Page 1

*5283,1'(;

 *$/$17

*HQHUDO 



(QJLQH



(QJLQH/XEULFDWLRQ 



)XHO 



(QJLQH&RROLQJ 



,QWDNHDQG([KDXVW 



7KLV :RUNVKRS PDQXDO FRQWDLQV SURFHGXUHV IRU VHU (QJLQH(OHFWULFDO YLFH PHFKDQLFV LQFOXGLQJ UHPRYDO GLVDVVHPEO\ LQ VSHFWLRQ DGMXVWPHQW UHDVVHPEO\ DQG LQVWDOODWLRQ (QJLQHDQG(PLVVLRQ&RQWURO 8VH WKH IROORZLQJ PDQXDOV LQ FRPELQDWLRQ ZLWK WKLV $XWRPDWLF7UDQVD[OH 7UDQVPLVVLRQ

PDQXDODVUHTXLUHG



)URQW$[OH 



5HDU$[OH 



:KHHODQG7\UH 



3RZHU3ODQW0RXQW 



)URQW6XVSHQVLRQ 



5HDU6XVSHQVLRQ 



:25.6+230$18$/

)25(:25'

7(&+1,&$/,1)250$7,210$18$/ %2'<5(3$,50$18$/ 3$576&$7$/2*8(

$OO LQIRUPDWLRQ LOOXVWUDWLRQV DQG SURGXFW GHVFULSWLRQV FRQWDLQHGLQWKLVPDQXDODUHFXUUHQWDVDWWKHWLPHRI 6HUYLFH%UDNHV  SXEOLFDWLRQ :H KRZHYHU UHVHUYH WKH ULJKW WR PDNH FKDQJHVDWDQ\WLPHZLWKRXWSULRUQRWLFHRUREOLJDWLRQ 3DUNLQJ%UDNHV

©0LWVXELVKL0RWRUV&RUSRUDWLRQ

-XQH

 

 

6WHHULQJ 



%RG\ 



([WHULRU  ,QWHULRUDQG6XSSOHPHQWDO  5HVWUDLQW6\VWHP 656



&KDVVLV(OHFWULFDO  +HDWHU$LU&RQGLWLRQHUDQG  9HQWLODWLRQ



&RPSRQHQW/RFDWLRQV



&RQILJXUDWLRQ'LDJUDPV



&LUFXLW'LDJUDPV 



 




*5283

*(1(5$/ &217(176

*(1(5$/ 



*(1(5$/(/(&75,&$/!  (




*5283

*(1(5$/ &217(176 +2:7286(7+,60$18$/



7528%/(6+227,1**8,'(/,1(6



+2:7286(7528%/(6+227,1* ,163(&7,216(59,&(32,176



7528%/(6+227,1*&217(176 



9(+,&/(:$6+,1* 



$33/,&$7,212)$17,&25526,21$*(176$1' 81'(5&2$76   6&$1722/ 087,,,68%$66(0%/< 

72:,1*$1'+2,67,1*





+2:7286(7+(,163(&7,21352&('85(6  

*(1(5$/'$7$$1'63(&,),&$7,216  

&211(&7250($685(0(176(59,&(32,176  

7,*+7(1,1*72548( 



&211(&725,163(&7,216(59,&(32,176  

/8%5,&$7,21$1'0$,17(1$1&(



+2:72&23(:,7+,17(50,77(17 0$/)81&7,216



,163(&7,216(59,&(32,176)25$%/2:1 )86(  +2:7275($7&855(177528%/( 



+2:7275($73$677528%/( 



,17(56<67(0$)),/,$7(''7& 5()(5(1&(7$%/(



9(+,&/(,'(17,),&$7,21 



9(+,&/(,'(17,),&$7,21180%(5/2&$7,21   9(+,&/(,1)250$7,21&2'(3/$7(

35(&$87,216%()25(6(59,&(





6833/(0(17$/5(675$,176<67(0 656

  +2:723(5)2509(+,&/(,'(17,),&$7,21 180%(5 9,1 :5,7,1*  ,1,7,$/,=$7,21352&('85()25/($51,1* 9$/8(,10),(1*,1( 

5(&200(1'('/8%5,&$176$1' /8%5,&$17&$3$&,7,(67$%/(  6&+('8/('0$,17(1$1&(7$%/(   0$,17(1$1&(6(59,&( 



)8(/6<67(0 7$1.3,3(/,1($1' &211(&7,21$1')8(/7$1.),//(578%(&$3  &+(&.)25/($.6   )8(/+26(6 &+(&.&21',7,21 



$,5&/($1(5(/(0(17 5(3/$&( 



(9$325$7,9((0,66,21&21752/6<67(0 (;&(37(9$325$7,9((0,66,21&$1,67(5  &+(&.)25&/2**,1*   63$5.3/8*6 5(3/$&( 



,17$.($1'(;+$8679$/9(&/($5$1&( >*0,9(&(1*,1($1'*0,9(&(1*,1( ,17$.(6,'( 21/<@ ,163(&7$1'$'-867

  7,0,1*%(/7 5(3/$&( 



/($51,1*352&('85()25,'/,1*,10), (1*,1(  

'5,9(%(/76 )257+(*(1(5$725$1' 32:(567((5,1*3803  &+(&.  

