Page 1

www.foodirelanddirectory.com

YEARBOOK AND DIRECTORY 2010


Making more of Irish Seafood

To add value to your business: Contact: BIM Seafood Development Centre Clogheen Road, Clonakilty Co. Cork.

www.bim.ie

Email SDC@bim.ie Tel 01 2144280


Serving The Irish Food & Drink Industry “To support the tradition of excellence in Irish food enshrined in the phrase, ‘Rogha gach bia agus togha gach di”, by providing information, analysis and a forum for shared experience to those who shape the Irish food industry”. Food Ireland’s mission statement.

MINISTER’S FOREWORD 0LQLVWHU IRU $JULFXOWXUH )LVKHULHV  )RRG%UHQGDQ6PLWK7'LQWURGXFHVWKH )RRG ,UHODQG <HDUERRN DQG 'LUHFWRU\ DQG H[DPLQHV WKH ELJ LVVXHV IDFLQJ WKH VHFWRULQWKH\HDUDKHDG             BORD BIA FOOD AND DRINK INDUSTRY AWARDS 7KHZLQQHUVRIWKH%RUG%LD)RRGDQG 'ULQN,QGXVWU\$ZDUGVSURYHGWKDW,ULVK IRRG DQG GULQNV FRPSDQLHV FDQ WKULYH GHVSLWHWKHFXUUHQWHFRQRPLFFOLPDWH 

INDUSTRY VIEW ,UHODQGÖVIRRGDQGGULQNFRPSDQLHVKDYH VXIIHUHG GHVSHUDWHO\ WKURXJKRXW  :LWKRXW HQOLJKWHQHG SROLF\ LQWHUYHQ WLRQ IURP *RYHUQPHQW  ZLOO VHH VLJQLILFDQW FDVXDOWLHV LQ ,UHODQGÖV PRVW LPSRUWDQWLQGLJHQRXVVHFWRUZULWHV3DXO .HOO\'LUHFWRU)RRGDQG'ULQN,QGXVWU\ ,UHODQG                          LOGISTICS (GZDUG6ZHHQH\'LUHFWRURI/HDUQLQJ 1DWLRQDO ,QVWLWXWH IRU 7UDQVSRUW DQG /RJLVWLFV DVVHVVHV ORJLVWLFV DQG 6XSSO\ &KDLQ0DQDJHPHQWH[FHOOHQFHLQDYROD WLOHJOREDOHQYLURQPHQW             EXPORTING 7KH ,ULVK ([SRUWHUV $VVRFLDWLRQ KDYH ODXQFKHG WKH QHZ &KDQQHO &OXVWHUV SURJUDPPH WR KHOS GRPHVWLF IRRG DQG GULQNFRPSDQLHVLQH[SRUWPDUNHWV  

SEAFOOD 'HVSLWHPDQ\FKDOOHQJHV%RUG,DVFDLJK 0KDUDVHHVRSSRUWXQLWLHVIRUJURZWKLQ ,UHODQGÖV VHDIRRG VHFWRU DQG KDV EHHQ H[WUHPHO\ DFWLYH LQ QXUWXULQJ WKRVH RSSRUWXQLWLHVWRIORXULVK             ENTERPRISE IRELAND 'LFN /HQHKDQ +HDG RI )RRG DW (QWHUSULVH ,UHODQG RQ WKH RUJDQLVD WLRQÖV UROH LQ DVVLVWLQJ JURZWK DQG FRPSHWLWLYHQHVV LQ WKH ,ULVK )RRG  'ULQNLQGXVWU\                 

MEAT TRACEABILITY 2UJDQLVHGE\WKH)RRG6DIHW\$XWKRULW\ RI ,UHODQG )6$,  LQ DVVRFLDWLRQ ZLWK *6,UHODQGDUHFHQW0HDW7UDFHDELOLW\ FRQIHUHQFH KLJKOLJKWHG WKH QHHG IRU VWDQGDUGV EHVW SUDFWLFH DQG D ZLOOLQJ QHVVWRVKDUHLQIRUPDWLRQDVFUXFLDOVWHSV IRUZDUG                          LEGISLATION )RRGODZ\HU5D\PRQG2Ö5RXUNHH[DP LQHVWKHFKDQJLQJIDFHRIIRRGODEHOOLQJ ZKLFK FRXOG KDYH GUDVWLF HIIHFWV RQ WKH IRRGVHFWRUDVZHNQRZLW          

R&D 5(/$<ÖVVWUDWHJLFIRFXVKDVFKDQJHGWR LGHQWLI\ FRPPHUFLDO RSSRUWXQLWLHV IURP ),50IXQGHGUHVHDUFK             PACKAGING (IIHFWLYH XVH RI EUDQGLQJ LV RQH RI WKH VLJQLILFDQWFRQWULEXWRUVWRDSURGXFWÖVXOWL PDWHVXFFHVVRUIDLOXUH/RUUDLQH&DUWHU RI3HUVRQD'HVLJQH[SODLQVKRZEUDQGLQJ FDQPDNHDOOWKHGLIIHUHQFH         

FOOD IRELAND IS PUBLISHED BY: TARA PUBLISHING CO. LTD.

TARA

ORGANIC FOOD :LWK WKH LPSDFW RI WKH UHFHVVLRQ ,UHODQGÖV FRQVXPHUV DUH PRUH YDOXH FRQVFLRXVWKDQHYHUEHIRUH&DQRUJDQLF IRRGFRPSHWH"                  

1/2 Poolbeg Street, Dublin 2. Tel: 241 3095 Fax: 241 3010 Email: kathleenbelton@tarapublishingco.com

FOOD CERTIFICATION *OREDO7UXVWIRUPHUO\NQRZQDV,)4& LVWKHOHDGLQJDQGPRVWIRUZDUGWKLQNLQJ DFFUHGLWHG )RRG &HUWLILFDWLRQ %RG\ LQ ,UHODQG                          BUSINESS PERFORMANCE 7KH FKDQJLQJ HQYLURQPHQW LV FUHDWLQJ QHZFKDOOHQJHVIRUVXSSOLHUVDQGUHWDLOHUV .HQ0F,QW\UH%DUQ*HQHUDO0DQDJHU *OHQGLQQLQJ ,UHODQG Ó D .DQWDU 5HWDLO &RPSDQ\ ZULWHV RQ KRZ ,ULVK RUJDQL VDWLRQVFDQGLVWLQJXLVKWKHPVHOYHVLQWKH ORQJWHUP                       

Managing Director: Fergus Farrell Editorial and Marketing Director: Kathleen Belton Editorial: John Walshe Advertising Executive: Rory O’Connor

LISTINGS SECTION

Design and Origination by: Rooney Media Graphics

352'8&7 6(59,&(,1'(;  &203$1</,67,1*6 

Printed by: C & R Print

&RVW€ 1 FOOD IRELAND


An Irish Company Delivering Accredited Certainty, 7UXVW&RQ¿GHQFH and Success for Purchasers and Producers in Over 15 Countries Energise your opportunities with our know how and expertise. Enhance Value, Reduce Costs.

Â&#x2021; Â&#x2021; Â&#x2021; Â&#x2021;

)RRG6DIHW\ %5&*OREDO6WDQGDUGV±2I¿FLDO%5&7UDLQLQJRU&HUWL¿FDWLRQ 2UJDQLF )RRG6HDIRRG6WDQGDUGV $OOHUJHQV 0DQDJHPHQW6WDQGDUGV±2I¿FLDO%5&7UDLQLQJRU&HUWL¿FDWLRQ (FR/DEHO )RRGDQG6HDIRRG6WDQGDUGV

Â&#x2021; (QHUJ\0DQDJHPHQW - ISO 16001 7UDLQLQJRU9HUL¿FDWLRQ Â&#x2021; &DUERQ7UXVW6WDQGDUGV 7UDLQLQJRU9HUL¿FDWLRQ Â&#x2021; &DUERQ5HGXFWLRQ9HUL¿FDWLRQ 7UDLQLQJRU9HUL¿FDWLRQ Â&#x2021; &RQVXPHU7UXVW6WDQGDUGV 3URGXFWDQG6HUYLFH/HYHO$VVXUDQFHV Â&#x2021; *RYHUQPHQW7UXVW6WDQGDUGV 6HUYLFH/HYHO$VVXUDQFHV If you have a credible statement to make then underpin its credibility and its potential through a YHUL¿FDWLRQVWDWHPHQWZLWK*OREDO7UXVW&HUWL¿FDWLRQ2XUVXFFHVVLVHQDEOLQJ\RXUVXFFHVV

Global Trust â&#x20AC;&#x201C; Dundalk â&#x20AC;&#x201C; Ireland

p: +353 (0) 42 932 0912 e: info@GTcert.com www. GTcert.com


MINISTERâ&#x20AC;&#x2122;S FOREWORD

Facing Up to the Challenges Ahead MINISTER FOR AGRICULTURE, FISHERIES & FOOD, BRENDAN SMITH TD, INTRODUCES THE FOOD IRELAND YEARBOOK AND DIRECTORY AND EXAMINES THE BIG ISSUES FACING THE SECTOR IN THE YEAR AHEAD.

,

DP JODG RI WKH RSSRUWXQLW\ WR LQWURGXFH WKH )RRG,UHODQG<HDUERRNDQG'LUHFWRU\IRU DQLQGLVSHQVDEOHUHIHUHQFHIRUWKH,ULVKIRRG DQGGULQNLQGXVWU\

7KHUH LV QR GRXEW WKDW  KDV EHHQ HQRUPRXVO\ FKDOOHQJLQJ 7KH LQWHUQDWLRQDO ILQDQFLDO FULVLV DQG GRZQWXUQ KDG D VHYHUH LPSDFW RQ RXU RSHQ WUDG LQJ HFRQRP\ 'DLU\ PDUNHWV LQ SDUWLFXODU ZHUH DIIHFWHG E\ D FRPELQDWLRQ RI FRQWUDFWLQJ GHPDQG DQGLQFUHDVHGVXSSO\7KLVZDVH[DFHUEDWHGE\RXU RZQILQDQFLDOGLIILFXOWLHVDQGORVVLQWUDGHZHLJKWHG FRPSHWLWLYHQHVV

)5$0(:25.)256867$,1$%/( (&2120,&5(1(:$/ /RRNLQJDKHDG,UHODQGÃ&#x2013;V)UDPHZRUNIRU6XVWDLQDEOH (FRQRPLF5HQHZDOIRFXVHVRQGHYHORSLQJWKH6PDUW (FRQRP\DQGUHFRJQLVHVWKHYDOXHDQGSRWHQWLDORI WKHDJULFXOWXUHILVKHULHVDQGIRRGVHFWRUVWRFRQWULE XWHWRHFRQRPLFUHLQYLJRUDWLRQLQFOXGLQJÃ&#x2DC;JUHHQLQJ RIWKHHFRQRP\Ã&#x2122; 7KH ,ULVK IRRG LQGXVWU\ ZLOO FRQWLQXH WR EH H[SRUW GULYHQ ,WV DELOLW\ WR FRPSHWH ZLOO GHSHQG RQ PDU NHWLQJ WKH VWUHQJWKV RI RXU QDWXUDO UHVRXUFHV DQG SURGXFWLRQPHWKRGVPDQDJLQJWRLQWHUQDWLRQDOEHVW OHDQDQGVXVWDLQDEOHVWDQGDUGVDQGJURZLQJFDSDFLW\ WRLQQRYDWHDQGZLQVDOHV

7+(:$<)25:$5' 'HYHORSLQJ VWURQJ EXVLQHVV UHODWLRQVKLSV WKURXJK WKHVXSSO\FKDLQOHYHUDJLQJWKHFDSDELOLW\LQIRRG UHVHDUFKQRZDYDLODEOHLQWKHFRXQWU\DQGFRQVLGHU LQJVWUDWHJLFFRQVROLGDWLRQFDQFRQWULEXWHWRKROGLQJ FXUUHQW PDUNHWV DQG SRVLWLRQLQJ WKH LQGXVWU\ IRU JURZWK LQ WKH QHZ PDUNHWV ZKLFK ZLOO HPHUJH LQ WKHXSWXUQ

Brendan Smith TD, Minister for Agriculture, Fisheries and Food.

7KH IRRG VHFWRU LQ ,UHODQG KDV WUDGLWLRQDOO\ EHHQ UHVLOLHQW DQG LWV SHUIRUPDQFH LQ WKH SDVW \HDU KDV EHHQLPSUHVVLYHZLWKFRPSDQLHVVHHNLQJWREURDGHQ H[SRUW UHDFK WKH EDVLV IRU JURZWK LQ WKH IXWXUH , ZLVK DOO FRPSDQLHV ZHOO LQ WKHLU HQGHDYRXUV LQ WKH FRPLQJ\HDU

%UHQGDQ6PLWK7' 0LQLVWHUIRU$JULFXOWXUH)LVKHULHV )RRG

3 FOOD IRELAND


BORD BIA FOOD

AND

DRINK INDUSTRY AWARDS

Bord Bia Salutes Success THE WINNERS OF THE BORD BIA FOOD AND DRINK INDUSTRY AWARDS PROVED THAT IRISH FOOD AND DRINKS COMPANIES CAN THRIVE, DESPITE THE CURRENT ECONOMIC CLIMATE.

7

K H  Z L Q Q H U V  R I  % R U G % L D Ã&#x2013; V  ) R R G  D Q G  ' U L Q N ,QGXVWU\ $ZDUGV  ZHUH DQQRXQFHG UHFHQWO\ E\ WKH 0LQLVWHUIRU$JULFXOWXUH)LVKHULHVDQG )RRG%UHQGDQ6PLWK7' Ã&#x2DC;7KH FUHDWLYLW\ LQQRYDWLRQ DQG HQWUHSUHQHXULDO VSLULW VKRZQ E\ WKLV \HDUÃ&#x2013;VZLQQHUVUHIOHFWWKHFDSDFLW\DQG GHWHUPLQDWLRQRIWKH,ULVKIRRGLQGXVWU\ WRDGGUHVVWKHKXJHO\FKDOOHQJLQJHQYL URQPHQW WKDW LV WRGD\Ã&#x2013;V PDUNHWSODFHÃ&#x2122; QRWHG 'DQ %URZQH &KDLUPDQ %RUG %LDÃ&#x2DC;,WDOVRGHPRQVWUDWHVDVZHHPHUJH IURP WKH GRZQWXUQ KRZ WKH LQGXVWU\ FDQSRVLWLRQLWVHOIIRUJURZWKDQGQRW ZLWKVWDQGLQJ FXUUHQW GLIILFXOWLHV SOD\ D NH\ UROH LQ WKH FRXQWU\Ã&#x2013;V HFRQRPLF UHFRYHU\Ã&#x2122;

$:$5':,11(56 7KH %RUQ *OREDO DZDUG UHFRJQLVLQJ RXWVWDQGLQJ DFKLHYHPHQW LQ WKH FKDO OHQJLQJ H[SRUW PDUNHW ZDV SUHVHQWHG WR .HUU\ )RRGV IRU LWV &KHHVWULQJV SURGXFW &KHHVWULQJV LV FXUUHQWO\ WKH QXPEHURQHFKLOGUHQÃ&#x2013;VFKHHVHVQDFNLQ WKH8.ZLWKDVKDUHRIWKHRYHUDOO FKHHVHVQDFNPDUNHWYDOXHGDWdP 7KHSURGXFWLVDOVRSHUIRUPLQJVWURQJO\ LQ)UDQFHDQG+ROODQGDQG.HUU\)RRGV HVWLPDWH RYHU P &KHHVWULQJV DUH HDWHQHDFK\HDUDFURVV(XURSH 2 D N  3 D U N  ) R R G V   & D K L U   & R  7LSSHUDU\ ZRQ WKH &RQVXPHU )RFXV DZDUGUHFRJQLVLQJSURGXFWLQQRYDWLRQ IRU LWV EDFRQ ULE SURGXFW 2DNSDUN )RRGV LV D IDPLO\ UXQ FRPSDQ\ ZLWK D XQLTXH LQWHJUDWHG IRRG FKDLQ ZKLFK JXDUDQWHHV WRWDO WUDFHDELOLW\ IURP Ã&#x2022;IHHG WR IRUNÃ&#x2013; 7KHLU ZLQQLQJ SURGXFW Ã&#x2022;2DNSDUN %DFRQ 5LEÃ&#x2013; LV LQQRYDWLYH LQ WKH,ULVKPDUNHWSODFHDVWKH\KDYHWDNHQ

The winners of the Bord Bia Food and Drink Industry Awards, (back row, l-r): Joe Collum, Glanbia; Sean McNamara, ABC Nutrition; Anne Hogan, C&C; and Mark Long, Highfield Nurseries; (front row, l-r): Denis Oâ&#x20AC;&#x2122;Riordan, Kerry Foods; John Fanning, chairman of the judging panel; David Brett, Oakpark; and Vincent Cleary, Glenisk.

DSURGXFWWKDWLVWUDGLWLRQDOO\VROGRYHU WKH EXWFKHUV FRXQWHU DQG GHYHORSHG D JUHDWYDOXHSUHSDFNDOWHUQDWLYH6LQFH LWVODXQFKLQ0DUFKWKH2DNSDUN %DFRQ5LEKDVVHHQVWURQJVDOHVDVFRQ VXPHUV KDYH EHFRPH LQFUHDVLQJO\ FRVW FRQVFLRXV

352027,1*6867$,1$%,/,7< 7KH(QYLURQPHQWDO(QULFKPHQWDZDUG IRUOHDGHUVKLSLQSURPRWLQJWKHSULQFL SOHVRIVXVWDLQDELOLW\ZDVSUHVHQWHGWR *OHQLVNEDVHGLQ.LOOHLJK&R2IIDO\ 7KH MXGJHV SUDLVHG *OHQLVN IRU LWV Ã&#x2DC;WUXO\ RXWVWDQGLQJÃ&#x2122; FRPPLWPHQW WR VXVWDLQDELOLW\ Ã&#x2DC;SDVVLRQDWH DERXW IDLU WUDGHDQGHQVXULQJWKDWWKHLUSURGXF WLRQ LV VXVWDLQDEOH WKLV IDPLO\ RZQHG 4 FOOD IRELAND

EXVLQHVV KDV H[FHOOHG LQ SURGXFLQJ D KLJK TXDOLW\ DQG GHVLUDEOH SURGXFW ZKLOH PLQLPLVLQJ WKHLU PDQXIDFWXULQJ LPSULQWÃ&#x2122; 7KH 2IIDO\EDVHG FRPSDQ\ ODVW \HDU LQVWDOOHG LWV RZQ ZLQG WXU ELQH DFKLHYHG DQ LQWHUQDO UHF\FOLQJ UDWH RI  DQG D  UHGXFWLRQ LQ ZDVWHJRLQJWRODQGILOO,WKDVUHFHQWO\ HPEDUNHGRQDSURMHFWWRPHDVXUHQRW RQO\ LWV RZQ SODQWÃ&#x2013;V FDUERQ IRRWSULQW EXWWKDWRIHDFKRILWVVXSSOLHUIDUPV 7KH7KLQNLQJ%LJDZDUGIRUVPDOO EXVLQHVVHV GHPRQVWUDWLQJ H[FHSWLRQDO HQWUHSUHQHXULDO VSLULW PDWFKHG E\ VWURQJ VDOHV DQG PDUNHWLQJ ZDV SUH VHQWHG WR $%& 1XWULWLRQ D KXPDQ QXWULWLRQ FRPSDQ\ EDVHG LQ 6KDQQRQ &R&ODUH$%&1XWULWLRQPDQXIDFWXUH


BORD BIA FOOD

AND

DRINK INDUSTRY AWARDS

DQGGLVWULEXWHQXWULWLRQDOSRZGHUVYLWD PLQFDSVXOHVDQGVSUD\YLWDPLQV *ODQELDĂ&#x2013;VUHEUDQGLQJRILWVIRUWLILHG PLONĂ&#x201C;6XSHU0LONĂ&#x201C;ZRQWKH6SRWOLJKW DZDUG DQ DZDUG WKDW DSSUHFLDWHV WKH YLWDOUROHWKDWEUDQGLQJDQGPDUNHWLQJ SOD\ LQ PDNLQJ D SURGXFW D VXFFHVV 6XSHU 0LON LQ LWV GLVWLQFWLYH UHG DQG ZKLWH SDFNDJLQJ KDV EHHQ RQH RI WKH VXFFHVVVWRULHVRIWKH,ULVKGDLU\PDUNHW LQWKHODVWIHZ\HDUVJURZLQJDWDUDWH RIRYHULQDQGDIXUWKHU LQ  7KH SURGXFW ZKLFK ZDV ILUVW PDUNHWHG DV Ă&#x2022;DQWLRVWHRSRURVLVĂ&#x2013; PLON KDV EHHQ VXFFHVVIXOO\ UHEUDQGHG DV D PDLQVWUHDPIDPLO\PLONZKLFKSURYLGHV DYDOXDEOHVRXUFHRIYLWDPLQ'

$'$37,1*$1',1129$7,1* 7KH +RPH *URZQ DZDUG UHFRJQLVLQJ FRPSDQLHVZKRKDYHDGDSWHGDQGLQQR YDWHGLQWKHOLJKWRIFKDQJHGHFRQRPLF FLUFXPVWDQFHV ZDV SUHVHQWHG WR & & IRULWVUHFHQWO\ODXQFKHG%XOPHUV3HDU &LGHU %XOPHUV 3HDU &LGHU LV & &Ă&#x2013;V ILUVWGHSDUWXUHIURPDSSOHFLGHUDQGLWV FUHDWLYH Ă&#x2022;(PEUDFH WKH 3HDUĂ&#x2013; FDPSDLJQ

Vincent Cleary, Glenisk, winners of the Environmental Enrichment award, is pictured with Minister for Agriculture, Fisheries and Food, Brendan Smith TD, and Dan Browne, Chairman, Bord Bia.

BORD BIA DRIVE TO PROMOTE EXPORTS IN EUROPE Bord Bia recently launched a new, intensified, drive to promote Irelandâ&#x20AC;&#x2122;s food exports aimed at broadening the industryâ&#x20AC;&#x2122;s market reach and boosting its exports, valued at â&#x201A;Ź8.2 billion in 2008. The task of â&#x20AC;&#x153;Broadening Export Reachâ&#x20AC;? has become a major strategic priority for Bord Bia in light of the challenges facing the food and drink industry as a result of the global economic downturn and the depreciation of Sterling.

â&#x20AC;&#x153;Although the UK will continue to be Irelandâ&#x20AC;&#x2122;s single largest export market, accounting for 43% of our exports in 2008, other Eurozone markets offer the prospect of new opportunities and more stability in the light of recent exchange rate volatility,â&#x20AC;? noted Dan Browne, Chairman of Bord Bia. Bord Bia organized a number of market building initiatives to assist the food industry broaden its export reach, including heavyweight participation at Anuga 2009 in October, the new Bord Bia Marketing Fellowship Programme, which is being run in association with the UCD Michael Smurfit Graduate Business School, and Marketplace 2010, a one day business networking event, to build on the momentum of the Fellowship Programme. The third Marketplace Ireland event will take place in Croke Park, Dublin on February 9, and according to Bord Bia, it will be the key business development event for the food industry in 2010. It is expected the event will attract upwards of 250 European, international and also Irish, retail and foodservice buyers to meet with Irish food and drink companies. â&#x20AC;&#x153;The Irish food and drink industry is experiencing probably the most challenging period in its entire history,â&#x20AC;? explained Bord Bia Chief Executive, Aidan Cotter. â&#x20AC;&#x153;Yet, as the world will need to double food production by 2050 to meet the needs of an expand30 Irish food and drink companies participated at Anuga 2009, where Bord Bia organised and coordinated ing population, the potential for the representatives from the meat and dairy sectors to seafood and frozen foods, exhibiting across six halls. industry to expand is immense.â&#x20AC;?

5 FOOD IRELAND


BORD BIA FOOD

AND

DRINK INDUSTRY AWARDS

KDVVRIDUJHQHUDWHGRYHUâ&#x201A;ŹPZRUWK RIGRPHVWLFVDOHV +LJKILHOG 1XUVHULHV EDVHG LQ 2OGWRZQ &R 'XEOLQ DQG LWV /LYLQJ )ODYRXU IUHVK KHUEV SURGXFW ZRQ WKH 1HZ3HUVSHFWLYHVDZDUG7KLVFDWHJRU\ UHFRJQLVHV SURGXFWV WKDW KDYH EHHQ UHSRVLWLRQHGWRPHHWFKDQJLQJFRQVXPHU GHPDQGVWKURXJKQHZDSSURDFKHVDQG VPDUW PDUNHW DGDSWDWLRQ ,Q  +LJKILHOG 1XUVHULHV FKDQJHG LWV EXVL QHVV IURP EHLQJ  SURGXFWLRQ RI IORZHULQJSODQWVWRSURGXFWLRQRI SRWKHUEVDQGOLYLQJOHWWXFH7KLVPDGH DKXJHGLIIHUHQFHWRLQFUHDVHSURILWDQG PDUJLQZKLOHUHGXFLQJZDVWH

7+(-8'*,1*3$1(/ 7KH LQGHSHQGHQW MXGJLQJ SDQHO F K D L U H G  E \  - R K Q  ) D Q Q L Q J   D O V R LQFOXGHG*RUGRQ&DPSEHOO0DQDJLQJ 'LUHFWRU 63$5 ,QWHUQDWLRQDO 0DWW 'HPSVH\ (GLWRU ,ULVK )DUPHUV

Joe Collum, Glanbia, who won the Spotlight award for the rebranding of its fortified milk, Super Milk, is pictured with Minister for Agriculture, Fisheries and Food, Brendan Smith TD, and Dan Browne, Chairman, Bord Bia.

BORD BIA QUALITY MARK The Bord Bia Quality Mark was introduced in the late 1980s in response to consumer demand for information on where their food comes from and how it has been produced. The Bord Bia Quality Mark means that care and attention has been given to ensuring the highest standards of quality, food safety and hygiene are involved in production. This covers the productâ&#x20AC;&#x2122;s journey right from the farm where it originated through to the shop shelf. Bord Bia implements Quality Assurance Schemes in the beef, lamb, pigmeat, poultry, eggs and horticulture sectors. These are integrated schemes involving primary producers and processors working in partnership. The main areas covered by the â&#x20AC;&#x153;farm assuranceâ&#x20AC;? element of the standards include: stockmanship; animal health and welfare; animal identification and traceability; water and feed; pasture management; environmental management and farm safety. In meat plants, the scheme lays down a number of key essential requirements, including: food safety; purchasing; welfare and transport; product identification and traceability; inspection and testing; hygiene and good manufacturing practice. These standards are in addition to existing statutory requirements and aim to ensure that the final product is wholesome, tasty, tender and succulent. The Schemes provide an objective assessment of the production standards for Irish food and horticulture. All standards are strictly enforced to ensure that consumers can trust the Bord Bia Quality Mark and be confident that the food they are serving is produced to the highest possible standard. Bord Bia works consistently to develop new standards, improve existing ones and ensure sufficient auditing and certification of all involved in the Quality Assurance Scheme. These standards safeguard the integrity of the Bord Bia Quality Mark. As well as providing reassurance to consumers in Ireland, the Bord Bia Quality Mark is also a fundamental seal of reassurance when it comes to marketing Irish food to the trade and consumers overseas. Marketing and Promotion The key objective for promoting the Quality Mark is to build consumer awareness and understanding of it across the range of products in retail outlets and to encourage shoppers to choose products in-store with the Quality Mark. In addition, the aim is to position these products as versatile, delicious and healthy options for everyday meals.

The Bord Bia Quality Mark has been marketed through a combination of above-the-line advertising (TV, radio, billboards, shopperlites, trolley handles and print media) and below the line activities (in-store point of sale material, on-pack competitions, commuter hand-outs). Each campaign has also been supported by Public Relations activities, including press releases, photo-shoots and radio competitions. In 2009, for the first time a generic Quality Mark campaign was launched to encourage consumers to choose product by giving them â&#x20AC;&#x153;peace of mindâ&#x20AC;? and assurance of where the food came from. Bord Bia also undertakes quarterly audits of the proportion of products across all retailers carrying the Bord Bia Quality Mark. This is a way of monitoring the usage of the brand in-store and ensuring it is reproduced in accordance with the Bord Bia guidelines. In a consumer survey, the results found: - 76% unprompted awareness of the Bord Bia Quality Assurance logo; - 85% promoted awareness of the Bord Bia Quality Assurance logo; - 65% or respondents say that the logo reassures them about the quality of food; - 79% of respondents are more likely to buy a product if it had the Bord Bia Quality Assurance logo on it; (Source: Millward Browne, January 2009) For further information on the Bord Bia Quality Mark and Quality Assurance Schemes please log on to www.bordbia.ie

6 FOOD IRELAND


BORD BIA FOOD

-RXUQDO6HQDWRU)HDUJDO4XLQQ-LP 3RZHU (FRQRPLVW DQG &KDLUPDQ RI /RYH ,ULVK )RRG )LQQ &RWWOH WUDGH FRQVXOWDQW DQG IRUPHU EX\HU ZLWK 6DLQVEXU\ÖV DQG 0RUULVRQV %DUWOH\ 2Ö&RQQRU +HDG RI 6XVWDLQDELOLW\ 3:&DQG0DUJRW6ODWWHU\'LYLVLRQDO 'LUHFWRU6RGH[R -RKQ)DQQLQJFKDLURIWKHMXGJ LQJ SDQHO FRPPHQWHG Ø7KH VHYHQ ZLQQHUV WRGD\ UHSUHVHQW VXFFHVV VWRULHV LQ DQ LQGXVWU\ WKDW KDV IDFHG XQSUHFHGHQWHGFKDOOHQJHVLQWKHODVW \HDU 7KURXJK LQQRYDWLYH SURGXFW GHYHORSPHQW DQG LQYHQWLYH EUDQG LQJ DQG PDUNHWLQJ WKHVH FRPSDQLHV KDYH DFKLHYHG VXFFHVV ERWK DW KRPH DQGDEURDG6RPHRIWKHZLQQHUVDUH VPDOOIDPLO\RZQHGLQGXVWULHVZKLOH RWKHUV DUH ODUJH JOREDO RSHUDWLRQV EXWDOOGLVSOD\WKHGHWHUPLQDWLRQDQG G\QDPLVP WKDW LV DW WKH FRUH RI WKH ,ULVK IRRG DQG GULQN VHFWRU ZKLFK LV RQH RI WKH FRUQHUVWRQHV RI WKH HFRQRP\Ù

AND

DRINK INDUSTRY AWARDS

Winners of the Born Global award, Kerry Foods’ Denis O’Riordan, is pictured with Eabha Last and Dan Browne, Chairman, Bord Bia.

C&C won the Home Grown award for its recently launched Bulmers Pear Cider. C&C’s Anne Hogan is pictured with Aidan Cotter, Chief Executive, Bord Bia. 7 FOOD IRELAND

,5(/$1'·6/$5*(67 ,1',*(1286,1'8675< ,ULVK IRRG DQG GULQN H[SRUWV IHOO IRU WKHILUVWWLPHLQE\WRMXVW XQGHU € ELOOLRQ )ROORZLQJ WZR \HDUV RI VXEVWDQWLDO JURZWK ZKLFK VDZ€ELOOLRQDGGHGWRWKHYDOXHRI ,ULVKIRRGDQGGULQNH[SRUWVDIXUWKHU GHFOLQH LV DQWLFLSDWHG LQ  DULV LQJ IURP FRQWLQXHG 6WHUOLQJ SUHVVXUH VHYHUH GLIILFXOWLHV LQ WKH JOREDO GDLU\ PDUNHWDQGWKHLPSDFWRIWKHHFRQRPLF GRZQWXUQZKLFKLVEULQJLQJSUHVVXUH RQUHWXUQVDFURVVDOOVHFWRUV+RZHYHU WKHUHLVVRPHSURVSHFWIRUDUHWXUQWR JURZWKLQ ,UHODQGÖV DJULIRRG VHFWRU SOD\V DQ LPSRUWDQW UROH LQ WKH ,ULVK HFRQRP\ DFFRXQWLQJ IRU DOPRVW  RI HPSOR\ PHQW DQG  RI ,ULVK H[SRUWV $V PXFKDVRIPDQXIDFWXULQJH[SRUWV E\ ,ULVKRZQHG ILUPV DUH HVWLPDWHG WR FRQVLVWRIIRRGDQGGULQN 7KH 8. LV WKH PDLQ GHVWLQDWLRQ IRU ,ULVK IRRG DQG GULQN H[SRUWV DFFRXQWLQJIRURIWKHWRWDO JR WR FRQWLQHQWDO (8 PDUNHWV ZLWK WKH UHPDLQLQJ  JRLQJ WR QRQ(8 PDUNHWV 7KH ,ULVK IRRG DQG GULQN VHFWRU KDV WKH KLJKHVW XVDJH RI ,ULVK SURGXFHGLQSXWVDFURVVPDMRUVHFWRUV LQ WKH ,ULVK HFRQRP\ ZLWK FORVH WR WKUHH TXDUWHUV RI WKH VHFWRUÖV LQSXWV VRXUFHGGRPHVWLFDOO\

Ý


SEAFOOD

Driving Innovation in the Irish Seafood Sector DESPITE MANY CHALLENGES, BORD IASCAIGH MHARA SEES OPPORTUNITIES FOR GROWTH IN IRELANDâ&#x20AC;&#x2122;S SEAFOOD SECTOR, AND HAS BEEN EXTREMELY ACTIVE IN NURTURING THOSE OPPORTUNITIES TO FLOURISH.



ZDVDGLIILFXOW\HDUIRUWKH VHDIRRG VHFWRU 7KH UHFHVVLRQ KDV DIIHFWHG DOO LQGXVWULHV DQG LQ WHUPV RI WKH ,ULVK ILVKLQJ LQGXVWU\LWKDVKDGDPDMRULPSDFWRQ WKHSULFHRIILVK5HWDLOGDWDIURP716 :RUOGSDQHO LQGLFDWHV WKDW RYHUDOO ILVK SULFHV GHFOLQHG E\  RYHU WKH  PRQWK SHULRG IURP -XO\  WR -XO\  7KLV KDV EHHQ GULYHQ E\ VLJQLIL FDQWSULFHUHGXFWLRQVDQGSURPRWLRQLQ WKH IUR]HQ VHDIRRG FDWHJRU\ ZLWK WKH DYHUDJH UHWDLO SULFH RI IUR]HQ ILOOHWV GHFOLQLQJLQWKLVWLPHSHULRGE\ 'HVSLWH WKHVH FKDOOHQJHV %,0 VHHV QLFKHRSSRUWXQLWLHVIRUJURZWKHVSHFLDOO\ LQWKHH[SRUWRIRUJDQLFSURGXFWVPRVW QRWDEO\VDOPRQDQGQHZLQQRYDWLYHSURG XFWVLQWKHZKLWHILVKDQGVKHOOILVKVHFWRUV )RUH[DPSOH%,0EHOLHYHVWKDWWKHUHLV LPPHGLDWH VFRSH IRU H[SDQVLRQ RI WKH RUJDQLF FHUWLILHG IDUPHG VDOPRQ VHFWRU ZLWK WKH SRWHQWLDO WR FUHDWH VLJQLILFDQW QHZ MREV ,Q  ,UHODQG SURGXFHG  WRQQHV RI IDUPHG VDOPRQ RI ZKLFK VRPH  ZDV FHUWLILHG RUJDQLF DQGWKHVHILVKIHWFKHGDSULFHSUHPLXP DERYHWKHUHJXODUPDUNHWSULFH

BIMâ&#x20AC;&#x2122;s state-of-the-art Seafood Development Centre, based in Clonakilty, Co. Cork.

