, it is setting new standards.â&#x20AC;? $SDWHQWDSSOLFDWLRQKDVEHHQÂżOHGIRUWKHQHZ7KHUEDQ6793 which was developed at Arlanxeoâ&#x20AC;&#x2122;s sites in Dormagen, Germany, and La Wantzenau, France. (* terpolymer is a polymer synthesized from three different monomers) The Lanxess Additives business unit exhibited several polyurethane material solutions at UTECH in Cologne in 0D\LQFOXGLQJĂ&#x20AC;DPH retardants, plasticizers, crosslinking agents, catalysts and hydrolysis stabilizers for rigid DQGĂ&#x20AC;H[LEOHIRDPV coatings, elastomers, sealants and adhesives. Its FRs are used widely in the automotive industry. Its PHT4-Diol reactive FRs RIIHUH[FHOOHQWĂ&#x20AC;DPHUHWDUGDQWSURSHUWLHVIRUDOO types of rigid PU foams without impairing mechanical properties

2018 ExtruAfrica NW University, Potchefstroom

31 July-3 August www.extruafrica.org.za

Manufacturing Indaba KZN 22 August Intâ&#x20AC;&#x2122;l Convention Centre, Durban www.manufacturingindaba.co.za Masterbatch 2018 Melia Castilla in Madrid, Spain

3-5 September www.ami.international

Innovations in Indus Tech Conf 7 September http://iic.mandela.ac.za Nelson Mandela University, PE Polymer Testing & Analysis Conf 11-12 September Berlin, Germany www.ami.international/events Propak West Africa Lagos, Nigeria Extrusion 2018 Cleveland, Ohio

18-20 September www.propakwestafrica.com 18-20 September www.extrusionconference.com

Wear-Resistant Plastics 2018 19-20 September Hotel Nikko, DĂźsseldorf, Germany www.ami. international/events

90

AUG / SEPT 2018

Plastic Pipes XIX Las Vegas, USA

24-26 September www.pvc4pipes.com

SPE Thermoforming Conference 24-26 September Forth Worth, Texas www.thermoformingdivision.com Labelexpo Americas Chicago, USA

25-27 September www.labelexpo-americas.com

Manufacturing Indaba W Cape 3 October CTICC, Cape Town www.manufacturingindaba.co.za No Dig South Africa CTICC, Cape Town

Diary new.indd 90

8-9 October www.nodigsouthafrica.com

The new Therban grade elastomer offers JRRGORZWHPSHUDWXUHĂ&#x20AC;H[LELOLW\ DVZHOODV high temperature tolerance) plus excellent mechanical properties in contact with fuels, oil and gas as well.

Infrastructure Africa 9-10 October Sandton Convention Centre, Jhb www.infrastructure-africa.com

Manufacturing Indaba E Cape 14 November Boardwalk Conference Centre, PE www.manufacturingindaba.co.za

3RO\ROHÂżQ$GGLWLYHV&RQIHUHQFH 2FWREHU Maritim Hotel, Cologne, Germany www.ami.international/events

Wood Plastic Composites 14-15 November Vienna, Austria www.ami.international/events

IOMÂł Young Persons Lecture Comp 11 October Port Elizabeth write to iomsa@mweb.co.za

Multilayer Flexible Packaging 19-21 November Austria Trend Savoyen Hotel, Vienna www.ami.international/events

WasteCon Emperors, Johannesburg

PU Tech Africa Sandton Convention Centre

20-21 November expo@technobiz-asia.com

Valve World Expo DĂźsseldorf, Germany

27-29 November www.valveworldexpo.de

Foam Expo Europe Hanover, Germany Fakuma 2018 Friedrichshafen, Germany

15-19 October www.wastecon.co.za 16-18 October www.foam-expo.eu 16-20 October www.fakuma-messe.de

Eurasian Composites 25-27 October Istanbul Expo Centre, Turkey www.eurasiancomposites.com Intâ&#x20AC;&#x2122;l Composites Congress 5-6 November Stuttgart, Germany www.composites-germany.org Conductive Plastics Conference 6-7 November Vienna, Austria www.ami.international/events African Advanced Mfg & Composites 7-9 November Port Elizabeth www.mandelabaycompositescluster.co.za Turkchem Istanbul Expo Centre, Turkey

8-10 November www.chemshoweurasia.com

WOPs â&#x20AC;&#x201C; Plastic & Rubber Expo 13-15 November Gallagher Convention Centre, Joburg www.vukanicomms.co.za Complast South Africa 13-15 November Gallagher Convention Centre, Joburg www.complastexpo.in

