Page 1


El Director del IEB acude al





Nยบ 21 mayo 2016


FORTALEZA Procedentes de distintos y lejanos enclaves de la geografía mexicana, decenas de antiguos alumnos del IEB que nacieron o trabajan en la nación azteca se dieron cita en una brillante ceremonia que se celebró en el edificio de la Bolsa Mexicana de Valores. Allí acudieron también autoridades gubernamentales, académicas y diplomáticas, además de representantes de empresas con las que colabora nuestro Centro de Estudios. Este encuentro ha mostrado la fortaleza del IEB en México, que es la nación de Iberoamérica en la que el IEB cuenta con más antiguos alumnos. Del mismo modo, en Colombia –otra nación iberoamericana en la que la presencia del IEB está fuertemente consolidada–, el Director de nuestro Centro de Estudios ha protagonizado una serie de conferencias ante un público empresarial que ha reiterado su interés en que vuelvan a producirse encuentros de esta índole. En el otro extremo del Orbe, nuestros estudiantes han vuelto a realizar su estancia académica en la Chinese University of Hong Kong, donde –además de realizar una inmersión en los Mercados Financieros asiáticos– han contribuido a afianzar las relaciones del IEB con la que es una de las más importantes instituciones formativas de Asia. Ya en el ámbito doméstico, hemos visto como dos importantes empresas del IBEX 35 –Telefónica e Indra– han patrocinado el ³'LJLWDO %DQNLQJ 'D\´ que organizó nuestro Departamento de Investigación. Esta Jornada sobre Banca Digital, tanto por su contenido, como por la envergadura de sus patrocinadores, el interés suscitado entre el numeroso público asistente y la repercusión mediática que ha logrado, es una clara demostración de la capacidad innovadora del IEB. Por otra parte, el desempeño profesional de nuestros antiguos alumnos evidencia la calidad de la formación que en el IEB reciben: un claro ejemplo de ello es que la Presidencia de la más importante asociación de EAFI en España esté ocupada por un graduado de las primeras promociones del Master en Bolsa y Mercados Financieros. Todo lo descrito y otras noticias que se recogen en el presente número de nuestra revista muestran la fortaleza de una institución docente cuyo prestigio aumenta año tras año.

IEB Magazine



6 10 22 24 28 30 38 42 52 54 4

Ceremonia en Mรฉxico



DIGITAL BANKING DAY Barranquilla, Colombia

1ER SIMPOSIO DE ร‰TICA Hong Kong, China

2ยช PROMOCIร“N EN LA CUHK Opiniรณn de Ana Guzmรกn Quintana







AURELIO GARCรA DEL BARRIO Director del Global MBA con Especializaciรณn en Finanzas Entrevista Antiguos Alumnos


JOSร‰ CARLOS GARCรA MORTE JULIA ANDRร‰S LANDALUCE nos habla de su pasiรณn por el golf




EDITA IEB. Consejo Editorial: Juan Pablo Tovar, Ignacio Llorente, Ana Moreno, รlvaro Sรกnchez. Telf. 91 524 06 15. Direcciรณn IEB. Maquetaciรณn: Pilar Seidenschnur. Depรณsito Legal: M-15642-2006


Ceremonia Institucional de

IEB Alumni

en México Decenas de antiguos alumnos del IEB, procedentes de toda la HFPHSBGÁBEFMBOBDJÆOB[UFDB TFSFËOFOFOFMJNQPOFOUFFEJmDJP de la Bolsa Mexicana de Valores.


l 25 de febrero tuvo lugar la Ceremonia Institucional de IEB Alumni en la Bolsa Mexicana de Valores con gran un éxito de convocatoria. Los antiguos alumnos pudieron reencontrarse como una gran familia y conectar con antiguos alumnos de diferentes programas como el Master in International Finance, Master en Bolsa y Mercados Financieros, el MBA (del que asistió una nutrida representación de la promoción 2005/2006 que este año cumple el X aniversario de su graduación), Programas Directivos y Cursos de Verano. Alumni procedentes de Guadalajara, Monterrey, Puebla, Tabasco, e incluso españoles que trabajan en México, se desplazaron a la capital azteca demostrando así que los antiguos alumnos del IEB, tras pasar por nuestras aulas, continúan el espíritu de orgullo y pertenencia al Centro de Estudios, acompañados a su vez de nuevos candidatos interesados en cursar programas en nuestra institución.


Asimismo, importantes personalidades institucionales participaron en la Ceremonia: desde la Subsecretaría de Educación de la República de México, el Presidente de la Academia Mexicana de Derecho Internacional y el Director General de la Bolsa Mexicana de Valores, José Oriol Bosch Par; quienes con una cálida bienvenida a los Alumni hicieron un reconocimiento a la labor del IEB como Centro de Estudios, con gran aceptación por parte de los mexicanos. También asistieron Jaime Ruiz Sacristán, Presidente de la Bolsa Mexicana de Valores, el que fuera Procurador General de la República y Embajador en Francia, Ignacio Morales, directivos de la Fiscalía General del Estado de la República Mexicana, la Academia del Notariado de México, Autoridades académicas de la Universidad Panamericana, la Universidad Anáhuac, la Universidad de Las Américas, el TEC de Monterrey y de las

Universidades Regiomontana, Iberoamericana, Autónoma de Puebla, entre otras. En la ceremonia participaron el Director del IEB, Álvaro Martínez-Echevarría, el Director de Relaciones Internacionales, Javier Ilardia Onaindía y, por parte del Departamento de Programas, Álvaro Sánchez Agustí, así como una nutrida representación de profesores del IEB que actualmente están desarrollando su labor profesional en México. Los asistentes manifestaron su deseo de que una ceremonia de este tipo se volviera a repetir y se está valorando la posibilidad de organizarla cada año en una ciudad distinta, en la que tengamos un número importante de antiguos alumnos, como Monterrey o Guadalajara. A tal efecto, varias Instituciones Académicas nos han ofrecido sus instalaciones para acoger la convocatoria de la próxima reunión. 'SR½EQSW IR UYI qWXI WIE IP TVMQIVS de muchos encuentros de IEB Alumni en México. ¡Enhorabuena a todos!


La exitosa ceremonia contó con la asistencia de más de 100 ex alumnos llegados de todo el país.

El Profesor Ponce Rojas con Manuel Reguera, Presidente de la Academia Mexicana de Derecho Internacional.

Jaime Morales, Exprocurador General de la República y Jaime Ruiz Sacristán, Presidente de la BMV.

El profesor Federico Ponce Rojas recibe la Cruz de Honor del IEB Álvaro Martínez-Echevarría conversa con el Director General de la BMV, José Oriol Bosch Par.


El Vicerrector de la Universidad Panamericana, el Profesor Carlos Teissier y Alvaro Sanchez Agustí.

Uno de los momentos más emotivos de la velada se dio cuando Federico Ponce Rojas recibió la Cruz de Honor del IEB, otorgada por la Junta de Dirección de nuestro Centro de Estudios, por su constante apoyo –desde hace años– a todas las actividades que el IEB realiza en la nación azteca. El profesor Ponce Rojas fue el Subprocurador General de la República Mexicana y ocupó la Vicepresidencia del Banco Nacional de México.


NOTICIAS NACIONAL Actualidad nacional relacionada con el IEB

(/,(%organizĂł un innovador


Sergio Reyes, Director de Programas a Medida del IEB; a su derecha, de TelefĂłnica, Pablo Berenguer, Head of Marketing Enterprise Customers; Eduardo Ariste, Director Comercial de Entidades Financieras y Seguros; Adriana GarcĂ­a, Marketing Sectorial EE.FF y Eva RodrĂ­guez, Consultora de Marketing Sectorial EE.FF. A continuaciĂłn, Rodrigo GarcĂ­a, Director del Programa Directivo en InnovaciĂłn y TecnologĂ­a Financiera del IEB; Ă lvaro de Salas, Director de InnovaciĂłn y Nuevos Negocios del Vertical de Banca, de Indra; Antonio HerraĂ­z, Director del Programa Directivo en InnovaciĂłn y TecnologĂ­a Financiera del IEB; Mario Robredo, Senior Manager de InnovaciĂłn y Nuevos Negocios del Vertical de Banca, de Indra; y Pablo Cousteau, Director de Programas Especializados del IEB.

ParticipaciĂłn de los asistentes en una de las performance artĂ­sticas desarrolladas durante el evento.

Rodrigo GarcĂ­a de la Cruz y Antonio HerraĂ­z Molina, Directores del Programa Directivo en InnovaciĂłn y TecnologĂ­a Financiera del IEB, durante la presentaciĂłn del panel sobre â&#x20AC;&#x153;Talento y cultura digitalâ&#x20AC;?.


El pasado 25 de noviembre, el IEB organizĂł, con los patrocinios de TelefĂłnica y de Indra, el Digital Banking Day, una jornada innovadora y formativa sobre el nuevo modelo de valor de la banca, durante la cual se presentaron las conclusiones del estudio sobre la TransformaciĂłn Digital de la


Luis CastejĂłn MartĂ­n, Profesor Titular ETSIT-UPM y Coordinador del â&#x20AC;&#x153;Estudio de transformaciĂłn digital de la banca espaĂąolaâ&#x20AC;? para el IEB, y el moderador de la jornada, Humberto RosellĂł, de Impulso Coaching.

Banca Espaùola, elaborado por el IEB. La NeomudÊjar de Atocha, centro disruptivo de ar tes, experimentación y creatividad, fue el escenario escogido para congregar a mås de 200 personas, entre los que se encontraban algunos de los mås destacados exper tos en innovaGMzR]XIGRSPSKuE½RERGMIVEPSWTVMRGMTE11

NOTICIAS NACIONAL Actualidad nacional relacionada con el IEB

les socios en transformación digital de la banca española y agentes relevantes del ecosistema Fintech. La jornada comenzó con el discurso de aper tura “Tecnología aplicada a la banca” de Iñaki Perkins, Director General de bancopopular-e y Eduardo Ariste, Director Comercial Entidades Financieras y Seguros de Telefónica. Y terminó con Almudena Román, Directora General de ING Direct, quien impar tió una ponencia sobre “La Era de la Banca Digital”. Entre ambas ponencias, y durante las casi seis horas que duró el evento, hubo entrevistas a los directivos de las entidades ½RERGMIVEW PuHIVIW IR )WTEyE ] WI SVKEnizaron diversas mesas redondas, como “Transformación digital de canales, productos y servicios” e “Impactos de la tecnología y servicios Fintech sobre el negocio bancario”.

El IEB presenta un informe elaborado sobre la transformación digital de la banca española

Álvaro de Salas y Mario Robredo, de Indra, durante su ponencia.

Eduardo Ariste e Iñaki Perkins, Director General de bancopopular-e, en la entrevista one2one.

Antonio Herraíz, Luis Castejón Martín y Rodrigo García, durante la presentación del estudio.

)P WIGXSV ½RERGMIVS WI IWXj XVERWJSVmando y la palabra “Digital” suena cada vez más en los comités de dirección de PEWTVMRGMTEPIWIRXMHEHIW½RERGMIVEW%Wu se inició la presentación del estudio La Transformación Digital de la Banca Española. El informe fue presentado por su coordinador Luis Castejón Martín y por los Co-Directores del Programa Directivo en Innovación y Tecnología Financiera, Rodrigo García de la Cruz y Antonio Herráiz Molina, siendo los tres co-autores del estudio junto con diversas entidades del sector.

Rodrigo Garcia de la Cruz y Antonio Herraíz Molina al inicio de la mesa redonda “Transformación digital de canales, productos y servicios”.


Almudena Román, Directora General de ING Direct, en el discurso de clausura.

Elaborado por el IEB, el informe recoge un análisis competitivo de la Banca Digital en España, en el que participan: Telefónica, Indra, Accenture Digital, Finnovista, Everis, TechRules y Spain Financial Centre/Spain Fintech Hub; que ETSVXEVSRPEZMWMzRHIPERYIZES½GMRE bancaria, el “Big Data”, la “Ciberseguridad”, la nueva forma de hacer banca digital, la multicanalidad, el asesoramiento TEXVMQSRMEP]½RERGMIVSFMXGSMRPEWWXEVtups innovadoras Fintech y su impacto IR IP WIGXSV ½RERGMIVS IWTEySP IRXVI los principales temas de estudio.

Un añadido más de esta dinámica y original jornada fueron las diversas performance ar tísticas con las que se quiso VI¾INEVMPYWXVEV]IRVMUYIGIVHIYREQEnera muy visual y vanguardista, la transformación que el entorno digital está provocando en la relación diaria con las IRXMHEHIW½RERGMIVEW El despliegue de información, arte y realización no dejó indiferente a nadie. El buen ambiente que se generó y la presencia de tantos representantes del secXSV½RERGMIVSJEZSVIGMIVSRPEWSTSV XYRMdades para realizar networking durante el cóctel de cierre. 13

NOTICIAS NACIONAL Actualidad nacional relacionada con el IEB


8QWDOOHUVREUH GHEDWH\RUDWRULD Consuelo Madrigal, Fiscal General del Estado y Jesús Santos, Director del Master de Acceso a la Abogacía del IEB, con los alumnos del Master.