6(59,&,1*(/(&75,&$/6<67(0 

(;+$8676<67(0 &211(&7,213257,212) 08))/(508))/(53,3(6$1'&219(57(5




 +($76+,(/'6  &+(&.$1'6(59,&( 



(1*,1(2,/ &+$1*( 



(1*,1(2,/),/7(5 5(3/$&( 



$8720$7,&75$16$;/()/8,' &+(&.)/8,' /(9(/$1'&21',7,21   (1*,1(&22/$17 &+$1*( 



&22/$17+26(6 5$',$725+26(+($7(5 +26(  ,163(&7   ',6&%5$.(3$'6527256 ,163(&7)25 :($5   %5$.(+26(6 &+(&.)25'(7(5,25$7,21 25/($.6  

%$//-2,17$1'67((5,1*/,1.$*(6($/6 ,163(&7)25*5($6(/($.6$1''$0$*(

  '5,9(6+$)7%2276 ,163(&7)25*5($6( /($.6$1''$0$*(   6863(16,216<67(0 ,163(&7)25 /226(1(66$1''$0$*( 



7,5(6 527$7( 



0$,16($/$17$1'$'+(6,9(7$%/(  




*(1(5$/

+2:7286(7+,60$18$/

+2:7286(7+,60$18$/ 0$,17(1$1&(5(3$,5$1' 6(59,&,1*(;3/$1$7,216

7KLVPDQXDOSURYLGHVH[SODQDWLRQVHWFFRQFHUQLQJ SURFHGXUHVIRUWKHLQVSHFWLRQPDLQWHQDQFHUHSDLU DQGVHUYLFLQJRIWKHVXEMHFWPRGHO8QOHVVRWKHUZLVH VSHFLILHGHDFKVHUYLFHSURFHGXUHFRYHUVDOOPRGHOV 3URFHGXUHVFRYHULQJVSHFLILFPRGHOVDUHLGHQWLILHG E\WKHPRGHOFRGHVRUVLPLODUGHVLJQDWLRQ HQJLQH W\SHWUDQVD[OHW\SHHWF $GHVFULSWLRQRIWKHVHGHV LJQDWLRQVLVFRYHUHGLQWKLVPDQXDOXQGHU9(+,&/( ,'(17,),&$7,21 

219(+,&/(6(59,&( 7KH219(+,&/(6(59,&(VHFWLRQKDVSURFH GXUHVIRUSHUIRUPLQJLQVSHFWLRQVDQGDGMXVWPHQWVRI SDUWLFXODUO\LPSRUWDQWFRPSRQHQWV7KHVHSURFH GXUHVDUHGRQHZLWKUHJDUGWRPDLQWHQDQFHDQGVHU YLFLQJEXWRWKHULQVSHFWLRQV ORRVHQHVVSOD\ FUDFNLQJGDPDJHHWF PXVWDOVREHSHUIRUPHG 

6(59,&(352&('85(6 7KHVHUYLFHVWHSVDUHDUUDQJHGLQQXPHULFDORUGHU $WWHQWLRQWREHSDLGLQSHUIRUPLQJYHKLFOHVHUYLFHDUH GHVFULEHGLQGHWDLOLQ6(59,&(32,176

'(),1,7,212)7(506 

67$1'$5'9$/8( ,QGLFDWHVWKHYDOXHXVHGDVWKHVWDQGDUGIRUMXGJLQJ ZKHWKHURUQRWDSDUWRUDGMXVWPHQWLVFRUUHFW 

/,0,7 6KRZVWKHPD[LPXPRUPLQLPXPYDOXHIRUMXGJLQJ ZKHWKHURUQRWDSDUWRUDGMXVWPHQWLVDFFHSWDEOH 

5()(5(1&(9$/8( ,QGLFDWHVWKHDGMXVWPHQWYDOXHSULRUWRVWDUWLQJWKH ZRUN SUHVHQWHGLQRUGHUWRIDFLOLWDWHDVVHPEO\DQG DGMXVWPHQWSURFHGXUHVDQGVRWKH\FDQEHFRP SOHWHGLQDVKRUWHUWLPH 

76%5HYLVLRQ

0



'$1*(5:$51,1*$1'&$87,21 '$1*(5:$51,1*DQG&$87,21FDOOVSHFLDO DWWHQWLRQWRDQHFHVVDU\DFWLRQRUWRDQDFWLRQWKDW PXVWEHDYRLGHG7KHGLIIHUHQFHVDPRQJ'$1*(5 :$51,1*DQG&$87,21DUHDVIROORZV â&#x20AC;¢ ,ID'$1*(5LVQRWIROORZHGWKHUHVXOWLVVHYHUH ERGLO\KDUPRUHYHQGHDWK â&#x20AC;¢ ,ID:$51,1*LVQRWIROORZHGWKHUHVXOWFRXOGEH ERGLO\LQMXU\ â&#x20AC;¢ ,ID&$87,21LVQRWIROORZHGWKHUHVXOWFRXOGEH GDPDJHWRWKHYHKLFOHYHKLFOHFRPSRQHQWVRU VHUYLFHHTXLSPHQW

7,*+7(1,1*72548(,1',&$7,21

7KHWLJKWHQLQJWRUTXHLQGLFDWHVDPHGLDQDQGLWVWRO HUDQFHE\DXQLWRI1â&#x2039;&#x2026;P LQOE RU1â&#x2039;&#x2026;P IWOE )RUIDV WHQHUVZLWKQRDVVLJQHGWRUTXHYDOXHUHIHUWR3 

63(&,$/722/127(

2QO\00&VSHFLDOWRROSDUWQXPEHUVDUHFDOOHGRXWLQ WKHUHSDLUVHFWLRQVRIWKLVPDQXDO3OHDVHUHIHUWRWKH VSHFLDOWRROFURVVUHIHUHQFHFKDUWORFDWHGDWWKH EHJLQQLQJRIHDFKJURXSIRUWKHVSHFLDOWRROQXPEHU WKDWLVDYDLODEOHLQ\RXUPDUNHW

$%%5(9,$7,216

7KHIROORZLQJDEEUHYLDWLRQVDUHXVHGLQWKLVPDQXDO IRUFODVVLILFDWLRQRIPRGHOW\SHV $7$XWRPDWLFWUDQVD[OHRUPRGHOVHTXLSSHGZLWK DXWRPDWLFWUDQVD[OH 0),0XOWLSRUWIXHOLQMHFWLRQRUHQJLQHVHTXLSSHG ZLWKPXOWLSRUWIXHOLQMHFWLRQ /HQJLQHOLWHU*!HQJLQHRUDPRGHO HTXLSSHGZLWKVXFKDQHQJLQH /HQJLQHOLWHU*!HQJLQHRUDPRGHO HTXLSSHGZLWKVXFKDQHQJLQH




Denotes tightening torque. If there is no indication of tightening torque, refer to tightening torque.

