Page 1

RETAIL ENVIRONMENT MAY 2013 - Issue 1

retailenvironment.co.uk

BUSINESS SUSTAINABILITY FOR RETAIL PROFESSIONALS AND SUPPLIERS

Thirsty business: water drips to the core of retail sustainability

NO PREMIUM ON ETHICS – THE CO-OPERATIVE INTERVIEW | COMMUNITY BENEFIT: THE LIVERPOOL ONE STORY | POORAN DESAI COLUMN | SOLAR POWER: THE DARK HORSE | LED: THE FUTURE OF LIGHTING | ANAEROBIC DIGESTION HEATS UP | REVERSED LOGISTICS TURNAROUND | FLEET FUEL EFFICIENCY | JOHN LEWIS RECYCLING CRACKDOWN | SUSTAINABLE TECHNOLOGY SPOTLIGHT


Business sustainability for retail professionals and suppliers

SUBSCRIBE FOR FREE It couldn’t be easier, either: Business sustainability for retail professionals and suppliers To continue receiving your FREE SUBSCRIPTION of Retail Environment please complete all sections of the form below, sign, date and return to the address provided, OR scan and email to retailenvironment@webscribe.co.uk OR visit www.retailenvironment.co.uk to subscribe online. Please note incomplete forms will not be processed. PLEASE COMPLETE IN BLOCK CAPITALS

Post the tear out registration form in this magazine

Name: ________________________________________________________________________________ Job Title : ______________________________________________________________________________ Company: ____________________________________________________________________________ Address : ______________________________________________________________________________ _____________________________________________________________________________________

Freepost Plus RTEC-KUGG-BLJS Webscribe Ltd Unit 8 Brook Street TRING HP23 5EF

Post code: ___________________ Country: __________________________________________________ Telephone: ____________________________________________________________________________ Email: ________________________________________________________________________________ What is your primary job function? † CEO/MD † Operational management † Procurement management † CSR management † Other, please specify _____________________________________ Are you personally responsible for purchasing / recommending / specifying DXWKRULVLQJRULQĂ&#x;XHQFLQJWKHSXUFKDVH of equipment or services for your organisation? † Yes † No

:KLFKFDWHJRU\EHVWÞWV\RXU organisation? †Multiple retailer †Shopping centre †Independent retailer † Industry association †FMCGs provider †Supplier, please specify

FOLD HERE

______________________________________ †Other, please specify ______________________________________ Retail Environment has a controlled circulation, applicants who, in the view of the Publisher, do not qualify, may be invited to take out a paid subscription.

YES, I would like to continue my FREE subscription to RETAIL ENVIRONMENT

Sign below if you would like to continue to receive a regular FREE copy of Retail Environment Signature: ________________________________________________ Date: _________________ †%\SURYLGLQJ\RXUGHWDLOVWRXVLQWKLVIRUP\RXFRQVHQWWREHLQJFRQWDFWHGZLWKUHOHYDQWLQIRUPDWLRQRQR˧HUVSURGXFWVDQG services by Environment Media Group Ltd. Please tick this box if you do not wish to receive this information.

† I have completed and signed the form

Send this card back NOW to continue your FREE subscription to Retail Environment. Please remember to SIGN the form!  01442 820580  retailenvironment@webscribe.co.uk Fax back on 01442 817 167

www.retailenvironment.co.uk

SUBSCRIPTION OPTIONS

Visit our website www.retailenvironment.co.uk and register online

Retail Environment is the new source of industry information, analysis and perspective on sustainability for retail professionals and those supplying services and products in the retail sector.

Published by Environment Media Group, a trusted authority on recycling and environmental matters Retail Environment covers the spectrum of issues shaping retailers’ efforts to make their businesses sustainable.

Subscribe here, or scroll down and take a journey through our content

All material on this website is copyright to the Environment Media Group. 5HJLVWHUHGRIÂżFH6WDWLRQ5RDG%HDFRQVÂżHOG%XFNLQJKDPVKLUH+34/5HJLVWHUHGLQ(QJODQG :DOHV1R

CONTACT US T: 020 7633 4500 E: info@retailenvironment.co.uk

Or call 01442 820 580 and register over the phone

Your subscription includes 11 issues of the magazine per year.

www.retailenvironment.co.uk


FOREWORD

Turning point &KDUORWWH2ZHQ (GLWRU 7HO (PDLOFKDUORWWHR#UHWDLOHQYLURQPHQWFRXN Amy North )HDWXUHVZULWHU 7HO (PDLODP\Q#UHWDLOHQYLURQPHQWFRXN &RQWULEXWRUV Will Date Steve Eminton Katie Johnson 3URGXFWLRQHGLWRU 7HO (PDLONDWLHM#UHWDLOHQYLURQPHQWFRXN Steve Eminton 3XEOLVKLQJGLUHFWRU 7HO (PDLOVWHYHH#UHWDLOHQYLURQPHQWFRXN Rob Mowat &RPPHUFLDOGLUHFWRU 7HO (PDLOUREP#UHWDLOHQYLURQPHQWFRXN 'DQQ\+HQGHUVRQ 6DOHVPDQDJHU 7HO (PDLOGDQQ\K#UHWDLOHQYLURQPHQWFRXN Iona Smith 0DUNHWLQJPDQDJHU 7HO LRQDV#UHWDLOHQYLURQPHQWFRXN Retail Environment is published by: Environment Media Group (OL]DEHWK+RXVH 39 York Road /RQGRQ6(14 ZZZUHWDLOHQYLURQPHQWFRXN Environment Media Group - Registered LQ(QJODQG :DOHV1R 3ULQWHGRQ)6&FHUWLĂžHGSDSHU 3ULQWHGE\+HDGOH\%URWKHUV/LPLWHG ,661

$WWKHĂ&#x17E;QJHUWLSVRIUHWDLOHUVLVDQ RSSRUWXQLW\WRJURZFRPSHWHLQQRYDWH LQĂ&#x;XHQFHDQGUHGXFHWKHLUHQWLUH HQYLURQPHQWDOIRRWSULQWAlready we are seeing this in voracious motion; paths built on traditional linear patterns of business and consumption are steadily being paved over to accommodate circular ones which respect WKHYDOXHRIQDWXUHDQGFUHDWHSURĂ&#x17E;W+DQGOLQJ water as a precious resource; conserving energy and using renewables; sourcing only sustainable â&#x20AC;&#x201C; â&#x20AC;&#x153;goodâ&#x20AC;? â&#x20AC;&#x201C; products; wasting less and producing better packaging are all EHFRPLQJSDUWRIWKLVSURFHVV Yet many still lag behind; long-term WKLQNLQJZLWKRXWVX˨ FLHQWJRYHUQPHQW support perhaps seems unpalatable in the midst of an economic downturn and other key pressures such as the development of e-commerce and surge in commodity SULFHV+RZHYHUWKHWUDQVLWLRQLVVRFRPSHOOLQJWKDWWKRVH\HWWRMXPSRQWKHJUHHQ EDQGZDJRQZLOOVRRQEHOHIWEHKLQG 7KHSD\EDFNZLOOFRPHDQGLQKXJHPHDVXUH$UHSRUWIURPWKH&RQIHGHUDWLRQRI British Industry estimated green growth contributed to at least a third of all growth LQWKH8.HFRQRP\RYHUZKLOH8.VDOHVLQWKHJUHHQHFRQRP\LQFUHDVHG WRzELOOLRQLQDQHVWLPDWHGJOREDOPDUNHWRIzWULOOLRQ7KHVHĂ&#x17E;JXUHVDUH RQO\H[SHFWHGWRULVH There is no escaping the fact that businesses must become entirely sustainable â&#x20AC;&#x201C; FRPPHUFLDOLW\UHVRXUFHDQGIRRGVHFXULW\DQGWKHHQYLURQPHQWKLQJHRQLW7KURXJK MXGLFLRXVFRQWURORILWVRSHUDWLRQVSURGXFWVDQGVXSSO\FKDLQVWKHUHWDLOVHFWRULVLQD NH\SRVLWLRQWRGRMXVWWKLV$QGQRZ With this magazine we hope to take a practical look at the issues concerning the VHFWRUmVURDGWRVXVWDLQDELOLW\2XUPRQWKO\VHFWLRQVRQHQHUJ\UHVRXUFHVGHVLJQDQG ORJLVWLFVZLOOFRYHUWKHODWHVWRSLQLRQSROLF\SLWIDOOVDQGVXFFHVVVWRULHVFRQFHUQLQJ WKHPRVWWRSLFDOVXEMHFWVWRD˧HFWWKHLQGXVWU\ ,KRSH\RXHQMR\UHDGLQJRXUĂ&#x17E;UVWLVVXHRI5HWDLO(QYLURQPHQW <RXUVVLQFHUHO\

6XEVFULSWLRQVLQFOXGHV 11 issues of the magazine per year

&KDUORWWH2ZHQ (GLWRU

MAY 2013 | RETAIL ENVIRONMENT 3


Sparkle that lasts

Philips MASTERColour CDM Evolution. We understand the essence of bringing long-lasting sparkle to fashion. The new Philips MASTERColour CDM Evolution makes your store sparkle for longer than you thought possible. Its 20,000 hour lifetime helps to save on re-lamping. And thanks to the lampâ&#x20AC;&#x2122;s high efficacy, youâ&#x20AC;&#x2122;ll save on energy too. Discover the attraction of crisp, white light with a lower Total Cost of Ownership at www.philips.com/mastercolour


CONTENTS

3 Foreword 7 Column Pooran Desai, Bioregional Co-founder 8 News 12 EU News

Interview 147XUQLQJHWKLFVLQWRSURĂ&#x17E;W&KULV Shearlock, head of sustainability, The Co-operative

Cover story 207KLUVW\EXVLQHVVZDWHUPDQDJHPHQWLQ the retail sector

Spotlight

20

26&RPPXQLW\EHQHĂ&#x17E;WVKRZ/LYHUSRROmV SUHPLHUVKRSSLQJFHQWUH/LYHUSRRO21(LV VHWWLQJWKHEHQFKPDUNIRUVXVWDLQDELOLW\

Energy

48

32(QHUJLVLQJZDVWHDQDHURELFGLJHVWLRQLV KRWWLQJXSFRPPHUFLDOO\ 367KHGDUNKRUVHVRODUSRZHUq WKHMXU\mVRXW

Resources 42 &ORVLQJWKHORRS-RKQ/HZLVmDSSURDFKWR ZDVWHDQGUHF\FOLQJ 457KDWmVDZUDSSDFNDJLQJmVSDUWLQ SUHYHQWLQJIRRGZDVWH

Design 48$EULJKWIXWXUHUROOLQJRXW/('OLJKWLQJ 515HVNHWFKLQJLQWHULRUVVXVWDLQDEOH VKRSĂ&#x17E;WWLQJV

14

Logistics 55)XHOOLQJXSPDNLQJĂ&#x;HHWmVIXHO FRQVXPSWLRQH˨FLHQW 59$JDLQVWWKHWLGHqWKHULVHLQ reverse logistics

Policy 63 A roundup of the latest policies to D˧HFWWKHUHWDLOVHFWRUIURPFOLPDWHFKDQJH adaptation to the Ecodesign Directive

New technology

51

647KHODWHVWJUHHQWHFKQRORJ\RQWKHPDUNHW DQGLQGHYHORSPHQW 66 Letters to the editor

MAY 2013 | RETAIL ENVIRONMENT 5


NEC Showcase NECSolutions SOLUTIONS SHOWCASE TobaccoDock, Dock, London London E1W Tobacco E1W 2SF 2SF th th May 2013 2013 Thursday16 16 May Thursday

Affordable High Performance Digital Signage INTRODUCING THE NEW HIGH BRIGHTNESS LED BACKLIT PUBLIC DISPLAYS The new V series public displays feature the latest display innovations from our design engineers in Japan. These new LED backlit displays deliver high brightness images whilst maximising energy efficiency through the use of high quality Japanese components and ambient light sensing. A robust all metal design and automated temperature management protects your investment. An Intel OPS compliant built-in slot allows you to plug in the latest digital signage player technology available today and in the future. The new slimmer NEC Value Series public displays, built to last.

+44 (0) 870 120 1160

www.nec-displays.co.uk

Copyright 2013 NEC Display Solution Europe GmbH. All rights are reserved in favour of their respective owners. This document is provided “as is” without warranty of any kind whatsoever, either express or implied.


COLUMN: POORAN DESAI

Consuming our way to a better future

Pooran Desai OBE Hon FRIBA is co-founder of entrepreneurial sustainability charity, BioRegional. He has worked in eco-farming, forestry, recycling and green property development, coining the term â&#x20AC;&#x2DC;One Planet Livingâ&#x20AC;&#x2122;. Communities, local authorities and companies, including B&Q, have adopted the One Planet Living framework.

We know it deep down: the future can be one of abundance and one where we harness knowledge, technology and values to improve our lot. If this is to be our future, it will require a revolution in our thinking and patterns of consumption. But the component parts of that revolution including concepts such as â&#x20AC;&#x2DC;collaborative consumptionâ&#x20AC;&#x2122;, â&#x20AC;&#x2DC;positive economyâ&#x20AC;&#x2122; and â&#x20AC;&#x2DC;choice editingâ&#x20AC;&#x2122; are only just emerging. Terrabytes of data exist on individual FRQVXPHUFKRLFHV'1$SURĂ&#x17E;OHVKHDOWK outcomes, climate change and the lifecycle impact of products, to name but a few. Finding some way to get a handle on, and manage, this knowledge is another matter. The only sensible way to operate in this potential morass of information is to take control and ask ourselves a simple question â&#x20AC;&#x201C; what exactly is it that we want to achieve? I know what I, my colleagues at the sustainability charity, BioRegional, and our partners want to achieve: we want to create a society where we can lead happy and healthy lives within the environmental limits of the planet. Within our knowledge there exists the potential to increase opportunity for everyone and to reduce VX˧HULQJ<HWDVHFRQRPLF short-termism has come to dominate our thinking, it becomes harder to reconcile our current patterns of consumption within this framework. But things are changing, from the grassroots to the big corporates and government. Technology, for example, is re-connecting people locally and enabling us to share more. From hiring neighboursâ&#x20AC;&#x2122; cars and borrowing lawnmowers, to big business ideas such as =LSFDUFROODERUDWLYHFRQVXPSWLRQLVWDNLQJR˧ B&Q is no longer selling products like patio heaters, it is choice-editing; making responsible choices on

behalf of customers. They are also becoming part of the community via the creation of interactive neighbourhood-building website â&#x20AC;&#x2DC;Streetclubâ&#x20AC;&#x2122; and developing alternative service models such as hire and repair rather than a simple sale. Unilever plans to reduce the environmental footprint of their products by 50%. Coca Cola is publicly facing up to the health problems they cause by selling sugary drinks. Fortunately, this bottom-up action is being matched by a top-down shift in thinking. There is now a commitment from the UK Government, the UN and World Bank â&#x20AC;&#x2DC;to going beyond GDPâ&#x20AC;&#x2122;, though DGPLWWHGO\ZHQHHGWRĂ&#x17E;QGWKHULJKWPHFKDQLVPVWR allow this transformation to occur. A lot is changing and it is exciting. Where can this take us? At this yearâ&#x20AC;&#x2122;s World Economic Forum in Davos one of the future scenarios we examined was that of a â&#x20AC;&#x2DC;Positive Economyâ&#x20AC;&#x2122; when, by WUXHHQYLURQPHQWDODQGVRFLDOFRVWVDQGEHQHĂ&#x17E;WV are included in national and company accounts. This is the big prize for sustainable development â&#x20AC;&#x201C; accounting

â&#x20AC;&#x153;So we are faced with a choice: carry on business as usual or aim for a better world. Every product we sell and every product we buy can be part of the solutionâ&#x20AC;? properly and aligning market forces to achieve the outcomes we truly desire. At the same time, we cannot underestimate the scale of the challenge and its urgency. Scientists now tell us that in our lifetime we are heading for a world 4oC hotter. This is incompatible with global society as we know it today. So we are faced with a choice: carry on business as usual or aim for a better world. Every product we sell and every product we buy can be part of the solution. Perhaps there really is no choice at all.

MAY 2013 | RETAIL ENVIRONMENT 7


NEWS

P&G ACHIEVES ZERO WASTE AT 45 SITES

No UK opt-out for EU neonicotinoid pesticide ban 8.UHWDLOHUVZLOOEHIRUFHGWRFRPSO\ZLWKDQ(8ZLGHEDQRQQHRQLFRWLQRLGSHVWLFLGHVIROORZLQJ DYRWHLQ%UXVVHOVRQ$SULOZKLFKGLYLGHGPHPEHUVWDWHVDQGSXVKHGWKHGHFLVLRQEDFNWRWKH (XURSHDQ&RPPLVVLRQ 7KH8.ZDVDPRQJHLJKWRWKHUFRXQWULHVWRYRWHDJDLQVWDQ(8SURSRVDOIRUDWRWDOEDQRQ QHRQLFRWLQRLGV%XWDVWKLVZDVQRWHQRXJKWRIRUPDTXDOLÞHGPDMRULW\XQGHU(8UXOHVWKHGHFLVLRQ ZDVKDQGHGEDFNWRWKH&RPPLVVLRQZKLFKKDVWKHRSWLRQWRLPSRVHDWZR\HDUUHVWULFWLRQRQ QHRQLFRWLQRLGVZKLFKWKH8.FDQQRWRSWRXWRI7KH&RPPLVVLRQKDVDOUHDG\VWDWHGLWZDQWVWKH WHPSRUDU\EDQWREHJLQQRODWHUWKDQ'HFHPEHU 7KHPRUDWRULXPZLOOQRWDSSO\WRFURSVQRQDWWUDFWLYHWREHHVRUWRZLQWHUFHUHDOEXWLWZLOO SURKLELWWKHVDOHDQGXVHRIVHHGVWUHDWHGZLWKWKHSHVWLFLGHV 7KH&RPPLVVLRQSURSRVDOIRUDEDQIROORZHGDUHSRUWSXEOLVKHGLQ-DQXDU\E\WKH(XURSHDQ )RRG6DIHW\$XWKRULW\ ()6$ WKDWVDLGWKUHHQHRQLFRWLQRLGLQVHFWLFLGHVqLPLGDFORSULGFORWKLDQLGLQ DQGWKLDPHWKR[DPqSRVHDnKLJKDFXWHULVNoWREHHKHDOWKDQGSRSXODWLRQ 7DNLQJKHHGRIWKLVDGYLFH8.VXSHUPDUNHWFKDLQ:DLWURVHDQQRXQFHGLWZDVWDNLQJD SUHFDXWLRQDU\DSSURDFKDVNLQJDOOLWVIUXLWYHJHWDEOHDQGßRZHUVXSSOLHUVWRDYRLGWKHXVHRIWKH WKUHHSHVWLFLGHVRQFURSVGHVWLQHGIRUWKHVXSHUPDUNHW :DLWURVHKDVDOVRSOHGJHGWREHDQRZQODEHOn*0)UHHo]RQHWKLV\HDU'DYLG)HOZLFN:DLWURVH PDQDJLQJGLUHFWRUVDLGn&XVWRPHUVVKRXOGEHDEOHWRPDNHDQLQIRUPHGFKRLFHDERXWWKHSURGXFWV WKH\DUHEX\LQJ7KHUHIRUHRYHUWKHSDVWPRQWKVZHKDYHEHHQSURJUHVVLYHO\UHIRUPXODWLQJ :DLWURVHRZQODEHOIRRGV DQGSHWIRRGV WRDYRLGWKHXVHRIJHQHWLFDOO\PRGLÞHGVR\DDQGPDL]He :HFRQWLQXHWRZRUNRQWKHLVVXHVRIRLOVDGGLWLYHVDQGRWKHUGHULYDWLYHVDQGZKHUHYHUSRVVLEOH RXULQWHQWLRQLVWRUHPRYHWKHPDVZHOO:HKDYHDQGZLOOFRQWLQXHWRSUHVVIRUIXOOWUDFHDELOLW\DQG GHWDLOHGLQIRUPDWLRQWRHQDEOHXVWRODEHODOORZQODEHOSURGXFWVFOHDUO\DQGRSHQO\o

LANDFILL CLAMPDOWN COULD SAVE UK £3.5BN ([WHQGLQJODQGÞOOEDQVWRIRRGZRRGWH[WLOHVDQGSODVWLFVFRXOGVDYHWKH8.zELOOLRQLQ UHFRYHUHGUHVRXUFHVDQGODQGÞOOFRVWVVD\VDQHZUHSRUW 7KH8.VWDQGVWRVDYHzELOOLRQLQODQGÞOOFRVWVLIWKH*RYHUQPHQWH[WHQGVWKHH[LVWLQJODQGÞOO EDQVRQFDUVDQGPRELOHVWRIRRGZRRGWH[WLOHVDQGSODVWLFV%XWWKHUHFRYHUHGUHVRXUFHVZRXOG DOVREULQJzELOOLRQLQYDOXHWRWKHHFRQRP\DFFRUGLQJWRDUHSRUWIURPLQGHSHQGHQWWKLQNWDQN *UHHQ$OOLDQFH 7KHUHSRUWIRXQGWKH8.FRXOGJDLQzEQIURPUHFRYHUHGSODVWLFVDQGQHDUO\zPLOOLRQDQG zPIURPWH[WLOHVDQGIRRGUHVSHFWLYHO\2YHUKDOIDELOOLRQSRXQGVFRXOGDOVREHVDYHGLQODQGÞOO FRVWVLIEDQVZHUHH[WHQGHGWRIRRGDQGDQDGGLWLRQDOzPFRXOGEHVDYHGIURPDSODVWLFVEDQ

8 RETAIL ENVIRONMENT | MAY 2013

&RQVXPHUJRRGVPDQXIDFWXULQJJLDQW3URFWHU *DPEOHLVQRZVHQGLQJ]HURZDVWHWRODQGÞOO DWRILWVVLWHVDFURVVWKHJOREHLQFOXGLQJ ÞYHLQWKH8. 7KHFRPSDQ\ZKLFKLVUHVSRQVLEOHIRU PDQXIDFWXULQJKRXVHKROGEUDQGVVXFKDV *LOOHWWH%UDXQ'XUDFHOODQG3DPSHUVRSHUDWHV VLWHVLQWKH8.DQG,UHODQGLQFOXGLQJ FRPPHUFLDOR˨FHVLQ6XUUH\DQG+DUURJDWH 2Q$SULOLWPDGHWKHDQQRXQFHPHQWWKDW DWKLUGRILWVVLWHVZHUHQRORQJHUVHQGLQJ ZDVWHWRODQGÞOODVDUHVXOWRIUHGXFLQJ ZDVWHLPSURYLQJUHF\FOLQJDQGXVLQJHQHUJ\ IURPZDVWHWHFKQRORJ\,WLVQRZFORVHWR VHQGLQJ]HURZDVWHWRODQGÞOODWDOORILWV PDQXIDFWXULQJVLWHVDFURVVWKHJOREHZLWK OHVVWKDQRILWVZDVWHFXUUHQWO\JRLQJWR ODQGÞOOZRUOGZLGH7KHFRPSDQ\KDVUHGXFHG WKHDPRXQWRIZDVWHLWSURGXFHVE\ VLQFH ,QWKH8.WKHFRPSDQ\UHYHDOHGWKDW LWV1HZFDVWOHR˨FHV6HDWRQ'HODYDO PDQXIDFWXULQJIDFLOLW\1HZFDVWOHLQQRYDWLRQ FHQWUH%RXUQHPRXWKGLVWULEXWLRQFHQWUH DQG5HDGLQJPDQXIDFWXULQJIDFLOLW\DOODUH QRZVHQGLQJ]HURZDVWHWRODQGÞOO,QWRWDO 3 *mVVLWHVLQWKH8.DUHDFKLHYLQJD UHF\FOLQJUDWH

SAINSBURY’S OPENS BRITAIN’S ‘GREENEST’ STORE 6DLQVEXU\mVRQ$SULOFODLPHGWRKDYH RSHQHG%ULWDLQmVPRVWHQYLURQPHQWDOO\ IULHQGO\FRQYHQLHQFHVWRUHLQ+DVOXFNV *UHHQ6ROLKXO 6RPHVRODUSDQHOVOLQHWKHURRI RIWKHEXLOGLQJJHQHUDWLQJN:K SHU\HDUHOHFWULFLW\,WDOVRUHTXLUHV OHVVKHDWGXHWRLQVXODWLRQIURPGRXEOH JOD]LQJRQWKHVKRSIURQWDQGWLPEHU VWUXFWXUDOLQVXODWHGSDQHOVZLWKLQLWV FRQVWUXFWLRQ 2WKHUIHDWXUHVLQFOXGHQDWXUDO UHIULJHUDWLRQUHGXFLQJFDUERQ HPLVVLRQVE\DQGDQHZKLJKO\ HQHUJ\H˨FLHQW/('OLJKWLQJXVHGDFURVV WKHZKROHVKRSZKLOHWKHVLJQDJHLQ WKHVWRUHIRUFXVWRPHUVLVPDGHIURP UHF\FOHGPDWHULDOV


Horsemeat scare prompts veggie produce surge

European and UK producers and retailers of vegetarian meat alternatives have noticed a spike in sales in the wake of the horsemeat scandal. Quorn, the UK’s biggest vegetarian ready-made brand, reported that they had seen their business more than double since the last half of February and has had to add shifts to its factories to keep up with demand. South African brand, Fry’s, which sells frozen vegetarian sausages, has seen a 30% increase in sales since February, outpacing its growth over the last few years by nearly three times while German brand, VeggieDay said that since their recent launch, sales had been higher than originally forecast.

US RETAIL GIANT PLANS ‘NET ZERO ENERGY’ STORE The US’s largest drugstore chain Walgreens has announced plans to build what it hopes will be the nation’s first net zero energy retail store. The store, in Evanston, Illinoi, will be complete with solar panels, wind turbines, geothermal technology, energy efficient building materials, LED lighting and ultra-high-efficiency refrigeration. Engineering estimates, which can vary due to factors such as weather, store operations and systems performances, indicate that the store will use 200,000 kilowatt hours per year of electricity while generating 256,000 kilowatt hours per year.

IKEA invests in innovative waterless textile dyeing system An Ikea Group corporate venture capital company dedicated to the cleantech sector has invested in waterless dyeing technology which should “bring real environmental and costs benefits for the textile industry by reducing water and chemical use”, according to the company. IKEA GreenTech AB will use the technology developed by DyeCoo Textile Systems, a Dutch company. It uses recycled carbon dioxide (CO2), avoiding the large amounts of water and chemicals used in traditional dyeing processes. The significant potential of the waterless dyeing process has also been recognised by leading apparel and footwear brand, NIKE, Inc. which invested in DyeCoo in 2012. Nike’s strategic partnerships group worked closely with IKEA GreenTech throughout the investment process.

