Issuu on Google+

HIT WORKFORCE SUMMIT Keeping Electronic Health Care Information Private and Secure TECHNOLOGY FUNDS How Tech Scholarships Help Students Succeed

AWARDS GALA 3URÀOHVRIWKH:LQQHUVRIWKH "Feel The Beat" Technology Awards

EVOLUTION OF TECHNOLOGY IT as a Service: What Does it Mean for the Future of IT Service Delivery?


TABLE OF CONTENTS FEATURED ARTICLES

11 21 23 27 5

TECH INNOVATION

Why Nashville Is Friendly To Innovation

PLANET OF THE APPS

How to Develop a Successful App

BUSINESS CONTINUITY PLPANNIG

Protect What You Have as Best You Can

JUMPSTART FOUUNDRY

Supporting the Entrepreneurial Ecosystem

RECYCLING TECHNOLOGY

What to do When Cutting-Edge Technology Loses it’s Edge


TABLE OF CONTENTS PAGE 4 LETTER FROM THE CHAIR

PAGE 23 PLANET OF THE APPS

Welcome Letter From Chris Sloan

Demand for Mobile Tech is on The Rise

PAGE 5 RECYCLING TECHNOLOGY

PAGE 25 EVOLUTION OF TECHNOLOGY

When Cutting-Edge Technology Loses Its Edge

IT as a Service: What Does it Mean for the Future of IT Service Delivery?

PAGE 7 TECHNOLOGY AWARDS

PAGE 27 TECH INNOVATION

)HHO7KH%HDW$ZDUG*DOD:LQQHUV

PAGE 9 TECHNOLOGY FUNDS How Tech Scholarships Help Students Succeed

!

PAGE 31 RELATIONSHIPS MATTER Relationships Are Key

PAGE 11 JUMPSTART FOUNDRY

PAGE 32 SUMMER CAMP/ FIRST CAMP

Supporting the Entrepreneurial Ecosystem

Help Get Students Excited About Technology

PAGE 13 WORKFORCE DEVELOPMENT

PAGE 33 NTC SPONSORS

Collaborative Effort to Address the Tech Workforce Issue in Middle Tennessee

PAGE 15 SOCIAL MEDIA

Belmont University and NTC Get Social

5

Why Nashville Is Friendly to Innovation

PAGE 16 TOP FIVE 7RS)LYH/LVWVIRU

PAGE 17 HEALTHCARE PRIVACY AND SECURITY Keeping Electronic Health Care Information Private and Secure

PAGE 19 TECH FACTS Fun Facts About Technology

PAGE 21 BUSINESS CONTINUITY PLANNING Protect What You Have as Best You Can

Thank You to Our Generous Sponsors

PAGE 35 VENTURE FOCUS Entrepreneurs Pursue Venture Capital

PAGE 37 SIGNAL SEEKERS NTC and the Wi-Fi Connection

PAGE 39 LOOKING AND LEANING FORWARD The Year Ahead at the Tech Council

PAGE 40 NTC CALENDAR Upcoming Events at the Tech Council

PAGE 41 - 43 LETTER FROM THE PRESIDENT/ NTC MEMBER DIRECTORY


LETTER FROM THE CHAIR Welcome to the 2012 Edition of Catalyst. As we move forward into 2012, I want to take DPRPHQWWRUHÁHFWRQZKDWKDVEHHQDYHU\HYHQWIXODQGWRGLVFXVVEULHÁ\RXU priorities for the coming year. 0RVWVLJQLÀFDQWO\7RG)HWKHUOLQJUHVLJQHGDVSUHVLGHQWDQG&(2RIWKH1DVKYLOOH 7HFKQRORJ\&RXQFLO7RGGHYRWHGKLVSURIHVVLRQDOOLIHWRWKH&RXQFLOIRUWKUHH\HDUVDQG XQGHUKLVOHDGHUVKLSZHGHYHORSHGDQGLPSOHPHQWHGDVXFFHVVIXOVWUDWHJ\WKDWVDZXV JURZLQHYHU\ZD\LQPHPEHUVKLSUHYHQXHDQGSURJUDPPLQJ,DQGRXU%RDUGRI 'LUHFWRUVDUHH[WUHPHO\JUDWHIXOWR7RGIRUDOOWKDWKHKDVGRQHIRUWKH&RXQFLODQGIRU WKH0LGGOH7HQQHVVHHWHFKQRORJ\DQGHQWUHSUHQHXUFRPPXQLWLHV (YHU\FKDOOHQJHSUHVHQWVDQRSSRUWXQLW\DQGLQWKLVFDVHRSSRUWXQLW\FDPHLQWKHIRUPRI /L]D/RZHU\0DVVH\)URPDQH[FHSWLRQDOSRRORIFDQGLGDWHVWKH&RXQFLOKLUHG/L]DDVLWV QHZSUHVLGHQWDQG&(2HIIHFWLYH6HSWHPEHUWK/L]DKDVDQLPSUHVVLYHOHDGHUVKLSDQG RSHUDWLRQDOEDFNJURXQGDQGHYHQLQWKHVKRUWWLPHVKHKDVEHHQKHUHVKHDQGWKHVWDII KDYHDOUHDG\EHHQEXV\JHWWLQJRXWLQWRWKHFRPPXQLW\VWUHDPOLQLQJSURFHVVHVDQG SODQQLQJIRUQH[W\HDU7KH&RXQFLO·VIXWXUHXQGHU/L]D·VOHDGHUVKLSLVDVEULJKWDVHYHU ,I\RXKDYHQRW\HWGRQHVRSOHDVHMRLQPHLQZHOFRPLQJKHUDQGKHUIDPLO\WR1DVKYLOOH :HKDYHWKUHHVWUDWHJLFSULRULWLHVIRUWKLV\HDU)LUVWZHPXVWFRQWLQXHWRDGGUHVV ZRUNIRUFHGHYHORSPHQW7KHUHUHPDLQIDUWRRPDQ\WHFKQRORJ\UHODWHGMRERSHQLQJV LQ0LGGOH7HQQHVVHHDQGWKH1DVKYLOOH7HFKQRORJ\&RXQFLOPXVWFRQWLQXHWRWDNHD OHDGHUVKLSUROHLQDGGUHVVLQJWKDWFKDOOHQJH6HFRQGZHPXVWLPSURYHPHPEHU HQJDJHPHQWWRVXVWDLQRXUJURZWKDQGUHWDLQRXUFXUUHQWPHPEHUVKLSZHPXVWFRQWLQXH WRHQVXUHWKDWRXUPHPEHUVUHFHLYHWKHPD[LPXPSRVVLEOHUHWXUQRQWKHLULQYHVWPHQWLQRXU RUJDQL]DWLRQ7KLUGDVPDOOWDVNIRUFHLVVWXG\LQJWKHSRVVLELOLW\RIH[SDQGLQJRXU RUJDQL]DWLRQRQDVWDWHZLGHEDVLV([SHFWWRKHDUPRUHDERXWDOOWKUHHRIWKHVHLVVXHVLQ the coming months. 7KH1DVKYLOOH7HFKQRORJ\&RXQFLOUHPDLQVVWURQJDQGLWVIXWXUHUHPDLQVEULJKW3OHDVHMRLQ ZLWKPHDQGZLWKRXUGHGLFDWHGVWDIIWRKHOSPDNHDQRWKHU\HDURIH[FHSWLRQDO JURZWKDQGVHUYLFHIRURXURUJDQL]DWLRQ

Chris Sloan%RDUG&KDLU

CATALYST ‡EDITORIAL STAFF  

 

 

 

 

 

1DVKYLOOH7HFKQRORJ\&RXQFLO‡%URDGZD\6XLWH 1DVKYLOOH71‡‡‡ZZZWHFKQRORJ\FRXQFLOFRP

Publisher: Liza0DVVH\‡Editor-HVVLFD+LOO‡Writers: Liza Massey, Mollie McCormick, Leah Magee, Jessica+LOO‡Proofreading: Mollie0F&RUPLFN‡Graphic Design: Jessica+LOO‡Contributors: Steve Chandler, Vanessa Frye, Vic Gatto, Kris Kelso, Sam Lingo, John Murdock, Sal Novin, Stephanie Oden, Robert 3UHLQLQJHU‡Administration: Mollie McCormick &RS\ULJKW$OOULJKWVUHVHUYHGE\WKH1DVKYLOOH7HFKQRORJ\&RXQFLO


RECYCLING TECHNOLOGY

When Cutting-Edge Technology Loses Its Edge 6WHSKDQLH2GHQ‡6LPV5HF\FOLQJ &RPSXWHUVFHOOSKRQHVDQGWHOHYLVLRQVDUHHVVHQWLDOWRPRGHUQOLIHWKH\FRQQHFWHQWHUWDLQLQIRUPDQGRUJDQL]HEXWWKH\ do not last forever and no one wants last year’s technology7KHVHDUHMXVWWZRUHDVRQVZK\$PHULFDQFRQVXPHUV SXUFKDVHGPLOOLRQQHZHOHFWURQLFGHYLFHVLQDFFRUGLQJWRHVWLPDWHVIURPWKH8QLWHG6WDWHV(QYLURQPHQWDO 3URWHFWLRQ$JHQF\ :KLOH86KRXVHKROGVDFFRXQWIRUWKHPDMRULW\RIWKRVHVDOHV,QWHUQDWLRQDO'DWD&RUSRUDWLRQUHFHQWO\UHSRUWHGWKH\RQO\ UHSUHVHQWDERXWSHUFHQWRIWKHPLOOLRQWRQVRIHOHFWURQLFVFROOHFWHGIRUUHF\FOLQJODVW\HDU7KLVFKDOOHQJHKDVPDGH HOHFWURQLFZDVWHWKHIDVWHVWJURZLQJVROLGZDVWHVWUHDPLQWKH8QLWHG6WDWHVDQGKDVIRFXVHGWKHDWWHQWLRQ RIWKHIHGHUDOJRYHUQPHQWDVZHOODVVWDWHDQGORFDOJRYHUQPHQWVEXVLQHVVHVDQGLQGLYLGXDOVRQWKHLPSRUWDQFHRI UHVSRQVLEOHHOHFWURQLFVVWHZDUGVKLS 7KHJOREDOYROXPHRIVFUDSHOHFWURQLFVLVLQFUHDVLQJDWDQH[WUDRUGLQDU\UDWHZKLFKLVZK\HOHFWURQLFVUHF\FOLQJLVVR LPSRUWDQWVDLG6WHYH6NXUQDF3UHVLGHQW6LPV5HF\FOLQJ6ROXWLRQV$PHULFDV)RUWXQDWHO\PDQ\LQGLYLGXDOVDQGEXVLQHVVHV DUHQRZZDNLQJXSWRWKHIDFWWKDWVXUSOXVHOHFWURQLFVVKRXOGQRWEHWUHDWHGDVZDVWHDQGZHDUHSOHDVHGWKDWDZDUHQHVV RIWKLVLVVXHLVEHFRPLQJPRUHZLGHVSUHDG 6KHHUYROXPHLVQRWWKHRQO\FKDOOHQJHSUHVHQWHGE\GLVFDUGHGHOHFWURQLFGHYLFHV³improperly handled e-waste can be hazardous to human health and the environment7KHHOHPHQWVUHVSRQVLEOHIRUWKHIXQFWLRQDOLW\FRQVXPHUVH[SHFWIURP WKHLUHOHFWURQLFV³FDGPLXPOHDGPHUFXU\QLFNHO³FDQOHDFKLQWRVRLODQGJURXQGZDWHULIQRWGLVSRVHGRIFRUUHFWO\ $OWKRXJKWKHUHLVQRIHGHUDOPDQGDWHLQWKH8QLWHG6WDWHVWRUHF\FOHHOHFWURQLFVLQFUHDVHGXQGHUVWDQGLQJRIWKHSRWHQWLDO KHDOWKDQGHQYLURQPHQWDOKD]DUGVOLQNHGWRWKHFDUHOHVVGLVSRVDORIHOHFWURQLFVKDVSURPSWHGVWDWHVWRUDWLI\HZDVWH OHJLVODWLRQHVWDEOLVKLQJHOHFWURQLFVUHFRYHU\SURJUDPVLQWKHODVWHLJKW\HDUV5HF\FOLQJHQGRIOLIHHOHFWURQLFV\LHOGV EHQHÀWVEH\RQGVDIHJXDUGLQJKXPDQKHDOWKDQGWKHHQYLURQPHQW³WKH\FRQWDLQDOXPLQXPFRSSHUJROGDQGVLOYHUZKLFK FDQEHUHFRYHUHGIRUXVHLQPDQXIDFWXULQJQHZSURGXFWV One metric ton of electronic scrap from "improperly handled e-waste can be hazardous to personal computers contains more gold than that recovered from 17 tons of gold human health and the environment" oreDQGUHF\FOLQJMXVWRQHWRQRISODVWLFV VDYHVDSSUR[LPDWHO\FXELF\DUGVRIODQGÀOOVSDFHDQGUHGXFHVFDUERQHPLVVLRQVE\WKUHHWRQVDFFRUGLQJWRWKH,QVWLWXWH RI6FUDS5HF\FOLQJ,QGXVWULHV+RZHYHUWUDQVIRUPLQJREVROHWHHOHFWURQLFVLQWRWKHUDZPDWHULDOVQHHGHGWRPDQXIDFWXUH QHZSURGXFWVUHTXLUHVFDSDFLW\DQGLQQRYDWLRQ $WVTXDUHIHHW6LPV5HF\FOLQJ6ROXWLRQV·/D9HUJQH7HQQHVVHHIDFLOLW\LVRQHRIWKHODUJHVWHOHFWURQLFVUHF\FOLQJ SODQWVLQWKHZRUOGDQGLVFDSDEOHRIKDQGOLQJWKDWNLQGRIYROXPH³WKHQHDUO\HPSOR\HHVSURFHVVDSSUR[LPDWHO\ IRXUPLOOLRQSRXQGVRIPDWHULDOSHUPRQWK7KHSODQWLVDOVRHTXLSSHGZLWKVHYHUDOFXWWLQJHGJHUHF\FOLQJWHFKQRORJLHV LQFOXGLQJDVWDWHRIWKHDUWQHDULQIUDUHGSODVWLFVVHSDUDWRUDQGDPHWDOVVHSDUDWRU7KHSODVWLFVVHSDUDWRUDXWRPDWLFDOO\ GHWHFWVDQGVHSDUDWHVYDULRXVW\SHVRISODVWLFDQGWKHPHWDOVVHSDUDWRUUHPRYHVFRSSHUFLUFXLWERDUGVDQGRWKHUPHWDOOLF DOOR\VIURPDOUHDG\VRUWHGPDWHULDOFRQWDLQLQJODUJHDPRXQWVRISODVWLF7KHVHPDFKLQHVZRUNLQXQLVRQWRproduce cleaner, less contaminated products³VWHHODOXPLQXPFRSSHUJODVVDQGSODVWLFV³WKDWFDQEHUHXVHGPRUHHIÀFLHQWO\ 2XUUHVHDUFKLQWRSODVWLFVVHSDUDWLRQWHFKQRORJ\LVRQHH[DPSOHRI6LPV5HF\FOLQJ6ROXWLRQV·FRPPLWPHQWWRDGYDQFLQJWKH HOHFWURQLFVUHF\FOLQJLQGXVWU\DQGSURGXFLQJDVXVWDLQDEOHVROXWLRQIRUHQGRIOLIHHOHFWURQLFVVDLG6NXUQDF6LQFHWKHVH HOHFWURQLFVFRQWDLQYDOXDEOHUHVRXUFHVWKDWFDQEHUHXVHGZHKDYHDGXW\WRVXVWDLQWKHHDUWK·VUHVRXUFHVE\UHF\FOLQJ them."

&$7$/<67

























3$*(




      

    

7RKHOSLQGLYLGXDOVDQGEXVLQHVVHVIXOÃ&#x20AC;OOWKDWGXW\6NXUQDFRIIHUVWKHVHVXJJHVWLRQVIRUGLVSRVLQJ of old or unwanted electronics. Do a good deed. 'RQDWHXVHGEXWVWLOOZRUNLQJHOHFWURQLFV7KLVDSSURDFKSURORQJVWKHOLYHVRIWKHVHSURGXFWVDQGGHOD\V WKHPIURPHQWHULQJWKHZDVWHVWUHDP<RXUGRQDWLRQDOVRKDVWKHSRWHQWLDOWREHQHÃ&#x20AC;WRWKHUVE\SURYLGLQJ WKHPZLWKHTXLSPHQWWKH\RWKHUZLVHFRXOGQRWDIIRUG 'RQ·WMHWWLVRQ\RXUMXQN. ,IUHXVHLVQRWDQRSWLRQUHF\FOH\RXUHZDVWH0DQ\PXQLFLSDOLWLHVRIIHUHOHFWURQLFVUHF\FOLQJDVSDUW RIKRXVHKROGKD]DUGRXVZDVWHFROOHFWLRQVRUVSHFLDOHYHQWV,QUHFHQW\HDUVSXEOLFDQGSULYDWH RUJDQL]DWLRQVKDYHVWDUWHGDFFHSWLQJHOHFWURQLFVIRUUHF\FOLQJ0DQ\HOHFWURQLFVPDQXIDFWXUHUVQRZRIIHU WDNHEDFNSURJUDPVZKHUHWKHFRQVXPHUSD\VWRPDLOWKHSURGXFWEDFNDQGWKHPDQXIDFWXUHUUHF\FOHV the item. Get the facts. %HIRUHWXUQLQJRYHU\RXUHOHFWURQLFVIRUUHXVHRUUHF\FOLQJSURWHFW\RXUSHUVRQDORUFRUSRUDWHGDWD 'DWDOHIWRQDQROGGHYLFHFDQSRWHQWLDOO\OHDGWRLGHQWLW\WKHIWRUVWROHQFXVWRPHULQIRUPDWLRQVR HUDVHGDWDIURPWKHKDUGGULYHVRIGHYLFHVGHVWLQHGIRUUHXVHDQGGHVWUR\WKHKDUGGULYHVIURPWKRVH VODWHGIRUUHF\FOLQJ7KHQDVNTXHVWLRQV:KRZLOOEHKDQGOLQJ\RXUHTXLSPHQW"'RWKH\KDYHSDUWQHUV DQGZKHUHDUHWKH\ORFDWHG":KDWZLOOKDSSHQWR\RXUHTXLSPHQWDIWHUFROOHFWLRQ"

:KHQGRQHFRQVFLHQWLRXVO\UHXVLQJDQGUHF\FOLQJHOHFWURQLFVSUHVHQWVDOORIXVZLWKDQRSSRUWXQLW\WREHFRPHEHWWHU HQYLURQPHQWDOVWHZDUGVVDLG6NXUQDF Sims Recycling SolutionsKROGVDIUHHHOHFWURQLFVFROOHFWLRQHYHQWIRUWKHSXEOLFHYHU\)ULGD\IURPDPWRSP DWLWVUHF\FOLQJIDFLOLW\ORFDWHGDW6DQIRUG5RDG/D9HUJQH7HQQHVVHH www.simsrecycling.com

,PDJHFRXUWHV\RIZZZZHUHF\FOHFRP

&$7$/<67

























3$*(


TECHNOLOGY AWARDS

2011 "Feel The Beat" Award Gala Winners Mollie McCormick Â&#x2021;1DVKYLOOH7HFKQRORJ\&RXQFLO The Technology Awards Gala is the most anticipated event of the yearâ&#x20AC;¦and for good reason! With a red carpet HQWUDQFHJRRGIRRGJUHDWZLQHDQGVRPHRIWKHEHVWSHRSOHLQ1DVKYLOOHDOOLQRQHVSRWZKDW·VQRWWRORYH"7KHVROGRXW gala draws over 500 attendees, 75 nominees, and 12 prestigious award winners each year and it is expected to FRQWLQXHJURZLQJ But why are the Technology Awards so important to our fair city? Each award category highlights a leader in the tech LQGXVWU\DVZHOODVLQWKHFRPPXQLW\DVDZKROH1DVKYLOOHLVDEHWWHUSODFHEHFDXVHRIWKHPDQGUHFRJQL]LQJWKHLUHIIRUWV DQGFRQWULEXWLRQVLVDYHU\LPSRUWDQWSDUWLQFRQWLQXLQJWKHJURZWKRIWKLVFLW\+HDUZKDWDIHZRIRXU7HFKQRORJ\ $ZDUGZLQQHUVKDYHWRVD\DERXWZKDWLWPHDQVWRWKHP

Innovator of the Year Stephen Hau6KDUHDEOH,QN $ERXWD\HDUDJR6KDUHDEOH,QNPRYHGWR1DVKYLOOH DUJXDEO\WKHQDWLRQ·VKHDOWKFDUHFDSLWDOZLWKWKHJRDO RIPDNLQJDPHDQLQJIXOGLIIHUHQFHLQKHDOWKFDUHBeing VRTXLFNO\UHFRJQL]HGDVWKH,QQRYDWRURIWKH<HDU by the Nashville Technology Council and the local business community is a great honor for the team.

$ZDUG:LQQHUVRQ6WDJHZLWK*XLWDUV

7KH6KDUHDEOH,QNPLVVLRQLVDQLPSRUWDQWRQH +HDOWKFDUHLVEHFRPLQJLQFUHDVLQJO\GDWDGULYHQEXW WKHLQGXVWU\KDVVWUXJJOHGZLWKJHWWLQJHOHFWURQLF² HVSHFLDOO\ZLWKSK\VLFLDQLQSXWWHGLQIRUPDWLRQ,QIDFW 86KRVSLWDOVUHSRUWWKDWless than 10% of physicians GRFXPHQWZLWKFRPSXWHUNH\ERDUGV

6WHSKHQ+DX6KDUHDEOH,QN

6KDUHDEOH,QNKDVDGGUHVVHGWKLVSUREOHPE\EXLOGLQJ a sophisticated cloud-based platform that converts natural human input (such as handwriting) to structured dataXVHDEOHE\HOHFWURQLFKHDOWKUHFRUGV DQGRWKHUV\VWHPV:KLOHWKHWHFKQRORJ\SXVKHVWKH frontiers of machine learning, the approach is completely LQWXLWLYHIRUSK\VLFLDQV

17&3UHVLGHQW/L]D/RZHU\0DVVH\

6KDUHDEOH,QNKDVPDGHPDQ\FXVWRPHUVVXFFHVVIXOZLWK WKLVDSSURDFKDQGZLOOKHOSGULYHEHQHÃ&#x20AC;WVLQKHDOWKFDUH GHOLYHU\DQGUHGXFHFRVWV ZZZVKDUHDEOHLQNFRP

$WWHQGHHVDWWKH6FKHUPRUKRUQ

&$7$/<67

























3$*(


Company of the Year Qualifacts 4XDOLIDFWVKDVKDGPXFKWRFHOHEUDWHWKLV\HDU,W·VVXFFHVVIXOEXVLQHVVWXUQDURXQGDQGFXOWXUDO WUDQVIRUPDWLRQFXOPLQDWHGWKLV\HDUZLWKVRPHRIWKHFRPSDQ\·VPRVWVLJQLÃ&#x20AC;FDQWDFFRPSOLVKPHQWV %HLQJKRQRUHGDVWKH1DVKYLOOH7HFKQRORJ\&RXQFLO&RPSDQ\RIWKH<HDUDQGRXUUHFHQW JURZWKLVPHDQLQJIXOYDOLGDWLRQRIWKHGHFLVLRQVZH·YHPDGHDQGWKHGLUHFWLRQZH·YHWDNHQWKH company over the past few years. 7KLVDZDUGUHFRJQL]HVWKHVXFFHVVRIWKHZKROHFRPSDQ\DQG RXUMRXUQH\KDVWUXO\EHHQDQHQWLUHFRPSDQ\HIIRUWWe are proud of our progress and inspired by our potential. 4XDOLIDFWVSURYLGHV(OHFWURQLF+HDOWK5HFRUGVIRUWKHEHKDYLRUDOKHDOWKDQGKXPDQVHUYLFHVPDUNHW DQGVHUYHVPRUHWKDQRUJDQL]DWLRQVDFURVVWKHFRXQWU\7KHLQFUHDVHGGHPDQGIRUVHUYLFHVKDV DOORZHG4XDOLIDFWVWRH[SDQGRXUZRUNIRUFHLQ1DVKYLOOHE\SHUFHQWRYHUWKHSDVWIRXU\HDUV www.qualifacts.com

'DYLG.OHPHQWV4XDOLIDFWV

)HHO7KH%HDW$ZDUG:LQQHUV IT StudentRIWKH<HDUÂ&#x2021;6SRQVRUHGE\+3 Rachelle Holloman%HOPRQW8QLYHUVLW\ VolunteerRIWKH<HDUÂ&#x2021;6SRQVRUHGE\+&$ Andy Flatt+HDOWKVSULQJ

Lifetime Achievement Beth Chase&&RQVXOWLQJ

Green CompanyRIWKH<HDUÂ&#x2021;6SRQVRUHGE\ +HDOWK6SULQJ Dsi

7KHDQQXDO7HFKQRORJ\$ZDUGVDUH LPSRUWDQWWR1DVKYLOOHDVDFLW\DQG also to tech organizations in the region. 7KH1DVKYLOOHDUHDKDVDVWURQJWHFK FRPPXQLW\EXWLW·VHDVLO\RYHUVKDGRZHG E\ZHOONQRZQLQGXVWULHVVXFKDVKHDOWK %HWK&KDVH&&RQVXOWLQJ FDUHDQGPXVLFThe Awards provide DQLPSRUWDQWPRPHQWLQWKHVSRWOLJKW IRUWHFKRUJDQL]DWLRQVWKDWDUHPDNLQJDSRVLWLYHLPSDFWLQWKH community. 7KLVDZDUHQHVVKHOSVEUDQG1DVKYLOOHDVDFUHDWLYH WRZQDQGLQWXUQKHOSVXVDWWUDFWWKHEHVWDQGEULJKWHVWZRUNHUV and companies here.

