Page 1

COMMERCIAL & DOMESTIC

APRIL 2018

THE NORTH’S FAVOURITE FREE WEE MAG

SpotLIGHT

WINDOW CLEANING

ELGIN, LOSSIE & DISTRICT

up to 80 ft

ROOF / GUTTER DRIVEWAY PATIO SOFFIT / FASCIA & SOLAR PANEL CLEANING

Telephone

07899 013890 zakfoster@hotmail.com

ELS Stoves March 18.pdf

1

08/02/2018

Regular & Reliable No Streaks - Guaranteed!

13:03

Buckie Furniture Front Horizontal April 18.pdf

1

09/03/2018

11:30

*SEE ADVERT INSIDE

45-49 West Church St, Buckie AB56 1BP Tel: (01542) 832653 www.buckiefurniture.co.uk


CALL 01343 810 400 We are looking for self-employed

HAIRDRESSERS & NAIL TECHNICIANS Facebook: @salonredlossiemouth 29a Queen Street, Lossiemouth IV31 6PR

MICRODERMABRASION The non-surgical approach to complete skin rejuvenation for: Stretch Marks Fine Lines & Wrinkles Acne & Acne Scarring Dull, Tired, Dehydrated Skin Open Pores & Black Heads Sun Damage & Pigmentation

£5 VOUCHER MICRODERMABRASION

Redeemable in salon during April 2018

01343 810 400

*terms & conditions apply


DW JOINERY & BUILDING CONTRACTORS s NEW BUILDS s EXTENSIONS s RENOVATIONS s LOFT CONVERSIONS s KITCHENS s uPVC WINDOWS, DOORS & CLADDING s ALL INTERNAL FINISHINGS FULL PACKAGES FROM CONCEPTION TO COMPLETION

ALL TRADES SUPPLIED EWAN 07969 909063 JAMES 07840 141782 Party Perfections QP April 18.pdf dwjoiners@outlook.com

Wedding Invite We have beautiful outfits to suit Mother of bride / Groom or Guest Fabulous fascinators Evening appointments on request to fit into busy lives Spring / Summer collections arriving daily Pitgaveny Quay, The Marina, Lossiemouth.

Spring/Summer Opening Times: Mon - Sun DPSP

www.myclothesline.co.uk 1

PARTY PERFECTION Make a special day more special Balloon displays and party hire delivered to your door We can create unique balloons for whatever the occasion just for you Stunning baby showers and birthday packages for adults & children

01/03/2018

12:45

Alicia Moxon Jan 18.pdf 1 20/11/2017 P\#P\FORWKHVOLQHFRXN‡

CANINE BEHAVIOURAL ADVISER AND TRAINER ALICIA MOXON Diploma In Canine Behavioural and Psychology

DO YOU NEED HELP WITH YOUR DOG’S BEHAVIOURAL ISSUES SUCH AS…. ‡(XCESSIVE BARKING‡)EARFULNESS ‡$GGRESSION ‡'EAFNESS WITH OLD AGE OR BORN DEAF AND NEEDS TRAINING ‡3ULLING ON THE LEAD‡(XCESSIVE LICKING ‡5ECALL‡:EIGHT ‡6EPARATION ANXIETY

O

www.party-perfection.co.uk

R DO YOU JUST WANT TO: FEEL MORE CONFIDENT WITH YOUR DOG GET A DOG BUT NOT SURE ON WHAT BREED FOR YOUR HOME AND LIFE STYLE RE-HOME A RESCUE DOG SUCCESSFULLY.

07927634202

TEL: 07708108225

09:0


SpotLIGHTon .co.uk

What’s on, Clubs, Eating out, Trades Listings and much more...

Clubs and Societies BELLES ON BIKES MORAY Ladies leisure cycling club – social rides, paced to the slowest cyclist on the day, including a café stop. Bike rides on Sundays at 10am from various meeting points. Find us on Facebook or email bellesonbikesmoray@gmail.com for more info.

