Page 1


YYYMWGPMGTFG YYYUKZDKFEQO 

$GVTCEJVGP5KGCWEJWPUGTG#WMVKQPUMCVCNQIGKO+PVGTPGV 7POKVVGNDCTPCEJFGT#WMVKQPMรŒPPGP5KGFKG'TIGDPKUUGCWHWPUGTGT *QOGRCIGGKPUGJGP  2NGCUGXKGYQWTCWEVKQPECVCNQIWGUCVYYYMWGPMGTEQO #NNCWEVKQPTGUWNVUYKNNDGCXCKNCDNGQPNKPGHQTXKGYKPICPFRTKPVKPI UJQTVN[CHVGTVJGCWEVKQP  8GWKNNG\ยพICNGOGPVEQPUWNVGTPQUECVCNQIWGUFGXGPVGFCPUNล‰+PVGTPGV UWTYYYMWGPMGTEQO.GURTKZTยพCNKUยพU[UGTQPVRWDNKยพUFKTGEVGOGPV CRTยฝUNCXGPVGCWZGPEJยฝTGU  5WNPQUVTQUKVQYYYMWGPMGTEQORQVGVGEQPUWNVCTGKPQUVTKECVCNQIJK GCEEGFGTGCNNyGNGPEQFGNNGCIIKWFKEC\KQPKGFGKNQVVKKPXGPFWVK.รƒ VTQXGTGVGCPEJGVWVVGNGKPHQTOC\KQPKUWNNGRTQUUKOGCUVG  2QFTยฑEQPUWNVCTPWGUVTQUECVยฑNQIQU[XGTGNGNGPEQFGNCU CFLWFKECEKQPGUQFGNQUNQVGUPQXGPFKFQUGPPWGUVTCRยฑIKPCYGD YYYMWGPMGTEQO  ะ’ั‹ ะผะพะถะตั‚ะต ะฟะพัะผะพั‚ั€ะตั‚ัŒ ะฝะฐัˆะธ ะฐัƒะบั†ะธะพะฝะฝั‹ะต ะบะฐั‚ะฐะปะพะณะธ ะฒ ะธะฝั‚ะตั€ะฝะตั‚ะต! ะ’ัะบะพั€ะต ะฟะพัะปะต ะพะบะพะฝั‡ะฐะฝะธั ะฐัƒะบั†ะธะพะฝะฐ ะผั‹ ะฟัƒะฑะปะธะบัƒะตะผ ั€ะตะทัƒะปัŒั‚ะฐั‚ั‹ ั‚ะพั€ะณะพะฒ ะฝะฐ ะฝะฐัˆะตะน ะธะฝั‚ะตั€ะฝะตั‚ ัั‚ั€ะฐะฝะธั†ะต.

6KVGNHQVQ 0T  

4755.#0&-#+5'44'+%* #NGZCPFGT+ )QNFOGFCKNNG\W&WMCVGPXQP*($TCPFV CWHFKG)TWPFUVGKPNGIWPIFGU5KGIGUFGPMOCNUCWHFGO -TGW\DGTIKP$GTNKPIGOGKPUCOOKV-รŒPKI(TKGFTKEJ 9KNJGNO+++XQP2TGWยญGPOOI &KCMQX.GJPGTV/CTKGPD FQTVKP5KNDGT 


164. AUKTION WORLD MONEY FAIR IN BERLIN SPITZENSTÜCKE DER RUSSISCHEN GELDGESCHICHTE

28. Januar 2010 Estrel Hotel Berlin, Sonnenallee 225, 12057 Berlin, Saal C Hotel-Telefon +49 (0)30-68 31 25 390 Hotel-Fax +49 (0)30-68 31 25 311 (nur während der Auktion/only during the auction/ uniquement pendant la vente/solamente durante l'asta/solamente durante la subasta/только во время аукциона)

ZEITPLAN AUKTIONEN 163 - 164 DONNERSTAG, DEN 28. JANUAR 2010 IM ESTREL HOTEL BERLIN SONNENALLEE 225 12057 BERLIN SAAL C

GOLD- UND SILBERMÜNZEN AUS MITTELALTER UND NEUZEIT

10.00 Uhr - 13.00 Uhr Nr. 1 bis Nr. 527 14.00 Uhr - 15.00 Uhr Nr. 528 bis Nr. 709

SPITZENSTÜCKE DER RUSSISCHEN GELDGESCHICHTE

Besichtigungen siehe Seite 5 Detailliertes Inhaltsverzeichnis siehe Seiten 6-9 Exposition des monnaies voir page 5 Sommaire détaillé voir pages 6-9

15.00 Uhr – 18.30 Uhr Nr. 1001 bis Nr. 1439

Viewing of auction good view page 5 Detailed table of contents view pages 6-9 Esposizione veda pagina 5 Indice dettagliato veda pagine 6-9


Sehr geehrte Kundin, sehr geehrter Kunde und Münzfreund, ich freue mich, daß Sie bereits heute, 4 Wochen vor unserer nächsten Auktion, die neuen Kataloge erhalten haben und wünsche Ihnen viel Freude bei der Lektüre unseres Auktionsangebotes. Wir wurden oft gebeten, den Ablauf einer Auktion etwas näher zu beschreiben, diesem Wunsch kommen wir gerne nach. Am Ende dieses Kataloges finden Sie die Rubrik: “Wie biete ich richtig“, die Ihnen als Ratgeber zur erfolgreichen Teilnahme an unseren Auktionen dienen soll. Sollten Sie darüber hinaus Fragen zum Auktionsablauf haben, helfen wir Ihnen auch gerne persönlich weiter. Die Mitarbeiterinnen unserer Kundenbetreuung stellen wir Ihnen auf der nächsten Seite vor. Mit herzlichen Grüßen aus Osnabrück

Ihr Fritz Rudolf Künker UNSERE ADRESSE OUR ADDRESS

Fritz Rudolf Künker GmbH & Co. KG Gutenbergstr. 23 · 49076 Osnabrück Ust.-Id.-Nr.: DE 256 270 181 Telefon/Phone: Fax: Gebührenfrei: E-Mail: Internet:

+49 (0)5 41-96 20 20 +49 (0)5 41-96 20 222 08 00-58 36 537 service@kuenker.de www.kuenker.de

Montag-Donnerstag Freitag Sonnabend

9.00 - 17.00 Uhr 9.00 - 15.30 Uhr nach Vereinbarung

Außerhalb unserer Geschäftszeit steht unseren Kunden ein automatischer Anrufbeantworter zur Verfügung. Monday-Thursday 9.00 a. m. to 5.00 p. m. Friday 9.00 a. m. to 3.30 p. m. Saturday by prior appointment Answering machine available after opening hours. WWW.KUENKER.DE WWW.KUENKER.COM

Auf unserer Internetseite haben Sie die Möglichkeit • die Abbildungen zu vergrößern • Ihre Gebote direkt abzugeben • die Ergebnisse der Auktionen abzurufen On our website you have the possibility • to zoom all images • to place your bids • to view all auction results

AUKTIONSHOTEL AUCTION LOCATION

Estrel Hotel Berlin, Sonnenallee 225, 12057 Berlin, Saal C Telefon/Phone: Fax:

2

+49 (0)30 68 31 25 390 +49 (0)30 68 31 25 311

Mitglied im Verband der Deutschen Münzenhändler e. V. Associaton Internationale des Numismates Professionnels (AINP)


UNSERE KUNDENBETREUUNG STEHT IHNEN GERNE ZUR VERFÜGUNG Die Maxime unseres Teams lautet: Nur wenn Sie als Kunde zufrieden sind, sind wir es auch! Geben Sie uns Ihre Auktionsgebote zu treuen Händen, wir sorgen dafür, daß sie korrekt ausgeführt werden. Auch wenn Sie sich von Teilen oder Ihrer gesamten Sammlung trennen möchten, sind wir Ihre ersten Ansprechpartner. Beachten Sie dazu bitte auch die Hinweise für Einlieferer auf der folgenden Seite bzw. im hinteren Teil des Kataloges.

WIR FREUEN UNS AUF IHRE AUKTIONSGEBOTE UND EINLIEFERUNGEN!

Ulrich Künker Leitung Kundenbetreuung ulrich.kuenker@kuenker.de

Alexandra Elflein English, Français, Italiano alexandra.elflein@kuenker.de

Anastasija Koepsell Russian, Deutsch anastasija.koepsell@kuenker.de

Barbara Westmeyer Deutschsprachige Kundenbetreuung barbara.westmeyer@kuenker.de

Marion Künker Deutsch, English marion.kuenker@kuenker.de

Dzmitry Nikulin Russian, Deutsch, English dzmitry.nikulin@kuenker.de

Nadine Zuber Deutsch, English nadine.zuber@kuenker.de

Cristina Welzel Italiano, Deutsch, English, Français cristina.welzel@kuenker.de

SO ERREICHEN SIE UNS GEBÜHRENFREI (AUS DEUTSCHLAND) TELEFON FAX INTERNET EMAIL

0800 / 5836537 (0800 / KUENKER) +49 (0) 541/ 96 20 20 +49 (0) 541/ 96 20 222 www.kuenker.de service@kuenker.de

WAS IST ZUR ERFOLGREICHEN AUKTIONSTEILNAHME BESONDERS WICHTIG? • • • • •

Ihr schriftlicher Auftrag sollte möglichst frühzeitig eintreffen, spätestens einen Tag vor der Auktion. Wenn Sie telefonisch an der Auktion teilnehmen möchten, bedarf das unserer vorherigen Genehmigung. Bitte teilen Sie uns diesen Wunsch daher mindestens 48 Stunden vor der Versteigerung mit. Nähere Informationen zum telefonischen Bieten finden Sie auf den folgenden Seiten. Beachten Sie bitte auch die Hinweise „Wie biete ich richtig“ im hinteren Teil des Kataloges. Gerne können Sie Ihre Gebote auch online abgeben. Unter www.kuenker.de bieten wir den gesamten Auktionskatalog online an. Bei Fragen rufen Sie uns an, unsere Kundenbetreuung freut sich auf Ihren Anruf! 3


WICHTIGE HINWEISE FÜR UNSERE EINLIEFERER 1.

Unser Expertenteam garantiert Ihnen eine fachgerechte Bearbeitung der von Ihnen eingelieferten Stücke. 2. Die Schätzpreise werden von uns aufgrund unserer hervorragenden Marktkenntnisse sorgfältig festgelegt. Die Stücke werden zu 80% der im Katalog angegebenen Schätzpreise ausgerufen. Durch diese Regelung werden Sie als Einlieferer geschützt. Für nicht verkaufte Objekte werden keine Gebühren erhoben. 3. Der Standard unserer Kataloge ist von hoher Qualität und findet internationale Anerkennung. Wir haben eine der besten Kundendateien, die es weltweit gibt. 4, Von der individuellen Betreuung unserer Kunden profitieren auch Sie als Einlieferer. 5. Als Einlieferer erhalten Sie Ihren Auktionserlös innerhalb von 45 Tagen nach der Auktion. Sonderregelungen sind nach Absprache möglich. 6. Auf Wunsch kann Ihre Einlieferung bei Ihnen zuhause abgeholt werden. Ab € 2.500,-- Einlieferungssumme übernehmen wir die Kosten, ab € 25.000,-können wir Ihre Einlieferungen unter Umständen und nach Absprache auch an einem vereinbarten Ort persönlich entgegennehmen. Selbstverständlich ist Ihr Versteigerungsgut durch uns versichert. 7. Nicht alle Münzen eignen sich, als Einzelstücke aufgenommen zu werden. Vertrauen Sie auf die Erfahrung unserer Experten, die niedrigpreisige Münzen liebevoll zu interessanten Lots zusammenstellen. 8. Der Schätzwert Ihrer Einlieferung sollte mindestens € 1.000,-- betragen. 9. Ihre Einlieferung wird Ihnen sofort bei Übernahme durch ein Protokoll quittiert. Spätestens fünf Wochen vor der Auktion erhalten Sie eine genaue Auflistung Ihrer Objekte mit den dazugehörenden Katalognummern. 10. Innerhalb einer Woche nach der Auktion erhalten Sie bereits die Ergebnisliste und können alle erzielten Preise feststellen. 11. Profitieren Sie von der Anziehungskraft eines führenden Unternehmens. Bitte wenden Sie sich bei Fragen an unseren Kundenservice unter 0541 – 96 20 20 oder gebührenfrei unter 0800 – 5 83 65 37. 12. Unsere Verträge für Einlieferungen können Sie unverbindlich anfordern. Haben Sie noch Fragen? Wir freuen uns auf Ihren Anruf. Telefon: 0541 – 96 20 20 oder gebührenfrei unter 0800 5 83 65 37.

RENSEIGNEMENTS IMPORTANTS A L'ATTENTION DES VENDEURS 1.

Notre équipe d’experts garantit une prise en charge compétente des pièces que vous nous confiez. 2. Notre excellente connaissance du marché nous permet de fixer soigneusement les prix estimés. Les pièces seront mises aux enchères à un prix représentant 80% du prix estimé indiqué dans le catalogue. Cette réglementation vous protège en tant que vendeur. Aucuns frais ne seront prélevés sur les pièces invendues. 3. Nos catalogues ont un niveau qualitatif élevé, reconnu au plan international. Nous disposons d’un des meilleurs fichiers clients du monde. 4. En tant que vendeur, vous profiterez vous aussi du suivi personnalisé que nous offrons à nos clients. 5. Le vendeur recevra le produit de la vente dans les 45 jours qui suivront les enchères. Des dispositions spéciales pourront être prises sur accord préalable. 6. Nous prendrons en charge les frais d´expédition des pièces dont le montant sera supérieur à € 2.500,--: Si leur montant est supérieur à € 25.000,--, l´un de nos employés pourra se charger de prendre la livraison à un lieu convenu. A votre demande notre assurance couvrira tous les risques. 7. Les pièces de monnaie ne se prêtent pas toutes à une vente individuelle. Faites confiance à l’expérience de nos spécialistes qui se chargeront avec plaisir de rassembler les pièces bon marché de manière à constituer des lots intéressants. 8. La valeur estimée des pièces fournies devra s’élever à un minimum de € 1.000,--. 9. Au moment de la prise en charge, vous recevrez un détail des pièces fournies. Au plus tard cinq semaines avant la vente aux enchères, vous recevrez une liste exacte de vos pièces avec les numéros de catalogue correspondants. 10. Dans la semaine qui suivra la vente aux enchères, vous recevrez déjà la liste de ses résultats et pourrez prendre connaissance des prix obtenus. 11. Profitez de l’attrait du leader du marché. Pour tout renseignement, veuillez-vous adresser à notre service clientèle: +49 (0)5 41-96 20 20. 12. Vous pouvez demander sans engagement de votre part nos contrats de dépôt de pièces? Vous avez d’autres questions? Nous serons heureux de vous répondre au +49 (0)5 41-96 20 20.

4

IMPORTANT INFORMATION FOR OUR CONSIGNERS 1.

Our team of specialists guarantees an expert treatment of the consigned items. 2. The estimates are carefully established by us due to our excellent knowledge of the market. Bidding for the items is then started at 80 % of the estimate price stated in the catalogue. This arrangement protects you as a consigner. Unsold items incur no fees. 3. The standard offered in our catalogue is of the highest quality, and is recognised internationally. We have one of the best clientele lists worldwide. 4. You as a consigner also profit from the individual consultation offered to our customers. 5. As a consigner, you receive the auction proceeds within 45 days of the close of auction. Special arrangements can be made following discussion. 6. For consignments with a value over € 2.500,-- we may bear the transportation costs. For deliveries over € 25.000,-- we may personally collect the items at an arranged place after prior consultation. Upon consultation, the shipping of your goods could be covered by our insurance. 7. Not all coins are suited to be registered as individual items. Trust in our expert´s experience as they carefully combine less-valuable coins into interesting lots. 8. The valuation price of your delivery should be at least € 1.000,--. 9. Your delivery is confirmed in writing immediately on receipt. At least five weeks before the auction, you receive an exact list of your objects with the relevant catalogue numbers. 10. Within a week of the close of auction, you receive a list with the results in order to see what prices were reached for each individual lot. 11. Profit from our position as a leading coin dealer. If you have any questions, please contact our customer service team on +49 (0)541 – 96 20 20. 12. Would you like to receive copies of our contracts for consigner, without making any commitment? Do you have any other questions? Our customer service team will be pleased to help you – please call on +49 (0)541 – 96 20 20.

INFORMAZIONI PER I NOSTRI DEPOSITANTI 1.

Il nostro team di esperti assicura un trattamento accurato dei pezzi che ci avete inviato. 2. Eseguiamo valutazioni finalizzate alla vendita. I prezzi di stima sono frutto della nostra eccezionale conoscenza del mercato e della nostra attenta valutazione. La base d´asta ammonta all´80% del prezzo di stima indicato sul catalogo. Non si addebitano spese per gli oggetti invenduti. 3. I nostri cataloghi sono di alta qualità e sono riconosciuti a livello internazionale. I nostri clienti sono fra i migliori al mondo. 4. Come depositanti potete beneficiare dell’assistenza riservata a ciascuno dei nostri clienti. 5. Come depositanti riceverete gli importi realizzati all’asta entro 45 giorni dal termine della stessa. Si possono concordare condizioni particolari. 6. A partire da un controvalore degli oggetti di € 2.500,--i costi del trasporto sono a nostro carico, mentre a partire da un controvalore di € 25.000 gli oggetti possono essere ritirati personalmente da un nostro incaricato ad un posto concordato. Naturalmente il trasporto dei vostri oggetti puó essere assicurato tramite la nostra assicurazione. 7. Non tutte le monete possono essere negoziate singolarmente. Fidatevi dell´esperienza dei nostri esperti, che raggruppano le monete non molto preziose in lotti di sicuro interesse. 8. Il valore stimato degli oggetti depositati deve ammontare ad almeno € 1.000,--. 9. Nel momento in cui gli oggetti sono presi in consegna, viene rilasciata una ricevuta numerata. Riceverete un elenco preciso degli oggetti che avete depositato con i relativi numeri di catalogo al massimo cinque settimane prima dell’asta. 10. Riceverete l’elenco degli oggetti aggiudicati entro una settimana dalla chiusura dell’asta. Potrete cosi verificare i prezzi realizzati. 11. Approfittate della capacità di un leader di mercato per aumentare il valore dei vostri oggetti. Se avete delle domande, rimaniamo a vostra disposizione per qualsiasi necessità. Rivolgetevi alla nostra consulenza ai clienti diretta al numero +49 (0)541-91 20 20. 12. Volete ricevere i nostri contratti senza impegno? Avete altre domande? Potete contattarci al numero +49 (0)541-96 20 20.


BESICHTIGUNG Besichtigung des Auktionsgutes in unseren Geschäftsräumen, Gutenbergstr. 23, 49076 Osnabrück, vom 04.01.2010 bis zum 22.01.2010, nach vorheriger telefonischer Vereinbarung unter +49 (0)5 41 96 20 20. Am Montag, den 25.01.2010 kann das Auktionsgut in unserem Büro im Kunsthaus Lempertz (Nikolaiviertel), Poststr. 22 in Berlin-Mitte, von 13.00 Uhr bis 18.00 Uhr und am Dienstag, den 26.01.2010 von 10.00 Uhr bis 18.00 Uhr besichtigt werden. Am Mittwoch, den 27.01.2010 findet die Besichtigung im Estrel Hotel Berlin, Sonnenallee 225, 12057 Berlin, Saal C, von 11.00 Uhr bis 18.00 Uhr statt. Eine Besichtigung am Auktionstag ist nicht möglich.

EXPOSITION Les monnaies seront visibles à Osnabrück, du 04 au 22 janvier 2010, Gutenbergstr. 23, 49076 Osnabrück sur rendez-vous téléphonique: +49 541 96 20 20. L’exposition à Berlin aura lieu dans notre bureau, Poststr. 22, 10178 Berlin (Kunsthaus Lempertz), lundi le 25 janvier 2010 de 13 h 00 à 18 h 00 jusqu’à mardi, le 26 janvier 2010 de 10 h 00 à 18 h 00. Mercredi le 27 janvier 2010 les monnaies seront visibles à l’Hôtel Estrel, Sonnenallee 225, 12057 Berlin, Salle C de 11 h 00 à 18 h 00. L’exposition n’aura pas lieu pendant la vente aux enchères.

EXPOSICIÓN

ON VIEW The coins are on view at our premises in 49076 Osnabrueck, Gutenbergstr. 23, January 04 – 22, 2010 by prior appointment. Please call +49 541 96 20 20. Viewing in Berlin is possible at our premises in BerlinMitte, Poststr. 22 (Kunsthaus Lempertz) on Monday, January 25, 2010 from 1.00 p. m. to 6.00 p. m. and on Tuesday, January 26, 2010 from 10.00 a. m. to 6.00 p. m. On Wednesday, January 27, 2010 viewing takes place at the Hotel Estrel, Sonnenallee 225, 12057 Berlin, Hall C, 11.00 a. m. to 6.00 p. m. Viewing is not possible on the day of auction.

ESPOSIZIONE I lotti dell´asta sono visionabili dal 04 gennaio 2010 al 22 gennaio 2010 presso la nostra sede, Gutenbergstr. 23, 49076 Osnabrück previo appuntamento telefonico +49 541 96 20 20. A partire da lunedí, 25 gennaio 2010 i lotti sono visionabili presso il nostro ufficio A Berlino, Poststr. 22 (presso Kunsthaus Lempertz) dalle ore 13:00 alle ore 18:00 e martedì, 26 gennaio 2010 dalle ore 10:00 alle ore 18:00. Mercoledì, 27 gennaio 2010 i lotti sono visionabili presso l’Hotel Estrel, Sonnenallee 225, 12057 Berlino, sala C, dalle ore 11:00 alle ore 18:00. Non è possibile visionare i lotti il giorno dell’asta.

ПРОСМОТР АУКЦИОННЫХ ЛОТОВ

Con cita previa +49 541 96 20 20 podrá ver todos los lotes entre el 04 de enero 2010 y el 22 de enero 2010 en nuestras oficinas en 49076 Osnabrück, Gutenbergstr. 23.

С 04.01.2010 по 22.01.2010 просмотр аукционных лотов проходит в нашем офисе по телефонной договоренности +49 541 96 20 20 по адресу: Gutenbergstr. 23, 49076 Osnabrück.

A partir de lunes, 25 de enero 2010, podrá ver todos los lotes en nuestras oficinas en Berlin, Poststr. 22 (Kunsthaus Lempertz) de 13 a 18 y el martes, 26 de enero 2010 de 10 a 18.

25.01.2010 и 26.01.2010 просмотр аукционных лотов проходит в нашем представительстве в Берлине по адресу: 10178 Berlin, Poststr. 22 (Kunsthaus Lempertz), в понедельник 25.01.2010 с 13.00 до 18.00, во вторник 26.01.2010 с 10.00 до 18.00.

El miercoles, 27 de enero 2010 podrá ver los lotes en el Hotel Estrel, Sonnenalle 225, en 12057 Berlin, Salón C, de 11 a 18. El día de la subasta no es posible ver los lotes.

27.01.2010 просмотр состоится в гостинице Estrel Hotel Berlin по адресу: Sonnenallee 225, 12057 Berlin, зал С с 11.00 до 18.00. В день проведения аукциона просмотр не состоится.

5


INHALT AUKTION 164 Nr. RUSSISCHE MÜNZEN UND MEDAILLEN

1001

-

1439

11

-

117

Kaiserreich

1001

-

1427

11

-

110

Großfürst Wasili III. Wasiliewitsch, 1425 - 1462 Eine silberne Suitenmedaille des Großfürsten Wasili III. Wasiliewitsch

6

Seite

-

1001

11

1001

11

1014

11

-

Zar Alexei Michailowitsch, 1645-1676 Ein Novodel des Rubels von Zar Alexei Michailowitsch Russische Gegenstempel von 1655 (Jefimiki) auf europäischen Talern

1002

1003

-

1014

11

-

14

Zar Peter I., der Große, 1682-1725 Ein goldenes 2 Rubel-Stück des Zaren Peter I. Silbermünzen des Moskauer Münzhofes Kadashevsky Silbermünzen des Roten Münzhofes in Moskau Zwei Sonnenrubel der Münzstätte St. Petersburg Ein Ku.-5 Kopeken Stück des Moskauer Münzhofes Naberezhny Kupfermünzen des Moskauer Münzhofes Kadashevsky Ein Tympf von 1707 Medaillen des Zaren Peter I.

1015

-

1073

14

-

31

1002

14 11

1015

31

1016

-

1027

15

-

17

1028

-

1048

18

-

21

1049

-

1050

21

-

22

1051

22

22

-

22 22 31

31

-

33

1052

-

1056

-

1054 1055 1073

Zarin Katharina I., 1725-1727 Ein goldenes 2 Rubel-Stück der Zarin Katharina I. Silbermünzen des Roten Münzhofes in Moskau Silbermünzen der Münzstätte St. Petersburg Eine Probprägung aus St. Peterburg

1074

-

1084

Zar Peter II., 1727-1730 Ein Dukat des Zaren Peter II. Silbermünzen des Roten Münzhofes ins Moskau Silbermünzen des Moskauer Münzhofes Kadashevsky Silbermünzen der Münzstätte St. Petersburg Eine Ku.-Kopeke des Moskauer Münzhofes Kadashevsky

1074

31

1075

-

1076

31

-

32

1077

-

1083 1084

32

-

33 33

1085

-

1094 1085

34

-

36 34

1086

-

1087

1088

-

1091

34

-

35

1092

-

1093

35

-

36

1094

34

36


Nr. Zarin Anna, 1730-1740 Silbermünzen des Moskauer Münzhofes Kadashevsky Silbermünzen des Roten Münzhofes in Moskau Silbermünzen der Münzstätte St. Petersburg Eine Probeprägung für einen Rubel 1730 des Moskauer Münzhofes Kadashevsky

Seite

1095

-

1110

36

-

39

1095

-

1105

36

-

38

1107

-

38

1109

38

1110

39

1113

40

1111

40 40

Zar Ivan III., 1740-1741 Ein 10 Kopeken-Stück des Roten Münzhofes Moskau Silbermünzen der Münzstätte St. Petersburg

1111

1112

-

1113

Zarin Elisabeth, 1741-1761 Zwei Goldmünzen des Roten Münzhofes in Moskau Drei Goldmünzen der Münzstätte St. Petersburg Silbermünzen des Roten Münzhofes in Moskau Silbermünzen der Münzstätte St. Petersburg Zwei Prägungen für Livland und Estland Prägungen für Ostpreußen Zwei Medaillen der Zarin Elisabeth

1114

-

1151

1114

-

1115

1116

-

1118

41

-

42

1119

-

1127

42

-

43

1128 1144 1146 1150

-

1143 1145 1149 1151

44

-

47 47 48 48

1152

-

1158

49

-

51

1152

-

1153

49

1154

50

Zar Peter III., 1762 Zwei Goldmünzen der Münzstätte St. Petersburg Ein silberner Rubel des Roten Münzhofes in Moskau Silbermünzen der Münzstätte St. Petersburg Zarin Katharina II., 1762-1796 Goldmünzen der Münzstätte St. Petersburg Silbermünzen des Roten Münzhofes in Moskau Silbermünzen der Münzstätte St. Petersburg Ein überprägtes Ku.-4 Kopeken-Stück von 1796 Eine Probeprägung für ein 20 Kopeken-Stück 1763 der Münzstätte St. Petersburg Prägungen für Sibirien Silbermünzen der Münzstätte Feodosia Ku. 5 Kopeken-Stücke der schwedischen Münzstätte Avesta Medaillen der Zarin Katharina II.

-

1106

41

-

48 41

1155

-

1158

50

-

51

1159

-

1210

52

-

64

1159

-

1172

52

-

55

1173

-

1176

55

-

56

1177

-

1195

56

-

59

-

59

60

-

60 61 61

63

-

1196

1198 1200

-

1197 1199 1201

1202 1204

-

1203 1210

62 64 7


Nr. Zar Paul I., 1796-1801 Ein 5 Rubel-Stück der Münzstätte St. Petersburg Silbermünzen der Münzstätte St. Petersburg Eine Medaille des Zaren Paul I. Zar Alexander I., 1801-1825 Zwei Goldmünzen des Zaren Alexander I. Silbermünzen der Münzstätte St. Petersburg Kupfermünzen der Münzstätte Suzun Kupfermünzen der Münzstätte Ekaterinburg Prägungen für Polen Medaillen des Zaren Alexander I. Zar Nikolaus I., 1825-1855 Goldmünzen des Zaren Nikolaus I. Platinmünzen des Zaren Nikolaus I. Silbermünzen der Münzstätte St. Petersburg Eine Poltina der Münzstätte Warschau Kupfermünzen der Münzstätte Ekaterinburg Eine Ku.-1/4 Kopeke der Münzstätte Izhora Kupfermünzen der Münzstätte Warschau Gedenkmünzen des Zaren Nikolaus I. Kupfermünzen der Münzstätte St. Petersburg Prägungen für Polen Zwei Medaillen des Zaren Nikolaus I. Zar Alexander II., 1855-1881 Goldmünzen des Zaren Alexander II. Silbermünzen der Münzstätte St. Petersburg Kupfermünzen der Münzstätte Ekaterinburg Kupfermünzen der Münzstätte St. Petersburg Eine Gedenkmünze des Zaren Alexander II. Medaillen des Zaren Alexander II. Zar Alexander III., 1881-1894 Goldmünzen des Zaren Alexander III. Silbermünzen der Münzstätte St. Petersburg Kupfermünzen der Münzstätte St. Petersburg Medaillen des Zaren Alexander III. 8

1211

-

Seite 1220

65

-

1211

67 65

1212

-

1219 1220

65

-

67 67

1221 1221

-

1252 1222

67

-

75 67

1223 1235

-

1234 1237

68

-

69 70

1238 1240 1244

-

1239 1243 1252

1253 1253 1265

-

1270

70 71 75

72

-

1310 1264 1269

76 76

-

87 77 78

-

1283 1284

79

-

81 81

1285

-

1288

81

-

82

1290 1293

-

1289 1292 1298

83

-

82 82 84

1299 1304 1309

-

1303 1308 1310

84 86

-

85 87 87

1311 1311

-

1336 1314

88

-

93 88

1315

-

1324

89

-

91

1325

-

1330

91

-

92

1331

-

1333

92

1335

-

1334 1336

92 93

1337 1337

-

1356 1340

94

-

98 94

1341

-

1348

94

-

96

1349 1352

-

1351 1356

96

-

96 98


Nr. Zar Nikolaus II., 1894-1917 Goldmünzen des Zaren Nikolaus II. Silbermünzen der Münzstätte St. Petersburg Ein 50 Kopeken-Stück der Münzstätte Paris Ein Rubel der Münzstätte Brüssel Kupfermünzen der Münzstätte St. Petersburg Ein halber Imperial von 1895 Gedenkmünzen des Zaren Nikolaus II. Probeprägung der Münzstätte Berlin Verdienstmedaillen des Zaren Nikolaus II. Medaillen des Zaren Nikolaus II.

Seite

1357 1357

-

1427 1366

98 98

-

110 99

1367

-

1394

99

-

103

1395 1396 1397

-

1411 1416 1423 1425

-

Eine russische Imitation eines niederländischen Dukaten von 1818

1409 1410 1415 1422 1424 1427

104 104 104

-

106 107

-

109

-

1428

105 106 107 109 109 110 110

Sowjetunion, 1917-1991

1429

-

1435

111

-

112

Russisches Republik seit 1992

1436

-

1437

112

Ein Lot russischer Münzen

1438

112

Eine Sammlung von Briefmarkengeld

1439

,

113

-

117

Ein Stichwortverzeichnis finden Sie am Ende des Auktionskataloges 163.

9


WICHTIGE HINWEISE FÜR UNSERE TELEFONBIETER

IMPORTANT INFORMATION ON TELEPHONE BIDDING

Wenn Sie telefonisch mitbieten möchten, bitten wir Sie aus organisatorischen Gründen, uns diesen Wunsch bis spätestens 48 Stunden vor der Versteigerung schriftlich mitzuteilen. Voraussetzung für ein telefonisches Mitbieten ist, daß Sie mindestens den Schätzpreis bieten. Telefonisches Bieten ist erst ab einem Schätzpreis von ca. 500 Euro pro Los möglich.

If you wish to participate in the auction as a telephone bidder, please inform us at least 48 hours in advance as we have to approve and schedule all calls. To register for telephone bidding, we require that you submit at least the estimate as written bid in addition to being called. Telephone bidding is accepted on lot numbers with estimates starting at 500 Euro.

Bitte beachten Sie, daß wir keinerlei Haftung übernehmen, falls die telefonische Verbindung während der Auktion nicht zustande kommt.

We do not assume liability should the telephone line be interrupted or not be achieved.

Sollten Sie Fragen zu der telefonischen Teilnahme an unseren Auktionen haben, können Sie uns vor der Auktion unter +49 (0)5 41-96 20 20 oder 08 00-58 36 537 (gebührenfrei) anrufen. Während der Auktion erreichen Sie uns unter der auf der ersten Seite angegebenen Telefonnummer.

INFORMATIONS POUR LA PARTICIPATION PAR TELEPHONE

Please call +49 (0)5 41-96 20 20 for more information or to register for telephone bidding. During the auction you will be able to reach us at the telephone number indicated on page 1.

INFORMAZIONI PER LA PARTECIPAZIONE TELEFONICA

Si vous désirez participer par téléphone à nos ventes aux enchères, veuillez vous mettre en relation avec Alexandra Elflein au moins 48 heures avant la vente au numéro +49 (0)5 41-96 20 233. Pendant la vente aux enchères nous vous prions d'appeler le numéro indiqué sur page no. 1 de ce catalogue.

Se desiderate la partecipazione telefonica in diretta durante l´asta, siete pregati di chiamare la Signora Cristina Welzel al numero diretto +49 (0)5 41-96 20 250 come minimo 48 ore prima dell´asta e di inviarci la vostra offerta, la quale deve ammontare come minimo al prezzo di stima anche per iscritto.

Une participation téléphonique à la vente sera possible à la condition que vous nous fassiez parvenir aussi votre ordre par écrit. Cet ordre devra être au moins égal au minimum au prix d’estimation et concerner un lot estimé au moins 500 Euros.

Accettiamo una partecipazione telefonica in diretta durante l´asta per oggetti il cui prezzo di stima ammonta come minimo ai 500 Euro. Non assumeremo nessuna responsabilità se la linea telefonica è occupata o se non siete raggiungibili.

Nous déclinons toute responsabilité dans le cas où la communication téléphonique serait interrompue, ou bien ne pourrait être établie.

INFORMACIONES DE COMO PARTICIPAR POR TELÉFONO Si quiere participar por teléfono en la subasta por favor se ponga en contacto anteriormente con la señora Cristina Welzel +49 (0)5 41-96 20 250 y envienos las pujas tambien por escrito por lo menos 48 oras antes de la subasta. Autorizamos una participación por teléfono solamente para lotes cuyos precio de estima es por lo menos 500 Euro. No asumimos la responsabilidad si la conexión telefónica se interumpa sin previsión o si está comunicando.

10

ВАЖНАЯ ИНФОРМАЦИЯ ДЛЯ УЧАСТИЯ ПО ТЕЛЕФОНУ Для участия в торгах по телефону просим Вас связаться с нами не позднее 48 часов до начала аукциона. Условием проведения телефонных торгов является письменное подтверждение ставки, равной как минимум стартовой цене. Участие в телефонных торгах возможно только для лотов со стартовой ценой свыше 500 евро. Для получения дополнительной информации и регистрации на аукционе звоните Анастасии Кепселль до аукциона по телефону +49 (0)5 41-96 20 268 и во время аукциона по телефону, указанному на первой странице каталога.