Fire Resistance in Plastics 2018 10-12 December Maritim Hotel, Cologne, Germany www.ami.international/events 2019 Propak Africa 2019 Expo Centre Nasrec, Joburg PlĂĄstico Brasil SĂŁo Paulo, Brazil

12-15 March www.propakafrica.co.za 25-29 March www.plasticobrasil.com.br

IOM National Rubber Conference 4-7 April Cape St Francis Resort iomsa@mweb.co.za Africa Automation Fair 2019 4-6 June Ticketpro Dome, Northgate, Joburg www.africaautomationfair.com KITE 2019 Durban Exhibition Centre K2019 DĂźsseldorf, Germany

24-26 July www.kznindustrial.co.za 16-23 October www.k-online.com

2018/08/01 11:17


CLASSIFIED ADVERTS Advertisers:– Aug / Sept 2018 Associated Additives 27 Brenntag SA IFC Cabletech Marketing 31 Carst & Walker 83 Complast (Smart Expos & Fairs India) 87 CTP 09 DemaPlas Tech 33 DH Polymers 43 Emeraude Chimie International 03 Engen Petroleum 55 Erex Technical Services 41 Extrupent (Pty) Ltd 13 Exxon Mobil Middle East Marketing Corp 11 FdB Consulting 75 Ferro Industrial Products 50 GPS Plastics 46 Green Tech Machinery 37 Hestico 25 Huarong Plastic Machinery 67 Inkulu Plastic Pipes 73 Ipex Machinery 59 Jenowill 71

Maritime Marketing Masterbatch SA MBT MGMW Trading Mould Base SA Nissei ASB Orion Engineered Carbons Performance Colour Systems PlasticsSA Plastomark Protea Chemicals Rapid Granulator Rawmac Reichmans Capital Relloy Safripol SAPY colours Sun Ace Tecnova Italy Vishva Exim Welltec Zerma Africa

01 77 79 53 39 29 61 69 19 63 / 65 47 21 70 IBC 17/49 05 45 57 35 51 42 OBC

EMPLOYMENT OFFERED Technical Manager (Gauteng) Purpose of the Job: The successful candidate will travel to customers, run trials and optimize our offering to clients. The incumbent will use the internal resources in the laboratory to perform trials, optimization projects and continuous improvement work. Technical competencies & experience: 1. 5 years’ experience the Chemical, Plastics or Polymer Industry in a Technical role 2. Polymer Technology, Plastics Technology B Sc or B Tech in Mechanical/Chemical Engineering 3. Experience in Project management 4. Knowledge and experience with SHERQ and corporate governance

5. Proficient in MS Office Suite 6. Experience in a laboratory environment 7. Ability to develop and interpret technical reports 8. Grow sales with good commercial acumen 9. Advance raw material courses will be add advantage 10. Knowledge of plastic processing 11. Manage internal resources and external customers

Behavioural competencies: 1. Excellent communicator (verbal and written) 2. Team player 3. Leadership skills 4. Self sufficient and proactive 5. Customer orientated 6. Willing to travel in Africa 7. Analyzing situations 8. Problem solving

Please send your CV to research@hcrecruit.co.za should you meet the requirements. Consider your application unsuccessful if you do not hear from us within 2 weeks of submitting your CV

THERMOFORMING, SHEET EXTRUSION, AND MATERIALS THERMOFORMING TECHNOLOGY

SAVE 90% of your electricity use with GN! • GN (Canada): machines for reduced waste and reduced energy • Thermoforming Moulds for GN and other thermoformers • ToolVu technology for productivity and NEW quality improvement on thermoforming machines • Complete lines for EPS foam trays and EPS cup moulding NEW

EXTRUSION TECHNOLOGY FROM AGRIPAK OF ITALY Mono & multi-layer extrusion lines for the production of: • ‘Cartonplast’ (twinwall/hollow profile sheet) • Multilayer sheet for packaging • Semi-foamed sheet for thermoforming

MATERIALS FOR THERMOFORMED PACKAGING

• Sealing films for trays and top web for FFS machines • OPS, PP, PET sheet for general packaging • PP/EVOH/PP for high barrier containers

BRE INNOVATIONS Contact: Tim Forshaw (083 381 5253) or Phil Hopkinson (083 408 5253) or 021 671 5253 or mail to tim@bre.co.za

WANTED IN KENYA Industry experienced CEO & Technical Engineers to work for or provide consulting/training services. Please send enquiries, CV and EOI to Sscullcarvalho@gmail.com