Visita al Tribunal Constitucional de los alumnos del Master de Abogacía del IEB (O PiV DOWR WULEXQDO HVSDxRO UHFLEH D QXHVWURV DOXPQRV FRPR SDUWH GHO SURJUDPDGHO0DVWHU8QLYHUVLWDULRSDUDHO$FFHVRDOD3URIHVLyQGH$ERJDGR Durante el mes de febrero y marzo, los alumnos del Master Universitario para el Acceso a la Profesión de Abogado tuvieron la oportunidad de visitar dos enclaves determinantes para enriquecer su formación. El 24 de febrero visitaron el Tribunal Constitucional, donde Consuelo Madrigal, Fiscal General de Estado, les atendió muy cordialmente, dedicando a nuestros alumnos una parte de la mañana, en la que les explicó las líneas maestras de la institución y sus principios informadores de actuación. A continuación, las Fiscales de la Unidad

de Apoyo de la FGE, Esmeralda Rasillo y Concha López-Yuste, explicaron cómo es la actuación del Ministerio Fiscal. Durante la visita, les acompañó uno de los funcionarios que integran el Cuerpo de Letrados del Tribunal Constitucional, quien pudo explicarles las principales competencias del Tribunal, así como la organización del mismo. Tras la charla recorrieron la biblioteca y la sala de Juntas. Unos días más tarde, el 4 de marzo, tuvo lugar la segunda visita, a la Comisaría GeRIVEPHIPE4SPMGuE'MIRXu½GE

Guíados por un miembro de este organismo, los alumnos pudieron conocer de forma exhaustiva la gran labor de investigación que realiza esta policía a la hora para analizar y esclarecer hechos criminales. Se remarcó la importancia que tiene preservar la cadena de custodia, imprescindible para no alterar las pruebas, así como el alto grado de especialización de los miembros que forman parte de la poliGuEGMIRXu½GEPSUYIPIWTIVQMXILEGIVYR XVEFENSI½GE^]HIKVERZEPSVIRRYIWXVE sociedad.

Un acuerdo que ofrece enormes ventajas a los estudiantes del IEB El IEB ha llegado a un acuerdo con Aluni.net, empresa especializada en el alojamiento en piso compartido, en familias o en estancias solidarias. Los IWXYHMERXIWHIP-)&WIFIRI½GMEVjRHIYR HI 14

descuento sobre los gastos de tramitación entre otras condiciones preferentes. Con este acuerdo, el IEB sigue dando pasos en la atención personalizada al alumno tanto nacional como extranjero.

Los alumnos de 2º de Grado en ADE y de Grado en Derecho, estudios universitarios que complementan con el Master en Bolsa y Mercados Financieros del IEB, han participado en el proyecto de Auditor por un día. Como parte del programa de Auditoría Universidad de la Agrupación 1ª del instituto de Censores Jurados de Cuentas de España (ICJCE), principal corporación que agrupa a los profesionales de la auditoría, se ha puesto en marcha esta iniciativa para que los estudiantes universitarios pasen

una jornada de trabajo integrados en un equipo de auditoría y conozcan la profesión “desde dentro”. Participaron en esta interesante iniciativa PEW TVMRGMTEPIW ½VQEW HI%YHMXSVuE GSQS Deloitte, PwC, EY, KPMG, Auren, Mazars, Gassó, BDO en las que los alumnos seleccionados pudieron tomar contacto con el mundo profesional, obtener la visión práctica de lo estudiado en el IEB, en sus clases de Contabilidad, y aprender de primera QERSUYqWMKRM½GEIPXVEFENSIRIUYMTS

El pasado marzo, los alumnos de la Doble Titulación del IEB participaron en un taller organizado por los departamentos de Orientación Profesional y Coordinación de Estudios Universitarios. Consistió en un debate entre los alumnos que contó con la presencia de José García Mateos, profesor de Técnicas de Debate y Oratoria, y formador de equipos de debate universitario y juez de competiciones de esta modalidad. Durante dos horas, los alumnos prepararon un tema, defendieron sus distintas posturas y escucharon las recomendaciones del profesor sobre la oratoria y las técnicas de persuasión, que les resultarán muy útiles para su futuro.

El Presidente de ASEAFI, antiguo alumno del IEB, visita nuestro Centro de Estudios Carlos García Ciriza, Presidente de ASEAFI (Asociación de Empresas de Asesoramiento Financiero), visita el IEB para relanzar un acuerdo entre ambas instituciones, que abarca tanto temas de Formación como de futuro profesioREPTEVEWYWEWSGMEHSWQjWHIIE½WJSVQER parte de esta Asociación. Carlos Ciriza, que es además Socio Director de C2 Asesores Patrimoniales, realizó con nosotros el Master de Bolsa y Mercados Financieros (promoción del 93) y el Programa Avanzado de Especialización en Banca Privada y Asesoramiento Financiero.


NOTICIAS NACIONAL Actualidad nacional relacionada con el IEB


    José Miguel Serrano, 'LUHFWRU$FDGpPLFRGHO,(% Medalla de la Orden de la Democracia Simón Bolívar

(OGHSDUWDPHQWRGH,QYHVWLJDFLyQGHO,(%\$[HVRU5DWLQJSUHVHQWDQHO LQIRUPHTXHKDQHODERUDGRFRQMXQWDPHQWHVREUHHOPHUFDGRGHUHQWDILMD El informe fue presentado por sus autores, Miguel Ángel Bernal y Javier Santacruz Cano, coordinador y profesor del Departamento de Investigación del IEB respectivamente, y por Adolfo Estévez, Director de Axesor Rating. En él se destaca que resulta complicado KIWXMSREVIPQIVGEHSHIVIRXE½NEGSRPSW actuales de tipos de interés casi nulos, tasas HIMR¾EGMzRGIVGEREWEGIVS]GVIGMQMIRXS económico débil. Manejar los diferenciales de tipos de interés es clave para generar

El pasado día 31 de marzo, en la Embajada de Colombia en Madrid, tuvo lugar el acto de imposición de la Medalla de la Democracia Simón Bolívar, concedida por la Cámara de Representantes de Colombia al Director Académico del IEB, D. José Miguel Serrano Ruiz Calderón “por los servicios prestados a la Patria”. El acto de imposición fue presidido por el Ministro Plenipotenciario D. Juan Manuel Uribe.

Javier Ilardia, Rocío Díez-Hochleitner, Jong-Dae Kim, Manuel Gómez y Sergio Reyes.

Reunión con el Decano de INHA University of Korea El IEB recibió en diciembre la visita institucional del Dr. Jong-Dae Kim, Decano de la Universidad de INHA de Corea. Fundada en 1954, está considerada como una de las universidades más prestigiosas de su país. Actualmente cuenta con más de 120.000 alumnos en todo el mundo. El Dr. Kim se reunió con Javier Ilardia, Rocío Díez-Hochleitner, Manuel Gómez y Sergio Reyes, para analizar futuros acuerdos de colaboración con el IEB. 16

valor, mientras la balanza se inclina hacia la renta variable en medio mundo. Según Santacruz őNCTGPVCſLCCOGTKECPCUG encuentra infravalorada, al igual que la europea, en dos escenarios (política monetaria acomodaticia y restrictiva)”. Pero argumenXEUYIPEVIRXE½NEWMXYEHETSVIRGMQEHIP grado de inversión o “investment grade” se halla ligeramente sobrevalorada en el escenario de política monetaria expansiva, con una prima negativa pero pequeña, tanto en EE.UU. como en la Eurozona.

&+,1$,QYHUVLRQHVHQ(XURSD\(VSDxD tamente la Unión Europea, se convertirá en los próximos años en un importante receptor de IED (Inversión Extranjera Directa) China”. Aunque los chinos han invertido en los 28 países de la UE, la mayoría de inversiones ha sido en el Reino Unido, Alemania y Francia. Portugal es el cuarto mayor receptor de inversiones chinas. Según José María Revello de Toro, Director del Master en Corporate Finance y Banca de Inversiones de IEB, “Esto se debe a que es el mayor mercado para las exportaciones chinas y por la oportunidad que supone para los inversores chinos el acceso a la tecnología utilizada en las empresas europeas (ya que las barreras de entrada para acceder a tecnología son menores en Europa que en EE.UU. o Japón), factor muy relevante a la hora de invertir dado que la economía china se encuentra en transición (de una economía exportadora a otra basada en el consumo interno), por lo cual es necesario mejorar sus procesos productivos”. Paul Moran destacó que la economía china ha alcanzado tasas tan altas por la reducción de las barreras a la inversión extranjera saliente y el estímulo dado a las empresas chinas para invertir en el extranjero por parte de su gobierno.


GARP y el IEB E½ER^ERWYWPE^SW En febrero, el Presidente y CEO de GARP (Global Association of Risk Professionals), Richard Apostolik, visitó el IEB con el objetivo de seguir estrechando los lazos de colaboración entre ambas instituciones. El IEB es el único centro autorizado en España para impartir la formación TVITEVEXSVME TEVE PE GIVXM½GEGMzR FRM (Financial Risk Manager). Asimismo, se ha alcanzado un acuerdo para que las ediciones de los exámenes FRM (Niveles I y II) de los meses de mayo y noviembre se realicen en las instalaciones del IEB en Madrid.

(O 2EVHUYDWRULR GH &RUSRUDWH )LQDQFH ,(%'HORLWWH DQDOL]D HO LPSDFWRGHODGHVDFHOHUDFLyQFKLQDHQODLQYHUVLyQH[WUDQMHUDGLUHFWD ¿Puede China controlar su desaceleración?, ¿el frenazo chino interrumpirá la tendencia de fusiones y adquisiciones por parte de empresas chinas en Europa?, ¿veremos más adquisiciones en España?... Éstos y otros interrogantes se analizan desde el Observatorio de Corporate Finance IEB-Deloitte que, con motivo del Año Nuevo Chino, ha presentado el informe “China: Inversiones en Europa y España”. María Fernández Jiménez, Héctor Flores García y Paul Moran Sheehan, autores del informe, destacan que “las fusiones y adquisiciones por parte de empresas chinas en el extranjero cada vez son mayores, tanto en el número de operaciones como en volumen, y las operaciones ſTOCFCUGPNQUÕNVKOQUOGUGU muestran que seguirán aumentando, ya que China mantiene un papel cada vez más relevante en el mercado internacional de fusiones y adquisiciones”. Según Yi-Wen Quian, socia de Deloitte, “La Unión Europea es uno de los principales inversores en China. Por el contrario, la inversión extranjera directa por parte de China en Europa todavía no tiene gran relevancia (actualmente solo supone el 6% de la inversión total), pero todos los indicios hacen pensar que probablemente Europa, y más concre-

Richard Apostolik, CEO de GARP.

PAUL PRESTON, Profesor de la LSE se reúne con profesores y directivos del IEB En el marco de nuestras relaciones con la London School of Economics, el historiador e hispanista británico Paul Preston visitó el IEB en septiembre. Se reunió con profesores y directivos y trataron el tema del papel del Rey Juan Carlos durante la transición política.

Paul Preston es Doctor por la Universidad de Oxford y catedrático de Historia Contemporánea española en la LSE. También fue profesor de Historia en la Universidad de Reading y en el Centro de Estudios Mediterráneos del Queen Mary College (Universidad de Londres).


NOTICIAS NACIONAL Actualidad nacional relacionada con el IEB



El IEB acoge la Fintech Unconference, y asisten mĂĄs de 60 CEOs de empresas del sector

Rodrigo GarcĂ­a de la Cruz, Codirector del Programa de InnovaciĂłn y TecnologĂ­a Financiera del IEB, y JesĂşs PĂŠrez Director del Fintech Unconference y CEO de Bolsa.com, fueron los moderadores de la jornada.

Como partner acadĂŠmico del Fintech Unconference, organizado por la Web Financial Group, el IEB acogiĂł en enero el primer gran evento Fintech en EspaĂąa.

SegĂşn Rodrigo GarcĂ­a de la Cruz, fue un evento Ăşnico â&#x20AC;&#x153;es la primera vez que se reĂşnen mĂĄs de 60 CEOs de Fintech espaĂąolasâ&#x20AC;?. Se propuso crear una autoridad Ăşnica re-

guladora, para competir con paĂ­ses anglosajones, y defender los intereses y tener mayor capacidad de comunicaciĂłn con los distintos stakeholders. Las Fintech son empresas con base tecnolĂłgica que ofrecen WIVZMGMSW ½RERGMIVSW EPXIVREXMZSW E PSW HI grandes bancos tradicionales. Se presentĂł el Fintech Index 25. Un Ă­ndice elaborado por Bolsa.com, revisado mensualmente y que incluye a las empresas cotizadas mĂĄs importantes de Fintech en el mundo. Este Ă­ndice comenzĂł a cotizar en 1.000 puntos en febrero y forman parte de ĂŠl Paypal, Square, o LendingClub, entre otras. JesĂşs PĂŠrez concluyĂł que â&#x20AC;&#x153;Lo mĂĄs relevante de las iniciativas Fintech es el impacto que va CVGPGTGPNCUĹżPCP\CUFGVQFCUNCURGTUQPCUĹ&#x2019; En esta primera ediciĂłn, ademĂĄs se contĂł con la colaboraciĂłn de SelfBank, Google, Leida.net, EY, BolsamanĂ­a, FinancialRed y Bolsa.com.