*(1(5$/

+2:7286(7+,60$18$/

Indicates the section title.

Indicates the group title.

Indicates the group number.

Indicates the page number.

Indicates procedures to be performed before the work in that section is started, and procedures to be performed after the work in that section is finished. Mark N denotes non-reusable part. Component diagram A diagram of the component parts is provided near the front of each section in order to give the reader a better understanding of the installed condition of component parts.

Repair kit or parts sets are shown. (Only very frequently used parts are shown.)

Maintenance and servicing procedures The numbers provided within the diagram indicate the sequence for maintenance and servicing procedures. Removal steps : The part designation number corresponds to the number in the illustration to indicate removal steps. Disassembly steps : The part designation number corresponds to the number in the illustration to indicate disassembly steps.

Installation steps : Specified in case installation is impossible in reverse order of removal steps. Omitted if installation is possible in reverse order of removal steps. Assembly steps : Specified in case installation is impossible in reverse order of removal steps. Omitted if assembly is possible in reverse order of disassembly steps.

AC400266 AB

76%5HYLVLRQ




*(1(5$/

+2:7286(7+,60$18$/

Classifications of major maintenance / service points When there are major points relative to maintenance and servicing procedures (such as essential maintenance and service points, maintenance and service standard values, information regarding the use of special tools, etc.). These are arranged together as major maintenance and service points and explained in detail. <<A>> : Indicates that there are essential points for removal or disassembly. >>A<< : Indicates that there are essential points for installation or assembly.

Operating procedures, cautions, etc. on removal, installation, disassembly and assembly are described

The title of the page (following the page on which the diagram of component parts is presented) indicating the locations of lubrication and sealing procedures.

Indicates (by symbols) where lubrication is necessary.

Symbols for lubrication, sealants and adhesives Symbols are used to show the locations for lubrication and for application of sealants and adhesives. These symbols are included in the diagram of component parts or on the page following the component parts page. The symbols do not always have accompanying text to support that symbol.

Grease (Multi-purpose grease unless there is a brand or type specified) Sealant or adhesive Brake fluid or automatic transmission fluid Engine oil, gear oil or air conditioning compressor oil Adhesive tape or butyl rubber tape

AC400267AB

76%5HYLVLRQ




*(1(5$/

7528%/(6+227,1**8,'(/,1(6

7528%/(6+227,1**8,'(/,1(6 9(5,)<7+(&203/$,17

â&#x20AC;¢ 0DNHVXUHWKHFXVWRPHU VFRPSODLQWDQGWKHVHU YLFHZULWHU VZRUNRUGHUGHVFULSWLRQDUHXQGHU VWRRGEHIRUHVWDUWLQJZRUN â&#x20AC;¢ 0DNHVXUH\RXXQGHUVWDQGWKHFRUUHFWRSHUDWLRQ RIWKHV\VWHP5HDGWKHVHUYLFHPDQXDOGHVFULS WLRQWRYHULI\QRUPDOV\VWHPRSHUDWLRQ â&#x20AC;¢ 2SHUDWHWKHV\VWHPWRVHHWKHV\PSWRPV/RRN IRURWKHUV\PSWRPVWKDWZHUHQRWUHSRUWHGE\WKH FXVWRPHURURQWKHZRUNRUGHUWKDWPD\EH UHODWHGWRWKHSUREOHP

'(7(50,1(3266,%/(&$86(6

&RPSDUHWKHFRQILUPHGV\PSWRPVWRWKHGLDJQRVWLF V\PSWRPLQGH[HVWRILQGWKHULJKWGLDJQRVLVSURFH GXUH ,IWKHFRQILUPHGV\PSWRPVFDQQRWEHIRXQGRQDQ\ V\PSWRPLQGH[GHWHUPLQHRWKHUSRVVLEOHFDXVHV â&#x20AC;¢ $QDO\]HWKHV\VWHPGLDJUDPVDQGOLVWDOOSRVVLEOH FDXVHVIRUWKHSUREOHPV\PSWRPV â&#x20AC;¢ 5DQNDOOWKHVHSRVVLEOHFDXVHVLQRUGHURISURED ELOLW\EDVHGRQKRZPXFKRIWKHV\VWHPWKH\ FRYHUKRZOLNHO\WKH\DUHWREHWKHFDXVHDQG KRZHDV\WKH\ZLOOEHWRFKHFN%HVXUHWRWDNH H[SHULHQFHLQWRDFFRXQW&RQVLGHUWKHFDXVHVRI VLPLODUSUREOHPVVHHQLQWKHSDVW7KHOLVWRI FDXVHVVKRXOGEHUDQNHGLQRUGHUIURPJHQHUDOWR VSHFLILFIURPPRVWOLNHO\WROHDVWOLNHO\DQGIURP HDV\WRFKHFNWRKDUGWRFKHFN

76%5HYLVLRQ

),1'7+(352%/(0

0

$IWHUWKHV\PSWRPVKDYHEHHQFRQILUPHGDQGSURE DEOHFDXVHVKDYHEHHQLGHQWLILHGWKHQH[WVWHSLVWR PDNHVWHSE\VWHSFKHFNVRIWKHVXVSHFWHGV\VWHP FRPSRQHQWVMXQFWLRQVDQGOLQNVLQORJLFDORUGHU 8VHWKHGLDJQRVWLFSURFHGXUHVLQWKHVHUYLFHPDQXDO ZKHQHYHUSRVVLEOH)ROORZWKHVHSURFHGXUHVFDUH IXOO\WRDYRLGPLVVLQJDQLPSRUWDQWVWHSLQWKHGLDJQR VLVVHTXHQFH,WPLJKWEHWKHVNLSSHGVWHSWKDWOHDGV WRWKHVROXWLRQRIWKHSUREOHP ,IWKHVHUYLFHPDQXDOGRHVQ WKDYHVWHSE\VWHSSUR FHGXUHVWRKHOSGLDJQRVHWKHSUREOHPPDNHDVHULHV RIFKHFNVEDVHGRQWKHUDQNHGOLVWRISUREDEOH FDXVHV7URXEOHVKRRWLQJFKHFNVVKRXOGEHPDGHLQ WKHRUGHUWKDWWKHOLVWRIFDXVHVZDVUDQNHG â&#x20AC;¢ JHQHUDOWRVSHFLILF â&#x20AC;¢ PRVWOLNHO\WROHDVWOLNHO\ â&#x20AC;¢ HDV\WRFKHFNWRKDUGWRFKHFN

