Graduation - 10 July 2024 - 09:30

Page 1


Graduation Ceremony

Date: 10 July 2024

Time: 09:30

Venue: The Great Hall

A MESSAGE TO GRADUATES FROM THE CHANCELLOR

CONGRATULATIONS! HALALA! GO LEAD SOUTH AFRICA TO GREATNESS!

A hearty congratulations to the class of 2024! Some of you entered university as the world sank into a global pandemic, COVID-19; some were already pursuing their studies at this world class university, the University of the Witwatersrand. We applaud you for strength of character, grit, and commitment to success.

Our country continues to experience a plethora of challenges that threaten our economic stability and social cohesion, further deepening inequality and hopelessness. It is in this century that, as one of the member states of the UN that approved the 2030 Agenda for Sustainable Development, we intend to eradicate inequality, achieve peace, prosperity, and dignity for all, through partnerships while preserving the planet for future generations. We cannot achieve these lofty ambitions without your wisdom and servant leadership as you embark on your careers.

Your hard work and dedication to achieve your dreams is a true reflection of your resilience and commitment. It is this resilience that makes us confident that you have what it takes to build a better future that is equal and just. History has proven time and again that it is the weakest amongst us that determine our strength as a nation. The highly educated have the responsibility to enlighten and fight for social justice for the marginalised, for the good of humankind.

As you venture into the world, take time to expand the depth and breath of your knowledge. Read outside your specialisation, engage with people outside your comfort zone. Be lifelong learners. Understand the plight of people less fortunate than yourself. Leaders who leave footprints worth emulating, are not only the brightest but also those who take time to learn from others, who are accountable for their actions and omissions, who use what they know and what they have, to make the world a better place. Leaders who care! Those leaders do this consistently with Integrity. May you be those leaders!

CONGRATULATIONS! HALALA! GO LEAD SOUTH AFRICA TO GREATNESS!

A MESSAGE TO GRADUATES FROM THE VICE-CHANCELLOR

AND PRINCIPAL

Dear Wits Graduate,

Congratulations on successfully completing your academic programme at the University of the Witwatersrand, the premier University on the continent.

You are now a member of an elite group of graduates of this august institution. More than 200 000 alumni at the cutting edge of excellence, both locally and internationally in business, the public sector, the academy, and in civil society have trodden this path.

Today, you become a member of this illustrious community. Over the past 100 years, Wits has grown into one of the leading universities on the continent and a globally respected institution for its teaching and learning, knowledge creation and generation, and social impact. It has shaped the lives of many and changed society for good. You are now an integral part of this proud and enduring legacy. Here at Wits, we actively pursue excellence and societal relevance in everything we do. From the abstract to the practical, our focus is on creating a space for the best thought, knowledge, and expertise to be unearthed and nurtured. Wits is renowned for its intellectual leadership and for nurturing critical thinkers, creative innovators, problem-posers, and problem solvers. We have strived to match your ambition and drive to overcome the challenges thrown our way by the pandemic. Together we have reached the crest of the hill and proven, once again that excellence is achievable, even in times of uncertainty and adversity.

Your success has furthered our commitment to equipping the next generation of leaders with the skills and determination that you will need to find innovative and sustainable solutions to the pressing problems of the 21st Century.

As a Wits graduate, you had access to an exceptional educational experience. You have been exposed to a world-class academic and research programme and a vibrant community that makes you a true global citizen. You have been part of an institution that generates cutting-edge knowledge and innovation for South Africa and the world. It is now time for you to step into the world and use that experience, for good. We know that you will enter the next stage of your journey with the determination to build a better society tomorrow. I want to encourage you to remain a part of the Wits family by participating in our alumni programme and by further advancing the reputation of your alma mater.

Best wishes for the next steps of your journey and congratulations on being such a big part of the history of this illustrious institution.

Gaudeamus igitur

Juvenes dum sumus

GAUDEAMUS

Post jucundum juventutem

Post molestam senectutem

Nos habebit humus.

Ubi sunt qui ante nos

In mundo fuere?

Vadite ad superos

Transite in inferos

Hos si vis videre.

Vita nostra brevis est Brevi finietur.

Venit mors velociter

Rapit nos atrociter

Nemini parcetur.

Vivat academia

Vivant professores

Vivat membrum quodlibet

Vivat membra quaelibet

Semper sint in flore.

Vivant omnes virgines

Faciles, formosae.

Vivant et mulieres

Tenerae amabiles

Bonae laboriosae.

Vivant et republica et qui illam regit.

Vivat nostra civitas, Maecenatum caritas

Quae nos hic protegit.

Pereat tristitia, Pereant osores.

Pereat diabolus, Quivis antiburschius

Atque irrisores.

Let us rejoice therefore

While we are young.

After a pleasant youth

After a troublesome old age

The earth will have us.

Where are they

Who were in the world before us?

You may cross over to heaven

You may go to hell If you wish to see them.

Our life is brief

It will be finished shortly.

Death comes quickly Atrociously, it snatches us away. No one is spared.

Long live the academy!

Long live the teachers!

Long live each male student!

Long live each female student!

May they always flourish!

Long live all maidens

Easy and beautiful!

Long live mature women also,

Tender and loveable

And full of good labor.

Long live the State

And the One who rules it!

Long live our City

And the charity of benefactors

Which protects us here!

Let sadness perish!

Let haters perish!

Let the devil perish!

Let whoever is against our school

Who laughs at it, perish!

NATIONAL ANTHEM

Nkosi sikelel’ iAfrika

Maluphakanyisw’ uphondo lwayo,

Yizwa imithandazo yethu, Nkosi sikelela

Thina lusapho lwayo.

Morena boloka setjhaba sa heso, O fedise dintwa le matshwenyeho, O se boloke, O se boloke setjhaba sa heso, Setjhaba sa, South Afrika — South Afrika.

Uit die blou van onse hemel, Uit die diepte van ons see, Oor ons ewige gebergtes, Waar die kranse antwoord gee,

Sounds the call to come together, And united we shall stand, Let us live and strive for freedom In South Africa our land.

The Wits Choir

The Wits Choir has been around since 1995. Their repertoire is colourful and vibrant. They perform regularly at graduations and important ceremonies. The Wits Choir has toured internationally as well as playing host to other choirs here. They are also active in the community, undertaking choral outreach programmes.

ORDEROF PROCEDURE

10JULY2024 AT09:30

Theaudiencewillrise astheacademicprocession enters thehallandwillremain standing untilthe Acting Vice-Chancellorisinplace

TheActing Vice-Chancellor willconstitutethecongregation

TheActing Vice-Chancellor willwelcomethegraduands,diplomates and guests

Addressto the congregation

Conferment of degreesand granting ofdiplomas

TheActing Presidentof Convocationwilladdressthe graduatesanddiplomates

TheActing Vice-Chancellor willdissolvethecongregation

Theaudiencewillstandwhile Ihele is played

Membersoftheaudiencearerequestedtostandwhiletheacademicprocessionleavesthehallandnottoleavethe hallbeforethe end oftheceremony.

IMPORTANT NOTICE

Intheeventofload-sheddingorpowercuts,theGreatHallmaybecometotallydarkuntilthegeneratorcomesinto operation.

FACULTYOFHEALTHSCIENCES

DEAN:PROFESSOR SA MADHIMBBChMMedPhD (Witwatersrand)FCPaeds(SA) MASSAfRSSAfTWAS CBE

MasterofDentistry

MOTSHOANE, Boitumelo Maxillo-Facial and Oral Surgery

RESEARCH REPORT: Epidemiologicalanalysisoftemporomandibularjointdislocation casestreatedatthe Universityof the Witwatersrand,Johannesburg

MasterofHealthSciencesEducation

BOCCHINO,Loredana Maria (with Distinction)

RESEARCH REPORT: A phenomenographicstudyofclinicianeducators'conceptionsofclinicalmedicalstudents' vocationalhabitus

MasterofMedicine

CHAANE,Nthabiseng

Diagnostic Radiology

RESEARCH REPORT: An auditofbreastcancerinyoung patients,40 yearsandyounger,intwolarge Johannesburg academic hospitals

LORENTZ,Liam Antony

Diagnostic Radiology

RESEARCH REPORT: A descriptive studyof MRI findingsofchildrenwithsuspectedhypoxicischaemicinjury ata Tertiary AcademicHospitalinJohannesburg, South Africa

MAKOFANE,LeratoIngrid Psychiatry

RESEARCH REPORT: ThedemographicandclinicalprofileofHIVinfectedand non-infectedchildrenand adolescentsattendingtwo districtpsychiatricclinicsin Sedibeng: arestrospective recordreview

SELEBELENG, Morakane Violet Paediatrics and Child Health RESEARCH REPORT: Adolescent fracturesandvitamin Dstatus: the birthto twentycohort(Bt20)

MasterofMedicineinAnaesthesia

BUCK, SamanthaClaire RESEARCH REPORT: Videoconference fatigueinan academicDepartment of Anaesthesiology

GAMEDE,IenNomdumiso

RESEARCH REPORT: AnauditofcancellationofelectivesurgeryinpaediatricpatientsatChrisHaniBaragwanath AcademicHospital

KUMALO,NthabisengJacqueline RESEARCH REPORT: Neuroprotectivestrategiesincardiacsurgery

LEROUX,JohannesJacobus

RESEARCH REPORT: Attitudesand perceptions ofcaregivers regardingtheirpresenceat induction of anaesthesia

MFEKA, NtombizabanguniGlory

RESEARCH REPORT: Postcaesareansection outcomesof obstetricvalvularheartdiseasepatientsat Charlotte MaxekeJohannesburg AcademicHospital