La rsc2, una innovadora herramienta de mediciĂłn La FundaciĂłn SERES y el IEB organizaron un debate sobre la importancia de la gestiĂłn y mediciĂłn de proyectos sociales como un indicador de valor para los grupos de interĂŠs: clientes, inversores, accionistasâ&#x20AC;Ś AcompaĂąado por Pablo Cousteau, Director de Programas Especializados del IEB, y TomĂĄs Calleja, socio director de McKinsey & Company, el Presidente de FundaciĂłn SERES, Francisco RomĂĄn, inaugurĂł la jornada haciendo hincapiĂŠ sobre cĂłmo rsc2 TYIHIMRžYMVIRPEXSQEHIHIGMWMSRIWHI MRZIVWSVIW]E]YHEVEGYERXM½GEVIPMQTEGto de la creaciĂłn valor compartido en la cuenta de resultados de las empresas y la captaciĂłn de inversiones interna y externa. Ana SĂĄinz, Directora General de FundaciĂłn SERES, iniciĂł el bloque de las ponencias, haciendo ĂŠnfasis en â&#x20AC;&#x153;el proceso estructurado 18

Los ponentes antes de iniciar la jornada.

Prometedor futuro para las SOCIMIS en EspaĂąa La jornada, organizada por el IEB y patrocinada por RENTA 4 BANCO, versaba sobre â&#x20AC;&#x153;Las SOCIMIs como vehĂ­culo de inversiĂłnâ&#x20AC;?. DestacĂł el altĂ­simo nivel de los ponentes expertos en la materia, que transmitieron su experiencia en el dĂ­a a dĂ­a de la gestiĂłn, como Simon Blaxland, de URO Property SOCIMI, y Luis Pereda, Presidente de Grupo LAR, y antiguo alumno del IEB. En un mercado que estĂĄ nacienHSIR)WTEyE EQFSWE½VQEVSR que el futuro es prometedor si comparamos nuestro mercado

de SOCIMIs con el desarrollo histórico que se ha producido en el resto del mundo y los inversores internacionales mantienen el interÊs actual por el producto. En la segunda parte, mås tÊcnica, destacó la exposición de Elías Rodríguez Viùas, de RENTA 4, centrada en el papel del asesor registrado y el MAB. Por otro lado, D. Manuel Romero, de Romero Rey Abogados, aclaVzPSWEWTIGXSWNYVuHMGS½WGEPIW 4EVE½REPM^EV LYFSYRXYVRSHI preguntas para aclarar las dudas de los asistentes.

El pasado septiembre se celebrĂł la jornada sobre GestiĂłn de Colaterales en el IEB, con la colaboraciĂłn de Optimissa. La presentaciĂłn e introducciĂłn de los conceptos bĂĄsicos en el mundo de colateral fue realizada por Eduardo Ramos de Optimissa, Product Manager de 2Cover. Posteriormente, JosĂŠ Luis MartĂ­n, Responsable del ĂĄrea de Portfolio Reconciliation & Dispute Resolution en Banco Santander, examinĂł el impacto regulatorio relacionado con el mundo de los colaterales y retos futuros.

Sergio del Corral, Director de la Mesa de Gestión de Colaterales de Bankinter, revisó el funcionamiento de las cåmaras de compensación, su operativa y cómo interactúan sus miembros. Constantino Toribio, Director de Liquidez Estructural en Bankia, explicó el proceso de optimización de colaterales, registro de un GSRXVEXS MRZIRXEVMSW HI½RMGMzRHIRIGIWMHEHIWHI½RERciación y garantías. Finalmente, se presentó la operativa de 2Cover, el sistema diseùado por Optimissa para la gestión de colaterales.

Jornada sobre â&#x20AC;&#x153;CĂłmo establecer VIPEGMSRIWHIGSR½ER^E]½HIPM^EGMzR de clientes en Banca-Segurosâ&#x20AC;?

en el que trabaja la FundaciĂłn SERES, para E½ER^EV PE QIHMGMzR ] IP HMjPSKS WSFVI PE creaciĂłn de valor para sociedad y empresa. Jorge Medina, Director de Programas en Banca Responsable del IEB, dijo que â&#x20AC;&#x153;las mĂŠtricas

de la RSC son cada vez mĂĄs valoradas en la IGUVKĂ&#x17D;PGUVTCVĂ&#x192;IKECFGNCKPFWUVTKCĹżPCPEKGTC8Cmos hacia un nuevo modelo de negocio en las KPUVKVWEKQPGUĹżPCPEKGTCUVCPVQCPKXGNFGOCTEQ regulatorio como de protecciĂłn al consumidorâ&#x20AC;?.

Sonia GarcĂ­a y Humberto RosellĂł.

Celebrada el pasado 27 de octubre en la Sede del IEB, la jornada fue dirigida por Humberto RosellĂł, socio-fundador de Impulso Coaching de Negocios y Sonia GarcĂ­a, Directora ExpansiĂłn DelegaciĂłn Madrid Impulso Coaching. Con una asistencia aproximada de 80 personas, desde el comienzo atrajo al pĂşblico congregado, que mostrĂł gran interĂŠs y un alto Ă­ndice de participaciĂłn

en las preguntas y debates. La practicidad de los ejemplos, el dinamismo de la charla, la exposición de los distintos comportamientos de los actores en estas relaciones, así como el conocimiento de los mercados de banca y seguros por parte de los ponentes, generaron YR EQFMIRXI I\GIPIRXI HI žYMHE GSmunicación y de gran utilidad, por los consejos aportados.


NOTICIAS NACIONAL Actualidad nacional relacionada con el IEB


La importancia de la función de compliance Desde 2010, las empresas están obligadas a tener planes de prevención de los delitos que puedan cometer sus administradores o sus empleados para evitar la responsabilidad penal, lo que en la terminología anglosajona se conoce como Compliance Programme. Dada la relevancia del tema, el IEB organizó una jornada en la que presentó el nuevo Programa de Especialización en Compliance, que prepara a los alumnos TEVEPE'IVXM½GEGMzR')7'31]UYIGSmenzó el pasado 2 de febrero.

Teresa Serrano, Teresa de Vicente y Enrique Alonso, ponentes de la jornada.

Dos nuevas Menciones de Honor en el



Javier Galera, Borja Zamorano, Juan Lafont y Carlos Garrido.

JORNADA PROJECT BONDS El IEB celebró en noviembre una Jornada sobre Project Bonds que congregó a más de 100 personas entre profesionales y exalumnos. Las ponencias corrieron a cargo de Javier Galera, Fundador y Director de Forinfra Infrastructure Partners, Borja Zamorano, Managing Director de Mizuho Internacional plc, Juan Lafont, Director HI6MIWKS%RjPMWMW]4PERM½GEGMzR*MRERciera de Ferrovial y Carlos Garrido, Director de Client Business Management Southern Europe de Standard & Poor’s, aportando la visión global del sector 20

de infraestructuras, la perspectiva del inversor y del banco de inversión, la experiencia del emisor de project bonds y la metodología aplicada por S&P en esta QSHEPMHEHHI½RERGMEGMzR El interés por este novedoso mercado en Europa quedó patente por el debate generado tras las ponencias, que se prolongó hasta las 10.15pm, y que fue especialmente dirigido al detalle de la metodología aplicada por las agencias, a la estructura y covenants exigidos a IWXEW ½RERGMEGMSRIW ] E PE I\TIVMIRGME personal del emisor.

En febrero, el IEB acogió la jornada “¿Cómo ZEPSVEV ] ½RERGMEV YRE 7XEVXYT#² MQTYPWEHE por José María Revello de Toro, Director del Master de Corporate Finance y Banca de Inversiones del IEB y por Rodrigo García de la Cruz, Director del Programa Directivo en Innovación y Tecnología Financiera del IEB. En la primera parte se trató la situación de las startups Fintech en España y a nivel mundial, su impacto en el Sector Financiero y el futuro de las Fintech. Participaron Antonio Herráiz Molina, Director del Programa Directivo en Innovación y Tecnología Financiera y Jesús Pérez Sánchez, Consejero en Financial Group International. En la segunda, se debatió WSFVI GzQS ZEPSVEV ] ½RERGMEV YRE WXEVXYT y se contó con la experiencia de prestigiosos emprendedores como Alberto Gómez Toribio, actual Blockchain CTO en Barrabés Group e Iván Nabalón, CEO de eID, empresa de disrupting digital identification4EVE½REPM^EV Ignacio Muñoz y José Antonio Davín Escobar, alumnos del Master de Corporate Finance y Banca de Inversiones, presentaron un modelo de Valoración de Startups desarrollado bajo el proyecto del Master de Corporate Finance y tutelado por José María Revello de Toro y Rodrigo García de la Cruz.

JUAN FRANCISCO CUELLO Mención de Honor PostGrado 2014

ARTURO DAUFFI MICHAVILA Mención de Honor Grado 2015

Juan Francisco es Ingeniero de Caminos, Canales y Puertos por la Universidad Politécnica de Valencia. Cursó el MBA de octubre de 2013 a julio de 2014, siendo número uno de su promoción. Para ser designado para el Muro HI PE *EQE PSKVz PE GEPM½GEGMzR más alta que otorga el Tribunal que evalúa a los mejores alumnos de cada uno de los masters del IEB. Cursó simultáneamente en marzo de 2014 el Programa Directivo de Gestión Patrimonial Familiar Private Wealth Management). Actualmente es Investment Analyst en Wealth Solutions, EAFI desde julio de 2014.

Ar turo obtuvo, por sus méritos, por su actitud y por el comportamiento que mostró durante su estancia en nuestro Centro de Estudios, la Primera Mención de Honor de la decimoctava Promoción de Estudios de Doble Titulación del IEB (Grado en Derecho por la Universidad Complutense de Madrid y Master en Bolsa y Mercados Financieros). Ar turo estudió en el Colegio Nuestra Señora de la ConsolaGMzRHI'EWXIPPzRHSRHIEP½RElizar el Bachillerato, obtuvo una media de Matrícula de Honor.


NOTICIAS INTERNACIONAL Actualidad internacional relacionada con el IEB



Ă lvaro MartĂ­nez-EchevarrĂ­a durante su ponencia.

Creative Commons

Excelentes personas, excelentes negocios

colectiva para generar nuevas realidades, y E½VQzUYIâ&#x20AC;&#x153;la ĂŠtica superior es la capacidad de dar a los demĂĄs mucho mĂĄs de lo que esperan de ti y no esperar nada a cambioâ&#x20AC;?. 0EWIKYRHEMRXIVZIRGMzRJYIEGEVKSHIP(Mrector del IEB, Ă lvaro MartĂ­nez-EchevarrĂ­a, GY]EGSRJIVIRGMEJYIYREEHETXEGMzRHIPEW GPEWIW UYI MQTEVXI IR RYIWXVS GIRXVS HI estudios sobre los â&#x20AC;&#x153;Fundamentos histĂłricos y ĹżNQUĂ&#x17D;ĹżEQUFGNCÂ&#x153;VKECFGNQU0GIQEKQUĹ&#x2019;8VEXz WSFVIIPFIRI½GMSUYIETSVXEEPEWSVKERMzaciones pensar y actuar con sentido deonXSPzKMGS â&#x20AC;&#x153;el olvido de los principios morales y el quebranto de todas las barreras ĂŠticas ha IGPGTCFQOWEJCUFGNCUETKUKUGEQPĂ&#x17D;OKECUSWG la humanidad padeceâ&#x20AC;? )P (MVIGXSV HIP -)& GSRGPY]zMRZMXERHSEPSWEWMWXIRXIWEZSPZIV E GVIIV IR PSW ZEPSVIW QSVEPIW SFNIXMZSW ] E IWJSV^EVWI TEVE TSRIVPSW IR TVjGXMGE 0EWGSRGPYWMSRIWJYIVSREGEVKSHI(I]Ena Acosta-Madiedo, Secretaria de Cultura ]4EXVMQSRMSHIP(ITEVXEQIRXSHIP%XPjRXMGS UYMIRMRWXzEPSWEWMWXIRXIWEETPMGEVPS aprendido en su dĂ­a a dĂ­a.

La mesa directiva estuvo compuesta por el Presidente, la Directora y varios miembros de la CorporaciĂłn PEP y por los dos conferenciantes invitados, Ă lvaro MartĂ­nez-EchevarrĂ­a y Gustavo Mutis.


NOTICIAS INTERNACIONAL Actualidad internacional relacionada con el IEB


Visita a la Bolsa de Valores de Hong Kong. 24

Sergio Reyes impartiĂł una ponencia sobre inversiones chinas en EspaĂąa.


Durante una de las clases impartidas por un profesor de la CUHK.

El Director del IEB recibe un obsequio de manos de Kenneth Tse.

Los alumnos en la sede del Banco Santander de Hong Kong.