MAY 2013 | RETAIL ENVIRONMENT 9


NEWS

Northern Ireland enforces bag charge 5HWDLOHUVLQ1RUWKHUQ,UHODQGDUHQRZUHTXLUHGWRFKDUJHFRQVXPHUVSIRUVLQJOHXVHFDUULHU EDJVDIWHULWEHFDPHWKH8.mVVHFRQGGHYROYHGDGPLQLVWUDWLRQEHKLQG:DOHVWRLQWURGXFHD EDJOHY\RQ$SULO %XWDFKDUJHRQSODVWLFEDJVLVVWLOOVRPHZD\R╦зLQ(QJODQGZLWKWKH'HSDUWPHQWIRU (QYLURQPHQW)RRGDQG5XUDO$╦зDLUV 'HIUD NHHQWRPRQLWRUWKHUHVXOWVRIWKHFKDUJHLQWKH WZRGHYROYHGQDWLRQVEHIRUHPDNLQJDQ\GHFLVLRQ 7KH1RUWKHUQ,UHODQG([HFXWLYHKRSHVWKHPHDVXUHZLOOUHGXFHSODVWLFEDJXVDJHE\DV PXFKDVDQGKDVHVWLPDWHGWKDWDVPDQ\DVPLOOLRQEDJVDUHXVHGLQWKHFRXQWU\ HDFK\HDU7KHFKDUJHDSSOLHVWRDOOVLQJOHXVHEDJVLQFOXGLQJWKRVHPDGHIURPSODVWLFSDSHU SODQWEDVHGPDWHULDODQGQDWXUDOVWDUFK +RZHYHUUHXVDEOHEDJVRUWKRVHXVHGIRUFDUU\LQJKRWIRRGDQGGULQNVSUHVFULSWLRQ PHGLFDWLRQRUXQFRRNHGPHDWSRXOWU\RU├ЮVKZLOOQRWEHVXEMHFWWRWKHFKDUJH)XQGVIURPWKH OHY\ZLOOJRGLUHFWO\WRWKH'HSDUWPHQWRI(QYLURQPHQWDQGZLOOEHXVHGWRVXSSRUWFRPPXQLW\ DQGYROXQWDU\SURMHFWVDFURVVWKHFRXQWU\7KHFKDUJHLVGXHWRULVHWRSLQ$SULO

JOHN LEWIS LAUNCHES SOFA REUSE SCHEME -RKQ/HZLVKDVODXQFKHGLWV├ЮUVWQRWIRUSUR├ЮWVHUYLFHWKHVRIDUHXVHVFKHPHZKLFKVHHVlHQG RI├ЮUVWOLIHmVRIDVFROOHFWHGE\WKHUHWDLOHUIURPFXVWRPHUVmKRPHVWKHQUHXVHGDQGRUUHF\FOHG LQFRQMXQFWLRQZLWKORFDOFKDULWLHVWRVXSSRUWGLVDGYDQWDJHGFRPPXQLWLHV 7KHUHWDLOJLDQWZRUNHGZLWK7KH)XUQLWXUH5HXVH1HWZRUN )51 DQDWLRQDOFRRUGLQDWLQJ ERG\IRU8.UHXVHRUJDQLVDWLRQVWKDWFROOHFWDZLGHUDQJHRIKRXVHKROGLWHPVWRSDVVRQWR SHRSOHLQQHHGWRODXQFKWKHVFKHPH$WULDOZDVUHFHQWO\FRPSOHWHGLQWKH1RUWK:HVWZKLFKVDZ VRIDVVXFFHVVIXOO\UHXVHGDQGRUUHF\FOHG 7KHUHWDLOHULVDOVRH[SORULQJRSSRUWXQLWLHVWRUHXVH&HQWULIRUFHSURGXFWVVXFKDVSODVWLF SODQNVDQGVKHHWLQJLQLWVQHZVWRUHFRQVWUXFWLRQSURJUDPPHWRDFKLHYHDlFORVHGORRSmLQLWV SODVWLFVZDVWHVWUHDP&HQWULIRUFHZLOOFROOHFWPRUHWKDQWRQQHVRISODVWLFVZDVWHIURP -RKQ/HZLVDQG:DLWURVHGLVWULEXWLRQFHQWUHVDFURVVWKH8.DQQXDOO\DQGEULQJWKHZDVWHWRLWV /LYHUSRROPDQXIDFWXULQJFHQWUH

Eco-cleaning products awarded C2C stamp %HOJLXPEDVHGHFRORJLFDOFOHDQLQJSURGXFW├ЮUP(FRYHUKDVUHODXQFKHGDUDQJHRISURGXFWV ZKLFKKDYHEHHQDZDUGHGDQHZ&UDGOHWR&UDGOH && FHUWL├ЮFDWLRQqnD├ЮUVWLQWKHZRUOGRI SURIHVVLRQDOFOHDQLQJo $WHDPRIVFLHQWLVWVDW(QYLURQPHQWDO3URWHFWLRQDQG(QFRXUDJHPHQW$JHQF\ (3($  DVVHVVHGDOOLQJUHGLHQWVSDFNDJLQJPDWHULDOVSURFHVVHVDQGVRFLDOSUDFWLFHV XVHGWHVWLQJIRUPD[LPXPPDWHULDOUHXWLOLVDWLRQDQG ELRGHJUDGDELOLW\WKHFRPSDQ\VDLGLQDVWDWHPHQWRQ $SULO$VDUHVXOW(FRYHU3URIHVVLRQDOQRZKDV VL[SURGXFWVWKDWDUH&UDGOHWR&UDGOHFHUWL├ЮHGDW 6LOYHUOHYHO&&FHUWL├ЮFDWLRQFRYHUV├ЮYHVWHSV IURPEDVLFWRSODWLQXPGHSHQGLQJRQWKHOHYHORI RSWLPLVDWLRQDFKLHYHG 7KHSURGXFWVZLOOEHVROGLQGLUHFWO\DFURVV (XURSHWKURXJKWKHH[LVWLQJEXVLQHVVWREXVLQHVV GHDOHUQHWZRUNn7KHUHVXOWLVDFRPSOHWHUDQJH RISRZHUIXOFOHDQLQJSURGXFWVWKDWDUHVDIH IRUSHRSOHDQGWKHSODQHW:LWKWKLVUDQJH ZHDUHUHDG\IRUWKHIXWXUHoVDLG-RKDQ7RSV ,QWHUQDWLRQDO%%PDQDJHU(FRYHU

10 RETAIL ENVIRONMENT | MAY 2013

Tesco ямВeets to use LNG Tesco, is turning to liquid natural gas (LNG) WRUHGXFHWKHUXQQLQJFRVWRILWV├ЯHHW7KLUW\ ├ЮYHGXDOIXHO+*9VZLOOUXQRQELR/1* VXSSOLHGE\*DVUHF 7KHIXHOZLOOFRPHIURPWKH'DYHQWU\ ,QWHUQDWLRQDO5DLO)UHLJKW7HUPLQDOD JURXQGEUHDNLQJLQVWDOODWLRQWKDWZLOO R╦иFLDOO\RSHQWRDOOGXDOIXHOYHKLFOHVIURP WKLVPRQWK 7HVFRmVGHDOZLWK*DVUHFLVH[SHFWHGWR FXWWKH├ЮUPmV&22HPLVVLRQVE\DPLQLPXP RIZLWKDUHGXFWLRQLQ12[DQG SDUWLFXODWHPDWWHUHPLVVLRQVKHOSLQJ7HVFR WRDFKLHYHLWVWDUJHWRIUHGXFLQJHPLVVLRQV SHUFDVHRIJRRGVGHOLYHUHGE\E\  IURPEDVHOLQH ,WKDVDOUHDG\ KDOYHGWKHHPLVVLRQVSHUFDVHGHOLYHUHGLQ WKH8.EHWZHHQ


Advertisement Feature

How to survive WEEE 2 Peter Hunt from WasteCare gives his view on the current WEEE consultation and its likely impact on UK retailers. Ever since the Waste Electrical and Electronic Equipment (WEEE) Regulations came into force in 2007, it was obvious that they were not fit for purpose and would need a major overhaul. The current system is costing WEEE producers over £65 million a year to comply, due to the high cost of evidence, the volume of WEEE avoiding the system and the Environment Agency and membership fees. These costs are naturally passed on to consumers and, as a result, artificially inflate the cost of new electrical goods. wastecare The much anticipated Government consultation on the new WEEE regulations is now underway and will close on 21st June 2013. The primary aims of the consultation are: • To satisfy the European directive for WEEE with the minimum of effort; the main change is the adoption of a 45% recycling target rising to a possible 85% by 2019; • To reduce the cost of compliance for producers; • To minimise bureaucracy by implementing the Red Tape Challenge. So, what does this mean to UK retailers and what are the potential impacts? Whilst retailers of electrical and electronic equipment will still need to offer in-store take back or join a collective scheme, there are a number of proposed developments which the UK’s retailers, many of whom are also WEEE producers, should consider. The first and most obvious change for retailers is the proposed requirement to extend their take back schemes to include small WEEE (no external dimension over 25cm) free of charge and with no obligation on the consumer to purchase goods of an equivalent type. The Government has proposed three new options to reform the existing WEEE system in response to the Red Tape Challenge, as well as considering whether the current system should be maintained. The four options proposed are:

Option 1 - do nothing; Option 2 - establish single National Compliance Scheme; Option 3 - set a Collection Target and Compliance Fee; Option 4 - establish a matching process of collection sites to PCSs. Early feedback from those involved in the system indicates that option 1 is not an option and option 2 will do little to reduce the burden of administration. Option 3 looks like it could deliver a more robust system, which could be further strengthened by setting the minimum level required for compliance at one tonne and ensuring it is easier for producers to move between schemes. At face value, option 4 looks workable but, for this proposal to work, the cost of entry would need to be much higher in order to reduce the number of schemes available (currently 39), most of which have no transport or reprocessing capability. This would also enable a reduction in the EA fee, thereby encouraging membership. It is really important that UK retailers not only make their voice heard by responding to the consultation but also take the opportunity to review the systems that they have in place to ensure they are getting best value. The common perception is that the Government’s Distributor Take Back scheme is the only option for those retailers who have an obligation but do not offer a take back scheme in store. This is not the case. Other schemes, such as the WeeeCollect scheme, offer exactly the same features as the DTS but at a fraction of the cost, with a lifetime membership fee of £40. The fact is that compliance should be cost neutral for producers, subject to maintaining current commodity prices.

By increasing reuse, expanding customer take back and providing an easy-touse service for collecting B2B WEEE WasteCare is able to offer customers a cost neutral service.

For more information, visit our website www.wastecare.co.uk or come along to one of WasteCare’s upcoming WEEE2 conferences www.weeecare.com/recast/


EU NEWS

EU mulls single market for green products

Brussels urged to implement EU-wide food waste policy

2013 RETAIL TRADE UP 1.2% IN EURO AREA In January 2013 compared with December 2012, the volume of retail trade rose by 1.2% in the euro area (EA17) and by 0.9% in the EU27, according to estimates from Eurostat, WKHVWDWLVWLFDOR˨FHRIWKH(8,Q December 2012 retail trade fell by 0.8% and 0.7% respectively.

12 RETAIL ENVIRONMENT | MAY 2013

A top consultative body in March called on the European Commission to urgently address food waste, which it says has been exacerbated by the economic crisis. The plans, laid down in an opinion adopted on March 20, would combine EU-wide and national measures to improve WKHH˨FLHQF\RI the food supply and consumption chains. The European Economic and Social Committee (EESC) recommends developing platforms for exchanging experience on combating food waste and passing on existing examples of good practices: channelling products from the food retail and catering sectors to food banks, initiatives on taxation, discharge of liability for donors or removal of administrative constraints are a few actions already successfully implemented in some EU countries and regions. â&#x20AC;&#x153;Up to 30% of food gets wasted in EU households, supermarkets, restaurants and along the food supply chain each year. We must take action to stop this,â&#x20AC;? said Yves Somville, rapporteur for the opinion.

A common system for measuring the environmental performance of green products and organisations across Europe is being proposed by the European Commission. The proposal comes as part of wider plans to improve transparency for consumers and increase performance on environmental and social matters. An EU poll showed around 48% of Europeans do not trust the environmental claims made by companies. The standard would not be binding, but EU member states should endorse it to foster an EU â&#x20AC;&#x153;single market for green products,â&#x20AC;? said the Commission. Companies concerned are asked to disclose information on policies, risks and results as regards environmental matters, social and employee-related aspects, respect for human rights, anti-corruption and bribery issues, and diversity on the boards of directors. The proposals are designed to provide reliable and easily comparable environmental information for consumers and companies â&#x20AC;&#x201C; such as those in the waste management sector â&#x20AC;&#x201C; about the environmental impacts and credentials of products and organisations. EU countries use a wide variety of methods to measure the green credentials of products and companies making comparison hard. EU environment commissioner Janez Potocnik, said in a statement in April that implementation of the standard would create a â&#x20AC;&#x153;single reference methodâ&#x20AC;? that would â&#x20AC;&#x153;reduce the costs for companies ZLVKLQJWRREWDLQFHUWLĂ&#x17E;FDWLRQDQG would be clearer and more reliable for consumersâ&#x20AC;?. Reacting to the proposal, retail, wholesale and international trade interest association, Eurocommerce warned: â&#x20AC;&#x153;A RQHVL]HZLOOQRWĂ&#x17E;WDOOLQWKLVLQVWDQFH,W is therefore essential for the commerce sector that the implementation of this new European proposal remains voluntary.â&#x20AC;?


UK renewables share among lowest in EU â&#x20AC;&#x201C; report In 2011 the UK was one of the lowest consumers of renewable energy, with only 3.8% contributing WRLWVWRWDOHQHUJ\FRQVXPSWLRQDFFRUGLQJWRĂ&#x17E;JXUHVSXEOLVKHGRQ$SULOE\(XURVWDWWKH(8mV VWDWLVWLFDOR˨FH,QUHQHZDEOHVPDGHXSRIWKH8.mVHQHUJ\VXSSO\ Under EU law the UK is required to generate 15% of its energy from renewable sources by 2020. A spokesperson for the Department of Energy and Climate Change (DECC) said the UK was still â&#x20AC;&#x153;on trackâ&#x20AC;? to meet its 2020 renewables target. â&#x20AC;&#x153;Currently 12% of our electricity comes from renewable resources. We have a robust strategy in place to ensure that we meet our target and we DUHDOUHDG\VHHLQJPDMRULQYHVWPHQWVIURPJOREDOĂ&#x17E;UPVLQRXUUHQHZDEOHHQHUJ\VHFWRUDQGVXSSO\ chain,â&#x20AC;? he said. $FURVVWKH(8UHQHZDEOHVZHUHHVWLPDWHGWRKDYHFRQWULEXWHGRIJURVVĂ&#x17E;QDO HQHUJ\FRQVXPSWLRQFRPSDUHGZLWKLQDQGLQ:KLOHWKHĂ&#x17E;JXUHVKDYH LPSURYHGRQSUHYLRXV\HDUVWKH(8LVVWLOOVRPHZD\R˧LWVE\WDUJHWLQJURVVĂ&#x17E;QDO energy consumption. 7KHQDWLRQDOWDUJHWVWDNHLQWRDFFRXQWWKH0HPEHU6WDWHVmGL˧HUHQWVWDUWLQJSRLQWVUHQHZDEOH energy potential and economic performance. The highest share of renewables was recorded in 6ZHGHQ  /DWYLD  )LQODQG  DQG$XVWULD  ,Q(VWRQLDZDVWKH Ă&#x17E;UVW0HPEHU6WDWHWRH[FHHGLWV(XURSHWDUJHW

EU to oďŹ&#x20AC;er greater transparency for ďŹ sheries and aquaculture products 7KH(XURSHDQ&RPPLVVLRQRQ$SULOODXQFKHGDQ(8ZLGHLQWHUDFWLYHZHEWRROR˧HULQJXS WRGDWHGDWDRQYROXPHYDOXHDQGSULFHRIĂ&#x17E;VKHULHVDQGDTXDFXOWXUHSURGXFWVWKURXJKRXWWKH supply chain, from when they land to port to when they are displayed on supermarket shelves. The European Market Observatory for Fishery and Aquaculture Products (EUMOFA) was ODXQFKHGE\(XURSHDQ&RPPLVVLRQHUIRU0DULWLPH$˧DLUVDQG)LVKHULHV0DULD'DPDQDNLDWWKH European Seafood Exposition on April 25. â&#x20AC;&#x153;If you want to know market trends and market drivers for wild or farmed seafood products, the Market Observatory is the tool for you,â&#x20AC;? said Damanaki. She continued: â&#x20AC;&#x153;What counts today is value, not volume, of production. With this modern tool we empower economic actors through accurate, real-time market information.â&#x20AC;? The Observatory will be updated daily with production information from the local to the EU-wide level and includes data on imports, exports and consumption trends. It regroups in one single place information that was previously spread over several sources, formats and languages.

EU crack down on â&#x20AC;&#x2DC;fraudulent labellingâ&#x20AC;&#x2122; In the wake of the horsemeat contamination scandal that shook several leading UK retailers, the European Commission ordered EU-wide testing and found less than 5% of the tested products had horse DNA and that about 0.5 % of the equine carcasses tested were found to be contaminated with bute. The issue was not about food safety, it was a matter of â&#x20AC;&#x153;food fraudâ&#x20AC;?, FRQFOXGHGWKH&RPPLVVLRQLQ$SULOn5HVWRULQJWKHWUXVWDQGFRQĂ&#x17E;GHQFHRI European consumers and trading partners in our food chain following this fraudulent labelling scandal is now of vital importance for the European economy given that the food sector is the largest single economic sector in the EU,â&#x20AC;? said Commissioner for health and consumers, Tonio Borg. In the next few months the Commission will propose to strengthen the controls along the food chain in line with lessons learned.

MAY 2013 | RETAIL ENVIRONMENT 13


INTERVIEW

Turning ethics into proďŹ t

The Co-operative has plans for a fourth UK windfarm to help with its target of taking 25% of its electricity from its own renewable energy sources

14 RETAIL ENVIRONMENT | MAY 2013


2Q'HFHPEHUDJURXSRIZRUNLQJ FODVVORFDOVIURPDVPDOOPDUNHWWRZQQHDU 0DQFKHVWHURSHQHGDVKRSEDVHGRQDVLPSOH SULQFLSOHVHOOLQJTXDOLW\IRRGDWUHDVRQDEOH SULFHVZHLJKWVDQGPHDVXUHV/LWWOHGLGWKH VRFDOOHG5RFKGDOH(TXLWDEOH3LRQHHUVNQRZ WKDWRQHGD\WKHLUKXPEOHLGHDZRXOGHYROYH LQWRDPXOWLELOOLRQSRXQGEXVLQHVVJLDQW FRPSULVLQJQHDUO\VWRUHVDQGPRUH WKDQSHRSOH7KH&RRSHUDWLYH*URXS KDVULVHQIURPDVRFLHW\HVWDEOLVKHGRYHU RQHDQGKDOIFHQWXULHVDJRRQWKHQRWLRQRI HWKLFDOWUDGLQJDQGEHOLHIWKDWEXVLQHVVSURĂ&#x17E;WV VKRXOGEHVKDUHGDPRQJVWPHPEHUVDFFRUGLQJ WRWKHLUSXUFKDVHV7RWKLVGD\WKHFRQFHSW UHPDLQVDWWKHFRUHRIWKHEXVLQHVVHWKRV &KDUORWWH2ZHQVSHDNVWR7KH&RRSHUDWLYHĂ&#x192;V KHDGRIVXVWDLQDELOLW\&KULV6KHDUORFNDERXW LWVDFKLHYHPHQWVWRGDWHDQGWKHFKDQJLQJ QDUUDWLYHRIVXVWDLQDELOLW\

$WWKHKHDUWRIWKH8.Ă&#x192;VĂ&#x17E;IWKELJJHVWIRRGUHWDLOHUDQGRZQHURI %ULWDLQĂ&#x192;VODUJHVWIDUPLQJRSHUDWLRQLVDQĂ&#x2026;HWKLFDOSODQĂ&#x2020;DUROOLQJ WKUHH\HDURSHUDWLQJVWUDWHJ\ZKLFKDLPVWRĂ&#x2026;SXWHWKLFDODQG HQYLURQPHQWDOREMHFWLYHVRQWKHVDPHIRRWLQJDVLWVĂ&#x17E;QDQFLDO RQHVĂ&#x2020;DFFRUGLQJWR0U6KHDUORFN The plan includes a series of 50 commitments and targets in eight focal areas including protecting the environment; tackling global poverty; and supporting co-operatives. While achieving a 43% reduction in absolute greenhouse gas emissions since 2006, moving palm oil sourcing to a sustainable IRRWLQJLQDQGWDNLQJRILWVHOHFWULFLW\IURPDJUHHQWDUL˧ might already seem like commendable feats, The Co-operative is setting its sights further. In its latest plan, the Group reiterates commitments to cut half of its greenhouse gases by 2020 and reduce HQHUJ\FRQVXPSWLRQE\DWKLUG7RSXOOLWR˧DKXJH&RRSHUDWLYH workforce needs to be implicated. â&#x20AC;&#x153;Something like that involves a cast of thousands,â&#x20AC;? says Mr Shearlock. â&#x20AC;&#x153;Weâ&#x20AC;&#x2122;ve implemented a training programme which reaches 12,000 of our colleagues in our food stores each year. Weâ&#x20AC;&#x2122;ve had to bring in a network of regional energy managers to help in that process. If you think about the sheer size of The Cooperative â&#x20AC;&#x201C; the scale of the challenge of ensuring everyone is pulling in the same direction is huge but something that weâ&#x20AC;&#x2122;re in a good spot to tackle as weâ&#x20AC;&#x2122;ve been doing it since 2006.â&#x20AC;? 7KURXJKHQHUJ\H˨FLHQF\VFKHPHV FRVWLQJzPLOOLRQD\HDU DV ZHOODVZDVWHUHGXFWLRQPHDVXUHV7KH&RRSHUDWLYHKDVVDYHGzPD year. Schemes such as putting doors on fridges â&#x20AC;&#x201C; â&#x20AC;&#x153;which some of our rivals are still reluctant to do,â&#x20AC;? says Mr Shearlock, are part of this process. The Group is committed to getting 2,000 doors on its fridges by 2020 and already has over 100 in its stores across the UK.

MAY 2013 | RETAIL ENVIRONMENT 15


INTERVIEW

WKHQHZ&RXUWDXOG&RPPLWPHQWmVWDUJHWWRYLHZSURGXFWV PRUHKROLVWLFDOO\7KH&RRSHUDWLYHKDVVWDUWHGDSURMHFWRQ SRWDWRHVZKLFKFRYHUVWKHHQWLUHVXSSO\FKDLQn:HJURZRXU RZQSRWDWRHVRQRXUIDUPVSDFNDJHWKHPLQRXUSDFNKRXVHV GLVWULEXWHWKHPDQGVHOOWKHPLQRXUVWRUHVVRDSURMHFWOLNH WKDW\RXmUHQRWMXVWORRNLQJDWSDFNDJLQJ\RXmUHORRNLQJDW ZDVWHFRVWDQGUHVRXUFHVDFURVVWKHVXSSO\FKDLQoDFFRUGLQJ WR0U6KHDUORFN 2YHUWKHSDVW\HDU7KH&RRSHUDWLYHKDVDOVREHHQZRUNLQJ DEDFNKDXOLQJVFKHPHIRUZDVWHZKLFKFRXOGVHHWKHJURXS VHQGLQJYLUWXDOO\]HURZDVWHWRODQGÞOOE\WKHHQGRI n:HKDGVWRUHVLQYROYHGLQWKHSURMHFWDVRIWKHHQGRI ODVW\HDUDQGDOOVWRUHVZLOOEHRQERDUGWKLVSURMHFWE\ WKHHQGRI5DWKHUWKDQJRLQJWRODQGÞOOZHFXUUHQWO\ UHF\FOHDERXWRIZDVWHE\WKHHQGRIWKLV\HDUYLUWXDOO\ HYHU\WKLQJ DOPRVW ZLOOEHUHF\FOHGo0U6KHDUORFNWHOOV 5HWDLO(QYLURQPHQW

Chris Shearlock, Co-operative head of sustainability

No premium on ethics

(QHUJ\VRXUFLQJDQGH˨FLHQF\LVLQWHJUDOWR7KH&R RSHUDWLYHmVVXVWDLQDELOLW\VWUDWHJ\6LQFH7KH&R RSHUDWLYHKDVWDNHQDOPRVWDOORILWVHOHFWULFLW\IURPDJUHHQ WDUL˧PDNLQJLWRQHRIWKHODUJHVWSXUFKDVHUVRIUHQHZDEOH HOHFWULFLW\LQWKHZRUOG7KHPRYHKDVDUJXDEO\EHHQPDGH PRUHHFRQRPLFDOO\YLDEOHE\MXPSLQJRQWKHUHQHZDEOHV EDQGZDJRQHDUOLHUWKDQRWKHUFRPPHUFLDOHQWHUSULVHV n%HFDXVH7KH&RRSHUDWLYHVWDUWHGEX\LQJJUHHQHQHUJ\LQ ZHPDQDJHGWRQHJRWLDWHJRRGGHDOVeDÞUVWPRYHU DGYDQWDJHoVD\V0U6KHDUORFN7KHUHDUHDOVRSODQVWRVRXUFH RI7KH&RRSHUDWLYHmVHOHFWULFLW\IURPLWVRZQUHQHZDEOHV n:HRSHQHGRXUÞUVWZLQGIDUPRQRXUIDUPODQGLQZH RSHQHGDVHFRQGLQZHmYHJRWDWKLUGXQGHUFRQVWUXFWLRQ DQGDIRXUWKZLWKSODQQLQJ SHUPLVVLRQoDFFRUGLQJ WR0U6KHDUORFN0RUH VRODUSRZHUSURMHFWVFRXOG DOVREHLQWKHSLSHOLQH 7KH&RRSHUDWLYHLQ WUDQVIRUPHG0DQFKHVWHUmV IW&,67RZHULQWR DIDFLOLW\FDSDEOHRISURGXFLQJRQVLWHUHQHZDEOHHQHUJ\ UHJDUGOHVVRIWKHZHDWKHU7KHzP6RODU7RZHUSURMHFWXVHV RYHUSKRWRYROWDLFFHOOSDQHOVWRFUHDWHXQLWVRI UHQHZDEOHHQHUJ\D\HDU

7KHUHmVQRUHDVRQEHLQJVXVWDLQDEOHVKRXOGGHQWSURÞWDQG UDLVHSULFHVIRUFRQVXPHUV7KHEXONRIWKHVHPHDVXUHVDUH FRVWQHXWUDODFFRUGLQJWR0U6KHDUORFNn,WKDVWREHGRQH RQWKLVEDVLV:HGRQmWFKDUJHDSUHPLXPIRURXUHWKLFV 7KDWLVRQHRIWKHFUXFLDOWKLQJVDERXW7KH&RRSHUDWLYH ZHDUHLQHYHU\SRVWDODUHDXSDQGGRZQWKH8.qZHDUHLQ VRPHD˩XHQWFRPPXQLWLHVDVZHOODVVRPHYHU\GHSULYHG FRPPXQLWLHV:HR˧HUWKHVDPHHWKLFDOFKRLFHVLQDOORXU VWRUHVLQGHSULYHGRUD˩XHQWFRPPXQLWLHV n:HZDQWFXVWRPHUVWRWUXVWWKDWZHmYHGRQHWKHZRUN WRPDNHVXUHWKDWZKDWmVEHLQJSUHVHQWHGRQWKHVKHOYHVLV UHVSRQVLEO\RUVXVWDLQDEO\VRXUFHG7KLQJVKDYHPRYHGTXLWH DELWRYHUWKHODVWIHZ\HDUVVXFKSURGXFWVDUHPRUHUHDGLO\ DYDLODEOHWKDQWKH\ZHUHDIHZ\HDUVDJR7DNLQJWKHH[DPSOH RIÞVKLI\RXZHQWEDFNÞYHRUVL[\HDUVDJR1*2VZRXOG KDYHEHHQVD\LQJWKLQJVOLNHnGRQmWHDWFRGRUKDGGRFNoEXW

n:HmYHDOOEHHQZRUULHGDERXWFOLPDWHFKDQJHRYHU WKHODVWGHFDGHqDQGWKDWmVRQO\JRLQJWRLQFUHDVHq EXWZKDWLVWDONHGDORWPRUHQRZLVUHVRXUFHVFDUFLW\o

Responsible waste $VZHOODVHQHUJ\DQRWKHU&RRSHUDWLYHVXFFHVVVWRU\OLHV ZLWKZDVWHPDQDJHPHQW)RULQVWDQFHWKH*URXSKDVDOUHDG\ UHGXFHGLWVRZQEUDQGSDFNDJLQJE\PRUHWKDQRYHU WKHODVWÞYH\HDUVDQGDVSDUWRIWKHRULJLQDO&RXUWDXOG &RPPLWPHQWGHOLYHUHGDURXQGDZHLJKWUHGXFWLRQ DKHDGRIVFKHGXOH,WWKHQORRNHGDWWKHFDUERQLPSDFWRILWV SDFNDJLQJDQGUHGXFHGWKDWE\WKHUHDUHSODQVWRJHW LWGRZQDIXUWKHUE\WKHHQGRIQH[W\HDU,QOLQHZLWK 16 RETAIL ENVIRONMENT | MAY 2013

QRZZHR˧HU06&>0DULQH6WHZDUGVKLS&RXQFLO@FRGDQG06& KDGGRFNZKLFKDUHIURPFHUWLÞHGZHOOPDQDJHGVXVWDLQDEOH VRXUFHV7KHZD\WKLQJVKDYHPRYHGRQKDVQmWPHDQWWKDWZHmYH GURSSHGVRPHWKLQJRXWLWmVVLPSO\WKDWZHmYHPDGHVXUHWKDW WKHVHWKLQJVDUHVXVWDLQDEOHVRXUFHGoEHOLHYHV0U6KHDUORFN n2ZQEUDQG)DLUWUDGHFR˧HHZLOOFRPSHWHTXLWHZHOOZLWK EUDQGHGFR˧HHZKLFKLVQmWQHFHVVDULO\)DLUWUDGHoDFFRUGLQJ WR0U6KHDUORFNn>&XVWRPHUV@DUHQRWQHFHVVDULO\SD\LQJ DSUHPLXPIRUHWKLFV)RUXVLWLVDERXWHQVXULQJ\RXKDYH DGHFHQWDQGVHFXUHVXSSO\FKDLQVRLI\RXmUHZRUNLQJ ZLWK)DLUWUDGHSURGXFHUVLQDORQJWHUPUHODWLRQVKLSWKHQ \RXNQRZ\RXmYHJRWFRQWLQXLW\RIVXSSO\on,I\RXORRNDW UHFRJQLWLRQRIVRPHHFRODEHOVOLNH)DLUWUDGHRU06&RU)6& >)RUHVW6WHZDUGVKLS&RXQFLO@LWmVQRZYHU\YHU\JRRGWKHUHLV


Do you need to talk about anything?