MPEMNYAMA,Lerato Nomonde

RESEARCH REPORT: Registrars'perspectivestowardsvirtual teachingprogrammeinanacademicdepartment duringtheCOVID-19 pandemic

PRINSLOO,Nathalie

RESEARCH REPORT: Preoperativefastingpractices and incidence of hypoglycaemia in patients presentingfor caesareansection at acentralhospital

RAPULENG,MoitoiAletta

RESEARCH REPORT: Emergencedeliriuminchildrenundergoingbotulinum toxininjectionsforstrabismus correction

SEPHEU,LetshokgeJulius

RESEARCH REPORT: Asurveyofcaudalanaesthesiapractice in an academic anaesthesiacircuit

STUART-CLARK,Hannah Elizabeth

RESEARCH REPORT: Retrospectivecaseseriesof theanaesthetic managementandoutcomesofpatientswith Rasmussen's aneurysmsat anacademichospital

TALANE, Pulane Adelice

RESEARCH REPORT: Asurveyoftheperceptionsandknowledgeofanaesthesiaandanaesthetistspossessedby Grade12 learnersinfourJohannesburgdistricts

VAN WYK,NatalieJean

RESEARCH REPORT: Audit ofasurgicalbookingsystemfor non-electivecasesin atertiary hospital

WAKABAYASHI, Koji

RESEARCH REPORT: Lowdose propofolasan effectivemethodinattenuating thecardiorespiratoryresponseto extubation:Single-blindedrandomizedplacebo-controlledtrial

MasterofMedicineinClinicalPathology

WILDING, BradleyThomas

Clinical Pathology

RESEARCH REPORT: AlaboratorybasedretrospectivestudyofplasmacellmyelomainthepublicsectorofSouth Africafrom2017 to 2019

MasterofMedicineinDermatology

GWINJI, Tapiwa Munyaradzi

Dermatology

RESEARCH REPORT: Clinicopathologicalspectrum ofcutaneous malignancies attheskintumourclinic,Charlotte MaxekeJohannesburg AcademichospitalinJohannesburg, South Africa: a5-year retrospectivereview

MAKONDO,Rulani

Dermatology

RESEARCH REPORT: Theimpactofchildhood atopicdermatitis oncaregiverqualityof lifeatRahimaMoosa MotherandChildHospital

MasterofMedicineinDiagnosticRadiology

KHWELA, Siphesihle

Diagnostic Radiology

RESEARCH REPORT: Hysterosalpingogramfindings in infertilityinwomen ofreproductive age atChrisHani Baragwanath AcademicHospital

LABUSCHAGNE, Hendrik Christiaan

Diagnostic Radiology

RESEARCH REPORT: Riskstratification of hospitaladmissionsforCOVID-19 pneumoniabychestradiographic scoringinaJohannesburg tertiary hospital

WIECHERS, Lumart

Diagnostic Radiology

RESEARCH REPORT: ClinicalAudit:TransradialUterine Artery Embolisationfor SymptomaticFibroidsat Park Lane Hospital

MasterofMedicineinEmergencyMedicine

HENNING, Jandre Emergency Medicine

RESEARCH REPORT: Theknowledgeandskillofregistered nursingstaffat ChrisHani Baragwanath Academic HospitalEmergencyUnits onendotrachealtubecuff manometry,before andafteratrainingsession

REDANT, Dean Patrick Emergency Medicine

RESEARCH REPORT: Knowledge,attitudesand practicesofclinicianmanagementofadults presenting with acetylcholinesterase inhibitorpoisoning

MasterofMedicineinHaematologicalPathology

MASIA,Tlangelani Vivian

RESEARCH REPORT: Verification andimplementationof achromogenicFactor VIII assaytomonitorFactor VIII levels in patientswith haemophilia Aonemicizumab therapy

NELL,Zanre

RESEARCH REPORT: A multi-centrestudyto evaluatean in-house multi-parameterimmunophenotypicpanelto identifyprecursorB-cellsinthedeterminationofmeasurableresidualdiseaseinpaediatricB-cellacutelymphoblastic leukaemia

MasterofMedicineinInternalMedicine

BAXTER,Jayson Mcneil

RESEARCH REPORT: Afifteen-yearreview ofMultipleMyelomainHIV-1seropositivepatientsatChrisHani Baragwanath AcademicHospital

BROZIN,DanielRichard

RESEARCH REPORT: A Review ofHIV-positive Patientsat ChrisHaniBaragwanath AcademicHospitalon Third-line AntiretroviralTherapy

HES,TamsinFaith

RESEARCH REPORT: PulmonaryManifestationsoftheIdiopathicInflammatory Myopathiesin aSouthAfrican population

KHOSA, MikatekoCain

RESEARCH REPORT: Afifteen-yearreviewofchroniclymphocyticleukaemiainadultsatChrisHaniBaragwanath AcademicHospital

KONDLO,Bafo

RESEARCH REPORT: Astudyoftheprevalenceofvitaminb12deficiencyinpatientswithtype2diabetesmellitusat HelenJosephHospital

MOGASHOA, Vanessa

RESEARCH REPORT: Anticoagulationfornon-valvularatrialfibrillation in South Africa

MPANZA,MbongiVicter

RESEARCH REPORT: Aretrospective audit ofthecytogenetic profile and managementoutcome in AcuteMyeloid Leukemia patientstreated atCharlotteMaxekeJohannesburg AcademicHospital(2017 - 2021)

NAIDU, Yashika

RESEARCH REPORT: Aretrospectivestudyof the epidemiology,management andoutcomes ofpatientswith dialysis-requiringacutekidneyinjury,overa24-monthperiod,atHelenJosephHospital,Johannesburg,SouthAfrica

NDWAMBI,RudzaniWendy

RESEARCH REPORT: Patternsof liverinjury inHIVpositivepatientsinthemedicaladmissionswardatChrisHani Baragwanath AcademicHospital

PERKS, MicheleLinda

RESEARCH REPORT: AprofileofpatientsonproteaseinhibitorsatatertiarylevelantiretroviralclinicinSouthAfrica

SETSHEGO, MothusiKoketso

RESEARCH REPORT: Theprevalence of ArrhythmiasinacuteSt-Segmentelevationmyocardialinfarction

URADE, YusufMohamed Abdillahi

RESEARCH REPORT: Epidemiologyandreferralpatterns ofpatientslivingwithchronickidney disease in Johannesburg, South Africa:asinglecentreexperience

MasterofMedicineinMedicalGenetics

NOVELLIE,MichaelRichard

RESEARCH REPORT: Audit ofLysosomalStorage Diseasestestingat the NationalHealth Laboratory Servicein Johannesburg from 2011-2020

VANIA, Ashira

RESEARCH REPORT: Geneticcharacterisation of epidermolysisbullosainSouth Africanpatients

MasterofMedicineinNeurology

GANESH,Annsureeka (with Distinction)

RESEARCH REPORT: TherelationshipbetweenincreasedBodyMassIndexandPrimaryHeadacheDisordersina group of AntiretroviralTherapy-induced overweight andobesepatients

MasterofMedicineinNeurosurgery

MOHALE, DiapoGerald

RESEARCH REPORT: Glioma histologyatCharlotte MaxekeJohannesburg Hospital, a5yearretrospective study

MasterofMedicineinObstetricsandGynaecology

MASUKUME,Rumbidzai

RESEARCH REPORT: An assessmentof the hospital learningenvironment withinthe Universityofthe WitwatersrandObstetricsandGynaecologyRegistrar Training Programme

MPHAPHULI,MikovheRejoice

RESEARCH REPORT: Pregnancyoutcomesofwomenpresentingwith2017AmericanCollegeofCardiologystage 1Hypertensionduring the firstprenatalclinicvisitbefore20 gestational weeks

STEVENS, Ronwyn Mercia

RESEARCH REPORT: Theclinicalsignificance ofplacentalhistopathologicalevaluation inthe managementof high-riskobstetric patients

MasterofMedicineinOphthalmology

KRÜGER, Hester

RESEARCH REPORT: Acomparison ofreboundand applanationtonometryinanaesthetisedchildrenwith and without primary congenitalglaucoma: across-sectionalcomparativestudy

MAKDA, Ismail

RESEARCH REPORT: Impactofthe COVID-19pandemiconOphthalmicSurgeryatatertiary hospitalin South Africa

WALTERS,Ingrid

RESEARCH REPORT: Spectrumof glaucomatousdiseaseat CharlotteMaxekeJohannesburgAcademicHospital

MasterofMedicineinOrthopaedicSurgery

GQAMANA,Loyiso

RESEARCH REPORT: TheeffectofHIVonthemicrobiologyofadultpatientspresentingwithsepticarthritisatChris HaniBaragwanathAcademicHospital

MKOMBE,Nangamso

RESEARCH REPORT: PrevalenceofvascularinjuryinpatientswithOrthopaedictraumaonthekneeatChrisHani Baragwanath AcademicHospital

NKOSI,CollenSandile

RESEARCH REPORT: Qualityof lifefollowinganopenLatarjet-Bristow procedurein ageneralpopulationwith arecurrentanteriorshoulderinstability

MasterofMedicineinOtorhinolaryngology

GAFFOOR,Nabeela

RESEARCH REPORT: Prevalenceandrecovery time ofolfactory dysfunctionin SARS-COV-2 positive patients: a prospectivesurvey

MasterofMedicineinPaediatrics

DLAMINI, Sibongile

RESEARCH REPORT: Presentationandoutcomesofchildren admittedwith organophosphate andcarbamate poisoningat RahimaMoosaMotherandChildHospital