Los estudiantes locales acogen con simpatĂ­a a sus compaĂąeros. 25

NOTICIAS INTERNACIONAL Actualidad internacional relacionada con el IEB

El IEB promueve sus programas formativos en ferias internacionales

รlvaro Sรกnchez Agustรญ, Coordinador del Master en Bolsa y Mercados Financieros y Javier Ilardia, Director de Relaciones Internacionales del IEB, con un grupo de colegas de la Facultad de Economรญa y Negocios de la Universidad Anรกhuac.





Richard Apostolik, CEO de GARP, junto al profesor Roberto Savina, Coordinador del รrea de Riesgos de Formaciรณn a Medida del IEB.


34-2-Ì2 Ana Guzmán Quintana







o cabe duda de que vivimos un momento histórico en el que estamos siendo espectadores (y en algunos casos MRGPYWSEGXSVIW HITVMQIVE½PEHIPSWQE]Sres experimentos económicos de la historia. =IRXVIIPPSWIWXjIPHIWGYFVMVUYIIPWYIPS no está en el cero cuando hablamos de tipos de interés. )RPEEGXYEPMHEHIP HIP4-&QYRHMEPTVSviene de países que están aplicando políticas de tipos negativos en un afán desesperado TSVIWXMQYPEVPEMR¾EGMzR]JSQIRXEVIPGVqdito. Efectivamente, ante una situación en la que se cobre por tener el dinero inmovilizado en un lugar seguro, buscaremos otras alternativas y estaremos dispuestos a asumir más riesgo a cambio de obtener cierta rentabilidad, lo que, a la larga, tendría que incentivar la velocidad del dinero en circulación y la concesión de crédito. Pero lo cierto es que estas medidas a día de hoy están teniendo un efecto limitado en la economía real y sin embargo un efecto muy peligroso en los QIVGEHSW½RERGMIVSWPEIPMQMREGMzRHIERj-

lisis fundamental y largo placista de aquellos activos que de verdad tienen valor. Todo vale por evitar depositar el dineVS IR YRE GYIRXE = WM LE] YR TVSFPIQE Mario Draghi ya nos ha dicho que no nos preocupemos, que ¡está dispuesto a hacer lo que sea necesario! En un mundo con tipos de interés negativos, nos podríamos enfrentar a situaciones como la siguiente: –Buenas tardes, quería informarme sobre las distintas modalidades de pago del gimnasio. –Pues mire precisamente tenemos una oferta muy especial: si usted se acoge a la cuota anual en lugar de la mensual, podrá hacer uso de nuestras instalaciones durante los doce meses y transcurrido este plazo, nos abona el importe, ahorrándose una mensualidad. Sí, no está mal, aunque vengo de otro gimnasio en el que en lugar de doce meses me ofrecen 18 y me ahorro dos mensualidades. -QTIRWEFPIZIVHEH#¡'zQSRSWZEREHINEV hacer uso de algo sin pagar y además hacernos una promoción por retrasar el pago

cuanto más mejor? ¿No tendría que ser al contrario? Si pagamos antes, nos hacen un descuento. Efectivamente, es una situación que se nos antoja absurda y que rompe con toda ley del valor temporal del dinero que se precie..., por lo menos en el mundo que hemos conocido hasta ahora, donde si se presta dinero, se exige el pago de un interés que tiene en cuenta además del riesgo del prestatario, el plazo al que se presta. Sin embargo, este ejemplo resume de una manera muy simple hasta dónde podríamos llegar en un mundo de tipos de interés negativos. Por otro lado, es cierto que todavía los tipos negativos sólo están siendo aplicados a enXMHEHIW½RERGMIVEW4IVS¡UYMqRRSRSWHMGI que el siguiente paso podría ser aplicarlas al GPMIRXI½REP#¡=UYqWMXYEGMzRWITPERXIEVuE# ¿Volveríamos al mítico calcetín para poner a resguardo nuestro dinero? En lugar de fomentar el pronto pago, ¿buscaríamos fórmulas para retrasar lo máximo posible la disponibilidad de efectivo? ¿Se fomentaría la economía sumergida basada en el trueque de cara a que no se descubra que tenemos dinero en efectivo por el que no queremos pagar por el mero hecho de depositarlo en una entidad o invertirlo? Ante este panorama, ahorradores, inversores particulares e institucionales se enfrentan a un doble reto en absoluto baladí: por una parte, tratar de dejar a un lado el corto plazo y tomar decisiones fundadas en activos que de verdad respondan a criterios de GEPMHEH]ZEPSV=TSVSXVE SFXIRIVVIRXEFMlidades sostenidas con un nivel ajustado de riesgos en un entorno de tipos de interés menguantes, donde además la correlación entre los distintos activos parece ser cada vez mayor. En este sentido, a lo largo de los años la IZSPYGMzRIRGYERXSEPEHMZIVWM½GEGMzRHI PEWGEVXIVEWLEWMHSWMKRM½GEXMZE ]EHuEHI

hoy no se concibe una cartera razonableQIRXI HMZIVWM½GEHE UYI RS GSRXIRKE YR porcentaje determinado no sólo de renta ½NE ] VIRXE ZEVMEFPI WMRS HI I\TSWMGMzR E HMWXMRXEW jVIEW KISKVj½GEW ] WIGXSVIW 4SV ejemplo, a la hora de llevar a cabo nuestra asignación de activos ¿cómo vamos a ignorar a Asia, cuando esta región contribuye en un 50% al crecimiento global? Quizá éste sea el momento para que los inversores comiencen a plantearse la inversión en otros tipos de activos como IPIQIRXS HI HMZIVWM½GEGMzR )R IWXI WIRtido, cabe destacar la inversión en infraestructuras o en inmuebles, algo presente en nuestro día a día, y que son fuentes de generación de rentas importantes y a los que, además, los entornos de tipos bajos PIW FIRI½GMER 3 PE MRZIVWMzR IR ±EMVGVEJX PIEWMRK STIVEGMSRIWHIZIRXEHIPEW¾SXEW aéreas por parte de las compañías aéreas para inmediatamente alquilarlos), bonos vinculados a catástrofes como huracanes, materias primas, papel, bonos vinculados a la tasa de mortalidad. Activos con una liquidez inmediata inferior, pero con un impacto mayor en la economía real y por tanto menos vulnerables a las decisiones de los Bancos Centrales y que además son una fuente alternativa de renta. 3NEPjHIRXVSHIYRSWEySW EPPIIVHIRYIvo este artículo, nos llevemos las manos a la cabeza y nos riamos del tinte alarmista del ejemplo planteado. Pero a día de hoy, y ante el cariz que está tomando el mayor experimento monetario puesto en marcha por los Bancos Centrales de los países desarrollados, no cabe duda de que las consecuencias son aún de una trascendencia MQTVIZMWXE ] YRE EYXqRXMGE HMZIVWM½GEGMzR junto con un análisis fundamental de calidad es el único antídoto para bandear el corto placismo que impera en los mercados ½RERGMIVSWO


Ana Guzmán Quintana Subdirectora del Master en Gestión de Carteras del IEB Licenciada en Administración y Dirección de Empresas por la Universidad Complutense de Madrid. Tiene un Master en +IWXMzRHI'EVXIVEWTSVIP-)& Desde 2011 compagina su labor profesional con la Sub-dirección académica de los Master de Gestión y 'EVXIVEW]1EWXIVHI3TGMSRIW ]*YXYVSWHIP-)&0ETVSJIWSVE Guzmán comenzó su carrera profesional en 2004 como gestora de Renta Fija y Fondos de Fondos en March Gestión y posteriormente en Caja España Fondos. En 2008 fue directora HI:IRXEW-RWXMXYGMSREPIWTEVE España, Andorra y Portugal en Dekabank, asumiendo la HMVIGGMzRHIPES½GMREIR Actualmente, Ana Guzmán es Country Head para la Península MFqVMGE=,IEHSJ&YWMRIWW Development de Aberdeen Asset Managers Ltd.- Sucursal en España.




Septiembre 2016

DuraciĂłn Precio

Cuatro Cursos AcadÊmicos. En cada uno de los cuatro cursos, nueve mensualidades de 1.140 euros cada una (precio para 2016-2017) susceptible HIQSHM½GEGMzRTSVIP'IRXVS )RIPTVMQIVGYVWSRMGEQIRXI]YREZI^EHQMXMHSIPEPYQRSEFSREVjIYVSWIR GSRGITXSHIVIWIVZEHITPE^E


Septiembre 2016

DuraciĂłn Precio

Cuatro Cursos AcadÊmicos. En cada uno de los cuatro cursos, nueve mensualidades de 900 euros cada una (precio para 2016-2017) susceptible HIQSHM½GEGMzRTSVIP'IRXVS )RIPTVMQIVGYVWSRMGEQIRXI]YREZI^EHQMXMHSIPEPYQRSEFSREVjIYVSWIR GSRGITXSHIVIWIVZEHITPE^E


Septiembre 2016

DuraciĂłn Precio

Cuatro Cursos AcadÊmicos. En cada uno de los cuatro cursos, nueve mensualidades de 1.140 euros cada una (precio para 2016-2017) susceptible HIQSHM½GEGMzRTSVIP'IRXVS )RIPTVMQIVGYVWSRMGEQIRXI]YREZI^EHQMXMHSIPEPYQRSEFSREVjIYVSWIR GSRGITXSHIVIWIVZEHITPE^E


Septiembre 2016

DuraciĂłn Precio

Cuatro Cursos AcadÊmicos. En cada uno de los cuatro cursos, nueve mensualidades de 750 euros cada una (precio para 2016-2017 susceptible HIQSHM½GEGMzRTSVIP'IRXVS )RIPTVMQIVGYVWSRMGEQIRXI]YREZI^EHQMXMHSIPEPYQRSEFSREVjIYVSWIR GSRGITXSHIVIWIVZEHITPE^E




Septiembre 2016

DuraciĂłn Precio

Cuatro Cursos AcadÊmicos. En cada uno de los cuatro cursos, nueve mensualidades de 750 euros cada una (precio para 2016-2017 susceptible HIQSHM½GEGMzRTSVIP'IRXVS )RIPTVMQIVGYVWSRMGEQIRXI]YREZI^EHQMXMHSIPEPYQRSEFSREVjIYVSWIR GSRGITXSHIVIWIVZEHITPE^E






Inicio Duraciรณn Precio

Octubre 2016 90 crรฉditos ECTS, 3 cuatrimestres 18.000 euros + tasas UCM

BOLSA Y MERCADOS FINANCIEROS (Convocatoria octubre 2016 ) Inicio Duraciรณn Precio

Abril 2017 14 meses / 550 horas 21.000 euros


Inicio Duraciรณn Precio

Octubre 2016 10 meses / 500 horas 18.000 euros

Inicio Duraciรณn Precio

Enero 2017 13 meses / 520 horas 18.500 euros


Inicio Duraciรณn Precio

Febrero 2017 13 meses / 501 horas 18.500 euros


Inicio Duraciรณn Precio

Enero 2017 12 meses / 504 horas 18.500 euros


Inicio Duraciรณn Precio

Febrero 2017 13 meses / 505 horas 18.500 euros


Inicio Duraciรณn Precio 32


Inicio Duraciรณn Precio

Abril 2017 12 meses / 600 h online / 300 h presenciales 18.500 euros

Octubre 2016 Equivalente a 250 horas 9REIWTIGMEPM^EGMzRIYVSW



Abril 2017 12 meses / 800 horas 9.000 euros


BOLSA Y MERCADOS FINANCIEROS (Convocatoria abril 2017 ) Inicio Duraciรณn Precio

Octubre 2016 14 meses / 550 horas 21.000 euros

Noviembre 2016 12 meses / 950 horas 9.000 euros


Inicio Duraciรณn Precio

Septiembre 2016 10 meses / 800 horas 25.000 euros

Inicio Duraciรณn Precio

Noviembre 2016 12 meses / 800 horas 9.000 euros




Enero 2017 189 horas 5.750 euros


1EV^S 60 horas 4.000 euros



Inicio Duraciรณn Precio

Inicio Duraciรณn Precio

Febrero 2017 126 horas 7.500 euros


Noviembre 2016 Equivalente a 250 horas 3.850 euros







Equivalente a 180 horas (20 horas presenciales) 3.200 euros


260 h


5.400 euros.