ALEXEI MICHAILOWITSCH

4755+5%*'/ª0<'070&/'&#+..'0

1001

)4155(ª4569#5+.++++9#5+.+'9+65%* 'KPGUKNDGTPG5WKVGPOGFCKNNGFGU)TQ­HÒTUVGP9CUKNK+++9CUKNKGYKVUEJ 

5KNDGTPG5WKVGPOGFCKNNGQ, ,CJTJWPFGTV XQP,)9CGEJVGT)GJCTPKUEJVGU$TWUVDKNFHCUVXX -TQPG ÒDGT UKGDGP <GKNGP 5EJTKHV FCTWPVGT 5GTKGPPWOOGT   OO  I &KCMQX    445GJTUEJÌPpXQT\ÒINKEJ 

1002

<#4#.':'+/+%*#+.19+65%* 'KP0QXQFGNFGU4WDGNUXQP<CT#NGZGK/KEJCKNQYKVUEJ 

4WDGN0QXQFGNI-CKO

4*ÒDUEJG2CVKPCXQT\ÒINKEJ



1003

4WUUKUEJG)GIGPUVGORGNXQP ,GHKOKMK CWHGWTQR·KUEJGP6CNGTP 

,GHKOQM  ÒDGTRT·IV CWH GKPGO 4GKEJUVCNGT  XQP $TCWPUEJYGKI9QNHGPDÒVVGN ,WNKWU    /ÒP\UV·VVG)QUNCT.KEJVVCNGTI/KV\YGK)GIGPUVGORGNPCWHFGT8QTFGTUGKVG 5V)GQTI KO-CORHOKVFGO&TCEJGP ,CJTGU\CJN&CXp \W 9GNVGTp \W  445GJTUEJÌP  'ZGORNCTFGT#WMVKQP)QTP[/QUEJ/ÒPEJGP0T   ,GHKOQM 2NWTCN ,GHKOKMK  YCT FGT CWU FGT RQNPKUEJGP 5RTCEJG ,QCEJKOKM  CDIGNGKVGVG TWUUKUEJG #WUFTWEM HÒT   6CNGT &GT 0COG UVCOOV XQP FGP )WNFGPITQUEJGP FKG FKG )TCHGP XQP 5EJNKEM KP FGT DÌJOKUEJGP $GTIUVCFV 5V   ,QCEJKOUVCN JGTIGUVGNNV JCVVGP /CP XGTYGPFGVG KP FGP DGKFGP UNCYKUEJGP 5RTCEJGP CNUQ FGP GTUVGP 6GKN FGT   WTURTÒPINKEJGP0QOKPCNDG\GKEJPWPI,QCEJKOUVCNGTY·JTGPFKO&GWVUEJGPWPF'PINKUEJGP 6CNGT&QNNCT FGT \YGKVG6GKNIGY·JNVYWTFG+O,CJTYWTFGPKP4W­NCPFXGTUEJKGFGPGXQTCNNGOFGWVUEJGWPFPKGFGTN·PFKUEJG 6CNGT OKV GKPGO )GIGPUVGORGN XGTUGJGP &KGUG 5VÒEMG YWTFGP ,GHKOQM U RTK\PCMQO IG\GKEJPGVGT ,GHKOQM  QFGT   GKPHCEJ MWT\ ,GHKOQM IGPCPPV &KG IGIGPIGUVGORGNVGP 6CNGT MQPPVGP UKEJ LGFQEJ PKEJV KO <CJNWPIUXGTMGJT   FWTEJUGV\GPWPFYWTFGPHÒTWPIÒNVKIGTMN·TV&CFKGOGKUVGP5VÒEMGYQJNGKPIGUEJOQN\GPYWTFGPUKPF,GHKOKMK JGWVGTGEJVUGNVGPWPF\·JNGP\WFGPDGIGJTVGUVGP/ÒP\GP4W­NCPFU

11


ALEXEI MICHAILOWITSCH

1004



1005

1006

,GHKOQM  ÒDGTRT·IV CWH GKPGO 4GKEJUVCNGT  XQP $TCWPUEJYGKI.ÒPGDWTI%GNNG %JTKUVKCP   $KUEJQHXQP/KPFGP/ÒP\UV·VVG#PFTGCUDGTI#WUDGWVGI/KV\YGK)GIGPUVGORGNP CWH FGT 4ÒEMUGKVG   5V )GQTI KO -CORH OKV FGO &TCEJGP   ,CJTGU\CJN  &CX p \W     /ÒUGNGTp \WE 9GNVGTp \W  45GJTUEJÌP  'ZGORNCTFGT5COONWPI#NDGTV-TWUG#WMVKQP)QTP[/QUEJ/ÒPEJGP0T



,GHKOQM  ÒDGTRT·IV CWHGKPGO4GKEJUVCNGT!XQP /CPUHGNF8QTFGTQTVKUEJG.KPKG*Q[GT8+ )GDJCTF 8++ #NDTGEJV 8++ WPF 2JKNKRR ++   I /KV \YGK )GIGPUVGORGNP CWH FGT   4ÒEMUGKVG 5V)GQTIKO-CORHOKVFGO&TCEJGP ,CJTGU\CJN&CXp \W 6QTPCWp \W HH  5GJTUEJÌP  'ZGORNCTFGT5COONWPI9KNN[(WEJU#WMVKQP5QVJGD[ U.QPFQP0T



,GHKOQMÒDGTRT·IVCWHGKPGO4GKEJUVCNGTXQP/CPUHGNF(TKGFGDWTI2GVGT'TPUV+$TWPQ ++9KNJGNO+WPF,QJCPP)GQTI+8/ÒP\UV·VVG'KUNGDGPI/KV\YGK)GIGPUVGO RGNPCWHFGT4ÒEMUGKVG 5V)GQTIKO-CORHOKVFGO&TCEJGP ,CJTGU\CJN&CXp \W  6QTPCWp \WI  5GJTUEJÌP  'ZGORNCTFGT5COONWPI9KNN[(WEJUWPFFGT#WMVKQP)QTP[/QUEJ/ÒPEJGP0T

1007



,GHKOQMÒDGTRT·IVCWHGKPGO4GKEJUVCNGTXQP 5CEJUGP%JTKUVKCP++,QJCPP)GQTI+WPF #WIWUV  /ÒP\UV·VVG &TGUFGP  I /KV \YGK )GIGPUVGORGNP CWH FGT 8QTFGTUGKVG    5V)GQTIKO-CORHOKVFGO&TCEJGP ,CJTGU\CJN&CXp \W 5EJPGGp \W   5GJTUEJÌP  'ZGORNCTFGT5COONWPI#NDGTV-TWUG#WMVKQP)QTP[/QUEJ/ÒPEJGP0T

12


ALEXEI MICHAILOWITSCH

1008



,GHKOQMÒDGTRT·IVCWHGKPGO4GKEJUVCNGTQ,FGU4ÌOKUEJ&GWVUEJGP4GKEJGU'T\JGT\QI(GT FKPCPF/ÒP\UV·VVG'PUKUJGKOI/KV\YGK)GIGPUVGORGNPCWHFGT8QTFGTUGKVG 5V )GQTIKO-CORHOKVFGO&TCEJGP ,CJTGU\CJN&CXp \WXCT 8QINJp \WXCT  45GJTUEJÌP



'ZGORNCTFGT5COONWPI#PVQPKP2TQMQR6GKN#WMVKQP#WTGC0WOKUOCVKMC2TCI0T

1009



1010

1011

,GHKOQM  ÒDGTRT·IV CWH GKPGO 4GKEJUVCNGT  FGU 4ÌOKUEJ&GWVUEJGP4GKEJGU (GTFKPCPF ++    /ÒP\UV·VVG -WVVGPDGTI  I /KV \YGK )GIGPUVGORGNP CWH FGT 4ÒEMUGKVG     5V )GQTI KO -CORH OKV FGO &TCEJGP   ,CJTGU\CJN  &CX p \W   &KGVKMGT p \W     8QINJp \W  5GJTUEJÌP  'ZGORNCTFGT5COONWPI#NDGTV-TWUG#WMVKQP)QTP[/QUEJ/ÒPEJGP0T



,GHKOQMÒDGTRT·IVCWHGKPGO6CNGTXQP 5CN\DWTI2CTKUXQP.QFTQPI /KV \YGK )GIGPUVGORGNP CWH FGT 4ÒEMUGKVG   5V )GQTI KO -CORH OKV FGO &TCEJGP   ,CJTGU\CJN   &CXp \W 2TQDU\Vp \W  -QTTQUKQPUURWTGPUGJTUEJÌP  'ZGORNCTFGT5COONWPI#PVQPKP2TQMQR6GKN#WMVKQP#WTGC0WOKUOCVKMC2TCI0T



,GHKOQM  ÒDGTRT·IV CWH GKPGO 2CVCIQP  XQP $TCDCPV 2JKNKRR +8  /ÒP\UV·VVG   #PVYGTRGPI/KV\YGK)GIGPUVGORGNPCWHFGT4ÒEMUGKVG 5V)GQTIKO-CORHOKVFGO&TC EJGP ,CJTGU\CJN&CXp \W &GNOp \W  45GJTUEJÌP



'ZGORNCTFGT#WMVKQP(TKV\4WFQNH-ÒPMGT1UPCDTÒEM0T

13


PETER I.





1014

1013

1012

,GHKOQM  ÒDGTRT·IV CWH GKPGO 2CVCIQP  XQP $TCDCPV 2JKNKRR +8  /ÒP\UV·VVG   $TÒUUGNI/KV\YGK)GIGPUVGORGNPCWHFGT4ÒEMUGKVG 5V)GQTIKO-CORHOKVFGO&TCEJGP  ,CJTGU\CJN&CXp \W &GNOp \W  5GJTUEJÌP



,GHKOQM  ÒDGTRT·IV CWH GKPGO 2CVCIQP  XQP $TCDCPV 2JKNKRR +8  /ÒP\UV·VVG   $TÒUUGNI/KV\YGK)GIGPUVGORGNPCWHFGT4ÒEMUGKVG 5V)GQTIKO-CORHOKVFGO&TCEJGP  ,CJTGU\CJN&CXp \W &GNOp \W  5GJTUEJÌP



'ZGORNCTFGT#WMVKQP)QTP[/QUEJ/ÒPEJGP0T



,GHKOQM  ÒDGTRT·IV CWH GKPGO 4GKEJUVCNGT  FGT 5VCFV %CORGP OKV 6KVGN (GTFKPCPFU +++    I /KV \YGK )GIGPUVGORGNP CWH FGT 8QTFGTUGKVG   5V )GQTI KO -CORH OKV FGO &TCEJGP    ,CJTGU\CJN&CXp \W &GNOp \W  5GJTUEJÌP  'ZGORNCTFGT5COONWPI#NDGTV-TWUG#WMVKQP)QTP[/QUEJ/ÒPEJGP0T

1015

2:1

2:1

<#42'6'4+&'4)4155' 'KPIQNFGPGU4WDGN5VÒEMFGU<CTGP2GVGT+ 

14

4WDGN/QUMCW4QVGT/ÒP\JQHI)GJCTPKUEJVGU$TWUVDKNFTOKV.QTDGGTMTCP\WPFWO IGNGIVGO/CPVGN5V#PFTGCUOKV*GKNKIGPUEJGKPUVGJVXXCWH5QEMGNFCU-TGW\JKPVGTUKEJJCNVGPF $KVMKP 4 &KCMQXXCT(D )1.&4(CUVXQT\ÒINKEJGU'ZGORNCT 


PETER I.

1016

5KNDGTOÒP\GPFGU/QUMCWGT/ÒP\JQHGU-CFCUJGXUM[ 

4WDGN  M[TKNNKUEJ  /QUMCW /ÒP\JQH -CFCUJGXUM[  I )GJCTPKUEJVGU $TWUVDKNF T)G   MTÌPVGT&QRRGNCFNGTOKV<GRVGTWPF4GKEJUCRHGNKPFGP(·PIGPWPVGP\WFGP5GKVGPFGT5EJYCP\HGFGTP FCU /ÒP\UV·VVGP\GKEJGP /  # QDGP -TQPG 8CTKCPVG OKV URKGIGNXGTMGJTVGT NGV\VGT <KHHGT FGT M[TKNNK   UEJGP,CJTGU\CJN$KVMKP 4 &CX&KCMQX  8QPITQ­GT5GNVGPJGKV(GKPG2CVKPCCVVTCMVKXGUUGJTUEJÌPGU'ZGORNCT  /KV'ZRGTVKUGFGU5VCCVNKEJGP*KUVQTKUEJGP/WUGWOUKP/QUMCW &CUXQTNKGIGPFG5VÒEMKUVYCJTUEJGKPNKEJCWHGKPGOURCPKUEJGP6CNGTÒDGTRT·IVYQTFGP



1017

1017 1,5:1



4WDGN/QUMCW/ÒP\JQH-CFCUJGXUM[I)GJCTPKUEJVGU$TWUVDKNFTOKV.QTDGGTMTCP\WPF WOIGNGIVGO /CPVGN)GMTÌPVGT &QRRGNCFNGT OKV <GRVGT WPF 4GKEJUCRHGN KP FGP (·PIGP QDGP -TQPG   $KVMKP 4 &CX&KCMQX  8QPITQ­GT5GNVGPJGKV5GJTCVVTCMVKXGU'ZGORNCTOKVJGTTNKEJGT2CVKPCUGJTUEJÌP  'ZGORNCTFGT5COONWPI#PVQPKP2TQMQR6GKN#WMVKQP#WTGC0WOKUOCVKMC2TCI0T

1018

1019



4WDGN M[TKNNKUEJ /QUMCW/ÒP\JQH-CFCUJGXUM[I$KVMKP 4 &CX&KCMQX 4(GKPG2CVKPCYKP\5EJTÌVNKPIUHGJNGTUGJTUEJÌP



4WDGN M[TKNNKUEJ /QUMCW/ÒP\JQH-CFCUJGXUM[I$KVMKP&CX&KCMQX 5GJTUEJÌP 



15


PETER I.

1020

1,5:1



1,5:1

4WDGN M[TKNNKUEJ /QUMCW/ÒP\JQH-CFCUJGXUM[+P752NCUVKMJQNFGTFGT0)%OKVFGT$GYGT VWPI/52.$KVMKP&CX&KCMQXXCT  W­GTUVUGNVGPKPFKGUGT'TJCNVWPI2TCEJVGZGORNCT 9KP\5EJTÌVNKPIUHGJNGTXQT\ÒINKEJp5VGORGNINCP\ 

1021



4WDGN M[TKNNKUEJ /QUMCW/ÒP\JQH-CFCUJGXUM[I$KVMKP&CX&KCMQX 5GNVGPKPFKGUGT'TJCNVWPI*GTTNKEJG2CVKPCCVVTCMVKXGUXQT\ÒINKEJGU'ZGORNCT 

1022

1,5:1



16

1,5:1

4WDGN 2QNVKPC  M[TKNNKUEJ /QUMCW/ÒP\JQH-CFCUJGXUM[I)GJCTPKUEJVGU$TWUVDKNF T OKV .QTDGGTMTCP\ WPF WOIGNGIVGO /CPVGN CO #TOCDUEJPKVV ) URKGIGNXGTMGJTV )GMTÌPVGT   &QRRGNCFNGTOKV<GRVGTWPF4GKEJUCRHGNKPFGP(·PIGPQDGP-TQPG$KVMKP 4 &KCMQX  8QPITÌ­VGT5GNVGPJGKV#VVTCMVKXGU'ZGORNCTOKVJÒDUEJGT2CVKPCMN2T·IGUEJY·EJGUGJTUEJÌP 


PETER I.

1023

1024

1025



4WDGN 2QNVKPC  M[TKNNKUEJ /QUMCW/ÒP\JQH-CFCUJGXUM[I$KVMKP 4 &KCMQX 45GJTCVVTCMVKXGU'ZGORNCTOKVJGTTNKEJGT2CVKPCUGJTUEJÌP





4WDGN 2QNVKPC  M[TKNNKUEJ /QUMCW/ÒP\JQH-CFCUJGXUM[I$KVMKP 4 &KCMQXXCT 45GJTCVVTCMVKXGU'ZGORNCTOKVJGTTNKEJGT2CVKPCUGJTUEJÌPpXQT\ÒINKEJ





 4WDGN 2QNVKPC   M[TKNNKUEJ ,CJTGU\CJN KO 5VGORGN CWU  IG·PFGTV  /QUMCW /ÒP\JQH   -CFCUJGXUM[I$KVMKP 4 &KCMQX 45GJTUEJÌP

1026



1026 1,5:1



4WDGN 2QNWRQNVKPPKM /QUMCW/ÒP\JQH-CFCUJGXUM[I)GJCTPKUEJVGU$TWUVDKNFTOKV .QTDGGTMTCP\ WPF WOIGNGIVGO /CPVGN)GMTÌPVGT &QRRGNCFNGT OKV <GRVGT WPF 4GKEJUCRHGN KP FGP   (·PIGPQDGP-TQPG$KVMKP 4 &KCMQX 445GJTUEJÌP 

1027

2:1



2:1

-QRGMGP )TKXGPPKM /QUMCW/ÒP\JQH-CFCUJGXUM[I$KVMKP 4 &KCMQX  8QPITQ­GT5GNVGPJGKV#VVTCMVKXGUUGJTUEJÌPGU'ZGORNCT

 17


PETER I.

1028

1029

1030

5KNDGTOÒP\GPFGU4QVGP/ÒP\JQHGUKP/QUMCW 

4WDGN M[TKNNKUEJ /QUMCW4QVGT/ÒP\JQHI$KVMKP 4 &CX&KCMQX  4'VYCUTCWJGT5EJTÌVNKPIUGJTUEJÌP





4WDGN M[TKNNKUEJ /QUMCW4QVGT/ÒP\JQHI$KVMKP&CX&KCMQX  #VVTCMVKXGUUGJTUEJÌPGU'ZGORNCT





4WDGN/QUMCW4QVGT/ÒP\JQHI$KVMKP&CX&KCMQX



5GJTUEJÌP

/KV'ZRGTVKUGXQP+IQT5EJKT[CMQX5VCCVNKEJGU*KUVQTKUEJGU/WUGWO/QUMCW

1031

1032

1033



4WDGN/QUMCW4QVGT/ÒP\JQHI$KVMKP&CX&KCMQX  9KP\5EJTÌVNKPIUHGJNGTHCUVUGJTUEJÌP





4WDGN/QUMCW4QVGT/ÒP\JQHI$KVMKP&CX&KCMQX  #VVTCMVKXGUUGJTUEJÌPGU'ZGORNCT





4WDGN/QUMCW4QVGT/ÒP\JQHI$KVMKPXCT&CX&KCMQXXCT  -N5EJTÌVNKPIUHGJNGTHCUVXQT\ÒINKEJ



18


PETER I.

1034

1035



4WDGN/QUMCW4QVGT/ÒP\JQHI$KVMKP 4 &CX&KCMQX  4#VVTCMVKXGU'ZGORNCTOKVHGKPGT2CVKPCUGJTUEJÌPpXQT\ÒINKEJ





4WDGN/QUMCW4QVGT/ÒP\JQHI$KVMKPXCT&CX&KCMQXXCT  #VVTCMVKXGU'ZGORNCTOKVHGKPGT2CVKPCUGJTUEJÌPpXQT\ÒINKEJ



'ZGORNCTFGT5COONWPI#PVQPKP2TQMQR6GKN#WMVKQP#WTGC0WOKUOCVKMC2TCI0T

1036

1036 1,5:1



4WDGN/QUMCW4QVGT/ÒP\JQHI$KVMKP&CX&KCMQX  5GJTUGNVGPKPFKGUGT'TJCNVWPI2TCEJVGZGORNCT8QT\ÒINKEJp5VGORGNINCP\

1038

1037



1039



4WDGN/QUMCW4QVGT/ÒP\JQHI$KVMKP 4 &CX&KCMQX  -N5EJTÌVNKPIUHGJNGTUGJTUEJÌP





4WDGN 2QNVKPC /QUMCW4QVGT/ÒP\JQH0QXQFGNI/KVINCVVGO4CPF$KVMKP* 4  &KCMQX50 4(GKPG2CVKPCXQT\ÒINKEJ





4WDGN 2QNVKPC /QUMCW4QVGT/ÒP\JQHI$KVMKPHHXCT&KCMQXHHXCT  42CVKPCHCUVUGJTUEJÌP

 19


PETER I.

1040



1041

4WDGN 2QNVKPC /QUMCW4QVGT/ÒP\JQHI$KVMKP 4 &KCMQX  445GJTCVVTCMVKXGU'ZGORNCTOKVJÒDUEJGT2CVKPCXQT\ÒINKEJ



'ZGORNCTFGT5COONWPI#PVQPKP2TQMQR6GKN#WMVKQP#WTGC0WOKUOCVKMC2TCI0T



4WDGN 2QNVKPC /QUMCW4QVGT/ÒP\JQHI$KVMKP 4 &KCMQX  4*ÒDUEJG2CVKPCCVVTCMVKXGUUGJTUEJÌPGU'ZGORNCT



1042

1,5:1



1,5:1

 4WDGN 2QNVKPC   /QUMCW 4QVGT /ÒP\JQH  I )GJCTPKUEJVGU $TWUVDKNF T OKV .QTDGGT   MTCP\ WPF WOIGNGIVGO /CPVGN)GMTÌPVGT &QRRGNCFNGT OKV <GRVGT WPF 4GKEJUCRHGN KP FGP (·PIGP   QDGP-TQPG$KVMKP 4 &KCMQXXCT 8QPITÌ­VGT5GNVGPJGKV 5GJTCVVTCMVKXGU'ZGORNCTOKVHGKPGT2CVKPCYKP\5EJTÌVNKPIUHGJNGTUGJTUEJÌPpXQT\ÒINKEJ  /KV'ZRGTVKUGFGU5VCCVNKEJGP*KUVQTKUEJGP/WUGWOUKP/QUMCW

1043

1,5:1



1,5:1

4WDGN 2QNWRQNVKPPKM  M[TKNNKUEJ /QUMCW4QVGT/ÒP\JQHI)GJCTPKUEJVGU$TWUVDKNFT OKV .QTDGGTMTCP\ WPF WOIGNGIVGO /CPVGN)GMTÌPVGT &QRRGNCFNGT OKV <GRVGT WPF 4GKEJUCRHGN KP FGP   (·PIGPQDGP-TQPG$KVMKP 4 &KCMQX FQTVWPVGT,CJTICPIUKGJG#POGTMWPI   8QPITQ­GT5GNVGPJGKV(GKPG2CVKPCCVVTCMVKXGUUGJTUEJÌPGU'ZGORNCT  'ZGORNCTFGT5COONWPI#PVQPKP2TQMQR6GKN#WMVKQP#WTGC0WOKUOCVKMC2TCI0T  &CUXQTNKGIGPFG5VÒEMYKTFKPFGT.KVGTCVWTCWHITWPFFGTWPFGWVNKEJGPNGV\VGP<KHHGTFGT,CJTGU\CJNWPVGTUEJKGFNKEJ FCVKGTV9KTPGKIGPFC\WFCU5VÒEMFGO,CJTICPI\W\WQTFPGPFCGUUVKNKUVKUEJOKVFGP,CJTI·PIGPWPF MQTTGURQPFKGTV

20


PETER I.

1044

1045

1046



)TKXPC M[TKNNKUEJ /QUMCW4QVGT/ÒP\JQHI$KVMKP&KCMQX

5GJTUEJÌP





)TKXPC M[TKNNKUEJ /QUMCW4QVGT/ÒP\JQHI$KVMKP&KCMQX  5GJTUGNVGPKPFKGUGT'TJCNVWPI*ÒDUEJG2CVKPCCVVTCMVKXGUHCUVXQT\ÒINKEJGU'ZGORNCT





-QRGMGP )TKXGPPKM /QUMCW4QVGT/ÒP\JQHI$KVMKPHHXCT&KCMQXHHXCT 49KP\5EJTÌVNKPIUHGJNGTUGJTUEJÌP



1047

1,5:1



1,5:1

-QRGMGP/QUMCW4QVGT/ÒP\JQHI$KVMKPXCT 4 &KCMQXXCT  44(CUVXQT\ÒINKEJ



1048 2:1

2:1



-QRGMG/QUMCW4QVGT/ÒP\JQH0QXQFGNI$KVMKP*&KCMQXp XIN50   8QPITQ­GT5GNVGPJGKV8QT\ÒINKEJ



'ZGORNCTFGT5COONWPI#PVQPKP2TQMQR6GKN#WMVKQP#WTGC0WOKUOCVKMC2TCI0T

1049

1049 1,5:1

<YGK5QPPGPTWDGNFGT/ÒP\UV·VVG5V2GVGTUDWTI 

4WDGN5V2GVGTUDWTI5QPPGPTWDGNI/KVMNGKPGOHÒPHUVTCJNKIGP5VGTPÒDGTFGO$TWUV DKNF )GJCTPKUEJVGU $TWUVDKNF T OKV .QTDGGTMTCP\ WPF WOIGNGIVGO /CPVGN8KGT IGMTÌPVG /QPQ   ITCOOGKPU-TGW\IGUVGNNVKPFGT/KVVG5QPPG\WFGP5GKVGPFKGIGVGKNVG,CJTGU\CJN$KVMKP 4  &CX&KCMQX W­GTUVUGNVGPKPFKGUGT'TJCNVWPI#VVTCMVKXGUXQT\ÒINKEJGU'ZGORNCT  21


PETER I.

1050



4WDGN5V2GVGTUDWTI5QPPGPTWDGNI$KVMKP 4 &CX&KCMQX  4#VVTCMVKXGU'ZGORNCTOKVJÒDUEJGT2CVKPCUGJTUEJÌP



(ÒTFKG4·PFGNWPIFGUXQTNKGIGPFGP5VÒEMGUYWTFGPKPVGTGUUCPVGTYGKUGXGTUEJKGFGPG4CPFYGTM\GWIGDGPWV\V

1052

1051

'KP-W-QRGMGP5VÒEMFGU/QUMCWGT/ÒP\JQHGU0CDGTG\JP[ 

-W-QRGMGP/QUMCW/ÒP\JQH0CDGTG\JP[I$KVMKP&KCMQX  5EJTÌVNKPIUHGJNGTCO4CPFUGJTUEJÌP



-WRHGTOÒP\GPFGU/QUMCWGT/ÒP\JQHGU-CFCUJGXUM[ 

-W-QRGMG M[TKNNKUEJ /QUMCW/ÒP\JQH-CFCUJGXUM[I$KVMKPXCT&KCMQXXCT 4$TCWPG2CVKPCUGJTUEJÌP



1053

1,5:1



1,5:1

-W-QRGMG/QUMCW/ÒP\JQH-CFCUJGXUM[I$KVMKP FKGUGU'ZGORNCT &KCMQX 445GJTCVVTCMVKXGU'ZGORNCTOKVJÒDUEJGT2CVKPCUGJTUEJÌPpXQT\ÒINKEJ



'ZGORNCTFGT5COONWPI#PVQPKP2TQMQR6GKN#WMVKQP#WTGC0WOKUOCVKMC2TCI0T

1054

1055



-W-QRGMGP/QUMCW/ÒP\JQH-CFCUJGXUM[I$KVMKP&KCMQX

5GJTUEJÌP



6[ORH  -QRGMGP   /QUMCW /ÒP\JQH -CFCUJGXUM[  I )GJCTPKUEJVGU $TWUVDKNF T OKV   .QTDGGTMTCP\ WPF WOIGNGIVGO /CPVGN)GMTÌPVGT &QRRGNCFNGT OKV <GRVGT WPF 4GKEJUCRHGN KP FGP   (·PIGPQDGP-TQPG$KVMKP 4 &KCMQX 445GJTUEJÌP 

'KP6[ORHXQP

'ZGORNCTFGT5COONWPI#PVQPKP2TQMQR6GKN#WMVKQP#WTGC0WOKUOCVKMC2TCI0T

22




PETER I.

1056

/GFCKNNGPFGU<CTGP2GVGT+ 

<KPPOGFCKNNGQ,  WPUKIPKGTV UR·VGTG2T·IWPIFGU,CJTJWPFGTVUXQP,%*GFNKPIGT CWH )TCH(GQFQT#NGZGLYKVUEJ)QNQXKPTWUUKUEJGT)GUCPFVGTKP%JKPCWPF)QWXGTPGWTXQP5KDKTKGP$TWUV DKNF )QNQXKPU N OKV WOIGNGIVGO /CPVGN.ÌYG UVGJVPCEJNOKVGTJQDGPGO5EJYGTVQDGP-TQPG\W FGP5GKVGP.QTDGGT\YGKIGOOI&KCMQX 9KP\4CPFHGJNGTXQT\ÒINKEJ



1057

1057

1,5:1



5KNDGTOGFCKNNG  WPUKIPKGTV XQP 6 +YCPQHH UR·VGTG 2T·IWPI WO   CWH FKG 'TDCWWPI FGT   (GUVWPI -TQPUEJNQ­ FKG GTUVGP 6GKNG YWTFGP CO  /CK  GKPIGYGKJV  #PUKEJV FGT (GUVWPI   5QPPGWPF9QNMGPÒDGTFGODCNVKUEJGP/GGTOKV\YGK5GIGNUEJKHHGPKO8QTFGTITWPFT/KPGTXCFKG CWHGKPG/ÌYGKPKJTGO0GUV\GKIVFCUKO/GGTUEJYKOOVOOI&KCMQX  44#VVTCMVKXGU'ZGORNCTOKVHGKPGT6ÌPWPIYKP\5VGORGNHGJNGTXQT\ÒINKEJp5VGORGNINCP\  'ZGORNCTFGT5COONWPIFGT(TGKJGTTGP$QPFG6GKN#WMVKQP(TKV\4WFQNH-ÒPMGT1UPCDTÒEM0T  2GVGT + FGT )TQ­G NKG­ CWH FGT KO (KPPKUEJGP /GGTDWUGP FKTGMV XQT 5V 2GVGTUDWTI NKGIGPFGP +PUGN -QVNKP FKG   IGYCNVKIG(GUVWPI-TQPUEJNQ­GTTKEJVGPWOUGKPG5VCFVXQT#PITKHHGPXQPFGT/GGTUGKVG\WUEJÒV\GP&GT<CTYQNNVG CWH FGT +PUGN GKPG 8QT\GKIGUVCFV GKP \YGKVGU #OUVGTFCO GTTKEJVGP 0CEJ FGO 6QF FGU <CTGP IGTKGVGP FKG   $CWCTDGKVGP LGFQEJ \WP·EJUV KPU 5VQEMGP WPF YWTFGP GTUV PCEJ GKPGT UEJYGTGP ªDGTUEJYGOOWPI  HQTVIGUGV\V   &KG(GUVWPI-TQPUEJNQ­ UR·VGT-TQPUVCFVIGPCPPV JKPFGTVGPKEJVPWTFKG5EJYGFGPKO0QTFKUEJGP-TKGIUQPFGTP CWEJFKG&GWVUEJGPKO<YGKVGP9GNVMTKGICO<WICPI\W5V2GVGTUDWTI

23


PETER I.

1058

1,5:1



1,5:1

5KNDGTOGFCKNNG  WPUKIPKGTV 6CRHGTMGKVUOGFCKNNG HÒT FKG 6GKNPGJOGT FGT 5EJNCEJV DGK .GUPCLC CO   5GRVGODGT)GJCTPKUEJVGU$TWUVDKNFTOKV.QTDGGTMTCP\WPFWOIGNGIVGO/CPVGN&GT<CTHCUVXX CWH GKPGO URTKPIGPFGP 2HGTF KPOKVVGP GKPGT 5EJNCEJVU\GPG QDGP \W FGP 5GKVGP \YGK 'PIGN FKG GKPG   -TQPGÒDGTUGKP*CWRVJCNVGPOOI&KCMQX 48QT\ÒINKEJ



#PHCPI,WPKGTJKGNVFGTUEJYGFKUEJG)GPGTCN#FCO.WFYKI.GYGPJCWRVXQP-CTN:++FGP#WHVTCIOKVUGKPGP 6TWRRGP XQP .KXNCPF CWU \WO UEJYGFKUEJGP *CWRVJGGT \W UVQ­GP FCU OKV FGO -ÌPKI  XQP 5CEJUGP MQOOGPF    4KEJVWPI4W­NCPFIGIGP2GVGTFGP)TQ­GP\QI&KG8QTDGTGKVWPIGPHÒTFKGUG*KNHUVTWRRGP\QIGPUKEJLGFQEJKPFKG .·PIG WPF CNU UKEJ 'PFG ,WPK  GPFNKEJ EC  /CPP OKV DGFGWVGPFGO 2TQXKCPV WPF 8QTT·VGP HÒT FCU   *CWRVJGGTCWHFGP9GIOCEJVGPIKPIFGT/CTUEJPWTNCPIUCOXQTCP2GVGTFGT)TQ­GYQNNVGFKG8GTGKPKIWPIFGT HGKPFNKEJGP6TWRRGPVGKNGWPFFGP0CEJUEJWDHÒTFKGUEJYGFKUEJG*CWRVCTOGGWOLGFGP2TGKUXGTJKPFGTPWPFUVGNNVG UKEJ )GPGTCN .GYGPJCWRV GPVIGIGP #O  5GRVGODGT CWH FGT /GFCKNNG KUV  PCEJ FGT TWUUKUEJGP 8CTKCPVG FGU   LWNKCPKUEJGP -CNGPFGTU MQTTGMV  FGT  5GRVGODGT CPIGIGDGP  MCO GU KO RQNPKUEJGP &QTH .GUPCLC JGWVG   9GK­TW­NCPF  \WT 5EJNCEJV KP FGT TWPF  5EJYGFGP HKGNGP QFGT IGHCPIGPIGPQOOGP YWTFGP &GT 4GUV XQP   .GYGPJCWRVU6TWRRGP EC/CPP GTTGKEJVGFCUUEJYGFKUEJG*CWRVJGGTCO1MVQDGT&KG5EJNCEJVDGK .GUPCLC YCT GKP MCVCUVTQRJCNGT 4ÒEMUEJNCI HÒT -CTN :++ YGKN UGKPG #TOGG FGP HÒT FGP #PITKHH CWH <CT 2GVGT   FTKPIGPF DGPÌVKIVGP 0CEJUEJWD PKEJV GTJKGNV (ÒT 2GVGT FGP )TQ­GP YCT FKG .GYGPJCWRV UEJG 5EJNCEJV FGT   )TWPFUVGKPHÒTUGKPGP5KGIÒDGTFGP4KXCNGP-CTN:++

1059

1059

1,5:1



24

$TQP\GOGFCKNNGXQP,-KVVGN XGTOWVNKEJUR·VGTG2T·IWPIFGU,CJTJWPFGTVU 6CRHGTMGKVUOG FCKNNGHÒTFKG6GKNPGJOGTFGT5EJNCEJVDGK.GUPCLCCO5GRVGODGT&GT<CTTGKVGVTKPXQNNGT4ÒUVWPI WPFOKV-QOOCPFQUVCDKPFGT4GEJVGPÒDGT-TKGIUVTQRJ·GPFCTWPVGTGKPGUEJYGFKUEJG(CJPGWPFGKP .ÌYGPMQRH&CTUVGNNWPI FGT 5EJNCEJVQTFPWPI KO 8QTFGTITWPF UKV\V 8KMVQTKC OKV .QTDGGTMTCP\ WPF   6TQORGVGCWH-TKGIUVTQRJ·GPPCEJNXQTKJTGKP5EJKNFOKVHÒPH\GKNKIGT#WHUEJTKHVQDGP5EJTKHVOKVFGT ,CJTGU\CJNCNU%JTQPQITCOOOOI&KCMQX 48QT\ÒINKEJ




PETER I.

1060

1060

1,5:1



5KNDGTOGFCKNNG  XQP 6 +YCPQHH UR·VGTG 2T·IWPI WO   CWH FKG 'KPPCJOG XQP 'NDKPI FWTEJ   FKGTWUUKUEJG#TOGGCO,CPWCT)GJCTPKUEJVGU$TWUVDKNFTOKV.QTDGGTMTCP\WPFWOIGNGIVGO /CPVGN2NCP FGT 5VCFV 'NDKPI CWU FGT 8QIGNRGTURGMVKXG KO 8QTFGTITWPF N FGT (NW­IQVV 'NDKPI OKV   3WGNNWTPG FGT GTUEJTQEMGP GKPGP TÌOKUEJGP 5QNFCVGP DGVTCEJVGV FGT GKPG $QODGWPFGKPG5VWTONGKVGT VT·IV QDGP 5EJTKHV OKV FGT ,CJTGU\CJN CNU %JTQPQITCOO  OO  I &KCMQX  4    &WVMQYUMK5WEJCPGM 442TCEJVGZGORNCTOKVHGKPGT6ÌPWPI8QT\ÒINKEJp5VGORGNINCP\  'ZGORNCT FGT 5COONWPI FGT (TGKJGTTGP $QPFG 6GKN  #WMVKQP (TKV\ 4WFQNH -ÒPMGT  1UPCDTÒEM    0T  &KG5VCFV'NDKPI RQNPKUEJ'NDN±I YCTUGKVFGORQNPKUEJGP(GNF\WI-CTNU:++'PFGUEJYGFKUEJDGUGV\V+O ,CPWCTYWTFGFKG5VCFVXQPTWUUKUEJGP6TWRRGPWO\KPIGNVWPFCO,CPWCTMCRKVWNKGTVGFGTUEJYGFKUEJG -QOOCPFCPV&COKVYCTFKGNGV\VGUEJYGFKUEJG$CUVKQPCWHRQNPKUEJGO$QFGPIGDTQEJGP  &CU &CVWO FGT -CRKVWNCVKQP KUV CWH FGT XQTNKGIGPFGP 2T·IWPI  CNNGTFKPIU WPMQTTGMV  PCEJ FGO ITGIQTKCPKUEJGP   -CNGPFGTCPIGIGDGPMQTTGMVOÒ­VGGUFGT(GDTWCTUGKP

1061

1061

1,5:1



5KNDGTOGFCKNNGXQP6+YCPQHH UR·VGTG2T·IWPIWO CWHFKG'KPPCJOGXQP-GZJQNO JGWVG 2TKQULQTUM4W­NCPF FWTEJFKG4WUUGPCO5GRVGODGT)GJCTPKUEJVGU$TWUVDKNFTOKV.QTDGGT MTCP\ WPF WOIGNGIVGO /CPVGN(GUVWPIURNCP XQP -GZJQNO KO 8QTFGTITWPF T UKV\V /CTU OKV 5VCFV   MTQPGKPFGTGTJQDGPGP4GEJVGPOOI&KCMQX 4   442TCEJVGZGORNCTOKVHGKPGT6ÌPWPI8QT\ÒINKEJp5VGORGNINCP\  'ZGORNCT FGT 5COONWPI FGT (TGKJGTTGP $QPFG 6GKN  #WMVKQP (TKV\ 4WFQNH -ÒPMGT  1UPCDTÒEM    0T  &KG UEJYGFKUEJG (GUVWPI -GZJQNO KP -CTGNKGP CP FGT /ÒPFWPI FGU (NWUUGU 8WQMUGP KP FGP .CFQICUGG IGNGIGP   YWTFG UGKV /KVVG ,WNK  XQP TWUUKUEJGP 6TWRRGP DGNCIGTV 0CEJ JGHVKIGO $GUEJW­ OW­VGP FKG 5EJYGFGP CO   5GRVGODGTMCRKVWNKGTGPWPFMQPPVGP-CTGNKGPFCTCWHJKPPKEJVOGJTJCNVGP

25


PETER I.