:LWK WRWDO VHDIRRG H[SRUWV LQ  DPRXQWLQJ WR â&#x201A;¬P ZH DUH VPDOO SOD\HUVRQDYHU\ELJVWDJH2XUPDUNHW VKDUHDPRXQWVWRDSSUR[LPDWHO\ LQPRVW(8PDUNHWVZKHUHXSWR

RIILVKFRQVXPHGLVLPSRUWHGIURPRXW VLGHWKH(8ZKHUHSURGXFHUVDUHRSHU DWLQJZLWKVLJQLILFDQWFRVWDGYDQWDJHV ,QDGGLWLRQWKH,ULVKVHDIRRGVHFWRU LVODUJHO\FRPPRGLW\GULYHQZLWK

$1(:$3352$&+ ,QEURDGHUWHUPVWKHUHLVQRGRXEWWKDW WKHLQGXVWU\QHHGVWRDGRSWDGLIIHUHQW DSSURDFK WR GRLQJ EXVLQHVV WR HQVXUH ZHDUHEHVWSODFHGWRWDNHDGYDQWDJHRI DQ\ IXWXUH JOREDO XSWXUQ 7UDGLWLRQDO EXVLQHVV PRGHOV ZLOO QHHG WR FKDQJH WKHQXPEHURI,ULVKFRPSDQLHVFRPSHW LQJ ZLWK RQH DQRWKHU LQ WKH (XURSHDQ PDUNHWSODFH FDQQRW EH VXVWDLQHG $W D PLQLPXP WKHUH LV VFRSH IRU LQFUHDVHG FRRSHUDWLRQ EHWZHHQ PDQ\ RI RXU H[SRUWHUVDQGLQGHHGWKRVHVHUYLQJWKH GRPHVWLFPDUNHW

By focusing on delivering value-added seafood relevant to end consumer needs, Irelandâ&#x20AC;&#x2122;s seafood sector can develop more stable markets and greater profitability. 8 FOOD IRELAND


SEAFOOD

RI WRWDO SURGXFH VROG DV FRPPRGLWLHV :KLOVWWKLVILWVZLWKWKHPDUNHWGHPDQG IRU VRPH VSHFLHV SDUWLFXODUO\ LQ WKH SHODJLF VHFWRU LW GRHV QRW GHOLYHU IRU RWKHUVSHFLHVDVWKH\FDQEHGHSHQGDQW RQ IOXFWXDWLQJ JOREDO PDUNHWV OHDY LQJWKHPRSHQWRSUHGDWRU\SULFLQJE\ ODUJHU LQWHUQDWLRQDO WUDGH SOD\HUV %\ IRFXVLQJRQGHOLYHULQJYDOXHDGGHGVHD IRRG UHOHYDQW WR HQG FRQVXPHU QHHGV WKH VHFWRU FDQ GHYHORS PRUH VWDEOH PDUNHWV DQG JUHDWHU SURILWDELOLW\ )RU HYHU\FRQYHUVLRQIURPFRPPRGLW\ WR YDOXHDGGHG VHDIRRG DQ DGGLWLRQDO €P SHU DQQXP LQ VDOHV FRXOG EH JHQHUDWHG

%,06($)22''(9(/230(17 &(175( %,0 KDV DOUHDG\ EHHQ DFWLYH LQ WKLV DUHDLQDQGZLOOFRQWLQXHWRDVVLVW LQGXVWU\ LQ WKLV UHJDUG LQ  7R KHOSGULYHWKLVYDOXHDGGHGDSSURDFK LQGXVWU\ZLOOEHDEOHWRDFFHVV%,0ÖV QHZGHGLFDWHG6HDIRRG'HYHORSPHQW &HQWUH 6'&  LQ &ORQDNLOW\ &R &RUN:LWKDIORRUVSDFHRIVTXDUH PHWUHVDQGIDFLOLWLHVLQFOXGLQJZHWILVK

Dr Susan Steele, Innovation Co-ordinator, BIM, is pictured at the official opening of Bord Iascaigh Mhara’s Seafood Development Centre.

SURFHVVLQJDUHDVEXVLQHVVLQFXEDWLRQ XQLWV JUDGXDWH ODERUDWRU\ SURGXFW GHYHORSPHQW NLWFKHQ DQG DQ LQQRYD WLRQ DQG SURGXFW FRQFHSW URRP WKH 6'&ZLOOVXSSRUWDQGSURYLGHLQGXV WU\ZLWKDFRPPHUFLDOO\IRFXVHGLQQR YDWLRQDQG1HZ3URGXFW'HYHORSPHQW FDSDELOLW\ ,WORRNVVHWWREHDQRWKHUEXV\\HDU IRUWKH,ULVKVHDIRRGLQGXVWU\LQ

DQG%,0ZLOOFRQWLQXHWRDVVLVWLQGXV WU\ WR GHOLYHU RQ WKH Õ&DZOH\Ö YLVLRQ ZKLFKLVWRGHOLYHUDVXVWDLQDEOHSURILW DEOH FRPSHWLWLYH DQG PDUNHWIRFXVHG VHDIRRGLQGXVWU\PDNLQJWKHPD[LPXP ORQJWHUP HFRQRPLF DQG VRFLDO FRQ WULEXWLRQ WR FRDVWDO FRPPXQLWLHV DQG ,UHODQGDVDZKROH )RU IXUWKHU LQIRUPDWLRQ RQ %,0ÖV VHUYLFHVSOHDVHYLVLWZZZELPLH

Ý

Technology ‘Meats’ Business at

,

))$ ZKLFK WDNHV SODFH LQ )UDQNIXUWIURP0D\ LVWKHOHDGLQJLQWHUQDWLRQDOWUDGH IDLU IRU SURFHVVLQJ SDFNDJLQJ DQGVDOHVLQWKHPHDWLQGXVWU\ ,))$WDNHVSODFHHYHU\WKUHH\HDUV DQGKDVEHHQWKHRQO\SODWIRUPLQWKH ZRUOG VLQFH  WR GLVSOD\ WKH FRP SOHWH PHDW LQGXVWU\ SURGXFWLRQ FKDLQ Ó IURP VODXJKWHULQJ DQG SURFHVVLQJ DOO WKH ZD\ WKURXJK WR SDFNDJLQJ DQG VHOOLQJ 7KH H[KLELWLRQ GLVSOD\V D ZLGH UDQJH RI SURGXFWV IURP WKH ILHOGV RI VODXJKWHULQJ GLVPHPEHULQJ SURFHVV LQJ ZHLJKLQJ ILOOLQJSDFNDJ LQJ FRQYH\LQJ FRROLQJVWRULQJ W U D Q V S R U W L Q J DQG VHOOLQJ DV ZHOO DV VSLFHV DQG DGGLWLYHV IRU PHDW DQG VDXVDJH SURG XFWV

,QWUDGHYLVLWRUVIURP RYHU  FRXQWULHV PDGH WKHLU ZD\ WR )UDQNIXUW ZKHUH  H[KLELWRUV RFFXSLHG RYHU  VTXDUH PHWUHV GLVSOD\LQJ WKHLU ODWHVW SURGXFWV LQQR YDWLRQV WUHQGV DQG WHFKQRORJ\ 7KH SURSRUWLRQRILQWHUQDWLRQDOYLVLWRUVURVH WRZLWKDOPRVWKDOIFRPLQJIURP RXWVLGH *HUPDQ\ WKLV XQGHUOLQHV WKH OHDGLQJVWDWXVRI,))$E\WKHH[WUDRU GLQDULO\KLJKOHYHORILQWHUQDWLRQDOSDU WLFLSDWLRQRQWKHSDUWRIERWKH[KLELWRUV DQGYLVLWRUV

(9(176$7,))$ 7KH ,))$ 0HDW 9LVLRQ &RQIHUHQFH SURYLGHV WKH ODWHVW LQIRUPDWLRQ IRU WRPRUURZÖV PDUNHWV 7KH  HYHQW ZLOO VHH D PRGHUQ %XWFKHUÖV 6KRS VSHFLDO VKRZ KLJKOLJKWLQJ WKH ODWHVW WUHQGV DQG RSSRUWXQLWLHV DYDLODEOH IRU WKHWUDGH

&203(7,7,216$7,))$ 6HYHUDOLQWHUHVWLQJTXDOLW\FRPSHWLWLRQV ZLOOEHKHOGHYHU\GD\RIWKHH[KLELWLRQ 9 FOOD IRELAND

2010

DWWKHFRPSHWLWLRQDUHDRIWKH*HUPDQ %XWFKHUVÖ $VVRFLDWLRQ 'HXWVFKHU )OHLVFKHU9HUEDQGÓ')9 LQ+DOO 7KHFRPSHWLWLRQSDUWLFLSDQWVZLOOFRPH IURPQXPHURXVEXWFKHUVÖVKRSVKRPH DQG DEURDG ZKR ZLOO VKRZFDVH WKH YDULHW\DQGLQQRYDWLRQRIWKHLUWUDGH DATE: May 8-13, 2010 VENUE: Frankfurt am Main TEL: +44 (0) 1784 415950 FAX: +44 (0) 1784 415951 E-MAIL: info@ireland.messefrankfurt.com WEB: www.iffa.messefrankfurt.com VISITOR REGISTRATION: www.ukfrankfurt.co.uk


ENTERPRISE IRELAND

Assisting Growth & Competitiveness DICK LENEHAN, HEAD OF FOOD AT ENTERPRISE IRELAND, ON THE ORGANISATION’S ROLE IN THE DEVELOPMENT OF THE IRISH FOOD & DRINK INDUSTRY.

(

QWHUSULVH,UHODQGLVWKH JRYHUQPHQW DJHQF\ UHVSRQVLEOH IRU WKH GHYHORSPHQWDQGSUR PRWLRQ RI ,UHODQGÖV LQGLJHQRXV PDQXIDFWXULQJ VHFWRUV 'LFN /HQHKDQ +HDG RI (QWHUSULVH ,UHODQGÖV)RRG'LYLVLRQH[SODLQV WKDWWKHIRRGDQGGULQNLQGXVWU\ KDV QHYHU EHHQ PRUH LPSRUWDQW WR WKH ,ULVK HFRQRP\ DV QRZ Ø,IPDQDJHGSURSHUO\LWKDVWKH DELOLW\WRJHQHUDWHPXFKQHHGHG H[WUD UHYHQXH IURP H[SRUWV DV ZHOO DV QHZ MREVÙ KH H[SODLQV Ø2QH RI WKH NH\ IDFWRUV ZKLFK ZLOO LQIOXHQFH WKH VXFFHVV DQG JURZWK RI WKH LQGXVWU\ LV WKH LQYHVWPHQW LQ LQQRYDWLRQ WR FUHDWH QHZ DQG EHWWHU SURGXFWV ZKLFK DUH FRPSHWLWLYH RQ ZRUOG PDUNHWVÙ

,1129$7,21$1'/($1 0$18)$&785,1* (QWHUSULVH,UHODQGHQFRXUDJHVLQQRYD WLRQ E\ HQFRXUDJLQJ ERWK VPDOO DQG ODUJHIRRGFRPSDQLHV HVSHFLDOO\WKRVH FRPSDQLHVZLWKDPRUHGHYHORSHG5 ' FDSDELOLW\  WR DYDLO RI LWV 5 ' )XQG 7KLV )XQG ZKLFK SURYLGHV JUDQWV XS WRIRUVPDOOFRPSDQLHVDQGXSWR  IRU ODUJH FRPSDQLHV LV GHVLJQHG WR VXSSRUW UHVHDUFK GHYHORSPHQW DQG WHFKQRORJLFDOLQQRYDWLRQUHOHYDQWDWDOO VWDJHV RI FRPSDQ\ GHYHORSPHQW DQG ZKLFKZLOOHQDEOHFRPSDQLHVWRSURJUHVV IURP XQGHUWDNLQJ DQ LQLWLDO UHVHDUFK SURMHFW WR KLJK OHYHO LQQRYDWLRQ DQG 5 'DFWLYLW\ 7KH5 ')XQGKHOSVFRPSDQLHVWR DFKLHYHWKHIROORZLQJ Ý $ VLJQLILFDQW RQJRLQJHVWDEOLVKHG 5 'EXGJHW

Ý $GHPRQVWUDEOHFRQQHFWLRQEHWZHHQ 5 'DQGWKHRYHUDOOEXVLQHVVREMHF WLYHV Ý $ FXOWXUH RI LQQRYDWLYH WKLQNLQJ WKURXJKRXW WKH FRPSDQ\ ZKLFK DLPVWRKDUQHVVWKHFUHDWLYLW\RIDOO WKH VWDII WRZDUGV GHILQHG EXVLQHVV JRDOV Ý $QHVWDEOLVKHG5 'WHDPZLWKKLJK OHYHOVNLOOV Ý +LJKTXDOLW\IDFLOLWLHVIRU5 ' Ý *RRG TXDOLW\ 5 ' PDQDJHPHQW V\VWHPVDQGSURFHGXUHV ,Q DGGLWLRQ WR WKH LQQRYDWLRQ DJHQGD (QWHUSULVH ,UHODQG KDV D VWURQJ EHOLHI WKDW WKHUH LV D UHDO RSSRUWXQLW\ IRU 1 0 FOOD IRELAND

PDQ\ IRRG FRPSDQLHV WR UHJDLQ FRPSHWLWLYHQHVVE\OHDUQLQJDERXW DQG DGRSWLQJ EHVWSUDFWLFH OHDQ DSSURDFKHV WR WKHLU EXVLQHVVHV 7KLV UHTXLUHV VLJQLILFDQW FKDQJHV LQWKHZD\WKDWPDQDJHPHQWWHDPV ZRUNDQGWKHVNLOOVEDVHUHTXLUHG ,WLVQRWDQHDV\MRXUQH\DQGRQH ZKLFKZLOOFKDOOHQJHPDQDJHPHQW WHDPV DQG RUJDQLVDWLRQV YHU\ VHULRXVO\ +RZHYHU WKH JDLQV WR EH DFKLHYHG DUH ZHOO ZRUWK WKH MRXUQH\ ,IFRPSDQLHVGRQRWPDNHWKH MRXUQH\ WKH\ ULVN WKH JUDGXDO GHFOLQH DQG SRWHQWLDO IDLOXUH RI WKHLU EXVLQHVVHV (QWHUSULVH ,UHODQG KDV GHYHORSHG DQG LV UROOLQJ RXW D VXLWH RI /HDQ VXS SRUW SURJUDPPHV WDUJHWHG DW WKH H[SRUWLQJ )RRG ,QGXVWU\ 7KHVH DUH WDLORUHG IRU FRPSDQLHV RI VLJ QLILFDQW VFDOH HJ VDOHV JUHDWHU WKDQ €P  VHFRQG WLHU FRPSDQLHV DQGVPDOOHU60(V7KHDSSURDFKHVDUH WDLORUHG WR EH DSSURSULDWH IRU FRPSD QLHVZLWKGLIIHULQJGHSWKVDQGEUHDGWK RIPDQDJHPHQWDQGUHODWHGDEVRUSWLRQ FDSDELOLWLHV

(17(535,6(,5(/$1'·652/( 2QDPRUHJHQHUDOOHYHO'LFNRXWOLQHV WKDW WKH )RRG 'LYLVLRQ LQ (QWHUSULVH ,UHODQGLVVWUXFWXUHGLQWRIRXUWHDPV 3ULPDU\ 0HDWV %HHI 3RUN DQG 6KHHSPHDW  'DLU\ DQG )XQFWLRQDO ,QJUHGLHQWV 3UHSDUHG &RQVXPHU )RRGV 2UJDQLFV DQG +RUWLFXOWXUH DQG %HYHUDJHV DQG %DNHU\ 7KHVH JURXSV DUH KHDGHG XS E\ D YHU\ H[SHULHQFHG PDQDJHPHQW WHDP RI 'HUHN %UHHQ 0LFKDHO 0RULDUW\ -LP 0XOFDK\ DQG -RH +HDO\ 7KHLU WHDPV RI 'HYHORSPHQW $GYLVHUV DUH


ENTERPRISE IRELAND

LQWXUQVXSSRUWHGZLWKLQWKH'LYLVLRQ E\ VSHFLDOLVWV LQ +5' DQG )RRG 7HFKQRORJLHV ([WHUQDOWRWKH'LYLVLRQ(QWHUSULVH ,UHODQG KDYH WKH FDSDELOLW\ WR LQYROYH DW D FRPSDQ\ OHYHO D WHDP RI FRP PHUFLDOLVDWLRQ VSHFLDOLVWV LQWHUIDFLQJ ZLWKWKHUHVHDUFKFRPPXQLW\LQ7KLUG /HYHO DQG IXQFWLRQDO VSHFLDOLVWV ZLWK H[SHUW NQRZOHGJH LQ DUHDV VXFK DV 6XSSO\ &KDQJH 0DQDJHPHQW /HDQ 0 D Q X I D F W X U L Q J   % H Q F K P D U N L Q J  7HFKQRORJ\ 7UDQVIHU HWF LQ DGGLWLRQ WR D EXVLQHVV LQIRUPDWLRQ FHQWUH ZLWK FDSDELOLW\ WR XQGHUWDNH UHVHDUFK DQG SURYLGHEXVLQHVVLQIRUPDWLRQIRULQGL YLGXDOFRPSDQLHV 'LFN JRHV RQ WR H[SODLQ WKDW (QWHUSULVH ,UHODQGĂ&#x2013;V UROH LQ WKH GHYHO RSPHQWRIWKHIRRGDQGGULQNLQGXVWU\ GLIIHUVIURPDOORWKHUVHFWRUVIRUZKLFK LWKDVUHVSRQVLELOLW\LQWKDW(QWHUSULVH ,UHODQG GRHV QRW KDYH WKH UROH RI VXS SRUWLQJ FRPSDQLHV LQ H[SRUW PDUNHWV Ă&#x2DC;7KLV LV WKH UROH RI RXU VLVWHU DJHQF\ %RUG%LDZKLFKZRUNVYHU\SRVLWLYHO\ ZLWK XV LQ WKH FROODERUDWLYH GHYHORS PHQWRIH[SRUWOHGFRPSDQLHVĂ&#x2122;KHQRWHV

6,*1,),&$17&+$//(1*( 'LFNFRQFOXGHVWKDWĂ&#x2DC;WKHFKDOOHQJHVIRU WKH,ULVKIRRGDQGGULQNVHFWRUDUHUHDO 7RZLQWKHIRRGLQGXVWU\IURPIDUPWR PDUNHWQHHGVWRRSHUDWHDVDWHDPLQ JRLQJ DIWHU WKH ELJ SUL]HV (QWHUSULVH ,UHODQGLVWKHUHWRKHOSWKHFRPSDQLHV GHYHORSLQJ QHZ PDUNHW OHG SURGXFWV EXLOGLQJ PDQDJHPHQW DQG OHDGHUVKLS FDSDELOLW\WRDEHVWLQZRUOGFODVVOHYHO ,WLVDOVRDVVLVWLQJZLWKWKHH[SDQVLRQ RI IDFLOLWLHV GHYHORSLQJ SURGXFWLRQ V\VWHPVWRZRUOGFODVVĂ&#x2022;/HDQĂ&#x2013;VWDQGDUGV DQGIRVWHULQJPDUNHWOHGFROODERUDWLRQ

EHWZHHQ 7KLUG /HYHO H[SHUWLVH DQG LQGXVWU\$QGFULWLFDOO\WKLVVXSSRUWLV GHOLYHUHG LQ SDUWQHUVKLS ZLWK '$)) 7HDJDVFDQG%RUG%LDDORQJWKHWRWDO YDOXHFKDLQĂ&#x2122; 0RUH LQIRUPDWLRQ FDQ EH JRW RQ DOO RI (QWHUSULVH ,UHODQGĂ&#x2013;V LQLWLD WLYHV E\ DFFHVVLQJ WKH ZHEVLWH ZZZ HQWHUSULVHLUHODQGFRP$OWHUQDWLYHO\ HDFK FOLHQW FRPSDQ\ KDV DQ DVVLJQHG 'HYHORSPHQW $GYLVHU ZKR ZLOO EH KDSS\ WR DGYLVH DV WR ZKDW PLJKW EH DYDLODEOHLQWKHFRQWH[WRI\RXUFRP SDQ\Ă&#x2013;VQHHGV

Ă?

ABOUT THE AUTHOR Dick Lenehan was appointed as Head of the Food Division at Enterprise Ireland in May 2008. A chartered Civil Engineer who also holds a degree in Commerce, Dick has worked in a variety of business development roles in both the IDA and Enterprise Ireland throughout the past 30 years. In Enterprise Ireland, Dick Lenehan has previously held a number of key management roles across industrial markets and food sector start-ups, life sciences, print, packaging and construction sectors. Commenting on his role, he said, â&#x20AC;&#x153;I am fortunate to lead a very experienced Enterprise Ireland team, which is taking on the challenge of contributing to the sustainable development of the food sector, which is of such key importance to the Irish economy. â&#x20AC;&#x153;Enterprise Ireland will continue to work to support and encourage the development of new export focused Irish food companies; whilst supporting and developing our existing client food companies at every stage of development.â&#x20AC;?

Speeding Up Honeytopâ&#x20AC;&#x2122;s Pancake Production ABB ROBOTS ARE HELPING HONEYTOP SPECIALITY FOODS LTD TO IMPROVE PRODUCTIVITY AND HYGIENIC CONDITIONS.

$

%%Ă&#x2013;V URERWLF WHFKQRORJ\ KDV KHOSHG WUDQVIRUP WKH SURGXFWLRQ RI SDQFDNHV DW WKH +RQH\WRS 6SHFLDOLW\ )RRG /WG SODQW E\ WKH LQVWDOODWLRQ RI WZROLQHVHDFKXWLOLVLQJIRXU)OH[3LFNHU ,5%  URERWV IRU WKH SLFNLQJ DQG VWDFNLQJ RI SDQFDNHV 7KH VROXWLRQ GHVLJQHGEXLOWDQGLQVWDOOHGE\$%%Ă&#x2013;V FKDQQHOSDUWQHU5*/XPDHQVXUHVWKH FRPSDQ\ FDQ PHHW LWV RZQ VWULQJHQW UHTXLUHPHQWVIRUWKHK\JLHQLFKDQGOLQJ RIIRRGDVZHOODVLQWURGXFLQJUHGXFHG ODERXUFRVWVDQGLPSURYHGKHDOWKDQG VDIHW\OHYHOVDWWKHVTXDUHIRRW PDQXIDFWXULQJ SODQW LQ 'XQVWDEOH %HGIRUGVKLUH8. +RQH\WRS 6SHFLDOLW\ )RRGV /WG WKH8.Ă&#x2013;VOHDGLQJSULYDWHO\RZQHGQDDQ EUHDG SURGXFHU DQG (XURSHĂ&#x2013;V OHDGLQJ YROXPHPDQXIDFWXUHURIVSHFLDOLW\IODW

EUHDGV SURGXFHV PRUH WKDQ  DUWLVDQDOEUHDGVDQKRXU5HFRJQLVLQJ WKH QHHG WR LPSURYH SURGXFWLYLW\ WKH IRRGVSHFLDOLVWDSSURDFKHG5*/XPD VXSSOLHUV RI LQGXVWULDO DXWRPDWLRQ VSHFLDO SXUSRVH PDFKLQHV DQG URERWLF LQWHJUDWLRQ ZLWK WKH UHTXLUHPHQW IRU QHZ DXWRPDWHG SURGXFWLRQ OLQHV WR KHOS LPSURYH K\JLHQLF FRQGLWLRQV DW WKHSODQWDQGLQFUHDVHIOH[LELOLW\IRUWKH SURGXFWLRQRISDQFDNHV 1 1 FOOD IRELAND

7KHDQVZHUZDVWRLQWURGXFHIOH[ LELOLW\ VSHHG DQG TXDOLW\ ZLWK IRXU )OH[3LFNHUURERWVFDSDEOHRIKDQGOLQJ SLFNVSHUPLQXWHWRHQVXUHDOOSDQ FDNHV DUH SLFNHG DQG VWDFNHG TXLFNO\ DQGSUHFLVHO\ 7KHVROXWLRQLVVSLOWLQWRIRXUDUHDVRI RSHUDWLRQHQDEOLQJWKHURERWVWRRSHU DWHLQDOWHUQDWLYHDUHDVWRWKHSUHFHGLQJ URERWRQWKHOLQH7KHUHVXOWLVIRXU$%% )OH[3LFNHU URERWV HYHQO\ VSDFHG RXW HDFK PDQQLQJ RQH VHFWLRQ RI WKH FRQ YH\RU7KLVORDGVKDULQJV\VWHPFRPHV FRPSOHWHZLWKDEXIIHUV\VWHPGHVLJQHG E\5*/XPDWRUHGXFHZDVWHOHYHOVDV WKHULJKWVWDFNRISURGXFWVLVSURGXFHG RQWKHFHQWUDORXWIHHGFRQYH\RU )RU PRUH LQIRUPDWLRQ RQ $%%Ă&#x2013;V ,5%  )OH[3LFNHU RU LWV VXSSRUWLQJ VRIWZDUH HPDLO URERWLFV#JEDEEFRP RUFDOO

Ă?


INDUSTRY VIEW

Government Must Support Food Sector PAUL KELLY, DIRECTOR, FOOD AND DRINK INDUSTRY IRELAND (FDII), ON THE BIG ISSUES FACING IRISH FOOD AND DRINKS COMPANIES IN 2010, AND THE MEASURES THAT MUST BE TACKLED TO ADDRESS THEM.

,

UHODQGร–V IRRG DQG GULQN FRPSD QLHV KDYH VXIIHUHG GHVSHUDWHO\ W K U R X J K R X W        : L W K R X W HQOLJKWHQHG SROLF\ LQWHUYHQ WLRQ IURP *RYHUQPHQW  ZLOO VHH VLJQLILFDQW FDVXDOWLHV LQ ,UHODQGร–V PRVW LPSRUWDQWLQGLJHQRXVVHFWRU 7KHGDWDIRUPDNHVJULPUHDG LQJ5HWDLOVDOHVRIIRRGLQWKHGRPHVWLF PDUNHW GHFOLQHG E\  RQ D \HDURQ \HDUEDVLVDQGYROXPHVE\2QWKH H[SRUW IURQW WKH YDOXH RI H[SRUWV LQ LVH[SHFWHGWRGHFOLQHE\ โ‚ฌELO OLRQ FRPSDUHG ZLWK  7KH VHFWRU KDVH[SHULHQFHGLQH[FHVVRIMRE ORVVHV 7KLV KDV ZLGHU LPSOLFDWLRQV IRU WKHHFRQRP\EHFDXVHZLWKRQHLQHLJKW ,ULVKMREVUHODWHGGLUHFWO\RULQGLUHFWO\ WRWKHDJULIRRGVHFWRULWLVDVLPSRUWDQW IRU ,ULVK HFRQRPLF JURZWK DV WKH FDU LQGXVWU\LVWR*HUPDQ\ 7KH VHFWRU VXSSRUWV  MREV GLUHFWO\  MREV LQ GLVWULEXWLRQ DQGWKHOLYHOLKRRGVRI,UHODQGร–V IDUPHUV 7KH FULWLFDO LVVXH LV WR VXS SRUWHQWHUSULVHDQGHPSOR\PHQWLQWKH VHFWRU QRZ VR LW KDV WKH FDSDFLW\ DQG FRPSHWLWLYHQHVV WR WDNH DGYDQWDJH RI LPSURYLQJ HFRQRPLF FRQGLWLRQV LQ WKH GRPHVWLF PDUNHW DQG DEURDG RYHU WKH QH[WPRQWKV

5(7$,/%8<,1*32:(5 VDZDVLJQLILFDQWSXEOLFGLVFRXUVH RQ WKH LVVXH RI UHWDLO EX\LQJ SRZHU )',,KDVOHGWKHGHEDWHFDOOLQJIRUWKH LQWURGXFWLRQRIPHDVXUHVWRSURYLGHD IDLUWUDGLQJHQYLURQPHQWLQWKHJURFHU\ VHFWRU $V D UHVXOW RI WKLV GHEDWH WKH 7ยกQDLVWH DQG 0LQLVWHU IRU (QWHUSULVH 7UDGH (PSOR\PHQW0DU\&RXJKODQ 7'KDVODXQFKHGDSXEOLFFRQVXOWDWLRQ RQWKHLQWURGXFWLRQRIDFRGHRISUDF

7KH LPEDODQFH EHWZHHQ UHWDLOHUV DQG VXSSOLHUV LV QRW D XQLTXHO\ ,ULVK LVVXH DQG LV EHLQJ DGGUHVVHG LQ PDQ\ FRXQWULHVDFURVV(XURSHDQGDOVRE\WKH (XURSHDQ&RPPLVVLRQ&RQVXPHUVZLOO DOVR JDLQ DV LW ZLOO VXSSRUW D KHDOWK\ DQG GLYHUVH VXSSO\ EDVH ZLOOLQJ WR LQYHVWLQLQQRYDWLRQ7KHWLPHIRUWDON LQJLVQRZRYHUDQGWKH7ยกQDLVWHPXVW LQWURGXFH D VWDWXWRU\ FRGH EDFNHG XS ZLWK DQ RPEXGVPDQ DV D PDWWHU RI XUJHQF\

7+($'9(57,6,1*'(%$7(

Paul Kelly, Director, Food and Drink Industry Ireland.

WLFH RPEXGVPDQ IRU JURFHU\ JRRGV XQGHUWDNLQJV 7KHSXUSRVHRIWKH&RGHLVWRHQVXUH WKDWXQIDLUSUDFWLFHVVXFKDVDUELWUDU\ ILQDQFLDO GHPDQGV DUH HIIHFWLYHO\ RXW ODZHG LQ WKH VHFWRU 7KHVH SD\PHQWV WKUHDWHQ WKH YLDELOLW\ RI VXSSOLHUV LQ WKH VHFWRU XSRQ ZKLFK RYHU  SHRSOH GHSHQG IRU HPSOR\PHQW 7KH FRGH ZLOO HQVXUH UHWDLOHUV HQWHU LQWR PRUH EDODQFHG ELQGLQJ DJUHHPHQWV ZLWK VXSSOLHUV ZKHUH ULVN DQG FRVW LV SURSRUWLRQDWHO\VKDUHG8OWLPDWHO\WKH FRQVXPHU ZLOO EHQHILW DV UHWDLOHUV FDQ FRQWLQXH WR SURYLGH DFFHVV WR TXDOLW\ ,ULVKIRRGDWDIIRUGDEOHSULFHV:LWKRXW D&RGHWKHUHLVDULVNWKDWVXSSOLHUVZLOO EH IRUFHG WR UHWUHQFK VWDOO LQYHVWPHQW DQGVHHWKHLUDELOLW\WRVHUYLFHUHWDLOHUV LQPRUHUHPRWHDUHDVFULWLFDOO\LPSDLUHG 1 2 FOOD IRELAND

$QRWKHU NH\ SROLF\ TXHVWLRQ WKDW WKH *RYHUQPHQW PXVW DGGUHVV HIIHFWLYHO\ IRFXVHV RQ DGYHUWLVLQJ )ROORZLQJ WKH HVWDEOLVKPHQW RI WKH %URDGFDVWLQJ $XWKRULW\ RI ,UHODQG %$,  WKH IRUWKFRPLQJ UHYLHZ RI WKH &KLOGUHQร–V $GYHUWLVLQJ &RGH KDV WKH SRWHQWLDO WR KLQGHU,ULVKIRRGFRPSDQLHVร–DELOLW\WR EXLOGWKHLUEUDQGVWKURXJKDGYHUWLVLQJ LQ WKH 5HSXEOLF RI ,UHODQG 7KHUH LV D VLJQLILFDQW ULVN WKDW LI WKH %$, FUHDWHV DQRYHUO\UHVWULFWLYHUHJXODWLRQUHJLPH VXFK DV D ZDWHUVKHG RQ IRRG DGYHUWLV LQJ DQG UHGXFWLRQV LQ DXGLHQFH SURILOH WKUHVKROGV LW ZLOO QRW LPSDFW RQ WKH REHVLW\ LVVXH LQ DGGLWLRQ WR OLPLWLQJ FRPSDQLHVร–DELOLW\WREXLOGWKHLUEUDQGV ,WLVYLWDOWKDWWKH%$,ILQGVDVXV WDLQDEOH EDODQFH DQG DFNQRZOHGJHV WKDW ,ULVK IRRG FRPSDQLHV FXUUHQWO\ FRQIRUP WR VWULFW JXLGHOLQHV XQGHU WKH $GYHUWLVLQJ 6WDQGDUGV $XWKRULW\ IRU ,UHODQG $6$,  :KHQ WKH &HQWUDO &RS\ &OHDUDQFH ,QLWLDWLYH &&&,  DQ LQGXVWU\VHOIUHJXODWRU\LQLWLDWLYHZKHUH DGYHUWLVLQJ ZDV YHWWHG ZDV XQGHU RSHUDWLRQWKHUHZDVQร–WRQHFRQWUDYHQ WLRQRIWKHVHJXLGHOLQHVE\SDUWLFLSDWLQJ FRPSDQLHV


INDUSTRY VIEW

7KH %$, PXVW HQJDJH ZLWK LQGXV WU\LQDUHDOZD\RQWKHQHZDGYHUWLV LQJFRGHVDVLWLVYLWDOWKDWDVLWXDWLRQ GRHVQร–W DULVH ZKHUH WKH DGYHUWLVLQJ RI PDQ\SURGXFWVDUHUHVWULFWHGLQ,UHODQG GULYLQJ DGYHUWLVLQJ SULFHV XS DQG VLJ QLILFDQWO\UHGXFLQJFRPSDQLHVร–DELOLW\WR EXLOGEUDQGVKHUHLQ,UHODQGUHVXOWLQJ LQDORVVRIPDUNHWVKDUH

7+(67(5/,1*'(&/,1( 7KHGHFOLQHLQWKHYDOXHRI6WHUOLQJLV DKXJHLVVXHIRUWKH,ULVKIRRGLQGXV WU\ ร“ SXW VLPSO\ WKH  RI IRRG H[SRUWVWKDWJRWRWKH8.DUHDFKLHY LQJSULFHV ZKHQFRQYHUWHGEDFNLQWR HXURV OHVVWKDQPRQWKVDJR 6LPLODUO\ WKHUH LV GLVSODFHPHQW RI ,ULVK SURGXFW RQ ,ULVK UHWDLO VKHOYHV E\6WHUOLQJGHQRPLQDWHGSURGXFWDQG DQ H[RGXV RI VKRSSHUV WR 1RUWKHUQ ,UHODQG +DYLQJ VDLG WKDW WKH GLYHU JHQFH EHWZHHQ QRUWK DQG VRXWK LV VWDUWLQJ WR GLPLQLVK VLJQLILFDQWO\ $QQXDOIRRGLQIODWLRQLVQRZUXQQLQJ DW  LQ WKH 5HSXEOLF RI ,UHODQG ZKHUHDVLWLVLQWKH8. 7KH WZR PDLQ ZD\V RI GHDOLQJ ZLWKWKHGLVSODFHPHQWLVVXHDUHWRFXW FRVWVDQGJHWFRPSHWLWLYHDJDLQDQGWR H[SODLQ WKH YDOXH SURSRVLWLRQ RI ,ULVK IRRGWRWKHFRQVXPHU)RRGFRPSDQLHV KDYHEHHQUHOHQWOHVVLQVWULSSLQJFRVWV RXWRIWKHLUEXVLQHVVHVDQGJHQHUDWLQJ HIILFLHQFLHV %XW WKHLU KDQGV DUH WLHG EHKLQG WKHLU EDFN DV ZH FRQWLQXH WR IDFHVRPHRIWKHKLJKHVWLQGXVWULDOHOHF WULFLW\FRVWVLQWKH(8ZDVWHFKDUJHV GRXEOH WKH OHYHO LQ WKH 8. DQG DYHU DJHLQGXVWULDOZDJHVKLJKHUKHUH %ULQJLQJRXUFRVWEDVHLQOLQHZLWKRXU QHDUHVW DQG ELJJHVW FRPSHWLWRU LV WKH RQO\ZD\ZHFDQVWD\RQUHWDLOVKHOYHV LQ,UHODQGDQG%ULWDLQ

Tรกnaiste and Minister for Enterprise, Trade & Employment, Mary Coughlan TD.

H[LVWLQJ HPSOR\PHQW DQG VWLPXODWLQJ MRE FUHDWLRQ LQ WKH VHFWRU  MREV ORVW VR IDU WKLV \HDU LQ WKH VHFWRU ZLOO FRVW DQ DGGLWLRQDO โ‚ฌP DQQXDOO\ LQ VRFLDOZHOIDUHSD\PHQWV

7+(9$/8(2),5,6+)22' )RRGFRPSDQLHVERWKLQGLYLGXDOO\DQG WKURXJKLQGXVWU\ZLGHLQLWLDWLYHVKDYH DOVR PDGH VLJQLILFDQW LQYHVWPHQWV LQ FRPPXQLFDWLQJWRFRQVXPHUVWKHYDOXH RI,ULVKSURGXFHDQGH[SODLQLQJSURY HQDQFHUHOLDELOLW\DQGWUXVWLQEUDQGV DV ZHOO DV SULFH 7KLV LV D FRPSOH[ PHVVDJHSHUKDSVEXWRQHWKDWUHIOHFWV WKH HFRQRPLF DQG VRFLDO LPSRUWDQFH RI IRRG DV RSSRVHG WR WKH VLPSOLVWLF SULFH FRPSDULVRQ VXUYH\V WRXWHG E\ FRQVXPHUERGLHV *RYHUQPHQW KDV D SDUW WR SOD\ DV ZHOO E\ SULRULWLVLQJ WKH SURWHFWLRQ RI

7KH SULRULW\ PXVW EH WR PDLQ WDLQ HPSOR\PHQW LQ WKH VHFWRU VXS SRUW H[SRUWV DQG KHOS FRPSDQLHV GHYHORS QHZ PDUNHWV DQG FXVWRPHUV *RYHUQPHQW FDQ GR WKLV LQ D QXPEHU RIZD\V ร ,QWURGXFH D VWDWHEDFNHG FUHGLW LQVXUDQFH VFKHPH 7KH QHFHVVDU\ FRYHUKDVEHFRPHXQDYDLODEOHRQWKH SULYDWHLQVXUDQFHPDUNHWEHFDXVHRI WKHILQDQFLDOFULVLV0DQ\(XURSHDQ FRXQWULHV KDYH PRYHG WR LQWURGXFH VXFK VFKHPHV WR KHOS WKHLU H[SRUW HUV 7KH DEVHQFH RI D VFKHPH LQ ,UHODQGSXWVRXUH[SRUWHUVDWDFRP SHWLWLYHGLVDGYDQWDJH ร ,QWURGXFHDWDUJHWHGVXSSRUWPHDV XUH WR DOORZ JUDQWV IRU VLJQLILFDQW SURGXFWLYLW\HQKDQFHPHQWPHDVXUHV E\H[SRUWPDQXIDFWXULQJFRPSDQLHV ZLWKDKLJKOHYHORIH[SRVXUHWRWKH 6WHUOLQJDUHD ร 0DLQWDLQIXQGLQJOHYHOVWRWKH$JUL IRRGUHVHDUFKSURJUDPPHWRVXSSRUW SULYDWHDQGSXEOLFLQQRYDWLRQFDSD ELOLW\LQWKHVHFWRU /RRNLQJ IRUZDUG WR  DQG EH\RQG WKH HFRQRP\ LV H[SHFWHG WR SXOORXWRIUHFHVVLRQWRZDUGVWKH HQGRI&RQVXPHUVSHQG LQJ LV H[SHFWHG WR ODJ RYHUDOO JURZWK DQG SRVLWLYH JURZWK LV QRW H[SHFWHG XQWLO  ([SRUWVDUHH[SHFWHGWREHWKH PDLQ GULYHU RI JURZWK EXW LQ WKH VKRUW WHUP ZLWK VXFK D ODUJH H[SRVXUH WR WKH 6WHUOLQJ]RQH IRRG FRPSDQLHV ZLOO FRQWLQXH WR H[SHUL HQFH GLIILFXOWLHV XQOHVV WKH\ GLYHU VLI\ LQ WR HXUR ] R Q H  P D U N H W V DQGRU 6WHUOLQJ V W U H Q J W K H Q V VLJQLILFDQWO\ %H\RQG WKDW DV HFRQRPLHV V W U H Q J W K H Q DQG WKH ZRUOG ZLGH JURZWK LQ GHPDQG IRU TXDOLW\ IRRG SURGXFH UHWXUQV WKHUH DUH KXJH RSSRUWXQLWLHV IRU ,ULVK IRRG FRPSDQLHV SUR YLGHG WKH IXQGDPHQWDOV RI FRPSHWLWLYHQHVVDQGLQQRYD WLRQDUHLQSODFH

ร

1 3 FOOD IRELAND


LOGISTICS

Excelling in Supply Chain Management EDWARD SWEENEY, DIRECTOR OF LEARNING, NATIONAL INSTITUTE FOR TRANSPORT AND LOGISTICS (NITL), ASSESSES LOGISTICS AND SUPPLY CHAIN MANAGEMENT EXCELLENCE IN A VOLATILE GLOBAL ENVIRONMENT.

