Issuu on Google+

1


Porta de Correr Automática Dânica, com o inovador painel de comando integrado inteligente

Compacta, econômica e inteligente Sem caixa externa de comando de abertura (painel elétrico) Sensor de segurança A Porta de Correr Automática Dânica é a primeira do mercado a integrar o painel de comando à porta, com fácil acesso ao

Aberturas parcial e total programáveis

controle de abertura e fechamento sem intervenção técnica.

Revestimento liso (sem calandra). Design clean, fácil limpeza

Sua instalação é até 40% mais rápida que a de um modelo convencional. Pode ser instalada junto a uma coluna, pois

Permite instalação monofásica 220V

dispensa o painel elétrico ao lado da porta, o que resulta em

Opcionais: controle remoto, chave de tração, laço indutivo e sensor de presença

versatilidade e economia de espaço.

Produção com máquinas contínuas de alta qualidade, produtividade e com sustentabilidade

SUDESTE São Paulo, SP 11 3043-7887 Jundiaí, SP 11 2448-3700 Rio de Janeiro, RJ 21 2498-0498 Betim, MG 31 3593-5003

fb.com/grupodanica

@grupodanica

Martini Meat

2

SUL Joinville, SC 47 3461-5300 Porto Alegre, RS 51 3302-7308 NORDESTE Recife, PE 81 2125-1900

Serbom

Comfrio

NORTE Belém, PA 91 3255-7555 CENTRO-OESTE Lucas do Rio Verde, MT 65 3549-8200 Goiânia, GO 62 3582-9001

vendas@danica.com.br | www.danica.com.br


LANÇAMENTO 2013

VENDAS@MAPASPONTEX.COM.BR

TRABALHAR COM SEGURANÇA COMEÇA PELA ESCOLHA DA LUVA.

ULTRAVINIL Pro PVC

CONHEÇA A NOVA LINHA ULTRAVINIL DA MUCAMBO PRO. LINHA DE LUVAS DE SEGURANÇA CONFECCIONADA EM PVC COM SUPORTE TÊXTIL DE ALGODÃO.

GARANTE MAIOR CONFORTO AO USUÁRIO DEVIDO A MALEABILIDADE DA LUVA. Conheça outras linhas no nosso site:

WWW.LUVAS.COM.BR

011 2133.3006 011 2133.3079

ULTRAVINIL Pro

26

ULTRAVINIL Pro

36

ULTRAVINIL Pro

46


Ă­ndice

4


editorial made in brasil Foram necessários sete anos de negociações para o Japão – maior importador de carne suína in natura do mundo – abrir o mercado para o Brasil. E ainda que a habilitação de Santa Catarina tenha ocorrido quase que simultaneamente à notícia da suspensão das importações à Ucrânia, então segundo maior comprador da carne suína brasileira, a notícia há que ser comemorada. E muito! E não é para menos. Muito além de ter sido o primeiro país a se beneficiar do reconhecimento de zona livre de febre aftosa para exportar carne suína para a ‘Terra do Sol Nascente’, o próprio secretário de Relações Internacionais do Ministério da Agricultura, Pecuária e Abastecimento, Célio Porto, reconheceu que “a conclusão de todo o processo terá impacto muito positivo para a economia regional”. E deixando de lado os limites territoriais e a regionalidade da questão, demonstrando ainda mais entusiasmo, o vice-presidente de Assuntos Corporativos da BRF, Wilson de Mello Neto, tratou de afirmar que o novo cenário dará “tranquilidade” ao mercado de carne suína brasileira. Opinião corroborada pelo hoje ex-presidente da Abipecs, Pedro de Camargo Neto, que acredita que a abertura do mercado japonês “muda a suinocultura no país”. E olha que como bem lembrou Mário Lanznaster, presidente de uma das maiores processadoras do produto no Brasil, a Coopercentral Aurora, os japoneses têm gosto refinado: pretendem comprar cortes nobres de carne suína, como pernil, paleta e carré. Ao todo, oito unidades frigoríficas foram habilitadas a exportar carne suína ao Japão, conforme lista divulgada em 10 de junho pela Secretaria de Defesa Agropecuária, sendo elas BRF (de Campos Novos e Herval D’Oeste), Seara (Seara e Itapiranga), Pamplona (Rio do Sul e Presidente Getúlio), Aurora (Chapecó) e Sul Valle (São Miguel do Oeste). No mesmo dia, outra notícia de igual relevância ao setor veio a público, quando a presente edição da Nova Revista Frigorífico já se encontrava, por sinal, em fase de pré-impressão na gráfica. E se não houve tempo hábil de preencher as páginas que merecia no interior do material, merece menção de destaque neste editorial, reescrito aos 46 minutos do segundo tempo: a JBS, que já é a maior produtora de carne bovina do mundo, acaba de se tornar líder global na produção de carne de frango após a aquisição da Seara Brasil, divisão de aves, suínos e processados do grupo Marfrig. Segundo anúncio oficial da companhia, que também dá um salto no segmento de alimentos processados, de maior valor agregado, e passa a ocupar a posição de segunda maior empresa do Brasil nesse segmento (atrás apenas da BRF, dona das marcas Sadia e Perdigão), a expansão impactará igualmente o seu faturamento, ao passo que a Seara deve adicionar R$ 10 bilhões à receita global da JBS. Tenha uma excelente leitura!

6


conexĂŁo

Santa Catarina ĂŠ habilitada a exportar carne suĂ­na para o JapĂŁo Os produtores de Santa Catarina estĂŁo autorizados a vender carne suĂ­na para o JapĂŁo. O paĂ­s reconheceu o Estado como livre de febre aftosa sem vacinação, o que permitiu a abertura de seu mercado. A liberação ocorre apĂłs sete anos de negociaçþes e passou a ser vĂĄlida desde 24 de maio. Segundo o ministro AntĂ´nio Andrade, do MinistĂŠrio da Agricultura, PecuĂĄria e Abastecimento (Mapa), as vendas poderĂŁo ser feitas assim que o Mapa enviar ao governo japonĂŞs a lista de estabelecimentos exportadores que atendam requisitos sanitĂĄrios locais. A lista estĂĄ em elaboração pela Secretaria de Defesa AgropecuĂĄria, em consulta com as empresas. O SecretĂĄrio de Relaçþes Internacionais do Mapa, CĂŠlio Porto, informou que o Brasil serĂĄ o primeiro SDtV TXH VH EHQHÂżFLDUi GR UHFRQKHFLPHQWR GH ]RQD livre de febre aftosa para exportar carne suĂ­na para o JapĂŁo. “AtĂŠ agora, o JapĂŁo sĂł aceitava importaçþes de carnes de animais susceptĂ­veis Ă  doença se o paĂ­s fosse inteiramente livreâ€?. Porto observou, ainda, que a abertura do mercado japonĂŞs ocorre em um Ăłtimo momento para o setor, tendo em vista que a Ucrânia, que era o segundo maior importador de carne suĂ­na brasileira, suspendeu as importaçþes do produto desde o dia 30 de março alegando a presença da bactĂŠria listeria em lotes de carnes oriundas do Brasil. De acordo com o secretĂĄrio, as exportaçþes poGHPEHQHÂżFLDUIRUWHPHQWHRVHJPHQWRQR%UDVLOÂł$V negociaçþes começaram em 2006 e a conclusĂŁo de todo o processo terĂĄ impacto muito positivo para a economia regionalâ€?. Mercado japonĂŞs - O JapĂŁo ĂŠ o maior importador mundial de carne suĂ­na in natura, tendo comprado US$ 5,1 bilhĂľes em 2012 (equivalentes a 779 mil toneladas), o que representa cerca de 31% das compras mundiais, em valor. O segundo maior mercado ĂŠ a RĂşssia, que importou US$ 2,5 bilhĂľes. Os principais fornecedores para o JapĂŁo foram Estados Unidos (US$ 2,1 bilhĂľes), UniĂŁo Europeia (US$ 1,4 bilhĂŁo) e CanadĂĄ (US$ 1,1 bilhĂŁo). No ano passado, o Brasil – que ĂŠ o quarto maior exportador de carne suĂ­na in natura do mundo – vendeu o produto para 63 mercados, totalizando US$ 1,3 bilhĂŁo (quase 500 mil toneladas). Santa Catarina estĂĄ no topo da lista dos Estados exportadores, vendendo US$ 492 milhĂľes, isto ĂŠ, cerca de 181 mil toneladas em 2012. O presidente da Associação Brasileira da IndĂşstria Produtora e Exportadora de Carne SuĂ­na (Abipecs), Rui Vargas, disse que o potencial de vendas de carne

8

suĂ­na brasileira ao JapĂŁo ĂŠ de 100 toneladas por ano no mĂ­nimo. “O JapĂŁo ĂŠ o maior consumidor da proteĂ­na no mundo, com compras de cerca de mil toneladas/ano de mercados produtores como Estados Unidos, MĂŠxico, CanadĂĄ, Dinamarca e Chile. Seria ideal se conseguĂ­ssemos chegar aos 10% dissoâ€?. Novo cenĂĄrio - Conforme disse o vice-presidente de Assuntos Corporativos da BRF, Wilson de Mello Neto, a possibilidade de exportar ao JapĂŁo darĂĄ mais “tranquilidadeâ€? ao mercado de carne suĂ­na brasileira. “AlĂŠm do paĂ­s ser o maior mercado consumidor do mundo, ĂŠ um mercado estĂĄvel, diferente de RĂşssia e Ucrânia. DarĂĄ mais tranquilidade Ă s vendas do setor e equilibra o jogo. É mais um competidor de pesoâ€?. O executivo nĂŁo quis citar o potencial de vendas, em toneladas, que o Brasil pode atingir, mas Mello Neto estima que, somente a comercialização da BRF ao paĂ­s pode chegar a uma receita cambial de US$ 300 milhĂľes em trĂŞs anos. Presidente de uma das maiores processadoras de carne suĂ­na do paĂ­s, a catarinense Coopercentral $XURUD 0iULR /DQ]QDVWHU WDPEpP DÂżUPRX QmR WHU estimativa de vendas, mas acredita que em um ano poderĂĄ ser atingido um nĂ­vel semelhante aos “bons tempos de exportação para a RĂşssiaâ€?, quando o Brasil chegou a vender cerca de 500 mil toneladas de carne suĂ­na por ano. Para a Aurora – que informou que sua unidade de abate FACH1, localizada em ChapecĂł, ĂŠ uma das habilitadas a exportar para o JapĂŁo –, a abertura do mercado japonĂŞs poderĂĄ representar vendas entre 200 e 400 toneladas jĂĄ neste ano. â€œĂ‰ um processo lento, mas calculamos que em 90 dias estaremos embarcando de trĂŞs a quatro contĂŞineres, com 25 toQHODGDVFDGD´DÂżUPRX/DQ]QDVWHU6HJXQGRD$XURUD os japoneses pretendem comprar cortes nobres de carne suĂ­na, como pernil, paleta e carrĂŠ. JĂĄ o ex-presidente da Abipecs, Pedro de Camargo Neto, estima que o Brasil tem condiçþes de exportar entre US$ 100 milhĂľes e US$ 200 milhĂľes ao mercado japonĂŞs. Camargo Neto, que iniciou as negociaçþes com o JapĂŁo, disse que “a formalização da abertura do mercado para as exportaçþes de carne suĂ­na de Santa Catarina conclui um ciclo de muito trabalhoâ€?, que envolveu os governos catarinense e federal, alĂŠm de produtores e agroindĂşstrias. Em sua opiniĂŁo, a abertura do mercado japonĂŞs “muda a suinoculturaâ€? no paĂ­s, ao passo que deve alavancar as vendas da carne suĂ­na produzida em Santa Catarina. AgĂŞncia Estado e Valor Online, com edição da NRF


conexĂŁo

Mesmo com restriçþes, RĂşssia ĂŠ importante mercado para o Brasil 2VHUYLoRGHÂżVFDOL]DomRYHWHULQiULDHÂżWRVVDQLWiULDGD RĂşssia (o Rosselkhoznadzor) suspendeu temporariamente as importaçþes de unidades processadoras de carne bovina do Minerva (SIF 431) e do Marfrig (SIF 3047), apĂłs realizar testes de laboratĂłrio que constataram a presença da bactĂŠria listeria em lotes de carnes importadas do Brasil. $MXVWLÂżFDWLYDSDUDDVXVSHQVmRGDVSODQWDVVHGHXVH gundo o serviço russo, em função de “repetidas nĂŁo-conformidadesâ€?. A planta do Minerva estĂĄ localizada em 3DOPHLUDVGH*RLiV *2 HQTXDQWRTXHDGR0DUIULJÂżFD em Mineiros (GO). O MinistĂŠrio da Agricultura, PecuĂĄria e $EDVWHFLPHQWR 0DSD QmRFRQÂżUPRXDSUHVHQoDGDEDF WpULDHPFDUQHGHIUDQJRGRIULJRUtÂżFR6HDUDFRPRKDYLD sido informado anteriormente. Contudo, mesmo com as restriçþes Ă s importaçþes do Rio Grande do Sul, ParanĂĄ e Mato Grosso anunciadas e nĂŁo efetivadas, alĂŠm do movimento constante de susSHQVmRHOLEHUDomRGHSODQWDVIULJRUtÂżFDVRPHUFDGRUXV so ainda ĂŠ um dos mais importantes para as exportaçþes brasileiras de carnes.

10

Os números do Mapa mostram que no primeiro quadrimestre deste ano a Rússia absorveu 22,7% das exportaçþes brasileiras de carne bovina, perdendo apenas para Hong Kong, que respondeu por 25,1%. No acumulado do ano as exportaçþes cresceram 14,5% em volume (para 101,8 mil toneladas) e 3,4% em valor (para US$ 408,1 milhþes). As exportaçþes de carne de frango não são menos expressivas para a Rússia, que estå fora da lista dos dez maiores importadores do produto brasileiro. No caso da carne suína, mesmo com poucas plantas habilitadas, a Rússia ainda Ê o principal mercado, absorvendo 27,3% das exportaçþes brasileiras, seguida por Hong Kong (23,5%) e Ucrânia (16,2%). No acumulado de janeiro a abril, as exportaçþes de carne suína para o mercado russo cresceram 39,35% em volume (para 42,2 mil toneladas) e 36,6% em valor (para US$ 125,9 milhþes). Vale lembrar que a base de comparação Ê muita EDL[DSRLVRGHVHPSHQKRGRDQRSDVVDGR¿FRXDTXpPGD mÊdia dos últimos anos, em função das restriçþes. Estadão e Canal Rural, com edição da NRF


conexĂŁo

MĂŠxico receberĂĄ frango brasileiro ainda no primeiro semestre O governo e importadores do MĂŠxico iniciaram contatos com o Brasil sinalizando a intenção de realizar a importação de carne de frango e ovos. Falando Ă  imprensa local, o subsecretĂĄrio de IndĂşstria e ComĂŠrcio da Secretaria de Economia do MĂŠxico, Ignacio Navarro ZermeĂąo, anunciou que seu paĂ­s começarĂĄ a receber importaçþes de carne de frango ainda em junho, “em especial do Brasilâ€?. Âłe XPD H[FHOHQWH QRWtFLD -i Âż]HPRV WHQWDWLYDV GH abrir o mercado mexicano que esbarraram na existĂŞncia de elevadas tarifas de importação e de um acordo de livre comĂŠrcio do paĂ­s com os Estados Unidosâ€?, explicou o presidente da UniĂŁo Brasileira de Avicultura (Ubabef), Francisco Turra. As primeiras informaçþes sĂŁo de que o MĂŠxico, onde foram registrados focos de gripe aviĂĄria, tem interesse em agilizar todas as negociaçþes e formalidades necessĂĄrias SDUDRDFRUGRVDQLWiULRFRPR%UDVLO6XUWRVGH,QĂ€XHQ]D AviĂĄria que vĂŞm sendo registrados em diversas partes do paĂ­s (e que levou milhĂľes de aves ao sacrifĂ­cio sanitĂĄrio) estĂŁo gerando explosĂŁo nos preços do frango.

A importação “extraâ€?, portanto, objetiva equilibrar os SUHoRVLQWHUQRVGRSURGXWR&RPHVVDÂżQDOLGDGHRJRYHUQR do MĂŠxico jĂĄ criou uma quota de importação de 300 mil toneladas, em relação Ă  qual retirou temporariamente todos os impostos originalmente incidentes. Atualmente o MĂŠxico ocupa a posição de quarto maior importador mundial de carne de frango, atrĂĄs de JapĂŁo, ArĂĄbia Saudita e UniĂŁo Europeia (dados do Departamento de Agricultura dos EUA – USDA). Segundo estimativas da Ubabef, o mercado mexicano pode exportar cerca de US$ 300 milhĂľes somente em carne de frango, tendo por base um preço mĂŠdio do produto inteiro e em cortes. A entidade realizou contatos com o governo brasileiro pedindo urgĂŞncia nas negociaçþes. “Nossa sugestĂŁo ĂŠ que o acordo sanitĂĄrio seja formalizado com base nos padrĂľes que o Brasil cumpre junto a mercados como UniĂŁo Europeia, JapĂŁo e ArĂĄbia Saudita, que estĂŁo entre os mais exigentes do mundo no que diz respeito Ă  segurança alimentarâ€?, informou Turra. Globo Rural e Avisite, com edição da NRF


mercado

CNA pede fim da cobrança de PIS/Cofins sobre insumos para pecuåria Os insumos utilizados para alimentação de animais na pecuåria e na produção de pescados serão isentos da cobrança de PIS/PASEP e da Contribuição SDUDR)LQDQFLDPHQWRGD6HJXULGDGH6RFLDO &R¿QV  A medida estå prevista em emenda apresentada pela presidente da Confederação da Agricultura e Pecuåria do Brasil (CNA), senadora Kåtia Abreu, à Medida Provisória (MP) 609, aprovada no dia 05 de junho pela Comissão Especial Mista que analisa a matÊria no Congresso. A emenda da senadora foi acatada pelo deputado Edinho Araújo (PMDB-SP), relator da matÊria. O texto segue agora ao plenårio da Câmara. A MP propþe, entre outros pontos, alíquota zero dos dois tributos sobre a receita decorrente da venda no mercado interno e sobre a importação de produtos que compþem a cesta båsica. Conforme a emenda apresentada pela presidenWHGD&1$DGHVRQHUDomRGR3,63$6(3HGD&R¿QV contempla as raçþes concentradas, suplementos minerais, concentrados e ureia pecuåria. A alíquota zero tambÊm incidiria sobre a receita bruta obtida com a venda destes produtos no mercado interno. +RMHDDOtTXRWDGH3,6&R¿QVpGH6HJXQ do ela, a iniciativa ajudaria a reduzir os custos de produção na atividade bovina, ovinocaprinocultura e na aquicultura. 1DSHFXiULDH[HPSOL¿FDDVLWXDomRVHDJUDYRX com a alta dos preços do milho e da soja, utilizados na fabricação de insumos usados na alimen-

WDomRGRVDQLPDLV³$LQFLGrQFLDGH3,6&R¿QVYHP prejudicando seriamente estes setores e a alta dos custos foi agravada com o aumento dos preços dos JUmRV´MXVWL¿FD A senadora lembra que somente os suplementos minerais tiveram alta acumulada de 122,7% nos úlWLPRVQRYHDQRVEHPDFLPDGDLQÀDomR1RPHVPR período, a valorização da arroba do boi gordo foi de 71,6% em 10 Estados (GO, MG, MS, MT, PA, PR, RS, RO, SP e TO) que representam 80% do plantel de animais. .iWLD D¿UPD WDPEpP TXH R ¿P GD LQFLGrQFLD dos dois tributos ajudarå a ampliar a competitividade GDSHFXiULDEUDVLOHLUDEHQH¿FLDQGRDVH[SRUWDo}HV de carne bovina e reduzindo as importaçþes de produtos låcteos, alÊm de corrigir as distorçþes tributårias existentes na cadeia produtiva da pecuåria. $ 03 SURS}H D GHVRQHUDomR GH 3,6&R¿QV VR bre alguns produtos da cesta båsica, como carnes (bovina, suína, ovina, caprina e de aves), cafÊ, açúcar, óleo de soja e outros óleos vegetais, manteiga, margarina, farinha de trigo e massas. O relatório tambÊm contempla outros itens de alimentação, entre os quais pão de forma, frango industrializado, erva mate, mortadelas, linguiças, açúcar cristal, biscoitos, molho de tomate, o vinagre e o polvilho, alÊm de produtos de higiene pessoal. O relator incluiu, ainda, dispositivos que tratam da redução das tarifas de energia elÊtrica. CNA no AgriPoint, com edição da NRF

Mapa divulga subprograma de monitoramento de resíduos em produtos de origem animal para 2013 Com o intuito de monitorar os níveis måximos de resíduos e contaminantes permitidos em carnes (bovina, suína, equina, caprina, ovina e de avestruz), leite, pescado, mel e ovos em 2013, o MinistÊrio da Agricultura, Pecuåria e Abastecimento (Mapa) divulgou o escopo do subprograma de monitoramento referente ao Plano Nacional de Controle de Resíduos Biológicos em Produtos de Origem Animal (PNCRB). O anúncio foi feito por meio da Instrução Normativa nº 17 publicada dia 31 de maio, no Diårio 2¿FLDOGD8QLmR '28  Atualizado anualmente pela Coordenação de Resíduos e Contaminantes (CRC), o subprograma

12

tem como objetivo principal promover a garantia de qualidade do sistema de produção de alimentos de origem animal ao longo das cadeias produtivas, levando em consideração a efetividade dos autocontroles instituídos por todos os entes responsåveis pela segurança do alimento. De acordo com o coordenador de Resíduos e Contaminantes do Mapa, Leandro Feijó, a publicação GDQRUPDWLYDR¿FLDOL]DD¿QDOLGDGHGR31&5%TXH Ê de obter informaçþes sobre a frequência, níveis e distribuição dos resíduos de produtos de uso veterinårio e contaminantes nas espÊcies monitoradas em todo o país. Mapa, com edição da NRF


mercado Consumo africano de carnes cresce e amplia mercado para brasileiros Dados da Associação Brasileira das IndĂşstrias de Alimentação (Abia) apontam que o continente africano importou US$ 6,48 bilhĂľes em alimentos industrializados do Brasil em 2012. Este resultado representa 14,88% do total das exportaçþes de aliPHQWRV EUDVLOHLURV TXH QR DQR SDVVDGR ÂżFDUDP em US$ 43,4 bilhĂľes. Ă frica do Sul, Egito, ArgĂŠlia, Marrocos, NigĂŠria e Angola sĂŁo os principais paĂ­ses compradores de produtos alimentĂ­cios do Brasil. As importaçþes destes paĂ­ses sĂŁo, contudo, basicamente de carnes e açúcar. Segundo estudo do Rabobank, a Ă frica ĂŠ a regiĂŁo onde o consumo de proteĂ­na animal mais cresceu nos Ăşltimos dez anos, expressivos 70,2%. E o potencial de mercado para os exportadores de alimentos ainda estĂĄ longe de se esgotar, de acordo com Wilson Mello, diretor de assuntos corporativos da BRF. “O continente possui uma população expressiva que ainda tem pouquĂ­ssimo acesso Ă  proteĂ­naâ€?, disse. Presente na Ă frica desde 2000, a BRF vĂŞ atualmente suas exportaçþes para o continente crescerem em um ritmo de 20% ao ano em volume, nĂşmero maior que o crescimento total das exporWDo}HV GD HPSUHVD TXH ÂżFRX HP  HP  JĂĄ em faturamento, as vendas para a Ă frica tĂŞm crescido 32% ao ano. “A Ă frica jĂĄ representa 8% do total exportado pela empresaâ€?, informou Mello. Os produtos da BRF jĂĄ estĂŁo nas prateleiras de 40 paĂ­ses africanos e a empresa atĂŠ desenvolveu uma PDUFDHVSHFtÂżFDSDUDDUHJLmRD&RQÂżGHQFH $ &RQÂżGHQFH IRL SHQVDGD SDUD VHU XPD PDUFD de entrada, por meio de produtos de preço mais

acessĂ­vel, como mortadela e salsicha. Mas a primeira marca da BRF a chegar no continente foi a Perdix, da PerdigĂŁo, no inĂ­cio do sĂŠculo com a venda de frangos inteiros e cortes. “Começamos com produtos bĂĄsicos e hoje vendemos tambĂŠm industrializadosâ€?, contou Mello. Segundo avaliação do executivo, o fato da BRF ter estudado os aspectos culturais e sociais da Ă frica permitiram uma maior adaptação aos costumes locais e, desta forma, ganhar mercado. Por exemplo, na venda de frangos inteiros e em cortes, as caixas padrĂŁo da BRF possuem 17 quilos. “PorĂŠm, na Ă frica, os ambulantes nĂŁo usam veĂ­culos e saem com as caixas sustentadas na cabeça para venderâ€?. A BRF criou, entĂŁo, caixas com 10 kg. “AlĂŠm do peso menor ĂŠ um valor redondo, mais fĂĄcil para o ambulante realizar cĂĄlculos na vendaâ€?, explicou. De acordo com dados da Copersucar, Ă sia e Ă frica sĂŁo as regiĂľes do planeta onde o consumo de açúcar mais cresce. Conforme o presidente do conselho de administração, LuĂ­s Roberto Pogetti, das 5,1 milhĂľes de toneladas de açúcar exportadas pela Copersucar na safra 2011/12, os paĂ­ses da Ă frica e Ă sia responderam por 40% das vendas. Para Amaryllis Romano, analista de agribusiness e sĂłcia da TendĂŞncias Consultoria, as exportaçþes de carnes e açúcar sĂŁo apenas a porta de entrada para outros produtos alimentĂ­cios de maior valor agregado no continente. “O crescimento da renda e a maior urbanização deverĂŁo contribuir para que as importaçþes de alimentos continuem se expandindo e o Brasil poderĂĄ abocanhar uma fatia deste mercadoâ€?, analisou. Valor Online, com edição da NRF


mercado

Liderança do paĂ­s no mercado global de carnes e grĂŁos ĂŠ consolidada A capacidade de competição demonstrada pelo agronegĂłcio contribuiu para consolidar a liderança do Brasil no mercado global de grĂŁos e carnes. No ano passado, considerando-se o agronegĂłcio e toda sua extensa cadeia de valores, as exportaçþes do setor atingiram US$ 95,814 bilhĂľes, numa variação de 0,89% em relação a 2011, com sua participação avançando de 37,1% para 39,5% nas vendas externas totais do paĂ­s. Praticamente 70% das exportaçþes do agronegĂłcio em 2012 tiveram origem nos complexos soja HFDUQHVVXFURDOFRROHLURHSURGXWRVĂ€RUHVWDLVFRP destaque para papel, celulose e madeira. Para este ano, a Confederação da Agricultura e PecuĂĄria do Brasil (CNA), segundo sua superintendente Rosimeire Cristina dos Santos, espera um crescimento novamente modesto, diante do cenĂĄrio internacional ainda conturbado e dos problemas logĂ­sticos enfrentados pelo paĂ­s. “Pode ser que tenhamos um crescimento mais expressivo no segundo semestre, com a normali-