1062

1062

1,5:1



5KNDGTOGFCKNNGXQP6+YCPQHH UR·VGTG2T·IWPIWO CWHFKG-CRKVWNCVKQPXQP4GXCN JGWVG 6CNNKPP'UVNCPF CO5GRVGODGT)GJCTPKUEJVGU$TWUVDKNFTOKV.QTDGGTMTCP\WPFWOIGNGI VGO/CPVGN#PUKEJVXQP4GXCNCWUFGT8QIGNRGTURGMVKXGFCTÒDGTUEJYGDVGKP)GPKWUOKV5EJYGTVWPF 5VCFVMTQPGQDGP5EJTKHVOKVFGT,CJTGU\CJNCNU%JTQPQITCOOOOI&KCMQX 4  442TCEJVGZGORNCTOKVHGKPGT6ÌPWPI8QT\ÒINKEJp5VGORGNINCP\  'ZGORNCT FGT 5COONWPI FGT (TGKJGTTGP $QPFG 6GKN  #WMVKQP (TKV\ 4WFQNH -ÒPMGT  1UPCDTÒEM    0T  0CEJ FGT -CRKVWNCVKQP XQP #TGPUDWTI WPF FGT 'KPPCJOG FGT +PUGN ¤UGN FWTEJ FKG 4WUUGP YCT 4GXCN FKG JGWVKIG   GUVKUEJG *CWRVUVCFV 6CNNKPP  FKG NGV\VG (GUVWPI FKG 5EJYGFGP KP FGP 1UVUGGRTQXKP\GP DGJCWRVGVG 0CEJ FGO   TWUUKUEJGP (GNF\WI FWTEJ .KXNCPF KO 5R·VUQOOGT  YCTGP FKG $GHGUVKIWPIGP PCEJ 2N·PGP XQP 'TKM &CJNDGTI   WOHCUUGPF GTPGWGTV WPF GTYGKVGTV YQTFGP WPF CWEJ FKG )CTPKUQP YWTFG CWH HCUV  /CPP CWHIGUVQEMV &KG   $GNCIGTWPIFGT5VCFVFWTEJTWUUKUEJG6TWRRGPDGICPP/KVVG#WIWUVKPUDGUQPFGTGYCTGPFKG4GXCNGTXQPFGT FWTEJFKG4WUUGPXQTIGPQOOGPGP7ONGKVWPIGKPGUHÒTFGP$GVTKGDFGT/ÒJNGPWPFFKG8GTUQTIWPIOKV6TKPMYCUUGT YKEJVKIGP-CPCNUDGVTQHHGP#W­GTFGOYCT#PHCPI#WIWUVFKG2GUVCWUIGDTQEJGPFGTGP8GTDTGKVWPIUKEJFWTEJFGP <W\WI XQP (NÒEJVNKPIGP WPF FKG FCTCWU TGUWNVKGTGPFG ªDGTDGXÌNMGTWPI PQEJ DGUEJNGWPKIVG &KG 5KVWCVKQP   XGTUEJNGEJVGTVGUKEJFGTCTVFC­FKGUEJYGFKUEJG(ÒJTWPICO5GRVGODGTÒDGTGKPG2TQMNCOCVKQP2GVGTUFGU )TQ­GPWPFÒDGTFKG-CRKVWNCVKQPDGTKGV5EJNKG­NKEJYWTFGCO5GRVGODGTFKG-CRKVWNCVKQPWPVGT\GKEJPGVWPFFKG 5VCFV FGP 4WUUGP ÒDGTNCUUGP &KG UEJYGFKUEJGP 5QNFCVGP UGIGNVGP ÒDGT FKG 1UVUGG KP FKG *GKOCV \WTÒEM 7O FKG   <GTUVÌTWPI FGT 5VCFV \W XGTJKPFGTP ÒDGTTGKEJVG FGT 5VCFVTCV FGO TWUUKUEJGP )GPGTCN (ÒTUV /GPUEJKMQY GKP   'JTGPIGUEJGPMKO9GTVXQP&WMCVGP&KG4WUUGPJCVVGPPWPICP\.KXNCPFKPKJTGP$GUKV\IGDTCEJV5VQN\YKTF KP FGT 4ÒEMUGKVGPWOUEJTKHV FGT XQTNKGIGPFGP /GFCKNNG XGTMÒPFGV 24#'&1/+0#06' 2'64+ 51.+1 4'8#.+#   %'55+6  4GXCN DGWIVG UKEJ XQT FGO CNNGU DGJGTTUEJGPFGP 6JTQP 2GVGTU  &CU KO #DUEJPKVV FGT 4ÒEMUGKVG   CPIGIGDGPG&CVWO,WPKKUVYKGUQQHVDGKFGP/GFCKNNGPCWUFGTTWUUKUEJGP/GFCKNNGPUGTKGXQP2JKNKRR*GKPTKEJ /ÒNNGT WPFFGOUR·VGTGP2T·IWPIGPXQP6KOQVGK+YCPQHH HGJNGTJCHV

1063



5KNDGTOGFCKNNG  XQP 6 +YCPQHH UR·VGTG 2T·IWPI WO   CWH FKG TWUUKUEJGP 'TQDGTWPIGP   KO ,CJT  )GJCTPKUEJVGU $TWUVDKNF T OKV .QTDGGTMTCP\ WPF WOIGNGIVGO /CPVGN*GTMWNGU KP   .ÌYGPHGNNMPKGVXXWPFJ·NV)NQDWUOKVFGT.CPFMCTVGXQP.KXNCPFCWHUGKPGP5EJWNVGTPKPFGTFKG 1TVG 0CTXC 4GXCN &QTRCV 2GTPCW 4KIC WPF #TGPUDWTI GKPIG\GKEJPGV UKPF  OO  I   &KCMQX 4  4#VVTCMVKXGU'ZGORNCTOKVJGTTNKEJGT2CVKPCXQT\ÒINKEJ  1HHGPDCTYCTFGT8GTMCWHFGT)GFGPMRT·IWPIGPCWHFKG'TQDGTWPIGKP\GNPGTNKXN·PFKUEJGT(GUVWPIGPFWTEJ2GVGT+ WPFUGKPG6TWRRGPUQGTHQNITGKEJFC­UKEJ2JKNKRR*GKPTKEJ/ÒNNGTWPFUR·VGT6KOQVGK+YCPQHHGPVUEJNQUUGPCWEJ /GFCKNNGPOKV$G\WICWHU·OVNKEJGNKXN·PFKUEJG'TQDGTWPIGPJGT\WUVGNNGP

26


PETER I.

1064



<KPPOGFCKNNG  XQP 6 +YCPQHH XGTOWVNKEJ UR·VGTG 2T·IWPI FGU  ,CJTJWPFGTVU  CWH FKG TWUUK   UEJGP'TQDGTWPIGPKO,CJT)GJCTPKUEJVGU$TWUVDKNFTOKV.QTDGGTMTCP\WPFWOIGNGIVGO/CPVGN 1XCNGT 5EJKNF OKV FGO TWUUKUEJGP &QRRGNCFNGT WOJGT CEJV OKV 5VCFVMTQPGP DGFGEMVG -CTVWUEJGP OKV   FGP #PUKEJVGP FGT (GUVWPIGP 'NDKPI 4GXCN 8KDQTI 4KIC &Ã&#x2019;PCOÃ&#x2019;PFG 2GTPCW -GZJQNO  

%#4'.# WPF#TGPUDWTIOOI&KCMQX 8QT\Ã&#x2019;INKEJ



1,5:1

1065



1065

5KNDGTOGFCKNNGWPUKIPKGTVCWHFKG8GTO·JNWPIUGKPGU5QJPGU<CTGYKVUEJ#NGZGL2GVTQYKVUEJOKV %JCTNQVVG %JTKUVKPG 5QRJKG 6QEJVGT .WFYKI 4WFQNHU XQP $TCWPUEJYGKI9QNHGPDÃ&#x2019;VVGN $GKFGT $TWUVDKN   FGT PGDGPGKPCPFGT T(GWGTCNVCT FGT OKV FGP 9CRRGPUEJKNFGP XQP 4W­NCPF WPF $TCWPUEJYGKI   IGUEJOÃ&#x2019;EMV KUV FCTÃ&#x2019;DGT \YGK KPGKPCPFGTITGKHGPFG *·PFG  OO  I $TQEMOCPP    &KCMQX 4  44(CUVXQT\Ã&#x2019;INKEJ  27


PETER I.

1066

1,5:1



1,5:1

4WDGNHÌTOKIG5KNDGTOGFCKNNGWPUKIPKGTV6CRHGTMGKVUOGFCKNNGHÒT5QNFCVGPKPFGT5GGUEJNCEJVDGKO HKPPKUEJGP*CPMQ TWUUKUEJ)CPIWVUEJYGFKUEJ*CPIÌ CO,WNK)GJCTPKUEJVGU$TWUVDKNFT OKV.QTDGGTMTCP\WPFWOIGNGIVGO/CPVGN&CTUVGNNWPIFGT5GGUEJNCEJVOOI$KVMKP/  4 &KCMQX# 4   8QPITQ­GT5GNVGPJGKVDGUQPFGTUKPFKGUGTKPVCMVGP'TJCNVWPI 5GJTCVVTCMVKXGUHCUVXQT\ÒINKEJGU'ZGORNCTOKVQTKIKPCNGT6TCIGÌUG  +O 5QOOGT  YCT FKG #WHTÒUVWPI FGT TWUUKUEJGP /CTKPG UQ YGKV HQTVIGUEJTKVVGP FC­ GKP #PITKHH CWH FKG   UEJYGFKUEJG (NQVVG GTHQNIXGTURTGEJGPF GTUEJKGP <CT 2GVGT + YQNNVG FKGUG HÒT FKG LWPIG 1UVUGGOCEJV 4W­NCPF UGJT   IGH·JTNKEJG (NQVVG WPUEJ·FNKEJ OCEJGP WPF CWEJ FGP 0CEJUEJWD HÒT FKG TWUUKUEJGP 'TQDGTWPIGP CP FGT HKPPKUEJGP   -ÒUVG UKEJGTP FGT FWTEJ FKG 5EJYGFGP CWH FGO 5GGYGI TGIGNO·­KI WPVGTDTQEJGP YWTFG &KG UEJYGFKUEJG (NQVVG   WPVGT#FOKTCN)WUVCX9CVVTCPIJCVVGDGTGKVUKO(TÒJUQOOGTDGKFGT*CPMQ*CNDKPUGN UEJYGFKUEJ*CPIÌWFF  2QUKVKQP DG\QIGP WO UKEJ FGP 4WUUGP GPVIGIGP\WUVGNNGP &KG TWUUKUEJG (NQVVG WPVGT #FOKTCN )TCH (GFQT #RTCMUKP   YWTFG FWTEJ YGKVGTG CWU FGO $CNVKMWO JGTDGKIG\QIGPG -TKGIUUEJKHHG XGTUV·TMV WPF CWEJ <CT 2GVGT + GKNVG   RGTUÌPNKEJPCEJ5ÒFHKPPNCPF0CEJFGOFGTWTURTÒPINKEJG2NCPFGUTWUUKUEJGP#FOKTCNUGKPGP6GKNUGKPGT5EJKHHGÒDGT FGP.CPFTÒEMGPFGT*CNDKPUGN\W\KGJGPWPFUQFKGUEJYGFKUEJG(NQVVG\WWO\KPIGNPIGUEJGKVGTVYCTDGUEJNQ­GTCO ,WNKFGPFKTGMVGP&WTEJDTWEJÒDGT5GGFWTEJFKGUEJYGFKUEJGP.KPKGP$GKTWJKIGO9GVVGTNKG­GPUKEJFKG MNGKPGPYGPFKIGP4WFGTUEJKHHGFGT4WUUGPFGWVNKEJDGUUGTOCPÌXTKGTGPCNUFKGUEJYGTGPUEJYGFKUEJGP-TKGIUUEJKHHG 0CEJGTUVGP'THQNIGPCO,WNKIGNCPIGUFGT\CJNGPO·­KIYGKVÒDGTNGIGPGPTWUUKUEJGP(NQVVGCO,WNKKPFGT DGKPCJG FTGK 5VWPFGP CPFCWGTPFGP JGHVKIGP 5GGUEJNCEJV FKG UEJYGFKUEJGP 5EJKHHG \W GPVGTP WPF FGP XGTYWPFGVGP   UEJYGFKUEJGP-QPVGTCFOKTCN0KNU'JTGPUMÌNFIGHCPIGP\WPGJOGP  'UYCTFGTGTUVGDGFGWVGPFG5GGUKGIKPFGTTWUUKUEJGP)GUEJKEJVGWPF<CT2GVGT+HGKGTVGUGKPGP'THQNIOKVGKPGO RQORÌUGP6TKWORJ\WIKP5V2GVGTUDWTIKPFGOCWEJFGTUEJYGFKUEJG-QPVGTCFOKTCN'JTGPUMÌNFOKVIGHÒJTVYWTFG &GT  ,WNK YWTFG XQP FGT TWUUKUEJGP -KTEJG \WO (GKGTVCI GTJQDGP FGT OKV FGP INGKEJGP <GTGOQPKGP YKG FGT   2QNVCYC6CI ,WPK DGICPIGPYGTFGPUQNNVG(ÒTFGP*GKNKIGPFGU,WNKFGP/·TV[TGT2CPVGNGKOQPYWTFGKP 5V2GVGTUDWTIGKPG-KTEJGGTTKEJVGV  9KGUEJQPPCEJFGO5KGIDGK2QNVCYCNKG­FGT<CTCP1HHK\KGTGWPF5QNFCVGP6CRHGTMGKVUOGFCKNNGPXGTVGKNGP#WHFGT XQTNKGIGPFGP JGWVG ·W­GTUV UGNVGPGP 6CRHGTMGKVUOGFCKNNG HÒT 5QNFCVGP YKTF KP FGT 4ÒEMUGKVGPWOUEJTKHV DGVQPV   #PUVTGPIWPI WPF HGUVGT )NCWDG ÒDGTVTGHHGP FKG 5V·TMG &COKV YKTF CWH FKG )TÌ­G WPF DGUUGTG #WUTÒUVWPI FGT   UEJYGFKUEJGP-TKGIUUEJKHHGKO8GTINGKEJ\WFGPMNGKPGTGPTWUUKUEJGP)CNGGTGPCPIGURKGNV$GKFGO5KGIJCVLGFQEJ XQT CNNGO FKG GTFTÒEMGPFG ªDGT\CJN FGT 4WUUGP FGP #WUUEJNCI IGIGDGP 9KG CWEJ CWH FGT JKGT CPIGDQVGPGP   8GTFKGPUVOGFCKNNG \W UGJGP KUV MQPPVGP ICT PKEJV CNNG  )CNGGTGP OKV  /CPP $GUCV\WPI CPITGKHGP FC FGT   2NCV\KPFGT$WEJVXQP*CPMQPKEJVCWUTGKEJVG

28


PETER I.

1067



5KNDGTOGFCKNNGOKV5KIPCVWT/- UR·VGTG2T·IWPIWO CWHFGP5GGUKGIDGKOHKPPKUEJGP *CPMQ TWUUKUEJ )CPIWV UEJYGFKUEJ *CPIÌ  CO  ,WNK  $TWUVDKNF FGU <CTGP 2GVGT + T OKV   .QTDGGTMTCP\WPFWOIGNGIVGO/CPVGN&CTUVGNNWPIFGT5GGUEJNCEJVOOI&KCMQX 4  8QPITQ­GT5GNVGPJGKV2TCEJVGZGORNCTOKVHGKPGT6ÌPWPI8QT\ÒINKEJp5VGORGNINCP\  'ZGORNCTFGT5COONWPIFGT(TGKJGTTGP$QPFG6GKN#WMVKQP(TKV\4WFQNH-ÒPMGT1UPCDTÒEM0T

1068



$TQP\GOGFCKNNG  OKV 5KIPCVWT + Û P UR·VGTG 2T·IWPI FGU  ,CJTJWPFGTVU  CWH FKG 5GGUEJNCEJV   DGKOHKPPKUEJGP*CPMQ TWUUKUEJ)CPIWVUEJYGFKUEJ*CPIÌ CO,WNK)GJCTPKUEJVGU$TWUV DKNF T OKV .QTDGGTMTCP\ WPF WOIGNGIVGO /CPVGN&CTUVGNNWPI FGT 5GGUEJNCEJV  OO  I   &KCMQX FQTVKP)QNFWPF5KNDGT  9KP\-TCV\GTXQT\ÒINKEJ



1069



5KNDGTOGFCKNNG  XQP 6 +YCPQHH UR·VGTG 2T·IWPI WO   CWH FGP 5GGUKGI DGKO HKPPKUEJGP   *CPMQ TWUUKUEJ )CPIWV UEJYGFKUEJ *CPIÌ  CO  ,WNK  )GJCTPKUEJVGU $TWUVDKNF T OKV   .QTDGGTMTCP\ WPF WOIGNGIVGO /CPVGN&CTUVGNNWPI FGT 5GGUEJNCEJV KO 8QTFGTITWPF GKP YGKDNKEJGT   )GPKWU OKV .QTDGGTMTCP\ WPF &TGK\CEM FGT OKV GKPGT 5EJKHHUMTQPG EQTQPC PCXCNKU  WPF GKPGO   .QTDGGT\YGKIXGTUGJGPKUVOOI&KCMQX 4   44#VVTCMVKXGU'ZGORNCTOKVHGKPGT6ÌPWPIXQT\ÒINKEJp5VGORGNINCP\  'ZGORNCTFGT5COONWPIFGT(TGKJGTTGP$QPFG6GKN#WMVKQP(TKV\4WFQNH-ÒPMGT1UPCDTÒEM0T

29


PETER I.

1070



<KPPOGFCKNNGXQP6+YCPQHHWPF5,WFKP UR·VGTG2T·IWPIFGU,CJTJWPFGTVU CWHFKG'TQDG TWPIXQP0[UEJNQV HKPPKUEJ5CXQPNKPPC CO,WNK)GJCTPKUEJVGU$TWUVDKNFTOKV.QTDGGTMTCP\WPF WOIGNGIVGO/CPVGN6QRQITCRJKUEJG-CTVGFGT(GUVWPIKO8QTFGTITWPFNKGIVGKPGIGMTÌPVGYGKDNKEJG )GUVCNVPCEJNOKVFGOTWUUKUEJGP9CRRGPUEJKNFKPFGT4GEJVGPFKG.KPMGCWHGKPG9CUUGTWTPGIGNGIV OOI&KCMQX (CUVXQT\ÒINKEJ



1071



<KPPOGFCKNNG  XQP 1 -CNCUJPKMQX IGRT·IV WO   6CRHGTMGKVUOGFCKNNG HÒT 6GKNPGJOGT FGT   5GGUEJNCEJVDGKFGTPÌTFNKEJXQP)QVNCPFIGNGIGPGP+PUGN5CPFÌCO/CK)GJCTPKUEJVGU$TWUV DKNF T OKV .QTDGGTMTCP\ WPF WOIGNGIVGO /CPVGN&CTUVGNNWPI FGT 5GGUEJNCEJV  OO  I   &KCMQX FQTVKP)QNFWPF5KNDGT  8QT\ÒINKEJ



'ZGORNCTFGT5COONWPIFGT(TGKJGTTGP$QPFG6GKN#WMVKQP(TKV\4WFQNH-ÒPMGT1UPCDTÒEM0T 7OFKGUEJYGFKUEJG5EJKHHCJTV\WUKEJGTPUGIGNVGPKO/CKFTGKUEJYGFKUEJG(TGICVVGPWPVGTFGO-QOOCPFQ XQP#PVQP,QJCP9TCPIGNXQP5VQEMJQNOKP4KEJVWPI$CNVKMWO#NUFGTTWUUKUEJG#FOKTCN(GFQT#RTCMUKPFGTUKEJ KP 4GXCN CWHJKGNV FCXQP GTHWJT GPVUCPFVG GT GKPG (NQVVG OKV UGEJU (TGICVVGP WO FKG UEJYGFKUEJGP 5EJKHHG   CWH\WDTKPIGP#O/CKMCOGUXQTFGTUEJYGFKUEJGP+PUGN5CPFÌ PÌTFNKEJXQP)QVNCPF \WGKPGODTWVCNGP 5GGIGHGEJVDGKFGOFKG5EJYGFGPCNNGFTGK5EJKHHGXGTNQTGP

1072



<KPPOGFCKNNGXQP/-WEJMKP 2T·IWPIFGU,CJTJWPFGTVU 6CRHGTMGKVUOGFCKNNGHÒT6GKNPGJ OGT FGT 5GGUEJNCEJV DGK .GFUWPF TWUUKUEJ )TGPICO  CWH FGP ’NCPF+PUGNP CO  ,WNK  )GJCT   PKUEJVGU$TWUVDKNFTOKV.QTDGGTMTCP\WPFWOIGNGIVGO/CPVGN&CTUVGNNWPIFGT5GGUEJNCEJVOO I&KCMQX 9KP\5VGORGNTK­XQT\ÒINKEJ 'ZGORNCTFGT5COONWPIFGT(TGKJGTTGP$QPFG6GKN#WMVKQP(TKV\4WFQNH-ÒPMGT1UPCDTÒEM0T #O  ,WNK  MCO GU DGK .GFUWPF \YKUEJGP FGP ’NCPF+PUGNP \W GKPGO 5GGIGHGEJV \YKUEJGP UEJYGFKUEJGP   -TKGIUUEJKHHGPWPFTWUUKUEJGP)CNGGTGPDGKFGOFKG5EJYGFGPXKGT(TGICVVGPXGTNQTGP&GT5GGUKGIDGKFGP’NCPF +PUGNPYWTFGXQP<CT2GVGTCWUIKGDKIIGHGKGTVCWEJYGKNFGT5KGICO,CJTGUVCIFGT5GGUEJNCEJVXQT*CPMQ TWUUKUEJ )CPIWV GTTWPIGPYWTFG

30




KATHARINA I.

1073



5KNDGTOGFCKNNGWPUKIPKGTV UR·VGTG2T·IWPIFGU,CJTJWPFGTVU CWHUGKPGP6QF)GJCTPKUEJVGU $TWUVDKNFTOKV.QTDGGTMTCP\&KGRGTUQPKHK\KGTVG'YKIMGKVVT·IVFGP<CTGP\WO*KOOGNGORQTWPVGP N FKG CO /GGTGUWHGT UKV\GPFG 4WUUKC PGDGP KJT GKP 5EJGOGN OKV -TÌPWPIUKPUKIPKGP T #VVTKDWVG FGT   -WPUV9KUUGPUEJCHVWPF+PFWUVTKGCWHFGO/GGT5GIGNUEJKHHWPF)CNGGTGKO*KPVGTITWPFNWPVGTIG JGPFG5QPPGOOI&KCMQX 4  445GJTUEJÌPpXQT\ÒINKEJ 

1074

2:1

2:1

<#4+0-#6*#4+0#+ 'KPIQNFGPGU4WDGN5VÒEMFGT<CTKP-CVJCTKPC+ 

 4WDGN  /QUMCW 4QVGT /ÒP\JQH  I )GMTÌPVGU $TWUVDKNF N OKV WOIGNGIVGO /CPVGN5V   #PFTGCUUVGJVXXOKV*GKNKIGPUEJGKPFCU-TGW\JKPVGTUKEJJCNVGPF$KVMKP 4 &KCMQX(D )1.&8QPITQ­GT5GNVGPJGKV 4CPFYWTFGJGTUVGNNWPIUDGFKPIVUEJNGEJVCWUIGRT·IVMN&TWEMUVGNNGPUGJTUEJÌP 

1075

5KNDGTOÒP\GPFGU4QVGP/ÒP\JQHGUKP/QUMCW 

4WDGN/QUMCW4QVGT/ÒP\JQHI$KVMKPXCT&CX&KCMQX  5GNVGPKPFKGUGT'TJCNVWPI/KP5EJTÌVNKPIUHGJNGTYKP\5VGORGNHGJNGTHCUVXQT\ÒINKEJGU'ZGORNCT

 31


KATHARINA I.

1076



4WDGN/QUMCW4QVGT/ÒP\JQHI$KVMKP&CX&KCMQX

5GJTUEJÌP

1077



1077

1,5:1

5KNDGTOÒP\GPFGT/ÒP\UV·VVG5V2GVGTUDWTI 

4WDGN  5V 2GVGTUDWTI 5QIGPCPPVGT 6TCWGTTWDGN  I $TWUVDKNF N OKV WOIGNGIVGO /CPVGN   )GMTÌPVGT &QRRGNCFNGT OKV <GRVGT WPF 4GKEJUCRHGN KP FGP (·PIGP QDGP -TQPG $KVMKP  4    &CX&KCMQX 449KP\*GPMGNURWTCVVTCMVKXGUUGJTUEJÌPGU'ZGORNCT 

1078

1078

1,5:1



4WDGN  5V 2GVGTUDWTI 5QIGPCPPVGT 6TCWGTTWDGN  I $TWUVDKNF N OKV WOIGNGIVGO /CPVGN   )GMTÌPVGT &QRRGNCFNGT OKV <GRVGT WPF 4GKEJUCRHGN KP FGP (·PIGP QDGP -TQPG $KVMKP  4    &CX&KCMQX 44#VVTCMVKXGUUGJTUEJÌPGU'ZGORNCT  'ZGORNCTFGT5COONWPI#PVQPKP2TQMQR6GKN#WMVKQP#WTGC0WOKUOCVKMC2TCI0T

32


KATHARINA I.

1079

1080

1081



4WDGN5V2GVGTUDWTII$KVMKPXCT&CX&KCMQXXCT



4WDGN5V2GVGTUDWTII8CTKCPVGOKV&TGKDNCVVWPVGTFGT5EJYCP\HGFGTFGU#FNGTU$KVMKP &CX&KCMQX 5GNVGPG8CTKCPVG#VVTCMVKXGU'ZGORNCTUGJTUEJÌPUGJTUEJÌPpXQT\ÒINKEJ





4WDGN5V2GVGTUDWTII$KVMKP 4 &CX&KCMQX  5GNVGPDGUQPFGTUKPFKGUGT'TJCNVWPI#VVTCMVKXGUUGJTUEJÌPGU'ZGORNCT





4WDGN 2QNVKPC 5V2GVGTUDWTII$KVMKP 4 &KCMQX

1083



5EJÌP



 44#VVTCMVKXGUUGJTUEJÌPGU'ZGORNCT



1,5:1

1,5:1



(CUVUGJTUEJÌP

)TKXPC5V2GVGTUDWTII$KVMKP 4 &KCMQX

'ZGORNCTFGT5COONWPI#PVQPKP2TQMQR6GKN#WMVKQP#WTGC0WOKUOCVKMC2TCI0T $KVMKPJCVFKGUGU'ZGORNCTFGT5COONWPI2TQMQRXGTUGJGPVNKEJUGKPGT0WOOGT\WIGQTFPGV



1084

1,5:1

1,5:1

'KPG2TQDGRT·IWPICWU5V2GVGTUDWTI 

4WDGN 2QNWRQNVKPPKM 5V2GVGTUDWTI2TQDGOKVIGTKHHGNVGO4CPFI)GMTÌPVGT&QRRGN CFNGT OKV <GRVGT WPF 4GKEJUCRHGN KP FGP (·PIGP QDGP -TQPG -WIGNP ÒDGT \YGK <GKNGP 5EJTKHV   ,CJTGUCPICDGWPF/ÒP\\GKEJGP$KVMKP 4 &KCMQX  8QPCNNGTITÌ­VGT5GNVGPJGKV)GNQEJVXQT\ÒINKEJp5VGORGNINCP\  33


PETER II.

1085

2:1

2:1

<#42'6'4++ 'KP&WMCVFGU<CTGP2GVGT++ 

&WMCV/QUMCW4QVGT/ÒP\JQHI)GJCTPKUEJVGU$TWUVDKNFTOKV.QTDGGTMTCP\WPFWOIG NGIVGO /CPVGN)GMTÌPVGT &QRRGNCFNGT OKV <GRVGT WPF 4GKEJUCRHGN KP FGP (·PIGP CWH FGT $TWUV 5V   )GQTIUUEJKNFQDGP-TQPG$KVMKP 4 &KCMQX(D  )1.&8QPITQ­GT5GNVGPJGKV5GJTUEJÌPpXQT\ÒINKEJ  /KV'ZRGTVKUGXQP+IQT5EJKT[CMQX5VCCVNKEJGUJKUVQTKUEJGU/WUGWO/QUMCW

1086

1087

1088

5KNDGTOÒP\GPFGU4QVGP/ÒP\JQHGUKP/QUMCW 

4WDGN/QUMCW4QVGT/ÒP\JQHI$KVMKP&CX&KCMQX  5GJTCVVTCMVKXGU'ZGORNCTOKVHGKPGT2CVKPCMN5VGORGNHGJNGTHCUVXQT\ÒINKEJ





4WDGN/QUMCW4QVGT/ÒP\JQHI$KVMKP&CX&KCMQX  5GJTCVVTCMVKXGU'ZGORNCTOKVHGKPGT2CVKPCHCUVXQT\ÒINKEJ



5KNDGTOÒP\GPFGU/QUMCWGT/ÒP\JQHGU-CFCUJGXUM[  34

4WDGN/QUMCW/ÒP\JQH-CFCUJGXUM[I$KVMKPHHXCT&CX&KCMQXHHXCT 2TCEJVGZGORNCT-N2T·IGUEJY·EJGXQT\ÒINKEJp5VGORGNINCP\




PETER II.

1089

1091

1090



4WDGN/QUMCW/ÒP\JQH-CFCUJGXUM[I$KVMKP 4 &CX&KCMQX  *ÒDUEJG2CVKPC5EJTÌVNKPIUHGJNGTUGJTUEJÌP





4WDGN/QUMCW/ÒP\JQH-CFCUJGXUM[I$KVMKPXCT&CX&KCMQXXCT  (CUVUGJTUEJÌP





 4WDGN 2QNVKPC   /QUMCW /ÒP\JQH -CFCUJGXUM[  I )GJCTPKUEJVGU $TWUVDKNF T OKV   .QTDGGTMTCP\ WPF WOIGNGIVGO /CPVGN)GMTÌPVGT &QRRGNCFNGT OKV <GRVGT WPF 4GKEJUCRHGN KP FGP   (·PIGPQDGP-TQPG$KVMKP 4 &KCMQX 442CVKPCUGJTUEJÌP 

1092

1,5:1

1,5:1

5KNDGTOÒP\GPFGT/ÒP\UV·VVG5V2GVGTUDWTI 

4WDGN  5V 2GVGTUDWTI  I )GJCTPKUEJVGU $TWUVDKNF T OKV .QTDGGTMTCP\ WPF WOIGNGIVGO   /CPVGN8KGT IGMTÌPVG /QPQITCOOG KPU -TGW\ IGUVGNNV KP FGT /KVVG FKG IGVGKNVG ,CJTGU\CJN      $KVMKPXCT&CX&KCMQXXCT 2TCEJVGZGORNCT(CUV5VGORGNINCP\  35


ANNA

1093



4WDGN5V2GVGTUDWTII$KVMKP&CX&KCMQX  9KP\5EJTÌVNKPIUHGJNGTUGJTUEJÌP



1094

1,5:1

1,5:1

'KPG-W-QRGMGFGU/QUMCWGT/ÒP\JQHGU-CFCUJGXUM[ 

-W-QRGMG/QUMCW/ÒP\JQH-CFCUJGXUM[I$KVMKPHHXCT&KCMQXHHXCT  #VVTCMVKXGUXQT\ÒINKEJGU'ZGORNCT

1095

1096



1097

<#4+0#00# 5KNDGTOÒP\GPFGU/QUMCWGT/ÒP\JQHGU-CFCUJGXUM[ 

4WDGN/QUMCW/ÒP\JQH-CFCUJGXUM[I$KVMKP 4 &CX&KCMQX  #VVTCMVKXGU'ZGORNCTUGJTUEJÌPpXQT\ÒINKEJ





4WDGN/QUMCW/ÒP\JQH-CFCUJGXUM[I$KVMKP 4 &CX&KCMQXXCT  4#VVTCMVKXGUUGJTUEJÌPGU'ZGORNCT





4WDGN/QUMCW/ÒP\JQH-CFCUJGXUM[I$KVMKPXCT&CX&KCMQXXCT  2CVKPCUGJTUEJÌPpXQT\ÒINKEJ



36


ANNA

1098

1099

1100



4WDGN/QUMCW/ÒP\JQH-CFCUJGXUM[I$KVMKPXCT&CX&KCMQXXCT  5GJTUEJÌP





4WDGN/QUMCW/ÒP\JQH-CFCUJGXUM[I$KVMKPXCT&CX&KCMQXXCT  5GJTUEJÌP





4WDGN/QUMCW/ÒP\JQH-CFCUJGXUM[I$KVMKPHH&CX&KCMQXXCT  5GJTUGNVGPDGUQPFGTUKPFKGUGT'TJCNVWPI9KP\<CKPGPFGCVVTCMVKXGUXQT\ÒINKEJGU'ZGORNCT



1101

1103

1102



4WDGN/QUMCW/ÒP\JQH-CFCUJGXUM[I$KVMKPXCT&CX&KCMQXXCT  5GJTUEJÌP





4WDGN/QUMCW/ÒP\JQH-CFCUJGXUM[I$KVMKP&CX&KCMQX  -N<CKPGPFGUGJTUEJÌP





4WDGN 2QNVKPC /QUMCW/ÒP\JQH-CFCUJGXUM[I8CTKCPVGOKV2WPMVGPKPFGT4ÒEMUGKVGP WOUEJTKHV$KVMKPHH&KCMQX 44#VVTCMVKXGU'ZGORNCTOKVHGKPGT2CVKPCUGJTUEJÌP

 37


ANNA

1104

1106

1105



4WDGN 2QNVKPC /QUMCW/ÒP\JQH-CFCUJGXUM[I$KVMKPXCT&KCMQXXCT  5GJTUEJÌP





4WDGN 2QNVKPC /QUMCW/ÒP\JQH-CFCUJGXUM[I$KVMKP&KCMQX  #VVTCMVKXGU'ZGORNCTOKVHGKPGT2CVKPCUGJTUEJÌP



5KNDGTOÒP\GPFGU4QVGU/ÒP\JQHGUKP/QUMCW 

4WDGN/QUMCW4QVGT/ÒP\JQHI$KVMKPXCT&CX&KCMQX  *ÒDUEJG2CVKPCUGJTUEJÌPUGJTUEJÌPpXQT\ÒINKEJ

1107

1108



1109

5KNDGTOÒP\GPFGT/ÒP\UV·VVG5V2GVGTUDWTI 

4WDGN5V2GVGTUDWTII$KVMKP 4 &CX&KCMQX  #VVTCMVKXGU'ZGORNCTOKVJÒDUEJGT2CVKPCUGJTUEJÌPpXQT\ÒINKEJ





4WDGN5V2GVGTUDWTII$KVMKPXCT&CX&KCMQXXCT  5GJTUEJÌPpXQT\ÒINKEJXQT\ÒINKEJ





4WDGN5V2GVGTUDWTII$KVMKPXCT&CX&KCMQX

38

 (CUVXQT\ÒINKEJXQT\ÒINKEJ




ANNA

2,5:1

1110

1110

'KPG2TQDGRT·IWPIHÒTGKPGP4WDGNFGU/QUMCWGT/ÒP\JQHGU-CFCUJGXUM[ 

4WDGN/QUMCW/ÒP\JQH-CFCUJGXUM[2TQDGOKV.CWDTCPFI)GMTÌPVGUWPFIGJCTPKUEJVGU $TWUVDKNFTOKVWOIGNGIVGO/CPVGN)GMTÌPVGT&QRRGNCFNGTOKV<GRVGTWPF4GKEJUCRHGNKPFGP(·PIGP CWH FGT $TWUV FGT 5V )GQTIUUEJKNF FGT &QRRGNCFNGT KUV WOIGDGP XQP FGT -GVVG FGU #PFTGCUQTFGPU   $KVMKP 4 &CXp \W &KCMQXp  8QPCNNGTITÌ­VGT5GNVGPJGKV#VVTCMVKXGU'ZGORNCTOKVHGKPGT2CVKPCUGJTUEJÌPpXQT\ÒINKEJ  'ZGORNCTFGT5COONWPI#PVQPKP2TQMQR6GKN#WMVKQP#WTGC0WOKUOCVKMC2TCI0T

39


IVAN III.