Totally free, confidential and independent

Outside UK +44 845 766 0113 Text HELPLINE to 88010* helpline@retailtrust.org.uk www.retailtrust.org.uk

Retail Trust is a registered charity in England and Wales (1090136) and in Scotland (SC039684) Company No 4254201 (Company limited by Guarantee) Registered in England and Wales Registered OfďŹ ce: Marshall Estate, Hammers Lane, London, NW7 4DQ *Only for UK. Standard network rates apply


INTERVIEW

The Cooperative Food was named as one of two retailers doing the most to address GL˧HUHQW issues of concern on pesticide use and the contamination of food

FXVWRPHUGHPDQGIRUWKLQJVZKLFKDUHFOHDUO\LGHQWLÞDEOHDV EHLQJVXVWDLQDEOHoKHDGGV ,Q7KH&RRSHUDWLYHEHFDPHWKHÞUVWPDMRU VXSHUPDUNHWWRVWRFN)DLUWUDGHSURGXFWVqEHIRUHWKH)DLUWUDGH ODEHOZDVODXQFKHG7KHVWUDWHJ\KDVFRQWLQXHGWRLQßXHQFH RWKHUUHWDLOHUVDQGPDQXIDFWXUHUVn6RPHRQHmVJRWWRJR ÞUVWRQDORWRIWKHVHWKLQJVDQGVKRZWKDWLWmVSRVVLEOHDQG WKDWLWFDQEHGRQHSURÞWDEO\oVD\V0U6KHDUORFNn,ILWFDQ EH)DLUWUDGHLWZLOOEH)DLUWUDGHE\WKHHQGRIWKH\HDUo7KH &RRSHUDWLYHKDVVDLG1RWORQJDIWHUWKHJURXSKDGLWVRZQ EUDQG)DLUWUDGHWHDDQGFR˧HHRQLWVVKHOYHVLQWKH OLNHVRI&DGEXU\DQG1HVWO´VWDUWHGWREULQJLQ)DLUWUDGHDVD VWDQGDUGnVRPHWKLQJXQLPDJLQDEOHÞYH\HDUVDJRoEHOLHYHV0U 6KHDUORFNn$OOWKH\mUHGRLQJLVFRS\LQJWKHDSSURDFKZKLFK ZHWRRNo

Changing narrative %XVLQHVVHVSULRULWLHVKDYHFKDQJHGRYHUWKHODVWIHZ\HDUV DFFRUGLQJWR0U6KHDUORFNn:HmYHDOOEHHQZRUULHGDERXW FOLPDWHFKDQJHRYHUWKHODVWGHFDGHqDQGWKDWmVRQO\JRLQJ WRLQFUHDVHqEXWZKDWLVWDONHGDORWPRUHQRZLVUHVRXUFH VFDUFLW\ Because \RXmYHJRW the emerging HFRQRPLHV WKH%5,& QDWLRQV\RXmYH got greater FRPSHWLWLRQIRUQDWXUDOUHVRXUFHVDQGWKDWSRLQWVWRKDYLQJ EHWWHUUHODWLRQVKLSVZLWKVXSSOLHUVZKLFKKHOSVWRPLQLPLVH WKRVHUHVRXUFHVDQGVDIHJXDUG\RXUVXSSO\oKHVD\Vn:KDW QHHGVWRKDSSHQRYHUWKHQH[WGHFDGHLVPRUHGHWDLOHGDQGLQ GHSWKUHODWLRQVKLSVZLWKVXSSO\EDVHVoDGGV0U6KHDUORFN $QRWKHUNH\IRFXVZLOOEHZDWHUVRPHWKLQJWKDWZLOOEHFRPH nPRUHLPSRUWDQWRYHUWLPHoVD\V0U6KHDUORFNn:HUHSRUW

n5HSRUWLQJLVRQHRIWKHEHVW ZD\VRIJHWWLQJSURJUHVV ZLWKLQDODUJHEXVLQHVVo

18 RETAIL ENVIRONMENT | MAY 2013

RQRXUZDWHUFRQVXPSWLRQDQGWKHZRUNZHGRWRUHGXFHLWLQ RXUHVWDWHV:HKDYHDQXPEHURISURMHFWVZLWKRXU)DLUWUDGH VXSSO\EDVLVRQZDWHUZDWHUDFFHVVDQGVDQLWDWLRQLQ$IULFD DQG6RXWK$PHULFDQDQGWKH&DULEEHDQo $QQXDOVXVWDLQDELOLW\UHSRUWLQJLQDGGLWLRQZLOOFRQWLQXH WRXQGHUSLQ7KH&RRSHUDWLYHmVVWUDWHJ\5HFRJQLVHGDV EHLQJnDPRQJWKHEHVWLQWKHZRUOGo&RRSHUDWLYHUHSRUWLQJ LVDnIDQWDVWLFGULYHURISHUIRUPDQFHEHFDXVHLWmVFOHDUDQG WUDQVSDUHQWDQGRXWLQWKHSXEOLFGRPDLQo5HSRUWLQJLVnRQH RIWKHEHVWZD\VRIJHWWLQJSURJUHVVZLWKLQDODUJHEXVLQHVVo EHOLHYHV0U6KHDUORFN n1RWRQO\FDQ\RXXQGHUVWDQGZKHUHFRVWVDUHLQWKH EXVLQHVVqKRZPXFKHQHUJ\DQGZDVWH\RXmUHSURGXFLQJLWLV DOVRSDUWLFXODUO\XVHIXOIRUKHOSLQJEXLOGPHGLDDQGPDUNHWLQJ UHODWLRQVKLSVDFFRUGLQJWR0U6KHDUORFN,QOLJKWRIWKHUHFHQW KRUVHPHDWVFDQGDOWUDQVSDUHQF\KDVEHFRPHDOOWKHPRUH UHVRQDQW7KH&RRSHUDWLYHmVFKLHIH[HFXWLYH3HWHU0DUNVLQ )HEUXDU\VDLGWKHJURXSZRXOGnLPSURYHWKHULJRXURI>LWV@ WHVWLQJDQGWDNHDFORVHUORRNDW>LWV@VXSSO\FKDLQWRHQVXUHLW LVWUDQVSDUHQWon)RUEXVLQHVVHVVWDUWLQJWKLVSURFHVVLWmVWKH ÞUVWWKLQJWKH\VKRXOGEHGRLQJoUHFRPPHQGV0U6KHDUORFN $VZLWKDOOEXVLQHVVHVSHUPHDWLQJ&RRSHUDWLYHGHFLVLRQ PDNLQJZLOOEHFRPPHUFLDOLW\SDUWLFXODUO\DVWKH*URXS WRRNDKLWWRLWVSURÞWVODVW\HDUPDLQO\IURPDQXPEHURI IDFWRUVLQLWVEDQNLQJGLYLVLRQn<RXKDYHWREHDSURÞWDEOH EXVLQHVVLQRUGHUWRGRRWKHU>HQYLURQPHQWDO@WKLQJV$Q\WKLQJ HQYLURQPHQWDOKDVWRVWDFNXSLQWKDWZD\,I\RXmUHQRW DWWUDFWLYHWRFXVWRPHUVWKHQHQYLURQPHQWDORQHZRQmWPDNHXS IRULWoDFFRUGLQJWR0U6KHDUORFN $VIDUDVWKHURDGDKHDGLVFRQFHUQHG7KH&RRSHUDWLYHLV QRWTXLWHDWWKHSRLQWRIRSHUDWLQJDFLUFXODUHFRQRP\qWKH XOWLPDWHVXVWDLQDELOLW\JRDOqEXWLWLVFHUWDLQO\SXWWLQJLWVHOI RQWKHULJKWSDWKn,WKLQNLI\RXORRNDWZKDWZHmYHGRQHWR UHGXFHHQHUJ\FRQVXPSWLRQDQGSDFNDJLQJIRUH[DPSOHDQG WKHZRUNZHmUHGRLQJZLWKLQRXUVXSSO\EDVHZHmUHGHÞQLWHO\ PRYLQJLQWKHULJKWGLUHFWLRQoFRQFOXGHV0U6KHDUORFN


 

= = = = = = = = =

Shop and Display Equipment Association

New products for retail display 2XUPHPEHUVDUHFRQVWDQWO\ODXQFKLQJ LQQRYDWLYHQHZSURGXFWVDQGVHUYLFHVIRUUHWDLO GLVSOD\ 

6HHDVHOHFWLRQDW ZZZVKRSGLVSOD\RUJQHZSURGXFWVKWPO 

6HDUFKRXUGDWDEDVHGD\RUQLJKWIRUDQ\WKLQJ DQGHYHU\WKLQJ\RXQHHGIRU\RXUUHWDLOLQWHULRUV

: &RKHOSGULYHVDOHVDW%0:3DUN/DQH

ïïïKshopdisplayKçêÃ&#x2013;

Shop and Display Equipment Association &UR\GRQ5RDG&DWHUKDP6XUUH\&5<57)(HQTXLULHV#VGHDFRXN


COVER STORY

Thirsty business The World Economic Forum has recognised water scarcity as the second most important risk facing the world in the coming years. In the UK, where previously water was seen as an abundant luxury, the prospect of diminishing supply coupled with a rising population has becoming a sobering reality, prompting radical shifts in business priorities. The retail sector, in particular, is now taking water to the very heart of its sustainability strategy, writes Charlotte Owen

20 RETAIL ENVIRONMENT | MAY 2013

For several years now environmental experts and business leaders have been debating whether water is â&#x20AC;&#x153;the new carbonâ&#x20AC;?, drawing obvious parallels to a resource that should be priced according to its value. While the comparison dismisses both the complexity of monitoring water and its value as a clean resource it is accurate in terms of its escalating standing as a key part of business modelling and economic growth. :DWHUPDQDJHPHQWLVDUJXDEO\RQHWKHPRVWVLJQLĂ&#x17E;FDQWFKDOOHQJHVIDFLQJWKHJOREDO economy today but it is only recently that businesses have begun waking up to the cost VDYLQJVDQGHQYLURQPHQWDOEHQHĂ&#x17E;WVWKDWFDQEHDFKLHYHGE\LPSOHPHQWLQJLQLWLDWLYHVWR reduce water use. With water footprint analysis now becoming as commonplace as their FDUERQFRXQWHUSDUWVEXVLQHVVHVDUHVHHNLQJPRUHRSSRUWXQLWLHVIRUH˨FLHQF\ and optimisation.

A commercial advantage :DWHUH˨FLHQF\DQGFRPPHUFLDOVXFFHVVDUHVORZO\EHLQJYLHZHGDVV\PELRWLF Independent environmental data organisation, the Carbon Disclosure Project (CDP) argues: â&#x20AC;&#x153;Successful businesses will be those that can capitalise on changing global water availability, measure and manage their water use, and manage the risks that water shortage can pose to their supply chain.â&#x20AC;? +RZHYHUVLQFHZDWHULVFKHDSHUWKDQRWKHUUHVRXUFHVqLWVSULFHKDVVFDUFHO\UHĂ&#x;HFWHG it value â&#x20AC;&#x201C; it has until recently been overlooked as a resource which costs businesses money. According to waste reduction body Waste & Resources Action Programme (WRAP), many businesses are unaware of how much water they are using and very few actually measure and monitor water consumption in their buildings. Moreover, nearly half (47%) of executives surveyed as part of a recent British Retail Consortium (BRC) survey believe acting on sustainability issues such as water scarcity ZRXOGGHFUHDVHSURĂ&#x17E;WV6LPLODUO\DVXUYH\RIKLJKOHYHOH[HFXWLYHVFRQGXFWHGE\ WKH&DUERQ7UXVWIRXQGPRVWRIWKH&/HYHOH[HFXWLYHVGRQmWEHOLHYHWKH\QHHGWRPDNH VLJQLĂ&#x17E;FDQWFKDQJHVLQWKHLUEXVLQHVVRSHUDWLRQVWRFRPEDWUHVRXUFHVFDUFLW\ LQFOXGLQJ DGGUHVVLQJZDWHUVKRUWDJHV XQWLODQGRYHUKDYHQRWGHYHORSHGJRDOVWRUHGXFH company water consumption, waste production or carbon emissions. 7KHĂ&#x17E;QGLQJVDUHDODUPLQJJLYHQUHFHQWHVWLPDWHVVKRZHGFXUUHQWnEXVLQHVVDV usualâ&#x20AC;? water management practices and levels of water productivity could put at risk DSSUR[LPDWHO\WULOOLRQRURIWKHSURMHFWHGJOREDO*'3 DWSULFHV 7KH 2012 report, by Veolia Water and the International Food Policy Research Institute (IFPRI), IRXQGIDLOLQJWRDFWRQZDWHUZRXOGFRVWWKHHTXLYDOHQWWRWLPHVWKHVL]HRIWRGD\mV entire global economy. Research by the UK Department for Environment, Food and Rural $˧DLUV 'HIUD LQDGGLWLRQVXJJHVWVWKDW8.EXVLQHVVHVVSHFLĂ&#x17E;FDOO\FRXOGEHPLVVLQJRXW on combined cost savings of as much as ÂŁ1 billion per year by failing to maximise the SRWHQWLDORIZDWHUH˨FLHQF\


In defence of inaction So who or what is to blame for water being R˧WKHEXVLQHVVUDGDUIRUVRORQJ)RU:5$3WKH UHDVRQERLOVGRZQWRDJHQHUDOODFNRIDZDUHQHVVRIWKH EHQHÞWVRIDGRSWLQJZDWHUH˨FLHQF\PHDVXUHVZKLFK nKDVVWLßHGDFWLRQVRIDUo:KLOHPDQ\EXVLQHVVHVDUH LQFUHDVLQJO\UHFRJQLVLQJWKHFRPPHUFLDODGYDQWDJHVWR ZDWHUPDQDJHPHQWVRPHUHPDLQREOLYLRXVWRWKHVLPSOHVW WKLQJVWKH\FDQGRWRUHGXFHFRQVXPSWLRQ,QDFRPPHUFLDO HQYLURQPHQWORZFRVWPHDVXUHVVXFKDVÞWWLQJFLVWHUQ YROXPHDGMXVWHUVLQ:&VUHGXFLQJWDSDQGVKRZHUßRZ UDWHVDQGÞWWLQJXULQDOßXVKFRQWUROOHUVFDQDOOSURYLGH TXLFNZLQVDUJXHV:5$3 0RUJDQ-RQHVFUHDWRURIWKH&DUERQ7UXVW:DWHU 6WDQGDUGEHOLHYHVZKLOHnZDWHUVFDUFLW\KDVEHFRPH DJUHDWHULVVXH>FRPPHUFLDOO\@oVRPHEXVLQHVVHVDUH VWUXJJOLQJWRGHDOH˧HFWLYHO\ZLWKWKHSUREOHP/RJLVWLFDO LVVXHVVXFKDVPHWUHVQRWEHLQJLQSODFHRUZLWKLQHDV\DFFHVV DUHVLPSOHEXWLPPHGLDWHO\SUHYHQWDWLYHREVWDFOHVWRSURJUHVVKH WHOOV5HWDLO(QYLURQPHQW,WLVDOVRDSSHDUVPRUHOLNHO\WKDWODUJHU UHWDLOVWRUHVWKRVHFRQVXPLQJPRUHZDWHUDUHLPSOHPHQWLQJEHWWHU PHDVXUHVIDVWHUKHDGGV ,QEURDGWHUPVUHWDLOHUVQHHGWRPDQDJHWKHLUULVNVDQG GHSHQGHQFLHVRIDFFHVVWRKLJKTXDOLW\ZDWHUVXSSOLHVDQGGHDOLQJ ZLWKVXUIDFHZDWHUWUDGHH˩XHQWDQGZDVWHZDWHULQDZD\ZKLFKLV H˧HFWLYHH˨FLHQWDQGHQYLURQPHQWDOO\VRXQG7KHVHPHDVXUHVZLOO EHFRVWO\PRQH\WKHUHWDLOVHFWRUVWLOOUHFRYHULQJIURPWKHEORZVRI UHFHVVLRQLVÞQGLQJKDUGWRVZDOORZ&RQVHTXHQWO\PHDVXUHVWKDW UHTXLUHLQYHVWPHQWSD\EDFNSHULRGVRIPRUHWKDQPRQWKVDUH RIWHQFLWHGDVEHLQJWRRORQJDQGIRUEXVLQHVVHVWKDWOHDVHWKH EXLOGLQJVWKH\RFFXS\WKHUHLVHYHQOHVVLQFHQWLYHWRLQYHVWLQZDWHU H˨FLHQF\PHDVXUHV 2YHUWKHODVWIHZ\HDUVWKRVHUHVSRQVLEOHIRUZDWHUPDQDJHPHQW KDYHVHHQWKHLUEXGJHWVVTXHH]HGDORQJZLWKDQLQFUHDVLQJSUHVVXUH IURPDERYHIRUVKRUWHUSD\EDFNSHULRGVRQLQYHVWPHQWV$VVXFKWKH EXGJHWVWKDWEHFRPHDYDLODEOHDUHRIWHQDOORFDWHGWRDUHDVZKHUHWKH ELJJHVWJDLQVFDQEHPDGHIRUH[DPSOHLQHQHUJ\UHGXFWLRQ+RZHYHU LIZDWHUVXSSO\DQGGLVFKDUJHFRVWVDQGWKHDVVRFLDWHGHQHUJ\FRVWV IRUKHDWLQJZDWHUDUHWDNHQLQWRDFFRXQWWKHEXVLQHVVFDVHFDQEH

H&MKDVSOHGJHGRYHU WKHQH[WWKUHH\HDUV WRZRUNZLWK::)WR LPSOHPHQWDKROLVWLF ZDWHUVWHZDUGVKLS VWUDWHJ\DLPHGDW VHWWLQJQHZVWDQGDUGV IRULWVnLQGXVWU\DQG EH\RQGo6RPH million litres of water KDVDOUHDG\EHHQVDYHG LQWKHSURGXFWLRQRI GHQLPDQGRWKHUZDWHU LQWHQVHSURGXFWVE\ DSSO\LQJZDWHUVDYLQJ SURGXFWLRQWHFKQLTXHV

MAY 2013 | RETAIL ENVIRONMENT 21


THE WHOLE IS GREATER THAN THE SUM OF THE PARTS

PARTNERSHIPS In partnership with Helistrat, M&S achieved its Plan A objective of zero waste to landfill ahead of schedule. Helistrat can do the same for you. We maximise the revenue from your recyclables with none of the residue going to landfill. For the story behind the headline M&S’ Mandy Keepax and Helistrat’s’ Joy Donnell will be speaking about Partnerships for Achievement at the Facilities Show on Thursday, 16 May at 1:30. Helistrat is on stand 2B66 come and talk to us about how our partnerships deliver added value as well as zero waste to landfill.

02392 604 773 www.helistrat.co.uk info@helistrat.co.uk


COVER STORY

Sainsbury’sKDVEHHQ ZRUNLQJFORVHO\ZLWKWKH water management specialists, Waterscan, and achieved its target RIDUHODWLYHUHGXFWLRQLQLWV ZDWHUXVHE\WKHHQGRI0DUFK 2013. Rainwater harvesting is EHLQJLQVWDOOHGLQDOOQHZVWRUHV DVVWDQGDUGDQGLWLVFXUUHQWO\ ORRNLQJDWUHWURÞWWLQJUDLQZDWHU KDUYHVWLQJXQLWVLQH[LVWLQJ VWRUHV)RUH[DPSOHDXQLW UHWURÞWWHGDW6DLQVEXU\mV6ZDQVHD QRZVXSSOLHVZDWHUIRUWRLOHW ßXVKLQJLQWKHVWRUHDQGKDV DFKLHYHGDQDQQXDOPDLQVZDWHU FRQVXPSWLRQVDYLQJRIP3. 6DLQVEXU\mVKDVDOVRLQYHVWHGLQ FDUZDVKZDWHUUHFODLPXQLWVDW RILWVVWRUHVVDYLQJQLQH2O\PSLF sized swimming pools worth of ZDWHUHDFK\HDU P3).

compelling, according to WRAP. Moreover, for those WKDWGRLQYHVWLQZDWHUH˨FLHQF\PHDVXUHVDQXPEHU of schemes are in place to help. Defra and HMRC’s Enhanced Capital Allowance (ECA) scheme allows FRPSDQLHVWRSXUFKDVHWKHZDWHUVDYLQJSURGXFWV OLVWHGRQWKH:DWHU7HFKQRORJ\/LVWPDNLQJWKHP HOLJLEOHIRUWD[UHOLHIRQWKHLULQYHVWPHQWZKLFK LQWXUQUHGXFHVWKHFRVWRILQYHVWPHQWDQGWKH SD\EDFNSHULRG