14

]DomRGRVĂ€X[RVGHFDUJDQRVHWRU´GL] Depois de reassumir a liderança mundial no mercado de carne bovina desde outubro de 2012, respondendo por 19% das exportaçþes globais, o paĂ­s deverĂĄ exportar neste ano “a cifra histĂłrica de US$ 6 bilhĂľesâ€?, batendo o recorde de 2012, quando as vendas do setor atingiram US$ 5,744 bilhĂľes, prevĂŞ AntĂ´nio Jorge Camardelli, presidente da Associação Brasileira das IndĂşstrias Exportadoras de Carne (Abiec). Como tendĂŞncia, o volume a ser vendido lĂĄ fora pela indĂşstria de carne bovina deverĂĄ aumentar 27%, com avanço entre 20% e 25% em receita. “VĂĄrios paĂ­ses alteraram o pacote de oferta, num rearranjo de cardĂĄpio que privilegiou os cortes de menor valor agregadoâ€?. Esse fator explica o valor mĂŠdio mais baixo neste ano. Os dados acumulados atĂŠ abril, segundo o MinistĂŠrio de Agricultura, PecuĂĄria e Abastecimento (Mapa), sugerem que o agronegĂłcio terĂĄ que realizar um esforço adicional para manter suas exportaçþes em crescimento. Valor Online, com edição da NRF


15


por dentro frigorĂ­ficos

Abertura de mercado japonês para a carne suína catarinense promete aquecer o setor Japão exige cortes nobres, absoluto rigor sanitårio e eficiente controle da produção

Vice-presidente da Aurora, Neivor Canton; presidente da Coopercentral MĂĄrio Lanznaster e o diretor de agropecuĂĄria Marcos AntĂ´nio Zordan

O Brasil Ê o maior fornecedor da carne de frango importada pelo Japão. Agora, Santa Catarina (SC) quer exercer papel semelhante no fornecimento de carne suína ao mercado japonês. Essa possibilidade foi sustentada pelo presidente do Sindicato das Indústrias de Carne e Derivados de Santa Catarina (Sindicarne), Clever Pirola à vila, dia 10 de junho, na sede da Fiesc, em Florianópolis, durante encontro para tratar dos impactos da abertura do mercado de carne suína do Estado para o Japão. O painel reuniu alÊm do Sindicarne e de representantes da Federação das Indústrias, o governador Raimundo Colombo, o presidente da Federação da Agricultura de SC (Faesc), JosÊ Zeferino Pedrozo, o presidente da Associação Brasileira da Indústria Produtora e Exportadora de Carne Suína (Abipesc), Rui Vargas, e o representante do Mapa em Santa Catarina, Luiz Gustavo Balena Pinto, alÊm do cônsul-geral do Japão para a região Sul do Brasil, Yoshio Uchiyama, do secretårio Kentaro Morita, da Embaixada do Japão no Brasil e a vice-cônsul Nana Kawamoto. $RWRGRRLWRIULJRUt¿FRVHVWmRKDELOLWDGRVD exportar ao mercado japonês, entre eles BRF (Campos Novos e de Herval D’Oeste), Seara (Seara e de Itapiranga), Pamplona (Rio do Sul

16

A abertura do mercado japonĂŞs para a carne suĂ­na de Santa Catarina – a Ăşnica ĂĄrea livre de afWRVD VHP YDFLQDomR QR %UDVLO Âą DQXQFLDGR RÂżFLDO PHQWH HP 7yTXLR H HP %UDVtOLD QR ÂżQDO GH PDLR cria expectativas positivas para a agroindĂşstria barriga-verde. HĂĄ cerca de dez anos as indĂşstrias, os produtores rurais e o governo desenvolviam gestĂľes diplomĂĄticas e comerciais com esse objetivo. “O JapĂŁo ĂŠ um dos maiores compradores mundiais e ĂŠ a melhor alternativa para a carne suĂ­naâ€?, ressaltou o presidente da Coopercentral Aurora Alimentos MĂĄrio Lanznaster. O paĂ­s tem capacidade potencial para importar atĂŠ 1,2 milhĂŁo de toneladas por ano, volume atualmente fornecido pelos Estados Unidos, atual maior fornecedor do produto. O dirigente acredita dentro de trĂŞs meses os primeiros embarques podem ser iniciados, se os contatos comerciais tiverem ĂŞxito.

e de Presidente Getúlio), Aurora (Chapecó) e o Sul Valle (São Miguel do Oeste). Parceria - O presidente do Sindicarne lembra que a experiência catarinense da parceria entre a Companhia Integrada de Desenvolvimento Agrícola de Santa Catarina (Cidasc) e do Instituto Catarinense de Sanidade Agropecuåria (Icasa) – criado em 2007 e mantido pelas agroindústrias catarinenses – foi essencial para a conquista dos mercados chinês, norteamericano e, agora, japonês. AtravÊs da Cidasc e do Icasa, as indústrias de processamento de carnes de SC complementaram as necessidades do Estado em vigilância sanitåria e abriram novas fronteiras comerciais. O Instituto investe mais de 10 milhþes de reais por ano em mÊdicos veterinårios (71, no total), veículos e equipamentos para manter uma força-tarefa de controle e evitar a entrada de doenças em território barriga-verde. à vila lembra que essa experiência vem sendo elogiada nos relatórios das missþes tÊcnicas internacionais e analisada pelos demais Estados da Federação Brasileira. A contribuição do Icasa foi de¿QLWLYD SDUD D REWHQomR GR DWXDO VWDWXV VDQLWiULR porque o instituto veio colaborar para que o Estado de Santa Catarina evoluísse nesta årea. MB Comunicação e Adjorisc, com edição da NRF


por dentro frigoríficos A decisão do Japão em comprar carne catarinense levou em consideração a estrutura de produção no campo e nas indústrias e o sistema de controle da sanidade animal. Uma comitiva japonesa virå ao Brasil para visitar as indústrias do Estado e orientar que tipos de cortes os japoneses desejam. O MinistÊrio da Agricultura, Pecuåria e Abastecimento (Mapa) indicarå as indústrias que serão vistoriadas. /DQ]QDVWHU FRQ¿UPRX TXH D XQLGDGH )$&+ GD Aurora, em Chapecó, jå estå habilitada para exportação para o Japão. Ele conta que serão necessårias algumas adequaçþes na planta industrial para DWHQGHUDVHVSHFL¿FLGDGHVGRVFRUWHVTXHRPHUFDGR MDSRQrV H[LJH $OpP GLVVR RV SUR¿VVLRQDLV VHUmR preparados para fazer os cortes solicitados pelos japoneses. Produto, apresentação e preço serão determinantes no fechamento dos negócios. Os japoneses querem cortes nobres, como pernil, paleta, sobrepaleta e carrÊ. Os clientes da Aurora no Japão, que hå dÊcadas compram carne de frango (especialmente peito, coxa e sobrecoxa desossada), jå estão mantendo contatos para a negociação com a carne suína brasileira. O diretor de agropecuåria e presidente da Or-

ganização das Cooperativas do Estado de Santa Catarina (Ocesc), Marcos Antonio Zordan, destacou TXH R -DSmR H[LJH DEVROXWR ULJRU VDQLWiULR H HÂż ciente controle do processo produtivo. A principal exigĂŞncia ĂŠ que os suĂ­nos sejam nascidos, criados e abatidos em territĂłrio catarinense, tenham nutrição de alto padrĂŁo e registro de todos os medicamentos ministrados durante a vida do animal em boletim veterinĂĄrio. Zordan destacou que a abertura do JapĂŁo beneÂżFLDUiRVSURGXWRUHVTXHSDUWLFLSDomRGRUHJLPHGH integração das agroindĂşstrias e das cooperativas agropecuĂĄrias, porque esses criadores jĂĄ cumprem todas as normas e exigĂŞncias do mercado nipĂ´nico. Para o vice-presidente da Aurora, Neivor Canton, ĂŠ necessĂĄrio conter a euforia. “NĂŁo podemos fazer investimentos desenfreados, por isso, a palavra de ordem ĂŠ moderaçãoâ€?, realçou. Para Canton, o momento ĂŠ de garantir que a produção esteja apta Ă  exportação e nĂŁo hĂĄ necessidade de se preocupar com a ampliação da produção, porque a industrialização estĂĄ no seu limite. “Nossa expectativa ĂŠ de que com a abertura do mercado japonĂŞs ocorra uma melhoria no preço da carne suĂ­na no mercado externoâ€?, comentou. MB Comunicação, com edição da NRF

17


por dentro frigoríficos

Marfrig cria Sistema de Responsabilidade Pós-Consumo de Embalagens e pausas maiores para descanso O Grupo Marfrig e a Secretaria do Meio Ambiente do Estado GH 6mR 3DXOR ¿UPDUDP QR GLD  GH MXQKR ± 'LD 0XQGLDO GR Meio Ambiente –, um termo de compromisso que vigorará por quatro anos para a criação de um sistema de logística reversa que promoverá a reciclagem das embalagens de produtos comercializadas no Estado. O documento prevê que a empresa implantará projetos de reciclagem em municípios paulistas onde têm operação e que necessitam ampliar sua coleta seletiva. Projetos-piloto devem ser implantados ainda este ano em Promissão e Jaguariúna. No próximo ano, o sistema de reciclagem será levado para os municípios de Amparo, Nuporanga e Votuporanga. Em 2015, chega a São Paulo e Osasco. O objetivo do Grupo é cumprir a meta estipulada pelo Ministério do Meio Ambiente de recolher e reciclar ou destinar corretamente 28% das embalagens de seus produtos depois de usadas até 2019, conforme a Política Nacional de Resíduos Sólidos. O Grupo Marfrig é a primeira empresa do setor de alimentos a base de proteína animal a assinar um termo de compromisso individual com o governo estadual. A Companhia fará um diagQyVWLFR VREUH D GHVWLQDomR GH UHVtGXRV QRV PXQLFtSLRV EHQH¿ ciados, selecionando associações ou cooperativas de catadores, bem como outros parceiros, para criar um sistema de reciclagem e logística reversa (recolhimento e destinação de embalagens pós-consumo). Para estimular o desenvolvimento da coleta seletiva em municípios onde ela ainda não é feita em larga escala, a Companhia trabalhará com as Prefeituras e o Estado para a criação de um modelo de parceria em todos os processos necessários para a separação dos materiais e a correta destinação dos resíduos. Serão também compradas máquinas e equipamentos para cooperativas e associações e promovidas capacitação dos catadores e campanhas educativas sobre o tema. “Assumimos também o compromisso de trabalhar junto a nossos fornecedores buscando alternativas para as embalagens, até então, consideradas não recicláveis”, destaca o diretor de Desenvolvimento Sustentável e Tecnologia do Grupo Marfrig, Clever Pirola Ávila. Por sua vez, o governo estadual se comprometeu a incluir orientações sobre a reciclagem de embalagem de alimentos em seus programas de educação ambiental e incentivar a capacitação de professores da rede pública de ensino sobre educação ambiental e gestão de resíduos, além de fomentar a atividade de reciclagem e a confecção de produtos com material reciclado, auxiliar nos contatos com os órgãos estaduais e municipais envolvidos no processo de coleta de lixo e reciclagem, e assegurar que procedimentos e atos administrativos sob sua responsabilidade permitam a implantação e expansão do sistema. Texto Comunicação Corporativa, com edição da NRF


por dentro frigorĂ­ficos

NR-36: projeto que altera pausas no trabalho Ê rejeitado Uma cartilha destinada a facilitar o cumprimento da Norma Reguladora número 36 (NR-36), assinada em abril pelo ministro do Trabalho, Manoel Dias, serå distribuída a cerca de 500 mil trabalhadores da indústria da carne no Brasil. A NR-36 regulamenta as condiçþes de trabalho em åreas de abate e de processamento de carnes e seus derivados. Presidente da Confederação Nacional dos 7UDEDOKDGRUHVQDV,QG~VWULDVGH$OLPHQWDomRH$¿QV &17$$¿QV ¹TXHUHSUHVHQWDRVWUDEDOKDGRUHVGR setor –, Artur Bueno explicou que o objetivo da cartilha Ê fazer com que os próprios trabalhadores ¿VFDOL]HPHOHYHPDRFRQKHFLPHQWRGRVVLQGLFDWRV e da confederação denúncias de eventuais abusos que serão relatados ao MinistÊrio do Trabalho. Um dos principais pleitos dos trabalhadores atendido pela norma são as pausas no exercício da atividade. A cada 50 minutos de trabalho que envolva esforço repetitivo, os trabalhadores deverão parar durante dez minutos para descanso. 1HVWH VHQWLGR D &17$ $¿QV UHMHLWRX R 3URMHWR de Lei 2363/11, do deputado Silvio Costa (PTB-PE),

20

que altera o artigo 253 da CLT. O projeto de lei, que esteve em audiência pública na Comissão de Trabalho, de Administração e Serviço Público da Câmara dos Deputados, limita a concessão de pausas para a recuperação tÊrmica e ao adicional de LQVDOXEULGDGHHPIULJRUt¿FRV 'HDFRUGRFRPD&17$$¿QVHPQRWDRSURMHWR de lei vai contra a Súmula 438 do Tribunal Superior do Trabalho (TST), editada em setembro passado, e Ê vista pelos trabalhadores como reação patronal à publicação da Norma Regulamentadora dos FrigoUt¿FRV 1507( HPYLJRUGHVGHDEULO ³'H¿QLU WLSRV GH DWLYLGDGHV H JUDXV GH WHPSH ratura (abaixo de 4ºC para insalubridade e entre 10ºC e 15ºC para concessão de pausas tÊrmicas) fere o esforço recente dos trabalhadores em torno da criação da NR 36, que levou dois anos para ser concluída. O projeto de lei restringe a quantidade de trabalhadores que vão ter o benefício e com isso não podemos concordar�, disse o coordenador político da entidade para a região Sul, Darci Pires da Rocha. Ag.Estado e Ag.Brasil, com edição da NRF


21


aves

Receita de exportaçþes de carne de frango aumenta 6% em maio A receita das exportaçþes brasileiras de carne de frango atingiu US$ 766,4 milhĂľes em maio, resultado prĂłximo ao recorde histĂłrico de US$ 770 milhĂľes de abril deste ano – apenas 0,4% inferior – e 6% maior em relação ao mesmo perĂ­odo do ano passado. Em volume houve redução de 8,3% na comparação entre os meses de maio de 2013 e 2012, com total de 343,9 mil toneladas embarcadas este ano. Ainda de acordo com os dados divulgados pela UniĂŁo Brasileira de Avicultura (Ubabef), no acumulado de 2013, a receita das exportaçþes soma alta tambĂŠm de 6%, com total de US$ 3,46 bilhĂľes entre janeiro e maio. Em volume, houve queda de 5,7%, com 1,584 milhĂŁo de toneladas exportadas. Segundo o presidente executivo da Ubabef, Francisco Turra, os embarques no mĂŞs de maio mantiveram o ritmo crescente que vem sendo registrado nas exportaçþes de carne de frango ao longo deste ano. “O volume exportado em maio de 2012, de 375 mil toneladas, foi recorde para o setor e atĂ­pico para o momento do ano, o que acentuou o Ă­ndice de queda registrado em maio deste ano“, destaca. Entretanto, conforme explica o dirigente, mercados com relacionamento de longo prazo com o

setor exportador brasileiro apresentaram redução nos volumes importados, a exemplo do JapĂŁo e da ArĂĄbia Saudita. â€œĂ‰ um comportamento esperado apĂłs um longo perĂ­odo com elevados nĂ­veis de embarques para esses mercados, que possivelmente estavam com estoques altosâ€?, detalha. Sobre a elevação na receita, o presidente da Ubabef destaca o aumento da exportação de carne salgada para a UniĂŁo Europeia. “Estamos no perĂ­odo HPTXHVHHQFHUUDRDQRFRWD SHUtRGRTXHGHÂżQHR volume total que pode ser embarcado para aquele mercado em 12 meses), quando os embarques para a Europa costumam apresentar elevaçþesâ€?, aponta. Ainda impactou positivamente sobre a elevação na receita das exportaçþes o repasse tardio dos custos de produção, decorrentes da crise dos insumos de 2012 (com a forte elevação na cotação do milho e da soja), aos preços no mercado internacional. “O processo de assimilação de elevação de custos no mercado internacional foi demorado, mas agora deverĂĄ perdurar, para compensar as perdas acumuladas pelas empresas exportadoras em 2012â€?, argumenta Turra. Ubabef, com edição da NRF

Mato Grosso do Sul deve abater 146 milhĂľes de aves em 2013 A expectativa da avicultura em Mato Grosso do Sul ĂŠ de que os abates em 2013 ultrapassem os 143 milhĂľes de aves, nĂşmero atingido em 2011, quando DSURGXomRDWLQJLXVHXPRPHQWRPDLVVLJQLÂżFDWLYR devido ao custo de produção favorĂĄvel. No ano passado, o Estado apresentou queda no nĂşmero de abate de aves, em relação a 2011, passando de 143 milhĂľes para 140 milhĂľes. “Houve crise no setor em 2012, devido os altos preços dos grĂŁos utilizados na fabricação de ração destinada as aves e suĂ­nosâ€?, lembra a economista da Famasul, Adriana Mascarenhas. Ela explica que o aumento pode ser considerado GHYLGRjKDELOLWDomRGRIULJRUtÂżFR)UDQJR%HOORTXH atualmente abate cerca de 90 mil aves por dia e gera em torno de 1,2 mil empregos. “No mĂŞs de IHYHUHLURGHVVHDQRPDLVXPIULJRUtÂżFRIRLKDELOLWD do para exportação de carne de frango para a China e os preços dos grĂŁos estĂŁo mais equilibrados. Esses fatores deixam a indĂşstria otimista para um

22

acrÊscimo no abate a nas exportaçþes em 2013�, conta. Mercado - Nos primeiros quatro meses desse DQR RV IULJRUt¿FRV GH 06 DEDWHUDP FHUFD GH  milhþes de aves e jå destinaram 39 mil toneladas para o exterior, o que representa acrÊscimo de 18% nas exportaçþes, em relação ao mesmo período de 2012, quando exportaram 33 mil toneladas. Junto ao volume exportado, a indústria alavancou tambÊm a receita do setor, passando dos US$ 75,9 milhþes no primeiro quadrimestre de 2012, para US$ 94 milhþes entre janeiro e abril desse ano. A China Ê o terceiro maior consumidor da carne de frango sul-mato-grossense, respondendo pelo consumo de 15,58% da produção de 2012. Fica logo atrås do Aråbia Saudita e do Japão, que importaram 24,34% e 24,28% da produção, respectivamente. Famasul, com edição da NRF


aves Avicultura brasileira intensifica estratĂŠgias contra Influenza AviĂĄria A avicultura brasileira estĂĄ preparada contra a RFRUUrQFLDGHIRFRVGH,QĂ€XHQ]D$YLiULDSHORPXQ do, inclusive em sua nova variedade – a H7N9 –, recentemente descoberta no leste e no centro da China. Dentre os maiores produtores mundiais, o Brasil ĂŠ o Ăşnico que nunca registrou um foco da enfermidade em suas variedades. De acordo com a UniĂŁo Brasileira de Avicultura (Ubabef), seguindo orientaçþes propostas pela entidade, as agroindĂşstrias associadas estĂŁo adotando uma sĂŠrie de medidas preventivas, especialmente quanto Ă  visita de estrangeiros em granjas avĂ­colas do Brasil. Dentro do programa de Procedimentos de Biosseguridade estabelecido pela Ubabef estĂĄ a proibição da visita de estrangeiros de paĂ­ses com regisWURVGHLQĂ€XHQ]DDYLiULDHPLQVWDODo}HVDYtFRODVH agroindustriais de aves e ovos. AtĂŠ mesmo visitas GH SURÂżVVLRQDLV EUDVLOHLURV jV LQVWDODo}HV GHYHP ser restringidas ao “estritamente necessĂĄrioâ€?. Visitantes de paĂ­ses onde a doença foi considerada extinta pelo governo brasileiro hĂĄ, no mĂ­nimo, 30 dias, tambĂŠm deverĂŁo cumprir perĂ­odo de

quarentena em seu paĂ­s de origem, sem contato com estabelecimentos avĂ­colas, e outro perĂ­odo no Brasil antes de realizar as visitas. AlĂŠm de todas essas restriçþes, deverĂŁo cumprir uma sĂŠrie de requisitos referentes aos equipamentos e cuidados sanitĂĄrios totalmente controlados. Tudo para manter DDYLFXOWXUDEUDVLOHLUDOLYUHGH,QĂ€XHQ]D$YLiULD Conforme o diretor de Produção e TĂŠcnico CienWtÂżFRGD8EDEHI$ULHO$QW{QLR0HQGHVDSURGXomR avĂ­cola brasileira tem contado com total apoio do MinistĂŠrio da Agricultura, especialmente por meio do Programa Nacional de Sanidade AvĂ­cola (PNSA), para manter o paĂ­s livre da enfermidade. “SerĂŁo LQWHQVLÂżFDGDVDLQGDPDLVDVDo}HVGHFRQVFLHQWL]D ção sobre a visita de estrangeiros no perĂ­odo prĂŠ e durante a Copa das Confederaçþesâ€?, reforça. “O status sanitĂĄrio brasileiro ĂŠ um dos bens mais valiosos da avicultura nacional. O poder pĂşblico e a iniciativa privada tĂŞm ciĂŞncia disto, e tĂŞm se mobilizado para evitar que qualquer problema afete a avicultura lĂ­der mundial em exportaçþes, e a terceira maior produção do planetaâ€?, destaca o presidente da Ubabef, Francisco Turra. Ubabef, com edição da NRF


aves Modernização de aviĂĄrios integra Plano AgrĂ­cola e PecuĂĄrio 2013/14 O presidente executivo da UniĂŁo Brasileira de Avicultura (Ubabef), Francisco Turra, comemorou o anĂşncio feito no dia 04 de junho pela presidenta da 5HS~EOLFD'LOPD5RXVVHĎ‘HSHORPLQLVWUR$QW{QLR Andrade, do MinistĂŠrio da Agricultura, PecuĂĄria e Abastecimento (Mapa), sobre a destinação de R$ 1 bilhĂŁo para incorporação de tecnologia pelos produtores rurais, dentro do Programa Inovagro, incluĂ­do no Plano AgrĂ­cola e PecuĂĄrio 2013/14. Segundo Turra, a Ubabef tem trabalhado fortemente junto ao Mapa nos Ăşltimos meses para a obtenção de um volume de recursos que permita PHOKRUDU GH IRUPD VLJQLÂżFDWLYD DV HVWUXWXUDV GDV granjas avĂ­colas brasileiras, principalmente nos estados do Sul, onde sĂŁo mais antigas. “Por esse motivo, a disponibilização dos recursos ĂŠ comemorada como uma vitĂłria para nosso setor, especialmente para os pequenos produtores. É um Plano Safra histĂłrico, valorizando de forma justa a avicultura como atividade econĂ´mica que contribui para o desenvolvimento social e a geração de renda no paĂ­sâ€?, destaca. Conforme explica o dirigente, o envelhecimento