1111

2:1

2:1

<#4+8#0+++ 'KP-QRGMGP5VÒEMFGU4QVGP/ÒP\JQHGU/QUMCW 

-QRGMGP )TKXGPPKM /QUMCW4QVGT/ÒP\JQHI$KVMKP 4 &KCMQX  44*ÒDUEJG2CVKPCUGJTUEJÌP

1112



1112 1,5:1

5KNDGTOÒP\GPFGT/ÒP\UV·VVG5V2GVGTUDWTI 

4WDGN  5V 2GVGTUDWTI  I $TWUVDKNF T OKV .QTDGGTMTCP\ WOIGNGIVGO /CPVGN WPF   #PFTGCUQTFGP)GMTÌPVGT &QRRGNCFNGT OKV <GRVGT WPF 4GKEJUCRHGN KP FGP (·PIGP CWH FGT $TWUV   5V)GQTIUUEJKNFWOJGTFKG-GVVGFGU#PFTGCUQTFGPUQDGP-TQPG$KVMKP 4 &CX&KCMQX 5GJTUGNVGPDGUQPFGTUKPFKGUGT'TJCNVWPI 5GJTCVVTCMVKXGU'ZGORNCTOKVHGKPGT2CVKPCYKP\2T·IGUEJY·EJGXQT\ÒINKEJ 

1113

1113 1,5:1



 4WDGN 2QNVKPC   5V 2GVGTUDWTI  I $TWUVDKNF T OKV .QTDGGTMTCP\ WPF WOIGNGIVGO   /CPVGN)GMTÌPVGT &QRRGNCFNGT OKV <GRVGT WPF 4GKEJUCRHGN KP FGP (·PIGP CWH FGT $TWUV 5V )GQTIU   UEJKNFWOJGTFKG-GVVGFGU#PFTGCUQTFGPUQDGP-TQPG$KVMKP 4 &KCMQX  5GJTUGNVGPDGUQPFGTUKPFKGUGT'TJCNVWPI #VVTCMVKXGU'ZGORNCTOKVHGKPGT2CVKPCUGJTUEJÌPpXQT\ÒINKEJ  'ZGORNCTFGT5COONWPI#PVQPKP2TQMQR6GKN#WMVKQP#WTGC0WOKUOCVKMC2TCI0T

40


ELISABETH

1114

2:1

2:1

<#4+0'.+5#$'6* <YGK)QNFOÒP\GPFGU4QVGP/ÒP\JQHGUKP/QUMCW 

4WDGN/QUMCW4QVGT/ÒP\JQHI$KVMKP 4 &KCMQX 4 (D  )1.&8QT\ÒINKEJ



1115

2:1



2:1

4WDGN ,CJTGU\CJNKO5VGORGNCWUIG·PFGTV /QUMCW4QVGT/ÒP\JQHI$KVMKP 4  &KCMQX 4 (D )1.&5GJTUEJÌPpXQT\ÒINKEJ



1116

1,5:1

1,5:1

&TGK)QNFOÒP\GPFGT/ÒP\UV·VVG5V2GVGTUDWTI 

4WDGN ,CJTGU\CJNKO5VGORGNCWUIG·PFGTV 5V2GVGTUDWTI5QIGPCPPVGT5EQVV+ORGTKCN  I )GMTÌPVGU $TWUVDKNF T OKV WOIGNGIVGO /CPVGN8KGT IGMTÌPVG 9CRRGP KPU -TGW\ IGUVGNNV   KP FGT /KVVG #FNGTUEJKNF KP FGP 9KPMGNP FKG IGVGKNVG ,CJTGU\CJN        $KVMKP  4    &KCMQX 4 (D  )1.&44#VVTCMVKXGU'ZGORNCTOKVHGKPGT)QNFRCVKPC9KP\-TCV\GTUGJTUEJÌPpXQT\ÒINKEJ  41


ELISABETH

1117 1,5:1

1,5:1



 4WDGN  5V 2GVGTUDWTI  I )GMTÌPVGU $TWUVDKNF T OKV WOIGNGIVGO /CPVGN8KGT IGMTÌPVG   9CRRGP KPU -TGW\ IGUVGNNV KP FGT /KVVG #FNGTUEJKNF KP FGP 9KPMGNP FKG IGVGKNVG ,CJTGU\CJN   $KVMKP 4 &KCMQX 4 (D  )1.&5GJTUGNVGPDGUQPFGTUKPFKGUGT'TJCNVWPI 9KP\5COONGTRWP\GKO(GNFFGT8QTFGTUGKVGXQT\ÒINKEJGU'ZGORNCT  $GKFGT5COONGTRWP\GKO(GNFFGT8QTFGTUGKVGJCPFGNVGUUKEJWOFCU<GKEJGPFGT5COONWPI*WVVGP%\CRUMK

1118 1,5:1



1,5:1

 4WDGN  5V 2GVGTUDWTI  I )GMTÌPVGU $TWUVDKNF T OKV WOIGNGIVGO /CPVGN)GMTÌPVGT   &QRRGNCFNGT OKV <GRVGT WPF 4GKEJUCRHGN KP FGP (·PIGP CWH FGT $TWUV 5V )GQTIUUEJKNF QDGP -TQPG   $KVMKP 4 &KCMQX 4 (D )1.&48QT\ÒINKEJ 

1119

1120

1121

5KNDGTOÒP\GPFGU4QVGP/ÒP\JQHGUKP/QUMCW 

4WDGN/QUMCW4QVGT/ÒP\JQHI$KVMKP&CX&KCMQXXCT  445GJTUEJÌP





4WDGN/QUMCW4QVGT/ÒP\JQHI$KVMKPHHXCT&CX&KCMQXNGKEJVXCT *ÒDUEJG2CVKPCUGJTUEJÌP



'ZGORNCTFGT5COONWPI#PVQPKP2TQMQR6GKN#WMVKQP#WTGC0WOKUOCVKMC2TCI0T

 42

4WDGN/QUMCW4QVGT/ÒP\JQHI$KVMKPXCT&CX&KCMQX  (GKPG2CVKPCMN5EJTÌVNKPIUHGJNGTUGJTUEJÌP




ELISABETH

1122

1123

1124



4WDGN/QUMCW4QVGT/ÒP\JQHI$KVMKP&CX&KCMQX

5GJTUEJÌP





4WDGN/QUMCW4QVGT/ÒP\JQHI$KVMKP&CX&KCMQX  5GJTCVVTCMVKXGU'ZGORNCTOKVHGKPGT2CVKPCXQT\ÒINKEJXQT\ÒINKEJp5VGORGNINCP\





4WDGN/QUMCW4QVGT/ÒP\JQHI$KVMKP&CX&KCMQX  *ÒDUEJG2CVKPCUGJTUEJÌP



1125

1126

1127



4WDGN/QUMCW4QVGT/ÒP\JQHI$KVMKP&CX&KCMQX

5GJTUEJÌP





4WDGN/QUMCW4QVGT/ÒP\JQHI$KVMKP&CX&KCMQX

5GJTUEJÌP





4WDGN/QUMCW4QVGT/ÒP\JQHI$KVMKP&CX&KCMQX

5GJTUEJÌP

 43


ELISABETH

1128

1,5:1

1,5:1

5KNDGTOÒP\GPFGT/ÒP\UV·VVG5V2GVGTUDWTI 

4WDGN5V2GVGTUDWTII)GMTÌPVGU$TWUVDKNFTOKVWOIGNGIVGO/CPVGN)GMTÌPVGT&QRRGN CFNGT OKV <GRVGT WPF 4GKEJUCRHGN KP FGP (·PIGP CWH FGT $TWUV 5V )GQTIUUEJKNF WOJGT FKG -GVVG FGU   #PFTGCUQTFGPUQDGP-TQPG8CTKCPVGOKVUEJOCNGO$TWUVDKNF$KVMKP 4 &CX&KCMQX 4  5GJTUGNVGPDGUQPFGTUKPFKGUGT'TJCNVWPI *GTTNKEJG2CVKPCUGJTUEJÌPpXQT\ÒINKEJ 

1129

1131

1130



4WDGN5V2GVGTUDWTII$KVMKPXCT&CX&KCMQXXCT

8QT\ÒINKEJ





4WDGN5V2GVGTUDWTII$KVMKPNGKEJVXCT&CX&KCMQXNGKEJVXCT  5GJTCVVTCMVKXGU'ZGORNCTOKVJÒDUEJGT2CVKPCUGJTUEJÌPpXQT\ÒINKEJ





4WDGN5V2GVGTUDWTII$KVMKP&CX&KCMQX



44

*ÒDUEJG2CVKPCUGJTUEJÌP


ELISABETH

1133

1132



4WDGN5V2GVGTUDWTII$KVMKP&CX&KCMQX  (CUVXQT\ÒINKEJGU'ZGORNCTOKVUEJÌPGT2CVKPC





4WDGN5V2GVGTUDWTI5QIGPCPPVGT5EQVV4WDGNI$KVMKP&CX&KCMQX (CUVXQT\ÒINKEJ



1134

1134 1,5:1



4WDGN5V2GVGTUDWTI5QIGPCPPVGT5EQVV4WDGNI)GMTÌPVGU$TWUVDKNFTOKVWOIGNGIVGO /CPVGN)GMTÌPVGT&QRRGNCFNGTOKV<GRVGTWPF4GKEJUCRHGNKPFGP(·PIGPCWHFGT$TWUV5V)GQTIUUEJKNF WOJGTFKG-GVVGFGU#PFTGCUQTFGPUQDGP-TQPG$KVMKP&CX&KCMQX  5GJTUGNVGPKPFKGUGT'TJCNVWPI*GTTNKEJG2CVKPCXQT\ÒINKEJp5VGORGNINCP\

1135



1135 1,5:1



4WDGN5V2GVGTUDWTI5QIGPCPPVGT5EQVV4WDGNI$KVMKP&CX&KCMQX -N2TQDKGTURWTXQT\ÒINKEJp5VGORGNINCP\

 45


ELISABETH

1136

1138

1137



4WDGN5V2GVGTUDWTI5QIGPCPPVGT5EQVV4WDGNI$KVMKP&CX&KCMQXXCT #VVTCMVKXGU'ZGORNCTHCUVXQT\ÒINKEJ





4WDGN5V2GVGTUDWTI5QIGPCPPVGT5EQVV4WDGNI$KVMKP&CX&KCMQX *ÒDUEJG2CVKPCMN5EJTÌVNKPIUHGJNGTUGJTUEJÌP





4WDGN5V2GVGTUDWTI5QIGPCPPVGT5EQVV4WDGNI$KVMKP 4 &CX&KCMQX  4  -N5EJTÌVNKPIUHGJNGTXQT\ÒINKEJp5VGORGNINCP\



1139

1139 1,5:1



4WDGN5V2GVGTUDWTII$KVMKP&CX&KCMQXXCT 4   5GNVGPKPFKGUGT'TJCNVWPI2TCEJVGZGORNCT(CUV5VGORGNINCP\

1141 1140

1140



4WDGN5V2GVGTUDWTII$KVMKP 4 &CX&KCMQX  45EJÌPG2CVKPCHCUVXQT\ÒINKEJ



4WDGN 2QNVKPC 5V2GVGTUDWTII$KVMKP 4FQTVHCNUEJDGUEJTKGDGP &KCMQX 4  44<WO6GKNFWPMNGT$GNCICWHFGT4ÒEMUGKVGUGJTUEJÌP

46



 


ELISABETH

1142

1,5:1



1,5:1

 4WDGN 2QNVKPC   5V 2GVGTUDWTI  I )GMTÌPVGU $TWUVDKNF T OKV WOIGNGIVGO /CPVGN   )GMTÌPVGT &QRRGNCFNGT OKV <GRVGT WPF 4GKEJUCRHGN KP FGP (·PIGP CWH FGT $TWUV 5V )GQTIUUEJKNF   WOJGTFKG-GVVGFGU#PFTGCUQTFGPUQDGP-TQPG$KVMKP 4   8QPITQ­GT5GNVGPJGKV*ÒDUEJG2CVKPCUGJTUEJÌP 

1143 2:1



-QRGMGP5V2GVGTUDWTII$KVMKP&KCMQX

2:1

#VVTCMVKXGUXQT\ÒINKEJGU'ZGORNCT



1145

1144

1144

<YGK2T·IWPIGPHÒT.KXNCPFWPF'UVNCPF 

.KXQPCKUG 4WDGN \W  -QRGMGP   /QUMCW 4QVGT /ÒP\JQH IGRT·IV HÒT .KXNCPF WPF 'UVNCPF    I )GMTÌPVGU $TWUVDKNF T OKV WOIGNGIVGO /CPVGN)GMTÌPVGT &QRRGNCFNGT OKV <GRVGT WPF   4GKEJUCRHGNKPFGP(·PIGPCWHFGT$TWUVFKG5EJKNFGXQP4KICWPF4GXCNQDGP-TQPG$KVMKP 4  &CX&KCMQX 4  5GNVGPDGUQPFGTUKPFKGUGT'TJCNVWPI(GKPG2CVKPCUGJTUEJÌP  'ZGORNCTFGT5COONWPI#PVQPKP2TQMQR6GKN#WMVKQP#WTGC0WOKUOCVKMC2TCI0T   DGVGKNKIVG UKEJ <CTKP 'NKUCDGVJ CP GKPGT IGUCOVGWTQR·KUEJGP -QCNKVKQP IGIGP (TKGFTKEJ ++ XQP 2TGW­GP 5KG   UEJKEMVG 6TWRRGP KP FKG DCNVKUEJGP 2TQXKP\GP FGTGP JGTTUEJGPFG 1DGTUEJKEJV ITÌ­VGPVGKNU FGWVUEJ YCT /KV FGO   XQTNKGIGPFGP.KXQPCKUGYQNNVG'NKUCDGVJFKGKPFGP2TQXKP\GPI·PIKIGP/ÒP\GPGTUGV\GP



 .KXQPCKUG  4WDGN \W  -QRGMGP   /QUMCW 4QVGT /ÒP\JQH IGRT·IV HÒT .KXNCPF WPF   'UVNCPFI$KVMKPNGKEJVXCT&KCMQXNGKEJVXCT 4*ÒDUEJG2CVKPCUGJTUEJÌP  'ZGORNCTFGT5COONWPI#PVQPKP2TQMQR6GKN#WMVKQP#WTGC0WOKUOCVKMC2TCI0T

47


ELISABETH

1146

2T·IWPIGPHÒT1UVRTGW­GP 

)TQUEJGP-ÌPKIUDGTIIGRT·IVHÒT1UVRTGW­GPWPVGTTWUUKUEJGT$GUCV\WPII$KVMKP

4 &KCMQX 4 1NFE 445GJTUEJÌP



'ZGORNCTFGT5COONWPI#PVQPKP2TQMQR6GKN#WMVKQP#WTGC0WOKUOCVKMC2TCI0T

1,5:1



1147

1,5:1

)TÌUEJGT-ÌPKIUDGTIIGRT·IVHÒT1UVRTGW­GPWPVGTTWUUKUEJGT$GUCV\WPII8CTKCPVGOKV )415755KPFGT9GTVCPICDG$KVMKP 4 &KCMQX 4 1NFD  5GJTUGNVGPDGUQPFGTUKPFKGUGT'TJCNVWPI8QT\ÒINKEJ



'ZGORNCTFGT5COONWPI#PVQPKP2TQMQR6GKN#WMVKQP#WTGC0WOKUOCVKMC2TCI0T

1148

1148 1,5:1



 6CNGT  /QUMCW 4QVGT /ÒP\JQH IGRT·IV HÒT 1UVRTGW­GP WPVGT TWUUKUEJGT $GUCV\WPI  I   $KVMKP 4 &KCMQX 4 1NF  5GJTCVVTCMVKXGU'ZGORNCTOKVHGKPGT2CVKPCHCUVXQT\ÒINKEJ



'ZGORNCTFGT5COONWPI#PVQPKP2TQMQR6GKN#WMVKQP#WTGC0WOKUOCVKMC2TCI0T

1149 1150

1151



)TÌUEJGT/QUMCW4QVGT/ÒP\JQHIGRT·IVHÒT1UVRTGW­GPWPVGTTWUUKUEJGT$GUCV\WPII $KVMKPNGKEJVXCT 4 &KCMQXNGKEJVXCT1NFC 5GJTUEJÌP



5KNDGTLGVQP  WPUKIPKGTV CWH KJTG -TÌPWPI -TQPG FCTÒDGT 5VTCJNGP CWU 9QNMGP5KGDGP <GKNGP   5EJTKHVÒDGT&TGKDNCVVOOI$KVMKP 4 &KCMQX 4  5GJTUEJÌP





5KNDGTCDUEJNCI XQP FGP 5VGORGNP FGU &WMCVGP  CWH KJTGP 6QF CO  &G\GODGT  I $KVMKP    4 &KCMQX 4 (D\WC 45GJTUEJÌP





<YGK/GFCKNNGPFGT<CTKP'NKUCDGVJ

48


PETER III.

1152

1,5:1

1,5:1

<#42'6'4+++ <YGK)QNFOÒP\GPFGT/ÒP\UV·VVG5V2GVGTUDWTI 

 4WDGN  5V 2GVGTUDWTI  I )GJCTPKUEJVGU $TWUVDKNF T OKV WOIGNGIVGO /CPVGN8KGT   IGMTÌPVG9CRRGPKPU-TGW\IGUVGNNVKPFGT/KVVG#FNGTUEJKNFKPFGP9KPMGNPFKGIGVGKNVG,CJTGU\CJN $KVMKP 4 &KCMQX 4 (D  )1.&5GJTUGNVGPDGUQPFGTUKPFKGUGT'TJCNVWPI8QT\ÒINKEJGU2TCEJVGZGORNCT  'ZGORNCTFGT#WMVKQP(TKV\4WFQNH-ÒPMGT$GTNKP0T  2GVGT +++ -CTN 2GVGT 7NTKEJ XQP *QNUVGKP)QVVQTR  YCT 'PMGN FGU <CTGP 2GVGT + FGU )TQ­GP WPF YWTFG  KO   #NVGTXQP,CJTGPXQPUGKPGT6CPVGFGT<CTKP'NKUCDGVJ\WO6JTQPHQNIGTDGUVKOOV+O,CJTYWTFGGTOKV UGKPGT %QWUKPG FGT 2TKP\GUUKP 5QRJKG #WIWUVG XQP #PJCNV<GTDUV XGTJGKTCVGV 9·JTGPF 2GVGT GKPG INÒJGPFG   8GTGJTWPIHÒTFGPRTGW­KUEJGP-ÌPKI(TKGFTKEJ++GORHCPFJGIVGUGKPG)GOCJNKPFKGUR·VGTG<CTKP-CVJCTKPCFKG )TQ­G GKPG VKGHG #DPGKIWPI IGIGP 2TGW­GP #NU <CTKP 'NKUCDGVJ  UVCTD YCT FGT #WUUVKGI CWU FGO   5KGDGPL·JTKIGP-TKGIFWTEJFGP5QPFGTHTKGFGPUXGTVTCIXQP5V2GVGTUDWTIOKV2TGW­GPFKGGTUVG#OVUJCPFNWPI2GVGTU +++ +PPGPRQNKVKUEJ UEJT·PMVG 2GVGT FKG 2TKXKNGIKGP FGU #FGNU UVCTM GKP WPF DGICPP OKV FGT /QFGTPKUKGTWPI FGU   5VCCVUYGUGPU PCEJ RTGW­KUEJGO8QTDKNF&GT<CT\QIUKEJPKEJVPWTFKG(GKPFUEJCHVFGUTWUUKUEJGP#FGNUUQPFGTP CWEJUGKPGTGKIGPGP(TCW\WOKVFGTGTGKPGWPINÒEMNKEJG'JGHÒJTVG&KG5KVWCVKQPGUMCNKGTVGWPFCO,WNK YWTFG -CVJCTKPC \WT <CTKP CWUIGTWHGP WPF 2GVGT HÒT VQV GTMN·TV &GT <CT YCT LGFQEJ ICT PKEJV VQV WPF YWTFG XQP   FKGUGP)GUEJGJPKUUGPXQNNMQOOGPÒDGTTCUEJV9GKNGT\ÌIGTVGIGNCPIGUFGP#WHUV·PFKUEJGPKJPIGHCPIGP\WPGJOGP WPF\WT#DFCPMWPI\W\YKPIGP2GVGTYWTFGKPFCU.CPFJCWU4QRUEJDGK5V2GVGTUDWTIIGDTCEJVWPFFQTVCO ,WNKWPVGTDKUJGWVGWPIGMN·TVGP7OUV·PFGPGTOQTFGV5GKPG)GOCJNKPTGIKGTVGHCUV,CJTGNCPIFCUTWUUKUEJG 4GKEJ

1153

1,5:1



1,5:1

 4WDGN  5V 2GVGTUDWTI  I )GJCTPKUEJVGU $TWUVDKNF T OKV WOIGNGIVGO /CPVGN8KGT IG   MTÌPVG 9CRRGP KPU -TGW\ IGUVGNNV KP FGT /KVVG #FNGTUEJKNF KP FGP 9KPMGNP FKG IGVGKNVG ,CJTGU\CJN   $KVMKP 4 &KCMQX 4 (D  )1.&445GJTCVVTCMVKXGU'ZGORNCTOKVHGKPGT)QNFRCVKPCUGJTUEJÌPpXQT\ÒINKEJ  49


PETER III.

1154

'KPUKNDGTPGT4WDGNFGU4QVGP/ÒP\JQHGUKP/QUMCW 

4WDGN/QUMCW4QVGT/ÒP\JQHI$KVMKP 4 &CX&KCMQX

5GJTUEJÌP



1155

1,5:1

1,5:1

5KNDGTOÒP\GPFGT/ÒP\UV·VVG5V2GVGTUDWTI 

4WDGN  5V 2GVGTUDWTI  I )GJCTPKUEJVGU $TWUVDKNF T OKV WOIGNGIVGO /CPVGN)GMTÌPVGT   &QRRGNCFNGTOKV<GRVGTWPF4GKEJUCRHGNKPFGP(·PIGPCWHFGT$TWUV5V)GQTIUUEJKNFWOJGTFKG-GVVG FGU#PFTGCUQTFGPUQDGP-TQPG$KVMKP&CX&KCMQX 4   5GJTUGNVGPKPFKGUGT'TJCNVWPI(GKPG2CVKPCHCUV5VGORGNINCP\ 

1156

1156 1,5:1

 50

4WDGN5V2GVGTUDWTII$KVMKP&CX&KCMQX 4 

45GJTUEJÌPpXQT\ÒINKEJ




PETER III.

1157

1,5:1



1,5:1

4WDGN  5V 2GVGTUDWTI  I )GJCTPKUEJVGU $TWUVDKNF T OKV WOIGNGIVGO /CPVGN)GMTÌPVGT   &QRRGNCFNGTOKV<GRVGTWPF4GKEJUCRHGNKPFGP(·PIGPCWHFGT$TWUV5V)GQTIUUEJKNFWOJGTFKG-GVVG FGU#PFTGCUQTFGPUQDGP-TQPG/KV4CPFUEJTKHV$KVMKP 4 &CX&KCMQX  5GNVGPKPFKGUGT'TJCNVWPI #VVTCMVKXGU'ZGORNCTOKVJGTTNKEJGT2CVKPCXQT\ÒINKEJ 

1158

1,5:1



1,5:1

4WDGN 2QNVKPC 5V2GVGTUDWTII)GJCTPKUEJVGU$TWUVDKNFTOKVWOIGNGIVGO/CPVGN )GMTÌPVGT &QRRGNCFNGT OKV <GRVGT WPF 4GKEJUCRHGN KP FGP (·PIGP CWH FGT $TWUV 5V )GQTIUUEJKNF   WOJGTFKG-GVVGFGU#PFTGCUQTFGPUQDGP-TQPG$KVMKP 4 &KCMQX 4   5GNVGPDGUQPFGTUKPFKGUGT'TJCNVWPI(GKPG2CVKPCCVVTCMVKXGUHCUVXQT\ÒINKEJGU'ZGORNCT 

51


KATHARINA II.

1159

1,5:1

1,5:1

<#4+0-#6*#4+0#++ )QNFOÒP\GPFGT/ÒP\UV·VVG5V2GVGTUDWTI 

4WDGN5V2GVGTUDWTII)GMTÌPVGU$TWUVDKNFTOKVWOIGNGIVGO/CPVGN8KGTIGMTÌPVG 9CRRGPKPU-TGW\IGUVGNNVKPFGT/KVVG#FNGTUEJKNFKPFGP9KPMGNPFKGIGVGKNVG,CJTGU\CJN $KVMKP 4 &KCMQX 4 (D )1.&5GJTUGNVGPDGUQPFGTUKPFKGUGT'TJCNVWPI 5GJTCVVTCMVKXGU'ZGORNCTOKVHGKPGT)QNFRCVKPCXQT\ÒINKEJ5VGORGNINCP\ 

1160

1,5:1

1,5:1



4WDGN5V2GVGTUDWTII)GMTÌPVGU$TWUVDKNFTOKVWOIGNGIVGO/CPVGN8KGTIGMTÌPVG 9CRRGP KPU -TGW\ IGUVGNNV KP FGT /KVVG #FNGTUEJKNF KP FGP 9KPMGNP FKG IGVGKNVG ,CJTGU\CJN   $KVMKP 4 &KCMQX 4 (D )1.&5GJTUGNVGPGT,CJTICPI (CUVXQT\ÒINKEJ 

1161

1161 1,5:1

 52

4WDGN5V2GVGTUDWTII$KVMKP 4 &KCMQX(DC  )1.&4-N5EJTÌVNKPIUHGJNGTUGJTUEJÌP




KATHARINA II.

1162

1,5:1



1,5:1

4WDGN5V2GVGTUDWTII)GMTÌPVGU$TWUVDKNFTOKVWOIGNGIVGO/CPVGN8KGTIGMTÌPVG 9CRRGPKPU-TGW\IGUVGNNVKPFGT/KVVG#FNGTUEJKNFKPFGP9KPMGNPFKGIGVGKNVG,CJTGU\CJN $KVMKP 4 &KCMQX 4 (DC  )1.&5GNVGPDGUQPFGTUKPFKGUGT'TJCNVWPI5GJTCVVTCMVKXGUXQT\ÒINKEJGU'ZGORNCT



1163

1,5:1



1,5:1

4WDGN ,CJTGU\CJNKO5VGORGNCWUIG·PFGTV 5V2GVGTUDWTII)GMTÌPVGU$TWUVDKNF TOKVWOIGNGIVGO/CPVGN8KGTIGMTÌPVG9CRRGPKPU-TGW\IGUVGNNVKPFGT/KVVG#FNGTUEJKNFKPFGP 9KPMGNPFKGIGVGKNVG,CJTGU\CJN$KVMKP 4 &KCMQX 4 (DC  )1.&4(CUVXQT\ÒINKEJ



1164

1,5:1



1,5:1

4WDGN5V2GVGTUDWTII)GMTÌPVGU$TWUVDKNFTOKVWOIGNGIVGO/CPVGN8KGTIGMTÌPVG 9CRRGPKPU-TGW\IGUVGNNVKPFGT/KVVG#FNGTUEJKNFKPFGP9KPMGNPFKGIGVGKNVG,CJTGU\CJN $KVMKP 4 &KCMQX 4 (DD )1.&44#VVTCMVKXGUXQT\ÒINKEJGU'ZGORNCT

 53


KATHARINA II.

1165

1,5:1



1,5:1

 4WDGN  5V 2GVGTUDWTI  I )GMTÌPVGU $TWUVDKNF T OKV .QTDGGTMTCP\ WPF WOIGNGIVGO   /CPVGN8KGTIGMTÌPVG9CRRGPKPU-TGW\IGUVGNNVKPFGT/KVVG#FNGTUEJKNFKPFGP9KPMGNPFKGIGVGKNVG ,CJTGU\CJN$KVMKP 4 &KCMQX(DD )1.&4(CUVXQT\ÒINKEJ 

1166

1,5:1



1,5:1

 4WDGN  5V 2GVGTUDWTI  I )GMTÌPVGU $TWUVDKNF T OKV WOIGNGIVGO /CPVGN8KGT IGMTÌPVG   9CRRGPKPU-TGW\IGUVGNNVKPFGT/KVVG#FNGTUEJKNFKPFGP9KPMGNPFKGIGVGKNVG,CJTGU\CJN $KVMKP 4 &KCMQX 4 (DC )1.&5GNVGPDGUQPFGTUKPFKGUGT'TJCNVWPI 9KP\5COONGTRWP\GKO(GNFFGT8QTFGTUGKVGXQT\ÒINKEJGU'ZGORNCT  $GKFGT5COONGTRWP\GKO(GNFFGT8QTFGTUGKVGJCPFGNVGUUKEJWOFCU<GKEJGPFGT5COONWPI*WVVGP%\CRUMK

1167

1,5:1

 54

1,5:1

4WDGN5V2GVGTUDWTII$KVMKP 4 &KCMQX 4 (DC  )1.&49KP\-TCV\GTXQT\ÒINKEJGU'ZGORNCT




KATHARINA II.

1168 1,5:1

1,5:1



 4WDGN  5V 2GVGTUDWTI  I )GMTÌPVGU $TWUVDKNF T OKV WOIGNGIVGO /CPVGN8KGT IGMTÌPVG   9CRRGPKPU-TGW\IGUVGNNVKPFGT/KVVG#FNGTUEJKNFKPFGP9KPMGNPFKGIGVGKNVG,CJTGU\CJN $KVMKP 4 &KCMQX 4 (DC )1.&4(CUVXQT\ÒINKEJ 

1169

1170

1171



4WDGN5V2GVGTUDWTII$KVMKP 4 &KCMQX 4 (DC  )1.&445GJTUEJÌPpXQT\ÒINKEJ





4WDGN5V2GVGTUDWTII$KVMKP 4 &KCMQX 4 (DD  )1.&45GJTUEJÌPpXQT\ÒINKEJ





4WDGN5V2GVGTUDWTII$KVMKP 4 &KCMQX 4 (DD  )1.&44(CUVUGJTUEJÌP



1172

2:1

2:1



4WDGN5V2GVGTUDWTII$KVMKP 4 &KCMQX(D  )1.&4#VVTCMVKXGUHCUVXQT\ÒINKEJGU'ZGORNCT

1174

1173



1174

5KNDGTOÒP\GPFGU4QVGP/ÒP\JQHGUKP/QUMCW 

4WDGN/QUMCW4QVGT/ÒP\JQHI$KVMKP&CX&KCMQX  'VYCURQTÌUGT5EJTÌVNKPIXQT\ÒINKEJ





-QRGMGP/QUMCW4QVGT/ÒP\JQHI$KVMKP&KCMQX



5GJTUEJÌP

55


KATHARINA II.

1176

1175



-QRGMGP/QUMCWI$KVMKP&KCMQX

*GTTNKEJG2CVKPCHCUVXQT\ÒINKEJ





-QRGMGP )TKXGPPKM /QUMCW4QVGT/ÒP\JQHI$KVMKP 4 &KCMQX  45GJTUEJÌP



1178

1177

 

5KNDGTOÒP\GPFGT/ÒP\UV·VVG5V2GVGTUDWTI

4WDGN5V2GVGTUDWTII$KVMKP&CX&KCMQX 4WDGN5V2GVGTUDWTII$KVMKP&CX&KCMQX

5GJTUEJÌPpXQT\ÒINKEJ (CUVXQT\ÒINKEJ

 

1180

1179

1179 1,5:1



4WDGN5V2GVGTUDWTII$KVMKP&CX&KCMQX  2TCEJVGZGORNCT8QT\ÒINKEJp5VGORGNINCP\5VGORGNINCP\



4WDGN5V2GVGTUDWTII$KVMKP&CX&KCMQX

1181

-N-TCV\GTHCUVXQT\ÒINKEJ

 

1181 1,5:1

 56

4WDGN5V2GVGTUDWTII$KVMKP&CX&KCMQX  2TCEJVGZGORNCT(CUV5VGORGNINCP\




KATHARINA II.

1182

1183

1184



4WDGN5V2GVGTUDWTII$KVMKP&CX&KCMQX

8QT\ÒINKEJ





4WDGN5V2GVGTUDWTII$KVMKP&CX&KCMQX  2TCEJVGZGORNCT(CUV5VGORGNINCP\





4WDGN5V2GVGTUDWTII$KVMKP 4 &CX&KCMQX 4   5GJTUGNVGPDGUQPFGTUKPFKGUGT'TJCNVWPI#VVTCMVKXGU'ZGORNCTOKVHGKPGT2CVKPCXQT\ÒINKEJ



1185

1187

1186



4WDGN5V2GVGTUDWTII$KVMKP&CX&KCMQX  2TCEJVGZGORNCT9KP\5EJTÌVNKPIUHGJNGTCO4CPFXQT\ÒINKEJp5VGORGNINCP\





4WDGN5V2GVGTUDWTII$KVMKP&CX&KCMQX 4   (GKPG2CVKPCXQT\ÒINKEJXQT\ÒINKEJp5VGORGNINCP\





4WDGN5V2GVGTUDWTII)GMTÌPVGU$TWUVDKNFTOKV.QTDGGTMTCP\WPFWOIGNGIVGO/CPVGN )GMTÌPVGT &QRRGNCFNGT OKV <GRVGT WPF 4GKEJUCRHGN KP FGP (·PIGP CWH FGT $TWUV 5V )GQTIUUEJKNF   WOJGTFKG-GVVGFGU#PFTGCUQTFGPU$KVMKP&CX&KCMQX 4   5GJTCVVTCMVKXGU'ZGORNCTXQT\ÒINKEJ  57


KATHARINA II.

1188

1188 1,5:1



4WDGN5V2GVGTUDWTII$KVMKP&CX&KCMQX 4   45GJTCVVTCMVKXGU'ZGORNCTOKVHGKPGT2CVKPCXQT\ÒINKEJ

1189



1189 1,5:1



4WDGN5V2GVGTUDWTII$KVMKP&CX&KCMQX 4   5GNVGPDGUQPFGTUKPFKGUGT'TJCNVWPI8QT\ÒINKEJp5VGORGNINCP\

1191



1192

1190



4WDGN 2QNVKPC 5V2GVGTUDWTII$KVMKP 4 &KCMQX 4 

 4(CUVUGJTUEJÌP





4WDGN 2QNWRQNVKPPKM 5V2GVGTUDWTII$KVMKP&KCMQX 4   *ÒDUEJG2CVKPCCVVTCMVKXGUHCUVXQT\ÒINKEJGU'ZGORNCT



'ZGORNCTFGT5COONWPI#PVQPKP2TQMQR6GKN#WMVKQP#WTGC0WOKUOCVKMC2TCI0T

 58

4WDGN 2QNWRQNVKPPKM 5V2GVGTUDWTII$KVMKP&KCMQX 4   #VVTCMVKXGU'ZGORNCTHCUVXQT\ÒINKEJ




KATHARINA II.

1194

1193

1193 1,5:1

1,5:1



4WDGN 2QNWRQNVKPPKM 5V2GVGTUDWTII$KVMKP&KCMQX 4 

45GJTUEJÌP





4WDGN 2QNWRQNVKPPKM 5V2GVGTUDWTII$KVMKP&KCMQX 4   #VVTCMVKXGU'ZGORNCTHCUVXQT\ÒINKEJ



'ZGORNCTFGT5COONWPI#PVQPKP2TQMQR6GKN#WMVKQP#WTGC0WOKUOCVKMC2TCI0T

1195

2:1

2:1



 4WDGN 2QNWRQNVKPPKM   5V 2GVGTUDWTI +P 752NCUVKMJQNFGT FGT 2%)5 OKV FGT $GYGTVWPI   /5$KVMKP&KCMQX 4   W­GTUVUGNVGPKPFKGUGT'TJCNVWPI2TCEJVGZGORNCT(CUV5VGORGNINCP\ 

1196

1,5:1

1,5:1

'KPÒDGTRT·IVGU-W-QRGMGP5VÒEMXQP 

-W -QRGMGP  WPDGUVKOOVG /ÒP\UV·VVG  I 5KEJVDCT ÒDGTRT·IV CWH GKPGO HTÒJGTGP   -W-QRGMGP5VÒEM -CVJCTKPCU ++ )GMTÌPVGU /QPQITCOO WOJGT  -WIGNP9GTVCPICDG KP FTGK   <GKNGPKO#DUEJPKVV,CJTGU\CJN$KVMKP 4 &KCMQX 4   8QPITÌ­VGT5GNVGPJGKVªDGTRT·IWPIUURWTGPUGJTUEJÌP  /KV'ZRGTVKUGFGU5VCCVNKEJGP*KUVQTKUEJGP/WUGWOUKP/QUMCW

59


KATHARINA II.

3:1

1197

1197

'KPG2TQDGRT·IWPIHÒTGKP-QRGMGP5VÒEMFGT/ÒP\UV·VVG5V2GVGTUDWTI 

 -QRGMGP  5V 2GVGTUDWTI 2TQDG  I )GMTÌPVGU $TWUVDKNF T OKV WOIGNGIVGO /CPVGN   )GMTÌPVGT&QRRGNCFNGTOKV<GRVGTWPF4GKEJUCRHGNKPFGP(·PIGPCWHFGT$TWUV5EJKNFOKVFGT9GTV\CJN WPVGP5EJTKHVDCPFOKVFGT,CJTGU\CJNQDGP-TQPGWOJGT-WIGNP/KV'ZRGTVKUGFGU-WNVWUOKPK UVGTKWOU FGT TWUUKUEJGP (ÌFGTCVKQP OKV FGO 5VCCVNKEJGP *KUVQTKUEJGP /WUGWO KP /QUMCW $KVMKP   

4 &KCMQX 4  8QPCNNGTITÌ­VGT5GNVGPJGKV0WT'ZGORNCTGIGRT·IV 5GJTCVVTCMVKXGUXQT\ÒINKEJGU'ZGORNCT  'ZGORNCTFGT#WMVKQP)QTP[/QUEJ/ÒPEJGP0T

1198

2T·IWPIGPHÒT5KDKTKGP  60

-W&GPIC5W\WP -QN[XCP HÒT5KDKTKGPI$KVMKP&KCMQX

(CUVXQT\ÒINKEJ




KATHARINA II.

1199

1,5:1



1,5:1

 -QRGMGP  5V 2GVGTUDWTI HÒT 5KDKTKGP 0QXQFGN FGT 2TQDG  I )GMTÌPVGU /QPQITCOO   WOJGT'KEJGPWPF.QTDGGT\YGKI<YGK<QDGNJCNVGPIGOGKPUCO\YGKIGMTGW\VG2HGKNGOKVGKPGOSWGT IGNGIVGP$QIGPFCTÒDGTJCNVGPUKGGKPG-TQPG$KVMKP* 4 &KCMQX0 4   8QPITQ­GT5GNVGPJGKV2TCEJVGZGORNCTOKVJGTTNKEJGT2CVKPCHCUV5VGORGNINCP\ 

1200

1,5:1

1,5:1

5KNDGTOÒP\GPFGT/ÒP\UV·VVG(GQFQUKC 

 -QRGMGP  (GQFQUKC -TKO   I )GMTÌPVGU /QPQITCOO FCTWPVGT FKG ,CJTGU\CJN9GTV   \CJNWOJGT-WIGNPWPVGPFCU/ÒP\UV·VVGP\GKEJGP6Ü/$KVMKP 4 &KCMQX 4  44#VVTCMVKXGU'ZGORNCTOKVHGKPGT2CVKPCXQT\ÒINKEJ 

1201

1,5:1



1,5:1

-QRGMGP(GQFQUKC -TKO I$KVMKP 4 &KCMQX 4   44.GKEJVG1DGTHN·EJGPMQTTQUKQPUGJTUEJÌP

 61


KATHARINA II.

1202

1,5:1

1,5:1

-W-QRGMGP5VÒEMGFGTUEJYGFKUEJGP/ÒP\UV·VVG#XGUVC 

-W -QRGMGP  5EJYGFKUEJG 2T·IWPI CWU FGT /ÒP\UV·VVG #XGUVC  I )GMTÌPVGU /QPQ   ITCOO \W FGP 5GKVGP FKG IGVGKNVG ,CJTGU\CJN    WOJGT .QTDGGT WPF 2CNO\YGKI)GMTÌPVGT   &QRRGNCFNGT OKV <GRVGT WPF 4GKEJUCRHGN KP FGP (·PIGP CWH FGT $TWUV 5V )GQTIUUEJKNF WOJGT FKG   -GVVGFGU#PFTGCUQTFGPUWPVGP/ÒP\\GKEJGP'/WPF5EJTKHVDCPFQDGP-TQPG#JNUVTÌO :4  $KVMKP 4 &KCMQX 4  8QPCNNGTITÌ­VGT5GNVGPJGKV5GJTUEJÌPGU'ZGORNCT  'ZGORNCTFGT#WMVKQP(TKV\4WFQNH-ÒPMGT1UPCDTÒEM0T  $GK FGO XQTNKGIGPFGP WPF PCEJHQNIGPFGP UGJT UGNVGPGP -WRHGTUVÒEMGP JCPFGNV GU UKEJ WO GKPG UEJYGFKUEJG   -TKGIURT·IWPICWUFGOTWUUKUEJUEJYGFKUEJGP-TKGIXQP)WUVCX+++NKG­KPUGKPGT/ÒP\UV·VVG#XGUVC -QRGMGP5VÒEMG JGTUVGNNGP OKV FGPGP UGKPG 6TWRRGP KP FGP )TGP\TGIKQPGP TWUUKUEJG #TDGKVGT DG\CJNGP MQPPVGP   &CDGK DGJCWRVGVGP FKG 5EJYGFGP FCUU UKG FKG -WRHGTOÒP\GP XQP TWUUKUEJGP 5EJKHHGP GTDGWVGV J·VVGP 6CVU·EJNKEJ   YCTGPFKGUEJYGFKUEJGP-QRGMGP5VÒEMGHÒTFCUCNNIGOGKPG2WDNKMWOMCWOXQPFGPTWUUKUEJGP\WWPVGTUEJGKFGP 8GTINGKEJVOCPFKGTWUUKUEJGPOKVFGPUEJYGFKUEJGP2T·IWPIGPUQH·NNVLGFQEJUQHQTVFGTIGTCFGCWHTGEJVG5VKNFGT <KHHGTPDGKFGP2T·IWPIGPCWU#XGUVCCWH#NNGUEJYGFKUEJGP-QRGMGP5VÒEMGYWTFGPKP#XGUVCJGTIGUVGNNV &COKV UKG KO TWUUKUEJGP <CJNWPIUXGTMGJT PKEJV UQHQTV CWHHKGNGP RT·IVG OCP FKG 5VÒEMG OKV XGTUEJKGFGPGP   ,CJTGU\CJNGP     &KGUG -TKGIURT·IWPI IGJÌTV \W FGP IGNFIGUEJKEJVNKEJ DGUQPFGTU KPVGTGUUCPVGP   'TUEJGKPWPIGPWPF\WFGPIGUWEJVGP5GNVGPJGKVGPFGTTWUUKUEJGPWPFUEJYGFKUEJGP0WOKUOCVKM

1203

1203

1,5:1



62

-W-QRGMGP5EJYGFKUEJG2T·IWPICWUFGT/ÒP\UV·VVG#XGUVCI)GMTÌPVGU/QPQITCOO \W FGP 5GKVGP FKG IGVGKNVG ,CJTGU\CJN    WOJGT .QTDGGT WPF 2CNO\YGKI)GMTÌPVGT &QRRGNCFNGT   OKV <GRVGT WPF 4GKEJUCRHGN KP FGP (·PIGP CWH FGT $TWUV 5V )GQTIUUEJKNF WOJGT FKG -GVVG FGU   #PFTGCUQTFGPUWPVGP/ÒP\\GKEJGP'/WPF5EJTKHVDCPFQDGP-TQPG#JNUVTÌOC$KVMKP 4  &KCMQX 4 5/* 445GJTUEJÌP 


KATHARINA II.

