Porttt by s_oay

sgemgrpypewwwqtfsazvbggjiyr sgemgrpypewwwqtfsazvbggjiyr sgemgrpypewwwqtfsazvbggjiyr sgemgrpypewwwqtfsazvbggjiyr sgemgrpypewwwqtfsazvbggjiyr neloipyhgxzaswdergnjythjjydgj neloipyhgxzaswdergnjythjjydgj neloipyhgxzaswdergnjythjjydgj sgemgrpypewwwqtfsazvbggjiyr fuyhghkuliffdwqqdgffhgjyfdshrh sgemgrpypewwwqtfsazvbggjiyr neloipyhgxzaswdergnjythjjydgj neloipyhgxzaswdergnjythjjydgj fuyhghkuliffdwqqdgffhgjyfdshrh neloipyhgxzaswdergnjythjjydgj saqwtyijgdsazzxbnmklodfhhjiig sgemgrpypewwwqtfsazvbggjiyr fuyhghkuliffdwqqdgffhgjyfdshrh fuyhghkuliffdwqqdgffhgjyfdshrh saqwtyijgdsazzxbnmklodfhhjiig fuyhghkuliffdwqqdgffhgjyfdshrh neloipyhgxzaswdergnjythjjydgj fuyhghkuliffdwqqdgffhgjyfdshrh puytrddddtopplkjhgfdsaxcvbvgr saqwtyijgdsazzxbnmklodfhhjiig puytrddddtopplkjhgfdsaxcvbvgr neloipyhgxzaswdergnjythjjydgj saqwtyijgdsazzxbnmklodfhhjiig saqwtyijgdsazzxbnmklodfhhjiig nmCdfgghjkloopiytressdgghjiuf fuyhghkuliffdwqqdgffhgjyfdshrh nmCdfgghjkloopiytressdgghjiuf saqwtyijgdsazzxbnmklodfhhjiig puytrddddtopplkjhgfdsaxcvbvgr puytrddddtopplkjhgfdsaxcvbvgr fettrgddfnnmddeyipasfteerwssd fuyhghkuliffdwqqdgffhgjyfdshrh puytrddddtopplkjhgfdsaxcvbvgr nmCdfgghjkloopiytressdgghjiuf fettrgddfnnmddeyipasfteerwssd nmCdfgghjkloopiytressdgghjiuf saqwtyijgdsazzxbnmklodfhhjiig puytrddddtopplkjhgfdsaxcvbvgr dfrtytuyfflffflddfkfwoef[ewgmnv fettrgddfnnmddeyipasfteerwssd dfrtytuyfflffflddfkfwoef[ewgmnv saqwtyijgdsazzxbnmklodfhhjiig nmCdfgghjkloopiytressdgghjiuf fettrgddfnnmddeyipasfteerwssd dfrrgrdweflefghuytoqqdgyyuiok puytrddddtopplkjhgfdsaxcvbvgr dfrrgrdweflefghuytoqqdgyyuiok nmCdfgghjkloopiytressdgghjiuf dfrtytuyfflffflddfkfwoef[ewgmnv dfrtytuyfflffflddfkfwoef[ewgmnv ddffssadgjkigffffghjjkkouytreefhj puytrddddtopplkjhgfdsaxcvbvgr fettrgddfnnmddeyipasfteerwssd dfrrgrdweflefghuytoqqdgyyuiok ddffssadgjkigffffghjjkkouytreefhj dfrrgrdweflefghuytoqqdgyyuiok nmCdfgghjkloopiytressdgghjiuf fettrgddfnnmddeyipasfteerwssd sgemgrpypewwwqtfsazvbggjiyr ddffssadgjkigffffghjjkkouytreefhj nmCdfgghjkloopiytressdgghjiuf ddffssadgjkigffffghjjkkouytreefhj dfrtytuyfflffflddfkfwoef[ewgmnv neloipyhgxzaswdergnjythjjydgj fettrgddfnnmddeyipasfteerwssd dfrtytuyfflffflddfkfwoef[ewgmnv sgemgrpypewwwqtfsazvbggjiyr fuyhghkuliffdwqqdgffhgjyfdshrh fettrgddfnnmddeyipasfteerwssd sgemgrpypewwwqtfsazvbggjiyr dfrrgrdweflefghuytoqqdgyyuiok neloipyhgxzaswdergnjythjjydgj dfrtytuyfflffflddfkfwoef[ewgmnv dfrrgrdweflefghuytoqqdgyyuiok sgemgrpypewwwqtfsazvbggjiyr saqwtyijgdsazzxbnmklodfhhjiig neloipyhgxzaswdergnjythjjydgj dfrtytuyfflffflddfkfwoef[ewgmnv sgemgrpypewwwqtfsazvbggjiyr fuyhghkuliffdwqqdgffhgjyfdshrh ddffssadgjkigffffghjjkkouytreefhj puytrddddtopplkjhgfdsaxcvbvgr neloipyhgxzaswdergnjythjjydgj fuyhghkuliffdwqqdgffhgjyfdshrh dfrrgrdweflefghuytoqqdgyyuiok ddffssadgjkigffffghjjkkouytreefhj neloipyhgxzaswdergnjythjjydgj saqwtyijgdsazzxbnmklodfhhjiig nmCdfgghjkloopiytressdgghjiuf dfrrgrdweflefghuytoqqdgyyuiok fuyhghkuliffdwqqdgffhgjyfdshrh saqwtyijgdsazzxbnmklodfhhjiig sgemgrpypewwwqtfsazvbggjiyr fuyhghkuliffdwqqdgffhgjyfdshrh puytrddddtopplkjhgfdsaxcvbvgr ddffssadgjkigffffghjjkkouytreefhj fettrgddfnnmddeyipasfteerwssd saqwtyijgdsazzxbnmklodfhhjiig puytrddddtopplkjhgfdsaxcvbvgr saqwtyijgdsazzxbnmklodfhhjiig ddffssadgjkigffffghjjkkouytreefhj nmCdfgghjkloopiytressdgghjiuf neloipyhgxzaswdergnjythjjydgj puytrddddtopplkjhgfdsaxcvbvgr dfrtytuyfflffflddfkfwoef[ewgmnv nmCdfgghjkloopiytressdgghjiuf puytrddddtopplkjhgfdsaxcvbvgr fettrgddfnnmddeyipasfteerwssd dfrrgrdweflefghuytoqqdgyyuiok fettrgddfnnmddeyipasfteerwssd fuyhghkuliffdwqqdgffhgjyfdshrh nmCdfgghjkloopiytressdgghjiuf nmCdfgghjkloopiytressdgghjiuf dfrtytuyfflffflddfkfwoef[ewgmnv ddffssadgjkigffffghjjkkouytreefhj fettrgddfnnmddeyipasfteerwssd dfrtytuyfflffflddfkfwoef[ewgmnv fettrgddfnnmddeyipasfteerwssd dfrrgrdweflefghuytoqqdgyyuiok saqwtyijgdsazzxbnmklodfhhjiig dfrtytuyfflffflddfkfwoef[ewgmnv dfrrgrdweflefghuytoqqdgyyuiok dfrtytuyfflffflddfkfwoef[ewgmnv ddffssadgjkigffffghjjkkouytreefhj ddffssadgjkigffffghjjkkouytreefhj puytrddddtopplkjhgfdsaxcvbvgr dfrrgrdweflefghuytoqqdgyyuiok dfrrgrdweflefghuytoqqdgyyuiok sgemgrpypewwwqtfsazvbggjiyr ddffssadgjkigffffghjjkkouytreefhj ddffssadgjkigffffghjjkkouytreefhj neloipyhgxzaswdergnjythjjydgj nmCdfgghjkloopiytressdgghjiuf fuyhghkuliffdwqqdgffhgjyfdshrh fettrgddfnnmddeyipasfteerwssd saqwtyijgdsazzxbnmklodfhhjiig puytrddddtopplkjhgfdsaxcvbvgr dfrtytuyfflffflddfkfwoef[ewgmnv nmCdfgghjkloopiytressdgghjiuf dfrrgrdweflefghuytoqqdgyyuiok fettrgddfnnmddeyipasfteerwssd dfrtytuyfflffflddfkfwoef[ewgmnv ddffssadgjkigffffghjjkkouytreefhj dfrrgrdweflefghuytoqqdgyyuiok

