Page 1

$

JACKPOT IS NOW nylottery.ny.gov Please Play Responsibly. ©2014 New York Lottery. You must be 18 years or older to purchase a Lottery ticket.

VIDEO GAMES YOU JUST CAN’T MISS

BIG COMPANIES UNVEIL MONSTER FUN AT E3.

257

MILLION

PAGE 20

NEW YORK CITY’S #1 FREE DAILY NEWSPAPER

Wednesday, June 11, 2014 www.metro.us | t: MetroNewYork | f: MetroNewYork

Pot busts same under de Blasio as Bloomberg PAGE 04

School shooting rocks Oregon PAGE 08

‘Subtlety’ exhibit anything but subtle PAGE 16

Forward thinking. A group in Bushwick, Brooklyn is using 3-D printers to create mini-recycling bins that will help keep city streets cleaner. Technology. Urban Hubs , the open source idea, is spreading around Brooklyn and the globe. PAGE 02

3-D CAN DO

Is it hot in here or do you sweat too much? PAGE 22

Daniel Figur, co-founder and creative director of TCR3D, demonstrates how Urban Hubs, a 3-D printed recycling bin, snap together. / MILES DIXON, METRO

P NO L AY W !


1 NEWS Today’s tweet

“New York Don’t Know How To Be Quiet.” @NiikOTRawW

Top 3

What’s trending online at Metro.us

1

‘Aaron Rodgers gay? New girlfriend Olivia Munn nixes the rumors (pics)’

2

‘Meet Jennifer Lydon, the Metro staffer who came out as transgender after 14 years’

3

‘Top 5 touching videos from transgender people’

www.metro.us Wednesday, June 11, 2014

NEW YORK

2

Using 3-D printing to help clean NYC streets Innovative. Urban Hubs are trying to change the way that the world recycles. If you’ve taken the L train to Brooklyn recently, you may have spotted clusters of bright, honeycomblike containers attached to signposts. Each unit is sized to hold an empty can or bottle. These mini recycling bins, called Urban Hubs, are part of a Bushwick-based project created by the 3-D printing startup TCR3D that is taking hold of cities around the globe. Urban Hubs were not just designed for ecological or environmental purposes. The contraption also serves to help “canners” collect discarded bottles and cans, which they then redeem for cash in order to make a living. “This happens every day,” Daniel Figur, TCR3D co-founder and creative director, said, gesturing to an overflowing garbage can on the sidewalk of Jefferson Street. It allow canners easier access to the bottles, while preventing trash from littering the city’s streets. The creators of Urban Hubs partnered with “Sure We Can,” a co-op for canners to create a product suited to the canning community’s needs. Urban Hubs is sponsored by the 3-D printing company 3DSystems,

TCR3D CEO Nate Kolbeck puts a bottle in an Urban Hubs cluster near his studio. / MILES DIXON, METRO

Visit Metro.us for five things that you didn’t know about 3-D printing. Spreading movement The Urban Hubs movement is spreading around the globe.

about $8 in plastic filament. •

It takes the current generation of 3-D printers about seven hours to create each individual bin, but only

Damage. City settles OWS protestors suit City attorneys agreed to pay up to $583,000 in damages to settle a lawsuit alleging NYPD officers wrongfully arrested protestors at a 2012 Occupy Wall Street rally. The protestors lawyers hailed the settlement. “This involved a fast-evolving, complicated policing situation occurring over many hours where only a small

Around the globe

Big money

$583K

The amount of money that the protestors will get from the city.

fraction of protesters was arrested,” Andrew Lucas, the Assistant Corporation Counsel for the city’s Law Department said. CHESTER JESUS SORIA

So far, Urban Hubs have popped up in Italy, Japan, Canada and Ukraine, in about a thousand international downloads.

“This person in Odessa, Ukraine really picked it up and started printing Urban Hubs in Ukrainian colors.” Realexis Castro Urban Hubs team member

whose printers they use to generate the hubs. “3-D printing helps raise awareness because it’s so novel and fresh and cool, so when people see something related to 3-D printing they want to participate in what’s happening, and in this case it’s recycling,” Nate Kolbeck, co-founder and CEO of TCR3D, said. The founders stress Urban Hubs are an open source idea — their blueprint is available for free online, and they encourage others to make their own Urban Hubs. Kolbeck and Figur are enthusiastic about the rise of 3-D printing, and predict that Urban Hubs will pick up momentum as 3-D printing becomes more widespread. Since the product’s release, one user has posted a photo online of himself using Urban Hubs as cup holders for his car. The team is also looking forward to seeing what the kids at P.S. 123 in Brooklyn make of Urban Hubs, with whom they are partnering to design a curriculum with their invention. At the end of the day, Figur and Kolbeck hope their creation will outlast its original purpose as a recycling bin. “I hope there is no need for recycle bins in the future because people start using reusable bottles,” Kolbeck said. “That would be awesome if there was no need for this.” LIBBY DVIR @MetroNewYork letters@metro.us

Museum

Frick proposes expansion, renovation The Frick Collection’s second floor may soon open to the public for the first time. A renovation and expansion proposal announced Tuesday includes construction of a new six-story wing on the museum’s East 70th Street side that would increase exhibition space,

add a rooftop garden and open up private upstairs rooms. “Since the Frick Collection opened as a museum nearly 80 years ago, we have been guided by Henry Clay Frick’s mandate that his home and exquisite collection offer inspiration and enjoyment to the public,” museum director Ian Wardropper said in a statement. Construction would begin in 2017 and could

A rendering of The Frick Collection plan from Fifth Avenue. / NEOSCAPE INC.

be completed as early as 2020. The project will undergo public reviews. ANNA SANDERS


www.metro.us

l e p n a . t a s S ccit R”U et. L’O bies“ Mark Ba irway ns. Fa lgree a . W stco o C rget. . Ta d e r e v i l e D

3 new york Wednesday, June 11, 2014

When you can get all of your favorite stores delivered today, nothing is ever more than a few clicks away.

google.com/express


www.metro.us Wednesday, June 11, 2014

NEW YORK

4

Getting around town

Court approves the ‘Taxi of Tomorrow’ New York City’s plan to create a uniform taxi fleet with cabs from Nissan Motor Co. won approval from a state appeals court on Tuesday, which overturned a lower court ruling that struck down the initiative. The “Taxi of Tomorrow”

Taxi of Tomorrow / GETTY IMAGES

initiative, developed by the New York City Taxi and Limousine Commission, is “a legally appropriate response to the agency’s statutory obligation to produce a 21st century taxicab consistent with the broad interests … that the agency is charged with protecting,” Justice David Saxe wrote for a 3-1 majority for the court. In 2011, Nissan won a

contract worth $1 billion to provide its Nissan NV200 cabs, only to have a state Supreme Court justice rule last October that the TLC overstepped its authority. The plan was challenged by Evgeny Freidman, city fleet operator, and the Greater New York Taxi Association, which claimed the commission could not force taxi operators to buy specific vehicles. REUTERS

Arrests for marijuana are essentially the same between Mayor de Blasio and former Mayor Bloomberg. / GETTY IMAGES

Report: NYC weed arrest patterns are unchanged Buzzkill. Findings are “more of the same,” according to the Marijuana Arrest Research Project. Marijuana arrest patterns during the first months of the de Blasio administration are “indistinguishable” from his predecessor, according to a recent report. An average of 80 people were arrested daily during the first four months of 2014 for possessing small amounts of marijuana, a report by the Marijuana Arrest Research Project found. An average of 78 such arrests were made in all of 2013. As a candidate, Mayor Bill de Blasio pledged to work with the NYPD to reduce low-level marijuana arrests. “We’re deeply disappointed that a promise

By the numbers

80

Average number of people a day arrested for low-level marijuana possession in the first four months of 2014, according to a Marijuana Arrest Research Project report.

Mayor de Blasio made has not been fulfilled,” said Loren Siegel of the research project, which cites statistics from the New York State Division of Criminal Justice Services for the report. NYPD arrest statistics provided by the mayor’s office show a slight discrepancy from the report, but those numbers still amount to an average of 79 daily arrests in the first four months of 2014. According to the city, an average of 85 arrests were made a day during the same time in 2013. ANNA SANDERS @AnnaESanders anna.sanders@metro.us

Harshing our mellow

“Mayor has said he agrees with the commissioner’s call to have officers exercise more discretion in marijuana cases, that excessive arrests for small amounts of marijuana are unproductive and the real thing we need to look out for is serious crime.” Phil Walzak, spokesman for de Blasio


See more at www.metro.us

NEW N YORK

5

text. Investor is An emotional push for Rich hiding money in NYC lower city speed limits Traffic. Families of those killed in traffic accidents demand change. Time is running out for state lawmakers if they want to reduce the city’s lowest speed limit to 25 mph. Family members of New Yorkers killed in traffic accidents and advocates gathered near City Hall on Tuesday to demand action in Albany before the legislative session ends June 19. “We need a lifesaver in the New York Senate,” Aaron Charlop-Powers said. His mother died in 2010 after she was killed by a city bus attempting to avoid an oncoming car in the Bronx. “Today I am here demanding 25 mph streets for my only son Sammy,” said Amy Cohen as she

NYC speed demons

“I hope people will reduce their speed, but I don’t think they will.” Advocates want the speed limit lowered to 25 mph. / GETTY IMAGES No need for speed

25

Advocates of the proposal say a person is twice as likely to survive being hit by a car traveling at 25 mph than one traveling at 30 mph.

held up a photo of her son who died in 2013. Both she and CharlopPowers belong to Families for Safe Streets, which gathered 6,000 petitions that they plan to deliver

to Senate co-leader Jeffrey Klein of the Bronx. Still, the push to change the law is stalled — the city’s speed limit is under the state Legislature’s jurisdiction, not City Hall’s. The Democratically controlled Assembly has a bill sponsored by Speaker Sheldon Silver, yet no one on the Senate has sponsored its own version. CHESTER JESUS SORIA @chestersoria chester.soria@metro.us

Theresa Khutoretsky, 58, UES

“Honestly, no it won’t make a difference. People that are going to speed will speed anyway, and I can only hope it will at least make things safer for kids.” Martin Lang, 38, Brooklyn

Money madness may be about to strike the five boroughs. California real estate investor Jazon Buzi, the man behind the @HiddenCash frenzy that had people searching for free money in San Francisco, is bringing his social experiment to NYC this weekend. Buzi hid envelopes of money across San Francisco last month and tweeted clues under the handle @HiddenCash. People across the city got involved in the hunt for the cash. In the interview with CNN’s Anderson Cooper this week, Buzi announced he would expand his

Join the game

Those interested in the hunt can follow @HiddenCash for clues to where the money has been hidden.

experiment to other cities this weekend. The treasure hunt will hit New York City on Saturday, followed by Chicago, Houston, Las Vegas and Mexico City. By the first week of July, @HiddenCash will go international, as Buzi hides money in London, Paris and Madrid. So far he has given away $15,000. SAMAR KHURSHID

CLUES HIDDEN IN SAN FRANCISCO @HIDDENCASH


www.metro.us Wednesday, June 11, 2014

Transit

Man dies after being punched at No. 6 train platform A 45-year-old man died after being assaulted at a No. 6 train platform last week, police said Tuesday. James Kutza, of the Bronx, got in a verbal dispute with a man aboard a northbound 6 train

The suspect / NYPD

6

NEW YORK

around 8:30 a.m. Friday, according to the NYPD. When the train pulled into the 125th Street station in Harlem, police said the dispute escalated and the man punched Kutza in the head, causing him to fall and hit his head against the platform. Kutza died at Harlem Hospital on Tuesday, police said. The suspect fled after the attack. He

Got info? Anyone with information about the murder is asked to call NYPD’s Crime Stoppers Hotline at 800-577-TIPS.

is described as lightskinned, 6-feet tall and weighing 180 pounds. ANNA SANDERS

Symbol. New York one step closer to having an official amphibian New York is a hop, skip and jump from adopting an official state amphibian. The wood frog is another step closer to being named New York’s official state amphibian after the State Senate passed a bill on Tuesday sponsored by the chairman of the Senate Finance Committee, Sen. John DeFrancisco. The bill will have to be approved by the assembly before it can be signed into law by the governor. In an interview earlier this year, DeFrancisco said the idea came from a 4thgrade class in his district

Wood frog

which wrote letters to his office questioning the absence of a state amphibian. The wood frog is found all over New York. It’s average length is 1 1/2 inches long with orange or dark brown skin. The male distinguishes itself with a quack rather than a croak. SAMAR KHURSHID

Some state mascots New York has many official symbols that represent the state.

1

In 1987, the apple muffin was chosen as the state muffin.

2

One year later, the state picked an official shell, the bay scallop.

3

There’s even an official fossil, the Eurypterus remipes, a 420-millionyear-old ancestor of the horseshoe crab.

/ GETTY IMAGES

2

1

3

Clinton talks in NYC Former Secretary of State Hillary Clinton stopped by the Barnes and Noble at Union Square on Tuesday morning to talk about her new book “Hard Choices.” More than 1,000 people reportedly attended the event and came out to hear her speak. Some of them camped out overnight for a chance to meet the former first lady. / GETTY IMAGES


www.metro.us

BUY 1 WINDOW GET 1 WINDOW 50% OFF

1

Because our window’s Fibrex material is twice as strong as vinyl, our window will help make your home safer, stronger and more comfortable. And right now, buy one of our windows—ANY SIZE— and your next window is 50% OFF! i EVERY double hung window i EVERY casement window i EVERY gliding window i EVERY specialty window

SAVE UP TO THOUSANDS! OFFER ENDS JUNE 29TH

BUY 1 WINDOW GET 1 WINDOW

%

$

0 0 0

WITH MONEY DOWN 1

50% OFF

PAYMENTS

INTEREST

FOR 1 YEAR

with our Instant Product Rewards.

Why can’t you buy our windows from stores or contractors? We take great pride in custom-building our windows, so we won’t let just anyone sell or install them. We take care of the entire process: only we sell, build, install and warrant our windows.

How much stronger is our window material compared to vinyl? Our patented Fibrex material is twice as strong as vinyl, and—unlike wood— requires virtually no maintenance*.

How are we able to install windows in just one day? Our teams of installers are exceptionally trained, tested, and skilled. This is why most installations— including the clean up—are completed in just one day.