Social Media/BloggerRIWKH<HDUÂ&#x2021;6SRQVRUHGE\ 5-<RXQJ Lyndsay Rush and Centresource InnovatorRIWKH<HDUÂ&#x2021;6SRQVRUHGE\+3$ Stephen Hau6KDUHDEOH,QN Start-upRIWKH<HDUÂ&#x2021;6SRQVRUHGE\%DNHU'RQHOVRQ Healthcare Productivity Automation +3$

,·YHEHHQLQYROYHGDVDPHPEHURIWKH7HFKQRORJ\&RXQFLOIRU DERXW\HDUV/LQGD5HEURYLFN &(2&RQVHQVXV3RLQW JRWPH LQYROYHGRQWKHERDUG,WZDVWKHQWKDW,UHDOL]HGKRZLPSRUWDQW WKH&RXQFLOLVWRRXUFLW\By helping the entire tech community, I DPKHOSLQJP\EXVLQHVV$QGWKDW·VZKDWNHHSVPHLQYROYHG

Software Engineer/ProgrammerRIWKH<HDUÂ&#x2021; 6SRQVRUHGE\&RPFDVW 5LFNH\6RXWK&+6 CISORIWKH<HDUÂ&#x2021;6SRQVRUHGE\&RUH%76 Craig Zimberg%0,

&KDQJHLVFRQVWDQW6RLQRXUÃ&#x20AC;HOG²PDQDJHPHQWDQGWHFKQRORJ\ FRQVXOWLQJ²ZHPXVWOHDGFKDQJHWKURXJKFUHDWLYLW\DQG persistence. We deal with people, process, and technology FKDQJHLQEXVLQHVVHV7HFKQRORJ\FKDQJHKDSSHQVTXLFNHUWKDQ WKHRWKHUWZR7KHIXWXUHLVPRUHFKDQJH

CTORIWKH<HDUÂ&#x2021;6SRQVRUHGE\9DFR -DQLFH0DODV]HQNR1LVVDQ CIORIWKH<HDUÂ&#x2021;6SRQVRUHGE\.30* Andy Flatt+HDOWKVSULQJ

5HFHLYLQJWKH/LIHWLPH$FKLHYHPHQWDZDUGLVWUXO\DQKRQRU0\ EXVLQHVVOLIHWLPHDFKLHYHPHQWLVVWDUWLQJFRQVXOWLQJÃ&#x20AC;UPVDQGP\ &RXQFLOLQYROYHPHQWRYHUZKDWVHHPVOLNHDOLIHWLPHKDVEHHQ years! ,KRSHWKHDZDUGVLJQLÃ&#x20AC;HVP\VWURQJGHVLUHWRKHOSWKLV entire community succeed.)URPDEXVLQHVVSHUVSHFWLYHLW·VYHU\ PXFKDteam award0\&WHDPLVDQLQFUHGLEO\WDOHQWHGJURXS RIOHDGHUVZKREHOLHYHLQKHOSLQJRWKHUVDQGJLYLQJEDFN,DPVR IRUWXQDWHWRKDYHWKHRSSRUWXQLW\WRZRUNZLWKHDFKDQGHYHU\RQH of them." www.c3-consult.com

CompanyRIWKH<HDUÂ&#x2021;6SRQVRUHGE\;2 &RPPXQLFDWLRQV Qualifacts Lifetime AchievementÂ&#x2021;6SRQVRUHGE\1:1 Beth Chase&&RQVXOWLQJ

&$7$/<67

























3$*(


TECHNOLOGY FUNDS

How Tech Scholarships Help Students Succeed Mollie McCormick Â&#x2021;1DVKYLOOH7HFKQRORJ\&RXQFLO5DFKHOOH+ROORPDQÂ&#x2021;%HOPRQW8QLYHUVLW\ 1RRQHFDQGHQ\WKHIDFWWKDWVFKRROLVH[SHQVLYHDQGFRVWV FRQWLQXHWRULVHHDFK\HDU2XUFRPPXQLW\DOVRFDQ·WUHIXWH the fact that ZHKDYHDSOHWKRUDRIMREVWRÃ&#x20AC;OOLQ the technology world RYHULQ0LGGOH71DFFRUGLQJWR WKHODVW-REV5HSRUWLQ6HSWHPEHU :LWKRXWWKHSURSHU HGXFDWLRQLQWKH,7DUHDWKHWHFKFRPPXQLW\ZLOOVWUXJJOH WRÃ&#x20AC;QGHPSOR\HHVWithout the help of scholarships to deserving students in need, they may never be able to DIIRUGWKHHGXFDWLRQLWWDNHVWREHFRPHOHDGHUVLQWKDW Ã&#x20AC;HOG6RZK\DUHVFKRODUVKLSVVRLPSRUWDQW"

Without the help of scholarships to deserving students in need, they may never be able to afford the education it WDNHVWREHFRPHOHDGHUVLQWKH,7Ã&#x20AC;HOG

Rachelle HollomanDVWXGHQWDW%HOPRQW8QLYHUVLW\DQG latest recipient of a NTC scholarship, tells her story of how VFKRODUVKLSVKDYHJRWWHQKHUWRWKHVXFFHVVIXOSODFHVKH is in now. 5DFKHOOH+ROORPDQ%HOPRQW

,VWDUWHGZRUNLQJRQFRPSXWHUVZKHQ,ZDVWKUHH\HDUVROG0\JRGIDWKHUJDYHP\IDPLO\DFRPSXWHUDQGZKLOHP\ PRWKHUZDVWDNLQJQRWHVRQKRZWRXVHLW,ZDVWHOOLQJKHUWKDW,DOUHDG\NQHZKRZWRDQG,GLG7HFKQRORJ\LVVRPHWKLQJ WKDWDOZD\VFDPHQDWXUDOO\WRPHVLQFH,ZDV\RXQJ,KDYHEHHQDEOHWROHDUQQHZSURJUDPVLQDVKRUWDPRXQWRIWLPH which helped me learn a lot of things. INQHZWKDWP\IXWXUHZDVLQWHFKQRORJ\VLQFH,ZDV\RXQJZKHQDQ\ERG\HYHU DVNHGPHZKDW,ZDVJRLQJWRGR,VDLGVRPHWKLQJFRPSXWHUUHODWHG:KHQ,ZDVLQPLGGOHVFKRRO,ZDVRQWKH6WXGHQW 7HFKQRORJ\/HDGHUVKLS7HDPDQGZHGLGWKHÃ&#x20AC;UVWYLGHRSURMHFWRQWKHKLVWRU\ RIWKH1DVKYLOOH&LW\&HPHWHU\7KHWHDPZRQÃ&#x20AC;UVWSODFHZKLFKPHDQWZH KDGZRQHLJKWGHVNWRSFRPSXWHUVIURP'HOOIRURXUVFKRRO,QP\MXQLRUDQG VHQLRU\HDUVRIKLJKVFKRRO,ZDVWKHVWXGHQWZRUNHUXQGHUWKH7HFKQRORJ\ 6XSSRUW6SHFLDOLVWZKLFKPHDQWHYHU\GD\,ZRXOGGRGLIIHUHQWWDVNVIURP SULQWLQJVWXGHQW,'VWRÃ&#x20AC;QGLQJZKHUHWKHORRSLQWKHSKRQHV\VWHPZDVDW ZKHQQRRQHFRXOGFDOORXW It got to the point where teachers were calling PHRXWRIP\FODVVHVWRÃ&#x20AC;[VRPHWKLQJWKDWZDVJRLQJZURQJ. My teachers ZRXOGOHWPHEHFDXVHWKH\KDGEHHQLQWKDWVLWXDWLRQEHIRUH,NQHZWKHQWKDW SHRSOHFRXOGGHSHQGRQPHWRKHOSWKHPDQG,OLNHGWKDWIHHOLQJVR,NQHZ that was what I was going to do. ,HQWHUHGLQWR%HOPRQWLQWKH)DOORI$OWKRXJKWKH\DUHEHWWHUNQRZQ IRU0XVLFDQG0XVLF%XVLQHVV,NQHZWKDWLWZRXOGEHDJRRGÃ&#x20AC;WIRUPH,DP an Information Systems Management major with a Computer Science minor, 3DW9RQGHWWH+35DFKHOOH+ROORPDQ%HOPRQWDQG DQG,KDYHEHHQDEOHWROHDUQWKHEXVLQHVVVLGHRIWKLQJVDVZHOODVWKHPRUH &KULV6ORDQ%DNHU'RQROVRQ technical side. I became involved with the NTC in April 2009 at the Intern Nashville Meeting at Nashville State Community College, and have had so many opportunities because of that initial meeting,DPFXUUHQWO\WKH6WXGHQW&RQJUHVV3UHVLGHQWIRUWKH17&,DPDOVRFRPSOHWLQJDQLQWHUQVKLSDWHCA HealthcareLQ&OLHQW6XSSRUW6HUYLFHVZKHUH,KDYHEHHQIRUWKHSDVWWZR\HDUV,KDYHOHDUQHGDORWDERXWJRRG FXVWRPHUVHUYLFH,GRQ·WIHHOOLNH,FKRVHWHFKQRORJ\LWNLQGRIFKRVHPHEHFDXVH,KDYHMXVWDOZD\VEHHQDEOHWR DFTXLUHNQRZOHGJHLQLWDORWHDVLHUWKDQDQ\WKLQJHOVH

&$7$/<67

























PAGE 9


6FKRODUVKLSVKDYHEHHQXVHIXOWRPHEHFDXVH,KDYHEHHQDEOH "Scholarships take the stress off of to attend Belmont on an academic and Hope Lottery scholarship. focusing on how expensive shcool is and ,ZRXOGQRWKDYHEHHQDEOHWRFRYHUWKHWXLWLRQZLWKRXWWKHKHOSRI allows me to focus on getting a good job VFKRODUVKLSV,KDYHKDGVFKRODUVKLSVIURPRWKHUVRXUFHVDVZHOOWKDW ZKHQ,JHWRXW DOZD\VKHOSZLWKWKHLQFUHDVHGWXLWLRQFRVWVHYHU\DFDGHPLF\HDU 6FKRODUVKLSVKDYHEHHQYDOXDEOHWRPHEHFDXVH,GLGQRWWRKDYHWR WDNHORDQVRXWXQWLOODWHULQP\FROOHJHFDUHHUZKLFKPHDQV,KDYHOHVVWRSD\EDFNZKHQ, JHWRXW6FKRODUVKLSVWDNHVRPHRIWKHVWUHVVRIIIRUPHRIKRZH[SHQVLYHFROOHJHFDQ be so I can focus on getting a good job once I get out and not have to worry about how ,DPJRLQJWRSD\IRUQH[WVHPHVWHU7KURXJK%HOPRQW,KDYHEHHQDEOHWRKDYHJUHDW H[SHULHQFHVLQDVFKRROQRWZHOONQRZQIRU7HFKQRORJ\EXWVKRZVWKDWLWVVWXGHQWVFDQEH VXFFHVVIXOLQ,7ZLWKZLQQLQJ,76WXGHQWRI<HDUIRUWKHSDVWWKUHH\HDUV

5DFKHOOHFRQWLQXHVWRYROXQWHHUKHUWLPHDQGHIIRUWV WRWKH17&DQGKDVEHHQDQLQYDOXDEOHDVVHWWRWKH organization. She recently won the 2011 IT Student RIWKH<HDU$ZDUGDQGZDVDZDUGHGDVFKRODUVKLS and a laptop from HP.

Past Technology Scholarship Recipients KeeAnthony Lindsley &XUUHQWO\HQUROOHGDW7UHYHFFD 1D]DUHQH&ROOHJH+HLVFXUUHQWO\ OLYLQJZLWKKLV$XQWDQGZRUNLQJLQ 1DVKYLOOH

7KH1DVKYLOOH7HFKQRORJ\&RXQFLO·V%RDUGRI'LUHFWRUV HVWDEOLVKHGWKHTechnology Scholarship Fund in ZLWKWKH&RPPXQLW\)RXQGDWLRQRI0LGGOH 7HQQHVVHH7KHIXQGZLOOHQGRZSHUPDQHQWO\RQHRU PRUHVFKRODUVKLSVEHQHÃ&#x20AC;WLQJ1DVKYLOOHKLJKVFKRRO VHQLRUVHQWHULQJWZRRUIRXU\HDUGHJUHHSURJUDPV LQSXUVXLWRIDQHGXFDWLRQLQÃ&#x20AC;HOGVUHODWHGWR WHFKQRORJ\(OLJLEOHDSSOLFDQWVDUHKLJKVFKRROVHQLRUV IURP1DVKYLOOHKLJKVFKRROVZKRDUHHQWHULQJWZRRU IRXU\HDUGHJUHHSURJUDPVLQÃ&#x20AC;HOGVUHODWHGWRWKH creation, innovation, installation or maintenance of technology.

Elvis Encalada &XUUHQWO\HQUROOHGDW71 7HFKQRORJLFDO8QLYHUVLW\LQ FRPSXWHUHQJLQHHULQJ+H LVJUDWHIXOIRUWKHDVVLVWDQFH IURPWKH7HFKQRORJ\&RXQFLO scholarship. It looks like he ZLOOKDYHDDYHUDJHWKLV VHPHVWHUDW717HFK

7RGRQDWHRUOHDUQPRUHDERXW7HFK 6FKRODUVKLSVSOHDVHYLVLW www.cfmt.org

7XLWLRQFRVWVIRUVRPH716WDWHZLGH6FKRROV

6&+22/

7<3(

78,7,21

180%(52)678'(176

9DQGHUELOW8QLYHUVLW\ 1DVKYLOOH71

)RXU<HDU*UDGXDWH







%HOPRQW8QLYHUVLW\ 1DVKYLOOH71

)RXU<HDU*UDGXDWH







Trevecca Nazarene 1DVKYLOOH71

)RXU<HDU*UDGXDWH







)LVN8QLYHUVLW\ 1DVKYLOOH71

)RXU<HDU







,QIRUPDWLRQSURYLGHGE\CollegeForTN.org

&$7$/<67

























3$*(


JUMPSTART FOUNDRY Supporting the Entrepreneurial Ecosystem 9LF*DWWRÂ&#x2021;0DQDJLQJ'LUHFWRUDW-XPSVWDUW)RXQGU\Â&#x2021;3DUWQHUDW6ROLGXV&RPSDQ\

$VPRVWWHFKQRORJLVWVNQRZWKHEDUULHUVWR HQWUHSUHQHXUVKLSKDYHFUXPEOHGRYHUWKHODVWIHZ \HDUV7RGD\LWLVHDVLHUDQGFKHDSHUWRODXQFK DFRPSDQ\GXHWRPDQ\IDFWRUVWKDWLQFOXGHRSHQ VRXUFHVRIWZDUHOHDQVWDUWXSPHWKRGRORJLHVFORXG EDVHGFRPSXWLQJDQGGLVWULEXWLRQWKURXJKH[FLWLQJ FRQVXPHUQHWZRUNV

"No single entrepreneur, company or LQYHVWRUFDQSURVSHUDORQH Jumpstart FoundryUXQVDQDQQXDOSURJUDPWKDWEULQJV WKLVFRPPXQLW\WRJHWKHUDURXQGWKHJRDORIsuccessfully ODXQFKLQJVL[WRWHQH[FLWLQJQHZVWDUWXSVLQDYHU\ short amount of time and with very little capital. We KDYHGHYHORSHGDIDVWSDFHGZHHNSURJUDPRYHU WKHVXPPHU$VDSDUWRIWKHSURJUDP-XPSVWDUW)RXQGU\ SURYLGHVDQGDORWRIHGXFDWLRQDQGPHQWRULQJ WRWKHVHVWDUWXSVDVWKH\ZRUNWRGHYHORSDYLDEOH EXVLQHVVPRGHODQGSURGXFWRIIHULQJ

Marcus Whitney)RXQGHU &72RI0RRQWRDVW VXPPDUL]HGWKHQHZHQYLURQPHQW´The cost of building an Internet based business, from infrastructure to bandwidth, has literally dropped WRWKHĂ RRU7KHFORXGPDNHVHQWHUSULVHOHYHO systems available on demand and at prices so low that a large IT budget is no longer a huge competitive advantage.â&#x20AC;?

This goal is intentionally very challenging to accomplish. ,WUHTXLUHVWKHKHOSRIWKHHQWLUH1DVKYLOOH HQWUHSUHQHXULDOFRPPXQLW\WREHVXFFHVVIXO7KLV DSSURDFKPDNHVWKHSRLQW²WKHWDVNRIEXLOGLQJVWDUWXS FRPSDQLHVLVQHYHUHDV\,WUHTXLUHVVPDUWH[SHULHQFHG SHRSOHWRZRUNORQJKRXUVIRUOLWWOH QR SD\%XWZKHQLW DOOFRPHVWRJHWKHUDQG\RXVHHDQH[FLWLQJEXVLQHVVPRGHO ULVHRXWRIWKHSLOHRIIDLOHGDWWHPSWV²LWLVDZRQGHUIXO thing to witness.

/HVVSXEOLFL]HGEXWDVH[FLWLQJIRU1DVKYLOOHLVWKH strengthening of alternative cities as a home for technology start-ups6LOLFRQ9DOOH\DQG%RVWRQ ZLOOQRORQJHUGRPLQDWHWKHHQWUHSUHQHXULDOZRUOG 2IFRXUVHPDQ\YHU\WDOHQWHGSHRSOHUHPDLQ LQWKRVHDUHDVGRQ¡WIHHOWRREDGO\IRUWKHP +RZHYHUVRFLDOPHGLDDQGEORJJHUVGLVVHPLQDWH QHZWHFKQLTXHVDQGHQWUHSUHQHXULDOOHVVRQV ZLWKLQGD\V LIQRWKRXUV RIGLVFRYHU\7KXVWKH DGYDQWDJHRIJHRJUDSKLFSUR[LPLW\LVà HHWLQJ DWEHVW -XPSVWDUW)RXQGU\ZDV created to capitalize on these trends and catalyze WKHHQWUHSUHQHXULDO HFRV\VWHP,XVHWKHWHUP ecosystem intentionally. We need an interdependent community of entrepreneurs, capital sources, technologists, and educational/support &KULVWRSKHU-DHJHU5HQW6WXIIFRP providers. We all need one DQRWKHUQRVLQJOHHQWUHSUHQHXU company or investor can prosper alone.

Tod Fetherling&KDLUPDQRI6WUDWDVDQKDVEHHQ LQYROYHGZLWKWKHJURXSVLQFHLQFHSWLRQ)URPWKHĂ&#x20AC;UVW PHHWXSWRWKHĂ&#x20AC;QDOSLWFKHYHQWWKHFRPPRQWKHPH IRU-XPSVWDUWZDVWKHQXPEHURIQHZUHODWLRQVKLSV FUHDWHGDPRQJWKHPHQWRUV7KHFRPPXQLW\WKDWZDVEXLOW DURXQGWKHSURJUDPZDVXQEHOLHYDEOH7KHURFNVWDUV of entrepreneurship from Nashvilleâ&#x20AC;&#x2122;s community were KHUHHYHU\ZHHNSXVKLQJWKHFRPSDQLHVDQGFUHDWLQJ new opportunities for those who were fortunate and GHGLFDWHGHQRXJKWRVKRZXS

9LF*DWWR6ROLGXV&RPSDQ\

&$7$/<67

























3$*(


2IFRXUVHWKHVHVWDUWXSVGRQ·WDOZD\VKDYHKDSS\ endings. Our goal is to bring the community together while building valuable companies. It DSSHDUVWREHZRUNLQJ-XPSVWDUW)RXQGU\LVEDWWLQJ DERXWRYHUWKHODVWWZR\HDUV)RURXUÃ&#x20AC;UVW\HDU  ZHKDGPHQWRUVDQGODXQFKHGVHYHQVWDUW XSFRPSDQLHVLQDVHULHVGXULQJWKHFDOHQGDU\HDU ,Q-XPSVWDUW)RXQGU\VZLWFKHGWRDFRKRUW PRGHODOORZLQJVL[VWDUWXSVWRSDUWLFLSDWHLQDWKUHH PRQWKSURJUDPWRJHWKHU7KLVPRGHOUHTXLUHV VWUHQJWKHQLQJRXUPHQWRUUDQNVWRDQGWKH FUHDWLRQRIDUREXVWZHHNE\ZHHNFXUULFXOXP:H also added angel investors and sponsors to strengthen the program.

-80367$570(17256 April Aden Roddy Bailey Chris Blanz Brian Bowman Bill Brennan Allen Brown Michael Burcham Sid Chambless Beth Chase -RH&RRN,,, Dr. Jeff Cornwall  David Corts 'DYH'H%XVN

:HKRSHWRLPSURYHXSRQWKHVHUHVXOWVEXWLW·VQRW DEDGVWDUW$GGLWLRQDOO\-XPSVWDUWKDVEXLOWWKH HQWUHSUHQHXULDOHFRV\VWHPVDURXQGLWVHOIThe mentors and angels come together to launch FRPSDQLHVEXWWKH\HQGXSQHWZRUNLQJJHWWLQJ to be friends and building established technology businesses in Nashville as well.