5(3$,57+(352%/(0

:KHQWKHVWHSE\VWHSWURXEOHVKRRWLQJFKHFNVILQGD IDXOWSHUIRUPWKHSURSHUUHSDLUV0DNHVXUHWRIL[WKH URRWFDXVHRIWKHSUREOHPQRWMXVWWKHV\PSWRP-XVW IL[LQJWKHV\PSWRPZLWKRXWIL[LQJWKHURRWFDXVHZLOO FDXVHWKHV\PSWRPWRHYHQWXDOO\UHWXUQ

9(5,)<7+(5(3$,5

$IWHUUHSDLUVDUHPDGHUHFKHFNWKHRSHUDWLRQRIWKH V\VWHPWRFRQILUPWKDWWKHSUREOHPLVHOLPLQDWHG%H VXUHWRFKHFNWKHV\VWHPWKRURXJKO\6RPHWLPHV QHZSUREOHPVDUHUHYHDOHGDIWHUUHSDLUVKDYHEHHQ PDGH




*(1(5$/

+2:7286(7528%/(6+227,1*,163(&7,216(59,&(32,176

+2:7286(7528%/(6+227,1*,163(&7,216(59,&( 32,176 7528%/(6+227,1*&217(176 CAUTION â&#x20AC;¢ 'XULQJGLDJQRVLVD'7&FRGHDVVRFLDWHGZLWK RWKHUV\VWHPPD\EHVHWZKHQWKHLJQLWLRQ VZLWFKLVWXUQHGRQZLWKFRQQHFWRU V GLVFRQ QHFWHG2QFRPSOHWLRQFRQILUPDOOV\VWHPV IRU'7&FRGH V ,I'7&FRGH V DUHVHWHUDVH WKHPDOO â&#x20AC;¢ :KHQWKH087,,,GHWHFWVDGLDJQRVWLFWURX EOHFRGHLWVGLVSOD\LQIRUPVXVHUVZKHWKHUD PHFKDQLFDOSUREOHPFXUUHQWO\H[LVWV FXUUHQW WURXEOH RUZKHWKHULWH[LVWHGEHIRUHEXWQRU PDORSHUDWLRQKDVEHHQUHVWRUHG SDVWWURX EOH +RZHYHULIDQ0),7306RU656 DLUEDJUHODWHG'7&LVVHW$FWLYH'7&6WRUHG '7&LVQRWGLVSOD\HG,QWKLVFDVHIROORZWKH GLDJQRVLVSURFHGXUHIRUFXUUHQWWURXEOH â&#x20AC;¢ ,IDWURXEOHGHWHFWHGLQD&$1FRPPXQLFD WLRQFDSDEOHV\VWHPFDQEHUHSURGXFHG GLDJQRVHWKH&$1EXVOLQHV 5HIHUWR*5283 &&DQ%XV/LQH'LDJQRVWLFV&KDUW3&   7URXEOHVKRRWLQJRIHOHFWURQLFFRQWUROV\VWHPVIRU ZKLFKWKHVFDQWRROFDQEHXVHGIROORZVWKHEDVLF RXWOLQHGHVFULEHGEHORZ(YHQLQV\VWHPVIRUZKLFK WKHVFDQWRROFDQQRWEHXVHGSDUWRIWKHVHV\VWHPV VWLOOIROORZWKLVRXWOLQH

67$1'$5')/2:2)',$*1267,& 7528%/(6+227,1*

7URXEOHVKRRWLQJVWUDWHJ\LVVKRZQLQHDFKJURXS

6<67(023(5$7,21$1'6<03720 9(5,),&$7,217(676

,IYHULILFDWLRQRIWKHV\PSWRP V LVGLIILFXOWSURFH GXUHVIRUFKHFNLQJRSHUDWLRQDQGYHULI\LQJV\PSWRPV DUHVKRZQ

',$*1267,&)81&7,21

7KHIROORZLQJWURXEOHFRGHGLDJQRVHVDUHVKRZQ â&#x20AC;¢ +RZWRUHDGGLDJQRVWLFWURXEOHFRGHV â&#x20AC;¢ +RZWRHUDVHGLDJQRVWLFWURXEOHFRGHV â&#x20AC;¢ ,QSXWLQVSHFWLRQVHUYLFHSRLQWV

',$*1267,&7528%/(&2'(&+$57

,IWKHVFDQWRROGLVSOD\VDGLDJQRVWLFWURXEOHFRGH ILQGWKHDSSOLFDEOHLQVSHFWLRQSURFHGXUHDFFRUGLQJWR WKLVFKDUW

76%5HYLVLRQ

6<03720&+$57

0

,IWKHUHDUHV\PSWRPVHYHQWKRXJKWKHVFDQWRROV VKRZWKDWQR'7&VDUHVHWLQVSHFWLRQSURFHGXUHV IRUHDFKV\PSWRPZLOOEHIRXQGE\XVLQJWKLVFKDUW