1

RWZLWKVWDQGLQJ WKH GLI ILFXOWLHV DVVRFLDWHG ZLWK WKH FXUUHQW HFRQRPLF WXU EXOHQFH GRPHVWLFDOO\ DQG JOREDOO\ WKH IRRG DQG GULQN VHFWRU LQ ,UHODQGFRQWLQXHVWRSOD\DNH\UROHLQ WKH HFRQRP\ DQG UHSUHVHQWV D VLJQLIL FDQWSURSRUWLRQRIRYHUDOO*13H[SRUWV DQG HPSOR\PHQW 7KH FKDOOHQJHV SUH VHQWHGE\UHFHQWFKDQJHVLQWKHEXVLQHVV HQYLURQPHQWKDYHVKDUSHQHGWKHIRFXV RQ WKH QHHG IRU UREXVW DSSURDFKHV WR ORJLVWLFVDQGVXSSO\FKDLQLPSURYHPHQW 7KLV DUWLFOH EDVHG RQ WKH WKHPH RI WKH UHFHQW /RJLVWLFV ,UHODQG  FRQIHUHQFH VHWV RXW WKH NH\ FKDQJHV LQWKHVWUDWHJLFFRQWH[WRIVXSSO\FKDLQ PDQDJHPHQW 6&0  LQ D JOREDO DQG

DQ ,ULVK FRQWH[W ,W JRHV RQ WR RXWOLQH VRPHRIWKHNH\FKDUDFWHULVWLFVRI6&0 H[FHOOHQFHLQWKHIRRGDQGGULQNVHFWRU EDVHGRQWKHDXWKRUÃ&#x2013;VH[SHULHQFHDQGRQ GRFXPHQWHGHYLGHQFHLQWKHOLWHUDWXUH 7KH SHUIRUPDQFH RI ,ULVK ILUPV LQ UHODWLRQ WR WKHVH NH\ FKDUDFWHULVWLFV LV GLVFXVVHG ZLWK UHIHUHQFH WR 1,7/Ã&#x2013;V RQJRLQJUHVHDUFKLQWKLVDUHD)URPWKLV DQXPEHURIFULWLFDOVXFFHVVIDFWRUVIRU HIIHFWLYHVXSSO\FKDLQUHHQJLQHHULQJLQ WKHVHFWRUDUHLGHQWLILHGDQGVRPHNH\ FRQFOXVLRQVGUDZQ

7+((92/9,1*675$7(*,& &217(;7 $ QXPEHU RI NH\ LVVXHV DUH FKDQJ LQJ WKH 6&0 VWUDWHJLF ODQGVFDSH 1 4 FOOD IRELAND

$UJXDEO\ WKH WKUHH PRVW VLJQLILFDQW VXFKLVVXHVDUH  ,QWHUQDWLRQDOLVDWLRQ RU JOREDOLVD WLRQ RIVXSSO\FKDLQV  9HUWLFDOGLVLQWHJUDWLRQ  7KH FKDQJLQJ UROH RI WKH VXSSO\ FKDLQLQVWUDWHJLFGLIIHUHQWLDWLRQ (DFKRIWKHVHGULYHUVLVDGGLQJFRP SOH[LW\WRIRRGDQGGULQNVXSSO\FKDQJH$ UHFRJQLWLRQRIWKHVWUDWHJLFUROHRI6&0LQ WKLVHYROYLQJFRQWH[WLVFULWLFDOWRWKHFRQ WLQXLQJVXFFHVVRI,ULVKILUPVLQWKLVVHFWRU $VLJQLILFDQWSURSRUWLRQRIWKHRYHU DOOFRVWEDVHRIIRRGDQGGULQNFRPSD


LOGISTICS

QLHVLVLQWKHVXSSO\FKDLQ+HQFHDQ\ ZRUWKZKLOHLPSURYHPHQWVWUDWHJ\QHHGV WRIRFXVRQWKHRSWLPLVDWLRQRIWRWDOVXS SO\ FKDLQ FRVWV DQG WKH HOLPLQDWLRQ RI QRQYDOXH DGGLQJ DFWLYLWLHV 19$V  D NH\REMHFWLYHRI6&0 &XVWRPHU VHUYLFH LV EHFRPLQJ D NH\ RUGHU ZLQQLQJ FULWHULRQ LQ PDQ\ VHFWRUV ,WV LPSRUWDQFH UHODWLYH WR SURGXFW TXDOLW\ QRZ RIWHQ ODUJHO\ DQ RUGHU TXDOLILHU  DQG SULFH ODUJHO\ GHWHUPLQHGE\WKHG\QDPLFVRIVXSSO\ DQGGHPDQGLQWKHPDUNHWDQGVXEMHFW WR GRZQZDUG SUHVVXUH LQ PDQ\ VHF WRUV  KDV LQFUHDVHG )RRG DQG GULQN FRPSDQLHV KDYH ORQJ UHFRJQLVHG WKDW FXVWRPHU VHUYLFH H[FHOOHQFH LV GHOLY HUHGE\WKHVXSSO\FKDLQ,QWKLVZD\ WKH VXSSO\ FKDLQ LWVHOI KDV EHFRPH D NH\GHWHUPLQDQWRIFRPSHWLWLYHDGYDQ WDJH ,Q VKRUW D FRPSDQ\ SXUVXLQJ D FRVWOHDGHUVKLSVWUDWHJ\DGLIIHUHQWLD WLRQ VWUDWHJ\ RU VRPH K\EULG RI WKHVH WZRFDQOHYHUDJHWKHVXSSO\FKDLQDV D IXQGDPHQWDO HOHPHQW RI WKHLU HIIRUW WRLPSURYHFRPSHWLWLYHSHUIRUPDQFH

7+(,5,6+&217(;77+( ,03257$1&(2)6&0 ,Q DGGLWLRQ WR WKH HYROYLQJ VWUDWHJLF FRQWH[W DQG WR WKH SRWHQWLDO RSHUD WLRQDO EHQHILWV LQ WHUPV RI FXVWRPHU VHUYLFHDQGVXSSO\FKDLQHFRQRPLFV 6&0 LV RI SDUWLFXODU LPSRUWDQFH LQ DQ ,ULVK FRQWH[W IRU VHYHUDO UHDVRQV ,UHODQG LV RQH RI WKH PRVW RSHQ

HFRQRPLHV LQ WKH ZRUOG ZLWK ERWK LPSRUWV DQG H[SRUWV UHSUHVHQWLQJ D VLJQLILFDQWSURSRUWLRQRIRYHUDOOHFR QRPLFDFWLYLW\ ,QGHHG WKH H[SRUWRULHQWDWLRQ RI WKH ,ULVK HFRQRP\ ZDV WKH SULQFLSDO GULYHU RI RYHUDOO HFRQRPLF VXFFHVV LQ WKH HDUO\ \HDUV RI WKH &HOWLF 7LJHU /RJLVWLFV DQG 6&0 DUH NH\ DFWLYLWLHV LQWKLVFRQWH[W *LYHQ,UHODQGÖVUHODWLYHJHRJUDSKL FDO SHULSKHUDOLW\ DQG WKH UHVXOWLQJ WUDQVSRUWDWLRQ FRVW GLVDGYDQWDJH IDFHGE\FRPSDQLHVORFDWHGKHUHLWLV LPSRUWDQWWRQRWHWKDWWUDQVSRUWDWLRQ FRVWVDUHRQO\RQHDQGRIWHQQRWWKH PRVWVLJQLILFDQWHOHPHQWRIWRWDOVXS SO\ FKDLQ FRVWV )XUWKHUPRUH VPDOO FRPSDQLHV DUH LQFUHDVLQJO\ UHFRJQLV LQJWKHLUUROHDVSDUWRIRIWHQJOREDO VXSSO\ FKDLQ FRQILJXUDWLRQV 7KLV LV LPSRUWDQW DV WKH JUHDW PDMRULW\ RI FRPSDQLHVLQWKH,ULVKIRRGDQGGULQN VHFWRU DUH VPDOO DQG PHGLXPVL]H HQWHUSULVHV 60(V 

H[KDXVWLYH OLVW RI WKH FKDUDFWHULVWLFV RI6&0H[FHOOHQFHEXWWKHIROORZLQJ IRXUHOHPHQWVDSSHDUWREHRIFULWLFDO LPSRUWDQFHIRUPRVWFRPSDQLHVLQWKH IRRGDQGGULQNVHFWRU

&+$5$&7(5,67,&62)6&0 (;&(//(1&( 6R ZKDW DUH WKH FKDUDFWHULVWLFV LQ HYLGHQFH LQ FRPSDQLHV WKDW PLJKW EH UHJDUGHG DV ZRUOG FODVV" Õ:RUOG &ODVVÖ LQ WKLV FRQWH[W PHDQV FRP SDQLHV WKDW KDYH EHHQ VXFFHVVIXO LQ WRXJK FRPSHWLWLYH LQWHUQDWLRQDO PDUNHWV RYHU D VXVWDLQHG SHULRG RI WLPH ,W LV LPSRVVLEOH WR GHYHORS DQ

7KLV LV EDVHG RQ GRFXPHQWHG HYL GHQFHRI6&0ØEHVWSUDFWLFHÙDQGDOOLHV ZLWKWKHDXWKRUÖVH[SHULHQFH,WLVZRUWK H[SORULQJWKHSHUIRUPDQFHRIFRPSDQLHV LQ,UHODQGLQUHODWLRQWRWKHVHLVVXHV

Ý ,GHQWLILFDWLRQ DQG PHDVXUHPHQW RI FXVWRPHUVHUYLFHEHFDXVHFXVWRPHU VHUYLFH ÕVHWV WKH VSHFÖ IRU VXSSO\ FKDLQGHVLJQ Ý ,QWHJUDWLRQ RI VXSSO\ FKDLQ DFWLYL WLHV DQG LQIRUPDWLRQ EHFDXVH PDQ\ VXSSO\ FKDLQ 19$V DUH FDXVHG E\ IUDJPHQWHGVXSSO\FKDLQFRQILJXUD WLRQV Ý 6&0DQGORJLVWLFVLVDVHQLRUPDQ DJHPHQWIXQFWLRQEHFDXVH6&0LVD VWUDWHJLFDFWLYLW\ Ý (VWDEOLVKPHQW DQG PHDVXUHPHQW RI VXSSO\ FKDLQ NH\ SHUIRUPDQFH LQGLFDWRUV .3,V EHFDXVHZKDWJHWV PHDVXUHGJHWVGRQH

+2:'2&203$1,(6,1 ,5(/$1'0($685(83" 1,7/ FDUULHV RXW UHVHDUFK DLPHG DW DVVHVVLQJWKHVXSSO\FKDLQFDSDELOLW\RI FRPSDQLHV LQ ,UHODQG DFURVV DOO PDMRU VHFWRUVRIWKHHFRQRP\LQFOXGLQJIRRG DQGGULQN$QXPEHURILQWHUHVWLQJIDFWV DUH HYLGHQW IURP WKLV UHVHDUFK LQ UHOD WLRQ WR WKH IRXU NH\ FKDUDFWHULVWLFV RI 6&0H[FHOOHQFHRXWOLQHGLQWKHSUHYL RXVVHFWLRQ Ý $SSUR[LPDWHO\  RI FRPSDQLHV PHDVXUH FXVWRPHU VHUYLFH IRUPDOO\ DQGWKHVHWHQGWRKDYHYHU\OLPLWHG PHDVXUHPHQWV Ý &RPSDQLHVVFRUHSRRUO\LQUHODWLRQ WR KDYLQJ WKH ODWHVW VXSSO\ FKDLQ LQIRUPDWLRQ DQG FRPPXQLFDWLRQV WHFKQRORJ\ ,&7 DQGKDYLQJWKHP LQWHJUDWHGDFURVVWKHVXSSO\FKDLQ Ý $VPDOOPLQRULW\RIFRPSDQLHVKDYH DQ\IRUPDO6&0SRVLWLRQ

Edward Sweeney of NITL is pictured (third from left) at Logistics Ireland 2009, with (l to r): Professor Martin Christopher, Dr Daniel Park, Dr Claudia Wagner, Colm Ryan and Professor David Grant. 1 5 FOOD IRELAND

Ý )HZFRPSDQLHVXVHFOHDUO\GHILQHG 6&0.3,V


LOGISTICS

2YHUDOO DQDO\VLV RI WKH UHVHDUFK ILQGLQJVLQGLFDWHVWKDWZKLOVWSRFNHWV RI H[FHOOHQFH XQGRXEWHGO\ GR H[LVW WKHUHLVVLJQLILFDQWURRPIRULPSURYH PHQWLQWKHVHNH\DUHDV$QXPEHURI SRVVLEOH EDUULHUV WR 6&0 H[FHOOHQFH KDYH DOVR EHHQ LGHQWLILHG DQG ZLOO EH H[SORUHG DV SDUW RI WKH RQJRLQJ UHVHDUFK DQG DVVRFLDWHG DQDO\VLV 7KHVHLQFOXGH Ă? ,QHIILFLHQFLHVDUHRIWHQEXLOWLQWRWKH VXSSO\FKDLQ Ă? &RPPXQLFDWLRQVWUXFWXUHVDUHRIWHQ LQHIIHFWLYHDQGH[FKDQJHRILQIRUPD WLRQSRRU Ă? &RUSRUDWHFXOWXUHRIWHQPDNHVHIIHF WLYHLQWHUILUPFROODERUDWLRQGLIILFXOW Ă? 7KHUH LV DQ H[FHVVLYH UHOLDQFH RQ IRUHFDVWLQJDQGVWRFNKROGLQJ Ă? 3UREOHPVDUHRIWHQPDQDJHGUDWKHU WKDQEHLQJVROYHGE\LGHQWLI\LQJDQG HOLPLQDWLQJWKHLUFDXVHV ,W LV LPSRUWDQW WKHUHIRUH WKDW DQ\ UREXVW DSSURDFK WR VXSSO\ FKDLQ LPSURYHPHQWDQGUHHQJLQHHULQJDWOHDVW DGGUHVVHVWKHVHDUHDVPHDQLQJIXOO\

6833/<&+$,1 5((1*,1((5,1* ,PSURYLQJ VXSSO\ FKDLQ SHUIRUPDQFH WKURXJKUHHQJLQHHULQJLQYROYHVDQDO\ VLVRILQWHUQDODQGH[WHUQDOSDUDPHWHUV XVLQJUHOHYDQWGDWDZKLFKKDVEHHQFRO OHFWHGWKHLGHQWLILFDWLRQDQGHYDOXDWLRQ RI SRVVLEOH DOWHUQDWLYH LPSURYHPHQWV DQG WKHLU GHWDLOHG SODQQLQJ DQG WKH LPSOHPHQWDWLRQ RI SODQQHG LPSURYH PHQWVLQFOXGLQJWKHDVVRFLDWHGFKDQJH PDQDJHPHQW,QVKRUW 5HHQJLQHHULQJ $QDO\VLV3ODQQLQJ ,PSOHPHQWDWLRQ ,WLVLPSRUWDQWWREHDULQPLQGWKDWLQ VXSSO\FKDLQUHHQJLQHHULQJQRSDQDFHD RUĂ&#x2022;PDJLFVROXWLRQĂ&#x2013;H[LVWV)XUWKHUPRUH DV HYHU\ FRPSDQ\ DQG HYHU\ VXSSO\ FKDLQ LV XQLTXH LQ VRPH UHVSHFW LW LV LQDSSURSULDWH WR DWWHPSW WR FRS\ RU LPLWDWH FRPSDQLHV UHJDUGHG DV EHLQJ H[SRQHQWVRIJRRGSUDFWLFH7KHXQLTXH QHVVFRXOGEHZLWKUHVSHFWWRSURGXFWV RU VHUYLFHV VXSSOLHG SURFHVVHV FXV WRPHUH[SHFWDWLRQVSHRSOHDQGFXOWXUDO

NITLâ&#x20AC;&#x2122;s Edward Sweeney is pictured chatting with Ingrid Miley of RTE at the recent Logistics Ireland conference.

LVVXHVV\VWHPVRUDQ\RQHRIDQXPEHU RI RWKHU IDFWRUV +RZHYHU WKHUH LV D ORJLFDODQGV\VWHPDWLFZD\RIDGGUHVVLQJ WKHVH FKDOOHQJHV EDVHG RQ HVWDEOLVKHG PHWKRGRORJLHVDQGDVVRFLDWHGWRROVDQG WHFKQLTXHV

&21&/8',1*&200(176 7KH FKDQJLQJ G\QDPLFV RI WKH VHFWRU JOREDOO\ KDYH UHVXOWHG LQ D VLWXDWLRQ ZKHUH WKH HIIHFWLYH PDQDJHPHQW RI IRRGDQGGULQNVXSSO\FKDLQVLVEHFRP LQJ LQFUHDVLQJO\ UHJDUGHG DV D PDMRU VRXUFH RI FRPSHWLWLYH DGYDQWDJH ,Q VKRUW WKH SRWHQWLDO H[LVWV DFURVV WKH LQGXVWU\WRVLJQLILFDQWO\HQKDQFHVKDUH KROGHU YDOXH WKURXJK WKH DGRSWLRQ RI 6&0WKLQNLQJ 7KHVSHFLILFHQYLURQPHQWLQZKLFK WKHLQGXVWU\RSHUDWHVEULQJVLWVRZQ SDUWLFXODU FKDOOHQJHV EXW WKHVH DUH QRW LQVXUPRXQWDEOH Ă&#x201C; UDWKHU WKH\ UHTXLUH WKDW FUHDWLYH 6&0 VWUDWH JLHVEHGHYHORSHGDQGWKHQH[HFXWHG VXSHUEO\ ZLWK VWURQJ DWWHQWLRQ WR GHWDLO )LQDOO\WKHDXWKRUĂ&#x2013;VH[SHULHQFHLQGL FDWHVWKDWWKHUHDOFULWLFDOVXFFHVVIDFWRUV LQ DQ\ VXSSO\ FKDLQ UHHQJLQHHULQJ RU FKDQJH SURFHVV LQ WKH VHFWRU UHODWH WR WKH SHRSOH GLPHQVLRQ DQG VSHFLILFDOO\ WRWKHQHHGWRHQKDQFHNQRZOHGJHDQG VNLOOOHYHOVWKURXJKHIIHFWLYHHGXFDWLRQ DQGOHDUQLQJ

Ă?

1 6 FOOD IRELAND

ABOUT THE AUTHOR Edward Sweeney is Director of Learning at the National Institute for Transport and Logistics (NITL). He has held full-time and visiting academic positions in universities in Ireland, the UK and Asia, and has worked with several leading Irish and multinational companies. The National Institute for Transport and Logistics (NITL) based at the Dublin Institute of Technology (DIT), works with individuals and organisations throughout Ireland and further afield through its education, research and consultancy activities in logistics and SCM. â&#x20AC;&#x2DC;Supply Chain Management and Logistics in a Volatile Global Environmentâ&#x20AC;&#x2122; by Edward Sweeney and friends was published recently by Blackhall Publishing in Dublin and is available from the publisher, amazon.co.uk and all good bookshops.


EXPORTING

Expanding Outside the Domestic Market 7+(,5,6+(;3257(56$662&,$7,21+$9(/$81&+('7+(1(:&+$11(/&/867(56 352*5$00(72+(/3'20(67,&)22'$1''5,1.&203$1,(67$&./((;32570$5.(76

$

QHZ %XVLQHVV 'HYHORSPHQW 3URJUDPPH WDLORUHG VSHFLIL FDOO\ WRZDUGV KHOSLQJ VPDOO DQG PHGLXP VL]HG IRRG DQG GULQN VXSSOLHUV LQ H[SRUW PDUNHWV KDV EHHQ ODXQFKHG E\ WKH ,ULVK ([SRUWHUV $VVRFLDWLRQ 7KH Õ&KDQQHO &OXVWHUVÖ SURMHFWZLOOVHHILUPVEHQHILWIURPKDQGV RQPHQWRULQJIURPH[SHUWVDQGH[SRVXUH DWDNH\LQWHUQDWLRQDOWUDGHIDLUQH[W\HDU 7KH ILYH FRPSDQLHV LQ WKH LQLWLDO FOXVWHU ZKR KDYH KDG YDU\LQJ GHJUHHV RIVXFFHVVLQH[SRUWPDUNHWVDUH'DZQ )UHVK )RRGV )HWKDUG &R 7LSSHUDU\  6LOYHU 3DLO 'DLU\ )HUPR\ &R &RUN  VDODGVXSSOLHU$*URZLQJ3OHDVXUH 1DDV &R.LOGDUH 8PPHUD6PRNHG3URGXFWV 7LPROHDJXH&R&RUN DQG'URPRODQG *DPH6SRUWV 'XEOLQDQG/LPHULFN  $V ZHOO DV H[KLELWLQJ XQGHU WKH ,ULVK ([SRUWHUV $VVRFLDWLRQ XPEUHOOD DW WKH )RRG DQG 'ULQN ([SR  LQ %LUPLQJKDPQH[W0DUFKDQGZRUNLQJ

WRJHWKHULQEHVWSUDFWLFHVKDULQJZRUN VKRSV HDFK FRPSDQ\ ZLOO DOVR JHW D VROLGEXVLQHVVRSSRUWXQLW\ZLWKWKHSUR JUDPPHÖV FKDQQHO SDUWQHU /D 5RXVVH )RRGVDOHDGLQJSUHPLXPIRRGVHUYLFH VXSSOLHU 7KH SURJUDPPH LQFOXGHV ILYH GD\V RI WDLORUHG EXVLQHVV PHQWRU LQJ IRU HDFK FRPSDQ\ ZLWK %XVLQHVV 'HYHORSPHQW &RQVXOWDQW 5RQDQ *LOOHVSLHRI1H[W6WHS,QWHUQDWLRQDO

,'(17,)<,1**52:7+ 23325781,7,(6 7KHHFRQRPLFGRZQWXUQDQGFRQWLQXLQJ SULFH GHIODWLRQ LQ WKH IRRG DQG GULQN VHFWRU RYHU WKH ODVW  PRQWKV KDYH IRUFHG VXSSOLHUV WR LGHQWLI\ EXVLQHVV JURZWK RSSRUWXQLWLHV DW KRPH DQG LQ H[SRUWPDUNHWVDQGWRORRNDWZD\VRI PDNLQJWKHLUEXVLQHVVHVPRUHHIILFLHQW Ø7KH &KDQQHO &OXVWHUV 3URMHFW LV WKH FRPSOHWH SDFNDJH RI DVVLVWDQFH IRU IRRG FRPSDQLHV QHHGLQJ WR PDNH WKH EUHDNWKURXJK LQ WHUPV RI VDOHV JURZWK DW KRPH DQGRYHUVHDVDQG GHYHORSLQJ QHZ S U R G X F W V  D Q G EUDQGVÙH[SODLQHG *RGIUH\ /\GRQ R I  W K H  , U L V K ( [ S R U W H U V $ V V R F L D W L R Q  Ø:LWK FRPSD QLHV XQGHU SUHV VXUH DV D UHVXOW RI ORZ FRQVXPHU FRQILGHQFH DQG Pictured at the launch of The Irish Exporters Association’s Channel WLJKWHU GLVSRV Clusters project are (from bottom left): Marie Kennedy, Dawn Fresh Foods; Pat Clarke, A Growing Pleasure; Godfrey Lydon, Irish Exporters DEOH LQFRPH WKH Association; Anthony Creswell, Umera Smoked Products; Don Walshe, QHHG IRU KDQGV Dromoland Game Sports; Marc Amand, La Rousse Foods; Ronan Gillespie, RQ H[SHUWLVH DQG Next Step International; Stuart Campbell, La Rousse Foods; Thea and Nikki Murphy, Silver Pail Dairy. DVVLVWDQFH WR JHW 1 7 FOOD IRELAND

WKHLUSURGXFWWRPDUNHWDQGNHHSLWWKHUH LVJUHDWHUWKDQHYHU7KH&KDQQHO&OXVWHUV 3URJUDPPHZLOOKHOSWKHPGRWKLV Ø'HVSLWHWKHGRZQWXUQWKHIRRGDQG GULQNVHFWRUFRQWLQXHVWRHPSOR\DURXQG SHRSOHGLUHFWO\DQGLQGLUHFWO\KDV WRWDORXWSXWLQWKHUHJLRQRI€ELOOLRQ DQGDFFRXQWVIRUWZRWKLUGVRIH[SRUWVE\ LQGLJHQHRXV PDQXIDFWXULQJ FRPSDQLHVÙ /\GRQFRQWLQXHGØZKLFKPHDQVWKDWWKH VHFWRUQHHGVWREHKHOSHGJHWEDFNRQLWV IHHWDQGUHDG\WRFRPSHWHÙ

0,1,0802) 3$57,&,3$7,1*&203$1,(6 7KH&KDQQHO&OXVWHUV3URJUDPPHZLOO KDYHDPLQLPXPSDUWLFLSDWLQJIRRG FRPSDQLHVLQ,UHODQGIURPWR Ø,WÖV JUHDW WR VHH WKHVH ILYH FRP SDQLHV DGGUHVVLQJ WKH QHZ EXVLQHVV HQYLURQPHQW LQ VXFK D SURDFWLYH ZD\Ù FRPPHQWHG5RQDQ*LOOHVSLHRI1H[W6WHS ,QWHUQDWLRQDO Ø7KH\ÖUH QRW ZDLWLQJ IRU WKLQJVWRKDSSHQWKH\ÖUHJRLQJWRPDNH WKHP KDSSHQ 2XU REMHFWLYH LV WR KHOS HDFKFRPSDQ\RQDRQHWRRQHEDVLVWR LGHQWLI\DQGH[SORLWEXVLQHVVRSSRUWXQLWLHV LQH[SRUWPDUNHWV:HZLOOZRUNZLWKRQH RIWKHFRPSDQLHVWRRSHQXSDGLVWULEX WLRQFKDQQHOLQWKH86IRUDQHZSURGXFW ODXQFKDQGZLWKDQRWKHURQDGGHGYDOXH SURGXFW GHYHORSPHQW WR WDS LQWR WKH %ULWLVKPDUNHW,QWHUPVRIWKHLURYHUDOO EXVLQHVV GHYHORSPHQW RWKHU LVVXHV ZH ZLOODGGUHVVRQWKHSURJUDPPHDUHEUDQG LQJFRVWFRQWURODQGEX\HUSUHVHQWDWLRQVÙ )RU IXUWKHU LQIRUPDWLRQ RQ WKH &KDQQHO &OXVWHUV SURJUDPPH FRQ WDFW 5RQDQ *LOOHVSLH 1H[W 6WHS ,QWHUQDWLRQDO7HOHPDLO URQDQJLOOHVSLH#LUHODQGFRPRU*RGIUH\ /\GRQ ,ULVK ([SRUWHUV $VVRFLDWLRQ 7HOHPDLOJRGIUH\O\GRQ# LULVKH[SRUWHUVRUJ

Ý


R&D

Commercial Benefits from FIRM funded research RELAY’S STRATEGIC FOCUS HAS CHANGED TO IDENTIFY COMMERCIAL OPPORTUNITIES FROM FIRM-FUNDED RESEARCH, WRITES RELAY’S DERBHILE TIMON, B.AGR.SC, MBA, DIP (IT).

5

(/$<UHVHDUFKIRUWKHIRRG LQGXVWU\ LV D XQLTXH VHUYLFH DQGWKHRQO\GHGLFDWHGSRUWDO IRU SXEOLFO\ IXQGHG IRRG UHVHDUFKLQ,UHODQG,WKDVEHHQIXQGHG E\ WKH 'HSDUWPHQW RI $JULFXOWXUH )LVKHULHV DQG )RRG WKURXJK WKH )RRG ,QVWLWXWLRQDO5HVHDUFK0HDVXUH ),50  VLQFH ,Q  5(/$<ÖV VWUDWHJLF IRFXV FKDQJHG DQG QRZ RQH RI LWV NH\ DLPV LV WR LGHQWLI\ FRPPHUFLDO RSSRUWXQL WLHV HPDQDWLQJ IURP ),50 IXQGHG UHVHDUFK 5(/$< VWDII ZRUN FORVHO\ ZLWK UHVHDUFKHUV DQG WKH 7HFKQRORJ\ 7UDQVIHU2IILFHV 772 DWWKHXQLYHUVL WLHV7HDJDVF,QVWLWXWHVRI7HFKQRORJ\WR LGHQWLI\ LQWHOOHFWXDO SURSHUW\ ,3  DQG SURMHFWVZLWKFRPPHUFLDOSRWHQWLDO

3527(&7,1*,17(//(&78$/ 3523(57< :KHQ ,3 LV LGHQWLILHG WKH 772 GHFLGH WKHPRVWDSSURSULDWHZD\WRSURWHFWWKH ,3IRUH[DPSOHWKH\FRXOGILOHDSDWHQW SURWHFWDVVHFUHWNQRZKRZ DVLVWKHFDVH ZLWK&RFD&ROD DQGRUDVVLJQFRS\ULJKW RUGHVLJQULJKWV+DYLQJGHFLGHGRQWKH PRVW DSSURSULDWH SURWHFWLRQ DQG FRP PHUFLDOLVDWLRQVWUDWHJ\5(/$<LVVXHVD FRPPHUFLDORSSRUWXQLW\DOHUWLQIRUPLQJ FRPSDQLHV RI WKH FRPPHUFLDO RIIHULQJ 7\SLFDOO\WKHVHDOHUWVVXPPDULVHWKHWHFK QRORJ\VWDJHRIGHYHORSPHQWDGYDQWDJH RI WKH WHFKQRORJ\ RYHU WKH FRPSHWLWLYH RIIHUWKHSULQFLSOHLQYHVWLJDWRUDQGGHWDLOV RIZKRWRFRQWDFW 'XULQJ WKH UHYLHZ RI WKH ),50 SURMHFWV   LW ZDV HVWDE OLVKHG WKDW  SDWHQWV KDG EHHQ ILOHG DQG DSSUR[LPDWHO\  SURMHFWV KDYH EHLQJ LGHQWLILHG DV KDYLQJ FRPPHUFLDO SRWHQWLDORUDUHLQWKHSURFHVVRIEHLQJ FRPPHUFLDOLVHG ,Q RWKHU SURMHFWV WKH

LQVWLWXWHXQLYHUVLW\ LV SURYLGLQJVHUYLFHVDQGRU IDFLOLWLHVWRLQGXVWU\

38%/,&*22' 6LJQLILFDQW ÕSXEOLF JRRGÖ YDOXHKDVEHHQJHQHUDWHG LQPDQ\SURMHFWVHJGDWD IURP WKH IRRG FRQVXPS WLRQ GDWDEDVHV IXQGHG WKURXJK ),50 SURYLGHG WKH)RRG6DIHW\$XWKRULW\ RI ,UHODQG )6$,  ZLWK GDWD WR HVWLPDWH WKH ULVN WR KXPDQ KHDOWK DVVRFL DWHG ZLWK WKH UHFHQW GLR[LQVFDUH:LWKRXWWKDW GDWDWKH)6$,ZRXOGQRW KDYH KDG WKH VFLHQWLILF SODWIRUP WR JXDUDQWHH SRUNSURGXFWVZHUHVDIH ),50 UHVHDUFK KDV DOVR OHG WR WKH GHYHORSPHQWRIH[SHUWLVHDQGHQKDQFHG FRPSHWHQFLHV WKURXJKRXW WKH UHVHDUFK FRPPXQLW\ 7R KHOS IRRG FRPSDQLHV LGHQWLI\ZKRZKHUHDQGZKDWH[SHUWLVH DQG HTXLSPHQW LV DYDLODEOH 5(/$< KDYH GHYHORSHG VHFWRUEDVHG JXLGHV 7KH PHDW WHFKQRORJ\ DQG H[SHUWLVH JXLGH IRU H[DPSOH IRFXVHV RQ WKH H[SHUWLVH HTXLSPHQW VHUYLFHV DQG FRQWDFW GHWDLOV IRU H[SHUWV DW 7HDJDVF 8QLYHUVLW\&ROOHJH&RUNDQG'XEOLQ $ UHFHQW H[DPSOH RI FRPPHUFLDO VXFFHVV UHODWHV WR D WHFKQRORJ\ WKDW LQFUHDVHV WKH VKHOIOLIH RI EUHDG E\ XS WRGD\V7KLVEUHDNWKURXJKKDVQRZ EHHQSDWHQWHGDQGOLFHQVHGWR3XUDWRV WKH %HOJLDQEDVHG PXOWLQDWLRQDO IRRG LQJUHGLHQWVFRPSDQ\3XUDWRVVXSSOLHV WKHEDNLQJDQGFRQIHFWLRQHU\LQGXVWULHV LQ RYHU  FRXQWULHV ZRUOGZLGH DQG ZLOO XSVFDOH WKH 8&& VFLHQWLVWVÖ ZRUN WRLQGXVWULDOOHYHOEHIRUHEULQJLQJLWWR 1 8 FOOD IRELAND

PDUNHW ),50 ILUVW IXQGHG 3URIHVVRU (ONH$UHQGWWRFRQGXFWWKLVUHVHDUFKLQ VXEVHTXHQWIXQGLQJZDVUHFHLYHG IURP(QWHUSULVH,UHODQG

5(/$<:(%6,7( 7KH 5(/$< ZHEVLWH  ZZZUHOD\UH VHDUFKLHLVDIRFDOSRLQWIRULQIRUPD WLRQ RQ UHVHDUFK SURMHFWV LQFOXGLQJ FRPPHUFLDO RSSRUWXQLWLHV DQG WHFKQRO RJ\ DQG H[SHUWLVH DOHUWV  UHVHDUFKHUV DQG LQVWLWXWLRQV DQG WKHLU DVVRFLDWHG DUHDV RI H[SHUWLVH DQG FDSDELOLW\ ,Q IDFWLI\RXZDQWWRNQRZZKDWZKRDQG ZKHUHIRRGUHVHDUFKLVEHLQJFRQGXFWHG LQ,UHODQGLWLVDYDLODEOHRQWKHZHEVLWH 5(/$< DLPV WR DVVLVW WKH IRRG LQGXVWU\ DQG DVVRFLDWHG VWDNHKROGHUV JDLQPD[LPXPEHQHILWIURPWKHNQRZO HGJHWHFKQRORJLHVDQGLQQRYDWLRQVJHQ HUDWHG IURP SXEOLFO\ IXQGHG UHVHDUFK LQ ,UHODQG LQ SDUWLFXODU WKDW IXQGHG WKURXJK),50

Ý


Technology meats Business: No. 1 for processing, packaging, selling

Frankfurt am Main 8 â&#x20AC;&#x201C; 13. 5. 2010 IFFA is the number one meeting point for the international meat industry. Only here will you find the latest trends and innovations as well as tailor-made technologies, products and services. Unique â&#x20AC;&#x201C; all market and technology leaders in the industry will be here to present their products and showcase the complete meat processing chain. Make sure youâ&#x20AC;&#x2122;re at IFFA 2010 in Frankfurt when the entire global meat industry meets up. info@ireland.messefrankfurt.com www.iffa.com


PACKAGING

What Your Packaging Says About Your Brand EFFECTIVE USE OF BRANDING IS ONE OF THE SIGNIFICANT CONTRIBUTORS TO A PRODUCTâ&#x20AC;&#x2122;S ULTIMATE SUCCESS OR FAILURE ON-SHELF. LORRAINE CARTER OF PERSONA DESIGN EXPLAINS HOW PACKAGING CAN MAKE ALL THE DIFFERENCE.