$VZHJHDUXSIRU-XPSVWDUW)RXQGU\ZHZRXOG love to involve more of the Nashville community in RXUHIIRUWV3OHDVHVLJQXSWRKHOSDWRXUZHEVLWH www.jumpstartfoundry.com. 6LJQXSWRKHOSDVWDUWXSVXFFHHGRUGRLWWROHDUQ DQHZWHFKQRORJ\RUVLJQXSWRPHHWLQWHOOLJHQW SDVVLRQDWHSHRSOHLQ1DVKYLOOHRUGRLWWRKHOSEXLOG WKHFRPPXQLW\LQZKLFK\RXOLYHEXWGHÃ&#x20AC;QLWHO\VLJQXS EHFDXVHLWLVDORWRIIXQ

6WHSKHQ%XKUPDQ.DKRRW]]

&KULV0F,QW\UH&KDQJH+HDOWKFDUH

3DUWQHU)LGHQW&RQVXOWLQJ 0HPEHU0LOOHU 0DUWLQ3//&E )RXQGHU&(2&UHDWLYH'LUHFWRURIFDEHGJHFRP

9LFH3UHVLGHQWDQG3DUWQHU&&RQVXOWLQJ (QWUHSUHQHXU 2ZQHU6ZHHW/LEHUW\//& 3UHVLGHQW&(21DVKYLOOH(QWUHSUHQHXU&HQWHU

([HFXWLYH'LUHFWRURI1&1 3UHVLGHQW &(2&&RQVXOWLQJ//& 0RXQWDLQ*URXS&DSLWDO -DFN&0DVVH\&KDLULQ(QWUHSUHQHXUVKLS %HOPRQW8QLYHUVLW\ 9LFH3UHVLGHQW$2/&RQWHQW3ODWIRUP )RXQGHUDQG*HQHUDO0DQDJHURIWK 3URSRVLWLRQ//&

.HLWK'HHUNRVNL 2ZQHU6ZHHW/LEHUW\//& Drew Fassett 9LFH3UHVLGHQW *HQHUDO0DQDJHU3HDN Tod Fetherling &(26WUDWDVDQ %ULDQ)R[ )RXQGHU&DSLWDO&RQÃ&#x20AC;UPDWLRQ,QF 7LP)UDQNH 3UHVLGHQWRI'XH1RUWK//& Vic Gatto 3DUWQHU6ROLGXV&RPSDQ\ Dr. Dave Gilbert )RXQGHU6DOWWW//& Harris Gilbert 2ZQHU*LOEHUW0DUNHW6ROXWLRQV Scott Gordon 3DUWQHU9DFR//& %RE*URKRYVN\ Microsoft Rajeev Gupta (QWUHSUHQHXU Jamin Guy 6HQLRU3URGXFW'HYHORSHUDW*ULIÃ&#x20AC;Q7HFKQRORJ\ 5REHUW+HQGULFN )RXQGHUFKDQJHKHDOWKFDUH Nicholas Holland &(2&HQWUHVRXUFH David Hooper 0XVLF0DUNHWLQJ>GRW@FRP Bryan Huddelston $FFRXQW0DQDJHU0LFURVRIW&RUSRUWDWLRQ Rob Humphreys (QWUHSUHQHXU)RUPHU&(28QLWHG)LEHUJODVV David Klements &(24XDOLIDFWV6\VWHPV,QF 6FRWW.R]LFNL 6HULDO(QWUHSUHQHXU Don Leyrer (QWUHSUHQHXU Dennis Lyftogt (QWUHSUHQXHU0HQWRU&RDFK Chris McIntyre 93RI3URGXFW (QJDJHPHQWFKDQJHKHDOWKFDUH 0DUN0RQWJRPHU\)RXQGHURI)/2^WKLQNHU\` Matt Mueller 3URMHFW0DQDJHUFKDQJHKHDOWKFDUH Matthew Musser 6DOHV 0DUNHWLQJ([HFXWLYH Jozef Nuyens )RXQGHU)LYHVWRQH3DUWQHUV Kate Oâ&#x20AC;&#x2122;Neill )RXQGHU &(2>PHWD@PDUNHWHU Rachael Qualls (QWUHSUHQHXU Christopher Rand 7UL6WDU7HFKQRORJ\9HQWXUHV -DFN5DQGRZ (QWUHSUHQHXU JJ Rosen &(2RI$WLED//& Eric Satz 3DUWQHU71&9 Salil Shibad 7HFKQRORJLVWDQG(QWUHSUHQHXU Chris Sloan 6KDUHKROGHUDW%DNHU'RQHOVRQ Adam Solesby 'LUHFWRURI7HFKQRORJ\$2/ -DFN:DGGH\ )RXQGLQJ0HPEHU:DGGH\ 3DWWHUVRQ3& -RKQ:DUN (QWUHSUHQHXU(GXFDWRU&RQVXOWDQW Marcus Whitney &KLHI7HFKQRORJ\2IÃ&#x20AC;FHU0RRQWRDVW %UHQGDQ:RYFKNR 'LUHFWRURI7HFKQRORJ\,QWHUR$OOLDQFH

&KULV0F,QW\UH0LFKDHO%XUFKDP0DUFXV:KLWQH\9LF*DWWR

&$7$/<67

























3$*(


TECH WORKFORCE DEVELOPMENT Collaborative Effort to Address the Tech Workforce Issue in Middle Tennessee /L]D/RZHU\0DVVH\Â&#x2021;1DVKYLOOH7HFKQRORJ\&RXQFLO $VRIIRXUWKTXDUWHUUHVHDUFKVKRZVWKDWWKDW0LGGOH7HQQHVVHHKDVDSSUR[LPDWHO\1,044 open technology related positions7KLVQXPEHULVXSIURPWKHSUHYLRXVTXDUWHUGRZQVOLJKWO\  RYHUWKHIRXUWKTXDUWHURI7KH QXPEHURIWHFKUHODWHGMRERSHQLQJVKDYHEHHQKRYHULQJEHWZHHQDQGVLQFHWKHQGTXDUWHURI²D VWURQJLQGLFDWRURIWKHVWUHQJWKRI0LGGOH7HQQHVVHH·VEXVLQHVVVHFWRU$VHFRQRPLFFRQGLWLRQVLPSURYHDFURVVWKHFRXQWU\ 0LGGOH7HQQHVVHHZLOOH[SHULHQFHDQHYHQODUJHUJDSEHWZHHQWKHQXPEHURIDYDLODEOHWHFKMREVDQGDVNLOOHGZRUNIRUFH WRÃ&#x20AC;OOWKHP 7KHVWDNHKROGHUVLPSDFWHGE\WKHVKRUWDJHRIDVNLOOHGWHFKZRUNIRUFHDUHQXPHURXVDQGFURVVDOOVHFWRUVRISULYDWH LQGXVWU\DVZHOODVWKHSXEOLFVHFWRUDQGHGXFDWLRQ2UJDQL]DWLRQVVXFKDVWKHNashville Technology Council, Nashville Area Chamber of Commerce, and economic agencies for Metro Nashville and the State of Tennessee are important VWDNHKROGHUVWRRDVWKLVUHJLRQ·VHFRQRPLFKHDOWKLVGHSHQGHQWXSRQDVNLOOHGWHFKZRUNIRUFHWRVXSSRUWRXUFRPSDQLHVDQG keep them here. 7KH17&LGHQWLÃ&#x20AC;HG,7ZRUNIRUFHGHYHORSPHQWDVDSULRULW\VHYHUDO\HDUVDJRDQGLQODXQFKHGWKH7XUQLQJWKH7LGH RI7HFKQRORJ\ 7 LQLWLDWLYHWRUDLVHDZDUHQHVVLQWKHVWXGHQWFRPPXQLW\RIWKHPDQ\RSSRUWXQLWLHVLQWHFKQRORJ\UHODWHG careers, enhance technology related academic programs so that they more closely match the needs of the technology VHFWRUDQGSURYLGHFDUHHURSSRUWXQLWLHVWRPHHWWKHZRUNIRUFHQHHGVRI0LGGOH7HQQHVVHH7KLVLQLWLDWLYHKDVEHHQ VXFFHVVIXOLQIDFLOLWDWLQJHVWDEOLVKPHQWRI$GYLVRU\%RDUGVLQQXPHURXVXQLYHUVLWLHVDQGODXQFKLQJD)LUVW&DPSWRJHWKLJK VFKRROVWXGHQWVLQWHUHVWHGLQWHFKFDUHHUV$FFRUGLQJWR-RKQ.HSOH\&KDLURIWKH17&7&RPPLWWHH7KHLPSDFWRIWKLV LQLWLDWLYHLVMXVWEHJLQQLQJWREHVHHQDQGZLOOLQFUHDVHRYHUWLPH2UJDQLFDOO\JURZLQJDSLSHOLQHRIWHFKZRUNHUVLVD YLVLRQDU\ORQJWHUPVROXWLRQIRUGHYHORSLQJWKHZRUNIRUFHQHFHVVDU\WRVXSSRUW1DVKYLOOH·VWHFKFRPPXQLW\ 6NLOOHG,7ZRUNHUVDUHHVSHFLDOO\QHHGHGLQ1DVKYLOOH·VKHDOWKFDUHLQGXVWU\ According to Ralph Schulz3UHVLGHQWDQG&(2RIWKH1DVKYLOOH$UHD&KDPEHU of Commerce, ":RUNIRUFHGHYHORSPHQWLVDNH\JRDOIRUWKH&KDPEHUDQG talent development is one of the four strategic drivers for the Partnership 2020 strategic plan,QDQGWKH1DVKYLOOH7HFKQRORJ\&RXQFLO DQGWKH1DVKYLOOH&KDPEHUSDUWQHUHGZLWKWKH1DVKYLOOH+HDOWK&DUH&RXQFLO WRIRFXVRQWKHWDOHQWQHHGVVSHFLÃ&#x20AC;FDOO\IRUKHDOWKFDUH,77KHJURXS HYDOXDWHGVKRUWDQGORQJWHUPSODQVWRUHFUXLWDQGJURZDVWURQJHUSLSHOLQH RIKHDOWKFDUH,7WDOHQWIRUWKH1DVKYLOOHUHJLRQ)RUXPVZHUHKHOGWREULQJ WRJHWKHUHPSOR\HUVDQGHGXFDWRUVWRLGHQWLI\QHHGVDQGSURYLGHPHWKRGVIRU WKHPWRZRUNWRJHWKHUDQGFROODERUDWH6RPHUHODWHG+,7GHJUHHSURJUDPV KDYHDOUHDG\EHHQGHYHORSHGRUH[SDQGHGDVDUHVXOWRIWKLVFROODERUDWLRQ $ZKLWHSDSHUUHOHDVHGLQ6HSWHPEHUDWWKH7HQQHVVHH+,006 FRQIHUHQFHLQ1DVKYLOOH71RXWOLQHVWKHÃ&#x20AC;QGLQJVDQGIXWXUHSODQVQHHGHGWR meet the health care-related talent needs. 7KH17&1DVKYLOOH&KDPEHU6WDWH·V'HSDUWPHQWRI(FRQRPLFDQG&RPPXQLW\'HYHORSPHQWDQGWKH0D\RU·V2IÃ&#x20AC;FHRI (FRQRPLFDQG&RPPXQLW\'HYHORSPHQWDUHZRUNLQJWRJHWKHUZLWKRWKHUDJHQFLHVDQGORFDOFRPSDQLHVWRGHYHORSDQG H[HFXWHRQDVWUDWHJ\WRPHHWWKHLPPHGLDWHDQGORQJWHUPQHHGVRIRXUUHJLRQ·VHPSOR\HUV7KHFROODERUDWLYHHIIRUW LQFOXGHVGRFXPHQWLQJWKHDUHD·VDVVHWV²LQLWLDWLYHVDQGSURJUDPVUHODWHGWRWHFKWDOHQWUHFUXLWPHQWDQGGHYHORSPHQWDQG REWDLQLQJDQGDQDO\]LQJGDWDUHJDUGLQJWKHVXSSO\DQGGHPDQGIRUWHFKZRUNHUV7KHVHDFWLYLWLHVZLOODOORZWKHJURXSWR

&$7$/<67

























3$*(


LGHQWLI\JDSVLQRXUFROOHFWLYHHIIRUWVDQGFUHDWHRUHQFRXUDJHFUHDWLRQRISURJUDPVDQGLQLWLDWLYHVWRÃ&#x20AC;OOWKHJDSV in RUGHUWRLQFUHDVHWKHUHJLRQ·VSRRORIVNLOOHGWHFKZRUNHUV $IWHUVWXG\LQJWKHLVVXHDQGWKHLQLWLDWLYHVLQSODFHRUEHLQJGLVFXVVHG,UHDOL]HGWKDWZHQHHGDIRXUSURQJHGVWUDWHJ\ WRDGGUHVVWKLVUHJLRQ·VWHFKZRUNIRUFHQHHGV7KHIRXUSURQJVEHLQJ²RUJDQLFDOO\JURZLQJDSLSHOLQHRIWHFKZRUNHUV WDUJHWHGWDOHQWUHFUXLWPHQWDFFHOHUDWHGWHFKVNLOOVGHYHORSPHQWDQGPDLQWHQDQFHRIWHFKVNLOOV," states Liza Lowery 0DVVH\17&3UHVLGHQWDQG&(27KHHIIRUWVWRRUJDQLFDOO\JURZWKHSLSHOLQHRIWHFKZRUNHUVWKURXJKRXUHGXFDWLRQDO V\VWHPZLOOFRQWLQXHWREHOHGE\WKH17&WKURXJKLWVWHFKZRUNIRUFHGHYHORSPHQWFRPPLWWHHOHGE\John Kepley 7HNQHWH[ DQGKent Fourman 3HUPDQHQW*HQHUDO&RPSDQLHV,QF 7DUJHWHGWDOHQWUHFUXLWPHQWZKLFKLGHQWLÃ&#x20AC;HVDQG H[SORLWVDUHDVZLWKKLJKOHYHOVRIXQHPSOR\PHQWDQGXQGHUHPSOR\PHQWRIWHFKZRUNHUVWRHQFRXUDJHWKHPWRUHORFDWH WR0LGGOH7HQQHVVHHZLOOEHOHGE\WKH1DVKYLOOH&KDPEHU$FFRUGLQJWRJanet Miller, Chief Economic Development and 0DUNHWLQJ2IÃ&#x20AC;FHUDWWKH1DVKYLOOH&KDPEHU7KH&KDPEHULVXQLTXHO\SRVLWLRQHGWRDGGUHVVIRFXVHGWDOHQWUHFUXLWPHQW :HDUHLQFUHDVLQJRXUHIIRUWVLQWKLVDUHDLQFOXGLQJXVLQJVWUDWHJLHVVLPLODUWRWKRVHWKDWKDYHSURYHQWREHYHU\VXFFHVVIXO LQUHFUXLWLQJEXVLQHVVHVWRWKHUHJLRQ 3URJUDPVWRTXLFNO\SURGXFHVNLOOHG,7ZRUNHUVDUHEHLQJLGHQWLÃ&#x20AC;HGDQGHQFRXUDJHGE\WKHJURXS7KHVHSURJUDPV WDUJHWXQGHUHPSOR\HGZRUNHUVZLWKWHFKWDOHQWVDQGWKRVHZKRGHVLUHWRSXUVXHQHZFDUHHUSDWKV3URJUDPVWRWUDLQWKHVH SRWHQWLDOWHFKZRUNHUVDUHEHLQJSODQQHGDQGSURYLGHGE\QRQSURÃ&#x20AC;WDQGIRUSURÃ&#x20AC;WDJHQFLHVDQGWUDGLWLRQDOLQVWLWXWHVRI KLJKHUHGXFDWLRQ)LQDOO\SURJUDPVWRHQVXUHWKDWWHFKZRUNHUVUHPDLQXSWRGDWHZLWKWKHLUVNLOOVDUHWKHIRXUWKDUHDLQ WKHVWUDWHJ\7RDGGUHVVVNLOOVFXUUHQF\17&LVUHYLVLQJDQGUHYLYLQJLWVSURIHVVLRQDOGHYHORSPHQWSURJUDPWRDGGUHVVWKLV IRXUWKDUHDRIWKHVWUDWHJ\XQGHUOHDGHUVKLSRIFRFKDLUV6KHLOD6WHUQ +&$ DQG7DPL2UUDQJH 7HNQHWH[  7KHLVVXHGLGQRWDULVHRYHUQLJKWDQGLWZLOOQRWEHVROYHGWKDWTXLFNO\HLWKHU7KHFROOHFWLYHOHDGHUVKLSRIWKH17& 1DVKYLOOH&KDPEHUDQG(FRQRPLFDQG&RPPXQLW\'HYHORSPHQWDJHQFLHVIRU1DVKYLOOHDQGWKH6WDWHRI7HQQHVVHHDORQJ ZLWKLQSXWDQGVXSSRUWRIRXUUHJLRQV·EXVLQHVVHVDQGHGXFDWLRQLQVWLWXWLRQVZLOOJRIDULQWXUQLQJWKHWLGH

"Organically growing a pipeline of tech workers is a visionary, long term solution for developing the workforce necessary to VXSSRUW1DVKYLOOH·VWHFKFRPPXQLW\-RKQ.HSOH\

      

 $%"!%&$ $" $%"!&$"- $%"!&$" $&%$%$(



      $%#&"$ &$%$&%!!*+% &$" &$&!$%&$'&'$!$& "$ !%&!%"! !!($"$ " !

 $%% $$'& %(      ,)))) #"  



    

 

&$7$/<67


























SOCIAL MEDIA Belmont University and Nashville Technology Council Get Social 6WHYH&KDQGOHUÂ&#x2021;ZZZFKDQGOHUWKLQNVZRUGSUHVVFRP 7KLVSDVW$XJXVW-DVRQ(ONLQV3DUWQHURI7UDQVSDUHQW 6RFLDO0HGLDMRLQHGPHDVDQDGMXQFWSURIHVVRUDW %HOPRQW8QLYHUVLW\7KHVFKRRODSSURDFKHGXVDERXW WHDFKLQJWKHĂ&#x20AC;UVWHYHUVRFLDOPHGLDFRXUVHLQWKH0DVVH\ 6FKRRORI%XVLQHVV 1HHGOHVVWRVD\ZHLPPHGLDWHO\KDGWREUHDNDIHZ traditional rules: 5XOHEUHDN1RWH[WERRNV7KHYHU\QRWLRQRIKDYLQJ DWH[WERRNRQVRFLDOPHGLDLVIXQQ\%\WKHZD\%HOPRQW UHTXLUHVD\HDUWULDOSHULRGRIDWH[WERRNEHIRUH RIĂ&#x20AC;FLDOO\DGRSWLQJLW5HDOO\"1RWLQWKLVFODVV:H¡UH XVLQJ*RRJOH0DVKDEOHEORJVDQGWKHXOWLPDWHXQLYHUVLW\ classroom killer - Wikipedia. 5XOHEUHDN<RXPXVWWZHHWLQFODVV+XK",WZDVDQ LGHDWKDWGUHZVWDUHVDQGDIHZJDVSVDPRQJWKHIDFXOW\ ´7ZHHWLQJDQG)DFHERRNDOORZHGLQDFODVVURRP+RO\ distractions!â&#x20AC;? Why not?:HZHUHHPEDUNLQJRQWKHĂ&#x20AC;UVWHYHUVRFLDO PHGLDPDUNHWLQJFODVVIRUWKH%HOPRQW8QLYHUVLW\ 0DVVH\6FKRRORI%XVLQHVV,IZHDUHJRLQJWRcreate an environment that fosters the principles of social mediaVXFKDVVKDULQJDQGFRPSOHWHWUDQVSDUHQF\ then live in-class tweeting was fair game. In fact, we GHVLJQDWHGDQRIĂ&#x20AC;FLDOVWXGHQWUHSUHVHQWDWLYHWRXSGDWH WKHRIĂ&#x20AC;FLDO)DFHERRNSDJHHDFKFODVVVHVVLRQ2XU7ZLWWHU KDVKWDJZDV%HOPRQW6R0H

-RH&UHZV-HQ0FPDNLQDQG&DURO*UD\

6WHYH&KDQG

OHUDQG-DVR

&$7$/<67

Q(ONLQV













%HOPRQW6WXGHQWV3UHVHQWLQJ7KHLU6RFLDO0HGLD3ODQIRU1DVK+LUH

Real learning requires a real client. 7KDW¡VZKHUHWKH Nashville Technology CouncilMRLQHGLQ:HVHQWRXWD IHZWZHHWVORRNLQJIRUFRPSDQLHVLQWHUHVWHGLQMRLQLQJXV DVDFODVVSURMHFW17&¡VRZQ-HVVLFD+LOO0DUNHWLQJ Coordinator, answered the tweet and along with Leah 0DJHH93RI%XVLQHVV'HYHORSPHQWYROXQWHHUHGWR FUHDWHDUHDOPDUNHWLQJSUREOHPIRUWKHFODVVWRDGGUHVV XVLQJVRFLDOPHGLD1DVK+LUHWKH17&LQLWLDWLYHWREULQJ WHFKQRORJ\MREDSSOLFDQWVWR0XVLF&LW\ZDVWKHFKDOOHQJH 7KHFODVVVSOLWXSLQWRIRXUWHDPVHDFKRXWWRGHYHORSD VRFLDOPHGLDSODQIRU1DVK+LUHV/LYHSUHVHQWDWLRQVZHUH given to present each plan with ideas ranging from large EUDQGLQJFKDQJHVWR7ZLWWHUFRQWHVWV7KHVWXGHQWVDSSOLHG UHDOOHDUQLQJWRDUHDOPDUNHWLQJSUREOHPDQGWKH17& UHFHLYHGPRUHLGHDVWKDQ\RXFDQVKDNHDWZHHWDW7KH ZLQQLQJVWXGHQWWHDPZDVDOVRUHFRJQL]HGDWWKHUHFHQW 1DVKYLOOH7HFKQRORJ\$ZDUGV*DODDWWKH6FKHUPHUKRUQ 3HUKDSVWKHPRVWLPSRUWDQWOHVVRQOHDUQHGIURPWKLVSURMHFW is that social media is becoming a real function of PDUNHWLQJVWDUWLQJLQWKHFODVVURRP7KHPDUNHWLQJZRUOG can no longer accept hiring interns that do not have an eye IRUPDUNHWLQJĂ&#x20AC;UVW7REHWUXO\HIIHFWLYHLWPXVWEHD priority of marketing. Having social media as part of PDUNHWLQJFXUULFXOXPLVDVWHSLQWKHULJKWGLUHFWLRQ













3$*(


5

TOP FIVE TOP FIVE TOP FIVE

DIGITAL CITIES

TOP FIVE

TOP FIVE

MAJORS IN NASHVILLE 2011

+RQROXOX+DZDLL 6HDWWOH:DVK 3. Nashville $XURUD&ROR WLH

&KLFDJR,OO WLH

&RUSXV&KULVWL7H[DV

%XVLQHVV0DQDJHPHQW 2. General Technology 9LVXDO&RPPXQLFDWLRQV 3ROLFH6FLHQFH &RPSXWHU1HWZRUNLQJ Technology