',$*1267,&7528%/(&2'( 352&('85(6

,QGLFDWHVWKHLQVSHFWLRQSURFHGXUHVFRUUHVSRQGLQJWR HDFKGLDJQRVWLFWURXEOHFRGH 5HIHUWR3 

6<03720352&('85(6

,QGLFDWHVWKHLQVSHFWLRQSURFHGXUHVFRUUHVSRQGLQJWR HDFKV\PSWRPOLVWHGLQWKH6\PSWRP&KDUW 5HIHUWR 3 

6(59,&('$7$5()(5(1&(7$%/(

,QVSHFWLRQLWHPVDQGQRUPDOMXGJPHQWYDOXHVKDYH EHHQSURYLGHGLQWKLVFKDUWDVUHIHUHQFHLQIRUPDWLRQ

&+(&.$7(&87(50,1$/6

7HUPLQDOQXPEHUVIRUWKH(&8FRQQHFWRUVLQVSHF WLRQLWHPVDQGVWDQGDUGYDOXHVKDYHEHHQSURYLGHG LQWKLVFKDUWDVUHIHUHQFHLQIRUPDWLRQ 

7(50,1$/92/7$*(&+(&.6  &RQQHFWDQHHGOHQRVHGZLUHSUREHWRDYROWPHWHU SUREH

CAUTION 6KRUWFLUFXLWLQJWKHSRVLWLYH  SUREHEHWZHHQD FRQQHFWRUWHUPLQDODQGJURXQGFRXOGGDPDJH WKHYHKLFOHZLULQJWKHVHQVRUWKH(&8RUDOO WKUHH8VHFDUHWRSUHYHQWWKLV  ,QVHUWWKHQHHGOHQRVHGZLUHSUREHLQWRHDFKRI WKH(&8FRQQHFWRUWHUPLQDOVIURPWKHZLUHVLGH DQGPHDVXUHWKHYROWDJHZKLOHUHIHUULQJWRWKH FKHFNFKDUW 127(0HDVXUHYROWDJHZLWKWKH(&8FRQQHFWRUV FRQQHFWHG <RXPD\ILQGLWFRQYHQLHQWWRSXOORXWWKH(&8WR PDNHLWHDVLHUWRUHDFKWKHFRQQHFWRUWHUPLQDOV &KHFNVGRQ WKDYHWREHFDUULHGRXWLQWKHRUGHU JLYHQLQWKHFKDUW  ,IYROWDJHUHDGLQJVGLIIHUIURPQRUPDOFRQGLWLRQ YDOXHVFKHFNUHODWHGVHQVRUVDFWXDWRUVDQG ZLULQJ5HSODFHRUUHSDLUDVQHHGHG




*(1(5$/

+2:7286(7528%/(6+227,1*,163(&7,216(59,&(32,176

 $IWHUUHSDLURUUHSODFHPHQWUHFKHFNZLWKWKH YROWPHWHUWRFRQILUPWKDWWKHUHSDLUKDVFRUUHFWHG WKHSUREOHP 

7(50,1$/5(6,67$1&($1'&217,18,7< &+(&.6  7XUQWKHLJQLWLRQVZLWFKWRWKH/2&. 2))  SRVLWLRQ  'LVFRQQHFWWKH(&8FRQQHFWRU

CAUTION ,IUHVLVWDQFHDQGFRQWLQXLW\FKHFNVDUHSHU IRUPHGRQWKHZURQJWHUPLQDOVGDPDJHWRWKH YHKLFOHZLULQJVHQVRUV(&8DQGRURKPPHWHU PD\RFFXU8VHFDUHWRSUHYHQWWKLV  0HDVXUHWKHUHVLVWDQFHDQGFKHFNIRUFRQWLQXLW\ EHWZHHQWKHWHUPLQDOVRIWKH(&8KDUQHVVVLGH FRQQHFWRUZKLOHUHIHUULQJWRWKHFKHFNFKDUW

127(&KHFNVGRQ WKDYHWREHFDUULHGRXWLQWKH RUGHUJLYHQLQWKHFKDUW  ,IWKHRKPPHWHUVKRZVDQ\GHYLDWLRQIURPWKH 1RUPDO&RQGLWLRQYDOXHFKHFNWKHFRUUHVSRQGLQJ VHQVRUDFWXDWRUDQGUHODWHGHOHFWULFDOZLULQJWKHQ UHSDLURUUHSODFH  $IWHUUHSDLURUUHSODFHPHQWUHFKHFNZLWKWKH RKPPHWHUWRFRQILUPWKDWWKHUHSDLUKDVFRUUHFWHG WKHSUREOHP

,163(&7,21352&('85(686,1* $126&,//26&23( :KHQWKHUHDUHLQVSHFWLRQSURFHGXUHVXVLQJDQ RVFLOORVFRSHWKHVHDUHOLVWHG

+2:7286(7+(,163(&7,21352&('85(6

0 7KHFDXVHVRIPDQ\RIWKHSUREOHPVRFFXUULQJLQHOHFWULFFLUFXLWU\DUHJHQHUDOO\WKHFRQQHFWRUVFRPSRQHQWV WKH(&8DQGWKHKDUQHVVHVEHWZHHQFRQQHFWRUVLQWKDWRUGHU7KHVHLQVSHFWLRQSURFHGXUHVIROORZWKLV RUGHU7KH\ILUVWWU\WRGLVFRYHUDSUREOHPZLWKDFRQQHFWRURUDGHIHFWLYHFRPSRQHQW

76%5HYLVLRQ




*(1(5$/

+2:7286(7528%/(6+227,1*,163(&7,216(59,&(32,176

(1) Relevant circuit(s) of the component which the DTC indicates are described.

(2) For connector color, refer to GROUP 80A, How to read configuration diagrams.

(3) Shows the location of the connector(s) from the circuit(s) above. (4) Explains about the operation principle of the component or its relevant parts in that circuit.

B-48(B)

ACX00861AE

76%5HYLVLRQ




*(1(5$/

+2:7286(7528%/(6+227,1*,163(&7,216(59,&(32,176

(5) Explains about technical details.

(6) Describes the conditions for that DTC being set (stored). (7) Describes possible cause(s)for that DTC.