7 new york Wednesday, June 11, 2014

CALL FOR YOUR FREE WINDOW DIAGNOSIS

800-357-3815 1 Restrictions and conditions apply; see your local representative for details. Cannot be combined with prior purchases, other offers, or coupons. No adjustments to previous orders. Offer not available in all areas, discount applied by retailer representative at time of contract execution and applies to minimum purchase of 6 or more windows. Offer does not include bay/bow windows or patio doors. As part of the Instant Product Rewards Plan, all homeowners must be present and must purchase during the initial visit to qualify. To qualify for discount offer, initial contact for a free Window Diagnosis must be made and documented on or before 6/29/14, with the appointment then occurring no more than 10 days after the initial contact. 0% APR for 12 months available to well qualified buyers on approved credit only. Not all customers may qualify. Higher rates apply for customer with lower credit ratings. Financing not valid with other offers or prior purchases. No Finance Charges will be assessed if promo balance is paid in full in 12 months. Renewal by Andersen retailers are independently owned and operated retailers, and are neither brokers nor lenders. Any finance terms advertised are estimates only and all financing is provided by third-party lenders unaffiliated with Renewal by Andersen retailers, under terms and conditions arranged directly between the customer and such lender, all subject to credit requirements. Renewal by Andersen retailers do not assist with, counsel or negotiate financing, other than providing customers an introduction to lenders interested in financing. NJ Consumer Affairs License #: 13HV01541700. NYC Consumer Affairs License#: 1244514. Nassau Consumer Affairs License #: H0810150000. Suffolk Consumer Affairs License #: 43991-H. NYC 1307704. Rockland County License #: H-11942-07-00-00. Renewal by Andersen of Central/Northern NJ and Long Island are independently owned and operated affiliates operating in the NJ/NY metropolitan area. “Renewal by Andersen” and all other marks where denoted are marks of Andersen Corporation. ©2014 Andersen Corporation. All rights reserved. ©2014 Lead Surge LLC. All rights reserved.


www.metro.us Wednesday, June 11, 2014

NYSCAS A D iv ision of

TOURO

COLLEGE

College with a personal touch apply ONLINE at

DSSO\WRXURHGX ASSOCIATE’S AND BACHELOR’S DEGREES

‡%XVLQHVV0DQDJHPHQWDQG$GPLQLVWUDWLRQ‡3DUDOHJDO6WXGLHV ‡,QIRUPDWLRQ7HFKQRORJ\‡+XPDQ6HU YLFHV‡%LRORJ\‡6RFLDO6FLHQFHV ‡3V\FKRORJ\‡(GXFDWLRQ‡'LJLWDO0XOWLPHGLD'HVLJQ ‡/LEHUDO$U WVDQG6FLHQFHV‡DQGPRUH INTEGRATED HONORS TRACKS

OTHER PROFESSIONAL OPPORTUNITIES

8QGHUJUDGXDWH2VWHRSDWKLF0HGLFLQH 8QGHUJUDGXDWH3KDUPDF\

‡3UH/DZ‡3UH0HGLFDO‡3UH'HQWDO MANHATTAN: 212.463.0400

x5500 BROOKLYN: 718.265.6534 x1003

INFORMATION SESSIONS: Manhattan: 27-33 West 23rd Street, $GPLVVLRQV2IÂżFH:HGQHVGD\VQRRQSP %URRNO\Q6WLOOZHOO$YHQXH $GPLVVLRQV2IÂżFH:HGQHVGD\VDPSP

Bensonhurst, Brighton Beach, Flatbush, Kings Highway, Starrett City

QUEENS:

718.520.5107 x109

www.touro.edu/nyscas .tou o.edu/ yscas

N ew Yor k S c h o o l o f C are e r and A p p li e d S tu di e s

Touro College l is an equal opportunity iin institution stitution tit

Scan to Win!

This Week’s Special 50% off:

Enter to Win!

Call C ll 212-779-8626 212 779 862 24/7 Book www.SmileArtistNY.com

One dead in Ore. school shooting Alert. The school was locked down and students were evacuated room by room, police said. A gunman walked into an Oregon high school with a rifle and shot a student to death on Tuesday before he was later found dead, in the third outbreak of gun violence to shake a U.S. high school or college campus in less than three weeks. Reynolds High School, in the middle-class Portland suburb of Troutdale, was scheduled to hold its last day of classes on Wednesday before the summer break. “A gunman entered the high school this morning [and] shot one student. Unfortunately, that student

for $99/month*

Gift Card*

has died,� Troutdale Police Chief Scott Anderson told reporters. “The gunman was located and the gunman is also deceased.� Authorities haven’t publicly named the gun-

NOW IN

Affordable Tuition

Convenient Location &HUWLˉFDWHV PRQWKV

Associates Degrees:

$20/month!*

Implants/2 visit Extreme Smile MakeOver* Proven Laser * Dentistry

Anderson

1

Call or Text the word SmileCafe To 77286 by this Friday (limited supplies) Dental Plan: Reduced to only

“The gunman was located and the gunman is also deceased.�

man nor said how he died, but USA Today cited a police spokesman as saying the shooter was a teenager who shot himself to death in a bathroom stall following the attack. Two girls from the high school, sisters Kadejah and Deondra Nixon, told Reuters after being reunited with their parents that police were asking students whether anyone had ridden a bus to school with a student carrying a guitar case. REUTERS

The college for business careers

50% off ends //14

To Get Your Free $100

Quoted

LIBI

Straight Teeth in 5 months, No Braces!*

Invisalign Express or Braces

A student is reunited with her parents. / GETTY IMAGES

Voted: Top Provider in US

For $1999

Express

8

NEWS

• Homeland Security &Security Management • Digital Marketing 2

BEST Fees & Quality Guaranteed on all procedures as low as $999* 3

• Emergency Care Management

• Elder Care Management

• Hospitality Management

• +HDOWK$GPLQLVWUDWLRQ 7HFKQRORJ\

• Business Management

• Hospitality Management

• 2IˉFH7HFKQRORJ\0HGLFDO2IˉFH

• (6/&HUWLˉFDWH

• Accounting • Court Reporting

Save

Now Only $199 – Exam/Cleaning $49*

Vet Friendly

Ask About Our 2+2 ÂŠÂŒÂ’ÂŽÂ—ÂœÂĄŽ‘¢ŽŽ¥Šš£Â?ÂŽÂĄÂ?¤“œš

te ImmediaDay Decisionsday Wedne

4

Lifetime Job Placement Assistance

or

International Students Welcome!

GED+DEGREE Available

Natural Strong Dentures as low as $999* 5

0DQKDWWDQ

Discover Natural Veneers as low as $999* “You too can have a Natural Gorgeous SEXY Smile for as low as $99/month* by NEW 3D imaging CAD/CAM Laser @ Relaxing Holistic Park Ave Dental Spa!*

STATE AND FEDERAL FINANCIAL AID AVAILABLE TO THOSE WHO QUALIFY

6

Treatment of pain, Bad Breath/Halitosis, Gummy Smile, Gingivitis. Laser Dentistry, and 500+ other treatments. *Promotions end ϲ/ϭϹ/14. Must qualify. Limitations apply. Please visit site & call for details before making a commitment.

Queens

Commack

WK

 Avenue -HULFKR7XUQSLNH )OXVKLQJ1< &RPPDFN1< q q q %URDGZD\ 1HZ<RUN1<

www.libi.edu

For consumer disclosure, please visit www.libi.edu & click Consumer Information link.


See more at www.metro.us

NEWS N

9

Law. Firms flock to gay-marriage proponents, shun the other side As U.S. lawsuits seeking gay-marriage rights move toward a likely showdown at the Supreme Court next year, major law firms are rushing to get involved â&#x20AC;&#x201D; but only on the side of the proponents. A Reuters review of more than 100 court filings during the past year shows that at least 30 of the countryâ&#x20AC;&#x2122;s largest firms are representing challengers to state laws banning same-sex marriage. Not a single member of the Am Law 200, a commonly

Same-sex marriage is legal in 19 of the 50 U.S. states and in the District of Columbia. / GETTY IMAGES

used ranking of the largest U.S. firms by revenue, is defending gay marriage prohibitions. In many of the cases,

the firms are working for free or at cut rates to provide legal services they deem to be in the public interest. REUTERS

San Francisco

Falling dolphin statue kills toddler on vacation

the cityâ&#x20AC;&#x2122;s busy Fishermanâ&#x20AC;&#x2122;s Wharf district, police said on Monday. The child, who was from Utah, was playing on Friday with or around the statue â&#x20AC;&#x201D; a 6-foot-tall metal dolphin located on the sidewalk in front of a business â&#x20AC;&#x201D; when it toppled over. REUTERS

A 2-year-old boy visiting San Francisco with his family was killed when a large metal statue fell on him in

Varicose Veins GOT YOU DOWN? FAST, NON-INVASIVE TREATMENTS FOR 6ARICOSE6EINSs3PIDER6EINSs&ACIAL6EINS

DAVID M. GLASS, -$ &!#3 "OARD#ERTIlED6ASCULAR3URGEON 9EARSOF%XPERIENCE

New York Cityâ&#x20AC;&#x2122;s Premier Vein Only Practice

-OST)NSURANCE!CCEPTED

1-888   WWW.EW9ORK6EIN#ENTERORG š#/092)'(4 .%79/2+6%).#%.4%2!,,2)'(432%3%26%$ "2//+,9.ää-!.(!44!.ää"2/.8

$/7.,/!$4(%.96#!00).4(% !00,%!0034/2%


www.metro.us Wednesday, June 11, 2014

Painful Varicose Veins and Swollen Legs? Now is the time to take care of it! Varicose veins are MORE than just a cosmetic problem. They can also be a warning sign of a condition called Venous Insufficiency that kills over half a million people every year.

ANGELINA JOLIE GETTY IMAGES

Jolie, UK’s Hague, vow action against sexual violence in war Actress Angelina Jolie and British Foreign Secretary William Hague vowed on Tuesday to ensure the world’s first summit on ending sexual violence in conflict resulted in practical action to punish those responsible and help victims. Up to 1,200 government officials and activists from up to 150 nations are attending the June 10-13 summit that is the result of a two-year partnership between Jolie and Hague to combat rape as a weapon of war.

Do you have any of these symptoms? Varicose Veins Spider Veins Itching and Burning Leg Pain and Cramps Heaviness and Swelling Skin Discoloration Ulcers and Blood Clots Problem Walking For Long Distance

REUTERS

USA Vein Clinics Will help!

CAREER TRAINING

With a non-surgical, minimally invasive, painless endovenous procedure, that takes only 15 minutes!

Tracy Morgan crash. ‘Terrible accident’ recounted in 911 tapes A woman who witnessed a multicar collision on a New Jersey highway that critically injured comedian Tracy Morgan and killed one of his associates called 911 to report a “terrible accident,” according to audio recordings released on Tuesday. “There was an accident on the New Jersey Turn911 tapes

“There’s a terrible accident. The car flipped. It’s on its side.” The unidentified woman told an emergency operator moments after the crash

pike. It happened behind us,” another caller said in 911 recordings released by the New Jersey State Police. Morgan and two other people riding in the van were critically injured and remained in a criticalcare unit on Tuesday, said a spokeswoman at the Robert Wood Johnson University Hospital Center in New Brunswick, New Jersey. Comic James “Jimmy Mack” McNair, 62, a writing partner of Morgan’s who was also in the van, died at the scene. A fifth passenger had minor injuries and was released from the hospital. REUTERS

MORGAN’S INJURIES INCLUDED A BROKEN LEG, NOSE AND RIBS, AND HE UNDERWENT SURGERY OVER THE WEEKEND. GETTY IMAGES

CAREER TRAINING

CAREER TRAINING

(888) 324-3822 (888) 500-0953 (888) 324-3822

Medicare and most insurances accepted! Trust Your Legs Only To Top Specialist! UÊÊ >“i`ʺ iÃÌÊ6iˆ˜Ê i˜ÌiÀ»Ê>˜`ʺi>`iÀʈ˜ÊÊ i>Ì…Ê >Ài»ÊwÛiÊ̈“iÃt UÊ*ˆœ˜iiÀʈ˜Ê“œ`iÀ˜ÊÛiˆ˜ÊÌÀi>̓i˜ÌÊÌiV…˜ˆµÕið UÊ >̈œ˜½Ãʜ˜ÞÊVœ>Ã̜̇‡Vœ>ÃÌÊÛiˆ˜ÊVˆ˜ˆV° UÊÊ œV̜ÀÃÊ-Ì>vvʘVÕ`iÊ œ>À`‡ iÀ̈wi`]Ê>ÀÛ>À`ÊÊ >˜`Ê-Ì>˜vœÀ`Ê/À>ˆ˜i`Ê-«iVˆ>ˆÃÌà UÊÊ >̈œ˜½ÃÊ/œ«Ê6iˆ˜Ê ˆ˜ˆV]ʘœÊœÌ…iÀÊVˆ˜ˆVÊÊ V>˜ÊLœ>ÃÌÊÃÕV…ÊiÝVii˜Viʈ˜ÊÛiˆ˜ÊV>Ài Do not commit to any other vein center without getting an evaluation from USA Vein Clinics. You will be very pleased you did.

New York: 1153 First Avenue, Manhattan, NY 10065 2511 Ocean Ave, Ste 102, Brooklyn, NY 11229 2444 86th St, Ste A, Bensonhurst, NY 11214 116-02 Queens Blvd, Forest Hills, NY 11375

766 Shrewsbury Ave, Ste 300, Tinton Falls, NJ 07724 *i˜˜ÃޏÛ>˜ˆ>ÊUÊ>ÃÃ>V…ÕÃiÌÌÃ

10

LEGAL MASSAGE LEGAL RESEARCH THERAPIST ASSISTANT

You may have a serious medical condition, called Venous insufficiency.

New Jersey:

Helping victims

NEWS

(917) 717-5135 Open on Saturdays

mildred-elley.edu

mildred-elley.edu

mildred-elley.edu

MEDICAL ASSISTANT

ADMINISTRATIVE ASSISTANT

OFFICE MANAGER

CAREER TRAINING

CAREER TRAINING

CAREER TRAINING

(866) 688-3018 (866) 755-5092 (866) 755-5092 mildred-elley.edu

mildred-elley.edu

mildred-elley.edu

Mildred Elley, a career college • 25 Broadway, NYC • International Students Welcome • For program details and disclosures visit mildred-elley.edu/disclosures


www.metro.us

LOW PROPERTY TAXES! EXPRESS COMMUTER BUSES (4 per hour) 90 mins to NYC!

Yes, you can own a brand new home for just $ 1,577 per mo.!* And just $6,997 Down! Classic has the values! Call us now! All Classic Mainline Homes include up to 4 bedrooms, 2½ baths, garage, living room, dining room, complete appliance package, Central Air and Heat, landscaping, and a host of features. including permitting, driveway and well -- all included in the purchase price!

THE COUNTRY HOME -- A Classic Mainline Home

NOW

$199,900

now

2,684 SQ. FT. • LARGE OPEN FOYER

$293,500

3,393 SQ. FT.! • Your Palace in the Poconos!

$6,997 DOWN PAYMENT $

THE CAMBRIDGE -- A Classic Mainline Home

1,577* per month pays all including principal, interest, taxes and insurance!*

$

$14,650 DOWN PAYMENT

1,953 per month pays all including principal, interest, taxes and insurance!*

Choose from Classic’s Complete Line of Brand New Homes in the Poconos!