1,5:1

1204

1204

/GFCKNNGPFGT<CTKP-CVJCTKPC++ 

)QNFOGFCKNNG \W  &WMCVGP  XQP 6 +YCPQHH WPF 5 ,WFKP CWH KJTG -TÌPWPI KP /QUMCW CO   5GRVGODGT)GMTÌPVGU$TWUVDKNFTOKVWOIGNGIVGO/CPVGN&KG2GTUQPKHKMCVKQPGPFGU)NCWDGPUWPF 4W­NCPFU JCNVGP GKPGP -TCP\ OKV FGO /QPQITCOO -CVJCTKPCU ++ ÒDGT GKPGP #NVCT CWH FGO GKPG   TCWEJGPFG 1RHGTUEJCNG UVGJV QDGP FKG RGTUQPKHK\KGTVG 8QTUGJWPI OKV -TQPG WPF <GRVGT KP 9QNMGP   OOI&KCMQX )1.&8QPCNNGTITÌ­VGT5GNVGPJGKV5GJTUEJÌPpXQT\ÒINKEJ 

1205



5KNDGTLGVQP  WPUKIPKGTV CWH KJTG -TÌPWPI KP /QUMCW CO  5GRVGODGT 5KGDGP <GKNGP 5EJTKHV   QDGP-TQPG-TQPGFCTÒDGTUVTCJNGPFGU&TGKGEMOOI$KVMKP&KCMQX  4*ÒDUEJG2CVKPCUGJTUEJÌPpXQT\ÒINKEJ

 63


KATHARINA II.

1206



-NKRRGPHÌTOKIG5KNDGTOGFCKNNGWPUKIPKGTV2T·UGP\\GKEJGPFGT-CKUGTNKEJGP#MCFGOKGFGT9KUUGP UEJCHVGP 5VTCJNGPFGU /QPQITCOO KP \YGK \WUCOOGPIGDWPFGPGP .QTDGGT\YGKIGP$WEJ CWH 5QEMGN   FCTCWH'WNGCWH)NQDWUXQTFGO)NQDWU%CFWEGWU5EJNÒUUGNWPF.GKGTZOOI &KCMQX 4  5GJTUEJÌP



1207



5KNDGTOGFCKNNGXQP6+YCPQHHCWHKJTG4GKUGKPFKG-TKOWPFCWHKJTL·JTKIGU4GIKGTWPIULWDK N·WO)GMTÌPVGU$TWUVDKNFTOKVWOIGNGIVGO/CPVGN.CPFMCTVGOKVFGT4GKUGTQWVGXQP5V2GVGTUDWTI KPFKG-TKOOOI&KCMQX 4   8QPITQ­GT5GNVGPJGKV1TKIKPCNRT·IWPI(GKPG2CVKPCYKP\4CPFHGJNGTUGJTUEJÌPpXQT\ÒINKEJ



1208



5KNDGTOGFCKNNG  XQP 6 +YCPQHH (ÒT 6CRHGTMGKV KP HKPPKUEJGP )GY·UUGTP )GMTÌPVGU $TWUVDKNF T   OKVWOIGNGIVGO/CPVGN5GEJU<GKNGP5EJTKHVOOI$KVMKP/ 4 &KCMQX 4  4'PVHGTPVG6TCIGÌUGUGJTUEJÌPUGJTUEJÌPpXQT\ÒINKEJ 

1209





64

1210

5KNDGTLGVQP  WPUKIPKGTV CWH FGP (TKGFGP XQP 8·T·N· 5ÒFQUVHKPPNCPF  \YKUEJGP 5EJYGFGP WPF   4W­NCPFCO#WIWUV PCEJITGIQTKCPKUEJGO-CNGPFGTCO#WIWUV 1NKXGP\YGKIKP.QTDGGTMTCP\ (ÒPH<GKNGP5EJTKHVOOI$KVMKP 4 &KCMQX 4  45GJTUEJÌPpXQT\ÒINKEJ



5KNDGTLGVQPWPUKIPKGTVCWHFGP(TKGFGPOKVFGT6ÒTMGK)GMTÌPVGU/QPQITCOOWOJGT.QTDGGT MTCP\8KGT<GKNGP5EJTKHVOOI$KVMKP 4 &KCMQX 4   2TCEJVXQNNG2CVKPCXQT\ÒINKEJ




PAUL I.

1211

2:1

2:1

<#42#7.+ 'KP4WDGN5VÒEMFGT/ÒP\UV·VVG5V2GVGTUDWTI 

4WDGN5V2GVGTUDWTII$KVMKP(D5EJN  )1.&44CPFHGJNGTGVYCUIGYGNNVUGJTUEJÌP

1212



1212 1,5:1

5KNDGTOÒP\GPFGT/ÒP\UV·VVG5V2GVGTUDWTI 

4WDGN5V2GVGTUDWTII)GMTÌPVGT&QRRGNCFNGTOKV<GRVGTWPF4GKEJUCRHGNKPFGP(·PIGP CWH FGT $TWUV 5V )GQTIUUEJKNF WOJGT FKG -GVVG FGU #PFTGCUQTFGPU QDGP -TQPG8GT\KGTVG 6CHGN OKV   XKGT<GKNGP5EJTKHV$KVMKP 4 &CX  44#VVTCMVKXGU'ZGORNCTOKVHGKPGT2CVKPCXQT\ÒINKEJ 

1213

1213 1,5:1



4WDGN5V2GVGTUDWTII8KGTIGMTÌPVG/QPQITCOOGKPU-TGW\IGUVGNNVKPFGT/KVVGTÌOK UEJG<KHHGT+8GT\KGTVG6CHGNOKVXKGT<GKNGP5EJTKHV$KVMKP 4 &CX  5GNVGPDGUQPFGTUKPFKGUGT'TJCNVWPI 5GJTCVVTCMVKXGU'ZGORNCTOKVJGTTNKEJGT2CVKPCXQT\ÒINKEJ

 65


PAUL I.

1214



1214

1,5:1

4WDGN5V2GVGTUDWTII8KGTIGMTÌPVG/QPQITCOOGKPU-TGW\IGUVGNNVKPFGT/KVVGTÌOK UEJG<KHHGT+8GT\KGTVG6CHGNOKVXKGT<GKNGP5EJTKHV$KVMKP 4 &CX  44(GKPG2CVKPCYKP\-TCV\GTHCUVXQT\ÒINKEJ



1215

1215 1,5:1



4WDGN5V2GVGTUDWTII$KVMKP&CX  5GJTCVVTCMVKXGU'ZGORNCTOKVHGKPGT2CVKPCXQT\ÒINKEJp5VGORGNINCP\

1216



1218



1217

4WDGN5V2GVGTUDWTII$KVMKP&CX  5GJTCVVTCMVKXGU'ZGORNCTOKVHGKPGT2CVKPCXQT\ÒINKEJp5VGORGNINCP\





4WDGN5V2GVGTUDWTII$KVMKP&CX

(CUVXQT\ÒINKEJ





4WDGN 2QNVKPC 5V2GVGTUDWTII$KVMKP  5GJTUGNVGPKPFKGUGT'TJCNVWPI2TCEJVXQNNG2CVKPC5EJTÌVNKPIUHGJNGTHCUV5VGORGNINCP\



66


ALEXANDER I.

1219

2:1



2:1

-QRGMGP5V2GVGTUDWTII$KVMKP  *ÒDUEJG2CVKPCYKP\5EJTÌVNKPIUHGJNGTHCUVXQT\ÒINKEJ



1220

'KPG/GFCKNNGFGU<CTGP2CWN+ 

5KNDGTOGFCKNNGQ,  XQP%/GKUPGTCWHUGKPG-TÌPWPIKP/QUMCW7PKHQTOKGTVGU$TWUVDKNFT OKVWOIGNGIVGO/CPVGN-TGW\OOI$KVMKP/ 4 &KCMQX 4   4-N&TWEMUVGNNGKO(GNFUGJTUEJÌP 

1221

2:1

2:1

<#4#.':#0&'4+ <YGK)QNFOÒP\GPFGU<CTGP#NGZCPFGT+ 

4WDGN5V2GVGTUDWTII$KVMKP 4 (D5EJN  )1.&8QPITÌ­VGT5GNVGPJGKV-CDKPGVVUVÒEM(CUV5VGORGNINCP\CWURQNKGTVGT2NCVVG



1222

2:1



2:1

4WDGN5V2GVGTUDWTII$KVMKP 4 (D5EJN  )1.&5GJTUGNVGPKPFKGUGT'TJCNVWPI9KP\-TCV\GTRQNKGTVG2NCVVG

 67


ALEXANDER I.

1223

1223 1,5:1

5KNDGTOÒP\GPFGT/ÒP\UV·VVG5V2GVGTUDWTI 

4WDGN5V2GVGTUDWTII$KVMKP&CX  5GJTUGNVGPKPFKGUGT'TJCNVWPI2TCEJVGZGORNCT(CUV5VGORGNINCP\

1225

1224



1226



4WDGN5V2GVGTUDWTII$KVMKP 4 &CX  4#VVTCMVKXGU'ZGORNCTOKVJGTTNKEJGT2CVKPCUGJTUEJÌPpXQT\ÒINKEJ





4WDGN 2QNVKPC 5V2GVGTUDWTII$KVMKP 4 

45GJTUEJÌPpXQT\ÒINKEJ





4WDGN 2QNWRQNVKPPKM 5V2GVGTUDWTII$KVMKP 4 

45GJTUEJÌP



1227

 68

1,5:1

1227

4WDGN5V2GVGTUDWTII$KVMKP&CX  5GJTUGNVGPKPFKGUGT'TJCNVWPI(GKPG2CVKPCXQT\ÒINKEJp5VGORGNINCP\




ALEXANDER I.

1229

1228



4WDGN5V2GVGTUDWTII$KVMKP&CX

2TCEJVXQNNG2CVKPCXQT\Ã&#x2019;INKEJ





4WDGN ,CJTGU\CJNKO5VGORGNCWUIG·PFGTV 5V2GVGTUDWTII$KVMKP&CX (CUVXQT\Ã&#x2019;INKEJ



1230

1,5:1



1,5:1

4WDGN 2QNVKPC 5V2GVGTUDWTII$KVMKP  5GNVGPDGUQPFGTUKPFKGUGT'TJCNVWPI-CDKPGVVUVÃ&#x2019;EM2TCEJVXQNNG2CVKPCHCUV5VGORGNINCP\



1231

1,5:1



1,5:1

4WDGN 2QNVKPC 5V2GVGTUDWTII$KVMKP 4   5GNVGPDGUQPFGTUKPFKGUGT'TJCNVWPI2TCEJVGZGORNCT8QT\Ã&#x2019;INKEJp5VGORGNINCP\

1232

1233



1234



-QRGMGP5V2GVGTUDWTII$KVMKP

(CUVXQT\Ã&#x2019;INKEJ





-QRGMGP5V2GVGTUDWTII$KVMKP

*Ã&#x2019;DUEJG2CVKPCXQT\Ã&#x2019;INKEJ





-QRGMGP5V2GVGTUDWTII$KVMKP 4 

448QT\Ã&#x2019;INKEJ

 69


ALEXANDER I.

1235

1236

1237

-WRHGTOÒP\GPFGT/ÒP\UV·VVG5W\WP 

-W-QRGMGP5W\WP -QN[XCP I$KVMKP 4   8QPITÌ­VGT5GNVGPJGKV9KP\4CPFHGJNGTUGJTUEJÌP





-W-QRGMGP5W\WP -QN[XCP I$KVMKP 4   8QPITQ­GT5GNVGPJGKV-N-TCV\GTUGJTUEJÌP





-W-QRGMGP5W\WP -QN[XCP I$KVMKP

8QT\ÒINKEJ



-W-QRGMGP'MCVGTKPDWTI2TQDGOKVIGTKHHGNVGO4CPFI$KVMKP 4   8QPITÌ­VGT5GNVGPJGKV8QT\ÒINKEJp5VGORGNINCP\



1238

1,5:1

1,5:1

-WRHGTOÒP\GPFGT/ÒP\UV·VVG'MCVGTKPDWTI 

'ZGORNCTFGT5COONWPI#PVQPKP2TQMQR6GKN#WMVKQP#WTGC0WOKUOCVKMC2TCI0T

1239

1239 1,5:1



-W-QRGMG'MCVGTKPDWTI2TQDGOKVIGTKHHGNVGO4CPFI$KVMKP 4   8QPITÌ­VGT5GNVGPJGKV)GUVQRHVGU.QEJYKP\4CPFHGJNGTUGJTUEJÌP /KV'ZRGTVKUGFGU5VCCVNKEJGP*KUVQTKUEJGP/WUGWOUKP/QUMCW

70




ALEXANDER I.

1240

1,5:1

1,5:1

2T·IWPIGPHÒT2QNGP 

<NQV[9CTUEJCWHÒT2QNGPI$KVMKP 4 (D FQTVWPVGT2QNGP 5EJN FQTV WPVGT2QNGP  )1.&4(CUVXQT\ÒINKEJ



1241

1,5:1



1,5:1

<NQV[9CTUEJCWHÒT2QNGPI$KVMKP 4 (D FQTVWPVGT2QNGP 5EJN FQTV WPVGT2QNGP  )1.&45GJTUEJÌPpXQT\ÒINKEJ



1242

2:1



2:1

<NQV[9CTUEJCWHÒT2QNGPI$KVMKP 4 (D FQTVWPVGT2QNGP 5EJN FQTV WPVGT2QNGP  )1.&49KP\4CPFHGJNGTUGJTUEJÌP



1243

2:1



2:1

<NQV[9CTUEJCWHÒT2QNGPI$KVMKP 4 (D FQTVWPVGT2QNGP 5EJN FQTV WPVGT2QNGP  )1.&45GJTUEJÌP

 71


ALEXANDER I.

1244

1245

1245

/GFCKNNGPFGU<CTGP#NGZCPFGT+ 



5KNDGTLGVQPWPUKIPKGTVCWHUGKPG-TÌPWPIKP/QUMCW)GMTÌPVGU/QPQITCOOFCTWPVGT2CNOWPF .QTDGGT\YGKI IGMTGW\V&TGK <GKNGP 5EJTKHV FCTÒDGT -TQPG WPVGP ,CJTGU\CJN  OO  I   $KVMKP 4 &KCMQX 4  4#VVTCMVKXGU'ZGORNCTOKVJÒDUEJGT2CVKPCUGJTUEJÌP



5KNDGTOGFCKNNG  XQP $ #PFTKGW CWH FKG 5EJNCEJV XQP #WUVGTNKV\ CO  &G\GODGT  $ÒUVG   0CRQN¾QPU+TOKV.QTDGGTMTCP\&KG$ÒUVGPXQP<CT#NGZCPFGT+XQP4W­NCPFWPF-CKUGT(TCP\+ XQP¤UVGTTGKEJGKPCPFGTIGIGPÒDGTOOI&KCMQX 4 <GKV\  9KP\-TCV\GTXQT\ÒINKEJ 

1246



5KNDGTOGFCKNNG  XQP $ #PFTKGW WPF , 2 &TQ\ CWH FGP (TKGFGP XQP 6KNUKV \YKUEJGP 2TGW­GP   4W­NCPFWPF(TCPMTGKEJ&KG$ÒUVGPXQP0CRQN¾QP+#NGZCPFGT+XQP4W­NCPFWPF(TKGFTKEJ9KNJGNO+++ XQP 2TGW­GP PGDGPGKPCPFGT T&GT (NW­IQVV 0KGOGP NCIGTV PCEJ N FGP NKPMGP #TO CWH GKPG CWU   UVTÌOGPFG 3WGNNWTPG IGNGJPV KP FGT 4GEJVGP J·NV GT FCU /QFGNN FGU <GNVGU KP FGO FKG FTGK4GIGPVGP \WUCOOGPMCOGPN¤NDCWOOOI&KCMQX 4 /CTKGPD2CZKP0WOOKU 8QT\ÒINKEJGU'ZGORNCTOKVUEJÌPGT2CVKPC



1247



72

5KNDGTOGFCKNNGXQP,2&TQ\CWHFKG5EJNCEJVCPFGT/QUMYCDGK$QTQFKPQ$ÒUVG0CRQN¾QPU+T OKV .QTDGGTMTCP\*GTMWNGU M·ORHV OKV FGP )KICPVGP QDGP UEJYGDGPFGT #FNGT  OO  I   5NI,WNKWU<GKV\p 8QT\ÒINKEJ 


ALEXANDER I.

1248

1,5:1



1,5:1

5KNDGTOGFCKNNG  XQP $ #PFTKGW WPF ( $TGPGV UR·VGTG2T·IWPIFGU<GKVTCWOGU CWH FGP'KP\WI0CRQN¾QPU+KP/QUMCW$ÒUVG0CRQN¾QPU+TOKV.QTDGGTMTCP\#PUKEJVFGU-TGONUOKV HTCP\ÌUKUEJGT /KNKV·TUVCPFCTVG /KV 4CPFRWP\G #PVKMG .CORG  OO  I 5NI ,WNKWU    <GKV\ 2TCEJVGZGORNCTOKVUEJÌPGT2CVKPC5VGORGNINCP\ 

1249



5KNDGTOGFCKNNG  XQP , .CPI CWH FCU $ÒPFPKU \YKUEJGP 2TGW­GP ¤UVGTTGKEJ WPF 4W­NCPF KO   -CORHIGIGP(TCPMTGKEJ&KGDGNQTDGGTVGP$ÒUVGPXQP(TCP\+XQP¤UVGTTGKEJ#NGZCPFGT+XQP4W­ NCPFWPF(TKGFTKEJ9KNJGNO+++XQP2TGW­GPPGDGPGKPCPFGTT<GJP<GKNGP5EJTKHVOOI &KCMQX 4  -N4CPFHGJNGTUGJTUEJÌPpXQT\ÒINKEJ



1250



5KNDGTOGFCKNNGXQP2,6KQNKGT(TCP\ÌUKUEJG2TQDGRT·IWPIGKPGU(TCPE5VÒEMGUIGHGTVKIV\W 'JTGP#NGZCPFGTU+XQP4W­NCPFCWHITWPFUGKPGU-CORHGUIGIGP0CRQN¾QP+/QPQITCOOFGU<CTGP FCTWPVGT2#4+5WPFFKG/GFCKNNGWTUUKIPCVWT)NQDWUFCTCWHFTGK.KNKGPOOI&KCMQX

4 /C\CTFC 4  49KP\4CPFHGJNGTYKP\-TCV\GTUGJTUEJÌP  73


ALEXANDER I.

1,5:1

1251



1251

)QNFOGFCKNNG\W&WMCVGPXQP*($TCPFVCWHFKG)TWPFUVGKPNGIWPIFGU5KGIGUFGPMOCNUCWH FGO-TGW\DGTIKP$GTNKPIGOGKPUCOOKV-ÌPKI(TKGFTKEJ9KNJGNO+++XQP2TGW­GP\WT'TKPPGTWPICP FKG5KGIGÒDGT0CRQN¾QP+&KG$ÒUVGPXQP#NGZCPFGT+XQP4W­NCPFWPF(TKGFTKEJ9KNJGNO+++XQP 2TGW­GP PGDGPGKPCPFGT N WOJGT .QTDGGTMTCP\#PUKEJV FGU 5KGIGUFGPMOCNU WOJGT FKG ,CJTGU\CJNGP   UQYKGGKPFTGK\GKNKIGT5EJTKHVMTGKUOOI&KCMQX FQTVPWTKP 5KNDGTWPF$TQP\G .GJPGTV/CTKGPD FQTVKP5KNDGT   )1.&8QPITÌ­VGT5GNVGPJGKV2TCEJVGZGORNCT /KP4CPFHGJNGTYKP\-TCV\GTHCUV5VGORGNINCP\  &CU FGWVUEJG 0CVKQPCNFGPMOCN HÒT FKG 5KGIG KP FGP $GHTGKWPIUMTKGIGP IGIGP 0CRQNGQP YWTFG CO  /·T\    GKPIGYGKJV &GT )TWPFUVGKP YCT CO  5GRVGODGT  XQO RTGW­KUEJGP -ÌPKI (TKGFTKEJ 9KNJGNO +++ WPF FGO   TWUUKUEJGP <CT #NGZCPFGT + IGOGKPUCO IGNGIV YQTFGP &CU  /GVGT JQJG &GPMOCN KUV CWU )W­GKUGP WPF PCEJ   2N·PGP XQP -CTN (TKGFTKEJ 5EJKPMGN XQP FGT -ÌPKINKEJ 2TGW­KUEJGP 'KUGPIKG­GTGK IGUEJCHHGP YQTFGP &KG   R[TCOKFGPHÌTOKIGPGQIQVKUEJG5RKV\U·WNGYKTFXQPGKPGOGKUGTPGP-TGW\IGMTÌPVFCUFGT$GTNKPGT'TJGDWPIFKGDKU FCJKP6GORGNJQHGT$GTIIGPCPPVYQTFGPYCTFGP0COGP-TGW\DGTIICD&CU&GPMOCN\GKIVFKGXKGTDGFGWVGPFGP 5EJNCEJVGP XQP )TQ­IÌTUEJGP .GKR\KI 8ÌNMGTUEJNCEJV 2CTKUWPF9CVGTNQQ+O9KPVGTYWTFGFCU 6QPPGPUEJYGTG/QPWOGPVJ[FTCWNKUEJCWHGKPCEJV/GVGTJQJGU2QFGUVIGJKGXVFCFKG\WPGJOGPFG$GDCWWPIFGT 6GORGNJQHGT8QTUVCFVFGP$NKEMCWHFCU&GPMOCNGKPIGUEJT·PMVJCVVG&KGXQTNKGIGPFGGZVTGOUGNVGPG/GFCKNNGKUV GKP GKPFTWEMUXQNNGU <GWIPKU HÒT FKG FGWVUEJTWUUKUEJG (TGWPFUEJCHV WPF GKP YKEJVKIGU &QMWOGPV HÒT FKG $GTNKPGT   5VCFVIGUEJKEJVG

74


ALEXANDER I.

1252

ex 1252



5WKVG XQP  $TQP\GOGFCKNNGPCWHFKG-·ORHG4W­NCPFUIGIGP0CRQN¾QP+&KGKPUIGUCOV  /GFCKNNGP WOHCUUGPFG 5WKVG GPVUVCPF KP FGP ,CJTGP  PCEJ GKPGO 'PVYWTH FGU )TCHGP   6QNUVQK WPF YWTFG XQP FGP 5V 2GVGTUDWTIGT /GFCKNNGWTGP # -NGRKMQY WPF # .[CNKP IGUEJPKVVGP   &KG8QTFGTUGKVGFGT$TQP\GOGFCKNNGP\GKIVLGYGKNUFCU$TWUVDKNF#NGZCPFGTU+NKPMUKOCPVKMGP*CT PKUEJOKV5RGGTWPF5EJKNFCWHFGUUGP/KVVGFGTTWUUKUEJG#FNGTFCTIGUVGNNVKUVWOJGTGKPG$QTFÒTGOKV 5EJNCEJVU\GPGP &KG 4ÒEMUGKVGP \GKIGP LGYGKNU #NNGIQTKGP WPF 5\GPGP OKV $G\WI CWH FKG 5EJNCEJVGP   IGIGP0CRQN¾QP+&WTEJOGUUGTLGYGKNUOO)GYKEJVLGECI$TCOUGPHH5OKT PQXHH 5VÒEM+PGKPGTOKV.GFGTDG\QIGPGP\GKVIGPÌUUKUEJGPGVYCU DGUEJ·FKIVGP5EJCVWNNGOKV)QNFRT·IGFTWEM 8QT\ÒINKEJp5VGORGNINCP\  75


NIKOLAUS I.

1253

2:1

2:1

<#40+-1.#75+ )QNFOÒP\GPFGU<CTGP0KMQNCWU+ 

4WDGN5V2GVGTUDWTII$KVMKP 4 (D5EJN  )1.&8QPITÌ­VGT5GNVGPJGKV2TCEJVGZGORNCT2QNKGTVG2NCVVG



1254



4WDGN5V2GVGTUDWTII$KVMKP(D5EJN

)1.&45GJTUEJÌP



1255

2:1

2:1



4WDGN5V2GVGTUDWTII$KVMKP(D5EJN  )1.&5GNVGPKPFKGUGT'TJCNVWPI(GKPG-TCV\GTRQNKGTVG2NCVVG

1256



1257



4WDGN5V2GVGTUDWTII$KVMKP(D5EJN

)1.&5GJTUEJÌPpXQT\ÒINKEJ





4WDGN5V2GVGTUDWTII$KVMKP(D5EJN  )1.&#VVTCMVKXGUHCUVXQT\ÒINKEJGU'ZGORNCT



76


NIKOLAUS I.

1258 1,5:1



1,5:1

4WDGN5V2GVGTUDWTII$KVMKP(D5EJN  )1.&5GJTUGNVGPKPFKGUGT'TJCNVWPI(GKPG-TCV\GTRQNKGTVG2NCVVG



1259 1,5:1



1,5:1

4WDGN5V2GVGTUDWTII$KVMKP(D5EJN  )1.&5GJTUGNVGPKPFKGUGT'TJCNVWPI9KP\-TCV\GTRQNKGTVG2NCVVG

1260

1,5:1





1,5:1

4WDGN5V2GVGTUDWTII$KVMKP(D5EJN  )1.&5GNVGPKPFKGUGT'TJCNVWPI9KP\-TCV\GTRQNKGTVG2NCVVG



1262

1261



4WDGN5V2GVGTUDWTII$KVMKP(D5EJN

)1.&5GJTUEJÌPpXQT\ÒINKEJ





4WDGN5V2GVGTUDWTII$KVMKP(D5EJN

)1.&8QT\ÒINKEJ



1263

1264

1263 1,5:1

1263 1,5:1



4WDGN5V2GVGTUDWTII$KVMKP(D5EJN  )1.&5GJTUGNVGPKPFKGUGT'TJCNVWPI9KP\-TCV\GTRQNKGTVG2NCVVG



4WDGN5V2GVGTUDWTII$KVMKP(D5EJN

)1.&5GJTUEJÌPpXQT\ÒINKEJ

  77


NIKOLAUS I.

1265

2:1

2:1

2NCVKPOÒP\GPFGU<CTGP0KMQNCWU+ 

4WDGN2NCVKP5V2GVGTUDWTII)GMTÌPVGT&QRRGNCFNGTOKV<GRVGTWPF4GKEJUCRHGNKPFGP (·PIGP CWH FGT $TWUV 5V )GQTIUUEJKNF WOJGT FKG -GVVG FGU #PFTGCUQTFGPU CWH FGP CWUIGDTGKVGVGP   (NÒIGNPLGFTGK9CRRGPUEJKNFG5EJTKHVOKV9GTVWPF,CJTGUCPICDG$KVMKP 4 (D5EJN 2.#6+0440WT'ZGORNCTGIGRT·IV2TCEJVGZGORNCT9KP\2TQDKGTURWTRQNKGTVG2NCVVG 

1266

1266 1,5:1



4WDGN2NCVKP5V2GVGTUDWTII$KVMKP 4 (D5EJN  2.#6+044#VVTCMVKXGUUGJTUEJÌPGU'ZGORNCT



1268

1267



4WDGN2NCVKP5V2GVGTUDWTII$KVMKP 4 (D5EJN

2.#6+08QT\ÒINKEJ





4WDGN2NCVKP5V2GVGTUDWTII$KVMKP 4 (D5EJN

2.#6+05GJTUEJÌP



1269 1,5:1



78

1,5:1

4WDGN2NCVKP5V2GVGTUDWTII$KVMKP 4 (D5EJN  2.#6+05GJTUGNVGPKPFKGUGT'TJCNVWPI2TCEJVGZGORNCT (CUV5VGORGNINCP\CWURQNKGTVGT2NCVVG




NIKOLAUS I.

1271

1270

5KNDGTOÃ&#x2019;P\GPFGT/Ã&#x2019;P\UV·VVG5V2GVGTUDWTI 

4WDGN5V2GVGTUDWTII$KVMKP&CX  5GJTUGNVGPKPFKGUGT'TJCNVWPI2TCEJVGZGORNCT(CUV5VGORGNINCP\





4WDGN5V2GVGTUDWTII$KVMKP&CX  5GJTUGNVGPKPFKGUGT'TJCNVWPI8QT\Ã&#x2019;INKEJp5VGORGNINCP\



1272

1,5:1



1,5:1

4WDGN 2QNVKPC 5V2GVGTUDWTII$KVMKP  5GJTUGNVGPKPFKGUGT'TJCNVWPI2TCEJVGZGORNCT5VGORGNINCP\

1273

1274



1275



4WDGN5V2GVGTUDWTII$KVMKP&CX

*GTTNKEJG2CVKPCXQT\Ã&#x2019;INKEJ





4WDGN5V2GVGTUDWTII$KVMKP&CX  -CDKPGVVUVÃ&#x2019;EM2TCEJVXQNNG2CVKPCHCUV5VGORGNINCP\





4WDGN  5V 2GVGTUDWTI +P 752NCUVKMJQNFGT FGT 0)% OKV FGT $GYGTVWPI /5  $KVMKP    QFGT&CX 5GNVGPKPFKGUGT'TJCNVWPI(CUV5VGORGNINCP\

 79


NIKOLAUS I.

1276

1,5:1



1,5:1

4WDGN5V2GVGTUDWTII$KVMKP&CX  5GJTUGNVGPKPFKGUGT'TJCNVWPI-CDKPGVVUVÃ&#x2019;EM*GTTNKEJG2CVKPC'TUVCDUEJNCI5VGORGNINCP\

1278

1277



1279



4WDGN5V2GVGTUDWTII$KVMKP&CX



4WDGN5V2GVGTUDWTI+P752NCUVKMJQNFGTFGT0)%OKVFGT$GYGTVWPI/5$KVMKP&CX (GKPG2CVKPCXQT\Ã&#x2019;INKEJ





4WDGN5V2GVGTUDWTI+P752NCUVKMJQNFGTFGT0)%OKVFGT$GYGTVWPI/5$KVMKP&CX (GKPG2CVKPCXQT\Ã&#x2019;INKEJ



1280

9KP\4CPFHGJNGTXQT\Ã&#x2019;INKEJ



1281



4WDGN 2QNVKPC 5V2GVGTUDWTII$KVMKP

#VVTCMVKXGUXQT\Ã&#x2019;INKEJGU'ZGORNCT





4WDGN 2QNVKPC 5V2GVGTUDWTII$KVMKP  5GJTUGNVGPKPFKGUGT'TJCNVWPI2TCEJVXQNNG2CVKPCXQT\Ã&#x2019;INKEJp5VGORGNINCP\CWURQNKGTVGT2NCVVG



80


NIKOLAUS I.

1282

1283



-QRGMGP5V2GVGTUDWTII$KVMKP

(GKPG2CVKPCHCUV5VGORGNINCP\





-QRGMGP5V2GVGTUDWTII$KVMKP  5GNVGPKPFKGUGT'TJCNVWPI*GTTNKEJG2CVKPCRQNKGTVG2NCVVGOKPDGTÒJTV



1284

1,5:1

1,5:1

'KPG2QNVKPCFGT/ÒP\UV·VVG9CTUEJCW 

4WDGN 2QNVKPC 9CTUEJCWI$KVMKP  5GJTUGNVGPKPFKGUGT'TJCNVWPI8QT\ÒINKEJp5VGORGNINCP\CWURQNKGTVGT2NCVVG



1285



-WRHGTOÒP\GPFGT/ÒP\UV·VVG'MCVGTKPDWTI

-W-QRGMGP'MCVGTKPDWTII$KVMKP

5GJTUEJÌP



-W-QRGMG'MCVGTKPDWTI0QXQFGNI$KVMKP* 4   44'VYCUHNGEMKIYKP\5EJTÌVNKPIUHGJNGTCO4CPFXQT\ÒINKEJp5VGORGNINCP\



1286

1,5:1



1,5:1

81


NIKOLAUS I.

1288

1287

1287



-W -QRGMGP  'MCVGTKPDWTI  I ªDGTRT·IV CWH FGO 5EJTÌVNKPI GKPGU  -QRGMGP5VÒEMGU   $KVMKPp \W  8QPITÌ­VGT5GNVGPJGKV5GJTUEJÌP 



-W-QRGMGP'MCVGTKPDWTII$KVMKP 4   5GNVGPDGUQPFGTUKPFKGUGT'TJCNVWPI2TCEJVGZGORNCT9KP\-QPVCMVUVGNNGRQNKGTVG2NCVVG



1289 2:1

2:1



'KPG-W-QRGMGFGT/ÒP\UV·VVG+\JQTC

-W-QRGMG+\JQTCI$KVMKP

8QT\ÒINKEJ



-W-QRGMG9CTUEJCW0QXQFGNI$KVMKP* 4   8QPITQ­GT5GNVGPJGKV2TCEJVGZGORNCT*GTTNKEJG2CVKPCHCUV5VGORGNINCP\



1290 1,5:1

1,5:1

-WRHGTOÒP\GPFGT/ÒP\UV·VVG9CTUEJCW 

'ZGORNCTFGT5COONWPI#PVQPKP2TQMQR6GKN#WMVKQP#WTGC0WOKUOCVKMC2TCI0T

1292 1291

1291



-W-QRGMGP9CTUEJCWI$KVMKP 4 

 44#VVTCMVKXGUHCUVXQT\ÒINKEJGU'ZGORNCT





-W2QNWUEJMC9CTUEJCWI$KVMKP 4  5GNVGPDGUQPFGTUKPFKGUGT'TJCNVWPI8QT\ÒINKEJ



82


NIKOLAUS I.

1293

1,5:1

1,5:1

)GFGPMOÃ&#x2019;P\GPFGU<CTGP0KMQNCWU+ 

4WDGN5V2GVGTUDWTICWHFKG'KPYGKJWPIFGU$QTQFKPQ&GPMOCNUI$KVMKP 4  &CX 44#VVTCMVKXGU'ZGORNCTOKVJGTTNKEJGT2CVKPCYKP\-TCV\GTXQT\Ã&#x2019;INKEJ 

1294

1295

1296



4WDGN5V2GVGTUDWTI&GPMOCNHÃ&#x2019;T#NGZCPFGT+I$KVMKP 4 &CX  5GJTCVVTCMVKXGU'ZGORNCTOKVRTCEJVXQNNGT2CVKPCXQT\Ã&#x2019;INKEJp5VGORGNINCP\





4WDGN5V2GVGTUDWTICWHFKG'KPYGKJWPIFGU$QTQFKPQ&GPMOCNUI$KVMKP 4 &CX 2TCEJVGZGORNCTOKVHGKPGT2CVKPC'TUVCDUEJNCIHCUV5VGORGNINCP\





4WDGN5V2GVGTUDWTICWHFKG'KPYGKJWPIFGU$QTQFKPQ&GPMOCNUI$KVMKP 4 &CX (GKPG2CVKPCXQT\Ã&#x2019;INKEJ

 83


NIKOLAUS I.

1297

1297 1,5:1



4WDGN  XQP * )WDG CWH FKG 8GTO·JNWPI UGKPGU 5QJPGU )TQ­HÃ&#x2019;TUV #NGZCPFGT 0KMQNCLGYKVUEJ   UR·VGT <CT #NGZCPFGT ++ OKV /CTKC XQP *GUUGP&CTOUVCFV 6QEJVGT .WFYKIU ++  I $KVMKP   

4 &CX# 44(GKPG2CVKPCXQT\Ã&#x2019;INKEJ  'ZGORNCTFGT5COONWPI#PVQPKP2TQMQR6GKN#WMVKQP#WTGC0WOKUOCVKMC2TCI0T

1298

1298 1,5:1



4WDGN  XQP * )WDG CWH FKG 8GTO·JNWPI UGKPGU 5QJPGU )TQ­HÃ&#x2019;TUV #NGZCPFGT 0KMQNCLGYKVUEJ   UR·VGT <CT #NGZCPFGT ++ OKV /CTKC XQP *GUUGP&CTOUVCFV 6QEJVGT .WFYKIU ++  I $KVMKP   

4 &CX# 44*GTTNKEJG2CVKPCHCUV5VGORGNINCP\  'ZGORNCTFGT5COONWPI#PVQPKP2TQMQR6GKN#WMVKQP#WTGC0WOKUOCVKMC2TCI0T

1299

1,5:1

1,5:1

-WRHGTOÃ&#x2019;P\GPFGT/Ã&#x2019;P\UV·VVG5V2GVGTUDWTI  84

-W-QRGMGP5V2GVGTUDWTI2TQDGI$KVMKP 4   8QPITQ­GT5GNVGPJGKV8QT\Ã&#x2019;INKEJp5VGORGNINCP\




NIKOLAUS I.