BIRNIE INDOOR BOWLING CLUB Mon & Thurs, 7pm. Come & play on our excellent carpets & enjoy good company. Call Charles Stewart on 01343 543307 BURGHEAD COASTAL ROWING CLUB Join us for fitness, fresh air & good companionship as part of a team rowing a 23 feet long skiff. Social & competition opportunities at regattas. See Facebook page for details Call Norman Millar on 01343 830928 or email at dusty.bcrc@talktalk.net

CONTACT THE ELDERLY Organises free monthly Sunday afternoon tea parties for socially isolated older people. Call

Sample one-off advertising rates (colour advert)

Box Big box ¼ page ½ page Full page

£51 £81 £133 £231 £441

Enhanced listings in What’s On pages starting from £30

Publisher:

Winterburn Media Ltd Comraich Woodside Farm Kinloss, IV36 3UA (01309) 690063

All material within the SpotLight magazines is subject to formal copyright restrictions and therefore the reproduction of any listings, editorial, advertiser artwork or any other content, without the publisherʼs prior consent, will be considered a breach of copyright.

page 4 - April 2018

Denise Robson on 01542 285010 or email at denise.robson@contact-theelderly.org.uk

DALLAS INDOOR BOWLING CLUB Wed & Sun, 7.15pm - 9.30pm, the Hall. New & old members most welcome. Call Whitey Fraser on 01343 890301

ELGIN AMATEUR ATHLETICS CLUB Tues & Thurs, 6.30pm - 8pm, Morriston Playing Field (Apr Oct) & Bishopmill Primary Gym (Oct - Mar). Coaching in running, jumps, throws, field & track athletics. Ages 9 + Membership fee + £1 per session. Please come & try. Call Violet Beattie on 01343 551021 or email at info.elginaac@gmail.com

ELGIN & DISTRICT BRANCH U3A Learning for the fun of it, see our Website www.u3a-Elgin.org.uk for further details. Membership is just is £15 & runs from 31/3 for 12 months. Try for free, meet new friends. Call the Membership Secretary on 07977 042258 or email at membershipsecretary@ u3a-elgin.org.uk

ELGIN DARBY & JOAN CLUB Tues (Oct - May), 2pm - 4pm for a sociable afternoon with entertainment or bingo for over 60’s. Elgin Community Centre. Call Moira Webb on 01343 541001

ELGIN JOG SCOTLAND Thurs, 6pm, Elgin Leisure Centre Jog Scotland is a recreational running group. In Elgin we are very much a social running group. For info email karen.gerrie@hotmail.co.uk

FOCHABERS OVER 60S LUNCH CLUB Thurs, 12pm, Bellie Church Hall, Fochabers. Enjoy a homecooked two-course lunch with tea/coffee & biscuits for £3. Call 01343 821300 or 01343 542862.

HARVEST CENTRE MAH JONG CLUB (AMERICAN RULES) 1st & 3rd Thurs of the month (Sept - Jun), 11am - 1pm, Harvest Centre, Elgin (next door to Yeadon’s bookshop). £3. For further Info email hce.roombookings@gmail.com www.spanglefish.com/ harvestcentremahjongclub

HELGIN ROLLER DERBY Fast-paced contact sport played on roller skates. Beginners Skating sessions Saturdays 11am – 1pm. Open to all aged 16+ with hire kit available. Find us on Facebook or email info@helginrollerderby.com Highland Gliding Club Sat & Sun all year & Wed evening (May - Oct), Easterton Airfield, Birnie. Gliding & soaring at all levels, beginner upwards, Call Anne Burgess on 01343 820834. www.highglide.co.uk

LOSSIEMOUTH SENIOR CITZENS FRIDAY WALKING GROUP Fri. We accept members from nearby Hopeman, Duffus & Cummingston as well as being Lossiemouth based. New members & Volunteer minibus drivers very welcome. Call Angie on 01343 835707

LOSSIEMOUTH TENNIS CLUB Club sessions every Sat, Juniors 1.30pm - 2.30pm; Adults 2.30pm - 3pm, Marine Park,

tel: 01309 690063

MONDAY DANCE CLUB Mon, 1.30pm - 4pm, Supper Room, Elgin Town Hall. Sequence, latin & ballroom dancing. £2. Tea & cakes available.