24

de parte da estrutura tecnolĂłgica das granjas avĂ­colas tem impactado na competitividade do setor, reduzindo os nĂ­veis produtivos. Com o estĂ­mulo Ă  modernização, Turra vislumbra que todo o paĂ­s se EHQHÂżFLDUiFRPJDQKRVHPSURGXWLYLGDGHUHGXomR nos custos e aumento de renda para o produtor. “Agora, vamos lutar para que o mesmo volume de recursos seja disponibilizado no prĂłximo Plano Safra. Conforme estudo feito pela Embrapa, serĂŁo necessĂĄrios cerca de R$ 1 bilhĂŁo em investimentos nas estruturas atuais das granjas para que o paĂ­s recupere, plenamente, seus nĂ­veis de competitividade, perdidos com a defasagem tecnolĂłgicaâ€?, diz o presidente da Ubabef. O Inovagro contarĂĄ, tambĂŠm, com recursos na ordem de R$ 2 bilhĂľes para a pesquisa e desenvolvimentos de mĂĄquinas e equipamentos destinados ao agronegĂłcio. Entre outros pontos importantes do novo Plano estĂŁo ainda os R$ 500 milhĂľes que serĂŁo investidos para aumentar a capacidade de armazenagem da Companhia Nacional de Abastecimento (Conab). Ubabef, com edição da NRF


25


bovinos

Risco insignificante para ‘mal da vaca louca’ no paĂ­s 2%UDVLOPDQWHYHRVWDWXVGHÂłULVFRLQVLJQLÂżFDQWH´ para a Encefalopatia Espongiforme Bovina (EBB), conhecida como doença da “vaca loucaâ€?, e foi reconhecido como livre de peste equina. As resoluçþes foram tomadas pela Organização Mundial de SaĂşde Animal (OIE) no inĂ­cio de junho, em Paris, durante a 81ÂŞ SessĂŁo Geral da Assembleia Mundial de Delegados. Pela primeira vez, o Brasil ĂŠ reconhecido como um paĂ­s livre de peste equina. Em maio de 2012, D2,(FULRXXPSURFHVVRGHUHFRQKHFLPHQWRRÂżFLDO de status da doença e apenas este ano a entidade GLYXOJDUiDSULPHLUDOLVWDFRPDVFODVVLÂżFDo}HVGRV paĂ­ses-membros, com o Brasil incluĂ­do. O diretor do Departamento de SaĂşde Animal

do MinistĂŠrio da Agricultura, Guilherme Marques – eleito presidente da ComissĂŁo Regional da Organização Mundial de SaĂşde Animal (OIE) para as AmĂŠricas no dia 26 de maio, durante a reuniĂŁo mundial da entidade, em Paris – disse, em nota, que as resoluçþes sĂŁo novas demonstraçþes de FRQÂżDQoDGDFRPXQLGDGHLQWHUQDFLRQDOQR%UDVLO (PUHODomRj((%RFRPLWrFLHQWtÂżFRGDHQWLGDGH Mi KDYLD DÂżUPDGR HP IHYHUHLUR GHVWH DQR TXH D LGHQWLÂżFDomR GH XP FDVR DWtSLFR GD GRHQoD QXPD fazenda do ParanĂĄ, nĂŁo colocava em risco o status brasileiro. “O paĂ­s faz parte de um grupo seleto de QDo}HVTXHGHWrPRVWDWXVGHULVFRLQVLJQLÂżFDQ te para a doença em todo o mundoâ€?, disse Marques. Valor Online, com edição da NRF

Exportação de carne bovina aumenta 10,2% no mês de maio As exportaçþes brasileiras de carne bovina in natura no mês de maio somaram 119,1 mil toneladas equivalentes carcaça (TEC), segundo o MinistÊrio do Desenvolvimento, Indústria e ComÊrcio Exterior (MDIC). Este volume Ê 3,8% menor que o de abril, quando foram exportadas 123,8 mil tec. Na comparação com maio de 2012, o resultado foi 10,2% maior. No mesmo mês do ano passado foram embarcadas 108,0 mil TEC. Jå o preço mÊdio foi de US$ 3.401,91 a TEC, recuo de 3,6%, na comparação com abril e de 7,7% frente a maio do último ano. A diminuição no preço mÊdio fez com que o re-

cuo do faturamento fosse maior que o do volume. Frente ao mĂŞs anterior a queda na receita foi de 7,2%. JĂĄ na comparação com o mesmo perĂ­odo do ano passado, o aumento foi de 1,7%, perante o acrĂŠscimo de 10,2% na quantidade. Para o presidente da Associação Brasileira das IndĂşstrias Exportadoras de Carnes (Abiec), Antonio Jorge Camardelli, as exportaçþes de carne bovina brasileira podem crescer ainda mais se o paĂ­s aproveitar os potenciais de crescimento de consumo de alguns mercados. “Detectamos muitas oportunidades a serem conquistadas, como o mercado asiĂĄticoâ€?, disse. Scot Consultoria e Ag. Estado, com edição da NRF

Novo recorde brasileiro em exportaçþes de couro As exportaçþes de couros e peles do Brasil bateram recorde em valores alcançados, pelo segundo mês consecutivo este ano. No mês de maio, o país vendeu ao mercado externo US$ 227 milhþes, segundo dados preliminares da Secretaria de ComÊrcio Exterior. Trata-se de um crescimento de 15,7% em relação ao mesmo mês do ano passado. Segundo o presidente executivo do Centro das Indústrias de Curtumes do Brasil (CICB), JosÊ Fernando Bello, os números positivos de 2013 – que jå registram crescimento de 18,5% se comparados ao acumulado do mesmo período de 2012 – têm ori-

26

gem nos esforços do setor para alavancar vendas e, tambĂŠm, em fatores de mercado. De acordo com Bello, a alta das exportaçþes brasileiras tem ligação com a estagnação de compras no mercado interno e com o aumento no volume de importaçþes dos paĂ­ses asiĂĄticos, em especial China e Hong Kong. “O preço da matĂŠria prima subiu, tambĂŠm. Podemos avaliar que, em mĂŠdia, dos cerca de 18% de alta no acumulado do ano, 5 a 6% sejam oriundos da elevação nos preçosâ€?, destaca o executivo. CICB, com edição da NRF


27


bovinos Rússia retoma exportaçþes de carne produzida em Mato Grosso Os russos voltaram a comprar carne bovina de Mato Grosso. Ainda que em volume irrisório diante da capacidade de processamento local, o comÊrcio foi retomado em abril e traz a expectativa de que grandes volumes passem a ser negociados nos próximos meses. A efetiva retomada do comÊrcio se GHXFLQFRPHVHVDSyVR¿PGRHPEDUJRFRQ¿UPDGR QR¿QDOGHQRYHPEURGRDQRSDVVDGRHFRORFD¿P a quase 24 meses de interrupçþes, que tambÊm se estenderam às carnes suínas, mas que no Estado seguem sem demanda daquele país atÊ o momento. Em abril, os russos importaram 32,5 toneladas de cortes bovinos, gerando receita de US$ 95 mil. Conforme o Instituto Mato-grossense de Economia Agropecuåria (Imea), com base nos dados da Secretaria de ComÊrcio Exterior (Secex), foram embarcadas 26,15 mil toneladas equivalente carcaça (TEC), elevação de 27,15% ante março. Em volume, o ranking dos principais destinos da carne mato-grossense Ê formado pela Venezuela, China, Oriente MÊdio, União Europeia e Rússia. Conforme o Imea, o destaque de abril vai para a Rússia, que voltou a comprar carne mato-grossense,

28

mesmo que em volume pouco representativo. AlÊm disso, a Venezuela estå consolidada como o principal parceiro comercial do Estado, com um volume de 8,47 mil TEC em abril e um acumulado no ano de 28,71 mil TEC embarcadas para o país. Os demais parceiros com representatividade na pauta bovina foram a China, com 5,28 mil TEC, o Oriente MÊdio, 2,37 mil TEC, e a União Europeia, 1,66 mil TEC. De janeiro a abril, conforme o MinistÊrio da Agricultura, as exportaçþes de carne bovina somaram 155,24 mil toneladas e receita de US$ 353,76 milhþes, crescimento anual de 43,59% em cifras. Hå pelo menos três anos, a Rússia era o principal mercado consumidor da carne bovina e suína processada no Estado, mas com as constantes paralisaçþes, perdeu participação para o Oriente MÊdio e a Venezuela, esta última responsåvel por absorver 32% de tudo que foi exportado atÊ o momento. O Estado detÊm o maior rebanho de bovinos do país, 29 milhþes de cabeças e o complexo carne, que incluiu tambÊm aves e suínos, Ê o terceiro segmento mais importante da pauta de exportaçþes. Diårio de Cuiabå, com edição da NRF


29


caprinos

Introduzida no Brasil em meados de 1927, a raça caprina Anglo Nubiana vem conquistando adeptos fora de suas fronteiras na Bahia, Pernambuco, Piauí e Ceará, como já é visto em São Paulo, Minas Gerais, Rio de Janeiro e Rio Grande do Sul. Apesar de ser uma raça de excelência na produção de leite, o porte mais avantajado dos animais lhe confere aptidão também para o corte. Para quem não conhece, um bom animal Anglo Nubiano traz em sua morfologia uma cabeça pequena, bem conformada e um SHU¿O FRQYH[LOtQHR Suas orelhas são grandes e caídas até a linha do focinho. Os olhos são grandes e vivos e o pescoço bem implantado na cabeça e tronco. A cor da pelagem varia, sendo comum a combinação entre preto, vermelho e pardo. “O conjunto é acompanhado de um porte grande e incrível rusticidade. As fêmeas são prolíferas, boas produtoras de leite e apresentam excelente abertura de posteriores”, explica o proprietário da Fazenda 3 Marias, em Sarapuí (SP), Fernando Fabrini, que também é vice-presidente da Associação Paulista dos Criadores de Caprinos (CapriPaulo). São Paulo tem um dos planteis geneticamente mais apurados do Brasil, no entanto, a região Nordeste é a que abriga o maior volume de animais e criadores. Por meio da seleção genética, os criadores conseguem qualidade superior, com enfoque na caracterização leiteira, mas sem perda das

Pertencente às raças do tronco das cabras Asiáticas e Africanas, os caprinos Anglo-Nubianos são assim denominados devido aos cruzamentos entre caprinos da Núbia (Sudão) com cabras comuns da Inglaterra – a exemplo da Zaraibi e da Chitral –, com o duplo objetivo de produção de carne e leite. Trata-se de uma raça, extremamente rústica, com ótima adaptação ao ambiente tropical, inclusive para a criação a pasto. Composta por animais de grande porte, com pê-

30

Crédito: Fernando Fabrini

Conhecida pela qualidade do leite, raça caprina Anglo Nubiano também pode ser boa produtora de carne características raciais necessárias para produzir carne. “Os julgamentos ajudam o produtor a buscar o animal ideal, com avaliações que priorizam caracterização racial, produção leiteira e porte”, explica. Um macho Anglo Nubiano chega a pesar entre 100 e 120 quilos, enquanto as fêmeas alcançam 80 quilos. Mesmo não sendo uma das raças que mais produzem leite, o grande diferencial da raça Anglo Nubiano está na qualidade, pela quantidade de sólidos totais em cada litro ordenhado. A matéria-prima é muito procurada para industrialização e fabricação de queijos ¿QRV H RXWUDV LJXD rias de alto valor agregado. Em média, as fêmeas produzem entre dois e quatro quilos de leite por dia, mas é comum YHU SURGXWRUHV PDLV WHFQL¿FDGRV FRQVHJXLQGR DWp seis litros. Os machos desenvolvem uma carcaça nobre ainda jovens e sua carne é uma das mais saborosas. O consumo é mais forte na região Nordeste e vem conquistando paladares no Sudeste, onde é elitizado. Pela exímia habilidade maternal e rusticidade, a raça também é utilizada no cruzamento industrial, contribuindo com o aleitamento e desenvolvimento dos cabritos meio-sangue. Para divulgar esses atributos, criadores de São Paulo e do Rio Grande do Sul participaram da Feinco Preview, de 17 a 21 de junho, no Centro de Exposições Imigrantes, na capital paulista. Pec Press® - Imprensa Agropecuária, com edição da NRF

los curtos e pelagem variada, a raça Anglo-Nubiana está bem distribuída, no Brasil, sendo muito utilizada nos cruzamentos absorventes para a produção de leite e carne, principalmente no Nordeste. No Piauí, por exemplo, a raça está cada vez mais em destaque. Apresenta grande importância econômica para introdução inicial em rebanhos criados, exten-sivamente, e que pretendem melhorar a produção leiteira. G1, com edição da NRF


31


suĂ­nos

Abipecs: “vendas no segundo semestre tendem a melhorarâ€? Devido Ă  perspectiva de uma retomada da demanda pela proteĂ­na de origem suĂ­na no exterior no segundo semestre, o volume das exportaçþes GHYHUi ÂżFDU HVWiYHO HP  DQWH  1R DQR passado, as vendas do produto ao mercado externo WRWDOL]DUDPPLOWRQHODGDV$DÂżUPDomRIRL feita no dia 17 de maio pelo diretor de Mercado da Associação Brasileira da IndĂşstria Produtora e Exportadora de Carne SuĂ­na (Abipecs), Jurandi Machado. $SURMHomRpGLIHUHQWHGDGLYXOJDGDQRÂżQDOGR ano passado, que previa um crescimento para um volume de 600 mil a 650 mil toneladas. Isso porque o setor nĂŁo contava com o embargo imposto pela Ucrânia, em vigor desde meados de março. A restrição foi sanitĂĄria: ucranianos alegaram que o produto brasileiro estava chegando ao paĂ­s com a bactĂŠria Listeria monocytogenes. AtĂŠ abril, o volume exportado foi de 156,035 mil toneladas, queda de 9% ante o de 171,466 mil toneladas do mesmo perĂ­odo de 2012. Somente em abril na comparação com o mesmo mĂŞs de 2012, o recuo em volume foi de 25,38%. “Esperamos que em junho o embargo seja revertido e voltaremos a vender ao mercadoâ€?, disse Machado. Segundo ele, a missĂŁo das autoridades ucranianas em abril no Brasil transcorreu bem, mas o paĂ­s ainda nĂŁo deu a resposta – favorĂĄvel ao Brasil – por processos burocrĂĄticos. De acordo com Machado, o responsĂĄvel pela assinatura dos documentos estĂĄ de fĂŠrias. A volta Ă  normalidade das vendas Ă  Argentina tambĂŠm sustenta as projeçþes de volume no ano. “Fechamos a cota para 3 mil toneladas/mĂŞs e jĂĄ estamos perto, maio jĂĄ estĂĄ sendo bom. SĂł que ĂŠ um paĂ­s instĂĄvel: nunca sabemos o que pode ocorrer.

Eles nunca formalizam o que prometem, sĂł falam e contamos com o cumprimento da palavra delesâ€?, declarou. “Mas, independentemente de Ucrânia e Argentina, as vendas no segundo semestre, tanto no mercado externo quanto interno, tendem a melhorarâ€?, completou. Com relação ao JapĂŁo, Machado disse que a demora na liberação nos embarques ĂŠ normal, porque o prazo do processo burocrĂĄtico no paĂ­s ĂŠ tradicionalmente lento. O diretor da Abipecs tambĂŠm acredita que junho serĂĄ o perĂ­odo no qual o mercado anunciarĂĄ as empresas que serĂŁo autorizadas a vender ao paĂ­s. Margens melhores - Com uma expectativa de melhora na demanda pela carne suĂ­na no exterior e no mercado interno, Machado disse que as margens da indĂşstria e dos produtores do setor vĂŁo melhorar a partir do segundo semestre. Para ele, a queda recente dos preços do milho vai ajudar a recompor a rentabilidade do setor. “Hoje o suĂ­no abatido e processado ainda tem XP FXVWR HOHYDGR 2V HIHLWRV EHQpÂżFRV GD TXHGD das cotaçþes do milho vai ser observado somente a partir do segundo semestreâ€?, explicou. Segundo ele, entre novembro de 2012 e janeiro de 2013, a saca do milho era adquirida por R$ 30. Hoje jĂĄ se compra o insumo por R$ 26 a saca e a tendĂŞncia ĂŠ de continuar o movimento de queda, por causa da produção recorde do cereal de segunda safra. Sobre a possĂ­vel fusĂŁo entre a Abipecs e a UniĂŁo Brasileira de Avicultura (Ubabef), Machado disse que os boatos sobre o movimento sempre existiram, mas que “nĂŁo estĂĄ sabendo de detalhes e conclusĂľes sobre o assuntoâ€?. AgĂŞncia Estado, com edição da NRF

Exportação brasileira de carne suína em maio Apesar de persistir o embargo dos ucranianos à carne suína brasileira, as exportaçþes de suíno in natura aumentaram 26,5% de abril para maio. De acordo com o Centro de Estudos Avançados em Economia Aplicada (Cepea), isso ajuda a explicar a recuperação dos preços do suíno vivo e da carne no mercado domÊstico ao longo do último mês. A diminuição da oferta de animais para abate em vårias regiþes tambÊm contribuiu para esse movimento. No início de junho, conforme levantamentos do Ce-

32

pea, as valorizaçþes mais expressivas ocorreram justamente nas regiþes tipicamente exportadoras. Segundo a Secretaria de ComÊrcio Exterior (Secex) do MinistÊrio do Desenvolvimento, Indústria e ComÊrcio Exterior (MDIC), nas quatro primeiras semanas de maio as exportaçþes de carne suína do Brasil renderam US$ 81,1 milhþes, com mÊdia diåria de US$ 4,8 milhþes. A quantidade total exportada chegou a 29,4 mil toneladas, com mÊdia diåria de 1,7 mil toneladas.


capa Por Danielle Michelazzo Martins

Informaçþes precisas e pontuais na indústria da carne Quando e como usar QRCode, RFID e o código de barras?

M

ais do que dar identidade aos produtos visando o reconhecimento da marca no mercado, rĂłtulos H HWLTXHWDV VmR R PHLR PDLV HÂżFLHQWH de uma empresa realizar o controle de produção e estoque, bem como a LGHQWLÂżFDomRGHORWHVHPEDODJHQVGH SURGXWRVHFDL[DVGHLGHQWLÂżFDomRHQ tre outros, nĂŁo importa o ramo de atuação. “Em termos gerais, as etiquetas sĂŁo utilizadas SDUD LGHQWLÂżFDU R SURGXWR LQIRUPDU R SHVR SUHoR por quilo, preço a pagar, data de fabricação, lote, conteĂşdo nutricional, exibir mensagens promocionais, imagens (SISP, SIF) e cĂłdigo de barrasâ€?, aponta o gerente de Desenvolvimento de Novos NegĂłcios do Grupo CCRR - DivisĂŁo RFID, Ronald Sagula. Ele explica, ainda, que no caso do segmento aliPHQWtFLRÂąQRTXDORVIULJRUtÂżFRVVHHQTXDGUDPÂą juntamente com os rĂłtulos dos produtos, as etiquetas exibem informaçþes mais detalhadas, incluindo a denominação do produto, origem, caracterĂ­sticas, peso lĂ­quido, lote, prazo de validade, ingredientes, instruçþes de preparo, informaçþes nutricionais, forma de armazenamento e alguns alertas obrigatĂłrios quanto Ă s formas e condiçþes de uso. Na visĂŁo do diretor comercial do Grupo RQ Tecnologia, do qual a RQ Etiquetas faz parte, Reginaldo Humberto Queiroz, as indĂşstrias de alimentos HEHELGDVWDLVFRPRIULJRUtÂżFRVODWLFtQLRVSURFHV sadoras de carnes, enlatados, massas, conservas, cervejarias, moinhos, Ăłleos e derivados, dentre outras, utilizam hoje etiquetas em larga escala, VHMDSDUDFRQWUROHLQWHUQRLGHQWLÂżFDomRGRSURGX to ou atĂŠ mesmo como uma forma de marketing. Isso porque as etiquetas sĂŁo uma forma barata e HÂżFLHQWH SDUD TXH HPSUHVDV H LQG~VWULDV SRVVDP