Headway

In 2012, RI ZDWHUXVH in the retail sector was PHDVXUHG XSIURP LQ 

,WLVQRWWRVD\SURJUHVVKDVQmWEHHQPDGHqLWKDV LQOHDSVDQGERXQGV7KH%5&IRXQGLQ RIZDWHUXVHLQWKHUHWDLOVHFWRUZDVPHDVXUHG XSIURPLQ7KLVEHKDYLRXUDOVKLIWFDQ EHDWWULEXWHGWRDQXPEHURIIDFWRUV1HFHVVLW\ UHSXWDWLRQDOULVNHQYLURQPHQWDODZDUHQHVV DQGFRPSHWLWLRQKDVVHHQZDWHUULVHXSRQWKH VXVWDLQDELOLW\DJHQGDDQGOHDNLWVZD\LQWRPDMRU FRQIHUHQFHVDQGGLVFXVVLRQSDSHUV:DWHUFULVHV ZHUHQDPHGDPRQJWKHWRSIRXUJOREDOULVNVDWWKH :RUOG(FRQRPLF)RUXPLQ'DYRVWKLV\HDU81 VHFUHWDU\JHQHUDO%DQ.L0RRQUHPLQGHG&(2VDQG ZRUOGOHDGHUVnPRVWRIXVGRQRW DSSUHFLDWHZDWHU:HMXVWWDNHLW for granted”. /RQGRQÃV:KLWH&LW\:HVWÞHOG, Lagging action has prompted ZLWKLWVPLOOLRQDQQXDOYLVLWRUV VHYHUDOOHDGLQJHQYLURQPHQWDODQGZDVWHRUJDQLVDWLRQVWRFRPHIRUZDUGZLWKNH\ LQLWLDWLYHVWRVWHHUEXVLQHVVHVRQWREHWWHUZDWHUPDQDJHPHQW:5$3mVVRFDOOHG5LSSOH˧HFW HPSOR\HHVDQGSXEOLF VXSSRUWSDFNDJHIRUH[DPSOHKHOSVEXVLQHVVHVXQGHUVWDQGKRZPXFKZDWHUWKH\DUH toilets hired water management XVLQJDQGLGHQWLÞHVZD\VWRPDNHVDYLQJV7KHRUJDQLVDWLRQVD\VWKDWLWLVSRVVLEOHIRU VSHFLDOLVW$TXDOLW\7UDGLQJ EXVLQHVVHVWKDWKDYHQRWWDNHQDQ\SUHYLRXVDFWLRQWRUHGXFHZDWHUXVDJHE\WKURXJK &RQVXOWLQJWRLQWURGXFHD ORZWRQRFRVWLQLWLDWLYHV)RUWKRVHWKDWPDNHIXUWKHUFDSLWDOLQYHVWPHQWWKLVFDQLQFUHDVH UDLQZDWHUKDUYHVWLQJV\VWHP WR WKDWFRXOGUDGLFDOO\LPSURYHWKH 7KH&DUERQ7UXVWNQRZQÞUVWDQGIRUHPRVWIRULWVFDUERQUHSRUWLQJWRROVWKLV\HDU environmental performance of WXUQHGLWVKDQGVWRQHZZDWHUFHUWLÞFDWLRQVWDQGDUGV7KHVFKHPHLVGHVLJQHGWRKHOS the shopping centre and deliver EXVLQHVVHVFROOHFWGDWDRQUHVRXUFHXVHVRWKDWLWFDQH[DPLQHWKHGDWDDQGXQGHUVWDQG SD\EDFNLQXQGHUÞYH\HDUV7KH WKHWUHQGVDQGH[SRVXUHWRULVNn$QRUJDQLVDWLRQmVDELOLW\WRPHDVXUHDQGDFFRXQWIRUWKH VLWHDOUHDG\KDGWZRP3 ZDWHULWXVHVDQGGLVFKDUJHVLQLWVRZQRSHUDWLRQVDQGWKHZDWHUHPEHGGHGLQLWVVXSSO\ DWWHQXDWLRQWDQNVIRUßRRG FKDLQLVDQLPSRUWDQWFRPSRQHQWLQXQGHUVWDQGLQJWKHEXVLQHVVULVNVRILQFUHDVLQJZDWHU FRQWUROWRKHOSGHOD\WKHUXQR˧RI VFDUFLW\oDFFRUGLQJWRWKH7UXVW UDLQZDWHULQWRWKHVHZHU$TXDOLW\ n7KRVHRUJDQLVDWLRQVWKDWFDQDFKLHYHWKHFHUWLÞFDWLRQDUHDEOHWRFODLPWKH WDLORUHGWKHVHH[LVWLQJIDFLOLWLHV UHSXWDWLRQDOEHQHÞWVWKDWFRPHIURPEHLQJLQGHSHQGHQWO\FHUWLÞHGDQGUHFRJQLVHGDV E\FRPELQLQJWKHDWWHQXDWLRQ OHDGHUVZLWKLQWKHLUVHFWRUVLQPDQDJLQJDGZLQGOLQJUHVRXUFHoLWDGGV,Q)HEUXDU\ 6DLQVEXU\mVEHFDPHRQHRIWKHÞUVWRUJDQLVDWLRQVDQGWKHÞUVWUHWDLOHUWRDFKLHYHWKH WDQNVZLWKWKHVWRUDJHWDQNVIRU &DUERQ7UXVW:DWHU6WDQGDUG WKHUDLQZDWHUKDUYHVWLQJV\VWHP 7KH&'3DQRWKHURUJDQLVDWLRQSUHYLRXVO\WRKDYHIRFXVHGSULPDULO\RQFDUERQnLQ qH˧HFWLYHO\FUHDWLQJDWDQNWKDW UHDFWLRQWRWKHZDWHUFULVLVoSXWLWVVSRWOLJKWZDWHU)RXU\HDUVDJRWKHRUJDQLVDWLRQ ZRXOGXWLOLVHWKHVWRUDJHYROXPHRI ODXQFKHGn&'3:DWHU'LVFORVXUHmZKLFKHYHU\\HDUVLQFHKDVDVNHGRYHURI WKHH[LVWLQJDWWHQXDWLRQXQLWV WKHZRUOGmVPRVWZDWHULQWHQVLYHFRPSDQLHVWRGLVFORVHEXVLQHVVFULWLFDOZDWHU UHODWHGLQIRUPDWLRQWRLQIRUPWKHLUGHFLVLRQPDNLQJSURFHVVHVDQGGULYHVWUDWHJLF

MAY 2013 | RETAIL ENVIRONMENT 23


COVER STORY

â&#x20AC;&#x153;Successful businesses will be those that can capitalise on changing global water availability, measure and manage their water use, and manage the risks that water shortage can pose to their supply chainâ&#x20AC;? investment. The surveys latterly have received a 50% response rate, a percentage which is only rising as businesses begin to react â&#x20AC;&#x153; out of awareness and necessity,â&#x20AC;? according head of water at the CDP, Cate Lamb. While businesses, including the retail sector, are waking up to the importance of better water management there has been, and still â&#x20AC;&#x153;very much is a cavalier attitude to water,â&#x20AC;? according to Ms Lamb. â&#x20AC;&#x153;Without water you have QREXVLQHVVe,IZDWHULVQRWDFFRXQWHGIRUVRRQ>WKH\@PD\Ă&#x17E;QGWKHPVHOYHVLQD SRVLWLRQZKHUHEXVLQHVVLVJURVVO\D˧HFWHGoEHOLHYHV Ms Lamb.

Looking ahead 7KHUHWDLOVHFWRULVPDNLQJVLJQLĂ&#x17E;FDQWVWULGHVLQZDWHUPDQDJHPHQW2QVLWHPHDVXUHVLQFOXGLQJ LQVWDOOLQJV\VWHPVWRUHGXFHZDWHUXVHVXFKDVUDLQZDWHUKDUYHVWLQJV\VWHPVZDWHUUHXVHV\VWHPV DQGEHWWHUVWD˧WUDLQLQJDUHEHFRPLQJPRUHFRPPRQSODFH+RZHYHUWKHELJJHUFKDOOHQJHIRU the sector will be to reduce the water used in global supply chains, particularly in areas of water stress. Part of this will come down to developing a greater understanding and relationship with its source base, something the retail sector is already beginning to investigate. :KLOHSURJUDPPHVVXFKDVWKH5LSSOH˧HFW(YHU\/DVW'URS&DPSDLJQ&DUERQ7UXVW Water Standard and CDP Water Disclosure are helping spur this on, there are still relatively few internationally recognised accounting standards and a limited number of water meters from which to take measurements. Accountability and reporting will allow the sector to put new insight at the heart of strategic business, investment and policy decisions which in turn will not RQO\FRQVHUYHWKHUHVRXUFHEXWZLOODOVRVDYHPRQH\+ROLVWLFDSSURDFKHVJUHDWHUFROODERUDWLRQ internationally and more responsibility taken from the very top strata of management will be key to tackling water management.

24 5(7$,/(19,5210(17| MAY 2013

The Sunlight Group reduced water usage through redesigning its wash processes and investing over ÂŁ2m in equipment and systems to clean DQGWKHQUHXVHZDWHU The laundry service Group has been able to reduce water usage by one billion litres per year. By achieving this, Sunlight, also saved hundreds of tonnes of carbon dioxide emissions every year, because less water needed to be pumped and treated. It is one of the Ă&#x17E;UVWFRPSDQLHVDORQJ with Sainsburyâ&#x20AC;&#x2122;s, to be awarded the Carbon Trust Water Standard.


WHY GET INVOLVED? šStimulateYZWViZidYg^kZ^begdkZbZcišEducateVcYXdccZXil^i]i]ZcZmi\ZcZgVi^dc šCelebrateegd\gZhh^cYg^k^c\YdlclVhiZšShowcase^ccdkVi^dcVcYrecogniseWZhiegVXi^XZ š@ZZejel^i]currentaZ\^haVi^dc Winners from the retail sector: GOLD:Jc^iZY7^hXj^ih#SILVER:7dd`ed^ciAiYq8]Vcign8ZcigZq9^V\Zd7Za[VhiEVX`V\^c\qB^YaVcYh8d"DeZgVi^kZqGdb[dgY7gZlZgnqI]Z=ZVgiH]dee^c\8ZcigZ# BRONZE:6^gZYVaZ8dbejiZgGZXnXa^c\q6h]aZnH]dee^c\8ZcigZq6iaVci^XK^aaV\ZH]dee^c\8ZcigZq:aVc=V^g9Zh^\cq@^c\hidlc;jgc^ijgZ L]^iZ[g^VghH]dee^c\8ZcigZqLdda\ViZH]dee^c\8ZcigZ#

SUBMIT YOUR ENTRY BY 1st JUNE 2013, simply… šVisit www.zerowasteawards.com šRead the judging criteria šUpload your entry and supporting material via the easy online entry form

7gdj\]iidndjWn/

HedchdgZYWn/

WEBINARSS 29th May 2013

GREENSTEPS TO THE CIRCULAR ECONOMY šPractical steps to help your organisation turn waste into a valuable resource šCase studies showcasing what forward thinking organisations are achieving today šFuture innovations Speaker1: Stuart Hayward-Higham, 9ZkZadebZci9^gZXidg! SITA UK

WHO SHOULD ATTEND? š>cYZeZcYZcigZiV^aZgh šBjai^eaZgZiV^aZgh šH]dee^c\XZcigZh š>cYjhignVhhdX^Vi^dch šGZiV^ahjeea^Zgh š;B8<hegdk^YZgh

Speaker 2: tbc

BROUGHT TO YOU BY:

;DGBDG:>C;DGB6I>DC6C9ID7DD@ NDJGEA68:HID96N!K>H>I

WWW.LETSRECYCLE.COM/EVENTS

AFFINITY PARTNER:


SPOTLIGHT The Chavasse Park is described by Liverpool ONE as itâ&#x20AC;&#x2122;s â&#x20AC;&#x153;jewel in the crownâ&#x20AC;? providing an oasis of calm when it is not used for oneR˧DQGVHDVRQDOHYHQWV

Community beneďŹ t Liverpool ONE has a big part to play on the regional stage, from retail through to the community. Steve Eminton reports

26 RETAIL ENVIRONMENT | MAY 2013

The 1.65 million sq ft shopping and leisure complex of Liverpool ONE has more of an environmental challenge than many city centre retail developments. ,WKDVWKHFKDOOHQJHRIĂ&#x17E;WWLQJLQZLWKWKHORFDODUHDZKHUHLWIRUPV SDUWRIDVWUHHWV\VWHPUDWKHUWKDQEHLQJDVWDQGDORQHGHYHORSPHQWLW VHUYHVDVDWRXULVPGHVWLQDWLRQLQDFLW\NHHQWRERRVWYLVLWRUQXPEHUV DQGLPSRUWDQWO\LWLVDODUJHSULYDWHVHFWRURSHUDWLRQZKLFKKDVFUHDWHG KXQGUHGVRIMREV 7KHSULYDWHVHFWRULQYHVWPHQWPDGHE\*URVYHQRURIDSSUR[LPDWHO\ zELOOLRQLQGHYHORSLQJ/LYHUSRRO21(FRQWULEXWHVWRWKHVWUDWHJ\RI /LYHUSRRO&LW\5HJLRQDUHJLRQDORUJDQLVDWLRQOHGE\WKHFLW\FRXQFLO 7KHUHJLRQDOERG\KDVGHYHORSHGDVWURQJHYLGHQFHEDVHZKLFKLW VD\VnVXSSRUWVWKHQHHGIRUHFRQRPLFJURZWKDQGZKLFKLGHQWLĂ&#x17E;HVWKRVH DUHDVRIRSSRUWXQLW\WRFUHDWHEXVLQHVVJURZWKDQGMREV2XUSULRULW\ LVWRPRYHIURPDSXEOLFVHFWRUGRPLQDWHGHFRQRP\WRDSULYDWHVHFWRU EDVHGHFRQRP\o ,QDVXEPLVVLRQWRWKHJRYHUQPHQWRQWKHQHHGIRU SXEOLFVXSSRUWWREDFNGHYHORSPHQWVWKHUHJLRQQRWHVWKDW n7KHUHLVPXFKHYLGHQFHRIORQJODVWLQJWUDQVIRUPDWLRQRIDVVHWVDQG SK\VLFDOLPSURYHPHQW7KHUHKDVEHHQVLJQLĂ&#x17E;FDQWSULYDWHDQGSXEOLF VHFWRULQYHVWPHQW)RUH[DPSOH*URVYHQRUmVzEQLQYHVWPHQWLQ /LYHUSRRO21(o /LYHUSRRO21(ZKLFKLQFOXGHVVKRSVPRUHWKDQEDUVDQG UHVWDXUDQWVDVFUHHQFLQHPDDQGDĂ&#x17E;YHDFUHSDUNDFFRUGLQJO\KDV


work to do to ensure it performs on the environmental front, in terms of everything from energy through to the community in a city where job creation, environmental improvements and economic development are all vital. A key element of the scheme’s activities are run and developed by Cath Riseborough, Liverpool ONE’s CSR manager who has a role that ranges from working in the community through to helping ensure the environmental impact of the estate is monitored and minimised. She joined the Liverpool ONE team in May 2011 and has brought focus to what the scheme does in its CSR activities including education and community work. Monitoring of Liverpool ONE’s environmental impacts has been carried out for the past four years using Carbon Guerilla monitoring software, run by Computatis, and results of this are to form the basis of a CSR report which will be published this spring.

Waste management In terms of some of the practicalities of the estate’s environmental work, energy and waste management DUHVLJQLÞFDQW0V5LVHERURXJKH[SODLQVWKDW “dealing with waste materials through recycling

is one of the biggest areas to alleviate impact. Separate zones are arranged back of house with material collected by Veolia Environmental Services for recycling. “We have a waste team who work from a few GL˧HUHQWSRLQWVRQVLWHDQGZHKDYHPHDVXUHG tonnage for the last few years - cardboard, glass, PHWDOVLQFOXGLQJPDWHULDOOHIWIURPVKRSÞWWLQJ ZRUNDQGRWKHULWHPVVXFKDVFR˧HHJUDQXOHVIURP shops. Green waste from the estate’s park at its top level is also collected. In 2012 a recycling level of 40% was achieved up from the previous year with the material collected commingled and then sorted by Veolia. Avoidance RIODQGÞOOLVEHLQJWDUJHWHGE\/LYHUSRRO21(DQG so far the diversion rate stands at 86% with energy from waste, composting and recycling contributing WRWKLVÞJXUH Food waste remains one of the areas that remains a challenge and Liverpool ONE is actively developing plans to allow for the provision of a food waste collection service and is currently investigating the installation of a biomass waste to water system.

“Dealing with waste materials through recycling is one of the biggest areas to alleviate impact”

MAY 2013 | RETAIL ENVIRONMENT 27


SPOTLIGHT

Energy In terms of utilities, electricity usage has the biggest impact at Liverpool ONE. The energy management system, Energy Manager, is used to track electricity meters with attention paid to spikes in usage which can be targeted and usage proactively controlled. The extent of the back of house area at Liverpool ONE is almost as large as the retail frontage and of necessity demands good lighting. Ms Riseborough explains: â&#x20AC;&#x153;We almost have more space underground than upfront. LED lighting and PIRs have also been installed to reduce electricity consumption.â&#x20AC;? Energy savings have been made on the CCTV IURQW7KLVXVHGWRUXQR˧VHUYHUVZKLFK have now been reduced to four. Actual energy JHQHUDWLRQRQVLWHLVVWLOOVRPHZD\R˧DOWKRXJK rainwater harvesting is carried out. The potential for generating solar power is an option and is the subject of ongoing study work but there are no plans in the shorter term. More details of the environmental impact are to be given in a report to the estateâ&#x20AC;&#x2122;s Board this spring, and this will look at both CSR and environmental activities.

Community One of Ms Riseboroughâ&#x20AC;&#x2122;s early tasks was to assess the schemeâ&#x20AC;&#x2122;s involvement with the community as Liverpool ONE was involved in a large number RISURMHFWVLQDZD\ZKLFKFRXOGEHQHĂ&#x17E;WIURP improvements, to some extent saying â&#x20AC;&#x2DC;yesâ&#x20AC;&#x2122; to most requests for backing or involvement. â&#x20AC;&#x153;We were doing a lot of things in the community ZKLFKZHUHYHU\VSUHDGRXWDQGRQHRIWKHĂ&#x17E;UVW

28 RETAIL ENVIRONMENT | MAY 2013

decisions I had to take was to determine what was right for us to get involved in and what we were unfortunately unable to support,â&#x20AC;? she explains. The community involvement, she emphasises, is very important to the estate and it is determined to get it right as well ensuring it helps both the image and success or the retailers at the heart of the business.

City council Delivering on community and environmental work is important in the links with the city as a whole which is aware of the important part that Liverpool ONE has played in terms of jobs, regeneration and tourism while also wanting it contribute more broadly to the city. Ms Riseborough says she believes the city is pleased with what it does. â&#x20AC;&#x153;The city council has a big push to be green so I think us being here is an asset for the city. The park at the top of the scheme is one of the greenest DUHDVRIWKHFLW\Ă&#x17E;YHDFUHVLQ H˧HFWDJUHHQURRIWRDVSDFHFDUSDUNDQGLWLV possibly the largest green roof in Europe.â&#x20AC;? The â&#x20AC;&#x2DC;Chavasse Parkâ&#x20AC;&#x2122; as the greenspace and gardens are known, is described by Liverpool ONE as its â&#x20AC;&#x2DC;jewel in the crownâ&#x20AC;&#x2122; providing an oasis of calm, although it is not always quite so quiet for it FRQWULEXWHVWRFRPPXQLW\XVHDVDYHQXHIRURQHR˧ and seasonal events â&#x20AC;&#x153;We have a big events programme for the community,â&#x20AC;? she says. â&#x20AC;&#x153;Over the winter we have had an ice rink and in the summer we had a beach. Back in 2011 we had a huge crowd to watch the royal Wedding. Music events have included the proms and all sorts of things.

â&#x20AC;&#x153;The energy management system, Energy Manager, is used to track electricity meters with attention paid to spikes in usage which can be targeted and usage proactively controlledâ&#x20AC;?

Liverpool ONE is home to 160 shops, more than 20 bars and restaurants and a 14-screen cinema


Knowledge isn’t just power; it’s energy. Kawneer’s smart, healthy and secure solutions go beyond energy savings to meet the challenges of today’s construction market and help you fulfill your sustainability objectives. By combining high-performance and value engineered products with decision support from our Architectural Services Team, you won’t have to worry about comparing apples to oranges. Together, we can energise architecture. EVERY DAY YOU MAKE A CHOICE. MAKE A CHOICE THAT COUNTS!

Architectural Aluminium Systems Curtain Walls + Brise Soleil Windows Sliding Solutions Entrance Doors + Framing Tel: 01928 502500 Email: kuk.kawneer@alcoa.com www.kawneer.co.uk


SPOTLIGHT

Liverpool ONEâ&#x20AC;&#x2122;s Thomas Steers Way

n7KLVDOOFRQWULEXWHVWRWKHFRPPXQLW\EHQHĂ&#x17E;WRI /LYHUSRRO21(:HDUHGHĂ&#x17E;QLWHO\SOHDVHGDERXWKRZ SRSXODUWKHSDUNLV:HKDYHDOVRZRUNHGZLWKFKDULWLHV WRSXWXSEXJER[HVDQGELUGER[HVDQGZHKDYH WUHHVPRVWRQWKHSDUNZKLFKKDYHUHFHQWO\EHHQJLYHQ DIXOOKHDOWKFKHFNo

Education 2QWKHHGXFDWLRQIURQWWRXUVDUHUXQDQGWKHHVWDWH has launched education resources. These have been ZRUNHGRQZLWK/LYHUSRRO-RKQ0RRUHV8QLYHUVLW\DQG their teacher training students. Students got involved DVSDUWRIWKHLUHQULFKPHQWDFWLYLWLHVDQGGHYHORSHGWKH UHVRXUFHVDQGWKHQWHVWHGWKHPZLWKORFDOWHDFKHUV 7KHUHLVDYDULHW\RIPDWHULDOIRUWKHPRUHREYLRXV topics such as geography and leisure and tourism and also business studies. And, the estate also ZRUNVZLWKFKDULW\SDUWQHUVWRKHOSZLWKHGXFDWLRQ DQGJHWVLQYROYHGLQSURYLGLQJPRFNLQWHUYLHZVIRU \RXQJSHRSOHDVZHOODVKRVWLQJ(QWHUSULVH'D\V0V Riseborough is clear about the commitment to the SXEOLFn,WKLQNZHGRKDYHDFRQVLGHUDEOHUHVSRQVLELOLW\ WRWKHFRPPXQLW\ZHVHHRXUVHOYHVDVDQLQWHJUDOSDUW RI/LYHUSRROo

CSR and jobs $WRWDORISHRSOHZRUNIRUWKH/LYHUSRRO21( PDQDJHPHQWRUJDQLVDWLRQZLWKRYHUIURPWKHORFDO DUHD7KLVLVMXVWSDUWRIWKH&65UHVSRQVLELOLW\VKH IHHOV7KHUHLVDOVRWKHZRUNE\/LYHUSRRO21(DQGWKH UHWDLOHUVRQDYRLGLQJWKHODQGĂ&#x17E;OOLQJRIZDVWHZKHUHnZH ZLOOZRUNZLWKWKHPWRJHWLWDVH˧HFWLYHDVFDQEHDQG ZHKDYHDQRQJRLQJGLVFXVVLRQZLWKUHWDLOHUVo n2QWKH&65IURQWZHDUHORRNLQJDWZKDWUHWDLOHUV GRLQWHUPVRIFKDULW\WRVHHLIWKHUHDUHZD\VZHFDQ EHQHĂ&#x17E;WERWKVLGHVIURPWKHZRUNZHDUHGRLQJRUE\ ZRUNLQJWRJHWKHUo6SHFLĂ&#x17E;FVXSSRUWLVJLYHQWRWKH

30 RETAIL ENVIRONMENT | MAY 2013

%UXQVZLFN<RXWKDQG&RPPXQLW\&HQWUHLQ%RRWOH XQGHUDWZR\HDUSDUWQHUVKLS)XQGUDLVLQJKDVLQFOXGHG DVZDSVKRSHYHQWLQ-DQXDU\ZKHUHUHWDLOHUVZHUH DVNLQJLIWKH\ZHUHZLOOLQJWRGRQDWHWRWKHHYHQW /LYHUSRRO21(DOVRKDVLWVRZQFKDULW\IXQG WKH/LYHUSRRO21()RXQGDWLRQZKLFKZDVVHWXSE\ *URVYHQRULQWKHGHYHORSPHQWSKDVHVRI/LYHUSRRO21( DQGGRQDWHVPRQH\WRFKDULWLHVWKURXJKDQHQGRZPHQW IXQGRIDERXWzPLOOLRQVHFRQGRQO\RQ0HUVH\VLGH WR-DPLH&DUUDJKHUmV)RXQGDWLRQ7KH/LYHUSRRO 21(HQGRZPHQWSURYLGHVDERXWzD\HDUIRU JUDVVURRWVFKDULW\ZRUN

Transport ,QWHUPVRIWUDQVSRUWDQGDFFHVVWRWKHVLWHZKLOH WKHJUHHQVSDFHIRUPVWKHURRIWRDODUJHFDUSDUN WKHHVWDWHLVNHHQWRSURPRWHWKHXVHRISXEOLFWUDYHO DQGZRUNVZLWKWKHVWRUHVWRORRNDWWUDYHOURXWHV0V 5LVHERURXJKUHPDUNVn:HDUHKXJJHGE\UDLOZD\ VWDWLRQVZLWKDEXVVWDWLRQDOPRVWRQVLWHDQGVRZH KDYHJUHDWDFFHVVLELOLW\WRSXEOLFWUDQVSRUWo Liverpool ONE has produced a Green Travel 'LUHFWRU\ZKLFKJLYHVDGYLFHRQWUDYHOOLQJE\EXVWUDLQ RUIHUU\WR/LYHUSRRO21(DVZHOODVE\ELNHRUFDU,W VWDWHVn/LYHUSRRO21(mVFLW\FHQWUHORFDWLRQPHDQVLW LVQRPRUHWKDQPLQXWHVZDONLQJGLVWDQFHIURPDOO ORFDOWUDQVSRUWIDFLOLWLHVo7KHVFKHPHKDVDGHVLJQDWHG F\FOHURXWHZKLFKOLQNVZHOOZLWKWKHH[LVWLQJFLW\ FHQWUHF\FOHQHWZRUNVDORQJZLWKVHFXUHF\FOHVWRUDJH IDFLOLWLHV7KHF\FOHVWRUHLVDVWDWHRIWKHDUWIDFLOLW\ PDQDJHGE\43DUNZLWKJDWHGVWRUDJHIRUF\FOHV Looking ahead, Liverpool ONE plans to build on LWVHQYLURQPHQWDODQGFRPPXQLW\ZRUNWRHQVXUH LWUHPDLQVDWWKHKHDUWRIWKHFRPPXQLW\DQGIXOĂ&#x17E;OV WKHDLPRIEXLOGLQJRQZKDWLWGHVFULEHVDVEHLQJWKH QHZnKHDUWRIWKHFLW\oVLQFHLWVR˨FLDORSHQLQJEDFN in May 2008.

CV - CATH RISEBOROUGH May 2011 CSR Manager Liverpool ONE May 2010 Freelance CSR and Fundraising Consultant working projects at Liverpool ONE and corporate volunteer activities for Rothschild in the Community 2007-2010 Corporate Responsibility 0Ę?DFS $JUZPG London 2005 â&#x20AC;&#x201C; 2007 Worked at various charities as a fundraiser 2003-2004 Warwick University: MA in Society and Culture in the Cold War 2000-2003 Warwick University: BA (Hons) History


Do YOU need help with Omni Channel retailing ?


ENERGY

e

n i g s i w g r a e st n E

More retailers are sending their food waste to anaerobic digestion, but few are utilising the energy from it.