sgemgrpypewwwqtfsazvbggjiyr sgemgrpypewwwqtfsazvbggjiyr neloipyhgxzaswdergnjythjjydgj sgemgrpypewwwqtfsazvbggjiyr neloipyhgxzaswdergnjythjjydgj sgemgrpypewwwqtfsazvbggjiyr fuyhghkuliffdwqqdgffhgjyfdshrh neloipyhgxzaswdergnjythjjydgj fuyhghkuliffdwqqdgffhgjyfdshrh neloipyhgxzaswdergnjythjjydgj saqwtyijgdsazzxbnmklodfhhjiig fuyhghkuliffdwqqdgffhgjyfdshrh saqwtyijgdsazzxbnmklodfhhjiig fuyhghkuliffdwqqdgffhgjyfdshrh puytrddddtopplkjhgfdsaxcvbvgr saqwtyijgdsazzxbnmklodfhhjiig puytrddddtopplkjhgfdsaxcvbvgr saqwtyijgdsazzxbnmklodfhhjiig nmCdfgghjkloopiytressdgghjiuf puytrddddtopplkjhgfdsaxcvbvgr nmCdfgghjkloopiytressdgghjiuf puytrddddtopplkjhgfdsaxcvbvgr fettrgddfnnmddeyipasfteerwssd nmCdfgghjkloopiytressdgghjiuf fettrgddfnnmddeyipasfteerwssd nmCdfgghjkloopiytressdgghjiuf dfrtytuyfflffflddfkfwoef[ewgmnv fettrgddfnnmddeyipasfteerwssd dfrtytuyfflffflddfkfwoef[ewgmnv fettrgddfnnmddeyipasfteerwssd dfrrgrdweflefghuytoqqdgyyuiok dfrtytuyfflffflddfkfwoef[ewgmnv dfrrgrdweflefghuytoqqdgyyuiok dfrtytuyfflffflddfkfwoef[ewgmnv ddffssadgjkigffffghjjkkouytreefhj dfrrgrdweflefghuytoqqdgyyuiok ddffssadgjkigffffghjjkkouytreefhj dfrrgrdweflefghuytoqqdgyyuiok sgemgrpypewwwqtfsazvbggjiyr sgemgrpypewwwqtfsazvbggjiyr ddffssadgjkigffffghjjkkouytreefhj sgemgrpypewwwqtfsazvbggjiyr ddffssadgjkigffffghjjkkouytreefhj neloipyhgxzaswdergnjythjjydgj neloipyhgxzaswdergnjythjjydgj sgemgrpypewwwqtfsazvbggjiyr neloipyhgxzaswdergnjythjjydgj fuyhghkuliffdwqqdgffhgjyfdshrh sgemgrpypewwwqtfsazvbggjiyr fuyhghkuliffdwqqdgffhgjyfdshrh neloipyhgxzaswdergnjythjjydgj fuyhghkuliffdwqqdgffhgjyfdshrh saqwtyijgdsazzxbnmklodfhhjiig neloipyhgxzaswdergnjythjjydgj saqwtyijgdsazzxbnmklodfhhjiig fuyhghkuliffdwqqdgffhgjyfdshrh saqwtyijgdsazzxbnmklodfhhjiig puytrddddtopplkjhgfdsaxcvbvgr fuyhghkuliffdwqqdgffhgjyfdshrh puytrddddtopplkjhgfdsaxcvbvgr saqwtyijgdsazzxbnmklodfhhjiig puytrddddtopplkjhgfdsaxcvbvgr nmCdfgghjkloopiytressdgghjiuf saqwtyijgdsazzxbnmklodfhhjiig nmCdfgghjkloopiytressdgghjiuf puytrddddtopplkjhgfdsaxcvbvgr nmCdfgghjkloopiytressdgghjiuf fettrgddfnnmddeyipasfteerwssd puytrddddtopplkjhgfdsaxcvbvgr fettrgddfnnmddeyipasfteerwssd nmCdfgghjkloopiytressdgghjiuf fettrgddfnnmddeyipasfteerwssd dfrtytuyfflffflddfkfwoef[ewgmnv nmCdfgghjkloopiytressdgghjiuf dfrtytuyfflffflddfkfwoef[ewgmnv fettrgddfnnmddeyipasfteerwssd dfrtytuyfflffflddfkfwoef[ewgmnv dfrrgrdweflefghuytoqqdgyyuiok fettrgddfnnmddeyipasfteerwssd dfrrgrdweflefghuytoqqdgyyuiok dfrtytuyfflffflddfkfwoef[ewgmnv dfrrgrdweflefghuytoqqdgyyuiok ddffssadgjkigffffghjjkkouytreefhj dfrtytuyfflffflddfkfwoef[ewgmnv ddffssadgjkigffffghjjkkouytreefhj dfrrgrdweflefghuytoqqdgyyuiok ddffssadgjkigffffghjjkkouytreefhj dfrrgrdweflefghuytoqqdgyyuiok sgemgrpypewwwqtfsazvbggjiyr ddffssadgjkigffffghjjkkouytreefhj ddffssadgjkigffffghjjkkouytreefhj neloipyhgxzaswdergnjythjjydgj fuyhghkuliffdwqqdgffhgjyfdshrh saqwtyijgdsazzxbnmklodfhhjiig puytrddddtopplkjhgfdsaxcvbvgr nmCdfgghjkloopiytressdgghjiuf fettrgddfnnmddeyipasfteerwssd dfrtytuyfflffflddfkfwoef[ewgmnv dfrrgrdweflefghuytoqqdgyyuiok ddffssadgjkigffffghjjkkouytreefhj