KEENE, AbigailMarriott

RESEARCH REPORT: InvasiveFungalDiseaseinChildrenwith Cancer: aten-yearanalysisfrom aPaediatric OncologyCentre in Soweto,South Africa

MAFORA,Tshiamo

RESEARCH REPORT: Virologicalresponseinchildrenandadolescentsswitchingtodolutegravirbasedregimensin Johannesburg, South Africa - A LongitudinalCohort Study

MAGOMANI, Xitshembiso Confidence

RESEARCH REPORT: CharacteristicsandoutcomesofHIV -infected children on antiretroviraltherapyreferredfor virologicalfailure

MAHLALELA,Gcebile

RESEARCH REPORT: Aretrospective descriptivestudyofdemographics,treatmentmodalitiesand outcomesof childhoodimmune thrombocytopeniaat atertiary hospitalin Soweto, South Africa

YACHAD,Nouraine

RESEARCH REPORT: An auditofinfantspresenting withcholestaticjaundiceat asecondary hospitalin Johannesburg, South Africa

MasterofMedicineinPlasticandReconstructiveSurgery

PHALAFALA, Refilwe PalesaMokgadi

RESEARCH REPORT: A multicentreretrospectiveaudit ofthetreatment modalitiesof sternalsepsis: a10-year review

MasterofMedicineinPsychiatry

BADAT, Ahmed

RESEARCH REPORT: Preparednessof finalyearmedicalstudents incaringfor lesbian, gay, bisexualand transgenderpatientswith mentalillness.

HARLIES,CelesteMichele

RESEARCH REPORT: Sleepqualityof adult psychiatryoutpatientsat ChrisHani Baragwanath AcademicHospital

HUMAN, Allison Kirsten

RESEARCH REPORT: Post-traumaticstresssymptomsin mentalhealthcareworkers duringtheCOVID-19 outbreak

HUNGWE,MichelleMandipa

RESEARCH REPORT: Assessingtheprevalence of anddescribingthepsychoticsymptomsofepilepticpatientsin anoutpatientclinicusingtheprodromalquestionnaire sixteen

NEMAVHOLA, Muthumuni

RESEARCH REPORT: Socio-demographic, forensicandclinicalcorrelatesin femaleobservandireferred for non-violentcrimes

PHUNGULA, Nokukhanya

RESEARCH REPORT: ViewsheldbyprimaryhealthcarenursesinacommunityhealthcenterinGautengProvince, South Africa, oncaringfor people living withmentalillnessand taskshifting

RODRIGUES,JanineBiancaLira

RESEARCH REPORT: Neurocognitive improvement inHIVpositive patientstreatedwith dolutegravirbased regimens

ZIKALALA,NonhlanhlaElizabeth

RESEARCH REPORT: Acomparison ofattachmentstylesin Statepatientswith andwithoutantisocialpersonality disorder atSterkfonteinHospital

MasterofMedicineinRadiationOncology

SCHNEEBERGER,Daniel Clarence

RESEARCH REPORT: Treatment outcomesfor patientsreceivingradiationtherapyforstageIIIBcervicalcancer with lowerthirdvaginalinvolvementinthedepartment ofRadiationOncology, Charlotte MaxekeJohannesburg AcademicHospital

TSHOEU, Phemelo

RESEARCH REPORT: Aretrospective analysisofconcurrentchemoradiationfor patientswith squamouscell carcinoma ofthe anustreatedbetween2014 and2019 inJohannesburg

MasterofMedicineinSurgery

GOVENDER,TarliaRasa

Paediatric Surgery

RESEARCH REPORT: Respondingtotheneed-thedevelopmentofsubspecialtyunitsinpaediatricsurgeryamidst theglobal surgerypandemic

HART,Benjamin Mark

RESEARCH REPORT: Metataxonomicanalysisdemonstratesashift induodenalmicrobiota in acohortof South African patientswithobstructiveJaundice: apilotstudy

HARTFORD,LeilaNompelo

Paediatric Surgery

RESEARCH REPORT: Singlestageproceduresforanorectalmalformations:asystematicreviewandmeta-analysis

JACOB,Joseph

RESEARCH REPORT: ClostridioidesDifficile Infectionin SurgicalPatientsManaged atCharlotte Maxeke Johannesburg AcademicHospital: aRetrospective, DescriptiveStudy

MASOLE,Ludo LoratoCarol

RESEARCH REPORT: Procalcitonininthepostoperative burnspatient

MATHIBELA, SetoniPiet

RESEARCH REPORT: Thefeasibilityofearlychemicalthromboprophylaxisin traumaticbrain injury patients admittedto atrauma ICU

MUKENDI,Ilunga Valerien

RESEARCH REPORT: Assessmentof geneticcounsellingandtesting of patientsdiagnosed withinvasive breast carcinoma in two South Africanbreast units

MasterofPharmacy

AYODELE, Simisola Ayobami (with Distinction)

DISSERTATION: Targeted nanosystemsforTB pericarditis intervention

KIM, Yedam

DISSERTATION: Useof probioticsincommunitypharmacyin South Africa: asurveyofpharmacist attitudes, perceptionsandknowledge

LIPHOLO,LineoJeanett (with Distinction)

DISSERTATION: Knowledge,attitudesandperceptionsofhealthcareworkersonadversedrugreactionreportingin agovernmenthospitalin Botswana

MAZARURA,KundaiRoselyn (with Distinction)

DISSERTATION: Designandevaluationof anon-opioidtripartitereleasetabletforchronicinflammatorypain.

SPINICKUM,LoganJade (with Distinction)

DISSERTATION: AntibacterialstewardshippracticesinSouthAfricaduringtheCovid-19era:aretrospectivereview

MasterofPublicHealth

BOKABA,DorahDorothea

Health Systems Policy

RESEARCH REPORT: Exploring inter-professionalcollaborationbetweencommunity health workers and health careproviders intwoclinicsintheCityof Johannesburgdistrict

DHAR,Nisha

Mother and Child Health

RESEARCH REPORT: AssociationbetweenserumzinclevelanddynamicsofGroupBStreptococcuscolonisation amongpregnantwomenin South Africa

KWATRA, Gaurav

Mother and Child Health RESEARCH REPORT: PrevalenceofGroup B Streptococcuscolonization andserotypedistribution among pregnantwomenin South Asian andAfricancountries

MCGRATH,Robyn Lesley (with Distinction)

Mother and Child Health RESEARCH REPORT: TheeffectsofCOVID-19 on paediatrictherapeuticservicesatChrisHaniBaragwanath AcademicHospital

ROWSE, SavannahMaida Social and Behaviour Change Communication RESEARCH REPORT: Factors thatpromoteand impedetreatment adherence ofout-patient mentalhealth care users atapsychiatrichospitalinJohannesburg

ZAMISA,Thulile Senzekile Occupational Hygiene RESEARCH REPORT: Noiseemissionsandexposuresamongdrilloperatorsandassistantsinanopencastminein South Africa

MasterofScienceinDentistry

HARI, Anisha Anil

RESEARCH REPORT: Theprevalenceandtypesofpathologiesrelatedtoimpactedmandibularthirdmolarsbased onpanoramicradiographs

RAMPERSAD, Yuvti

RESEARCH REPORT: Antibioticprescribing patterns amongdentistsin the DurbanMetroRegion, South Africa

MasterofScienceinEpidemiology

CHIPISE,Elisha

Implementation Science RESEARCH REPORT: Factors associated withextremenonadherencetoTBtreatmentamongadultdefaulters attendingGqeberhaclinic between2018 and 2019

CHISHIBA,Charlotte Njavwa

Implementation Science RESEARCH REPORT: Theassociation betweenintermittent preventivetreatmentuptakeandAnaemiaamongst pregnantwomeninZambia in 2018: aspatialanalysis

DINGA,Aphiwe NomathibaneZilungile

Epidemiology and Biostatistics RESEARCH REPORT: OccupationalcharacteristicsandeconomicactivitiesofHealth Workers intheQuarterly LabourForceSurvey:2008 -2017

DZIMBANHETE,TsitsiCherry

Epidemiology and Biostatistics RESEARCH REPORT: TherelationshipbetweentraumaticeventsandqualityofsleepinolderadultsinruralSouth Africa

ELAKPA,DanielNgbede

Implementation Science RESEARCH REPORT: Factors associated withvectorcontrolforonchocerciacis controlin Sub-Saharan Africa (2000- 2023):asystematic review

GEORGES,Some

Epidemiology and Biostatistics RESEARCH REPORT: Predictors of frailtyand multimorbidity in adultsaged 40 to65 yearsin aruralpopulation cohortinBurkina Faso

JOHNSTON, Leigh Clare Field Epidemiology RESEARCH REPORT: Determinants of sub-optimalglycaemiccontrol among patients enrolledina medicine dispensing programmeinKwazulu-Natal:a cohortstudy,2018-2021

KANZOOLE, Kingsley Implementation Science RESEARCH REPORT: Riskfactors forrecurrenttuberculosisamongHIVpatients who areon anti-retroviral treatment inruralNortheast,South Africa

KUPA, NkgodiObed

Infectious Disease Epidemiology RESEARCH REPORT: Therelationshipbetweenthecombinedeffectsoflife-coursetraumaandHIVoncognitionin ruralSouthAfrican adults: asecondary data analysis

MUCHAI, Lilian Njeri

Epidemiology and Biostatistics RESEARCH REPORT: Earlylifefactors associated withchildhood trajectoriesof violenceamongtheBirth to Twenty-pluscohort in Soweto, South Africa