Buy a home now -- Get up to $5,000 toward Closing Costs! ALSO AVAILABLE -- Previously Owned Homes from just $80,000 11 new york Wednesday, June 11, 2014

Call toll free

1-800276-4000 Visit our all-new website:

www.classicqualityhomes.com

Or text: cqh to 411669 to get text updates about our Home Buying Incentive programs * Monthly payments based on FHA 30 yr. fixed interest rate of 4.5% with 5% APR with a finance cap of $271,000. Lower rates may apply to qualified buyers. All numbers are estimated. Conventional mtgs. also available.


Are Your Legs Suffering From... Varicose Veins Leg Ulcers Spider Veins Pain Restlessness

NEWS & ODDITIES

www.metro.us Wednesday, June 11, 2014

12

Zoom

Heaviness Swelling Itching Fatigue Cramping Burning

Sweeping ribbon of white lights Photographer Martin Kimbell shows he is a real bright spark with these spectacular light drawings, which use the night sky as his canvas. The 25-year-old used a special technique to create the intricate spirals, which look like they were created on the 1960s toy Spirograph. The images meander among the trees, and a tornado-like beam that extends from the sky. MWN / MARTIN KIMBELL/SOLENT NEWS

OMG! Ancestors’ flying fists shaped our faces Human faces might have been shaped by violent fist fights, according to research at the University of Utah, which deals a heavy to blow to prior research that showed changes in bone structure were the result of the dietary need to crush hard foods. Lead researcher David Carrier explains to Metro why

COVERED BY MOST HEALTH INSURANCES INCLUDING MEDICARE Certified by the American Board of Venous and Lymphatic Medicine

stronger bones were needed to buttress against a new form of boxing. What were our ancestors fighting about? I think it would have been pretty much the same as gorillas and chimpanzees: competition over females, territory and defense of one’s

Visit us online at Metro.us/omg for more interviews. family and offspring. So in some ways it’s similar to today. So why was there a need for such considerable facial reconstruction? This evolution occurred at the same time that our hands were changing in proportion to allow us to make a fist-like club. The bones which are susceptible to fracturing during a fist fight have increased in both australopiths and humans. EDWARD THOMPSON

They contend that human faces — especially those of our australopith ancestors — evolved to minimize injury from punches to the face during fights. / UNIVERSITY OF UTAH

FT/PT DRIVERS WANTED For Bronx Based Access-A-Ride Company

U Must be at Least 21 Years Old

U Clean NYS CDL

111 John St., Suite 1450 (bet Cliff & Pearl St), NY, NY 10038

212.204.6501 TreatmentsOfManhattan.com DRLEV@TREATMENTSOFMANHATTAN.COM

Drivers License

U Type C with Passenger Endorsement Required U Knowledge of Five Boroughs a Plus We Offer: Paid training after course completion and start in revenue service, Paid Sick and Personal Days, Paid Holidays, Two Weeks Paid Vacation After One Year, Medical Benefits, Competitive Salary, Safe Driving and Attendance Incentives.

Applicants Must Apply in Person at: 2383 Blackrock Ave., Bronx, NY 10462 Contact: Roger Izzi at 718-828-2472 ext 201 or rizzi@cbttrans.com 9:00 am - 2:00 pm


1

Lohan living it up in London (soberly)

Lindsay Lohan may be making a scene in London partying late every night, but she’s still in great shape sobriety-wise, a source close to the troubled actress insists — despite the fact that Lohan hasn’t been entirely sober lately. “Lindsay was off the wagon. Everyone has their stumbles, everyone will go out to drink,” the source explains. “She fell off the horse, but she picked herself

13

GOSSIP

Wolverine sheds

back up and got back on. It’s a struggle. Just because you have a hiccup doesn’t mean you have to hold your breath.” And even with this hiccup, there’s still reason to be optimistic. “Lindsay’s in clubs, but she’s not drinking. Her friends have never seen her doing so well,” the source says. “Lindsay goes to the gym every single day. She’s really trying to stay sober. And she’s taking it one day at a time.”

What happened to our beloved Hugh Jackman’s hair? Just this weekend he was looking mighty fine in all of his hirsute glory while hosting the Tony Awards. And now this photo appears on Instagram? Reportedly, Jackman did not do this as a result of a fit of mania ala Britney Spears. And although he looks a little like one of those toys where you magnetically move hair around the face of a bald man, the new look is for the role of Blackbeard he’s going to play in an upcoming movie called “Pan.”

2 3

CULTURE Talking point

Heeeey, you guyyyys, a ‘Goonies’ sequel may happen

LASSE E. KRISTIANSEN

INSTAGRAM

J.Lo will do the World Cup after all

It turns out Jennifer Lopez will be helping kick off the World Cup after all, despite her reps telling CNN over the weekend that she wouldn’t perform as planned during the Opening Ceremony in Brazil. “The backlash was so significant that she decided she needed to attend,” a source tells the National Enquirer. So what caused her to pull out in the first place? It was all about the money. “]Lopez] was in a back-and-forth with the World Cup about expenses,” the source says. “She had wanted them to cover everything for her, from private transportation to her hotel and the

THE WORD Ned Ehrbar takes on the world of gossip. NED EHRBAR

@Nedrick ned.ehrbar@metro.lu

2 Good news for fans hoping Richard Donner’s plans for a “Goonies” sequel pan out. Sean Astin, who starred in the original, is totally onboard, and so is Corey Feldman — if anybody wants them. “My first thought when Dick said he was doing that was like, ‘All right, maybe this time it’s true,’” Astin tells E! News. “I certainly like the idea of doing it.” As for Feldman? “We talk a lot; Corey and I are buddies,” Astin says. “He’s fired up. He’s ready to go.”

Brazil will get its fill of Lopez at the World Cup. / GETTY IMAGES

costs associated for her entire entourage.” But apparently there are other things more important than money (when you’re

rich, anyway): “It’s the world stage. It would have been foolish for her not to exploit the World Cup for the publicity alone.”

MIRACLES DON’T JUST HAPPEN WITHOUT LASER! TREAT YOURSEL RESTORE the BEAUTY that FADED AWAY!

AESTHETIC MEDICAL LASER CLINIC FARHAD MOHEBBAN MD BOARD CERTIFIED

200 West 57th Street, Suite 204 On the Corner of 57th Street and 7th Ave

• FACE REJUVENATION with your own PLASMA or BODY FAT • DOUBLE CHIN and ARM improvement sAcne, Surgical Scar Improvement • BOTOX, FILLERS,Skin Discoloration Repair Non-surgical double chin removal Se Habla Español and many, many More

212-315-3009

Train 1, 2, 3, A, B, E, F, N, R, Q

www.sensualaesthetics.com Follow us in

SAMPLE SALE

READY TO WEAR, FOOTWEAR & HANDBAGS

261 WEST 36TH STREET BETWEEN 7 & 8 AVENUE WWW.CLOTHINGLINE.COM

JUNE 11 - JUNE 13 WEDNESDAY - FRIDAY 11 AM - 7 PM


See more at www.metro.us

www.metro.us Wednesday, June 11, 2014

FILM FI I

14

â&#x20AC;&#x2DC;Life sucks sometimesâ&#x20AC;&#x2122; Interview. Laura Dern talks about the joys of being in the sometimes dark â&#x20AC;&#x153;The Fault in Our Stars.â&#x20AC;?

Laura Dern plays the mom of a cancer patient (Shailene Woodley) in â&#x20AC;&#x153;The Fault in Our Stars.â&#x20AC;? GETTY IMAGES

Laura Dern is used to taking on serious roles, but morphing into a character whose daughter is dying of cancer is emotional on a whole new level. But when â&#x20AC;&#x153;The Fault In Our Starsâ&#x20AC;? director Josh Boone offered the part of Franny to Dern â&#x20AC;&#x201D; a role she didnâ&#x20AC;&#x2122;t even audition for â&#x20AC;&#x201D; she jumped at the chance. â&#x20AC;&#x153;I read John Greenâ&#x20AC;&#x2122;s book [on which the movie is based] and just fell in love with it and what this movie could mean for all people, philosophically, who are fearless enough to love even though a love may end,â&#x20AC;? she explains. â&#x20AC;&#x153;Iâ&#x20AC;&#x2122;m really happy to be a

part of it.â&#x20AC;? â&#x20AC;&#x153;The Fault In Our Starsâ&#x20AC;? is about a teen with terminal cancer named Hazel (Shailene Woodley) who falls in love with Gus (Ansel Elgort), who is in her cancer support group. Their love is as sweet as teenage love can be, except for the fact that it is destined to be unfairly short-lived. For Dern, it was author John Green who helped her carry the heavy weight of her role as Hazelâ&#x20AC;&#x2122;s mom. â&#x20AC;&#x153;He was there to hug us and thank us each day,

which I canâ&#x20AC;&#x2122;t imagine another author doing. His love of us made us fiercely protective of him and the book and it was an amazing, joyful experience. We would have dinners together as a cast every single night and laugh so much. That really carried me through,â&#x20AC;? she says. She also had long talks with Green about her character and the inspiration behind her. â&#x20AC;&#x153;Heâ&#x20AC;&#x2122;s definitely known parents going through something similar and there are spe-

What it taught her

The upside Though ďŹ lming ended last year, Dern says her life is forever changed by playing Franny. â&#x20AC;&#x153;It absolutely was such an incredible gift in my life to be grateful for these small blessings each day

and really try to remain in the moment and not be overwhelmed by the fear and pain that one will go through in life, for whatever oneâ&#x20AC;&#x2122;s life traumas are,â&#x20AC;? she says. â&#x20AC;&#x153;Life sucks sometimes and itâ&#x20AC;&#x2122;s inescapable. This is a movie about how to navigate that.â&#x20AC;?

cific parents that I think meant the world to him. He would tell me about how heâ&#x20AC;&#x2122;s seen how extraordinarily tireless a mother can be while she is trying to normalize her daughterâ&#x20AC;&#x2122;s diagnosis so she can have a regular teenage day. ... Itâ&#x20AC;&#x2122;s just unimaginable, and yet there are so many people going through it.â&#x20AC;? The mother-daughter relationship in the movie is its own love story, as strong as the romantic one between the two cancer struck teens. Naturally, a strong bond carried over in real life between Dern and Woodley. They both have similar outlooks on life, a bit hippyish in a way, and while filming they spent their off-time cooking healthy meals and going to yoga classes together. â&#x20AC;&#x153;Weâ&#x20AC;&#x2122;re best friends now,â&#x20AC;? Dern says. EMILY LAURENCE @EmLaurence

emily.laurence@metro.us

Come Find Out Why Swedish Institute is Right For You!

Open House! Thursday, June 12th â&#x20AC;˘ 10:00am-7:00pm

B7@32=4;/A97<5 B63>@=0:3;7T g]c¸`S ]\S ]T bVS bV]caO\Ra eV]¸dS PSS\ ^`SaQ`WPSR O 1>/> [OaY b] ab]^ a\]`W\UO\Rb`SObg]c`aZSS^O^\SOg]cOZ`SORgY\]ebVObU]W\Uc\b`SObSRWa \]bO\]^bW]\7U\]`W\Ug]c`Q]\RWbW]\QO\ZSORb]aS`W]caVSOZbVWaacSa

We offer programs in:

S=aaZSS^¸a0]O`R1S`bW¿SR^VgaWQWO\a]TTS`[O\gRWTTS`S\bb`SOb[S\b]^bW]\a a][SQO\bOYSOaZWbbZSOa [W\cbSa

Personal Training â&#x20AC;˘ Clinical and Administrative Medical Assistant Massage Therapy â&#x20AC;˘ Surgical Technologist Medical Billing and Coding â&#x20AC;˘ Nursing Spend time with Admissions to learn more about your program of interest. Donâ&#x20AC;&#x2122;t miss this great event! Please inquire about our Day and

Evening Schedules!

4]`bVSb`SOb[S\b]Ta\]`W\UO\RaZSS^O^\SO Please visit our Admissions OfďŹ ce at:

151 West 26th Street

1-888-530-9582

S=aaZSS^Q][ ;]ab7\ac`O\QS>ZO\a/QQS^bSR

www.swedishinstitute.edu

Swedish Instituteâ&#x20AC;&#x2122;s programs are registered with and regulated by the New York State Education Department. Accredited by ACCSC. For important information on program costs, completion and placement rates, median debt incurred, etc., please visit goo.gl/hacsRh.

3Oab$$bVAb`SSb<SeG]`YÂ&#x2019; $ 1S\b`OZ>O`YESab<SeG]`Y #&'0`]OReOg<SeG]`YÂ&#x2019;&!!<]`bVS`\0ZdR5`SOb<SQY B]aQVSRcZSO\O^^]W\b[S\b(&S]aaZSS^&!$%%#!!


TELEVISION

15

PLAY DINE UNWIND

TV watch list

Over 5,000 Games. Minutes Away!

Weâ&#x20AC;&#x2122;ll be honest: Dave gets top pick today because Janelle Monae is involved. / FILMMAGIC LATE NIGHT

â&#x20AC;&#x2DC;The Late Show with David Lettermanâ&#x20AC;&#x2122; Tonight, see Christopher Walken, Tatiana Maslany (your favorite clone on â&#x20AC;&#x153;Orphan Blackâ&#x20AC;?) and musical guest Janelle Monae.

Show Starring Jimmy Fallonâ&#x20AC;&#x2122; Jimmy hosts reality stars Mama June and Honey Boo Boo. Heâ&#x20AC;&#x2122;ll also be talking to Barbara Walters, probably about her nonretirement. 11:34

â&#x20AC;&#x2DC;True Lifeâ&#x20AC;&#x2122;

P.M., NBC

REALITY

11:35 P.M., CBS

â&#x20AC;&#x2DC;The Tonight

The trouble this week concerns a bickering family who canâ&#x20AC;&#x2122;t agree on how to run their restaurant. Would your family be good at running a restaurant? 10:00 P.M., FOOD

â&#x20AC;&#x2DC;Restaurant: Impossibleâ&#x20AC;&#x2122;

Two young people struggle with odd phobias. Weâ&#x20AC;&#x2122;re pretty scared of airplane bathrooms. Does that count as a phobia? 11:00 P.M., MTV LISA WEIDENFELD

PODIATRIST The Most Advanced Techniques Used for Bunions and Hammertoes A new approach for treating Tendon Injuries for the Achilles, Tendonitis and Plantar Fasiitis (Heel and Arch Pain) New Treatment For Heel Pain, Shockwave, PRP as seen on the front page of The New York Times

Platelet Rich Plasma Therapy (PRP)

Take the Foot Health Checkup s-YTOENAILSARESTREAKED DISCOLORED THICKENED s4HESIDEOFMYTOENAILSDIGINTOTHESKINANDHURT s)HAVEALARGEBUMPBEHINDMYBIGTOEORLITTLETOE WHICHISALWAYSRED s)GETANEXTREMELYPAINFULhCRAMPvINTHEAREAOFMYTHIRDANDFOURTHTOESWHENWEARINGSHOES s-YTOESARENTSTRAIGHT THEYARECROOKED BENTANDHURT s)HAVEPAINFULCALLUSESONTHEBALLOFMYFOOTWHICHKEEPBUILDINGUP s)HAVECORNSONMYTOESWHICHGETTHICKERNOMATTERWHATSHOESIZE)WEAR s4HEBOTTOMOFMYHEELHURTSALLDAY BUTITSWORSEWHEN)STEPOUTOFBEDINTHEMORNING THEMORNING G s)HAVECRAMPSINMYLEGSWHICHALWAYSHAPPENWHEN)WALKTHESAMEDISTANCE CE s-YANKLESARESWOLLENMOSTOFTHETIME s-YFEETAREALWAYSDRYANDSCALY SOMETIMESTHEYITCH s-YFEETJUSTHURTALLOVERWHEN)STANDORWALKALOT s)HAVENUMBNESS BURNING INFECTION PERSISTENTPAIN SKINRASH OROPENSORES S

.