32 RETAIL ENVIRONMENT | MAY 2013

Amy North takes a closer look at what options are available


Spiralling energy prices coupled with increasing pressure to be environmentally responsible is shifting the spotlight onto unconventional resources to power our energy needs. One such material to gain increasing commercial traction is waste, in particular food waste. While there is still a stigma attached to the term waste, it has proven to be a reliable fuel source helping to generate both UHQHZDEOHHOHFWULFLW\DQGKHDW3HUKDSVWKHPRVWH˨FLHQWZD\WR WUHDWIRRGZDVWHLVWKURXJK $' ZKLFKKDVVHYHUDOEHQHĂ&#x17E;WVDVLGH from the energy. )URPDĂ&#x17E;QDQFLDODQGHQYLURQPHQWDOSRLQWRIYLHZUHWDLOHUV primarily need to do all they can to prevent food waste from arising LQWKHĂ&#x17E;UVWSODFH+RZHYHUIRUWKHXQDYRLGDEOHZDVWHDQDHURELF GLJHVWLRQGRHVR˧HUDPXFKFKHDSHUDOWHUQDWLYHWKDQODQGĂ&#x17E;OOZLWK gate fees averaging between ÂŁ20 and ÂŁ50 per tonne depending on the type of material whereas ODQGĂ&#x17E;OOWD[DORQHLVzSHUWRQQH before a gate fee is even applied. This is the path being taken by many supermarkets who have signed contracts with waste PDQDJHPHQWĂ&#x17E;UPVWRFROOHFWDQG treat their food waste. Among these are Waitrose, Marks & Spencer and Sainsburyâ&#x20AC;&#x2122;s, the latter being the largest retail user of AD with all of its food waste VHQWIRUWUHDWPHQWE\%L˧D And itâ&#x20AC;&#x2122;s not just the large retailers getting involved. A number of VPDOOHUĂ&#x17E;UPVWKURXJKRXWWKHVXSSO\FKDLQDUHWDNLQJDGYDQWDJHRI WKHEHQHĂ&#x17E;WVRIVHQGLQJIRRGZDVWHWR$'$FFRUGLQJWRWKH:DVWH  Resources Action Programme (WRAP) many small and medium sized enterprises are keen to have their food waste recycled. The major driver behind this is the incremental year-on-year LQFUHDVHLQODQGĂ&#x17E;OOWD[,QLWZLOOUHDFKDSHDNRIzD tonne. Companies are likely to show an interest in any collection service which enables them to reduce their waste disposal costs, WRAP adds. There are a number of other reasons why food waste collections DUHEHFRPLQJPRUHSRSXODU0DWWKHZ+LQGOHSROLF\PDQDJHUIRU the Anaerobic Digestion and Biogas Association (ADBA) â&#x20AC;&#x201C; a not for SURĂ&#x17E;WRUJDQLVDWLRQUHSUHVHQWLQJEXVLQHVVHVLQWKH$'VHFWRUqVD\V corporate social responsibility (CSR) is also playing a part. â&#x20AC;&#x153;After disposal costs, the second consideration is how you make VXUH\RXJHWWKHJUHDWHVWHQYLURQPHQWDOEHQHĂ&#x17E;WVIURPWKHZDVWH that you are producing. That is becoming more and more important for businesses in terms of corporate social responsibility and their desire to reduce their carbon footprint. Again that has an economic EHQHĂ&#x17E;WDVZHOOLQWKHZD\WKDWVRPHHQYLURQPHQWDOWD[HVDUHVWDUWLQJ to come in. This means bigger businesses are looking in the direction of government policy and trying to gauge where it might be headed. â&#x20AC;&#x153;I think we will see more retailers rolling this out in the future and we are seeing it already. I think the key barrier from the point of view of a food waste producer is very simply the availability

of a collection scheme in the area and we are seeing that availability LQFUHDVHVRLWLVDJURZLQJWUHQGDQGZHH[SHFWLWWRFRQWLQXHo he adds. The UK currently doesnâ&#x20AC;&#x2122;t have the capacity to treat all of the IRRGZDVWHSURGXFHGE\EXVLQHVVHVDQGKRXVHKROGVVD\V0U+LQGOH DVKHH[SODLQVWKDWLQFUHDVLQJFDSDFLW\JRHVKDQGLQKDQGZLWK increasing collections.

Energy While more retailers are rolling out food waste collections, M&S is somewhat ahead of the curve having signed an energy deal with ZDVWHPDQDJHPHQWĂ&#x17E;UP6KDQNVZKLFKWUHDWVWKHZDVWHIURPLWV Scottish stores at its plant in Cumbernauld, Glasgow. Under the deal, M&S purchases 19,000 megawatt hours of renewable electricity â&#x20AC;&#x201C; enough to power 33 M&S Simply Food stores.

â&#x20AC;&#x153;If we look at the future of the market those deals where you are essentially signing a contract to buy that energy DUHJRLQJWREHPRUHDQGPRUHSRSXODUo Deals such as this are likely to be more common in the future, VD\V0U+LQGOHZKRH[SODLQVWKDWXQOLNHFROOHFWLRQVWKHUHDUHQmW any barriers in the way as it is simply a case of setting up a contract EHWZHHQWKHWZRĂ&#x17E;UPV â&#x20AC;&#x153;If we look at the future of the market those deals where you are essentially signing a contract to buy that energy are going to be more and more popular. In particular there is also an opportunity as we VHHWKHĂ&#x17E;UVWELRPHWKDQHWRJULGSURMHFWVFRPLQJRQOLQHZKLFKPHDQV that companies will be able to use the gas produced at a biomethane site to replace gas demand on site or put it into the vehicles that WKH\XVHo At the moment, the vast majority of electricity is fed directly into the national grid whereas the heat is often used on-site to heat the digester.

BV Dairy In some cases, it can also help to reduce electricity costs as a number of producers at the start of the supply chain are building their own plants which feed electricity and heat directly into their business. 2QHVXFKĂ&#x17E;UPLV%ODFNPRUH9DOH'DLU\ %9'DLU\ ZKLFKVXSSOLHV dairy products to food manufacturers. It opened its own AD plant at its site in Shaftesbury, Dorset in 2011. BV Dairyâ&#x20AC;&#x2122;s ÂŁ2.3 million plant, the majority of which was funded E\:5$3KDVWKHFDSDFLW\WRWUHDWWRQQHVRIZDVWHHYHU\ year. Alan McInnes, technical and operations director at BV Dairy, says there were a number of hurdles in getting the plant up and

MAY 2013 | RETAIL ENVIRONMENT 33


ENERGY

running. â&#x20AC;&#x153;At the time we did it, a lot of people GLGQmWXQGHUVWDQG$'DQGLWKDVWDNHQR˧Ă&#x17E;QDOO\ LQWKHODVWWKUHHRUIRXU\HDUV,WLVUHDOO\LPSRUWDQW to get help and get a consultant which we didnâ&#x20AC;&#x2122;t GRDQGZHVWUXJJOHGĂ&#x17E;QGLQJRXUZD\WKURXJKWKH legislation from environmental things in terms of permitting and from the Ofgem side of things,â&#x20AC;? KHVD\V 7KH$'SODQWZKLFKZDVEXLOWE\8.OLTXLGELR ZDVWHFRPSDQ\&OHDUĂ&#x;HDXSURFHVVHVZDVWHIURP WKHGDLU\PDQXIDFWXULQJSURFHVVDQG ZDVKZDWHUVZKLFKZDVSUHYLRXVO\WUHDWHGE\ WKHVHZDJHZRUNV7KHHOHFWULFLW\SURGXFHGIURP WKHSODQWLVXVHGE\%9'DLU\DQGPHHWVRILWV operational needs. At present, the heat is lost to atmosphere. â&#x20AC;&#x153;The heat we are working on at the moment is dispersed to atmosphere but we are looking at it to warm up the tanks to make the soft cheese which will in turn be used to make the permeate which goes to the plant. This means we will have a FORVHGORRSSURFHVV:HDUHORRNLQJWRGRWKDWODWHUWKLV\HDUo 2QWKHĂ&#x17E;QDQFLDOVLGHWKHSODQWLVEUHDNLQJHYHQDW SUHVHQWKRZHYHULI%9'DLU\FDQXWLOLVHWKHKHDW0U0F,QQHV LVFRQĂ&#x17E;GHQWLWZLOOEHDnVROLGSURĂ&#x17E;WPDNHUon,WKLQNRWKHU manufacturers should be taking advantage of this and using WKLVWHFKQRORJ\oKHDGGV %9'DLU\LVQRWWKHRQO\RQH6WDSOHV9HJHWDEOHVRQHRI WKHODUJHVWVXSSOLHUVRIEUDVVLFDVqFDEEDJHFDXOLĂ&#x;RZHU EURFFROL%UXVVHOVVSURXWVqIHHGVLWV$'SODQWRQLWV Lincolnshire site with out-of-spec vegetables, dual crops VXFKDVVZHHWFRUQDQGHQHUJ\FURSV7KHĂ&#x17E;UPXVHVWKH

HQHUJ\IURPWKHIDFLOLW\WRSRZHULWVSDFNKRXVHDQGWRVHOO to other consumers through the grid. It also uses the heat on-site. 6WDSOHV9HJHWDEOHVVD\VWKHZKROHSURMHFWXVHVDFORVHG ORRSV\VWHPZKLFKLVEDVHGRQDVXVWDLQDEOHF\FOHWKH SURGXFWWKDWVWDUWVRQWKHIDUPĂ&#x17E;QLVKHVRQWKHIDUP7KH waste generated on the farm is used to power operations within the business while the digestate is spread to the land as a soil improver. 2YHUDOO$'IDFLOLWLHVR˧HUWKH8.WKHSRWHQWLDOWRERRVW GRPHVWLFUHQHZDEOHHQHUJ\SURGXFWLRQZKLFKVRRQZLOO EHPRUHFRVWH˨FLHQWDVJULGSDULW\VWHSVHYHUFORVHU As more feedstock becomes available and the number of SODQWVLQFUHDVHWKLVSRWHQWLDOORRNVOLNHO\WREHPD[LPLVHG :KLOH$'PD\QHYHUEHDEOHWRPHHWWKH8.mVHQHUJ\QHHGV DORQHLWGRHVKDYHDQLPSRUWDQWUROHWRSOD\ZLWKWKHDGGHG ERQXVRIDOVRR˧HULQJDVXVWDLQDEOHURXWHIRUWKHGLVSRVDO of food waste.

HOW DOES ANAEROBIC DIGESTION WORK? Anaerobic digestion (AD) is the breakdown of organic matter in the absence PGPYZHFO*OBTUPNBDIMJLFUBOL UIFNBUFSJBMJTFĘ&#x17D;FDUJWFMZEJHFTUFEBOE is broken down into biogas (a mixture of carbon dioxide and methane) and a nutrient-rich digestate. The biogas can be burned to produce heat and electricity and the digestate, which comes in liquid and solid form, is most commonly used as a fertiliser. AD can be used to treat sewage, farm and food wastes.

A food waste alternative thatâ&#x20AC;&#x2122;s easy to stomach. See what we could save you at www.refood.co.uk or call 0800 011 3214.

34 RETAIL ENVIRONMENT | MAY 2013

â&#x20AC;&#x153;Demand for food waste recycling solutions is growing amongst businesses at every stage of the food chain. The use of AD plants such as ReFood provides food producers and retailers with DFRVWH˧HFWLYH sustainable alternative to the use of environmentally harmful options VXFKDVODQGĂ&#x17E;OORU LQFLQHUDWLRQĂ&#x2020;VD\V 3KLOLS6LPSVRQ commercial GLUHFWRU5H)RRG


S nd Se ndin in ng fo f od d was a te to la and n filll do do oes esn’ es n’tt m ke ma k se en nse e com mme m rc cia allly y,, soc cia all l y or envi en vironm vi viro ronm ro nmen e ta all lly. y.. ReF y eFoo o d, d the e UK K’’s le ead a in ng food food fo d was aste e re ec cy yc cliing ng spe eci c al a is ist, t, pro ovi vide des de es ag grree eene er, r saffer er and nd che h a ap per e altter erna na n ative tive ti ve.. Ou O ur na nati to on nwi w de e net etw wo ork of c cu uttttiin ngg ed edge dg ge e AD pla lant n s pr prov ovid ovid ide e a un niq que u , se ecu cure *Fi Fiigur gure e ba ase ed on Apri prill 2013 3 la andfi ndfill ll ratte vs. vs. s v vol o ume e we w igh ght ght gh

end-to en d-tto do-e -end nd sol nd ou uttio ion n th hat at con nv ve ertts food fo ood d wa w asstte in nto o re en ne ew wab able e ene erg rgy, y, cutts your y, yo y ourr ca arrb bon n foo ootp print rintt, an ri nd re redu d ce du ces fo ood od wasste t diisp d spossal al costs ossts by up o p to 40 40%* in n the e pro oce essss. S e wh Se what we co ou ulld sa s ve e you at www. ww w re efo ood od.c co. o.uk u or ca uk c ll l 0800 80 0 01 0 1 32 3 14 4.


ENERGY

The dark horse $FURVVWKHZRUOGELOOLRQV of rooftops and open spaces lie sparse and overlooked, R˧HULQJPLQLPDORU negative environmental EHQHĂ&#x17E;W0DQ\RIWKHODUJHVW EXLOGLQJVDUHKRPHWR UHWDLOHUVZKRFRXOGEH transforming spaces the VL]HRIIRRWEDOOSLWFKHVLQWR solar power platforms. While many have done just this, a reticence lingers over the majority of the industry. Charlotte Owen explores the reasons for this /RZKDQJLQJIUXLWVVXFKDV/('OLJKWLQJUHIULJHUDWRUGRRULQVWDOODWLRQDQGVLPSOHHQHUJ\H˨FLHQF\VFKHPHVDUHEHFRPLQJFRPPRQSODFH in the retail sector. The upfront investment isnâ&#x20AC;&#x2122;t backbreaking; the payback is short. In the midst of economic downturn and other new challenges WRD˧HFWEXVLQHVVWKHODVWWKLQJUHWDLOHUVPD\FRQVLGHULVDUHQHZDEOHHQHUJ\WHFKQRORJ\WKDWR˧HUVDSD\EDFNSRWHQWLDOO\XSWRVHYHQ\HDUVODWHU $IHZ\HDUVDJRWKHUDWHRIJRYHUQPHQWVXEVLGLHVZHUHDWWUDFWLYHSURPSWLQJPRUHEXVLQHVVOHDGHUVWRORRNXSZDUGVDQGH[SORUHWKHXVHRIWKH VSDFHEHWZHHQWKHVN\DQGWKHFHLOLQJ,QVWDOODWLRQPRUHRYHUZDVUHJDUGHGDVDSRWHQWLDOO\LQFRPHJHQHUDWLQJEXVLQHVVYHQWXUHLQWKH8.H[FHVV solar energy can still be sold back to the national grid. 'HVSLWHV\VWHPFRVWVDFWXDOO\GURSSLQJqGXHWRFRPSHWLWLRQPDLQO\IURP&KLQDDVZHOODVLQFUHDVHVLQSURGXFWLRQqFXWVLQ)HHGLQ7DUL˧V ),7 DVFKHPHLQWURGXFHGLQ$SULOWRUHZDUGUHQHZDEOHHOHFWULFLW\JHQHUDWLRQIRUVRPHPDGHVRODUDOHVVDWWUDFWLYHRSWLRQ$FFRUGLQJWRWKH %ULWLVK5HWDLO&RQVRUWLXP %5& WKLVFRQWULEXWHGWRnDODFNRIWUXVWLQWKHPDUNHWWKDWWKHSULFHLVUREXVWDQGORQJWHUPo /RJLVWLFDOO\LWPD\QRWHYHQEHSRVVLEOHRUMXVWLĂ&#x17E;DEOHIRUVRPHUHWDLOHUVWRGHSOR\WKHWHFKQRORJ\7KHSURSHUIXQFWLRQLQJRIVRODUSDQHOVLV KLQGHUHGE\DQXPEHURIIDFWRUVLQFOXGLQJWKHVXUURXQGLQJODQGVFDSHHQYLURQPHQWDOSROOXWDQWVFORXGFRYHUDQGGDUNQHVV0RUHRYHULQPDQ\ FDVHVSODQQLQJSHUPLVVLRQPD\EHUHTXLUHGWRĂ&#x17E;WDQ\WKLQJWRWKHRXWVLGHRIDEXLOGLQJWKH\LHOGPD\EHWRRORZWRZDUUDQWWKHRSHUDWLRQVRQVLWH RUWKHUHWDLOHULVRQO\OHDVLQJWKHEXLOGLQJ$VVXFKPDQ\UHWDLOHUVDUHORRNLQJDWVRODUIRUWKHLUKHDGR˨FHVDQGEDFNR˨FHVWD˧ORFDWLRQVEXWQRW necessarily for operational sites.

36 RETAIL ENVIRONMENT | MAY 2013


Frontrunners Despite the challenges and feasibility problems associated with solar installation, a number of retailers have pushed ahead with grand solar plans, recognising that despite a cut in subsidies, because system and framework costs have dropped, capital outlay could even be less. Capital outlay, according to Steve Bingham, business development manager at the UKâ&#x20AC;&#x2122;s leading solar energy company, Solar Century, is â&#x20AC;&#x153;a quarter less than it was two years ago.â&#x20AC;? In the near future energy price hikes coupled with carbon reduction programmes, for example, will make solar installation a more viable option, says Mr Bingham. In his experience, â&#x20AC;&#x153;more and more retailers are looking at [solar power]â&#x20AC;?, particularly those that own their buildings. Power Purchasing Agreements (PPAs) are also becoming more commonplace as a way of reducing carbon emissions without the need for large capital outlay.

33$VDUHDĂ&#x17E;QDQFLDODUUDQJHPHQWLQZKLFKDWKLUGSDUW\GHYHORSHU owns, operates, and maintains the photovoltaic (PV) system, and a host customer agrees to site the system on its roof or elsewhere on its property and purchases the systemâ&#x20AC;&#x2122;s electric output from the solar services provider for a predetermined period. Sainsburyâ&#x20AC;&#x2122;s is currently leading the way with retail uptake of solar power. As part of its â&#x20AC;&#x2DC;20 by 20 Sustainability Planâ&#x20AC;&#x2122;, the supermarket giant installed 69,500 new solar panels to generate 16 megawatts 0: RISRZHUHQRXJKIRUKRPHVRUnPLOOLRQFXSVRIWHDo The solar power will reduce Sainsburyâ&#x20AC;&#x2122;s total CO2 emissions by an estimated 6,800 tonnes per year and each storeâ&#x20AC;&#x2122;s energy consumption as well as delivering energy cost savings. The strategy is part of the supermarketâ&#x20AC;&#x2122;s broader target of an absolute carbon reduction of 50% by 2030.

MAY 2013 | RETAIL ENVIRONMENT 37


ENERGY

We believe the retail sector should take another look at solar energy as a viable way to reduce its impact on the environment â&#x20AC;&#x201C; Sainsburyâ&#x20AC;&#x2122;s

Global solar PV demand is set to advance by 2GW to 31GW in 2013 compared to the previous year, thanks in SDUWWRĂ&#x17E;UP&KLQHVHGHPDQG according to market research analysts Solarbuzz

Dispelling doubts that solar power installation is a bad option for business Justin King, chief executive of Sainsburyâ&#x20AC;&#x2122;s said: â&#x20AC;&#x153;This solar rollout is another big step forward. It makes sense for us - itâ&#x20AC;&#x2122;s good for the environment and for our business and we are actively looking to install more panels. â&#x20AC;&#x153;We already produce far more solar power than most commercial solar farms. We believe the retail sector should take another look at solar energy as a viable way to reduce its impact on the environment. â&#x20AC;&#x153;Big contracts like this support job creation in the renewable energy sector and are essential for our solar industry to thrive. We believe that weâ&#x20AC;&#x2122;ll see the cost of solar energy reaching parity with the grid on commercial installations like this in the next two and four years, and that may well herald a new boom in the solar industry.â&#x20AC;? The Body Shop has also installed one of the UKâ&#x20AC;&#x2122;s largest solar PV installations, at their headquarters in Littlehampton. Despite the short deadline of the FIT reductions, which saw many businesses pull out of similar schemes, The Body Shop completed the installation before the deadline. Their system generates 25% of their HQ energy needs and will cut their carbon emissions by 650 tonnes per year, it says. The cosmetics company says the installation even inspired a number of employees to install solar PV in their own homes. The IKEA Group too is investing heavily in this direction. Some â&#x201A;Ź1.5 billion will be invested in wind and solar power by 2015 as part of the Groupâ&#x20AC;&#x2122;s bid to meet all its energy needs from renewable sources by 2020. The plans come as part of an overarching company strategy to â&#x20AC;&#x153;take the lead in developing and promoting products and solutions that help customers save or generate energy, reduce or sort waste, use less or recycle water at the lowest possible priceâ&#x20AC;?, it says. Some 342,000 solar panels have already been installed on buildings around the world, including 39,000 in UK stores with more to follow. Another success story can be found at the Grays Shopping Centre in

38 RETAIL ENVIRONMENT | MAY 2013

Essex. Rockspring Property Investment Managers, in conjunction with Ellandi LLP and Syzygy Renewables, in 2012 installed a 15,000 sq ft solar array on the roof of the building. Approximately 200 solar panels will produce around 45,000kWh per year, delivering potential savings of around 600 tonnes of CO2 over the life of the project. The scheme will deliver enough electricity to power the shopping centreâ&#x20AC;&#x2122;s car park for half of the year. Under current health and safety regulations, the centre is required to provide 24 hour lighting. The group has also secured planning for solar projects at two other Rockspring retail outlets; The Dolphin Centre in Romford, and the Marlands Shopping Centre in Southampton.

Government support Despite these success stories, changes made to the FITs in late 2011, announced with extremely VKRUWWLPHVFDOHVnVLJQLĂ&#x17E;FDQWO\GDPDJHGEXVLQHVV FRQĂ&#x17E;GHQFHLQWKHUHOLDELOLW\RI*RYHUQPHQWSROLF\ and reducing investmentâ&#x20AC;?, according to the BRC. This led to a number of major retailers pulling out of ambitious solar energy projects. Primark, for example, mulled delivering a carbon neutral store at its East Ham development implementing as many carbon saving strategies as possible, including using solar energy. It concluded however, the technologies needed to make the store carbon neutral did not deliver a payback within Primarkâ&#x20AC;&#x2122;s investment policies and the plan was dropped. During planning, details of FITs were limited, said the retailer. Now that they have been launched and with the future introduction of Renewable Heat Incentives of technologies such as biomass, solar water heating and ground source heat pumps, Primark is reconsidering greater future use of renewables, according to the Carbon Trust, which the retailer approached in 2008 for advice on developing a new approach to energy consumption. â&#x20AC;&#x153;If a FIT of 26 p/kWh had been available on the proposed PV array for East Ham, while the renewables would have a higher capital cost than the CCHP technologies considered, the revenue from FITs would have provided a more rapid payback period. It would have also saved more carbon emissions than CCHP,â&#x20AC;? explains Primark. Tesco had also considered an ambitious solar project â&#x20AC;&#x201C; 1MW arrays of PV cells on about half a dozen distribution centres across the country â&#x20AC;&#x201C; but put plans on ice last year. The retail giant is still mulling whether to install solar panels at its distribution centres as part of its plan to become a zero carbon business by 2050, according to industry insiders.


digital Bring the power of ments to physical environ s and Connect all channel obile touch-points via m onsive Make websites resp context to device & userâ&#x20AC;&#x2122;s

We turn shoppers into buyers & buyers into loyal customers

Find out how. Get in to ouch: bill@spongegroup.com or 0207 612 1910

www.spongegroup.com


ENERGY

â&#x20AC;&#x153;Changes made to the FITs in late 2011, announced with extremely short timescales, VLJQLĂ&#x17E;FDQWO\ damaged business FRQĂ&#x17E;GHQFHLQ the reliability of Government policy and reducing investmentâ&#x20AC;?

Another retailer to be rocked by changes to the FITs is ASOS. In March 2011, the clothing giant PRYHGLQWRDQHZVWDWHRIWKHDUWIXOĂ&#x17E;OPHQWFHQWUH in Grimethorpe, Barnsley. As well as being a PRUHHQHUJ\H˨FLHQWEXLOGLQJWKHURRIVSDFH provided ample opportunity to install solar panels. However, after months of conversations between ASOS and potential partners, the plan was put on hold after the government announced changes to the FITs. â&#x20AC;&#x153;The uncertainty has made LWYHU\GL˨FXOWWRPDNHORQJWHUPLQYHVWPHQWV in this area. It has led companies to question the governmentâ&#x20AC;&#x2122;s commitment to a long term alternative energy strategy and its role in moving to a more sustainable economy,â&#x20AC;? says the BRC in its latest report.

Outlook Since November 2012, reduced rates (degression) for new solar PV installations under the FIT scheme will occur every three months depending on the DPRXQWRI39GHSOR\HG)RUVRODU39WKHĂ&#x17E;UVW

reduction is May, followed by another cut in July. â&#x20AC;&#x153;Under the Renewables Obligation (RO) Order, banding levels are reviewed every four years so renewable developers can continue to receive the appropriate level of support when market conditions and innovation within sectors change,â&#x20AC;? according to a Department of Energy and Climate Change (DECC) spokesperson. Whether or not this legislative uncertainty will D˧HFWUHWDLOHUVmORQJWHUPSODQVWRXVHVRODUSRZHU remains to be seen. Of course economics will be a factor but issues such as logistics and even a dogged reluctance to embrace non-traditional technologies for the short-term will also play a part LQD˧HFWLQJUHWDLOEHKDYLRXU7KRVHWRKDYHDOUHDG\ made the leap will no doubt reap the dividends as energy prices rise and renewables reach grid parity. Whether payback comes in three or seven years, well-promoted success of the projects could set in motion a replicable trend that will likely ripple through the entire sector wherever it can be applied.

FIT payment rate table Description

FIT Year 4 2013/14 For eligible installations with an eligibility date on or after February 1 2013 and before May 1 2013 (p/kWh)

For eligible installations with an eligibility date on or after May 1 2013 and before July 1 2013

Solar PV with total installed capacity of 4kW or less, where attached to or wired to provide electricity to a new building EHIRUHĂ&#x17E;UVWRFFXSDWLRQ

Higher rate Middle rate Lower rate

15.44 13.90 7.10

Higher rate Middle rate Lower rate

15.44 13.90 7.10

Solar PV with total installed capacity of 4kW or less, where attached to or wired to provide electricity to a building which is already occupied

Higher rate Middle rate Lower rate

15.44 13.90 7.10

Higher rate Middle rate Lower rate

15.44 13.90 7.10

Solar PV (other than stand-alone) with total installed capacity greater than 4kW but not exceeding 10kW

Higher rate Middle rate Lower rate

13.99 12.59 7.10

Higher rate Middle rate Lower rate

13.99 12.59 7.10

Solar PV (other than stand-alone) with total installed capacity greater than 10kW but not exceeding 50kW

Higher rate Middle rate Lower rate

13.03 11.73 7.10

Higher rate Middle rate Lower rate

13.03 11.73 7.10

Solar PV (other than stand-alone) with total installed capacity greater than 50kW but not exceeding 100kW

Higher rate Middle rate Lower rate

11.50 10.35 7.10

Higher rate Middle rate Lower rate

11.10 9.99 6.85

Solar PV (other than stand-alone) with total installed capacity greater than 100kW but not exceeding 150kW

Higher rate Middle rate Lower rate

11.50 10.35 7.10

Higher rate Middle rate Lower rate

11.10 9.99 6.85

Solar PV (other than stand-alone) with total installed capacity greater than 150kW but not exceeding 250kW

Higher rate Middle rate Lower rate

11.00 9.90 7.10

Higher rate Middle rate Lower rate

10.62 9.55 6.85

Solar PV (other than stand-alone) with total installed capacity greater than 250kw

7.10

6.85

Stand-alone (autonomous) solar PV (not attached to a building and not wired to provide electricity to an occupied building)

7.10

6.85

EXPORT TARIFF

4.64

4.64

6RXUFH2IJHP)HHGLQ7DUL˧SD\PHQWUDWHWDEOHIRU39HOLJLEOHLQVWDOODWLRQVIRU),7 )HEUXDU\q-XQH

40 RETAIL ENVIRONMENT | MAY 2013


New Evolution for The ARC Show! For architects, designers, retailers and developers.

The ARC Show is now one of four districts that form The May Design Series, a new, intelligent, commercially focused event for the architectural, design, property and retail communities. Created by UBM and shaped by mondo*arc and darc magazines, The ARC Show represents the best in high end architectural and decorative lighting specification.