PORTFOLIO

ddffssadgjkigffffghjjkkouytreefhj

sgemgrpypewwwqtfsazvbggjiyr sgemgrpypewwwqtfsazvbggjiyr sgemgrpypewwwqtfsazvbggjiyr sgemgrpypewwwqtfsazvbggjiyr neloipyhgxzaswdergnjythjjydgj sgemgrpypewwwqtfsazvbggjiyr sgemgrpypewwwqtfsazvbggjiyr sgemgrpypewwwqtfsazvbggjiyr neloipyhgxzaswdergnjythjjydgj sgemgrpypewwwqtfsazvbggjiyr neloipyhgxzaswdergnjythjjydgj neloipyhgxzaswdergnjythjjydgj fuyhghkuliffdwqqdgffhgjyfdshrh sgemgrpypewwwqtfsazvbggjiyr neloipyhgxzaswdergnjythjjydgj sgemgrpypewwwqtfsazvbggjiyr neloipyhgxzaswdergnjythjjydgj neloipyhgxzaswdergnjythjjydgj fuyhghkuliffdwqqdgffhgjyfdshrh sgemgrpypewwwqtfsazvbggjiyr sgemgrpypewwwqtfsazvbggjiyr neloipyhgxzaswdergnjythjjydgj fuyhghkuliffdwqqdgffhgjyfdshrh fuyhghkuliffdwqqdgffhgjyfdshrh saqwtyijgdsazzxbnmklodfhhjiig fuyhghkuliffdwqqdgffhgjyfdshrh neloipyhgxzaswdergnjythjjydgj fuyhghkuliffdwqqdgffhgjyfdshrh fuyhghkuliffdwqqdgffhgjyfdshrh saqwtyijgdsazzxbnmklodfhhjiig neloipyhgxzaswdergnjythjjydgj sgemgrpypewwwqtfsazvbggjiyr neloipyhgxzaswdergnjythjjydgj neloipyhgxzaswdergnjythjjydgj fuyhghkuliffdwqqdgffhgjyfdshrh saqwtyijgdsazzxbnmklodfhhjiig saqwtyijgdsazzxbnmklodfhhjiig puytrddddtopplkjhgfdsaxcvbvgr sgemgrpypewwwqtfsazvbggjiyrsaqwtyijgdsazzxbnmklodfhhjiig fuyhghkuliffdwqqdgffhgjyfdshrh saqwtyijgdsazzxbnmklodfhhjiig fuyhghkuliffdwqqdgffhgjyfdshrh saqwtyijgdsazzxbnmklodfhhjiig puytrddddtopplkjhgfdsaxcvbvgr neloipyhgxzaswdergnjythjjydgj fuyhghkuliffdwqqdgffhgjyfdshrh fuyhghkuliffdwqqdgffhgjyfdshrh saqwtyijgdsazzxbnmklodfhhjiig puytrddddtopplkjhgfdsaxcvbvgr puytrddddtopplkjhgfdsaxcvbvgr nmCdfgghjkloopiytressdgghjiuf sgemgrpypewwwqtfsazvbggjiyr neloipyhgxzaswdergnjythjjydgj saqwtyijgdsazzxbnmklodfhhjiig puytrddddtopplkjhgfdsaxcvbvgr saqwtyijgdsazzxbnmklodfhhjiig puytrddddtopplkjhgfdsaxcvbvgr puytrddddtopplkjhgfdsaxcvbvgr nmCdfgghjkloopiytressdgghjiuf sgemgrpypewwwqtfsazvbggjiyr fuyhghkuliffdwqqdgffhgjyfdshrh saqwtyijgdsazzxbnmklodfhhjiig saqwtyijgdsazzxbnmklodfhhjiig puytrddddtopplkjhgfdsaxcvbvgr nmCdfgghjkloopiytressdgghjiuf nmCdfgghjkloopiytressdgghjiuf fettrgddfnnmddeyipasfteerwssd neloipyhgxzaswdergnjythjjydgj fuyhghkuliffdwqqdgffhgjyfdshrh nmCdfgghjkloopiytressdgghjiuf puytrddddtopplkjhgfdsaxcvbvgr nmCdfgghjkloopiytressdgghjiuf nmCdfgghjkloopiytressdgghjiuf fettrgddfnnmddeyipasfteerwssd puytrddddtopplkjhgfdsaxcvbvgr neloipyhgxzaswdergnjythjjydgj saqwtyijgdsazzxbnmklodfhhjiig puytrddddtopplkjhgfdsaxcvbvgr puytrddddtopplkjhgfdsaxcvbvgr nmCdfgghjkloopiytressdgghjiuf fettrgddfnnmddeyipasfteerwssd fettrgddfnnmddeyipasfteerwssd dfrtytuyfflffflddfkfwoef[ewgmnv fuyhghkuliffdwqqdgffhgjyfdshrh saqwtyijgdsazzxbnmklodfhhjiig nmCdfgghjkloopiytressdgghjiuf