Feet Hurt? Bunions? Hammertoes? Heel Pain?

Now Featuring

Helps Eradicate Fungal Nails

If any of these apply to you, call today. Dr. Paul Drucker, DPM Dr. Martin McGrath, DPM

Dr. Paul Drucker, DPM Dr. Martin McGrath, DPM

184 East 70th Street, B1 Between Lex and 3rd Ave

121 E. 60th St. Suite 3D (Between Lex & Park) New York, NY

212-772-3500

(212) 486-7333

235 east 22nd street ( between 2nd and 3rd ave) 1212 4867333

Dr. Paul Drucker, DPM

Dr. Ernest Levi, DPM Midtown - Grand Central 30 E. 40th St., Suite 401

212-685-5100 162-15 Highland Ave Jamaica, NY 11432

(718) 658-9383

0ATIENTISRESPONSIBLEFORCO PAYSDEDUCTIBLEs-OSTINSURANCEPLANSACCEPTEDs#OMPLETEFAMILYFOOTCAREs,ASERSURGERYAVAILABLE

110-00 Rockaway Blvd. Jamaica, NY 11420 rwnewyork.com 1-888-888-8801 In Queens, near JFK Airport. Locate Your Free Shuttle: www.RWRedExpress.com MUST BE 18 YEARS OF AGE OR OLDER TO PLAY THE NEW YORK LOTTERY GAMES. PLEASE PLAY RESPONSIBLY.


Stubborn fat has met its match.

Freeze your fat away.

Transform yourself without diet, exercise or surgery.

CoolSculpting® is the revolutionary body contouring treatment that freezes and naturally eliminates fat from your body. There are no needles, no special diets, no exercise programs and best of all – no downtime. FDA-cleared, safe and clinically proven.

BEFORE

12 WEEKS AFTER

4 WEEKS AFTER

FIRST TREATMENT

SECOND TREATMENT Procedure by Ivan Rosales-Berber, MD

FREE CONSULTATION

113 East 39th Street New York, NY 10016 866-634-4777 www.LexingtonPlasticSurgeons.com

www.metro.us Wednesday, June 11, 2014

ART & GOING OUT 16

Art with ‘Subtlety’ Arts. Check out the last installation that will take place at the Domino Sugar Factory. Kara Walker is best known for her black stencils of antebellum scenes that critique Civil War-era ethics. But she just created her first large-scale project in Williamsburg’s 90,000-square-foot Domino Sugar Factory. Ripe with gallows humor, “A Subtlety: or the Marvelous Sugar Baby” tackles the powerful topic of race politics. The installation is an homage to the If you go

‘A Subtlety: or the Marvelous Sugar Baby’ Through July 6 Domino Sugar Factory South First Street at Kent Avenue Fridays: 4 p.m.-8 p.m. Saturdays-Sundays: Noon-6 p.m. 212-206-6674 www.creativetime.org

The statue towers over viewers at 35-by-75 feet. See it live before July 6. / PROVIDED

unpaid and overworked laborers who refined sugar in the factory from its conception in 1856 to its closure in 2004. At times taboo and sexually charged, this provocative installation investigates the history of the Domino Sugar Factory through age-old racial tropes. The installation is a 35-foot-tall, 75-foot-long sphinx surrounded by child attendants — and it’s all created from sugar and molasses. A combination of racist stereotypes of black women, the head is a kerchiefwearing “Mammy,” whose jolly persona lived to please the domestic needs of wealthy white families. Her body is the erogenous

“Jezebel” with her prominent breasts, buttocks and sexuality on display. With sullen faces, the molassescovered attendants recall the historical socioeconomic gap between white and black culture. To give scale to the gargantuan installation, the children are the height of an average adult. This exhibit is the last before the factory’s demolition. In March 2014, the City Planning Commission approved a $1.5 billion redevelopment to connect the neighborhood to the waterfront and create a modern Brooklyn skyline. DANIELLE KALAMARAS @metronewyork letters@metro.us

The Weekly Yelp. Best sports bars Face it: You’ll probably never have the chiseled physique of Cristiano Ronaldo. So you might as well relax and root for Team USA with other soccer fans of modest ambition. Here are a few suggestions for where to watch the World Cup.

games. But you can request other games that aren’t on, whether football, baseball, soccer, tennis, basketball — you name it. DON B.

Triona’s on Third

Hair of the Dog

Great contemporary sports bar and pub — a dozen big flat screens ablaze with several

Love all the different pennants, banners and posters hanging on the walls and ceiling. The beer

selection is all craft brews, and, typically, more than a few will catch your eye. KAITLIN W.

Yelp.com connects people with great local businesses in their neighborhood — everything from bars, restaurants and spas to dog groomers, mechanics and even dentists!


See more at www.metro.us Kid’s room. Create a room that has as much personality as your little munchkin. When it comes to bedrooms, the conventional design wisdom is “less is more”: neutral walls, tranquil bedding, maybe a tasteful zen rock garden if you insist on expressing yourself. But kids don’t need to escape to a Restoration Hardware-induced coma — they need imaginative, exciting spaces to dream, play and create. We hit up Pennsylvania-based interior designer and illustrator Lou Marshall for kid-friendly decor tips.

LIGHT UP THEIR ROOMS

HOME H O

17

Pint-sized product pick

For the beach If you’re packing up for the beach this summer, we love this petite chair-and-umbrella set from Pottery Barn Kids. Chair ($17) and umbrella ($11), www. potterybarnkids.com

+ $27.5M

The golden rule Ultimately, designing a child’s bedroom isn’t (or shouldn’t be) that much different from designing your own. “Above all else,” says Marshall, “think about when you’re going to sleep: What would you want to be around and look at before you close your eyes?” Be thrifty

Cheap trick For quick, cheap art, Marshall recommends perusing the party store’s wrapping paper section. Bright, cheery and frequently starring the latest princesses and trendiest robots, it’s perfect for framing and will only set you back around $3.

StreetEasy.com is a

Help your kids have bright, fun rooms with these easy tips. / FUSE Painting

Quoted

“If they’re sent to their room, I want them to be happy about it.” Marshall

Softer colors are more sleep-friendly. / FUSE

New York-based real estate information portal that aggregates the most comprehensive set of sale and rental listings along with other useful info.

PARKCHESTER

-* "1-Ê6 ÊÊUÊÊ",   Ê, /

Color theory Kids’ worlds are colorful, and their rooms should be, too. That said, Marshall recommends staying away from harsher primary colors and keeping things light and bright (sleep is the end-game, after all). Swap the hot

Priciest

The most expensive property to come on the market this week is a $27.5 million condo located at 30 Park Place in Tribeca. This half-floor duplex penthouse features five bedrooms, six+ bathrooms, private elevator, library with wet bar and a media room.

The five-year plan Before you commission that “Frozen” mural, think about what your aspiring princess will be aspiring to next year. “I want a room to grow with a child, to last a good five or six years,” says Marshall. If your little one is obsessed with a certain Disney character right now, consider buying the bedding, but go less-specific with bigger investments such as wallpaper and rugs.

PLUS

pink for a softer cottoncandy hue, the bright blue for a chalkier version and dark greens for a cheery apple shade. MONICA WEYMOUTH @metronewyork letters@metro.us

Express yourself

Spark imaginations “I like to inspire kids to play and create rooms they can play with,” says Marshall, who paints interactive eyelevel murals (check them out at loulouswhimsicals.com). “If they’re sent to their room, I want them to be happy about it.” No art skills? No problem. A foolproof, inexpensive coat of chalkboard or magnetic paint turns any wall into a canvas.

  /Ê 7Ê/  -ÊÊUÊÊ, / Ê "1 / ,/"* 7Ê** -ÊÊUÊÊ-/  --Ê-/ Ê - £ÊEÊÓÊ ,Ê, /Ê*,/ /-Ê-/,/Ê/Êf££ÓxÊ* ,Ê" /I  9½-]Ê-/, 1 -]Ê** ½-]Ê-1* ,, /-]ÊLˆ˜ŽÊ/ ->˜`Ê1 Ê", ÊÊ" ‡-/ ÊÊUÊÊÓ{Ê,Ê,"6 Ê- 1,/9 /+061/+&6190r01$41-'4(''r'#4.;(7674'1%%72#0%; "«i˜œÕÃi\/ÕiÃE/…ÕÀÃx\ää‡Ç\{x«“U->Ì™\ää>“‡£Ó\{x«“

917-634-5295

or apply online at www.parkchesternyc.com *Apts with traditional kitchens still available starting at $1035


www.metro.us Wednesday, June 11, 2014

NEWLY CONSTRUCTED APARTMENTS FOR RENT IN MANHATTAN

HOME

18

th

44 Street Development LLC is pleased to announce that applications are now being accepted for affordable housing rental apartments at 510-550 West 45th Street in the Clinton section of Manhattan. The buildings are being constructed through the Inclusionary Housing Program of the New York City’s Department of Housing Preservation and Development (HPD) with financing provided by New York State Housing Finance Agency (HFA). The size, rent and income requirements of the units are below: III – 135% AMI Unit Size

Monthly Rent*

Family Size**

2 Bedroom

$2,460

2 3 4

$86,435 - $89,640 $86,435 - $100,845 $86,435 - $112,050

3 Bedroom

$2,836

3*** 4 5 6

$99,875 - $100,845 $99,875 - $112,050 $99,875 - $121,095 $99,875 - $130,005

Total Gross Annual Income****

IV - 165% AMI Unit Size

Monthly Rent*

Family Size**

Total Gross Annual Income****

Studio

$1,997

1

$70,423 - $95,865

1 Bedroom

$2,509

1 2

$88,012 - $95,865 $88,012 - $109,560

2 Bedroom

$3,020

2 3 4

$105,635 - $109,560 $105,635 - $123,255 $105,635 - $136,950

3 Bedroom

$3,483

3*** 4 5 6

$122,058 - $123,255 $122,058 - $136,950 $122,058 - $148,005 $122,058 - $158,895

*includes cooking gas; **subject to occupancy standards; ***minimum household size of 3 only permitted in 530 West 45th Street; ****income guidelines subject to change

Applicants will be required to meet income guidelines and additional selection criteria. To request an application, please call the leasing office at 212-247-2682, visit the leasing office at 530 West 45th Street, Apartment 4D, Mondays through Fridays (excluding holidays) 10AM - 5PM, or by visiting the leasing website www.530west45.com. Applications will be accepted on a rolling basis until all units have been leased. Applications for unit types that are no longer available will be held on a waiting list.

www.nyc.gov/hpd ANDREW M. CUOMO, Governor BILL DE BLASIO, Mayor VICKI BEEN, Commissioner – NYCHPD DARRYL C. TOWNS, Commissioner/CEO – NYSHCR

Behold the penthouse at 960 Fifth Ave., above and below. Sawiris reportedly beat out Walmart heiress Alice Walton for the co-op. / PROVIDED

Billionaire buys priciest co-op in NYC Penthouse. Nassef Sawiris just wrote a very big check.

CLASSIC OPENS 2ND LOCATION!

Expansion Follows Banner Year Classic Quality Homes is proud to announce they are opening a second sales and showroom location in East Stroudsburg. Located at 203 Eilenberger Road, just off of route 209, it’s only five minutes from New Jersey and the Delaware Water Gap and only 75 minutes from the George Washington Bridge. This second location makes Classic Quality Homes the closest Pocono builder for New York City and New Jersey commuters. Classic Quality Homes still has a location in Pocono Summit, off of route 940, just west of I-380. Shown above is our all-new Pinebrook model, priced at an amazing $159,900 COMPLETE. Included are 3 spacious bedrooms, 2 1/2 baths, beautifully equipped kitchen, dining room, front porch, spacious attached garage and much more! A total of 1,842 square feet! Today, only Classic offers such outstanding value for the money. Call now for complete details on this great new home and available financing. A limited number will be available, so act now! LOW PROPERTY TAXES! EXPRESS COMMUTER BUSES (4 per hour) 90 mins to NYC!

Call toll free 1-800-276-4000 Visit our all-new website: www.classicqualityhomes.com

Edgar Bronfman’s 960 Fifth Ave. penthouse is not only staying in the billionaire’s club, but has also broken a record for the most expensive co-op ever sold in New York City. The home, which was originally listed for $65 million and entered contract for $70 million, sold to Egyptian billionaire Nassef Sawiris for that exact contract price, according to records filed today. The deal officially tops music mogul David Geffen’s 785 Fifth Ave. penthouse buy in 2012 for $54 million. The news was first reported by the New York Daily News. Sawiris, who heads Orascom Construction Industries, Egypt’s most valuable publicly traded company, is the 193rd richest person in the world, with a net worth of $7 billion, according to Forbes. Walmart heiress Alice Walton was initially rumored to be the buyer. Brown Harris Stevens’ Mary Rutherfurd, Leslie Coleman and Alina Pedroso listed the apartment at $65 million in February. The brokers couldn’t

By the numbers

$70M

Price paid by Nassef Sawiris for the penthouse at 960 Fifth Ave., a new record for a co-op NASSEF SAWIRIS NICK WOOD

be reached for comment. Charges for monthly maintenance of the apartment are $19,000. The home has five bedrooms, eight bathrooms, and a wrap-around terrace space that looks out on to Central Park. The home is a fixer-upper in need of a complete renovation, an unidentified source previously told the New York Post. Bronfman died in December; he was 84. ZACHARY KUSSIN AND HITEN SAMTANI

$54M

The price David Geffen paid for his penthouse at 785 Fifth Ave., the previous record

$19K

Monthly maintenance charges for the penthouse at 960 Fifth Ave. TheRealDeal.com is a daily blog and monthly magazine covering real estate in the New York metro area.