“This event is for the design industry and that is what appeals to me. With so many new technological advances for us to show, The ARC Show will provide ERCO with the opportunity to meet a wider audience and be part of this bigger design and specification show.” Chris Tiernan, Managing Director, ERCO Lighting.

Featuring the most innovative international brands in architectural, retail and decorative lighting including...

s

19 – 21 May 2013

Register now for your free ticket and save the £40 onsite entry fee at www.thearcshow.com Please quote promo code ARC31 Trade only. Strictly no children

Organised by:

Trade only. Strictly no children

Shaped by:

/ PART OF THE MAY DESIGN SERIES / 19-21 MAY 2013 EXCEL LONDON


RESOURCES

Closing

the loop

The John Lewis Partnershipâ&#x20AC;&#x2122;s head of waste Mike Walters is passionate about reducing the impact of his business on the environment. He recently told delegates at a conference in Norwich about the companyâ&#x20AC;&#x2122;s approach to waste and recycling. Will Date reports

42 RETAIL ENVIRONMENT | MAY 2013

For Mike Walters, recycling and waste operations manager at retail giant the John Lewis Partnership, managing the estimated 60,000 tonnes of waste generated by the more than 300 John Lewis and Waitrose stores across the UK each year is very much a â&#x20AC;&#x2DC;hands onâ&#x20AC;&#x2122; job. Speaking in front of an invited audience of business owners and community group organisers earlier this year at a session organised by Norfolk county council, titled â&#x20AC;&#x2DC;Innovation in Waste Managementâ&#x20AC;&#x2122; Mike outlined his companyâ&#x20AC;&#x2122;s accountability-based approach to waste management. The company, as is common for brands with the prestige of a market leader such as John Lewis, has FRPPLWWHGWRVHQGLQJ]HURZDVWHWRODQGĂ&#x17E;OOE\ZLWK DQLQWHULPWDUJHWRIODQGĂ&#x17E;OOGLYHUVLRQE\WKHHQG of 2013, but Mike is keen to ensure that this is not seen simply an empty platitude. n2XUWDUJHWLVWRVHQG]HURZDVWHWRODQGĂ&#x17E;OOoKHWROG delegates at the session in January. â&#x20AC;&#x153;My contractors say it could be 2020 when we can honestly say we are zero waste. I could do it now but it is about retaining ownership right WKURXJKWRWKHHQGo The â&#x20AC;&#x2DC;ownershipâ&#x20AC;&#x2122; philosophy that Mike has instilled DFURVVWKHFRPSDQ\LQYROYHVDĂ&#x17E;YHSURQJHGZDVWH management strategy, which sees waste separated at source EHIRUHLWLVWKHQWUDQVIHUUHGWRRQHRIĂ&#x17E;YHSURFHVVRUV HDFKRIZKLFKKDQGOHVDVSHFLĂ&#x17E;FZDVWHVWUHDPIRU-RKQ Lewis across the whole of the UK. â&#x20AC;&#x153;I have been working to consolidate our contract base because we had so many


GL˧HUHQWFRQWUDFWVDQGWKDWPDGH LWYHU\GL˨FXOWDQGZHDUHGRZQWR ÞYHNH\FRQWUDFWVoKHH[SODLQHG n7KHEXVLQHVVRIUHWDLQLQJ RZQHUVKLSUHOLHVRQPHZRUNLQJ FORVHO\ZLWKWKRVHFRQWUDFWRUVo

Team work 3ODVWLFZDVWHZKLFKFRPSULVHV DURXQGWRQQHVRIZDUHKRXVH SDFNDJLQJSDOOHWÞOPVDQGlEDJV IRUOLIHmSHUDQQXPLVSURFHVVHG E\/LYHUSRROEDVHGUHF\FOLQJÞUP &HQWULIRUFH7KHFRPSDQ\ZDV DSSURDFKHGE\-RKQ/HZLVDVLW FRXOGR˧HUDXQLTXHlFORVHGORRSm RSSRUWXQLW\E\VHOOLQJWKHPEDFNWKHUHF\FOHGSODVWLFVLQ WKHIRUPRISODVWLFKRDUGLQJVIXUQLWXUHDQGZDONZD\VWKDW ZLOOEHXVHGDFURVVLWVVWRUHVLQWKH8. 0HDQZKLOHSDSHUDQGFDUGLVUHF\FOHGE\.HQWEDVHG FRUUXJDWHGSDFNDJLQJÞUP6PXUÞW.DSSDZDVWHHOHFWULFDO LWHPVDQGPL[HGPHWDOVDUHKDQGOHGE\UHF\FOLQJDQG ZDVWHPDQDJHPHQWÞUP:DVWH&DUHIRRGZDVWHZKLFK PDNHVXSDVLJQLÞFDQWSURSRUWLRQRIWKHJURXSmVZDVWH LVKDQGOHGE\%HGIRUGVKLUHEDVHG&DZOH\VZKLOHWKH FRQWUDFWWRWUHDWUHVLGXDOZDVWHDQGJODVVLVKHOGE\6LPSO\ :DVWH6ROXWLRQV (DFKRIWKHFRQWUDFWRUVKDVDOVREHHQVHOHFWHGRQWKH FULWHULDWKDWDOORIWKHZDVWHWKH\PDQDJHRQEHKDOIRI -RKQ/HZLVLVSURFHVVHGLQWKH8.VRPHWKLQJWKDW0LNH SDVVLRQDWHO\EHOLHYHVLVNH\WRUHGXFLQJWKHHQYLURQPHQWDO LPSDFWRIWKHEXVLQHVV +HH[SODLQHGn:KHQZDVWHJRHVWR&KLQDRU,QGLD ZKDWFKDQFHGR,KDYHRINQRZLQJWKDWLWLVEHLQJUHF\FOHG SURSHUO\",FDQmWOHWRXUFRPSDQ\EHDVVRFLDWHGZLWKWKDW :HKDYHORRNHGDWUHF\FOLQJZDVWHH[FOXVLYHO\LQWKH8. VLQFHDERXWDV&KLQDEHJDQWRVWDUWWRFORVHLWVJDWHV WRZDVWHIURPRYHUVHDV,GRQmWZDQWP\EXVLQHVVEHLQJDW WKHLUEHFNDQGFDOODVWRZKHWKHUWKH\ZDQWWKDWPDWHULDO DQGLWPLJKWVWLPXODWHLQYHVWPHQWWKDWLVEDGO\QHHGHGLQ WKH8.o :KLOHWKHPRYHKDVEHHQODXGHGE\VRPH FRPPHQWDWRUVZKRDUJXHWKDWH[SRUWLQJZDVWHRXWVLGH RIWKH8.VHHVHPSOR\PHQWH[SRUWHGRYHUVHDVRWKHUV KDYHDUJXHGWKDWWKHH[SRUWPDUNHWKDVEHHQFUXFLDOIRU JURZLQJUHF\FOLQJLQWKH8.DWWLPHVZKHQWKHUHZDVOLWWOH LQIUDVWUXFWXUHDYDLODEOHLQWKH8.

Food matters )RRGZDVWHIRUPVDODUJHSURSRUWLRQRIWKHZDVWH JHQHUDWHGDFURVVWKH:DLWURVHVWRUHVLQWKH8.2YHU DQGWKHFRPSDQ\VHQWDQHVWLPDWHGWRQQHV WREHUHSURFHVVHGYLDDQDHURELFGLJHVWLRQZKLFKWXUQV RUJDQLFZDVWHLQWRHQHUJ\WKURXJKELRJDVDQGDIHUWLOL]HU 0LNHDGGHGn%DFNLQ)HEUXDU\ZHODXQFKHGDIRRG ZDVWHKLHUDUFK\,OHDUQHGHDUO\RQLI\RXFDQGHDOZLWK

Plastic waste, which comprises around IRRGZDVWHHYHU\WKLQJHOVHEHFRPHVPRUHVWUDLJKWIRUZDUG 3,000 tonnes of qLWWHQGVWRFRQWDPLQDWHHYHU\WKLQJHOVHLQWKHELQV warehouse packaging, qRQFHZHVRUWHGWKDWRXWDOOZHZHUHOHIWZLWKZHUH SDOOHWÞOPVDQGÂEDJV FDUGERDUGSODVWLFDQGSDSHUo for life’ per annum is SURFHVVHGE\/LYHUSRRO 0HDQZKLOHORRNLQJXSWKHZDVWHKLHUDUFK\WKH EDVHGUHF\FOLQJÞUP SDUWQHUVKLSZRUNVZLWKIRRGUHGLVWULEXWLRQFKDULW\ Centriforce )DUH6KDUHWRHQVXUHWKDWFRQVXPDEOHIRRGWKDWFDQQR ORQJHUEHVROGLVHDWHQ 0LNHFRPPHQWHGn$WWKHHQGRIHDFKGD\RXUVKRSV FDQZRUNZLWK)DUH6KDUHWRGLVWULEXWHVXUSOXVIRRGWR PDNHVXUHLWJHWVFRQVXPHG7KHUHLVIRRGWKDWLVSDVWLWV GDWHEXWÞQHWREHHDWHQEXWZHFDQmWGRDQ\WKLQJZLWK LWo+RZHYHUKHDFNQRZOHGJHGWKDWZKLOHWKLVLVDQLGHDO VROXWLRQWRIRRGZDVWHWKHFRPSDQ\LVDOVRNHHQWRHQVXUH WKDWLWSURWHFWVLWVVWDWXVqDQGHQVXULQJVSRLOHGIRRGLV QRWFRQVXPHGLVYLWDO +HDGGHGn:HKDYHJRWWREHFDUHIXO,NQRZKRZORQJ LWKDVWDNHQXVWREXLOGRXUUHSXWDWLRQDQG,FKHULVKWKH ZD\FXVWRPHUVORRNXSWRXVqLWLVDERXWGRLQJWKHULJKW WKLQJVWRGHOLYHURQRXUFXVWRPHUVmH[SHFWDWLRQVo

n-RKQ/HZLVKDYHFRPPLWWHGWR VHQGLQJ]HURZDVWHWRODQGÞOOE\ ZLWKDQLQWHULPWDUJHWRI ODQGÞOOGLYHUVLRQE\WKHHQGRIo -RKQ/HZLVEUDQFKHVDOVRWDNHDGYDQWDJHRIlEDFN KDXOLQJmqWUDQVSRUWLQJUHF\FODEOHPDWHULDOVWRWKHGHSRW LQRWKHUZLVHHPSW\YHKLFOHVRQFHWKH\KDYHFRPSOHWHGD GHOLYHU\RIVWRFN7KHPRYHZDVGHVLJQHGQRWRQO\WRVDYH WUDQVSRUWFRVWVEXWWRFXWWKHDPRXQWRI&2HPLVVLRQV WKHFRPSDQ\LVUHVSRQVLEOHIRUE\UHGXFLQJWKHDPRXQWRI YHKLFOHVLWSXWVRQWKHURDG :KLOH-RKQ/HZLVDSSURDFKHVLWVWDUJHWWRVHQG]HUR ZDVWHWRODQGÞOOWKHFRPSDQ\EHOLHYHVWKDWlWDNLQJ RZQHUVKLSmRILWVZDVWHZLOOEHNH\WRWKHVHDPELWLRQV

MAY 2013 | RETAIL ENVIRONMENT 43


A ‘Waste’ of Space? Lack of space for efficient waste management is a big issue for Shopping Centres. Grundon provides a single-source solution for all major waste types, tailored to the space available.

Mixed recyclables Landfill diversion - Energy from Waste Food waste Compactors, static or mobile Wheeled bins for extra mobility Cardboard & plastic bale collection Rebates available Performance reports Call 01753 764959 or e-mail: info@grundon.com for details

By Appointment to Her Majesty The Queen Waste Management Grundon Waste Management Ltd Colnbrook

RETAIL ENVIRONMENT MAY 2013 - Issue 1

retailenvironment.co.uk

BUSINESS SUSTAINABILITY FOR RETAIL PROFESSIONALS AND SUPPLIERS

Business sustainability for retail professionals and suppliers

To advertise here please call Danny Henderson on 020 7633 4521 or email danny.h@ retailenvironment.co.uk

Thirsty business: water drips to the core of retail sustainability

NO PREMIUM ON ETHICS – THE CO-OPERATIVE INTERVIEW | COMMUNITY BENEFIT: THE LIVERPOOL ONE STORY | POORAN DESAI COLUMN | SOLAR POWER: THE DARK HORSE | LED: THE FUTURE OF LIGHTING | ANAEROBIC DIGESTION HEATS UP | REVERSED LOGISTICS TURNAROUND | FLEET FUEL EFFICIENCY | JOHN LEWIS RECYCLING CRACKDOWN | SUSTAINABLE TECHNOLOGY SPOTLIGHT


RESOURCES

That’s a wrap The Waste & Resources Action Programme is looking to debunk a common misconception that packaging is “bad” and prove that it can actually help reduce household food waste. Amy North reports Packaging is vital. Not only does it keep the products fresh and XVDEOHLWDOVRR˧HUVEUDQGVDVSDFHWRPDNHWKHLUSURGXFWDSSHDOLQJ WRFXVWRPHUVDQGSURYLGHXVHIXOLQIRUPDWLRQVXFKDVWKHQXWULWLRQDO FRQWHQWDQGLQJUHGLHQWV3HUKDSVPRVWLPSRUWDQWO\LWNHHSVWKH SURGXFWVVDIHDQGIUHHIURPFRQWDPLQDWLRQ %XWLWDOVRSXWVUHWDLOHUVLQDWULFN\SUHGLFDPHQWKRZWRUHFRQFLOH WKHFRQWLQXRXVFULWLFLVPWKDWWKHJRRGVWKH\VHOODUHRYHUSDFNDJHG ZLWKWKHQHFHVVLW\RIRIWHQGRLQJVR,IXVHGLQWKHULJKWZD\SDFNDJLQJ FDQKRZHYHUSUHVHQWDQXPEHURIRSSRUWXQLWLHVLQFOXGLQJFXWWLQJ IRRGZDVWH :KLOHUHWDLOHUVKDYHFRPHXQGHUÞUHIRUFUHDWLQJH[FHVVZDVWH WKURXJKWKHXVHRISDFNDJLQJDUHSRUWSXEOLVKHGE\WKH:DVWH  5HVRXUFHV$FWLRQ3URJUDPPH :5$3 VKRZVWKDWWKHFRUUHFWXVHE\ FRQVXPHUVFRXOGDFWXDOO\KHOSUHGXFHIRRGZDVWHLQWKHKRPH1R GRXEWDFRQWURYHUVLDOLGHDWRVRPHWKHUHSRUWHQWLWOHGl&RQVXPHU $WWLWXGHVWR)RRG:DVWHDQG)RRG3DFNDJLQJmKLJKOLJKWVWKHQHHGWR XWLOLVHSDFNDJLQJLQWKHKRPHUDWKHUWKDQWKURZLQJLWDZD\DVVRRQDV WKHVKRSSLQJLVXQSDFNHGLQDELGWRKHOSUHGXFHWKHDPRXQWRIIRRG HQGLQJXSLQWKHELQ $QGZLWKDSSUR[LPDWHO\RIKRXVHKROGIRRGZDVWHDULVLQJIURP SURGXFWVZKLFKDUHQRWXVHGLQWLPHDWDFRVWRIzELOOLRQWKHUHLVD YDOLGDUJXPHQWIRUERWKUHWDLOHUVDQGFRQVXPHUVWRWDNHUHVSRQVLELOLW\ IRUWKHSURGXFWVDQGKHOSUHGXFHZDVWH 7KHUHVHDUFKLQWKHUHSRUWZDVSURGXFHGLQSDUWQHUVKLSZLWKWKH ,QGXVWU\&RXQFLOIRU3DFNDJLQJDQGWKH(QYLURQPHQW ,1&3(1 WKH 3DFNDJLQJ)HGHUDWLRQWKH)RRGDQG'ULQN)HGHUDWLRQWKH.HQW:DVWH 3DUWQHUVKLSDQGWKH%ULWLVK5HWDLO&RQVRUWLXP %5& 

Innovation $OLFH(OOLVRQHQYLURQPHQWSROLF\DGYLVRUDWWKH%5&VD\VWKDWJURFHU\ UHWDLOHUVKDYHDOUHDG\WDNHQVLJQLÞFDQWVWHSVWRUHGXFHSDFNDJLQJDQG IRRGZDVWHERWKDWWKHLUVWRUHVDQGRQFHWKHJRRGVDUHLQFRQVXPHUVm 0$<_5(7$,/(19,5210(17 45


RESOURCES

Used in the right way packaging can present a number of opportunities, including cutting food waste

Key points highlighted in the research n$POTVNFSDPOĂ&#x2DC;EFODF BSPVOETUPSJOHGPPE JTIJHICVUDBOCF NJTQMBDFEBTUIF JOGPSNBUJPOPOMBCFMT BOEIPXUIFZBSFVTFE DPVMECFNPSFFĘ&#x17D;FDUJWF

homes. A range of innovative products to help extend the home-life of food and also reduce the amount of packaging used have been LQWURGXFHGE\UHWDLOHUVLQFOXGLQJXVLQJGL˧HUHQW materials; vacuum packing; and introducing more resealable packs. One example of innovation to reduce food waste is the â&#x20AC;&#x2DC;Itâ&#x20AC;&#x2122;s Fresh!â&#x20AC;&#x2122; strip, developed by Food Freshness Technology, which removes the ripening hormone ethylene and helps to keep fruit and vegetables fresher for longer. It has been applied by retailers to a variety of goods, such as Marks & Spencerâ&#x20AC;&#x2122;s strawberries and Tescoâ&#x20AC;&#x2122;s avocadoes. Discussing the work that has been undertaken, Ms Ellison says: â&#x20AC;&#x153;I hope this research helps to end the demonisation of packaging. We have long said that appropriate use of packaging preserves food and reduces waste. Grocery retailers have already achieved notable reductions in food and packaging waste through working with WRAP on the Courtauld Commitment targets and the Love Food Hate Waste campaign. This report should stimulate further reductions in food waste by promoting the role that packaging plays in keeping food fresher for longer in the home.â&#x20AC;? She also highlights the work done to improve the labelling of products to make it clearer to consumers when the food is safe to eat, such as the roll out of â&#x20AC;&#x2DC;best beforeâ&#x20AC;&#x2122; and â&#x20AC;&#x2DC;use byâ&#x20AC;&#x2122; dates. 'HVSLWHUHWDLOHUVmH˧RUWVPDQ\FRQVXPHUV believe keeping food in packaging at home leads to it spoiling more quickly. The research shows that just 13% of consumers feel packaging has a role to play protecting food in the home. In addition, over half of the 4,000 respondents say that it uses too much material and is bad for the environment. It DOVRQRWHVWKDWFRQVXPHUVIHHOFRQĂ&#x17E;GHQWDERXWKRZ WKH\VWRUHIRRGDWKRPHKRZHYHUWKLVFRQĂ&#x17E;GHQFH may be misplaced with only 22% of consumers looking at storage guidance on packaging.

46 RETAIL ENVIRONMENT | MAY 2013

WRAP says to help drive down waste food, retailers, manufacturers and trade associations need to raise awareness with their consumers about these innovations in packaging, food labelling and design.

Campaign Retailers are taking further action following the publication of the report in March, with communications campaign â&#x20AC;&#x2DC;Fresher for Longerâ&#x20AC;&#x2122; which was launched alongside it. Leading the way was M&S which rolled out visual aids and messages to its shoppers to demonstrate the important role packaging can play. The campaign forms part of WRAPâ&#x20AC;&#x2122;s successful nationwide scheme Love Food Hate Waste. It demonstrates that packaging keeps food fresher for longer but also protects food in the home. Retailers, councils and brand-owners are encouraged to join in and promote the message. Commenting on the campaign, David Bellamy, environment policy manager at the Food and Drink Federation, adds: â&#x20AC;&#x153;We believe the â&#x20AC;&#x2DC;Fresher IRU/RQJHUmFDPSDLJQZLOOĂ&#x17E;QDOO\EULQJKRPHWR consumers that good packaging does actually save waste.â&#x20AC;? Overall, it is hoped the research and the campaign will help consumers make small changes in their behaviour towards packaging and continued innovation, which will not only keep the food fresher for longer, but will save money and reduce food waste. The research concludes: â&#x20AC;&#x153;Industry is already doing a lot to optimise what is on the label, and through innovation to extend the life of food. It seems that small changes in behaviour could make XVHRIWKHVHWRGHOLYHUWKHEHQHĂ&#x17E;WVFRQVXPHUVVWDWH they are looking for â&#x20AC;&#x201C; keeping food fresher for longer, saving money and reducing the impact of food on the environment.â&#x20AC;?

n5IFSFJTSFDPHOJUJPO UIBUGPPESFUBJMFST BOENBOVGBDUVSFST IBWFNBEFQSPHSFTT JOSFDFOUZFBSTUP SFEVDFUIFBNPVOUPG QBDLBHJOHBOEFWFO UIPTFXIPDPOTJEFS QBDLBHJOHUPCFBNBKPS FOWJSPONFOUBMJTTVF IBWFOPUFEQSPHSFTT â&#x20AC;˘ Consumer concern BCPVUQBDLBHJOH SFEVDFTJOSFTQPOTF UPNPSFJOGPSNBUJPO  XIFSFBTDPODFSOBCPVU GPPEXBTUFJODSFBTFT n5IFSFJTBTUSPOH DPSSFMBUJPOCFUXFFO DPODFSOTBCPVU QBDLBHJOHNBUFSJBMTBOE IPXFBTZJUJTUPSFDZDMF UIFNBUIPNF5IF IBSEFSJUJTUPSFDZDMF UIFNPSFDPODFSOJT FYQSFTTFEBOE n.BOZDPOTVNFSTEP OPUSFDPHOJTFUIBU QBDLBHJOHQSPUFDUT GPPEJOUIFIPNF  IPXFWFSUIFZEP BDLOPXMFEHFUIBUJU QMBZTBOJNQPSUBOUSPMF JOLFFQJOHJUTBGFPOJUT XBZUPBOEJOUIFTUPSF


Advertisement Feature

LED Lighting enriches the retail experience and slashes energy bills MHA Lighting, based in Greater Manchester, uses two-thirds of the energy of its closest competitors and is helping retailers improve their customers’ experience, whilst slashing energy bills. The award-winning lighting specialist’s patented waveguide technology uses 80% the energy of traditional fluorescent fittings - cutting carbon emissions by the equivalent amount. Their fully-sealed units do not attract dust or insects making them the most hygienic option for any supermarket or food retailer. At Tout’s Budgens in Cheddar, MHA Lighting replaced traditional fluorescents with 84 of their unique TiLite fittings from its patented product range. A further 38 LED down lighters were installed in the store’s Subway concession (over tables) and in the pharmacy areas. The new installations have provided Tout’s Budgens with energy savings of £89,539 over the product’s lifetime, whilst saving 567 Co2 tonnes. The installation not only achieves high colour rendering of 80CRI with 4500 kelvin – the optimal colour for displaying produce – but has cut lighting energy costs and Co2 production by 65%. The lighting system is also extremely low maintenance and will run for 60,000 hours of continuous use. In the case of Tout’s Budgens 18 hour a day operation, the lights will not need replacing for nine years, saving an added £12,880 on routine maintenance. The lack of heat given off by LED lighting allows further energy savings to be made through reduced use of air conditioning systems. The machines do not have to work as hard to cool down additional heat in the shop, which is beneficial for open refrigerators.

The store’s security was improved with the removal of the old fluorescent lighting fittings. The LED lighting allows for a clearer identification of suspects and reduces flicker on CCTV monitors. Philip Tout, owner Tout’s Budgens, said: “We chose to make the switch to LED lighting as part of our commitment to improving the customer experience and reducing the carbon footprint of the business. MHA Lighting provided a LED lighting solution that not only improves lighting levels but reduces our on-going energy costs and equivalent Co2 emissions. We are delighted with the results and are already getting positive feedback from our customers about how great the new store looks and the feel of the store created by the light. All our stores stock the best quality fresh produce from local growers and the LED lighting really enhances

the appearance of our fruit and veg and butchery offering.”

How does the technology work? MHA is the only lighting manufacturer to use waveguide technology to shine light sideways into an encapsulation – not directly outwards. This avoids direct contact with the eye and provides a safe and efficient light output. The patented waveguide technology offers distinct advantages over other LED manufacturers as it allows the company to replicate the light quality and uniformity of traditional lighting. MHA also use acrylic rods to amplify and control the light output, reducing the number of LEDs required. This means they can use high power LEDs, draw less current and have no need to diffuse the output.

For more information please call 01942 887 400, visit www.mhalighting.co.uk or email sales@mhalighting.com


DESIGN

A bright future

As environmental and sustainable practices become more prominent, retailers are increasingly looking at ways to save energy and money. One such route they are taking is using LED lighting. Amy North takes a look at this emerging trend

48 RETAIL ENVIRONMENT | MAY 2013

Good lighting is everything. It creates ambience, makes an environment warm and inviting and most importantly makes SURGXFWVMXPSR˧WKHVKHOYHVKRSHIXOO\LQWRWKHKDQGVRI the customers. Retailers go to great lengths to ensure their stores are welllit to create the perfect atmosphere. However with the price of energy rising and opening hours extending, keeping stores bright unfortunately equates to increased costs. One way a number of major retailers are combatting this is through the use of LEDs. .QRZQIRULWVKLJKHQHUJ\H˨ FLHQF\DQGORQJOLIH/(' OLJKW emitting diodes) lighting is becoming more widespread. Philips, the ZRUOGmVODUJHVWOLJKWLQJPDQXIDFWXUHUUHSRUWHGDMXPSLQĂ&#x17E;UVW quarter LED sales from a year earlier with the bulbs now representing 23% of its lighting sales. Household names including Morrisons, Tesco and Waitrose are all using the technology. And while the initial costs of LEDs are higher than those of other lamps, retailers could save money on energy and maintenance in the long term.


Philips used LEDs to light up Selfridges in London

With LEDs â&#x20AC;&#x153;you are going to save a lot of money on your electricity bill and there should be no maintenance. I could also argue that they create a more pleasant environment because they donâ&#x20AC;&#x2122;t throw out lots of heat. If you put the right LED solution in then you can create a very high quality light scheme.â&#x20AC;? However, he advises retailers to research to ensure they are getting a high-quality product. While technology used in LEDs has come a long way over the last decade, Mr Tapsell warns that there are still cheap, low quality products available on the market which is wavering peopleâ&#x20AC;&#x2122;s trust in good LEDs. Mr Tapsell says banks and the Carbon Trust are keen to be involved in projects such as these, meaning retailers could get Ă&#x17E;QDQFLDOVXSSRUWWRKHOSWKHPUROORXW/('V+HVD\Vn<RXZLOOKDYH to make a capital investment but you are going to get that back in the next three years and after that you are making a lot of money.â&#x20AC;? He adds that even small retailers could save tens of thousands of pounds over the life time of the product. Looking forward, Mr 7DSVHOOLVFRQĂ&#x17E;GHQWWKDW/('ZLOOVRRQEHFRPHWKHPDLQFKRLFHRI retailers for both commercial and environmental reasons.