NHLAPHO, MapuleDorcus Public Health Informatics RESEARCH REPORT: Avisualanalyticsapproachtocharacterisingdiseaseprogressionamongadultswithchronic diseases inruralnortheast South Africa

MasterofScienceinMedicine

BARNARD, Sebastian Genetic Counselling RESEARCH REPORT: Areviewofgenetictestingforfemalesreferredtogeneticcounsellingforapersonalorfamily history of gynaecologicalcancer

BENNETT,Matthew Biokinetics RESEARCH REPORT: Theeffectivenessofamultidisciplinary,protocol-basedapproachtopatientsofdifferentage groupswith lowerbackpainin Bloemfontein,Gqeberha,Polokwane,andJohannesburg

BEUKMAN,Danielle Genomic Medicine

RESEARCH REPORT: RB1andbeyond: Determining geneticcauses ofRetinoblastoma in South-African patients

BLIGNAUT,Chanel Pharmacy

DISSERTATION: Assessingthe potentialinteraction betweenCBDandTBR1T-boxDomain

BRESLER, Anréé Genomic Medicine

RESEARCH REPORT: Predicting exomesequencing outcomesfrom phenotypic data in an Africanpatientcohort with developmentaldelay

DUVENHAGE,Megan Genetic Counselling RESEARCH REPORT: Theutilisationofgeneticcounsellingservices amongstprenatalhealthcare providersin Gauteng, South Africa

ELONGA,Jessica Pharmacology

DISSERTATION: The invitrodiffusionacrossexercisedporcineskin ofvariousformulationsofcompoundsused topically inthetreatment of skinafflictions

EME,Ifeanyi Clinical Microbiology & Infectious Diseases

DISSERTATION: Effectof pneumococcalconjugatevaccineoninvasive pneumococcaldiseaseinchildren hospitalised atChrisHaniBaragwanathHospitalover a13-year period

FONGUH,Oliver Khan Vaccinology

RESEARCH REPORT: FunctionalconsequencesofnovelIgG3allelicvariation onCAP256-VRC26.25

FUTI,Benedicte Malonda Physiology DISSERTATION: Theepidemiologyof menstrualpain ina South AfricanUniversitypopulation

GALLANT,Simone

Anatomical Sciences DISSERTATION: Characterizing luminalA breastcancerheterogeneityandinvitroresponse to hormonetherapy

GAVIN,JessicaRobyn

Anatomical Sciences DISSERTATION: Assessmentofdisabilityresulting fromdegenerative jointdiseasein asouthern Africanskeletal population

GOLDFEIN,Batsheva Chana Physiology DISSERTATION: microRNAexpressionandarterialfunction in typeIIdiabetesmellitus

GOVENDER,DemiNatisha Anatomical Sciences DISSERTATION: TheeffectsofIbogaine on myelinationinSpragueDawleyrats

GROBLER,Nico (with Distinction) Physiotherapy DISSERTATION: Thedevelopmentofaquestionnairetoassesstrainingandmatchdemandinadolescentcricketers

ISMAIL,Tahir Clinical Pharmacy RESEARCH REPORT: Asurveyofthe delivery of clinical servicesin independent community pharmacies in South Africa

KAIRUZ,Dylan Matthew (with Distinction) Haematology and Molecular Medicine DISSERTATION: Developingnon-viralvectorformulationsforthe delivery ofsyntheticself-amplifyingRNA

KHAN,Muneerah (with Distinction) Bioethics and Health Law RESEARCH REPORT: Epistemic(in)justice,socialidentityand the BlackBox problem in patient care

KHOZA,Nhlamulo (with Distinction) Human Genetics DISSERTATION: Characterisingthecombinedeffectsofcytochrome P450 missensevariantswithinthestar allele nomenclature

LUBBE, Andrea Physiology

DISSERTATION: Neurophysiologicaleffectsofcitalopraminarodentmodelof ACTHinduced HPAaxis dysregulation

MAKHA, LeratoMathabelo Pharmaceutical Affairs RESEARCH REPORT: Designandsynthesisofananocapsulesystemfortransdermaldeliveryoflignocaineacross theskin

MALINGA,Thandeka VuyiswaBongiwe

Genomic Medicine RESEARCH REPORT: Characterisation ofthegeneticvariation inpharmacogenesinvolved inanti- tuberculosis drugmetabolism acrossAfricanpopulations

MANGENA,ZaneleGrannyMahalia (with Distinction)

Clinical and Experimental Pharmacology DISSERTATION: An evaluationof the effectsofmetal complexeson lungcancer celllines

MATHABELA,Nomfundo Ntombikayise

Chemical Pathology DISSERTATION: Sequencing forhigh-risktype 1diabetesgenotypesin the SouthAfricanblackpopulation using ampliseqNanoporenextgenerationsequencing

MATHIKHI,KhethaniThendo Physiology DISSERTATION: Investigating the toxiceffectsof nyaope onthebrain,liverand kidneyofSprague-Dawley rats

MCCARTHY,DylanJames (with Distinction)

Genomic Medicine RESEARCH REPORT: Analysisofsinglenucleotidevariants andcopynumbervariants in patientswithfeatures suggestive of aRASopathyusing whole exomesequencing

MHLATHI, Xolisiwe

Anatomical Sciences DISSERTATION: Microarchitectureof the human postnatalmaxilla inrelationto tooth developmentand eruption

MINNS,Chantelle

Clinical Pharmacy RESEARCH REPORT: Investigatingthecorrelation betweendemographicandcomorbidityprofileswith chemotherapeutictoxicityexperiencesinearly-stagebreastcancerpatientsinaprivatemedicaloncologypracticein South Africa

MMBI, PhophiMmapole

Genomic Medicine RESEARCH REPORT: Investigatingthegeneticcauseof oculocutaneousalbinismtype 2inindividualsofAfrican descentthroughexomesequencing

MNGOMA,Ndabenzinhle Ronald

Anatomical Sciences DISSERTATION: Effectsofbinge alcohol consumptionon the developmentof thefemurof adolescent Sprague Dawleyrats

MOHUN, Shameeda Clinical Pharmacy RESEARCH REPORT: Aretrospectivereview onthe utilisation of meropenem in atertiary hospitalsetting

MOTLHALE,Gomotsegang Physiology DISSERTATION: Effectsoflycopeneonthebone, kidneyandpancreatichealth ofgrowingWistarratsfeda high fructosediet

MUNIAN, Pariska Physiology DISSERTATION: The impactofaltitudeontheprevalenceandcharacteristicsof RestlessLegsSyndrome

NAICKER,Racilya (with Distinction)

Genomic Medicine RESEARCH REPORT: Analysisof Whole ExomeSequenceDatafrom African Patientswith HD-Like Featuresand NoKnownHD PhenocopySyndrome

NCHIMUNYA, Bbautu Exposure Science RESEARCH REPORT: Efficacyofnoise controlmeasures athigh noisezonesfromacopper mine inZambia

NEVES,KeilaDias (with Distinction) Haematology and Molecular Medicine DISSERTATION: Expressionand immunogenicity of HBV surfaceantigensfollowing in vitro and invivogene delivery usingrecombinant adenoviruses

PEYA, Yolanda (with Distinction) Anatomical Sciences DISSERTATION: Adocumentationof the morphology ofthelungsoftheSprague Dawleyratafterchronicheat exposure

PIKETH, AimeeJane

Clinical Microbiology & Infectious Diseases

DISSERTATION: Investigation of mono-andpolymicrobialantibiofilm activities of Defensin-likeantimicrobial peptide-2againstCandida aurisand Pseudomonasaeruginosa

PILLHOFER, Gabriella Peta

Genomic Medicine RESEARCH REPORT: GermlineCancerPredispositionVariantsin PaediatricRhabdomyosarcoma

RABINDA, KentieRofhiwa

Genomic Medicine RESEARCH REPORT: Exomesequencingof individualswithvitiligoandtheirrelativeswith and without autoimmunedisorders

RAJCOOMAR,Yashmika Pharmaceutical Affairs RESEARCH REPORT: Thewound healing effect ofexosomesderivedfrom Lobostemon fruticosus

RAMTAHAL, Kieara-Lee Bioethics and Health Law RESEARCH REPORT: Themoralobligationtoincludepregnantwomen inclinicaltrials

SAMUDH,Nazia (with Distinction) Haematology and Molecular Medicine DISSERTATION: Characterizationof the murine immuneresponseto self-amplifyingmRNAsequencesencoding HepatitisBvirussurfaceproteins

SARANGARAJAN,Ruach

Bioethics and Health Law DISSERTATION: Dogovernmentshave anyprima faciedutiestofund influenzavaccination(forthe elderly in SA) and adults65 yearsandabovetovaccinate against influenza,respectively?

SCHEEPERS, VanessaChristina Bioethics and Health Law RESEARCH REPORT: Isitfair and morallyjustifiedto limit accesstofree Human Papillomavirusvaccinationsto onlygirls inpublicschoolsinSouth Africa?