HOME

19

NYU growth blocked by condo board

LUXURY NO-FEE RENTALS MINUTES TO MANHATTAN

INSPIRED CITY LIVING IF YOU CAN MAKE IT HERE, YOU CAN MAKE IT HERE IN 15 MINUTES

Building dispute. At issue is the universityâ&#x20AC;&#x2122;s right to punch a hole in a wall. New York Universityâ&#x20AC;&#x2122;s plans to connect its Upper East Side fine arts institute with a donated space in a neighboring building appear to have been quashed by that buildingâ&#x20AC;&#x2122;s condo board, which claims the universityâ&#x20AC;&#x2122;s plans require the boardâ&#x20AC;&#x2122;s consent. The institute operates from a 40,000-square-foot space at 1 E. 78th St. NYU hoped to gain more room by connecting the building to a neighboring six-story, 13-unit building at 3 E. 78th St. via a 10-foot-long breezeway. Billionaire Sheldon Solow donated the ground floor commercial condominium in the building to NYU in the late 1990s. Building the breezeway would require NYU to punch a hole in the French Gothic property, designed in 1899 by renowned American architect C.P.H. Gilbert. But Adam Leitman Bailey, the lawyer for the condo board at 3 E. 78th, wrote to the LPC last month, stating that the wall in question is owned by the condo board, and represents a structural change to the building. That would require approval by the condo board president, per the buildingâ&#x20AC;&#x2122;s bylaws. NYU maintains the bylaws allow the owner of the commercial ground floor condominium to make alterations without the boardâ&#x20AC;&#x2122;s consent, according to The New York Times. Bailey claims NYU falsely represented itself in the application as owners of 3 E. 78th St. to secure approval of the work. â&#x20AC;&#x153;In light of NYUâ&#x20AC;&#x2122;s knowing and deceptive submission of this unauthorized application, the Board respectfully requests that the application be rejected in all respects,â&#x20AC;? he wrote to the LPC. As part of the landmarks process, university

The university has ruďŹ&#x201E;ed some feathers with its expansion plans. / CITYREALTY

representatives initially appeared before the areaâ&#x20AC;&#x2122;s Community Board 8 in May to present the plans. The community board voted 41-1 against NYUâ&#x20AC;&#x2122;s proposal. â&#x20AC;&#x153;The presentation information did not fully illustrate the proposed changes,â&#x20AC;? the board stated in a letter to the LPC dated May 22. The letter notes â&#x20AC;&#x153;the materials are not appropriate to the existing buildingsâ&#x20AC;? and the construction would disturb â&#x20AC;&#x153;the original fabricâ&#x20AC;? of the two buildings. The Times stated that NYU temporarily suspended its application after it was rejected by the board. But it was the Landmarks commission that withdrew the application, until NYU and the condo board agree about the right person to sign the application, according to correspondence between the LPC and the condo board. HITEN SAMTANI

NYU

Impact on residents? New York University wants to use the space at 3 E. 78th St. to build additional facilities. NYU spokeswoman Shonna Keogan told us that the university shared these plans with building residents over a year ago. â&#x20AC;&#x153;The addition of the breezeway was included in large part to reduce the traďŹ&#x192;c in the main entrance in order to minimize impact to the condo residents,â&#x20AC;? she said.

TheRealDeal.com is a daily blog and monthly magazine covering real estate in the New York metro area.

/&81035q(PUIBNT'SJFOEMZ/FJHICPSDPN


www.metro.us Wednesday, June 11, 2014

TECHNOLOGY

E3 UNVEILED THE GAMES YOUâ&#x20AC;&#x2122;LL BE PLAYING

One of the games unveiled at E3 is Sonyâ&#x20AC;&#x2122;s sci-ďŹ adventure â&#x20AC;&#x153;Destiny.â&#x20AC;? / SONY

POCONOSâ&#x20AC;&#x2122; LEADING HOME BUILDER LTS Will Beat Any Builderâ&#x20AC;&#x2122;s Incentive*!

$249,900

Donâ&#x20AC;&#x2122;t gamble with another builder. Build with the best! 6ISIT,43 s#LOSESTLOCATIONSTO.9AND.* s"ESTQUALITY VALUESERVICE s,OWDOWNPAYMENTSINTERESTRATES s(OMEDESIGNSSTARTINGAT 

Call Today! 800-587-5432 EXCEEDING EXPECTATIONSâ&#x201E;˘

GWB to I-80W into0!exit 309, go Âź mi.

Models open daily! #ERTAIN,43COMMUNITIESCONSISTOFPROPERTIESTHATAREBOUNDBYA(OMEOWNERS!SSOCIATION

OFFEREDTHROUGHA0!/FFERING3TATEMENT4HISADISNOTINTENDEDASANOFFERTORESIDENTSINSTATESWHEREPROPERTIESARENOTREGISTERED "ASEDON INCENTIVESADVERTISEDBY0!"UILDERSINTHE.9$AILY.EWSWITHINTHESAMEWEEK ANDWITHINMILESFROMOUROFlCE 4HISOFFERMAYBEWITHDRAWNATANYTIME

WWW.LTSHOMES.COM

"%34 ,/#! "%34,/#!4)/.3s0/#/./3"%34s6)3)4,4334s"%34,/#!4)/.3s0/#/./3"%34s6)3)4,4334s"%34,/#!4)/.3s0/#/./3"%34s6)3)4,4334s0/#/./3"%34s "%34,/#!

6)3)4,4334s"%34,/#!4)/.3s0/#/./3"%34s6)3)4,4334s"%34,/#!4)/.3s0/#/./3"%34s6)3)4,4334s

"%34,/#!4)/.3s0/#/./3"%34s6)3)4,4334s"%34,/#!4)/.3s0/#/./3"%34s6)3)4,4334s"%34,/#!4)/.3s0/#/./3"%34s6)3)4,4334s0/#/./3"%34s

6)3)4,4334s"%34,/#!4)/.3s0/#/./3"%34s6)3)4,4334s"%34,/#!4)/.3s0/#/./3"%34s6)3)4,4334s

The Canterbury Starting at

20

Every year a bunch of drunken digital elves turn Los Angeles into a gamerâ&#x20AC;&#x2122;s paradise, where the games and consoles of the future are unveiled, usually by dorky dudes wearing suits. Hereâ&#x20AC;&#x2122;s what went down!

Sony The PlayStation 4 has shipped gobs of units, taking an early lead in what is referred to by industry insiders as the â&#x20AC;&#x153;console wars.â&#x20AC;? They could have rested on their laurels, but Sony used E3 to go heavy on even more games, like the brutal â&#x20AC;&#x153;Bloodborne,â&#x20AC;? which is set in a bizarro London, and the absolutely stunning â&#x20AC;&#x153;No Manâ&#x20AC;&#x2122;s Sky,â&#x20AC;? which allows you to explore space â&#x20AC;&#x201D; forever. They also announced the new sci-fi franchise starter â&#x20AC;&#x153;Destiny.â&#x20AC;? Also, thereâ&#x20AC;&#x2122;s going to be a white PS4.

Microsoft Microsoft came into this E3 with something to prove. Xbox One isnâ&#x20AC;&#x2122;t the runaway success of its predecessor and the brand

hasnâ&#x20AC;&#x2122;t exactly stayed on message. They delivered with scores of game announcements, from a new â&#x20AC;&#x153;Crackdownâ&#x20AC;? (yes!) to a â&#x20AC;&#x153;Haloâ&#x20AC;? HD collection, not to mention new installments in the â&#x20AC;&#x153;Tomb Raiderâ&#x20AC;? franchise. The only downside? Most of these games were teased with cinematic trailers. Little-to-no gameplay was actually shown.

Nintendo Nintendoâ&#x20AC;&#x2122;s presence at E3 offered some surprises, sure, but for my money the star of the show was the forthcoming duo of â&#x20AC;&#x153;Super Smash Bros.â&#x20AC;? games launching for Wii U and 3DS. If the recent success of â&#x20AC;&#x153;Mario Kart 8â&#x20AC;? is any indication, games that allow friends to crowd around the couch and beat the crap out of one another rule the world. Metro does not endorse the opinions of the author.

SIDESCROLLER

LAWRENCE BONK letters@metro.us

A.I. Japanese robot Pepper will â&#x20AC;&#x2DC;getâ&#x20AC;&#x2122; you Siri is cool and all, but no matter how hard you try, you just canâ&#x20AC;&#x2122;t seem to form an emotional connection with the dang thing. Thank goodness there is a robot coming to market that is all about getting friendly with humans. Japanese tech firm SoftBank has just unveiled Pepper, a friendly robot with a heart of, um, gold. It is powered by something they are calling an â&#x20AC;&#x153;emotional engine.â&#x20AC;? In laymanâ&#x20AC;&#x2122;s terms that just means that dear old Pep-

BEHOLD PEPPER, YOUR NEW HUMANOID OVERLORD. GETTY IMAGES

per understands emotional states and can respond accordingly. Youâ&#x20AC;&#x2122;ll be able to purchase Pepper in February for around $1,900. LAWRENCE BONK


1

Tequila Avionâ&#x20AC;&#x2122;s Reserva 44

For the man who loves a tech-y backstory: Tequila Avionâ&#x20AC;&#x2122;s Reserva 44 spends 43 months in a temperaturecontrolled stone cave, then ages an additional month in a ďŹ&#x201A;avor-enhancing barrel. $150, www.tequilaavion.com

Cheers to dad He might like a new tie. Heâ&#x20AC;&#x2122;d probably enjoy some new tools. But you know what heâ&#x20AC;&#x2122;s sure to appreciate after years of bailing you out? A stiďŹ&#x20AC; drink. MONICA WEYMOUTH

3

Tullamore D.E.W. Phoenix

Cutty Sark Prohibition Edition Cutty Sarkâ&#x20AC;&#x2122;s new Prohibition Edition is a high-proof, no-nonsense, full-ďŹ&#x201A;avored whisky for the manliest of manly men â&#x20AC;&#x201D; aka, your dad (heâ&#x20AC;&#x2122;ll appreciate the ďŹ b). $30, www. cutty-sark. com

2

5

STYLE

21

Lock Stock & Barrel

Lock Stock & Barrelâ&#x20AC;&#x2122;s doubledistilled, 13-year straight rye whiskey got all dressed up for Fatherâ&#x20AC;&#x2122;s Day in a hand-stained wood gift box. $117, www. lockstockand barrelspirits. com

6

The Rabbit Electric Cocktail Mixer

Tullamore D.E.W. Phoenix is a limited-edition, triple-distilled, 55-ABV whiskey thatâ&#x20AC;&#x2122;ll make him forget all about that money your owe him. And the other money, if youâ&#x20AC;&#x2122;re lucky. $55, www. tullamoredew.com

Because shaken and stirred are both a little stuďŹ&#x20AC;y for his style: The Rabbit Electric Cocktail Mixer makes for the happiest of hours. $20, www. bedbathand beyond.com

Loose Dentures? Missing Teeth Chew Better! Get Implants Free Implant Consultation www.newcenturysmile.com (View Our Implant Video) â&#x20AC;˘ â&#x20AC;˘ â&#x20AC;˘ â&#x20AC;˘ â&#x20AC;˘

Tighten Ex is ting Dentures Replace Dentures with Fixed Teeth R egrow B o n e Eliminate Gum Disease O ver 25y r s E xpe r ie n c e

A l l D e n t a l S e r v i c e s Ava i l a b l e Most Insurances Accepted F I N A N CING AVA ILA B LE

(212) 752-2212 New Century Smile George Manthas, DDS Howard B. Marshall, DDS 250 E. 58th St, NYC NY 10022

METRO IS THE MOST READ FREE DAILY NEWSPAPER IN NEW YORK WITH 709,300 DAILY READERS Source: Scarborough 2012-13.

Spiegelau IPA goblets

FOR ADVERTISING: advertising@metro.us or 212-457-7735

The glassware gurus at Spiegelau teamed up with the hopsheads at Sierra Nevada and DogďŹ sh Head to create these IPA-speciďŹ c goblets, designed to enhance the ďŹ&#x201A;avor and aroma of his favorite pale ale. $50 per six-pack, www.spiegelauusa.com

4

Specialized Diagnostic Medical Sonography Career Training at Center for Ultrasound Research & Education

Center for Ultrasound Research & Education

Â&#x2019;  ";]\bV1S`bWÂżQObS>`]U`O[a Â&#x2019;2OgO\R3dS\W\U1ZOaaSaÂ&#x2019;8]P>ZOQS[S\b/aaWabO\QS Â&#x2019;7\bS`Sab4W\O\QWOZ/aaWabO\QS/dOWZOPZS Â&#x2019;:WQS\aSRPg<GA320>AAÂ&#x2019;5`]eW\U7\2S[O\R>`]TSaaW]\

1/::&##B631C@3Â&#x2019;&##&"! &%! %<]`bV/dS<Se@]QVSZZS<GÂ&#x2019;eeeQc`SSRc

C:B@/A=C<21/@33@A0357<63@3 /QQ`SRWbSRPg/063A


www.metro.us Wednesday, June 11, 2014

NEW TREATMENT AVAILABLE FOR CHRONIC FOOT PAIN -7/]Ă&#x160;>Â?Ă&#x192;Â&#x153;Ă&#x160;Â&#x17D;Â&#x2DC;Â&#x153;Ă&#x153;Â&#x2DC;Ă&#x160;>Ă&#x192;Ă&#x160; -Â&#x2026;Â&#x153;VÂ&#x17D;Ă&#x153;>Ă&#x203A;iĂ&#x160;/Â&#x2026;iĂ&#x20AC;>ÂŤĂ&#x17E;Ă&#x160;Â&#x2C6;Ă&#x192;Ă&#x160; >Ă&#x160;Â&#x2DC;iĂ&#x153;Ă&#x160;Â&#x2DC;Â&#x153;Â&#x2DC;Â&#x2021;Ă&#x192;Ă&#x2022;Ă&#x20AC;}Â&#x2C6;V>Â?Ă&#x160; Ă&#x152;Ă&#x20AC;i>Ă&#x152;Â&#x201C;iÂ&#x2DC;Ă&#x152;Ă&#x160;Ă&#x152;Â&#x2026;>Ă&#x152;Ă&#x160; Ă&#x2022;Ă&#x192;iĂ&#x192;Ă&#x160;Ă&#x192;Â&#x153;Ă&#x2022;Â&#x2DC;`Ă&#x160;Ă&#x153;>Ă&#x203A;iĂ&#x192;Ă&#x160; Ă&#x152;Â&#x153;Ă&#x160;VĂ&#x2022;Ă&#x20AC;iĂ&#x160;Ă&#x152;Â&#x2026;iĂ&#x160;VÂ&#x2026;Ă&#x20AC;Â&#x153;Â&#x2DC;Â&#x2C6;VĂ&#x160; ÂŤ>Â&#x2C6;Â&#x2DC;Ă&#x160;>Ă&#x192;Ă&#x192;Â&#x153;VÂ&#x2C6;>Ă&#x152;i`Ă&#x160;Ă&#x153;Â&#x2C6;Ă&#x152;Â&#x2026;Ă&#x160; ÂŤÂ?>Â&#x2DC;Ă&#x152;>Ă&#x20AC;v>Ă&#x192;VÂ&#x2C6;Â&#x2C6;Ă&#x152;Â&#x2C6;Ă&#x192;]Ă&#x160;Â&#x2026;iiÂ?]Ă&#x160; >Ă&#x20AC;VÂ&#x2026;]Ă&#x160;>Â&#x2DC;`Ă&#x160;>VÂ&#x2026;Â&#x2C6;Â?Â?iĂ&#x192;Ă&#x160; Ă&#x152;iÂ&#x2DC;`Â&#x153;Â&#x2DC;Ă&#x160;ÂŤ>Â&#x2C6;Â&#x2DC;°