Choice

But not everyone not is jumping on this brightly lit bandwagon. In some cases it comes down to money; in others, retailers have VLPSO\EHHQUHOXFWDQWWRVZLWFKIURPWKHLUIDLWKIXOĂ&#x;XRUHVFHQWDQG halogen bulbs. So do the potential savings outweigh the risks?

BeneďŹ ts Phil Tapsell, sales director at Greater Manchester-based MHA Lighting believes they do. Aside from the energy savings, he VD\V/('OLJKWLQJKDVDGGLWLRQDOEHQHĂ&#x17E;WVRYHULWVĂ&#x;XRUHVFHQW counterparts. However he notes that retailers are reticent to make any changes if they could have a negative impact on their sales. He says: â&#x20AC;&#x153;From a retailerâ&#x20AC;&#x2122;s perspective obviously everything they need is a high quality uniformity of light with exceptional colour rendering. In a retail environment lighting is everything. They want to make a nice environment for the customers, to make sure light washes across all of the products and that there are no gloomy areas.â&#x20AC;?

Choice in the LED market, according to Rowena Preiss, creative director at Philips, is another aspect to make things harder for the retailer. Looking at how the technology has transformed over the last few years, she says: â&#x20AC;&#x153;I think the awareness around what the energy EHQHĂ&#x17E;WVFDQEHKDVVLJQLĂ&#x17E;FDQWO\JURZQRYHUWKHODVWWZR\HDUV :KHQ/('VĂ&#x17E;UVWVWDUWHGHPHUJLQJJRLQJEDFNWHQ\HDUVWKH\ZHUH so expensive that it wasnâ&#x20AC;&#x2122;t worth looking at. We have now reached the tipping point where if you make an investment the paybacks are TXLFNĂ&#x17E;QDQFLDOO\LWPDNHVDORWRIVHQVHWRPDNHWKDWVZLWFKo Having been around for 125 years, Philipsâ&#x20AC;&#x2122; reputation precedes it. Being a household name in lighting means it has worked with some of the top retailers, having designed and rolled out LED displays to Selfridges, Marks & Spencer and The Co-operative. :KLOH0V3UHLVVLVDĂ&#x17E;UPDGYRFDWHRI/('VVKHVD\VWKHOLQJHULQJ stigma attached to it means some retailers may be reluctant to use it. 6KHDGGVWKDWVRPHFRPSDQLHVKDYHKDGWKHLUĂ&#x17E;QJHUVEXUQHGE\WKH technology as â&#x20AC;&#x153;no-name manufacturersâ&#x20AC;? release cheaper products LQWRWKHPDUNHWZLWKEROGFODLPVDERXWLWVOLIHWLPHDQGEHQHĂ&#x17E;WVRQO\ to leave their customer with a failing product. For those seriously thinking about rolling out or trialling LEDs, Ms Preiss advises that retailers engage a professional lighting designer to discuss what the best approach is for them. And for WKRVHORRNLQJWRUHWURĂ&#x17E;WDVWRUHVKHVD\VUHWDLOHUVPXVWEHDZDUH WKDW/('VPD\EHVPDOOHUWKDQWKHOLJKWĂ&#x17E;WWLQJVDOUHDG\LQSODFHVR FRXOGORRNGL˧HUHQW$GGLWLRQDOO\GXHWRWKHZD\/('VZRUNq E\HPLWWLQJDGLUHFWEHDPRIOLJKWRQWRDQDUHDqIHZHUODPSVPD\ DOVREHQHHGHG,WLVWKLVFDVFDGHRIGL˧HUHQWRSWLRQVDQGH˧HFWV that Ms Preiss says makes it confusing for retailers. However she notes that better awareness about the issues helps ensure they are not oversold. She concludes: â&#x20AC;&#x153;We need to get the retailers into a position where they are challenging what they are being told. I want to see them challenging us and being more creative because if they have got traditional lighting in place already and if they are really informed about it they can change it to an LED solution.â&#x20AC;?

MAY 2013 | RETAIL ENVIRONMENT 49


DESIGN

CASE STUDY Vodafone

Marks & Spencerâ&#x20AC;&#x2122;s sustainable learning store LQ6KH˨HOGXVHV3KLOLSVĂ&#x192;/('OLJKWLQJ

Decision While LEDs are becoming increasingly popular in other sectors, Nick Wraith, president of the Shop and Display Equipment Associationâ&#x20AC;&#x2122;s executive council, says retailers should think carefully before making any rash decisions. Mr Wraith, who is also managing director of United Aluminium DQGOLJKWLQJĂ&#x17E;UP/XPHQDOVD\Vn1RERG\LVVSHFLI\LQJl,ZDQW/('WR illuminate my store or displaysâ&#x20AC;&#x2122; simply because they have some weird preference for the technology. Thatâ&#x20AC;&#x2122;s the wrong approach. n0RVWUHWDLOHUVVLPSO\ZDQWKLJKTXDOLW\VDIHHQHUJ\H˨FLHQW lighting. It shouldnâ&#x20AC;&#x2122;t cost the earth to either buy or install, and it should EHDEOHWREHPDLQWDLQHGFRVWH˧HFWLYHO\/LJKWHQJLQHVZKLFKODVWDV long as the manufacturer claims is also a must. Now, if all those things happen to point to an LED solution, then so be it.â&#x20AC;? He adds that many of the problems retailers face can be solved by LED but it is important not to let the technology dictate the process; the lighting industry needs to take a fair and honest approach to ensure their customersâ&#x20AC;&#x2122; needs are not being overlooked. n$VLWVRKDSSHQVPRVWRIWKRVHFULWHULDFDQEHVROYHGZLWK/(' under the right circumstances, and this is how the apparent LED boom has come about. Retailers who have taken that approach have realised that LED is, for them, the PRVWYLDEOHORQJWHUP solution.â&#x20AC;? Looking forward Mr Wraith says it is down to the lighting industry to lead the way and to guide their customers through the process of choosing the appropriate lighting VROXWLRQIRUWKHPn:KLOH/('LVQmWWKHRQO\RSWLRQLWLVIDVWEHFRPLQJ the preferred method in retail for many challenges. Having said this, retailers are looking to the lighting industry to lead and to be transparent.â&#x20AC;? So, while the take up of LED is perhaps not as fast as the lighting industry would like, it appears that with the rollout of the technology by a number of trendsetting major retailers, it may soon be the method of choice.

n0RVWUHWDLOHUVVLPSO\ ZDQWKLJKTXDOLW\ VDIHHQHUJ\H˨FLHQW lighting. It shouldnâ&#x20AC;&#x2122;t cost the earth to either buy or installâ&#x20AC;?

50 RETAIL ENVIRONMENT | MAY 2013

In 2010 phone retailer Vodafone trialled LED lighting in one of its stores in a bid to save money on energy bills and reduce its carbon footprint. It was hoped that it would reduce energy used for lighting by 73% over the year. Vodafone reviewed the outcomes of the trial and eventually $IWHUWULDOOLQJ/('V decided against Vodafone decided rolling out LEDs across its stores. against rolling them out nationwide Vodafone says: â&#x20AC;&#x153;Following the trial we reviewed whether the LED lights were suitable for our shops and came to the conclusion that at the time they didnâ&#x20AC;&#x2122;t provide enough light for the retail environment. We review that decision periodically, but have not yet taken the decision to go to LED. The technology is evolving rapidly, so itâ&#x20AC;&#x2122;s not a case that we wonâ&#x20AC;&#x2122;t move in the future, just that weâ&#x20AC;&#x2122;re not adopting LED at present.â&#x20AC;?

CASE STUDY Next and Luxonic Lighting Fashion and homeware retailer Next is in the process of rolling out LEDs across at least 100 of its stores. The roll out is happening in three stages, with ten stores SFUSPĂ&#x2DC;UUFEJO UIFĂ&#x2DC;STUUXP phases and the remaining in UIFĂ&#x2DC;OBMPOF It is hoped the move will save Next up to 40% Nextâ&#x20AC;&#x2122;s Kidderminin energy. ster store was one The LEDs replaced existing MR16 RIWKHĂ&#x17E;UVWWREH halogens, ceramic metal halide and refurbished DPNQBDUĂ&#x2122;VPSFTDFOUMBNQTJOTUPSFT BOEIBWFCFFOVTFEGPSPOUIFTIPQĂ&#x2122;PPSBOEBTQBSUPG the window displays as well. The technology used is GE Lightingâ&#x20AC;&#x2122;s Infusion LED Modules incorporated into Luxonic LED Twin Gimbal luminaires, Luxonic LED Window Lights and Luxonic LED Modular Trough luminaires.


DESIGN

Re-sketching interiors

Lured in perhaps by an attractive front window display, a customer walks through a store to peruse the aisles and shelves for their favourite products. Little thought is given to the lifecycles of the materials responsible for showcasing the goods that will end up at the checkout. Until recently, little consideration QHLWKHUKDVEHHQJLYHQWRVKRSĂ&#x17E;WWLQJVE\WKH retailers themselves. Functionality, aesthetics and modernism have taken precedent over environmental sustainability. Charlotte Owen reports

While many retailers have led the way by making improvements and encouraging sustainability in their business in general, one crucial area that has failed to receive the attention it deserves LVVKRSĂ&#x17E;WWLQJV The shelves, racks, mannequins and rails that often embed themselves inconspicuously within the shop may be the last thing a retailer or customer would associate with environmental damage. While design has continued to push the envelope in recent decades â&#x20AC;&#x201C; evolving in exciting and innovative new ways â&#x20AC;&#x201C; designers have been slow to seriously consider the sustainability of the materials used and the assembly and building of this equipment. What these products are made of and where and how they are disposed of when they are swept aside as next seasonâ&#x20AC;&#x2122;s stock sweeps in, has until now largely slipped the mind of the retailer and consumer. 2IWHQUHSODFHGDQGGLVFDUGHGXVXDOO\WRODQGĂ&#x17E;OOVKRSĂ&#x17E;WWLQJVKDYH important environmental and cost implications. Store refurbishment

MAY 2013 | RETAIL ENVIRONMENT 51


DESIGN Frequent changes to window displays means more consideration should be given to reused or recycled material

n6WRUHUHIXUELVKPHQWLV often limited to changing equipment, and much of the old equipment ends up in a VNLSDQGWKHQLQDODQGÞOOo

is often limited to changing equipment, and much of the old equipment ends up in a VNLSDQGWKHQLQDODQGÞOO7KHHTXLSPHQWLVRIWHQGHVLJQHGWRODVWPXFKORQJHUWKDQLWV DFWXDOXVHLQWKHVKRS 7KHVFDOHRISRWHQWLDOIRUFKDQJHLVKXJH8.UHWDLOVDOHVZHUHzELOOLRQLQ RIZKLFKIRRGVWRUHVDFFRXQWHGIRUzEQDFFRUGLQJWRWKH%XLOGLQJ5HVHDUFK (VWDEOLVKPHQW %5( $WWKHHQGRIWKHUHZHUHRYHUUHWDLORXWOHWVZLWK UHWDLOHUVFRPPRQO\XSGDWLQJWKHLUVKRSÞWWLQJGLVSOD\HTXLSPHQWHYHU\WKUHHWRÞYH \HDUVVD\V%5(ZKLFKVSHFLDOLVHVLQVXVWDLQDELOLW\VWDQGDUGVFRGHVDQGPHWKRGRORJLHV IRUEXLOGLQJVKRPHVDQGFRPPXQLWLHV

Monitoring impacts 2QHNH\H[DPSOHRISURJUHVVLQWKLVDUHDLV7KH/RZ,PSDFW6KRSÞWWLQJ7RRO /,67  GHYHORSHGE\%5()LWFK'LVSOD\3ODQDQG0DUNV 6SHQFHU 0 6 WRUHGXFHWKHLPSDFW RIUHWDLOGLVSOD\SURGXFWVRQWKHHQYLURQPHQW7KHSURMHFWDOORZVUHWDLOHUVGHVLJQHUV DQGPDQXIDFWXUHUVWRHYDOXDWHDQGFRPSDUHWKHHQYLURQPHQWDOLPSDFWVRIVKRSÞWWLQJ GLVSOD\PDWHULDOVDQGHTXLSPHQWSUHYHQWLQJDQ\ZDVWHRIÞ[WXUH $YDLODEOHVLQFH/,67HQFRXUDJHVGHVLJQHUVWRFRQVLGHUWKHHQYLURQPHQWDO FRQVHTXHQFHVRIWKHSURGXFWIURPWKHSUHOLPLQDU\GHVLJQVWKURXJKRXWWKHOLIHF\FOHRI WKHVKRSÞWWLQJGLVSOD\HTXLSPHQW7KHVFKHPHVKRXOGLQßXHQFHVKRSÞWWLQJGHVLJQHUV DQGPDQXIDFWXUHUVWRXVHPRUHVXVWDLQDEOHPDWHULDOVDQGUHWDLOHUVWRVHOHFWHTXLSPHQW WKDWZLOOVXSSRUWWKHLUVXVWDLQDELOLW\JRDOV 2QHH[DPSOHRIWKLVLQDFWLRQLV0 6mXVHRIDQHZZLUHV\VWHP$VSDUWRILWVl3ODQ$m FRPPLWPHQWWRHWKLFDODQGVXVWDLQDEOHSURGXFWVRXUFLQJWKHVXSHUPDUNHWZRUNHGZLWK :DQ]OWKHODUJHVWVKRSSLQJWUROOH\PDQXIDFWXUHULQWKHZRUOGWRGHVLJQDQGGHYHORSD QHZORRNIRRGKDOOH[SHULHQFHDURXQGLWVFRUHZLUHV\VWHP:DQ]OVD\VLWHQVXUHVWKDW DOOUDZPDWHULDOVPHHWVWULFWTXDOLW\DQGVXVWDLQDELOLW\FULWHULD7KHEUDQGFRQWLQXHV 52 RETAIL ENVIRONMENT | MAY 2013


to increase its use of recycled and recyclable materials, particularly the steel used in the Wire Tech system and all timbers used by Wanzl are FSC-COC (Forest Stewardship &RXQFLO&KDLQRI&XVWRG\&HUWLĂ&#x17E;FDWLRQ DFFUHGLWHG n7KHYHUVDWLOLW\RI:LUH7HFKH[WHQGVEH\RQGWKHRULJLQDOVHUYLFHOLIHDQGFDQEHQHĂ&#x17E;W from Wanzlâ&#x20AC;&#x2122;s UK-based â&#x20AC;&#x2DC;Revivaâ&#x20AC;&#x2122; brand remanufactured process which provides a second VHUYLFHOLIHDQGDUDQJHRIDUWĂ&#x17E;QLVKHVZKLFKFDQUHĂ&#x;HFWUXVWLFLQGXVWULDODQGUHWUR WKHPHVoH[SODLQVWKHFRPSDQ\

Ships to shops In 2008 PVC extrusion specialists Wilks announced the launch of a â&#x20AC;&#x153;Green Rangeâ&#x20AC;? recycling scheme which allowed its shipbuilding customers to return materials for UHF\FOLQJYLDDFUHGLWYRXFKHUV\VWHP7KHVFKHPHKDVVLQFHEHHQUROOHGRXWWRDVLPLODU SURJUDPZLWKLQWKHVKRSĂ&#x17E;WWLQJLQGXVWU\ â&#x20AC;&#x153;Our ability to reuse the postconsumer waste generated from major store refurbishments would allow us to provide a â&#x20AC;&#x153;closed-loopâ&#x20AC;? strategy when handling waste SODVWLFVoVD\V6FRWW%HUU\:LONVMRLQWPDQDJLQJGLUHFWRU7KHV\VWHPDOVRnGUDPDWLFDOO\ ORZHUVoWKHFDUERQIRRWSULQWRIWKHFRPSDQ\mVGRPHVWLFFXVWRPHUVKHDGGV â&#x20AC;&#x153;The inherent characteristics of plastics ensure that they remain an excellent choice RIPDWHULDOIRULPSDFWSURWHFWLRQVROXWLRQVIRUZDOOVDQGUHWDLOĂ&#x17E;[WXUHV3ODVWLFVWKHUHIRUH continue to have a future in store design but there is a growing emphasis upon all users to take a level of responsibility in ensuring they have as minimum an impact upon RXUHQYLURQPHQWDVSRVVLEOHoKHDGGV'HVSLWHWKHFRPSDQ\DOUHDG\PDQXIDFWXULQJ DQXPEHURISURĂ&#x17E;OHVLQUHF\FOHGPDWHULDOVWKLVFRXOGLPSURYHnE\WDNLQJDELJ VWHSDQGDFWLYHO\ZRUNLQJDORQJVLGHHQGXVHUVZKRZRXOGH˧HFWLYHO\EHFRPHUHF\FOLQJ SDUWQHUVoDFFRUGLQJWR:LONV

â&#x20AC;&#x153;At the end of 2007, there were RYHU retail outlets, with retailers commonly updating their VKRSĂ&#x17E;WWLQJGLVSOD\ equipment every WKUHHWRĂ&#x17E;YH\HDUVo

The three Rs UK retail and commercial design specialist, Resolution Interiors is working with its clients WRFUHDWHPRUHHQYLURQPHQWDOO\IULHQGO\VWRUHV7KHFRPSDQ\DLPVWRPD[LPLVHOLIHF\FOHV E\UHXVLQJUHVHOOLQJRUUHF\FOLQJWKHYDVWPDMRULW\RIDOOROGĂ&#x17E;[WXUHVDQGĂ&#x17E;WWLQJVE\ XSJUDGLQJROGĂ&#x17E;[WXUHVDQGUHXVLQJWKHPIRUDQRWKHUVWRUHZLWKLQWKHFOLHQWmVHVWDWH ,QWKHFRPSDQ\FRPSOHWHGDQH[WHQVLYHUHĂ&#x;RZSURJUDPPHIRUWKH8.mVODUJHVW VXSSOLHURIWUDGHWRROVDQGKDUGZDUHSURGXFWV6FUHZĂ&#x17E;[ZKLFKHQFRPSDVVHGVLWHV $OOĂ&#x17E;[WXUHVWKDWFRXOGQRWEHVDOYDJHGZHUHVHSDUDWHGLQWRWLPEHUDQGPHWDOVZLWKDOO PHWDOVEHLQJVHQWEDFNWRWKHFOLHQWIRUVWRUDJHWREHVHQWRQWRVFUDSIRUUHF\FOLQJ)RU DQRWKHUFOLHQW9LUJLQ0HGLDWKHFRPSDQ\VKLSSHGDOOROGĂ&#x17E;WWLQJVDQGĂ&#x17E;[WXUHVEDFNWRLWV ZDUHKRXVHIRUVWRUDJHZKLOHORRNLQJWRUHXWLOLVHRUUHVHOODVPXFKRIWKHNLWDVSRVVLEOH 7KHFRPSDQ\LVDOVRLQWKHSURFHVVRIGHOLYHULQJDSURJUDPPHRIUHĂ&#x17E;WVIRU&DGEXU\ )DFWRU\2XWOHWV As most waste on sites comes from packaging and demolitions, the company has to put in place waste management plans for all of its construction sites to make sure that all that can be recycled or re-used is, â&#x20AC;&#x153;This is also achieved through working with waste handling companies who provide diversion from ODQGĂ&#x17E;OOZLWKWKHDLPRIGLYHUWLQJRIDOOZDVWHEDFN LQWRUHF\FOLQJVWUHDPVoLWH[SODLQV At the other end of the product life cycle, the FRPSDQ\GHVLJQVEHVSRNHĂ&#x17E;[WXUHVIXUQLWXUHDQG merchandising display units, aiming â&#x20AC;&#x153;to keep materials DQGSDUWVWRDPLQLPXPo â&#x20AC;&#x153;We look to purchase metalwork from a recycled source, and where possible we will look to use alternative and newly innovative materials which are more sustainable â&#x20AC;&#x201C; such as straw board instead of plaster board in the case of the B&Q energy saving FRQFHVVLRQODXQFKoDFFRUGLQJWR5HVROXWLRQ,QWHULRUV

Resolution Interiors operates a UHĂ&#x;RZSURJUDPZKLFKFDQVHSDUDWH FXVWRPHUVPHWDOVDQGWLPEHULQWR VFUDSIRUUHF\FOLQJ

MAY 2013 | RETAIL ENVIRONMENT 53


LOGISTICS

Fuelling

up

:LWKIXHOSULFHVVSLUDOOLQJ H˨FLHQWPDQDJHPHQW RIWKHUHVRXUFHLV IDVWEHFRPLQJYLWDO $P\1RUWKH[DPLQHV ZKDWEXVLQHVVHVDUH GRLQJWREULQJGRZQ FRVWVDQGUHGXFHWKHLU FDUERQHPLVVLRQV

7KHĂ&#x;HHWLVDQLQWHJUDOSDUWRIDQ\UHWDLORSHUDWLRQ Whether it is delivering goods to stores, warehouses or directly to the customers, it provides a crucial link between the merchandisers and the consumers. However, with fuel accounting for approximately 40% of transport FRVWVDQGSULFHVFRQWLQXLQJWRULVHUXQQLQJDĂ&#x;HHWLVEHFRPLQJ an increasingly expensive feat. Moreover, with added pressure to cut carbon and other greenhouse gas emissions, thanks to the Governmentâ&#x20AC;&#x2122;s mandatory targets (the UK is committed to slash 80% of 1990 greenhouse gas emission levels by 2050), businesses need to HQVXUHWKH\DUHXVLQJIXHODVH˨FLHQWO\DVSRVVLEOH One way a number of retailers are doing this is to join the Freight Transport Associationâ&#x20AC;&#x2122;s Logistics Carbon Reduction Scheme. As one

of the UKâ&#x20AC;&#x2122;s largest trade associations, the FTA represents the transport interests of organisations moving goods by road, rail, sea and air. The free scheme works by measuring the amount of fuel used by each member and calculating the carbon emissions. To date, 83 companies have signed up to the voluntary scheme and pledged their commitment to the target of reducing carbon emissions by 8% by 2015 against a 2010 baseline. The signatories range from large and VPDOOUHWDLOHUVPDQXIDFWXUHUVORJLVWLFVĂ&#x17E;UPVDQGZDVWHPDQDJHPHQW companies and include: Coca-Cola Enterprises; DHL; NestlĂŠ UK; Superdrug; and Tesco. At present, it covers over 60,000 vehicles but Rachael Dillon, climate change policy manager at the FTA says while good progress has been made under the scheme, it must continue to grow.

MAY 2013 | RETAIL ENVIRONMENT 55


LOGISTICS

The FTA is to publish its third annual report on the Logistics Carbon Reduction Scheme at its annual Carbon Conference on May 22 2013. The report will look at government policy, carbon innovation and data showing by how much the scheme has reduced emissions.

BeneямБts 0V'LOORQVD\VFRPSDQLHVVWDQGWRJDLQDORWE\PDQDJLQJWKHLUIXHOH╦иFLHQWO\n0DQDJLQJ\RXUIXHO H╦иFLHQWO\LVLPSRUWDQWEHFDXVHIXHOLVWKHELJJHVWFRVWIRUDFRPSDQ\WUDQVSRUWLQJJRRGV$QGLWLVRQ the government agenda and public agenda on climate change meaning the industry and other sectors QHHGWRWDNHUHVSRQVLELOLW\IRUWKHLUWUDQVSRUWo She adds that the scheme is hoping to reduce any potential regulatory burden on companies by EHLQJSURDFWLYHn,WKLQNZKDWZHDUHWU\LQJWRGRZLWKWKHVFKHPHLVEHSURDFWLYHUDWKHUWKDQZDLWLQJ IRUJRYHUQPHQWWRSXOODUHJXODWLRQOHYHUDQGFUHDWHVRPHWKLQJZKLFKZLOOFDXVHDORWRIEXUGHQDQG LQVWHDGFUHDWHVRPHWKLQJZKLFKZRUNVZLWKWKHLQGXVWU\o 1RWRQO\GRHVH╦зHFWLYHIXHOPDQDJHPHQWKHOSWRLPSURYHDLUTXDOLW\LWFDQDOVREHXVHGDVD PDUNHWLQJWRROWRVKRZFXVWRPHUVWKDWWKHEXVLQHVVLVHQYLURQPHQWDOO\UHVSRQVLEOHDGGV0V'LOORQ 2QHRIWKHIRXQGLQJPHPEHUVRIWKHVFKHPHSKDUPDFHXWLFDODQGEHDXW\UHWDLOHU%RRWVWRRN action to reduce its fuel consumption and carbon emissions by introducing a multi-deck urban GHOLYHU\WUDLOHULQ7RGD\%RRWVm├ЯHHWRIPXOWLGHFNWUDLOHUVDUHDFKLHYLQJDQDQQXDOVDYLQJ RIQHDUO\KDOIDPLOOLRQNLORPHWUHVHYHU\\HDUDQGDSSUR[LPDWHO\WRQQHVRI&2$QGWKH PHWUHORQJWUDLOHUVZKLFKKDYHWZR├ЯRRUVFDQFDUU\UROOFDJHVDLQFUHDVHRQWKHFDSDFLW\RI DQRUPDOPHWUHXUEDQWUDLOHUPHDQLQJIHZHUMRXUQH\VDUHUHTXLUHG

Drivers &KULV(YDQVVROXWLRQVGHYHORSPHQWPDQDJHUDW9ROYR7UXFNVEHOLHYHVGULYHUWUDLQLQJLVWKHEHVWZD\ WR├ЮQGVDYLQJVDQGXUJHVFRPSDQLHVQRWWRIRFXVSXUHO\RQPLOHVWRWKHJDOORQ PSJ DVWKLVFDQYDU\ GHSHQGLQJRQFLUFXPVWDQFHVVXFKDVZHDWKHUDQGWUXFNVL]H+HDGGVWKDWEXVLQHVVHVVKRXOGWUDLQ WKHLUGULYHUVWROHDUQJRRGWHFKQLTXHVVXFKDVFRDVWLQJDQGDYRLGLQJKDUVKEUHDNLQJDQGDFFHOHUDWLRQ EXWZDUQVWKDWFKDQJLQJGULYHUVmKDELWVFDQEHFKDOOHQJLQJ 0SJLVDUHVXOWRIJRRGGULYLQJWHFKQLTXHVZKLFKWKHGULYHUVDGRSWDVZHOODVPDQ\RWKHU XQFRQWUROODEOHYDULDEOHV0U(YDQVDGGVn7KHGULYHUWHFKQLTXHVVKRXOGEHFRQVLVWHQWUHJDUGOHVVRI WKHZHDWKHUW\UHSUHVVXUHVHYHQJURVVZHLJKWWRVRPHH[WHQW:RUNLQJZLWKGULYHUWHFKQLTXHVPHDQV ZHFDQPHDVXUHDQDO\VHDQGFRPSDUHGULYHUVDWDQ\WLPHo 2╦зHULQJDGYLFHWRWKRVHEXVLQHVVHVORRNLQJWRLPSURYHWKHLUIXHOH╦иFLHQF\KHVD\Vn,ZRXOG UHFRPPHQGVWDUWLQJZLWKWKHGULYHUVLWKDVWKHELJJHVWSRWHQWLDOIRUVDYLQJVEXWZKDWHYHU\RXGHFLGH WRWDFNOH├ЮUVWZLWK\RXUIXHOVDYLQJSURJUDPPHUHPHPEHUVDYLQJIXHOLVDMRXUQH\qQRW DGHVWLQDWLRQ

Fuel accounts for approximately 40% of transporting costs

56 RETAIL ENVIRONMENT | MAY 2013


([DPSOHVRIIXHOPDQDJHPHQWV\VWHPVRQWKHPDUNHW Name

FuelLog 2 by E-Drive Technology

'\QDĂ&#x;HHWE\9ROYR

$FWLYH7UDQVSRUW 0DQDJHPHQW6\VWHPE\ ,VRWUDN

Price

ÂŁ2,000 for a singular system plus ÂŁ345 per vehicle

Each module is ÂŁ13 per truck per month

Costs vary but the basic telematics system costs ÂŁ1 per day per vehicle

How it works

)XHO/RJR˧HUVVHFXUH access to unattended fuel supplies and is attached to fuel pumps and vehicles to measure the amount of fuel distributed. When the YHKLFOHĂ&#x17E;OOVXSWKHV\VWHP automatically reports back to the server the vehicle and GULYHULGHQWLĂ&#x17E;FDWLRQWKHWLPH date and quantity of fuel used. This allows companies to monitor how much fuel is being used. It is distributed in the UK by Batrak.