SHRILALL, CreanneJizell

Haematology and Molecular Medicine DISSERTATION: DevelopmentofinvitrotranscribedRNAinterferenceactivatorsforthetherapeuticinhibitionofthe hepatitisBvirus

SIMBU,Shivar Bram (with Distinction) Pharmacy DISSERTATION: Essentialoilcompoundsincombination withconventionalantibioticsfordermatology

SMIT, IngridMaria Genomic Medicine RESEARCH REPORT: Cysticfibrosis: an update onthevariantprofile andcarrierfrequencyinthe BlackSouth African population

STEYN, StephanusFrederik (with Distinction)

Clinical Pharmacy RESEARCH REPORT: Brainconcentrationsandthe neurochemicaleffectsof passivelyadministered fluoxetine in Flinderssensitivelinerat offspring

TSOLO,SemakalengTheresia

Vaccinology RESEARCH REPORT: EvaluationofnovelassayformatsforIndoleamine 2,3 dioxygenaseasaTBbiomarker

ZUNGU,Zwile

Vaccinology RESEARCH REPORT: UnderstandingSARS-CoV-2vaccinehesitancyamong pregnantwomeninSoweto, South Africa: aqualitativestudy

MasterofScienceinNursing

CLAY,Nadia Susan

DISSERTATION: PrivateSectorHealth Care users'forchoosingmaternityservicesina District in Mpumalanga

CLUFF,Megan Andrea

RESEARCH REPORT: AstrategicassessmentofemergencycarecapacityatPrivatePrimaryHealthCareFacilities inGauteng

MARE,Magdalena Elizabeth

DISSERTATION: Guidelinesforthe implementationofblended learningina nursingcollege campusin Gauteng: a mixed methodsstudy

MOTSUMI,TheodoraMapadime

RESEARCH REPORT: Thepsychosocialwork environmentof primary health carenursesintheNorthern Sub-DistrictCityof Ekurhuleni

QUIROGA,NeilDylan

RESEARCH REPORT: Theemergencymanagement ofpatientswhohave experiencedsexualviolence: an integrativeliteraturereview

MasterofScienceinOccupationalTherapy

PRETORIUS, Jeanette Maria

RESEARCH REPORT: Impactof aruralcontextin Kwazulu Natalon primary caregiver'smanagementofpain non-communicatingchildrenwithsevere neurologicalimpairment

MasterofScienceinPhysiotherapy

CHIROMBO,Hannah Edith

RESEARCH REPORT: Investigatingthephysiotherapymanagement ofpatients with polytraumaadmitted to acute caresettingsandfactors thatinfluenceservice deliveryafterdischarge: aNamibiansurvey

DAHYA, Karishma

RESEARCH REPORT: Mappingelectro-acupunctureinthe treatmentof lowerbackpain. aScopingreview

DAWOOD,Zaheerah

DISSERTATION: Factors contributingtouncontrolled highbloodpressure in Ekurhuleni,Johannesburg:the communityhealthworkers'perspectives

HURST, Samantha Lee Anselmo

RESEARCH REPORT: Breathing Pattern Dysfunction amongst patientswithMedianSternotomy PostHospital Discharge: across-sectionalstudywithin a South African context

LEANDER,Natalie

RESEARCH REPORT: Exercisedosagesforthe management ofgeneralized anxietydisorder: ascopingreview

MASILANA, Masocha Vusi

RESEARCH REPORT: Running-related injuriesandriskfactors amongrunnersinSoweto townshipclubs, Johannesburg

STEYN,Joretha

RESEARCH REPORT: Modeof delivery,analgesic, andneuromusculoskeletalprofileofwomen developing new onset lower backpain postpartum

VANHEERDEN,Martin Harry

DISSERTATION: Patient'sperspectives,pain,andhealth-relatedqualityoflifeinsame-daydischargehipandknee arthroplasty

BachelorofClinicalMedicalPracticeHonours

ALEXANDER,Fatima Emergency Medicine

BachelorofHealthSciencesHonours

BOOYSEN, Brandon Mark Physiology

CHINGUNO, Shingirai Pharmacology

DU-PONT,Justine Manda (with Distinction) Biokinetics

GERBER,RachelBatya Physiology

GUMEDE,GcinathinaNkazimulo Biokinetics

KUHN, SebastianCJ Forensic Sciences

KUNUTU, Prudence Boniswa Anatomical Pathology

MAHLAELA,Malope Valentia Lebogang Physiology

MAZIBUKO, NoxoloQueenUnity Molecular Medicine and Haematology

MOETAPELE,Keitumetse DeboraFlavia Forensic Sciences

MOTAUNG,Lerato Mapaseka (with Distinction) Human Biology

NCUBE, MbaliFaith (with Distinction) Human Genetics

NDOU,Onakesa Pharmacology

NYAWO,Sithabile Forensic Sciences

NYONI, Emmanuel Virology

PATJANE, MamodianeAnna (with Distinction) Virology

PISANTI,Rosa (with Distinction) Human Biology

PRENTICE,Kaylee (with Distinction) Biokinetics

SEBOLA, Mokgaetsi Albertina Exercise Science

SHUSHA,NomceboNonjabulo Immunology

TAMLIN, AmberRebekah (with Distinction) Pharmacology

TSIBOGO,Pahora Veronica

Clinical Microbiology and Infectious Diseases

TSWAI,Refilwe Bridgett Health Systems Sciences

BachelorofDentalScience

GUMEDE,Nhlanhla Prince

KÖSTER, Emma

LANGA,NanikieBetty

LATEGAN,Carissa

MACDONALD, Sean Nicholas

MAKHETHA,Zoliswa

MARKOULIDES,Stelios

MOKALE,Teboho Macdonald

NAST, KimberleyAmber

NGOMANE, Tricia Pertunia

PATHER, KeashtraPragason

PIENAAR, Marcia

SALLEY, Sameer

SUJEE, Ammaarah (with Distinction)

TAKADIYI,MirandaTadiwa

TLAKANE, Mpinane Eunice

VANDENHEEVER,Deniell

VANDE WETERING, Monique

YASIN,Mohammed Abdiqafar

BachelorofMedicineandBachelorofSurgery

AMADI-IHUNWO,Glory Chukwuka

ASHER,Horeb

AZIZOLLAHOFF,Liat Devorah

DEGOUVEIA, Tammi

DLAMINI, Awongiwe KamvelihleHlonela

FEENEY,Connor Mcleod

HOFFMANN,Hilton Allan

KABEYA, KapembGloria

KHWASHA, NokuthulaPrecious

MABIZELA,Tshegofatjo Selaelo

MAHARAJ, Kashiv

MAKUA, Nelisiwe Kemalo

MASEMOLA, LeratoAdelaide

MATLOGA,KabeloFortune

MILLER,Georgina Michele

MOHETA, Boitumelo

MOOLLA,Ahmed Mohammed

MUNIEN,CameronDevan

NAIDOO,Vishen

NDLOVU,Nceba

NHLAPO,Nhlonipho Emelinah

NTSHANGA, Asithandile

PHILIP,Serin Ninan

RADEBE,NolwaziDorcas

RAMOSHU,Lehlogonolo Pleasure

SENGANE, Nomzamo Ayanda

SHABALALA,Sanele Lwazi

BachelorofNursing

BEILING,Claireece Carise (with Distinction)

DUPLESSIS,RenschePetronella (with Distinction)

KGAGARA,KgotsofaloPebetse

KHOABANE,Palesa

MAKHUBELA, ColwynTanaka

MAKHUVHA, Uhone

MALEPE, RegaogetsweTracy

MAZALENI,Nosiphiwe Hope

MBALENI,Tokazi Lilitha

MBUTHO,Minenhle NonjabuloHopewell

BachelorofPharmacy

DAMARI, KabeloJohn

DUPLESSIS,Nerine

ESSA, Mohamed

LUBISI, Linda Ebenezer

STAMPER,Mbasa

STANDER,Lizette

TIFO,MpunduJennette

WAFAWANAKA,TadiwanasheNathanTawanamubatsiri

WIRSIY, John-Leroy Njofon

ZONDO,SiphokuhleNombusoSanda

METHOLA,Thapelo Patrick

MPEPELE, Lethabo Audrey

MPHAHLELE,Leago

NDLOVU,ThabileLindokuhle

NHLEKO, Ayanda

NTEMA, NalediNathaly

SAMIMI, Sahra

SANGWENI,Tholakele Ayanda

THOMPSON,AliciaGeorgia

ULLBRICHT,ChanelJesse

MALAPANE, Boitumelo Pretty

MALATJI, Karabo Advice

PILLAY, CaitlynnElizabeth

BachelorofScienceinOccupationalTherapy

LAMULA,Luyanda Samukelisiwe

BachelorofScienceinPhysiotherapy

NKOSI,ThandolwethuZinhle

BachelorofClinicalMedicalPractice

CHEPAPE,TebogoLesiba Mukelo

MAHUDU,Dimakatso Agnes

MNGUNI, Sthokozile Asande

MOGARI,LebogangOuma Emily

BachelorofHealthSciences

BOOI,Sisipho Biomedical

DAHIR,FatimaHasan Biomedical

DUNCAN, Robyn Erin Biomedical

KHANYI,FezekaHappy Health Systems Sciences

KHUMALO,NosiphoThandeka Biokinetics

KHUMALO, SanelisiweNomhle Health Systems Sciences

LETSELELA, RekhotsoMatshepiso Biomedical

MAKGATHE,Deborah Khowele Health Systems Sciences

MALEKA,KeletsoPortia Biomedical

MASOLA, MahlatseDanny (with Distinction) Health Systems Sciences

MASWI, Boikanyo Health Systems Sciences

MATLALA,Otshepegile Salvina Biomedical

MATYANA,Luthando Biokinetics

MCHUNU,Thandeka Health Systems Sciences

MLGUNI,ThembekaAnele Pearl Biomedical

MOHAMMAD, Amaarah Ali Biomedical

MOKGWADI,LethibeOdgah Biomedical

MPHAPHULI,Neo (with Distinction)

MTHEMBU, Kwanele Phindile (with Distinction)

MULEWA, Keziah

Health Systems Sciences

Health Systems Sciences

Health Systems Sciences

MUNESAR, Kavish Biomedical

NCUBE, QueenMbali Biomedical

NOMPULA, Aphindiwe Biomedical

SIBIYA, PrincessNompumelelo (with Distinction)