MORAY AUTISM For anyone on the autistic spectrum, family members, carers or professionals working with those who have autism. Find out about events happening within Moray for people with autism & their families. Call 07785 697058 or email at aimee.killa@moray.gov.uk

JOG SCOTLAND ELGIN Thurs, 6pm, Elgin Library during winter months & Cricket Pavilion during summer months. Beginners to advanced joggers welcome. New members please arrive at 5.45pm. Email at jselgin@walkjogrunmoray.org.uk

LOSSIE HAE A NEWS! 3rd Tues of month, 1.30pm 3pm, Hersbruck Court Sheltered Housing, Ramsay Lane, Lossiemouth. Have a cuppa & a news, quizzes, dominoes, bingo, crafts, card games, gentle exercises, etc. Call Sharon FInlay (Community Activities Organiser) on 07584 408209 or email sfinlay@alzscot.org

Lossiemouth. Coaching sessions & summer camps throughout July & Aug. Email marineparktennis@gmail.com www.marineparklossie.org.uk/ tennis-club/ or see Facebook

MORAY CARERS CHOIR Mon, 11am - 1pm, St Giles church hall, Elgin. £4 per session. For carers who love to sing. Call01542 850441 or at moraycarerschoir@gmail.com

MORAY OSTOMATES 1st Sat of month until Dec, 1pm 3pm, Moray Resource Centre, Elgin. Come along for a cup of tea & a chat. Call Meggie or Kathleen on 01343 552449 or 01343 821628

THE ELGIN STROKE FRIENDS (CHEST HEART & STROKE SCOTLAND) Fri, 10am - 12.30pm, Elgin & Forres Free Church. Offers support, friendship, fun & outings to people who are living with the effects of stroke & their carers Call Anne Toye (Chest Heart & Stroke Scotland) on 07919 023449

PLEASE NOTE Details of Clubs & Societies are published on a rotational basis. If you would like your details to be included in this section please email linda@winterburnmedia.co.uk

admin@winterburnmedia.co.uk


Here at SpotLight, we are constantly looking at providing both useful and interesting information for our readers and following a number of suggestions we are, this month, introducing a regular new book feature - The Monthly Book Club. For the feature we have tried to pick a good cross section of book types which are mostly new releases (we are fortunate to have an ex librarian on our staff to help us with the selections!). Most of the books listed will be available in print and on Kindle.

PUBLISHER ..............David Nelmes ADVERTISING ..............Susan Innes ADVERTISING....Rachel Engelmann PRODUCTION .........Linda J Donald ART & DESIGN ..............Chris Kemp ACCOUNTS ..................Alan Radley

May Issue Deadlines

Editorial - Friday 30/03/18 1 06/03/2018 Advertising - Wednesday 04/04/18

Mccalls April 18.pdf

10:42

   ‘‘ͷŠ‹”‡‘—–ϐ‹–•ƒ† ™‡™‹ŽŽ‰‹˜‡›‘— –Š‡‰”‘‘•‘—–ϐ‹–ȋ–Š‡͸–ŠȌ  –‡”•Ƭ…‘†‹–‹‘•ƒ’’Ž›Ǥ‘–ƒ˜ƒ‹Žƒ„Ž‡‹…‘Œ—…–‹‘™‹–Šƒ›‘–Š‡”‘ˆˆ‡”Ǥ

ͷͶ‘—–Š–”‡‡–ǡŽ‰‹ Ͳͳ͵Ͷ͵ͷͶͲͷͻͲ ™™™Ǥ……ƒŽŽ•Ǥ…‘Ǥ—


Words by the Wayside “...a friend of... sinners!” (Luke 7:34)

Reader, The Lord Jesus loves the sinner but hates the sin. The Saviour is willing and able to save, but the sinner must acknowledge their sin. It is through repentance toward God and faith in The Lord Jesus Christ that men and women are cleansed from their sins and justified in God’s sight. Christ Jesus came into the world to save sinners, Christ died for the ungodly, there is none righteous, no, not one. Your sins, which are many, He alone can take away. munro masonry may 17.qxp Registered Scottish10/04/2017 charity SC041290 09:46 Page 1

W W

www.wordsbythewayside.co.uk

ScotEng April 18.pdf

1

20/02/2018

Domestic, Commercial & Industrial Garage Doors Supplied & Installed

01309 671477 Garage Door Automation Stone carving Masonry repairs & replacements Masonry building Lime pointing Lime harling / lime washing Lime plastering