New & Advanced Treatments UĂ&#x160;Â&#x2C6;Â&#x2DC;Â&#x2C6;Â&#x201C;>Â?Â?Ă&#x17E;Ă&#x160;Â&#x2C6;Â&#x2DC;Ă&#x203A;>Ă&#x192;Â&#x2C6;Ă&#x203A;iĂ&#x160; Ă&#x2022;Â&#x2DC;Â&#x2C6;Â&#x153;Â&#x2DC;Ă&#x160;Ă&#x192;Ă&#x2022;Ă&#x20AC;}iĂ&#x20AC;Ă&#x17E; UĂ&#x160;Ă&#x160;-Â&#x2026;Â&#x153;VÂ&#x17D;Ă&#x153;>Ă&#x203A;iĂ&#x160;Ă&#x152;Â&#x2026;iĂ&#x20AC;>ÂŤĂ&#x17E;Ă&#x160;vÂ&#x153;Ă&#x20AC;Ă&#x160;iiÂ?Ă&#x160;*>Â&#x2C6;Â&#x2DC;]Ă&#x160;*Â?>Â&#x2DC;Ă&#x152;>Ă&#x20AC;Ă&#x160; >Ă&#x192;VÂ&#x2C6;Â&#x2C6;Ă&#x152;Â&#x2C6;Ă&#x192;]Ă&#x160;>Â&#x2DC;`Ă&#x160;/iÂ&#x2DC;`Â&#x153;Â&#x2DC;Â&#x2C6;Ă&#x152;Â&#x2C6;Ă&#x192; UĂ&#x160;>Â&#x201C;Â&#x201C;iĂ&#x20AC;Ă&#x160;/Â&#x153;iĂ&#x160;>Â&#x2DC;`Ă&#x160; iĂ&#x2022;Ă&#x20AC;Â&#x153;Â&#x201C;>Ă&#x160;Ă&#x20AC;iÂŤ>Â&#x2C6;Ă&#x20AC; UĂ&#x160;>Ă&#x192;iĂ&#x20AC;Ă&#x160;Ă&#x192;Ă&#x2022;Ă&#x20AC;}iĂ&#x20AC;Ă&#x17E;Ă&#x160;vÂ&#x153;Ă&#x20AC;Ă&#x160;7>Ă&#x20AC;Ă&#x152;Ă&#x192;]Ă&#x160;-V>Ă&#x20AC;Ă&#x192;]Ă&#x160;>Â&#x2DC;`Ă&#x160;/Â&#x153;iÂ&#x2DC;>Â&#x2C6;Â?Ă&#x192; UĂ&#x160;/Â&#x153;iĂ&#x160;-Â&#x2026;Â&#x153;Ă&#x20AC;Ă&#x152;iÂ&#x2DC;Â&#x2C6;Â&#x2DC;}Ă&#x160;>Â&#x2DC;`Ă&#x160;-Ă&#x152;Ă&#x20AC;>Â&#x2C6;}Â&#x2026;Ă&#x152;iÂ&#x2DC;Â&#x2C6;Â&#x2DC;} UĂ&#x160; Â&#x153;Ă&#x192;Â&#x201C;iĂ&#x152;Â&#x2C6;VĂ&#x160;vÂ&#x153;Â&#x153;Ă&#x152;Ă&#x160;Ă&#x192;Ă&#x2022;Ă&#x20AC;}iĂ&#x20AC;Ă&#x17E;

Most Insurance & HMO Plans Accepted

"vwViĂ&#x160;>VÂ&#x2C6;Â?Â&#x2C6;Ă&#x152;Ă&#x17E;Ă&#x160;VVĂ&#x20AC;i`Â&#x2C6;Ă&#x152;i`Ă&#x160;LĂ&#x17E;Ă&#x160;Ă&#x152;Â&#x2026;iĂ&#x160;Â&#x153;Â&#x2C6;Â&#x2DC;Ă&#x152;Ă&#x160; Â&#x153;Â&#x201C;Â&#x201C;Â&#x2C6;Ă&#x192;Ă&#x192;Â&#x2C6;Â&#x153;Â&#x2DC;  /"7

"7 /"7 ÂŁĂ&#x17D;Ă&#x17D;Ă&#x160; >Ă&#x192;Ă&#x152;Ă&#x160;x{Ă&#x152;Â&#x2026;Ă&#x160;-Ă&#x152;Ă&#x20AC;iiĂ&#x152; {Ă&#x201C;Ă&#x160; Ă&#x20AC;Â&#x153;>`Ă&#x153;>Ă&#x17E; Ă&#x201C;ÂŁĂ&#x201C;°Ă&#x2021;xÂ&#x2122;°Â&#x2122;äÂ&#x2122;ä Ă&#x201C;ÂŁĂ&#x201C;°Ă&#x2021;nx°£Ă&#x2021;ÂŁĂ&#x2021; 1*/"7 , Ă&#x160; /, ÂŁxĂ&#x2021;Ă&#x160; >Ă&#x192;Ă&#x152;Ă&#x160;nĂ&#x2C6;Ă&#x152;Â&#x2026;Ă&#x160;-Ă&#x152;Ă&#x20AC;iiĂ&#x152; Ă&#x17D;Ă&#x2C6;Ă&#x160;7iĂ&#x192;Ă&#x152;Ă&#x160;{{Ă&#x152;Â&#x2026;Ă&#x160;-Ă&#x152;°Ă&#x160; Ă&#x201C;ÂŁĂ&#x201C;°Ă&#x2021;Ă&#x201C;Ă&#x201C;°Ă&#x201C;{Ă&#x201C;{ ­xĂ&#x152;Â&#x2026;Ă&#x2030;Ă&#x2C6;Ă&#x152;Â&#x2026;Ă&#x160;>Ă&#x203A;i°Ž Ă&#x201C;ÂŁĂ&#x201C;°Ă&#x2021;Ă&#x2C6;n°Ă&#x2021;Â&#x2122;Â&#x2122;Â&#x2122;

Â&#x153;>Ă&#x20AC;`Ă&#x160; iĂ&#x20AC;Ă&#x152;Â&#x2C6;wi`Ă&#x160;Â&#x2C6;Â&#x2DC;Ă&#x160;Â&#x153;Â&#x153;Ă&#x152;Ă&#x160;EĂ&#x160;Â&#x2DC;Â&#x17D;Â?iĂ&#x160;-Ă&#x2022;Ă&#x20AC;}iĂ&#x20AC;Ă&#x17E; Ă&#x153; Ă&#x153; Ă&#x153;° Ă&#x20AC;i Â? Â&#x2C6; i Ă&#x203A; i v Â&#x153; Â&#x153; Ă&#x152; ÂŤ > Â&#x2C6; Â&#x2DC; ° V Â&#x153; Â&#x201C;

$1

Laser Teeth Whitening

(w/Check-up and Cleaning*) *covered by your PPO Dental Plan

Up to 12 Shades Whiter in just 1 hour Call (212) 537-6923 - Open Weekends and Evenings 30 East 40th 3TsBLOCKFROM'RAND#ENTRAL3TATION 0H  sWWW:OOMFORCOM H[S

Porn might aďŹ&#x20AC;ect your brain

Researchers regrow teeth Location of study: U.S. Study subjects: Rodents Results: A novel procedure has uncovered a potential new way to treat damaged teeth â&#x20AC;&#x201C; by growing new ones. Researchers are using low-level lasers to stimulate stem cells that regenerate dentin, which serves as the foundation of teeth. SigniďŹ cance: In general, the process of regenerating stem cells isnâ&#x20AC;&#x2122;t so simple. â&#x20AC;&#x153;I think the big novelty is connecting the dots here in our ability to use a noninvasive tool and perform clinical therapy driving stem cell diďŹ&#x20AC;erentiation,â&#x20AC;? said lead author Praveen Arany.

22

IS IT JUST SUMMER OR SOMETHING MORE?

This week in health news

Location of study: Germany Study subjects: 64 men Results: Watching excessive amounts of pornography may be linked to brain changes in men. In a recent study, men who said they watched signiďŹ cant amounts of porn were found to have decreased brain matter and less brain activity. SigniďŹ cance: Researchers say the ďŹ ndings might be taken as evidence that the neural response to sexual stimuli is blunted with more frequent exposure. But the study was unable to determine whether the pornography caused the observed neural eďŹ&#x20AC;ects, or if the speciďŹ c biology dictated the preference for pornography.

WELLBEING

The ability to regrow teeth should not replace taking care of the ones you have now! / DIGITAL VISION

Many feel less stress at work than at home Location of study: U.S. Study subjects: Over 100 working Americans Results: Stressed out? Cutting back at work might not be the best remedy. New research suggests we might be more stressed at home than at the oďŹ&#x192;ce. Cortisol, the â&#x20AC;&#x153;stress hormone,â&#x20AC;? was generally found to be higher while weâ&#x20AC;&#x2122;re home. SigniďŹ cance: Sarah Damaske of Penn State University says the ďŹ ndings held true across gender, marital status, occupation and education. Focusing on work tasks and successfully completing them could be good for you, she said. Content provided by ZipTrials.us,  a trusted source for health news and clinical trial registration

=2207((7+:+,7(1,1* 2)) &OXE0HWURLVRIIHULQJD=220WHHWK ZKLWHQLQJWUHDWPHQWZLWK'U3HWHU0DQQDW 6PLOH$UWVRI1<IRU UHJXODUSULFH 

=220EULJKWHQVWHHWKXSWRVKDGHVEUHDNV XSVWDLQVDQGGLVFRORUDWLRQDQGLVWKHPRVW WHFKQRORJLFDOO\VDYY\ZKLWHQLQJJDPHLQWRZQ

For your chance to win, log on to CLUBMETRO.METRO.US 6LJQXSIRU&OXE0HWURDQGVWD\LQWKHORRSWRZLQJUHDWSUL]HV DQGUHFHLYHVSHFLDOGHDOV

Sometimes, sweating is due to more than just warmer weather. CREATAS

The Doctor Will See You Now

DR. MARK MELROSE URGENTCAREMANHATTAN.COM Mark Melrose, DO, is a board-certiďŹ ed emergency physician at Urgent Care Manhattan. E-mail him your questions at askdrmark@metro.us.

I sometimes arrive at work drenched in sweat. How do I know if I sweat too much?

Perspiration, or sweat, is the bodyâ&#x20AC;&#x2122;s way of cooling itself by evaporation of a slightly salty, water-based fluid secreted from glands in the skin. The amount you perspire depends on how many sweat glands you have; women have more than men, but menâ&#x20AC;&#x2122;s sweat glands are more active. Sweating is usually a response to higher ambient temperatures. When it is hot outside, you sweat more! Increased humidity also makes it feel as if you are sweating more; when there is more moisture in the air, there is less evaporation from the skin. Sweating is an involuntary response to the environment or other factors, such as diet (caffeine, spicy foods, alcohol), anxiety and stress, pain, low blood sugar, hormonal fluctuations and fever from an infection. Emotional stress often causes sweating that is isolated to the palms,

feet, armpits and groin, whereas sweating for cooling purposes occurs all over the body. The fluid secreted by sweat glands is largely water with a low concentration of electrolytes, minerals and fatty acids. On a particularly hot day or in response to vigorous exercise, the body can lose up to 2 liters of fluid per hour, so stay hydrated! Excessive sweating (hyperhidrosis) might be caused by a number of medical conditions, including nervous system disorders, infections, hormonal imbalances, medication side effects and anxiety. Though thereâ&#x20AC;&#x2122;s no baseline for how much sweat is too much, there could be a concern if youâ&#x20AC;&#x2122;re sweating for no apparent reason. If you suspect that you sweat more than is appropriate due to weather or exercise or at inappropriate times, then a doctor can conduct a purposeful history and physical exam. Metro does not endorse the opinions of the author.


LETTERS & GAMES Letters

Horoscope

Gemini | May 22-June 20. This is not the day to make promises. You’ll be confused regarding what’s expected of you. Get clear instructions.

Virgo | Aug. 23-Sept. 22. Trouble is brewing behind the scenes: If you are doubtful regarding a person’s intentions, refuse to get involved.

Cancer | June 21-July 22. An indirect proposal will prove intriguing. Follow your instincts, and get the particulars from someone knowledgeable.

Libra | Sept. 23-Oct. 22. Join an organization that appreciates what you have to offer. A partnership will develop from a mutual desire to get involved in a worthy cause.

Capricorn | Dec. 22-Jan. 20. Conceal your plans. Someone is likely to take credit if you are too open. Listen, and you will discover ulterior motives.

Scorpio|Oct. 23-Nov. 21. You will end up in a worse predicament if you hand your hard-earned cash to a schemer. Offer advice, not money.

Aquarius | Jan. 21-Feb. 18. Join forces with someone who can help you achieve your goals. Having a partner will cut your workload in half.

Leo | July 23-Aug. 22. Make sure that the attention you give doesn’t cause a problem with a friend or loved one. An innocent gesture will lead to an unsettling disagreement.

Sagittarius | Nov. 22Dec. 21. Make sure your feelings are reciprocated before making any romantic announcements. It’s likely that your love interest isn’t ready.

Pisces | Feb. 19-March 20. Speak up, or someone will expect you to be a follower. Make it known that you intend to forge your own path.

3 8 2 1

1

4

7

6

5

7

9

2

3 4

7

5 5

6

1

4 3

7

7

8 5

1 7

Taurus | April 21-May 21. Now is the time to invest, not spend. Sound economic advice will enable you to add to your finances. Put quality over quantity. BERNICE BEDE OSOL

CANEPA-ZIPPRICH, VIA EMAIL

8

Lydon story inspiration

Aries | March 21-April 20. You are well-equipped to handle anything that comes your way. Communication and travel will figure into your schedule.

7

9

5 8

9

6 3

2

2 6

4

6

6

4 1

9

4

2

5

9 5

1

7

4 3

5

7

6

2 1

2

8

Regrets no excuse Re: ‘Obama easing school debt law’ (Metro, June 10) I was taught by my family that one meets his or her obligations and you don’t sign anything unless you understand what you’re signing. I will and have assisted my children with their students loans and would never allow them to not meet their obligations. “I did not know how much it would be” is no excuse. CAMELIA

Sudoku: Easy and hard

3

23

How to play Fill in the grid so that every row, every column and every 3x3 box contains the digits 1-9. There is no math involved. You solve the puzzle with reasoning and logic.

Re: ‘I’m proud of who I am’ (Metro, June 10) Thank you to Jennifer Lydon and Metro for helping to tell her story. Gender,

like many other aspects of who we are as human beings, is not necessarily as simple as we might have been told. Here’s to better understanding how we can all be our true selves! CAROL C. REIMAN, VIA EMAIL

Too weird for rest of US Re: ‘WTF, Hugh Jackman’ (Metro, June 9) Hugh Jackman is WAY better than Neil Patrick Harris as host. Remember, this telecast goes to the whole country, not just the intheater crowd of NYC. NPH is way too bizarre for the rest of the country. MICHAEL CHIMENTI, VIA EMAIL

letters@metro.us Keep them as brief as possible, preferably under 100 words. Metro reserves the right to edit all letters. Please include your name and contact info.