SKOSANA, XolaniJosiah

TSHIWANDIMONI, Khodani

BachelorofOralHealthSciences

DUMA, KhensaniPatricia

Health Systems Sciences

Health Systems Sciences

Health Systems Sciences

MQALA,Phumelele

PostgraduateDiplomainHealthSciencesEducation

MAFOJANE,TumaneDaniel

MATLHADISHA, PhutiGermina

PostgraduateDiplomainOccupationalHealth

JINNY,MutambayNdaya

MABEBA,DanielMphenywa (with Distinction)

MAKHWITING, Podile Prodexcel

MAROLE,ThapeloHenry

NTSHANGASE,Sesiphiwe SandaNomfundo

OMOYENI,OlusholaOluranti

ZIKALALA,Hlengiwe

PostgraduateDiplomainTropicalMedicineandHygiene

MHLONGO,WandileMason

THEWITSHEALTHPROFESSIONAL'SHIPPOCRATICPLEDGE

AsaHealthProfessionalgraduandoftheUniversityoftheWitwatersrand,Isolemnlypledgethat:

- Iwilldedicatemylifetotheserviceofhumanity;

- Iwillexercisemyprofessiontothebestofmyknowledgeandabilityinaccordancewith soundhealthpracticesandwithcompassion,conscience,integrityandhumility;

- Thehealthandwell-beingofallpersonsentrustedtomycareandthewell-beingofthe communitywillbemyfirstconsideration;

- Iwillrespecttheautonomyanddignityofmypatientandwillnotknowinglydoanythingto theirdetrimentorprejudice;

- Iwillnotpermitconsiderationofage,religion,nationality,politics,race,gender,sexual orientation,disability,disease,lifestyle,economicstatus,socialstandingoranyother factortointerferewithmydutytomypatient;

- IwillnotimproperlydivulgeanythingIhavelearnedinmyprofessionalcapacity;

- Iwillupholdanddefendmyprofessionalindependence;

- Iwilladvocateforhumanrightsandwillnotviolatesuchrightsandcivilliberties,even underthreat;

- Iwillconductresearchonpatientsonlyinaccordancewithsoundethicalprinciplesand with theapprovalofaformallyconstitutedethicscommittee;

- Iwillembracelife-longlearningtoimprovemyprofessionalknowledgeandskillsandwill sharemyknowledgeforthebenefitofpatientsandtheadvancementofhealthcare;

- Inmyrelationswithpatients,colleaguesandothers,Iwillconductmyselfasbecomesa memberofanhonourableprofession.

Imakethispledgesolemnly,freelyanduponmyhonour.

GRADUATIONAWARDS

FACULTYOFHEALTHSCIENCES

Prizestobepresented at theGraduationCeremony

GoldMedalofthe SouthAfricanDentalAssociation: AwardedtotheDentalGraduandwho hasachievedthemostdistinguishedacademicrecordoverthefiveyearsof study.

Ammaarah Sujee

Raymondand Marjorie DartMedals:

Thismedalisawardedto themost distinguishedgraduandwho performed ataconsistentlyhigh levelthroughout thefouryearsofstudyinBNursing.

Rensche Petronella Du Plessis

Prizestobepresented at theFaculty’s prizegiving ceremony

AfricanOxygenBronzeMedal:

Thismedalisawardedto thefifth-yeardentalstudent adjudgedthemostdistinguished inthe administration of generalanaesthetics.

Ammaarah Sujee

BarbaraRobertson Prize forIntegratedGeneralNursing(IGN)IV:

Thisprize isawarded tothe studentwhohas achieved thehighestmark in both thetheoreticaland practical components oftheIntegratedGeneral Nursing(IGN)IVcourse.

Rensche Petronella Du Plessis

BronzeMedaloftheHenryScheinDentalWarehouse:

Awardedtothemostdistinguishedstudent in Prosthodontics.

Ammaarah Sujee

CommunityDentistryPrize:

Tothestudentwhoachievesafirstclasspassandthe highestmark in PublicOralHealth

Ammaarah Sujee

Dean's MeritListBachelorof Health SciencesYear 3:

Citationforachieving an average of75%inthethirdyearofstudyforthedegree ofBachelor ofHealth Sciences.

Fatima Hasan Dahir

Robyn Erin Duncan

Fezeka Happy Khanyi

Deborah Khowele Makgathe

Mahlatse Danny Masola

Thandeka Mchunu

Neo Mphaphuli

Kwanele Phindile Mthembu

Keziah Mulewa

Princess Nompumelelo Sibiya

Dean's MeritListBachelorof Nursing Year4:

Citationforachieving an average of75%inthefourth yearofstudyforthedegree Bachelor ofNursing.

Claireece Carise Beiling

Rensche Petronella Du Plessis

Regaogetswe Tracy Malepe

Sahra Samimi

Alicia Georgia Thompson

Chanel Jesse Ullbricht

Dean's MeritListBachelorof Oral Health Sciences (OralHygiene)Year 3:

Citationforachievinganaverageof75%inthethirdyearofstudyforthedegreeBachelorofOralHealthSciences

Khensani Patricia Duma

Dean's MeritListBachelorof Pharmacy Year4:

Citationforachieving an average of75%inthefourth yearofstudyforthedegree ofBachelorof Pharmacy. Boitumelo Pretty Malapane

Henrietta StockdaleFloatingTrophyforNursing:

Thisprize isawarded tothe studentwhoachievesthe highestlevelofprofessionalmaturity duringthefour-year Nursing degree.

Rensche Petronella Du Plessis

JockGearMemorialAwardforNursing:

AwardedtothefinalyearNursingstudentwhohas achieved ahigh levelofclinical competence and provided meritoriousserviceincaringforclients and patientsin bothcommunityand hospitalsettings. Claireece Carise Beiling

LesterBrownMedalfor MeritinMaxillo-Facial&OralSurgery:

Thismedalisawardedto thefinal yeardentalstudent adjudgedthe mostdistinguishedinMaxillo-Facialand Oral Surgery.

Emma Köster

Nestlé Prize inMidwifery II:

Thisprizeisawardedtothe finalyearNursingstudent adjudgedthemostdistinguishedinthecourseofMidwifery. Claireece Carise Beiling

OHASA/Oral-BAward:

Thisprizeis awardedannuallytothefinalyearstudent inthe BachelorofOralHealth Sciencesadjudgedthe most distinguished inthecourse Fundamentals ofClinicalOralHygieneIII.

Khensani Patricia Duma

Operative DentistryMedaloftheSouthAfricanDentalAssociation:

Thisprize isawarded tothe mostdistinguished final yearstudentinRestorative Dentistry.

Ammaarah Sujee

OrthodonticsBronzeMedaloftheSouthAfricanDentalAssociation:

Thisprize isawarded tothe mostdistinguished student inthecourse,Orthodontics.

Ammaarah Sujee

PeriodontologyPrize:

Thisprize isawarded tothe mostdistinguished final yearstudentinthecourse, Periodontology.

Emma Köster

Rousseau ViljoenMemorialPrizeinOral Medicine:

Thisprizeisawardedtothefifth-yeardentalstudentwhohasshownthegreatestpromiseinOralMedicine,orwho hasattained adistinction in thecourse.

Emma Köster

SidSetzer-MillnersPaedodonticMedal:

AwardedtothemostdistinguishedfinalyearstudentinClinicalPaediatricdentistry.

Teboho Macdonald Mokale

SouthAfrican Dental AssociationLeadership Medal:

Awardedannuallytothe DentalGraduandwhoisdeemedtohavehada satisfactory undergraduatecareerandto havedisplayedconspicuousleadership qualities,characterand sportsmanship. Stelios Markoulides

TheAnnAndrewAward:

Thisprize isawarded annuallyforthe beststudentin MedicalCellBiologyIII. Robyn Erin Duncan

TheJCAllanHonoursAward:

Thisprize isawarded tothe beststudent in the BachelorofHealth Scienceswith Honours inHuman Biology. Rosa Pisanti

OFFICERSOFTHEUNIVERSITY

Chancellor

DRNJ DLAMINIMBChB(Natal)DOH(Free State)MBA(Witwatersrand)DBL(Unisa)PGCE(Witwatersrand)IEC (Stanford-USA)

Vice-Chancellorand Principal

PROFESSORZ VILAKAZI BSc(Manchester)MScPhD(Witwatersrand)FRS, FAAS, MASSAf

Chairman of Council

MRI SHONGWE BA(Wesleyan)MPhil(Oxford)

Senior Deputy Vice-Chancellor (Academic)

PROFESSOR ROSMAN BA(Witwatersrand)HDipEd BEd(Unisa)MEd PhD(Witwatersrand) MASSAf

DeputyVice-Chancellor (Research andInnovation)

PROFESSOR LMORRIS BSc(Hons)(Witwatersrand)DPhil(Oxford)FRSSAFAAS MASSAf

DeputyVice-Chancellor (SystemsandOperations)

PROFESSOR IRJANDRELLBSc(Eng)GDE PhD(Witwatersrand)IntPE(SA)PrEngFSAAEFSAIEE SMIEEE

DeputyVice-Chancellor (People Developmentand Culture)

PROFESSORGSTEVENSBA(CapeTown)BAPsychHonsMPsych(WesternCape)DLittetPhil(Unisa),MASSAf

Registrar

MSCG CROSLEYBAHDipEd(Witwatersrand)BEd Hons(Unisa)MEd(Witwatersrand)

ChiefFinancialOfficer

MSMMMANYAMACA(SA)BComAccounting(CapeTown)BComptHons(Unisa)BComHonsTaxation(Pretoria) MBA(GIBS)

DeanofStudentAffairs

MRJAPSEPTEMBER BA MPhil (CapeTown)

DEANSOFTHE FACULTIES

FacultyofCommerce,LawandManagement

PROFESSORJCOHEN BComHonsPhD(Witwatersrand)

FacultyofEngineering andtheBuiltEnvironment

PROFESSORT MAJOZIBScEngMScEng(Natal) PhD(UMIST)CEngPrEngFIChemEFAASMASSAfFWISA FSAAE

FacultyofHealthSciences

PROFESSOR SAMADHI MBBCh MMed PhD(Witwatersrand)FCPaeds(SA)MASSAf,RSSAf, TWAS,CBE

FacultyofHumanities

PROFESSOR MMUSEMWA BAHons(Zimbabwe) MA(CapeTown) PhD(Minnesota, USA)MASSAf

FacultyofScience

PROFESSOR NCHETTY BScHons(Natal)MS PhD (U.IllinoisUrbana-Champaign) MASSAf, MSAIP

President of Convocation

MSKMUFAMADI BALLBLLM(Witwatersrand)

FACULTYOFHEALTHSCIENCES

The Faculty of Health Sciences at the University of Witwatersrand in Johannesburg, South Africa has been established for more than 100 years and is regarded as one of most reputable institutions for health sciences education in sub-SaharanAfrica.