07510 163820 email: munromasonry@outlook.com

www.munromasonry.co.uk

Car Ports and Patio Roofs Security Shutters Driveway Gates (Manual or Automatic) Garage Door Repairs Doors supplied to trade customers

Scotengineering, Unit 3, Waterford Circle, Forres, Moray Email: info@scotengineering.co.uk Web: www.scotengineering.co.uk

10:19


COUNSELLING Relationship & Addiction

TANDOORI RESTAURANT ELGIN’S PREMIER

INDIAN RESTAURANT Est. since 1987 3 COURSE BUSINESS LUNCH From £4.95 - £10.95 Mon - Sat 12pm - 2pm

BUFFET NIGHT EVERY MONDAY Eat as much as you like £14.95

TAKEAWAY SERVICE ALSO AVAILABLE Free Delivery within Elgin on orders over £25 10% Discount on collected meals only Whatever the occasion choose the Qismat Tandoori for freshly cooked food and a personal friendly service. Outside catering also available For bookings telephone: 01343 541461 / 540785 202-204 High St, Elgin IV30 1BA www.qismat.restaurant info@qismat.restaurant 1 07/03/2018 Carlton Clubs April 18.pdf FB: qismatelgin TW: @qismatelgin

Recommended on:

Helping you to explore and manage whatever is happening in your life ‡5HODWLRQVKLS&RXQVHOOLQJ ‡0DUULDJHRU&RXSOH&RXQVHOOLQJ ‡6DPH6H[&RXSOH&RXQVHOOLQJ ‡ $GGLFWLRQ&RXQVHOOLQJ ‡ Abuse and TUDXPD&RXQVHOOLQJ ‡%HUHDYHPHQW&RXQVHOOLQJ ‡'HSUHVVLRQDQG¬6WUHVV

For further details contact RAMONA at

on:

07523 857 957 14:31

ramona@rhcounselling.co.uk rhcounselling.co.uk


SpotLIGHTon .co.uk

What’s on, Clubs, Eating out, Trades Listings and much more...

Pastoral Leer & Church Meetings ‘It is darkest just before the dawn.’

How true this is in life, especially at Easter. The dreadful events of Good Friday can be summed up quite simply in Jesus’ words “My God, my God, why did you forsake me?” Mk 15:34 It is most certainly the ‘Dark Night of the Soul’. Our modern society often leaves people bereft, looking for meaning, and facing a future that appears to be the blackest of pits. Meaningless. From which there appears to be no return. For followers of ‘The Way’ (those who live and walk in the footsteps of Jesus) we know that the Crucifixion of God’s Son (the anointed one) is just a lens that all must pass through in order to achieve God’s fullness; Joy! Life in Christ! Unity with God! We become ‘Divine’… This is what Easter is all about. New life! People often talk about having Faith, or more likely, not having faith. A better word would be TRUST. To trust in God is to hand yourself completely over to the One who loves you. Who will be there for you, and will never let you down. This may seem ridiculous in the

dark light of Good Friday or after an appalling experience in life, but the reality is that you are just passing (with Jesus) through a very dark tunnel – it may appear never ending, but keep travelling, keep trusting, ‘All Will Be Well’. At our communion services each week we say (during the Eucharistic Prayer) “do this in remembrance of me”. Lk 22:19;1 Cor 11:24 It is Jesus’ last commandment to you and me. It reminds us how Jesus lived and acted throughout His life: worshipping God and loving His neighbour as Himself. He always had time for everyone, and ALL were loved equally. Some people in society appear to respond positively to a quotation of Boetcker’s (an American preacher born in the 19th Century) ‘you cannot help men permanently by doing for them what they can and should do for themselves’. Sadly, life is not so kind to some, as it is to others, we all need help – some permanently! Jesus taught us to love in this way: “Give to everyone who asks…” Lk 6: 30 Surely this is the meaning of “How blissful the