34

LGHQWLÂżFDU FRQWURODU UDVWUHDU H FRPHUFLDOL]DU VHXV produtos. “As etiquetas sĂŁo imprescindĂ­veis, com elas conVHJXHVHUDVWUHDUHLGHQWLÂżFDUWRGRRSURFHVVRLQ dustrial, desde a produção e armazenamento atĂŠ a comercialização da carneâ€?, sintetiza Queiroz. ImpressĂŁo por transferĂŞncia tĂŠrmica Muitas sĂŁo as etapas e processos que compĂľem a cadeia de processamento da carne, que vai desde o abate dos animais atĂŠ a exposição dos produtos na prateleira. Nestes diversos processos, podem ser utilizados variados tipos de etiquetas – auto-adesiYDVRXWDJVGHSDSHODRÂżOPH “As etiquetas sĂŁo utilizadas em todas as etapas GD SURGXomR RQGH Ki D QHFHVVLGDGH GH LGHQWLÂż cação, rastreamento e acompanhamento do produto. Podem ser etiquetas internas (dentro da peça, embaladas a vĂĄcuo), etiquetas de garrĂŁo (partes inteiras), etiquetas testeiras (caixas) e rĂłtulosâ€?, elucida o diretor da RQ Tecnologia. PorĂŠm, como relata a diretora de marketing da IIMAK, Audrey Kompier, todas sĂŁo impressas com a tecnologia de transferĂŞncia tĂŠrmica com uso de ribbons. “A tecnologia de impressĂŁo por transferĂŞncia tĂŠrmica com ribbons ĂŠ a que melhor atende a este segmento por ser mais segura e limpa, alĂŠm de ser a mais barata. TambĂŠm ĂŠ a que imprime a maior variedade de cĂłdigo de barras, bi-dimensionais, 2D e QRcode, entre outrosâ€?. Mas, em se tratando de produtos cĂĄrneos, Audrey lembra que as etiquetas destinadas ao setor neFHVVLWDPWHUGXUDELOLGDGHHUHVLVWrQFLDHVSHFtÂżFDV principalmente por se tratarem de mercadorias que serĂŁo congeladas. “Para isto, ĂŠ necessĂĄrio que as informaçþes estejam impressas com uma tecnologia de impressĂŁo segura, com uma tinta (ribbon) que garanta a resistĂŞncia a temperaturas baixas ou


capa elevadas, resistĂŞncia ao sangue e gordura animal etc.â€?, ressalta. Outra questĂŁo imprescindĂ­vel ĂŠ o uso de frontais e ribbons atĂłxicos, lavĂĄveis e impermeĂĄveis, visando a nĂŁo contaminação da carne e garantindo a manutenção das informaçþes durante todo o processo. “As etiquetas e ribbons que vĂŁo em contato direto com a carne nĂŁo podem possuir substâncias QRFLYDVHFDQFHUtJHQDV´DÂżUPD “Para etiquetas que estarĂŁo em contato direto com a carne, o processo de fabricação ĂŠ mais rigoroso, pois a matĂŠria-prima e as tintas utilizadas precisam ser atĂłxicas para nĂŁo comprometerem a saĂşdeâ€?, concorda Queiroz. Evitando problemas na hora da impressĂŁo Como explica Audrey, para a impressĂŁo de uma etiqueta sĂŁo necessĂĄrios alguns componentes: equipamentos, sendo um computador e uma impressora de TT; um software de controle; a base, isto ĂŠ, a etiqueta, que pode ser adesivada ou nĂŁo e, neste caso, ĂŠ conhecida como tag; e o ribbon (tinta), que ĂŠ a resina com a qual, por termotransferĂŞncia, sĂŁo impressas as etiquetas. “Juntos estes elementos produzem a etiqueta impressa com as informaçþes sobre o produto, bem como a impressĂŁo dos dados variĂĄveis, cĂłdigo de barras, nĂşmero do lote, validade, data de fabriFDomRHWF´H[HPSOLÂżFDDGLUHWRUDGD,,0$. Mas, para que a impressĂŁo saia de forma legĂ­vel e a aderĂŞncia da tinta seja garantida, ĂŠ preciso veriÂżFDU R HVWDGR GD LPSUHVVRUD PDLV SUHFLVDPHQWH se a mesma encontra-se regulada e com base adequada. E, mais importante ainda, ĂŠ saber que DSyV D HVSHFLÂżFDomR GD HWLTXHWD H GR ULEERQ p fundamental que, mesmo se o fornecedor for alteUDGRQmRVHSRGHDOWHUDUDHVSHFLÂżFDomRVHPTXH isso comprometa toda a cadeia de impressĂŁo e LGHQWLÂżFDomRFRPRDOHUWD$XGUH\ “Hoje, o que vemos ĂŠ a falta de conhecimenWRWpFQLFRGRVIULJRUtÂżFRVGHPRGRJHUDOVREUHRV SURGXWRV HVSHFtÂżFRV SDUD D LPSUHVVmR SRU WUDQV ferĂŞncia tĂŠrmica, pois para cada tipo de impressĂŁo ODVHU LQNMHW RĎ‘VHW WW HWF  H[LVWH XPD EDVH H PXLWDVYH]HVXPDWLQWDHVSHFtÂżFD´ Em outros termos, ela explica que nos casos em que ĂŠ feita a troca de fornecedores ou o uso de diversos fornecedores ao mesmo tempo, o risco de ocorrer problemas de impressĂŁo e/ou de resistĂŞncia (durabilidade) e de leitura das informaçþes impressas ĂŠ bastante grande, jĂĄ que podem ser produtos semelhantes, mas nĂŁo adequados. “Assim como o ribbon, muitas vezes a olho nu nĂŁo dĂĄ para saber que o material nĂŁo ĂŠ adequado,

entĂŁo o problema sĂł aparece lĂĄ na frente, quando nĂŁo imprime, quando nĂŁo hĂĄ aderĂŞncia do ribbon na base, ou quando nĂŁo resisteâ€?, relata. Visando alcançar um ponto de equilĂ­brio perfeito entre a etiqueta a ser usada e o ribbon correto para o procedimento, o nĂ­vel de durabilidade necessĂĄrio – por exemplo, resistĂŞncia ao sangue, gordura animal, frio, ĂĄgua, anti-congelantes etc. – deve ser sempre informado ao fornecedor, na hora da compra, ao passo que o adesivo deve ser espeFtÂżFRSDUDDVXSHUItFLHDRQGHVHUiDÂż[DGDHHVWDU em conformidade com o nĂ­vel de resistĂŞncia. “EntĂŁo, para que haja uma boa leitura das informaçþes ĂŠ fundamental que as etiquetas e o ribbon sejam adequados para a aplicação a que se destinam e que aceitem a impressĂŁo por transferĂŞncia tĂŠrmicaâ€?, resume Audrey. “A escolha do adesivo adequado ĂŠ importante e a aplicação sempre deve ser informada ao fornecedor da etiqueta ou do rĂłtulo, para evitar transtornos na linha de produção. Os grandes fabricantes de auWRDGHVLYRVSRVVXHPDGHVLYRVHVSHFtÂżFRVSDUDVHU HPXWLOL]DGRVHPIULJRUtÂżFRV´FRPSOHPHQWD5RQDOG Sagula, da CCRR, que engloba a RR Etiquetas. “NĂŁo existe fĂłrmula mĂĄgica. A melhor tecnologia ĂŠ aquela que funciona e, para saber a maneira correta de empregĂĄ-la, sĂł indo QR FOLHQWH H YHULÂżFDQGR VXDV reais necessidadesâ€?, concorda o Account Manager – Ports & Cold Storage da Honeywell Scanning & Mobility, Luis Carlos Hachiya Pinto.

Luis Carlos Hachiya Pinto, Account Manager – Ports & Cold Storage da Honeywell Scanning & Mobility

Aplicação do cĂłdigo de barras Assim como em grande parte dos segmentos GH QHJyFLRV H[LVWHP SDUD D LQG~VWULD IULJRUtÂżFD produtos especialmente desenvolvidos com tecnologias que buscam atender Ă s exigĂŞncias mais caracterĂ­sticas pertinentes ao setor. De extrema importância para a cadeia da carne, as etiquetas de cĂłdigo de barras fazem parte desse rol. Elas permitem a automação e integração de muitos processos, proporcionando melhora nos apontamentos de todas as etapas da operação e redução de tempo e de custos. “O cĂłdigo de barras impresso nas etiquetas produzidas especialmente para o segmento fri-

35


capa JRUt¿FR VXSRUWD DPELHQWHV FRP WHPSHUDWXUDV inferiores a -40oC e grande condensação de umidade. Essa tecnologia tem aplicação em caixas de transporte e paletes dos produtos congelados nas åreas de armazenamento e distribuição, para aprimorar o processo e disponibilizar informaçþes de rastreabilidade do processo produtivo e de distribuição. Adicionalmente, proporciona aumento de produtividade em todo o processo e integração total das informaçþes�, explica Sagula. Criado nos Estados Unidos em 1973, o código de barras Ê um modelo que representa uma VHTXrQFLD JUi¿FD GH DOJDULVPRV WUD]HQGR XPD LGHQWL¿FDomR Ui pida e isenta de erros. No Brasil, o código Nacional de Produtos – código de barras – foi introduzido QR DQR GH  D ¿P GH LGHQWL¿FDU UHJLVWUDU H RUJDQL]DU os produtos ao serem fabricados e comercializados no mercado interno ou externo. Os números que são observados no código de barra são como o RG do produto, sua identidade, não podendo, assim, existir dois SURGXWRVFRPDPHVPDLGHQWL¿FDomR Os números são colocados de acordo com o país, sendo que cada país possui sua combinação própria. No Brasil, por exemplo, os três primeiros números são 789, indicando que o produto foi cadastrado aqui – o que, SRUpPQmRVLJQL¿FDTXHWHQKDVLGR fabricado no país. Função dos leitores e coletores de dados 6HQGR D LGHQWL¿FDomR SRU FyGL go de barras útil em cada etapa da FDGHLDGDFDUQHGHVGHRFRQ¿QDPHQWR passando pela fase de corte atÊ a comercialização, Ê necessårio um sistema de leitura råpiGRHH¿FD]SDUDWHUDFHVVRjVLQIRUPDo}HVFRPSUH cisão. É aí que entram os leitores e os coletores de dados. 3UHVHQWHVQRVIULJRUt¿FRVYLVDQGRDRUJDQL]DomR H OHLWXUD D SDUWLU GD LGHQWL¿FDomR Mi IHLWD SRU ULE bons, esses sistemas são de suma importância em todos os setores. São eles que permitem a leitura dos códigos de barra e, consequentemente, o acesso às informaçþes pertinentes aos produtos previamente cadastrados.

36

Contudo, segundo ressalta Luis Carlos Hachiya Pinto, da Honeywell, ĂŠ preciso diferenciar o uso de leitores de cĂłdigo de barras e de coletores de dados. “Os coletores sĂŁo usados dentro da ĂĄrea de logĂ­stica que pode ser usado desde a saĂ­da da produção, montagem do pallet de produtos, endereçamento dentro do freezer e posterior separação para entrega. Os leitores seriam usados no começo da cadeia produtiva durante a embalagem dos produWRVGXUDQWHVXDLGHQWLÂżFDomRHPXPD mesa de separação, por exemploâ€?. O coletor de dados se diferencia de um leitor de cĂłdigo de dados pela sua capacidade de armazenamento e transferĂŞncia de dados diretamente para um servidor, onde a informação coletada ĂŠ processada. Equipamento portĂĄtil (computador de mĂŁo) que ĂŠ utilizado para coletar, processar e armazeQDUGDGRVGHIRUPDUiSLGDHHÂżFL ente que serĂŁo transmitidos posteriormente ou em tempo real para o sistema de gestĂŁo da empresa, ĂŠ ideal para gerenciar estoques (entrada e saĂ­da de mercadorias) e na distribuição de produtos, jĂĄ que permite capturar e analisar dados como quantidade, tipo, validade, destino e outras informaçþes. 6LPSOLÂżFDQGR R FROHWRU GH GDGRV ĂŠ um aparelho portĂĄtil, que pode ser levado a campo para ler os cĂłdigos, armazenar os dados em txt, e depois descarregĂĄ-los no software de controle, proporcionando mais agilidade H HÂżFLrQFLD (VWH HTXLSDPHQWR SRV sui, geralmente, um leitor de cĂłdigo de barras ou cĂłdigos 2D (via laser) que, ao ser acionado, capta o cĂłdigo lançando as informaçþes contidas no mesmo, para a aplicação que estĂĄ sendo executada no coletor. Por seu turno, enquanto o coletor possui um banco de dados e ĂŠ capaz de armazenar as informaçþes capturadas, o leitor de cĂłdigos de barras ĂŠ um equipamento Ăłtico usado para efetuar a leitura de cĂłdigos de barras e transmitir o cĂłdigo coletado para um equipamento receptor, que pode ser um computador. O leitor nĂŁo processa dados, apenas efetua a leitura do cĂłdigo de barras. PorĂŠm, hĂĄ alguns modelos que permitem o armazenamento de vĂĄrios cĂłdigos que serĂŁo depois descarregados. Os leitores mais utilizados sĂŁo os modelos com cabo de transmissĂŁo de dados conectado Ă  entra-


capa da de teclado do computador ou usb. Mas tambĂŠm H[LVWHPOHLWRUHVVHPÂżRTXHWUDQVPLWHPRVGDGRV para a sua base que, por sua vez, estĂĄ conectada ao computador. A leitura ĂŠ obtida por um scanner ou leitor de cĂłdigo de barras que pode ser efetuada apĂłs uma emissĂŁo de laser que passa pela numeração do cĂłdigo. De modo que a parte impressa na cor escura absorve a luz e a de cor mais clara – fundo do FyGLJR GH EDUUDV Âą UHĂ€HWH SDUD R OHLWRU ID]HQGR assim, com que os dados sejam lidos pelo computador, que faz a conversĂŁo em letras ou nĂşmeros TXHSRVVDPVHULGHQWLÂżFDGRVFRPFODUH]D 6REUHTXDQGRXWLOL]DUDWHFQRORJLDGHOHLWXUDÂż[D ou mĂłvel, Hachiya Pinto dĂĄ novo exemplo. “O leitor mĂłvel, conforme comentado acima, entraria no LQtFLR GD RSHUDomR QD LGHQWLÂżFDomR LQGLYLGXDO GRV produtos jĂĄ com etiquetas apropriadas, apĂłs estes serem acondicionados. Em ĂĄreas produtivas como DGHXPIULJRUtÂżFRpFRPXPXVDUXPOHLWRUÂż[RGH esteira que faz a leitura das caixas que sĂŁo direFLRQDGDVSDUDRFDUUHJDPHQWRÂżQDORXDWpPHVPR para armazenagemâ€?. JĂĄ com relação ĂĄ utilização desses equipamentos em ambientes refrigerados, como freezers e câmeras frias, o gerente da Honeywell lembra que, QHVWHSRQWRDOJXPDVHVSHFLÂżFLGDGHVWDPEpPVmR exigidas. “Os coletores de dados tĂŞm que estar preparados para uso em local Ăşmido e frio, e serem resistentes Ă  presença de lĂ­quidos e Ă s diferentes temperaturas entre ambientes. A Honeywell dispĂľe de equipamentos SUHSDUDGRV HVSHFLÂżFD mente para este ambiente, com sistema de aquecimento para evitar condensação e parada do equipamento durante a operaçãoâ€?. Ronald Sagula, gerente de Desenvolvimento de Novos NegĂłcios do Grupo CCRR - DivisĂŁo RFID

Esta antena responde aos sinais de uma base transmissora ou receptora. Os cĂłdigos ou dados do LWHP ÂżFDP JUDYDGRV QR FKLS H XP HTXLSDPHQWR leitor captura essas informaçþes e as envia para um sistema central, para que sejam processadas e gravadasâ€?, esclarece o gerente da CCRR. Ele conta que nos projetos concretizados pela HPSUHVDSDUDDSOLFDomRGR5),'HPIULJRUtÂżFRVQR Brasil, Uruguai e Argentina, foi comprovado um DXPHQWRQDHÂżFLrQFLDGDFDSWXUDGDVLQIRUPDo}HV FRQWLGDVQDVHWLTXHWDVÂąQRVSURFHVVRVGHLGHQWLÂż cação, expedição e recebimento de produtos – em atĂŠ 43 vezes. “Quando usada uma etiqueta impressa com cĂłdigo de barras, para a leitura de 50 caixas em um palete, sĂŁo necessĂĄrios 3 minutos, aproximadamente, para a captura dos dados das etiquetas com leitor de cĂłdigo de barras. JĂĄ a captura dessas PHVPDV  FDL[DV LGHQWLÂżFDGDV FRP HWLTXHWDV RFID, atravessando um portal, acontece em apenas 1 segundo. Esse trabalho pode ser feito durante o embarque do produto, sem interrupção da operação GHFDUUHJDPHQWR´H[HPSOLÂżFD6DJXOD $LQGD GH DFRUGR FRP R JHVWRU MXVWLÂżFDQGR RV vultosos investimentos em uma fĂĄbrica nacional de inlays RFID feitos pelo Grupo CCRR, atravĂŠs de sua DivisĂŁo RFID, com a solução em RFID a etapa de FDUUHJDPHQWRÂżFDPDLVHÂżFLHQWHDVGRFDVHDLQ fraestrutura sĂŁo mais bem utilizadas e os produtos nĂŁo perdem temperatura enquanto aguardam sua LGHQWLÂżFDomR “Ela permite a visualização dos dados a todos os envolvidos nos processos produtivos e comerciais, inclusive ao consumidorâ€?, destaca.

6ROXomR5),'HPIULJRUtÂżFRV Outra tecnologia bastante utilizada e que tem DSOLFDomR LPSRUWDQWH QR VHJPHQWR IULJRUtÂżFR FRP ganhos comprovados, ĂŠ a tecnologia de RFID – ,GHQWLÂżFDomRSRU5DGLRIUHTXrQFLD “As etiquetas de RFID, tambĂŠm conhecidas como ‘etiquetas inteligentes’, sĂŁo compostas por uma antena de alumĂ­nio conectada a um chip que, posteriormente, ĂŠ encapsulada em uma etiqueta.

37


capa

Leitores e coletores de dados 1RYD 5HYLVWD )ULJRUt¿FR  Informaçþes precisas e pontuais são fundamentais para o bom andamento de todo e qualquer segmento LQGXVWULDO HQWUH HOHV R IULJRUt¿FR 4XDO D LP portância da automação para as indústrias, como um todo? Andrade - A otimização dos processos com suporte das tecnologias de automação e informação se tornou uma necessidade vital para as indústrias em geral, especialmente as focadas em alimento e saúde, que para cumprir exigências sanitårias e boas pråticas de manipulação, regulamentadas por RUJDQLVPRV R¿FLDLV FRPR D $19,6$ $JrQFLD 1D cional de Vigilância Sanitåria), precisam de dados precisos, coletados e processados em tempo real. As indústrias que ainda não recorrem à automação de processos correm o sÊrio risco de perder a competitividade de forma irrecuperåvel para as demais. NRF - E qual a relevância dos leitores de código de barras e dos coletores de dados, neste sentido, para a indústria da carne? Andrade - Pelo processo de coleta de dados pela OHLWXUDGHFyGLJR GHEDUUDVpSRVVtYHO LGHQWL¿FDUH rastrear os produtos ao longo de toda cadeia. Para a indústria da carne Ê fundamental a rastreabili-

38

Confira entrevista exclusiva realizada com o gerente de negĂłcios para Canais da Intermec Brasil, Reinaldo AraĂşjo Andrade.

dade integral, desde a condição de estoque vivo atÊ seus derivados alimentícios nas prateleiras das J{QGRODV QRV SRQWRV GH YHQGDV DR FOLHQWH ¿QDO Consideremos como exemplo, o caso da cadeia do gado bovino. Quando ele estå na condição de estoque vivo, ou seja, no campo ou na criação intensiva, torna-se necessåria a rastreabilidade no controle da alimentação, no controle sanitårio etc.; no abate, a partir do processamento dos cortes, na separação de peças e empacotamento; na manufatura de alimentos a base da carne; QRV DUPD]HQDPHQWRV QDV FkPDUDV GR IULJRUt¿FR do distribuidor e do varejo atÊ a destinação ao FOLHQWH ¿QDO (Q¿P QR SURFHVVR ORJtVWLFR ¹ VHMD intralogístico ou extralogístico –, as tecnologias têm relevância fundamental no rastreamento do produto. 2FyGLJRGHEDUUDVXWLOL]DGRFRPRLGHQWL¿FDGRU do animal durante sua vida adotado pelo Sistema %UDVLOHLUR GH ,GHQWL¿FDomR H &HUWL¿FDomR GH 2UL gem Bovina e Bubalina (Sisbov) Ê o GS1-128. Por este código, toda a informação sobre o animal em sua condição pregressa como estoque vivo estarå DFHVVtYHOWDQWRSHORIULJRUt¿FRFRPRSHORVGHPDLV elos da cadeia: indústrias alimentícias, agências regulatórias, etc. Após, o abate do animal, novos processos de rastreabilidade são estabelecidos,


capa normalmente utilizando código de barras, sempre permitindo uma conexão com os sistemas anteriores, garantindo a rastreabilidade dos produtos. NRF - 4XDLV WLSRV GH OHLWRUHV WrP PHOKRU aplicabilidade na indústria da carne: esferoJUi¿FRVFDQQHUODVHUOHLWRUHV&&'RXOHLWRUHV com câmeras? Andrade - Diante do avanço tecnológico, os OHLWRUHV HVIHURJUi¿FRV GH FyGLJR GH EDUUDV Mi VH tornaram obsoletos. Atualmente são utilizados os leitores a laser, CCD (do inglês Charge-Coupled DeYLFH HDVFkPHUDVIRWRJUi¿FDV 2V OHLWRUHV D ODVHU VmR H¿FD]HV QDV DSOLFDo}HV ¿[DVSRUH[HPSORD¿[DGRVHPHVWUXWXUDVGHWUDQV portes como as esteiras por onde passam produtos embalados. Jå para as leituras onde se exige mais mobilidade do operador, os leitores CCD se tornaram a melhor opção, pois sua estrutura mecânica não utiliza partes móveis como os leitores a laser, portanto, são menos vulneråveis a danos causados por impactos. Por sua vez, os leitores com câmeras tiram uma cópia digital do código e um software proFXUD LGHQWL¿FDU H LQWHUSUHWDU R FyGLJR GH EDUUDV na imagem capturada. Estes softwares são complexos, demandam uma unidade de hardware de SURFHVVDPHQWRVR¿VWLFDGDFXMRWHPSRGHUHVSRVWD pode ou não atender ao processo onde se deseja realizar o controle. Alguns aplicativos para smartphones interpretam código de barras por meio de processamento de imagens capturadas pelas suas câmeras. NRF -4XDOGHQWUHHOHVSRVVXLDWHFQRORJLD mais avançada e quais são as diferenças? De que forma Ê feita a leitura dos códigos de barras? Andrade - Atualmente, o conjunto tecnológico mais avançado Ê baseado na tecnologia CCD. Um de seus diferenciais Ê que eles leem códigos lineares e bidimensionais (Datamatrix e QRCode) com grande performance, tornando-se um dos leitores com a melhor relação custo/benefício para o mercado. Na tecnologia CCD, um conjunto de diodos emissores e receptores de luz realiza uma leitura quase fotogrå¿FDGRFyGLJRSHODUDSLGH]FRPTXHWRGRRFyGLJRp lido, porÊm, se utilizando somente de componentes eletrônicos que dispensam o uso de sistemas óticos-mecânicos como os leitores a laser. NRF - Em quais etapas da cadeia produtiva da carne eles têm aplicação? Eles se diferenciam de acordo com cada atividade a ser realizada?