RankedbytheShanghaiRankingsinthetop300intheworldinsubjectrankingsforclinicalmedicineandthetop70 in the world in subject rankings for public health, the faculty holds its own amongst the top 400 universities internationally and preparesstudentsforafuture inthehealthcaresectoracross theglobe.

As South Africa’s largest and most comprehensive health sciences faculty, with over 7000 registered students, it offers undergraduate degrees in dentistry, medicine, medical and health sciences, nursing, occupational therapy, physiotherapy and pharmacy. It also offers a graduate entry medical and physiotherapy programme, Masters degreesinscienceand medicineanda PhDprogramme.

Teaching programmes in the faculty are student-centred, internationally recognised, socially responsive and exemplify excellence in all dimensions. More than 1200 health sciences professionals graduate each year and are sought-afternationally,regionallyandglobally.

The faculty provides excellent support and an intellectually stimulating environment for postgraduate study. Significantly, the Faculty has increased its postgraduate output significantly in the last five years and boasts excellent postgraduatesupervisors who participate in cutting-edgeresearch in clinical,appliedand basicsciences, providing fertile and varied fieldsofresearchto undertake.

The Faculty of Health Sciences is home to one Nobel Prize Winner;seven research intensive Schools; nine NRF A-rated scientists; twoDepartment of Science & Innovation (formerly the Department of Science and Technology) andtheNationalResearchFoundation’sCentresofExcellence(DSI-NRFCoEs);twoAfricanNetworkforDrugand Diagnostics Innovation Centres (ANDI) and to eight Department of Science and Technology/National Research Foundation South African Research Chairs. There are currently 28 research entities based in the Faculty and two Research Thrusts (Diseases of Lifestyle and Molecular Biosciences). The quality of the Faculty’s research output ranks amongst the best in the country and is respected internationally. The faculty publishes more than 2000 researchpapers eachyear.

AnumberofprogrammesforthetrainingofthenextgenerationofacademicsareprovidedthroughtheFaculty.One suchprogrammeisCARTA(ConsortiumforAdvancedResearchTraininginAfrica),amulti-disciplinaryprogramme aimedatgrowingprofessional,academicandresearchcapacityinAfricainthefieldofpublicandpopulationhealth. Its Pan-African focus of research includes reproductive health and sexuality as well as killer diseases in Africa, notablyTB,HIVand malaria.

One of seven Schools in the Faculty of Health Sciences, the School of Clinical Medicine is the largest with nine departments and about 40 divisions, which include sub-specialities. The School trains undergraduate and postgraduate students across a number of teaching platforms, including Chris Hani Baragwanath Hospital, the largest hospital on the Africa continent. Training is also undertaken at the Charlotte Maxeke Johannesburg Academic Hospital, the Helen Joseph Academic Hospital and the Rahima Moosa Hospital as well as 20 additional hospitals and clinics throughout Gauteng. The School prides itself on its high throughput of Bachelor of Medicine andBachelorofSurgerystudents.Ithasthreerecognisedresearchcentres,withtheCentreforRuralHealthandthe Steve Biko Bioethics Centre for Medical Bioethics being pillars of the Faculty’s social accountability stance, addressingmatters of accesstohealthcare forall SouthAfricans.

The School of Public Health enjoys an exceptional national and international reputation in teaching, research, academicserviceand partnerships.

Full-timeacademicsintheSchoolaredrawnfromdifferentdisciplinarybackgroundsthatrangefromthesocialtothe bio-medical sciences, enhancing multi-disciplinary approaches essential for public health. The School’s academic activities are also supported by more than 100 honorary staff members The School has an impressive research recordand hoststwo MRC researchunits, the AgincourtRuralPublic Health and HealthTransitions ResearchUnit (Agincourt) and the Centre for Health Policy (CHP), both of which are internationally renowned with a long track recordofsupportingtransformationinitiativestoimprovepopulationhealthandtheperformanceofthehealthsector. PRICELESS SA (Priority Cost Effective Lessons for Systems Strengthening South Africa) has produced translational researchdirectlyimpacting health policy inthe salt and sugar areas inSouthAfrica

The School of Therapeutic Sciences provides high-quality professional education for pharmacists, nurses, occupational therapists and physiotherapists who continue to make significant contributions to the national health sector by rendering professional services. With a focus on health and wellness, and exercise rehabilitation the School also prepares individuals for careers in biokinetics, exercise science and sports medicine. As a significant contributor to research excellence and output at the University, the School continues to produce meaningful research that serves communities, such as through its involvement with the Wits Research Institute for Malaria whichprovidesanenvironmenttoenhancegroundbreakingresearchintooneofAfrica’sdeadliestdiseases,andthe Wits Advanced Drug Delivery Platform (WADDP) Research Unit which conducts and delivers innovative drug delivery research solutions such as RapiDiss Wafer Technology. Other research initiatives have contributed to the understanding ofhumanmovement,sportsmedicineandsportseducation.

TheSchool of Pathology provides excellence in pathology in the form of service, teaching and research and contributes to the public health in South Africa through the provision of cost-effective, high-quality diagnostic laboratory services to the public sector. Research departments support diagnostic services and contribute to basic researchintheunderstandingofdiseaseprocesseswhilstalsoallowingforR&Dtyperesearch.TheSchoolteaches at both undergraduate and postgraduate levels. The School is home to a number of highly successful research entities including the Antiviral Gene Therapy Research Unit, the Wits Vaccines and Infectious Diseases Analytics ResearchUnit, and the HIV PathogenesisResearchUnit.

TheSchool of Oral Health Sciences is a leader in dental education on the continent graduating dentists, oral hygienistsandspecialiststomakeasignificantcontributiontotheoralhealthofthecommunity.Trainingisprimarily undertaken at the Wits Dental Hospital, located within the Charlotte Maxeke Johannesburg Academic Hospital Primary dental care is provided comprehensively by the undergraduate students of the School, who are under the closesupervisionofexperiencedfacultymembers.TheSchoolalsosupportsextensiveoralhealthcareservicesto distant communities, through initiatives such as The Transnet-Phelophepa Health Care Train, hosted by the TransnetFoundationandviaMobileDentalUnits.

TheSchoolofPhysiology isthelargestentityteachingphysiologyinSouth Africa,andprobablyonthecontinent. It plays a significant role in the training of physiologists; some of its graduates hold high-profile and prestigious appointments in South Africa and throughout the world. Indeed, its graduates can be found as academic staff in many universities teaching physiology in South Africa and overseas. The School is well known locally and internationally for the outstanding quality of its teaching and research and includes top-rated scientists as well as manyexpertsrenownedworldwideintheirfields.EveryyeartheSchoolisproudtobe“home”toundergraduateand postgraduatestudentsof bothhumanand animalphysiology.

Theoldest School in the Faculty, the School of Anatomical Sciences undertakes studies in morphological anatomy, structural biology (histology), and biological anthropology. Undergraduate students are instructed on the structureand development ofthe humanbody,inadditionto humanbiologyandcellbiology. Researchactivitiesof the School are broad, covering the fields of Biological Anthropology, Comparative Neurosciences, Adult Neurogenesis, and Reproductive Biology. The recently formed Human Variation and Identification Research Unit (HIRU) offers a professional forensic anthropological and archaeological service of the highest international standard.

EmergencyandFirePlansduringGraduations

1.Intheeventof anemergencyand/orfire:

• The presiding official (Chancellor/Vice-Chancellor/Deputy Vice-Chancellor) will make an announcement requesting guests, graduandsandstaff tokeepcalm andremainseated;

• TheUsherswillassistgueststoproceedtothenearestEmergencyexitsinordertoevacuatetheGreatHall inanorderlyfashion;

• Emergencyexitsignsarevisibleinredaboveallexitdoorssituatedonyourleftandrighthandsidesaswell asthe backoftheHall;

• TheUsherswillassisttheelderly and disabledguests outofthebuilding;

• Theacademicprocessiononstage must exitthroughthebackstagedoor;

• OnceoutsidetheGreatHallallguests,graduandsandstaffmustproceedtothemainassemblypointonthe piazza.

2.Intheeventof a Bomb threat

All bomb threats will be treated as real in order to protect lives and property and the premises will be evacuated immediately.