Inicio Duraciรณn Precio

Noviembre 2016 150 horas (90 horas presenciales + 60 horas online) 4.200 euros


Inicio Duraciรณn Precio

Noviembre 2016 150 horas 3.200 euros 33



Inicio Duraciรณn Precio

Octubre 2016 Equivalente a 100 horas 2.000 euros


Inicio Duraciรณn Precio

Octubre 2016 99 horas 2.750 euros


Inicio Duraciรณn Precio

Octubre 2016 141 horas 3.200 euros


Inicio Duraciรณn Precio

Octubre 2016 120 horas 2.200 euros


Inicio Duraciรณn Precio

Noviembre 2016 Equivalente a 200 h. / 24 h. presenciales IYVSWTSVRMZIP RMZIP-]--


Inicio Duraciรณn Precio

1E]S 93 horas 2.500 euros


Octubre 2016


3.200 euros

Octubre 2016 135 horas 3.850 euros

Inicio Duraciรณn Precio


Octubre 2016 141 horas 3.500 euros

Inicio Duraciรณn Precio

Octubre 2016 123 horas 3.500 euros

Inicio Precio

Octubre 2016 1.500 euros

Inicio Duraciรณn Precio

Julio 2016 100 horas 2.500 euros

Inicio Duraciรณn Precio

Inicio Duraciรณn Precio


Inicio Duraciรณn Precio

Inicio Duraciรณn Precio

Julio 2016 100 horas 2.500 euros

Inicio Duraciรณn Precio

Octubre 2016 63 horas 2.200 euros


Inicio Duraciรณn Precio

Octubre 2016 96 horas 2.700 euros


Inicio Duraciรณn Precio

Octubre 2016 87 horas 2.600 euros

Julio 2016 100 horas 2.500 euros


Inicio Duraciรณn Precio

Julio 2016 100 horas 2.500 euros

Julio 2016 100 horas 2.500 euros


Febrero 2017 75 horas 2.400 euros


Julio 2016 100 horas 3.000 euros



Inicio Duraciรณn Precio

Julio 2016 100 horas 2.500 euros


Julio 2016 100 horas 2.500 euros


Inicio Duraciรณn Precio





Inicio Duraciรณn Precio




Inicio Duraciรณn Precio

Octubre 2016 108 horas 3.300 euros



Inicio Duraciรณn Precio



Inicio Duraciรณn Precio

Octubre 2016 76 horas 1.400 euros




Octubre 2016




40 horas


39 horas


3.100 euros


900 euros


Inicio Duraciรณn Precio

Octubre 2016 40 horas 3.100 euros + IVA.

Precio antiguos alumnos 2.430 euros + IVA 35


PREPARACIร“N AL CFAยฎ NIVEL I (Presencial/Online)


Inicio Duraciรณn Precio

Inicio Duraciรณn Precio

Junio 2016 21 horas 850 euros

Inicio Duraciรณn Precio

Octubre 2016 4 dรญas / 10 horas 120 euros


Inicio Duraciรณn Precio

Noviembre 2016 4 dรญas / 10 horas 120 euros


Inicio Duraciรณn Precio

1EV^S 4 dรญas / 10 horas 120 euros


Inicio Duraciรณn Precio

Abril 2017 4 dรญas / 10 horas 120 euros


Inicio Duraciรณn Precio 36

HIQE]S 3 horas lectivas de 19 a 22 horas 175 euros

Inicio Duraciรณn Precio

Septiembre 2016 60 horas 1.300 euros

Noviembre 2016 60 horas 1.300 euros





Inicio Duraciรณn Precio

Octubre 2016 21 horas 450 euros / antiguo alumno 275 euros


Inicio Duraciรณn Precio

Octubre 2016 21 horas 550 euros / antiguo alumno 350 euros


Inicio Duraciรณn Precio

Octubre 2016 21 horas 500 euros / antiguo alumno 300 euros


Inicio Duraciรณn Precio

Octubre 2016 22 horas 475 euros / antiguo alumno 280 euros

Master in International Finance The main objective for the students is to gain ERMRHITXLORS[PIHKISJLS[MRXIVREXMSREPยฝnance operates on a worldwide basis. In order to pursue this goal, the master degree is supTSVXIH F] XLVII TVIWXMKMSYW EGEHIQMG MRWXMXYtions: Whar ton School, The London School of )GSRSQMGWERH8LI'LMRIWI9RMZIVWMX]SJ,SRK Kong. Throughout the program, the attendees will WXYH]XLIJYRHEQIRXEPWSJยฝRERGIEREP]^IXLI QEMR MRXIVREXMSREP GSVTSVEXI ยฝRERGI XVERWEGXMSRW ERH YRHIVWXERH XLI ยฝRERGMEP QEVOIXW as well as the products traded. Fur thermore, XLI][MPPORS[LS[XLIMRXIVREXMSREPTE]QIRX W]WXIQSTIVEXIWERHMXWMQTPMGEXMSRWXSEPPXLI relevant par ticipants.


CLAUSTRO Noticias, entrevistas y actualidad referentes al profesorado del IEB

Profesor del IEB desde hace ya 15 años, Aurelio García comparte con nosotros su dilatada experiencia profesional en posiGMSRIW HMVIGXMZEW IR PEW jVIEW ½RERGMIVE ] HI TPERM½GEGMzR IWXVEXqKMGE IR IQTVIWEW GSQS 7MWXIPGSQ )P 'SVXI -RKPqW 4(1 Compaq y JTI, ¿Qué le llevó a incorporarse al IEB y por qué decidió ser profesor?




)WXYHMq QM GEVVIVE IR )WXEHSW 9RMHSW ] HYVERXIPSWPXMQSWEySWLIZMZMHSIR TEuWIW]KIWXMSREHSGEWMQIVGEHSWGSR lo que mi vida durante este tiempo ha transGYVVMHS ZMENERHS GSRWXERXIQIRXI ,E WMHS una experiencia dura en el terreno personal, pero apasionante en el profesional, ya que me ha permitido descubrir el mundo y todo PSUYIIPPSGSRPPIZEEHETXEGMzRHMZIVWMHEH



7MLEGIQSWYRVIGYIRXSHIPEWPXMQEWKIneraciones de alumnos, hay un sinfín de diferencias, en su forma de actuar, resolver problemas, enfrentarse a la realidad y afronXEV]PSKVEVIPETVIRHM^ENI (IWXEGEVuE WSFVIXSHS PSWEWTIGXSWHMKMXEles y el impacto que esto tiene sobre los EPYQRSW]WYQERIVEHIZIVIPQYRHS ¿Por qué realizar el Global MBA con Especialización en Finanzas?




WYGEWEFMFPMSXIGEWWEPEWHIIWXYHMSIXG PE XIGRSPSKuEPSQERXMIRIGSRIGXEHS )P EPYQRS E½ER^E WYW HSXIW HI PMHIVE^KS MRGVIQIRXEWYGETEGMHEHTEVEPEVIWSPYGMzR HITVSFPIQEW]TEVEMRXIKVEVWIIRIUYMTSW de trabajo, aspectos muy demandados por PEIQTVIWE0EJSVQEGMzRHIFIWIVGSRXMRYE hay que aprender, desaprender y reaprender, formar parte de un viaje educativo compartido por profesores y estudiantes, eso es lo que nuestros alumnos pueden enGSRXVEVIRIP+PSFEP1&%

¿Qué diferencia al IEB?


1jW FMIR PE IGSRSQuE IR KIRIVEP 2SW enfrentamos a un mundo convulso y voláXMP,IQSWZMWXSGSQS)WXEHSW9RMHSWRS EGEFEHIHIWTIKEVTIWIEWYPEVKSTVSKVEQEI\TERWMZSPEGVMWMWHIPTIXVzPIS'LMRE y sus problemas estructurales, países en la zona Euro rescatados, importantes ecoRSQuEW IQIVKIRXIW GSQS &VEWMP ] 6YWME IR VIGIWMzR ] EUYu WM FMIR GSR GMJVEW HI crecimiento del PIB por encima de la meHME IYVSTIE GSR EWMKREXYVEW TIRHMIRXIW IRXIQEWHIHq½GMX]HIWIQTPIS)PWIGXSV ½RERGMIVSGSVVIIRQYGLEWSGEWMSRIWIR paralelo a la economía real de los países, y deberíamos ajustar esa diferencia y hacerPSWXERKIRGMEPIW ¿Cómo debemos prepararnos para afrontar esos retos?


CLAUSTRO Noticias, entrevistas y actualidad referentes al profesorado del IEB











José Carlos García Morte, que apostó por la especialización para posicionarse y aumentar sus opciones de éxito en un QSQIRXS GSQTPMGEHS IR IP QYRHS ½nanciero, nos cuenta su experiencia.


%P½REPM^EVQMWIWXYHMSWHI%HQMRMWXVEGMzR y Dirección de Empresas en 2010, uno de los peores años en términos de oportunidades profesionales, decidí aprovechar la ocasión para continuar con mi formación especializándome en aquello que realmente me apetecía, iniciando el Master en Corporate Finance y Banca de Inversiones del IEB. Fue al poco de iniciarlo cuando me incorporé a Acciona como analista de inversiones dentro de la división energética del grupo, allí tuve la oportunidad de consolidar y aplicar los conocimientos que fui adquiriendo a lo largo del master y que me resultaron de gran ayuda para desempeñar el trabajo, consistente en analizar nuevas oportunidades de inversión y operaciones de M&A dentro de Acciona Energía a nivel mundial. Tras casi dos años en Acciona, me incorporé a Genova Capital, una boutique de M&A para el segmento de middle market en España, trabajando en operaciones para un diverso rango de industrias. Desde la posición de associate tuve la oportunidad de participar en todo el proceso de las transacciones, lo cual me permitió reforzar mi capacitación profesional desde un punto de vista de multiresponsabilidad. Finalmente y tras estar dos años y medio en Genova Capital, me incorporé a Arcano como asociado en el área de Capital Markets, puesto que ocupo desde hace un año.


¿Cuál ha sido su trayectoria profeWMSREPHIWHIUYI½REPM^zPEGEVVIVE#

¡'zQSLEMR¾YMHSIRWYHIWEVVSPPS profesional haber hecho el Master MR'SVTSVEXI*MRERGIHIP-)&#

Ha sido fundamental, no sólo por la di½GYPXEH UYI IP QIVGEHS HI XVEFENS TVIWIRXEFE GYERHS ½REPMGq QM GEVVIVE WMRS por el abanico de nuevas oportunidades

UYI SJVIGI GYVWEV JSVQEGMzR IWTIGu½GE de alto valor añadido. Me permitió iniciar mi carrera profesional desde el punto de partida correcto para poder desarrollar YRE XVE]IGXSVME IR ½RER^EW GSVTSVEXMZEW y banca de inversión que de otro modo hubiera sido prácticamente imposible. ¿En qué consiste el trabajo que deWEVVSPPEIR%VGERS#

Actualmente en el área de mercado de capitales nos dedicamos a aportar soPYGMSRIW HI ½RERGMEGMzR XERXS HIYHE como Equity, a compañías que por su tamaño y trayectoria están en disposición de acceder al mercado de capitales, bien sea a través de la emisión de bonos o mediante su salida a bolsa o ampliación de capital para empresas ya cotizadas. Tenemos un equipo especializado en la originación y estructuración de los productos, al cual yo pertenezco, encargado HIMHIRXM½GEVPEWSTSVXYRMHEHIWKIRIVEV las ideas, establecer la relación con el cliente y estructurar el producto concreto para cada compañía. Adicionalmente, contamos con una mesa de mercado especializada en bonos high yield español que adicionalmente actúa como bookrunner en las operaciones de primario que generamos desde el área de estructuración. ¿Qué consejo le daría a alguien que UYMIVEWIKYMVJSVQjRHSWIIR½RER^EW# ¡(IFIVuE WIV GSRXMRYE PE JSVQEGMzRIRIWXIWIGXSV#

Alguien que quiera desarrollar su carreVE IR IP jQFMXS HI PEW ½RER^EW RS XMIRI más remedio que buscar aquella formación que mejor le posicione en relación al objetivo que quiera conseguir. Por ello, siendo una decisión tan importante, es muy relevante dedicar tiempo a analizar las alternativas formativas que se adapten a sus necesidades. Es un mundo competido, con mucho talento en el mercado tratando de buscar una posición, por lo que cualquier aspecto que te diferencie será un valor añadido que en el futuro te permitirá capitalizar el esfuerzo inicial.

0EW ½RER^EW WSR YR jVIE HI GSRWXERXI evolución y por tanto requiere de una formación continua y un conocimiento profundo de las tendencias del mercado en cada momento. Por suerte tenemos la oportunidad de acceder a los numerosos cursos y seminarios que el IEB imparte a lo largo del año y que te permiten estar actualizado sobre muchos asuntos relaGMSREHSW GSR PSW QIVGEHSW ½RERGMIVSW que son actualidad en cada momento. ¡7MKYI IR GSRXEGXS GSR PSW GSQTEyIVSWHIWYTVSQSGMzR#

¡Todo lo posible! Después de un año y medio trabajando juntos codo a codo, aprendiendo unos de otros y apoyándo-

nos mutuamente es natural que se hagan buenas amistades. Particularmente, tuve la suerte de caer en una promoción fantástica en la que había muy buen ambiente, mucho compañerismo y poca competitividad entre nosotros, primando más en todo momento las ganas de ayudar a tu colega de al lado. Es uno de los aspectos que más valoro de mi paso por el IEB, la calidad del capital humano que me encontré, no solo en las clases, sino también en los profesores y el personal que, día a día, estaban a disposición para ayudarte con cualquier cosa que necesitaras. ¿Cree que su paso por el IEB le ha WYTYIWXS YR IRVMUYIGMQMIRXS E RMZIPTVSJIWMSREP]LYQERS#

Mi paso por el IEB ha sido a nivel personal un hito muy importante, un eje sobre el que pivotar en muchos sentidos, me ha ayudado a crecer como ser humano y como profesional. Me ha aportado una base de conocimientos muy sólida que, lógicamente, debes apoyar en tu actitud y esfuerzo para que la combinación sea exitosa, pero está claro que me aportó todas las herramientas necesarias para poner en valor capacidades y aspiraciones. ¡'YjPIWWSRWYWE½GMSRIW#

Me gusta viajar, compartir tiempo con familia y amigos, practicar tenis, pádel y deportes de motor. O



Iniciativas del Club de Emprendedores de la Asociación de Antiguos Alumnos del IEB Este proyecto ya cuenta con el apoyo de Foro Fintech, de Spain Fintech Hub, del IEB como partner académico así como de Spain Financial Center.