Visit us online at Metro.us Use your smartphone to find today’s crossword answers! Download and open the Blippar app on your smartphone and hold the screen over the puzzle.

Crossword

= Across 1 Kitty’s bane 5 Sea, in a gale 9 Farewell 14 Dr.’s visit 15 NASA nix (hyph.) 16 Dolphins’ city 17 Clingy fabric 18 Felt remorse 19 Spurred on 20 Broke loose 22 Spent (2 wds.) 24 Unmuddled 26 Jr.’s son, maybe 27 Deadly 30 On the cutting edge 35 UFO pilot 36 Ranch segment 37 Meditation guide 38 Cargo hauler 39 Least demanding 42 Floating leaf 43 Singer — James 45 Sigh of relief 46 Biscotto flavoring 48 Demolishes 50 Battery terminals 51 Squirrel hangout 52 “To Do” lists 54 Caps with propellers 58 Dark-furred martens 62 Lead Chipmunk 63 “Star Wars” princess

65 Dreaded czar 66 Avignon’s river 67 Hold down a job 68 Caligula’s nephew 69 Needing bleach 70 Club fee 71 Ballooned

Down 1 Pseudo 2 RN assistants 3 Large-scale 4 Legation member 5 Let out line 6 Dutch export 7 Size above med. 8 The Force was with him 9 Ms. Earhart 10 Grooving on 11 “Othello” heavy 12 Shaman’s quest 13 Agree with 21 Flying machine 23 Dwells 25 Most suggestive 27 Rinsed off 28 Buoy up 29 Faint colors 31 Made a sketch 32 Amorous archer 33 Wipe out data

34 Tenderfoots 36 Really pale 40 Opened one’s eyes 41 Cisterns 44 Making up for 47 Snacker’s delight 49 Old blues singer Ma — 50 Most Hindus 53 Eager 54 Minstrel 55 Post-kindergarten 56 Cosmetics brand 57 Iditarod vehicle 59 At any time 60 Uncommon 61 Blizzard maker 64 Perfume label word

Yesterday’s answer

As the world’s largest global newspaper, Metro has more than 18 million readers in more than 100 major cities in 23 countries. • • Metro New York 120 Broadway, New York, NY 10271 • main 212-457-7790 • to advertise 212-457-7735 • sales fax: 212-952-1505 • National and Executive Sales Director Ed Abrams • U.S. Circulation Director Joseph Lauletta • U.S. Marketing Director Wilf Maunoir • email sales advertising@metro.us • email distribution distribution@ metro.us • Advertisements appearing in Metro are published in good faith. Metro does not endorse and makes no representations about any of the advertising content appearing in its pages. Metro is not responsible for any loss or damages whatsoever resulting from readers using the services of its advertisers. Readers should exercise caution when replying to advertisements, especially those which require any form of payment, and, where necessary, should seek independent legal advice. • Editor in Chief Aleksander Korab, aleksander.korab@metro.us • Managing Editor/ Sports Editor Mark Osborne, mark.osborne@metro.us • National News Editor Jill Gadsby, jill.gadsby@metro.us • City Editor Allen Houston, allen.houston@metro.us • Features Editor, Music Editor Pat Healy, pat.healy@metro.us • Deputy Features Editor, Home/Style/Food Editor Tina Chadha, tina.chadha@metro.us • • TV Editor Lisa Weidenfeld, lisa.weidenfeld@metro.us • Film/Tech Editor Matt Prigge, matt.prigge@metro.us • Wellbeing/Going Out/Travel Editor Eva Kis, eva.kis@metro.us • Careers/Education/Dating Editor Lakshmi Ghandi, lakshmi.gandhi@metro.us • Copy Chief Tracie Michelle Murphy, tmichelle.murphy@metro.us


3 SPORTS

Watch online

Find video and recap of last nightâ&#x20AC;&#x2122;s late Yankees-Mariners road game at: Metro.us/sports.

www.metro.us Wednesday, June 11, 2014

SPORTS

Fisher pushes aside inexperience issues NBA. The new Knicks head coach was introduced to the media Tuesday. The Knicks officially announced the hiring of Derek Fisher as the franchiseâ&#x20AC;&#x2122;s 26th head coach on Tuesday. And perhaps no coach has had his credentials as scrutinized as the former NBA point guard. But the always affable Fisher, once the NBA players association president, quickly dispelled the notion heâ&#x20AC;&#x2122;s not up for the immediate career change. â&#x20AC;&#x153;There obviously will be a lot of talk about my inexperience as a head coach, and that is factually true,â&#x20AC;? said the 39-year-old Fisher. â&#x20AC;&#x153;I have not been a head coach in the NBA, college or high school, but I am

24

Melo out?

Fisher to talk to Anthony about return Derek Fisherâ&#x20AC;&#x2122;s opening press conference as head coach would not have been complete without addressing the biggest topic on the Knicks hands â&#x20AC;&#x201D; likely free-agent-to-be Carmelo Anthony. â&#x20AC;&#x153;As far as Carmelo, we feel heâ&#x20AC;&#x2122;s one of the top players in the world and we want him to be here, but ultimately itâ&#x20AC;&#x2122;s his choice,â&#x20AC;? Fisher said. â&#x20AC;&#x153;Heâ&#x20AC;&#x2122;s never been a free agent, so perhaps he wants to go through that process.â&#x20AC;? TONY WILLIAMS

Fisher reportedly signed a ďŹ ve-year, $25 million deal. / GETTY IMAGES

experienced. Basketball is a game that I am experienced in playing, in its understanding, leading, guiding and helping a group of people achieve the greatest gift in the world as a professional athlete, and thatâ&#x20AC;&#x2122;s being a champion. That I am experienced in and that

is something that I plan on sharing with these players and this organization.â&#x20AC;? Fisher said he believes heâ&#x20AC;&#x2122;s been grooming himself since he was in elementary school. â&#x20AC;&#x153;Iâ&#x20AC;&#x2122;ve very rarely been the best player, most talented, the tallest, the highest

Quoted

jumper or the best shooter on my basketball team, so right away I immediately had to start thinking how the game was played,â&#x20AC;? Fisher said.

â&#x20AC;&#x153;Iâ&#x20AC;&#x2122;ll have Derek wear all ďŹ ve of his rings to show Carmelo the ďŹ rst time they talk.â&#x20AC;?

TONY WILLIAMS @TBone8

Phil Jackson, president, on Fisher meeting with Anthony

sports@metro.us

ATTENTION NEW YORK LAWYERS NEW! FROM METRO NEW YORK

LAWYER SOURCE PROFILE YOUR LEGAL EXPERTISE TO OVER 850,000 READERS

HY WX <X2B 

 u\

<   

E U    EX XX  X\X .   \FP UY]  \.  \. X XX ]^X  ^ /

SPACE RESERVATION DEADLINE: JUNE 20 FOR MORE INFORMATION CONTACT THOMAS FRANKE 212.457.7751 â&#x20AC;˘ NYCLAWYER@METRO.US -69(+=,9;0:05.*65;(*;:(3,:(;69(+=,9;0:05.'4,;96<:


SPORTS

Q&A: Nico Calabria, one leg but lots of skill Soccer. Metro spoke to the American who wonâ&#x20AC;&#x2122;t be kept oďŹ&#x20AC; the pitch. Nico Calabria is a first-class soccer player, capable of scoring from distance and running off to celebrate after scoring with an amazing bicycle kick. But Calabriaâ&#x20AC;&#x2122;s ability is even more remarkable, knowing the amateur has just one leg and plays against able-bodied opponents. Metro spoke to Calabria, who will be playing for Team USA in the Am-

Up against it

Rangers ďŹ ght uphill battle in Cup Final

putee Football World Cup in Mexico later this year. How do you hone your abilities in soccer? I decided to focus on my strengths. Speed and agility will never be my my strong points in football, so I focused on controlling my touch, passing, vision and creativity. What are your dreams? My life plans are to become a motivational speaker and a teacher. I also hope to have time to train as much in [soccer] and wrestling. Who are your favorite

25

To see video of Nico Calabria in action on the soccer ďŹ eld, go to www.metro.us/sports. / COURTESY NICO CALABRIA

players that will be in the World Cup? I admire some skills in several players. I think [Andres] Iniesta has a very creative view of the field. Others are [Lionel] Messi, Cristiano [Ronaldo] and Neymar.

Visit Metro.us to see the most expensive team money can buy.

If you could describe your life philosophy in a few words, what would it be? Everyone has the power to challenge the expectations.

CLASSIFIED DIRECTORY

EDGAR SANCHEZ @metronewyork sports@metro.us

Rangers head coach Alain Vigneault couldnâ&#x20AC;&#x2122;t mask his anger Tuesday when asked about his teamâ&#x20AC;&#x2122;s mood one day before facing elimination in the Stanley Cup Final. â&#x20AC;&#x153;Weâ&#x20AC;&#x2122;re down 3-0,â&#x20AC;? Vigneault said. â&#x20AC;&#x153;Weâ&#x20AC;&#x2122;re all lacking sleep. This is tough. I didnâ&#x20AC;&#x2122;t expect my players today to be cheery and upbeat. Weâ&#x20AC;&#x2122;re in the Stanley Cup Final and weâ&#x20AC;&#x2122;re down 3-0. You donâ&#x20AC;&#x2122;t get a lot of these opportunities. â&#x20AC;&#x153;Excuse us if today weâ&#x20AC;&#x2122;re not real cheery. But tomorrow I can tell you weâ&#x20AC;&#x2122;re going to show up.â&#x20AC;? For the ďŹ fth time in this playoďŹ&#x20AC; campaign, the Rangers are facing an elimination game. But unlike Game 7 against the Flyers, and Games 5 and 7 against the Penguins, the Rangers seem accepting of

CHRIS KREIDER HAS NO GOALS IN THE FINAL. GETTY IMAGES

their fate. â&#x20AC;&#x153;We believed that wasnâ&#x20AC;&#x2122;t it for us,â&#x20AC;? Marc Staal said of his teamâ&#x20AC;&#x2122;s mindset after falling behind the Penguins, 3-1. â&#x20AC;&#x153;We werenâ&#x20AC;&#x2122;t going to lose the series that way. We knew we had better. Our focus was playing one solid game.â&#x20AC;? Even if the Rangers win in Game 4, history is not on their side. Only the 1942 Maple Leafs have come back from a 0-3 deďŹ cit in the Stanley Cup Final. â&#x20AC;&#x153;Iâ&#x20AC;&#x2122;m not going to lie to you,â&#x20AC;? Brad Richards said. â&#x20AC;&#x153;Itâ&#x20AC;&#x2122;s pretty much impossible to be upbeat.â&#x20AC;? DENIS GORMAN

To advertise please contact 866-900-9473 or Newyorkclassifieds@metro.us Do you have

CHRONIC OBSTRUCTIVE PULMONARY DISEASE also known as

Type 1 Diabetes Study The PERL: Preventing Early Renal Loss in Diabetes

Chronic obstructive pulmonary disease (COPD)

includes

chronic bronchitis and emphysema.

Is chronic constipation a problem for you? Are you experiencing less than 3 bowel movements per week?

If you have COPD you may be interested in volunteering for our COPD CLINICAL RESEARCH STUDY. QualiďŹ ed participants must: U Have COPD U Be 40 years of age or older U Be a current or former smoker

For more information call

Those who qualify receive study-related exams, evaluations and study drug or placebo at no cost. Medical insurance is not required and compensation for time and travel may be provided.

212-777-6977

Consider joining a research study for individuals with chronic constipation. If youâ&#x20AC;&#x2122;re aged 18-80 and experiencing less than 3 bowel movements a week, you may qualify. If you qualify, study exams and investigational drug will be provided to you at no cost. There may be compensation for your travel.

You may be eligible for PERL if:

3EARCH#LINICAL4RIALS #HECK-EDICAL.EWS (ELP&INDA#URE

Call Manhattan Medical Research to learn more!

Check out our NEW website:

917-409-3931 or ltisdale@manhattanmedicalresearch.com

0%2,äISäAäRESEARCHäSTUDYäSPONSOREDäBYä THEä.ATIONALä)NSTITUTESäOFä(EALTHäANDäTHEä *UVENILEä$IABETESä2ESEARCHä&OUNDATIONää 0%2,äISäTESTINGäWHETHERäAäMEDICINEä COMMONLYäUSEDäTOäTREATäGOUTäMAYäALSOä HELPäPROTECTäKIDNEYäFUNCTIONäINäPEOPLEä WITHäTYPEääDIABETES

ZipTrials.us Powered by

sää9OUäHAVEäHADäTYPEääDIABETESä FORäATäLEASTääYEARS

sä9OUäAREäBETWEENäTHEäAGESäOFä 

sä9OUäHAVEäINCREASEDäPROTEINäINäTHEäURINEä %LIGIBLEäPARTICIPANTSäWILLäHAVEääSTUDYäVISITSä OVERääYEARSäANDäWILLäRECEIVEäUPäTOääATä STUDYäCOMPLETIONä4RANSPORTATIONäCOSTSäWILLä BEäREIMBURSEDä0%2,äSTUDYäSITESäAREäAVAILABLEä INäTHEä"RONX ä-ANHATTANäANDä,ONGä)SLANDä

&ORäMOREäINFORMATION äPLEASEäCONTACT

Diabetes Clinical Trials Unit

718-405-8271 0%2, EINSTEINYUEDU


To advertise please contact 866-900-9473 or Newyorkclassifieds@metro.us

LEGAL SERVICES

BANKRUPTCY

DIVORCE $179

Not Sure Who to See for Bankruptcy?

1-800-414-0333

Want an Attorney Who Will Provide Friendly, Caring, Personal Service at a Low Price? Then Call

TheDivorceCenter.com

*AY3IMONs

Spouseâ&#x20AC;&#x2122;s Signature Not Needed

32 Court Street, Suite 805, Brooklyn

Donâ&#x20AC;&#x2122;t Be Fooled By Imposters

Bankruptcy Only, Chapter 7 Specialist, Low Fee, One Set Fee, Installments, Personalized Attention, Free Consultation

To advertise call Thomas Franke at 212-457-7751 or email thomas.franke@metro.us

www.metro.us

CLASSIFIED DIRECTORY

Plus Court Fee - Without Children - With This Ad EXPIRES 6/30/2014

The Bankruptcy Whisperer

Over 60 Years of Experience

DINERMAN BERGAM & DINERMAN

ABSOLUTE

8::@;<EK6

DIVORCE

ALL ACCIDENT CASES HANDLED

ä"ROADä3T äTHä&LOOR ä.9 ä.9ää   ä\äWWWABSOLUTEDIVORCEINCCOM

ÂŁxäĂ&#x160; ," 79Ă&#x160; 9 Ă&#x160;UĂ&#x160;­Ă&#x201C;ÂŁĂ&#x201C;ÂŽĂ&#x160;Ă&#x201C;Ă&#x2C6;Ă&#x2021;Â&#x2021;Ă&#x2021;xĂ&#x2021;x &REE#ONSULTATION

ASK FOR MARIA

34!24).' !4 $219 äCOURTäFEES

Hablamos EspaĂąol

#AR"US4RAINs3LIP4RIPAND&ALLs%LEVATORs2EAL%STATE

SUMMER SPECIAL

Must bring in ad Expires 8/30/2014.