fettrgddfnnmddeyipasfteerwssd nmCdfgghjkloopiytressdgghjiuf fettrgddfnnmddeyipasfteerwssd fettrgddfnnmddeyipasfteerwssd dfrtytuyfflffflddfkfwoef[ewgmnv nmCdfgghjkloopiytressdgghjiuf fuyhghkuliffdwqqdgffhgjyfdshrh puytrddddtopplkjhgfdsaxcvbvgr nmCdfgghjkloopiytressdgghjiuf fettrgddfnnmddeyipasfteerwssd dfrtytuyfflffflddfkfwoef[ewgmnv dfrtytuyfflffflddfkfwoef[ewgmnv dfrrgrdweflefghuytoqqdgyyuiok saqwtyijgdsazzxbnmklodfhhjiig puytrddddtopplkjhgfdsaxcvbvgr dfrtytuyfflffflddfkfwoef[ewgmnv fettrgddfnnmddeyipasfteerwssd dfrtytuyfflffflddfkfwoef[ewgmnv dfrtytuyfflffflddfkfwoef[ewgmnv saqwtyijgdsazzxbnmklodfhhjiig dfrrgrdweflefghuytoqqdgyyuiok fettrgddfnnmddeyipasfteerwssd nmCdfgghjkloopiytressdgghjiuf fettrgddfnnmddeyipasfteerwssd fettrgddfnnmddeyipasfteerwssd dfrtytuyfflffflddfkfwoef[ewgmnv dfrrgrdweflefghuytoqqdgyyuiok dfrrgrdweflefghuytoqqdgyyuiok ddffssadgjkigffffghjjkkouytreefhj puytrddddtopplkjhgfdsaxcvbvgr nmCdfgghjkloopiytressdgghjiuf dfrtytuyfflffflddfkfwoef[ewgmnv dfrrgrdweflefghuytoqqdgyyuiok dfrtytuyfflffflddfkfwoef[ewgmnv dfrrgrdweflefghuytoqqdgyyuiok dfrrgrdweflefghuytoqqdgyyuiok ddffssadgjkigffffghjjkkouytreefhj puytrddddtopplkjhgfdsaxcvbvgr fettrgddfnnmddeyipasfteerwssd dfrtytuyfflffflddfkfwoef[ewgmnv dfrtytuyfflffflddfkfwoef[ewgmnv dfrrgrdweflefghuytoqqdgyyuiok ddffssadgjkigffffghjjkkouytreefhj ddffssadgjkigffffghjjkkouytreefhj sgemgrpypewwwqtfsazvbggjiyr nmCdfgghjkloopiytressdgghjiuf fettrgddfnnmddeyipasfteerwssd dfrrgrdweflefghuytoqqdgyyuiok ddffssadgjkigffffghjjkkouytreefhj dfrrgrdweflefghuytoqqdgyyuiok ddffssadgjkigffffghjjkkouytreefhj ddffssadgjkigffffghjjkkouytreefhj nmCdfgghjkloopiytressdgghjiuf dfrtytuyfflffflddfkfwoef[ewgmnv dfrrgrdweflefghuytoqqdgyyuiok dfrrgrdweflefghuytoqqdgyyuiok ddffssadgjkigffffghjjkkouytreefhj sgemgrpypewwwqtfsazvbggjiyr sgemgrpypewwwqtfsazvbggjiyr neloipyhgxzaswdergnjythjjydgj fettrgddfnnmddeyipasfteerwssd dfrtytuyfflffflddfkfwoef[ewgmnv ddffssadgjkigffffghjjkkouytreefhj ddffssadgjkigffffghjjkkouytreefhj fettrgddfnnmddeyipasfteerwssd dfrrgrdweflefghuytoqqdgyyuiok ddffssadgjkigffffghjjkkouytreefhj ddffssadgjkigffffghjjkkouytreefhj neloipyhgxzaswdergnjythjjydgj neloipyhgxzaswdergnjythjjydgj dfrtytuyfflffflddfkfwoef[ewgmnv fuyhghkuliffdwqqdgffhgjyfdshrh dfrrgrdweflefghuytoqqdgyyuiok dfrtytuyfflffflddfkfwoef[ewgmnv ddffssadgjkigffffghjjkkouytreefhj fuyhghkuliffdwqqdgffhgjyfdshrh fuyhghkuliffdwqqdgffhgjyfdshrhdfrrgrdweflefghuytoqqdgyyuiok saqwtyijgdsazzxbnmklodfhhjiig ddffssadgjkigffffghjjkkouytreefhj dfrrgrdweflefghuytoqqdgyyuiok saqwtyijgdsazzxbnmklodfhhjiig saqwtyijgdsazzxbnmklodfhhjiigddffssadgjkigffffghjjkkouytreefhj puytrddddtopplkjhgfdsaxcvbvgr