'\QDĂ&#x;HHWLVDQRQOLQH transport information system for Volvo trucks allowing the user to see in real time the location, fuel consumption and driver times for each vehicle. As one of the four FRUQHUVWRQHVRI'\QDĂ&#x;HHW the fuel management tool R˧HUVGHWDLOHGUHSRUWV which give an immediate overview for drivers and vehicles on breaking, engine and gear utilisation, speed adaptation and standstill.

Active Transport Management System (ATMS), although not directly a fuel management system, provides real time location monitoring using GPS satellite data. It works with a routing and scheduling system which uses data from Isotrak to optimise routes and re-organise distribution operations. The real time visibility of vehicles helps businesses better plan their routes and operate more H˨ FLHQWO\VDYLQJPRQH\IXHO and time.

Image

n,I\RXZDQWWRJHWWKHORZHVWSRVVLEOHIXHOXVHG\RXZLOOQHHGWRZRUNRQRWKHUIDFWRUVWKDWD˧HFW how much fuel is used as well as driver techniques, such as tyres, aerodynamics, trailer or body design and so on.â&#x20AC;? One company which has embraced the importance of driver training is department store chain 'HEHQKDPV7KHĂ&#x17E;UPmVĂ&#x;HHWZKLFKLVRSHUDWHGE\'+/XVHV,VRWUDNWHFKQRORJ\WRUHYLHZDQGLPSURYH driver behaviour and de-brief with them at the end of each shift. Debenhams says this helps it to tackle issues such as over-acceleration, excessive braking and engine idling, all of which are unnecessary fuel burners. The technology also quickly pays for itself as fuel savings add up, it adds. $QRWKHUZD\WKHUHWDLOHULVGULYLQJGRZQWKHLPSDFWRILWVĂ&#x;HHWLVE\LQYHVWLQJLQQHZYHKLFOHV It introduced 25 new articulated vehicles with the latest Euro 5 engines in a bid to drive down HPLVVLRQVDQGSDUWLFXODWHV2WKHUYHKLFOHVLQLWVĂ&#x;HHWKDYHDOVREHHQFRQYHUWHGWRORZHPLVVLRQ ]RQH /(= VSHFLĂ&#x17E;FDWLRQV0RYLQJIRUZDUG'HEHQKDPVSODQVWRXSJUDGHLWVZKROHĂ&#x;HHWLQOLQHZLWK environmental requirements. Through this and other measures Debenhams reduced its fuel consumption across its UK and Ireland Ă&#x;HHWE\IURPWRZKLOHDOVRGULYLQJGRZQWKHGLVWDQFHWUDYHOOHGE\LWVĂ&#x;HHWE\DQ LPSUHVVLYH$GGLWLRQDOO\LWUHGXFHGLWV&2HPLVVLRQVSHUXQLWVGRZQE\

Future /RRNLQJWRWKHIXWXUH0V'LOORQEHOLHYHVIXHOH˨ FLHQF\ZLOOFRQWLQXHWRSXVKLWVZD\XSWKHDJHQGDn, WKLQNWKHUHZLOOSUREDEO\EHPRUHH˧RUWRQIXHOH˨ FLHQF\DVWKHFOLPDWHFKDQJHSROLF\DJHQGDKDVPRYHG IRUZDUGSDUWLFXODUO\DWDJRYHUQPHQWOHYHO7HQ\HDUVDJRRSHUDWRUVRUĂ&#x;HHWPDQDJHUVZRXOGKDYHKDG environmental programmes or statements but now they have got to really incorporate carbon into that. n$QGZLWKWKHZHDOWKRIGL˧HUHQWSROLF\FRPLQJRXWRIJRYHUQPHQWRQUHGXFLQJFDUERQWKHLVVXH LVQmWJRLQJWRJRDZD\DWDOOeWKHERWWRPOLQHLVWKDWJRYHUQPHQWLVFRPPLWWHGWRWKH&OLPDWH&KDQJH$FW DQGZHFDQmWUHO\RQIRVVLOIXHOVIRUHYHU,WLVJRRGWKDWZHORRNDWHQHUJ\H˨ FLHQF\LQDQ\VHFWRUoVKH concludes.

â&#x20AC;&#x153;The bottom line is that government is committed to the Climate Change Act DQGZHFDQmW rely on fossil fuels foreverâ&#x20AC;? MAY 2013 | RETAIL ENVIRONMENT 57


Pall-Ex Retail Plus+, the rapidly growing, competitive and highly efficient distribution solution that’s making its mark on Britain’s High Streets. More and more leading retailers are turning to Pall-Ex Retail Plus+ to deliver a quality service they can count on. That’s because we’re dedicated to making shipping and stock control easier for you, with key benefits such as: X Immediate cost savings X Optimum stock control X Increased efficiency X Reduced staff health and safety risk X Unrivalled standards of reliability and flexibility

Unlike standard ‘drop and go’ operations, we’ll also unwrap the freight, decant it and deliver it into your storeroom – we can even remove the waste packaging for recycling. So if you’d like a bespoke end-to-end stock delivery service that’s taking High Street retail logistics to new heights, please call 01530 239028 or email retailplus@pallex.com

www.pallex.co.uk/retailplus/

DISTRIBUTION WA R E H O U SI N G S TO R AG E

F U L L / H A L F / Q UA R T E R E U R O PA L L E T OPTIONS

HANGING G A R M E N TS DELIVERIES

FL E XIBL E TIM E D DE L IVE R IE S

ON E - S TOP LOGIS TIC S I.T. MA N AGE M E N T

DA ILY E UR OP E A N DE L IVE R IE S

R E DUC E D C A R BON FOOTP R IN T


LOGISTICS

Against the tide Reversed Logistics: WKHßRZRI surplus or unwanted material, JRRGVRUHTXLSPHQWEDFNWRWKH ÞUPWKURXJKLWVORJLVWLFVFKDLQIRU UHXVHUHF\FOLQJRUGLVSRVDO Retail (QYLURQPHQWORRNVDWWKHEHQHÞWVRI switching retailers’ attention from KRZWRGLVWULEXWHWKHLUSURGXFWVWR WKRVHÞQGLQJWKHLUZD\EDFN In the last seven years the UK retail sector has reduced the amount RIZDVWHLWVHQGVWRODQGÞOOE\DTXDUWHU:KLOHWKHH˧RUWVHHPV FRPPHQGDEOHLQVXFKDUHODWLYHO\VKRUWVSDFHRIWLPHLWVWLOODFFRXQWV IRURIDOO8.FRPPHUFLDOZDVWHRIZKLFKHQGVXSLQODQGÞOO 7KHÞJXUHVFRPSLOHGE\WKH'HSDUWPHQWIRU(QYLURQPHQWDQG 5XUDO$˧DLUV 'HIUD DQGWKH%ULWLVK5HWDLO&RQVRUWLXP %5& DUHQRW DUHYHODWLRQIRUDUHWDLOVHFWRUZDNLQJXSWRWKHV\PELRVLVRIUHF\FOLQJ DQGZDVWHEHKDYLRXUVDQGFRPPHUFLDODQGHQYLURQPHQWDOVXFFHVVHV,Q DUHFHQWUHSRUWWKH5HWDLO,QGXVWU\/HDGHUV$VVRFLDWLRQVDLGWKDWPDQ\ UHWDLOHUVZHUHQRZDVSLULQJWRDORQJWHUPYLVLRQRI]HURZDVWHEXW DOOXGHGWRWKHnPDQ\FRPSOH[LWLHVRIFROOHFWLQJDQGUHF\FOLQJGL˧HUHQW PDWHULDOW\SHVo 3DUWRIWKHVXFFHVVRIDFKLHYLQJWKLVORQJWHUPYLVLRQZLOOEH WKURXJKHQDFWLQJDUHYHUVHGDSSURDFKWRVXSSO\FKDLQPDQDJHPHQW 2QFHSUDFWLFHGSULPDULO\E\WKHDXWRPRWLYHLQGXVWU\ZKHUH PDQXIDFWXUHUVWULHGWRUHFRYHUYDOXHIURPUHF\FOLQJFDUSDUWVUHYHUVHG ORJLVWLFVDQGWKHRSWLPLVDWLRQRIVXSSO\FKDLQVLVIDVWEHFRPLQJNH\ WRUHWDLOHUVm]HURZDVWHVWUDWHJ\7UHQGVVXFKDVWKHULVHRIRQOLQH VKRSSLQJDQGKRPHGHOLYHULHVJURZLQJSUHVVXUHWRPDNHH˨FLHQW XVHRIWUDQVSRUWDQGUHJXODWLRQVUHTXLULQJLWHPVVXFKDVHOHFWULFDO SURGXFWVDQGFDUGERDUGZDVWHWREHUHF\FOHGDUHDOUHDG\SXWWLQJ UHYHUVHORJLVWLFVKLJKHUXSWKHUHWDLODJHQGD

Influence 8QGHUVWDQGLQJWKHFKDQJHVPDGHE\IHOORZUHWDLOHUVDQGWKHUHVXOWV DFKLHYHGFDQSURYLGHYDOXDEOHLQVLJKWIRUWKRVHHLWKHUHPEDUNLQJ XSRQRUHQKDQFLQJD]HURZDVWHSURJUDPPH7UDYLV3HUNLQVDOHDGHULQ EXLOGLQJVXSSOLHVDQGPDWHULDOVGLGMXVWWKLV

MAY 2013 | RETAIL ENVIRONMENT 59


LOGISTICS

recycle, enabling them to turn their waste management from a cost LQWRDSURĂ&#x17E;WVWUHDP0DNLQJVXFKDGL˧HUHQFHWRWKHERWWRPOLQHKDV embedded recycling within our everyday culture.â&#x20AC;? These changes have resulted in an annual cost avoidance in excess of ÂŁ5 million.

Backhauling Hemel EStore Recycling Zone, Travis Perkins

In 2009 specialist waste management company, SAICA NATUR formed a partnership with Travis Perkins plc to provide and implement a new waste management strategy at the company. 7KHFRPSDQ\VHWDWDUJHWWRKDOYHWKHDPRXQWRIZDVWHVHQWWRODQGĂ&#x17E;OO by 2012, which has been achieved. To do this SAICA NATUR worked as a consultant with the company to develop a plan on which to base future recycling operations. Initially, source segregated processes and collections were put in SODFHDFURVVDOOORFDWLRQVWRPDQDJHWKHPRVWSUROLĂ&#x17E;FPDWHULDOVSODVWLF cardboard and pallets. A segregation system for general waste and dry mixed recyclables was also introduced at the distribution centres. Continuous improvement and monitoring has been ongoing since the scheme was introduced, with all recycling outputs and general waste quantities recorded.

SAICA Natur has also developed and deployed the same logisticsled programme for the backhauling and recycling of materials from individual stores to a central retail distribution point for a number of retail clients. Backhauling saves costs by integrating returns into the outbound logistics network. The company believes the emphasis should not just be on DFKLHYLQJELJFKDQJHVnVPDOODQGRQJRLQJH˨FLHQFLHVFDQPDNH DELJGL˧HUHQFHWRGD\WRGD\RSHUDWLRQVoLWVD\V)RUH[DPSOHD new loading technique for bales which increases the average load weight per vehicle and allows unloading at twice the speed has been developed. This reduces waste miles, fuel costs and carbon emissions. By taking a holistic approach to supply chain management, reverse logistics is one area where retailers have an opportunity to make substantial cost savings while helping the environment. Many, like Travis Perkins, already appear to be doing exactly this.

Culture change As part of the partnership, Saica helped the company to initiate a reverse logistics scheme across the group. The scheme now sees all cardboard, plastic, pallets and other materials transported back from branches and stores to collection points at seven distribution centres where it is sorted and baled. At the start of the project, some three years ago, the group recycled 14% of what it then considered to be waste. Now, it has achieved ]HURZDVWHWRODQGĂ&#x17E;OODWDOO distribution centres and an overall recycling rate across the group of 60%. By 2014 the objective is to increase the recycling rate to 90%. Commenting on the progress made to date, John /HDGHUHQYLURQPHQWPDQDJHUDW7UDYLV3HUNLQVVDLG â&#x20AC;&#x153;Initially, the processes that we put in place heralded a massive culture change in our organisation, particularly in our merchanting branches, where they were used to having a skip outside the back door. We knew that all had to change. n2XUEUDQFKHVDQGVWRUHVQRZVHJUHJDWHPRUHWKDQGL˧HUHQW waste streams at each site. Weâ&#x20AC;&#x2122;ve also introduced an Environmental ,PSURYHPHQW6FKHPHDFURVVWKH*URXSLQFOXGLQJRXUKHDGR˨FH in Northampton, which incentivises recycling. Each merchanting branch is paid for every bag of plastic, card or pallets that they

RETAIL ENVIRONMENT 61


POLICY

BULLETIN Retailers selling electrical goods will be required to take back small waste electrical and electronic equipment (WEEE) in plans being consulted on by the Department for Business, Innovation & Skills. The consultation outlines how the Government plans to implement changes required to bring the requirements of the recast WEEE Directive into UK law, including implementing higher collection targets and the wider scope of the Regulations. It is entitled Implementation of the WEEE Recast Directive 2012/19/ EU and changes to the UK WEEE system. Its outcome will shape the future of the WEEE compliance for recyclers and producers of electronic equipment. The plans require retailers of electronic goods with sales areas exceeding PLQDQ\VLQJOHVWRUHWRR˧HUIUHHWDNHEDFNRIVPDOO WEEE (no external dimension over 25cm) from customers. The provision will not apply to members of the Distributor 7DNHEDFN6FKHPHKRZHYHUQRQPHPEHUVZLOOEHREOLJHGWR IXOĂ&#x17E;OWKLVQHZUHTXLUHPHQW7KHFRQVXOWDWLRQHQGVRQ-XQH 21 and the Government plans to publish its response within HLJKWZHHNV7KHQHZUHJXODWLRQVDUHH[SHFWHGWRFRPHLQWR IRUFHIURP-DQXDU\ZLWKJXLGDQFHQRWHVVHWWREH DYDLODEOHDWOHDVWZHHNVEHIRUH

â&#x20AC;&#x153;In 2013 up to 18 new ecodesign and/or labelling PHDVXUHVZLOOEHDGRSWHGo 7KHĂ&#x17E;UVWNational Adaptation Programme (NAP) will be published before November 2013, the Department IRU(QYLURQPHQW)RRGDQG5XUDO$˧DLUV 'HIUD KDV announced. A consultation is already completed and WKHĂ&#x17E;QGLQJVDUHEHLQJFRQVLGHUHG7KHGRFXPHQWZLOOVHW out stricter environmental guidelines for government, academia, charities and businesses. Defra will review NAP HYHU\Ă&#x17E;YH\HDUV The Groceries Code Adjudicator Bill was given Royal $VVHQWRQ$SULOFUHDWLQJWKH8.mVĂ&#x17E;UVWLQGHSHQGHQW adjudicator to oversee the relationship between large VXSHUPDUNHWVDQGWKHLUGLUHFWVXSSOLHUV7KHLGHDLVWR JLYHDOOEXVLQHVVHVEHWWHUDFFHVVWRIDLUDQGRSHQPDUNHWV n7KH*URFHULHV&RGH$GMXGLFDWRUZLOOPDNHVXUHWKDWODUJH VXSHUPDUNHWVDELGHE\WKH*URFHULHV6XSSO\&RGHRI Practice, and treat their suppliers fairly and lawfully.

This will give suppliers the stability to help them grow, LQQRYDWHDQGFRPSHWHLQWKHPDUNHWoVDLGFRPSHWLWLRQ PLQLVWHU-R6ZLQVRQ Retailers in Northern Ireland on April 8 started charging a minimum of 5p for each carrier bag handed out to customers, as part of a drive across the province to reduce SODVWLFZDVWH6FRWODQGLVVWLOOORRNLQJWREDQSODVWLFEDJV in 2015. An EU consultation on plastics waste was launched by the European Commission on March 7 and will last XQWLOWKHEHJLQQLQJRI-XQH7KHUHVXOWVZLOOIHHGLQWR further policy action in 2014 as part of a broader waste SROLF\UHYLHZZKLFKZLOOORRNLQSDUWLFXODUDWWKHH[LVWLQJ WDUJHWVIRUZDVWHUHFRYHU\DQGODQGĂ&#x17E;OODVZHOODVDQH[ SRVWHYDOXDWLRQRIĂ&#x17E;YHGLUHFWLYHVFRYHULQJYDULRXVZDVWH VWUHDPV2QWKHEDFNRIWKLVWKH&RPPLVVLRQZLOOUHOHDVH a communication on plastic bags before December, a &RPPLVVLRQVRXUFHFRQĂ&#x17E;UPHG7KHSDSHUZLOOUHYLHZZKDW DFWLRQVKRXOGEHWDNHQDW(8OHYHOWRUHJXODWHPHPEHUVWDWHmV use of plastic bags. The Commission will launch a public consultation on sustainable food in May and plans to publish its communication on this in December. As part of this the Commission will explore whether or not to extend the scope of the EU Ecolabel by introducing criteria for food and feed products. The Commission is in the process of launching preparatory studies for the products in the priority list of WKHZRUNLQJSODQRIWKHEcodesign Directive. It will wait XQWLOWKHHQGRIRUEHJLQQLQJRIWRVHHWKHĂ&#x17E;UVW regulatory proposals, for ecodesign and/or energy labelling, RQWKHVHSURGXFWV$ORWRIUHJXODWRU\ZRUNLVLQWKHSLSHOLQH UHODWHGWRSURGXFWVLQWKHĂ&#x17E;UVWZRUNLQJSODQ   and even the transitory period. In 2013 up to 18 new ecodesign and/or labelling measures will be adopted. A review of EU chemical legislation REACH, adopted in February, concluded that while some adjustments are needed, no major overhaul is required. Among the recommendations LVWRUHGXFHWKHĂ&#x17E;QDQFLDODQGDGPLQLVWUDWLYHEXUGHQRQ 60(VLQRUGHUWRHQVXUHWKHSURSRUWLRQDOLW\RIOHJLVODWLRQ DQGWRDVVLVWWKHPWRIXOĂ&#x17E;ODOOWKHLU5($&+REOLJDWLRQV7KH Commission also wants to ensure legislative stability and predictability for European businesses. A new registration GHDGOLQHLVGXHLQ-XQHIRUVXEVWDQFHVRITXDQWLWLHVKLJKHU than 100 tonnes per year. Companies have now registered Ă&#x17E;OHVZLWKWKH(XURSHDQ&KHPLFDOV$JHQF\ (&+$  describing the uses and properties of 7,884 chemical VXEVWDQFHVPDQXIDFWXUHGRUSODFHGRQWKHPDUNHW

MAY 2013 | RETAIL ENVIRONMENT 63


TECHNOLOGY Rising energy prices, government mandates, competition and corporate responsibility are propelling retailers to pay closer attention to greener technologies. Now experiencing a surge in innovation, the green technology market is undergoing burgeoning growth, unleashing waves of cleaner, more energy and cost efďŹ cient, products day by day. This section takes a look at some of the latest creations to be adopted by the retail sector

Philips â&#x20AC;&#x201C; TLED

Cybertill â&#x20AC;&#x201C; Mobile PoS system

TLED is the latest innovation in LED (light HPLWWLQJGLRGHV OLJKWLQJIURP3KLOLSV7KH prototype tube lighting replacement is the ZRUOGmVPRVWHQHUJ\H˨ FLHQW/('ODPS suitable for general lighting applications, DFFRUGLQJWR3KLOLSVZKLFKDGGVWKDW its lighting engineers have been able to achieve 200 lumens per watt (lm/W) of white light (compared with 100lm/W for Ă&#x;XRUHVFHQWOLJKWLQJ ,QWHQGHGWRUHSODFH Ă&#x;XRUHVFHQWWXEHOLJKWLQJFXVWRPHUVDUH H[SHFWHGWRUHDSlVLJQLĂ&#x17E;FDQWmHQHUJ\DQG cost savings with the added bonus that their carbon footprint is also reduced. The 7/('LVH[SHFWHGWRKLWWKHPDUNHWLQ

Cybertillâ&#x20AC;&#x2122;s system works through any web enabled mobile or tablet device giving retailers the ability to check stock levels and complete transactions from anywhere in the store, rather WKDQDWUDGLWLRQDOĂ&#x17E;[HGWLOOSRLQW7KH03R6V\VWHPERDVWVD number of other features which can help to improve a storeâ&#x20AC;&#x2122;s HQYLURQPHQWDOFUHGHQWLDOV)RUH[DPSOHLWFRPHVZLWKWKHRSWLRQ of emailing receipts directly to the customers, which reduces waste and being based on a mobile or tablet also means it uses far less energy than a standalone till point which is constantly connected to the mains.

NEC â&#x20AC;&#x201C; MultiSync X462S

Epson â&#x20AC;&#x201C; TM-T88V-DT

NECâ&#x20AC;&#x2122;s super slim MultiSync X462S is part of its public display ECO range, which can be used for a wide array of applications including retail signage. Lit by LED backlight technology, the lightweight 46 inch LCD VFUHHQFDQEHĂ&#x17E;WWHGLQWRDFDELQHWRU wall mounted. This energy H˨ FLHQWPRGHOKDV a built in ambient light sensor which reduces brightness when it is not needed and can be programmed to reduce unnecessary running time. The screen even comes with a carbon savings meter and an â&#x20AC;&#x2DC;ECOModeâ&#x20AC;&#x2122; which helps to save power and reduce heat.

7KHDZDUGZLQQLQJ7079'7ZHEHQDEOHG receipt printer with an integrated peripheral controller is designed to work with the internet. Retailers can streamline operations, saving costs and space using this thermal receipt printer. As a standalone solution, it GRHVQmWQHHGWREHFRQQHFWHGWRDFRPSXWHURU326WHUPLQDO saving money on electricity by reducing the amount of hardware needed. Additionally, the built in paper save feature can help reduce paper use by 30% which is achieved by reducing the top margin on the receipt and also the size of the barcode, with an average saving on 6cm per receipt.

64 RETAIL ENVIRONMENT | MAY 2013

Star Micronics â&#x20AC;&#x201C; TSP100 ECO 'HVFULEHGDVWKHZRUOGmVĂ&#x17E;UVWGHGLFDWHGHFR326SULQWHU6WDU0LFURQLFVmODWHVWDGGLWLRQWRWKH 763futurePRNT series provides retailers with a number of cost saving features. Retailers could see up to a 70% reduction in use of receipt paper due to a default 3mm top margin and built LQVRIWZDUHZKLFKUHGXFHVUHFHLSWVL]HE\ RU$GGLWLRQDOO\WKH763(&2KDVDQ innovative power management system which means that it reverts into a low power standby PRGHXVLQJZDWWVZKHQQRWLQXVHWRVDYH energy, compared to 29 watts when printing.


Tools Paper Saving r that no othe cturer printer manufa . can match

Rest assured, the TSP100 futurePRNT ™ ECO is the most environmentally friendly POS printer money can buy… and still at a competitive price ! Here at Star, we’ve put every waking hour into creating the world’s first dedicated ECO POS printer. The TSP100 futurePRNT™ ECO is an entry-level POS solution that not only saves you money but also helps fight climate change and reduce IT environmental impact. In creating the TSP100 futurePRNT™ ECO, the greenest POS printing solution available, we have taken every aspect of its manufacture and usage into consideration from innovative ECO packaging through to the provision of key tools to reduce power and paper consumption. Inspired by the cheetah, nature’s greatest exponent of energy efficiency, the TSP100 futurePRNT™ ECO uses less power than most competitive printers available today and can reduce paper consumption by up to 70%. And, just like the cheetah, its performance is second-to-none making it an ideal solution to meet the demands of the toughest retail and hospitality environments. But in times of inactivity, it simply goes to sleep, saving valuable energy and reducing carbon emissions. Great for your bottom line and even better for the environment. So if you’re hunting for a fast, affordable and highly flexible POS solution that won’t cost the earth, you’ll really want to get your paws on the TSP100 futurePRNT™ ECO. For more information about our Paper Saving Tools that will help reduce costs and climate change, call our sales team on +44 (0) 1494 471111 or visit www.futurePRNT.com

NEW 4 year Warranty on all futurePRNT models (Europe mainland only – see website for terms & conditions)

The world’s first ECO POS printer.


LETTERS

Letters to the Editor We want to hear from you. If you would like us to publish your opinion on any of the themes raised in this issue of Retail Environment or on a broader issue of interest, please email: Charlotte.O@retailenvironment.co.uk Or post to: Charlotte Owen, Editor Retail Environment Environment Media Group Elizabeth House 39 York Road London SE1 7NQ We will endeavour to publish as many letters as possible.

Checkout

66 RETAIL ENVIRONMENT | MAY 2013


Environmental legislation overseas: Do you need to worry?

All of these countries have environmental legislation To find our if youâ&#x20AC;&#x2122;re affected why not come along to one of our free International Compliance Seminars Book your place at

www.valpak.co.uk/events or call us on 08450 682 572

www.valpak.co.uk

info@valpak.co.uk

08450 682 572


Expanding the market for secondary raw materials in the UK, we provide sustainable solutions for your recycling and waste management needs. As a recycling partner you can benefit from: Closed loop UK recycling Financial and Environmental benefits Expertise in management, services and equipment Support to achieve Zero Waste to landfill

why not contact SAICA Natur today BRINGING NEW LIFE TO WASTE PRODUCTS

SAICA Natur UK Ltd 144 Manchester Road Carrington M31 4QN

Telephone customer services on

01666 825619

E. info.natur.uk@saica.com W. www.saica.com F. 01666 826121

Retail Environment May 2013  

Retail Environment is the new source of industry information, analysis and perspective on sustainability for retail professionals and those...

Read more
Read more
Similar to
Popular now
Just for you