(ABLAMOS%SPAĂ&#x2014;OL

Mon-Sun 10am-10pm

BEAUTY SPA 646-429-9001 45 ST/5 AVE

OUR GUIDE WILL RUB YOU THE RIGHT WAY.

MASSAGEPLACES.COM

CAREER TRAINING

&DUHHU7UDLQLQJ

TELMKTRS

Brooklyn www.AccessCareers.Edu

MADE YOU LOOK!!! Now All You Have To Do is Call. Salary + Comm. + Bonus = $8.-$12/Hr. David (212) 563-7500

CLASSIFIEDS

BEST TRAINING BEST PRICE MEDICAL TRAINING Medical M Assistant.............. CALL E EKG Technician................. $399 P Phlebotmy Tech................. $399 M Medical Billing................... $499 P Pharmacy Tech.................. $899 C CNA (Nurse Assistant)........... $899

&DUHHU7UDLQLQJ

Access Careers

F/T EXP ONLY!

To place an ad call 866-900-9473

     

&DUHHU7UDLQLQJ

For Select Programs If Qualify

ACE INSTITUTE of TECHNOLOGY

www.acecareer.edu M A N H AT TA N 212-695-9700 Q U E E N S 718-575-3223

DRIVERS

Hiring Delivery Box Truck Drivers for FRESHDIRECT! Weekly pay! BeneďŹ ts! Growth Opportunity! DOT card/Medical CertiďŹ cate required!

Non-CDL $11/CDL $12 to start.

866-487-5432

Medical Assistant--- Call for Low Price Dental Assistant ----- Only $ 7500 Physical Therapy Aide --- New Program * Nurse Aide (CNA) * EKG & Phlebotomy (Combo) * Patient Care Technician * Pharmacy Technician * Medical Billing & Coding * *

Business Analyst

New Media Production (Audio & Video)

(2 openings in NYC):

0#4s((!s-EDICAL!SST

Analyze business requirements

CNA FREE Training if eligible &REE4RAINING536ETS 3OLAR4ECHETC

Morning, Evening & Weekend Classes * We Accept voucher (Workforce, VESID, HRA etc) * Licensed by NYSED & Accredited by COE * Financial Aid Available for Select programs if qualiďŹ ed * Close to Subway 2, 3, 4, 5, A, C, G, Q, D, F, at Hoyt St * Lifetime Job Placement Assistance

General Help Wanted

Place!

%+'0(,%0HARM4ECH

*

JOBS

JOBS We Train &

Call Now

*

#ALL   STUDENT VISAS @ LOW COST On Queens Blvd Next to E/F Train Q10 Bus 8002 Kew Gardens Rd,Kew Gardens, NY

WWW.ACCESSQUEENS.COM

&

translate

into

system

functional designs. Collect data and

information

on

system

performance discrepancies for root cause analysis. Develop functional

specifications

documents.

Req.:

equiv.

Management

in

Bachelor/ &

Systems, CS, Math or related

$&DUHHU:LWK$*UHDW)XWXUHItâ&#x20AC;&#x2122;s Time.

fields. Good understanding of systems development cycle & business analysis. Strong skills in system management from integration, changing control to

C COMPUTER & IT TRAINING  PC Technician (A+)............ $399  Networking Ne Concepts (N+). $399  Network Ne Security (S+)........ $399 FINANCIAL AID AVAILABLE

&DUHHU7UDLQLQJ

minimizing technical

Paralegal Legal Assistant

NYCI HVWDEOLVKHG

Court

5HSRUWLQJ

Medical

2IÂżFH$GPLQ%LOOLQJ &RGLQJ

Health Info Technology

&ORVHG&DSWLRQLQJ NEW YO YORK ORK OPEN O P HOUSE CAREER :HGDPSP INSTITUTE

The College of Legal & Medical Professions.

6DWDPSP

Call Â&#x2021;Â&#x2021;Â&#x2021;ZZZQ\FLHGX

Or Apply at www.freshdirect.com/jobs

'D\(YHQLQJ 6DW&ODVVHVÂ&#x2021;'HJUHH &HUWLÂżFDWH3URJUDPVÂ&#x2021;7UDQVIHU&UHGLWV$FFHSWHGÂ&#x2021;9$$SSURYHG

Call James 718-404-7311 For immediate interview

11 PARK PLACE, NYC &RQYHQLHQWO\/RFDWHGLQ/RZHU0DQKDWWDQ

For Disclosure Information, view Program Details @ nyci.edu

risks. writing

Excellent skills.

Send

resume to 7thonline Inc, 24 West 40th, 11th Fl, NY, NY 10018. 26 new york Wednesday, June 11, 2014

IMPORTANT INFORMATION: All classiďŹ ed advertising is subject to the terms and conditions of the applicable Metro ClassiďŹ ed rate card and to approval and acceptance at Metro U.S. option. Metro US reserves the right to edit, reject, cancel or reclassify an ad, and reserves the right to convert any classiďŹ ed advertising to alternative formats for use and publication in other Metro U.S. publications. It is the advertiserâ&#x20AC;&#x2122;s sole responsibility to check each ad the ďŹ rst day it is published. Metro U.S. assumes no responsibility for any reason, for any error or omission in any ad.


www.metro.us

CLASSIFIED DIRECTORY

To advertise please contact 866-900-9473 or Newyorkclassifieds@metro.us

JOBS General Help Wanted Business Opportunity-Owner/ Operator-Open House Deliver newspapers as an Owner/Operator under agreement with our company in Manhattan. Earn up to $1,000+/month. Must have dependable car. Call 646-277-3795 for details

Ashmatt Employment Agency

Education

Education

No computer needed!! Call 24/7 for free brochure 1-800-264-8330

,OOKINGFOR7ORK 7EHAVE)MMEDIATE&4 0OSITIONS %NTRY,EVELW!DVANCEMENT 7E0REFER.O%XPERIENCE !SWEPROVIDE /N 4HE *OB4RAINING !VGHR (IGHER%ARNING0OTENTIALFOR 0ROVEN,EADERS  #ALL  

(OUSE/FFICE#LEANING 3PECIALISTS7ANTED )MMEDIATEOPENING &ULL0ARTTIME  

Attention Renters: Enjoy summer in your own home! Startt with St ith as littl little as

STOP PAYING RENT Register in person at our ofďŹ ce: ,/6).'#!2% !.$(%!,).' 4ODAYISAMIRACLE DAYFORALL

$ 5,000

1-2 Family Homes in Brooklyn, Bronx, and Queens Good credit/bad credit All cases processed ÂŁ{Ă&#x17D;Â&#x2021;ÂŁĂ&#x17D;Ă&#x160;Â&#x2C6;Â?Â?Ă&#x192;Â&#x2C6;`iĂ&#x160;Ă&#x203A;i°]Ă&#x160;>Â&#x201C;>Â&#x2C6;V>Ă&#x160; 9Ă&#x160;ÂŁÂŁ{Ă&#x17D;xĂ&#x160;UĂ&#x160; Ă&#x17E;Ă&#x160;/Ă&#x20AC;>Â&#x2C6;Â&#x2DC;\Ă&#x160;/>Â&#x17D;iĂ&#x160;Ă&#x152;Â&#x2026;iĂ&#x160;ºĂ&#x160; /Ă&#x20AC;>Â&#x2C6;Â&#x2DC;Ă&#x160;Ă&#x152;Â&#x153;Ă&#x160;-Ă&#x2022;Ă&#x152;ÂŤÂ&#x2026;Â&#x2C6;Â&#x2DC;Ă&#x160; Â?Ă&#x203A;`Ă&#x160;UĂ&#x160; Ă&#x17E;Ă&#x160; >Ă&#x20AC;\Ă&#x160;/>Â&#x17D;iĂ&#x160;6>Â&#x2DC;Ă&#x160;7Ă&#x17E;VÂ&#x17D;Ă&#x160;Ă&#x152;Â&#x153;Ă&#x160;Â&#x2C6;Â?Â?Ă&#x192;Â&#x2C6;`iĂ&#x160;Ă&#x203A;i

718-291-1800 START NOW!!

Rentals

Rooms for Rent

!STORIA4OTALLY5PDATED BEDAPT#LOSETO4RANS #REDIT3CORE2EQ ORABOVE.OPETS 0REFNON SMOKER #ALL

Affordable Furnished Rooms in Manhattan

Utilities Included Same Day Move In Cable, TV, Internet No Credit Check fÂŁĂ&#x201C;xĂ&#x160;ÂŤiĂ&#x20AC;Ă&#x160;Ă&#x153;iiÂ&#x17D;Ă&#x160;UĂ&#x160; >Â?Â?Ă&#x160;Ă&#x201C;ÂŁĂ&#x201C;Â&#x2021;nĂ&#x2C6;Ă&#x201C;Â&#x2021;ä{xĂ&#x2021;

Rooms for Rent

100â&#x20AC;&#x2122;s Available, All Boroughs

All Manhattan/Bronx

SERVICES You want a solution for all your problems? Mr. Q, he's a man og god. He can clear negativity, spiritual cleaning, stops witches, defeats your enemies, and offers powerful protection. Do you have problems with your relationships, family, property, court cases?

REDUCE YOUR CABLE BILL!

Mr. Qaadir 718-213-9945

SO CALL NOW 877-356-0526

Get an All-Digital Satellite System installed for FREE and programming starting at $19.99/mo. FREE HD/DVR upgrade for new callers,

Give me a call. Appt. only

CLASSIFIEDS

Private Entry Bath Cooking 1 Person/2 Person $125wk/up room rentals Studios $900/up 212-697-3 

To place an ad call 866-900-9473

HIGH SCHOOL DIPLOMA If youâ&#x20AC;&#x2122;re 18 or older you can complete your high school education at home right now in as few as 2 months

212-967-7010 469 7th Ave, 7th Floor (Btwn 35th & 36th Street) 27 new york Wednesday, June 11, 2014

28 32 Homeowners needed by May 15 extended to June 30th!

Psychics

3(%)+(3!,%% AFRICANMEDIUMCOM  -YSTICAL!FRICAN -EDIUM3PIRITUALIST SOLVESALLYOURISSUES

,OVESPECIALIST

REUNITELOVERS

BUSINESS JOB COURT

LUCK BLACKMAGIC

PROTECTION IMPOTENCY

IMMIGRATION ETC %NGLISHAND&RENCH 3PEAKING 15)#+2%35,43Ă?

#ALL4ODAY 3TART4OMORROW #USTOMER2ELATIONS2EP EARNHRAVG 0LUS"ONUS/PPORTUNITIES 3CHOLARSHIPDOLLARS 'REAT7ORK%NVIRONMENT )FYOUARE %NTHUSIASTIC $RIVENAND POSITIVE4HISIS 9OUR/PPORTUNITYTOSTART RIGHTAWAYĂ?Ă? 3TUDENTS WELCOME #ALL  

!0043ETTERS.EEDED 04 &4.OWHIRINGMAT

CAREERMINDEDINDIV WKLYPOT

*Licensed Real Estate Broker

www.diplomafromhome.com Benjamin Franklin High School

#ONCIERGE&RONT$ESK .EW/PENINGS -USTBE YRS /FFICER/RTIZ

Real Estate for Sale

AFFORDABLE 1ST HOMES III

6-8 weeks accredited Get a Diploma! Get a Job!

PSYCHICS

REAL ESTATE Real Estate for Sale

HIGH SCHOOL DIPLOMA FROM HOME

Many Job Openings Construction, Restaurants, Deli Cashiers, Domestics and more

(718) 478-5690 Fee

PSYCHICS

Accepted by NYS OfďŹ ce of Higher Ed Liberty H.S. Brattlelboro, Vt.

CUSTOMER SERVICE POSITIONS AVAILABLE NOW

â&#x20AC;˘ No exp. necessary â&#x20AC;˘ Great pay â&#x20AC;˘ Training provided â&#x20AC;˘ Close to public trans.

For an interview please call

917-310-2511

-2+(!,)&! ).4%2.!4)/.!, !&2)#!.30)2)45!, (%!,%2 #,!)26/9!.4 7ITHYEAR%XP(ELPING PEOPLEACROSSTHEWORLD 3OLVESALLPROBLEMS"AD INFLUENCE "LOCKAGE 5NK NOWN$ISEASE 5NHAPPY SITUATIONS 3EXUALPROBL EMS "AD,UCK"USINESS SUCCESS "LACK-AGIC

%XAMS #OURT#ASES 5N HAPPY-ARRIAGE2ELA TIONSHIP2ESULTSWITHIN NIGHTS#ALL OR 3%2)'.%    3PIRITUAL2EADER #OACHBRINGBACKLOVED /NE STOPPEDINFIDELITYIN 2ELATIONSHIP MARRIAGE

*OB SUCCESSINBUSINESS

#OURTCASE REMOVEDBAD ,UCK WITCHCRAFT BLACK MAGIC3TOPENEMY OFFERPROTECTION &!342%35,43 3PIRITUALRESTORECOM

My child is going to college at

Their tomorrow depends on your words today.

Help complete your childâ&#x20AC;&#x2122;s future by encouraging them to get a college degree. Call the Hispanic Scholarship Fund today at 1-877-HSF-INFO or visit YourWordsToday.org to learn more.

Furnished Rooms For Rent! Cable/Internet Ready! Move In Today! All utilities Inc. Starting Just $125/wk. Call Us Now:(212)368-2685

CLASSIFIEDS

To place an ad call 866-900-9473 or visit us at www.metro.us

.


www.metro.us

NO CONTRACTS â&#x20AC;¢ SPIN CLASSES â&#x20AC;¢ PERSONAL & GROUP TRAINING TONS OF WEIGHTS â&#x20AC;¢ MIND-BENDING YOGA â&#x20AC;¢ MILES OF CARDIO ALL IN ONE PLACE! Try us out with this 3-DAY PASS! 13 NYC AREA GYMS â&#x20AC;¢ CRUNCH.COM ([SLUHV*XHVWSDVVYDOLGIRUFRQVHFXWLYHGD\V0XVWEH¿UVWWLPHJXHVW\HDUVRUROGHURUDFFRPSDQLHGE\DQDGXOW 0XVWKDYHYDOLGORFDO,'2IIHUQRWDSSOLFDEOHDW&UXQFK(VVHQWLDO/RFDWLRQVÂ&#x2039;&581&+//&

28 new york Wednesday, June 11, 2014

A B I L I T I E S

20140611_us_new york  
Read more
Read more
Similar to
Popular now
Just for you