730-'-89(()-27'6-4'-Ì2 %73'-%'-Ì2%28-+937%091237 Los campos con (*) deben ser rellenados obligatoriamente para poder inscribirse en la Asociación de Antiguos Alumnos.

DATOS PERSONALES *Primer apellido:

Segundo apellido:




Domicilio Población:


Código postal:

*Teléfono de contacto:

Otro teléfono:


Fecha de nacimiento:



*Programa realizado:

*Año académico:



Domicilio Población:


Código postal:




Sector de Empresa:



Experiencia profesional anterior: A los efectos de la Ley Orgánica 15/1995, de 13 de diciembre, de Protección de Datos de Carácter Personal se le informa que los datos obXIRMHSWTSVIWXIJSVQYPEVMSWIVjRMRGPYMHSWIRYR½GLIVSEYXSQEXM^EHS HI HEXSW HI GEVjGXIV TIVWSREP GY]E ½REPMHEH IW WIVZMV E PEW EGXMZMHEHIW propias del IEB y de su Asociación de Antiguos Alumnos. 0SWIRGEVKEHSWHIPXVEXEQMIRXSHIHMGLS½GLIVSWIVjRPSWVIWTSRWEFPIW del Departamento de Orientación Profesional del IEB. El Centro garanXM^E IP INIVGMGMS HI PSW HIVIGLSW HI EGGIWS VIGXM½GEGMzR GERGIPEGMzR ] oposición de los datos facilitados. De igual modo se compromete. en la 44

YXMPM^EGMzRHIPSWHEXSWMRGPYMHSWIRIP½GLIVSEVIWTIXEVWYGSR½HIRGMEPMdad, a no cederlos a terceros distintos de los mencionados en el siguiente TjVVEJS]EYXMPM^EVPSWHIEGYIVHSGSRPE½REPMHEHHIPQMWQS Remitiendo la información solicitada, el interesado consiente expresamente la cesión de sus datos a otros alumnos o antiguos del IEB, a sus profesores y colaboradores, a su Asociación de Antiguos Alumnos, a las empresas pertenecientes al Grupo y a otras empresas o despachos, españoles o extranjeros, para el desarrollo de las actividades propias de la Asociación y las del Departamento de Orientación Profesional.

Nace la Asociación Española de Fintech e Insurtech Apenas ha iniciado su andadura y ya tiene el respaldo de más de 50 compañías españolas de sector. El objetivo de la Asociación será crear un entorno favorable para el desarrollo de Startups y empresas Fintech e Insurtech en España, realizando labores de interlocución, comunicación y colaboración con los organismos y agentes relevantes del sistema para fortalecer su crecimiento y su ecosistema. Para ello, además, se crearán grupos verticales en los que habrá coordinadores especializados que representen al resto de compañías de la Asociación. También, se creará un área de investigación para la elaboración de proyectos que faciliten la dinamización del sector y permita compartir las buenas prácticas de la industria. Entre las compañías que apoyan esta Asociación destacan: Accurate Advisors, Afterbanks, Ahorro.net, Asesora.com, Axon Partners Group, Bankimia, Becash, besepa, bewa7er, bit2me, Bolsa.com, La Bolsa Social, Captio.com, Clluc, Darwinex, Dinube, Ebury, Eurobits, Feel Capital, Fibanx.com, Finametrix, Fintonic, Gocardless, Grow.ly, Housers, Iahorro, iAsesoria, Impok, Inbonis, Indexa Capital, IQapla, Kotraders, Kuarix, MyTripleA, Paga+Tarde, Pagantis, Patrimony, Qubitia, Quebueno, Rastreator, Segurosmedicos.com, Sersan Sistemas, SetPay, Socios Inversores, Spotcap, Strands, TECHNOactivity, TechRules, The Crowd Angel, Tradertw.it, Unience, Vdos, Web Financial Group, Wiquot y Zank. A nivel internacional, la Asociación está cerrando varias alianzas estratégicas con otras Asociaciones Fintech de referencia, entre las que cabría destacar la Asociación Mexicana de Fintech “Fintech México” que ha mostrado todo su apoyo.

A nivel nacional, cabe destacar las alianzas con la aceleradora Blockchain Space, inaugurada el pasado 18 de febrero. Entre las actividades de las asociadas conviene señalar: • Brokers: Social Trading, Microtrading. • Ahorros/Asesoramiento: Wealth Management, Robo Advisors, Trading Algorítmico, Depósitos. • Lending y crédito: Crowdlending, Lending Marketplace, p2p lending, Factoring, DeuHEW'SR½VQMRK7GSVMRK • Crowd Equity: Crowfunding de proyectos, Marketplaces. • Inmobiliario: Crowdfunding Inmobiliario, Property Crowdfunding. • Finanzas Personales: Personal Financial Management. • Pagos: Plataformas de pagos, Comercio electrónico, Pagos periódicos, Tarjetas de crédito.

• Divisas: Cambio de Divisa, Transferencias internacionales. • Blockchain/Bitcoin: Infraestructura, Bitcoin, Digital Assets. ˆ (MWXVMFYGMzR HI TVSHYGXSW ½RERGMIVSW Bancos 2.0, Comparadores. • Gestorías/Contabilidad: Software ContaFMPMHEH*EGXYVEW+IWXMzR½RERGMIVE • Infraestructura Financiera: Api Bancaria, Datos Usuarios, Tecnología. • Insurtech: p2p Insurance, Comparadores. Además, se ha habilitado un link para que las Fintech y las Insurtech españolas puedan darse de alta en la Asociación de forma online. Por último, se va a crear un registro detallado de las mismas que se actualizará de forma recurrente. La Asociación, y sus principales líneas de actuación, fue presentada a la Junta Directiva el pasado 2 de marzo en el IEB. O 45





Licenciada en Derecho y Master en Bolsa y Mercados Financieros, Lara comenzó sus prácticas en la Gestoría de Bankinter a través de Indra, en el departamento hipotecario realizando estudios de viabilidad de préstamos hipotecarios y, aunque le ofrecieron renovar las prácticas, Copernicus Servicing le concedió la oportunidad de incorporarse con ellos como abogada Junior al reunir su formación EGEHqQMGEPIKEP]½RERGMIVEPEGSQFMREGMzRTIVJIGXETEVEIPHuEE día en la gestión legal de activos distressed.



'LUHFWRUGH*UDQGHV&XHQWDV GHO'HXWVFKH%DQN Licenciado en Economía por la Universidad Autónoma de Madrid, tras 12 años desarrollando su carrera profesional en Bankinter en Banca Corporativa, en 2014 Pablo decidió realizar un Programa de Especialización en Análisis del Riesgo de Crédito en el IEB, lo cual le supuso dar un salto de calidad al análisis de las propuestas y reuniones con los clientes, así como un master de inglés ejecutivo. Hace un año llegó a Deutsche Bank a banca de empresas, negocio al que siempre ha estado ligado y con una visión de crecimiento profesional futuro.

Pablo Jiménez apostó por la IRUPDFLyQHQHO IEB para ampliar VXVRSFLRQHVGH futuro.


José Carlos Morón preparó VX&HULÀFDFLyQ EFA en el IEB.


Es licenciado en ADE en la UAM con beca Erasmus en la Dublin City 9RMZIVWMX]3FXYZSPE'IVXM½GEGMzR)*%XVEWJSVQEVWIIRIP-)&]EGXYEPmente prepara en Londres el CFA nivel 2. Ha sido analista de Fondos de Inversión en Santander Private Banking, UBS Junior en Portfolio Management, y accedió a un programa de graduados en el Banco de Espana, dentro de las áreas de Control y Contabilidad. La siguiente etapa de José Carlos fue en Consultoría Estratégica en Everis como analista de negocio, hasta que surgió la oportunidad de trabajar en Londres, en Allfunds Bank, en el área de Investment Research y después en el grupo Informa Business Intelligence. 47

FORO Por Domingo Morales, MRICS Miembro de la Royal Institution of Chartered Surveyors Alumno del Programa Avanzado de ValoraciĂłn de Empresas





n@ investigacio



ecuerdo los primeros días en mi primer trabajo. Una empresa de alquiler y venta de maquinaria de construcción. Estaba algo desorientado. A esta desorientación (supongo que mås o menos normal en muchos de nosotros) contribuía especialmente la jerga que utilizaban tanto mis compaùeros como los clientes. De poco me servían los nombres tÊcnicos que había aprendido durante la carrera (Arquitectura). Ahora me encontraba ante la realidad (en la obra) frente a una serie de elementos que recibían nombres curiosos (ranas, cangrejos, pico-patos, plumas, etc.). Si quería sobrevivir, debía adaptarme råpidamente y casi olvidarme los tecnicismos que, mås bien, distanciaban. El uso de la jerga me acercaba a los demås. Al cabo de tres aùos, dejÊ aquel mundo y me fui al de la vaPSVEGMzR= qWXI QI PPIZz EP HI PSW QIVGEHSW ½RERGMIVSW= YR día oí algo acerca de toros y osos (bull market y bear market). Supongo que mantenía sin saberlo la antena encendida. Otra jerga. Entonces pensÊ que habría mås animales en este mundo. =IQTIGqPEFWUYIHE*YMEPEGE^EHIQMWERMQEPIW½RERGMIVSW Comenzando con los ya citados, (aunque sólo sea porque fueron los primeros que encontrÊ). Hay que citarlos juntos pues ambos describen, bien la tendencia alcista (el toro), bien la tendencia bajista (el oso) del mercado. Pero realmente, ¿quÊ los relaciona? Pues cómo atacan, o se de½IRHIR WIKRWIQMVI )PXSVSIQFMWXIWMIQTVI de abajo arriba (lÊase mercado alcista), y el oso ataca con su zarpa de arriba abajo (mercado bajista). Que se lo digan al protagonista de la reciente película El Renacido. Fåcil de recordar y muy ilustrativo, ¿no? Es famoso el toro de Wall Street (mucha gente se acerca para JSXSKVE½EVWINYRXSEqP ]¹XSGEVPS² ]WMWI½NERIWXjIRHMWTSWMción de embestir (de abajo arriba, de iniciar una etapa alcista supongo). Pekín tambiÊn tiene su correspondiente toro. Pero Êste no estå solo. El toro de Pekín estå, directamente, aplastando al oso. Allí parece que no quieren oír hablar de mercados bajistas. ¥5Yq SXVSW ERMQEPIW ½RERGMIVSW LE] IR YR QIVGEHS EPGMWXE S bajista? Tras un periodo alcista podemos encontrar tres movi-

mientos que por sus características nos indican el inicio de un TIVMSHS FENMWXE 7M MHIRXM½GEQSW TSV PSW LEVEQMW  XVIW QSvimientos del mercado que sean repetitivos en el tiempo, de cadencia similar, de similares características, estamos ante los tres cuervos negros, indicador del inicio de un periodo bajista. =EPVIZqWWMMHIRXM½GEQSWXVIWLEVEQMWHIWTYqW de un periodo bajista, similares, estamos ante el inicio de un periodo alcista, son los tres soldados blancos. Puede decirse que tres cuervos negros y tres soldados blancos son antónimos en los QIVGEHSW½RERGMIVSW Envidio el dominio que tiene la prensa especializada en el mundo del toro. Me gusta el lenguaje. Creo sinceramente que la jerga nos ayuda a entendernos, que nos acerca. Que transmitimos mejor. Si hay ocasión, en próximos números estarÊ encantado de haFPEVHISXVSWERMQEPIW½RERGMIVSWHIRXVSHIIWXEGYVMSWENIVKE Mientras tanto, ¥buena caza! O



Harami: El alcista es una pauta de anĂĄlisis tĂŠcnico que implica el giro alcista. El bajista (bearish harami) es la pauta contraria.