GRAPHIC DESIGN STUDIO

pranwalai kittirattanawiwat 7188776933 4121 73 st apt 2 fl woodside ny 11377 s_oay@hotmail.com

sgemgrpypewwwqtfsazvbggjiyr sgemgrpypewwwqtfsazvbggjiyr objective neloipyhgxzaswdergnjythjjydgj sgemgrpypewwwqtfsazvbggjiyr neloipyhgxzaswdergnjythjjydgj To work in a creative and energetic environment sgemgrpypewwwqtfsazvbggjiyr fuyhghkuliffdwqqdgffhgjyfdshrh that has great communication between people. neloipyhgxzaswdergnjythjjydgj fuyhghkuliffdwqqdgffhgjyfdshrh neloipyhgxzaswdergnjythjjydgj saqwtyijgdsazzxbnmklodfhhjiig fuyhghkuliffdwqqdgffhgjyfdshrh saqwtyijgdsazzxbnmklodfhhjiig software competencues fuyhghkuliffdwqqdgffhgjyfdshrh puytrddddtopplkjhgfdsaxcvbvgr Adobe Photoshop Adobe Illustrator saqwtyijgdsazzxbnmklodfhhjiig puytrddddtopplkjhgfdsaxcvbvgr saqwtyijgdsazzxbnmklodfhhjiig Adobe Indesign Adobe Flash nmCdfgghjkloopiytressdgghjiuf puytrddddtopplkjhgfdsaxcvbvgr nmCdfgghjkloopiytressdgghjiuf Microsoft Office Word puytrddddtopplkjhgfdsaxcvbvgr fettrgddfnnmddeyipasfteerwssd nmCdfgghjkloopiytressdgghjiuf fettrgddfnnmddeyipasfteerwssd languages nmCdfgghjkloopiytressdgghjiuf dfrtytuyfflffflddfkfwoef[ewgmnv fettrgddfnnmddeyipasfteerwssd English dfrtytuyfflffflddfkfwoef[ewgmnv fettrgddfnnmddeyipasfteerwssd dfrrgrdweflefghuytoqqdgyyuiok Chinese dfrtytuyfflffflddfkfwoef[ewgmnv dfrrgrdweflefghuytoqqdgyyuiok dfrtytuyfflffflddfkfwoef[ewgmnv Thai ddffssadgjkigffffghjjkkouytreefhj dfrrgrdweflefghuytoqqdgyyuiok ddffssadgjkigffffghjjkkouytreefhj dfrrgrdweflefghuytoqqdgyyuiok activity and experisgemgrpypewwwqtfsazvbggjiyr ddffssadgjkigffffghjjkkouytreefhj ence ddffssadgjkigffffghjjkkouytreefhj neloipyhgxzaswdergnjythjjydgj - 08/2007, Graphic drsigner,Sky studio ygrjiyr fuyhghkuliffdwqqdgffhgjyfdshrh - Create poster of seminar announcegdgj gj ythjjydrh h ment saqwtyijgdsazzxbnmklodfhhjiig iyyfrgdjsyhfdsghr - Create logo of restaurant (kokun) fyhdfhghj jfihi hjiig puytrddddtopplkjhgfdsaxcvbvgr ordkhlodsvhbrhvgrbvgr education mjysafdxc axcv f f nmCdfgghjkloopiytressdgghjiuf u s dhiiggfd hgjgiihgjighjiu - 05/2006-07/2007 Language and computer institute of Ecc, Thailand h g f d d d s d d s r s s oe r s g s ss - 06/2008-08/2011 Thammasat University, Faculty of liberal arts, Thaiv vprdibypsvtagrsxefcftvaebsevfrtwieuewfrgwmngvmfettrgddfnnmddeyipasfteerwssd n i up j e w k land oj gdytrgdefheskjysifidwsgkosgfedhwf[roweyfs[syeduyioykuidfrtytuyfflffflddfkfwoef[ewgmnv - 10/2012-12/2013 Barunch collage, Digital design (Certificate), NY dftdfeledradwsftfotqeqemdonqgvqdggmtrnevetfrheefhjr y t y w dfrrgrdweflefghuytoqqdgyyuiok efygolihepuf[gehwwuhogyjejfk[koejkojkukuoiuoyvkbggjiy j - 10/2011-10/2012 Spainish American institute, NY g wedfgdffkffgfgyffyfuqgidhgqytfyshaj z eddffssadgjkigffffghjjkkouytreefhj d j y h j f j ktiogqjkqidgytowqwtwreeuf ygtrnejyth dshrh