(8) Start of the diagnosis procedure for that DTC.

(M.U.T.-III Sub Assembly)

(9) Identifies the special tool(s) necessary for diagnosing that DTC.

(10) Provides the inspection procedure for that DTC step by step.

AC210616 AB

&855(177528%/(

,QGLFDWHVWKDWWKHWURXEOHLVFXUUHQWO\SUHVHQW&DUU\ RXWWURXEOHVKRRWLQJDVGHVFULEHGLQWKHDSSOLFDEOH LQVSHFWLRQSURFHGXUH

76%5HYLVLRQ

3$677528%/(

,QGLFDWHVWKDWWKHVWDWXVLV6WRUHGDQGWKHWURXEOHLV KLVWRULF6LQFHWKHWURXEOHPD\VWLOOEHSUHVHQWVHW WKHYHKLFOHWRWKHGLDJQRVLVFRGHGHWHFWLRQFRQGLWLRQ DQGFKHFNWKDWWKHVWDWXVFKDQJHVWR$FWLYH,IWKH VWDWXVGRHVQRWFKDQJHIURP6WRUHGREVHUYHWKH DSSOLFDEOHLQVSHFWLRQSURFHGXUHZLWKSDUWLFXODU HPSKDVLVRQFRQQHFWRU V DQGZLULQJKDUQHVV


*(1(5$/

+2:7286(7528%/(6+227,1*,163(&7,216(59,&(32,176

+$51(66,163(&7,21

&KHFNIRUDQRSHQRUVKRUWFLUFXLWLQWKHKDUQHVV EHWZHHQWKHWHUPLQDOVZKLFKZHUHIDXOW\DFFRUGLQJWR WKHFRQQHFWRUPHDVXUHPHQWV&DUU\RXWWKLVLQVSHF WLRQZKLOHUHIHUULQJWR*5283(+DUQHVV&RQ QHFWRU,QVSHFWLRQ3(+HUH&KHFNKDUQHVV EHWZHHQSRZHUVXSSO\DQGWHUPLQDO[[DOVRLQFOXGHV FKHFNLQJIRUEORZQIXVH)RULQVSHFWLRQVHUYLFH SRLQWVZKHQWKHUHLVDEORZQIXVHUHIHUWR,QVSHF WLRQ6HUYLFH3RLQWVIRUD%ORZQ)XVH3



0($685(6727$.($)7(5 5(3/$&,1*7+(3&025(&8

,IWKHWURXEOHV\PSWRPVKDYHQRWGLVDSSHDUHGHYHQ DIWHUUHSODFLQJWKH3&0RU(&8UHSHDWWKHLQVSHF WLRQSURFHGXUHIURPWKHEHJLQQLQJ

&211(&7250($685(0(176(59,&(32,176

0 7XUQWKHLJQLWLRQVZLWFKWRWKH/2&. 2)) SRVLWLRQZKHQ FRQQHFWLQJDQGGLVFRQQHFWLQJWKHFRQQHFWRUV7XUQWKHLJQLWLRQ VZLWFKWR21ZKHQPHDVXULQJXQOHVVWKHUHDUHLQVWUXFWLRQV WRWKHFRQWUDU\

,),163(&7,1*:,7+7+(&211(&725 &211(&7(':$7(53522)&211(&7256! SPECIAL TOOL

%HVXUHWRXVHVSHFLDOWRRO1HYHULQVHUWDWHVWSUREHIURPWKH KDUQHVVVLGHDVWKLVZLOOUHGXFHWKHZDWHUSURRISHUIRUPDQFH DQGUHVXOWLQFRUURVLRQ

ACX00863AE

,),163(&7,1*:,7+7+(&211(&725 &211(&7('25',1$5< 121:$7(53522)  &211(&7256! 5HTXLUHG6SHFLDO7RRO â&#x20AC;¢ 0%([WUD)LQH3UREH ,QVSHFWE\LQVHUWLQJDWHVWSUREHIURPWKHKDUQHVVVLGH,IWKH FRQQHFWRULVWRRVPDOOWRLQVHUWDWHVWSUREH HJFRQWUROXQLW FRQQHFWRU GRQRWLQVHUWLWIRUFLEO\8VHVSHFLDOWRROH[WUDILQH SUREH 0% 

MB992006

AC105598AG

76%5HYLVLRQ




*(1(5$/

+2:7286(7528%/(6+227,1*,163(&7,216(59,&(32,176

,),163(&7,1*:,7+7+(&211(&725 ',6&211(&7(':+(1,163(&7,1*$ )(0$/(3,1! 5HTXLUHG6SHFLDO7RRO â&#x20AC;¢ 0%,QVSHFWLRQ+DUQHVV ,QFOXGHGLQ0% +DUQHVV6HW

â&#x20AC;¢ 7KHVSHFLDOWRRO0%IRUFRQQHFWRUSLQFRQWDFWSUHV VXUHVKRXOGEHXVHG7KHWHVWSUREHVKRXOGQHYHUEHIRUF LEO\LQVHUWHGDVLWPD\FDXVHDGHIHFWLYHFRQWDFW

MB991219

ACX00865 AB

â&#x20AC;¢ )URPEDFNVLGHRIWKHFRQQHFWRU 656(&8KDUQHVVVLGH FRQQHFWRU

â&#x20AC;¢ 6LQFHWKH656(&8KDUQHVVFRQQHFWRULVSODWHGWRLPSURYH FRQGXFWLYLW\REVHUYHWKHZDUQLQJEHORZZKHQFKHFNLQJWKLV FRQQHFWRU

SRS-ECU HARNESS CONNECTOR

WARNING

AC001607AB

,QVHUWWKHEDFNSURELQJWRROLQWRWKHFRQQHFWRUIURP WKHKDUQHVVVLGHDQGFRQQHFWWKHWHVWHUWRWKHEDFN SURELQJWRRO,IDQ\WRRORWKHUWKDQWKHEDFNSURELQJ WRROLVXVHGLWPD\FDXVHGDPDJHWRWKHKDUQHVVDQG RWKHUFRPSRQHQWV)XUWKHUPRUHPHDVXUHPHQW VKRXOGQRWEHFDUULHGRXWE\WRXFKLQJWKHEDFNSURE LQJWRROGLUHFWO\DJDLQVWWKHWHUPLQDOVIURPWKHIURQW RIWKHFRQQHFWRU7KHWHUPLQDOVDUHSODWHGWRLQFUHDVH WKHLUFRQGXFWLYLW\VRWKDWLIWKH\DUHWRXFKHGGLUHFWO\ E\WKHEDFNSURELQJWRROWKHSODWLQJPD\EUHDNZKLFK ZLOOGHFUHDVHUHOLDELOLW\