Alves Church First Sunday every month 11.30am. Tel: 01309 690474. Birnie & Pluscarden Church Sunday worship at 11am alternating weekly between Birnie & Pluscarden. All welcome. Burghead Free Church Sunday service at 11am with Sunday school and crèche. Evening service 6pm. Midweek meeting Wednesday at 7pm. Contact Peter Turnbull 07841 777482. Visit www.burgheadfreechurch.org Elgin and Forres Free Church of Scotland Sunday Service, Sunday school, and crèche 11am. Evening service 6pm. Midweek meeting Wednesday 7.30pm. Contact Colin Morison: 01343 542196. Elgin Baptist Church Sunday worship 11am includes crèche, preSunday school, Sunday school, and Bible class. Evenings 6pm. Youth fellowship 7.30pm. Tel: 01343 547743. Elgin Church of God Pinetree Crescent, Elgin. Sunday Worship 10:30am followed by refreshments in the church cafe. All welcome. Elgin City Church Harvest Centre Elgin (formerly St Giles Church Hall), Greyfriars Street. Sundays 10.30am. Childrens’ church and crèche available. Tel: 01343 543624. Elgin Community Church of God) Sunday Service in "The Gallery” at Elgin Library 10.30am with Sunday School. All midweek meetings, including Toddler Group (Tues 10-11.30am), at Riverside Gospel Hall, Bridge St, Elgin. www.elginccog.org Elgin High Church Sunday service 11am. Contact Parish Asst. Paula Baker: 01542 832662. Gordon Chapel Scottish Episcopal Church, Fochabers Sunday Family Eucharist 10am. 1st Wednesday of month Communion

page 8 - April 2018

destitute, abject in spirit, for theirs is the kingdom of heaven.” Matt 5: 3 This is the example of love demonstrated by Jesus in His Passion and Resurrection. All is summed up in the words of the Eucharistic Prayer “Do this in remembrance of me.” The dark tunnel of Lent and Holy Week are now over. They teach us that even in the darkest of times, there is light at the end of the tunnel, and a new beginning (probably not one we have not planned). We may bear scars from our experience, but Jesus has been with us all the time. We need to TRUST in God and keep travelling. For ‘all will be well’. There will be JOY! again!

May the Risen Lord bless you greatly with Joy this Eastertide. Christopher Ketley Rector of Holy Trinity, Elgin & St. Margaret’s, Lossiemouth A Scottish Episcopal Church (A member of the Anglican Communion)

2.30pm. 2nd Sunday of month Evensong 6.30pm. Tel: 01542 882782. www.gordonchapelfochabers.uk Holy Trinity Elgin. Sundays 8am: Holy Communion. 11am: Family Eucharist. 6.30pm: evening service. Tel: 01343 547505. Hopeman Baptist Church Sundays 11am and 6pm. Living Waters Fellowship Wednesdays 7pm: Road to Recovery - for alcholics, addicts and the homeless. Sundays 12.30pm: preachin’, prayin’ and singin’ followed by lunch. Sundays 12.30pm and Wednesdays 7pm: Truck Stop Ministries - for truck drivers & bikers. New Elgin & Ashgrove Hall, King Street, Elgin, IV30 6BN. Tel: 07730 256543. Website: www.livingwatersfellowship.co.uk Lossiemouth Baptist Church Sundays 9:15am, 11am (and junior church) and 6pm. Thursdays 6.15pm - 8pm: kids church (P4-P7). Contact Rev. Rae Mackenzie: 01343 812062. Website: www.lossiebaptist.org Lossiemouth Gospel Hall Sunday club12.30pm (Sept - May). Gospel meeting 6.30pm. Tel: 01343 812211. For details visit www.lossiemouthgospelhall.org.uk Lossiemouth United Free Church of Scotland Sundays 11am and 6pm including Sunday school. Website: www.lossieufchurch.org Moray Presbytery www.moraypresbytery.org.uk

Listed A - L and regularly rotated. If you are a member of a church not listed and would like to be considered for inclusion or to amend existing details, please email linda@winterburnmedia.co.uk

tel: 01309 690063

admin@winterburnmedia.co.uk


chaos

EST 2000

hair studio

CCTV inspection guarantees quality. Triple filtered vacuum eliminates dust. offers the very best cleaning. Power Sweeping Sweep

Firewood Available

Opening Hours: Wednesday Thursday Friday Saturday

9am - 7pm 9am - 5.30pm 9am - 5.30pm 9am - 3.30pm

07766 164301 www.allmorayschimneys.com

))) ! % *%&"$

! &

Tel: 01343 569300 Email: chaoshairstudio@hotmail.com &

Gift Vouchers Available 6 Academy Street, Elgin1 17.pdf

Lossie Tilers Mar

14/03/2017

$")

' '%

!