edgfgrhphjjyukpfkfeoguhzyajjskwkoder dgffhgjyf hhjiig fg ffhgx df qq

upcake ideas

ANILLA V ALL COCONUT CREAM AND VANILLA ICING

A little cupcake

E H T T CH A

X O -B

Appetizer Edamame Steamed Green Syo Beans Seasoned w/ Sea Salt & Served w/ Ginger Dressing Gyoza Pan-Fried Japanese Pork or Seafood Dumplings (4pcs) Shumai Steamed Shrimp Dumplings (4pcs) Seaweed Salad Seaweed Marinated in Sesame Oil & Sesame Seeds

4.00 5.00 5.00 5.50

Entree / Noodles (served with rice & miso soup or salad) Grilled Atlantic Salmon Teriyaki Grilled Salmon w/ Zucchini & Japanese Vegetables Grilled Chicken Teriyaki Grilled Chicken w/ Zucchini & Japanese Vegetables Tempura Udon Noodles Udon Noodles & Shrimp Tempura in Bonito Stock Yaki Soba Soba Noodles Sautéed w/ Chicken & Vegetables

8.50 8.50 8.50 7.00

Bentos Lunch Box Combo Chicken Bento Chicken Teriyaki, California Roll (4pcs), Shrimp & Vegetable Tempura 8.95 Salmon Bento Salmon Teriyaki, California Roll (4pcs), Shrimp & Vegetable Tempura 8.95 Sushi Bento Sushi (3pcs), California Roll (4pcs), Shrimp & Vegetable Tempura 8.95 New York Strip Steak New York Strip Steak, California Roll (4pcs), Shrimp & Vegetable Tempura 8.95 Shrimp Bento Sautéed Shrimp (7pcs), California Roll (4pcs), Shrimp & Vegetable Tempura 9.95 Sashimi Bento Sashimi (6pcs), California Roll (4pcs), Shrimp & Vegetable Tempura 10.95

WONDERFUL

new york for information apply nyc tours

for information apply sichuan tours

THAILAND for information apply thailand tours

e h T

B e & s l t a n i g i Or

NET WT. 12 OZ. (340g)

700

XTRA

000

SCOR

5000 TRANFERS SPECIAL

1000

1000 3000 spin

4000

6000

400

NUS x 4

0 0 7

E V L IEW P M E T

AIL A N D

N A C I R E M A

THE

r i a f FOOD TH

APRIL 14 2 PM - 8 PM

4121 73 ST WOODSIDE NY 11377 Fried grill Snacks Bakery

www.americanfoodfair.org For more information please call 718-877-6933

s â&#x20AC;&#x2122; P e t e S t o re

Providing personalized service to help you find the perfect pet

g n i h t v ery

et p r u o for y

Open : 11 am - 5 pm Every tuesday - saturday come to : 950 Elizabeth Avenue, Elizabeth, NJ 07201 Call: (908) 353-8610

E R A E TR S U

J JJJJ

Q U

A DAY Magaz

ine

What are the top 10 healthy foods? Written by Christian Nordqvist

Imagine a choice of foods that were tasty, nutritious and good for your health - i.e. they helped you maintain a healthy body weight, improved your overall mood, and reduced your risk of developing diseases. According to several sources and surveys in North America and Western

1) Apples

Apples are an excellent source of antioxidants, which combat free radicals. Free radicals are damaging substances generated in the body that cause undesirable changes and are involved in the aging process and some diseases. Some animal studies have found that an antioxidant found in apples (polyphenols) might extend lifespans. Tests on fruit flies found that polyphenols also help them to preserve their ability to walk, climb and move about. Another study found that adult females who regularly ate apples had a 13% to 22% lower risk of developing heart disease.