Andrade - Sim, a aplicação de cada tecnologia se diferencia nas etapas da cadeia produtiva. ExemSOL¿FDQGRQRFDVRGDOHLWXUDGRFyGLJRGHEDUUDVQD cadeia derivada da carne bovina, os leitores móveis CCD podem ser utilizados na fase de manejo com a leitura do código Sisbov. Após o abate, durante o processamento dos cortes e embalagens, Ê mais YDQWDMRVRROHLWRU¿[RDRORQJRGDVHVWHLUDVWUDQV portadoras de peças embaladas e etiquetadas com código de barras. Durante a fase de estocagem, poGHP VHU XWLOL]DGRV OHLWRUHV ¿[RV H PyYHLV GHSHQ dendo dos processos utilizados, se mais manuais, os leitores portåteis serão mais vantajosos. Na fase de movimentação entre a distribuição e o varejo, podem prevalecer os leitores móveis se a separação de pedidos for mais manual. Em situaçþes onde hå mais automação envolvida, o emprego de leitores ¿[RVpFRPXP1RVSRQWRVGHYHQGDVHQFRQWUDPRV OHLWRUHV¿[RVSDUDXVRSHORVFOLHQWHVQDFKHFDJHP de preços e tambÊm leitores móveis pelos operadores e repositores para maior agilidade nas suas açþes. NRF - 6HQGR D LGHQWL¿FDomR SRU FyGLJR GH barras necessåria em cada etapa, desde o FRQ¿QDPHQWRSDVVDQGRSHODIDVHGHFRUWHDWp a comercialização, Ê necessårio um sistema GH OHLWXUD UiSLGR H H¿FD] SDUD WHU DFHVVR jV LQIRUPDo}HV FRP SUHFLVmR 4XDQGR XWLOL]DU D WHFQRORJLDGHOHLWXUD¿[DRXPyYHO" Andrade - $ OHLWXUD SRU HTXLSDPHQWRV ¿[RV deve ser realizada quando o ambiente oferece elementos de transporte, como esteiras, que då suporte ao processo. Em uma linha de produção do IULJRUt¿FRQDIDVHGHHQYDVHGRVFRUWHVHVWHVVmR LGHQWL¿FDGRV FRP HWLTXHWDV GH FyGLJRV GH EDUUDV H UDVWUHDGRV DWp D HVWRFDJHP SHORV OHLWRUHV ¿[RV pois toda sua movimentação se då pelas esteiras e elementos de transporte automåticos. No caso dos leitores móveis, estes são mais utilizados quando hå maior interação do operador com RV LWHQV D VHUHP LGHQWL¿FDGRV H UDVWUHDGRV FRPR na fase de estoque vivo. Como Ê preciso cuidar do boi, um a um, Ê mais fåcil e ågil trabalhar com o leitor móvel. Outra aplicação viåvel para os equipamentos móveis Ê no reconhecimento das unidades embaladas que chegam aos estoques do varejo. NRF -4XDORFXVWREHQHItFLRDRLPSOHPHQ WDU OHLWRUHV GH FyGLJR GH EDUUDV HP IULJRUt¿ FRV"&RPRVDEHUTXDODWHFQRORJLDTXHPHOKRU atende cada setor? Andrade - Atualmente jå não hå mais dúvida quanto à necessidade de se utilizar leitores de FyGLJRV GH EDUUDV QRV IULJRUt¿FRV $ DQiOLVH GH

39


capa custo-benefício vai focar basicamente nas funcionalidades necessårias que os equipamentos devem oferecer para cada etapa onde se requer a identi¿FDomR GRV LWHQV HWLTXHWDGRV (TXLSDPHQWRV VXE funcionais ou com funcionalidades desnecessårias VLJQL¿FDP GHVSHUGtFLR GH FXVWR RX GH EHQHItFLRV A adequação da tecnologia de leitura de código de barras deve ser recomendada por uma empresa ou SUR¿VVLRQDOGDiUHDGHPRELOLGDGHDOLQKDGRFRPRV que desenvolveram ou conhecem os processos produtivos detalhadamente. Desta forma, assegura-se que o equipamento utilizado oferecerå a melhor relação custo-benefício para o cliente. NRF -&RPUHODomRDVROXo}HVSDUDHWLTXH WDVFRPRDVHWLTXHWDVFRPWHFQRORJLD45FRGH podem contribuir para a indústria da carne? Andrade - As etiquetas com tecnologia QRCode (do inglês Quick Response Code) podem contribuir para a indústria da carne na medida em que elas permitem condensar um volume muito maior de dados. O QRCode permite armazenar alÊm do código do produto, dados como data de validade, LGHQWL¿FDGRUGHRULJHPLGHQWL¿FDGRUGHORWHHQWUH outras informaçþes. NRF - 4XDLV DV YDQWDJHQV GHVVH VLVWHPD 45FRGH " Andrade - Acredito que sejam duas vantagens relevantes. Primeiro, sua alta densidade de informação. O QRCode permite o registro de centenas de caracteres contra as atÊ duas dezenas dos códigos lineares. Com isso, o controle e segurança sobre os produtos que levam esta etiqueta são muito PDLRUHV 6HJXQGR VXD HVWUXWXUD JUi¿FD FRP HOH mentos de redundância permite reconstituir a informação mesmo que o código tenha sofrido um dano razoåvel. NRF - &RPUHODomRjVLPSUHVVRUDVYROWDGDV SDUDDLQG~VWULD(ODVWDPEpPDFRPSDQKDUDP DHYROXomRH[LJLGDSHORVHWRU" Andrade - A tecnologia das impressoras evoluiu muito e hoje temos uma diversidade delas que oferecem aplicaçþes com etiquetas variadas, que podem ser usadas no frio ou no calor, que tem resistência à umidade ou aos ambientes com presença de substâncias químicas diversas. A evolução nos mecanismos e na eletrônica das impressoras tem sido crescente. Atualmente, elas apresentam facilidades de conexão wireless, geram etiquetas com padrþes de softwares de impressão distintos durante um mesmo processo de impressão, permitem monitoramento remoto, gravam etiquetas RFID, dentre outras facilidades. Existem impressoras de eleva-

40

da robustez que suportam trabalhar o ano inteiro ininterruptamente, bem como modelos portåteis TXH JDUDQWHP H¿FLrQFLD SHOD OHYH]D H D IDFLOLGDGH de uso e transporte. No processo de etiquetagem, vale ressaltar que jå existe automação para aplicar etiquetas em caixas ou contêineres. A colocação dos produtos e o fechamento da caixa são automåticos, assim como a etiquetagem, utilizando um aplicador acoplado à impressora. NRF - Fale um pouco sobre a tecnologia 5),'QDLQG~VWULDGDFDUQH Andrade - O RFID Ê uma tecnologia que estå cada vez mais acessível para diversas aplicaçþes. A capacidade de informação armazenada na memória GRVWDJVpGH¿QLGDVHJXQGRDQHFHVVLGDGHGRSUR cesso a controlar. Existem tags RFID com os mais diversos formatos e encapsulamentos. Podem ser inseridos na camada interna de uma etiqueta, para serem gravados durante o processo de impressão de código de barras. Existem aplicaçþes que pedem, por redundância, alÊm da etiqueta com código de barras, o código tambÊm registrado no tag RFID. Por exemplo, as etiquetas utilizadas em produtos congelados onde a camada de cristais de gelo formada sobre a etiqueta pode impedir a råpida leitura do código de barras. AlÊm disso, atravÊs de um portal RFID Ê possível ler, simultaneamente, diversos itens idenWL¿FDGRVFRPWDJV5),' Ainda na indústria da carne, os tags RFID podem ser utilizados no manejo do gado, inserido nos EULQFRV LGHQWL¿FDGRUHV GRV DQLPDLV 0XLWDV YH]HV o brinco tem, simultaneamente, o código de barras e um tag RFID, para facilitar a leitura quando RFyGLJRGHEDUUDVHVWiVXMRRXGDQL¿FDGRRXQmR se deseje estressar o gado com a aproximação de leitores junto à cabeça dos animais. Entre outras aplicaçþes do RFID, pode ser vantajoso colocar tags nos contêineres e pallets de armazenamento. Com a utilização cada vez mais disseminada dos tags RFID, em breve atÊ as mais simples embalagens com produtos alimentícios os estarão utilizando e, isso se aplica tambÊm à indústria da carne e seus derivados. O objetivo principal Ê propiciar a rastreabilidade e segurança dos produtos que consumimos. Dentre as vantagens acessórias, estå a mercadológica, lå no ponto de venda, onde um produto que porta um tag RFID pode ser reconhecido por um smartphone que levarå seu usuårio, num piscar de olhos, a visitar o site do fabricante daquele produto alimentício, onde conteúdos informacionais podem tornå-lo mais atrativo à sua compra.


geral

Pisos e revestimentos de

alto desempenho

Resistência e durabilidade são peças-chave para setor frigorífico

P

isos, tintas e revestimentos são importantes para erguer uma construção e tirå-la do papel, mas, para cada obra, Ê necessårio escolher produtos adequados ao ambiente e TXHWHQKDPGXUDELOLGDGHSDUDD¿QDOLGDGHSURSRV ta. Então, qual tipo de piso Ê considerado ideal para SODQWDVIULJRUt¿FDVFRQIRUPHDQRUPDYLJHQWHHVWD belecida para o setor? Por que utilizar revestimenWRVHWLQWDVGLIHUHQFLDGRVQRVIULJRUt¿FRV" Nestes ambientes, um dos passos mais importantes – seja no projeto de instalação ou ao realizar reformas – Ê fazer as escolhas dos materiais de acordo com as normas da Agência Nacional de Vigilância Sanitåria (Anvisa), que Ê o órgão que determina o padrão a ser seguido por todo o segmento DOLPHQWtFLR FRP R ¿P GH SUH]DU SHOD OLPSH]D H saúde do consumidor e, tambÊm, pela qualidade do alimento. De acordo com a Portaria CVS-6/99, de 10/03/99, que se aplica a todos os estabelecimentos nos quais sejam realizadas atividades de produção, industrialização, fracionamento, armazenamento e transporte de alimentos, devem ser aplicados pisos compostos por material liso, resistente, impermeåvel, lavåvel, de cores claras, antiderrapante e resistente ao ataque de substâncias corrosivas. Por se tratar de um setor delicado, que pode

Por Danielle Michelazzo Martins e Alyne Martinez

fornecer riscos à saúde humana caso algum proFHGLPHQWR VHMD UHDOL]DGR GH IRUPD HUUDGD D ¿P de evitar o acúmulo de alimentos ou sujeiras que podem causar proliferação de bactÊrias e gerar contaminação, outras características importantes que devem ser observadas são o bom estado de conservação e a facilidade de higienização (lavagem e desinfecção). Ademais, para não permitir o acúmulo de alimentos ou sujidades, o piso deve ter incliQDomR VX¿FLHQWH HP GLUHomR DRV UDORV QmR SHU PLWLQGR TXH SRoDV GH iJXD ¿TXHP HVWDJQDGDV Lembrando que em åreas que permitam existência, os ralos devem ser sifonados, e as grelhas devem possuir dispositivos que permitam o fechamento. Cuidado especial tambÊm deve ser voltado para o revestimento, pois, mesmo que submetido D OLPSH]DV GLiULDV VHPSUH ¿FDP UHVTXtFLRV HQWUH o revestimento e o piso que são imperceptíveis e podem gerar transtorno se não forem mantidos em bom estado. 3LVRVSDUDRVHWRUIULJRUL¿FR De acordo com o gerente de contas da empresa Resinar Materiais Compostos Ltda., Wanderley 3IHϑHUNRUQ SDUD DWHQGHU DV GLIHUHQWHV iUHDV GR VHWRUIULJRUt¿FRFRPRDVVDODVGHDEDWHGHVRVVD

41


geral triparia, salgamento, embutimento, câmaras frias para carcaças e tĂşneis de congelamento, ĂŠ preciso um piso que aguente as imposiçþes fĂ­sicas, quĂ­micas e tĂŠrmicas pertinentes a tais ambientes, alĂŠm GHXPERPDFDEDPHQWRÂżQDO ,VVR SRUTXH VHJXQGR H[SOLFD 3IHĎ‘HUNRUQ FDGD local tem peculiaridades decorrentes de sua ativiGDGHGHÂżQLGDÂł1RVIULJRUtÂżFRVERYLQRVSRUH[HPS lo, onde hĂĄ muita incidĂŞncia de sangue nas primeiras separaçþes das peças – que ĂŠ derramado constantemente no piso –, o sangue acaba se transformando em ĂĄcido Ăşrico em função da temperatura muito corrosiva para os pisos destas ĂĄreas. Para as outras ĂĄreas nĂŁo hĂĄ muita incidĂŞncia de sangue, porĂŠm, o trânsito das pessoas e o constante arraste de equipamentos e gorduras (estas em maior quantidade HP IULJRUtÂżFRV SDUD IUDQJRV H VXtQRV  FRQWULEXHP para que o piso seja bem projetadoâ€?, relata. Ele aponta, neste sentido, que nĂŁo somente piVRVPRQROtWLFRVVmRXWLOL]DGRVQRVIULJRUtÂżFRVPDV tambĂŠm os pisos de cerâmicas extrudadas anticorrosivas conjugados com as devidas argamassas adequadas para assentamento e o rejuntamento em compĂłsito polimĂŠrico anticorrosivo, como as resinas epĂłxi novolac e ĂŠster vinĂ­lica. “Nas câmaras frias, o revestimento do piso, seja de cerâmica anticorrosiva extrutada ou argamassado monolĂ­tico polimĂŠrico, tambĂŠm tem que ser resistente Ă s baixas temperaturas e variaçþes causando grandes dilataçþes em função destas variaçþes. Por isso, pisos e revestimentos devem ser sempre planejados com os materiais apropriadosâ€?, diz. JĂĄ na visĂŁo do CEO da NS Brazil Pisos e Revestimentos Especiais, Newton Carvalho Jr., indagado SHOD 1RYD 5HYLVWD )ULJRUtÂżFR VREUH TXDO SLVR WHP PHOKRU DSOLFDomR QR VHWRU IULJRUtÂżFR Âą RV HSR[tGL cos, uretanos (concreto resinado) ou cimentĂ­cios –, o de composição uretânica foi o escolhido, entre as alternativas apresentadas. A opção, segundo ele, foi baseada levando-se em conta as solicitaçþes normais existentes em um IULJRUtÂżFRHQWUHHODVRVFRQVWDQWHVFKRTXHVWpUPL cos, provocados pela lavagem com ĂĄgua quente e/ ou vapor em um ambiente com baixa temperatura; as agressĂľes mecânicas, como abrasĂŁo e impactos diversos; os ataques quĂ­micos, provocados pelo uso de detergentes, desinfetantes e sanitizantes no sistema de higienização da planta; e tambĂŠm os ataques de compostos orgânicos, como sangue e gorduras. “Sem dĂşvida alguma, dentre as opçþes [epoxĂ­dicos, uretanos (concreto resinado) ou cimentĂ­cios], o revestimento com alto desempenho ĂŠ o uretânico, pois ele possui as caracterĂ­sticas de excelente resistĂŞncia ao impacto, por absorver e transferir para

42

o substrato as cargas recebidas. Possui tambĂŠm excelente resistĂŞncia quĂ­mica a um amplo espectro de produtos quĂ­micos, desde sangue e urina, aos mais diversos ĂĄcidos inorgânicos e orgânicos preVHQWHV QXP IULJRUtÂżFR EHP FRPR RV VDQLWL]DQWHV alĂŠm de apresentar um acabamento liso, conforme a versĂŁo, fosco e impermeĂĄvelâ€?, elucida. (OHFRQFRUGDFRP3IHĎ‘HUNRUQSRUpPTXDQWRj necessidade de aplicar uma solução diferenciada para cada departamento dentro da ĂĄrea industrial, em função do tipo de solicitação. Ou seja, ĂŠ de extrema importância levar em consideração qual o VHJPHQWRGHDWXDomRGRIULJRUtÂżFRVHERYLQRVXt no ou de aves, por exemplo, pois as necessidades VmRVLJQLÂżFDWLYDPHQWHGLIHUHQWHV “Em geral, para ĂĄreas produtivas, com umidade constante e temperatura baixa, o revestimento uretânico ĂŠ o mais indicado, podendo variar a textura, de lisa para antiderrapante e, em função da solicitação mecânica, de autonivelante para argamassado, podendo atĂŠ ter a adição de agregados metĂĄlicos para situaçþes que necessitem de extrema resistĂŞncia aos impactos. JĂĄ para as ĂĄreas secas e com temperatura ambiente, pode-se avaliar a possibilidade da aplicação de um revestimento epoxĂ­dico, levando-se em consideração a intensidade da solicitação mecânica, seja abrasiva ou por impactoâ€?, esclarece o executivo. Durabilidade e resistĂŞncia Algumas caracterĂ­sticas sĂŁo fundamentais e devem ser contempladas pelos pisos e revestimenWRV DSOLFDGRV HP SODQWDV IULJRUtÂżFDV HQWUH HODV D UHVLVWrQFLDjDEUDVmRLPSDFWRFRPSUHVVmRĂ€H[mR e choque tĂŠrmico. Contudo, outras duas ganham destaque: a resistĂŞncia quĂ­mica, que corresponde ao grau de inalterabilidade da superfĂ­cie em contato com reagentes de baixa e de alta concentração; e a resistĂŞncia mecânica, que corresponde Ă  capacidade em suportar esforços exercidos por cargas (pessoas, objetos, veĂ­culos) que possam provocar rupturas, esmagamento e quebras. 'HDFRUGRFRP3IHĎ‘HUNRUQRVSLVRVPRQROtWLFRV de epĂłxi, uretanos, tĂŞm boa resistĂŞncia, mas proporcionam menor durabilidade, pois estes polĂ­meros que sĂŁo confeccionados sĂŁo vulnerĂĄveis Ă s solicitaçþes de abrasĂŁo constante. Para ele, os dois sistemas para pisos, monolĂ­tico ou cerâmico, contemplam tecnologia na confecção dos compĂłsitos. Mas, levando as consideraçþes de resistĂŞncia quĂ­mica, somente o cerâmico, com um bom rejuntamento polimĂŠrico, fornece maior desempenho quanto Ă  durabilidade. “Pisos cerâmicos anticorrosivos tĂŞm maior dura-


geral bilidade em função dos grandes esforços exigidos HPGLYHUVDViUHDVGRIULJRUtÂżFRWDLVFRPRODYDJHQV constantes com detergentes e antibactericidas a quente, carrinhos com rodas de dureza muito rĂ­gida trafegando constantemente e atritando no piso, arrastes constantes de pequenas mesas de aço para DSRLRVREUHRSLVR´DÂżUPD O gerente da Resinar declara, ainda, que cada solução em piso apresenta durabilidade e resistĂŞnFLD HVSHFtÂżFDV EHP FRPR UHTXHU XP WLSR GH PD nutenção. “Os pisos argamassados monolĂ­ticos poOLPpULFRV H[LJHP UHIRUPDV RX UHSRVLomR VXSHUÂżFLDO em um prazo relativamente curto, pois sĂŁo confecFLRQDGRVFRPUHVLQDVWHUPRÂż[DVTXHVmRVHQVtYHLVj abrasĂŁo, ao trânsito e arraste de equipamentos sobre o piso. Quanto aos pisos de cerâmicas extrudados rejuntados ‘ao topo’ com argamassa anticorrosiva polimĂŠrica, tĂŞm maior tempo de durabilidade e as reformas somente acontecem quando um equipamento ĂŠ deslocado de lugar, necessitando que o piso seja UHIHLWRSRLVDVVDSDWDVGRVHTXLSDPHQWRVVmRÂż[DGDV no pisoâ€?. “Por sua vez, pisos de cerâmicas anticorrosivas extrudadas tĂŞm extrema resistĂŞncia mecânica e quĂ­mica e, quando tambĂŠm conjugados com as argamassas de assentamento e rejuntamento polimĂŠrico, WrPJUDQGHGXUDELOLGDGH´DFUHVFHQWD3IHĎ‘HUNRUQ AlĂŠm das caracterĂ­sticas abordadas, Newton Car-

valho Jr. lembra que outros fatores devem ser considerados para a escolha de pisos e revestimentos. O revestimento uretânico, ressalta, ĂŠ isento de solvente e, por isso, possui baixo VOC, sendo tambĂŠm UHFRPHQGDGR SDUD SURMHWRV TXH EXVTXHP D FHUWLÂż cação LEED. O Leadership in Energy and Environmental Design pXPVLVWHPDGHFHUWLÂżFDomRHRULHQWDomR DPELHQWDO GH HGLÂżFDo}HV GHVHQYROYLGR SHOR 86*%& (Green Building Council dos EUA) para medir o desempenho ambiental de design, construção e manutenção de edifĂ­cios. “NĂŁo apresentando odores, um de seus diferenciais estĂĄ na possibilidade de ser aplicado em ĂĄreas de processamento de alimentos sem que se necessite a paralisação da produção. Para as indĂşstrias alimentĂ­cias em geral, uma das suas caracterĂ­sticas ĂŠ a facilidade na limpeza e assepsia. Outro diferencial ĂŠ a liberação para trĂĄfego em 12 horasâ€?, conta o CEO da NS Brazil. Novidades do setor Carvalho Jr. conta que a NS Brazil desenvolveu algumas versĂľes com caracterĂ­sticas totalmente diferentes das existentes no mercado, tais como o acabamento brilhante, a resistĂŞncia aos raios ultravioleta H XPD YHUVmR Ă€H[tYHO SDUD R DXWRQLYHODQWH DVVLP como a versĂŁo com agregado metĂĄlico.

43


geral

Por Danielle Michelazzo Martins e Alyne Martinez

Armazenamento em câmaras frigoríficas Prateleiras aramadas modulares são opçþes versåteis para a indústria da carne

T

endo em vista o crescimento do setor cĂĄrQHRFDGDYH]PDLVRVIULJRUtÂżFRVWrPDP pliado cuidados para que a carne chegue ao mercado em Ăłtima qualidade. O paĂ­s conta, hoje, com a produção de mais de 24 milhĂľes de toneladas de carne, e para que esta quantidade seja disponibilizada para venda, ĂŠ preciso passar pelo sistema de armazenamento. Sistemas de armazenamento consistem, basicamente, no processo de armazenagem da carne QDVFkPDUDVIULJRUtÂżFDVDÂżPGHSUHYHQLODGHGH terioração por bactĂŠrias e conservar o alimento por um tempo maior. Ademais, se por um lado o frio impede que os microrganismos estraguem a carne, ele permite que a ação lenta das enzimas amoleça os tecidos mais duros – o que torna a carne mais macia. Assim, as indĂşstrias de processamento de FDUQHXVDPRDUPD]HQDPHQWRHPFkPDUDVIULJRUtÂż cas para tambĂŠm amaciar a carne, estocando o alimento durante sete a dez dias. Levados para armazenamento nas câmaras frigoUtÂżFDV RQGH VmR HVWRFDGRV RV SURGXWRV FiUQHRV sĂŁo distribuĂ­dos em prateleiras. Segundo Rubens Longhi, do setor de vendas da empresa Versus, as prateleiras aramadas sĂŁo as mais utilizadas, pois proporcionam excelente resistĂŞncia e total circulação do ar para o resfriamento dos produtos. “E por serem aramadas, facilitam a limpeza, pois a superfĂ­cie nĂŁo acondiciona sujeirasâ€?, complementa. Ainda de acordo com ele, facilmente montĂĄveis e desmontĂĄveis, as prateleiras aramadas modulares permitem o adicionamento de mais nĂ­veis de prateleiras, tornando-as versĂĄteis para a indĂşstria. RegulĂĄveis, permitem variadas possibilidades, sem necessidade do uso de ferramentas especiais. “O sistema de armazenagem, separação e transporte ĂŠ feito por conectores e tubos, podendo ser montado na medida desejada, dispensando parafusos e porcas, somente por encaixes. As estruturas podem ser reguladas de forma vertical, horizontal e angularâ€?, explica. Outra grande vantagem do produto ĂŠ a mobilidade, ao passo que por terem rodinhas, as prateleiras levam praticidade a todo o processo. FĂĄceis de movimentar inclusive dentro das câmaras frias, ganham, ainda, proteção antimicrobiana e acabamento especial para suportar as baixas temperaturas a que sĂŁo expostas. “PrĂĄticas e de alta resistĂŞncia, as prateleiras para FkPDUDVIULJRUtÂżFDVVmRIDEULFDGDVHPDoRFDUERQR FRP DFDEDPHQWRV VXSHUÂżFLDLV DQWLFRUURVLYRV TXH

44

sĂŁo apresentados de dois tipos: primer + epĂłxi e o revolucionĂĄrio Capanyl-Rilsan poliamidaâ€? explica Longhi, sobre os modelos oferecidos pela Versus. &RQIRUPHRSURÂżVVLRQDOHVWDWpFQLFDpIHLWDDSDU tir de projetos considerando todas as situaçþes TXH SRGHP GDQLÂżFDU R SURGXWR GXUDQWH D PRYL mentação nos corredores. Indagado sobre como promover a manutenção da proteção anticorrosiva que acompanha os produtos, Longhi conta que a limpeza ideal ĂŠ a feita Ă  base de ĂĄgua, sem produtos abrasivos. “Ademais, os produtos devem ser movimentados de baixo para cima, sem serem arrastados, pois desta forma SRGHULDP GDQLÂżFDU R DFDEDPHQWR GLPLQXLQGR VXD vida Ăştilâ€?. Armazenagem e estocagem Sobre os processos de armazenagens e a estocagem, ĂŠ importante ressaltar que enquanto o primeiro ĂŠ feito em longo prazo e em condiçþes esSHFtÂżFDVSDUDRFRQVXPRDHVWRFDJHPpUHDOL]DGD em curto prazo de tempo, onde o recurso serĂĄ alojado provisoriamente, ou seja, o produto tem saĂ­da rĂĄpida. Devido Ă  quantidade de nĂşmero de cargas que entram e saem do sistema por hora, ĂŠ possĂ­vel determinar o nĂşmero de unidades a armazenar e a expedir durante o funcionamento, uma vez que a movimentação de materiais estĂĄ relacionada com os nĂ­veis de produção e saĂ­da de produtos, alĂŠm de o mĂĄximo de aproveitamento dos espaços Ăşteis existentes nas unidades de armazenagem. 3RU ÂżP JUDQGH SDUWH GRV DUPD]pQV IULJR UtÂżFRV LQYHVWH QRV VHUYLoRV GH IRUQHFLPHQWR GH energia elĂŠtrica a caminhĂľes e contĂŞineres, bem como vistorias, lavagem, desinfecção e forração de veĂ­culos, visando garantir a mesma qualidade de DUPD]HQDJHP IHLWD QRV SUySULRV IULJRUtÂżFRV &RP isso, acabam proporcionando o mesmo sistema de armazenagem e, assim, a qualidade da carne nos transportes para a venda.