1300

1,5:1

1,5:1



-W-QRGMG5V2GVGTUDWTII$KVMKP 4 

442TCEJVGZGORNCT5VGORGNINCP\



1301

1,5:1



1,5:1

-W-QRGMG5V2GVGTUDWTII$KVMKP 4 

8QPITQ­GT5GNVGPJGKV8QT\Ã&#x2019;INKEJ



1302

2:1



2:1

-W&GPG\JMC5V2GVGTUDWTI2TQDGI$KVMKP

44(CUV5VGORGNINCP\



1303

2:1



-W2QNWUEJMC5V2GVGTUDWTI2TQDGI$KVMKP

2:1

44(CUV5VGORGNINCP\

 85


NIKOLAUS I.

1304

2:1

2:1

2T·IWPIGPHÒT2QNGP 

4WDGN <NQV[ 5V2GVGTUDWTIHÒT2QNGPI$KVMKP 4 (D FQTVWPVGT2QNGP  5EJN FQTVWPVGT2QNGP  )1.&45GJTUEJÌPpXQT\ÒINKEJ



1305

2:1



2:1

4WDGN <NQV[ 5V2GVGTUDWTIHÒT2QNGPI$KVMKP 4 (D FQTVWPVGT2QNGP  5EJN FQTVWPVGT2QNGP  )1.&45GJTUEJÌPpXQT\ÒINKEJ



1306

3:1



3:1

 4WDGN  <NQV[   5V 2GVGTUDWTI HÒT 2QNGP  I $KVMKP  4  (D  FQTV WPVGT   2QNGP 5EJN FQTVWPVGT2QNGP   )1.&8QPCNNGTITÌ­VGT5GNVGPJGKV9KP\5EJTÌVNKPIUHGJNGTRQNKGTVG2NCVVG  'ZGORNCT FGT #WMVKQP #FQNRJ *GUU 0CEJHQNIGT  (TCPMHWTV/CKP  0T  FQTV OKV #POGTMWPI #WU   5COONWPI6QNUVQK 

1307

 86

4WDGN <NQV[ 5V2GVGTUDWTIHÒT2QNGPI$KVMKP&CX

 (CUVXQT\ÒINKEJ




NIKOLAUS I.

1308

1,5:1



1,5:1

4WDGN <NQV[ 5V2GVGTUDWTIHÒT2QNGPI$KVMKP 4 &CX  8QPITQ­GT5GNVGPJGKV8GTOWVNKEJPWT'ZGORNCTGIGRT·IV 2TCEJVXQNNG2CVKPCMN4CPFHGJNGTXQT\ÒINKEJGU'ZGORNCTXQPRQNKGTVGP5VGORGNP 

1309

1,5:1

1309

<YGK/GFCKNNGPFGU<CTGP0KMQNCWU+ 

5KNDGTOGFCKNNG  9GTMUVCVV ) .QQU CWH FKG 'KPPCJOG FGT VÒTMKUEJGP (GUVWPI 5KNKUVTKC JGWVG   $WNICTKGP $ÒUVGTOKV.QTDGGTMTCP\5KGDGP<GKNGP5EJTKHVWOJGT.QTDGGTMTCP\OOI &KCMQX 4  8QT\ÒINKEJ

1310



1,5:1



1310

5KNDGTOGFCKNNG  WPUKIPKGTV -ÒTCUUKGTVCNGT IGHGTVKIV CWH UGKP L·JTKIGU ,WDKN·WO CNU %JGH FGU    RTGW­KUEJGP -ÒTCUUKGT4GIKOGPVU )GMTÌPVGU /QPQITCOO ÒDGT \YGK <GKNGP 5EJTKHV&KG ,CJTGU\CJ   NGPºWOJGT.QTDGGTMTCP\OOI&KCMQX/CTKGPD  2TCEJVGZGORNCT*GTTNKEJG2CVKPCHCUV5VGORGNINCP\

 87


ALEXANDER II.

1311

2:1

2:1

<#4#.':#0&'4++ )QNFOÃ&#x2019;P\GPFGU<CTGP#NGZCPFGT++ 

4WDGN5V2GVGTUDWTII$KVMKP(D5EJN  )1.&5GJTUGNVGPKPFKGUGT'TJCNVWPI2QNKGTVG2NCVVG



1312

1,5:1



1,5:1

4WDGN5V2GVGTUDWTII$KVMKP 4 (D5EJN  )1.&49KP\-TCV\GTXQT\Ã&#x2019;INKEJ



1313

1,5:1

1,5:1



4WDGN5V2GVGTUDWTII$KVMKP(D5EJN

)1.&8QT\Ã&#x2019;INKEJ



1314

1,5:1

 88

1,5:1

4WDGN5V2GVGTUDWTI+P752NCUVKMJQNFGTFGT0)%OKVFGT$GYGTVWPI/5$KVMKP 4  (D5EJN )1.&9KP\-TCV\GTXQT\Ã&#x2019;INKEJp5VGORGNINCP\ 


ALEXANDER II.

1315

1,5:1

1,5:1

5KNDGTOÒP\GPFGT/ÒP\UV·VVG5V2GVGTUDWTI 

4WDGN5V2GVGTUDWTII$KVMKP 4 &CX  44-CDKPGVVUVÒEMOKVHGKPGT2CVKPC2QNKGTVG2NCVVGOKPDGTÒJTV

1316



1316 1,5:1



4WDGN5V2GVGTUDWTII$KVMKP 4 &CX  5GNVGPGT,CJTICPI(GKPG2CVKPCUGJTUEJÌPpXQT\ÒINKEJ



'ZGORNCTFGT5COONWPI#PVQPKP2TQMQR6GKN#WMVKQP#WTGC0WOKUOCVKMC2TCI0T

1317

1,5:1



1,5:1

4WDGN5V2GVGTUDWTII$KVMKP&CX  5GNVGPKPFKGUGT'TJCNVWPI8QT\ÒINKEJp5VGORGNINCP\CWURQNKGTVGT2NCVVG

 89


ALEXANDER II.

1318

1319



4WDGN5V2GVGTUDWTII$KVMKP&CX

2TCEJVGZGORNCT8QT\ÒINKEJp5VGORGNINCP\



4WDGN5V2GVGTUDWTI+P752NCUVKMJQNFGTFGT0)%OKVFGT$GYGTVWPI/5$KVMKP&CX (GKPG2CVKPCXQT\ÒINKEJp5VGORGNINCP\

 

1320

1,5:1



1,5:1

4WDGN 2QNVKPC 5V2GVGTUDWTII$KVMKP  W­GTUVUGNVGPKPFKGUGT'TJCNVWPI-CDKPGVVUVÒEM'TUVCDUEJNCIHGKPUVGT5VGORGNINCP\

1321



1321 1,5:1



4WDGN 2QNVKPC 5V2GVGTUDWTII$KVMKP

1322

4(CUVXQT\ÒINKEJ



1322 1,5:1

 90

4WDGN 2QNVKPC 5V2GVGTUDWTII$KVMKP  2TCEJVGZGORNCT(GKPG2CVKPCXQT\ÒINKEJp5VGORGNINCP\




ALEXANDER II.

1323 1,5:1

1,5:1



-QRGMGP5V2GVGTUDWTII$KVMKP 4   8QPITÌ­VGT5GNVGPJGKV*ÒDUEJG2CVKPCUGJTUEJÌPpXQT\ÒINKEJ



1324 1,5:1

1,5:1



-QRGMGP5V2GVGTUDWTII$KVMKP 4 

44*GTTNKEJG2CVKPCHCUV5VGORGNINCP\



1325

2:1

2:1

-WRHGTOÒP\GPFGT/ÒP\UV·VVG'MCVGTKPDWTI 

-W-QRGMG'MCVGTKPDWTII$KVMKP 4   8QPITÌ­VGT5GNVGPJGKV9KP\5VGORGNHGJNGTUGJTUEJÌP



$GK FGO XQTNKGIGPFGP 'ZGORNCT JCPFGNV GU UKEJ JÌEJUVYCJTUEJGKPNKEJ WO GKPG 2TQDGRT·IWPI \W FGP CD    CWUIGIGDGPGP-W-QRGMGP'TUVCWPNKEJKUVFC­FCU5VÒEMKO)GNFWONCWHIGYGUGPKUV

1326

1327



-W-QRGMGP'MCVGTKPDWTI+P752NCUVKMJQNFGTFGT0)%OKVFGT$GYGTVWPI2(4$$KVMKP 5GNVGPKPFKGUGT'TJCNVWPI2QNKGTVG2NCVVG





-W-QRGMGP'MCVGTKPDWTI+P752NCUVKMJQNFGTFGT0)%OKVFGT$GYGTVWPI2(4$$KVMKP 5GNVGPKPFKGUGT'TJCNVWPI2QNKGTVG2NCVVG

 91


ALEXANDER II.

2:1

1329

1328

1330



-W-QRGMGP'MCVGTKPDWTI+P752NCUVKMJQNFGTFGT0)%OKVFGT$GYGTVWPI2(4$$KVMKP 5GNVGPKPFKGUGT'TJCNVWPI2QNKGTVG2NCVVG





-W-QRGMGP'MCVGTKPDWTI+P752NCUVKMJQNFGTFGT0)%OKVFGT$GYGTVWPI2(4$$KVMKP 5GNVGPKPFKGUGT'TJCNVWPI2QNKGTVG2NCVVG





-W-QRGMG'MCVGTKPDWTI'KPUGKVKIGU0QXQFGNI$KVMKP* 4   8QPITÌ­VGT5GNVGPJGKV8QT\ÒINKEJ



'ZGORNCTFGT5COONWPI#PVQPKP2TQMQR6GKN#WMVKQP#WTGC0WOKUOCVKMC2TCI0T

1332 1333

1331

-WRHGTOÒP\GPFGT/ÒP\UV·VVG5V2GVGTUDWTI 

-W -QRGMGP  5V 2GVGTUDWTI +P 752NCUVKMJQNFGT FGT 0)% OKV FGT $GYGTVWPI 2(  4$   $KVMKP 5GNVGPKPFKGUGT'TJCNVWPI2QNKGTVG2NCVVG





-W-QRGMG5V2GVGTUDWTI+P752NCUVKMJQNFGTFGT0)%OKVFGT$GYGTVWPI2(4$$KVMKP 5GNVGPKPFKGUGT'TJCNVWPI2QNKGTVG2NCVVG





-W-QRGMG5V2GVGTUDWTI+P752NCUVKMJQNFGTFGT0)%OKVFGT$GYGTVWPI2(4$$KVMKP 5GNVGPKPFKGUGT'TJCNVWPI2QNKGTVG2NCVVG



1334

1334 1,5:1

'KPG)GFGPMOÒP\GFGU<CTGP#NGZCPFGT++  92

4WDGN5V2GVGTUDWTI&GPMOCNHÒT0KMQNCWU+I$KVMKP&CX  (GKPG2CVKPCXQT\ÒINKEJ




ALEXANDER II.

1,5:1

1335

1335

/GFCKNNGPFGU<CTGP#NGZCPFGT++ 

5KNDGTOGFCKNNGXQP8#NGZGGXWPF4)CPPGOCPCWHUGKPG-TÌPWPI$ÒUVGT)GMTÌPVGT&QR RGNCFNGT OKV <GRVGT WPF 4GKEJUCRHGN KP FGP (·PIGP CWH FGT $TWUV 5V )GQTIUUEJKNF WOJGT FKG -GVVG   FGU #PFTGCUQTFGPU CWH FGP (NÒIGNP LG XKGT YGKVGTG 9CRRGPUEJKNFG QDGP -TQPG  OO  I   &KCMQX 4  448QT\ÒINKEJ 

1336



$TQP\GOGFCKNNG  XQP # 5GOGPQX CWH FCU L·JTKIG ,WDKN·WO FGT MCKUGTNKEJGP 7PKXGTUKV·V KP   5V 2GVGTUDWTI $ÒUVGP #NGZCPFGTU + WPF #NGZCPFGTU ++ KP QXCNGP 8GT\KGTWPIGP GKPCPFGT IGIGPÒDGT   QDGP-TQPG\YKUEJGP\YGKIGMTGW\VGP'KEJGP\YGKIGPWPVGP9CRRGPUEJKNFFCTCWHFGTIGMTÌPVG&QRRGN CFNGT OKV <GRVGT WPF 4GKEJUCRHGN KP FGP (·PIGP CWH FGT $TWUV 5V )GQTIUUEJKNF#PUKEJV FGT   7PKXGTUKV·V FCTWPVGT KP TWPFGT 8GT\KGTWPI FKG $ÒUVG 5GTIG[ 5GOLQPQYKVUEJ 7YCTQYU )TÒPFGT FGT   7PKXGTUKV·VOOI&KCMQX 8QT\ÒINKEJ

 93


ALEXANDER III.

1337 1,5:1

1,5:1

<#4#.':#0&'4+++ )QNFOÒP\GPFGU<CTGP#NGZCPFGT+++ 

4WDGN5V2GVGTUDWTII$KVMKP(D5EJN  )1.&440WT'ZGORNCTGIGRT·IV5GJTUEJÌPpXQT\ÒINKEJ



1339 1340

1338



4WDGN5V2GVGTUDWTII$KVMKP(D5EJN

)1.&8QT\ÒINKEJ





4WDGN5V2GVGTUDWTII$KVMKP(D5EJN

)1.&5GJTUEJÌPpXQT\ÒINKEJ





4WDGN5V2GVGTUDWTII$KVMKP(D5EJN

)1.&8QT\ÒINKEJ



1341 1,5:1

1,5:1

5KNDGTOÒP\GPFGT/ÒP\UV·VVG5V2GVGTUDWTI 

-QRGMGP5V2GVGTUDWTII$KVMKP 4   440WT'ZGORNCTGIGRT·IV*GTTNKEJG2CVKPCXQT\ÒINKEJ



'ZGORNCTFGT5COONWPI#PVQPKP2TQMQR6GKN#WMVKQP#WTGC0WOKUOCVKMC2TCI0T

1342

 94

4WDGN5V2GVGTUDWTII$KVMKP&CX

-N-TCV\GTXQT\ÒINKEJ




ALEXANDER III.

1343

 

1344

4WDGN5V2GVGTUDWTII$KVMKP&CX 4WDGN5V2GVGTUDWTII$KVMKP&CX

8QT\ÒINKEJCWURQNKGTVGT2NCVVG (CUVXQT\ÒINKEJ

 

1345

1,5:1



1,5:1

4WDGN5V2GVGTUDWTII$KVMKP 4 &CX  5GNVGPGT,CJTICPIKPCW­GTIGYÌJPNKEJGT3WCNKV·V2TCEJVGZGORNCT5VGORGNINCP\



1346



4WDGN5V2GVGTUDWTII$KVMKP&CX  5GNVGPKPFKGUGT'TJCNVWPI2TCEJVXQNNG2CVKPCXQT\ÒINKEJp5VGORGNINCP\



1347

1,5:1



1,5:1

-QRGMGP5V2GVGTUDWTII$KVMKP 4   8QPITQ­GT5GNVGPJGKV0WT'ZGORNCTGIGRT·IV 8QT\ÒINKEJGU'ZGORNCTXQPRQNKGTVGP5VGORGNP

 95


ALEXANDER III.

1348

1349



-QRGMGP5V2GVGTUDWTII$KVMKP

1349

8QT\ÒINKEJp5VGORGNINCP\



-WRHGTOÒP\GPFGT/ÒP\UV·VVG5V2GVGTUDWTI 

-W-QRGMG5V2GVGTUDWTI+P752NCUVKMJQNFGTFGT0)%OKVFGT$GYGTVWPI2(4$$KVMKP 5GNVGPKPFKGUGT'TJCNVWPI2QNKGTVG2NCVVG

1350 2:1



-W-QRGMG5V2GVGTUDWTII$KVMKP 4 



2:1

448QT\ÒINKEJp5VGORGNINCP\



1351 2:1



2:1

-W-QRGMG5V2GVGTUDWTII$KVMKP 4 

448QT\ÒINKEJ



1352

2:1

2:1

/GFCKNNGPFGU<CTGP#NGZCPFGT+++ 

6TCIDCTG IQNFGPG 8GTFKGPUVOGFCKNNG Q , XQP # )TKNKEJGU XGTNKGJGP HÒT 8GTFKGPUVG WO FGP 5VCCV   KPUDGUQPFGTGDGK9CJNGP$ÒUVGT&TGK<GKNGP5EJTKHVWOJGTUGEJU.KPKGPMTGKUGOOI &KCMQXNGKEJVXCT 4FQTVOKVITÌ­GTGT5EJTKHVCWHFGT4ÒEMUGKVG   )1.&8QPITÌ­VGT5GNVGPJGKV8QT\ÒINKEJp5VGORGNINCP\  'ZGORNCT FGT #WMVKQP )QTP[  /QUEJ  /ÒPEJGP  0T  WPF 'ZGORNCT FGT 5COONWPI )GQTI   /KEJCKNQYKVUEJ#FQNRJ*GUU#).W\GTP0T

96


ALEXANDER III.

1353

2:1



2:1

6TCIDCTGIQNFGPG8GTFKGPUVOGFCKNNGQ,XQP#)TKNKEJGUXGTNKGJGPHÒT8GTFKGPUVGWOFGP5VCCVWPF -KTEJGP·OVGT $ÒUVG T5EJPWTMTGKU FCTKP NGGTGU (GNF WOJGT 5EJTKHVMTGKU OKV ·W­GTGO <KGTMTGKU   OOI&KCMQX 4  )1.&8QPITÌ­VGT5GNVGPJGKV8QT\ÒINKEJp5VGORGNINCP\  'ZGORNCT FGT #WMVKQP )QTP[  /QUEJ  /ÒPEJGP  0T  WPF 'ZGORNCT FGT 5COONWPI )GQTI   /KEJCKNQYKVUEJ#FQNRJ*GUU#).W\GTP0T

1354

2:1



2:1

6TCIDCTG)QNFOGFCKNNGQ,XQP#)TKNKEJGU2TGKUOGFCKNNGFGT/QUMCWGT*CPFGNUCMCFGOKG$ÒUVGT )GHNÒIGNVGT/GTMWTUVCDOKV'KEJGPMTCP\IGUEJOÒEMVOOI&KCMQX 4   )1.&8QPITÌ­VGT5GNVGPJGKV9KP\-TCV\GTXQT\ÒINKEJp5VGORGNINCP\  'ZGORNCTFGT#WMVKQP)QTP[/QUEJ/ÒPEJGP0T'ZGORNCTFGT5COONWPI/QTGKTC#WMVKQP 5WRGTKQT &G\GODGT  0T  WPF 'ZGORNCT FGT 5COONWPI )GQTI /KEJCKNQYKVUEJ #FQNRJ *GUU #)    .W\GTP0T

97


NIKOLAUS II.

1355



5KNDGTOGFCKNNG Q , WO   WPUKIPKGTV XQP . 5VGKPOCP 2T·OKG FGT TWUUKUEJGP )GUGNNUEJCHV HÒT   +PFWUVTKGWPF*CPFGN\WT#WUUVGNNWPIXQP6WTMGUVCP$ÒUVGT(ÒPH<GKNGP5EJTKHVWOJGT'KEJGPMTCP\ OOI&KCMQX 4  44(GKPG2CVKPCXQT\ÒINKEJp5VGORGNINCP\ 

1356



6TCIDCTGUKNDGTPG8GTFKGPUVOGFCKNNGWPUKIPKGTVXQP#)TKNKEJGULTCWHUGKPGP6QFXGTNKGJGP CP2TKGUVGTHÒJTGPFG1HHK\KGTGWPFTCPIJÌJGTG$GCOVGFKGWPVGT#NGZCPFGT+++IGFKGPVJCDGP$ÒUVGT N .QTDGGT\YGKI&KG 4GIKGTWPIUFCVGP  QDGP -TQPG WPVGP -TGW\  OO  I   &KCMQX *ÒDUEJG2CVKPCXQT\ÒINKEJ 

1357

1358

<#40+-1.#75++ )QNFOÒP\GPFGU<CTGP0KMQNCWU++ 

4WDGN5V2GVGTUDWTII$KVMKP(D5EJN  )1.&9KP\4CPFHGJNGTXQT\ÒINKEJ





4WDGN5V2GVGTUDWTII$KVMKP(D5EJN



)1.&8QT\ÒINKEJ

1359

2:1

 98

2:1

4WDGN5V2GVGTUDWTII$KVMKP(D5EJN  )1.&8QT\ÒINKEJGU'ZGORNCTXQPRQNKGTVGP5VGORGNP




NIKOLAUS II.

1360

2:1

2:1



4WDGN5V2GVGTUDWTII$KVMKP(D5EJN  )1.&5GJTUGNVGPKPFKGUGT'TJCNVWPI2QNKGTVG2NCVVGOKPDGTÒJTV

1361

1362

1363



4WDGN5V2GVGTUDWTII$KVMKP 4 (D5EJN



4WDGN5V2GVGTUDWTII$KVMKP(D5EJN



1364

)1.&48QT\ÒINKEJ



)1.&8QT\ÒINKEJ





4WDGN5V2GVGTUDWTII$KVMKP(D5EJN )1.&8QT\ÒINKEJp5VGORGNINCP\





 4WDGN  5V 2GVGTUDWTI +P 752NCUVKMJQNFGT FGT #0# OKV FGT $GYGTVWPI /5  $KVMKP    (D5EJN )1.&2TCEJVGZGORNCT(CUV5VGORGNINCP\



1365

1367

1366

1367



 4WDGN  5V 2GVGTUDWTI +P XGTRNQODVGO 2NCUVKMJQNFGT WPF OKV <GTVKHKMCV FGT <GPVTCNDCPM FGT   4WUUKUEJGP(ÌFGTCVKQP$KVMKP(D5EJN )1.&(CUV5VGORGNINCP\





 4WDGN  5V 2GVGTUDWTI +P XGTRNQODVGO 2NCUVKMJQNFGT WPF OKV <GTVKHKMCV FGT <GPVTCNDCPM FGT   4WUUKUEJGP(ÌFGTCVKQP$KVMKP(D5EJN )1.&(CUV5VGORGNINCP\



5KNDGTOÒP\GPFGT/ÒP\UV·VVG5V2GVGTUDWTI 

4WDGN5V2GVGTUDWTII$KVMKP&CX

9KP\-TCV\GTHCUVXQT\ÒINKEJ

 99


NIKOLAUS II.

1368

1,5:1



1,5:1

4WDGN5V2GVGTUDWTII$KVMKP 4 &CX  5GNVGPGT,CJTICPIKPCW­GTIGYÌJPNKEJGT3WCNKV·V2QNKGTVG2NCVVG

1369



1369 1,5:1



4WDGN5V2GVGTUDWTII$KVMKP 4 &CXp \W   5GNVGPGT,CJTICPI9KP\-TCV\GTRQNKGTVG2NCVVG



1370

1,5:1

 100

1,5:1

4WDGN5V2GVGTUDWTI+P752NCUVKMJQNFGTFGT0)%OKVFGT$GYGTVWPI2($KVMKP&CX 5GJTUGNVGPKPFKGUGT'TJCNVWPI2QNKGTVG2NCVVG




NIKOLAUS II.

1371

1371 1,5:1



4WDGN5V2GVGTUDWTI+P752NCUVKMJQNFGTFGT0)%OKVFGT$GYGTVWPI/5$KVMKP&CX 2TCEJVGZGORNCT(CUV5VGORGNINCP\



1372

1,5:1



1,5:1

-QRGMGP5V2GVGTUDWTII$KVMKP 4   8QPITQ­GT5GNVGPJGKV2TCEJVXQNNG2CVKPCYKP\-TCV\GTRQNKGTVG2NCVVG



1373

1,5:1



1,5:1

-QRGMGP5V2GVGTUDWTII$KVMKP 4   5GNVGPDGUQPFGTUKPFKGUGT'TJCNVWPI2TCEJVXQNNG2CVKPCRQNKGTVG2NCVVG



1374

1,5:1



1,5:1

-QRGMGP5V2GVGTUDWTII$KVMKP 4   5GJTUGNVGPDGUQPFGTUKPFKGUGT'TJCNVWPI(GKPG2CVKPCYKP\-QPVCMVUVGNNGRQNKGTVG2NCVVG

 101


NIKOLAUS II.

1375

1,5:1

1,5:1



-QRGMGP5V2GVGTUDWTII$KVMKP 4   5GNVGPDGUQPFGTUKPFKGUGT'TJCNVWPI9KP\-TCV\GTRQNKGTVG2NCVVG



1376

1,5:1



1,5:1

-QRGMGP5V2GVGTUDWTII$KVMKP  5GJTUGNVGPKPFKGUGT'TJCNVWPI2TCEJVGZGORNCT2QNKGTVG2NCVVG



1377 1,5:1



1,5:1

-QRGMGP5V2GVGTUDWTII$KVMKP

1378

1379

2TCEJVGZGORNCT5VGORGNINCP\

1380



1381



-QRGMGP5V2GVGTUDWTII$KVMKP 4 

48QT\Ã&#x2019;INKEJ





-QRGMGP5V2GVGTUDWTII$KVMKP

2QNKGTVG2NCVVG





-QRGMGP5V2GVGTUDWTII$KVMKP 4   5GJTUGNVGPDGUQPFGTUKPFKGUGT'TJCNVWPI2QNKGTVG2NCVVG





-QRGMGP5V2GVGTUDWTII$KVMKP



102

2QNKGTVG2NCVVG


NIKOLAUS II.

1382

1383

1384

1385



-QRGMGP5V2GVGTUDWTII$KVMKP

2QNKGTVG2NCVVG





-QRGMGP5V2GVGTUDWTII$KVMKP

'TUVCDUEJNCI5VGORGNINCP\





-QRGMGP5V2GVGTUDWTII$KVMKP

2QNKGTVG2NCVVG





-QRGMGP5V2GVGTUDWTII$KVMKP

2QNKGTVG2NCVVG



1386



1388

1387

-QRGMGP5V2GVGTUDWTII$KVMKP 4 

1389

8QPITÌ­VGT5GNVGPJGKV8QT\ÒINKEJ



'ZGORNCTFGT5COONWPI#PVQPKP2TQMQR6GKN#WMVKQP#WTGC0WOKUOCVKMC2TCI0T



-QRGMGP5V2GVGTUDWTII$KVMKP

2TCEJVGZGORNCT2QNKGTVG2NCVVG





-QRGMGP5V2GVGTUDWTII$KVMKP 4   5GJTUGNVGPDGUQPFGTUKPFKGUGT'TJCNVWPI2QNKGTVG2NCVVG





-QRGMGP5V2GVGTUDWTII$KVMKP



1390

1391

2QNKGTVG2NCVVG

1392

1393

1394



-QRGMGP5V2GVGTUDWTII$KVMKP

2QNKGTVG2NCVVG





-QRGMGP5V2GVGTUDWTII$KVMKP

2QNKGTVG2NCVVG





-QRGMGP5V2GVGTUDWTII$KVMKP

(NGEMKIG2CVKPCRQNKGTVG2NCVVG





-QRGMGP5V2GVGTUDWTII$KVMKP

2QNKGTVG2NCVVG





-QRGMGP5V2GVGTUDWTII$KVMKP 4 

445GJTUEJÌPpXQT\ÒINKEJ

 103


NIKOLAUS II.

1395 1,5:1

1,5:1

'KP-QRGMGP5VÃ&#x2019;EMFGT/Ã&#x2019;P\UV·VVG2CTKU 

-QRGMGP2CTKUI$KVMKP

5GJTUGNVGPKPFKGUGT'TJCNVWPI2QNKGTVG2NCVVG



1396

1,5:1

1,5:1

'KP4WDGNFGT/Ã&#x2019;P\UV·VVG$TÃ&#x2019;UUGN 

4WDGN$TÃ&#x2019;UUGNI$KVMKP&CX  5GJTUGNVGPKPFKGUGT'TJCNVWPI*GTTNKEJG2CVKPCRQNKGTVG2NCVVGOKPDGTÃ&#x2019;JTV

1397

1398



1399

-WRHGTOÃ&#x2019;P\GPFGT/Ã&#x2019;P\UV·VVG5V2GVGTUDWTI 

-W-QRGMGP5V2GVGTUDWTII$KVMKP



-W-QRGMGP5V2GVGTUDWTII$KVMKP 4 



-W -QRGMGP  5V 2GVGTUDWTI +P 752NCUVKMJQNFGT FGT 0)% OKV FGT $GYGTVWPI 2(  4&   $KVMKP 4  5GNVGPDGUQPFGTUKPFKGUGT'TJCNVWPI2QNKGTVG2NCVVG

104

5GNVGPKPFKGUGT'TJCNVWPI2QNKGTVG2NCVVG 4(GKPG2CVKPCHCUV5VGORGNINCP\

  


NIKOLAUS II.

1401

1400

1403

1402



-W -QRGMGP  5V 2GVGTUDWTI +P 752NCUVKMJQNFGT FGT 0)% OKV FGT $GYGTVWPI 2(  4$   $KVMKP 5GNVGPKPFKGUGT'TJCNVWPI2QNKGTVG2NCVVG





-W -QRGMGP  5V 2GVGTUDWTI +P 752NCUVKMJQNFGT FGT 0)% OKV FGT $GYGTVWPI 2(  4$   $KVMKP 5GNVGPKPFKGUGT'TJCNVWPI2QNKGTVG2NCVVG





-W -QRGMGP  5V 2GVGTUDWTI +P 752NCUVKMJQNFGT FGT 0)% OKV FGT $GYGTVWPI 2(  4&   $KVMKP 5GNVGPKPFKGUGT'TJCNVWPI2QNKGTVG2NCVVG





-W -QRGMGP  5V 2GVGTUDWTI +P 752NCUVKMJQNFGT FGT 0)% OKV FGT $GYGTVWPI 2(  $0   $KVMKP 5GNVGPKPFKGUGT'TJCNVWPI2QNKGTVG2NCVVG



1406

1405

1404

1407



-W-QRGMGP5V2GVGTUDWTII$KVMKP  5GNVGPKPFKGUGT'TJCNVWPI-N(NGEMRQNKGTVG2NCVVG





-W -QRGMGP  5V 2GVGTUDWTI +P 752NCUVKMJQNFGT FGT 0)% OKV FGT $GYGTVWPI 2(  4&   $KVMKP 5GNVGPKPFKGUGT'TJCNVWPI2QNKGTVG2NCVVG





-W-QRGMG5V2GVGTUDWTI+P752NCUVKMJQNFGTFGT0)%OKVFGT$GYGTVWPI2(4$$KVMKP 5GNVGPKPFKGUGT'TJCNVWPI2QNKGTVG2NCVVG





-W -QRGMG  5V 2GVGTUDWTI +P 752NCUVKMJQNFGT FGT 0)% OKV FGT $GYGTVWPI 2(  4$   $KVMKP 4  5GNVGPDGUQPFGTUKPFKGUGT'TJCNVWPI2QNKGTVG2NCVVG



1408

1,5:1



1409

1,5:1

1,5:1

1,5:1

-W-QRGMG5V2GVGTUDWTII$KVMKP 4   8QPITQ­GT5GNVGPJGKV8QT\Ã&#x2019;INKEJp5VGORGNINCP\



'ZGORNCTFGT5COONWPI#PVQPKP2TQMQR6GKN#WMVKQP#WTGC0WOKUOCVKMC2TCI0T



-W -QRGMG  5V 2GVGTUDWTI +P 752NCUVKMJQNFGT FGT 0)% OKV FGT $GYGTVWPI 2(  4$   $KVMKP 4  5GJTUGNVGPDGUQPFGTUKPFKGUGT'TJCNVWPI2QNKGTVG2NCVVG

 105


NIKOLAUS II.

1410

3:1

3:1

'KPJCNDGT+ORGTKCNXQP 

4WDGN +ORGTKCN 5V2GVGTUDWTII$KVMKP 4 (D5EJN  )1.&8QPITÌ­VGT5GNVGPJGKV0WT'ZGORNCTGIGRT·IV2TCEJVGZGORNCT 8QT\ÒINKEJp5VGORGNINCP\ 

1411

1412

)GFGPMOÒP\GPFGU<CTGP0KMQNCWU++ 

4WDGN5V2GVGTUDWTICWHUGKPG-TÌPWPII$KVMKP&CX

8QT\ÒINKEJ





4WDGN5V2GVGTUDWTI&GPMOCNHÒT#NGZCPFGT++I$KVMKP 4 &CX  (GKPG2CVKPCUGJTUEJÌPpXQT\ÒINKEJ



1413

1,5:1

 106

1,5:1

4WDGN5V2GVGTUDWTI&GPMOCNHÒT#NGZCPFGT+++I$KVMKP 4 &CX  48QT\ÒINKEJ




NIKOLAUS II.

1414

1414 1,5:1



4WDGN5V2GVGTUDWTICWHFKG,CJTHGKGTFGU5KGIGUÒDGT0CRQNGQPI$KVMKP&CX (GKPG2CVKPCXQT\ÒINKEJp5VGORGNINCP\



1415

1,5:1



1,5:1

4WDGN  5V 2GVGTUDWTI )CPIWV4WDGN IGRT·IV CWH FKG ,CJTHGKGT FGU 5GGUKGIGU DGK *CPIÌ  

)CPIWV ÒDGTFKG5EJYGFGPI$KVMKP 4 &CX  445GJTCVVTCMVKXGU'ZGORNCTOKVHGKPGT2CVKPCXQT\ÒINKEJ  +P FGT 5GGUEJNCEJV XQP *CPIÌ HKPPKUEJ *CPMQ  YWTFG FGT UEJYGFKUEJG #FOKTCN 'JTGPUMLÌNF XQP TWUUKUEJGP 5GG   UVTGKVMT·HVGPIGHCPIGPIGPQOOGP

1416

1,5:1

1,5:1

2TQDGRT·IWPIGPFGT/ÒP\UV·VVG$GTNKP 

-W -QRGMGP  $GTNKP 2TQDG OKV FGT ,CJTGU\CJN  KP FGT 4ÒEMUGKVGPWOUEJTKHV  I   $KVMKP 4  8QPITQ­GT5GNVGPJGKV8QT\ÒINKEJp5VGORGNINCP\  107


NIKOLAUS II.

1417

1,5:1

1,5:1



-W-QRGMGP$GTNKP2TQDGOKVFGT9GTVCPICDGUQYKGFGT,CJTGU\CJNKPFGT7OUEJTKHV CWHDGKFGP5GKVGPI$KVMKP 4  8QPITQ­GT5GNVGPJGKV8QT\Ã&#x2019;INKEJp5VGORGNINCP\



'ZGORNCTFGT5COONWPI#PVQPKP2TQMQR6GKN#WMVKQP#WTGC0WOKUOCVKMC2TCI0T

1418

1,5:1



1,5:1

-W -QRGMGP  $GTNKP 2TQDG OKV FGT ,CJTGU\CJN  KP FGT 4Ã&#x2019;EMUGKVGPWOUEJTKHV  I   $KVMKP 4  8QPITQ­GT5GNVGPJGKV8QT\Ã&#x2019;INKEJp5VGORGNINCP\  'ZGORNCTFGT5COONWPI#PVQPKP2TQMQR6GKN#WMVKQP#WTGC0WOKUOCVKMC2TCI0T

1419 1,5:1

1,5:1



-W-QRGMG$GTNKP2TQDGOKVFGT,CJTGU\CJNKPFGT4Ã&#x2019;EMUGKVGPWOUEJTKHVI$KVMKP  4  8QPITQ­GT5GNVGPJGKV(CUV5VGORGNINCP\



'ZGORNCTFGT5COONWPI#PVQPKP2TQMQR6GKN#WMVKQP#WTGC0WOKUOCVKMC2TCI0T

1420 2:1



2:1

-W -QRGMG  $GTNKP 2TQDG OKV FGT 9GTVCPICDG  UQYKG FGT ,CJTGU\CJN  KP FGT   4Ã&#x2019;EMUGKVGPKPUEJTKHVI$KVMKP 4  8QPITQ­GT5GNVGPJGKV8QT\Ã&#x2019;INKEJp5VGORGNINCP\  'ZGORNCTFGT5COONWPI#PVQPKP2TQMQR6GKN#WMVKQP#WTGC0WOKUOCVKMC2TCI0T

108


NIKOLAUS II.

1,5:1



1421

1,5:1

 -QRGMG  $GTNKP 2TQDG KP -WRHGT0KEMGN OKV FGT 9GTVCPICDG  UQYKG FGT ,CJTGU\CJN   KPFGT4ÒEMUGKVGPKPUEJTKHVI$KVMKP 4  8QPITQ­GT5GNVGPJGKV8QT\ÒINKEJ  'ZGORNCTFGT5COONWPI#PVQPKP2TQMQR6GKN#WMVKQP#WTGC0WOKUOCVKMC2TCI0T

1422

2:1



2:1

-W -QRGMG  $GTNKP 2TQDG OKV FGT 9GTVCPICDG  UQYKG FGT ,CJTGU\CJN  KP FGT   4ÒEMUGKVGPKPUEJTKHVI$KVMKP 4  8QPITÌ­VGT5GNVGPJGKV8QT\ÒINKEJp5VGORGNINCP\  'ZGORNCTFGT5COONWPI#PVQPKP2TQMQR6GKN#WMVKQP#WTGC0WOKUOCVKMC2TCI0T

1423

1424

1425

8GTFKGPUVOGFCKNNGPFGU<CTGP0KMQNCWU++ 



5KNDGTOGFCKNNG Q , WPUKIPKGTV FGT MCKUGTNKEJ TWUUKUEJGP )GUGNNUEJCHV HÒT NCPFYKTVUEJCHVNKEJG   )GHNÒIGN\WEJV9GKDNKEJG)GUVCNVUVGJVXXWPFHÒVVGTV)GHNÒIGNT<KGIGWPF*CUGPKO*KPVGTITWPF $CWO8KGT <GKNGP 5EJTKHV WOJGT .QTDGGT WPF 'KEJGP\YGKI /KV \YGK 2WP\GP CWH FGT 4ÒEMUGKVG     1XCN&TGKGEM-QRHT 4GEJVGEM0 URKGIGNXGTMGJTV :OOI&KCMQXp  8QT\ÒINKEJ



&KEMG 5KNDGTOGFCKNNG Q , WPUKIPKGTV 2TGKUOGFCKNNG FGT UVCCVNKEJGP $GJÌTFG HÒT 2HGTFG\WEJV HÒT FCU   DGUVG4GPPRHGTF-QRHN8KGT<GKNGP5EJTKHVFCTWPVGT5VGTPOOI&KCMQX 4  49KP\4CPFHGJNGTHCUVXQT\ÒINKEJ



/GFCKNNGPFGU<CTGP0KMQNCWU++ 

6TCIDCTG 5KNDGTOGFCKNNG  WPUKIPKGTV CWH UGKPG -TÌPWPI KP /QUMCW $ÒUVG N-TQPG ÒDGT \YGK   <GKNGP5EJTKHVWPF&CVWOUCPICDGOOI&KCMQXp \W  5GJTUEJÌP

 109


NIKOLAUS II.