FORO Por Omar Famhy Senior Investment Analyst en Sudáfrica Master in International Finance del IEB






n@ investigacio

Facts about Africa: 54 countries 30.2mn km2 (3x Europe) 15% of world population (1.2bn) 40% of world gold reserves 90% of world platinum reserves 8% of world oil reserves >5% GDP growth in 2014 4 countries in OPEC 7 African nations enerally speaking, whenever we mention Africa, the run banks with world-class amongst the 10 ½VWXXLMRKXLEXGSQIWXSQMRHMWTSZIVX]GSVVYTmanagement trading at less fastest growing XMSR JEQMRI HMWIEWIW TSPMXMGEP MRWXEFMPMX] GSR¾MGXW than 0.4x their price-to-book economies in and civil wars, etc… Similarly, whenever we speak about investvalues while those banks are the world QIRXMR%JVMGEXLI½VWXXLMRKXLEXTISTPIVIPEXIXSMWYWYEPP]ZIV] comfortably meeting their between LMKLVMWOFIMXXLVSYKLLMKLMR¾EXMSRPIZIPWLMKLGYVVIRG]ZSPEXMPMX] cost of equity and maintain 2010 and high transaction costs, etc… capital adequacy ratios (CAR) 2015 Those perceptions lack depth and present an inaccurate underhigher than 18% on average4 standing of the reality of investing in Africa. way above the average for EuropeThe problem with most of the African countries historically has been an banks for instance.The reader should the misallocation of the resources and the mismanagement by the keep in mind that a company that is generating a return on equity governments. However, that has remarkably changed over the last equal to its cost of equity should be trading at its book value (ie: 1x 2 decades, as profound macroeconomic reforms have been taken, BV). In other words, it is fairly rational to expect a potential gain of which ensured consistent improvement in the economies of the Af150% on the investment5 when those banks re-rate to trade at their rican nations. For instance, external debt as percentage of GDP has book value. For many investors, this might seem too good to be decreased from 60.7% in 1998 to 22% as at 20131.That compares to true, but the matter of fact is the short-term pressure on the stock Spain’s 94% (net external debt) for instance2-R¾EXMSRLEWHIGVIEWIH markets created by noise and short-term oriented investors create for many countries from high double digits to single digits over the such opportunities. If we stretch the previous example a bit further same time period. Another misperception about investment in Afriand assume that the initial investment was done in EUR currency ca is that the economies in the continent are entirely reliant on the and that the Nigerian Naira depreciates by 30% for example over resources sector, which is factually incorrect. It is worth noting that the investment period, that leaves the investor with a gain of 120% the contribution of the resources industry has seen its share of the in EUR terms6. total GDP shrink over the years with the mining sector representing 0EWXP]MRZIWXMRKMR%JVMGETVSZMHIWMRZIWXSVW[MXLXLIFIRI½XSJHMZIV15% or less of the total GDP on average for most of the countries3 WM½GEXMSR KMZIR XLI PS[GSVVIPEXMSR [MXL SXLIV EWWIX GPEWWIW [LMGL (and for all of the biggest economies in Africa).There is undeniably a leaves investors with a decent cushion against future declines in the negative impact on net exporters from the lower commodity prices developed markets’ indexes. O that the world has seen over the last year; however, the impact is PEVKIP]PMQMXIHKMZIRXLIHMZIVWM½IHREXYVISJXLIXLSWIIGSRSQMIW 1 IMF 8LEXXEOIWYWXSXLIRI\XUYIWXMSR GER[I½RHGSQTIPPMRKMRZIWX2 Eurostat: Net external debt - quarterly data, % of GDP 3 ment opportunities in Africa? World Bank 4 According to Basel II standard. There are very attractive investment opportunities in Africa that 5 is no capital gain tax in Nigeria EVIZIV]HMJ½GYPXXS½RHER][LIVIIPWIMRXLI[SVPH -J[IPSSOEX 6 There Euro depreciated by 10% against the USD during in 2015 and by ~22% since 2014, GSQQIVGMEP FEROW MR 2MKIVME JSV I\EQTPI [I GER ½RH ZIV] [IPP making it more volatile than many of the African currencies.



FORO DEPORTE Por Ă lvaro Barcala EsplĂĄ 2Âş curso de los estudios para la Doble TitulaciĂłn



Julia ha formado parte del 'IRXVS HI8IGRM½GEGMzR HI PE FederaciĂłn Andaluza de Golf y del equipo de golf SIGA (Sotogrande International Golf Academy). â&#x20AC;&#x153;Con 14 aĂąos era handicap 1 y fui ganadora del Campeonato Abierto de Sotogrande (mi mayor satisfacciĂłn al ser mi club)â&#x20AC;?. Participar en cientos de campeonatos puntuables tanto en el ranking andaluz, como en el nacional, le ha supuesto una gran disciplina personal. â&#x20AC;&#x153;El golf es un deporte de enorme esfuerzo, que me ha enseĂąado a ser trabajadora y constante. Saber que uno puede conseguir lo que quiera poco a poco, pero trabajando duro. AdemĂĄs te enseĂąa a ser leal, honesto, tener buen ĂĄnimo siempre, a pesar de haber dado el peor golpe del mundo... (no es tan fĂĄcil como parece); ese autocontrol se


convierte en una lecciĂłn para tu vida. Lo llaman â&#x20AC;&#x153;el deporte de la humildadâ&#x20AC;?, pero te enseĂąa a levantarte siempre despuĂŠs de un fracaso. He vivido experiencias muy buenas viajando en un ambiente sano de compaĂąerismo y de gente deportista. He tenido la oportunidad de competir con chicas que en la actualidad se dedican profesionalmente a este deporte y ocupan la ĂŠlite del golf europeo. Espero poder formar parte del equipo nacional algĂşn dĂ­a, puesto que ahora me dedico por completo a mis estudios universitarios y me es imposible dedicarle mĂĄs tiempo y defender un alto nivel de golf. Lo mejor de todo es que voy a seguir disfrutando de ĂŠl muchos aĂąos mĂĄs, porque el golf es un deporte para toda la vida.â&#x20AC;? O Julia AndrĂŠs Landaluce

Julia jugando en el Real Club de Golf de Sotogrande.

En la foto, Gonzalo Moreno, Felipe Leiva, RamĂłn GonzĂĄlez, Javier Ilardia, JosĂŠ Antonio Gallardo, Luis de Jove, JesĂşs Eduardo Vera y Javier Sada.


Campeonato IEB El pasado mes de enero, el IEB organizĂł un campeonato de fĂştbol 7 en Centro Deportivo de la Chopera, del madrileĂąo Parque del Retiro. Lo peculiar y divertido del campeonato fue que, tanto alumnos de la Doble TitulaciĂłn como miembros del staff del IEB, tuvieron tiempo para demostrar sus dotes futbolĂ­sticas. Compitieron cuatro equipos, uno formado por miembros del staff del IEB, otros

dos compuestos por alumnos de AdministraciĂłn y DirecciĂłn de Empresas y el cuarto estaba formado por alumnos de Derecho. Sin entrar en detalles (el resultado es lo de menos â&#x20AC;&#x201C;consuelo para el equipo staff IEB, que no ganĂł ningĂşn partidoâ&#x20AC;&#x201C;), los participantes pasaron una agradable tarde y, tras el encuentro, pudieron disfrutar de unos refrescos, mientras debatĂ­an y comentaban los lances de la contienda. O


IEB COOPERA Los programas de ayuda a los mĂĄs necesitados y la colaboraciĂłn activa del Centro de Estudios

X EdiciĂłn de IEB Solidario


De caråcter anual, IEB Solidario se enmarca dentro de la Responsabilidad Social Corporativa del Centro de Estudios, que tiene GSQS½REPMHEHMQTYPWEVIPIWTuVMXYHIGSQpromiso y voluntariado de sus alumnos hacia acciones promovidas por Fundaciones y ONGs, en el entorno económico actual. Han participado: Cooperación Internacional, Caritas, Asociación Espaùola Contra el Cåncer, Sauce, Prójimo Próximo, Fundación 7uRHVSQI(S[RHI1EHVMH7SyEV(IWTMIVXS *YRHEGMzR 1ERSPS 1EIWXVI *YRHEGMzR del Valle, Fundación Promoción Social de la Cultura, Turkana, Fundación Lo Que De Verdad Importa, Fundación Infancia, AsociaGMzR%OE½ ,SWTMXEPMHEHHI0SYVHIW (S[R )WTEyE 7SyEV (IWTMIVXS *YRHEGMzR 1ERSPS 1EIWXVI *YRHEGMzR )QEPEMOEX *YRHE54

GMzR 1EHVMRE *YRHEGMzR ,YQEREI 1ERSW 9RMHEW]PE'SQYRMHEHHI1EHVMHEXVEZqW de la SubdirecciĂłn General de Voluntariado, CooperaciĂłn Internacional y RSC.

(O,(%DSR\DHOVHFWRU IXQGDFLRQDOGHVGH HOiPELWRGHODIRUPDFLyQ \OD56& %RE1SVIRS.IJIHI)WXYHMSW]VIWTSRWEFPI de IEB Solidario, ha destacado â&#x20AC;&#x153;la solidaridad hoy en dĂ­a tambiĂŠn puede considerarse un componente reputacional para las empresas. Muchas de ellas canalizan a travĂŠs de sus Fundaciones, un patrimonio que se invierte en

fomento del conocimiento y en investigaciĂłn. En Estados Unidos, por ejemplo, el sector fundacional es pionero en ello. Las Fundaciones impulsan la investigaciĂłn a travĂŠs de las universidades, y es un sector muy consolidado con inversiones sĂłlidas que contribuyen al crecimiento UQUVGPKDNGFGNCUQEKGFCF'UVCĹżPCNKFCFFGDGrĂ­a perseguirse tambiĂŠn en Europa, y nosotros pretendemos poner un granito de arena como instituciĂłn de formaciĂłn y contribuir a que nuestros estudiantes y antiguos alumnos, desde sus ĂĄmbitos profesionales, se impliquen en elloâ&#x20AC;?. 'SRIWXEMRMGMEXMZE IP-)&UYMIVIWIVYRZuRculo de integraciĂłn de los alumnos con la labor social, mĂĄs allĂĄ de su paso por el Centro de Estudios, que aprendan cĂłmo hacer TIVHYVEV PSW ½RIW WSGMEPIW JYRHEGMSREPIW LEGMEKIRIVEGMSRIWJYXYVEW 1SVIRSI\TPMGE

Ana Moreno Giraldo, Jefe de Estudios del IEB, es la responsable de IEB Solidario. Ignacio MuĂąoz a su izquierda es Coordinador del MBA con EspecializaciĂłn en Finanzas del IEB, y a su derecha estĂĄ Conrado GimĂŠnez, Presidente de la FundaciĂłn Madrina.

â&#x20AC;&#x153;implicamos a los alumnos en este tipo de actividades sociales desde su paso por Grado a Postgrado y de allĂ­ a la empresa. La responsabilidad social es una asignatura pendiente que se debe fomentar desde el ĂĄmbito educativoâ&#x20AC;?. 1EVMWE )PSWYE 'SSVHMREHSVE HIP (ITEVXEmento de Empresas y Relaciones InstituGMSREPIWHI1ERSW9RMHEWLEHIWXEGEHSPE importancia de â&#x20AC;&#x153;acercar a los estudiantes a la realidad de la pobreza, que se sensibilicen con los desfavorecidos mĂĄs allĂĄ de su entorno. Con la crisis de los refugiados atendemos a colectivos de Siria e Irak en Jordania, y contarlo nos mueve a participar en el IEB Solidarioâ&#x20AC;?. 1EVuE4E^7ER^1EVXuRI^ GSSVHMREHSVEHI voluntariado de La AsociaciĂłn EspaĂąola Contra el CĂĄncer, comenta que â&#x20AC;&#x153;ademĂĄs de voluntad se necesita carĂĄcter ya que al

tratarse del apoyo de los jĂłvenes a niĂąos se requiere formaciĂłn bĂĄsica de voluntariado que les permita desarrollar bien ese apoyo UQEKCN&GUFG+'$5QNKFCTKQDWUECOQURGTĹżNGU de voluntarios que nos ayuden a mejorar la calidad de vida de las personasâ&#x20AC;?. (IWHI PE 'SQYRMHEH HI 1EHVMH HIWXEGER que â&#x20AC;&#x153;participamos en este tipo de iniciativas para dar visibilidad a las empresas y particulares que fomentan el voluntariado. Y servimos de plataforma de encuentro entre las fundaciones para ayudarlas a establecer redes de colaboraciĂłn y que sigan creciendoâ&#x20AC;?. Desde el IEB queremos agradecer su labor a todas aquellas personas que de una maRIVEERzRMQEHIHMGERWYHuEEHuEEPYGLEV contra la desigualdad y por los mĂĄs desfavorecidos de nuestra sociedad. O 55



LIBROS RECOMENDADOS Secciรณn elaborada por:

/XLV0DUtD&D]RUOD3ULHWR Secretario General del Consejo de Administraciรณn de Bolsas y Mercados Espaรฑoles, y Director del Programa de Derecho de los Mercados Financieros del IEB, nos presenta su libro

/DpWLFDHQHOGHUHFKRGHORVPHUFDGRVILQDQFLHURV El libro del Catedrรกtico, Acadรฉmico de la Real Academia de Jurisprudencia y Legislaciรณn y Secretario General de Bolsas y Mercados Espaรฑoles, constituye un ensayo sobre lo que WMKRMยฝGE PE qXMGE TEVE PSW MRXIVZMRMIRXIW IR PSW QIVGEHSW ยฝRERGMIVSW PEW VIKPEW IR PEW UYI WI I HMZIVWMยฝGE ] WY MRGSVTSVEGMzR E TVIGITXSW NYVuVuu dicos, que regulan, entre otros muchos aspectos, os, cuรกles deben ser las normas de conducta, las nororr mas antiabuso de mercado y la responsabilidad dad WSGMEPGSVTSVEXMZE )RXVIPEWTVMRGMTEPIWGEVEGXIVuWXMGEWHIIWXIVIGMIRXI MIRXI libro, cuyo prรณlogo ha escrito el conocido econoconomista Juan Velarde Fuertes, podemos destacar ar que se trata de un estudio original del alcance actual tual de la รฉtica en las sociedades mercantiles, principalmente almente













A CORUร‘A AVIR G.YER*PzVI^   ยˆ BARCELONA GARBร :uE%YKYWXE   ยˆ GARBร UIC c/ Inmaculada, 22







- ยˆ





Iglesia medieval de Ă&#x2DC;sterlars.