6RXUFH7KH&HQWHUIRU'LJLWDO*RYHUQPHQW

6RXUFH1DVKYLOOH6WDWH&RPPXQLW\&ROOHJH

TECH HIRING COMPANIES IN MIDDLE TN

TOP FIVE

+&$ +06 9DQGHUELOW &+6 'HORLWWH

TECHNOLOGIES 2011

&ORXGFRPSXWLQJ 0RELOHDSSVDQGPHGLDWDEOHWV 1H[WJHQDQDO\WLFV 6RFLDODQDO\WLFV 6RFLDOFRPPXQLFDWLRQDQG FROODERUDWLRQ

6RXUFH17&-REV'DWD

38%/,&&203$1,(6,1 NASHVILLE

6RXUFH*DUWQHU

1. Tractor Supply Co 1$6'$476&2

2. HealthSpring Inc 1<6(+6

Dollar General Corp 1<6('*

Genesco Inc 1<6(*&2 * &UDFNHU%DUUHO2OG&RXQWU\6WRUH Inc 1$6'$4&%5/

TOP FIVE

5(&58,7('7(&+ POSITIONS IN MIDDLE TN

6RXUFH1DVKYLOOH%XVLQHVV-RXUQDO

1. Developer 2. Analyst 7HFK0DQDJHPHQW 1:(QJLQHHU 'DWDEDVH5HODWHG 6RXUFH17&-REV'DWD

&$7$/<67

























3$*(


HEALTHCARE PRIVACY AND SECURITY Keeping Electronic Health Care Information Private and Secure /L]D/RZHU\0DVVH\Â&#x2021;1DVKYLOOH7HFKQRORJ\&RXQFLO 'XHWRWKHHYHULQFUHDVLQJGLJLWL]DWLRQLQWHJUDWLRQDQGVKDULQJRIKHDOWKLQIRUPDWLRQKHDOWKFDUHFRPSDQLHVDUHVWUXJJOLQJ ZLWKKRZWRUHPDLQLQFRPSOLDQFHZLWKWKH+HDOWK,QVXUDQFH3RUWDELOLW\DQG$FFRXQWDELOLW\$FW +,33$ WKH+HDOWK,QIRUPDWLRQ 7HFKQRORJ\IRU(FRQRPLFDQG&OLQLFDO+HDOWK +,7(&+ $FWDQGRWKHUIHGHUDODQGVWDWHOHJLVODWLRQZKHQWKHLUHOHFWURQLFUHFRUGV DUHVKDUHGDPRQJEXVLQHVVDVVRFLDWHVEven if a company is compliant, how do they ensure that their data sharing partners are in compliance?7KLVLVVXHLVEHFRPLQJVRDFXWHWKDWWKH1DVKYLOOH7HFKQRORJ\&RXQFLOLVFRQYHQLQJH[SHUWVIURPKHDOWKFDUH DXGLWLQJVWDQGDUGVDQGFRPSOLDQFHRUJDQL]DWLRQVWRGLVFXVVWKHVHLVVXHVDQGGHYHORSDZKLWHSDSHUFRQWDLQLQJEHVWSUDFWLFHV and recommendations. 7KHHealth Care IT Privacy and Security ConsortiaXQGHUZULWWHQE\KPMG, is VFKHGXOHGWREHJLQLQ0DUFKDQGLQFOXGHVDKDOIGD\V\PSRVLXPVHYHUDO VXEVHTXHQWURXQGWDEOHGLVFXVVLRQVDQGGHYHORSPHQWRIDZKLWHSDSHUWRDGGUHVV KRZWKHKHDOWKFDUHFRPPXQLW\FDQHQVXUHWKDWSURWHFWHGKHDOWKLQIRUPDWLRQLVNHSW SULYDWHDQGVHFXUHHYHQZKHQLWLVQRWXQGHUWKHLUFRQWURO17&EHOLHYHVWKHHYHQW ZLOODWWUDFWWKRXJKWOHDGHUVIURPDOODUHDVRIKHDOWKFDUH²SURYLGHUVKHDOWKSODQV SD\HUVHWFDQGRWKHULQWHUHVWHGSDUWLHVVXFKDVSURYLGHUVRIOHJDODQGFRQVXOWLQJ VHUYLFHVDQGKHDOWKVRIWZDUHSURYLGHUV7KHJRDORIWKHHIIRUWLVWRproduce a body of ZRUNWKDWDGGUHVVHVWKHFRPSOLDQFHLVVXHVIDFHGE\WKHKHDOWKFDUHLQGXVWU\.

Even if a company is FRPSOLDQWKRZGRWKH\ ensure that their data sharing partners are in compliance?

2QHDSSURDFKWREHFRQVLGHUHGDVDPRGHOIRUWKHJURXSLV3&,VWDQGDUGV2IÃ&#x20AC;FLDOO\WLWOHGWKH3D\PHQW&DUG,QGXVWU\'DWD 6HFXULW\6WDQGDUGV 3&,'66 WKHFRPSOLDQFHJXLGHOLQHVZHUHGHYHORSHGE\WKH3&,6HFXULW\6WDQGDUGV&RXQFLOWRSURWHFWFDUG KROGHUV·GDWD&RPSOLDQFHLVUHYLHZHGDQQXDOO\WKURXJKDQH[WHUQDODXGLWRUDVHOIDVVHVVPHQWSURFHVV7KHVWDQGDUGVDUHQRW OHJLVODWLYHO\HQDFWHGRUHQIRUFHG7KHPDUNHWSD\PHQWFDUGSURYLGHUVLQWKLVFDVHLVVHOIUHJXODWLQJWRSURWHFWFRQVXPHUGDWD 7HQQHVVHH·V&RQJUHVVPDQ0DUVKD%ODFNEXUQDJUHHVZLWKWKLVW\SHRIDSSURDFK,ZDQWWRHQVXUHWKDWZH>JRYHUQPHQWDQG LQGXVWU\@ZRUNWRJHWKHUWRSURWHFWFRQVXPHUVZKLOHDWWKHVDPHWLPHJXDUGLQJDJDLQVWJRYHUQPHQW·VLPSXOVHWRRYHUUHJXODWH

Technology and HealthSpring... a Leading Combination.

&$7$/<67

Follow Us:

























3$*(


&RQJUHVVPDQ%ODFNEXUQVWDWHGDWD3ULYDF\DQG6HFXULW\5RXQGWDEOHVKHKHOGLQ1DVKYLOOHLQ1RYHPEHU7KHURXQGWDEOH ZKLFKZDVFRKRVWHGE\WKH17&DQG(QWUHSUHQHXU&HQWHUEURXJKWWRJHWKHUEXVLQHVVSURIHVVLRQDOVHGXFDWRUVDQGJRYHUQPHQW RIÃ&#x20AC;FLDOVWRGLVFXVVVHFXULW\DQGSULYDF\FRQFHUQVDQGZKDWWKH\EHOLHYHWKHUROHRIJRYHUQPHQWVKRXOGEHLQUHJXODWLQJKLJKWHFK $FFRUGLQJWR.\OH'XNH+HDOWK6SULQJ·V&KLHI,QIRUPDWLRQ6HFXULW\2IÃ&#x20AC;FHU :HFDQEXLOGWKHEHVWLQWHUQDOVHFXULW\SURJUDPLQWKHZRUOGDQGVWLOO VXIIHUDQGEHKHOGDFFRXQWDEOHIRUDEUHDFKDWWKHKDQGVRIRQHRIRXU EXVLQHVVSDUWQHUV.\OHJRHVRQWRH[SODLQWKDW+,7(&+UHJXODWLRQVPDNH LWLPSRUWDQWWKDWEXVLQHVVDVVRFLDWHVZLWKZKRPSURWHFWHGKHDOWK LQIRUPDWLRQLVVKDUHGLPSOHPHQWWKHVDPHVHFXULW\PHDVXUHVWKDW +HDOWK6SULQJ²DFRYHUHGHQWLW\²KDVLQSODFH

10 REASONS WE NEED E-HEALTH RECORDS

3UHYHQW0HGLFDO(UURUV 0DLQWDLQ0RUH&RPSUHKHQVLYH0HGLFDO Records In Less Space

7KH+,7(&+$FWHQDFWHGDVSDUWRIWKHIHGHUDOJRYHUQPHQW·V$PHULFDQ 5HFRYHU\DQG5HLQYHVWPHQW$FW $55$ RILVLQWHQGHGWRVWLPXODWH LPSOHPHQWDWLRQRIHOHFWURQLFKHDOWKUHFRUGV (+5 DQGDGGUHVVHVSULYDF\ DQGVHFXULW\IRUWKHWUDQVPLVVLRQRI(+5$VVXFKLWH[SDQGVSULYDF\DQG security protections enacted under HIPAA. It also increases enforcement DQGOHJDOOLDELOLW\IRUQRQFRPSOLDQFH+,7(&+LQFOXGHVLQFHQWLYHVWR LPSOHPHQW(+5DVZHOODVQHZQRWLÃ&#x20AC;FDWLRQUHTXLUHPHQWVIRUFRYHUHG HQWLWLHVEXVLQHVVDVVRFLDWHVYHQGRUVDQGRWKHUUHODWHGRUJDQL]DWLRQV ZKHQEUHDFKHVRIXQVHFXUHGSURWHFWHGKHDOWKLQIRUPDWLRQ 3+, RFFXU +,7(&+DOVRH[WHQGVGLVFORVXUHUHTXLUHPHQWVIRU(+5DQGVKRUWHQVWKH WLPHSHULRGIRUDFFRXQWLQJIRUGLVFORVXUHVRISDWLHQWV·KHDOWKLQIRUPDWLRQ 3DWLHQWVFDQDOVRUHTXHVWDFRS\RIWKHLU(+5LIWKHSURYLGHUKDVDQ(+5 V\VWHP:KLOHWKHLQWHQWRI+,7(&+LVWRLQFUHDVHDGRSWLRQRI(+5LWDOVR increases complexity and potentially costs for health care companies.

5HGXFH5HSHDW0HGLFDO7HVWV &XW:DVWHDQG6DYH0RQH\ 6SHHG8S3DWLHQW&DUH &UHDWH0RUH-REV ([SDQG3DWLHQWV·$FFHVVWR7KHLU2ZQ0HGLFDO Records .HHS3DWLHQWV2Q7UDFN &RPSLOHWKH0RWKHU/RGHRI0HGLFDO5HVHDUFK 3UHYHQW0HGLFDO3UREOHPV)URPWKH*HW*R

(YHQWKRXJKWKH\FRXOGEHKHOGUHVSRQVLEOHIRUEUHDFKHVWKDWEXVLQHVV KWWSQHZVGLVFRYHU\FRPWHFKUHDVRQVHOHFWURQLFKHDOWKUHFRUGVKWPO DVVRFLDWHVVXIIHUZKHQSURWHFWHGKHDOWKLQIRUPDWLRQLVLQYROYHGLWLVQRW UHDOLVWLFIRU+HDOWK6SULQJRUDQ\RWKHUKHDOWKFDUHFRPSDQ\WRWKRURXJKO\ DXGLWHYHU\RQHRIWKHLUSOXVGDWDWUDGLQJSDUWQHUV$GGLWLRQDOO\ PDQ\RIWKHGDWDWUDGLQJSDUWQHUVZRUNLQJZLWK+HDOWK6SULQJDUHWKHVDPH GDWDWUDGLQJSDUWQHUVZRUNLQJZLWKRWKHUFRYHUHGHQWLWLHVKHUHLQ1DVKYLOOH7KHVHGDWDWUDGLQJSDUWQHUVdo not want to go through different audit processes for each and every partnerHLWKHU:LWKWKDWVFHQDULRDVDEDFNGURSWKRXJKWOHDGHUVLQWKH ORFDOKHDOWKFDUHLQGXVWU\EHOLHYHWKDWFRPSDQLHVFDQZRUNWRJHWKHUWRincrease security, compliance and assurance while limiting the cost and disruption of multiple audits of the same entities,EHOLHYHWKDWWKHJUHDWKHDOWKFDUHLQQRYDWRUVKHUH LQ1DVKYLOOHFDQGHÃ&#x20AC;QHWKHVWDQGDUGVWREXLOGDPRUHVHFXUHFRPSOLDQWDQGSUDFWLFDOKHDOWKFDUH,7HQYLURQPHQWWKDWFDQVHUYH DVDPRGHOIRUWKHUHVWRIWKHFRXQWU\VWDWHV.\OH:HDJUHH

Based in Nashville, HealthSpring is one of the countryâ&#x20AC;&#x2122;s largest and fastest-growing coordinated care plans with

OVER 200 IT PROFESSIONALS and growing. Serving members from Houston to Baltimore, HealthSpring is setting the standard for information

Healthspring Ad

technology in the healthcare industry. Itâ&#x20AC;&#x2122;s an exciting place to be for IT professionals wanting more. At HealthSpring, we build a deep understanding of our members and how to deliver the care they need. Thatâ&#x20AC;&#x2122;s why we

Learn more at:

partner with doctors and provide them with extra tools to give

www.healthspring.com

our members the time, attention, and quality care they deserve.

&$7$/<67  model, but an uncommon   practice.  Itâ&#x20AC;&#x2122;s a common-sense















3$*(


TECH FACTS 160 billion emails are sent daily, 97% of which are spam.

2QDYHUDJHWKHUHDUHPRUHWKDQ 400 tweets per minute containing a

<RX7XEHOLQN

one

1 response to every 12 million emails

*RRJOHKDQGOHVDERXW

6SDPPHUVJHW

billion VHDUFKTXHULHVSHUGD\

they send. Each person receives 26.4 e-mails a day on average.

www.symbolics.comZDVWKHÃ&#x20AC;UVW domain name registered online.

51%

'XULQJWKHKROLGD\VHDVRQ of shoppers used their mobile device to help make an in-store SXUFKDVHGHFLVLRQ

Almost half the people online have at least

THREE HPDLODFFRXQWV

All three letterZRUGFRPELQDWLRQV

97%RIPRELOHVXEVFULEHUVZLOO

from aaa.com to zzz.com are

read a text message within 15

already registered as

84 %

minutes of receiving it; will respond within 1 hour.

domain names.

10,000

0LFURVRIW+ROGV2YHU

Patents

1972

In 5D\7RPOLQVRQVHQWWKH Ã&#x20AC;UVWHPDLO

Al Pacinoâ&#x20AC;&#x2122;s Face was on the

original )DFHERRN+RPHSDJH 6RXUFHV KWWSZZZNQRZOHGJHEDVHVFULSWFRPGHPRDUWLFOHKWPO KWWSGLG\RXNQRZRUJIDVWIDFWVWHFKQRORJ\ KWWSZZZVWUDWHJLFJURZWKFRQFHSWVFRPJURZWKPRELOHWHFKQRORJ\IDFWVKWPO KWWSPDVKDEOHFRP

&$7$/<67

























3$*(


Top 10 Most Viral News Stories of 2011 1. Satellite Photos of Japan%HIRUHDQG$IWHUWKH4XDNH DQG7VXQDPL 1HZ<RUN7LPHV

2. What teachers really want to tell parents &11

No, your zodiac sign hasnâ&#x20AC;&#x2122;t changed &11

3DUHQWVGRQ¡WGUHVV\RXUJLUOVOLNHWUDPSV &11

 YLGHR ²Father Daughter Dance Medley <DKRR

At funeral, dog mourns the death of Navy SEAL NLOOHGLQ$IJKDQLVWDQ <DKRR

7. <RX¡OOIUHDNZKHQ\RXVHHWKHQHZ)DFHERRN &11

Dog in Japan stays by the side of ailing friend in the rubble <DKRR

Giant crocodile captured alive in Philippines <DKRR

10. New Zodiac Sign Dates: Ophiuchus The 13th Sign?  7KH+XIĂ&#x20AC;QJWRQ3RVW

1300 percent

TwitterKDGDPRQWKO\JURZWK RIXVHUV RIRYHU

123456 is the all-time most popular email password 7KHĂ&#x20AC;UVWLWHP listed on eBay was a

EURNHQODVHUSRLQWHU

Secret Easter Egg

7KHFirst iPod+DG$ DJDPHWKDWFRXOGEH DFFHVVHGLI\RXNQHZWKHULJKWFRPELQDWLRQRIEXWWRQVWRSUHVV

&$7$/<67

























3$*(


BUSINESS CONTINUITY PLANNING Protect What You Have As Best You Can 5REHUW3UHLQLQJHUÂ&#x2021;ZZZVXUYLYDOSDUWQHUVEL]

8QFHUWDLQW\:HDOOKDYHWRGHDOZLWKLWHYHU\GD\LQRXU personal and professional life. 3URGXFWLRQZRUNHUVPDQDJHUVDQGH[HFXWLYHVDOOVKDUHD FRPPRQWKUHDWWRWKHLUSK\VLFDODQGĂ&#x20AC;QDQFLDOZHOOEHLQJ 7KHZRUOGLVDULVN\SODFHWROLYHDQGLIWKDWZDVQ¡WEDG HQRXJKDGGWRDULVN\ZRUOGWKHIDFWWKDWWLPHQHYHU stands still. 7KUHDWVWRIDPLO\EXVLQHVVDQGRXUQDWLRQDUHFRQWLQXDOO\ evolving in complexity, emerging from ever changing QDWXUDOWHFKQRORJLFDODQGPDQPDGHSRLQWVRIRULJLQ So what can be done to protect what is important to us?

$QVZHUVWRWKHVHTXHVWLRQVDOORZWKHEXVLQHVVFRQWLQXLW\ planning team to determine the exact content of the plan, LWVFRVWDQGKRZLWZLOOEHLPSOHPHQWHGGRFXPHQWHGDQG maintained. :KLOHWKLVDOOPD\VRXQGDELWLQWLPLGDWLQJLPDJLQHD VLWXDWLRQZKHUHWZRHTXDOFRPSDQLHVH[SHULHQFHDQ LGHQWLFDOEXVLQHVVGLVUXSWLQJHYHQW2QHFRPSDQ\KDVD FRQWLQXLW\SODQDQGWKHRWKHUGRHVQRW:KLFK FRPSDQ\LVPRUHOLNHO\WRPDLQWDLQFDVKĂ RZUHWXUQWR QRUPDOIDVWHUDQGUHWDLQWKHFRQĂ&#x20AC;GHQFHRILWV HPSOR\HHVDQGNH\VWDNHKROGHUV"Which company would you rather be?

No business can be completely secure without a plan in place to continue operations in an emergency. ,QFRUSRUDWLQJDEXVLQHVVFRQWLQXLW\SODQDQGHQFRXUDJLQJD FXOWXUHRIUHVLOLHQF\ZLOOKHOSSURWHFW\RXUHPSOR\HHV FXVWRPHUVDQGEXVLQHVVIURPĂ&#x20AC;QDQFLDOPLVIRUWXQHRUZRUVH

$JRRGWHDPDORQJZLWKDJRRGSODQDQGFRQĂ&#x20AC;GHQFHLQERWKJLYHV \RXUEXVLQHVVLWVEHVWRGGVRIVXUYLYLQJDQHPHUJHQF\HVSHFLDOO\ LQXQFHUWDLQHFRQRPLFWLPHV

&RQWLQXLW\SODQQHUVPD\HPSOR\YDULRXVPHWKRGVEXWWKH\ DOOWUHQGWRZDUGRQHXQGHUO\LQJREMHFWLYH3URWHFWZKDW \RXKDYHDVEHVWDV\RXFDQZKHUHYHU\RXFDQDQGE\DQ\ OHJDOPHDQVWKDW\RXFDQDIIRUG

'RQ¡WOHWWKHSRWHQWLDOLQYHVWPHQWRIWLPHPRQH\DQG UHVRXUFHVVFDUH\RXDZD\IURPWDNLQJWKHDGGLWLRQDO steps necessary to protect employees, operations and VWDNHKROGHULQWHUHVWVIURPIRUHVHHDEOHULVNV7KHJRRG QHZVLVWKDWSURFHVVLPSURYHPHQWVXQFRYHUHGZKLOH EXLOGLQJ\RXUSODQFDQRIWHQSD\IRUWKHSODQQLQJSURMHFW and then some.

(IIHFWLYHEXVLQHVVFRQWLQXLW\SODQQLQJUHTXLUHVDQ REMHFWLYHVWUXFWXUHGDSSURDFKWRDVNLQJPDQDJHPHQW WHDPVFXVWRPHUVHPSOR\HHV\RXUVHOIDQGRWKHUV Â&#x2021;:KDWLVFULWLFDOO\LPSRUWDQWIRUXVWRSURWHFWRUKDYH DYDLODEOHZKHQQHHGHG" Â&#x2021;:KDWULVNVWKUHDWHQWKHDVVHWVRUFDSDELOLWLHVLGHQWLĂ&#x20AC;HG DVLPSRUWDQW" Â&#x2021;+RZZLOOZHEHDIIHFWHGLIRQHRUPRUHRIWKHVHULVNV ZHUHWRKDSSHQ" Â&#x2021;:KHUHFDQZHFUHDWHDSODQWRDYRLGRUPLQLPL]HWKH HIIHFWRIWKHVHULVNVLQWKHHYHQWWKH\DFWXDOO\KDSSHQ"

&$7$/<67













$JRRGWHDPDORQJZLWKDJRRGSODQDQGFRQĂ&#x20AC;GHQFH LQERWKJLYHV\RXUEXVLQHVVLWVEHVWRGGVRIVXUYLYLQJDQ HPHUJHQF\HVSHFLDOO\LQXQFHUWDLQHFRQRPLFWLPHV9LVLW RXUZHEVLWHDWZZZVXUYLYDOSDUWQHUVEL]IRUIUHH UHVRXUFHVWRKHOSJHW\RXVWDUWHGRQWKHURDGWRDIXWXUH of personal and professional resiliency. Robert Preininger is the owner of Business Survival Partners and provides direction and guidance to companies interested in planning for the safety of their employees and surviving threats to their operations. Call or click: 615.878.4342 or support@survivalpartners.biz to learn PRUHDERXWEXVLQHVVFRQWLQXLW\SODQQLQJDQGLWVEHQHĂ&#x20AC;WV













3$*(


www.

What’s the point of your digital strategy? Many companies are aware that digital is a massive opportunity but are unclear about exactly what to do. Deloitte can help you harness the business opportunities created by 2.0. It’s a complex, largely unproven world, and taking the right actions needs the informed guidance of an expert. Make a point of visiting www.deloitte.com

As used in this document, “Deloitte” means Deloitte & Touche LLP, Deloitte Consulting LLP, Deloitte Financial Advisory Services LLP, and Deloitte Tax LLP, which are separate subsidiaries of Deloitte LLP. Please see www.deloitte.com/us/about for a detailed description of the legal structure of Deloitte LLP and its subsidiaries. All services are provided within the rules and regulations applicable under the practice of public accounting.

&$7$/<67







Copyright © 2011 Deloitte Development LLC. All rights reserved. Member of Deloitte Touche Tohmatsu Limited 36 USC 22056




















PLANET OF THE APPS Demand for Mobile Tech is on The Rise 9DQHVVD)U\HÂ&#x2021;&HQWUHVRXUFH

GLJLWDOFDPHUDV³PRVWFRPHZLWKIURQWDQGUHDU facing lenses now, which make it easier than ever to WDNHVHOISKRWRV%\WKHWLPH\RX·UHUHDGLQJ WKLVPRUHDQGEHWWHUFDPHUDDSSOLFDWLRQVZLOOH[LVW to capitalize on.

,QDZRUOGZKHUHPRELOHSKRQHVDUHDQHVVHQWLDOSDUW RIRXUZDUGUREHapplications have become just as vital an accessory.'R\RXOHDYHWKHKRXVHZLWK\RXU NH\ULQJEXWQRW\RXUNH\V" Doubtful.