1426



5KNDGTOGFCKNNG  XQP # )TKNKEJGU CWH FKG +PFWUVTKG WPF -WPUVCWUUVGNNWPI KP 0K\JP[ 0QYIQTQF   -QRHN4WUUKCUVGJVXXOKV2CNO\YGKIKPFGT4GEJVGPOKVFGT.KPMGPDGMT·P\VUKGGKPGO·PPNKEJG WPF GKPG YGKDNKEJG )GUVCNV FKG XQT KJT MPKGP KO *KPVGTITWPF #PUKEJV FGU #WUUVGNNWPIUIGD·WFGU   OOI&KCMQX 4  (GKPG2CVKPCXQT\ÒINKEJp5VGORGNINCP\



1427



5KNDGTOGFCKNNGXQP#8CU[WVKPUM[CWHFKG,CJTHGKGTFGU/CTKPGOKPKUVGTKWOU&KG-ÌRHGXQP 0KMQNCWU ++ WPF #NGZCPFGT + PGDGPGKPCPFGT N9GKDNKEJG )GUVCNV KP CPVKMGT -NGKFWPI OKV GTJQDGPGT   (CEMGN KP FGT 4GEJVGP WPF 4WFGT KP FGT .KPMGP UKV\V PCEJ T CWH GKPGT 9CUUGTWTPG CO 7HGT KO   *KPVGTITWPF5EJNCEJVUEJKHHOOI&KCMQX 44CPFHGJNGTHCUVXQT\ÒINKEJ



1428

1,5:1

1,5:1

'+0'4755+5%*'+/+6#6+10'+0'50+'&'4.0&+5%*'0&7-#6'0810  110

&WMCV5V2GVGTUDWTII+OKVCVKQPGKPGUPKGFGTN·PFKUEJGP4KVVGTFWMCVGP$KVMKP(D 5EJNp )1.&45GJTUEJÌP




SOWJETUNION

1429

519,'670+10 

-QRGMGP2TQDGKP$TQP\GOKVIGTKHHGNVGO4CPFI7UJCMQX(GFQTKP 4   445GJTUEJÌP



1430

1,5:1



1,5:1

-QRGMGP2TQDGOKVUEJOCNGT9GTV\CJNWPFIGTKHHGNVGO4CPFI7UJCMQX(GFQTKP 4  8QPITÌ­VGT5GNVGPJGKV0WT'ZGORNCTGIGRT·IV8QT\ÒINKEJp5VGORGNINCP\



1431

1,5:1



1,5:1

-QRGMGP2TQDGOKVDTGKVGT9GTV\CJNWPFIGTKHHGNVGO4CPFI7UJCMQX(GFQTKP 4  8QPITQ­GT5GNVGPJGKV8QT\ÒINKEJp5VGORGNINCP\

1432

 



1433

4WDGN2TQDGI7UJCMQX(GFQTKP 4 

448QT\ÒINKEJp5VGORGNINCP\



4WDGN2TQDGI7UJCMQX(GFQTKP 4 

44/KPDGTKGDGPUGJTUEJÌPpXQT\ÒINKEJ



'ZGORNCTFGT#WMVKQP*&4CWEJ)OD*9KGP0T

111


RUSSISCHE REPUBLIK

1434 1,5:1



1,5:1

4WDGN 6UEJGTYQPG\ /QUMCWI(GKPIQNF(D C 5EJN  )1.&2QNKGTVG2NCVVG



ex 1435



/ÒP\UCV\.GPKPITCFDGUVGJGPFCWU4WDGN2NCVKP4WDGN2CNNCFKWO Z UQYKG4WDGNKP 5KNDGT -/    ,CJTG 'PVFGEMWPI 4WUUKUEJ#OGTKMCU +PUIGUCOV  I 2NCVKP WPF  I   2CNNCFKWOHGKP(D5EJN  5VÒEM2.#6+0 Z WPF2#..#&+7/ Z +PTQVGO1TKIKPCNGVWK2QNKGTVG2NCVVG 

ex 1436

4755+5%*'4'27$.+-5'+6 

/ÒP\UCV\  /QUMCW DGUVGJGPF CWU    WPF  4WDGN 4WUUKUEJGU $CNNGVV +PUIGUCOV   I(GKPIQNF(D5EJN  5VÒEM)1.&+P1TKIKPCNp*QN\UEJCVWNNG2QNKGTVG2NCVVG



ex 1437



/ÒP\UCV\/QUMCWDGUVGJGPFCWUWPF4WDGN<QDGN+PUIGUCOVI(GKPIQNF (D5EJN  5VÒEM)1.&+P1TKIKPCNUEJCVWNNG2QNKGTVG2NCVVG



'+0.164755+5%*'4/ª0<'0 

112

0KMQNCWU + 5KNDGTLGVQP  WPUKIPKGTV CWH UGKPG -TÌPWPI KP /QUMCW &KCMQX    -QRGMGP    $KVMKP   #NGZCPFGT ++ 5KNDGTLGVQP  WPUKIPKGTV CWH UGKPG -TÌPWPI KP /QUMCW  

&KCMQX 0KMQNCWU++-QRGMGP5V2GVGTUDWTI $KVMKP  5VÒEM8QT\ÒINKEJ




SAMMLUNG BRIEFMARKENGELD

ex 1439 (minimal verkleinert)

113


SAMMLUNG BRIEFMARKENGELD

ex 1439

114


SAMMLUNG BRIEFMARKENGELD

'+0'5#//.70)810$4+'(/#4-'0)'.& 

*QEJDGFGWVGPFG5COONWPIXQP$TKGHOCTMGPIGNF4WUUNCPFUWPF.GVVNCPFU&CUGKP\KICTVKIG1DLGMVGPVJ·NV W C 4CTKV·VGP FGT 4GIKQPGP +OCP 6UEJGTMCUUMQLG  5VÒEM  WPF .GRUKPUM  5VÒEM  &KG )GDKGVG   6UEJCDCTQYUM 6GTGM &CIJGUVCP 0QTFYGUV #TOGG WPF 6UEJKVC UKPF OKV KPUIGUCOV  'ZGORNCTGP   XGTVTGVGP&GU9GKVGTGPUKPFKPFGT5COONWPI$NÌEMGWPF$ÌIGPXQPDKU\W5VÒEMGPYGNEJGKP FGT$GUVCPFUCWHPCJOGNGFKINKEJLGYGKNUCNUGKP'ZGORNCTIGTGEJPGVYWTFGP$GKFGONGVVKUEJGP6GKNFGT 5COONWPI JCPFGNV GU UKEJ WO DGKFUGKVKI DGFTWEMVG $TKGHOCTMGP FKG CWU WPHGTVKIGP )GNFUEJGKPGP XQP   #YCNQHH$GTOQPV WPF 5QYLGV4KIC JGTIGUVGNNV YWTFGP W C  4WDGN -CTFCMQHH 0T   &KGUG   JGTCWUTCIGPFG YQJN GKP\KICTVKIG 5COONWPI OKV \CJNTGKEJGP 4CTKV·VGP KUV XQP JÌEJUVGT $GFGWVWPI HÒT   FCUTWUUKUEJG$TKGHOCTMGPIGNFYGUGPWPFUQNNVGFGVCKNNKGTVDGUKEJVKIVYGTFGP  +PUIGUCOV'ZGORNCTGKP#NDGP5GJTUEJÌPpXQT\ÒINKEJ  )GUEJKEJVGWPF7TURTWPIFGTXQTNKGIGPFGP5COONWPI  &GT$GUVCPF4*DKNFGVG#PHCPIFGTGT,CJTGFGP)TWPFUVQEM\WTLGV\KIGP5COONWPI  4*GOKPGPVGT2CRKGTIGNFURG\KCNKUVWPF(CEJCWVQTJCVVGDGTGKVUXQTFGO++9GNVMTKGIFCUTWUUKUEJG$TKGHOCTMGP IGNF IGUCOOGNV #NU YGUGPVNKEJGT $GKVTCI WPF YGKVGTGT <WYCEJU CWU FGO ,CJT  KUV FGT 'TYGTD FGU $GUVCPFGU   -.CWU9\WPGPPGP&CTÒDGTJKPCWUYWTFGFKG5COONWPIUGKV#PHCPIFGTGT,CJTGFWTEJ'KP\GNGTYGTDWPIGP CWUFGO+PWPF#WUNCPFUV·PFKIGTI·P\VWPFYGKVGTCWUIGDCWV  4WUUNCPF  <WFKGUGT)TWRRGIGJÌTGPUQYQJNFKGTGEJVJ·WHKIG/CUUGPYCTGFGU<CTGPTGKEJGUFGTRTQXKUQTKUEJGP4GIKGTWPIQFGT FGT 7MTCKPG CNU CWEJ UGNVGPG )GDKGVG YKG \$ %JCDCTQYUM .GRUKPUM 6UEJKVC 0QTFCTOGG 4QFULCPMQ DKU JKP \W    GZVTGOGP 4CTKV·VGP YKG 5VÒEMG CWU +OCP WPF 6EJGTMCUUMQLG &KGUG TGEJV WPVGTUEJKGFNKEJGP )GDKGVG YWTFGP PKEJV    GKP\GNPCWHKJTGP9GNVTCPIRNCV\WPVGTUWEJV  

#NDGTV 2KEM D\Y FKG $C[GTKUEJG *[RQVJGMGPDCPM KP /ÒPEJGP JCVVGP XQT IGTCWOGT <GKV FKG DGTÒJOVG 5COONWPI    -CTFCMQHH ÒDGTPQOOGP 'U NCI FCJGT PCJG IGPCWG #WUMÒPHVG ÒDGT FGTGP CMVWGNNG TWUUKUEJGP $GUV·PFG GKP\WJQNGP    ªDGTTCUEJGPFGTYGKUG UVGNNVG UKEJ JGTCWU FCUU KP /ÒPEJGP UGJT ITQ­G .ÒEMGP DGKO TWUUKUEJGP $TKGHOCTMGPIGNF    XQTJCPFGPUKPF$GKGKPGTIG\KGNVGP#WUYCJNFGTUKGDGPUGNVGPUVGP6GKNIGDKGVGJKGTXQPKUVHGUV\WUVGNNGPFCUUCNNGKPFTGK KP /ÒPEJGP ÒDGTJCWRV PKEJV XGTVTGVGP UKPF FCTWPVGT FKG CNU CNNGTUGNVGPUVGP \W DGVTCEJVGPFGP 4GIKQPGP +/#0 WPF    65%*'4-#55-1,' MGKP GKP\KIGT $GNGI FCXQP FQTV XQTJCPFGP JKGT KP FGT 5COONWPI UKPF GU  5VÒEMG  0KEJV    ICP\UQUGNVGPWPFFGPPQEJGDGPUQOKVMGKPGO5VÒEMKP/ÒPEJGPXGTVTGVGPKUV.GRUKPUM JKGTNKGIGPYKGFGTWO 'ZGORNCTGXQT #NNGKPFKGUGTCUEJG(GUVUVGNNWPIUQNNVGIGPÒIGPWOFGTXQTNKGIGPFGP5COONWPIFKGYGNVYGKVGTUVG 2QUKVKQP\WCVVGUVKGTGP#DGTCWEJFKGYGKVGTG$GVTCEJVWPIFGTKP/ÒPEJGPXQTJCPFGPGP)GDKGVG%JCDCTQYUM6GTGM &CIJGUVCP0QTFYGUV#TOGGWPF6UEJKVCDGUV·VKIVFKGUEJQPXQTJGTGTMCPPVGLGFQEJWPGTYCTVGVG&KUMTGRCP\&GPKP /ÒPEJGPXQTJCPFGPGP'ZGORNCTGPUVGJGPKPFGTXQTNKGIGPFGP5COONWPIKPUIGUCOV5VÒEMGFKGUGTXKGT)GDKGVG IGIGPÒDGT  

5WOOC5WOOCTWO5GNDUVYGPPDGTÒEMUKEJVKIVYGTFGPMCPPFCUUKPFGT5COONWPIGKPKIG8CTKCPVGP\WU·V\NKEJ\W *CWRVPWOOGTP CWHIGHÒJTV UKPF URTGEJGP FKG 'PF\CJNGP HÒT UKEJ FG HCEVQ UKPF XQP FGP  UKGDGP JGTCWUIGUVGNNVGP    KPVGTGUUCPVGUVGP )GDKGVGP OKV $TKGHOCTMGPIGNFCWUICDGP  5GNVGPJGKVGP KP FGT 5COONWPI  GPVJCNVGP KP FGT    5COONWPIFGT*[RQXGTGKPUDCPM5VKHVWPI *8$ UKPFGUNGFKINKEJGKPHÒPHVGNP·ONKEJ5VÒEMG  'KPG 8GTINGKEJUWPVGTUWEJWPI FGT J·WHKIGP DKU OKVVGNUGNVGPGP $TKGHOCTMGPIGNFMCVGIQTKGP YKG \$ FKG 4QOCPQY    #WUICDGPQFGT1FGUUC7MTCKPGHCPFPKEJVUVCVVWPFKUVCWEJPKEJVXQP4GNGXCP\/ÌINKEJGTYGKUGUKPFKP/ÒPEJGP XQP UQNEJGP J·WHKIGTGP 5VÒEMGP KO 8GTJ·NVPKU OGJT 'ZGORNCTG XQTJCPFGP CNU XQP FGP 5GNVGPJGKVGP YCU NQIKUEJ    Y·TG  

'UKUVCP\WPGJOGPFCUUYGKVGTG5COONWPIGPXQPTWUUKUEJGO2CRKGTIGNFGZKUVKGTGPKPFGPGPGVYCU$TKGHOCTMGPIGNF KPVGITKGTV KUV YKG CWU FGO 9GTM-CTFCMQHH\WXGTOWVGPKUVCWH5GKVG8UGKPGU-CVCNQIGUXQPURTKEJVGTXQP ō -QTTGURQPFGPVGPŋ UQYKG XQP ōGKPGT ICP\GP 4GKJG XQP TWUUKUEJGP WPF CWUN·PFKUEJGP 5COONWPIGPŋ #NU    YKEJVKIG-QTTGURQPFGPVGPYGTFGPXQP-CTFCMQHHUQNEJGYKG#PVKRQHH&T-GNNGT2NCVD·T\FKUWPF1WEJMQHHIGPCPPV &C -CTFCMQHH LGFQEJ FCU IGUCOVG TWUUKUEJG 2CRKGTIGNF XQP  DKU  DGJCPFGNV WPF FCU $TKGHOCTMGPIGNF PWT    GKPGP $TWEJVGKN FCXQP FCTUVGNNV KUV GU PKEJV DGMCPPV QD WPF YGPP LC YGT XQP FGP FCOCNKIGP 5RG\KCNKUVGP    $TKGHOCTMGPIGNF ÒDGTJCWRV DGUC­ QFGT UKEJ FCOKV CWUMCPPVG <WOKPFGUV UEJGKPV FCU IGUCOVG GZKUVKGTGPFG /CVGTKCN    JKGTXQP KO -CTFCMQHHMCVCNQI GTHCUUV \W UGKP &GT 8GTDNGKD FGT MCVCNQIKUKGTVGP $TKGHOCTMGPIGNFUVÒEMG KUV CNNGTFKPIU    WPDGMCPPVKJTG.QMCNKUKGTWPIJGWV\WVCIGWPOÌINKEJ  

.GVVNCPF  $GKFGT5COONWPI.GVVNCPFJCPFGNVGUUKEJWODGKFUGKVKIDGFTWEMVG$TKGHOCTMGPFKGCWUWPHGTVKIGP)GNFUEJGKPGPXQP #YCNQHH$GTOQPV WPF 5QYLGV4KIC JGTIGUVGNNV YWTFGP *KGTHÒT Y·TG FKG $G\GKEJPWPI /CTMGPIGNF TKEJVKIGT CNU    $TKGHOCTMGPIGNF  

4WUUNCPFWPF.GVVNCPF  $GK 4WUUNCPF WPF .GVVNCPF UKPF  $NÌEMG WPF $ÌIGP XQP DKU \W  5VÒEMGP XQTJCPFGP ,GFGT FKGUGT $NÌEMG WPF     $ÌIGP\·JNVKPFGT$GUVCPFCWHPCJOGLGFQEJNGFKINKEJCNUGKP'ZGORNCTKPFGT5COONWPI <W FGT 5COONWPI IGJÌTGP YGKVGTG  'ZGORNCTG KPMNWUKX (CTDXCTKCPVGP WPF GKPKIG YGPKIG &WDNGVVGP &KG    )GUCOV\CJNFGT5VÒEMGDGN·WHVUKEJUQOKVCWH'ZGORNCTG  <YGKÌUVGTTGKEJKUEJG$TKGHOCTMGPCWUFGT5COONWPI4G[PQNFUUKPFFCDGKYWTFGPLGFQEJPKEJVOKVIG\·JNV  $GK.GVVNCPFUKPFPWTYGPKIG5VÒEMGWPF$NÌEMGCNUUGNVGP\WDG\GKEJPGPGTY·JPGPUYGTVFCDGK\$  4WDGN-CTFCMQHH0TRCIGOKV)QNFOCTM  $GK 4WUUNCPF JKPIGIGP YKG DGTGKVU GTY·JPV \·JNGP GVNKEJG 5VÒEMG CWU %JCDCTQYUM +OCP 6GTGM &CIJGUVCP    .GRUKPUM6UEJGTMCUUMQLG6UEJKVCWPFFGT0QTFCTOGG\WFGPITQ­GP4CTKV·VGPKPFGT5COONWPI  &KGXQP-CTFCMQHHCPIGIGDGPGP2TGKUGKP)QNFOCTMCWUFGO,CJTUQYKGFKG2TGKUPQVKGTWPIGPXQP2KEMKP&/

&GWVUEJG /CTM  CWU FGO ,CJT  YGPP CWEJ N·PIUV QDUQNGV GTNCWDGP CWH LGFGP (CNN GKPGP \WXGTN·UUKIGP WPF    FKHHGTGP\KGTVGP5GNVGPJGKVUXGTINGKEJ&KG/CUUGPYCTGXQO<CTGPTGKEJDGK2KEMOKVņ&/DGYGTVGVFÒTHVGJGWVG CWEJMCWOOGJT9GTVUGKP(ÒTFCUTGUVNKEJG/CVGTKCNOÒUUGPFKG2TGKUGUQYQJNXQP-CTFCMQHHCNUCWEJXQP2KEM KO5EJPKVVOCNDKUOWNVKRNK\KGTVYGTFGPWOGKPGCMVWGNNG$GYGTVWPIKP'WTQKPGVYC\WGTJCNVGP7PCDJ·PIKI FCXQP YKTF DGUUGTGU TWUUKUEJGU $TKGHOCTMGPIGNF CWH FGO 9GNVOCTMV UQ IWV YKG PKG CPIGDQVGP GKPG    ,CJTVCWUGPFUCOONWPIFGT5WRGTNCVKXGYKGFKGXQTNKGIGPFG5COONWPIGTUVTGEJVPKEJV 

115


SAMMLUNG BRIEFMARKENGELD

GEBIET – REGION CHABAROWSK OSTRUSSLAND CHINESISCHE GRENZE IMAN OSTSIBIRIEN TEREK DAGHESTAN GEBIET KAUKASUS LEPSINSK SÜDKASACHSTAN ALAKOLSKY REGION NORDWEST ARMEE Sondercorps: Rodsjanko - Judenitsch TSCHERKASSKOJE KASACHSTAN / ZENTRALASIEN TSCHITA SÜDOSTSIBIRIEN TOTAL

RUSSIAN STAMP MONEY / RUSSISCHES BRIEFMARKENGELD DIE SIEBEN SELTENSTEN GEBIETE Bestandsvergleich: Sammlung Hypovereinsbank / Sammlung X Hypovereinsbank (*)

SAMMLUNG X

5 Pieces

19 Pieces

6 Pieces

9 Pieces

25 Pieces

23 Pieces

1 Piece

6 Pieces

9 Pieces

7 Pieces

28 Pieces

22 Pieces

116 Pieces

(*) Hypovereinsbank: Ehemalige Sammlung Pick nach Übernahme der russischen Sammlung von Kardakoff, heute Hypovereinsbank Stiftung Geldscheinsammlung München

GEBIET – REGION CHABAROWSK OSTRUSSLAND CHINESISCHE GRENZE

IMAN OSTSIBIRIEN TEREK DAGHESTAN GEBIET KAUKASUS

LEPSINSK SÜDKASACHSTAN ALAKOLSKY REGION

NORDWEST ARMEE Sondercorps; Rodsjanko - Judenitsch TSCHERKASSKOJE KASACHSTAN / ZENTRALASIEN

TSCHITA SÜDOSTSIBIRIEN

116

RUSSIAN STAMP MONEY / RUSSISCHES BRIEFMARKENGELD Bestandsvergleich: Sammlung HVB / Sammlung X PICK / HVB (*) VORLIEGENDE SAMMLUNG X (Kardakoff Page 236) Dito 2 Zeilen, violetter 1 (50 Kop.), 2 (75 Kop.), 3 (1 R.), Stempel in Rahmen 4 (1,25 R.), 6 (3 R.), 7 (5 R.) 4 (1,25 R.) (Kardakoff Page 236-237) Dito 3 Zeilen, violetter oder 14 (50 Kop.), 15 (75 Kop.), 16 (1 R.), roter Stempel 17 (1,25 R.), 18 (2 R.), 19 (3 R.), 20 (5 R.) 14 (50 Kop.), 15 (75 Kop.), 16 (1 R.), 18 (2 R.) (Kardakoff Page 240) ▬▬ 2 (50), 3 (75), 4 (1 R.), 5 (1,25 R.), 6 (2 R.), 7 (3 R.) (Kardakoff Page 107) Dito H schmal, ohne Punkt 1 (25 K.), 2 (50 K.) 3 (1 R.), 4 (3 R.), 2 (50 K.), 3 (1 R.), 5 (5 R.) 6 (10 R.), 7 (25 R.), 8 (100 R.) (Kardakoff Page 107) Dito H breit, mit Punkt 10 (50 K.) , 11 (1 R.), 12 (3 R.), 13 (5 R.), 9 (25 K.), 11 (1 R.), 12 (3 R.), 14 (10 R.), 15 (25 R.), 16 (100 R.) 14 (10 R.), 15 (25 R.), 16 (100 R.) (Kardakoff Page 192) Kleiner Adler im Stempel ▬▬ 1 (1 R.), 2 (3 R.), 3 (5 R.) Papier blau, 3a (5 R.) Papier weiss, 4 (10 R.), (Kardakoff Page 192) ▬▬ Großer Adler im Stempel 5 (1 R.), 6 (3 R.), 7 (5 R.), 8 (10 R.) (Kardakoff Page 45) Dito 3.1a (50 Kop.) 3.1 (50 Kop.) beidseitig, hellgrün einseitig, hellgrün 3.1a (50 Kop.) einseitig, hellgrün 3.1b (50 Kop.) einseitig, dunkelgrün, dünnes Papier (Kardakoff Page 197) schwarz ▬▬ 1 (1 R.), 2 (3 R.), 3 (5 R.), 4 (25 R.) (Kardakoff Page 197) violett ▬▬ 5 (1 R.), 12 (35 R.), 13 (70 R.) (Kardakoff Page 249) Dito Rahmen einfach 13 (1 R.), 14 (2 R.), Stempelmarken 15 (3 R.), 16 (5 R.) 13 (1 R.), 16 (5 R.) (Kardakoff Page 250) Dito Rahmen einfach 18 (3 R.), 19 (5 R.), 20 (10 R.), Kontrollmarken 21 (25 R.), 22 (100 R.) 20 (10 R.) (Kardakoff Page 250) Dito Rahmen verziert 23 (1 R.), 24 (2 R.), 25 (3 R.), 26 (5 R.) Stempelmarken 23 (1 R.), 24 (2 R.), 25 (3 R.)


SAMMLUNG BRIEFMARKENGELD (Kardakoff Page 250) Dito Rahmen verziert 28 (3 R.), 30 (10 R.) 31 (25 R.), 32 (100 R.) Kontrollmarken 32 (100 R.) (*) PICK / HVB: Ehemalige Sammlung Pick, heute Hypovereinsbank Stiftung Geldscheinsammlung München

Russland + Lettland

AUFFÜHRUNG DER STÜCKZAHLEN NACH SELTENHEITSSTUFEN A B C D Weltrang Gesamt Unikate 2-3 Ex 1 420 10? 15-20?

E 4-7 Ex. 20-30?

Bedeutung der Einteilungen und Abkürzungen A Weltrangstellung der Sammlung B Gesamtzahl der Stücke in der Sammlung C Anzahl der Unikate der Sammlung D Anzahl der Stücke, die mit jeweils 2-3 Exemplaren bekannt sind E Anzahl der Stücke, die mit jeweils 4-7 Exemplaren bekannt sind Aktueller Stand der Sammlung und Zukunftsperspektiven (ZP) Aktuell Fehlen C Fehlen D Fehlen E Komplett Unikate 2-3 Ex. 4-7 Ex. 90% ? ? 30? 99% ─ ─ ─

Russland Lettland

ZP Zukunft +++ fast komplett

RUSSIAN STAMP MONEY / RUSSISCHES BRIEFMARKENGELD Konkordanztabelle zur Literatur GEBIET – REGION RUSSLAND ZARENREICH + PROVISORISCHE REGIERUNG

KARDAKOFF

DENIS

WPM GEN.

Page 14-15

Page 3

1005 + 1006

PICK BFG

GEBIET – REGION CHABAROWSK OSTRUSSLAND CHINESISCHE GRENZE IMAN OSTSIBIRIEN KRIM GEBIETSREGIERUNG SÜDWESTRUSSLAND TEREK REPUBLIK KAUKASUS TEREK DAGHESTAN GEBIET KAUKASUS LEPSINSK SÜDKASACHSTAN ALAKOLSKY REGION NORDWEST ARMEE Sondercorps; Rodsjanko - Judenitsch HAUPTKOMMANDO SÜDRUSSLAND (Gen. Denikin) TSCHERKASSKOJE KASACHSTAN / ZENTRALASIEN TSCHITA SÜDOSTSIBIRIEN UKRAINE UKRAINISCHE VOLKSREPUBLIK URALSK WESTKASACHSTAN AMUR REGION OSTASIEN BAKU TRANSKAUKASUS MINERALNYJE WODY NORD KAUKASUS ODESSA UKRAINE

KARDAKOFF

DENIS

WPM SPEC.

Page 236

Page 47

Page 37-38

Page 240

Page 43

Page 38

Page 92

Page 9

Page 792

Page 38

Page 108

Page 10

Page 800

Page 38-39

Page 107

Page 10

Page 799

Page 39

Page 192

Page 62

Page 40

Page 45

Page 7

Page 786

Page 40

Page 94

Page 9

Page 794

Page 40

Page 197

Page 94

Page 40-41

Page 249/250

Page 94

Page 41-42

Page 60

Page 7

Page 788

Page 42

Page 217

Page 76

Page 814

Page 42

Page 224

Page 19

Page 825

Page 43

Page 162

Page 25

Page 808

Page 43

Page 114

Page 68

Page 43

Page 79

Page 74

Page 791

Seite 43

Page 37 PICK BFG

WPM GEN.: World Paper Money General Issues – Fifth edition – Volume two – Albert Pick, Iola 1986 KARDAKOFF: Katalog der Geldscheine von Russland und der Baltischen Staaten 1769-1950. Berlin 1953 DENIS: Catalogue des monnaies émises sur le territoire de la Russie, Jules Florange, Louis Ciani. Paris 1927 WPM SPEC.: World Paper Money Specialized Issues – Fifth edition – Volume one – Albert Pick. Iola 1986 PICK BFG: Briefmarkengeld (Stamp money), Verlag: Klinkhardt & Biermann. Braunschweig 1970

117


Max Liebermann. Die Blumenterrasse im Wannseegarten nach Norden 1919. Öl auf Karton, 50 x 75 cm. Auktion am 5. Dezember

Herbstauktionen Photographie 4. Dez. Zeitgenössische Kunst 5. Dez. Moderne Kunst 5. Dez. Asiatische Kunst 11./12. Dez. Präkolumbische Kunst 30. Jan. (in Brüssel) Einlieferungen für unsere Frühjahrsauktionen sind willkommen

LEMPERTZ gegründet 1845

Neumarkt 3 50667 Köln Tel. 0221 ⁄ 92 57 29 - 0 Fax - 6 www.Lempertz.com Poststraße 22 10178 Berlin Tel. 030 ⁄ 27 87 60 80 München 089 ⁄ 98 10 77 67 1, rue aux Laines 1000 Brüssel Tel. +32 ⁄ 2⁄514 05 86


010 2 , 1 29. – 31. Janua 3 – r 2010 | January 29

Ehrengast | Guest of Honour South African Mint Auktionshaus Fritz Rudolf Künker 5. Berlin Auktion | 28. Januar 2010


HINWEISE FÜR UNSERE BIETENDEN AUKTIONSKUNDEN 1. Die Auktionsbedingungen finden Sie am Ende dieses Katalogs. 2. Bitte senden Sie uns Ihre Aufträge möglichst frühzeitig zu. Wenn uns Ihr Auftrag erst kurz vor der Auktion erreicht, können sich bei der Bearbeitung Fehler einschleichen. 3. Das beiliegende Formular macht es Ihnen leicht, ein schriftliches Gebot abzugeben. Falls Sie Ihre Gebote faxen möchten: unser Telefax 0541 - 96 20 222 steht Ihnen Tag und Nacht zur Verfügung. 4. Die von Ihnen ersteigerten Objekte werden Ihnen innerhalb von acht Tagen nach Beendigung der Auktion zugeschickt. Die Aufträge werden in der Reihenfolge des Eingangs bearbeitet, d. h. die zuerst eingegangenen Aufträge werden auch zuerst bearbeitet. Auch alle Bieter, die keinen Zuschlag erhalten haben, werden von uns nach der Auktion benachrichtigt. 5. Wenn Sie telefonisch bieten möchten, teilen Sie uns diesen Wunsch bitte mindestens 48 Stunden vor der Auktion mit. Unseren Kundenservice erreichen Sie unter 0541 – 96 20 20 oder gebührenfrei unter 0800 – 5 83 65 37. 6. Wenn Sie als neuer Kunde noch nicht bei uns gekauft haben, ist es empfehlenswert, wenn Sie uns Referenzen angeben. Nennen Sie uns eine Münzhandlung, mit der Sie bereits in Geschäftsverbindung stehen. Oder rufen Sie unseren Kundenservice an. 7. Die Echtheit aller verkauften Objekte wird auch über die gesetzliche Frist hinaus gewährleistet. 8. Alle Kunden, die als Bieter an einer unserer Auktionen teilnehmen, erhalten innerhalb von zwei Wochen nach der Auktion unsere Ergebnisliste gratis. 9. Sie haben Fragen zu einer bestimmten Münze? Sie möchten persönlich an unserer Auktion teilnehmen? Sie haben andere Fragen? Unser Kundenservice freut sich auf Ihren Anruf, entweder direkt unter 0541 – 96 20 20 oder gebührenfrei unter 0800 – 5 83 65 37.

IMPORTANT INFORMATION FOR PLACING BIDS 1. The terms and conditions of the auction can be found at the end of this catalogue. 2. Please send us your instructions as early as possible. The likelihood of errors occurring increases if we do not receive your instructions until shortly before the auction. 3. The enclosed form makes it simple for you to submit a written bid. Our fax machine +49 (0)541 – 96 20 222 is on standby day and night in case you wish to fax your bids. 4. The objects which you purchase will be delivered to you within eight days of the close of auction. Instructions are processed in the same order as they were received – in other words, the first instructions to be received are the first to be processed. All unsuccessful bidders will be also informed after the auction. 5. If you would like to bid by telephone, please ring our customer service beforehand on +49 (0)541 - 96 20 20. 6. If you are a new customer who has not yet bought anything through us, we recommend that you give us references. Name a coin dealer with whom you have already done business. Or call our customer service. 7. The genuineness of all sold objects is also warranted beyond the statutory length of time. 8. All customers who participate as bidders in our auction receive our list of results free of charge within two weeks of the close of auction. 9. Do you have questions about a particular coin? Would you like to participate personally in our auction? Do you have any other questions? Our customer service team will be pleased to help you – call on +49 (0)541 - 96 20 20.

RENSEIGNEMENTS À L'ATTENTION DE NOS CLIENTS DES VENTES AUX ENCHÈRES 1. Vous trouverez les conditions générales de vente aux enchères à la fin de ce catalogue. 2. Veuillez nous faire parvenir vos ordres le plus tôt possible. Si vos ordres nous parviennent juste avant la vente aux enchères, des erreurs risquent d’être commises lors de leur traitement. 3. Le formulaire ci-joint vous aidera à rédiger facilement votre offre. Si vous souhaitez faxer votre offre, vous pourrez le faire 24 heures sur 24 au +49 (0)541 – 96 20 222. 4. Les objets dont vous serez adjudicataire vous seront envoyés dans les huit jours suivant la fin de la vente aux enchères. Les commandes seront prises en compte dans l’ordre de leur arrivée, c’est-à-dire que les commandes nous parvenant les premières seront d’abord traitées. Après la vente aux enchères, nous préviendrons tous les enchérisseurs n’ayant pas obtenu l’adjudication. 5. Si vous souhaitez faire des enchères par téléphone, veuillez appeler aupravant notre service clientèle au +49 (0)541 – 96 20 20. 6. Si vous êtes un nouveau client et n’avez encore fait aucune acquisition chez nous, il serait conseillé de nous fournir quelques références. Indiquez nous si vous traitez déjà avec un professionnel du commerce des monnaies. Ou contactez notre service clientèle au +49 (0)541 – 96 20 20. 7. L’authenticité des pièces vendues sera garantie même au-delà des délais légaux. 8. Tous les clients participant à l’une de nos ventes aux enchères en tant qu’enchérisseurs recevront gratuitement une liste de résultats dans les deux semaines suivant la vente aux enchères. 9. Vous avez des questions concernant une pièce particulière? Vous désirez prendre part personnellement à notre vente aux enchères? Vous avez d’autres questions? Notre service clientèle se fera un plaisir de vous répondre au +49 (0)541 – 96 20 20.

INFORMAZIONI PER GLI OFFERENTI DELLE NOSTRE ASTE 1. Le condizioni d’asta si trovano alla fine di questo catalogo. 2. Siete pregati di inviarci i vostri ordini il più presto possibile. Se il vostro ordine ci perviene poco tempo prima dell’apertura dell’asta, si possono verificare errori nell’elaborazione dello stesso. 3. Per le vostre offerte scritte potete utilizzare il modulo allegato al catalogo. Nel caso voleste trasmettere le vostre offerte per fax, siete pregati di inviarle al seguente numero: +49 (0)541-96 20 222. 4. Gli oggetti che avete acquistato all’asta vi saranno spediti entro otto giorni dal termine della stessa. Gli ordini vengono evasi in base alla data di ricevimento, quindi hanno precedenza quelli pervenuti prima. Anche gli offerenti che non hanno avuta alcuna aggiudicazione riceveranno una nostra comunicazione al termine dell’asta. 5. Se desiderate la partecipazione telefonica in diretta durante l´asta, siete pregati di chiamare prima la consulenza ai clienti al numero diretto +49 (0)541-96 20 20. 6. Se siete clienti nuovi e non avete mai acquistato da noi, vi proponiamo di inviarci delle referenze. Dateci il nome di un negozio di monete presso il quale avete già fatto degli acquisti, oppure chiamate la nostra consulenza ai clienti al numero +49 (0)541 96 20 20. 7. Il certificato d’autenticità di tutti gli oggetti venduti viene rilasciato anche oltre i termini privisti per legge. 8. Tutti i clienti che hanno partecipato ad una nostra asta riceveranno gratuitamente l´elenco delle aggiudicazioni entro quindici giorni dal termine della stessa. 9. Avete delle domande su una moneta in particolare ? Desiderate partecipare personalmente ad una nostra asta? Avete altre domande? Rivolgetevi al nostro Servizio Clienti al numero +49 (0)541 – 96 20 20.


MEINE TEILNAHME ALS SCHRIFTLICHER BIETER 1. 2. 3. 4. 5. 6. 7.

Studieren Sie den Katalog sorgfältig und notieren Sie alle Lose, die interessant für Sie sind. Legen Sie für jedes Los Ihr persönliches Limit fest, das Sie maximal zu zahlen bereit sind. Füllen Sie das beiliegende Formular aus (siehe rechte Seite) und tragen Sie für jedes Los Ihr Höchstgebot ein. Schicken Sie uns Ihren Auftrag frühzeitig. Bei gleich hohen Geboten erhält das zuerst eingegangene Gebot den Zuschlag. Sie haben interessante Lose für insgesamt € 10.000,-- gefunden, möchten jedoch nur € 2.000,-- ausgeben. Kein Problem: Sie geben als Gesamtlimit (ohne Aufgeld) € 2.000,-- an. Wenn Sie Fragen haben: Die MitarbeiterInnen unserer Kundenbetreuung sind für Sie da. Tel. 0800 – 583 65 37 (gebührenfrei). Wenn Sie telefonisch an unseren Auktionen teilnehmen möchten, ist das ab einer Schätzung von € 500,- pro Los möglich. Bitte teilen Sie uns diesen Wunsch mindestens einen Werktag vor Beginn der Versteigerung schriftlich mit.

MEINE PERSÖNLICHE TEILNAHME IN OSNABRÜCK 1.

3.

Wir freuen uns sehr, wenn Sie persönlich nach Osnabrück kommen möchten. Das Flair einer Auktion und die Stimmung im Auktionssaal sind ein besonderes Erlebnis für Sie als Sammler. Osnabrück ist außerdem immer eine Reise wert und die persönliche Betreuung durch unsere Mitarbeiter wissen immer mehr Kunden zu schätzen. 2. Bitte rufen Sie uns rechtzeitig an, damit wir Ihnen Tipps für die Anreise geben und Ihnen ein Hotelzimmer reservieren können. Sie erreichen uns gebührenfrei unter: 0800 – 5 83 65 37. Als erfolgreicher Bieter können Sie Ihre neu erworbenen Stücke gleich persönlich mit nach Hause nehmen. Als guter Kunde unseres Hauses haben Sie 20 Tage Zahlungsziel nach der Auktion.