A MESSAGE TO GRADUATES FROM THE PRESIDENT OF CONVOCATION

Dear Wits Graduate,

There are a few defining moments in life – and it is without doubt that graduation is one of them!

Today, you enter the world as a graduate from one of the top universities on the African continent. You enter into a world filled with many challenges, but a world that is also filled with limitless possibilities. May you meet all the challenges and opportunities that await you with pride, drive, passion, innovation, social-conscience and positive-purpose.

In addition to earning the degree conferred upon you today, you have also earned the right to be associated with a special group of individuals – the Convocation of Wits University. Convocation represents all the degreed graduates of Wits and forms a vital link between the University and the global community in which it operates. Membership to Convocation is free and serves as an official channel, allowing you, the members, to convey to the University management your views about the University. This membership comes with several unique privileges, which include nominating the Chancellor of the University. The Convocation Executive has two members on the Wits Council (the governing body of the University) and maintains other regular contact with the University to ensure the voice of the Convocation is represented at the highest levels of The University.

There are approximately 200 000 Wits alumni worldwide. The distinction of our university is important to the prestige of our collective qualifications. We call upon you to nurture and enhance the value of your degree by promoting Wits’ image, preserving our values, and contributing towards our ongoing development, ensuring that we grow in stature as a globally competitive, proudly South African institution of higher learning. Please engage with us via our numerous social media channels and keep connected with us so you can access career support, receive invitations to events and reunions and have sight of all the latest news about Wits and prominent Witsies: www.wits.ac.za/alumni/updateyourdetails/

I would like to extend a warm welcome to you – you are now a #Witsie4Life!

Convocation is a statutory body that includes all graduates of the University. Convocation is the largest constituency of the University (since the founding of the University in 1922, graduates number over 200 000). Its statutory mandate is to “… discuss and state its opinion upon any matters relating to the University including matters referred to it by the Council” and allows for the views of graduates to be represented at the highest levels of governance of the University.

IHELE THE PROCESSION

IHELE

Words and music by S.B.P. Mnomiya

Anhom

Falalala

Obani labo?

Baphi Ahhom?

Ngibona beza

Beyikazela

Bathwel ‘ongiyane

Bavela kuphi na?

Obani labo?

Ongqondongqondo

Osibakhulu

Yibo labo hhom!

Yini na leyo?

Ihele

Ihele lezingwazi zakithi

Ahhom udwendwe

Ahhom

Udwendwe lwezingqwele zakithi

Nant’ ihele

Longqondongqondo

Nant’ ihele

Losibakhulu

Udwendwe

Udwendwe Iwezingqwele zakithi

THE PROCESSION

Who are those?

Which, Falalala?

I see them coming

Walking with swinging garments

They are wearing head rings

Where do they come from?

Who are those?

They are people with knowledge

They are people in authority

These are the ones

What is that?

It is a procession

A procession of our heroes

It is a procession

A procession of our champions

Here is a procession

Of people of knowledge

Here is a procession

Of people of knowledge

A procession

A procession of our heroes

Ihele is known as the ‘Black’ Gaudeamus Igitur. In song, the writer, Mnomiya uses very poetic language to describe a graduation ceremony. The soloist sings of the ‘strange’ procession of people in long robes and head gear. The choir responds by saying that these people are academics who read profound books of knowledge.

Mnomiya goes on to say that the graduates are an inspiration to all of us, and we will also graduate like them one day. The song goes on to wish the graduates well and it ends with a resounding “Halala” (well done!).

THE UNIVERSITY MACE

Maces were originally weapons of defence, designed to break through armour. In medieval times, bishops carried a mace instead of a sword into battle to enable them to defend themselves in accordance with the canonical rule that forbade a priest to shed blood. In time, the mace has come to be regarded as a symbol of delegated authority vested in a person or an institution. At this University, it is a symbol of the authority vested in the Chancellor and a reminder of the mandate given by the legislature of this country to the University to grant degrees.

The University mace is the work of the Edinburgh designer, silversmith and engraver, William Kirk, who designed and made the mace of the University of Stirling and of other institutions. It is silver-and gold-plated, is 1070 millimetres long and 180 millimetres broad and weighs seven kilograms. The heraldic devices used in the decoration reflect the character of this University as an institution of learning, set in a mining centre within the Republic of South Africa.

The head of the mace with its spreading vertical blades is symbolic of the horns of a springbok. The central vertical spike is representative of a rock drill on the mine, and the amber stone set in the head is intended as a tribute to a past Chancellor through its association with his name, Bernstein, which in German means amber stone. The heavy quality of the head is consistent with the traditional concept of the mace as a weapon of defence. The collar repeats the shape of the head. It consists of eight cogs which symbolise the cog-wheel in the University coat of arms and represents mining and industry. The shaft is octagonal and divided into three sections. The coat of arms of the University is placed on the shaft under the collar. Below this the words Universitas Witwatersrandensis Johannesburgi: are inscribed, followed by the date in Roman numerals – MCMLXXVI (1977) – which signifies the year of the dedication of the mace.

The mace is a symbolic portrayal of this University, this city, the Witwatersrand and the Republic of South Africa. It is a constant reminder to members of Council and Senate to uphold at all times the rights, powers and privileges of the University and its governing bodies.

ACADEMIC DRESS

The academic dress of this University is patterned on that of the Universities of Oxford and Cambridge, with modifications based on the model of the University of London and certain individual features, particularly in the costumes of office bearers and the hoods of degreesof bachelor and master.

Dress for Office Bearers

• The Chancellor wears a scarlet silk gown with a broad facing of black velvet down each side, embroidered in gold and a black velvet cap with gold cord and tassels.

• The Vice-Chancellor and Principal wears a blue silk gown with a broad facing of gold silk down each side, embroidered in blue, the sleeves being lined with gold silk. The cap is of the same design as that of the Chancellor.

• The Chairman of Council wears a black silk gown with a broad facing of red velvet down each side and around the neck, the sleeves being lined with gold silk. The cap is of the same design as that of the Chancellor.

• The academic dress of the Deputy Vice-Chancellors and the Executive Directors is the same as that of the Vice-Chancellor and Principal, except that the colour of the facing and sleeves of the gown and of the cord and tassels of the cap is silver-grey.

• The gown of the President of Convocation is of blue silk, with a broad facing of gold silk down each side, the sleeves being lined with white silk. The cap is the same as that of the Chancellor, but with a blue cord and tassels.

• The Registrar wears a black silk gown with a broad facing of blue silk down each side, bordered with gold braid. The cap is the same as that of the President of Convocation.

• A member of Council wears a black silk gown with a broad facing of gold silk. The cap is the same as that of the Chancellor.

• The gown of the President of the Students’ Representative Council is black with a broad facing of blue satin.

Graduands’ Gowns

• The gowns for all degrees of bachelor and master of the University are black, of the same pattern as the gown for a Master of Arts at the University of Oxford.

• The gown for the degree of Doctor of Philosophy is scarlet, after the University of London pattern.

• The gown for a senior doctorate is the same as that for the PhD, but with a gold satin facing on each side of the gown and with the sleeve button and cord in gold.

The Academic Hood

The academic hood is the principal feature of the costume for holders of our degrees of bachelor and master. The hood for the PhD is standard, regardless of the Faculty in which the degree was obtained. It is scarlet silk, lined with white silk.

Degree Colours

The hoods reflect the colour or colours of a particular degree or associated degrees.

DISTINCTLY WITS

As a 100-year-old public university in South Africa, Wits is proud of its record of achievement as a significant contributor to our society. We contribute people to society that are training in their chosen field that are engaged and able to tackle problems using evidence-based solutions. We also contribute knowledge that has a positive impact on the quality of life. Wits for Good.

Wits is a world-class research university based on our intellectual excellence, international competitiveness, and commitment to social justice; all of which have a measurable impact.

What makes Wits distinct? Here are a few of many differentiators:

• An international perspective that helps us maintain high standards in teaching and learning and research while not distracting us from our place in Johannesburg, South Africa, and Africa. 60% out our 2021 publications included international collaborators.

• An intellectual hub of Africa, a founding member of the African Research University Alliance. In 2021 Wits published 167 articles with Namibia, 220 with Botswana, 326 with Zimbabwe and 137 with Mozambique.

• An active and engaged community leader that takes a stand on social issues and is fully committed to the advancement of the public good.

• A growing contribution to the body of knowledge through peer reviewed academic publications: 4 400 in 2021 and an average growth rate of 500 per year over the last five years.

• Knowledge contribution that is above global quality averages in several fields including: clinical and pre-clinical health studies (76% above global norms); arts and humanities (58% above global norms); life sciences (36% above global norms); physical sciences (12% above global norms).

• Wits is particularly associated with the study of the fields of virology, particle physics and the Higgs Boson, malaria, archaeology, paleontology, paleoanthropology, violence, local and regional politics, geochemistry, rock mechanics, deep mining, forensic anthropology, climate change, migration, social justice, and many more.

• Proud of the four Nobel laureates and the 98 Rhodes Scholars.

• Proud of our current 40 000 students of whom 16 000 (40%) are undertaking postgraduate studies and learning to make their own unique contributions to the global knowledge base.

• Proud of our 200 000 graduates. More than 90% of Wits graduates obtain permanent employment within 12 months of graduation.

• Proud of its ability to raise external funding to support and drive its research efforts, with contributions exceeding R 2 billion per annum.

Turn static files into dynamic content formats.

Create a flipbook
Issuu converts static files into: digital portfolios, online yearbooks, online catalogs, digital photo albums and more. Sign up and create your flipbook.
Graduation - 10 July 2024 - 09:30 by witsmarketing - Issuu