%% "'$ *% ) "$ # "# "( ! " ' * ( !& & ! !%' & '! &% "! "$& & $ %&"$ 12:30 $ ( &"$ (

EPDM Flat RooĮng | PVC Fascia & GuƩering | Box ProĮle Metal RooĮng Roof Repairs | Maintenance | Joinery

Contact Robert of Lossie Tilers T 01343 815107 M 07837 821761 E info@lossietilers.co.uk www.morayepdm.co.uk The Ultimate Flat Roofing System


Westwood, Littlemill, Nairn

Tel: 01667 454 536 gillian@westwoodcattery.co.uk westwoodcattery.co.uk

Carpets, Rugs & Upholstery Cleaned Are your carpets looking sad & depressed, spotty or downtrodden? If so, let me clean them for you.

Opening Times - Saturday and Sunday 10 am - 12 noon Monday, Wednesday, Thursday & Friday 10 am - 12 noon and 5 pm - 6 pm, Tuesday - Closed all day

Local, reliable, high quality service Call today for a FREE Survey and Quotation

Listed in the Cattery guide as one of the top 100 catteries in the UK

01343 835383 or 07415 258342 JG Fencing Jan 18.pdf

1 22/11/2017 www.amcleaners.co.uk

14:36

FAB

GUIDI PLUMBING 27/01/2017 DAVIDand Moray the Highlands onlyMar17.pdf F.A.B registered1cattery

DAVID GUIDI JOHN GAMMIE ‘YOUR FORRES FENCER’

BOILER CHANGES GAS & OIL

ALL TYPES OF GARDEN FENCES ERECTED AND REPAIRED

SOLID FUEL CENTRAL HEATING

NO MONEY EXCHANGED UNTIL 100% HAPPY WITH WORK

POWER FLUSHING

BATHROOMS NEW BUILDS

DISTANCE NO OBJECT

GUTTERS & DRAINS

07977 598618

ALL PLUMBING & HEATING WORK UNDERTAKEN

01309 271012

CALLEasymove NOWApril FOR FREE 18.pdf 1 QUOTE 28/02/2018

12:23

EASYMOVE REMOVALS EAS EA YM SY OV MO VEE R E M O V A L S

Call us Today for your FREE Quote

Efficient, Reliable & Friendly A Local Service from a Company delivering nationwide

07912 424512 OR 01343 559594

H: 01343 810765 M: 07751 821559 McGregor Jan17.pdf 1 14/12/2016 13:50 E: Rdavidguidi@hotmail.com

R McGregor M O N U M E N TA L E N G R AV E R Additional inscriptions, Regilding, Raised lead lettering, Cleaning of headstones also re-fixing done in any cemetery Phone:01309671982 ‡ Mobile:07740950580 42 Randolph Lane Forres


FINA LIST TE

AM OF THE YE AR

WITH BUSINE MORAY SS W O MEN


SpotLIGHTon .co.uk

What’s on, Clubs, Eating out, Trades Listings and much more...

Parliament Blog & Tide Times As the MP for Moray, defence issues are always high up my agenda given we are home to both Kinloss Barracks and RAF Lossiemouth. Both bases play an important role in Moray life and the local economy. I also know the welcome our service men and women and their families receive here is greatly appreciated by all. While the wintry weather resulted in the postponement of the Secretary of State for Defence cutting the first sod in the groundwork’s for the arrival of the new P8 Poseidon aircraft, these works continue. This represents significant investment by the UK Government and Boeing. RAF Lossiemouth is a major strategic base for our military and the investment we will see both on the camp and in the local area over the next few years will no doubt benefit local businesses and our communities. Douglas Ross MP LOW TIDE TIMES FOR LOSSIEMOUTH IN

APRIL

Walking on the beach should be possible 2 hours either side of these times 1 2 3 4 5 6 7