WIE ENTSTEHT DER PREIS EINER AUKTION? 1. 2.

Der im Auktionskatalog angegebene Preis ist ein Schätzpreis, der durch unsere Experten festgelegt wurde. Das Mindestgebot liegt bei 80% dieses Wertes. Die Zuschlagpreise sind oft deutlich höher als die Schätzpreise. Als Auktionshaus müssen wir bereits vor der Auktion alle schriftlichen Gebote koordinieren. Folgende Beispiele sind im Bietverfahren möglich:

Beispiel 1 (Schätzpreis: € 1.000,--) Es liegt kein schriftlicher Auftrag vor: der Auktionator ruft das Los in der Auktion mit € 800,-- aus. Wenn im Saal nur ein Bieter darauf ein Gebot abgibt, erhält der Saalbieter den Zuschlag für € 800,--.

Beispiel 3 (Schätzpreis: € 1.000,--) Es liegt dem Auktionator nur ein schriftliches Gebot von € 850,-- vor: das Los wird in der Auktion mit € 800,-ausgerufen. Falls kein Bieter im Saal ein Gegenangebot abgibt, erhält der schriftliche Bieter den Zuschlag bei € 800,--.

Beispiel 2 (Schätzpreis: € 1.000,--) Es liegen dem Auktionator drei schriftliche Gebote vor:

Beispiel 4: (Schätzpreis: € 1.000,--) Es liegt dem Auktionator nur ein schriftliches Gebot von € 1.200,-- vor: der Auktionator ruft das Los mit € 800,-- aus. Gibt es im Saal keinen Gegenbieter, erhält der schriftliche Bieter den Zuschlag bei € 800,--. Falls es im Saal Gegenbieter gibt, bietet der Auktionator für seinen schriftlichen Bieter bis maximal € 1.200,-- und erteilt einem Gegenbieter im Saal erst bei mehr als € 1.200,-- den Zuschlag.

Bieter 1: Limit € 2.900,-Bieter 2: Limit € 1.800,-Bieter 3: Limit: € 800,-Nach der Versteigerungsordnung muss der Auktionator im Interesse von Bieter 1 und 2 angemessen überbieten (um ca. 5 bis 10%). Der Ausrufpreis in der Auktion beträgt daher im Interesse von Bieter 1, € 1.900,-- (obwohl die Schätzung € 1.000,-- beträgt). Falls keine höheren Gebote aus dem Saal erfolgen, erhält Bieter 1 den Zuschlag für € 1.900,--. Das Höchstangebot von € 2.900,-- musste nicht ausgeschöpft werden.

Beispiel 5 (Schätzpreis: € 1.000,--) Es liegen drei Gebote von je € 975,-- vor: um Missverständnisse zu vermeiden, überzieht der Auktionator das zuerst eingegangene Gebot geringfügig und erteilt den Zuschlag bei € 1.000,--.


MUSTERAUKTIONSAUFTRAG FÜR SCHRIFTLICHE BIETER 1. Name, Adresse, Telefon: Ihre vollständige Anschrift ist wichtig, damit wir Ihren Auktionsauftrag annehmen und bearbeiten können. Ihre Telefonnummer brauchen wir, um Sie bei Rückfragen zu Ihren Geboten schnell erreichen zu können.

5. Ihre Kundennummer Die Angabe Ihrer Kundennummer unterstützt uns bei der Bearbeitung Ihres Auktionsauftrages. Viele Vorarbeiten für die Auktion werden dadurch einfacher und es werden Fehler vermieden.

2. Losnummern und Gebote Listen Sie alle Lose, für die Sie sich interessieren, mit ihrer Katalognummer auf und legen Sie für sich selbst fest, wie viel Sie bereit sind für jedes einzelne Los zu bieten.

6. Ihr Limit pro Einzellos An dieser Stelle geben Sie an, was Sie für jedes einzelne Stück maximal bereit sind auszugeben.

3. „Oder“-Gebote Wenn Sie sich für mehrere Münzen interessieren, aber nur ein Stück davon erwerben wollen, können Sie Ihre Gebote einfach mit einem „oder“ verbinden. Wichtig: bei den „oder“-Geboten können Sie nicht auf frühere Katalognummern zurückgreifen (z.B. 2890 oder 1558), da die Nr. 1558 dann bereits versteigert ist. 4. Unterschreiben Sie Ihren Auktionsauftrag . . .nachdem Sie Ihre Angaben noch einmal überprüft haben. Ihre Unterschrift ist wichtig, denn damit bestätigen Sie uns, dass sie tatsächlich teilnehmen wollen.

7. Überschreitung Ihrer Limits pro Einzellos In der Praxis zeigt sich, daß oft mehrere Bieter mit ihren Geboten dicht beieinander liegen. Deshalb empfiehlt es sich, an dieser Stelle einer geringfügigen Überschreitung Ihrer Gebote zuzustimmen. Dadurch erhöhen sich Ihre Chancen, im Wettbewerb mit anderen den Zuschlag zu erhalten. 8. Begrenzung Ihres Gesamtlimits Hier können sie die Gesamtsumme Ihrer Gebote begrenzen und festlegen, was Sie insgesamt maximal bereit sind auszugeben. Aufgeld und Mehrwertsteuer kommen später noch hinzu.

ANTWORTEN AUF FRAGEN, DIE UNS OFT GESTELLT WERDEN 1.

Zuschlagpreis/Aufgeld: Wir berechnen als Auktionshaus ein Aufgeld von 15% auf den Zuschlagpreis, dazu kommt die gesetzliche Mehrwertsteuer. Beispiel 2: Zuschlagpreis: € 1.000,-€ 100,-Aufgeld 15% € 150,-€ 15,00 Versandkosten, z. B.* € 5,90 € 5,90 MwSt. 7% € 80,91 € 8,46 ______ ________ Rg.-Betrag € 1.236,81 Rg.-Betrag € 129,36 Mehrwertsteuer: üblicherweise in Deutschland 7%, seit dem 01.01.2000 sind viele Goldmünzen, die nach 1800 geprägt wurden, steuerfrei. Bei Fragen zu der MWSt-Berechnung rufen Sie uns an, gebührenfrei unter: 0800 / 5836537. Rücklosverkauf: Alle Lose, die in der Auktion nicht verkauft wurden, können Sie innerhalb von vier Wochen nach der Versteigerung zu 80% des Schätzpreises (zzgl. Aufgeld und Mehrwertsteuer) erwerben. Achtung: Viele Rücklose sind schnell vergriffen. Unser Spezialservice: Alle Bieter erhalten gratis die Ergebnisliste innerhalb von zwei Wochen nach der Auktion. Im Internet können Sie die Ergebnisliste der Auktion sofort nach der Auktion unter www.kuenker.de einsehen. Beispiel 1:

2. 3.

4.

Zuschlagpreis Aufgeld 15%: Versandkosten, z.. B.* MwSt. 7%

* Die Kosten für Versand und Versicherung werden nach Aufwand berechnet.


ВАЖНАЯ ИНФОРМАЦИЯ ОБ УЧАСТИИ В АУКЦИОНЕ 1. 2. 3. 4. 5. 6. 7. 8.

Наши аукционные правила и условия Вы можете найти в конце каталога. Мы просим Вас присылать Ваши ставки заранее. В противном случае вероятность ошибки при обработке заказа, присланного перед самым аукционом, возрастает. Приложенный образец заполнения письменного заказа поможет Вам при отправлении Ваших письменных ставок. Ставки можно отправить как по почте, так и по факсу : +49 (0)541–96 20 222 круглосуточно. Успешные заказы будут обрабатываться в порядке их поступления к нам. Все участники, которым не удалось что-либо купить на аукционе, будут также проинформированы после аукциона. Если Вы впервые принимаете участие в нашем аукционе, то мы рекомендуем Вам сообщить нам Ваш референц – аукционные дома, с которыми Вы уже сотрудничали. Или свяжитесь с нами по телефону. Мы гарантируем подлинность всех предметов, проданных на нашем аукционе, в течении неограниченного времени. Все участники нашего аукциона получают в течении 2-ух недель результаты торгов бесплатно. У Вас есть вопросы по определенной монете? Вы хотели бы лично принять участие в аукционе? У Вас возникли другие вопросы? Звоните нам по телефону +49 (0)541-96 20 268, и мы будем рады Вам помочь.

МОЕ ЗАОЧНОЕ УЧАСТИЕ В АУКЦИОНЕ 1. 2. 3. 4. 5. 6.

Тщательно изучите наш каталог и запишите те лоты, которые Вас заинтересовали. Определите для Себя ту максимальную сумму, которую Вы готовы заплатить за каждый лот. Заполните приложенный формуляр. Отправьте нам Ваш заказ заранее. При 2-ух и более равных ставок на один и тот же лот преимущество получает ставка, пришедшая к нам первой ( ранее других). Если стоимость выбранных Вами лотов составляет например 10000 евро, а Вы могли бы потратить только 2000 евро, то в этом случае укажите Ваш общий лимит в размере 2000 евро. Если у Вас возникли вопросы по заполнению формуляра, звоните нам по телефону +49 (0)541-96 20 268. Наши сотрудники будут рады Вам помочь.

МОЕ ЛИЧНОЕ УЧАСТИЕ В ОСНАБРЮКЕ 1. 2. 3.

Мы будем рады Вашему личному присутствию в Оснабрюке. Атмосфера, которая стоит во время аукционных торгов в зале, особенная и непередаваемая. Для получения более подробной информации по Вашей поездке в Оснабрюк, в частности, бронирования номеров в гостинице, мы просим Вас заранее связаться с нами по телефону: +49 (0)541-96 20 268. Приобретенные на аукционе лоты Вы можете лично забрать после окончания торгов. Наши постоянные клиенты осуществляют оплату в течение 20 дней после получения счета. Участвующие в аукционе впервые осуществляют 100%-ую предоплату.

УЧАСТИЕ ПО ИНТЕРНЕТУ Все каталоги доступны для просмотра на нашем сайте в интернете по адресу www.kuenker.de. На сайте Вы можете выбрать интересующие Вас лоты и отправить Ваши ставки на нашу электронную почту service@kuenker.de. Если у Вас возникнут дополнительные вопросы, мы просим Вас связаться с нами по телефону +49 (0)5 41-96 20 268.

УЧАСТИЕ ПО ТЕЛЕФОНУ Для участия в торгах по телефону просим Вас связаться с нами не позднее 48 часов до начала аукциона. Условием проведения телефонных торгов является письменное подтверждение ставки, равной как минимум стартовой цене. Участие в телефонных торгах возможно только для лотов со стартовой ценой свыше 500 евро. Для получения дополнительной информации и регистрации на аукционе звоните Анастасии Кепселль до аукциона по телефону +49 (0)5 41-96 20 268 и во время аукциона по телефону, указанному на первой странице каталога.


КАК ОБРАЗОВЫВАЕТСЯ ЦЕНА НА АУКЦИОНЕ? 1. 2.

Все лоты в нашем каталоге были предварительно оценены нашими экпертами. Минимальная ставка составляет 80% от оценочной стоимости лота. Конечные цены зачастую намного превышают оценочные. Ваши письменные ( заочные ) ставки должны быть обязательно обработаны нашими сотрудниками до начала аукциона. Рассмотрим несколько возможных примеров: Пример 1 ( Оценочная стоимость: € 1.000,-- ) Заочных ставок нет. Аукционатор начинает торги с €800,--. Если в зале только один человек, желающий приобрести этот лот, то соответственно он получит его за €800,--.

Пример 3 (Оценочная стоимость: € 1.000,-- ) У аукционатора имеется только 1 заочная ставка в размере € 850,--. Аукционатор начнет торги с € 800,--. Если среди очных участников никто не даст более высокую ставку, то заочный участник получит этот лот за €800,--

Пример 2 ( Оценочная стоимость: € 1.000,-- )

Пример 4 (Оценочная стоимость: € 1.000,-- ) У аукционатора имеется только 1 заочная ставка в размере €1200,--. Аукционатор начнет торги с €800,--. Если среди очных участников никто не даст более высокую ставку, то заочный участник получит этот лот за €800,--. Если же в зале очный участник согласен на более высокую ставку ( больше €800,-- ), то в этом случае аукционатор в интересах заочного участника имеет право тоговаться до €1200,--. Следовательно только при ставке, превышающей €1200,--, данный лот получит очный участник в зале.

У аукционатора имеются 3 заочные ставки: Заочный участник 1 : Лимит € 2.900,-Заочный участник 2 : Лимит € 1.800,-Заочный участник 3 : Лимит € 800,--

По правилам аукциона аукционатор в интересах заочного участника 1 и 2 должен повышать ставку равномерно ( приблизительно на 5 – 10% ). Поэтому в нашем случае в интересах заочного участника 1 аукционатор начнет торги с € 1900,-( хотя оценочная стоимость составляет €1000,--). Если среди очных участников никто не даст более высокую ставку, то заочный участник 1 получит Пример 5 (Оценочная стоимость: € 1.000,-- ) этот лот за €1900,--. Его лимит в €2900,-- ни в коем У аукционатора имеются 3 заочные ставки, каждая в размере €975,--. Среди очных участников случае не будет исчерпан. интереса к лоту не имеется. В этом случае чтобы избежать недоразумений, аукционатор имеет право ненамного повысить лимит и сделать ставку равной €1000,--. Данный лот за €1000,-- получит тот заочный участник, чей письменный формуляр мы получили раньше всего.

КАК Я МОГУ ПОЛУЧИТЬ ПРИОБРЕТЕННЫЕ ЛОТЫ? Вывоз приобретенных на аукционе предметов осуществляется одним из следующих способов по Вашему выбору: • Вы можете лично забрать Ваши лоты. По окончании торгов мы готовим все необходимые документы на вывоз из Германии. При вывозе за пределы Евросоюза, НДС Вам возвращается. • Почтовые отправки в Россию ( Беларусь, Украину ) приобретенных Вами лотов осуществляются по предварительной договоренности. Для связи с нами звоните нам по телефону +49 (0)541-96 20 268.

С 1971 года имя Кюнкер является гарантией надежности и компетентности. Мы не станем изменять нашим принципам и в будущем. Спасибо Вам за Ваше доверие, которое является не только самым сильным стимулом в нашей работе, но и наилучшей ее оценкой. Я желаю Вам успехов на нашем аукционе!

Фриц-Рудольф Кюнкер


VERSTEIGERUNGSBEDINGUNGEN Die Versteigerung erfolgt im Auftrag und für Rechnung der Eigentümer unter Einhaltung der sich aus der Versteigerungsordnung (BGB1 I 1976, 1346) ergebenden und für Kommissionäre geltenden gesetzlichen Bestimmungen des BGB und HGB gegen Barzahlung des Kaufpreises in ~-Währung. Durch Abgabe eines Gebotes werden die Versteigerungsbedingungen anerkannt, dies gilt auch für die schriftlichen Gebote. Der Zuschlagpreis ist Nettopreis im Sinne des Umsatzsteuergesetzes und bildet die Berechnungsgrundlage für das vom Käufer zu zahlende Aufgeld in Höhe von 15 %. Auf den daraus entstehenden Gesamtpreis (Zuschlag + Aufgeld) wird die jeweils gültige Umsatzsteuer erhoben, soweit dies gesetzlich vorgeschrieben ist. Ausländischen Käufern aus Ländern der europäischen Gemeinschaft wird die in Deutschlang gültige Umsatzsteuer berechnet. Anderen ausländischen Käufern (aus Drittländern) wird, sofern die Münzen durch uns exportiert werden, ein Aufgeld von 15 % netto auf den Zuschlagpreis berechnet; sie erhalten die Lieferung nur gegen Zahlung des Kaufpreises in ~ - Währung, bankspesenfrei. Ausländischen Münzhändlern aus Ländern der europäischen Gemeinschaft wird bei Nachweis der Umsatzsteuer-Identifikationsnummer (§ 27 a USTG) und der sonstigen Voraussetzungen gemäß § 4 Nr. 1 b USTG in Verbindung mit § 6 a USTG die Lieferung ohne Umsatzsteuer berechnet. Sofern nichts anderes vereinbart wird, ist die Zahlung der Auktionsrechnung bei anwesenden Käufern sofort, bei schriftlichen Bietern spätestens 20 Tage nach Erhalt fällig. Bei Zahlungsverzug werden Zinsen von 1 % pro Monat berechnet. Wird die Zahlung nicht sofort an den Versteigerer geleistet oder die Abnahme der zugeschlagenen Sache verweigert, so findet die Übergabe der Sache an den Ersteigerer nicht statt. Der Ersteigerer verliert vielmehr seine Rechte aus dem Zuschlag, und die Sache kann auf seine Kosten erneut versteigert werden. In diesem Fall haftet der Ersteigerer für den Ausfall, dagegen hat er auf den Mehrerlös keinen Anspruch. Der Zuschlag erfolgt nach dreimaligem Ausruf des höchsten Gebotes und verpflichtet zur Abnahme und Zahlung. Bei Meinungsverschiedenheiten über den Zuschlag wird die Nummer noch einmal ausgerufen. Der Versteigerer ist berechtigt, Nummern zu vereinigen oder zu trennen. Eine Vorausnahme von Nummern erfolgt nicht. Der Zutritt zur Versteigerung ist nur Interessenten gestattet, die einen Katalog besitzen.

Die Mindeststeigerungsstufen für das Bietungsverfahren betragen:

Mindestangebote

Mindeststeigerungsstufe

Schriftliche Aufträge werden von uns ohne Auftragsprovision gewissenhaft ausgeführt. Aufträge von uns unbekannten Sammlern können nur ausgeführt werden, wenn ein Depot hinterlegt wird oder Referenzen benannt werden. Schriftliche Gebote können nur bis 24 Stunden vor Auktionsbeginn verbindlich berücksichtigt werden. Im Bedarfsfall ist der Auktionator berechtigt, die Limits um 3 – 5 % zu überschreiten. Bei mehreren gleichhohen Geboten erhält das zuerst eingegangene den Zuschlag. Unlimitierte Aufträge haben keinen Anspruch auf unbedingte Ausführung. Telefonisches Bieten ist nur in Ausnahmefällen möglich. Telefonische Bieter müssen sich mindestens einen Werktag vor der Auktion voranmelden. Der Versand geht zu Lasten und auf Risiko des Ersteigerers bzw. Empfängers. Das Auktionsgut bleibt bis zur vollständigen Bezahlung aller Forderungen aus Anlaß der Versteigerung Eigentum des Verkäufers. Ist der Käufer Vollkaufmann, so ist Osnabrück als Gerichtsstand vereinbart. Für das Mahnverfahren gilt die Zuständigkeit des Amtsgerichts Osnabrück auch in allen anderen Fällen als vereinbart. Ansonsten ist es Osnabrück nur, wenn nur die Firma Fritz Rudolf Künker GmbH & Co. KG ihren allgemeinen Gerichtsstand in der BRD hat, oder wenn alle Ansprüche im Wege des Mahnverfahrens geltend gemacht werden, oder wenn die im Klageweg in Anspruch zu nehmende Vertragspartei nach Vertragsabschluß ihren gewöhnlichen Aufenthaltsort aus dem Geltungsbereich der BRD verlegt hat, oder ihr Wohnsitz oder gewöhnlicher Aufenthaltsort zum Zeitpunkt der Klage nicht bekannt ist. Die Beschreibung im Katalog ist gewissenhaft durchgeführt. Sie begründet jedoch keine Rechts- oder Sachmängelhaftung gemäß §§ 434, 459 ff BGB. Die Angabe der Erhaltung ist streng nach den im deutschen Münzhandel üblichen Erhaltungseinstufungen vorgenommen und gilt als persönliche Beurteilung. Bei der Auktion anwesende Käufer kaufen grundsätzlich „wie besehen“. Da durch Vorbesichtigung Gelegenheit gegeben ist, sich vom Erhaltungszustand des Versteigerungsgutes zu überzeugen, können nach erfolgtem Zuschlag Reklamationen nur bei irrtümlich übersehener Henkel- oder Fassungsspur oder gestopftem Loch berücksichtigt werden. Bei Losen mit mehreren Stücken sind die Stückzahlen nur Circa-Angaben, irrtümliche Zuschreibungen sind im Einzelfall nicht ausgeschlossen. Diese Lose sind nach erfolgtem Zuschlag von jeder Reklamation ausgeschlossen. Der Versteigerer kann bei eventuellen Meinungsverschiedenheiten bzw. Beanstandungen einen vereidigten Sachverständiger seiner Wahl (die Kosten trägt der unterliegende Teil) beauftragen. Eventuelle Beanstandungen können nur innerhalb von 8 Tagen nach der Auktion bzw. nach Erhalt der ersteigerten Stücke berücksichtigt werden. Die Echtheit der Stücke wird bis zur Höhe des Kaufpreises garantiert. Die beigedruckten Preise sind Schätzpreise, die unter- oder überschritten werden können. Aufträge, die unter 80 % des Schätzpreises liegen, können nicht bearbeitet werden.

bis zu

€ 100,--

€ 5,--

bis zu

€ 200,--

€ 10,--

bis zu

€ 500,--

€ 20,--

bis zu

€ 1.000,--

€ 50,--

Soweit nicht anders vermerkt, gelten im übrigen die allgemeinen Versteigerungsbestimmungen und – auch im Verhältnis zu ausländischen Kunden – gilt Deutsches Recht.

bis zu

€ 2.000,--

€ 100,--

Die Ergebnisliste erscheint sofort nach der Auktion.

bis zu

€ 5.000,--

€ 200,--

DIE VERSTEIGERER:

bis zu

€ 10.000,--

€ 500,--

bis zu

€ 20.000,--

€ 1.000,--

bis zu

€ 50.000,--

€ 2.000,--

ab

€ 50.000,--

€ 5.000,--

Ausländische Kunden kaufen nach den Devisen-, Zoll- und Steuerbestimmungen ihres Landes. Versandformalitäten werden vom Versteigerer erledigt.

FRITZ RUDOLF KÜNKER DR. ANDREAS KAISER ARNE KIRSCH OLIVER KÖPP


TERMS AND CONDITIONS OF AUCTION The auction is conducted on behalf and for the account of the appropiate proprietors of the goods and is subject to the federal Auction Regulation (Versteigerungsordnung, BGB1 I 1976, 1346) published in the Federal Law GazetteVol. I, 1976, 1346 and the relevant provisions for factors in accordance with the German Cicil Code (BGB) and Commercial Code (HGB). Payment of the hammer-price has to be made in cash and in Euro. The submission of an offer implies the express acknowledgement of these Terms and Conditions of Auction; the same applies to the submission of an offer in writing. The hammer-price is exclusive of applicable German VAT according to the prevailing VAT – legislation and represents the basis for calculating the surcharge of 15 percent payable by the puchaser. The total price so calculated (hammerprice plus surcharge) is subject to the VAT (value added tax=Mehrwertsteuer), which is payabel additionally. Purchasers from abroad will be charged a surcharge of 15 per cent net on the hammer-price, provided the export of the coins is undertaken by the auctioneer. Buyers in European Community (EEC) countries (other than Germany) will be charged Value Added Tax at the rates prevailing in Germany. Dealers from EEC countries (other than Germany) will receive goods free of tax upon presentation of their VAT I.D. number, and upon fulfillment of the other conditions set forth in Paragraph 4, Nr. 1 b, and Paragraph 6 a of the GermanTurnover Tax Law Buyers from other countries are not charged Value Added Tax. Delivery will be made against payment in Euro with no bank charges to the auctioneer. Unless mutually agreed otherwise, payment of the auction bill from purchasers present at the auction is due immediately. From purchaser who have submitted a bid in writing, payment is due within 20 days after receipt of the goods. Defaulted payments shall bear an interest charge of 1 % per month in the amount in default. Should payment to the auctioneer not be made immediately or should the acceptance of the awarded item be refused, such item shall not be handed overt to the purchaser. Instead the purchaser shall forfeit all right and title in and to such item from the award and the item may again be put to auction at this buyer’s cost. In this event the buyer shall be liable for any shortfall, while he shall have no right or claim towards any excess proceeds. An item will be knocked down after the highest bid has been called three times. The award shall be a binding commitment and liability on the part of the bidder to take acceptance and delivery of the item or items so awarded. In the event of any dispute with regard to the award the lot will be put up again for bidding. The auctioneer reserves the right to combine or to seperate lots. Lots will not be called out of sequence. Access to the auction will only be permitted to interested persons who are in possession of the catalogue. The minimum rates of increase for the bidding procedure are: for minimum offers

minimum increase rate

up to

€ 100,--

€ 5,--

up to

€ 200,--

€ 10,--

up to

€ 500,--

€ 20,--

up to

€ 1.000,--

€ 50,--

up to

€ 2.000,--

€ 100,--

up to

€ 5.000,--

€ 200,--

up to

€ 10.000,--

€ 500,--

up to

€ 20.000,--

€ 1.000,--

up to

€ 50.000,--

€ 2.000,--

above

€ 50.000,--

€ 5.000,--

Orders submitted in writing will be carried out diligently and without charge of an extra commission. Orders from collectors unknown to the auctioneer can only be accepted and carried out if a deposit or references to the satisfaction on the auctioneer are given. To be bindingly accepted, written bids need to be received at least 24 hours before auction. If necessary, the auctioneer is allowed to increase the bids by 3-5%. Should several bids be obtained in writing bidding the same price or prices for a given lot, the bid first received by the auctioneer shall be given the award. Unlimited bids shall not oblige the auctioneer to consider, accept or carry out such order. Telephone bidding is generally an option for lots of substantial value only. The registration is required at the latest a day before auction. Shipment (by mail or otherwise) of the goods shall be for the sole cost and risk of the purchaser or receipient, resp. The auctioned goods remain the sole and exclusiv property of the vendor until full payment and settlement of any and all dues and claims in connection with the auction. In the event the purchaser is a merchant (in the sense of the German commercial laws) Osnabrück shall be the agreed and exclusive place of jurisdiction. The competence of the District Court (Amtsgericht) of Osnabrück is agreed in respect of summary proceedings for the collection of defaulted payments (Mahnverfahren) as well as in any and all other cases. Should the purchaser not be a merchant Osnabrück shall be the place of jurisdiction with the District Court of Osnabrück’s competence, if only the auctioneer has his ordinary legal domicil in the Federal Republic of Germany or if claims are made by way of summary proceedings of collection (Mahnverfahren) or if the defendant has moved his ordinary legal domicil outside the jurisdiction of the Federal Republik of Germany or if the legal domicil of the defendant is unknown to the auctioneer at the time of filing a suit. To the exclusion of any other legislation German law, as in force at the time, shall be applied for the settlement of any and all legal or judicial matters. The specifications and descriptions in the catalogue have been prepared diligently and in good faith do, however, not constitute the acceptance by the auctioneer of any warranty or liability in respect of defect in material or title. The state of preservation of items is strictly assessed in accordance with the grades accepted by the German coin trade and only represents an individual and personal assessment. Purchasers present at the auction acquire items strictly on the basis of “as is where is” and “as inspected”. In view of the opportunity of prior inspection to ascertain the state and condition of the auction lots, complaints and objections made after the sale will only be considered, if by obvious error or mistake loop or traces or moutings, traces of trimmings or settings, or the plugging of a hole (eyelet) have remained unnoticed. If and when auctioned in lots, the quantities of individual pieces given, only represent an approximate figure. An error in the allocation of indivdual pieces to a certain lot cannot be excluded. Such lots are, therefore, excluded from any complaintes or objections after the lot is knocked down. In the event of disputes or complaints as to the quality of an item the auctioneer may call upon a gernerally sworn expert of the trade, which the auctioneer may choose at his sole discretin, for assessment an the rendering of a decision as to the justification of such dispute or complaint. The costs of such expert shall be borne by the party loosing the dispute according to the expert’s decision. Complaints or objections, if justified, will only be considered if made and received by the auctioneer within 8 days after the auction or after receipt the lots, respectively. The authenticity of the coins is warranted. Warranted up to the total purchase price. The prices set out in the catalogue are estimates only, which may bei exceeded or undercut. Orders for less than 80 per cent of the estimated price cannot accepted. Purchasers from abroad will have to observe all applicable laws and regulations in respect of foreign exchange, customs duties and taxation of their country. The auctioneer will only discharge such formalities, which have to be observed, in the Federal Republic of Germany in connection with the export of the purchased item(s). Unless stipulated otherwise herein, the general rules regulations for auctions applicable in Germany shall govern any transaction in respect of the auction; German Law shall also be applicable in relation to purchasers form abroad. Only the German text has legal forde. The prices realized will be published in the form of a list immediately after the auction. THE AUCTIONEERS:

FRITZ RUDOLF KÜNKER DR. ANDREAS KAISER ARNE KIRSCH OLIVER KÖPP


NUMISMATISCHE AUSDRÜCKE EXPRESSIONS NUMISMATIQUES NUMISMATIC TERMS TERMINI DI NUMISMATICA НУМИЗМАТИЧЕСКИЕ ТЕРМИНЫ DEUTSCH

ENGLISCH

FRANÇAIS

ITALIANO

RUSSISCH

Abschlag Am Rand Berieben Blei Dezentriert Doppelschlag Einfassung Einseitig Emailliert Erhaltung Etwas Exemplar Fassungsspuren Fehlpr?gung

struck at the rim/border slightly polished lead uncentered double struck frame uniface enamelled condition/preservation slightly specimen, copy trace of mounting mis-strike

frappe en tranche frotté plomb décentré double frappe encadrement uniface émaillé conservation un peu exemplaire traces de monture défaut de frappe

coniazione al bordo trattato piombo non centrato ribattitura cornice uniface smaltato conservazione un poco esemplare tracce di montatura difetto di coniazione

Feld(er) Fundexemplar Gedenkmünze Gegl?ttet Gelocht Geprägt Gewellt Goldpatina Henkelspur Hübsch Jahrh. = Jahrhundert. Kl. = klein Korrosionsspuren Kratzer Kupfer Legierung Leicht(e) l. = links Min. = minimal Nachahmung Prachtexemplar

field(s) specimen from a hoard commemorative coin tooled holed minted bent golden patina mount mark attractive century small traces of corrosion scratch(es) copper alloy slightly left minimal imitation attractive, perfect piece

champ exemplaire de trouvaille monnaie commémorative retouch? trou? frappé ondulé patine dorée Trace de monture joli siècle petit traces de corrosion rayure cuivre alliage légèrement gauche minime imitation pièce magnifique

campo da tesoretto moneta commemorativa liscio bucato coniato ondolato patina d´oro Tracce di appicagnolo carino secolo piccolo segni di corrosione graffio(i) rame lega leggero sinistra minimamente contraffazzione esemplare magnifico

Prägeschwäche Randdelle Randfehler Randschrift r. = rechts Rückseite Schriftspuren

weakly struck edge nick edge faults lettered edge to right reverse traces of inscription

de frappe faible défaut sur la tranche erreur sur la tranche tranche inscrite droite revers traces de légende

conio stanco ammaccatura al bordo errore nel bordo inscrizione sul bordo destra rovescio tracce di leggenda

Schrötling Schrötlingsfehler Schwach ausgeprägt Selten in dieser Erhaltung

flan flan defect weakly struck rare in this condition

flan flan défectueux de frappe faible rare en cet état

tondello errore di tondello conio stanco conservazione rara

Seltener Jahrgang Stempel Stempelfehler Überdurchschnittlich erhalten Überprägt Unediert

rare year die(s) mistake in the die extraordinary condition

année rare coin erreur de frappe conservation extraordinaire

annata rara conio errore di conio conservazione estraordinaria

ОТТИСК НА ГУРТЕ ПОТЕРТАЯ СВИНЕЦ АССИМЕТРИЧНЫЙ ДВОЙНОЙ ЧЕКАН КАЙМА ОДНОСТОРОННЯЯ ЭМАЛИРОВАННАЯ СОХРАННОСТЬ СЛЕГКА ЭКЗЕМПЛЯР СЛЕДЫ ОБРАБОТКИ ОШИБКА В ПРОЦЕССЕ ЧЕКАНКИ ПОЛЕ ЭКЗЕМПЛЯР ПАМЯТНАЯ МОНЕТА ОТГЛАЖЕННАЯ ПРОКОЛАТАЯ ОТЧЕКАНЕННАЯ ВОЛНИСТАЯ ЗОЛОТАЯ ПАТИНА СЛЕДЫ ОТ УШКА КРАСИВАЯ СТОЛЕТИЕ МАЛЕНЬКИЙ СЛЕДЫ КОРРОЗИИ ЦАРАПИНА МЕДЬ СПЛАВ ЛЕГКИЙ СЛЕВА МИНИМАЛЬНЫЙ ИМИТАЦИЯ ПРЕВОСХОДНЫЙ ЭКЗЕМПЛЯР ИЗДЕРЖКН ПРИ ЧЕКАНКE ВМЯТИНА НА ГУРТЕ ОШИБКА НА ГУРТЕ ГУРТОВАЯ НАДПИСЬ СПРАВА РЕВЕРС СЛЕДЫ ПРЕДЫДУЩЕЙ НАДПИСИ ЗАГОТОВКА БРАК ЗАГОТОВКИ СЛАБО ОТЧЕКАНEНА РЕДКАЯ В ТАКОЙ СОХРАННОСТИ РЕДКИЙ ГОД ШТАМП ОШИБКА ШТАМПА СОХРАННОСТЬ ВЫШЕ СРЕДНЕГО

overstruck unpublished

surfrappé in?dit

ribattuto inedito

Unikum Vergoldet Von allergrößter Seltenheit Vorderseite Winz.= winzig Zain Zierrand Zinn ziseliert

unique specimen gilt extremely rare head tiny flan ornamental border tin chased

unique doré de toute rareté en face petit flan tranche ornée ?tain ciselé

pezzo unico dorato di estrema raritá diritto veramente piccolo tondello taglio ornato stagno cesellato

ПЕРЕЧЕКАН НЕОПУБЛИКОВАННАЯ МОНЕТА УНИКАЛЬНАЯ ПОЗОЛОЧЕННАЯ НАИРЕДЧАЙШАЯ АВЕРС НЕЗНАЧИТЕЛЬНЫЙ ЗАГОТОВКА ДЕКОРАТИВНЫЙ ГУРТ ЦИНК ГРАВИРОВАННЫЙ


Künker eAuctions

Künker eAuctions

Unsere eAuctions umfassen circa 250 Losnummern. In einem festgelegten Zeitraum von 14 Tagen haben Sie die Möglichkeit, online auf die für Sie interessanten Münzen und Medaillen zu bieten. Die einzelnen Losnummern laufen zeitlich versetzt aus. Selbstverständlich werden Sie über Ihren aktuellen Gebotsstatus laufend per Email informiert und können Ihre Gebote bei Bedarf bis zur letzten Sekunde erhöhen.

Our eAuctions contain 250 lots. During a fixed period of 14 days you have the opportunity to submit your bids online on your favourite coins and medals.

Weitere Informationen und die nächsten Termine zu den Künker eAuctions finden Sie unter:

You may find further information and the next dates of the Künker eAuctions here:

www.kuenker.de

www.kuenker.com

Each lot will expire at different times. Certainly you will be informed constantly by email about the current status of your bids so that you permanent have the possibility – if necessary – to raise your bids till the end of the eAuction.

Fritz Rudolf Künker GmbH & Co. KG Gutenbergstraße 23 · 49076 Osnabrück · Germany Tel. +49 (0)541 96 20 20 · Fax +49 (0)541 96 20 222 www.kuenker.de · service@kuenker.de Osnabrück · Berlin · München · Zürich


IMPRESSUM NUMISMATISCHE BEARBEITUNG FOTOS LAYOUT DRUCK

Alexandra Spreu, Jens Ulrich Thormann M. A., Eva Weber, Manuela Weiß Lübke & Wiedemann, Stuttgart danner pc - gesteuerte systeme waiblingen meister print und media, Kassel Jeglicher Nachdruck, auch auszugsweise, bedarf der Genehmigung des Auktionshauses

ZAHLUNGEN AUS DEM INLAND Deutsche Bank Osnabrück Dresdner Bank Osnabrück Sparkasse Osnabrück Volksbank eG Bad Laer-Borgloh-Hilter-Melle Bankhaus Lampe KG, Bielefeld Postbank Hannover HypoVereinsbank München WestLB Dortmund Paypal

(BLZ 265 700 90) Konto-Nummer 0 177 006 (BLZ 265 800 70) Konto-Nummer 780 520 200 (BLZ 265 501 05) Konto-Nummer 247 320 (BLZ 265 624 90) Konto-Nummer 1 200 222 400 (BLZ 480 201 51) Konto-Nummer 174 076 (BLZ 250 100 30) Konto-Nummer 2900 60-308 (BLZ 700 202 70) Konto-Nummer 24 17 952 (BLZ 440 500 00) Konto-Nummer 1128 842 paypal@kuenker.de, Service charge: 3,5 %

ZAHLUNGEN AUS DEM AUSLAND - FOREIGN PAYMENTS Deutsche Bank Osnabrück Sparkasse Osnabrück Postbank Hannover Credit Suisse Credit Cards Paypal

IBAN: DE11 2657 0090 0017 7006 00 Swift-Code: DEUTDE3B265 IBAN: DE50 2655 0105 0000 2473 20 Swift-Code: NOLADE22XXX IBAN: DE73 2501 0030 0290 0603 08 Swift-Code: PBNKDEFF IBAN: CH43 0483 5177 3509 0200 0 Swift-Code: CRESCHZZ80A We do accept VISA and MASTERCARD, Service charge: 4,5 % paypal@kuenker.de, Service charge: 3,5 %

ERHALTUNGS- UND SELTENHEITSGRADE ERHALTUNGSGRADE/ GRADING TERMS DEGRÉS DE CONSERVATION GRADI DI CONSERVAZIONE

SELTENHEITSGRADE

Polierte Platte Proof

Flan bruni Fondo specchio

Stempelglanz Uncirculated

Fleur de coin Fior di conio

Vorzüglich Extremely fine

Superbe Splendido

Sehr schön Very fine

Très beau Bellissimo

Schön Fine

Beau Molto Bello

Gering erhalten Very good

Très bien conservé Bello

R = Selten Von großer Seltenheit

RR = Sehr selten Von größter Seltenheit

Profile for Fritz Rudolf Kuenker GmbH & Co. KG

Auktion 164 Künker  

Spitzenstücke der russischen Geldgeschichte

Auktion 164 Künker  

Spitzenstücke der russischen Geldgeschichte