/

DXQFKLQJ QHZ SURGXFWV WR PDUNHW EH LW ZLWK D ORQJ HVWDEOLVKHG EXVLQHVV RU HDUO\ VWDUW XS LV ERWK DQ H[FLWLQJDQGGDXQWLQJWLPHDQGQHYHU PRUH VR WKDQ LQ WKH FXUUHQW HQYLURQ PHQW'RQHFRUUHFWO\LWĂ&#x2013;VDJUHDWZD\ WR JURZ \RXU EXVLQHVV SURILWDEO\ 0LVPDQDJHG DQG LW FDQ FDXVH XQWROG GDPDJH:LWKFDUHIXOEUDQGSODQQLQJ FOHDU XQGHUVWDQGLQJ DQG NH\ VWUDWH JLF GRĂ&#x2013;V DQG GRQĂ&#x2013;WV IRU WKH DOO EUDQG UHODWHG FRPPXQLFDWLRQV LW LV D YHU\ VXFFHVVIXO DQG FULWLFDO LQJUHGLHQW LQ GULYLQJWKHEXVLQHVVIRUZDUG 9DULRXV VWDWLVWLFV RQ WKH IDLOXUH UDWHV RI QHZ SURGXFW ODXQFKHV UDQJH IURP  7KLV VXJJHVWV D JUDYH \DUG OLWWHUHG ZLWK PDQ\ SURPLVLQJ LGHDVWKDWGLGQĂ&#x2013;WUHDFKWKHLUIXOOSRWHQ WLDO )DLOXUH UDWHV IRU QHZ SURGXFW ODXQFKHVLQWKHUHWDLOJURFHU\LQGXVWU\ LVDSSUR[LPDWHGDWDVKRFNLQJ ,QWKH86WKHWRSIRRGFRPSDQLHV KDYH DQ DSSUR[LPDWHG  VXFFHVV UDWH ZKLOH DW WKH RSSRVLWH HQG RI WKH VFDOHWKHERWWRP86IRRGFRP SDQLHV KDYH DQ DSSUR[LPDWHG  VXFFHVVUDWHIRUQHZSURGXFWLQWURGXF WLRQV 7KH PDMRU GLIIHUHQFH EHWZHHQ WKH WRS WLHU DQG ERWWRP FDWHJRU\ ZDV WKHDSSDUHQWODFNRIUHVHDUFKVWUDWHJLF PDUNHWLQJDQGSRZHUIXOEUDQGLQJ6R KRZGR\RXDYRLGWKHSLWIDOOV"

())(&7,9(86(2)%5$1',1* 7KHUHDUHPDQ\FRPPRQPLVWDNHVPDGH ZLWK IDLOHG SURGXFW ODXQFKHV DQG D ORW RIUHVHDUFKKDVEHHQFRQGXFWHGRQWKH UHDVRQVIRUWKHVHVXFFHVVHVRUIDLOXUHV (IIHFWLYHXVHRIEUDQGLQJZDVLGHQWLILHG DVRQHRIWKHVLJQLILFDQWFRQWULEXWRUVIRU VXFFHVVEHFDXVHLWGHYHORSV

Zed Candyâ&#x20AC;&#x2122;s Tilleyâ&#x20AC;&#x2122;s Confectionery range: a great example of how packaging can help to reposition your brand.

Ă? $  F O H D U  X Q G H U V W D Q G L Q J  D Q G H[SUHVVLRQ RI ZKDW WKH EXVLQHVV RIIHUV KRZ WKH EXVLQHVV GHOLY HUVLWDQGZKDWLWPHDQVIRUWKHLU F X V W R P H U V   S D U W Q H U V  D Q G  N H \

DXGLHQFHV LH WKH VWUHQJWKV RI WKH EUDQG KRZ WR SOD\ WR WKHP DQG ZKHUH WR SRVLWLRQ WKH EUDQG LQWKHWHUULWRULHVZKHUHWKHEXVL QHVVRSHUDWHV

OPTIMISING MAP FOR FRUIT & VEG Researchers at the Department of Process and Chemical Engineering, UCC, have developed PACK-in-MAP, a web-based software tool (www.packinmap.com) to help companies optimise modified atmosphere packaging (MAP) for fresh and fresh-cut fruits and vegetables. The optimised packaging solution recommends the most cost effective packaging material, gas atmosphere and temperature conditions to extend shelf-life, quality and safety of produce. UCC are seeking partners to commercialise this technology with view to licensing the software on an exclusive or non-exclusive basis. The technology simulates different packaging environments and produce using a software tool. It allows the user to change the product information, packaging type, modified atmosphere, temperature and storage conditions in a matter of minutes, before proceeding to the production line. The software is available online at www. packinmap.com, where the demo version can be used upon registration.

2 0 FOOD IRELAND


from scoops to bottles...

• Scoops & Spoons • Bottles, Jars & Boxes • Measures & Spatulas • Caps & Plugs • Tubes & Fasteners • Stock Products • Bespoke Packaging • Screen Printing

Sometimes, it’s the little extras that count and Measom Freer has the measure of everything in plastic packaging. Measures, scoops, fasteners, spatulas and spoons are all readily available from stock – as well as an extensive range of bottles, containers and caps. Whatever you need, we’ve been providing a personal service with great attention to detail for over 70 years – so you can rely on Measom Freer to provide the ideal plastic packaging solution. For an illustrated catalogue, or to request samples, contact our sales department.

Tel: +44 (0) 116 288 1588 Fax: +44 (0) 116 281 3000 Email: sales@measomfreer.co.uk Web: www.measomfreer.co.uk 6%D

Measom Freer (Sales) Ltd. 37-41 Chartwell Drive, Wigston, Leicestershire LE18 2FL England.

www.measomfreer.co.uk <( $

%86,1(66 ,1 56

ZZZQSSLH


PACKAGING

Ă? .H\VWUDWHJLFGRĂ&#x2013;V GRQĂ&#x2013;WVIRUEUDQG EHKDYLRXU DQG FRPPXQLFDWLRQV WKDW HQDEOHWKHSODQQLQJRIEUDQGDFWLYLWLHV VXFFHVVIXOODXQFKHVDQGLQWHOOLJHQWFRP PXQLFDWLRQVFRQJUXHQWZLWKWKHFRUH EUDQGVLJQDWXUHRUFKDUDFWHUDVSDUWRI WKHNH\EXVLQHVVGHYHORSPHQWVWUDWHJ\ Ă? $ GLVWLQFWLYH EUDQG IUDPHZRUN WR HQDEOH D FRPSDQ\ WR HVWDEOLVK D VWUDWHJLFDQGGHIHQGDEOHSRVLWLRQLQJ LQWKHPDUNHW V ZKHUHWKH\RSHUDWH

$6787(5(6285&( '(3/2<0(17 (YHQ ZLWK D PRGHVW EXGJHW D ORW FDQ EH VXFFHVVIXOO\ DFKLHYHG ZLWK DVWXWH UHVRXUFH GHSOR\PHQW 7KLV LV SDUWLFX ODUO\UHOHYDQWWRPRVWFRPSDQLHVRSHU DWLQJRQWLJKWHUEXGJHWVLQWKHFXUUHQW PDUNHW DQG SDUWLFXODUO\ LPSRUWDQW IRU WKHDYHUDJH60(LQ,UHODQG 6WURQJ ZHOOPDQDJHG DQG ZHOO SURWHFWHG EUDQGV FDQ LQFUHDVH VDOHV DQG SURILWDELOLW\ FUHDWH VXVWDLQDEOH

FRPSHWLWLYH DGYDQWDJH UHGXFH PDUJLQ HURVLRQ DQG FRPPRGLWLVDWLRQ SRZHU QHZSURGXFWODXQFKHVEHFRPHDYDOX DEOH,3DVVHWDGGLQJWRWKHFRPPHUFLDO YDOXH RI WKH EXVLQHVV ZKHQ VHOOLQJ RU VHHNLQJIXUWKHULQYHVWPHQWLQLW

&200(5&,$/(;$03/(6 7KHIROORZLQJDUHWZRSHUIHFWH[DPSOHV RIEUDQGLQJDWZRUN 0F&RQQHOOĂ&#x2013;V *RXUPHW 6PRNHG )RRGV KDYH RSHUDWHG VXFFHVVIXOO\

GOLIATH PACKAGING SYSTEMS LTD Goliath Packaging Systems Ltd supplies, installs and after-sales services a comprehensive range of end-of-line packaging, materials handling and washing equipment to the Irish food sector, via its trading division, Goliath Food.

â&#x20AC;˘

Packaging Materials (Film, Top Sheets, hoods, Strapping, Tape, Plastic & SS Pallets etc)

Goliath also offers a Project Management / Packaging Consultancy Service to assist in the early determination of your particular food packaging equipment requirements. Goliath serves the following segments of the Irish food sector; â&#x20AC;˘ Fruit & Vegetable â&#x20AC;˘ Food Processing â&#x20AC;˘ Bakery & Confectionery â&#x20AC;˘ Dairy â&#x20AC;˘ Meat â&#x20AC;˘ Frozen Foods â&#x20AC;˘ Fish â&#x20AC;˘ Beverage Via partnerships with internationally known suppliers such as Soco System, OK International & Adpak, Goliath has positioned itself as a major provider of packaging machinery, materials handling systems & washing equipment to the Irish food sector.

The Goliath Food product range consists of the following distinct items: â&#x20AC;˘ Shrink Wrapping, Flow Wrapping & Tray Sealing â&#x20AC;˘ Vacuum Packing & Dip Tanks â&#x20AC;˘ Case Erecting, Case Packing & Bag-in-Box Systems â&#x20AC;˘ Liquid Filling Systems â&#x20AC;˘ Case Sealing (Tape & Glue) â&#x20AC;˘ Case & Load Conveying â&#x20AC;˘ Pallet Inverting (Fixed, Mobile & Automatic In-line) â&#x20AC;˘ Pallet Exchange & Freezer Spacer Removal â&#x20AC;˘ Lifting (Scissors & Vacuum) â&#x20AC;˘ Materials Handling Systems â&#x20AC;˘ Pallet Elevating Systems â&#x20AC;˘ Palletising (Gantry, Articulated Arm & Layer) â&#x20AC;˘ Stretch Wrapping â&#x20AC;˘ Strapping Systems (Case & Pallet) â&#x20AC;˘ AGV Transport â&#x20AC;˘ Washing Systems (Pallet, Box, Dolav, Eurobin, Crate, Tray, Drum, Glove, Apron, Bottle & IBC)

Centrally located in Nenagh, Co. Tipperary, Goliath is less than two hours from all major markets, while trained engineers maintain spare parts and service all equipment installed with annual service contracts (reactive/preventative) available as preferred. To discuss your food packaging equipment needs, please contact: George Oâ&#x20AC;&#x2122;Leary, Director, Goliath Packaging Systems Ltd, Beechwood, Nenagh, Co. Tipperary. Tel: 067 37893. Fax: 067 34794. Mobile: 087 1222816. E-mail: info@goliath.ie / service@goliath.ie. Web: www.goliath.ie.

In addition, the following complimentary (ancillary) items are provided by Goliath in order to offer a fully integrated turn-key service: â&#x20AC;˘ Weighing Systems â&#x20AC;˘ Labelling & Coding Equipment â&#x20AC;˘ X-Ray / Metal Detection

2 2 FOOD IRELAND


Equipment Tray Sealers Thermoformers Yoghurt/ Pate Fill Sealers Carton Formers Case Erectors Sleevers & Palletisers Complete End of Line Solutions Shelf Ready Solutions

packaging is changing the w ay w e shop and eat

Materials Meat, Fish & Poultry Trays Gastronorm and Food Service Trays Dual Ovenable - CPET, Aluminium Trays Microwavable Serve-Over Containers Tamper Evident Buckets Ice-cream & Salad Containers Shelf Ready Packaging Anti-fog & Barrier Lidding Films Thermoform Base & Top Webs Vacuum Pouches - Side Seal, & Tubular Stand-up, Printed and Plain Pouches

Silverstream Business Park, Silverstream, Co Monaghan. Tel: 00353 4785177 Fax: 00353 4785199 e-mail: info@versatilepackaging.ie Contact: Michael O’Reilly Richard Mulligan web: www.versatilepackaging.ie

greaterconvenience Innovations in packaging have enabled retailers to provide a m uch w ider choice of food w ith greaterconvenience,increased safety and higher quality.And w ith today’s busy lifestyle,this trend is notgoing to slow dow n.

The Woodlands, Carrigmore, Ballineen, Co Cork. T: 00353 23 8847333, F: 00353 23 8847671 E: info@aicplasticpallets.com W: www.aicplasticpallets.com

U U U U U

Hygenic and anti bacterial pallets for the food industry Cost effective one trip pallets ideal for export Collapsable protective boxes manufactured to your specifications Industry specific totes for bakery, poultry and meat processors Wide range of general purpose pallets, totes and boxes to suit all purposes

For the past 50 years,C ryovac® packaging products and system s have led change in the food industry. And there’s m uch m ore to com e. See how w e can help you keep up w ith the future and stay profitable. Visitus on: w w w .cryovac-retailpartners.com VisitSealed Air,Cryovac Europe’s Perm anentExhibition Centre,Paris Nord 2, Roissy Charles-de-G aulle Airport


PACKAGING

IRU PDQ\ \HDUV VXSSO\LQJ SUHPLXP SURGXFWV WR WKH IRRG VHUYLFH DQG KRV SLWDOLW\VHFWRUXQGHUDZHOONQRZQDQG UHVSHFWHGQDPH$GULDQ6ZHHQH\0' ZDQWHG WR OHYHUDJH WKDW JRRGZLOO DQG EUDQG HTXLW\ LQWR WKH PRUH SUHPLXP UHWDLO DUHQD :LWK 3HUVRQD 'HVLJQ KH UHDOLVHGWKDWWKHLUEUDQGLQJQHHGHGDQ XSGDWH LQ RUGHU WR PDNH WKH UHTXLVLWH LPSDFW:LWKRXWDPDVVLYHDGYHUWLVLQJ RUSURPRWLRQVEXGJHWWKHLUSDFNDJLQJ KDGWRGRDOOWKHZRUNZLWKVXIILFLHQW VKHOILPSDFWWRJUDEVHFRQGVRIWKH WLPHGHSULYHG FRQVXPHUĂ&#x2013;V DWWHQWLRQ 7KH UHVXOWLQJ EUDQG RYHUKDXO SURYHG H[WUHPHO\ VXFFHVVIXO DQG ZDV FRP PHQGHGLQWKH%HVW3DFNDJLQJFDWHJRU\ DWWKH,','HVLJQ$ZDUGV

CRYOVAC: FOR ALL YOUR PACKAGING NEEDS Cryovac Packaging and Cryovac Food Solutions are the two food packaging business units of Sealed Air Corporation, a world leading innovator in flexible and rigid packaging materials, systems and services for the food industry and food retailing for over 50 years. They service food markets such as fresh, frozen, smoked or processed meat, poultry, fish and seafood, cheese and dairy products, bakery products, fruits and vegetables, pizzas, ready meals, foodservice and processed foods. The product range includes: - Shrink films; - Shrink barrier bags; - Non-shrink hybrid and coextruded structures; - Cook-in, heat treatable, microwavable and dual ovenable materials; - Pouches for hot and cold pumpable foods; - Retort and aseptic materials for shelf-stable applications; - Rigid containers, barrier, non-barrier rigid and foam trays and absorbent food pads. High Performance Machines Further, a wide range of high performance machines are offered, including vacuum packaging, vacuum skin packaging, MAP for HFFS and tray lidding, and VFFS systems. They range from simple, manual units to fully automated, integrated systems, all designed for the highest efficiency, safety, productivity and economy. With more than 3,000 employees throughout the region, Sealed Air Cryovac operates manufacturing facilities in Europe, the Middle-East and Africa (EMEA). Also located at the Italian site is the Sealed Air Cryovac EMEA Packaging Technical Centre. The EMEA Customer Systems Centre is located in Root, Switzerland. PackforumÂŽ, Sealed Air Cryovac EMEAâ&#x20AC;&#x2122;s permanent customer care centre, is located at Roissy Charles de Gaulle near Paris, France. Improving Environmental Performance Sealed Air is dedicated to permanently improving its environmental performance and strives for safety and environmental excellence, while also ensuring that plastic food packaging is more efficient than ever. The company is actively engaged in source reduction and total material utilisation through recycling or reuse of industrial scrap, otherwise energy recovery through appropriate incineration.

McConnellâ&#x20AC;&#x2122;s Gourmet Smoked Foodsâ&#x20AC;&#x2122; brand overhaul proved extremely successful.

$ VLPLODU UHEUDQGLQJ H[HUFLVH VDZ =HG &DQG\Ă&#x2013;V 7LOOH\Ă&#x2013;V &RQIHFWLRQHU\ UDQJH EHLQJ JLYHQ D FRPSOHWHO\ QHZ ORRNZKLFKUHSRVLWLRQHGWKHEUDQGIURP WKHYDOXHVHFWRULQWRLQWKHXSSHUHQGRI WKHPDUNHWIRUUHWDLOLQJLQKLJKHUPDUJLQ ORFDWLRQV 7KHVHDUH,ULVKFRPSDQLHVZKRKDYH SURGXFHGJUHDWEUDQGLQJUHVXOWVLQYHVW LQJ PRGHVW VXPV FDUHIXOO\ UHVHDUFKHG DQGGHSOR\HGWRGHI\WKHRGGVSURYLQJ LWSD\VWREUDQGHIIHFWLYHO\ZLWKDNHHQ IRFXVRQ\RXUWDUJHWPDUNHWDGGLQJWR WKHSURILWDELOLW\RIWKHEXVLQHVVDQGWR WKHERWWRPOLQH

Ă?

ABOUT THE AUTHOR: Lorraine Carter is MD of award-winning brand design consultants Persona Design. In business over 17 years, their expertise has expanded the growth of both national and international brands for companies and brands such as Cater Hire Ireland, Castle Brands Inc., Chivers, Connemara Seafoods, GAA, and Wavin Ireland. 2 4 FOOD IRELAND


ORGANIC FOOD

Is the Future Organic? WITH THE IMPACT OF THE RECESSION, IRELANDโ€™S CONSUMERS ARE MORE VALUE-CONSCIOUS THAN EVER BEFORE. CAN ORGANIC FOOD COMPETE?

)

DOOLQJ SULFHV IRU EUDQGHG JRRGV WKH LQH[RUDEOH ULVH RI RZQ ODEHO WKH LQFUHDVLQJ SRSXODULW\RIVSHFLDORIIHUVDOO HYLGHQFHRIWKH,ULVKFRQVXPHUร–VGHVLUH IRU YDOXH SUREDEO\ WKH JUHDWHVW VLQJOH IDFWRU LQ SXUFKDVLQJ GHFLVLRQV WRGD\ 6R ZKHUH GR RUJDQLF IRRGV IHDWXUH" 7UDGLWLRQDOO\PRUHH[SHQVLYHWKDQQRQ RUJDQLF SURGXFH LV WKHUH D IXWXUH IRU RUJDQLFIRRGLQ,UHODQGRUKDVWKHGHVLUH WRHDWRUJDQLFDOO\EHHQVXSSODQWHGE\D QHHGWRFXWFRVWV" ร˜2UJDQLF IRRG VDOHV FRQWLQXH WR JURZ DV SHRSOH ORRN IRU TXDOLW\ SUR GXFHHYHQZKHQPRQH\LVWLJKWร™QRWHG .DWH &DUPRG\ &KDLUSHUVRQ RI WKH ,ULVK 2UJDQLF )DUPHUV  *URZHUV $VVRFLDWLRQ ,2)*$  ZKLFK LV WKH ODUJHVWRUJDQLFFHUWLILFDWLRQRUJDQLVDWLRQ LQ,UHODQGUHSUHVHQWLQJDSSUR[LPDWHO\ IDUPHUVJURZHUVDQGSURFHVVRUV ร˜,W FRQILUPV WKDW WKH RUJDQLF PHVVDJH RIVXSSRUWIRUWKHKLJKHVWVWDQGDUGVRI DQLPDOZHOIDUHSHVWLFLGHVIUHHIDUPLQJ VXSSRUWLQJELRGLYHUVLW\DQGVXVWDLQDEOH IDUPLQJ LV LQFUHDVLQJO\ LPSRUWDQW WR ,ULVK FRQVXPHUV HYHQ LQ GLIILFXOW HFR QRPLFWLPHVร™ 'DUUHQ *UDQW 0DQDJLQJ 'LUHFWRU RI,UHODQGร–VODUJHVWRQOLQHDQGLQVWRUH UHWDLOHU RI RUJDQLF IRRG WKH 2UJDQLF 6XSHUPDUNHWLQ%ODFNURFN&R'XEOLQ EHOLHYHV WKDW FODLPV RI PDVVLYH SULFH GLIIHUHQWLDOVEHWZHHQRUJDQLFDQGQRQ RUJDQLFIRRGVWXIIVDUHZD\RIIWKHPDUN ร˜,I \RX VLQJOH RXW IUXLW DQG YHJ HWDEOHVWKHUHDUHQRZPDUJLQDOGLIIHU HQFHVร™ KH QRWHG LQ DQ RSHQ OHWWHU LQ GHIHQFH RI RUJDQLF IRRG ร˜,Q IDFW RXU VWRUHFDQEHFKHDSHUWKDQQRQRUJDQLF YHUVLRQVRIWKHVDPHIRRGร™ ร˜2UJDQLF IRRG SULFHV DUH GURS SLQJ WKH PRUH ZH EX\ WKH FKHDSHU LW EHFRPHVร™ *UDQW H[SODLQV ร˜:H HOLPLQDWHWUDQVSRUWDWLRQFRVWE\EX\LQJ GLUHFWIURPIDUPHUVDQGZHFXWRXWWKH PLGGOHPHQ$WWKHPRPHQWRQO\RI

RQKRZWRFRPSLOHWKHQHZO\UHTXLUHG ILYH\HDUEXVLQHVVSODQ

)25ร‰625*ร‰1$&+

,ULVKIDUPVDUHRUJDQLFFDQ\RXLPDJLQH KRZFKHDSLWZRXOGEHLIRIIDUPV ZHUHRUJDQLF"ร™

352*5$00()25 *29(510(17 &HUWDLQO\WKH*RYHUQPHQWEHOLHYHVLQD IXWXUHIRURUJDQLFIRRG7KHPRVWUHFHQW 3URJUDPPHIRU*RYHUQPHQWHQVXUHVWKDW UHVRXUFHVDUHSURYLGHGWRFRQWLQXHVXS SRUWIRURUJDQLFIDUPLQJDLPLQJWRJURZ WKHODQGJLYHQRYHUWRRUJDQLFDJULFXOWXUH IURP  WR  7KH 2UJDQLF )DUPLQJ 6FKHPHSURYLGHVIRUSD\PHQWVWRIDUP HUVDQGWKHFDSLWDOVFKHPHVRIJUDQWDLG SURYLGH VXSSRUW IRU ERWK RQIDUP DQG RIIIDUPLQYHVWPHQW ร˜7KLV ILUP FRPPLWPHQW VKRXOG HQFRXUDJH IDUPHUV ZKR PLJKW EH FRQ VLGHULQJWKHRUJDQLFRSWLRQIRUWKHILUVW WLPHWRWDNHLWDVWHSIXUWKHUDQGSUHSDUH WR DSSO\ IRU VXSSRUW LQ ร™ QRWHG 7UHYRU6DUJHQW7'0LQLVWHUIRU)RRG DQG+RUWLFXOWXUHDWWKH'HSDUWPHQWRI $JULFXOWXUH )LVKHULHV DQG )RRG ร˜,Q SDUWLFXODU WKH\ VKRXOG QRZ FRQVLGHU WDNLQJXSWKHRSSRUWXQLW\WRDWWHQGWKH WUDLQLQJ FRXUVHV RUJDQLVHG E\ 7HDJDVF ZKLFK ZLOO EH D UHTXLUHPHQW IRU HQWU\ WRWKH2UJDQLF)DUPLQJ6FKHPHZKHQ LWUHRSHQVLQ-DQXDU\ร™ 7KHVH 7HDJDVF )(7$&DFFUHGLWHG FRXUVHV IXOILO WKH QHZ UHTXLUHPHQW RI SRWHQWLDO DSSOLFDQWV IRU WKH 2UJDQLF )DUPLQJ6FKHPHWRFRPSOHWHDQDFFUHG LWHGFRXUVHDVZHOODVWUDLQLQJDWWHQGHHV 2 5 FOOD IRELAND

 DOVR VDZ WKH HVWDEOLVKPHQW RI )RUยกV 2UJยกQDFK D QHZ ERG\ HVWDE OLVKHGWRGULYHIRUZDUGWKHGHYHORSPHQW RIWKHRUJDQLFVHFWRULQ,UHODQGUHSODF LQJWKH1DWLRQDO6WHHULQJ*URXSIRUWKH 2UJDQLF6HFWRU:KHUHDVWKH1DWLRQDO 6WHHULQJ*URXSEURXJKWQRPLQHHVIURP YDULRXV VWDNHKROGHU JURXSV WRJHWKHU WRDJUHHDSURJUDPPHRIDFWLRQ)RUยกV 2UJยกQDFK LV PDGH XS RI LQGLYLGXDOV ZLWK H[SHUWLVH LQ SDUWLFXODU DUHDV ZKR FDQ EULQJ WKHLU WDOHQWV DQG VSHFLDOLVW NQRZOHGJH WRJHWKHU WR GHYHORS WKH RUJDQLFVHFWRUIXUWKHU 7KH,ULVKRUJDQLFUHWDLOPDUNHWZDV HVWLPDWHG WR EH ZRUWK โ‚ฌP LQ -XO\ XSIURPโ‚ฌPLQโ‚ฌPLQ DQGMXVWโ‚ฌPLQ'HPDQG IRU RUJDQLF SURGXFW FRQWLQXHV WR ULVH GHVSLWHWKHUHFHVVLRQ'RPHVWLFGHPDQG URVHE\DFFRUGLQJWRWKHODWHVWILJ XUHV DYDLODEOH ,Q WKH 8. PHDQZKLOH WKHRUJDQLFPDUNHWLVYDOXHGDWโ‚ฌELO OLRQZKLOHWKH*HUPDQPDUNHWLVZRUWK โ‚ฌELOOLRQ 8S WR  LQ VRPH FDWHJRULHV RI RUJDQLF IRRG VROG LQ ,UHODQG SDUWLFX ODUO\ IUXLW DQG YHJHWDEOHV LV LPSRUWHG 0XFK RI WKLV IRRG FRXOG EH SURGXFHG LQ,UHODQG 3URFHVVRUV RI RUJDQLF PHDW KDYH UHSHDWHGO\FDOOHGIRUPRUHSURGXFWLRQ HVSHFLDOO\ RI EHHI WR PHHW JURZLQJ GHPDQG LQ H[SRUW PDUNHWV LQ WKH 8. DQG*HUPDQ\ ร˜7KHUH DUH UHDO RSSRUWXQLWLHV IRU ,ULVK IDUPHUV SURFHVVRUV DQG ZKROH VDOHUV LQ WKH RUJDQLF VHFWRUร™ QRWHG 0LQLVWHU6DUJHQWUHFHQWO\ร˜QRWRQO\LQ IUXLWDQGYHJHWDEOHVIRUKRPHFRQVXPS WLRQEXWDOVRLQGDLU\LQJEHHIODPEDQG RWKHU DUHDV ZKHUH HYHQ LQ WKH SUHVHQW HFRQRPLFFOLPDWHWKHUHLVDELJSRWHQ WLDOH[SRUWPDUNHWร™

ร


MEAT TRACEABILITY

The Future of Traceability ORGANISED BY THE FOOD SAFETY AUTHORITY OF IRELAND (FSAI), IN ASSOCIATION WITH GS1 IRELAND, A RECENT MEAT TRACEABILITY CONFERENCE HIGHLIGHTED THE NEED FOR STANDARDS, BEST PRACTICE AND A WILLINGNESS TO SHARE INFORMATION AS CRUCIAL STEPS FORWARD.

7

KH  SRUN GLR[LQ FULVLV WKDW OHG WR D WRWDO UHFDOO RI ,ULVK SRUN SURGXFWV ZDV WKH ILUVWDQGILQDOWRSLFWREHGLV FXVVHGDWWKH0HDW7UDFHDELOLW\FRQIHU HQFHLQ'XEOLQHDUOLHUWKLVPRQWK 7KH )6$, &(2 3URIHVVRU $ODQ 5HLOO\ NLFNHG RII SURFHHGLQJV ZLWK D FDQGLG RYHUYLHZ RI WKH LQFLGHQW DQG VDLG LW ZDV LPSRUWDQW WR OHDUQ OHVVRQV EHFDXVHVRPHWKLQJVLPLODUZRXOGDOPRVW FHUWDLQO\KDSSHQDJDLQ :KLOH WKHUH LV FRXQWU\ RI RULJLQ ODEHOOLQJ DQG RWKHU PHFKDQLVPV WR IDFLOLWDWH Ã&#x2022;IDUP WR IRUNÃ&#x2013; YLVLELOLW\ WKH VXSSO\FKDLQFRPSOH[LW\WKDWJRHVLQWR IRRGSURGXFWLRQFKDOOHQJHVWKHFRQFHSW RI FRPSOHWH WUDFHDELOLW\ DFFRUGLQJ WR 3URIHVVRU 5HLOO\ 7KH LQJUHGLHQWV RI D VLQJOHSRUNVDXVDJHIRUH[DPSOHFRXOG FRPHIURPGLIIHUHQWDQLPDOVGLI IHUHQWIDUPVDQGVL[GLIIHUHQWFRXQWULHV 3URIHVVRU 5HLOO\ ZDV WKH ILUVW RI D QXPEHURIVSHDNHUVWRUHIHUWR(8IRRG ODZ  WKH Ã&#x2022;RQHXS RQH GRZQÃ&#x2013; OHJDOUHTXLUHPHQWZKHUHE\DIRRGSUR GXFWLRQIDFLOLW\PXVWNQRZZKRVXSSOLHG WKHPDQGZKHUHRUWRZKRPWKHLUSURG XFWKDVJRQHÃ&#x2DC;,QWKHGLR[LQFULVLVHYHU\ ERG\KDGFRPSOLHGZLWKWKLV6RQRZLWÃ&#x2013;V WLPHWRJRDVWHSIXUWKHUÃ&#x2122;KHVDLG ,WWRRNWKUHHZHHNVWRUHFDOODOOSRUN SURGXFWV XVLQJ WKH (8 5DSLG $OHUW 6\VWHP D WLPHOLQH WKDW KH VXJJHVWHG FRXOGEHLPSURYHGLISURGXFWWUDFHDELOLW\ LQIRUPDWLRQZDVDEOHWRIORZPRUHIUHHO\ WKURXJKWKHVXSSO\FKDLQÃ&#x2DC;:HNQHZLW ZDV D FULVLV EXW EHFDXVH ZH ZHUH MXVW VHHLQJSLHFHVRIDMLJVDZZHGLGQRWVHH WKHH[WHQWRILWDWILUVWÃ&#x2122;KHVDLG

Pictured at the Meat Traceability conference are (l-r): Garry Hartley, GS1 New Zealandâ&#x20AC;&#x2122;s Manager for Strategic Initiatives; Justin Carton, Director, Carton Group; Denis Oâ&#x20AC;&#x2122;Brien, IT Consultant; Professor Alan Reilly, Chief Executive, FSAI; Jim Bracken, CEO, GS1 Ireland; Niels Peter Baadsgaard, Veterinary Research and Development, Danish Pig Production; John Keogh, SVP, Traceability & EPCglobal, GS1 Canada; Jimmy Oâ&#x20AC;&#x2122;Connor, Technical Manager, Rosderra Irish Meats Group; and Dr Wayne Anderson, Director of Food Science and Standards, FSAI.