In addition to the portability and "nifty" factors, why the massive and speedy surge to mobile apps? Three reasons: FRQYHQLHQFHFRQWH[WDQGIXQ

2XUSKRQHVKDYHQRZEHFRPHHYHU\WKLQJIURPRXU ZDOOHWVWRRXU*36V\VWHPDQGSKRWRDOEXPV :KR XVHVWKRVHSODVWLFSKRWRDFFRUGLRQVDQ\PRUH" 7KLVLV ODUJHO\GXHQRWWRWKHQHHGWRWHOHSKRQHIURPDQ\ ORFDWLRQEXWIURPWKHYDOXHDGGHGDSSOLFDWLRQVRU DSSVWKDWQRZSRSXODWHWKHVHGHYLFHV



$SSVKDYHDOVREHHQGHVLJQHGWR create shopping portals6DYY\   UHWDLOHUVKDYHDOVRFDXJKWRQ DQGZRUNWRPDNHWKHLUDSSVERWKIULHQGO\DQG HQWHUWDLQLQJ)RUH[DPSOH7DUJHWUHFHQWO\XSJUDGHG DOOLQVWRUHVFDQQHUVWREHPRELOHVFUHHQUHDG\

:KHQWKHÃ&#x20AC;UVWDSSFDPHRQOLQHLQIHZH[SHFWHG WKHUHVXOWLQJERRPWKDWFRQWLQXHVH[SDQGLQJLQDOO directions even now. $WÃ&#x20AC;UVWLWZDVMXVWFKHFNLQJWKH ZHDWKHURUÃ&#x20AC;QGLQJDPRYLHQRZSKRQHVVWDUWFDUV set thermostats and much more:KHQ\RXSXUFKDVH DSKRQH\RXH[SHFWLWWRFRPHHTXLSSHGZLWKHQRXJK WHFKQRORJ\IRU\RXWRFRPSOHWHWUDQVDFWLRQVWKDWXQWLO UHFHQWO\ZRXOGKDYHUHTXLUHGDFRPSXWHUDQG,QWHUQHW connectivity.



7KHVXFFHVVRIRQOLQHYLDSKRQHSXUFKDVHVKDVEHHQ UHSOLFDWHGE\HGXFDWLRQVRIWZDUHGHYHORSHUVDVZHOO iPads are increasingly used in classroom settings across all grade levels, and in tandem with other WDEOHWVDQGZKLWHERDUGWHFKQRORJ\DUHIDVW UHSODFLQJVWDQGDORQH3&VDVHGXFDWLRQDOSODWIRUPV Developers are creating apps that work with every JUDGHOHYHOQRWWRPHQWLRQWKRVHWKDWFDQEH TXLWH OLWHUDOO\ WDSSHGE\DGXOWOHDUQHUV

7RWKDWHQGGHPDQGLVVXFKWKDWPRELOHWHFKLVIDU RXWSDFLQJDQ\GHYHORSPHQWSODWIRUPWKDWSUHFHGHGLW ,QIDFWVWXGLHVVKRZWKDWRIWKHELOOLRQPRELOHSKRQHV LQWKHZRUOGRYHUELOOLRQRIWKHPDUH¶VPDUW·DQGDSS UHDG\%\PRELOHLQWHUQHWXVDJHZLOOVXUSDVV GHVNWRSLQWHUQHWXVDJHDQGE\RYHURI ORFDOVHDUFKHVDUHGRQHIURPDPRELOHGHYLFH

$OWKRXJKVWLOOLQLWVLQIDQF\VWDJHmobile recruiting LVDQRWKHUQHZRXWOHWLQWKHWHFKZRUOGWKDWZLOOEH WDNLQJRIITXLFNO\&XUUHQWO\RQO\SHUFHQWRI HPSOR\HUVXVHDPRELOHFRPSDWLEOHVLWHIRUMRE SRVWLQJVDQGRQO\SHUFHQWKDYHJRQHZLWKDQDWLYH DSSWKXVOHDYLQJSOHQW\RIURRPIRUJURZWKDQG LQFUHDVHGRSSRUWXQLWLHV

,QDGGLWLRQWRWKHSRUWDELOLW\DQGQLIW\IDFWRUVZK\ WKHPDVVLYHDQGVSHHG\VXUJHWRPRELOHDSSV"7KUHH UHDVRQVFRQYHQLHQFHFRQWH[WDQGIXQ 7DNHIRUH[DPSOHRQHRIWKHPRVWHYROYHGVPDUWSKRQH IHDWXUHVthe camera+HUHDIDPRXVTXRWHKROGV WUXH7KHEHVWFDPHUDLVWKHRQH\RXKDYHZLWK\RX &DPHUDVRQVPDUWSKRQHVDUHFRPSDUDEOHWRVHSDUDWH

&$7$/<67

























3$*(


Currently, only 7 percent of employers use a mobile compatible site for job postings and only 3 percent have gone with a native app, thus leaving plenty of room IRUJURZWKDQGLQFUHDVHGRSSRUWXQLWLHV

STEP 30RQHWL]LQJ\RXUDSSOLFDWLRQLVH[WUHPHO\ important. Deciding whether or not the app will EHIUHHYVSDLGRUIUHHZLWKDGVRUIUHHZLWKRXW ads, a free and a paid version of the app and ZKDWWKHIHDWXUHGLIIHUHQFHVDUHEHWZHHQWKHWZR DUHDOORSWLRQVWKDWZLOOKDYHWREHGHWHUPLQHG EHIRUHGHYHORSPHQWFRPPHQFHV

Build Bigger â&#x20AC;&#x201D; And Better 7KHRSSRUWXQLW\IRUDSSVLVHQGOHVVEXWWKHODQGVFDSHLV OLWWHUHGZLWKGHYHORSHUVZKRZRUNHGWRRIDVWRUGLGQ¡W SURSHUO\WKLQNLWWKURXJK)RUHYHU\VXFFHVVIXODSSWKHUH DUHSOHQW\RIGXGV6RLQVKRUWWKLQNLWWKURXJK

If a free app with ads is chosen, an ad platform ZLOOWKHQQHHGWREHVHOHFWHG7KLVVHOHFWLRQZLOOEH HDVLO\GHWHUPLQHGE\ZKLFKRSHUDWLQJV\VWHP\RX KDYHVHOHFWHG7\SLFDOO\L26XVHVL$GVDQG$QGURLG XVHV$G0REIRUH[DPSOH

2QFHWKHGHFLVLRQKDVEHHQPDGHWREXLOGDQDSSWKH most important next step is creating the development VWUDWHJ\+HUH¡VVL[VWHSVWKDW¡OOGULOOGRZQSUHWW\ DJJUHVVLYHO\LQWRWKHSURFHVV STEP 1 Determine the platform in which the application will be built/HW¡VRQO\GLVFXVVL26 DQG$QGURLGIRUWKLVVWHSEXWNHHSLQPLQGWKHUH DUHPXOWLSOHRWKHUSODWIRUPVLQZKLFKWRFKRRVH :LQGRZ¡V0RELOH%ODFNEHUU\6\PELDQHWF 

STEP 4'HYHORSPHQWDQGGHVLJQDUHQH[W. Which IXQFWLRQVRIWKHSKRQHZLOOWKHDSSXVH",VLWDQDSS that will need to access the contacts list or the FDPHUDLQWHUIDFHEXLOWLQWRWKHSKRQH"7KHVH TXHVWLRQVZLOOQHHGWREHGHWHUPLQHGLQRUGHUWR develop the app properly.

 

7KHUHDUHYDULRXVRSWLRQVWKDWQHHGWREH FRQVLGHUHGL26L3KRQHRQO\L3DGRQO\RUL3KRQH DQGL3DGFRPSDWLEOH$QGURLGSKRQHRQO\ WDEOHWRQO\RUSKRQHDQGWDEOHW FRPSDWLEOH 7KHEHVWZD\WRGHWHUPLQHZKLFKSODWIRUPWR FKRRVHLVE\IROORZLQJDUHVHDUFKSURFHVVLQZKLFK the penetration of smart devices is dictated. It is SRVVLEOHWRGHYHORSDPXOWLSODWIRUPDSSEXWWKDW FDQEHWULFN\WLPHFRQVXPLQJDQGYHU\FRVWO\

While in the development stage, another important SLHFHLVLQWHJUDWLQJHQRXJKWLPHLQWKHGHYHORSPHQW SURFHVVWRWHVWWKHDSS,WZLOOQHHGWREHWHVWHG DFURVVYDULRXVSODWIRUPVWRHQVXUHXVDELOLW\6HYHUDO JHQHUDWLRQVRIWKHL3KRQHDQGWZRJHQHUDWLRQVRI WKHL3DGH[LVWWRGD\%HIRUHUROOLQJRXWWKHDSSDOO YHUVLRQVZLOOQHHGWREHWKRURXJKO\WHVWHG,QIDFW \RXVKRXOGKDYHDQDGGLWLRQDOVWUDWHJ\UHYROYLQJ VROHO\DURXQGWHVWLQJ

 

&XUUHQWO\SHUFHQWRIVPDUWSKRQHXVHUV EHWZHHQWKHDJHVRIDUHXVLQJ$QGURLG GHYLFHVZKLOHSHUFHQWDUHXVLQJDQL3KRQH

STEP 51H[WGHVLJQLQJWKHDHVWKHWLFVRIWKHDSSWR reach the intended target audienceLVDFUXFLDOSDUW RIWKHGHYHORSPHQWVWUDWHJ\,IWKHDSSEHLQJEXLOW LVDJDPHWKHORRNDQGIHHOQHHGVWRUHĂ HFWWKDW

        

    

     

)DPLOLDUL]H\RXUVHOIZLWKWKH7HUPVDQG&RQGLWLRQV VXEPLVVLRQSURFHVVIRUHLWKHUWKH$SS6WRUHRU Android Market, and determine the date in which WKHDSSQHHGVWREHVXEPLWWHGLQRUGHUWRPHHW WKHODXQFKGDWH.HHSLQPLQGWKDWLWFRXOGWDNH DQ\ZKHUHIURPIRXUWRZHHNVWRKDYHWKHDSS approved and placed in the store.

STEP 6 Finally, the app is built and ready for launch! $OOWKDWKDUGZRUNLVĂ&#x20AC;QDOO\DERXWWRSD\ RIIDVORQJDVWKHSURGXFWLVPDUNHWHGSURSHUO\ 7KLVVWHSLVYHU\LPSRUWDQWEXWDOVRUHTXLUHVLWVYHU\ RZQVWUDWHJ\7KHPDLQZD\WRKDYHDÂś7RS$SS¡LV WKURXJKUDWLQJV+DYHHYHU\RQH\RXNQRZUDWHWKH DSS7KHEHWWHUWKHUDWLQJVDQGWKHPRUHRIWKHP WKHIDVWHUWKHDSSZLOOPRYHXSLQUDQNLQJV

STEP 2 1H[Wdecide the code base in which the app will be developed7LWDQLXPM47RXFK DQG3KRQH*DSDUHDOOLQWXLWLYHSODWIRUPVWKDW allows developers to create native applications. 'HSHQGLQJRQZKLFKRSHUDWLQJV\VWHP\RXKDYH VHOHFWHGWKHFRGHEDVHRUSODWIRUPXVHGFDQ EHGHWHUPLQHG,I\RXKDYHQ¡WKHDUGRIWKHVH take some time to research and learn more DERXWHDFK7KHWLPH\RXSXWLQQRZZLOOSD\ RIIODWHULQWKLVSURFHVVDVZHOODVLQIXWXUHDSS development.

&$7$/<67













$SSOLFDWLRQGHYHORSPHQWFDQEHDQLQWHUHVWLQJ EHDVWEXWZLWKDJUHDWLGHDLWFDQEHMXVWWKHWKLQJ WRWDNH\RXUEXVLQHVVWRWKHQH[WOHYHO&RQVLGHUDOO RSWLRQVEHIRUHWDFNOLQJWKHSURMHFWDQGFKRRVHDQ DJHQF\WKDWFDQQRWMXVWPHHWEXWH[FHHG\RXU expectations. Centresource Interactive can do just WKDW<RXFDQĂ&#x20AC;QGXVLQDQVVW\OHKRXVHLQ Nashvilleâ&#x20AC;&#x2122;s Germantown neighborhood.













3$*(


EVOLUTION OF TECHNOLOGY IT as a Service: What Does it Mean for the Future of IT Service Delivery? /L]D/RZHU\0DVVH\Â&#x2021;1DVKYLOOH7HFKQRORJ\&RXQFLO The following article is based in part on research I conducted as a Senior Fellow for the Center for Digital Government (CDG), which resulted in my development of many of these concepts and eventual publication of the whitepaper "IT-As-AService in State and Local Government" by CDG.

"Enterprise systems coupled with expanding connectivity options, led to creation of virtual organizations â&#x20AC;&#x201C; ones in which the boundaries between organizations are blurred by LQIRUPDWLRQV\VWHPV

Information technology service delivery has evolved since introduction RIFRPSXWLQJLQWRWKHZRUNSODFHLQWKH¡V :KDWEHJDQDVELJER[HV LQJODVVKRXVHVEHFDPHPRUHGLVWULEXWHGZLWKWKHSUROLIHUDWLRQRIGHVNWRS FRPSXWHUVLQWKHZRUNSODFHLQWKH¡V7KDQNVWRQHWZRUNVWKHIUHHORYH DSSURDFKWRFRPSXWLQJVRRQHYROYHGLQWRDPRUHFRQQHFWHGHQYLURQPHQWVLQFH employees within organizations still needed to share information and PDQDJHPHQWUHTXLUHGDFRQVROLGDWHGYLHZ$VRUJDQL]DWLRQVUHDOL]HGWKH YDOXHRIFRQVROLGDWHGLQIRUPDWLRQHQWHUSULVHV\VWHPVEHFDPHWKHQRUPDQG PDQ\RUJDQL]DWLRQVLPSOHPHQWHGHQWHUSULVHUHVRXUFHSODQQLQJFXVWRPHU UHODWLRQVKLSPDQDJHPHQWDQGGDWDZDUHKRXVLQJV\VWHPV(QWHUSULVHV\VWHPV FRXSOHGZLWKH[SDQGLQJFRQQHFWLYLW\RSWLRQVOHGWRFUHDWLRQRIYLUWXDO RUJDQL]DWLRQV²RQHVLQZKLFKWKHERXQGDULHVEHWZHHQRUJDQL]DWLRQVDUH EOXUUHGE\LQIRUPDWLRQV\VWHPV)RULQVWDQFHVXSSO\FKDLQPDQDJHPHQW V\VWHPVHQDEOHVHDPOHVVLQWHJUDWHGGDWDWRà RZEDFNDQGIRUWKEHWZHHQ VXSSOLHUVSURYLGHUVDQGFXVWRPHUV    

   

   

   

   

   

   

  

  

  

  

  

  

  

 

 

 

 

 

 

 

,PDJHFRXUWHV\RIZZZGXPPLHVFRP    







7KDQNVWRFORXGFRPSXWLQJYLUWXDOL]DWLRQRIWKHHQWHUSULVH KDVFRPHWRPHDQWKDWRUJDQL]DWLRQVFDQZRUU\OHVVDERXW KRZZKHUHDQGE\ZKRP,7V\VWHPVDQGVHUYLFHVDUH GHOLYHUHG7KUHHIDFWRUVHQDEOHWKLVWUHQG7KHĂ&#x20AC;UVWRQH² consolidation²KDVRIWHQEHHQYLHZHGDVDGLUW\ZRUG :KHQGHĂ&#x20AC;QHGDVH[WUDFWLQJFRPPRQWHFKQRORJ\UHVRXUFHV DQGFRPELQLQJWKHPWRVHUYHPXOWLSOHEXVLQHVVXQLWV FRQVROLGDWLRQPDNHVEXVLQHVVVHQVH7KHVHFRQGWUHQGcloud computingLHDODUJHSRRORIHDVLO\XVDEOHDQGDFFHVVLEOH YLUWXDOL]HGUHVRXUFHVHQDEOHVRUJDQL]DWLRQVWRDFFHVV LQIUDVWUXFWXUHDQGV\VWHPVYLDWKH,QWHUQHW)LQDOO\WRXJK economic times make collaborationRUVKDULQJUHVRXUFHVLQ WKLVFDVHPXFKPRUHDWWUDFWLYH

7KUHHFDWHJRULHVRIFORXGFRPSXWLQJVHUYLFHVDUHEHFRPLQJWKHQRUPInfrastructure as a Service ,DD6 LHYLUWXDO servers, storage and even entire data centers, Platform as a Service 3DD6 LHGHYHORSPHQWV\VWHPPRQLWRULQJDQG GDWDEDVHWRROVDQGSoftware as a Service 6DD6 RURQGHPDQGDSSOLFDWLRQVDUHEHFRPLQJFRPPRQSODFH7KHVH VHUYLFHVVKDUHFRPPRQIHDWXUHVSD\SHUXVDJHRQGHPDQGGHOLYHU\PXOWLWHQDQF\DQGEDVHGRQZHOOGHĂ&#x20AC;QHG service level agreements.

&$7$/<67

























3$*(


$UHFHQWVWXG\FRQGXFWHGE\,QIRUPDWLRQ:HHN $QDO\WLFVIRXQGDLQFUHDVHLQFORXGFRPSXWLQJLQ ZLWKRIUHVSRQGHQWVZKRZHUHQRW\HWLQ WKHFORXGLQGLFDWLQJWKDWWKH\ZHUHKHDGHGWKDWZD\LQ WKHQHDUIXWXUH 7DNLQJWKHDVD6HUYLFHPRGHORQHVWHSIXUWKHUOHDGV WR,7DVD6HUYLFH ,7DD6 DPRGHOLQZKLFK,7PDWWHUV EXWZKHUHZKRDQGKRZLWLVGHOLYHUHGGRHVQRW7KLV PRGHOUHVXOWVLQNQRZQFRVWVIRUDOO,7VHUYLFHV GUDPDWLFDOO\UHGXFHVRZQHUVKLSRI,7UHVRXUFHV SURYLGHVHODVWLFVHUYLFHOHYHOVEDVHGRQQHHGDQG IXQGLQJDYDLODELOLW\DQG would truly be business driven since the end result could be the elimination of traditional internal IT departments.7KHUHVXOWVRI WKLVDSSURDFKZRXOGLQFOXGHUHGXFHGFRVWVLQFUHDVHG ÁH[LELOLW\LPSURYHGVHUYLFHOHYHOVDQH[SDQGHGSRRO RIUHVRXUFHVHQKDQFHGGDWDVKDULQJDQGDIRFXVRQ EXVLQHVVQRWWHFKQRORJ\*HWWLQJWKHUHUHTXLUHV NQRZLQJZKHUH\RXDUHWRGD\HVWDEOLVKLQJVROLGPHWULFVVHWWLQJFOHDUDQGVSHFLÀFEXVLQHVVH[SHFWDWLRQV PHDVXULQJDQGLPSURYLQJSHUIRUPDQFHXQGHUVWDQGLQJVHFXULW\DQGSULYDF\ LPSOLFDWLRQVDQGREWDLQLQJDQGPDLQWDLQLQJEX\LQ$GGLWLRQDOO\,7DD6OLNH PRVWWHFKQRORJ\GHSOR\PHQWVUHTXLUHVSODQQLQJIRUSHRSOHHOLPLQDWLRQRU UHGHSOR\PHQWRYHUFRPLQJUHVLVWDQFHDQGHQGLQJWXUIZDUV 6RZKDWZRXOG,7DD6ORRNOLNH"3LFWXUHWKLV²,7LVDQ    HQDEOLQJFRPSRQHQWRIEXVLQHVVRSHUDWLRQVQRWD    VWUDWHJ\LQDQGRILWVHOI7KHEXVLQHVVFRQGXFWV    SURFHVVLPSURYHPHQWVSURMHFWPDQDJHPHQW    UHTXLUHPHQWVGHYHORSPHQWVDQGPHDVXULQJVXFFHVV    DFWLYLWLHV%XVLQHVVSURIHVVLRQDOVEURNHUDQGPDQDJH    EHVWYDOXHWHFKQRORJ\VROXWLRQV7HFKQRORJ\UHVRXUFHV    H[SDQGDQGFRQWUDFWDVQHHGHG,7VWUDWHJLFSODQQLQJ    LVVLPSO\DSDUWRIWKHRUJDQL]DWLRQ·VRYHUDOO    VWUDWHJLFSODQQLQJHIIRUWV,7SROLFLHVDUHDMXVWFKDSWHU LQWKHHPSOR\HHKDQGERRN$FKLHIVHFXULW\RIÀFHULVUHVSRQVLEOHIRUVHFXULW\ RIDOORUJDQL]DWLRQDODVVHWVLQFOXGLQJ,7UHVRXUFHV$WWHQWLRQLVIRFXVHGZKHUHLW EHORQJV²RQWKHFRUHEXVLQHVVGHOLYHUDEOHV

,PDJHFRXUWHV\RIYLUWXDOVKDUSFRP

Sounds too good to be true, you say.+RZLVLWDOOSRVVLEOH"6HYHUDOIDFWRUV HQDEOH,7DD6&RQVXPHUL]DWLRQRIWHFKQRORJ\ZKLFKOHDGVWRHYHULQFUHDVLQJHQG XVHUVRSKLVWLFDWLRQLVGULYLQJWHFKQRORJ\EH\RQGWKHFRPPRGLW\VWDJHWRWKHSRLQW ZKHUHFRPPHUFLDOWHFKQRORJLHVDUHEHFRPLQJFRPPRQLQWKHZRUNSODFH7KH GLYLGLQJOLQHLVEOXUULQJDQGZLOOVRRQGLVDSSHDUDOWRJHWKHU&KHDSXQWHWKHUHG DFFHVVGHYLFHVDUHEHFRPLQJWKHQRUP7KHVHGHYLFHVDUHUHSODFHGQRW UHSDLUHGDQGFRQÀJXUHGDQGPDQDJHGUHPRWHO\WKDQNVWRXELTXLWRXV FRQQHFWLYLW\6XSSRUWLVDOVRGHOLYHUHGYLUWXDOO\ ,I\RXVWLOOWKLQNWKDW,7DD6VRXQGVLPSRVVLEOHRULPSUREDEOH\RXPLJKWZDQWWR JHW\RXUKHDGRXWRIWKHVDQGDQGLQWRWKHFORXGV&RQVLGHUWKDWWKH)HGHUDO JRYHUQPHQWQRWXVXDOO\DQHDUO\DGRSWHUKDVLQVWLWXWHGD&ORXG)LUVWDSSURDFK DQGLQGXVWU\HGXFDWLRQDQGSXEOLFVHUYLFHRUJDQL]DWLRQVDOLNHDUHDOOPRYLQJLQ this direction. It’s just one more step in the evolution of IT service delivery.