,),163(&7,1*:,7+7+(&211(&725 ',6&211(&7(':+(1,163(&7,1*$0$/( 3,1! CAUTION $WWKLVWLPHEHFDUHIXOQRWWRVKRUWWKHFRQQHFWRUSLQVZLWK WKHWHVWSUREHV'RLQJVRPD\GDPDJHWKHFLUFXLWVLQVLGH WKH(&8 7RXFKWKHSLQGLUHFWO\ZLWKWKHWHVWSUREH

ACX00867 AB

76%5HYLVLRQ


*(1(5$/

+2:7286(7528%/(6+227,1*,163(&7,216(59,&(32,176



&211(&725,163(&7,216(59,&(32,176 9,68$/,163(&7,21 â&#x20AC;¢ â&#x20AC;¢ â&#x20AC;¢ â&#x20AC;¢ â&#x20AC;¢

CONNECTOR DISCONNECTED OR IMPROPERLY CONNECTED

0

&RQQHFWRULVGLVFRQQHFWHGRULPSURSHUO\FRQQHFWHG &RQQHFWRUSLQVDUHSXOOHGRXW 6WUHWFKHGDQEURNHQZLUHVDWWHUPLQDOVHFWLRQ /RZFRQWDFWSUHVVXUHEHWZHHQPDOHDQGIHPDOHWHUPLQDOV /RZFRQQHFWLRQSUHVVXUHGXHWRUXVWHGWHUPLQDOVRUIRUHLJQ PDWWHUORGJHGLQWHUPLQDOV

STRETCHED OR BROKEN WIRES

HARNESS WIRE BREAKAGE AT TERMINAL SECTION LOW CONTACT PRESSURE GOOD BAD

ACX00868AC



&211(&7253,1,163(&7,21 ,IWKHFRQQHFWRUSLQVWRSSHULVGDPDJHGWKHWHUPLQDOFRQQHF WLRQV PDOHDQGIHPDOHSLQV ZLOOQRWEHSHUIHFWHYHQZKHQWKH FRQQHFWRUERG\LVFRQQHFWHGEHFDXVHWKHSLQVPD\SXOORXWRI WKHEDFNVLGHRIWKHFRQQHFWRU7KHUHIRUHJHQWO\SXOOWKHZLUHV RQHE\RQHWRPDNHVXUHWKDWQRSLQVSXOORXWRIWKHFRQQHFWRU

ACX00869AB



&211(&725(1*$*(0(17,163(&7,21 5HTXLUHG6SHFLDO7RRO â&#x20AC;¢ 0%,QVSHFWLRQ+DUQHVV FRQWDLQHGLQ0% 7HVW+DUQHVV

76%5HYLVLRQ




*(1(5$/

+2:7286(7528%/(6+227,1*,163(&7,216(59,&(32,176

MB991219

8VHVSHFLDOWRRO0%WRLQVSHFWWKHHQJDJHPHQWRIWKH PDOHSLQVDQGIHPDOHSLQV>3LQGUDZLQJIRUFH1 SRXQG  RUPRUH@

ACX00870 AB

+2:72&23(:,7+,17(50,77(17 0$/)81&7,216

0 0RVWLQWHUPLWWHQWPDOIXQFWLRQVRFFXUXQGHUFHUWDLQFRQGLWLRQV,I WKRVHFRQGLWLRQVFDQEHLGHQWLILHGWKHFDXVHZLOOEHHDVLHUWR ILQG 

72&23(:,7+,17(50,77(170$/)81&7,21 $6.7+(&86720(5$%2877+(0$/)81&7,21 $VNZKDWLWIHHOVOLNHZKDWLWVRXQGVOLNHHWF7KHQDVNDERXW GULYLQJFRQGLWLRQVZHDWKHUIUHTXHQF\RIRFFXUUHQFHDQGVR RQ 

'(7(50,1(7+(&21',7,216)5207+( &86720(5 65(63216(6 7\SLFDOO\DOPRVWDOOLQWHUPLWWHQWPDOIXQFWLRQVRFFXUIURPFRQGL WLRQVOLNHYLEUDWLRQWHPSHUDWXUHDQGRUPRLVWXUHFKDQJHSRRU FRQQHFWLRQV)URPWKHFXVWRPHU VUHVSRQVHVLWVKRXOGEHUHD VRQHGZKLFKFRQGLWLRQLVPRVWOLNHO\ 

86(6,08/$7,217(67 8VHWKHVLPXODWLRQWHVWVEHORZWRDWWHPSWWRGXSOLFDWHWKHFXV WRPHU VFRPSODLQW'HWHUPLQHWKHPRVWOLNHO\FLUFXLW V DQGSHU IRUPWKHVLPXODWLRQWHVWVRQWKHFRQQHFWRUVDQGSDUWVRIWKDW FLUFXLW V %HVXUHWRXVHWKHLQVSHFWLRQSURFHGXUHVSURYLGHGIRU GLDJQRVWLFWURXEOHFRGHVDQGWURXEOHV\PSWRPV )RUWHPSHUDWXUHDQGRUPRLVWXUHFRQGLWLRQUHODWHGLQWHUPLWWHQW PDOIXQFWLRQVWU\WRFKDQJHWKHFRQGLWLRQVRIWKHVXVSHFWHGFLU FXLWFRPSRQHQWVWKHQXVHWKHVLPXODWLRQWHVWVEHORZ 