$180%(56*$0( :KHQLWFRPHVWRDSUDFWLFDODSSURDFKWR WUDFHDELOLW\QXPEHUVDUHWKHQDPHRIWKH JDPH-XVWLQ&DUWRQ0DQDJLQJ'LUHFWRU RI WKH &DUWRQ *URXS ,UHODQGÃ&#x2013;V ODUJHVW SRXOWU\ SURFHVVLQJ FRPSDQ\ VDLG KLV ILUPKDGJRQHEH\RQGWKHEDVLFUHTXLUH PHQWV DQG LQVWLJDWHG D VRSKLVWLFDWHG QXPEHULQJV\VWHPWKDWFRYHUVHYHU\WKLQJ IURPFKLFNHQIHHGWRWKHGLIIHUHQWFXWVRI PHDWWKDWDUHGHOLYHUHGWRVXSHUPDUNHWV :LWKUHOLDEOHLGHQWLILFDWLRQRIHYHU\ LWHPLWZDVSRVVLEOHEXLOGDV\VWHPZLWK FRPSOHWHWUDFHDELOLW\,QLWLDOO\GHVLJQHG DVDZD\WRGHDOPRUHHIIHFWLYHO\ZLWK FXVWRPHU FRPSODLQWV LW LV SDUW RI WKH FRPSDQ\Ã&#x2013;V VWUDWHJ\ WR PDNH FXVWRPHU VHUYLFHDGLIIHUHQWLDWRU )ROORZLQJ H[DPSOHV IURP WKH WHFK QRORJ\ ZRUOG DQG 'HOO LQ SDUWLFXODU 2 6 FOOD IRELAND

HYHU\VXSSOLHULVFODVVLILHGDQGFRGHGWR JLYH WKH FRPSDQ\ HQGWRHQG FRQWURO &DUWRQHYHQEXLOWLWVRZQIHHGPLOODQG NHHSVDQDUFKLYHRIIHHGVDPSOHVZKLFK PHDQVLWFDQLGHQWLI\ZKDWHYHU\ELUGDWH 7KH FRPSDQ\ LV D ELJ XVHU RI ,7 DQG KDV DGRSWHG D Ã&#x2022;JDWKHU GDWD RQFHÃ&#x2013; DSSURDFK WKDW KDV PDGH WKH EXVLQHVV PRUH HIILFLHQW DQG FRPSHWLWLYH LQ D FURZGHGPDUNHWSODFHÃ&#x2DC;,WÃ&#x2013;VQRWDWUDFH DELOLW\ V\VWHP SHU VH EXW LWÃ&#x2013;V DQ LQWH JUDWHGV\VWHPZLWKRQHVHWRIGDWDWKDW FRYHUV HYHU\WKLQJ IURP UDZ PDWHULDOV WRILQLVKHGJRRGVÃ&#x2122;VDLG-XVWLQ&DUWRQ $QRWKHU H[DPSOH RI D FRPSDQ\ WKDW KDV JRQH EH\RQG WKH EDVLF OHJDO UHTXLUHPHQWLVWKH5RVGHUUD,ULVK0HDWV *URXS D SRUN SURFHVVLQJ FRPSDQ\ WKDWKDGLWVWUDFHDELOLW\V\VWHPVSXWWR WHVW ZLWK WKH GLR[LQ FULVLV 7HFKQLFDO


MEAT TRACEABILITY

0DQDJHU -LPP\ 2Ö&RQQRU RXWOLQHG KRZLWVVODXJKWHUKRXVHWUDFNDQGWUDFH V\VWHPZRUNHGXVLQJDQHODERUDWHQXP EHULQJV\VWHPWRIDFLOLWDWHWKHSURFHVV LQJRISLJVHYHU\ZHHN 7KH SURFHVV VWDUWV ZLWK WKH ÕVODS PDUNÖWKH,'WDJWKDWUHFRUGVWKHVSH FLHVIDUPDQGFRXQW\RIHDFKSLJDQGLV SDUWRIDQDWLRQDOWUDFNLQJV\VWHP0RUH GDWDLVFDSWXUHGLQWKHVODXJKWHUKRXVHDV HDFKSDUWRIWKHFDUFDVVLVFODVVLILHGDQG WKH LQIRUPDWLRQ HQWHUHG LQWR WKH FRP SDQ\ÖV EXVLQHVV PDQDJHPHQW VRIWZDUH &RPSUHKHQVLYHLQIRUPDWLRQDERXWHDFK SURGXFWLVWKHQHPEHGGHGRQDGLJLW EDUFRGHDVZHOODVRQWKHSURGXFWODEHO 2QWKHGD\RIWKHGLR[LQFULVLVWKH SKRQHVVWDUWHGULQJLQJIURPFXVWRPHUV DFURVV (XURSH 2QH )UHQFK FXVWRPHU KDG€ZRUWKRI,ULVKSRUNDQG ZDQWHGWRNQRZLILWFRXOGEHUHOHDVHG WRPDUNHW %\ DQDO\VLQJ LWV WUDFHDELOLW\ GDWD 5RVGHUUD KDG D FRPSUHKHQVLYH YLHZ RI KRZ WKH FRQWDPLQDWLRQ FRXOG KDYH DIIHFWHGLWVSURGXFWVE\WKHQH[WPRUQ LQJ,WZDVDEOHWRWHOOWKH)UHQFKFXV WRPHUWKDWKHZDVJRRGWRJR

,03529,1*352'8&75(&$// 2Ö&RQQRUVDLGWKHUHZDVFHUWDLQO\URRP IRU LPSURYHPHQW LQ WKH ZD\ WKH UHFDOO ZDVFDUULHGRXWDQLVVXHWKDWZDVODWHU DGGUHVVHG LQ VRPH GHWDLO E\ PHPEHUV RI *6 -RKQ .HRJK 9LFH 3UHVLGHQW RI *6 &DQDGD VSRNH DERXW GHYHORS LQJDIRRGVDIHW\UHFDOOQHWZRUNZKHUH SDUWLFLSDQWV ZRXOG SXEOLVK SURGXFW LQIRUPDWLRQRQDZHEVLWH ,W ZRXOG EHFRPH D VLQJOH WUXVWHG VRXUFHRIGDWDZKHUHLWHPVDUHLGHQWL ILHGDQGYLVLEOHWKURXJKRXWWKHVXSSO\ FKDLQ7KHFKDOOHQJHLVSHUVXDGLQJFRP SDQLHVWKDWWKHLUFRPPHUFLDOO\VHQVLWLYH LQIRUPDWLRQ ZRXOG EH VHFXUH LQ WKH V\VWHP7KHEHQHILWZRXOGEHDGDWDEDVH WKDW FRXOG EH DFFHVVHG LQ D FULVLV DQG XVHG WR LQVWLJDWH D FRPSUHKHQVLYH DQG WLPHO\SURGXFWUHFDOO Ø:HÖUH QRW WHOOLQJ SHRSOH KRZ WR GR WKHLUSURGXFWUHFDOOZHÖUHGRLQJWKHSLHFH LQWKHPLGGOHÙH[SODLQHG.HRJK+HOHIW QRGRXEWRIWKHQHHGIRULPSURYHGSURFH GXUHV,QWKH86RIFRPSDQLHVKDG H[SHULHQFHGUHFDOOVWKDWKDGFRVWRQDYHU DJHP)XUWKHUUHVHDUFKVKRZHGWKDW DUHFDOOW\SLFDOO\WDNHVGD\VDQGRQO\ RISURGXFWVDUHWUDFHG Ø,WÖV VKRFNLQJÙ DUJXHG .HRJK ØDQG ZH QHHG WR VHH LPSURYHPHQWV E\ XVLQJ

LQIRUPDWLRQWKDWWUDQVODWHVMXVWDVHDVLO\IRU VRPHRQHUXQQLQJDVPDOOVWRUHLQWKHPLG ZHVWRI$PHULFDWRDPXOWLQDWLRQDOFKDLQÙ

%2267,1*%5$1'9$/8( 7KHGULYHUVIRURUJDQLVDWLRQVWRLPSURYH WUDFHDELOLW\ DUH WZRIROG DFFRUGLQJ WR .HRJK7KHUHLVIHGHUDOUHJXODWRU\SUHV VXUHDQGWKHUHLVEUDQGYDOXH+HDUJXHG WKDW WKH ULVN RI QHJDWLYH EUDQG LPSDFW VKRXOGEHWKHEHVWUHDVRQHQFRXUDJLQJ RUJDQLVDWLRQVWRLPSURYHWUDFHDELOLW\DQG XVHLWDVDZD\WRGLIIHUHQWLDWHDQGFUHDWH FRPSHWLWLYHDGYDQWDJH+HDOVRLGHQWLILHG VLPSOHPDUNHWUHDOLWLHVDVDJUHDWZD\RI PRYLQJFRPSDQLHVDORQJ&DQDGLDQILUPV ORRNLQJWRWUDGHZLWK&KLQDIRUH[DPSOH PXVWKDYHVWURQJWUDFHDELOLW\SURFHVVHV LQSODFH *6,UHODQGLVDOVRZRUNLQJZLWK,7 FRQVXOWDQW'HQQLV2Ö%ULHQWRGHYHORSDQ DSSOLFDWLRQIRUVKDULQJSURGXFWLQIRUPD WLRQ7KHGDWDEDVHFRXOGEHLQWHUURJDWHG OLNH*RRJOHZLWKDQLQGH[VHDUFKVHUYLFH IRUSXOOLQJXSGDWDE\EDWFKQXPEHUDQG RWKHU FULWHULD IRU D FRPSOHWH SLFWXUH RI WKHVXSSO\FKDLQ 5HPLQGLQJGHOHJDWHVWKDWGHOD\VLQ WKHGLR[LQUHFDOOZHUHFDXVHGE\PLVVLQJ LQIRUPDWLRQ 2Ö%ULHQ HPSKDVLVHG WKDW VXFK D WUDFNDQGWUDFH V\VWHP ZRXOG RQO\EHDVJRRGDVWKHGDWDLWFRQWDLQHG +HDOVRWDONHGDERXWWKHHYROXWLRQRI WKH EDUFRGH SRLQWLQJ RXW WKDW WKH QHZ JHQHUDWLRQRI*6GDWDPDWUL[DQG*6 GDWDEDUFDUU\PXFKPRUHLQIRUPDWLRQDQG FRXOGSOD\DYLWDOUROHLQDUHFDOO(YHQLI DSURGXFWKDGVOLSSHGWKURXJKDQGPDGH LWWRWKHVKHOYHV2Ö%ULHQH[SODLQHGWKDWLW FRXOGVWLOOEHFDXJKWDWWKHSRLQWRIVDOH DVWKHVFDQZRXOGEHDOHUWHGE\DQXPEHU WKDWZDVRQWKHUHFDOOOLVW 7KHUH ZDV WDQJLEOH HYLGHQFH DW WKH HYHQW WKDW WKH EDUFRGLQJ WHFKQRORJLHV DQG LQIUDVWUXFWXUH LV WKHUH LWÖV MXVW D PDWWHURIVWDQGDUGLVLQJWKHGDWDVHW7KLV ZDVWKHNH\PHVVDJHIURP-LP%UDFNHQ &KLHI([HFXWLYH2IILFHURI*6,UHODQG ZKR H[SODLQHG WKDW *6 KDV RYHU  \HDUV H[SHULHQFH LPSOHPHQWLQJ EHVW SUDFWLFHLQVXSSO\FKDLQVDQGKDGSUHYL RXVO\ZRUNHGZLWKWKH,ULVKEHHILQGXVWU\ LQGHYHORSLQJDEHVWSUDFWLFHWUDFHDELOLW\ VROXWLRQEDVHGRQ*6VWDQGDUGV %UDFNHQ KLJKOLJKWHG WKH LPSRU WDQFH RI VWDQGDUGLVLQJ EDUFRGHV DQG WKH QHHG WR FUHDWH D VKDUHG GDWD SRRO IRU D PRUH WLPHO\ DQG HIIHFWLYH DFFHVV WR GDWD Ø7KH FXUUHQW ODEHOOLQJ V\VWHP LQWKHLQGXVWU\LVQRQVWDQGDUGEXWWKH 2 7 FOOD IRELAND

WHFKQRORJ\LVWKHUHDQGD*6VWDQGDUG ODEHOIRUPDWFRXOGEHTXLFNO\DQGHDVLO\ LPSOHPHQWHGÙ +HDOVRGLVFXVVHGWKHUROHRIVFDQ QLQJ VROXWLRQV DQG WKH ULVH RI 5),' WDJJLQJZKLFKZDVH[SORUHGIXUWKHUE\ WZRLQWHUQDWLRQDOVSHDNHUV *DUU\+DUWOH\1HZ=HDODQGÖV*6 PDQDJHU DQG 1LHOV 3HWHU %DDGVJDDUG SURMHFWOHDGHULQ'DQLVK3LJ3URGXFWLRQ ZHUH ERWK ZRUNLQJ RQ SLORW SURMHFWV XVLQJXOWUDKLJKIUHTXHQF\ 8+) 5),' IRUWDJJLQJOLYHVWRFN7KH\FODLPHGWKDW ORZIUHTXHQF\WDJVDQGUHDGHUVFRXOGEH VXSHUVHGHG E\ WHFKQRORJ\ WKDW ZRXOG DOORZGHWDLOVRIOLYHVWRFNWREHFDSWXUHG PRUHTXLFNO\DQGHIILFLHQWO\ 7KHLUWULDOVKDGVKRZQKLJKVXFFHVV UDWHV ZLWK SURWRW\SH HTXLSPHQW RYHU GLVWDQFHVRIXSWRILYHRUVL[PHWUHVDQG ERWKZHUHORRNLQJWRH[WHQGWKHOLIHDQG UHDFKRIWKHLUSLORWSURJUDPPHV 7KH SURMHFWV KDG RWKHU WKLQJV LQ FRPPRQ %RWK ZHUH XVLQJ WHFKQRORJ\ WR SURWHFW LQWHUQDWLRQDO WUDGLQJ LQWHU HVWV E\ LPSURYLQJ WUDFHDELOLW\ RQ NH\ QDWLRQDO H[SRUWV $QG ERWK HOLFLWHG DQ DQJU\ UHVSRQVH IURP RWKHU SOD\HUV LQ WKHLU LQGXVWULHV ZKR IRU YDULRXV UHD VRQVKDGVHWWOHGRQWKHH[LVWLQJVROXWLRQ DQG ZHUH UHOXFWDQW WR SXUVXH DQRWKHU HYHQWKRXJKWKHEHQHILWVZHUHWDQJLEOH 7KHSROLWLFDOGLPHQVLRQRIWU\LQJWR LPSURYH RQ ROG ZD\V RI GRLQJ WKLQJV ZDV WRXFKHG RQ LQ WKH URXQGWDEOH GLVFXVVLRQ WKDW FRQFOXGHG WKH HYHQW :KLOHDOOWKHVSHDNHUVKDGUHLQIRUFHG WKH LGHD WKDW VWDQGDUGV DQG FRPPRQ SUDFWLFHV DUH SLYRWDO LQ D KHDYLO\ UHJXODWHGVHFWRUOLNHWKHIRRGLQGXVWU\ WKHUH ZDV UHFRJQLWLRQ WKDW HYHU\RQH QHHGVWRFKDQJHDQGZRUNPRUHFORVHO\ WRJHWKHU WR PLQLPLVH WKH IDOORXW IURP IXWXUHLQFLGHQWV $FNQRZOHGJLQJ WKDW QRWKLQJ KDG KDSSHQHGLQWKHODVW\HDUWRSUHYHQWD VLPLODU FULVLV IURP RFFXUULQJ &RUPDF +HDO\ RI ,%(& DVVXUHG GHOHJDWHV WKDW WKLQJV ZHUH VWDUWLQJ WR FKDQJH Ø7KH LQGXVWU\ LV ZRUNLQJ ZLWK WKH 'HSDUWPHQWRI$JULFXOWXUHDQGZHDUH FORVHWRVWDQGDUGLVLQJDIRUPDWIRULQIRU PDWLRQWKDWZRXOGPDNHWKLQJVHDVLHULQ WKHIXWXUHÙKHVDLG *6,UHODQGDQGWKH,ULVKPHDWLQGXV WU\ DUH LQ GLVFXVVLRQ RQ WKH DSSOLFDWLRQ RI D VWDQGDUG ODEHO DSSOLFDWLRQ WR KHOS LPSURYH WUDFHDELOLW\ UHTXLUHPHQWV DQG HQVXUHWKHUHSHUFXVVLRQVRIDPDVVSURG XFWUHFDOODUHPLQLPLVHGLQWKHIXWXUH

Ý


LEGISLATION

New Laws to Spark Label Wars? FOOD LAWYER RAYMOND O’ROURKE EXAMINES THE CHANGING FACE OF FOOD LABELLING, WHICH COULD HAVE DRASTIC EFFECTS ON THE FOOD SECTOR AS WE KNOW IT.

(

XURSHDQ &RPPLVVLRQ SUR SRVDOV IRU FKDQJHV WR (8 IRRGODEHOOLQJODZVDUHSUHV HQWO\ EHIRUH WKH (XURSHDQ 3DUOLDPHQW IRU GHEDWH DQG DGRSWLRQ 7KHSURSRVHG(85HJXODWLRQRQ)RRG ,QIRUPDWLRQZLOOEHDGRSWHGE\FRGHFL VLRQEHWZHHQWKH&RXQFLORI0LQLVWHUV DQGWKH(XURSHDQ3DUOLDPHQWHQWDLOLQJ WZRUHDGLQJVLQERWKLQVWLWXWLRQVWKHUH IRUHLWLVOLNHO\WREHFRPHODZLQ PRQWKVWLPH 7KHUH KDV ORQJ EHHQ D YLHZ WKDW WKH (8ÖV IRRG ODEHOOLQJ UXOHV QHHGHG XSGDWLQJ HVSHFLDOO\ LQ UHODWLRQ WR WKH ZKROH DUHD RI QXWULWLRQDO ODEHO OLQJ ,W LV LQWHUHVWLQJ WR QRWH WKDW WKH 5HJXODWLRQ ZLOO FRYHU IRRG LQIRUPD WLRQ QRW MXVW IRRG ODEHOOLQJ 7KH GHILQLWLRQ LQ WKH SURSRVHG OHJLVODWLRQ VWDWHV LW ZLOO FRYHU DQ\ LQIRUPDWLRQ SURYLGHG WR WKH ILQDO FRQVXPHU ØE\ PHDQVRIDODEHORWKHUDFFRPSDQ\LQJ PDWHULDO RU DQ\ RWKHU PHDQV LQFOXG LQJPRGHUQWHFKQRORJ\WRROVRUYHUEDO FRPPXQLFDWLRQ ,W GRHV QRW FRYHU FRPPHUFLDO FRPPXQLFDWLRQVÙ 7KLV ZLOOKDYHPDMRULPSOLFDWLRQVIRUIRRG FRPSDQLHV ZKR ZLOO KDYH WR HQVXUH WKDWLQIRUPDWLRQSURYLGHGWRWKHFRQ VXPHULQDGGLWLRQWRWKHIRRGODEHOLV LQOLQHZLWK(8UXOHV 7KH SURSRVDO DLPV WR LPSURYH WKH OHJLELOLW\ RI WKH LQIRUPDWLRQ SURYLGHG RQDIRRGODEHOE\LQWURGXFLQJDPLQL PXP IRQW VL]H RI PP IRU DOO PDQGD WRU\ ODEHOOLQJ UHTXLUHPHQWV ,QGXVWU\ KDV UDLVHG PDQ\ FRQFHUQV DERXW WKLV UHTXLUHPHQWVWDWLQJWKDWLWZLOOPLOLWDWH DJDLQVWPXOWLOLQJXDOODEHOVDQGLVELJJHU WKDQ ZDUQLQJV UHTXLUHG IRU FKHPLFDO SURGXFWV PP  :KLOH WKH (8 FXUUHQWO\ DOUHDG\ KDV DOOHUJHQ ODEHOOLQJ LQ SODFH WR FRYHU SUH

YLVLRQ RI D IRRG ODEHO 7KH PDLQ QHZ DVSHFWV RI WKH SURSRVDO RQ QXWULWLRQ ODEHOOLQJDUH Ý 7KH PDQGDWRU\ QXWULWLRQ GHFODUD WLRQ PXVW LQFOXGH WKH HQHUJ\ YDOXH DQG WKH DPRXQWV RI IDW VDWXUDWHV FDUERK\GUDWHV VXJDUV DQG VDOW H[SUHVVHG DV DPRXQWV SHU J RU SHUPORUSHUSRUWLRQLQWKHSULQ FLSDOILHOGRIYLVLRQ IURQWRISDFN  2WKHU QXWULHQWV IURP D GHILQHG OLVW PD\ EH IXUWKHU GHFODUHG YROXQWDU LO\ ,W LV LQWHUHVWLQJ WR QRWH WKDW WKH &RPPLVVLRQ VKLHG DZD\ IURP GHPDQGLQJ WKH VSHFLILF LQGLFDWLRQ RIWUDQVIDWW\DFLGVGHVSLWHWKHIDFW WKDWLWLVFRPSXOVRU\WRLQGLFDWHWKHLU SUHVHQFHLQWKH86$

Food and consumer lawyer Raymond O’Rourke.

SDFNDJHGIRRGVWKHQHZSURSRVDOZRXOG H[WHQGWKHVFRSHRIODEHOOLQJWRFRYHUDOO IRRG FRQWDLQLQJ DOOHUJHQLF VXEVWDQFHV VXFK DV SHDQXWV PLON PXVWDUG RU ILVK Ó $QQH[ ,, LQ WKH SURSRVDO FRQWDLQV D FRPSOHWHOLVW LQFOXGLQJIRRGVROGDWORFDO IDUPHUVÖ PDUNHWV FRQVXPHG LQ UHVWDX UDQWVDQGE\RWKHUIRRGFDWHULQJIDFLOLWLHV 'XH WR WKHLU VSHFLILF QDWXUH ZLQH VSLULWV DQG EHHU DUH H[HPSW IURP WKH LQJUHGLHQWOLVWLQJDQGPDQGDWRU\QXWUL WLRQ ODEHOOLQJ RI WKLV SURSRVDO EXW WKH GUDIW 5HJXODWLRQ GHPDQGV WKDW WKH &RPPLVVLRQUHSRUWRQWKHSRVVLELOLW\RI VXFK UXOHV EHLQJ LQWURGXFHG IRU ZLQH VSLULWV DQG EHHU IROORZLQJ D ILYH \HDU FRQVXOWDWLRQSHULRG 7KHSURSRVDOPDNHVQXWULWLRQODEHO OLQJPDQGDWRU\LQWKHSULQFLSDOILHOGRI 2 8 FOOD IRELAND

Ý 7KH PDQGDWRU\ HOHPHQWV PXVW DOVR EHGHFODUHGLQUHODWLRQWRUHIHUHQFH GDLO\LQWDNHVZKLOVWRWKHUSUHVHQWD WLRQIRUPDWV HJWUDIILFOLJKWVVLJQ SRVWLQJODEHOOLQJ PD\EHGHYHORSHG WKURXJKYROXQWDU\QDWLRQDOVFKHPHV Ý 7KHUHTXLUHPHQWIRUIURQWRISDFN DJHPDQGDWRU\QXWULWLRQDOLQIRUPD WLRQZLOODSSO\WKUHH\HDUVDIWHUWKH HQWU\LQWRIRUFHRIWKH5HJXODWLRQWR DOORZLQGXVWU\WLPHWRDGMXVWWRWKH QHZUHTXLUHPHQWVZKLOHVPDOOIRRG EXVLQHVV RSHUDWRUV LH ZLWK OHVV WKDQHPSOR\HHV ZLOOEHJLYHQD ILYH\HDUWUDQVLWLRQDOSHULRG ([HPSWLRQV IURP WKH UHJXODWLRQ YLV  YLV LQJUHGLHQWV OLVWLQJ DQG QXWULWLRQDO ODEHOOLQJ DUH VHW RXW LQ WKH SURSRVHG 5HJXODWLRQ 7KHVH LQFOXGH H[HPSWLRQV IRU IUHVK IUXLWV DQG YHJHWDEOHV FDU ERQDWHG ZDWHU IHUPHQWDWLRQ YLQHJDUV FKHHVH EXWWHU IHUPHQWHG PLON DQG


LEGISLATION

FUHDPIRRGVXSSOHPHQWVQDWXUDOPLQ HUDOZDWHUVDQGDOFRKROLFEHYHUDJHV

ELRWLF VWUDLQV QRW D VLQJOH RQH ZDV VKRZQWRKDYHJXWKHDOWKLPPXQLW\RU DQ\RWKHUEHQHILWV0RVWKHUEDOVZHUH IRXQG ZDQWLQJ IRU D KRVW RI EHQHILWV IURP H\H KHDOWK WR ZHLJKW PDQDJH PHQWDQGPRRGHQKDQFHPHQW7KLVLVD PDMRUFRQFHUQWRLQGXVWU\DVWKHUHLVD SUROLIHUDWLRQRISURELRWLFIRRGSURGXFWV RQWKHPDUNHWDQGWKHFODLPVPDGHRQ WKHVHSURGXFWVPD\KDYHWREHGHOHWHG IURP WKH ODEHOOLQJ DQG PDUNHWLQJ RI VXFKSURGXFWVLQWKHIXWXUH 7KHUH LV IXUWKHU EDG QHZV IRU LQGXVWU\DVWKH(XURSHDQ&RPPLVVLRQ KDVLQGLFDWHGWKDWWKH\DUHQRWRSHQWR DOHUWLQJWKHVHVFLHQWLILFDVVHVVPHQWVE\ PHDQVRIDQDSSHDOSURFHVVVRWKHRQO\ DYHQXH RSHQ WR FRPSDQLHV LV WR WDNH D FDVH EHIRUH WKH (XURSHDQ &RXUW RI -XVWLFHLQ/X[HPERXUJZKLFKWDNHVXS WRWZR\HDUVWRJLYHDUXOLQJ7KH&RXUW KDVHTXDOO\EHHQUHOXFWDQWWRRYHUWXUQ IRRGUHJXODWRU\GHFLVLRQVPDGHE\WKH &RPPLVVLRQEDVHGRQWKHEHVWDYDLODEOH VFLHQWLILFDGYLFH

1875,7,21 +($/7+&/$,06 $QLQFUHDVLQJQXPEHURIIRRGVVROGLQ WKH(8EHDUQXWULWLRQDQGKHDOWKFODLPV $ QXWULWLRQ FODLP VWDWHV RU VXJJHVWV WKDW D IRRG KDV EHQHILFLDO QXWULWLRQDO SURSHUWLHVVXFKDVÕORZIDWÖÕQRDGGHG VXJDUÖRUÕKLJKLQILEUHÖ$KHDOWKFODLP LV DQ\ VWDWHPHQW RQ ODEHOV PDUNHWLQJ RU DGYHUWLVLQJ WKDW KHDOWK EHQHILWV FDQ UHVXOWIURPFRQVXPLQJDJLYHQIRRGIRU LQVWDQFHWKDWDIRRGFDQKHOSUHLQIRUFH WKHERG\ÖVQDWXUDOGHIHQFHVRUHQKDQFH OHDUQLQJDELOLW\ , Q  ' H F H P E H U        W K H  ( 8 DGRSWHG D 5HJXODWLRQ OD\LQJ GRZQ KDUPRQLVHG (8ZLGH UXOHV IRU WKH XVH RI KHDOWK RU QXWULWLRQDO FODLPV RQ IRRGVWXIIV 2QH RI WKH NH\ REMHF WLYHV RI WKLV 5HJXODWLRQ LV WR HQVXUH WKDWDQ\FODLPPDGHRQDIRRGODEHOLV VXEVWDQWLDWHG E\ VFLHQWLILF HYLGHQFH 7KH(XURSHDQ)RRG6DIHW\$XWKRULW\ ()6$  LV UHVSRQVLEOH IRU YHULI\LQJ WKH VFLHQWLILF VXEVWDQWLDWLRQ RI VXFK FODLPV :LWK WKLV VFLHQWLILF HYLGHQFH WKH &RPPLVVLRQ DQG 0HPEHU 6WDWHV ZLOO PDNH GHFLVLRQV DV ZKHWKHU WR SHUPLW VXFK KHDOWK FODLPV RQ IRRG SURGXFWV 7KH ()6$ LQ 2FWREHU  SXE OLVKHGLWVILUVWVHULHVRIRSLQLRQVRQWKH OLVW RI ÕJHQHUDO IXQFWLRQÖ KHDOWK FODLPV FRPSLOHGE\IRRGFRPSDQLHVLQWKH(8

7KHRSLQLRQVSURYLGHGVFLHQWLILFDVVHVV PHQWV RI  KHDOWK FODLPV UHODWLQJ WR RYHU  IRRGV DQG IRRG FRPSRQHQWV VXFK DV YLWDPLQV DQG PLQHUDOV ILEUH IDWVFDUERK\GUDWHVÕSURELRWLFÖEDFWHULD DQGERWDQLFDOVXEVWDQFHV )RUDSSUR[LPDWHO\RQHWKLUGRIWKH FODLPVWKHRXWFRPHVRIWKHHYDOXDWLRQV ZHUH IDYRXUDEOH DV WKHUH ZDV VXIIL FLHQWVFLHQWLILFHYLGHQFHWRVXSSRUWWKH FODLPV 7KHVH UHODWHG PDLQO\ WR IXQF WLRQVRIYLWDPLQVDQGPLQHUDOVDQGDOVR LQFOXGHGGLHWDU\ILEUHVDQGIDWW\DFLGV IRU PDLQWHQDQFH RI FKROHVWHURO OHYHOV DQGVXJDUIUHHFKHZLQJJXPIRUPDLQ WHQDQFHRIGHQWDOKHDOWK $OPRVW KDOI RI WKH HYDOXDWLRQV ZLWK XQIDYRXUDEOH RXWFRPHV ZHUH RZLQJ WR D ODFN RI LQIRUPDWLRQ RQ WKH VXEVWDQFH RQ ZKLFK WKH FODLP LV EDVHG IRU H[DPSOH ÕSURELRWLFÖ EDFWHULD DQG ERWDQLFDO VXEVWDQFHV :LWKRXW FOHDU LGHQWLILFDWLRQ RI WKH VXEVWDQFH LQ TXHVWLRQ WKH ()6$ FRXOG QRW YHULI\ WKDW WKH VFLHQWLILF HYLGHQFH SURYLGHG WR WKHP UHODWHG WRWKHVDPHVXEVWDQFHIRUZKLFKWKH KHDOWKEHQHILWVDUHFODLPHG ,QGXVWU\ LV YHU\ FULWLFDO RI WKH ()6$ÖV ÕRYHUO\ FOLQLFDOÖ DVVHVVPHQWV RI WKHVH QXWULWLRQ DQG KHDOWK FODLPV LQSDUWLFXODUWKHIDFWWKDWWKH\UHMHFWHG HYHU\ KHDOWK FODLP GRVVLHU FRYHULQJ SURELRWLFV 2XW RI KXQGUHGV RI SUR 2 9 FOOD IRELAND

&21&/86,216 )RRGODEHOOLQJVKRXOGQRWEHVHHQDVWKH SDQDFHDWRDOOWKHIRRGLVVXHVWKDWPD\ DULVH LQ WKH IXWXUH 2YHUDOO WKRXJK WKH PDLQ LPSURYHPHQW WKDW FRXOG EH PDGH LQ WKLV DUHD RI IRRG ODZ ZRXOG EH WKDW WKH H[LVWLQJ ODZ LV SURSHUO\ LPSOHPHQWHG DQG HQIRUFHG 7KH UXOHV DUHVXIILFLHQWO\GHWDLOHGEXWLIWKH\DUH XQGHUPLQHG E\ IRRG PDQXIDFWXUHUV FLUFXPYHQWLQJWKHUXOHVWKHQWKHUHZLOO EH D ORVV RI FRQVXPHU FRQILGHQFH WKH YHU\WKLQJWKHLQIRUPDWLYHIRRGODEHOLV VHHNLQJWRSUHYHQW 7KH IRRG ODEHO ZLOO FRQWLQXH WR EH RQHRIWKHPDLQWRROVZKHUHE\OHJLVOD WRUVVHHNWRHQVXUHFRQVXPHUFRQILGHQFH LQWKHIRRGWKH\SXUFKDVHDVKLJKOLJKWHG E\ WKHVH SURSRVHG QHZ IRRG ODEHOOLQJ QXWULWLRQ DQG KHDOWK FODLPV UXOHV ,Q WKDWFDVHIRRGODEHOOLQJFRQWLQXHVWREH DIXQGDPHQWDOSDUWRIWKHRYHUDOOERG\ RI(8IRRGODZ

Ý

ABOUT THE AUTHOR Raymond O’ Rourke is a food & consumer lawyer. Author of European Food Law (3rd edition) (2005), he has recently completed an EU project in St. Lucia advising the Government on food regulatory issues. He is a member of Bord Bia’s Taste Council and is a Teaching Fellow in the Faculty of Food Sciences, University of Ulster, Coleraine.


Fit & Forget Instruments & Controls

7+(3$&.$*,1* &(175(/7' )RUDOO<RXU3DFNDJLQJ1HHGV */$66 3KDUPDFHXWLFDO )RRG %RWWOHV -DUV

3/$67,& %XFNHWV%RWWOHV3XPSV7DSV &DSV 6SUD\V

3$3(5 3ULQWHG)RLO 3DSHU%DJV 6HOI$GKHVLYH/DEHOV

Manotherm, 4 Walkinstown Road, Dublin 12. Tel: 01 - 452 2355 Fax: 01 - 451 6919 email: info@manotherm.ie web: www.manotherm.ie

Packaging Industries Fox & Geese House, Naas Road, Dublin 22 Tel: 01 450 8759 Fax: 01 450 7567

Sam McLernon Fox & Geese House, Naas Road, Dublin 22 Tel: 01 450 4121 Fax: 01 450 7567

Email: sales@thepackagingcentre.ie Web: www.thepackagingcentre.ie


FOOD CERTIFICATION

Global Trust: Delivering Certainty GLOBAL TRUST, FORMERLY KNOWN AS IFQC, IS THE LEADING AND MOST FORWARD-THINKING ACCREDITED FOOD CERTIFICATION BODY IN IRELAND, AND IS NOW OPERATIONAL IN 15 COUNTRIES.

*

O R E D O  7 U X V W   I R U P H U O \ N Q R Z Q  D V  , ) 4 &   K D V H[SDQGHG LWV VHUYLFHV WR IXUWKHU DVVLVW FOLHQWV WR PHHWWKHLUSRWHQWLDOLQWKHDUHDVRIIRRG VDIHW\ RUJDQLFV DOOHUJHQ PDQDJHPHQW HQHUJ\PDQDJHPHQWJUHHQYHULILFDWLRQ DQG KHDOWK  VDIHW\ 7KHLU FOLHQW OLVW FRQWDLQV WKH OHDGLQJ IRRG SURFHVVRUV IRRG UHWDLOHUV DQG IRRG VHUYLFH FRPSD QLHVDFURVVWKHZRUOG,QGHHGSURGXFWV FHUWLILHGE\*OREDO7UXVWZLOOEHVROGLQ RYHUPKRPHVLQ Ø*OREDO 7UXVWÖV FRQWLQXHG VXF FHVV LV EDVHG RQ WKH GHOLYHU\ RI WUXVW DQG VXFFHVV IRU RXU FOLHQWVÙ H[SODLQV %HUQDGHWWH 9HUQRQ 'LUHFWRU *OREDO 7UXVWØ:HDUHDSURXG,ULVKFRPSDQ\ :HXQGHUVWDQGWKHSUHVVXUHVLQ,UHODQG DQG FRQWLQXH WR ZRUN ZLWK WKH ,ULVK IRRG LQGXVWU\ WKURXJK LQGHSHQGHQW &HUWLILFDWLRQ DQG LGHD JHQHUDWLRQ WR KHOS RXU FOLHQWV WUDQVSDUHQWO\ GHPRQ VWUDWH WKHLU FUHGHQWLDOV DQG YDOLGDWH PDUNHWSURGXFWDQGVHUYLFHDWWULEXWHVÙ *OREDO 7UXVW RIIHUV D QXPEHU RI FHUWLILFDWLRQVHUYLFHVWRVXLWERWKODUJH DQG VPDOO FRPSDQLHV &HUWLILFDWLRQ VHUYLFHVLQFOXGH%5&*OREDO6WDQGDUGV +$&&36WDQGDUGV(FR/DEHO(QHUJ\ DQG 6XVWDLQDELOLW\ 6WDQGDUGV DQG 2UJDQLFDQG4XDOLW\6WDQGDUGV*OREDO 7UXVW DOVR RIIHU IRUPDO WUDLQLQJ LQ WKH DERYHWKURXJK*OREDO6HUYLFHV

DQQXDOERWWRPOLQHWKURXJKHQHUJ\VDY LQJV 7KHLU DXGLWRUV DQG YHULILHUV VSH FLDOLVHLQWKHHQHUJ\XWLOLWLHVUHVRXUFHV IRRGDQGEHYHUDJHVHFWRUV

*5((1&5('(17,$/6 $V D VFLHQFHEDVHG FRPSDQ\ *OREDO 7UXVWLVGHGLFDWHGWRLQYHVWLJDWLQJDQG FHUWLI\LQJ HQYLURQPHQWDO DQG VXVWDLQ DELOLW\FODLPV7KHLUH[SHUWLVHFRPELQHV YHULILFDWLRQPHWKRGRORJLHVHQYLURQPHQ WDODQGVXVWDLQDELOLW\VFLHQFHDQGLVVXHV DXGLWLQJDQGUHSRUWLQJWRDVVLVWFOLHQWVÖ VWDQGRXW7KHLUWHDPFRQVLVWVRIDFRUH JURXS RI VXVWDLQDELOLW\ VSHFLDOLVWV DQG DJOREDOURVWHURIDXGLWRUVDQGWKHLUFOL HQWOLVWLQFOXGHVFRPSDQLHVRIDOOVL]HV RSHUDWLQJLQDOOSDUWVRIWKHJOREH

75$&($%,/,7<&5('(17,$/6 *OREDO7UXVWDUHH[SHUWVLQ7UDFHDELOLW\ &HUWLILFDWLRQ WKH\ RSHUDWH LQ DQG

WKURXJK VXSSO\ FKDLQV WKDW VWUHWFK DV IDU DV &KLQD DQG 5XVVLD 7KH\ RIIHU DQG YDOLGDWH 7UDFH$VVXUDQFH LI \RX KDYH LW YDOLGDWH LW DQG SURPRWH LW *OREDO 7UXVW FDQ KHOS PDQXIDFWXUHUV TXDOLI\ DQG TXDQWLI\ SRWHQWLDO UHFDOO H[SRVXUH DQG RIIHU FHUWLILFDWLRQ WR VWDQGDUGV XS WR DQG LQFOXGLQJ ,62  WKH LQWHUQDWLRQDO VWDQGDUG IRU 7UDFHDELOLW\ WKDWFDQEHXVHGWRFRP PXQLFDWH FRQILGHQFH WR PDUNHWV DQG FRQVXPHUV

0$5.(7$//(5*(1$1' )22'6$)(7<&5('(17,$/6 7KH %5& *OREDO 6WDQGDUG IRU )RRG 6DIHW\ LV WKH PRVW IUHTXHQWO\ XVHG VWDQGDUG LQ WKH ,ULVK IRRG FKDLQ 5HJDUGHGDVWKHØPLQLPXPHQWU\OHYHOÙ E\NH\UHWDLOHUVWKHVWDQGDUGLVDOVRDQ RSSRUWXQLW\ WR GHPRQVWUDWH \RXU FRP SDQ\ÖVFRPPLWPHQWWRIRRGVDIHW\TXDO LW\DQGOHJDOLW\*OREDO7UXVWRIIHUVWKLV DQGPRUHDQGFDQFRPELQH%5&ZLWK $OOHUJHQ 0DQDJHPHQW &HUWLILFDWLRQ *OREDO7UXVWFDQKHOS\RXJHWPD[LPXP YDOXH RXW RI WKH FHUWLILFDWLRQ SURFHVV HYDOXDWLQJVWUHQJWKVDQGLPSURYHPHQW RSSRUWXQLWLHV)RUVHQLRUPDQDJHPHQW WKLVPHDQVLQFUHDVHGNQRZOHGJHRIWKH RUJDQLVDWLRQÖVDELOLW\WRPHHWLWVVWUDWH JLFREMHFWLYHV +(/3,1*&/,(176727+( 0$5.(7 ,Q WKLV DJH RI FRUSRUDWH VFUXWLQ\ DQG FRVW VHQVLWLYLW\ LW LV LPSHUDWLYH WR FKRRVH D G\QDPLF IRUZDUG WKLQNLQJ IRRG FHUWLILFDWLRQ ERG\ *OREDO 7UXVW LV PDUNHW IRFXVHG DQG LQ WXQH ZLWK QDWLRQDODQGLQWHUQDWLRQDOPDUNHWVROX WLRQV )RUPRUHLQIRUPDWLRQRQ6WDQGDUGV 3URJUDPPHV7UDLQLQJRUWRGLVFXVVWKH YDOLGDWLRQRIDPDUNHWLQJFRQFHSWFRQ WDFW*OREDO7UXVW5LYHUODQH'XQGDON &R/RXWK 7HO   :HE ZZZ*7&(57FRP (PDLO LQIR# *7&(57FRP

(1(5*<0$1$*(0(17 7RGD\PRUHWKDQHYHUHIIHFWLYHHQHUJ\ PDQDJHPHQW LV D FUXFLDO LVVXH IRU WKH VXFFHVVDQGUHSXWDWLRQRIDQ\EXVLQHVV )RU PDQ\ WKH DQVZHU LV DQ (QHUJ\ 0DQDJHPHQW 6\VWHP (Q06  Ó D IUDPHZRUN IRU WKH V\VWHPDWLF PDQDJH PHQW RI HQHUJ\ DQG WKH UHGXFWLRQ RI FRVWV *OREDO 7UXVW RIIHU H[SHUWLVH LQ ,62  DQG WKH QHZ (QHUJ\ 0DQDJHPHQW 6WDQGDUGV 7KLV LV QRW D FRPSOLFDWHG SURFHVV DQG WKH EHQHILWV DUH WKUHHIROG FHUWLILFDWLRQ DV DQ HFR HQWHUSULVH FRVW UHFRYHU\ DQG D EHWWHU

Ý

3 1 FOOD IRELAND


BUSINESS PERFORMANCE

Standing Out From the Crowd KEN MCINTYRE-BARN, GENERAL MANAGER, GLENDINNING IRELAND â&#x20AC;&#x201C; A KANTAR RETAIL COMPANY, WRITES ON HOW IRISH ORGANISATIONS CAN DISTINGUISH THEMSELVES IN THE LONG-TERM.