&$7$/<67

























3$*(


TECH INNOVATION

Why Nashville Is Friendly To Innovation 6DO1RYLQ‡+HODWKFDUH3URGXFWLYLW\$XWRPDWLRQ‡ZZZKSDSURFRP ,RQFHKHDUGWKHHQWUHSUHQHXULDOVSLULWRIDWRZQZDVEHVW PHDVXUHGE\WKHQXPEHURIFRIIHHVKRSVSHUVTXDUHPLOH $FFRUGLQJWRWKDWPHWULF1DVKYLOOHKDVFRPHDORQJZD\ VLQFH,UHORFDWHGKHUH\HDUVDJR+DYLQJMXVWVWDUWHGDW +&$RQHGLVWLQFWPHPRU\IURPP\ÀUVWGD\DWZRUN ZDVVSHQGLQJPRVWRIP\OXQFKKRXUMXVWVHDUFKLQJIRUD FRIIHHVKRS²OHWDORQHRQHZKLFKZRXOGOHWPH¶VHWXS VKRS·,UHPHPEHUZRQGHULQJ:KHUHDP,VXSSRVHGWR VSHQGP\ZHHNHQGVEUDLQVWRUPLQJFRGLQJDQGÀQGLQJ RWKHUVLQWKHVDPHERDW"

this time, it simply cannot compare to my less than one KRXUFRPPXWHLQ1DVKYLOOH$WÀUVWJODQFHWKLVH[WUD WLPHPD\QRWVHHPOLNHDELJGHDOEXWFRQVLGHUWKDWWZR KRXUVDGD\UHVXOWVLQDIXOOKRXUZRUNGD\HDFKZHHN 2YHUWKHFRXUVHRID\HDULWHTXDOVRYHUWZRDQGDKDOI PRQWKVRIDGGLWLRQDOWLPHWKDWD1DVKYLOOHHQWUHSUHQHXU KDVRYHUVRPHRQHLQ6DQ)UDQFLVFR1HZ<RUN/RV $QJHOHVRURWKHUELJFLWLHV²DQG\RXUSURGXFWLYLW\ZKLOH FRPPXWLQJLVQRWHQWLUHO\FRQWLQJHQWRQJHWWLQJDVHDWRQ WKHVXEZD\

$VWKHTXDQWLW\DQGTXDOLW\RIHQWUHSUHQHXULDOVXSSRUW FRQWLQXHVWRJURZP\SHUVRQDOH[SHULHQFHKDVEHHQWKDW PDQ\RI1DVKYLOOH·VGLVWLQFWDGYDQWDJHVZHUHSUHVHQWIURP WKHGD\,DUULYHGDQGFRQWLQXHWRPDNHLWDQLQQRYDWRU IULHQGO\WRZQWRWKLVGD\6RPHRIWKHVHFKDUDFWHULVWLFVDUH PRUHREYLRXVWKDQRWKHUVEXWHDFKFKDUDFWHULVWLFEHDUV DWOHDVWVRPHUHOHYDQFHWRWKHPDQ\HQWUHSUHQHXUVDQG LQQRYDWRUVZKRFDOO1DVKYLOOHKRPH²EXWHYHQLQP\ÀUVW IHZGD\VLQ1DVKYLOOH,FRXOGVHQVHWKHUHZDVDJUHDWVSLULW LQWKHWRZQDQGRQHZKLFKRIIHUHGWKHUDUHRSSRUWXQLW\WR watch it grow with time.

COST OF LIVING Among the many attractiveDVSHFWVRIOLYLQJLQ1DVKYLOOH LVLWVFRVWRIOLYLQJ)RUD\RXQJHQWUHSUHQHXUZKR ÀQDQFHVWKHLUFUHDWLYHHQGHDYRUVXVLQJ'LVSRVDEOH,QFRPH (TXLW\3DUWQHUVDORZFRVWRIOLYLQJLVSHUKDSVWKHPRVW DWWUDFWLYHÀQDQFLHU1RWRQO\GLGWKHFRVWRIOLYLQJKHOS me afford new tools and software; I also experienced OHVVDQ[LHW\ZKHQVSHQGLQJPRQH\RQP\QHZEXVLQHVV

&$7$/<67



BIG COMPANIES 1DVKYLOOHKDVDJUHDWHTXLOLEULXPRIVPDOODQGODUJH EXVLQHVVHV$PRQJRWKHUWKLQJVELJFRPSDQLHVRIIHUD ,WFHUWDLQO\KDVJURZQFRQVLGHUDEO\RYHUWKHSDVW VDOHVFKDQQHOIRUVWDUWXSVZLWKRXWWKHKLJKFRVWRIWUDYHO GHFDGH7RGD\IDUPRUHRUJDQL]DWLRQVH[LVWWRVXSSRUW and they also provide a safety net in case a new DQGPHQWRUQHZHQWUHSUHQHXUV7KHUH·VDVWURQJHUPRUH YHQWXUHH[SHULHQFHVDIDLOXUHWRODXQFK$GGLWLRQDOO\ELJ HVWDEOLVKHGWHFKQRORJ\FRPPXQLW\$OVRPRUHSURIHVVLRQDO FRPSDQLHVDOVRGUDZWRSWDOHQWIURPDURXQGWKHFRXQWU\ DVVRFLDWLRQVDUHFDWHULQJWRDEURDGHUDXGLHQFHRI )URPSHUVRQDOH[SHULHQFH+&$·VVL]HDQGQDPH HQWUHSUHQHXUVRIIHULQJ recognition helped me overcome WKHRSSRUWXQLW\WROHDUQ HYHQLQP\ÀUVWIHZGD\VLQ1DVKYLOOH,    FRQFHUQVDERXWWKHVL]HRIWKH share and network among    could sense there was a great spirit in the 1DVKYLOOHPDUNHWSDUWLFXODUO\ SHHUVLQ1DVKYLOOH0XFK for a Canadian whose only EHWWHUDFFHVVWRFDSLWDODV WRZQ    SHUFHSWLRQRIWKHVRXWKKDGEHHQ ZHOODVKHOSLQÀQGLQJWKH    IRUPHGE\HSLVRGHVRI%DUEDUD ULJKWIRUPRIFDSLWDODUHDOVRDYDLODEOH Mandrell and the Mandrell 6LVWHUV,QRZVKDPHIXOO\DGPLWWKDWHYHQ,KDGH[SHFWHG TIME WRVHHIDUPRUHSHRSOHLQFRZER\KDWV1RWHYHU\ORQJ 7KHPRVWSUHFLRXVUHVRXUFHRIDQ\VRIWZDUHSURMHFWLVWLPH GLVWDQFHWUDQVSODQWZRUNVRXWWREHDSHUIHFWÀWDWD DQGWKLVQHHGLVHVSHFLDOO\WUXHIRUDQHZHQWUHSUHQHXU ODUJHRUJDQL]DWLRQ,TXLFNO\UHDOL]HGWKDW+&$KDG working nights and weekends trying to realize a dream. QXPHURXVIHOORZÁHGJOLQJHQWUHSUHQHXUV0DQ\RIWKHP ,Q7RURQWR,ZRXOGVSHQGWKUHHKRXUVHDFKGD\ ZHUHDEOHWREXLOGUHODWLRQVKLSVÀQGSDUWQHUVDQGFUHDWH FRPPXWLQJDQGWKRXJK,WULHGWRPDNHSURGXFWLYHXVHRI EXVLQHVVQHWZRUNVWKDWWKH\OHYHUDJHGDIWHUWKH\OHIW























3$*(


:KLOH+&$SOD\HGDPDMRUUROHLQP\ move, other organizations like Deloitte, 9DQGHUELOWDQG%ULGJHVWRQHVHUYHD VLPLODUUROHIRURWKHUHQWUHSUHQHXUV 0RUHUHFHQWO\1LVVDQ+3'HOODQGWKH ever increasing list of health care FRPSDQLHVKDYHDGGHGWR1DVKYLOOH·V DELOLW\WRFDVWDQHYHQZLGHUQHWWRGUDZ top talent.

"For every reason â&#x20AC;&#x201C; shared or personal â&#x20AC;&#x201C; itâ&#x20AC;&#x2122;s essential that future entrepreneurs have more and more reasons to also choose Nashville, and continue to grow it LQWRDQHQWUHSUHQHXUIULHQGO\WRZQ

WORK-LIFE BALANCE :RUNOLIHEDODQFHIRUDQHQWUHSUHQHXU EHDUVDGLIIHUHQWPHDQLQJWKDQLWGRHV WRPRVWSHRSOH1DVKYLOOHRIIHUVD pace and a way of life that makes it HDV\WRJHWDZD\8QOLNHRWKHUFLWLHV ZKHUHLWLVDOPRVWLPSRVVLEOHWRHVFDSH WKHIUHQHWLFDFWLYLW\WKDWEHFRPHVD SDUWRIGD\WRGD\OLIH1DVKYLOOHOLIHKDV DPRUHEDODQFHGSDFH(YHQZKHQZRUN KDVVHHPHGDOOFRQVXPLQJ,KDYHIRXQGLW UHPDUNDEO\HDV\WREHDEOHWRTXLFNO\ shift gears and take a moment to smell WKHURVHV2IFRXUVHHYHU\RQHKDVWKHLU RZQUHDVRQVIRUPDNLQJ1DVKYLOOHWKHLU home, and it is always fascinating to hear QHZVWRULHVDERXWKRZVRPHRQHJRWWKHLU VWDUWDQGZK\WKH\FKRVH1DVKYLOOH)RU HYHU\UHDVRQ²VKDUHGRUSHUVRQDO²LW·V HVVHQWLDOWKDWIXWXUHHQWUHSUHQHXUVKDYH more and more reasons to also choose 1DVKYLOOHDQGFRQWLQXHWRJURZLWLQWR DQHQWUHSUHQHXUIULHQGO\WRZQ

PEAK PERFORMANCE

IS HUMANLY

POSSIBLE

Last year, companies brought us 100,000 IT challenges. Why? Experisâ&#x201E;¢ IT helps clients improve business performance cost-effectively through project solutions and professional resourcing. Cloud. Security. Migrations. BI. ERP. Healthcare solutions. Thatâ&#x20AC;&#x2122;s just the start. Our solutions are completely scalable. Our teams can work with you directly or independently. Onsite, offsite or at our own Technology Centers. Connect with us and watch your business take off. experis.us

Sal Novin is the CEO of Healthcare Productivity Automation. He also won a Technology Council Award for "Innovator Of The Year". www.hpapro.com

&$7$/<67









Brad Kimbler Business Development Manager 401 Commerce St. t Nashville, TN 615.770.2828











© 2011 ManpowerGroup. All rights reserved.







3$*(


ON-SITE DATA & HARD DRIVE DESTRUCTION PROVIDED BY THE WORLD’S LEADING PROVIDER OF ITAD SERVICES

Located in the Nashville area, Sims Recycling Solutions - LaVergne is one of the largest electronics recycling plants in the world that provides a comprehensive solution to all your asset disposition or corporate sustainability objectives. It not only serves the electronics recycling needs of the Southeast US, the facility also plays host to our state-of-the-art near infrared plastics separator and metal sensing technologies. Small business, mid-sized companies and the largest manufacturers know about LaVergne’s capabilities first-hand -- and rely on Sims to responsibly and competently manage their end of life assets. sĀ sĀ sĀ sĀ sĀ sĀ

Local Pickups Provided 200,000 Sq Ft Facility ISO 14001, OHSAS 18001 and R2 Certified Resale and Revenue Sharing Options Data Capture Capabiliities Publicly Traded Company

For more information on how Sims Recycling Solutions can help aid in managing your end-of-life electronics, contact us today. 417 Sanford Road / LaVergne, TN 37086 / Phone: 615.967.6807 us.simsrecycling.com &$7$/<67

























3$*(


&$7$/<67

























3$*(


!

RELATIONSHIPS MATTER

Relationships Are Key .ULV.HOVRÂ&#x2021;ZZZWKHNHOVRJURXSFRP :KDWLVWKHYDOXHRIDVLQJOHSLHFHRILQIRUPDWLRQZLWKRXWDQ\FRQWH[W" .QRZLQJWKDWWKHDQVZHULVWKUHH:LWKRXWDQ\RWKHUUHOHYDQWLQIRUPDWLRQLV XVHOHVV(YHQZLWKDODEHOVXFKDVPLOHVGROODUVRUFXVWRPHUV\RXVWLOOGRQ·WKDYH DQ\ZD\WRMXGJHZKHWKHUWKUHHLVJRRGRUEDGXQWLO\RXVHHLWLQUHODWLRQWR some other piece of information. 5HODWLRQVKLSVDUHNH\WRXQGHUVWDQGLQJWKH value of the data.

"Rare is the electronic device that does not communicate with DQRWKHUGHYLFH

The same concept applies to modern computing5DUHLVWKHHOHFWURQLFGHYLFH WKDWGRHVQRWFRPPXQLFDWHZLWKDQRWKHUGHYLFHFrom a server to a smartphone, the value is not in the computing power of the device itself, but in its ability to communicate with potentially millions of other devices7KH,QWHUQHWZDVEXLOWRQ DQGUHOLHVRQWKHVHYDOXDEOHUHODWLRQVKLSV +XQGUHGVRIVXFFHVVIXOEXVLQHVVHVH[LVWIRUWKHVROHSXUSRVHRIFRQQHFWLQJRWKHU EXVLQHVVHVDQGH[FKDQJLQJLQIRUPDWLRQ7KHYDOXHWKH\SURYLGHDQGWKHSURÃ&#x20AC;WV WKH\HDUQDUHEDVHGRQcreating, managing, and optimizing relationships. 7KHLQIRUPDWLRQLVQRWWKHDVVHW²WKHUHODWLRQVKLSVDUHWKHDVVHW)URP+,(·VWR 7ZLWWHUDFFRXQWVWKHÃ&#x20AC;UVWSHUVRQRURUJDQL]DWLRQLQYROYHGGRHVQRWEHQHÃ&#x20AC;WXQWLO DVHFRQGSHUVRQRURUJDQL]DWLRQVLJQVRQ7KHUHODWLRQVKLSVGRQ·WMXVWHQKDQFH WKHYDOXHthey are the value.

Relationships are just as important among people,QGLYLGXDOVDUHÃ&#x20AC;OOHGZLWKLQFUHGLEOHNQRZOHGJH H[SHULHQFHVLQVLJKWVDQGFUHDWLYLW\%XWWKRVHDVVHWVDUHRIOLWWOHYDOXHXQWLOWKH\DUHVKDUHGZLWK DQRWKHUSHUVRQ,WLVRQO\WKURXJKUHODWLRQVKLSV²WKHJLYHDQGWDNHRIVKDULQJLGHDVWKDWDSHUVRQ realizes his or her own self-worth. )RUSHRSOHZKRGRQRW\HWXQGHUVWDQGWKLVUHODWLRQVKLSVDUHXQGHUYDOXHGSDVVLYHO\PDLQWDLQHGDQG VRPHWLPHVZLOOIXOO\QHJOHFWHG$VDUHVXOWWKHLUOLYHVIXQFWLRQOLNHDGDWDEDVHZLWKSRRUO\GHÃ&#x20AC;QHG GDWDVWUXFWXUHVRUDQHWZRUNWKDWKDVEHHQFREEOHGWRJHWKHUDVFKHDSO\DVSRVVLEOH7KH\QHYHU UHDOL]HWKHIXOOSRWHQWLDORIWKRVHUHODWLRQVKLSVDQGWKHLURZQZRUWK 7KRVHZKRGRXQGHUVWDQGKRZHYHUZLOOLQYHVWWKHWLPHDQGHQHUJ\UHTXLUHGWRGHYHORSVWUHQJWKHQ DQGSURWHFWWKHLUUHODWLRQVKLSV7KH\DUHDFWLYHO\ZRUNLQJWRmaintain lines of communication and to build new ones7KH\DUHopen to meeting new people, recognizing that each new node on the QHWZRUNDGGVWRWKHYDOXHRIWKHQHWZRUNDVDZKROH One of the greatest qualities of Nashville as a technology community is the strength of the relationships that have developed and continue to grow7KH1DVKYLOOHFRPPXQLW\LVERWKFORVHNQLW DQGZHOFRPLQJWRQHZFRPHUV(DFKSHUVRQEHQHÃ&#x20AC;WVIURPWKHKLJKGHJUHHRIWUXVWWUDQVSDUHQF\DQG FROODERUDWLRQZLWKLQWKHFRPPXQLW\5HVSHFWDQGJRRGZLOOH[LVWVHYHQDPRQJFRPSHWLWRUVZKHUHWKH WHPSWDWLRQLVWRZDUGFXWWKURDWFRPSHWLWLRQ $VZHDVDFRPPXQLW\FRQWLQXHWRVHHNRXWWKHQH[WJUHDWLQQRYDWLRQOHW·VQRWIRUJHWZKHUHWKHUHDO YDOXHOLHV:KHWKHUZHDUHWDONLQJDERXWGDWDV\VWHPVEXVLQHVVHVRUSHRSOH«the value is in the relationships.

&$7$/<67

























3$*(


SUMMER CAMP / FIRST CAMP Help Get Students Excited About Technology 5HEHFFD&ROOLQVÂ&#x2021;:&6 0ROOLH0F&RUPLFNÂ&#x2021;1DVKYLOOH7HFKQRORJ\&RXQFLO :LOOLDPVRQ&RXQW\6FKRROVUHFRJQL]HVWKHimportance of technology and how it ultimately affects Middle Tennessee and the technology community as a whole:LWKRYHUWHFKQRORJ\MREVZDLWLQJWREHĂ&#x20AC;OOHG LQRXUDUHDDORQHWKHUHLVFOHDUO\DQHHGWRJHWVWXGHQWVLQWHUHVWHGDQGDZDUHRIWKHYDULRXVWHFKQRORJ\ FDUHHUVZDLWLQJIRUWKHP7RPHHWWKLVREMHFWLYH:&6KDVGHYHORSHGRQJRLQJHYHQWVZKLOHLQYROYLQJNH\ SHRSOHZLWKLQWKHWHFKQRORJ\FRPPXQLW\7KLVKDVKHOSHGFUHDWHDQLPPHGLDWHDZDUHQHVVRIKLJKGHPDQG WHFKQRORJ\VNLOOVDQGFDUHHUVLQRXUVFKRROVDQGFRPPXQLW\

With over 1,000 technology jobs waiting to be

Girls TEC WDFNOLQJHPHUJLQJFDUHHUV &DPSLVRQH Ă&#x20AC;OOHGLQRXUDUHDDORQHWKHUHLVFOHDUO\DQHHGWR RIWKHPDQ\ZD\V:&6SURPRWHVWHFKQRORJ\WR VWXGHQWV*LUOV7(&DOORZVULVLQJHLJKWKJUDGHJLUOVWR get students interested and aware of the various SODQDQGFRPSOHWHDYDULHW\RISURMHFWVZLWKLQ WHFKQRORJ\FDUHHUVZDLWLQJIRUWKHP VHOHFWHGFDUHHUDQGWHFKQRORJ\FXUULFXOXPSDUWLFLSDWH LQSUREOHPVROYLQJDQGWHDPEXLOGLQJDFWLYLWLHVWUDYHO WRORFDOVFKRROVEXVLQHVVHVWRVHHWHFKQRORJ\DWZRUNDQGKHDUIURPG\QDPLFZRPHQLQQRQWUDGLWLRQDO FDUHHUVVXFKDVIDVWJURZLQJKLJKSD\LQJWHFKQRORJ\Ă&#x20AC;HOGV0ROOLH0F&RUPLFNZLWKWKH1DVKYLOOH 7HFKQRORJ\&RXQFLOZDVDVHVVLRQSUHVHQWHUDQGVSHDNHUWKLVSDVW\HDU7KHJLUOVZHUHDPD]HGWKDWWKH\ WRRFRXOGKDYHDMRE´EORJJLQJÂľDQG´SOD\LQJRQWKHFRPSXWHUÂľDVSDUWRIWKHLUFDUHHU2IFRXUVH0ROOLH GRHVPRUHWKDQWKDWEXWVKHIRXQGDZD\WRJHWWKHJLUOVH[FLWHGDERXWWHFKQRORJ\DQGRSHQWKHLUPLQGVWR the various technology careers available.   

  

  

  

  

  













      

      

      

      

      

      

2WKHURQJRLQJHYHQWVWKDW:LOOLDPVRQ&RXQW\6FKRROV LPSOHPHQWVWRLPSURYHVWXGHQWDZDUHQHVVLQWHFKQRORJ\LV RIIHULQJVWXGHQWVWKHRSSRUWXQLW\WRDWWHQGWKH´World of Possibilitiesâ&#x20AC;? Career Fair, Guys CAN Camp, and Nashville Technology Council FirstCamp. Each of these events allows VWXGHQWVWRH[SORUHWHFKQRORJ\FDUHHUVDQGGLVFRYHUKRZ technology is applied to their everyday lives. ,QIRUPDWLRQ7HFKQRORJ\3URJUDPVZLWKLQRXUKLJKVFKRROVDUH DQDGGHGERQXVWKDWHQDEOHVRXUVWXGHQWVLQWHFKQRORJ\  &RPSOHWLRQRI,7SURJUDPVDOORZVWXGHQWVWRJUDGXDWHZLWK WKHVNLOOVQHHGHGLQWHFKQRORJ\DQGHDUQQHFHVVDU\,7 FHUWLĂ&#x20AC;FDWLRQV7KLVDSSURDFKJLYHV:&6VWXGHQWVDQ DGYDQWDJHLQSXUVXLQJERWKSRVWVHFRQGDU\HGXFDWLRQDO RSSRUWXQLWLHVDQGLGHDOWHFKQRORJ\FDUHHUV

It is important to continuously put technology opportunities in front of studentsVRWKH\ZLOOEHUHDG\IRU WKHFDUHHUVZDLWLQJIRUWKHPDIWHUVFKRRO1RPDWWHUZKHUH\RXOLYHRUZKDWODQJXDJH\RXVSHDNWHFKQRORJ\ SOD\VDQLPSRUWDQWUROHLQRXUHYHU\GD\OLYHV7DNHDORRNDURXQGDQG\RX¡OOVWDUWWRQRWLFHWKDWWHFKQRORJ\LV everywhere and it is here to stay!

&$7$/<67

























3$*(


NTC SPONSORS (YHU\VLQJOHPHPEHURIWKH1DVKYLOOH7HFKQRORJ\&RXQFLOLVLPSRUWDQWDQGYLWDOWRRXUVXFFHVVDQGPLVVLRQWRKHOSWKH WHFKQRORJ\FRPPXQLW\LQ0LGGOH7HQQHVVHHVXFFHHG,W·VDQH[DPSOHRI0HWFDOIH·V/DZHDFKRUJDQL]DWLRQQRWRQO\DGGVWKH YDOXHRIRQHEXWDGGVYDOXHZLWKHDFKRQHRILWVHPSOR\HHVDQGWKHLUFRQQHFWLRQV ,QDGGLWLRQWRPHPEHUVKLSZHKDYHFORVHWRFRPSDQLHVWKDWKDYHVWHSSHGXSWKHLUVXSSRUWZLWKÃ&#x20AC;QDQFLDOFRPPLWPHQW DQGGHGLFDWHGHQJDJHPHQWIURPWKHLUHPSOR\HHV7KHVHFRPSDQLHVDOOKDYHDXQLTXHDJUHHPHQWWKDWLQFOXGHV VSRQVRUVKLSVDWWHQGDQFHIRUYDULRXVHYHQWVDQGSURJUDPVDQGWKHLUDQQXDOPHPEHUVKLSGXHV(DFK\HDUWKHDJUHHPHQW LVQHJRWLDWHGDQGXSGDWHG7KLVDSSURDFKKHOSVWRVWUDWHJLFDOO\SODQWKHLULQYROYHPHQWDQGFRPPLWPHQWZLWKWKH1DVKYLOOH 7HFKQRORJ\&RXQFLOIRUWKHHQWLUH\HDU ,QWKH17&VLJQHG+3DVRXUÃ&#x20AC;UVW7HFK'LDPRQG6SRQVRUDDQQXDOFRPPLWPHQWZLWK&RPFDVW%XVLQHVV 6HUYLFHVIROORZLQJVXLW,QDGGLWLRQZHKDYH7HFK7LWDQVDDQQXDOFRPPLWPHQWÃ&#x20AC;YH8QGHUZULWHUVD DQQXDOFRPPLWPHQWDQGQLQH7HFK3DWURQ6SRQVRUVDDQQXDOFRPPLWPHQW7KDQN\RXWRHDFKRIRXU7HFK Sponsors.