9(5,)<7+(,17(50,77(170$/)81&7,21,6 (/,0,1$7(' 5HSDLUWKHPDOIXQFWLRQLQJSDUWDQGWU\WRGXSOLFDWHWKHFRQGL WLRQ V DJDLQWRYHULI\WKHLQWHUPLWWHQWPDOIXQFWLRQKDVEHHQ HOLPLQDWHG 

6,08/$7,217(676 127(,QFDVHRIGLIILFXOW\LQILQGLQJWKHFDXVHRIWKHLQWHUPLW WHQWPDOIXQFWLRQWKHGDWDUHFRUGHUIXQFWLRQLQWKHVFDQWRROLV HIIHFWLYH

76%5HYLVLRQ


*(1(5$/

+2:7286(7528%/(6+227,1*,163(&7,216(59,&(32,176



)RUWKHVHVLPXODWLRQWHVWVVKDNHWKHQJHQWO\EHQGSXOODQG WZLVWWKHZLULQJRIHDFKRIWKHVHH[DPSOHVWRGXSOLFDWHWKHLQWHU PLWWHQWPDOIXQFWLRQ â&#x20AC;¢ 6KDNHWKHFRQQHFWRUXSDQGGRZQDQGULJKWDQGOHIW â&#x20AC;¢ 6KDNHWKHZLULQJKDUQHVVXSDQGGRZQDQGULJKWDQGOHIW (VSHFLDOO\FKHFNWKHVSOLFHSRLQWVRIZLULQJKDUQHVVHVFDUH IXOO\5HIHUWR*5283(+DUQHVV&RQQHFWRU,QVSHFWLRQ 3( â&#x20AC;¢ 6KDNHWKHSDUWRUVHQVRU

ACX00871 AB

76%5HYLVLRQ




*(1(5$/

+2:7286(7528%/(6+227,1*,163(&7,216(59,&(32,176

,163(&7,216(59,&(32,176)25$%/2:1 )86(

0 5HPRYHWKHEORZQIXVHDQGPHDVXUHWKHUHVLVWDQFHEHWZHHQ WKHORDGVLGHRIWKHEORZQIXVHDQGWKHJURXQG&ORVHWKH VZLWFKHVRIDOOFLUFXLWVZKLFKDUHFRQQHFWHGWRWKLVIXVH,IWKH UHVLVWDQFHLVDOPRVWΩDWWKLVWLPHWKHUHLVDVKRUWVRPH ZKHUHEHWZHHQWKHVHVZLWFKHVDQGWKHORDG,IWKHUHVLVWDQFHLV QRWΩWKHUHLVQRVKRUWDWWKHSUHVHQWWLPHEXWDPRPHQWDU\ VKRUWKDVSUREDEO\FDXVHGWKHIXVHWREORZ 7KHPDLQFDXVHVRIDVKRUWFLUFXLWDUHWKHIROORZLQJ â&#x20AC;¢ +DUQHVVEHLQJFODPSHGE\WKHYHKLFOHERG\ â&#x20AC;¢ 'DPDJHWRWKHRXWHUFDVLQJRIWKHKDUQHVVGXHWRZHDURU KHDW â&#x20AC;¢ :DWHUJHWWLQJLQWRWKHFRQQHFWRURUFLUFXLWU\ â&#x20AC;¢ +XPDQHUURU PLVWDNHQO\VKRUWLQJDFLUFXLWHWF 

BATTERY

FUSE

LOAD SWITCH

SHORTCIRCUIT OCCURRENCE SECTION

LOAD

ACX00872 AB

+2:7275($7&855(177528%/(

0 0DNHDQRWHRIWKHGLDJQRVWLFWURXEOHFRGHDQGHUDVHLW &KHFNWKHWURXEOHV\PSWRPDJDLQ &KHFNIRUGLDJQRVWLFWURXEOHFRGHVDJDLQ ,IDGLDJQRVWLFWURXEOHFRGHLVVHWIROORZWKHDSSOLFDEOH 'LDJQRVWLF7URXEOH&RGH&KDUW  ,IQRGLDJQRVWLFWURXEOHFRGHLVVHWUHIHUWR+RZWR&RSH ZLWK,QWHUPLWWHQW0DOIXQFWLRQ3    

+2:7275($73$677528%/(

0 6LQFHWKHWURXEOHPD\VWLOOEHSUHVHQWHYHQWKHVWDWXVLV 6WRUHGVHWWKHYHKLFOHWRWKHGLDJQRVLVFRGHGHWHFWLRQFRQGL WLRQDQGFKHFNWKDWWKHVWDWXVFKDQJHVWR$FWLYH,IWKHVWDWXV GRHVQRWFKDQJHIURP6WRUHGFDUU\RXWWKHIROORZLQJSURFH GXUH  (VWDEOLVKIURPWKHFXVWRPHUZKHWKHUDIXVHRUFRQQHFWRU KDVEHHQUHSODFHGRUGLVFRQQHFWHG  ,I\HVHUDVHWKHGLDJQRVLVFRGHDQGWKHQFKHFNWKDWQR GLDJQRVWLFFRGHLVUHVHW,IQRGLDJQRVLVFRGHLVUHVHWWKH GLDJQRVLVLVFRPSOHWH  ,IQRIROORZWKHDSSOLFDEOH'LDJQRVWLF7URXEOH&RGH&KDUW 7KHQFKHFNWKHZLULQJKDUQHVVDQGFRQQHFWRUDQGUHIHUWR +RZWR&RSHZLWK,QWHUPLWWHQW0DOIXQFWLRQ3

76%5HYLVLRQ


Thank you very much for your reading. Please Click Here Then Get More Information.

2009 Mitsubishi Galant Service Repair Manual  
2009 Mitsubishi Galant Service Repair Manual  
Advertisement