7

KH FKDQJLQJ HQYLURQPHQW LV FUHDWLQJ QHZ FKDOOHQJHV IRU VXSSOLHUV DQG UHWDLOHUV 0DNLQJPRUHPDUJLQRXWRI OHVV RU QHJDWLYH JURZWK UHTXLUHV ELJ LGHDV DQG EUHDNWKURXJK WKLQNLQJ DV ZHOO DV JUDQXODU DQDO\WLFV WRROV DQG LQVLJKW 6WDQGLQJ RXW IURP WKH FURZG LV EHFRPLQJ LQFUHDVLQJO\ FKDOOHQJLQJ DVOHDGLQJ)0&*SOD\HUVDQGUHWDLOHUV UDLVHWKHEDU7KHIRFXVQHHGVWREHRQ H[HFXWLRQ DQG RUJDQLVDWLRQV QHHG WR EHFDSDEOHRIPRYLQJTXLFNO\WKURXJK LQVLJKWVWUDWHJ\DQGLQWRDFWLYDWLRQ$V D UHVXOW FRPPHUFLDO WHDPV DUH EHLQJ IRUFHG WR UHWKLQN WKH ZD\ WKH\ SODQ RUJDQLVH DQG JR WR PDUNHW $GDSWLQJ DQG WKULYLQJ LQ WKLV HQYLURQPHQW UHTXLUHVQHZRUJDQLVDWLRQDOUHVSRQVHV WKDWVSDQFDSDELOLWLHVDQGIXQFWLRQV 1RERG\ QHHGV D UHPLQGHU RI KRZ GLIILFXOW D WUDGLQJ \HDU  ZDV ZLWK VLJQLILFDQW FKDQJH WDNLQJ SODFH LQ WKH ,ULVK UHWDLO PDUNHW 7R VXUYLYH PDQ\ RUJDQLVDWLRQV KDYH DJJUHVVLYHO\ DWWDFNHG WKHLU FRVW EDVH UHVXOWLQJ LQ QHZPRUHHIILFLHQWRUJDQLVDWLRQVWUXF WXUHVZKLFKDUHEHWWHUHTXLSSHGWRGHDO ZLWK WKH QHZ UHWDLO ODQGVFDSH 6RPH VLJQLILFDQWDODUPEHOOVZHQWRIIIRUPDU NHWHUV GXULQJ  IRU H[DPSOH WKH JURZWKRISULYDWHODEHOIURPLQ WKHODVWIRXU\HDUV 6RXUFH$&1LHOVHQ  ZKLOHPDUNHWGDWDUHYHDOVWKDWHYHQZHOO NQRZQEUDQGVKDYHORVWVRPHJURXQG

&+$//(1*,1*7,0(6%5,1* 23325781,7,(6 'HVSLWH DOO WKH FKDOOHQJHV UHFHVVLRQV UHSUHVHQWJUHDWRSSRUWXQLWLHVIRURUJDQL VDWLRQV 7R TXRWH $* /DIIH\ &(2 RI 3URFWHU DQG *DPEOH Ã&#x2DC;:KHQ WLPHV

DUH WRXJK \RX EXLOG VKDUHÃ&#x2122; 7KHUH DUH PDQ\JUHDWH[DPSOHVRIIDPRXVEUDQGV WKDW ZHUH ODXQFKHG LQ UHFHVVLRQ VXFK DV L3RG IROORZLQJ WKH GRWFRP FROODSVH LQ  0LFURVRIW GXULQJ WKH V RU +3 GXULQJ WKH JUHDW GHSUHVVLRQ RI WKHV7KHUHDUHHYHQH[DPSOHVRI RUJDQLVDWLRQV ZKLFK JDLQHG VLJQLILFDQW VKDUHE\LQYHVWLQJLQWKHLUEUDQGVGXULQJ DGRZQWXUQ,QWKHVIRUH[DPSOH .HOORJJÃ&#x2013;V PDLQWDLQHG WKHLU PDUNHWLQJ LQYHVWPHQWV OHYHOV ZKHUHDV WKHLU PDLQ FRPSHWLWRU 3RVW UHGXFHG WKHP $V D UHVXOW.HOORJJÃ&#x2013;VGRPLQDWHGWKHEUHDNIDVW FHUHDOPDUNHWIURPWKHQRQ 7KHUHDUHIRXUNH\DUHDVZKLFKVXS SOLHUVVKRXOGEHIRFXVHGRQULJKWQRZ

8QGHUVWDQG6KRSSHUV ,Q WKH ORQJHUWHUP JURZWK ZLOO UHTXLUH PRUH WKDQ MXVW ORZ SULFHV 3 2 FOOD IRELAND

,ULVKFRQVXPHUDQGVKRSSHUEHKDY L R X U  K D V  F K D Q J H G  F R Q V L G H U D E O \  WUDQVLWLRQLQJ IURP KLJK OHYHOV RI FRQVXPHU FRQILGHQFH DQG ODFN RI DZDUHQHVV RI SULFH WR EHFRPLQJ H[WUHPHO\ SULFH VHQVLWLYH DQG WKHLU FRQILGHQFH VKDWWHUHG HYHQ WKRVH Z L W K  P R Q H \  V W R S S H G  V S H Q G L Q J  +RZHYHUFRQVXPHUVDUHVWDUWLQJWR UHDOLVH WKDW WKH\Ã&#x2013;UH QRZ LQ FRQWURO 7KH\ NQRZ ZKDW WKH\ ZDQW ZKDW LWUHDOO\FRVWVDQGZKHUHWRJHWWKH EHVW GHDO (YHQ ZKHQ WKH HFRQRP\ KDVUHERXQGHGLWLVOLNHO\WKDWFRQ VXPHUEHKDYLRXUVZLOOKDYHFKDQJHG SURIRXQGO\ DQG WKH\ ZLOO FRQWLQXH WR VSHQG FDXWLRXVO\ 7KLV GRHV QRW PHDQ FRQVXPHUV ZLOO IRUHYHU EH LQ UHFHVVLRQPRGH WKRXJK NH\ GLIIHU HQWLDWRUV VXFK DV VHUYLFH OHYHO DQG TXDOLW\ZLOOFRPHEDFNLQWRSOD\


BUSINESS PERFORMANCE

$VWKHVN\FOHDUVZHZLOOGLVFRYHU Ý $QHZFRQVXPHUZKRLVPRUHFRQ ILGHQW DQG GHWHUPLQHG WR EX\ RQO\ ZKDW KH RU VKH FDQ DFWXDOO\ DIIRUG DQG UHDOO\ QHHGV ZKR ZLOO UHMHFW D € FRPSXWHU ZLWK HQRXJK SRZHUWRQDYLJDWHDURFNHWLQIDYRXU RID€QHWERRNZLWKMXVWHQRXJK SRZHU Ý $QHZUHWDLOHUWKDWRSHUDWHVVPDOOHU ZHOOHGLWHGVWRUHVRUJDQLVHGWRPHHW WKHQHHGVRIWKHQHZFRQVXPHUQRW WKHVXSSOLHU Ý $ QHZ RQOLQH UHWDLOLQJ SUHVHQFH WKDW PRYHV HWDLOLQJ IURP LWV VWDWXV DV DQ DGGRQ WR VWRUH YROXPH WR D SODFHDWWKHFRUHRIWKHEXVLQHVVDVD FRQWULEXWRUWRUHWDLOSURVSHULW\DQG EUDQGGHYHORSPHQW 5HWDLOHUV DQG PDQXIDFWXUHUV WKDW XQGHUVWDQGDQGUHVSRQGWRWKHVHWKUHH SKHQRPHQD FDQ H[LW WKH UHFHVVLRQ UHFKDUJHG IRU VXFFHVV 7KH PRVW VXF FHVVIXO VXSSOLHUV DQG UHWDLOHUV ZLOO EH WKRVHZKRKDYHIRVWHUHGVKRSSHUOR\DOW\ DQG WUXVW DQG ZKR RIIHU D VROXWLRQ EDVHGWDUJHWHGVKRSSLQJH[SHULHQFH 5HPHPEHU WKH FRQVXPHU TXHVW IRU YDOXHGRHVQRWDOZD\VPHDQORZSULFH ,QWKH8.ZKHUHSULYDWHODEHOKDVKDG DORQJDQGVXFFHVVIXOKLVWRU\FRQVXP HUVDUHVKLIWLQJIURPRZQODEHOEDFNWR EUDQGHG SURGXFWV DFFRUGLQJ WR 716 WKH JOREDO PDUNHW UHVHDUFK ILUP 7KLV EHKDYLRXU VXJJHVWV WKDW WRGD\ÖV PRUH VREHU VKRSSHU EHOLHYHV WKDW EUDQGHG

ZLOO KDYH IHZHU 6.8V WKDW WKH\ ZLOO KDYHHYHQIHZHUZLWKGLVWULEXWLRQ DQGWKDWWKHUHZLOOEHPRUHSULYDWHODEHO EUDQGVRQVKHOYHV DQGLQPDQ\FDVHV IHZHUVKHOYHV  Ý -XVWLI\ HYHU\ 6.8 RQ WKH EDVLV RIDUHOHYDQWDQGFRPSHOOLQJFRQ VXPHUDQGVKRSSHUSURSRVLWLRQRU UHPRYHLW Ý *RLQJ IRUZDUG SURGXFWV ZLOO QHHG WRGLVSOD\YDOXHLQWHUPVRIQHWFDW HJRU\JURZWKYHORFLW\DQGVKRSSHU VDWLVIDFWLRQ

Ken McIntyre-Barn, General Manager, Glendinning Ireland – a Kantar Retail Company.

SURGXFWVVRPHWLPHVRIIHUJUHDWHUYDOXH ,Q IDFW WKH SULFH GLIIHUHQFH EHWZHHQ RZQODEHODQGPDQXIDFWXUHUEUDQGVKDV QDUURZHG DV PDQXIDFWXUHUV SURPRWH DJJUHVVLYHO\WRGULYHYROXPHDQGGHIHQG DJDLQVWRZQODEHO,WFRXOGEHDQLQGLFD WRURIJURZLQJFRQILGHQFHWKDWWKHZRUVW RIWKHUHFHVVLRQFRXOGEHRYHU

%UDQG3RUWIROLR  2SWLPLVDWLRQ 1RZLVWKHWLPHWRIRFXVRQ\RXUSRZHU DVVHWV DQG WDNH D ORQJ KDUG ORRN DW \RXUEUDQGSRUWIROLR6XSSOLHUVQHHGWR EHFRPHDFFXVWRPHGWRWKHIDFWWKDWWKH\

Ý ,Q WKH 86$ WKHUH LV DQHFGRWDO HYLGHQFH WKDW .URJHU LV DLPLQJ WR UHGXFH6.8VE\DQG6DIHZD\ E\  ,UHODQG LV XQOLNHO\ WR EH GLIIHUHQW$VWKHUHFHVVLRQFRQWLQXHV WKLVWUHQGLVOLNHO\WRFRQWLQXH:KDW GR\RXNQRZDERXW6.8UHGXFWLRQV DW\RXUUHWDLOHUV",V\RXUFRPSDQ\ SUHSDUHGIRUDFURVVWKHERDUG6.8 UHGXFWLRQV"

([FHOOHQFHRI([HFXWLRQ $FFRUGLQJ WR 0LFURVRIW &(2 %LOO *DWHV VWUDWHJ\ ZLWKRXW H[HFXWLRQ LV GD\GUHDPLQJ 7KH JOREDO RXWRIVWRFN RSSRUWXQLW\LVHVWLPDWHGDW86'ELO OLRQ*UHDWLQVWRUHH[HFXWLRQLVFULWLFDO WRVXFFHVVDQGDOOFXVWRPHUVVKRXOGEH PDQDJHGDQGLQFHQWLYLVHGDJDLQVWSRLQW RISXUFKDVHJURZWKGULYHUV7ZRFUXFLDO IDFWRUV QHHG WR EH FRXQWHUEDODQFHG WKHYROXPHSRWHQWLDO ZKLFKFXVWRPHUV GHOLYHU\RXUYROXPHDQGWKRVHWKDWRIIHU \RX IXWXUH JURZWK RSSRUWXQLWLHV  DQG H[HFXWLRQDO FDSDELOLW\ WKRVH ZKR FDQ SUDFWLFDOO\DQGFRQVLVWHQWO\GHOLYHUWKHLU SURPLVHVZKHUHLWPDWWHUV (QHUJLVH(TXLS(QJDJH <RX FDQ JDLQ FRPSHWLWLYH DGYDQWDJH WKURXJKFDSDELOLW\GHYHORSPHQW7KHUH LV D SURYHQ FRUUHODWLRQ EHWZHHQ WKH SHUIRUPDQFH RI D EXVLQHVV DQG SHRSOH FDSDELOLW\ \HW PDQ\ FRPSDQLHV FXW WUDLQLQJ EXGJHWV GXULQJ  DQG JRW VXFNHGLQWRDQHJDWLYHVSLUDORIDQDO\VLV DQG WU\LQJ WR H[SODLQ WKH UHFHVVLRQ LQ PRQWKO\ UHSRUWV DQG PHHWLQJV RI HYHU LQFUHDVLQJGRRPDQGJORRP ,Q WKH FRPLQJ PRQWKV DQG \HDUV RUJDQLVDWLRQV ZLOO QHHG PRUH FXW WKURXJKWKDQHYHUDQGSHRSOHQHHGWREH DW SHDN SHUIRUPDQFH 7KH ZHOONQRZQ :KDUWRQ6FKRRO0DUNHWLQJ3URIHVVRU

3 3 FOOD IRELAND


BUSINESS PERFORMANCE

*HRUJH'D\GHILQHVFRPSHWLWLYHDGYDQ WDJHDVKDYLQJWKUHHFRPSRQHQWV  6XSHULRUYDOXHDGGHGIURPWKHFXV WRPHUÖVSRLQWRIYLHZ  $QRIIHULQJWKDWLVGLIILFXOWIRUFRP SHWLWRUVWRLPLWDWH  (QKDQFHGIOH[LELOLW\ :HRIWHQKHDUDERXWRUJDQLVDWLRQVWKDW JHWEHWWHUDWJHWWLQJEHWWHUEXWZKDWGRHV WKDWPHDQWKHVHRUJDQLVDWLRQVDUHGRLQJ" ,WSUREDEO\PHDQVWKDWWKH\DUHFRQVWDQWO\ GLVFRYHULQJQHZZD\VWRVDWLVI\FXVWRPHUVÖ QHHGVQHZZD\VWRGHYHORSSURGXFWVDQG VHUYLFHV DQG QHZ ZD\V WR GHOLYHU WKRVH SURGXFWVDQGVHUYLFHV%\GHILQLWLRQWKHVH HQWHUSULVHVZLOOPHHWHDFKRI'D\ÖVFULWHULD DQGZLOOHQMR\DVWURQJFRPSHWLWLYHDGYDQ WDJH7KHOHDUQLQJFDSDELOLW\LVLQLWVHOID FRPSHWLWLYHDGYDQWDJHLWEULQJVVXSHULRU YDOXHLWÖVKDUGWRLPLWDWHDQGLWKDVEXLOW LQIOH[LELOLW\,QIDFW$ULH'H*HXVDUJXHV WKDWOHDUQLQJLVWKHRQO\VRXUFHRIVXVWDLQ DEOHFRPSHWLWLYHDGYDQWDJH $IWHU\HDUVWKHDQQXDOVXUYH\E\ )RUWXQHDQGWKH+D\*URXSVWLOOILQGV WKDWWKHZRUOGÖVHOLWHRUJDQLVDWLRQVVKDUH RQHWKLQJFRUSRUDWHFXOWXUHVWKDWYDOXH SHRSOHDQGKRZWKH\OHDUQ7KHVHFRP SDQLHVGRQÖWMXVWFODLPSHRSOHDUHWKHLU EHVW DVVHW WKH\ EHKDYH WKDW ZD\ 7KH GHFLVLRQWRLQYHVWLQOHDUQLQJLVGHILQHG E\ D VHW RI YDOXHV H[SHFWDWLRQV DQG EHKDYLRXUVUHODWHGWRDFWLYHO\PDQDJLQJ RUJDQLVDWLRQDO OHDUQLQJ 7KH OHDUQLQJ RULHQWHGFRUSRUDWHFXOWXUHVHWVWKHFRQ WH[WRIHYHU\WKLQJWKHRUJDQLVDWLRQGRHV Ø7KHFKDOOHQJHIRUEXVLQHVVOHDGHUV WKHQLVWRFRQFHQWUDWHOHVVRQWU\LQJWR DFKLHYH VSHFLILF EXVLQHVV UHVXOWV DQG PRUHRQFUHDWLQJDVHOIVXVWDLQLQJFXO WXUH WKDW SURGXFHV PRUH HQHUJ\ WKDQ LW FRQVXPHV 7KH EHDXWLIXO E\SURGXFW RIDQRUJDQLVDWLRQZKRVHHQWLUHFXOWXUH IRFXVHV RQ OHDUQLQJ LV WKDW LW LQVSLUHV RUGLQDU\ SHRSOH WR IORXULVK LQ DQ LQFUHDVLQJO\WXUEXOHQWZRUOGÙ 6RXUFH &UHDWLQJD/HDUQLQJ&XOWXUHE\0DUFLD /&RQQHUDQG-DPHV*&ODZVRQ

&5($7,1*7+(&<&/(2) 68&&(66 &KDUDFWHU WUDLWV HQDEOH WRSSHUIRUPLQJ FRPSDQLHVWRFUHDWHWKH&\FOHRI6XFFHVV DQGZLQZLWKWUDGLQJSDUWQHUVRYHUWLPH 2Q 2FWREHU   RXU VLVWHU FRP SDQ\ &DQQRQGDOH $VVRFLDWHV UHOHDVHG LWV DQQXDO 3RZH5DQNLQJn VWXG\ )LUVW SXEOLVKHG LQ  WKH 3RZH5DQNLQJn

VWXG\ DVNV UHWDLOHUV DQG PDQXIDFWXUHUV WRUDQNHDFKRWKHURQ WKHDUHDVZKHUHWKH\ LQWHUIDFH )LJXUH   7KHUHVXOWLVDWRS FRPSRVLWH UDQNLQJ IRU PDQXIDFWXUHUV DQG UHWDLOHUV DV ZHOO DV UDQNLQJV RQ HDFK PHWULFIRUERWKWUDG LQJSDUWQHUV )LJXUHV  DQG   $OWKRXJK 86$IRFXVHGLWFRQ Figure 1: PoweRanking® Metrics WDLQV XVHIXO LQVLJKWV Source: Cannondale research and analysis IRU,ULVKVXSSOLHUVDQG UHWDLOHUV 7KLV \HDU LQ WKH 3RZH5DQNLQJn DQG ORQJWHUP &\FOHV RI 6XFFHVV 7KH *HQHUDO0LOOVDQG1HVWO©JDLQHG%RWK EHVW UHWDLOHUV DQG PDQXIDFWXUHUV KDYH FRPSDQLHV DUH FLWHG IRU SURJUDPPHV HPEUDFHGDPRUHFRRSHUDWLYHPRGHRI WKDW HQKDQFH PHDO FUHDWLRQ DW KRPH GRLQJ EXVLQHVV %H\RQG WKH RSHUDWLQJ ZKLFK KDV SURYHQ WR EH LPSRUWDQW LQ SKLORVRSK\RIFROODERUDWLRQ&DQQRQGDOH WKH FXUUHQW HFRQRP\ 2Q WKH UHWDLOHU LGHQWLILHGILYHFKDUDFWHUWUDLWVFRPPRQWR VLGH YDOXHIRFXVHG UHWDLOHUV LQFOXGLQJ WKRVHFRPSDQLHVWKDWKDYHDFKLHYHGWKH :DOPDUW EHQHILWHG IURP WKH HFRQRPLF JUHDWHVWVXFFHVVRYHUWLPH GRZQWXUQ DQG FRQ VXPHUVÖGHVLUHWRILQG YDOXH LQ WKHLU UHWDLO SXUFKDVHV$OWKRXJK :DOPDUWÖV EXVLQHVV ZDVUHFRYHULQJSULRU WRWKHGRZQWXUQWKH HFRQRP\ FDWDSXOWHG WKHP LQWR KLJK SHUIRUPDQFH PRGH .URJHUDOVRUHFRUGHG JDLQVDVLWFRQWLQXHG WR OHYHUDJH VKRSSHU Figure 2: PoweRanking® Metrics Composite – Retailers LQVLJKWV Source: Cannondale research and analysis ) R U  W K H  I L U V W WLPH &DQQRQGDOH 6LPSOLFLW\ DOVR LGHQWLILHG WKRVH PDQXIDFWXU 5HWDLOHUV DQG PDQXIDFWXUHUV WKDW HUV DQG UHWDLOHUV WKDW KDYH FRQVLVW GHYHORSDVLPSOHJRWRPDUNHWVWUDWHJ\ HQWO\ SHUIRUPHG LQ WKH WRS  RI WKH VLPSOHPHVVDJHDQGVLPSOHZD\RIGRLQJ 3RZH5DQNLQJn FRPSRVLWH VLQFH EXVLQHVV HVWDEOLVK D ILUP IRXQGDWLRQ WKH RULJLQDO 3RZH5DQNLQJ 6XUYH\ ZDV ILHOGHG LQ  )LJXUH  7 K L V  \ H D U Ö V 3 R Z H 5 D Q N L Q J n H[DPLQHVWKHFKDUDF WHU WUDLWV WKDW HQDEOH WRSSHUIRUPLQJFRP SDQLHV WR FUHDWH WKH &\FOH RI 6XFFHVV DQGZLQZLWKWUDGLQJ SDUWQHUV RYHU WLPH &ROODERUDWLRQ LV WKH Figure 3: PoweRanking® Metrics Composite – Manufacturers NH\ WKUHDG UXQQLQJ Source: Cannondale research and analysis WKURXJK WKH VKRUW 3 4 FOOD IRELAND


BUSINESS PERFORMANCE

Figure 4: Top PoweRankingÂŽ Performers over the Past 10 Years Source: Cannondale research and analysis

IRU FROODERUDWLQJ ZLWK WKHLU WUDGLQJ SDUWQHUV

&RQVLVWHQF\ 8VLQJDFRQVLVWHQWDSSURDFKQRWRQO\ KHOSV WR EXLOG WUXVW DQG UHVSHFW EXW DOVR HQDEOHV HDFK SDUWQHU WR GHYHORS DQG UHFRPPHQG VWUDWHJLHV WKDW ZLOO VWDQG D KLJKHU OLNHOLKRRG RI JDLQLQJ DJUHHPHQW )ROORZ7KURXJK 5HVXOWVDUHIXQGDPHQWDOWRVXFFHVVDQG WKH\DUHEDVHGRQWUDGLQJSDUWQHUVIRO ORZLQJWKURXJKRQZKDWWKH\VD\WKH\ DUHJRLQJWRGR &UHDWLYLW\ 7KLQNLQJ FUHDWLYHO\ WR LGHQWLI\ QHZ WHFKQLTXHV DQG WHFKQRORJLHV KHOSV GLI IHUHQWLDWHWKHOHDGHUV ,QYROYHPHQW 8QGHUVWDQGLQJ WUDGLQJ SDUWQHUVĂ&#x2013; EXVL QHVV REMHFWLYHV DQG LVVXHV JRHV D ORQJZD\LQGHYHORSLQJDFROODERUDWLYH UHODWLRQVKLS DQG FUHDWLQJ WKH &\FOH RI 6XFFHVV 81'(50,1,1*68&&(66 &RQYHUVHO\ WZR WUDLWV WKDW XQGHUPLQH VXFFHVVLQDWUDGLQJUHODWLRQVKLSLQFOXGH

/DFNRI)OH[LELOLW\ 7UDGLQJSDUWQHUVZDQWWRIHHOWKDWWKHUH LVVRPHJLYHDQGWDNHDQGDZLOOLQJQHVV WREHQG,QIOH[LELOLW\EORFNVWKHFROODER UDWLYHSURFHVV 6XUSULVHV 'HOLYHULQJDJDLQVWH[SHFWDWLRQVLVFULWL FDO 6XUSULVHV HURGH WUXVW DQG GHVWUR\ FROODERUDWLRQ ,GHQWLI\LQJ OHDGHUVKLS FKDUDFWHU LVWLFV PD\ EH KHOSIXO EXW WKH &\FOH RI 6XFFHVV XOWLPDWHO\ GHSHQGV RQ KRZ WKRVH WUDLWV DUH SXW LQWR SUDFWLFH &DQQRQGDOHĂ&#x2013;V H[DPLQDWLRQ RI WKH WRS 3RZH5DQNLQJ6XUYH\SHUIRUPHUVLGHQ WLILHG WKUHH EDVLF LPSURYHPHQW UHFRP PHQGDWLRQV (FRQRPLVHWKHPHVVDJH &RQVLVWHQW ZLWK WKH VXFFHVV WUDLW RI VLPSOLFLW\ VXFFHVVIXO FRPSDQLHV PXVW EHDEOHWRLGHQWLI\DUHDVIRUZKLFKWKH\ ZDQWWREHIDPRXVDQGĂ&#x201C;LQDVRXQGELWH Ă&#x201C;FRPPXQLFDWHKRZWKHLUVWUDWHJLHVFDQ EULQJWKHVHDUHDVWROLIH 2ZQDIHZWKLQJVDQGGR WKHPZHOO 0RVW VXFFHVVIXO FRPSDQLHV ZKLOH DVVXULQJ WKDW D PLQLPXP DQWH LV VHW FRQFHQWUDWHUHVRXUFHVLQDVHOHFWVHWRI

3 5 FOOD IRELAND

DUHDVRQDUHSHDWHGEDVLVWKDWZLOOKHOS WKHPDFKLHYHDFRPSHWLWLYHDGYDQWDJH DQGHQDEOHWKHPWRVWDQGRXWZLWKWKHLU SDUWQHUVRYHUWKHORQJWHUP

'ULYHDFWLRQVWKURXJK LQVLJKW $OWKRXJKLQVLJKWFRQWLQXHVWREHWKH PRVW YDOXHG FROODERUDWLYH FXUUHQF\ LQVLJKWZLWKRXWDFWLRQLVVLPSO\QRLVH 7KHEHVWWUDGLQJSDUWQHUVHQVXUHWKDW HYHU\ OLQN LQ WKH FKDLQĂ&#x201D;IURP SURE OHP LGHQWLILFDWLRQ WR UHODWHG LQVLJKW WR LQGLFDWHG DFWLRQĂ&#x201D;LV VHDPOHVVO\ FRQQHFWHG $'$37,1*72&+$1*( $OWKRXJKOLWWOHLVFHUWDLQLQWKLVHFR QRPLFWXUPRLOZHNQRZWKLVIRUVXUH LWZLOOHQG0DQ\RIWRGD\Ă&#x2013;VUHWDLOHUV DQG VXSSOLHUV ZLOO EH KLVWRU\ 0RVW ZLOO VLPSO\ VXUYLYH $ VHOHFW IHZ ZLOO IDOO LQWR D WKLUG FDWHJRU\ WKH\ ZLOO HPHUJH VWURQJHU EHFDXVH WKH\ VHHN RSSRUWXQLWLHV ZKHUH VXUYLYRUV VHH RQO\ FKDOOHQJHV ,WĂ&#x2013;V QRW WKH ILW WHVW ZKR ZLOO VXUYLYH Ă&#x201C; LWĂ&#x2013;V WKH PRVW DGDSWDEOH

Ă?

ABOUT THE AUTHOR Ken McIntyre-Barn is General Manager of Glendinning Ireland â&#x20AC;&#x201C; a Kantar Retail company. Kantar Retail is an insight and consulting business that works with clients to transform the purchase behaviour of consumers, shoppers and retailers. By combining the resources of Glendinning, MVI, Cannondale, Retail Forward and Red Dot Square, Kantar Retail can solve client issues, from strategic to tactical, and provide organisations with the skills and capabilities to act. They offer clients better internal alignment and project efficiency, from insight through strategy to activation, and across marketing through category to sales. The end product is enhanced revenue and profitability for clients. For further information, contact Ken on 086 8074211. e-mail: ken.mcintyre-barn@glendinningmc.net


PRODUCT & SERVICE INDEX

F

O O D

I

R E L A N D

2009/10

Product and Service Index ACCREDITATION

Codico Distributors Ltd BARCODING/LABELLING

ADC Barcode Advanced Coding Solutions Ltd AIS Ltd ALS Labelling Solutions Atwell Self Adhesive Labellers P.J. Boner & Co. Ltd Codico Distributors Ltd Com-Plas Packaging Faculty of Food Science & Technology Goliath Packaging Systems Ltd GS1 Ireland Heavey Technology Label Art Ltd Label One Ltd Logopak International Ltd Matcon Group Ltd Obeeco Ltd Waveform Solutions Weber Labelling & Coding Ltd Weigh-Tech Ltd WrenTech Ltd EDUCATION/TRAINING/ CERTIFICATION/CONSULTANCY

AB Cheesemaking Campden BRI Commercial Excellence Ltd FAS - Training & Employment Authority Food Safety Interactive Training Irish Exporters Association Irish National Accreditation Board Kantar Retail NSAI NSAI (Training Section) SGS Ireland Ltd UCD (Agri-Food)

FOOD SAFETY AUDITING

Campden BRI Central Health & Safety Services Ltd Global Trust Certification Irish Exporters Association SGS Ireland Ltd Topaz Energy Ltd CONSULTANTS

Campden BRI Central Health & Safety Services Ltd Cross Refrigeration Irish Exporters Association Q-Lab Ltd CONTROL/INSTRUMENTATION

Advanced Packaging Machinery Ltd P.J. Boner & Co. Ltd Campden BRI Cross Refrigeration Festo Ltd Shaw Scientific Ltd Weber Labelling & Coding Ltd HYGIENE

Campden BRI Central Health & Safety Services Ltd Cross Refrigeration Enviroclad Systems Ltd Georgia Pacific Ireland Ltd Global Trust Certification Teknomek Industries Ltd TESTING/INSPECTION

Advanced Packaging Machinery Ltd P.J. Boner & Co. Ltd Campden BRI Central Health & Safety Services Ltd Cross Refrigeration Global Trust Certification Lennox Laboratory Supplies Obeeco Ltd Q-Lab Ltd Sartorius Mechatronics 3 6 FOOD IRELAND

Shaw Scientific Ltd Teagasc Ashtown Food Research Centre Weber Labelling & Coding Ltd WrenTech Ltd TRACKING SYSTEMS

Advanced Packaging Machinery Ltd Central Health & Safety Services Ltd Codico Distributors Ltd Heavey Technology Logopak International Ltd Matcon Group Ltd Sartorius Mechatronics Weber Labelling & Coding Ltd WrenTech Ltd GENERAL SERVICES/ SUPPLIERS TO THE TRADE

ABB Ltd Aerobord Ltd Air Products Ireland Ltd All in All Ingredients Ltd Atwell Self Adhesive Labellers Bank of Ireland Global Markets Blenders Ltd Bord Bia - The Irish Food Board Codico Distributors Ltd Com-Plas Packaging ESB Independent Energy Festo Ltd Filling Machines & Equipment Flogas Ireland Ltd Georgia Pacific Ireland Ltd Healy Group Heavey Technology Irish National Accreditation Board Kantar Retail Kingspan Controlled Environments Lennox Laboratory Supplies NSAI NSAI (Training Section) Norman Lauder Ltd Odlums Ltd Pegler & Louden


Pharmafoods Ltd Q-Lab Ltd Security Pak Ltd Shaw Scientific Ltd Sustainable Energy Ireland Topaz Energy Ltd Weber Labelling & Coding Ltd Weigh-Tech Ltd HEALTH & SAFETY

Campden BRI Central Health & Safety Services Ltd Enviroclad Systems Ltd Global Trust Certification SGS Ireland Ltd INGREDIENTS

All in All Ingredients Ltd Andrew Ingredients Ltd Blakes Ingredients Camida Ltd Cereform Ltd Cloverhill Food Ingredients Ltd Corcoran Chemicals Ltd EDME Ltd Glanbia plc Healy Group Heterochem (Dist.) Ltd IMCD Ingredient Solutions Ltd Irish Dairy Board Kiernan’s Food Ingredients Ltd Kilfera Foods Ltd National Food Ingredients Ltd Norman Lauder Ltd Nutrition Supplies O’Brien Ingredients P.K. Chemicals Ltd Purac biochem Puratos Crest Foods Ltd Redbrook Ingredient Services Ltd Unifood Ltd Weigh-Tech Ltd D.D. Williamson (Ireland) Ltd Wilson’s Country Ltd IT SERVICES & OUTSOURCING

O O D

I

R E L A N D

2009/10

MARKING & CODING

Codico Distributors Ltd MATERIALS HANDLING SERVICE CONTROL/INSTRUMENTATION

ABB Ltd Advanced Packaging Machinery Ltd P.J. Boner & Co. Ltd Festo Ltd David Kellett & Partners Ltd Manotherm Ltd Mason Technology Odenberg Engineering Ltd Sartorius Mechatronics Shaw Scientific Ltd Treatment Systems Ltd Weber Labelling & Coding Ltd Weigh-Tech Ltd

PALLETS, CRATES & CONTAINERS

AIC Plastic Pallets Ltd Goliath Packaging Systems Ltd Industrial Packaging Ltd Irish Dairy Board Linpac Allibert Matcon Group Ltd Odenberg Engineering Ltd Olivo UK Ltd WrenTech Ltd PUMPS & VALVES

Festo Ltd David Kellett & Partners Ltd Mason Technology Moody plc Pegler & Louden Topaz Energy Ltd Treatment Systems Ltd

MACHINERY/EQUIPMENT

REFRIGERATION/COLD STORAGE

ABB Ltd Advanced Packaging Machinery Ltd Avery Weigh-Tronix Axium Process Ltd Caterquip Ltd Filling Machines & Equipment Fischbein-Saxon Goliath Packaging Systems Ltd David Kellett & Partners Ltd Kliklok International Ltd Krones UK Ltd Mason Technology Masterlift Ireland Ltd Matcon Group Ltd Moody plc Obeeco Ltd Odenberg Engineering Ltd Record Packaging Systems Ltd Sartorius Mechatronics Security Pak Ltd Silverson Machines Ltd Teknomek Industries Ltd Topaz Energy Ltd Toyota Material Handling Ireland Treatment Systems Ltd Weber Labelling & Coding Ltd Weigh-Tech Ltd WrenTech Ltd

Blakes Ingredients Commercial Refrigeration Ltd Cross Refrigeration CRS Mobile Cold Storage Ltd Festo Ltd Irish Dairy Board Kingspan Controlled Environments Odenberg Engineering Ltd Shaw Scientific Ltd Topaz Energy Ltd Trans-Stock Warehousing & Cold Storage Ltd TRANSPORT & LOGISTICS

Celtic Forwarding Ltd Irish Dairy Board Johnston Logistics Krones UK Ltd Logopak International Ltd NITL Topaz Energy Ltd Toyota Material Handling Ireland Trans-Stock Warehousing & Cold Storage Ltd Waveform Solutions Weber Labelling & Coding Ltd Weigh-Tech Ltd WASTE MANAGEMENT / RECYCLING

Weber Labelling & Coding Ltd Weigh-Tech Ltd

Thorntons Recycling Ltd Treatment Systems Ltd

3 7 FOOD IRELAND

PRODUCT & SERVICE INDEX

F


PRODUCT & SERVICE INDEX

F

PACKAGING/DESIGN/ LABELLING

O O D

I

R E L A N D

2009/10

PROCESSING EQUIPMENT BAKERY

Advanced Packaging Machinery Ltd Aerobord Ltd Air Products Ireland Ltd ALS Labelling Solutions Amcor Flexibles Boxmore Plastics Ltd Campden BRI Celtic Sales Co. Ltd Celtic Sales Co. (Cork) Ltd Com-Plas Packaging Diamond Corrugated Dollard Packaging Ltd Elopak Fischbein-Saxon Goliath Packaging Systems Ltd Grabher Indosa AG Industrial Packaging Ltd Innovia Films Ltd Irish Dairy Board Irish Exporters Association Irish Papers Johnsen & Jorgensen Kiernan’s Food Ingredients Ltd Kliklok International Ltd Label One Ltd Limerick Packaging Measom Freer & Co. Ltd Multivac Ireland Ltd NPP Group Ltd T.S. O’Connor & Son Ltd Packaging Centre Ltd, The Packex Industries Ltd P.C. Packaging Ltd Persona Design Consultants Ltd Pharmafoods Ltd Quinn Packaging Ltd Record Packaging Systems Ltd Sealed Air Ltd Security Pak Ltd Sidaplax - Plastic Suppliers Inc Smurfit Kappa Ireland Veriplast Solutions Versatile Packaging Ltd Weigh-Tech Ltd WrenTech Ltd

Advanced Packaging Machinery Ltd Atwell Self Adhesive Labellers Avery Weigh-Tronix Axium Process Ltd Caterquip Ltd Commercial Refrigeration Ltd Cross Refrigeration Fischbein-Saxon Goliath Packaging Systems Ltd JBT FoodTech Moody plc Obeeco Ltd Pharmafoods Ltd Security Pak Ltd Silverson Machines Ltd SNA Associates Teknomek Industries Ltd Topaz Energy Ltd Versatile Packaging Ltd Weber Labelling & Coding Ltd WrenTech Ltd DAIRY