Recycle your plastic with us

We buy most forms of clean factory waste

Contact: Desiré Preston for more info Tel: 011 894 3520 | Cell: 083 774 6038 | Email: desire@jcl.co.za www.jcl.co.za

To place a classified advert please Fax: 086 519 6089 or Tel: 021 712 1408 or E-mail: saplastics@iafrica.com

www.saplastics.co.za AUG / SEPT 2018

91


Sport ),)$:RUOG&XSRIÂżFLDOJDPHEDOO $GLGDVSUHVHQWV7HOVWDU

Advanced polyurethane materials

for perfect flight www.covestro.com

Adidas â&#x20AC;&#x2DC;Telstar 18â&#x20AC;&#x2122; is the most advanced World Cup ball to date ALL eyes were again on the ball when 2018 FIFA World Cup Russia kicked off on 14 June. The â&#x20AC;&#x2DC;Telstar 18â&#x20AC;&#x2122; proudly FRQWLQXHGWKHVHULHVRI2IÂżFLDO:RUOG Cup balls Adidas has produced since 1970, when the original Telstar with its iconic 32 black and white panels changed football design forever. â&#x20AC;&#x153;Telstar 18 employs the latest developments in polyurethane coated textiles, which lends it optimal KDQGOLQJJUHDWĂ&#x20AC;LJKWFKDUDFWHULVWLFV and superb water resistanceâ&#x20AC;? said Thomas Michelis, head of Covestro Textile Coatings EMLA, the company that has developed and supplied

advanced materials for Adidas soccer balls for more than 30 years. â&#x20AC;&#x153;Its outer shell with its ImpranilÂŽ layers and DispercollÂŽ adhesives make Telstar 18 high-tech sports equipment and light years ahead of the stitched leather balls I used to play with as a kid,â&#x20AC;? Michelis continued. â&#x20AC;&#x153;Modern synthetic materials ensure players get predictable ball performance under all weather conditions, something anyone experienced wet soccer balls will appreciate.â&#x20AC;? The innermost layer of the ball skin is an adhesion coating that

connects the textile substrate to the layers above. On top of this is a polyurethane foam layer, roughly one millimeter thick, made up of millions RIJDVÂżOOHGPLFURVSKHUHV7KLVIRDP is highly elastic so that the ball, after being deformed from being kicked, immediately returns to its spherical VKDSHWRHQVXUHDQRSWLPDOĂ&#x20AC;LJKWSDWK The outer skin comprises two compact layers of polyurethane with different thicknesses. These layers are responsible for the outstanding UHVLVWDQFHWRH[WHUQDOLQĂ&#x20AC;XHQFHV and abrasion, and for the ballâ&#x20AC;&#x2122;s high elasticity.

Nike kit made with recycled plastic YOU may know that 75% of all Nike shoes and apparel now contain some recycled material. You may also know that Nike has diverted nearly 5 billion plastic bottles IURPODQGÂżOOVVLQFH%XWGLG\RXNQRZWKDWDWOHDVWRIWKRVHERWWOHVIRUPWKH backbone for every one of Nikeâ&#x20AC;&#x2122;s federation kits â&#x20AC;&#x201D; the very uniforms worn in Russia for this yearâ&#x20AC;&#x2122;s Soccer World Cup? Nike is the number-one user of recycled polyester in WKHLQGXVWU\)RUERWK1LNHÂśV)DVW)LW9DSRUNQLWNLWV ZRUQE\%UDVLO&URDWLD(QJODQG 1LJHULD3RODQGDQG3RUWXJDO DQG1LNHÂśV0DWFKMHUVH\V ZRUQE\$XVWUDOLD6DXGL$UDELD DQG6RXWK.RUHD WKHSURFHVVLQYROYHVUHF\FOLQJRUUHF\FOHGSODVWLFGULQNLQJ ERWWOHVUHVSHFWLYHO\WRSURGXFHDÂżQHKLJKTXDOLW\NLWGHOLYHULQJSHDNSHUIRUPDQFH with a lower impact on the environment. 92

Sports.indd 92

AUG / SEPT 2018

2018/08/01 13:51


C

M

Y

CM

MY

CY

CMY

K


The Home of Size Reduction

Classifieds Feb/Mar'18.indd 92

2018/01/29 12:33

SA Plastics & Rubber Technology  

SA Plastics & Rubber Technology magazine was launched in 2002 by Summit Publishing, based in Cape Town and owned by publisher/editor Martin...

SA Plastics & Rubber Technology  

SA Plastics & Rubber Technology magazine was launched in 2002 by Summit Publishing, based in Cape Town and owned by publisher/editor Martin...

Advertisement