47


geral AveSui encerra com sucesso de pĂşblico e negĂłcios de R$ 400 milhĂľes A 12ÂŞ edição da Feira Latino-americana de Aves e SuĂ­nos, a Avesui 2013, realizada entre 14 e 16 de maio, terminou com o balanço de 17,8 mil visitantes durante os trĂŞs dias de atividades e uma estimativa de R$ 400 milhĂľes em negĂłcios concretizados. O evento, que aconteceu no CentroSul, em FlorianĂłpolis, reuniu mais de 150 empresas nacionais e internacionais e centenas de produtos e serviços dos setores de aves e suĂ­nos. A feira provou que com inovação, tecnologia e conhecimento ĂŠ possĂ­vel reverter o momento de turbulĂŞncia enfrentado pelo mercado no Ăşltimo ano e alcançar resultados positivos em 2013. AlĂŠm dos estandes das empresas, uma das ĂĄreas mais visitadas durante a feira foi a Granja Modelo, uma espĂŠcie de showroom com o que tem de melhor e mais moderno no mercado para criação de aves e suĂ­nos. A presença chinesa no evento, Ă  frente de 60 dos 150 estandes, assim como a de visitantes argentinos, chilenos, americanos, franceses, holandeses, entre outras nacionalidades, tambĂŠm foi destaque, mostrando que a AveSui jĂĄ entrou no calendĂĄrio internacional de eventos do setor. A participação de expositores internacionais na feira dobrou em comparação Ă  edição anterior. 26HPLQiULR7pFQLFR&LHQWtÂżFRTXHLQFOXLXSDL nĂŠis temĂĄticos, como os de Biomassa, LogĂ­stica e de Reciclagem Animal, tambĂŠm teve presença maciça dos visitantes, que vieram atrĂĄs de mais conhecimento e estudos na ĂĄrea. “A edição da AveSui deste ano consolidou ainda mais o evento no cenĂĄrio mundial da avicultura e suinocultura, mostrando sua importância para os setores como multiplicadora de negĂłcios, inovação e conhecimentoâ€?, avaliou Andreia Gessulli, diretora da feira. Segundo ela, as rodadas de negĂłcios entre empresas brasileiras e estrangeiras tambĂŠm foram um ponto alto da feira, o que resultou em diversas parcerias e acordos de cooperação que podem movimentar o mercado nos prĂłximos meses. “O evento cumpriu bem o seu papel, de colocar as pessoas no FHQWURGRVQHJyFLRV´DÂżUPRX$QGUHLDTXHSODQHMD novidades para a prĂłxima edição da AveSui, a ser realizada novamente em FlorianĂłpolis.

ceres Leandro Hackenhaar abordou a importância de estabelecer controles de qualidade na produção. “Se receber uma soja ou um milho de mĂĄ qualidade tem que devolver. NĂŁo adianta compensar com aditivos depoisâ€?, disse. Ele enfocou a necessidade e a importância da prevenção: “aplicar protocolos de biossegurança ĂŠ sempre mais baratoâ€?. No inĂ­cio do painel de suinocultura, a Birchwood Genetics, dos EUA, apresentou as tendĂŞncias para o desenvolvimento genĂŠtico, como a inseminação pĂłs-cervical, a utilização cada vez menor de cĂŠlulas e doses para cada aplicação e a preservação criogĂŞnica do sĂŞmen. “Produzir suĂ­nos ĂŠ uma ciĂŞncia mas tambĂŠm ĂŠ uma arte. Bem tratado, o animal melhora seu potencial produtivo e para isso ĂŠ fundamental dar treinamentos para os funcionĂĄrios. Nos EUA, a rotatividade caiu bastante, para 30% ao ano na linha de produção e a atividade estĂĄ um pouco menos nas mĂŁos de famĂ­lias e mais nas de grandes empresasâ€?, explicou o diretor tĂŠcnico da Agroceres PIC, JosĂŠ Henrique Piva. Nas Ăşltimas dĂŠcadas, os Estados Unidos reduziram o nĂşmero de matrizes (hoje em 45 milhĂľes), mas ampliaram o volume de abates (60 milhĂľes/ ano), fruto das melhorias genĂŠticas e da otimização da produção. “O mercado americano deixou de ser importador para ser exportador, atendendo hoje paĂ­ses como JapĂŁo, China e Coreia do Sulâ€?, disse Piva.

GenÊtica e qualidade da ração No últimos painÊis da AveSui 2013, o destaque foi a experiência americana na evolução da produção e no desenvolvimento genÊtico e os cuidados necessårios para produzir uma ração de qualidade. No painel de avicultura, o gerente tÊcnico da Agro-

48

Foto: Divulgação


geral

18ª FEIRA INTERNACIONAL DE REFRIGERAÇÃO, AR CONDICIONADO, VENTILAÇÃO, AQUECIMENTO E TRATAMENTO DO AR

RINO COM

O FUTURO ESTA NO AR 250 EXPOSITORES + DE 550 MARCAS

DO BRASIL E DO EXTERIOR

30 MIL

VISITANTES/COMPRADORES

+,(+,

:,;,4)96+, *,5;96+, ,?76:0h³,: 040.9(5;,: SÃO PAULO - SP DAS 13 H ÀS 20 H VISITE O MAIOR E MAIS COMPLETO EVENTO DO SETOR NA AMÉRICA LATINA.

ÁREA TOTAL DE

38 MIL M2

Evento simultâneo:

.(9(5;((.69(4,:46(:<( *9,+,5*0(3(5;,*07(+( i9Í70+6,-Í*03(*,::, H MLIYH] >>>-,)9(=(*64)9

(

05 (7Í. 56:: *<9;( ,)662 * 56-(

Local:

Colaboradores:

Apoio de Divulgação:

Apoio Institucional:

Organização e Promoção:

49


acontece

Seara lança linha infantil com personagens da Turma da MĂ´nica Aliando qualidade, saudabilidade e diversĂŁo, a Seara anuncia mais uma novidade para unir geraçþes que buscam alimentação saborosa e equilibrada: uma linha de produtos infantis com os personagens da Turma da MĂ´nica. O lançamento acontece em junho, mas os novos produtos foram apresentados no estande da empresa na APAS 2013, realizada de 6 a 9 de maio, no Expo Center Norte, em SĂŁo Paulo. A Linha Seara Turma da MĂ´nica traz 11 opçþes: os Empanados de Frango (Filezinho, Chikenitos Tradicional, Chikenitos Cenoura e Chickenitos Queijo), Mortadela de Frango, HambĂşrguer de Frango, Salsicha e Mini Salsicha de Frango, PĂŁo de Queijo, Batata Frita, e a nova Mini Lasanha de Frango. Toda a linha foi desenvolvida cuidadosamente, considerando as necessidades do pĂşblico infantil. Ă&#x2030; enriquecida com vitaminas, ferro e zinco, tem teor reduzido de sĂłdio e gordura, ĂŠ rica em proteĂ­nas Ă  base de carne de frango e utiliza farinhas especiais e matĂŠrias primas de alta qualidade. As novas embalagens sĂŁo mais coloridas e atrativas, estampadas com os queridos personagens MĂ´nica, Cebolinha, Magali e CascĂŁo. AlĂŠm de garantirem melhor visibilidade nos pontos de venda, as embalagens agora destacam o valor nutricional dos produtos e apresentam de maneira simples e didĂĄtica o modo de preparo dos alimentos. â&#x20AC;&#x153;Nossa parceria com Mauricio de Sousa, uma referĂŞncia hĂĄ 50 anos no segmento infantil, agrega muito valor Ă  marca Seara, reconhecida pela qualidade e respeito ao consumidor. Temos uma linha infantil em nosso portfĂłlio e agora vamos deixa-la mais visĂ­vel e ampla, expandindo nossa atuação no segmento infantil e reforçando nossa par-

50

ticipação no mercado de alimentos industrializadosâ&#x20AC;?, destaca o diretor de marketing da Seara, Antonio Zambelli. Em 2012, os empanadinhos Turma da MĂ´nica representaram 13% do volume vendido da categoria â&#x20AC;&#x153;Pequenos Moldadosâ&#x20AC;?, segundo a Nielsen. Todas as versĂľes serĂŁo disponibilizadas em seus tamanhos atuais: frango empanado (Chickenitos) em caixas de 300 gramas; a Salsicha e a Mini Salsicha de Frango em pacotes de 500 e 250 gramas; a embalagem de HambĂşrguer de Frango contĂŠm 672 gramas; e o pacote de Batata Congelada e de PĂŁo de Queijo, 400 gramas. JĂĄ a inovação da linha, a Mini Lasanha de Frango, estarĂĄ disponĂ­vel em embalagem de 350g â&#x20AC;&#x201C; um prato de fĂĄcil e rĂĄpido preparo para o pĂşblico infantil. Mais novidades com os personagens de Mauricio de Sousa estĂŁo previstas para o segundo semestre, uma vez que a Seara tambĂŠm obteve os direitos de uso da linha Turma da MĂ´nica Jovem.

Sobre a MSP - A Mauricio de Sousa Produçþes (MSP) Ê a empresa responsåvel pela produção de histórias em quadrinhos, desenhos animados, criação e desenvolvimento de personagens, licenciamento de produtos e todos os projetos UHODFLRQDGRVFRPDV¿JXUDVGD7XUPDGD0{QLFD e demais personagens de Mauricio de Sousa. Possui o quarto maior estúdio do setor no mundo e, em sua trajetória, que jå dura mais de 50 anos, conquistou aproximadamente 86% do mercado brasileiro na årea de quadrinhos infantojuvenis, nas bancas. Nas livrarias, seus números WDPEpP VmR VLJQL¿FDWLYRV FRP XPD PpGLD GH 1 milhão de exemplares vendidos ao ano. No licenciamento, Ê a empresa número um do Brasil e trabalha com cerca de 100 empresas nacionais e internacionais, que utilizam seus personagens em aproximadamente 2.500 produtos.


acontece

Sadia e Batavo apoiam os Jogos Olímpicos Rio 2016™ José Antonio Fay e Carlos Arthur Nuzman

O Comitê Organizador dos Jogos Olímpicos e Paralímpicos Rio 2016™ (Rio 2016™) e a BRF anunciaram, dia 21 de maio, que as marcas Sadia e %DWDYRVHUmRDSRLDGRUDVR¿FLDLV QtYHO GRV-RJRV Olímpicos do Rio de Janeiro nas categorias Alimentos Embalados e Lácteos, respectivamente. O Presidente do Rio 2016™, Carlos Arthur Nuzman, celebrou o acordo. “Sadia e Batavo são marcas que desfrutam de enorme empatia do consumidor brasileiro e têm um histórico de envolvimento com o esporte. O acordo funcionará como uma excelente plataforma para engajar a população e reforçar nosso compromisso com os atletas e a comunidade esportiva do país. São mais duas marcas de imenso prestígio a acreditar no projeto dos Jogos, o que nos deixa muito contentes e orgulhosos”, disse. Presidente da BRF, José Antonio Fay completou: “Essa será a primeira vez que os Jogos Olímpicos e Paralímpicos acontecerão no Brasil, um momento aguardado por todos nós, e do qual não poderíamos ¿FDU GH IRUD $V PDUFDV 6DGLD H %DWDYR VmR SHU feitas para disseminar a prática esportiva por todo o país. Ambas possuem potencial para impactar positivamente a vida dos brasileiros”, argumentou o executivo.

H DV ¿OKDV GH IXQFLRQiULRV GD IiEULFD LQVWDODGD QD cidade. “O apoio ao Rio 2016™ é a coroação para a estratégia da plataforma de esportes da Sadia”, disse o vice-presidente de mercado interno da BRF, José Eduardo Cabral. “O esporte é um dos pilares estratégicos da marca, que entende que investir em grandes atletas é uma forma de inspirar gerações e disseminar valores. A marca acredita no esporte como uma forma prazerosa de levar uma vida mais saudável e equilibrada”, completa. A Batavo também sempre esteve próxima do mundo dos esportes, tanto por meio de patrocínios à grande paixão nacional, o futebol, quanto por meio de ações de incentivo a práticas saudáveis, como apoio a corridas de rua e academias. Mas este, sem dúvida, é o seu maior envolvimento com o esporte. “A participação dos parceiros comerciais é fundamental para a organização dos Jogos. A assinatura de acordos com a BRF nessas duas categorias demonstra o crescente interesse do setor privado em participar do evento. Contar com Sadia e Batavo como apoiadores engrandece o projeto”, acrescentou o diretor-geral do Rio 2016™, Sidney Levy.

Parceira do esporte - O engajamento da Sadia com os esportes Olímpicos é antigo. A marca patrocina a Família Sadia – 24 atletas de alto rendimento –, bem como as Confederações Brasileiras de Judô, Ginástica e Desportos Aquáticos. Além desses patrocínios, a marca possui outras iniciativas de apoio ao esporte com foco na inclusão social, como o patrocínio aos atletas do Instituto Lançar-se para o Futuro, no Rio de Janeiro, que promove o desenvolvimento de crianças e jovens pela iniciação e prática desportiva do atletismo; e o Projeto Ginástica Rítmica de Toledo (PR), criado SHODPDUFDHPSDUDEHQH¿FLDUDFRPXQLGDGH

51


acontece

Aurora lança novos produtos na APAS, em São Paulo A Coopercentral Aurora Alimentos lançou em maio, durante a feira da Associação Paulista de Supermercados (APAS), seis novos produtos da linha de Sanduíches e de Pratos Prontos Individuais, três de linguiças e um produto para os consumidores da região norte e nordeste do Brasil, todos orientados para a praticidade, sabor e qualidade nutricional. Os lançamentos, além de irem de encontro com as necessidades dos consumidores, aumentam a exposição da marca e fortalecem o mix da Aurora, observa o diretor comercial Leomar Somensi. Sanduíches - A nova linha de sanduíches Mr. Burger Aurora, elaborados com hambúrgueres maiores que o tradicional e grelhados, estreia com o Mr. Burger X-Burger com molho Barbecue, feito com hambúrguer grelhado de carne bovina, fatia de queijo mussarela e saboroso molho Barbecue, além do pão com gergelim. Outro reforço é o Mr. Burger X-Chimichurri com maionese, preparado com hambúrguer sabor chimichurri grelhado, fatia de queijo mussarela e molho maionese, além do pão com gergelim. Cada um pesa 170 gramas. Ambos são congelados, têm validade de 180 dias e vêm embalados em caixas de 3,06 kg com 18 unidades de 170g.

Pratos prontos - A Aurora também apresenta quatro novas variedades em Pratos Prontos na linha Aurora Prático e Gostoso, formada por pratos prontos individuais que unem praticidade e sabor. Todos são oferecidos ao consumidor congelados, com validade de 180 dias e embaladas em caixas de 4,2kg com 12 caixetas de 350g. O Talharim a Parisiense é elaborado com a massa fresca do talharim, com molho branco, ervilhas, pedaços de presunto e frango e um toque de tempero caseiro. Já o Talharim ao sugo com Almôndega é elaborado com a massa fresca do talharim, com molho de tomate ao sugo, queijo parmesão, cubos de tomate e um toque de tempero caseiro, além de

52

uma porção de Almôndegas Aurora. O Nhoque a Bolonhesa, por sua vez, une a tradicional receita do nhoque ao molho bolonhesa com toque de tempero caseiro. E para completar o pacote de lançamentos tem a Lasanha Presunto e Queijo, preparada com ingredientes selecionados combinados com presunto e queijo, molho ao sugo e com cobertura suave de molho branco. Linguiças Case de sucesso nacional, as linguiças produzidas pela Aurora são consumidas em todo o País, no cotidiano das famílias brasileiras e nos momentos de festas e comemorações. E para reforçar ainda mais esse grupo de produtos, entram em campo mais três estrelas: linguiça calabresa enroladinha 800g, linguiça churrasco 800g e linguiça churrasco mini 5kg. A linguiça calabresa enroladinha Aurora e a linguiça churrasco Aurora vêm embaladas em caixas de 16 kg com 20 pacotes de 800 gramas, com validade para 120 dias. Estes produtos concorrem com as linguiças porcionadas e embaladas e terão como canais de venda pequenos, médios e grandes autosserviços. A Linguiça Churrasco Mini Aurora destina-se ao mercado nacional, ampliando a presença em churrascarias e no mercado do food service, com maior rendimento e preço competitivo. Vem embalada em caixas de 25 kg com 5 pacotes de 5kg e validade de 120 dias. Norte e Nordeste - Um produWR D¿QDGR FRP D SUHIHUrQFLD GR H[ igente consumidor das regiões norte e nordeste do País também faz parte dos lançamentos: o lanche de frango quadrado. Com o lanche de frango no formato quadrado tem-se o fatiamento ideal para o pão de forma. Os canais de vendas são as padarias, pequenos, médios e grandes autosserviços e atacados, sendo o produto distribuído em caixas de 5kg com 2 peças de 2,5kg e validade de 120 dias.


acontece

Nova campanha institucional marca evolução da PerdigĂŁo A PerdigĂŁo, marca da BRF apta a democratizar o acesso a alimentos prĂĄti-cos e nutritivos, estreou uma nova campanha institucional para reforçar os atributos GDPDUFDQRGLDGHPDLRÂł2VÂżOPHV chamam atenção para o fato de que as coisas boas da vida sempre sĂŁo comemoradas em ocasiĂľes especiais, entre elas, um jantar em famĂ­lia, churrasco entre amigos e almoço de negĂłciosâ&#x20AC;?, revela o diretor de marketing do segmento de carnes da BRF, Eduardo Bernstein. A PerdigĂŁo acredita que esses momentos merecem uma comida gostosa, preparada com os melhores ingredientes, por quem realmente entende do assunto e estĂĄ no mercado hĂĄ quase 80 anos. Com o mote â&#x20AC;&#x153;PerdigĂŁo. Viver dĂĄ uma fomeâ&#x20AC;?, os vĂ­deos de 30 e 10 marcam um momento de evolução da marca, que estĂĄ sempre atenta Ă s necessidades e demandas de consumidores ĂĄvidos por novidades, qualidade e praticidade. Criada pela Talent, nova agĂŞncia de publicidade da PerdigĂŁo, os comerciais estĂŁo sendo veiculados em todo o paĂ­s nos canais Globo, Band, Record e Rede TV. â&#x20AC;&#x153;Todos os vĂ­deos serĂŁo acompanhados de um sonoro HPDUFDQWH3HUGLJmRJmRJmRXPDPDQHLUDFULDWLYDSDUDÂż[DUDLQGDPDLVDPDUFDMXQWRDRFRQVXPLGRU´ DÂżUPD%HUQVWHLQ 3DL[mR1DFLRQDO Ainda em 2013, a PerdigĂŁo adquiriu a cota de title sponsorship do maior campeonato de futebol nacional, a Copa do Brasil, que se chamarĂĄ Copa PerdigĂŁo do Brasil atĂŠ 2015. â&#x20AC;&#x153;Nossa estratĂŠgia ĂŠ estar cada vez mais presente na rotina do brasileiro e, para isso, nada melhor que o futebol, um das maiores paixĂľes nacionaisâ&#x20AC;?, explica o diretor da BRF.

Marluvas apresenta ao mercado a sua nova marca A Marluvas Calçados de Segurança apresenta ao mercado o redesenho de sua marca. A nova marca continua forte e sĂłlida, porĂŠm, com linhas mais leves para traduzir os valores da empresa. AlĂŠm disso, a letra â&#x20AC;&#x2DC;Mâ&#x20AC;&#x2122; ganhou barras inclinadas, mais modernas, que representam proteção e lembram o solado caracterĂ­stico dos calçados. Durante 40 anos, a Marluvas construiu uma reODomRGHFRQÂżDQoDFRPRPHUFDGRPDQWHQGRXPD posição tradicionalmente reconhecida, atravĂŠs da qualidade de seus produtos e a excelĂŞncia no atendimento. A nova marca ĂŠ mais um passo na evolução da empresa, uma comemoração para as muitas mudanças. SĂŁo seis novas unidades, com o objetivo de XPD SURGXomR PDLV HÂżFLHQWH H QRYDV WHFQRORJLDV que garantem segurança e leveza, como a M Micro, produto inovador que substitui o couro. Sem falar no novo design de solado â&#x20AC;&#x201C; mais dinâmico, confortĂĄvel e seguro â&#x20AC;&#x201C; e no novo sistema de logĂ­stica adotado,

cujas vĂĄrias melhorias garantem que os produtos cheguem com mais rapidez aos milhares de clientes. â&#x20AC;&#x153;Chegaram os novos tempos, e a nova marca ĂŠ o sĂ­mbolo do compromisso com a inovação e a segurança. SĂŁo mudanças de dentro para fora que deixam nossa empresa ainda mais preparada para o futuro. Uma nova marca para uma Marluvas cada YH]PDLVFRQÂżiYHO´JDUDQWHDHPSUHVD

53


acontece

Risco apresenta sĂŠrie superior de embutideiras na IFFA Uma das lĂ­deres mundiais no fornecimento de mĂĄquinas e sistemas para processamento de carnes para a indĂşstria alimentĂ­cia, a Risco, fundada hĂĄ mais de 45 anos, conquistou a posição de destaque no mercado mundial e reconhecimento como pioneira no desenvolvimento de novas soluçþes e novos processos. Na recente feira internacional destinada a toda a cadeia de processamento de carnes, IFFA, realizada em Frankfurt, Alemanha, a companhia lançou sua sĂŠrie RS-600 de embutideiras de pleno vĂĄcuo. A sĂŠrie pode ser perfeitamente sincronizada com clipadoras automĂĄticas de alta velocidade e com a maioria dos acessĂłrios Risco, garantindo satisfação completa e mĂĄxima produtividade para a indĂşstria de larga escala. A sĂŠrie RS-600 inclui 6 modelos adequados para a produção em larga escala de produtos tradicionais tais como salame, linguiças e produtos emulsionados, bem como para produtos contemporâneos como pratos prontos. Em particular, o modelo RS-650 foi especialmente projetado para embutimento de presuntos de alta qualidade a partir de grandes pedaços de mĂşsculos inteiros. AlĂŠm da sĂŠrie RS-600, a empresa apresentou o sistema de carne moĂ­da porcionada em bandejas RS-920, GHVWLQDGRjDOWDSURGXomRGHFDUQHPRtGDERYLQDVXtQDRXGHDYHV2Ă&#x20AC;X[RFRQWtQXRGRSURGXWRHDDomR mecânica da faca garantem uma alta e constante qualidade na aparĂŞncia das porçþes, padronização das dimensĂľes do bloco da carne, porcionamento preciso e alta produtividade. Mais detalhes no website www. risco.it ou pelo e-mail risco@risco.it.