Advanced Packaging Machinery Ltd Atwell Self Adhesive Labellers Avery Weigh-Tronix Axium Process Ltd Cross Refrigeration Elopak Filling Machines & Equipment Fischbein-Saxon Goliath Packaging Systems Ltd JBT FoodTech David Kellett & Partners Ltd Moody plc Obeeco Ltd Odenberg Engineering Ltd Pharmafoods Ltd Security Pak Ltd Silverson Machines Ltd SNA Associates Teknomek Industries Ltd Topaz Energy Ltd Versatile Packaging Ltd Weber Labelling & Coding Ltd WrenTech Ltd

PEST CONTROL/FLYSCREENS DRINK

Farwood Flyscreens Omega P.C.S. Rentokil Pest Control

Advanced Packaging Machinery Ltd Atwell Self Adhesive Labellers Avery Weigh-Tronix Axium Process Ltd Caterquip Ltd Cross Refrigeration 3 8 FOOD IRELAND

Filling Machines & Equipment Goliath Packaging Systems Ltd Moody plc Obeeco Ltd Odenberg Engineering Ltd Pharmafoods Ltd Security Pak Ltd Silverson Machines Ltd SNA Associates Teknomek Industries Ltd Topaz Energy Ltd Versatile Packaging Ltd Weber Labelling & Coding Ltd WrenTech Ltd FRESH FOOD

Advanced Packaging Machinery Ltd Atwell Self Adhesive Labellers Avery Weigh-Tronix Caterquip Ltd Cross Refrigeration Filling Machines & Equipment Fischbein-Saxon Goliath Packaging Systems Ltd JBT FoodTech Obeeco Ltd Odenberg Engineering Ltd Pharmafoods Ltd Security Pak Ltd Silverson Machines Ltd SNA Associates Teknomek Industries Ltd Topaz Energy Ltd Versatile Packaging Ltd Weber Labelling & Coding Ltd Weigh-Tech Ltd MEAT, FISH & POULTRY

Advanced Packaging Machinery Ltd Atwell Self Adhesive Labellers Avery Weigh-Tronix Caterquip Ltd Cross Refrigeration Goliath Packaging Systems Ltd JBT FoodTech Obeeco Ltd Odenberg Engineering Ltd Pharmafoods Ltd Security Pak Ltd Silverson Machines Ltd SNA Associates Teknomek Industries Ltd Topaz Energy Ltd Versatile Packaging Ltd Weber Labelling & Coding Ltd Weigh-Tech Ltd


MACHINERY AUCTIONEERS

Cross Refrigeration Goliath Packaging Systems Ltd Moody plc SNA Associates Topaz Energy Ltd Weber Labelling & Coding Ltd RECRUITMENT

Commercial Excellence Ltd Innovate Food Technology RESEARCH & DEVELOPMENT

All in All Ingredients Ltd Campden BRI Healy Group

O O D

I

R E L A N D

2009/10

Irish Dairy Board Irish Exporters Association Relay - Research for the Food Industry Teagasc Moorepark Food Research Centre Teagasc Ashtown Food Research Centre WrenTech Ltd STAINLESS STEEL FABRICATION

Axium Process Ltd Cross Refrigeration Goliath Packaging Systems Ltd Teknomek Industries Ltd WrenTech Ltd

Notes

3 9 FOOD IRELAND

TRADE ASSOCIATION

Irish Association Of Seafood Companies (IASC) Irish Exporters Association Repak Ltd WASTE MANAGEMENT / RECYCLING

Goliath Packaging Systems Ltd Repak Ltd

PRODUCT & SERVICE INDEX

F


F

O O D

I

R E L A N D

2009/10

C O M PA N Y L I S T I N G S

Company Listings A

ADC Barcode Address:

ABB Ltd UK: Auriga House, Precedent Drive, Rooksley, Milton Keynes, MK13 8PQ. Telephone: (0044) 1908 350 300 Fax: (0044) 1908 350 301 Email: robotics@gb.abb.com Web: www.abb.com www.abb.com/robotics Contact: UK - Robotics Managing Director: Chris Withey Ireland: Belgard Road, Tallaght, Dublin 24. Telephone: (01) 405 7300 Fax: (01) 405 7327 Email: marketing@ie.abb.com Web: www.abb.ie Main Products/ ABB is one of the world’s Services: leading engineering companies, we help our customers to use electircal power effectively and to increase industrial productivity in a sustainable way. Contact: Ireland Robotics Group: Sales & Marketing Manager: Nigel Platt Address:

AB Cheesemaking Address:

7 Daybell Close, Bottesford, Nottingham, NG13 0DQ, England. Telephone: (0044) 1949 842 867 Fax: (0044) 1949 842 867 Email: chrisashby@ abcheesemaking.co.uk Web: www.abcheesemaking.co.uk Main Products/ Cheesemaking training Services: and consultancy. Contact: Christine Ashby

Unit 1B, 11 Canal Bank, Hume Avenue, Parkwest, Dublin 12. Telephone: (01) 620 9777 Fax: (01) 620 9722 Email: info@adcbarcode.com Web: www.adcbarcodesolutions.com Main Products/ Thermal transfer Services: printers, EU178 software, labels, thermal foil, scanners. Contact: Marketing Manager: Celine Wogan

Web: www.test.ie Main Products/ Metal detectors, Services: x-ray inspection systems & check weighers. Contact: Sales Director: Stephen Dallas

Aerobord Ltd Address: Telephone: Fax: Email: Web: Main Products/ Services: Contact:

Askeaton, Co. Limerick. (061) 604 600 (061) 604 601 jblessing@aerobord.ie www.aerobord.ie Packaging for food industry. John Blessing

Advanced Coding Solutions Ltd Address:

Derrynane House, Eadestown, Naas, Co. Kildare. Telephone: (045) 883 510 Mobile: 087 236 9569 Fax: (045) 880 934 Email: bob@acsprint.ie philip@acsprint.ie Web: www.acsprint.ie Main Products/ Citronix printers, Services: Masca laser, Stream feeder, reconditioned Videojet printers, replacement inks & fluids for all printers, full range of shrink wrap equipment, liquid filling, labelling & service. Contact: Director (Printing): Bob Powles Director (Packaging): Philip Cleary

AIC Plastic Pallets Ltd Address:

The Woodlands, Carrigmore, Ballineen, Co. Cork. Telephone: (023) 884 7333 Fax: (023) 884 7671 Email: info@aicplasticpallets.com Web: www.aicplasticpallets.com Main Products/ Materials handling Services: platforms, pallets, containers, boxes, plastic & wooden, ISPMI5 compliance, trays, tote boxes. Contact: Joint Managing Director: Charles O’Donovan Joint Managing Director: Jerry O’Flynn

Air Products Ireland Ltd Advanced Packaging Machinery Ltd Address:

Telephone: Fax: Email:

718 Northwest Business Park, Ballycoolin, Dublin 15. (01) 861 2141 (01) 861 2142 s.dallas@test.ie 4 0 FOOD IRELAND

Address:

Telephone: Fax: Email: Web:

Unit 950, Western Industrial Estate, Killeen Road, Dublin 12. (01) 465 9650 (Amy Egan) (01) 408 0858 ieinfo@airproducts.com www.airproducts.com


Main Products/ With over 40 years Services: experience of supplying gas, services and technologies to the food industry Air Products’ Freshline® Solutions can assist you with all your Modified Atmosphere Packaging (MAP) Requirements. Freshline Gases® include CO2, Nitrogen and Oxygen in liquid or gaseous form. To find out more please visit our website. Contact: Sales Manager: David Bourke

O O D

I

R E L A N D

2009/10

ALS Labelling Solutions Ltd Address:

Unit 8, Westpoint Business Park, Mulhuddart, Dublin 15. Telephone: (01) 824 2643 Fax: (01) 815 7497 Email: info@labelling.ie Web: www.labelling.ie Main Products/ Automatic labelling Services: machines, print & apply, label printers, barcode scanning, HP inkjet systems, service & spares, thermal ribbons & labels. Contact: Pat Phibbs

Amcor Flexibles AIS Ltd Automatic Identification Systems Address:

Telephone: Fax: Email: Web: Main Products:

Services:

Contact:

Unit 48, Canal Walk, Park West Industrial Park, Nangor Road, Dublin 12. (01) 620 5742 (01) 620 5735 info@aisltd.ie www.aisltd.ie RFID equipment, automatic labelling, print & apply systems, industrial barcode scanning, 2D barcode equipment, hand held readers, mobile computers, fixed mount scanning, label printers, mobile printers, desktop printers, industrial printers, barcode printers, labels & ribbons. Supply, install & maintenance of auto ID products. Custom solution development for product traceability suitable for you. Sales Manager: Matt Stapleton

All In All Ingredients Address:

33 Lavery Avenue, Park West, Dublin 12. Telephone: (01) 626 3957 Fax: (01) 626 6052 Email: dhickey@allinall.ie Web: www.allinall.ie Main Products/ Ingredients, blending Services: services, research & development. Contact: Managing Director: Daniel Hickey

Address:

Da Vincilaan 2, B-1935, Zaventem, Belgium. Telephone: 0032 (0)2 416 2611 Fax: 0032 (0)2 416 2612 Email: info@amcor-flexibles.com Web: www.amcor.com Main Products/ With annual net sales of Services: €1.8 billion and manufacturing operations in 22 countries across Europe and the Americas, Amcor Flexibles, a division of Amcor, is a market leader and one of the world’s largest suppliers of flexible and tobacco packing. It supplies a wide range of products to the food, beverage, tobacco & healthcare markets.

Andrew Ingredients Ltd Address:

141 Dromore Road, Hillsborough, Co. Down, BT26 6JA. Telephone: (01) 842 6222 Fax: (048) 9268 3798 Email: timandrew@ andrewingredients.co.uk Web: www.andrewingredients.co.uk Main Products/ Ingredients. Services: Contact: Managing Director: Tim Andrew

Atwell Self-Adhesive Labellers Address:

Unit 18, Bolney Grange Business Park, Stairbridge Lane, Hickstead, West Sussex, RH17 5PB. 4 1 FOOD IRELAND

Telephone: (0044) 1444 239 970 Fax: (0044) 1444 246 609 Email: sales@atwell-labellers.co.uk Web: www.atwell-labellers.co.uk Main Products/ Labelling machine Services: suppliers, service & spares. Self-adhesive labellers and specialist labelling systems, Cross Web labellers for thermoformers and tray sealers. Inline coders, printers and label verification systems, linerless/linerfree print & apply systems, plain & printed labels. Contact: David Charlesworth

Avery Weigh-Tronix Address:

Airton Park, Airton Road, Tallaght, Dublin 24. Telephone: (01) 400 0700 Fax: (01) 400 0750 Email: irelandinfo@awtxglobal.com Web: www.averyweightronix.com/ireland Main Products/ A full range of Services: maintenance support contracts. Espera labelling equipment; Ravenwood linerless packaging machines; HenkoVac vacuum packaging machines; Atex Systems for Pharmaceutical & associated industries; liquid and bag filling; vessel and hopper weighing; lorry weighbridges & management systems; emergency breakdown service; full range of calibration services including UKAS; high precision balances; project management and project support; provide service for all manufacturers brands not only Avery equipment; software contract support; full range of equipment hire; full range of consumable products, printheads, thermal transfer ribbons, labels. Contact: Pre-Pack Manager: Stuart Bird

C O M PA N Y L I S T I N G S

F


F

O O D

I

R E L A N D

2009/10

C O M PA N Y L I S T I N G S

Axium Process Ltd

P.J. Boner & Co. Ltd

Address:

Instrument & Weighing Specialists

Hendy Industrial Estate, Hendy, Swansea, SA4 0XP Telephone: (0044) 1792 883 882 Fax: (0044) 1792 886 049 Email: info@axiumprocess.com Web: www.axiumprocess.com Main Products/ Fabrication, membrane Services: filtration & stockists of stainless steel fittings. Contact: Business Development Manager: Derek Davies

B

Bank of Ireland Global Markets Address:

Colvill House, Talbot Street, Dublin 1. Telephone: (01) 799 3000 Fax: (01) 799 3035 Email: info@boigm.com Web: www.boi.ie/globalmarkets Main Products/ Currency risk Services: management, Interest rate risk management, treasury investments and deposits, trade finance, structured products.

Blakes Ingredients Address:

Unit 1 & 2, Western Business Park Oak Close, Dublin 12. Telephone: (01) 450 7177 Fax: (01) 450 7190 Email: sales@blakesingredients.com Web: www.blakesingredients.com Main Products/ Sugars, seasonings and Services: food ingredients (frozen & ambient). Contact: Richard West

Address:

35 Western Parkway Business Centre, Ballymount Drive, Ballymount, Dublin 12. Telephone: (01) 450 5050 Fax: (01) 450 5183 Email: sales@pjboner.com Web: www.pjboner.com www.scales.ie Main Products/ Supply, Service and Services: Calibration of Instruments, Controls, Weighing. Contact: Managing Director: Pat J. Boner

Bord Bia - The Irish Food Board

Unit 4, IDA Centre, Newmarket, Dublin 8. Telephone: (01) 453 6960 Fax: (01) 453 7607 Email: sales@blenders.ie Main Products/ Mayonnaises, dressings, Services: bouillons, cooking sauces, table sauces, carvery sauces, relishes in bulk catering, sachets and retail jar formats. Branded and private label. Contact: Director of Sales: David Chandler Directors: Robin Simpson, David Simpson

Contact:

Address:

Clanwilliam Court, Lower Mount Street, Dublin 2. Telephone: (01) 668 5155 Fax: (01) 668 7521 Email: info@bordbia.ie Web: www.bordbia.ie Main Products/ Marketing, promotion Services: and development of Irish food, drink & horticulture. Contact: Chief Executive: Aidan Cotter

Boxmore Plastics Ltd Address:

Annagh Industrial Park, Ballyconnell, Co. Cavan. (049) 952 6219 (049) 952 6423 chris.gaffney@ boxmoreplastics.com www.boxmoreplastics.com

Telephone: Fax: Email:

Blenders Ltd Address:

Services:

Web: Main Products/ Services: Dairy & sauce bottles. Contact: Sales Director: Chris Gaffney

C

Camida Ltd Address:

Tower House, New Quay, Clonmel, Co. Tipperary. Telephone: (052) 612 5455 Fax: (052) 612 5466 Email: joe.guiney@camida.com Web: www.camida.com Main Products/ Ingredient supplier 4 2 FOOD IRELAND

to the Food & Drinks industries. We work with our customers to supply product & service solutions via the representation of key principals in our marketplace. Specialised in Lecithin, Flavour systems, Seasonings, Functional blends for Water and fat management, Coating systems, Injection and tumbling mixes. Biopolymers including Carrageenan, Alginate, Microcrystalline cellulose. Intensive Sweeteners, including Neohesperidin DC (NHDC) and Citrus Bioflavonoids. Sales Manager: Joe Guiney

Campden BRI Address:

Chipping Campden, Gloucestershire, GL55 6LD, UK. Telephone: (0044) 1386 842 104 Fax: (0044) 1386 842 100 Email: training@campden.co.uk Web: www.campden.co.uk Main Products/ Research, Training, Services: Consultancy and Publications for the Food, Drink and Allied Industries Worldwide. Contact: Head of Membership & Training Department: Bertrand Emond

Caterquip Ltd Address:

Unit Q19, Greenogue Business Park, Rathcoole, Co. Dublin. Telephone: (01) 401 1858 Fax: (01) 401 1857 Email: caterquip@eircom.net Web: www.caterquip.ie Main Products/ Catering & bakery Services: equipment. Contact: Director: Michael Hill

Celtic Forwarding Ltd Address:

Telephone: Fax:

Celtic House, 30 Marlborough Street, Dublin 1. (01) 865 6000 (01) 874 6745


Email: Web: Main Products/ Services: Contact:

info@celticfwd.ie www.celticfwd.ie Shipping, transport, customs clearance. Sales Manager: Gerard Kiernan

Celtic Sales Company Ltd Address:

203 Northwest Business Park, Blanchardstown, Dublin 15. Telephone: (01) 829 3944 Fax: (01) 829 3955 Email: paddybyrne@celticsales.ie Main Products/ Packaging materials Services: for fresh food. Contact: Managing Director: Paddy Byrne

Celtic Sales Company (Cork) Ltd Address:

Unit 3B, Waterfront Business Park, Little Island, Co. Cork. Telephone: (021) 429 7984 Fax: (021) 429 7990 Email: celticsalescork@eircom.net Main Products/ Suppliers of packaging, Services: containers for food, cakes & salads, net bags, plastic bags & cardboard boxes. Contact: Mary Oâ&#x20AC;&#x2122;Brien

Central Health & Safety Services Ltd Address:

Block B, The Courtyard, Newbridge, Co. Kildare. Telephone: (045) 436 166 Fax: (045) 438 851 Email: maura@chss.ie Web: www.chss.ie Main Products/ Central Health & Safety, Services: are a FETAC & FAS registered centre with a team of highly qualified and experienced consultants in all aspects of Health & Safety, including Safe Food Handling (HACCP). We can help you adhere full compliance in relation to Health & Safety Regulations and attend to all your associated training requirements. Contact: Office Manager: Maura Kavanagh

O O D

I

R E L A N D

2009/10

Cereform Ltd Address:

Barn Way, Lodge Farm, Northampton, NN5 7UW. Telephone: (0044) 1604 755 522 Fax: (0044) 1604 752 470 Email: dmcdonald@cereform.com Web: www.cereform.com Main Products/ Dough Conditioners, Services: Cake & Confectionery Mixes and Concentrates, Icings & Fillings. Contact: Account Manager, Ireland: Damien McDonald

Contact:

specialises in helping businesses grow faster and more profitably through the creation, development and implementation of successful sales & marketing solutions. Our core practices include Strategy, Capability, Occupational Testing, Coaching & Recruitment. Managing Director: Ken McIntyre-Barn

Cloverhill Food Ingredients Ltd

Commercial Refrigeration Ltd

Address:

Address:

Mountleader Ind. Estate, Millstreet, Co. Cork. (029) 21844 (029) 21845 info@cloverhill.ie www.cloverhill.ie

Telephone: Fax: Email: Web: Main Products/ Services: Food ingredients.

Codico Distributors Ltd Address:

Cleaboy Business Park, Old Kilmeaden Road, Co. Waterford. Telephone: (051) 379 933 Fax: (051) 372 352 Email: sales@codico-distributors.com Web: www.codico-distributors.com Main Products/ Domino: Inkjet, Laser, Services: Outer Case, Thermal Transfer, Thermal Inkjet, Print and Apply Labelling, 2D, Data Matrix Systems, Electrox: Yag, Fibre, UV Lasers, Handling Stations. Contact: Sales Director: Noel Cooney Mobile: 087 746 3583

Commercial Excellence Ltd Address:

54 Torcaill, Portmarnock, Co. Dublin. Telephone: (01) 845 9920 Fax: (01) 845 9920 Email: ken@commercialexcellence.ie Web: www.commercialexcellence.ie Main Products/ Commercial Excellence Services: is an International Sales & Marketing Consultancy which Cont. 4 3 FOOD IRELAND

Mullinabro Business Centre, Mullinabro, Ferrybank, Co. Waterford. Telephone: (051) 875 441 Fax: (051) 875 449 Email: info@commercialireland.com Web: www.commercialireland.com Main Products/ Refrigeration, Catering, Services: Bar, Supermarket, Air Conditioning and Beer Cooling Systems. Contact: Managing Director: Mary Bowman Sales Director: Damien Hughes

Com-Plas Packaging Address:

Naas Industrial Estate, Naas, Co. Kildare. Telephone: (045) 874 088 Fax: (045) 874 090 Email: sales@complas.ie Web: www.complas.ie Main Products/ Food Pots & Buckets, Services: Food Trays, Lidding Machine and a Wide Range of Packaging Containers. Contact: Managing Director: Patrick Gregory Sales Manager: Philip Nolan

Corcoran Chemicals Ltd Address:

17-22 Parkgate Street, Dublin 8. Telephone: (01) 633 0404 Fax: (01) 679 3521 Email: nora@corcoranchemicals.com Web: www.corcoranchemicals.com

C O M PA N Y L I S T I N G S

F


F

C O M PA N Y L I S T I N G S

Main Products/ Raw materials for use in Services: the food & drink industries. Starch, native, modified, sweetners. Contact: (01) 633 0400

Cross Refrigeration (Irl) Ltd Address:

Nationwide with offices in Armagh, Cork, Dublin and Limerick. Telephone: Armagh: (028) 3752 6090 Cork: (021) 430 2321 Dublin: (01) 451 1915 Limerick: (061) 417 415 Email: info@cross-group.org Web: www.cross-group.org Main Products/ Energy management & all Services: major types of Refrigeration and Air Conditioning systems installed & commissioned. www.crossdirect.ie offers commercial refrigeration, best prices, delivered direct within one week of order! Dedicated Refrigeration and Air Conditioning rental business - check out: www.crosshire.ie

CRS Mobile Cold Storage Ltd Address:

Carnisle, Kildalkey, Co. Meath. Telephone: (046) 943 5000 Fax: (046) 943 5068 Email: enquiry@crs.ie Web: www.crs.ie Main Products/ Increase your on site cold Services: storage capacity: CRS offer a wide range of temperature controlled storage solutions both new and professionally refurbished for rent and purchase. Our products include 1-58 pallet portable cold stores and 10-106kw portable blast freezers. Contact: Managing Director: Paul Tyrrell

O O D

I

R E L A N D

2009/10

Enviroclad Systems Ltd

D

Address:

Diamond Corrugated Address:

12-13 Pennyburn Industrial Estate, Londonderry, Northern Ireland, BT48 OLU. Telephone: (048) 7126 2957 Fax: (048) 7126 7094 Email: mail@diamondcorr.com Web: www.diamondcorr.com Main Products/ Corrugated, multi-point Services: glued, litho-laminated corrugated, folding cartons. Contact: Sales & Marketing Manager: Joanne Beckett

Unit 57B, Hebron Industrial Estate, Hebron Road, Co. Kilkenny. Telephone: (056) 775 2866 Fax: (056) 777 0955 Email: info@enviroclad.com Web: www.enviroclad.com Main Products/ Supply and Fitting of Services: Enviroclad Hygienic Wall and Ceiling Cladding in P.V.C. for the Food Industry. Contact: Director: Liam Moylan Director: Mary Moylan

Dollard Packaging Ltd Address:

Units 6-11, Eklad Park, Malahide Road Industrial Park, Malahide Road, Dublin 17. Telephone: (01) 847 0044 Fax: (01) 847 0614 Email: sales@dollard-packaging.ie Web: www.dollard-packaging.ie Main Products/ Print and Packaging. Services: Contact: Sales Director: David Hilliard

ESB Independent Energy Address:

Tel: Fax: Email: Web: Address:

E

EDME Ltd Address:

EDME House, Mistley, Manningtree, Essex, CO11 1HG. Telephone: (0044) 1206 393 725 Fax: (0044) 1206 396 699 Email: info@edme.com Web: www.edme.com Main Products/ Food ingredient Services: manufacturer. Contact: Sales Director: Sharon Clayton-Bovill

Dublin Office: Woodford Business Park, Santry, Dublin 17. (01) 862 8300 (01) 862 8350 info@esbie.ie www.esbie.ie Belfast Office: 33 Clarendon Dock, Laganside, Belfast BT1 3BG. (028) 9051 1246 (028) 9027 8400 info@esbie.ie www.esbie.co.uk

Tel: Fax: Email: Web: Main Products/ Services: Energy Supplier. Contact: Marketing Manager: John Conlon Commercial Manager: Derek Russell

F

Elopak

Faculty of Food Science and Technology

Address:

Address:

67 Broomhill Road, Tallaght, Dublin 24. Telephone: (01) 452 1111 Fax: (01) 451 3938 Web: www.elopak.com Main Products/ Liquid Packaging, Milk, Services: Soup and Juice Cartons, Packaging Machines. Contact: Derek Nangle

4 4 FOOD IRELAND

University College, Co. Cork. Telephone: (021) 490 3527 Fax: (021) 427 6398 Email: dean.food@ucc.ie Web: http://food.ucc.ie Main Products/ Education, research, Services: continuing education & training.


O O D

I

R E L A N D

2009/10

Farwood Flyscreens

Fischbein-Saxon

Glanbia plc

Address:

Address:

Address:

Unit 6, Hermes Industrial Estate, Ardmore Park, Dun Laoghaire, Co. Dublin. Telephone: (01) 235 0655 Fax: (01) 235 0688 Email: richardwhelan46@yahoo.com Main Products/ Flyscreens (Pest Control). Services: Contact: Sales Director: Richard Whelan

FÁS - Training and Employment Authority Address:

27-33 Upper Baggot Street, Dublin 1. Telephone: (01) 607 7416 Fax: (01) 607 0618 Email: maurice.walsh@fas.ie Web: www.fas.ie/services_to_ business/food_sector.htm Main Products/ Standards and human Services: resource initiatives for workers in the food & drinks sector. Contact: Manager - Food & Drink Sector: Maurice Walsh

Festo Ltd

Alexandra Business Centre, 274 Alma Road, Enfield, Middlesex, EN3 7RS, England. Telephone: (0044) 8701 609 314 Fax: (0044) 8701 609 315 Email: sales@fischbein-saxon.co.uk Web: www.fischbein.com Main Products/ Sealing equipment, Services: sewing systems, conveyors, consumable. Contact: General Manager: R. Bontemps UK Sales Manager: Y. Mannekens

Flogas Ireland Ltd Address:

Dublin Road, Drogheda, Co. Louth. Telephone: (041) 983 1041 Fax: (041) 983 4652 Email: info@flogas.ie Web: www.flogas.ie Main Products/ Natural Gas Supplier, Services: LP Gas Supplier. Contact: Managing Director: Richard Martin Sales Manager: John O’Donoghue

Address:

Head Office: Unit 5, Sandyford Park, Sandyford Industrial Estate, Dublin 18. Telephone: (01) 295 4955 Fax: (01) 295 5680 Email: sales_ie@festo.com Web: www.festo.com/ie Main Products/ Pneumatic, electrical & Services: sensoric equipment. Industrial automation training. Engineering service. Complete system solutions.

Filling Machines & Equipment

Food Safety Interactive Training Address:

Tievebane, Burnfoot, Co. Donegal. Telephone: (086) 827 9352 Email: info@foodsafetycd.com Web: www.foodsafetycd.com Main Products/ Basic Food Safety Training Services: on an interactive CD Rom in English, Polish & Latvian. Contact: Managing Director: Cathy Hannigan Sales: Ann Robinson

G

Address:

Unit A1, Ballymount Drive Industrial Estate, Walkinstown, Dublin 12. Telephone: (01) 456 5311 Fax: (01) 456 5313 Email: fme2@eircom.net Web: www.fillingmachinesandequipment.ie Main Products/ Manufacturer/sales Services: liquid & cream filling machines/depositors/ pumps/potato mashing machines. Contact: Brian McNally

Glanbia House, Co. Kilkenny. Telephone: (056) 777 2200 Fax: (056) 777 2222 Email: corporatecomms@glanbia.ie Web: www.glanbia.com Main Products/ Cheese, nutritional Services: dairy ingredients, milk & fresh dairy products. Contact: Group Managing Director: John Moloney

Georgia Pacific Ireland Ltd Address:

McKee Avenue, Finglas, Dublin 11. Telephone: (01) 806 8100 Fax: (01) 806 8183 Email: info@lotusprofessional.ie Web: www.lotusprofessional.ie Main Products/ Disposable paper Services: products: wiping, washroom, kitchen & dispensing systems. Contact: AFH Sales Director: Liam Smith 4 5 FOOD IRELAND

Global Trust Certification Ltd Address:

Rivercourt Business Centre, Riverlane, Dundalk, Co. Louth. Telephone: (042) 932 0912 Fax: (042) 938 6864 Email: bernadettevernon@GTcert.com Web: www.GTcert.com www.brc-ireland.com Main Products/ Food quality certification/ Services: BRC certification / organic certification / eco certification. Contact: Information Manager: Bernadette Vernon

Goliath Packaging Systems Ltd Address:

Beechwood, Nenagh, Co. Tipperary. Telephone: (067) 37893 Fax: (067) 34794 Email: info@goliath.ie Web: www.goliath.ie Main Products/ End of line packaging Services: equipment & materials handling systems. Contact: Director: George O’Leary

Grabher Indosa AG Address:

P.O Box 447 CH 9434 AU (SG) Switzerland. Telephone: (0041) 7174 75757 Fax: (0041) 7174 75747 Email: info@indosa.com Web: www.indosa.com Main Products/ Can filling and seaming Services: machines & lines.

C O M PA N Y L I S T I N G S

F


F

O O D

I

C O M PA N Y L I S T I N G S

Griffin Foods Ltd Address:

Unit 1B, Plato Business Park, Damastown, Dublin 15. Telephone: (01) 826 3960 Fax: (01) 826 3965 Email: info@griffinfoods.net Web: www.griffinfoods.net Main Products/ Food ingredients, dairy Services: products, flavours, fillings, nuts, colours. Contact: Managing Director: John Griffin Sales Director: Gerry Lynch

GS1 Ireland Address:

The Nutley Building, Merrion Road, Dublin 4. Telephone: (01) 208 0660 Fax: (01) 208 0670 Email: info@gs1ie.org Web: www.gs1ie.org Main Products/ Global supply chain Services: standards, bar code numbering, RFID, eCommerce, Datapool. Contact: GS1 Ireland Helpdesk

H

Healy Group Address:

HCL House, Second Avenue, Cookstown Industrial Estate, Tallaght, Dublin 24. Telephone: (01) 404 9200 Fax: (01) 404 9201 Email: ghealy@healy-group.ie Web: www.healy-group.com Main Products/ Healys Chemical Group, Services: founded in 1985, is the market leader in clean label & natural ingredients to the food and drinks markets in Ireland. Actively involved in the chemical, pharmaceutical, tabletting, health care, and mining sectors. Offices located in Cookstown Industrial Estate, Dublin with fully approved ISO 9001 state of the art warehouse, storage (including chilled

Contact:

R E L A N D

2009/10

area) and handling facilities. Healy Group UK has offices & warehouses in Leicestershire, servicing the UK market. A key strength of the group is the ability to source an extensive range of products from various supply sources worldwide. Products offered: Caramels colours, aromatics, pastes. Rice Starches and Syrups. Gelatin and Hydrolzed Collagen. Aromild Plus, yeast extract and flavourings, replacement for MSG. Potato and Pea Starches, potato flakes, granules. Starch, Glucose, Proteins. Glucose powders and syrups, maltodextrins. Potassium Sorbate / Sorbic Acid. Xanthan Gum, Guar Gum, Carrageenan, emulsifiers & stabilisers. Naturally brewed Soy Sauce, Teryaki Sauce, M&S approved, Apple fiber and Oat fiber. Brands: Emsland, Nigay, BeneoRemy, Stringer Flavour, Rousselot, Kohjin, Cesalpinia, Palsgaard, Kikkoman, Microfood. CEO: Maurice Healy Sales Manager: Gareth Healy Technical Director: Pat McDonagh

Contact:

Heterochem (Dist.) Ltd Address:

Unit 49, Baldoyle Industrial Estate, Dublin 13. Telephone: (01) 839 3127 Fax: (01) 832 5746 Email: info@heterochem.ie Web: www.heterochem.com Main Products/ Flavourings, colours, Services: preservatives & other food additives for the food industry. Contact: Sales Manager: Ken Cunningham Accounts Manager: Noelle Shannon

I

IMCD Address:

Address:

Ballyowen Lane, Lucan, Co. Dublin. Telephone: (01) 626 1458 Fax: (01) 623 3575 Email: fehin@heaveytechnology.com Web: www.heaveytechnology.com Main Products/ Scanning traceability Services: (food tracking), weigh labelling, van sales, thermal printers, barcode 4 6 FOOD IRELAND

Lakedrive, Citywest, Dublin 24. (01) 469 3153 (01) 469 3156 brenda.collins@imcd.co.uk www.imcdgroup.com

Telephone: Fax: Email: Web: Main Products/ Services: Food ingredients. Contact: Technical Sales: Brenda Collins

Industrial Packaging Ltd Address:

Heavey Technology

scanners/terminals, warehouse management, label print & apply solutions, up to 8 colour labels & ribbon, support & maintenance of all of the above. Fehin McDwyer 086 222 6870

Killarney Road, Bray, Co.Wicklow. Telephone: (01) 286 4010 Fax: (01) 286 4015 Email: sales@industrialpackaging.ie Web: www.industrialpackaging.ie Main Products/ Containers, fibre drums, Services: intermediate bulk containers (fibre & plastic), all-plastic silos & materials handling products. Contact: Sales Reps.