ImĂĄgenes: Creative Commons/Flickr




Ronne es la capital de la isla de Bornholm, de 589 kms2 (el tamaĂąo de Ibiza) y tiene 14.000 habitantes censados.

ara los investigadores Erling Haagen-sen y Henry Lincoln, esta isla de soberanĂ­a danesa, situada 200 kms al este de Copenhague, podrĂ­a muy bien ser el lugar donde los Caballeros Templarios escondiesen algunos de los tesoros encontrados bajo las ruinas del Templo de SalomĂłn, en JerusalĂŠn, cuya custodia les fue encomendada en el siglo XII. En 1162 el obispo danĂŠs Eskil viajĂł a Francia para visitar al Gran Maestre de aquella orden, Bertrand de Blanchefort; y se cree que en tal circunstancia habrĂ­a surgido la idea de esconder en esta tranquila isla bĂĄltica algunas de las piezas mĂĄs valiosas del tesoro del Temple, como el Arca de la Alianza o el Santo Grialâ&#x20AC;Ś Verdad o no, lo cierto es que esta isla (a menos de una hora en aviĂłn desde Copen-


hague, y a 5,5 h, en ferry) reviste unos atractivos realmente cautivadores: bosques de hayas, pinos, robles y abetos que recubren su porciĂłn central, y que se pueden recorrer en bicicleta a travĂŠs de una preciosa cicloruta â&#x20AC;&#x2DC;de interĂŠs paisajĂ­sticoâ&#x20AC;&#x2122;. En su extremo sur, se extiende la fantĂĄstica playa de arena de Duoadde como principal atracciĂłn. En cuanto a su promontorio de Hammeren, en el opuesto extremo noroeste, alberga los mejores itinerarios de trekking insular EP ½PS HI YRSW IWTIGXEGYPEVIW EGERXMPEHSW uno de ellos hasta el faro mĂĄs alto de toda Dinamarca. Y ademĂĄs, estĂĄn los molinos de viento tradicionales de Egeby y Aarsdale, en Svaneke; el pequeĂąo archipiĂŠlago satĂŠlite de Erthomene, con su fortaleza naval centenaria y sus reservas ornitolĂłgicas; o tranquilos

/DDUHQDGHHVWDSOD\DHVWDQĂ&#x20AC;QDTXH se utiliza para los relojes de arena.

Molino de viento de 8 lados (1877), en Aarsdale.

Es dĂ­a de mercado en Aakirkeby.

Faro de Hammeren.

Ruinas del Castillo Hammershus.

pueblos rurales como Aakirkeby; o las singulares iglesias medievales de planta redonda, las rundkirker (como la de Iglesia Ă&#x2DC;sterlars) que constituyen precisamente las claves en las que se fundamenta la teorĂ­a de que Bornholm es la isla secreta de los Templarios. Lo cierto es que la importancia estratĂŠgica de esta isla (posible patria original de la tribu germĂĄnica de los Burgundios) ha sido relevante a lo largo de la Historia, como lo demuestran las imponentes ruinas de Hammershus, la mayor fortaleza medieval del norte de Europa. Un bastiĂłn codiciado por suecos y coaligados hanseĂĄticos, que en la Segunda Guerra Mundial sirviĂł de base EIVSREZEP]VEHMSXIPIKVj½GETEVEIPVqKMQIR nazi, lo que motivĂł al cabo un feroz bombardeo soviĂŠtico sobre la isla justo en los Ăşltimos dĂ­as de aquella contienda. Pero hoy, Bornholm es sobre todo, una concurrida fortaleza turĂ­stica en tiempos de verano, famosa entre artistas y pintores, renombrada por sus fĂĄbricas artesanas de cristal y cerĂĄmica, cuyos pescados ahumados y quesos azules son recomendados por los principales chefs escandinavos. Y cuyo restaurante Nordborholms Rogeri, en la localidad de Sandvik, constituye un hito gastronĂłmico imprescindible: con su preciosa terraza volada sobre el mar que hace de ella, algo asĂ­, como ese famoso CafĂŠ del Sol de Sant Antony de Portmany: solo que en Bornholm, Islas Aran esa especie de Ibiza nĂłrdicaâ&#x20AC;Ś O 59




llå por el otoùo de 1547, en Alcalå de Henares, cuarto de los siete hijos de Rodrigo y Leonor, nació Don Miguel de Cervantes y Saavedra, quien se convertiría en una referencia literaria mundial. Son muchas las teorías generadas en torno a la vida de este singular escritor, incluso existen dudas sobre si su aspecto es el que estamos acostumbrados a ver en retratos. Su vida fue una sucesiva serie de infortunios, cautiverio, cårcel, afrenta pública.... No tenía rentas y no era ducho en el trato con los mecenas. La mala fortuna lo acompaùó durante toda su vida.Tan solo el Êxito de las dos partes del Quijote le proporcionó cierto reconocimiento, aunque sin superar las penurias económicas. A pesar de su precaria situación económica, Rodrigo se preocupaba por la educación de sus hijos y en 1555, ingresa a Miguel en el colegio de los jesuitas de Córdoba. Un aùo mås tarde, parten hacia Sevilla GSR IP ½R HI TVSWTIVEV TYIW IWXE GMYHEH era la puerta de Espaùa a las riquezas de las Indias y la tercera ciudad de Europa, tras París y Nåpoles. Una dÊcada mås tarde, Miguel se ha convertido en un adolescente tímido y tartamudo, que asiste al colegio jesuita y es asiduo espectador de las obras del popular Lope de Rueda. Entonces la familia decide mudarse de nuevo. Esta vez el destino es la pujante villa de Madrid. En 1559, huyendo de la justicia, que tras una reyerta lo ha condenado a la amputación de la mano derecha, llega a los dominios espaùoles en Italia y se alista como soldado en la compaùía de Diego de Urbina. En aquel entonces, el Imperio Otomano y los



paĂ­ses del MediterrĂĄneo luchaban por el control de la tierra y el poder. Finalmente las huestes espaĂąolas vencen a los turcos en la batalla de Lepanto. Esa gloria inmediata marcĂł a Cervantes, que relatarĂĄ las circunstancias de la lucha. en la primera parte del Quijote. Durante dicha batalla recibe tres heridas, una de las cuales, se cree, inutilizĂł para siempre su mano izquierda y le valiĂł el apelativo de â&#x20AC;&#x153;el manco de Lepantoâ&#x20AC;?.

³(OTXHOHHPXFKR\ DQGDPXFKRYHPXFKR \VDEHPXFKR´ Tras unos aùos en Italia, decide mejorar su situación en la milicia con su promoción al grado de capitån, y con esta intención, con HSWGEVXEWHIVIGSQIRHEGMzRUYIGIVXM½GER su valiente actuación en la batalla de Lepanto, y con su hermano Rodrigo, el 20 de septiembre de 1575 emprende su regreso a la patria, pero el viaje se convierte en el principio de una desafortunada y larga peripecia. Su goleta es abordada por tres corsarios berberiscos al mando de Arnaute Mamí, un albanÊs renegado, y los hermanos Cervantes caen prisioneros. Mamí, al ver las cartas, cree hallarse ante una persona principal y convierte a Miguel en su esclavo, apartado del canje de prisioneros, lo que sumado a su mano lisiada, le evitarå las galeras. Durante su prolongado cautiverio, Cervantes protagoniza cuatro aciagos intentos de fuga, hasta que el 19 de septiembre de 1580, y tras abonar 465 ducados, es liberado, y regresa a Espaùa. Tenía 33 aùos. Al volver renuncia a la carrera militar, y se entusiasma con las perspectivas de prosperidad de los funcionarios de Indias. Intenta obtener un puesto en AmÊrica, pero fracasa. Mientras, es padre de una niùa fruto de sus relaciones clandestinas con una joven casada, Ana de Villafranca (o Ana de Rojas). Dos aùos despuÊs, contrae matrimonio con la joven Catalina de Salazar y Palacios, de Esquivias, pueblo campesino de La Mancha. Meses antes, el escritor ya había acabado su primera obra importante, La Galatea, una

novela pastoril, por cuyo manuscrito recibió 1.336 reales. Esta cifra nada despreciable y la buena acogida y el relativo éxito del libro le animan a dedicarse a escribir comedias, pero es vencido por el nuevo y refrescante Lope de Vega, dueño absoluto de la escena española y deja de escribir comedias, activiHEHUYIVIXSQEVjEP½RHIWYWHuEW %YRUYIIRXVI]½NEWYVIWMHIRcia en Esquivias, suele visitar Madrid; donde alterna con los escritores de su tiempo, lee sus obras y mantiene una permanente querella con Lope de Vega. En 1587 ingresa en la Academia Imitatoria, primer círculo literario madrileño, y ese mismo año lo designan comisario real de abastos (recaudador de especies) para la Armada Invencible. Tampoco esto le sale bien: se enfrenta con la Iglesia y es excomulgado; lo encarcelan, acusado de vender parte del trigo requisado. Al morir su madre en 1594, abandona Andalucía y regresa a Madrid, donde siguen las penurias económicas: nombrado recaudador de impuestos, quiebra el banquero a quien había entregado importantes sumas y Cervantes pasa cinco meses en la prisión. A principios de 1605, aparece en Madrid El ingenioso hidalgo don Quijote de La Mancha, GY]S¾EGSEYXSV]ELEGYQTPMHSPSW años, es tolerante con su turbulenta familia, TSGSLjFMPTEVEKEREVHMRIVS¾SNSIRXMIQpos de paz y aguerrido en la guerra.

La fama fue inmediata, mas no así los efectos económicos. Mientras Don Quijote y Sancho ya pertenecían al acervo popular, su Cervantes seguía pasando estrecheces. Animado por el Êxito de la obra, en 1609 ingresa en la Cofradía de Esclavos del Santísimo Sacramento, a la que pertenecen Lope de Vega y Francisco de Quevedo, En EUYIP QMWQS EyS WI ½VQE IP HIGVIXS HI expulsión de los moriscos, cosa que Êl celebra, y se acentúa el endurecimiento de la vida social espaùola, sometida al rigor inquisitorial. Son aùos de redacción de testamentos y sórdidas contiendas familiares.

Âł/DSOXPDHVODOHQJXD GHODOPD´ Cervantes escribe a un ritmo imparable: las Novelas ejemplares, en 1613 y el Viaje al Parnaso, en verso, en 1614. Ese mismo aĂąo aparece en Tarragona, un tal Avellaneda, que se proclama autor de la autĂŠntica continuaciĂłn de las aventuras del hidalgo. AsĂ­, que enfermo y urgido, y mientras prepara la publicaciĂłn de las Ocho comedias y ocho entremeses nuevos acaba la genuina segunda parte del Quijote, que se imprimirĂ­a en el curso del mismo aĂąo. Dos aĂąos despuĂŠs ya estĂĄ terminando una novela de aventuras en estilo bizantino: Los trabajos de Persiles y Sigismunda. El 19 de abril recibe la extremaunciĂłn y el 20 redacta una dedicatoria para su mecenas el conde de Lemos: â&#x20AC;&#x153;Ayer me dieron la extremaunciĂłn y hoy escribo ĂŠsta; el tiempo es breve, las ansias crecen, las esperanzas menguan y, con todo esto, llevo la vida sobre el deseo que tengo de vivir...â&#x20AC;?. Dos dĂ­as despuĂŠs, envuelto en su hĂĄbito franciscano, Don Miguel de Cervantes y Saavedra fallece en su casa de Madrid, asistido por su esposa y una sobrina. De esto hace 400 aĂąos y con motivo de ello, son innumerables los actos y celebraciones que se suceden no solo en EspaĂąa sino en el mundo entero, ya que este autor de vida desafortunada nos regalĂł una de las mejores obras literarias que jamĂĄs se han escrito. O 61


2015 2016















11 62








11 12
























































































Comienza el

Ceremonia de clausura


1 8










El Museo del Prado inaugura


Inicio del






Arranacan las


Comienzan los


Inicio del




Comienza la gira de Alejandro Sanz

6LURSHYLYR en Barcelona

Terminan los


Profile for IEB Spain

IEB Magazine 21  

IEB Magazine 21  

Profile for ieb_spain