Krominox investe em novo galpĂŁo para agilizar entregas Com o objetivo de trazer ainda mais qualidade e facilidade na entrega de seus produtos, a Krominox acaba de implementar um novo Centro de Distribuição (CD). O novo endereço foi idealizado e constituĂ­do apĂłs anĂĄlise e planejamento logĂ­stico, visando, alĂŠm de ampliar a capacidade, buscar maior rapidez nas entregas. Localizado em Jandira, a 30 km da Capital de SĂŁo Paulo e a poucos minutos das Rodovias de acesso ao interior do estado, o CD encontra-se prĂłximo aos principais parceiros de manufatura do processo de fabricação da Krominox. A ĂĄrea foi completamente reformada e possui 3.000 m² de espaço coberto para alocar os produtos. A outra novidade ĂŠ que a empresa, jĂĄ consolidada H FHUWLÂżFDGD SHOD ,62  FRP R HVFRSR o qual engloba a gestĂŁo de fabricação de tubos e conexĂľes de aço inoxidĂĄvel, reforça o seu estoque, investindo diretamente na comercialização de conexĂľes em aço carbono. Esse incremento do portfĂłlio vem ao encontro das necessidades dos segmentos de mercado aos quais atua. â&#x20AC;&#x153;Nos Ăşltimos anos a Krominox teve um crescimento bastante acelerado e o endereço da Matriz, HP 6mR %HUQDUGR GR &DPSR ÂżFRX SHTXHQR QRV

54

obrigando a realizar a ampliaçãoâ&#x20AC;?, conta o diretor comercial Claudio Bombassei. Com o investimento, a estimativa da empresa ĂŠ continuar em ascensĂŁo em 2013. AlĂŠm do novo espaço e nova linha de produtos, a empresa conta DWXDOPHQWHFRPSURÂżVVLRQDLVHVSHFLDOL]DGRVSDUDR controle de gestĂŁo. â&#x20AC;&#x153;Muitos empresĂĄrios preocupam-se com o lucro de hoje e nĂŁo investem para acompanhar o cresciPHQWR TXH VHUi UHĂ&#x20AC;HWLGR DPDQKm H HVVH HUUR QyV da Krominox nĂŁo vamos cometer. Estamos no controle e engajados na reestruturação e gestĂŁo da nova realidade e a abertura deste novo galpĂŁo serĂĄ imprescindĂ­vel para dar suporte ao crescimento da empresa, principalmente por conta da expansĂŁo dos QHJyFLRVHP´DÂżUPD


acontece

Big Dutchman aprimora tecnologias e projeta investimentos para o 2° semestre no mercado de suínos Ainda receoso devido às últimas perdas, o merFDGRGHVXtQRVQR%UDVLOHVSHUDJDQKDUPDLVFRQ¿ ança nos próximos meses e projeta investimentos para o segundo semestre de 2013. Mesmo tímidas, as aplicações esperadas passam diretamente pela busca dos produtores por tecnologia e automação, característica importante para manter o setor movimentado e em desenvolvimento. Atualmente priorizando a redução de gastos com mão de obra, que está em falta, e melhorias de resultados, os criadores de suínos devem investir em produtos modernos, levando as empresas do setor a aprimorarem seus produtos. Essa perspectiva mostra que as indústrias apostarão na inovação da atual cadeia produtiva, esperando uma mudança de mercado com a volta ao crescimento e novos investimentos. Preparada para este cenário, a Big Dutchman Brasil atuará ao lado dos produtores como sempre fez, levanto até eles novas tecnologias, soluções e melhorias de produtos. Líder mundial em equipamentos para avicultura e suinocultura, a Big Dutchman é uma empresa que busca constantemente aprimorar novas tecnologias para o mercado brasileiro. “A Big Dutchman tem se voltado para o mercado de suínos, não como uma linha complementar de vendas, mas sim com a dedicação que o mercado exige. Com preços competitivos, estamos trazendo o que há de mais moderno para o setor e disponibilizando as reais adaptações necessárias ao Brasil”, revela o gerente comercial do departamento de suínos da multinacional, Vilceu Almeida de Oliveira. “Estamos prontos para ajudar o mercado”, completa o gerente geral de vendas da Big Dutchman Brasil, Ricardo Santanna

Atenta a inovações, a multinacional alemã oferece opções vantajosas, como o aquecedor Jet Master, que alcança 100% de capacidade térmica e se enquadra nas principais características procuradas pelos criadores – alto rendimento, economia e segurança, entre outros benefícios. “Disponível para operar com gás natural ou propano, este aquecedor foi desenvolvido com alta tecnologia e é controlado por meio de um termostato. Promovendo baixo consumo e economia, seu custo-benefício vale o investimento e mostra-se muito superior a modelos antigos, utilizados até hoje em várias propriedades”, garante a empresa. Contando com um ventilador interno, o Jet Master oferece grande variedade de trabalho e distribui o ar quente de forma ideal por todo o galpão. O sistema de segurança do equipamento é outro destaque, já que desliga o aparelho automaticamente caso algum problema ocorra, evitando vazamento de gás não queimado. Para completar, o produto da Big Dutchman traz um novo Burner Control Unit (BCU) em seu interior, que é capaz de equilibrar as temperaturas desiguais dentro da área de criação utilizando apenas a circulação de ar. O aquecedor também não necessita de conexão com chaminés, pois o calor gerado é 100% EHQp¿FRDRVDQLPDLV Para o Brasil, o modelo GP 70 do Jet Master é o mais indicado, porém, a Big Dutchman também trabalha com as versões ERA 33, GP 14, GP 40 e GP 95. Para saber mais, entre em contato com a empresa.

Aquecedores modernos - Manter galpões com temperaturas ideais é fundamental para a saúde dos animais. Em regiões onde as mudanças climáticas são mais comuns, essa preocupação é recorrente e leva o criador a procurar sistemas de aquecimento modernos e com ótimo custo-benefício. Não por acaso, estes modelos empregam cada vez mais tecnologias e suas vendas crescem ano após ano.

55


acontece

Akso inaugura nova sede em SĂŁo Leopoldo, RS A Akso Produtos EletrĂ´nicos inaugurou sua nova sede em abril, dia 24, com um coquetel que reuniu colaboradores, clientes, parceiros e familiares. No evento, a diretora comercial e fundadora da empresa, Tatiane Seibel, na companhia do diretor tĂŠcnico, o engenheiro Marcelo Carraro, falou sobre a realização do projeto e sobre a histĂłria da empresa. AlĂŠm de agradecer a todos os colaboradores pelo comprometimento e empenho dedicado na construção da nova sede, ela reforçou todo o suporte dado tambĂŠm para o sucesso e crescimento da empresa ao longo dos seus 10 anos de existĂŞncia. â&#x20AC;&#x153;O crescimento da Akso aconteceu de forma sĂłlida e permeado pelos princĂ­pios da ĂŠtica. Estamos muito felizes em poder compartilhar esse momento com nossos amigos e parceiros que tambĂŠm fazem parte dessa histĂłriaâ&#x20AC;?, disse Tatiane. O novo prĂŠdio, que conta com uma ĂĄrea total de 800 m², propiciarĂĄ Ă  empresa um aumento no nĂ­vel organizacional, permitindo que continue crescendo FRPVROLGH]HVHJXUDQoDÂłRTXHFHUWDPHQWHUHĂ&#x20AC;HWLUi no aumento da qualidade dos serviços prestados aos seus clientesâ&#x20AC;?, completou. A Akso atende todo o Brasil, fornecendo instrumentos de medição para variados segmentos, alĂŠm de prestar serviços de calibração.

ExpoZebu: Alta obteve alto desempenho nas pistas A alta qualidade genética dos animais pôde ser conferida durante a 79º Edição da ExpoZebu, realizada em Uberaba (MG), entre os dias 3 e 10 de maio, com destaque para a progênie dos touros da bateria da Alta nas pistas do Nelore e Nelore Mocho. A raça Nelore foi a que teve maior participação, com 722 animais inscritos no Nelore Padrão, onde VmR¿OKRVGHWRXURVGDEDWHULDGD$OWD2VWRX ros Bitelo SS, Basco SM, Jeru BRUM, Fricks Cocal, Guincho de Naviraí e Donato de Naviraí foram os que apresentaram maior número de progênie na pista. Entre os premiados nas diversas categorias, como Campeões ou Reservado Campeões, 88% são ¿OKRVGHWRXURVGD$OWD Na raça Nelore Mocho, 53% dos animais inscritos e 66% dos premiados são progênie de touros Alta. A progênie de Cartucho MBA, Tecelão SM e %DVFR 60 UHD¿UPDUDP D TXDOLGDGH JHQpWLFD GRV touros da Alta, já observada no Nelore Padrão. Grande nome da ExpoZebu 2013, a progênie do touro Basco SM alcançou todos os principais SUrPLRVVHQGR¿OKRVGH%DVFRR*UDQGH&DPSHmR

56

a Grande CampeĂŁ e a ProgĂŞnie de Pai CampeĂŁ da raça Nelore, tanto na variedade PadrĂŁo quanto na Mocha, fato inĂŠdito na histĂłria do evento. AlĂŠm de sua progĂŞnie acumular o maior nĂşmero de campeonatos, 14 num total de 24 categorias, ou VHMDTXDVHGRVSUHPLDGRVVmRÂżOKRVGH%DVFR Entre eles, o Grande CampeĂŁo Elkro da Nelore PadrĂŁo da FNT, ĂŠ ExpoZebu 2013, o o novo contratouro Elkro da FNT, tado da ÂżOKR GH %DVFR 60 Alta e da vaca Enlevo da Morungaba, foi contratado pela Alta Genetics, e jĂĄ estĂĄ em quarentena na Central. Elkro se destaca pelo volume de carcaça, beleza racial e aprumos corretos. â&#x20AC;&#x153;O Elkro ĂŠ um animal diferenciado que une a beleza racial com a carcaça funcional e atende a atual necessidade do mercado. Com certeza enriquecerĂĄ a bateria da Empresaâ&#x20AC;?, prevĂŞ o gerente de produtos da Alta, Rafael Jorge de Oliveira


acontece

Brasiterm apresenta novo website, mais dinâmico A Brasiterm estĂĄ com um novo website: o www. brasiterm.com.br. Totalmente reformulado, com design moderno e fĂĄcil de usar, no endereço eletrĂ´nico ĂŠ possĂ­vel encontrar documentação dos produtos oferecidos pela empresa e conhecer destaques e lançamentos, alĂŠm de consultar boletins tĂŠcnicos e se cadastrar para receber informativos periĂłdicos. Ă&#x2030; possĂ­vel, tambĂŠm, se informar sobre eventos dos quais a Brasiterm realiza e participa e conferir a relação de todos os representantes da empresa em diversos estados do Brasil.

Farmabase realiza seminĂĄrios com Aurora e Nutreminas A Farmabase e a Aurora realizaram um seminĂĄrio VREUHVDQLGDGHDYtFRODQRÂżQDOGHDEULOHP,Wi 6&  2REMHWLYRGRHYHQWRIRLLQWHJUDURVSURÂżVVLRQDLVGD Farmabase com a equipe tĂŠcnica de avicultura da Aurora, alĂŠm de discutir os impactos zootĂŠcnicos e econĂ´micos causados por doenças que afetam frangos de corte. O SeminĂĄrio contou com a participação dos professores Paulo Lourenço e Antonio Piantino, respectivamente da Universidade Federal de Uberlândia e da Universidade de SĂŁo Paulo, e do mĂŠdico veterinĂĄrio ObiratĂŁ Rodrigues, do laboratĂłULR0HUFRODEDOpPGHSURÂżVVLRQDLVGD)DUPDEDVH MĂŠdico veterinĂĄrio e consultor da Farmabase, JosĂŠ Severino Neto apresentou o â&#x20AC;&#x153;Programa Farmabase â&#x20AC;&#x201C; Ave SaudĂĄvel/Alimento Seguroâ&#x20AC;?, que abordou o papel dos antibiĂłticos no auxĂ­lio da redução e controle da salmonelose em aves. Severino tambĂŠm mostrou aspectos prĂĄticos de farmacologia, avanços genĂŠticos e manejo que interferem nos programas de medicação das aves; alĂŠm dos pontos crĂ­ticos e fatores de sucesso da medicação via ĂĄgua de bebida. â&#x20AC;&#x153;Ă&#x2030; importante trabalhar sempre em função da dose correta dos medicamentos e manejo adequado de sua preparação e fornecimento atravĂŠs da ĂĄgua de bebidaâ&#x20AC;?. O coordenador de ĂĄrea da Farmabase, Rosano Dilceu Immich, falou como maximizar resultados do controle de enterites bacterianas. â&#x20AC;&#x153;Demonstrei os padrĂľes de sensibilidade da Amoxicilina frente ao principal agente causador da Enterite NecrĂłtica, o Clostridium Perfringensâ&#x20AC;?, disse. â&#x20AC;&#x153;Este foi o primeiro de muitos que vamos realizar e que contribuirĂĄ para RIRUWDOHFLPHQWRGDHTXLSH´DÂżUPRX,PPLFK

bactĂŠria causadora da disenteria em suĂ­nos, foi o tema do workshop realizado pela Farmabase e a Nutreminas, dia 30 de abril, no Clube Ponte Novense, em Ponte Nova (MG). A apresentação foi ministrada por Roberto Guedes, professor da Universidade Federal de Minas Gerais (UFMG), e reuniu SURÂżVVLRQDLVGD1XWUHPLQDVHFRQVXOWRUHVGDUHJLmR â&#x20AC;&#x153;A Brachyspira hyodysenteriae ĂŠ uma doença reemergente, ou seja, no passado jĂĄ havia preocupado alguns suinocultores, mas atualmente voltou de forma mais agressiva, tornando-se um tema bastante relevante para ser abordado novamenteâ&#x20AC;?, disse o coordenador de vendas da Farmabase, TĂŠlcio Ferreira, que esteve presente no evento. Para o diretor tĂŠcnico da Nutreminas, JosĂŠ Renato Marinho Monteiro, o encontro foi um alerta para os tĂŠcnicos que atuam na suinocultura, pois a doença, quando acomete um rebanho, ocasiona grandes prejuĂ­zos econĂ´micos. â&#x20AC;&#x153;Ă&#x2030; importante mantermos programas rigorosos de biossegurança, especialmente em relação Ă  quarentena de animais de reposição. Esta ĂŠ a Ăşnica forma de minimizarmos os riscos de contaminação dos nossos rebanhosâ&#x20AC;?.

SuĂ­nos - $V FDUDFWHUtVWLFDV H GHVDÂżRV HQYROYL dos para o controle da Brachyspira hyodysenteriae,

57


tec - tecnologia e ciĂŞncia

-XOLD3HUHLUD3DXOD(LGWH3ULVFLOD.LUFKKRĎ&#x2018;

Nova norma traz regras específicas para o setor frigorífico No dia 19 de abril desse ano foi publicada pelo MinistÊrio do Trabalho e Emprego (MTE) a Norma Regulamentadora nº 36 (NR-36), que trata da segurança e saúde no trabalho em empresas de abate e processamento de carnes e derivados. O objetivo da NR-36 Ê estabelecer os requisitos mínimos para a avaliação, controle e monitoramento dos riscos existentes nas atividades desenvolvidas na indústria de abate e processamento de carnes e derivados destinados ao consumo humano. Nesse sentido, a regulamentação publicada pelo MTE Ê bastante abrangente, tratando de diversos aspectos de saúde e segurança do trabalho, entre os quais: estrutura organizacional com foco em HUJRQRPLD MRUQDGD GH WUDEDOKR SDXVDV SVLFR¿VL ológicas durante a jornada de trabalho, mobiliårio, måquinas e equipamentos, treinamento, vestimentas, ferramentas etc. A regulamentação das condiçþes de trabalho no VHWRUIULJRUt¿FRUHVXOWDGDSUHRFXSDomRGRVUHSUH sentantes da categoria e das autoridades trabalhistas com as estatísticas de acidentes de trabalho e doenças ocupacionais registradas pelo MinistÊrio da Previdência Social nesse tipo de atividade. De acordo com o MinistÊrio da Previdência Social, somente no ano de 2011, foram registrados DFLGHQWHVHyELWRVHPIULJRUt¿FRV A NR-36 entra em vigor 6 meses após a sua publicação, exceto quanto aos itens que demandem intervençþes estruturais de mobiliårio e equipamentos, alteraçþes nas instalaçþes físicas da empresa ou estejam relacionados a concessão de assentos e pausas aos empregados, casos nos quais os prazos variam, podendo chegar a 24 meses. Considerando que a partir de outubro de 2013 a maior parte das disposiçþes constantes da NR36 entrarão em vigor e, portando, jå deverão estar sendo cumpridas, Ê importante que, desde logo, as empresas estejam empenhadas na implementação das exigências trazidas pelo novo regramento. Contudo, alguns aspectos merecem atenção especial para que não tragam riscos trabalhistas para as empresas, como Ê o caso da equiparação salarial. Em diversos itens da norma regulamentadora hå previsão de alternância entre postos de trabalho que demandem diferentes exigências físico-motoras, assim como determinação de que todos os trabalhadores estejam treinados para as diferentes atividades que irão executar. Em que pese essas

58

medidas visem evitar os movimentos repetitivos que podem resultar em doenças ocupacionais â&#x20AC;&#x201C; comuns no setor â&#x20AC;&#x201C;, ao mesmo tempo podem acarretar problemas relacionados Ă  equiparação salarial. Vale lembrar que, de acordo com o artigo 461 da CLT, sendo idĂŞntica a função, a todo trabalho de igual valor, prestado ao mesmo empregador, na mesma localidade, corresponderĂĄ igual salĂĄrio, sem distinção de sexo, nacionalidade ou idade. Em razĂŁo disso, ĂŠ importante que os empregadores estejam atentos quando da organização do rodĂ­zio das atividades, uma vez que empregados inseridos no mesmo grupo de rodĂ­zio deverĂŁo estar na mesma faixa salarial, salvo se tiverem diferenças de, no mĂ­nimo, dois anos de serviço na função. 1RTXHGL]UHVSHLWRjÂżVFDOL]DomRSHOR0LQLVWpULR do Trabalho e Emprego (MTE), destaca-se que o descumprimento das normas regulamentadoras pode ensejar a aplicação de multa administrativa por meio da lavratura de auto de infração, sendo que, para cada item descumprido pode ser emitido XPDXWRGHLQIUDomRHPFDGDRSRUWXQLGDGHGHÂżV calização. $ H[HPSOR GR TXH VH REVHUYD QDV ÂżVFDOL]Do}HV relacionadas com a NR-17 (Ergonomia) e NR-12 (Segurança no Trabalho em MĂĄquinas e Equipamentos), quando os Auditores Fiscais do Trabalho LGHQWLÂżFDPH[SUHVVLYRGHVFXPSULPHQWRGDQRUPD o MinistĂŠrio PĂşblico do Trabalho (MPT) costuma ser acionado para uma atuação conjunta. 1HVVHVFDVRVDSDUWLUGRUHODWyULRGDÂżVFDOL]DomR informando o descumprimento das disposiçþes de saĂşde e segurança, o MinistĂŠrio PĂşblico do Trabalho (MPT) instaura procedimento investigatĂłrio que tem sempre por objetivo o compromisso da empresa de se adequar Ă s exigĂŞncias legais, o que pode se dar por meio da assinatura de termo de ajustamento de conduta com previsĂŁo de multas em caso de descumprimento dos prazos estabelecidos. Nas hipĂłteses em que seja frustrada a negociação direta com o MPT, a empresa poderĂĄ ter que enfrentar a exigĂŞncia de adequação por meio de Ação Civil PĂşblica. Atualmente a Justiça do Trabalho, o MinistĂŠrio do Trabalho e Emprego, o MinistĂŠrio PĂşblico do Trabalho e outras entidades pĂşblicas e privadas estĂŁo engajadas na melhoria das condiçþes de saĂşde e segurança dos trabalhadores visando Ă  diminuição dos Ă­ndices de acidente e doenças ocupacionais. Considerando que a NR-36 busca a redução dos aci-


tec - tecnologia e ciência dentes de trabalho e das doenças ocupacionais no VHWRUIULJRUt¿FRFXMRVtQGLFHVVmRFRQVLGHUDGRVDOWRV pelas autoridades trabalhistas e previdenciårias, a expectativa Ê que, a partir do início da vigência da 15VHMDPRUJDQL]DGRVJUXSRVHVSHFt¿FRVGH¿V calização no setor, que devem atuar em conjunto com o MinistÊrio Público do Trabalho. Diante dessas circunstâncias, levando em conta a complexidade da Norma Regulamentadora nº 36, a sua ampla abrangência, bem como os custos relacionados à sua implementação, em que pese o início da vigência esteja previsto apenas para outubro, Ê de extrema importância que as empresas, desde logo, estudem e se organizem para dar

cumprimento às suas disposiçþes. 'HVVH PRGR TXDQGR LQLFLDGDV DV ¿VFDOL]Do}HV as empresas jå estarão adequadas às novas diretrizes estabelecidas pelo MinistÊrio do Trabalho e Emprego, ou pelo menos, poderão apresentar cronograma de adequaçþes que demonstrem comprometimento nesse sentido, o que pode evitar procedimentos mais complexos junto ao MinistÊrio Público do Trabalho. *Julia Pereira, Paula Eidt e Priscila Kirchhoff são advogadas da årea Trabalhista do Trench, Rossi e Watanabe Advogados

59


calendĂĄrio de eventos

SimpĂłsio de Sustentabilidade & CiĂŞncia Animal acontece em agosto O SimpĂłsio de Sustentabilidade & CiĂŞncia Animal (Sisca) ĂŠ um evento promovido pela Faculdade de Medicina VeterinĂĄria e Zootecnia da Universidade de SĂŁo Paulo (FMVZ/USP), por meio do seu Programa de PĂłs-Graduação em Nutrição e Produção Animal (PPGNA) e do seu LaboratĂłrio de AnĂĄlises SocioeconĂ´micas e CiĂŞncia Animal (LAE). O SISCA ĂŠ o Ăşnico evento nacional para tratar HVSHFLÂżFDPHQWH Âą VRE R SRQWR GH YLVWD FLHQWtÂżFR e prĂĄtico â&#x20AC;&#x201C; o tema da sustentabilidade aplicado Ă  CiĂŞncia Animal. A produção animal apresenta uma grande responsabilidade social e econĂ´mica no que se refere ao IRUQHFLPHQWR GH ÂżEUDV DOLPHQWRV H VHUYLoRV SDUD a sociedade. Por outro lado, ĂŠ uma atividade que apresenta uma forte inter-relação com o ambiente e com o homem, de uma forma geral. Dessa maneira, a produção e a ciĂŞncia dos aniPDLV SDVVDP D VHU IRUWHPHQWH GHVDÂżDGRV 2 HQ tendimento dessas relaçþes e dessas demandas â&#x20AC;&#x201C; visando nĂŁo apenas o seu atendimento atual, mas tambĂŠm a prospecção de novas tendĂŞncias

â&#x20AC;&#x201C;, ĂŠ o objetivo principal do Sisca, assim como a GLVFXVVmR HQWUH SURÂżVVLRQDLV GDV GLIHUHQWHV iUHDV que compĂľe a sustentabilidade (tĂŠcnica, ambiental e socioeconĂ´mica). O evento acontecerĂĄ em dois dias, 21 e 22 de agosto, no Campus da USP em Pirassununga (SP). O primeiro dia serĂĄ dedicado a palestras e discussĂľes conduzidas por acadĂŞmicos e cientistas. O segundo dia serĂĄ dedicado a apresentaçþes de empresĂĄrios, tĂŠcnicos especializados e de representantes de segmentos da sociedade.

III Sisca - Simpósio de Sustentabilidade e &LrQFLD$QLPDO Data: 21 e 22 de agosto de 2013 Local: Pirassununga (SP) Realização: USP/FMVZ - Campus Pirassununga 7HO (19) 3565-4224 Site: www.sisca.com.br E-mail: lae@usp.br

BelĂŠm sedia IV ConferĂŞncia Nacional sobre Defesa AgropecuĂĄria A IV ConferĂŞncia Nacional sobre Defesa AgropecuĂĄria, que acontece entre os dias 1° a 4 de outubro, no Centro de Convençþes da AmazĂ´nia, em %HOpP 3$  IRL ODQoDGD RÂżFLDOPHQWH QR GLD  GH maio, e jĂĄ estĂĄ com as inscriçþes abertas. O tema deste ano ĂŠ â&#x20AC;&#x153;Defesa AgropecuĂĄria e Sustentabilidadeâ&#x20AC;?. Durante o lançamento, em BelĂŠm, o superintendente da Agricultura no ParĂĄ, Andrei Castro, destacou a importância do debate para o crescimento do estado e das demais unidades da federação no Norte do paĂ­s, discutindo melhorias nas polĂ­ticas pĂşblicas para o reconhecimento do potencial de produção da regiĂŁo. A conferĂŞncia ĂŠ o maior evento tĂŠcnico da defesa agropecuĂĄria no Brasil e serĂĄ realizada pela primeira vez na regiĂŁo Norte. O objetivo ĂŠ dar visibilidade Ă s açþes de defesa para o desenvolvimento econĂ´mico do paĂ­s com sustentabilidade. A programação inclui palestras, rodas de debates, cursos e mostras tecnolĂłgicas. SĂŁo esperadas cerca de 2 mil pessoas entre autoridades,

60

SUR¿VVLRQDLV H UHSUHVHQWDQWHV GR VHWRU SURGXWLYR UHSUHVHQWDQWHV GH ¿VFDOL]DomR H LQVSHomR DJUR pecuåria, empresårios, agroindústrias, indústrias e distribuidores de insumos agropecuårios, pesquisadores, docentes, estudantes de nível superior e pós-graduação. O evento Ê organizado pelo MinistÊrio da Agricultura, Pecuåria e Abastecimento (Mapa), pela Agência de Defesa Agropecuåria do Parå (Adeparå), pela Federação da Agricultura e Pecuåria do Parå (Faepa) e pela Sociedade Brasileira de Defesa Agropecuåria (SBDA). ,9 &RQIHUrQFLD 1DFLRQDO VREUH 'HIHVD Agropecuåria Data: 1° a 4 de outubro de 2013 Local: Centro de Conv. da Amazônia, BelÊm (PA) Realização: Mapa, Adeparå, Faepa e SBDA Inscriçþes por intermÊdio do site: http://conferencia.defesaagropecuaria.com/


Eventos Paralelos:

06 a 08 de Agosto 2013 São Paulo - Expo Center Norte - 13h às 20h

O EVENTO LÍDER PARA DESENVOLVIMENTO PLETO M O C S I A M A R O G DE PRODUTOS ALIMENTÍCIOS A PONTO DE ENCONTRO ANUAL Em sua 17ª edição a Fi e Hi serão realizadas juntas, proporcionando ao visitante um contato anual com as novas tecnologias e produtos do setor. NUTRACÊUTICOS E SUPLEMENTOS Pela

forte

convergência

entre

as

indústrias

15.000 potenciais visitantes das indústrias Food, Nutraceuticals e Pharma Evento mais completo e abrangente Maior retorno de investimento

farmacêutica e alimentícia, a Fi South America ficará

Conteúdo e Networking

ainda mais completa sendo organizada na mesma

Fi Conferences, Fi Seminar Sessions e Fi Excellence Awards

data e local da CPhI South America, evento que reúne os fornecedores de matérias-primas farmacêuticas, cada vez mais usadas pela indústria alimentícia.