2) Almonds

Almonds are rich in nutrients, including magnesium, vitamin E, iron, calcium, fiber, and riboflavin. A scientific review published in Nutrition Reviews last year found that almonds as a food may help maintain healthy cholesterol levels. The authors wrote: “The message that almonds, in and of themselves, are a heart-healthy snack should be emphasized to consumers. Moreover, when almonds are incorporated into a healthy, balanced diet, the benefits are even greater.” Almonds have more fiber than any other tree nut. The fatty acid profile of almonds, which is made up of 91-94% unsaturated fatty acids, may partly explain why it helps maintain healthy cholesterol levels.

3) Broccoli

Broccoli is rich in fiber, calcium, potassium, folate and phytonutrients. Phytonutrients are compounds which reduce the risk of developing heart

disease, diabetes and some cancers. Broccoli also contains vitamin C, as well as beta-carotene, an antioxidant. Overcooking can destroy myrosinase - if the enzyme myrosinase is not destroyed during cooking, broccoli can also reduce the risk of developing cancer. The best way to cook broccoli and to preserve the myrosinase is to steam the vegetable lightly - if it is overcooked, the vegetable’s beneficial effects can be seriously undermined, researchers from the University of Illinois wrote in the peer-reviewed journal Nutrition and Cancer. Myrosinase converts some of the sulfur-based chemicals found in broccoli (called glucosinolates) into isothiocyanates (other sulfur-containing chemicals), which are known to have anticancer properties. The researchers said that adding broccoli to a meal can often double its cancer protection properties. Another ingredient, sulforphane, which exists in broccoli, is also said to have anti-cancer as well as anti-inflammatory qualities. However, overcooking can destroy most of the benefits. Broccoli powder does not contain myrosinase. A recent article on the health benefits of broccoli: “Lightly Steamed Broccoli Has Powerful Anticancer Enzyme Myrosinase”

4) Blueberries

Blueberries are rich in fiber, antioxidants and phytonutrients. Phytonutrients are natural chemicals found in plants. Unlike minerals and vitamins that are also found in plant foods, phytonutrients are not essential for keeping us alive. However, they may help prevent disease and keep the body working properly. According to a study carried out at Harvard Medical School, elderly people who eat plenty of blueberries (and strawberries) are less likely to suffer from cognitive decline, compared to other people of their age who do not. Blueberries were found in another study carried out by scientists at Texas Woman’s University, to help in curbing obesity. Plant polyphenols, which are abundant in blueberries, have been shown to reduce the development of fat cells (adipogenesis), while inducing the breakdown of lipids and fat (lipolysis). Regular blueberry consumption can reduce the risk of suffering from hypertension (high blood pressure) by 10%, because of the berry’s bioactive compounds, anthocyanins, scientists from East Anglia University, England, and Harvard University, USA reported in the American Journal of Nutrition. (Link to article) Blueberry consumption has also been associated with a lower risk of artery hardening, and/or intestinal diseases. The fruit has also been linked to stronger bones in animal studies.

5) Oily fish

Examples of oily fish include salmon, trout, mackerel, herring, sardines and anchovies. These types of fish have oil in their tissues and around the gut. Their lean fillets contain up to 30% oil, specifically, omega-3 fatty acids. These oils are known to provide benefits for the heart, as well as the nervous

Travel Best Day Ever : Lower Manhattan by Jeralyn Gerba

NEW YORK CITY – Lower Manhattan: Gateway to America! Starting point of New York City! Home of Lady Liberty! And a darn fine place to spend the day. 1. Wake yourself up with a brisk stroll down Manhattan’s West Side promenade. Wink at Lady Liberty, then head to Zucker’s Bagels for a traditional NYC breakfast with a schmear. 2. Below Bowling Green Park is the Beaux Arts beauty the National Museum of the American Indian, home to a terrific traditional costume collection and a spectacular gallery in the round that is usually empty. If it’s a nice, warm day, pop into the Elevated Acre at 55 Water Street, a secret garden nook surrounded by skyscrapers. 3. Lunch! Iron chef Julian Medina’s Toloache Taqueria offers delicious spins on Latin fare (on handmade tortillas) and $2 Taco Tuesday. Cross your fingers for the spring comeback of New Amsterdam Market, a high-quality produce and artisan foodstuffs market at the Seaport. Come summer, it’s all about Luke’s Lobster shack on Williams Street. A summery scene at one of the New Amsterdam Market stalls. This photo (and below): Courtesy of New Amsterdam Market.

It’s a beautiful morning. Photos (from top left): Courtesy of National Museum of the Native American Indian; courtesy of NYC Parks Department; courtesy of Zucker’s Bagels. 4. Cruise down past South Street Seaport to check out the varietals at Pasanella & Sons, which has worked hard to rebuild its wine shop in the wake of Hurricane Sandy. (Other historical spots have not fared so well.) Pack a few bottles of Brooklyn moonshine to take home as souvenirs. Pasanella’s neighbor, The Paris Cafe, deserves a nod. One of the oldest tap rooms in NYC, it once hosted Annie Oakley and Thomas Edison, among other notables. (Shout out to Teddy Roosevelt!) Word on the street is that they are working to reopen in the area.