TECH DIAMONDS

TECH TITANS

&$7$/<67

























3$*(


TECH TITANS

TECH UNDERWRITERS

TECH PATRONS

&$7$/<67

























3$*(


VENTURE FOCUS Entrepreneurs Pursue Venture Capital 6DP/LQJRÂ&#x2021;1DVKYLOOH(QWUHSUHQHXU&HQWHU -RKQ0XUGRFNÂ&#x2021;1DVKYLOOH(QWUHSUHQHXU&HQWHU 9HQWXUHFDSLWDOLVWVNQRZWKDWWKHTXLFNHVWZD\WRORVHWKHLUPRQH\LVWRJLYHLWWRHYHU\HQWUHSUHQHXUWKDWDVNV 0RUHQRQLQYHVWDEOHLGHDVDUHRXWWKHUHWKDQLQYHVWDEOHRQHVDQGIRUDQHQWUHSUHQHXUWRJHWLQYHVWPHQWIURPYHQWXUH FDSLWDO 9& LQYHVWRUVKHRUVKHKDVWRFRQYLQFHWKHPWKDWWKLVLGHDLVRQHRIWKHVSHFLDORQHV$WWKH(QWUHSUHQHXU &HQWHUZHKDYHDQDO\]HGDQGGRFXPHQWHGWKHSURFHVVDQHQWUHSUHQHXUPXVWJRWKURXJKWRFRQYLQFHD9&WRLQYHVW ,I\RXKDYHJDLQHGDQDXGLHQFHZLWKD9& ZHFDQKHOSZLWKWKDWWRR \RXKDYHDWPRVW12 minutes to complete the following process.  

 

 

 

 

 

Interest the VC in your idea. 7KHÃ&#x20AC;UVWVWDJHRI\RXUSLWFKLVWRKRRNWKH9&LQWKHJHQHUDO FRQFHSWRI\RXUEXVLQHVV7KLVKDVWKUHHVWHSVPurpose, Problem, and Solution<RXKDYH WRGHVFULEHWKHRYHUDOOSXUSRVHRI\RXUEXVLQHVVLQDsingle, declarative sentence that resonates with investors<RXKDYHWRVWDWHZKDWPDUNHWSUREOHP\RXUEXVLQHVVVROYHVDQG ZKDWVROXWLRQ\RXUEXVLQHVVSURYLGHV,I\RXVWDWHDULQJLQJSXUSRVHDELJSUREOHPDQGDQ H[HFXWDEOHVROXWLRQ\RXZLOOKDYHWKH9&·VDWWHQWLRQIRU6WDJH7ZR

   

   

   

2: Convince the VC the time for your idea is now. A good idea at the wrong time makes as PXFKPRQH\DVDEDGLGHDDWDQ\WLPH ]HUR ,I\RXULQYHVWRULVLQWHUHVWHGLQ\RXUEXVLQHVV LGHDWKHQ\RXQHHGWRH[SODLQKRZELJ\RXUPDUNHWLVKRZELJLWZLOOEHDQGZKDWPDUNHW WUHQGVPDNHQRZWKHULJKWWLPHIRU\RXULGHDWRPDNHDWRQRIPRQH\,I\RXPDNHWKLV DSSHDOLQJWR\RXULQYHVWRU\RXZLOOEHUHDG\IRU6WDJH7KUHH 3DVVWKHJXWFKHFN,I\RXULGHDLVVRJUHDWWKHPDUNHWVRDSSHDOLQJDQGWLPHVRULJKW why isnâ&#x20AC;&#x2122;t everyone, or anyone else, doing it?,I\RXKDYHDZRQGHUIXOLGHDDWWKHULJKWWLPH \RXKDYHWRFRQYLQFHWKHLQYHVWRUWKDW\RXUFRPSHWLWLRQLVQ·WDOUHDG\GRLQJLWDQGWKDWWKH\ ZRQ·WLPPHGLDWHO\VTXDVK\RXZKHQWKH\Ã&#x20AC;QGRXW\RXDUHGRLQJLW,IDQRWKHUFRPSDQ\WDNHV \RXUJUHDWLGHDDQGH[HFXWHVLWEHIRUH\RXKDYHDFXVWRPHUEDVHWKHQ\RXZLOOKDYHORVW\RXUV DQGWKHLQYHVWRUV·PRQH\,I\RXSDVVWKHJXWFKHFN\RXULQYHVWRUVDUHOLVWHQLQJIRU6WDJH)RXU

   

   

   

 

 

 

  

  

  

    

    

    

&$7$/<67



&RQYLQFHWKHLQYHVWRUVWKDW\RXULGHDLVH[HFXWDEOH,I\RXPDGHLWWKLVIDUGRQ·WJHWD ELJKHDG<RXULQYHVWRUVDUHLQWHUHVWHGEXWWKH\DUHWKLQNLQJPD\EHQRRQHHOVHLVGRLQJWKLV EHFDXVHLW·VQRWSRVVLEOH$WWKLVVWDJH\RXKDYHWRSURYHWKDW\RXKDYHDSURGXFWRUVHUYLFH that delivers the solution you provided, and a business model to repeatedly deliver on that promise at scale,I\RXFRQYLQFH\RXULQYHVWRUVDJDLQWKH\ZLOOEHOHDQLQJLQIRU6WDJH)LYH &RQYLQFHWKHLQYHVWRUWKDW\RXUWHDPFDQH[HFXWHLW <RXIHHOUHDOO\FORVH²,NQRZ%XW\RXULQYHVWRULVVD\LQJ WKDWVRXQGVOLNHDUHDOO\JUHDWLGHDEXWDUHWKHVHWKH SHRSOHWRGRLW"<RXKDYHWRFRQYLQFHWKHLQYHVWRUVWKDW you have the right team in placeWREHDEOHWRH[HFXWH WKHEXVLQHVVPRGHO\RXKDYHGHVFULEHG$WWKLVVWDJHLQ WKHJDPHLQYHVWRUVDUHEHWWLQJLQODUJHSDUWRQWKHWHDP EHFDXVHWKH\NQRZWKDWDOPRVWHYHU\JUHDWLGHDWKH\ LQYHVWLQZLOOORRNGLIIHUHQWGRZQWKHURDGEXWWKHULJKW WHDPZLOOEHDEOHWRÃ&#x20AC;QGVXFFHVVWKURXJKF KDQJH

















3DWULFN:LGHQDQG*HRUJH6LEEOH







3$*(


  

  

6. Show them the money! &RQJUDWXODWLRQVLI\RXPDGHLWWKLVIDU\RXUHDOO\DUHDOPRVWWKHUH 7KLVSDUWRIWKHSUHVHQWDWLRQLVWKHLQYHVWRUV·IDYRULWH<RXMXVWKDYHWRVKRZWKHPKRZ\RXU EXVLQHVVPRGHOLVJRLQJWRPDNHPRQH\KRZPXFKLWLVJRLQJWRPDNHDQGZKHQLWLV JRLQJWREHPDNLQJLW

  

,I\RXVXFFHVVIXOO\FRPSOHWH6WDJHVRQHVL[\RXZLOOKDYHDYHU\LQWHUHVWHG investor. %XWPDNHQRPLVWDNH*HWWLQJWRJHWKHUDVROLGEXVLQHVVPRGHODQG LQYHVWRUSLWFKWKDWVXFFHVVIXOO\GRHVDOORIWKHVHWKLQJVLVDORWRIYHU\GHPDQGLQJ ZRUN$WWKH(QWUHSUHQHXU&HQWHUZHVSHFLDOL]HLQSUHSDULQJHQWUHSUHQHXUVWR GHOLYHUWKDWVXFFHVVIXOSLWFK :HGRWKLVIRUDOOVRUWVRIFRPSDQLHVLQFOXGLQJWHFKQRORJ\EDVHGRQHV6HYHUDO RIRXULQFXEDWLQJFRPSDQLHVDUHWHFKQRORJ\EDVHGVWDUWXSV2XUQHWZRUNRI over 100 professional mentors, dozens of corporate sponsors, and programming DOOVXSSRUWWKHVHWHFKQRORJ\VWDUWXSV:HDOVRRIIHUDQGKRVWSURJUDPPLQJ VSHFLÃ&#x20AC;FDOO\IRUWHFKQRORJ\VXFKDV0LFURVRIW·V%L]6SDUN&RGH5HWUHDWDQG 5XE\RQ5DLOV7UDLQLQJIf you want to launch your technology company, we can help.

0LFKDHO%XUFKDP3UHVLGHQW &(2RIWKH 1DVKYLOOH(QWUHSUHQHXU&HQWHU

www.entrepreneurcenter.com

FRPPRQ6WDUWXS0RQH\0LVWDNHV 1.8QGHUHVWLPDWLQJVWDUWXSFRVWV. 7KHPRVWFRPPRQPLVWDNHKHVHHVHQWUHSUHQHXUVPDNHZKHQODXQFKLQJ DEXVLQHVVLVXQGHUHVWLPDWLQJWKHDPRXQWRIPRQH\WKH\ZLOOQHHG6WDUWXSFRVWVUHSD\LQJLQYHVWRUVDQGHYHQ WKHIRXQGHU·VVDODU\DUHDOODUHDVZKHUHHQWUHSUHQHXUVDUHWRRIUXJDOLQWKHLUHVWLPDWHVKHVD\V:KHQWKH UHDOLW\RIWKHWUXHFRVWRIUXQQLQJWKHEXVLQHVVKLWVPDQ\Ã&#x20AC;QGWKHLUEXGJHWVVWUHWFKHGVRPHWLPHVEH\RQG ZKDWLVVXVWDLQDEOH 2. )DLOLQJWRHVWDEOLVKDPDUNHWLQJEXGJHW.6RFLDOPHGLDHPDLOPDUNHWLQJDQGSXEOLFLW\PD\EHWRXWHG DVORZFRVWZD\VWRSURPRWH\RXUEXVLQHVVEXWZKHQEXVLQHVVRZQHUVWKLQNWKH\FDQODXQFKRQDVKRHVWULQJ WKH\RIWHQUXQLQWRWURXEOH6WUDXVVVD\V7KHRQO\ZD\\RXFDQWXUQRQWKHOLJKWDQGOHWSHRSOHNQRZ\RX·UH WKHUHLVE\PDUNHWLQJDQGDGYHUWLVLQJRU\RX·UHJRLQJWRKDYHQRFXVWRPHUVKHVD\V:KLOHVRPHVD\WKH UXOHRIWKXPEIRUHVWDEOLVKLQJDPDUNHWLQJEXGJHWLVSHUFHQWRISURMHFWHGDQQXDOUHYHQXH6WUDXVVVD\V HDFKEXVLQHVVKDVWRWDLORULWVPDUNHWLQJEXGJHWWRLWVRZQQHHGV$UHJLRQDOEXVLQHVVPD\KDYHPRUHOLPLWHG PDUNHWLQJYHQXHVWKDQDEXVLQHVVWKDWLVODXQFKLQJQDWLRQDOO\RULQWHUQDWLRQDOO\IRUH[DPSOH 1RWRUJDQL]LQJIRUWD[VDYLQJV,W·VLPSRUWDQWWRVHHNWKHFRXQVHORIDNQRZOHGJHDEOHÃ&#x20AC;QDQFLDO DGYLVRUWRGHWHUPLQHKRZWRRUJDQL]H\RXUEXVLQHVVIRUWKHEHVWSRVVLEOHWD[DGYDQWDJH6RPHSHRSOHUXQ WKHLUEXVLQHVVHVDVVROHSURSULHWRUVKLSVLQVWHDGRI//&VRU6FRUSVDQGJLYHXSUHDOVDYLQJVRQWD[HV7KDW·VD ELJPLVWDNH6WUDXVVVD\V Spending too much. :KHQ\RXODQGWKDWELJORDQRUKDYHVRPHVDYLQJVDFFUXHGIRUVWDUWXSLWFDQEH WHPSWLQJWRVSOXUJHRQDQLFHRIÃ&#x20AC;FHVSDFHRUDELJVWDII7KDW·VDQRQR6WUDXVVVD\V.HHSLQJRYHUKHDGORZ LVRQHRIWKHHDVLHVWZD\VEXVLQHVVHVFDQEHWWHUPDQDJHWKHLUPRQH\DQGHQVXUHWKHLUVXUYLYDOKHVD\V7KLV LVHVSHFLDOO\LPSRUWDQWZKHQ\RX·UHLQWKHKHDG\Ã&#x20AC;UVWGD\VDQG\RXZDQWWRJREX\QHZIXUQLWXUHDQGQHZ FRPSXWHUVDQGELJUHQW6ORZGRZQWKHUHFRZER\6WUDXVVVD\V7KLQNDERXWKRZWREHWWHUVDYHRULQYHVW WKDWPRQH\IRUWKHORQJWHUPJURZWKRI\RXUEXVLQHVV ,QIRUPDWLRQ3URYLGHG%\ZZZHQWUHSUHQHXUFRP

&$7$/<67

























3$*(


SIGNAL SEEKERS NTC and the Wi-Fi Connection -HVVLFD+LOOÂ&#x2021;1DVKYLOOH7HFKQRORJ\&RXQFLO ,W·VVDIHWRVD\WKDWLI\RXDUHUHDGLQJWKLVPDJD]LQHHVSHFLDOO\WKHGLJLWDOYHUVLRQ\RXXVH\RXUVPDUWSKRQHRUWDEOHW RQDGDLO\EDVLVWRFKHFNHPDLOXSGDWH\RXU)DFHERRNVWDWXVUHDGWKHQHZVDQGPRUH:KLOHVRPHIRONVVFRIIDWXV signal-seekers, plugging-in is now an indispensable part of our lives:KHWKHUZH·UH ORRNLQJXSEXVVFKHGXOHVRUWZHHWLQJSLFWXUHVLW·VEHFRPHDEDVLFWRRORIRXUGDLO\OLYHV Whether weâ&#x20AC;&#x2122;re ,WXVHGWREHWKDWPRVWRIXVKDGRQHGHYLFHWKDWUHTXLUHGD:L)LVLJQDORXUODSWRSEXW looking up bus QRZPDQ\RIXVKDYHDWOHDVWtwo or moreGHYLFHVHLWKHUDURXQGRUZLWKXVWKDWKDYH:L)L schedules or EXLOWLQWRWKHP$WPDQ\KRPHVWKHUHDUHSKRQHVWDEOHWVFRPSXWHUVLQWHUQHWFRQQHFW79 RU79GHYLFHVVXFKDVD5RNXDQGHYHQGLJLWDOFDPHUDV1HZWHFKQRORJ\LVFRQVWDQWO\ tweeting pictures, HPHUJLQJWKDWZLOOUHTXLUHHYHQPRUH:L)LFRQQHFWLRQV Wi-Fi has become

a basic tool of RXUGDLO\OLYHV

7KHJRRGQHZVLVWKDWLI\RXDUHLQ'RZQWRZQ1DVKYLOOHIURP5LYHUIURQWWR%ULGJHVWRQH $UHQD\RXDUHDEOHWRFRQQHFWWRDIUHHSXEOLF:L)LQHWZRUN<HSWKDW·VEORFNV RIIUHH:L)LWKDWLVSURYLGHGE\WKH1DVKYLOOH7HFKQRORJ\&RXQFLO

7KLVQHWZRUNVHUYHVWKHORFDOFRPPXQLW\HYHU\GD\DQGFDQVXSSRUWDERXWVLPXOWDQHRXVXVHUV+RZHYHULWFDQEH PDGHVWURQJHUIRUPDQ\HYHQWVWKDW1DVKYLOOHKRVWVHDFK\HDUVXFKDVWKH&0$)HVWLYDODQG$ZDUGVIn order to provide and maintain this public service, we rely on the generous support of sponsorsVXFKDV,ULV1HWZRUNV, Resource Communications Group, Intel and Country Music Association &0$ ,QDGGLWLRQPDQ\GRZQWRZQPHUFKDQWVDQG EXVLQHVVHVDOORZHGXVWRSODFHHTXLSPHQWRQWKHLUURRIWRSV$VWKHSRSXODULW\RIZLUHOHVV,QWHUQHWDFFHVVJURZVFLWLHVDFURVV WKH86DUHFRPSHWLQJWRSURYLGHWKHEHVWIUHH:L)LDYDLODEOHWRWKHLUUHVLGHQWVDQGYLVLWRUV-XVWDVORFDOEXVLQHVVHVXVH IUHHZLUHOHVVDFFHVVWRDWWUDFWFXVWRPHUVPDQ\FLWLHVIHHOWKHQHHGWRLPSURYHSXEOLFDFFHVVWRDWWUDFWQHZUHVLGHQWVDQG WRXULVWV     

    

    

    

    

    

)UHH:L)LLVDEHQHÃ&#x20AC;WWRDOOWKHZLUHOHVVXVHUVLQWKHFLW\. We hope VSRQVRUVZLOOLQFUHDVLQJOO\KHOSWKHGRZQWRZQ1DVKYLOOH:L)LQHWZRUN JURZE\KHOSLQJXVZLWKHTXLSPHQWDQGPDLQWHQDQFH%HVXUHWRWDNH DGYDQWDJHRIWKHIUHHSXEOLF:L)LZKHQHYHUDQGZKHUHYHU\RXFDQ DQGKHOSXVJURZWKLVJUHDWVHUYLFHZHSURYLGH

Leah Magee on one of the many Nashville rooftops sheâ&#x20AC;&#x2122;s been on installing Wi-Fi.

The large crowd at the 2011 CMA Festival who rely on the free Wi-Fi connection.

&$7$/<67

























3$*(


,PDJHFRXUWHV\RIPDVKDEOHFRP

!%$# &*%"#)

'!((        *(#((,)"*!)%!"$! ($!*)$#()$" .$*'!('

 #'(%'$'"## '*-%#((

$ )

!#

$'#,)$  ),$' %)"/)$#  (*%%$')(!!'''(

#!($*'($!*)$#( "*()$""(.



 

&$7$/<67





 





'## !#(  $"!'#'$"$*' -%')(   $*)$''## !#(

"%!$.!* '$'"  ($*#),'!((('+ $'.$*' "%!$.(

   

 

       3$*(      !   


LOOKING AND LEANING FORWARD /L]D/RZHU\0DVVH\Â&#x2021;1DVKYLOOH7HFKQRORJ\&RXQFLO (YHQWKRVHRIXVZKRDUHQRWVROGLHUVRUVSLHVXQGHUVWDQGWKHFXUUHQWXVHRIWKHWHUPOHDQLQJIRUZDUGWRGHVFULEHDEXVLQHVV SHUVRQRURUJDQL]DWLRQWKDWLVIRFXVHGRQWKHIXWXUHSURJUHVVLYHHDJHUHYHQDJJUHVVLYH:KLOHLWZDVEURXJKWLQWRWKH PDLQVWUHDPE\PLOLWDU\OHDGHUVthe term conjures an image that is especially relative to technology professionals. Even GXULQJWKHLQWHUYLHZSURFHVVIRUP\SRVLWLRQZLWKWKH17&DPHPEHURIWKHVHOHFWLRQFRPPLWWHHUHPDUNHGWKDWKHWKRXJKW,ZDV DJRRGÃ&#x20AC;WEHFDXVH,ZDVDIRUZDUGOHDQLQJW\SHRISHUVRQ $VWKH17&WHDPSODQQHGIRUDQGFRQVLGHUHGKRZZHFDQFRQWLQXHWRKHOSPDNH0LGGOH7HQQHVVHH·VWHFKQRORJ\ FRPPXQLW\VXFFHVVIXOZHIRXQGRXUVHOYHVGRLQJVRPHOHDQLQJIRUZDUGDVZHUHYLHZHGRXUFXUUHQWSURJUDPVDQGHYHQWVDQG FRQWHPSODWHGQHZRQHV6RPHPLJKWFRQVLGHUXVJORULÃ&#x20AC;HGSDUW\SODQQHUVDVZHKDYHEHHQ ORYLQJO\ FDOOHGEXWZHVHH RXUVHOYHVDVSURDFWLYHSURIHVVLRQDOVZKRDQWLFLSDWHWKHQHHGVRI0LGGOH7HQQHVVHH·VWHFKFRPPXQLW\DQGZRUNWRDGGUHVVWKHP 2IFRXUVHZHGRNQRZKRZWRWKURZDJUHDWSDUW\ ,Q2FWREHURXUFROOHDJXHVDWC3 ConsultingXQGHUWKHOHDGHUVKLSRI%HWK&KDVHIDFLOLWDWHGDQRWKHUOHDQLQJIRUZDUG H[HUFLVHDSODQQLQJPHHWLQJZLWK17&·V%RDUGRI'LUHFWRUV7ZRWRSLFVZHUHGLVFXVVHG²WKHSRVVLELOLW\RISXUVXLQJIRUPDWLRQ RIDVWDWHZLGHWHFKQRORJ\FRXQFLODQGRXUPHPEHUFRPSDQLHV·SDLQSRLQWVRUIRFXVIRUWKHXSFRPLQJ\HDU7KHUHVXOWVRIRXU GLVFXVVLRQUHJDUGLQJWKHWRSLFRIDVWDWHZLGHWHFKQRORJ\FRXQFLOÃ&#x20AC;QGVWKH17&WHDPDQGVHYHUDOYROXQWHHUVGRLQJPRUHUHVHDUFK DQGGHYHORSLQJUHFRPPHQGDWLRQVIRUWKH%RDUG·VFRQVLGHUDWLRQODWHUWKLV\HDU7KHSDLQSRLQWVGLVFXVVLRQUHVXOWHGLQ FRQÃ&#x20AC;UPDWLRQRIZKDWZHDOUHDG\EHOLHYHGRXUPHPEHUFRPSDQLHVDUHPRVWFRQFHUQHGDERXWÃ&#x20AC;QGLQJDQGUHWDLQLQJDWRSQRWFK ,7ZRUNIRUFHDQGPDNLQJFRQQHFWLRQVIRUPLQJSDUWQHUVKLSV 17&KDVDKLVWRU\RIOHDGLQJHIIRUWVWRDGGUHVV,7ZRUNIRUFHGHYHORSPHQW7KLV\HDUZLOOVHHXVFRQWLQXLQJWRfocus on the three Râ&#x20AC;&#x2122;s of recruitment, retooling, and retraining:HZLOODOVRH[SDQGRXUVXFFHVVIXO)LUVW&DPSZKLFKVWULYHVWRFUHDWHIRUZDUG OHDQLQJWHFKSURIHVVLRQDOVRXWRIKLJKVFKRROVWXGHQWV7RDGGUHVVWKHDUHDRIFRQQHFWLRQVDQGIRUPLQJSDUWQHUVKLSV17& LQWHQGVWRFRQWLQXHZLWKPDQ\RIRXUFXUUHQWHYHQWVVXFKDVRXUHGXFDWLRQDOURXQGWDEOHV,QIR6HFDQG0HPEHU%UHDNIDVWDQG QHWZRUNLQJRSSRUWXQLWLHVVXFKDVJROÃ&#x20AC;QJZLWKWKH%RDUGKROLGD\SDUWLHVDQGWKH7HFK$ZDUGV*DOD:HZLOOEHUHYDPSLQJ 7HFK1DVKYLOOHDQGDGGLQJD+,76HFXULW\DQG3ULYDF\&RQVRUWLDDQGHPHUJLQJJURZWKEXVLQHVVVHULHV6HHWKH(YHQW&DOHQGDU IRUPRUHLQIRUPDWLRQDQGZDWFKRXUHYHQWQHZVOHWWHUDQGZHEVLWHIRUGHWDLOVUHJDUGLQJWKHVHDQGRWKHUHYHQWVDQGSURJUDPV )ROORZLQJWKHWKHPHRISDUWQHULQJ17&ZLOOFRQWLQXHWRUHDFKRXWWRRWKHURUJDQL]DWLRQVWRSDUWQHURQHYHQWVDQGSURJUDPVDQG LQFUHDVHYDOXHWRRXUPHPEHUV:HZLOOFRQWLQXHWRZRUNZLWKWKHEntrepreneur Center, Nashville Chamber, Nashville Health Care Council and ISSADQGZLOOLQFUHDVHRXUSDUWQHUVKLSVZLWKWIT, SIMDQGRWKHUPHPEHUEDVHGRUJDQL]DWLRQVWKURXJKMRLQW HYHQWVVSRQVRUVKLSVSURYLGLQJVSHDNHUVDQGPHPEHUGLVFRXQWV )LQDOO\ZHDUHLPSURYLQJRXUGDWDFDSWXUHDQGDQDO\VLVFDSDELOLWLHVVRZHFDQFUHDWHDPRUHDFFXUDWHPHPEHUSURÃ&#x20AC;OHWREHWWHU XQGHUVWDQGRXUWDUJHWDXGLHQFHPRUHFORVHO\DOLJQRXUSURJUDPVDQGHYHQWVZLWK\RXUQHHGVDQGLQWHUHVWVDQGÃ&#x20AC;OODQ\JDSV WKDWZHÃ&#x20AC;QG7KLVSURÃ&#x20AC;OHZLOODOVRKHOSXVDVZHORRNIRUZDUGWR%RDUG0HPEHUHOHFWLRQVODWHUWKLV\HDU:HZDQWWRHQVXUH WKDWRXU%RDUGLVWUXO\UHSUHVHQWDWLYHRIRXURYHUDOOPHPEHUVKLS :HKRSHWKLV\HDUÃ&#x20AC;QGV\RXOHDQLQJIRUZDUGZLWKXV