POTENCIAIS COMPRADORES DOS MERCADOS FOOD E PHARMA NO MESMO LOCAL. ESTEJA PRESENTE NO MAIOR PONTO DE ENCONTRO DE SOLUÇÕES EM LIFE SCIENCE DA AMÉRICA LATINA. Apoio Exclusivo:

Parceiro de Pesquisa:

Mídia Oficial:

Realização:

Para mais informações sobre como patrocinar e expor: 55 11 4878-5935 | esanches@ubmbrazil.com.br 61


Vamos dar um tempinho? Combinar meia e sapato nem sempre ĂŠ tarefa fĂĄcil Escolher a cor da meia e do sapato ĂŠ essencial para o homem moderno, principalmente, no ambiente corporativo, onde existe um dress code paUD FDGD SHUÂżO GH SURÂżVVLRQDO 0DV FRPR FRPEL nar a meia com o sapato? Uma regra simples para o homem que quer estar elegante e na moda, combinando seu calçado com a meia, pode ser facilmente seguida. â&#x20AC;&#x153;A meia precisa ser a ponte entre o sapato e a calça, portanto, ela ĂŠ muito importante no vestuĂĄrio e deve sempre combinar com a cor do sapato. Se vocĂŞ estiver usando um sapato preto, a meia deve seguir o mesmo tom do calçado, portanto, precisa

ser preta. O mesmo acontece com um sapato da cor marrom, que deve ser usado com uma meia na cor marromâ&#x20AC;?, explica Luciano GuimarĂŁes, do site Meias em Casa. Segundo o especialista no assunto, apesar das dĂşvidas iniciais a respeito da combinação, o essen-cial ĂŠ seguir a regra e sempre combinar a cor da meia com a cor do sapato. â&#x20AC;&#x153;Saber como combinar meia com sapato ĂŠ bem simples, mas ĂŠ uma ques-tĂŁo que confunde muito os homens na hora de se vestir. O fato ĂŠ que ela deve estar sempre no mesmo tom do sapatoâ&#x20AC;?, acrescenta GuimarĂŁes.

Fonte: o meiaemcasa.com ĂŠ um site especializado em planos de assinatura de meias do tipo social da marca Lupo, maior fabriFDQWHGHPHLDVGRSDtV2VLWHRIHUHFHTXDWURYDULDo}HVGHDVVLQDWXUDHWUrVWLSRVGHPHLDFOiVVLFDDOJRGmRRXUHÂżQDWD

Pense nisso...

â&#x20AC;&#x153;

Coisas menores podem tornar-se momentos de grande revelação quando as encontramos pela primeira vez.â&#x20AC;? (Margor Fonteyn)

â&#x20AC;&#x153;

Cada lição serĂĄ repetida atĂŠ que seja aprendida. Cada lição serĂĄ apresentada a vocĂŞ de diversas maneiras, atĂŠ que a tenha aprendido. Quando isto ocorrer, poderĂĄ passar para a seguinte.â&#x20AC;? (Maine de Biran)

â&#x20AC;&#x153;

Aprender ĂŠ a Ăşnica coisa de que a mente nunca se cansa, nunca tem medo e nunca se arrepende.â&#x20AC;? (Leonardo da Vinci)

â&#x20AC;&#x153;A caridade ĂŠ amada e aprovada por Deus e ĂŠ considerada a principal entre todas as boas açþes. Em verdade, esta palavra abençoada ĂŠ neste sentido, um sol entre as palavras.â&#x20AC;? BahĂĄâ&#x20AC;&#x2122;uâ&#x20AC;&#x2122;llĂĄh, do livro PadrĂŁo de Vida BahĂĄâ&#x20AC;&#x2122;Ă­

62


63


visĂŁo empresarial Desafios e tendĂŞncias de TI para as PMEs TI deixou de ser diferencial e passou a ser fator crĂ­tico para ser competitivo. Embora o suporte efetivo de TI ainda seja uma realidade distante do ideal para as pequenas e mĂŠdias empresas (PMEs), GLÂżFLOPHQWHHVWDVLUmRVREUHYLYHUVHQmRDXPHQWD rem seus investimentos em soluçþes de negĂłcio baseadas em tecnologia. A grande questĂŁo ĂŠ o modelo que estas empresas utilizam para implementar soluçþes de TI em suas organizaçþes. Grande parte delas utiliza serviços de terceiros para implementar alguns sistemas de informatização HQDPDLRULDGRVFDVRVQmRÂżFDVDWLVIHLWDFRPRV serviços prestados. Como resultado, a ideia de que recursos de TI sĂŁo caros e nĂŁo funcionam vai gaQKDQGRIRUoDHID]HQGRFRPTXHDV30(VSUHÂżUDP nĂŁo investir na melhoria de seus sistemas. Mas a realidade ĂŠ que estĂĄ mais do que na hora destas empresas quebrarem os paradigmas e aderirem Ă s inovaçþes proporcionadas pela TI. Em termos de oferta de tecnologias e serviços a custos compatĂ­veis, as PMEs podem encontrar soluçþes que as atendam em todas as ĂĄreas que representam tendĂŞncias de melhores prĂĄticas. Acho, FRQWXGR TXH R JUDQGH GHVDÂżR HVWi QDV SUySULDV empresas em determinar suas prioridades e onde precisam realmente investir. Outro aspecto ĂŠ que a implementação de tecnologia, se nĂŁo for realizada adequadamente com o uso dos componentes necessĂĄrios e corretamente dimensionados, pode se transformar em uma armadilha perigosa, jĂĄ que ĂŠ muito comum se pensar mais no curto prazo e tratar investimentos como custos. Ă&#x2030; preciso que os pequenos e mĂŠdios empresĂĄrios pensem com uma visĂŁo de mĂŠdio e longo prazo, criando um roadmap de crescimento baseado em orçamentos realistas, objetivos claros e prioridades consistentes com investimentos adequados em cada etapa. O ano de 2012 trouxe evidĂŞncias importantes TXHUDWLÂżFDPDWHQGrQFLDGDDGRomRGHWUrViUHDV cruciais da TI: virtualização, cloud computing (computação em nuvem) e redes sociais. Enquanto a virtualização possibilita tornar o gerenciamento e o suporte mais simples e mais barato, a nuvem oferece a oportunidade Ă s empresas de utilizarem tecnologias e soluçþes de ponta por preços dentro de seus orçamentos, alĂŠm de proporcionar a escalabilidade necessĂĄria. A sua adoção ainda depende, contudo, da remoção de barreiras â&#x20AC;&#x153;emocionaisâ&#x20AC;? da VHJXUDQoDHFRQÂżGHQFLDOLGDGHGDVLQIRUPDo}HV Outra tendĂŞncia importante, a mobilidade, vem evoluindo como um instrumento de trabalho fantĂĄstico levando a decisĂŁo para as pontas, trazendo HÂżFLrQFLDHHÂżFiFLDUHGX]LQGRGHVORFDPHQWRVHHFR nomizando tempo. Usado inicialmente para troca

64

de mensagens, acesso a internet e e-mails, hoje Ê difícil imaginar um vendedor, por exemplo, que não tenha poder de decisão onde quer que ele esteja e D TXDOTXHU PRPHQWR 3UR¿VVLRQDLV QHJRFLDP FRP os clientes, em reuniþes de trabalho, acessando informaçþes e aplicativos de negócio atravÊs de um dispositivo móvel. Da mesma forma, equipes de VXSRUWHPRELOL]DGDVVHWRUQDPDOpPGHH¿FLHQWHV H¿FD]HV QR DWHQGLPHQWR DR FOLHQWH (PSUHVDV prestadoras de serviço de informaçþes apostam na mobilidade para oferecer consultas atravÊs de smartphones ou tablets. Mobilidade começa a ser associada tambÊm às mídias sociais. Estas mídias trazem a oportunidade de conhecer a realidade do comportamento de clientes ou consumidores, permitindo açþes comerciais mais efetivas e um atendimento mais preciso. Contudo, embora a presença nas redes sociais jå tenha virado uma espÊcie de palavra de ordem entre os empreendedores, poucos estão usando estas ferramentas de forma efetiva. As redes sociais vieram para revolucionar a relação entre empresa e consumidor. A cada dia, novas possibilidades são descobertas para satisfa]HURFOLHQWHH¿GHOL]iOR2IHQ{PHQRVRFLDOPHGLD cresce como uma bola de neve. Principalmente para DV30(VDFULDomRGHSiJLQDVHRXSHU¿VQDVUHGHV ajuda (e muito!) na consolidação dos negócios, alÊm de ser uma ferramenta de baixo custo. Os benefícios imediatos de se utilizar as redes sociais são: relacionamento com os clientes, levantamento de críticas e sugestþes (as redes funcionam como pesquisa online gratuita), e divulgação de promoçþes de produtos. Assim, diante da lacuna entre oportunidades e uso efetivo, acredito ser bastante provåvel, tal como aconteceu no passado com a presença na internet atravÊs de websites, que o uso intenso das ferramentas associadas às mídias sociais pelas PMEs tenha um crescimento explosivo. O mercado brasileiro, em especial a PME, Ê follower e conservador. Embora, como indivíduos, gostamos de novidades e aderimos imediatamente aos novos håbitos, no ambiente empresarial Ê diferente. O empresårio gosta de referências e de visualizar experiências anteriores. Neste aspecto, o ano de 2012 foi um excelente laboratório e as tecnologias emergentes, que certamente se tornarão XPSDGUmRQRVSUy[LPRVDQRVMiHVWmRVX¿FLHQWH mente testadas para serem usadas em larga escala. Enio Klein Ê gerente geral nas operaçþes de vendas da SalesWays no Brasil e professor nas disciplinas de Vendas e Marketing da Business School São Paulo (www.salesways.com.br)


visĂŁo empresarial O biossistema da inovação exige uma liderança inspiradora ,QRYDomR VLJQLÂżFD PXGDQoD H PXGDQoD H[LJH uma liderança inspiradora. A liderança estĂĄ ligada ao processo de inovação, ao aporte de novas ideias, mĂŠtodos ou soluçþes. Nos dias de hoje, sete entre dez funcionĂĄrios nĂŁo se sentem envolvidos com seu trabalho, disse Dov Seidman, consultor especializado em construir empresas com princĂ­pios. Pior: 84% deles cumprem suas tarefas por medo ou coerção, 12% por motivação e apenas 4% por inspiração, que Seidman acredita ser o Ăşnico modo de gerar uma autĂŞntica cultura de inovação. 3DUDLQWHUYLUHPRSHUDo}HVGHÂżFLWiULDVFULDUQR vas unidades de produção, desenvolver novos produtos ou serviços, incorporar novos procedimentos, reerguer operaçþes ameaçadas de cancelamento ou liberar o espĂ­rito de criatividade sufocado por exigĂŞncias burocrĂĄticas, precisamos de lĂ­deres inspiradores que façam coisas que nunca tinham sido feitas e descubram lugares nunca antes descobertos. O trabalho do lĂ­der ĂŠ mudar. E toda mudança exige que os lĂ­deres busquem ativamente formas de tornar as coisas melhores, crescer, inovar e melhorar. Ă&#x2030; preciso que os lĂ­deres inspirem seus colaboradores a tomar iniciativas. Se hĂĄ uma empresa que pode ser descrita como pioneira em inovação, essa empresa ĂŠ a norte-americana 3M, que começou fabricando lixas e hoje conseguiria encher um supermercado inteiro sĂł com seus 55 mil produtos. A 3M contou, desde o inĂ­cio, com um gestor que encorajava todos os funcionĂĄrios a tomar iniciativas. Seu nome: William McKnight. E foi esse incentivo do lĂ­der ao intraempreendedorismo que fez toda a diferença, mais do que conhecimento, cultura, estrutura ou qualquer outro ingrediente isolado. McKnight percebeu que quando as pessoas pensam em suas conquistas, pensam logo em algum

WLSRGHGHVDÂżR3RUTXr"3HORIDWRGHTXHTXDQGR as coisas sĂŁo estĂĄveis e seguras, ninguĂŠm ĂŠ testado de fato. Podem atĂŠ apresentar um bom desempenho, conquistar promoçþes, atĂŠ mesmo adquirir fama e fortuna. Mas a segurança e a rotina induzem Ă  acomodação. Em contrapartida, as necessidades pessoais e da empresa pĂľem as pessoas cara a cara com o que elas sĂŁo de fato e em que sĂŁo capazes de tornar-se. Nos estudos que realizamos ao longo do tempo VREUH OLGHUDQoD ÂżFRX HYLGHQWH TXH R HVWXGR GR fenĂ´meno da liderança ĂŠ o estudo de como homens e mulheres guiam outras pessoas atravĂŠs da adversidade, da incerteza, da necessidade, dos transtornos, da transformação, da transição, da recuperação, dos novos começos e de outros signiÂżFDWLYRV GHVDÂżRV e R HVWXGR GH SHVVRDV TXH WUL XQIDPVREUHIRUPLGiYHLVGLÂżFXOGDGHVTXHWRPDPD iniciativa diante da inĂŠrcia, que confrontam a ordem estabelecida, que mobilizam pessoas e instituiçþes para enfrentar severas resistĂŞncias. SĂŁo os lĂ­deres inspiradores que fazem as coisas acontecerem. E, para fazer com que aconteçam coisas novas, eles tĂŞm de olhar para fora, para encontrar ideias inovadoras, olhar para alĂŠm das fronteiras conhecidas. Ă&#x2030; preciso que eles questionem o status quo, o imobilismo e a acomodação inspirando todos da sua equipe para novas possibilidades. Wilson Mileris ĂŠ criador de vĂĄrios mĂŠtodos de treinamento e educação de executivos, com ĂŞnfase nas ĂĄreas de Liderança, Motivação, Comunicação e Negociação. Autodidata e pesquisador do comportamento humano, atua hĂĄ mais de 30 anos como conferencista, palestrante e consultor de recursos humanos (www.mileris.com.br)

dica de leitura 3URSRUFLRQDU jV HPSUHVDV FOLHQWHV SURÂżVVLRQDLV GRV yUJmRV GH GHIHVD GR FRQVXPLGRU H GH agĂŞncias reguladoras uma visĂŁo clara da situação dos serviços ao consumidor no Brasil. Com esse propĂłsito o livro â&#x20AC;&#x153;A Era do DiĂĄlogoâ&#x20AC;?, dos autores Roberto Meir, especialista internacional em relaçþes de consumo, e Jacques Meir, especialista em gestĂŁo de marcas, chega ao mercado para ajudar a reduzir a distância entre â&#x20AC;&#x153;o que se diz que faz e o que se faz realmenteâ&#x20AC;?, alĂŠm de aumentar a transparĂŞncia dentro das companhias em tudo o que cerca a qualidade do atendimento aos clientes. O livro nasce, tambĂŠm, com base em experiĂŞncias pessoais dos autores, reconhecidos e renomados no cenĂĄrio das relaçþes de consumo. Em suas 320 pĂĄginas sĂŁo descritos padrĂľes de conduta (ou de problemas com a conduta) das empresas e as principais demandas dos consumidores junto aos ĂłrgĂŁos de defesa do consumidor.

65 65


desenvolvimento pessoal Prospecção de clientes: uma caça por oportunidades Por Carlos Cruz

O vendedor ĂŠ um grande caçador de oportunidades. Por trĂĄs de cada negociação fechada, existe um WUDEDOKRLQYHVWLJDWLYRSDUDTXHRSURÂżVVLRQDOFRQVLJD LGHQWLÂżFDU SRQWRV LPSRUWDQWHV FRPR QHFHVVLGDGHV motivadores de compras e as melhores soluçþes para que cada projeto seja viabilizado. No entanto, antes de colocar em prĂĄtica qualquer tĂŠcnica de venda, ĂŠ preciso passar pela primeira etapa: a prospecção de FOLHQWHVRXVHMDRPRPHQWRGHFRQVWUXLUFRQÂżDQoD e credibilidade, por meio de um relacionamento, com compradores em potencial. Existem situaçþes em que as vendas nascem atravĂŠs de um atendimento receptivo com uma oportunidade, por exemplo, quando o comprador procura a empresa jĂĄ determinado a adquirir uma solução esSHFtÂżFD3RUpPFDVRVFRPRHVVHVVmRFDGDYH]PDLV raros e dependem de questĂľes como investimentos em marketing e indicaçþes, sobretudo no mundo do B2B (Business to Business). Com o mercado cada vez mais competitivo, ĂŠ imSUHVFLQGtYHO TXH RV SURÂżVVLRQDLV DWXHP LQFHVVDQWH mente em busca de oportunidades, que ĂŠ a soma das necessidades a serem atendidas. Nos Ăşltimos anos, a internet tornou-se grande aliada no processo de vendas. AlĂŠm de conter inforPDo}HVVREUHDVHPSUHVDVTXHDMXGDUmRRSURÂżVVLR nal a mapear possĂ­veis necessidades dos clientes realizando uma abordagem consultiva, permite chegar aos tomadores de decisĂľes com mais facilidade, principalmente, apĂłs o surgimento das redes sociais HVSHFtÂżFDV Uma das ferramentas utilizadas ĂŠ o LinkedIn, espaço voltado para negĂłcios e desenvolvimento de carreira, com mais de 150 milhĂľes de usuĂĄrios cadastrados. Por meio dele ĂŠ possĂ­vel estabelecer conexĂľes FRPSURÂżVVLRQDLVGHFDUJRVHOHYDGRVFRPRGLUHWRUHV HSUHVLGHQWHVTXHSRGHPLQĂ&#x20AC;XHQFLDUGLUHWDPHQWHQD decisĂŁo de compra. Outra alternativa ĂŠ a aproximação presencial, situação na qual o alinhamento de repertĂłrio deve ser muito bem utilizado. Segundo Philip Kotler, professor americano conhecido como o pai do marketing, sĂŁo cinco os papĂŠis assumidos pelas pessoas diante de uma compra:  ,QĂ&#x20AC;XHQFLDGRU LQLFLDGRU SHVVRD TXH SULPHLUR sugere a ideia de comprar um produto ou serviço esSHFtÂżFR  ,QĂ&#x20AC;XHQFLDGRUHV GLYHUVRV D GHFLVmR GR FRP SUDGRUSRGHVHULQĂ&#x20AC;XHQFLDGDSRUSRQWRVGHYLVWDRX sugestĂľes;  Tomador de decisĂŁo: pessoa com poder decisĂłrio sobre qualquer componente de uma compra. Por exemplo: por que deve comprar, o quĂŞ, como e

66

onde adquirir o produto;  Comprador: indivĂ­duo responsĂĄvel por efetivar a compra. Por vezes, ele nĂŁo ĂŠ o tomador da decisĂŁo, mas a ele ĂŠ delegado o poder do fechamento no processo da compra;  UsuĂĄrio: que consumirĂĄ o produto ou serviço. Em uma reuniĂŁo, por exemplo, ĂŠ importante aproveitar cada minuto com o cliente e dar espaço para que ele aponte o que realmente precisa. Com isso, as chances de acertar nos argumentos serĂŁo maiores. O problema de um presidente, por exemplo, pode ser a insatisfação dos acionistas pela perda de lucratividade, jĂĄ o do diretor industrial o aumento de custos, o do diretor de marketing o declĂ­nio da participação do mercado e, dos vendedores, a quedas nas vendas. Desta forma, ĂŠ possĂ­vel alinhar o repertĂłrio com cada LQĂ&#x20AC;XHQFLDGRU QR SURFHVVR GH FRPSUD SDUD TXH HP VHJXLGD R YHQGHGRU SURÂżVVLRQDO SRVVD DSUHVHQWDU uma solução adequada. Feiras e palestras tambĂŠm podem servir como boas oportunidades para estreitar o relacionamento com executivos. Antigamente, o vendedor era conhecido por falar muito, tomando algo como 80% do tempo de um encontro de negĂłcios. Hoje, isso deve VHUUHSHQVDGRHLQYHUWLGRRXVHMDRSURÂżVVLRQDOGH vendas deve fazer perguntas assertivas, ouvir muito mais e, na hora de se pronunciar, ser assertivo e usar de informaçþes apresentadas no momento anterior. TambĂŠm nĂŁo podemos deixar de lado as prospecçþes por telefone, a estratĂŠgia mais usada por muitas companhias. Por se tratar de uma relação disWDQWHDVFRQGLo}HVVmRtQÂżPDVGHLGHQWLÂżFDURSHUÂżO da pessoa que estĂĄ do outro lado da linha em uma venda complexa, por exemplo, mas ĂŠ possĂ­vel fazer XPD TXDOLÂżFDomR LQLFLDO GR FOLHQWH H GDV SURYiYHLV oportunidades. 3RUWDQWR DQWHV GH LQLFLDU D FRQYHUVD GHÂżQD XP foco e disponha de todas as perguntas possĂ­veis, com um repertĂłrio para conectar soluçþes as necessidades dos clientes. NĂŁo desestabilizar diante de uma negativa, saber persistir sem demonstrar insistĂŞncia e estar preparado para possĂ­veis questionamentos e SRXFRFDVRWUDQVPLWHPXPDVHQVDomRGHFRQÂżDQoD ao interlocutor. Lembre-se: a pressa pode ser inimiga de uma negociação de sucesso. A ligação ĂŠ mais um passo dentro do processo de vendas e construir uma relação de proximidade pode contribuir. AlĂŠm disso, vale lembrar que qualquer informação transmitida pela pessoa pode servir de base para uma ação estratĂŠgica em vendas. &DUORV&UX] ĂŠ vendedor, treinador de vendas e diretor do Instituto Brasileiro de Vendas (IBVendas) www.ibvendas.com.br


Monitoração de Temperatura e 8PLGDGHVHPßR

(FRQRPLD e facilidade na LQVWDOD™R

RHT-Air: Medição e monitoramento de temperatura e umidade. Conectividade Wireless de alta FRQßDELOLGDGH. ▪Validável segundo requisitos FDA/ANVISA ▪Ideal para centros de distribuição e laboratórios ▪Comunicação Wireless IEEE 802.15.4

Umidade

Temperatura

www.novus.com.br

11 3097-8466


MOBIL

Ingredientes para maior produtividade.

Gerentes de fábricas de processamento de alimentos devem sempre equilibrar a fome por produtividade com a necessidade de segurança dos produtos. Por isso criamos a série Mobil SHC Cibus, uma linha de lubrificantes sintéticos para máquinas de alimentos com registro NSF-H1 feitos não apenas para proteger o seu equipamento, mas também sua marca. É mais uma maneira prática e gostosa em que ajudamos você a aumentar seus lucros. Nós não só fazemos a sua indústria funcionar, nós a fazemos voar! Visite www.cosan.com.br/mobil para mais informações.

TM Todas as marcas comerciais utilizadas nesta peça são marcas comerciais ou marcas registradas da Exxon Mobil Corporation ou de uma de suas subsidiárias, a menos que indicado de outra forma, utilizadas por Cosan Lubrificantes e Especialidades S.A., ou uma de suas controladas, sob licença. © 2012 Exxon Mobil Corporation.


Revista Frigorífico Jun13