O O D

I

R E L A N D

2009/10

Ingredient Solutions Ltd Address:

Boherbue, Mallow, Co. Cork. Telephone: (029) 76981 Fax: (029) 76984 Email: gary@ingredientsolutions.net Web: www.ingredientsolutions.net Main Products/ Supplier of quality cheese Services: ingredients to the foodservice and manufacturing sectors of the food industry. Contact: Sales Manager: Gary Davies

Innovate Food Technology Address:

1st Floor, 39 Dame Street, Dublin 2. (01) 887 0112 (01) 677 0686 careers@foodjobs.ie www.foodjobs.ie

Telephone: Fax: Email: Web: Main Products/ Services: Recruitment. Contact: Recruitment Manager: Ann Nooney

Innovia Films Ltd Address:

R & D Centre, West Road, Wigton, Cumbria, UK, CA7 9XX. Telephone: (0044) 1697 342 281 Fax: (0044) 1697 341 452 Email: filmsinfo@innoviafilms.com Web: www.innoviafilms.com Main Products/ Speciality BOPP and Services: Cellulose Films for Packaging and Labels. Contact: Sales & Marketing Manager - Packaging UKIN & EEMA: Paul McKeown

Irish Association of Seafood Companies (IASC) Address:

70B Clanbrassil Street. Dundalk, Co. Louth. Telephone: (042) 938 6977 Fax: (042) 939 5566 Email: martina@iasc.ie Web: www.iasc.ie Main Products/ Development association Services: representing independent seafood processors and retailers. Contact: Martina Clarke

Irish Dairy Board Address:

Grattan House, Mount Street Lower, Dublin 2. Telephone: (01) 661 9599 Fax: (01) 661 2778 Email: idb@idb.ie Web: www.idb.ie www.kerrygold.com Main Products/ Export & marketing Services: of dairy products. Contact: Media & PR Co-ordinator: M. C. Moran

Contact:

quality & hygiene. Our comprehensive range of profiles cover all sectors of the food industry and are at the cutting edge of packaging development. We are constantly introducing new products to meet both market needs and individual customer specific requirements. Eoin McConnon

J

JBT FoodTech Address:

Irish Exporters Association Address:

28 Merrion Square, Dublin 2. Telephone: (01) 661 2182 Fax: (01) 661 2315 Email: iea@irishexporters.ie Web: www.irishexporters.ie Main Products/ Food and Drink Export Services: Ireland, a division of the IEA, provides assistance to Irish food and drink companies in the home market and to increase their sales abroad. Contact: Godfrey Lydon

Irish National Accreditation Board Address:

Wilton Park House, Wilton Place, Dublin 2. (01) 607 3003 inab@inab.ie www.inab.ie

Telephone: Email: Web:

East Mains Industrial Estate, Broxburn West Lothian, EH52 5NP. Telephone: (0044) 1506 857 112 Fax: (0044) 1506 852 232 Email: foodtech.uk@jbtc.com Web: www.jbtfoodtech.com Main Products/ Freezers, chillers, Services: proofers, refrigeration, ovens, fryers, coating equipment. Contact: Barry Jackson

Johnsen & Jorgensen Address:

Unit 8, Westpoint Enterprise Park, Clarence Avenue, Trafford Park, Manchester, M17 1QS. Telephone: (0044) 1618 741 930 Fax: (0044) 1618 741 931 Email: sales@jjpack.com Web: www.jjpack.com Main Products/ Glass, plastic bottles Services: and jars. Contact: Sales Manager: Matthew Scott

Irish Papers

Johnston Logistics Ltd

Address:

Address:

74 Baldoyle Industrial Estate, Dublin 13. Telephone: (01) 839 3144 Fax: (01) 839 3057 Email: info@irishpapers.ie Web: www.irishpapers.com Main Products/ Irish Papers is a leading Services: supplier of aluminium foil containers, pizza boxes, paper carrier bags and food packaging products in Europe with a reputation for innovation, 4 7 FOOD IRELAND

Blackchurch Business Park, Rathcoole, Co. Dublin. (01) 401 3333 (01) 458 8015 info@jol.ie www.johnstonlogistics.ie

Telephone: Fax: Email: Web: Main Products/ Services: Warehousing & Logistics. Contact: Business Development: Deirdre McGuirk

C O M PA N Y L I S T I N G S

F


F

C O M PA N Y L I S T I N G S

K

O O D

I

Contact:

R E L A N D

2009/10

Managing Director: David Kellett

Kiernan’s Food Ingredients Ltd Address:

Kantar Retail Address:

54 Torcaill, Portmarnock, Co. Dublin. Telephone: (01) 845 9920 Fax: (01) 845 9920 Email: Ken.McIntyre-Barn@Kantarretail.ie Web: www.kantarretail.com Main Products/ Kantar Retail is an Services: insight and consulting business that works with clients to transform the purchase behaviour of consumers, shoppers & retailers. By combining the resources of MVI, Glendinning, Cannondale, Retail Forward and Red Dot Square, we can solve client issues from strategic to tactical and provide organisations with the skills and capabilities to act. We offer clients better integral alignment and project efficiency, from insight through strategy to activation, and across marketing through category to sales. The end product is enhanced revenue and profitability for our clients. Contact: Managing Director: Ken McIntyre-Barn

David Kellett & Partners Ltd Address:

Maple Court, Wormbridge House, Wormbridge, Hereford, HR2 9DH. Telephone: (0044) 1981 570 611 Fax: (0044) 1981 570 599 Email: davidkellett@davidkellett.co.uk Main Products/ Dairy Engineering, Services: Systems/Membranes, Reverse Osmosis, Ultra Osmosis®, Ultra Filtration and Micro Filtration, Effluent Treatment, Spiral Wound and Plate & Frame, Cheese Maturing Vacuum Pouches

Unit 8 Steadfast Industrial Estate, Carrickmacros, Co. Monaghan. Telephone: (042) 966 2096 Fax: (042) 966 3954 Email: info@kiernans.ie Web: www.kiernans.ie Main Products/ Seasoning, sauces, Services: marinades, cures & packaging. Contact: Joint Managing Director: Martin Kiernan Joint Managing Director: Nuala Kiernan Contact: James Kiernan

Krones UK Ltd Address:

Westregen House, Great Bank Road, Wingates Industrial Park, Westhoughton, Bolton, Lancashire, BL5 3XB. Telephone: (0044) 1942 845 000 Fax: (0044) 1942 845 091 Email: sales@krones.co.uk Web: www.krones.com Main Products/ Process, packaging and Services: bottling machinery suppliers, also offering warehousing & logistics solutions. Contact: Managing Director: Andrew Wilson Sales Director: Mark Heath

Kilfera Foods Ltd Address:

Purcellsinch, Co. Kilkenny. Telephone: (056) 776 4044 Fax: (056) 776 4060 Email: kilfera@iol.ie Main Products/ Functional food Services: ingredients. Contact: Managing Director: Paddy O’Neill

Kingspan Controlled Environments Address:

Hangar 1A, Wrights Lane, Burtonwood, Cheshire, WA5 4DB, England. Telephone: (0044) 1925 711 157 Mobile: 086 257 2437 Fax: (0044) 1925 711 158 Email: info@kingspance.com Web: www.kingspance.com Main Products/ Manufacturers of PIR Services: (Polyisdryanurate) insulated panels for food processing, cold storage & clean room environments. Contact: Consultant: Michael Culhane

Kliklok International Ltd Address:

Western Drive, Hengrove Park Estate, Bristol, BS14 0AY. Telephone: (0044) 1275 836 131 Fax: (0044) 1275 891 754 Email: m.tatum@kliklok-int.com Web: www.kliklok-int.com Main Products/ Packaging equipment/ Services: machinery. Contact: Michelle Tatum 4 8 FOOD IRELAND

L

Label Art Ltd Address:

70-74 Broomhill Road, Tallaght, Dublin 24. Telephone: (01) 451 3555 Fax: (01) 451 0424 Email: gerard.molloy@labelart.ie Web: www.labelart.ie Main Products/ Self-adhesive labels, Services: non-adhesive tags, digital print. Contact: Sales Director: Gerard Molloy

Label One Ltd Address:

44-56 Dargan Crescent, Belfast, BT3 9JP. Telephone: (048) 9077 7444 Fax: (048) 9077 4067 Email: info@labelone.ie Web: www.labelone.ie Main Products/ Self-adhesive labels, Services: extended content leaflet labels. Contact: Sales Manager, ROI: Chris Moore 087 252 3335

Lennox Laboratory Supplies Address:

Telephone: Fax: Email: Web:

JFK Drive, Naas Road, Dublin 12. (01) 455 2201 (01) 450 7906 denis@lennox.ie www.lennox.ie


Main Products/ Leading supplier of Services: laboratory reagents, consumables and instrumentation in Ireland Contact: Product Manager: Denis Coll

O O D

I

R E L A N D

2009/10

M

Manotherm Ltd

Contact:

Address:

Limerick Packaging Address:

Eastlink Business Park, Ballysimon Road, Co. Limerick. Telephone: (061) 400 035 Fax: (061) 400 036 Email: info@lmkpkg.ie Web: www.limerickpackaging.ie Main Products/ Corrugated Boxes, Services: Polythene Bags, Edgeguards, Palletwrap, Strapping, Tapes. Contact: Mike Boland

LINPAC Allibert Address:

Unit 1, Kinsealy Business Park, Kinsealy, Co. Dublin. Telephone: (01) 846 2323 Fax: (01) 846 2522 Email: info@linpac-ireland.com Web: www.linpacallibert.com Main Products/ Plastic Materials Handling Services: Products - Boxes, Bins, Trays, Pallets etc. Contact: Sales Manager, Ireland: Brendan McGarry 087 676 7161

LogoPak International Ltd Address:

Enterprise House, George Cayley Drive, Clifton Moor, York, YO30 4XE. Telephone: (0044) 1904 692 333 Fax: (0044) 1904 690 728 Email: salesonweb@logopak.net Web: www.logopakprintandapply.co.uk Main Products/ Print & Apply Services: Labelling. Contact: General Manager: Wilson Clark

4 Walkinstown Road, Dublin 12. Telephone: (01) 452 2355 Fax: (01) 451 6919 Email: info@manotherm.ie Website: www.manotherm.ie Main Products/ Distributors of Services: controls & instrumentation. Temperature: Thermometers, Controllers, Digital Indicators, Transmitters, Thermocouples, Bestobell Steam Traps, Recorders, Calibrators, Temperature Regulating Valves. Sanitary Valves, Controls and Instrumentation. Process Valves. Pressure: Gauges, Transducers, Switches, Transmitters, Pressure Regulators, Manometers, Calibrators. Flow: Meters, Switches, Control Valves and Regulators, D/P Transmitters. Level: Indicators, Controllers, Transducers, Sight Gauges, Float Switches. Humidity/Moisture: Humidistats, Recorders, Dewpoint and Moisture Contents. Electrical: Relays, Recorders. Counters: Production Counters, Tachometers. Pneumatic: Tubing, Fittings, Regulators, Calibraters, Valves, I/P Converters. Signal Conditioning: Transmitters, Isolaters, Converters, SQR Extractors. 4 9 FOOD IRELAND

Data Acquisition: Data Loggers, Chart Recorders. Flue Gas Analysers. Controls for Clean Rooms: Magnehelic Gauges & Switches. Managing Director: R.V. Gilbert Director & Project Sales Engineer: Robert C. Gilbert Technical Sales Rep: Frank Gallagher

Mason Technology Address:

228 South Circular Road, Dublin 8. Telephone: (01) 453 4422 Fax: (01) 415 4492 Email: pmunds@masontec.ie Website: www.masontechnology.ie Main Products/ Laboratory equipment, Services: industrial weighing and industrial vaccuum. Contact: Paul Munds

Masterlift Ireland Ltd Address:

Units 3-5, Block K, Greenogue Business Park, Grants Road, Rathcoole, Co. Dublin. Branches: Dublin, Galway, Waterford, Sligo. Service Outlets: Limerick, Tipperary, Donegal. Telephone: (01) 458 0190 Callsave: 1850 230 363 Fax: (01) 458 0186 Email: sales@masterlift.ie Web: www.masterlift.ie Main Products: Nissan forklifts, Kalmar heavyduty trucks, Crown warehousing equipment, Narrow Aisle Flexi BP Sideloaders, JCB Teletruk. Services: Forklift sales, lease, 24-hour service, parts, rental long/short term, forklift driver training, health & safety training, manual handling, first aid available nationwide. Contact: Managing Director: Dermot Carroll

C O M PA N Y L I S T I N G S

F


F

O O D

I

C O M PA N Y L I S T I N G S

Contact:

R E L A N D

Chairman: Paul Moody Managing Director: Malcolm Wilkinson

Matcon Group Ltd

Multivac Ireland Ltd

Address:

Address:

Matcon House, London Road, Moreton-In-Marsh, Gloucestershire GL56 OHJ, England. Telephone: (0044) 1608 651 666 Fax: (0044) 1608 651 635 Email: matcon@matconibc.com Web: www.matconibc.com Main Products/ IBC Systems for Services: Materials Handling. Contact: Sales Director: Paul Cooper Business Development Manager: Richard Meheran

2009/10

Unit 7, Fonthill Business Park, Clondalkin, Dublin 22. Telephone: (01) 643 6810 Mobile: 087 283 4067 (Sales) Fax: (01) 630 0826 Email: info@ie.multivac.com Web: www.multivac.com Main Products/ Vacuum Packing, Services: Traysealing, Thermoforming Packaging Machinery and Labelling. Contact: Managing Director: Derek Nugent Sales: Liam Cronin

N

National Food Ingredients Ltd Measom Freer & Co. Ltd Address:

37/41 Chartwell Drive, Wigston, Leicester, LE18 2FL, England. Telephone: (0044) 116 288 1588 Fax: (0044) 116 281 3000 Email: sales@measomfreer.co.uk Web: www.measomfreer.co.uk Main Products/ Measom Freer Services: manufacture and stock quality plastic bottles, custom moulded bottles, dropper caps, scoops, measures, boxes, jars, tubes, fasteners etc, for food use. Services include 3D design, inhouse tool making and screen printing. Contact: Sales Director: Mark Freer Technical Director: Andrew Freer

Moodyâ&#x20AC;&#x2122;s Address:

Telephone: Fax: Email: Web:

West Carr Road Industrial Estate, Retford, Nottinghamshire, DN22 75N, UK. (0044) 1777 701 141 (0044) 1777 709 086 info@moodyplc.com www.moodyplc.com

Address:

Dock Road, Co. Limerick. Telephone: (061) 314 498 Fax: (061) 310 878 Email: info@nationalfood.ie Web: www.nationalfood.ie Main Products/ Seasonings, marinades Services: rusks, coatings, phosphates, proteins, starches, colours. Contact: Sales Director: Patsy Bourke 086 256 6263 pbourke@nationalfood.ie Moira Daly 086 254 2459 m.daly@nationalfood.ie Richard West 086 258 0433 rwest@blakesingredients.com

National Standards Authority of Ireland (NSAI) Address:

1 Swift Square, Northwood, Santry, Dublin 9. Telephone: (01) 807 3800 Fax: (061) 332 982 Email: info@nsai.ie Web: www.nsai.ie Main Products/ Certification and Services: inspection services to national & international product & management 5 0 FOOD IRELAND

Contact:

system standards including ISO 22000, ISO 9001, OHSAS and BRC Global Food Standard. Vincent Delaney (061) 332 882 CEO: Maurice Buckley

National Standards Authority of Ireland (NSAI) Training Section Address:

1 Swift Square, Northwood, Santry, Dublin 9. Telephone: (01) 807 3993 Fax: (01) 807 3844 Email: training@nsai.ie patricia.whelan@nsai.ie Web: www.nsai.ie Main Products/ NSAI offers public Services: courses to help individuals gain the skills that they require to operate management systems effectively. The range of courses offered reflects the wide range of certification services offered by NSAI. Contact: Patricia Whelan

NITL Address:

Dept. of Engineering, Dublin Institute of Technology, Bolton Street, Dublin 1. (01) 402 4023 (01) 402 3991 AdeLinares@dit.ie www.nitl.ie

Telephone: Fax: Email: Web: Main Products/ Services: Learning & Research. Contact: Antonio de Linares

Norman Lauder Ltd Address:

Telephone: Fax: Email: Web:

2A Richview Office Park, Clonskeagh Road, Dublin 14. (01) 260 0442 (01) 260 0675 sales@nll.ie www.nll.ie


Main Products/ Food ingredients. Services: Emulsifier & hydrocolloids, nutrient premixes, Inulin/FOS dietary fibre, Omega 3, Amimo Acids, protein milk, plant extracts, bioactives, food minerals, IBC - intermediate bulk containers. Contact: Sales Manager: Susan Ellis

O O D

I

R E L A N D

2009/10

O’Brien Ingredients

Olivo UK Ltd

Address:

Address:

O’Brien House, Magna Drive, Magna Business Park, Dublin 24. Telephone: (01) 469 1400 Fax: (01) 469 1360 Email: pobrien@ obrien-ingredients.ie Web: www.obrien-ingredients.ie Main Products/ Flavours, colours, Services: vitamins, juices, citrates, bakery ingredients. Contact: Managing Director: Paul O’Brien

T.S. O’Connor & Son Ltd NPP Group Ltd

Address:

Address:

Unit 509 Mitchelstown Road, Northwest Business Park, Ballycoolin, Dublin 15. Telephone: (01) 880 9299 Fax: (01) 880 9298 Email: sales@npp.ie Web: www.npp.ie Main Products/ Flexible plastic Services: packaging distributors. Contact: Commercial Director: Ken Martin

Telephone: Fax: Email: Web: MainProducts/ Services: Contact:

Unit C, 67 Heather Road, Sandyford Industrial Estate, Dublin 18. (01) 295 5696 (01) 295 5741 andrew@tsoconnor.ie www.bags.ie Self Adhesive Tapes, Labels & Flexible Packaging. Sales Manager: Andrew Haughton

Address:

Innishannon, Co. Cork. Telephone: (021) 477 5522 Fax: (021) 477 5449 Email: ursula.lecane@nutritionsupplies.ie Web: www.nutritionsupplies.ie Main Products/ Vitamin & Nutrient Services: Precision Premixes. Contact: Managing Director: Dr. Frank Cremin Technical Director: Ursula Lecane

2004 Orchard Avenue, City West Business Campus, Naas Road, Dublin 24. Telephone: (01) 413 6200 Fax: (01) 457 0219 Email: info@odenberg.ie Web: www.odenberg.ie Main Products/ Robotics, mechanical Services: handling systems. Contact: Business Unit Manager: James J. Deane

O

Obeeco Ltd Address:

Annaville Avenue, Blackrock, Co. Dublin. Telephone: (01) 278 2323 Fax: (01) 278 2374 Email: sales@obeeco.ie Web: www.obeeco.ie Main Products/ Packaging machinery, Services: materials, thermal print solutions. Contact: Director: Richard Burke Director: Olive Walker

Omega P.C.S. Address:

7 Lime Tree Avenue, Termon Abbey, Drogheda, Co. Louth. Telephone: (01) 836 7535 Fax: (041) 984 4835 Email: rose@omegapcs.ie Web: www.omegapcs.ie Main Products/ Pest Control, EFKs Services: Service and Supply. Contact: Partner: Rose Walsh Michael Walsh

P

The Packaging Centre Ltd Odenberg Engineering Ltd Address:

Nutrition Supplies

89 The Ashway, Brixworth, Northampton, NN6 9UZ. Telephone: (0044) 1952 408 070 Fax: (0044) 1952 881 051 Email: bg@olivo.eu Web: www.olivo.fr Main Products/ Insulated/refrigerated Services: portable containers. Contact: Bill Gilmour

Odlums Ltd Address:

Merrywell Industrial Estate, Ballymount, Dublin 12. Telephone: (01) 405 1500 Fax: (01) 460 1336 Email: info@odlums.ie Web: www.odlums.ie Main Products/ Flour, mixes, heat Services: modified flour, oat products. Contact: Gavin King 5 1 FOOD IRELAND

Address:

Fox & Geese House, Naas Road, Dublin 22. Telephone: (01) 450 8759 Fax: (01) 450 7567 Email: sales@thepackagingcentre.ie Web: www.thepackagingcentre.ie Main Products/ Glass, paper and plastic Services: packaging. Contact: Clodagh McDevitt

Packex Industries Ltd Address:

Unit 1, Village Mills Business Park, Rathnew, Co. Wicklow. Telephone: (0404) 69 851 Fax: (0404) 69 861 Email: sales@packex.ie Main Products/ High quality Services: flexible packaging. Contact: Ivan Cruise

P.C. Packaging Ltd Address:

Telephone: Fax: Email: Web:

Derrynane House, Eadestown, Naas, Co. Kildare. (045) 883 510 (045) 880 934 philip@pcpackaging.ie www.pcpackaging.ie

C O M PA N Y L I S T I N G S

F


F

C O M PA N Y L I S T I N G S

Main Products/ Packaging machinery/ Services: shrink films, flexible packaging, Belca range of shrink wrappers, Ilapak flow wrapping, Sovereign labelling systems, Sick sensors.

Pegler & Louden Address:

White Heather Industrial Estate, 301 South Circular Road, Dublin 8. South Link Park, Ballycurreen Road, Grange, Co. Cork. Telephone: (01) 416 5170 (01) 416 5175 (021) 497 7128 Fax: (021) 491 5213 Main Products/ Industrial valves and Services: actuators. Contact: Sales Director: Pat Kelly Office Manager (Cork): Pat Oâ&#x20AC;&#x2122;Brien

Persona Design Consultants Ltd Address:

Persona House, 21 Carrickbrack Lawn, Sutton, Dublin 13. Telephone: (01) 832 2724 087 255 2184 Fax: (01) 839 3102 Email: info@personadesign.ie Web: www.personadesign.ie Main Products/ Services: Services: Award winning graphic design consultants who specialise in the creation and strategic management of brand development and packaging design. Persona Design helps their clients grow and maintain their brands through fresh creativity and strategic thinking which adds value to their products or services ensuring they sustain long term competitive advantage. Expertise: Strategic brand development, packaging design, brand auditing and appraisal consulting, brand

O O D

I

R E L A N D

2009/10

relaunch strategy, corporate and consumer brand identity, new product development, name origination, collateral and literature systems, vehicle livery, POS, project management, print management. Established: 1993. Agency Type: Award winning graphic design consultants. Clients: Services supplied to companies both on the national and international markets (available on request). Contact: Lorraine Carter, Adv. Dip. Des. Dit., IDI, ICAD

Pharmafoods Ltd Address:

Lower Waterford Road, Carrickbeg, Carrick-on-Suir, Co. Tipperary. Telephone: (051) 645 066/645 084 Fax: (051) 645 033 Email: info@pharmafoods.net Web: www.pharmafoods.net Main Products/ Bilwinco Multihead Services: Weighers, Mondini Tray Sealers Vacuum and Gas, Limitech Liquid Processing Equipment, Rovema Vertical Form Fill Sealers, Cartoning, Bag In Box, Abtech Premade Pouch Production for Tuna in Foil. Contact: Dermot Brett 086 259 0667 Don Malanowski 086 389 1567

PK Chemicals Ltd Address:

Unit 23, Sandyford Office Park, Blackthorn Avenue, Sandyford Industrial Estate, Foxrock, Dublin 18. Telephone: (01) 295 6977 Fax: (01) 295 8338 Email: info@pkchemicals.com Main Products/ Food Ingredients, Services: Flavours and Colours. Contact: Technical Sales Manager: Graeme Locke

5 2 FOOD IRELAND

Purac biochem Address:

PO Box 21, Arkelsedijk 46, 4200AA Gorinchem, The Netherlands. Telephone: (0044) 1212 361 828 Fax: (0031) 183 695 600 Email: puk@purac.com Web: www.purac.com Main Products/ Natural lactic acid, Services: lactates and gluconates. Contact: Sales Manager: Gareth Jones

Puratos Crest Foods Ltd Address:

70 - 71 Dunboyne Business Park, Dunboyne, Co. Meath. Telephone: (01) 825 5505 Fax: (01) 825 5506 Email: info_ireland@puratos.com Web: www.puratos.com Main Products/ Bakery, patisserie and Services: chocolate ingredients. Belcolade Belgian chocolate, Puratos bakery & patisserie products, PatisFrance premium patisserie ingredients. Contact: General Manager: Sean McDaid

Q

Q-Lab Ltd Address:

PO Box 27, Kerlogue Industrial Estate, Drinagh, Co. Wexford. Telephone: (053) 914 5600 Fax: (053) 918 4575 Email: info@qlab.ie Web: www.qlab.ie Main Products/ Microbiological & Services: chemical analysis of food, water & environmental samples. Contact: Managing Director: Anne-Marie Kelly Financial Controller: Aidan Byrne Chem. Lab. Manager: Peter Oâ&#x20AC;&#x2122;Byrne Micro. Lab Manager Brian Healy Business Development Manager: Liz Morris


O O D

I

R E L A N D

Quinn Packaging Ltd

pork, beef and poultry flavour, texture and yield enhancement. Red Arrow: Smoke & grill systems. Raps: Marinades & sauces. Cosucra: Allergan free starch and fibre products. DMV: Milk & whey protein ingredients. Ocean Nutrition: Omega 3. Customer specific manufacturing with technical application advice & support. CEO: Kieran Fox MD: Liam Egan

Address:

Rathkeelan, Ballyconnell, Co. Cavan. Telephone: (049) 952 5650 Fax: (049) 952 5651 Email: info@quinn-packaging.com Web: www.quinn-packaging.com Main Products/ Thermoform, print Services: & IML containers for the dairy industry, meat & poultry trays, blown film, shrink & stretch hoods, strapping. Contact: General Manager: Colin Donnelly Sales Manager: John Larkin

2009/10

Services:

Contact:

R

Record Packaging Systems Ltd Address:

Unit 41, Stretford Motorway Estate, Manchester M32 0ZH. Telephone: (0044) 1618 643 971 Fax: (0044) 1618 641 390 Email: sales@recordpackaging.com Web: www.recordpackaging.com Main Products/ Flowrappers, shrink Services: wrappers, L-sealers, vacuum packers, tray sealers, vertical form fill and seal. Contact: Managing Director: Edward Murphy

Redbrook Ingredient Services Ltd Address:

Unit 1, Plato Business Park, Damastown, Mulhuddart, Dublin 15. Branches: Head Office Dublin: Redbrook Ingredient Services Athlone: Redbrook Blentech Ltd Daventry, UK: Unique Ingredients Ltd Daventry, UK: Dandy Lion Ltd (Honey/Maple) Telephone: (01) 860 4900 (0044) 1327 876 200 Fax: (01) 860 4950 (0044) 1327 312 712 Email: info@redbrook.ie Web: www.redbrookingredients.com Main Products: Custom manufactured powder blends and liquid ‘Impact’ flavours, seasonings, spices and herbs. Injection brincs for

Relay - Research For The Food Industry

Contact:

CEO: Andrew Hetherington Membership Services Manager: Declan Martin

S

Sartorius Mechatronics Address:

Unit 41, The Business Centre, Stadium Business Park, Ballycoolin Road, Dublin 11. Telephone: (01) 808 9050 Fax: (01) 808 9388 Email: info.ireland@sartorius.com Web: www.sartorius.ie Main Products/ Industrial & laboratory Services: weighing equipment, checkweighers, x-ray & metal detection. Contact: Mechatronics Manager Ireland (Designate): Nick Parsons Service Manager: Robert Green

Address:

Teagasc, Moorepark Food Research Centre, Fermoy, Co. Cork. Telephone: (025) 42 247/321 Fax: (025) 42 293 Email: info@relay.teagasc.ie Web: www.relayresearch.ie Main Products/ Communication of Services: Food Research Information. Contact: Derbhile Timon Breda Mulvihill

Scientific & Chemical Supplies Ltd Address:

Eastlink House, Eastlink Business Park, Carrigtwohill, Co. Cork. (021) 488 2388 (021) 488 2389 cork@scichem.com www.scichem.com

Telephone: Fax: Email: Web: Main Products/ Services: Laboratory supplies. Contact: John Molloy

Rentokil Pest Control Nationwide Coverage Telephone: 1890 869 869 Fax: (045) 852 890 Email: pestcontrolinfo@rentokil.ie Web: www.rentokil.ie Main Products/ Suppliers of Services: Pest Control to ISO 9001:2000 specification. Contact: Pest Control: Michael O’Mahoney

Repak Ltd Address:

Telephone: Fax: Email: Web:

Red Cow Interchange Estate, 1 Ballymount Road, Clondalkin, Dublin 22. (01) 467 0190 (01) 403 0196 info@repak.ie www.repak.ie 5 3 FOOD IRELAND

Sealed Air Ltd Address:

Unit 400, Beech Road, Western Industrial Estate, Dublin 12. Telephone: (01) 456 5303 Fax: (01) 450 6208 Email: cryovac.ukmkt@sealedair.com Web: www.sealedair-emea.com Main Products/ Packaging solutions and Services: equipment for all food markets - meat/fish/ dairy/produce/bakery and ready meals. Product offering includes films, barrier bags, rigid trays, punnets and pots. Contact: Bill Twamley

C O M PA N Y L I S T I N G S

F


F

O O D

I

R E L A N D

2009/10

C O M PA N Y L I S T I N G S

Security Pak Ltd

SNA Associates

Address:

Address:

5 Portside Business Centre, East Wall Road, Dublin 3. Telephone: (01) 855 2377 Fax: (01) 836 5391 Email: john@securitypak.ie Web: www.securitypak.ie Main Products/ Suppliers of packaging Services: machinery and materials. Contact: Director: John Martin

SGS Ireland Ltd Address:

Lakedrive 3026, Citywest Business Campus, Naas Road, Dublin 24. Telephone: (01) 295 0654 Fax: (01) 295 0816 Email: fiona.o’brien@sgs.com Web: www.ie.sgs.com Main Products/ SGS can offer Services: certification for ISO 22000, BRC Global Food Standard Issue 4, BRC Packaging Standard (IOP), BRC Transport Standard, GMP B2 & B3, IFIS International Feed, European Code of Good Trading Practice - Coceral, Store Inspections, 2nd Party Audits and Food Safety Training e.g. bespoke HACCP, ISO 22000 (1 Day Foundation & 2 Day Internal Auditor Training Courses & Also 5 Day Lead Auditor Training) and Also BRC Training. In addition to offering certification against ISO 9001, ISO 14001 and OHSAS 18001. Contact: Fiona O’Brien

Shaw Scientific Ltd Address:

Greenhills Industrial Estate, Walkinstown, Dublin 12. Telephone: (01) 450 4077 Fax: (01) 450 4328 Email: seamus@shawscientific.com Web: www.shawscientific.com Main Products/ Laboratory Equipment Services: Distributor. Contact : Managing Director: Derry Shaw General Manager: Seamus Amond

Sidaplax - Plastic Suppliers Inc. Address:

7 Harrowden Road, Brackmills, Northampton, NN4 7EB. Telephone: (0044) 1604 766 699 Fax: (0044) 1604 766 768 Email: barnard@sidaplax.co.uk Web: www.earthfirstpla.com Main Products/ Converter/Distributor Services: of Plastic Films & Biopolymers. Contact: General Manager: Colin Barnard

Silverson Machines Ltd

Unit 2, West Stockwith Business Park, Misterton, Nr Doncaster, DN10 4ES. Telephone: (0044) 1924 248 686 Fax: (0044) 1924 248 687 Email: info@snaassociates.co.uk Web: www.snaassociates.co.uk Main Products/ Supply & purchaser of Services: quality food processing machinery, anything from a metal detector to a spiral freezer to a complete turn key factory. Contact: Managing Director: Steven N. Abraham

Address:

Waterside, Chesham, Buckinghamshire, HP5 1PQ, UK. Telephone: (0044) 1494 786 331 Fax: (0044) 1494 791 452 Email: sales@silverson.co.uk Web: www.silverson.com Main Products/ High shear mixers for Services: laboratory or production scale batch or in-line mixers & powder/liquid mixing systems.

Sustainable Energy Ireland Address:

Telephone: Fax: Email: Web: Contact:

Wilton Park House, Wilton Place, Dublin 2. (01) 808 2100 (01) 808 2002 info@sei.ie www.sei.ie Head, Energy Demand Management: Kevin O’Rourke Declan Healey

T

Smurfit Kappa Ireland

Teagasc Moorepark Food Research Centre

Address:

Address:

Ballymount Road, Walkinstown, Dublin 12. Telephone: (01) 409 0000 Fax: (01) 456 4509 Email: info@smurfitkappa.ie Web: www.smurfitkappa.ie www.skpackaging.ie www.smurfitkappadirect.ie Main Products/ Ireland’s leading Services: manufacturer of packaging and point of purchase displays, with a wide product range to suit the needs of the food industry. Standard packaging & promotional products can now be bought on-line via our webshop at www.smurfitkappadirect.ie Contact: Marketing Manager: Daragh Wall 5 4 FOOD IRELAND

Moorepark, Fermoy, Co. Cork Telephone: (025) 42 222 Fax: (025) 42 340 Email: eileen.lehane@teagasc.ie Web: www.teagasc.ie Main Products/ R&D on dairy products, Services: functional foods and food Ingredients. Pilot processing plant facilities, analytical services. Contact: Centre Director: Liam Donnelly Manager, Moorepark Technology Ltd: Sean Tuohy


O O D

I

R E L A N D

2009/10

Teagasc Ashtown Food Research Centre

Shell Lubricants Master Distributor

Address:

Ashtown, Dublin 15. Telephone: (01) 805 9500 Fax: (01) 805 9550 Email: pat.daly@teagasc.ie Web: www.teagasc.ie Main Products/ Training, consultancy, Services: innovation & new product development, research, food safety HACCP, quality, hygiene, specialist testing & analysis. Contact: Head of Centre: Declan Troy Head of Food Training and Technical Services: Pat Daly

Teknomek Industries Ltd Address:

Brunel Way, Sweetbriar Industrial Estate, Norwich, Norfolk, England NR3 2BD. Telephone: 0044 1603 788 833 Fax: 0044 1603 418 380 Email: mail@teknomek.co.uk Web: www.teknomek.co.uk Main Products/ Stainless steel equipment Services: manufacturers & fabricators. Contact: General Manager: Anne Ferris-Jones

Thorntons Recycling Ltd Address:

Unit S3B Henry Road, Parkwest Business Park, Dublin 12. Tel: (01) 623 5133 Fax: (01) 623 5131 Email: info@thorntons-recycling.ie Web: www.thorntons-recycling.ie Main Products/ Thorntons Recycling offer Services: industry specific waste and recycling solutions in compliance with Government legislation. Our offer is based on delivering efficient and economic services and exceeding our customers’ expectations. Contact: Commercial Sales Manager: John Staunton

Topaz Energy Ltd Address:

Topaz House, Beech Hill, Clonskeagh, Dublin 4. Telephone: (01) 202 8888 Head Office: (01) 202 8823 Mobile: 086 678 3928 Fax: (01) 283 8318 Email: jack.condon@topazenergy.ie Web: www.topazenergy.ie Main Products/ Food Grade Lubricants Services: Shell Cassida, Shell Ondina. Food Grade Lubricants - An Outstanding Range of Fully Synthetic Lubricants for Virtually Every Application Within the Food Industry. Contact Technical Manager: Jack Condon

Toyota Material Handling Ireland Address:

Killeen Road, Dublin 12. Telephone: (01) 419 0200 Fax: (01) 419 0325 Email: materialhandling@toyota.ie Web: www.toyota-forklifts.ie Main Products/ Toyota forklifts and Services: warehouse equipment. diesel/LPG and electric forklifts, powerpallet trucks, stackers etc. Contact: Managing Director: Terry O’Reilly

Transtock Warehousing & Cold Storage Ltd Address:

Christendom, Ferrybank, Co. Waterford. Tel: (051) 832 411 Fax: (051) 832 666 Email: info@trans-stock.com Web: www.trans-stock.com Main Products/ Warehousing and frozen Services: and chilled cold storage, logistics. Contact: Managing Director: Colm Browne

5 5 FOOD IRELAND

Treatment Systems Ltd Address:

Canice’s Court, Dean Street, Co. Kilkenny. Telephone: (056) 776 3932 Fax: (056) 776 3933 Email: sales@treatmentsystems.ie Web: www.treatmentsystems.ie Main Products/ Water & Waste Services: Water Design and Engineering. Contact: Seamus Crickley Henk van der Puil Tim Vierhout

U

UCD (Agri-Food) Address:

Agri-Food, Human Nutrition, Veterinary Medicine & Environmental Sciences, UCD, Belfield, Dublin 4. Undergraduate UCD Agricultural Programmes: Science and Veterinary Medicine Programme Office UCD Agriculture and Food Science Centre Tel: (01) 716 7194 Email: agandvet@ucd.ie Web: www.ucd.ie/agandvet Postgraduate UCD School of Programmes: Agriculture, Food Science and Veterinary Medicine UCD Veterinary Sciences Centre Tel: (01) 716 6100 Email: agfoodvet@ucd.ie Web: www.ucd.ie/agfoodvet School of Biology & Environmental Sciences: UCD Science Education and Research Centre (West) Tel: (01) 01 716 2243 Email: BiolandEnv@ucd.ie Web: www.ucd.ie/bioenvsci/index.html Services: Education/Training, Research & Development.

C O M PA N Y L I S T I N G S

F


F

O O D

I

R E L A N D

2009/10

C O M PA N Y L I S T I N G S

D.D. Williamson (Ireland) Ltd

W

Address: INGREDIENTS

Unifood Ltd Address:

Merrywell Industrial Estate, Ballymount, Dublin 12. Telephone: (01) 405 1500 Fax: (01) 460 1336 Email: kingg@shamrockfoods.ie Web: www.unifood.ie Main Products/ Food service & Services: ingredient sales. Contact: Gavin King

V

Waveform Solutions Address:

Unit 1B, 11 Canal Bank, Hume Avenue, Parkwest, Dublin 12. Telephone: (01) 620 9700 Fax: (01) 620 9701 Email: info@waveform.ie Web: www.waveform.ie Main Products/ Voice directed solutions, Services: mobile solutions, stock control systems, warehouse management software, RFID solutions, food traceability solutions EU178/2002, FFA (field force automation), mobile van sales solutions. Contact: Managing Director: Alan Carroll

Weber Labelling & Coding Veriplast Solutions Address:

Dragonville Industrial Estate, Durham, DH1 2RL. Telephone: (0044) 7768 983 922 Fax: (0044) 1913 830 670 Email: dpercy@veriplast.com Web: www.veriplast.com Main Products/ Plastic packaging for Services: food & drinks. Contact: Sales Manager UK & Ireland: Darren Percy

Address:

Kilcannon Industrial Estate, Old Dublin Road, Enniscorthy, Co. Wexford. Tel: (053) 923 3778 Fax: (053) 923 3284 Email: weberireland@eircom.net Web: www.webermarking.com Main Products/ Print & Apply Labelling Services: Systems, Desktop Printers, Laser Coders. Manufacturers of Blank & Pre Printed Labels.

Weigh-Tech Ltd

Wilson’s Country Ltd Address:

25 Carn Road, Carn Industrial Estate, Craigavon, Co. Armagh BT63 5WG. Telephone: (0044) 2838 391 029 Fax: (0044) 2838 391 042 Email: sales@ wilsonscountry.com Web: www.wilsonscountry.com Main Products/ Potato pre-packers, Services: potato processors and processors of fresh cut fruit. Contact: Managing Director: Lewis Cunningham Sales Manager: Ruth Pollock Sales Manager: Joanne Weir Sales Manager ROI: Eamonn Long

Address:

Versatile Packaging Ltd Address:

Silverstream Business Park, Silverstream, Tyholland, Co. Monaghan. Telephone: (047) 85 177 Fax: (047) 85 199 Email: info@versatilepackaging.ie Web: www.versatilepackaging.ie Main Products/ Food Packaging Materials Services: and Equipment - Tray Sealers, CPET, Barrier, Antifog Films, Aluminium Trays, Stand Up Pouches, Vacuum Pouches, Pouch Filling & Sealing Equipment. Contact: Director: Richard Mulligan Director: Michael O’Reilly

9 Naas Road Business Park, Muirfield Drive, Naas Road, Dublin 12. Telephone: (01) 460 8850 Fax: (01) 460 8851 Email: sales@weightech.ie Web: www.weightech.ie Main Products/ Supply and Services: Service of Industrial Weighing and Labelling Systems, Factory Management Software, Data Collection & Traceability Solutions, Calibration Service. Contact: Simon Kingman

Little Island Industrial Estate, Little Island, Co. Cork. Telephone: (021) 435 3821 Fax: (021) 435 4328 Email: info@ddwmson.com Web: www.ddwilliamson.com Main Products/ Caramel colours, Services: natural colours, burnt sugars, natural colour blends. Services: liquids & powders. Contact: Anne O’Dwyer

5 6 FOOD IRELAND

WrenTech Ltd Address:

Eversley, Church Bay Road, Crosshaven, Co. Cork. Telephone: (021) 483 2644 Fax: (021) 483 1363 Email: smurray@wrentech.ie Web: www.wrentech.ie Main Products/ Ytron & Matcon Services: mixing & blending, powder dispersion / incorporation, dust free transfer batch systems, powder bins / silo discharging, auger filling, dosing. Contact: Michael Wren


Logopak International, Grovewood House, Kettlestring Lane, Clifton Moor, York YO30 4XF

Telephone: 01904 692333 Telefax: 01904 690728 Email: sales@logopak.net Web: www.logopak.com


www.bordbia.ie

For peace of mind look for the Quality Mark

Food Ireland 2009 / 2010  

An annual information guide and reference source of products and services for the food & drink manufacturing and processing industries.

Food Ireland 2009 / 2010  

An annual information guide and reference source of products and services for the food & drink manufacturing and processing industries.

Advertisement