)DOO*ROI2

6XPPH

&$7$/<67







U3DUW\



XWLQJ

J

KLS0HHWLQ 0HPEHUV



















3$*(


&$7$/<67

























3$*(


LETTER FROM THE PRESIDENT 'HDU0HPEHUV² :HOFRPHWRWKHÃ&#x20AC;UVWHGLWLRQRIWKH1DVKYLOOH7HFKQRORJ\&RXQFLO·V&DWDO\VWPDJD]LQHXQGHUP\ OHDGHUVKLS$V\RXUHDGWKURXJKWKLVHGLWLRQ,KRSH\RXVKDUHRXUH[FLWHPHQWDQGHQWKXVLDVP RYHUZKDWKDVEHHQGRQHZKDWLVEHLQJGRQHDQGZKDWZHKDYH\HWWRGRLQ0LGGOH7HQQHVVHH·V WHFKFRPPXQLW\ 7KDQNVWRHYHU\RQHZKRFRQWULEXWHG2XUJXHVWZULWHUVSURYLGHGLQWHUHVWLQJDQGLQIRUPDWLYH DUWLFOHVDQG17&VWDIIHUV/HDK0DJHHDQG0ROOLH0F&RUPLFNFRQWULEXWHGLQPDQ\ZD\VLQFOXGLQJ writing and getting other to write articles, proofreading, and getting sponsors and advertisers. $YHU\VSHFLDOWKDQN\RXDQGFRQJUDWXODWLRQVWR-HVVLFD+LOORXU(GLWRULQ&KLHIWKLV\HDU6KH PDGHLWKDSSHQDQGLVWKHFUHDWLYHIRUFHEHKLQGWKHOD\RXWJUDSKLFVDQGIDFWRLGV 7KHFRQWHQWVWKLV\HDUKLJKOLJKWRXULQQRYDWRUVHQWUHSUHQHXUVDQGWKRXJKWOHDGHUV:HDUH SOHDVHGWKDWRQHRIRXUVFKRODUVKLSUHFLSLHQWVDQG7HFK6WXGHQWRIWKH<HDUFRQWULEXWHGKHU WKRXJKWVDERXWSXUVXLQJDFDUHHULQWHFKQRORJ\:HDOVRHQFRXUDJH\RXWRFKHFNRXWRXUFDOHQGDU RIHYHQWVDQGMRLQXVDVRIWHQDVSRVVLEOH$V/HDKOLNHVWRVD\WKH17&ZRUNVZKHQ\RXZRUNLW 7KDQN\RXIRU\RXUVXSSRUWDQGPHPEHUVKLSLQWKH1DVKYLOOH7HFKQRORJ\&RXQFLO<RXRXU PHPEHUVPDNHLWSRVVLEOHIRUXVWRGHOLYHURQRXUPLVVLRQ²KHOSLQJWRPDNH0LGGOH7HQQHVVHH·V WHFKFRPPXQLW\VXFFHHG %HVW5HJDUGV Liza Lowery Massey

&$7$/<67


























What makes Nashville the ideal place for hospital companies and their IT partners to grow?

“The front line of healthcare is here.” — Tom Stephenson, CEO

Healthcare Management Systems, Inc. (HMS) has a 27-year history of innovation and growth in Nashville. We serve more than 700 community and specialty hospitals throughout the United States, and our Nashville headquarters’ presence has grown to more than 400 employees.

Proud to be a health IT partner for: ◾ Behavioral Centers of America

◾ LifePoint Hospitals

◾ Community Health Systems

◾ Quorum Health Resources (QHR)

◾ Haven Behavioral Healthcare

◾ RegionalCare Hospital Partners

&$7$/<67



HEALTHCARE MANAGEMENT SYSTEMS, INC.® 3102 West End Avenue, Suite 400, Nashville, TN 37203 Phone: Fax www.hmstn.com    615.383.7300   615.844.7499     




NTC MEMBER DIRECTORY QG/RRN6WXGLR QPHGLD $DURQ 6DQGHUV3//& $EVROXWH6RIWZDUH $EVROXWH:LUHOHVV $FFXYDQW $GDUD1HWZRUNV $'3 $GYDQFHG1HWZRUN6ROXWLRQV $GYL]H;7HFKQRORJLHV Advocat Inc $GYRFDWH0DUNHWLQJ 3ULQW $HJLV+HDOWK*URXS,QF $HJLV6FLHQFHV&RUSRUDWLRQ $JLOH7LFNHWLQJ6ROXWLRQV $LUQHW*URXS,QF Alert Logic $OOLHG,QIR6HFXULW\ Alltech, Inc. AmMed Direct $P6XUJ $QJHO&DSLWDO*URXS Anthony-Denmark &RPPXQLFDWLRQV $2/6WXGLR1RZ $SH[6\VWHPV,QF $3,'LJLWDO Applied Information 0DQDJHPHQW,QVWLWXWH $UGHQW+HDOWK6HUYLFHV $57(·&HQWHU $VVRFLDWHG3DFNDJLQJ,QF $VXULRQ $7 7 $WLED6RIWZDUH//& $XVWLQ3HD\6WDWH8QLYHUVLW\ $XWRGHVN,QF Avankia Avaya %DNHU'RQHOVRQ%HDUPDQ &DOGZHOO %HUNRZLW]3& %DUJH:DJJRQHU6XPQHUDQG Cannon, Inc. %DUUDFXGD1HWZRUNV %DVV%HUU\ 6LPV3/& %% 7&RRSHU/RYH-DFNVRQ 7KRUQWRQ +DUZHOO

%HDFK/LVW'LUHFW,QF %HOPRQW6RIWZDUH6HUYLFHV %HOPRQW8QLYHUVLW\ %HQHÀW&RPPXQLFDWLRQV,QF %LJ'DWD0DUNHWLQJ %OXH&RDW6\VWHPV %2+$1 %RQGZDUH,QF %RQH0F$OOHVWHU1RUWRQ3//& %RRNV$0LOOLRQ %RUGHU-XPS %RVRQ6RIWZDUH//& %RWWRP/LQH&RQVRUWLXP//& %UDGOH\$UDQW%RXOW&XPPLQJV//3 %UDQGRQ7HFKQRORJ\&RQVXOWLQJ,QF %ULGJHPRUH6ROXWLRQV//& %ULGJHVWRQH)LUHVWRQH,QF %URDGFDVW'DWD6\VWHPV %URDGFDVW0XVLF,QF %0,

%URRNVRXUFH &&RQVXOWLQJ//& &7HFKQRORJLHV &DGUH,QIRUPDWLRQ6HFXULW\ &%76 &LQFLQQDWL%HOO7HFKQRORJ\ 6ROXWLRQV

CDW &HOO-RXUQDOLVW,QF &HQWHUIRU,QIRUPDWLRQ7HFKQRORJ\ (GXFDWLRQRI71 &,7(

&HQWUH6RXUFH,QF &HQWXU\/LQN IRUPHUO\4ZHVW%XVLQHVV

&LEHU,QF Claritas Capital &OHDU3D\PHQWV,QF &OHDU7UDFN,QIRUPDWLRQ1HWZRUN Clearwater Compliance, LLC &REEOH6RIW,QWHUQDWLRQDO/WG &ROLJRV&RQVXOWLQJ &RPFDVW%XVLQHVV&RPPXQLFDWLRQV LLC. Comdata &RPPXQLW\+HDOWK6\VWHPV &+6

&RPP9DXOW6\VWHPV,QF &RPSDVV([HFXWLYHV//& &RPS1DWLRQ &RPSXWHU &DEOH6HUYLFHV*URXS &&6*,QF

&RPSXWHU3URIHVVLRQDOV,QF &RPSXZDUH&RUSRUDWLRQ &RQFHSW7HFKQRORJ\,QF Conexess &RQQHFWHG7HQQHVVHH &RQVHQVXV3RLQW &RUH%XVLQHVV7HFKQRORJ\6ROXWLRQV &RUUHFW&DUH6ROXWLRQV &RXULRQ&RUSRUDWLRQ &35 &UHHNPRUH&RQVXOWLQJ &XPEHUODQG&RQVXOWLQJ*URXS//& &\EHUD,QF 'DOFRQ&RPPXQLFDWLRQ6\VWHPV,QF 'DWD,QWHOOLJHQFH*URXS 'HFLVLRQ6RXUFH,QF 'HOO&RPSXWHU&RUSRUDWLRQ Deloitte Dex Imaging and Mailing 'LJLWDO1DVKYLOOH Direct Administration Inc. 'ROODU*HQHUDO 'UHDP6\VWHPV Dreamline '6L'RFXPHQW6ROXWLRQV,QF Dynamic Edge edo Interactive, Inc. (GXFDWLRQ1HWZRUNVRI$PHULFD (1$

(OL]D%URFN6RIWZDUH Emdeon H0LGV7HFKQRORJLHV Emma, Inc. (QIR3RLQW//& H1WHJULW\6ROXWLRQV (QYLURQPHQWDO6FLHQFH&RUSRUDWLRQ espaces, inc. H7UDQV; ([DFW7DUJHW ([SHULV )RUPHUO\&RPV\V

)1HWZRUNV )'+&RQVXOWLQJ )LGHQW//& )LUHÁ\/RJLF )ODW(DUWK1HWZRUNLQJ,QF )RFXV7HFKQRORJ\*URXS )RUWLV,QVWLWXWH

3$*(


NTC MEMBER DIRECTORY )UDQNOLQ$PHULFDQ0RUWJDJH )UHVHQLXV0HGLFDO&DUH1HWZRUN Engineering *6TXDUHG:LUHOHVV *DUWQHU *%75HDOW\&RUSRUDWLRQ *HQLV\V*URXS,QF *,6EL] *OREDO&URVVLQJ *OREDO7HFKQRORJ\$GYLVRU\*URXS *7$*

*RRGZLOO,QGXVWULHVRI0LGGOH7HQQHVVHH *ULIÃ&#x20AC;Q7HFKQRORJ\ *URXS'DWD6HUYLFHV *XEELQV/LJKW 3RZHU&RPSDQ\//& +DOO&RQVXOWLQJ*URXS +DPPRFN,QF +DQFRFN$GYHUWLVLQJ&R +&$ +RVSLWDO&RUSRUDWLRQRI$PHULFD

+HDOWKER[7HFKQRORJLHV +HDOWKFDUH0DQDJHPHQW6\VWHPV,QF +06

+HDOWKFDUH3URGXFWLYLW\$XWRPDWLRQ +HDOWK6SULQJ +HDOWK6WUHDP,QF +HDOWKZD\V +HUULQJ7HOHFRP +LVFDOO,QF +ROODQG6TXDUH*URXS +RW7RSLF,QF +3(QWHUSULVH6HUYLFHV +XPDQ&DSLWDO*URXS,QF ,$6,6+HDOWKFDUH ,%0 ,&*/LQN,QF ,&96ROXWLRQV,QF iDesign, Inc. ,PDJH4XHVW ,QGXVWULDO6WUHQJWK0DUNHWLQJ,QF ,QÃ&#x20AC;QLW\5HVRXUFH*URXS ,QIREOR[ ,QIRUPDWLFV&RUSRUDWLRQRI$PHULFD ,&$

,QIRUPDWLRQ%XLOGHUVL:D\6RIWZDUH ,QIR6\VWHPV,QF InfoWorks, Inc. Ingenix

,QJHQXLW\$VVRFLDWHV//& ,QJUDP&RQWHQW*URXS ,QVLJKW*OREDO,QF ,Q6WUHDP Intel Internetwork Engineering ,RQ,7*URXS,QF L3UDFWLFH*URXS ,URQ6ROXWLRQV,QF ,7$&6ROXWLRQV ,777HFKQLFDO,QVWLWXWH - -3&&RQFHSWV,QF -DFNVRQ1DWLRQDO/LIH,QVXUDQFH&RPSDQ\ -DFNVRQ7KRUQWRQ7HFKQRORJLHV -DUUDUG3KLOOLSV&DWH +DQFRFN,QF -RKQVWRQ7HFKQRORJLHV -RXUQH\7($0²0LFUR7HFK .HOO\,75HVRXUFHV .HOVR*URXS .H\VWRQH%XVLQHVV6ROXWLRQV//& .30*//3 .UDIW$QDO\WLFV//& .UDIW(QWHUSULVH6\VWHPV .UDIW7HFKQRORJ\*URXS,QF .\]HQ&RUSRUDWLRQ /DQ/LQN&RPPXQLFDWLRQV /DWLWXGH7KLUW\6L[ )RUPHUO\7HFK53

/DWWLPRUH%ODFN0RUJDQ &DLQ3& /%0&

/HDQ.LW %DQGLW6RIWZDUH

/HOO\HWW 5RJHUV6HUYLFHV&R//& LetterLogic, Inc. /HYHO&RPPXQLFDWLRQV /LIH6FLHQFH7HQQHVVHH /LSVFRPE8QLYHUVLW\ /RFDO6HDUFK0DVWHUV /RHZV+RWHOV 5HVRUWV /36,QWHJUDWLRQ,QF 0DF$XWKRULW\ Magazines.com, LLC 0DLQIUDPH6HUYLFHV,QF 0DLQOLQH,QIRUPDWLRQ6\VWHPV 0DLQ1HUYH,QF 0DMRU0HQXV 0DQFKHVWHU7DQN McAfee

0&3F,QF MDE Enterprises, Inc. 0(',$6(59(//& 0HGLFDO0DQDJHPHQW3URIHVVLRQDOV 0HG6ROXWLRQV,QF 0HQWDO+HDOWK&RRSHUDWLYH Meridian Leasing >PHWD@PDUNHWHU 0HWUR*RYWRI1DVKYLOOH'DYLGVRQ&W\ ,76HUYLFHV 0HWUR3XEOLF6FKRROV,QIRUPDWLRQ 7HFKQRORJ\ 0HWURSROLWDQ1DVKYLOOH$LUSRUW$XWKRULW\ Microsoft Corporation 0LGGOH7HQQHVVHH6WDWH8QLYHUVLW\ 0768

0LNH&ROOLQV $VVRFLDWHV MindLinx, LLC 0RELOH&DPSDLJQ 0RQDUFK,QIRUPDWLRQ1HWZRUNV 0RRQ7RDVW 0XUUD\6WDWH8QLYHUVLW\&HQWHUIRU760 0XVLF&LW\1HWZRUNV 0\+HDOWK',5(&7 MyWerx, LLC 1DVKYLOOH$UHD&KDPEHURI&RPPHUFH 1DVKYLOOH%XVLQHVV-RXUQDO 1DVKYLOOH&DUHHU$GYDQFHPHQW&HQWHU 1DVKYLOOH(OHFWULF6HUYLFH 1DVKYLOOH+HDOWK&DUH&RXQFLO 1DVKYLOOH6WDWH&RPPXQLW\&ROOHJH 1HWZRUN6HUYLFHV*URXS,QF 1HWZRUN6ROXWLRQV*URXS//& 1H[7LPH,QF 1H[XV*URXS IRUPHUO\,6'11HW,QF

1,&,QF 7HQQHVVHH,QIRUPDWLRQ&RQV

1LVVDQ1RUWK$PHULFD,QF 1RUWK+LJKODQG&RPSDQ\ 1RUWKZD\6ROXWLRQV*URXS 1RWLI\0' 1RYDFRS\ 129$67HFKQRORJ\*URXS 1:1 )RUPHUO\&RP)UDPH

2DWHVDQG&RPSDQ\ 2QH%HDFRQ7HFKQRORJ\,QVXUDQFH 2QOLIH+HDOWK,QF 2QRUD*URXS

3$*(


NTC MEMBER DIRECTORY 2SWLPXP6ROXWLRQV,QF 2UDFOH 2WWHU%DVH 3$(7(& 3DUHQWDO+HDOWK//& 3DWK*URXS,QF 3DWLHQW·V3DJHUV3UHFLVLRQ'7& Advertising 3HDN 3HQJXLQ0DUNHWLQJ,QF 3HUPDQHQW*HQHUDO&RPSDQLHV Inc 3+*7HFKQRORJLHV 3KLVK0H,QF 3LQQDFOH)LQDQFLDO3DUWQHUV 3OXJJHG,Q,QF 3RLQW&OHDU6ROXWLRQV 3RPHUR\ 3UHPLHUH*OREDO6HUYLFHV 3*,,QF

3UHVV*DQH\$VVRFLDWHV,QF 3ULQFH0DUNHW5HVHDUFK,QF 3ULVP7HFKQRORJLHV//& 3URDFFXUD 3URJUDPPLQJ5HVRXUFHV,QF 3URV\V 3XUH6DIHW\ 46RXUFH 4XDOLIDFWV6\VWHPV,QF 4XDUUL7HFKQRORJLHV 4XDVLXV,QYHVWPHQWV*&$ 5-<RXQJ 5DGZDUH 5HVRXUFH&RPPXQLFDWLRQV*URXS //& 5&*

5H]XOW 5LFKDUGV 5LFKDUGV 5M%3DUWQHUV//& 5RFNKRXVH3DUWQHUV 5RJHUV*URXS,QF 56$6HFXULW\ 5XWKHUIRUG&RXQW\*RYHUQPHQW 5\DQ6HDUFK &RQVXOWLQJ 6DIH1HWZRUN6ROXWLRQV 6DQGOHU7UDLQLQJ 6D\HUV//& 6%5,QF 6FDUOHWW/HDGHUVKLS,QVWLWXWH 6FKQHLGHU(OHFWULF

6HDUFK9L] 6HFRQG+DUYHVW)RRG%DQNRI 0LGGOH71 6(6$& 6KDFNOHIRUG=XPZDOW +D\HV//3 6KDUHDEOH,QN 6+,,QF 6LPSOH[+HDOWKFDUH 6LPSOLI\ 6LPV5HF\FOLQJ6ROXWLRQV 6LULXV&RPSXWHU6ROXWLRQV 6LWH+DZN 6LWHPDVRQ,QF 6PDUWYXH&RUSRUDWLRQ 6PLWK6HFNPDQ5HLG,QF 6RFLDO)OLJKWV 6RIWFKRLFH 6RIWZDUH21( 6ROLGXV 6SULQW 6WUDLJKW$UURZ&RQVXOWLQJ 6WUDWDVDQ )RUPHUO\+HDOWK'DWD6RXUFH

6WUDWHJLF%OHQG//& 6WULQJIHOORZ7HFKQRORJ\*URXS,QF 6WXGLR1DVK9HJDV 6XEOLPH&RPSXWHU6HUYLFHV 6\QHUJ\6\VWHPV//& 6\VJHQL[5HVRXUFHV 6<6/2*,&7HFKQRORJ\6ROXWLRQV 6\VWHPV6ROXWLRQV7HFKQRORJLHV//& VWQHW

7DEOH*URXS&RQVXOWLQJ 7DNH&DUH+HDOWK6\VWHPV IRUPHUO\&+' 0HULGLDQ

7HFKQLFDO,QQRYDWLRQ 7HFKQRORJ\$FFHVV&HQWHU 7HNQHWH[ 7(.V\VWHPV,QF 7HO)RUFH*URXS 7HQQHVVHH6WDWH8QLYHUVLW\ 768

7HQQHVVHH7HFKQRORJLFDO8QLYHUVLW\ 7HQQHVVHH7HFKQRORJ\'HYHORSPHQW &RUSRUDWLRQ 77'&

7KH/DPSR*URXS,QF 7KH2XWVHW*URXS 1DVKYLOOH

7KH5HKDE'RFXPHQWDWLRQ&RPSDQ\,QF 7KH:RUN,QVWLWXWH WKH.LW 7KRPDV1HOVRQ,QF

7,7$17HFKQRORJ\3DUWQHUV/LPLWHG 7UDFWRU6XSSO\&RPSDQ\ 7UDQVFHQGHQW*URXS 7UHQG0LFUR,QF 7UHYHFFD1D]DUHQH8QLYHUVLW\ 7ULQLV\V//& 7ULSZLUH,QF 7UXH%ULGJH5HVRXUFHV 76$,QF 7736ROXWLRQV 7XQHG,Q%URDGFDVWLQJ 799&DSLWDO )RUPHUO\$QGUHZ: %\UG &R//&

tw telecom 8QLWHG0HWKRGLVW&RPPXQLFDWLRQV 867*OREDO 9DFR//& 9DQGHUELOW8QLYHUVLW\2ZHQ*UDGXDWH 6FKRRORI0JPW 9DQGHUELOW8QLYHUVLW\6FKRRORI Engineering 9DQJXDUG+HDOWK6\VWHPV 9HUL]RQ:LUHOHVV 9LGHR*DPLQJ7HFKQRORJLHV,QF 9ROXQWHHU6WDWH&RPPXQLW\&ROOHJH :6TXDUHG :DGGH\ 3DWWHUVRQ3& :DOLFN.HPS $VVRFLDWHV :LOOLDPVRQ&RXQW\(FRQRPLF 'HYHORSPHQW&RXQFLO Williamson Medical Center Willis :LQGVWUHDP&RPPXQLFDWLRQV :LSUR*DOODJKHU6ROXWLRQV,QF :RPHQLQ7HFKQRORJ\RI71 :RRG3HUVRQQHO :3&6HUYLFHV ;HUR[&RUSRUDWLRQ ;0L&RPPHUFLDO5HDO(VWDWH ;0L+ROGLQJV ;2&RPPXQLFDWLRQV,QF =D\R*URXS =&ROR

=RRP,QWHUQDWLRQDO =\FURQ,QF

3$*(


NOTES

3$*(


615.346.9139 &$7$/<67


























Catalyst 2012