Luke’s lobster rolls are back (post-Sandy), and better than ever. Photo: Courtesy of Luke’s Lobster. 5. Speaking of old school, the historically hip Bowne & Co. Stationers is just up a block. The 19th-century print shop is one of downtown’s most charming relics, and the letterpress is still going strong. Pick up notecards and wrapping paper before peeking into to the wood-carving nook. 6. The new Magic Mix Juicery is a sleek white temple to all that is coldpressed and fresh. A green juice or granola snack will keep you company as you make your way to up the Brooklyn Bridge (a marvel of engineering) for a seat on a bench and a look at the grand isle.

A R A

n o i h s Fa

How Zara Grew Into the World’s Largest Fashion Retailer

Galicia, on the Atlantic coast of northern Spain, is the homeland of Generalissimo Francisco Franco, but is otherwise famous for being a place people try to leave. For much of the 20th century, hundreds of thousands of gallegos, as they are called, emigrated to countries as far away as Argentina to escape Galicia’s rural poverty. Today, however, even as Spain teeters on the edge of economic catastrophe, the Galician city La Coruña has attracted notice as the hometown of Amancio Ortega Gaona, the world’s third-richest man — he displaced Warren Buffett this year on the Bloomberg billionaire index — and the founder of a wildly successful fashion company, Inditex, more commonly known by its oldest and biggest brand, Zara. Ortega has never given an interview, according to his communications department, nor does he attend award ceremonies or parties. He rarely allows his picture to be taken. Pablo Isla, who took over the company when the 76-year-old Ortega stepped down as chairman last year, rarely gives interviews or waves to the camera, either. In fact, the public face of Inditex is its soft-spoken communications director, Jesus Echevarría, who, as I discovered during a recent visit to the Inditex complex, is perhaps the only communications director on the planet who all but apologizes whenever he must answer questions about Inditex’s runaway success. The company’s outward modesty reflects its surroundings. La Coruña is a quiet place, typically European in its humdrum perfection: tidy highways and compact cars, clean taxis, no need to worry about tipping. The week I visited in late July, the conservative national government was threatening to implement a new austerity plan, and unemployment among people under 30 in Spain hit 50 percent, but the city seemed calm. Restaurants were busy, beaches packed. People dozed on La Coruña’s seaside boulders, while their dogs leapt in the water. The city is a little more than 300 miles from Madrid and 555 miles from Barcelona. It’s an odd location for an aggressive, global company like Inditex.

Jackets from Zara’s fall 2012 collection await inspection at a factory in Arteixo, Spain. The campus (located in the industrial area of Arteixo, next door to La Coruña) consists of corporate headquarters for the entire company, as well as headquarters for Zara and Zara Home, two of Inditex’s eight brands. There are also factories and a distribution center where clothes are loaded onto trucks to be sent around the world. The factories are directly across from the corporate offices. The main building, where I waited for my hosts, somewhat resembled a hospital waiting room, with rows of plain boxy black chairs and little else. Apart from a single poster of a fashion model, nothing adorned its white walls. No flowers, no words, no ads, no fashion magazines, no style. The setting felt appropriate for the age of austerity, even if Inditex is one company in Spain that is actually thriving.

The 9 Best Cupcakes In New York City By Camille DeMere

It appears as if the cupcake trend is here to stay. Here are some of the best spots in the city for a sweet treat. This Valentine’s Day, try one of these nine sweet treats.

1.Baked 359 Brunt Street Brooklyn, NY 1123 1

Declaring your cupcake affinity in the city may be more polarizing than wearing Greek letters at college, or picking a table in a high schoollunchroom. Lovers of Billy’s, however, pledge their allegiance proudly. From the sugary pastel colors, to the grandma’s kitchen aroma, your cupcake experience is sure to be amazing. Snatch up a coconut cupcake if they have them, or go for classic chocolate or vanilla with cloud-like fluffs of buttercream icing.

3.Butter Lane

123 East 7th Street New York, NY 10009 (212) 677-2880

4.Chokolat Patisserie 3111 Broadway New York, NY 10027 (212) 662-6096

If you’re willing to m ake the trek to Red H ook, this Food Network-featur ed bakery will make sure that you’ll get your just de sserts: try the sweet’n ’salty cupcake to see what w e mean. Homemade caramel and dark chocolat e can’t be beat. Try ou t their

2.Billy’s Bakery 184 9th Avenue New York, NY 10011 (212) 647-9956

East Villagers already kn ow this spot for creamy an d delicious sweet treats. Bu tter Lane calls itself “cupcakes for grownups.” The frosting is prepared two different ways, one being th e traditional American sty le you know and love, the ot her a French style involvi ng eggs that evokes merengu e. Customize your cupcak e – choose your own icing and make a pairing.

Red velvet cupcakes that are to die for. Rich, real cream cheese icing. Space is a little tight – there’s really only one table – so enjoy your taste of heaven on the go. For insider deals and giveaways, follow them on Twitter.

CONTINUOUS QUALITY

YOU

TRUST A D A Y