SU M TU W TH F SA

AM 07:12 07:49 08:23 08:58 09:34 10:13 11:00

page 12 - April 2018

PM 19:37 20:13 20:47 21:21 21:56 22:37 23:28

This year marks 100 years since some women got the vote. Nicola Sturgeon (our female first Minister who appointed a gender balanced cabinet) led a debate in Holyrood to mark the occasion. A lot has changed in 100 years, and for that I am truly thankful. But while we have made some bold changes already, let’s not be complacent, or take progress for granted. With that in mind, I am glad to see the theme of this year’s International Women’s Day is #PressforProgress. We need concerted, deliberate action if we are going to achieve gender equality. Research shows that gender parity is over 200 years away. Women should not have to wait this long for equality, we deserve it now. Maree Todd MSP

8 9 10 11 12 13 14 15 16 17 18 19

SU M TU W TH F SA SU M TU W TH

AM 00:48 02:25 03:39 04:28 05:06 05:41 06:16 06:50 07:27 08:04 08:43

tel: 01309 690063

PM

12:07 13:45 15:12 16:08 16:49 17:25 18:00 18:34 19:10 19:47 20:25 21:04

Many of us will have watched Blue Planet and seen the devastating impact of plastic in our seas. With straws, carrier bags and other plastic waste ending up in the ocean, suffocating wildlife and polluting our beautiful coastline. Undoubtedly, plastic straws are contributing to the increase in plastic litter in our seas, and so much of the litter we find on our beaches is plastic based, as I’ve seen first-hand when I’ve joined the Spey Bay Dolphin Centre on some of their beach cleans. That litter on our shores and in our seas is a result of our behaviour, with all the single use plastic we throw away every day. It’s abundantly clear the damage that plastics are causing to our planet and it is vital that we do everything we can to reduce the volume of plastic that we use and discard. So I am hugely supportive of the campaign to ban single use plastic straws and am pleased that the Scottish Government has committed to a ban in Scotland. Richard Lochhead MSP

20 21 22 23 24 25 26 27 28 29 30

F SA SU M TU W TH F SA SU M

AM 09:27 10:18 11:22 01:27 02:51 03:57 04:49 05:33 06:13 06:50

PM 21:49 22:43 23:55 12:46 14:14 15:28 16:26 17:14 17:57 18:35 19:11

admin@winterburnmedia.co.uk


SEASONAL GARDEN FURNITURE Decora caters to all your garden needs

DECORA adore your home www.diydecora.com

NOW IN STOCK!

Lossiebank Mills, Bridge Street, Elgin IV30 4DE

Tel:

01343 542 218

Open: Mon - Fri 0900 -1900. Sat 0900 -1800, Sun 1000 -1700

* Decora guarantee the lowest price on all our kitchen and bathroom ranges or we will match any difference, unlike any of our competitors. So you’re always going to D.I.Y for less.


SUPPORTING YOUR LOCAL COMMUNITY FROM OUR INVERNESS AND HUNTLY DEPOTS

Home Heating Oil Marine Gas Oil Tractor Diesel Commercial Fuels Oil Storage Tanks CallBuckie us for a free quote on 0800 224224 Furniture HP April 18.pdf 1 08/03/2018 www.highlandfuels.co.uk

11:13

FANTASTIC DEALS ON

CHESTS & DRAWERS -ÊUÊ7, ," -ÊUÊ ,7 ,-ÊUÊ/  -ÊÊUÊÊ-"-ÊUÊ ,* /-ÊUÊ  -ÊUÊ1 Ê", °°° WAS £120 NOW

£60

3 Drawer Chest*

WAS £220 NOW

WAS £299 NOW

WAS £320 NOW

£110

£150

£160

4 Drawer Dresser*

2+2 Drawer Chest*

*Self Assembly - Limited Stock - Subject to Availability

Monday - Saturday 9.30am - 5pm (Closed 1-2pm) Open all day Saturday

Deliver In Your Area

GET YOURS WHILE IN STOCK

Finance Available

45-49 West Church St, Buckie AB56 1BP sTel: (01542) 832653 swww.buckiefurniture.co.uk

4 Drawer Chest*


HOWDENS ELGIN

LEAP INTO SPRING WITH A FANTASTIC NEW KITCHEN TO SUIT ANY BUDGET We understand what it takes to make a great looking kitchen, & importantly one that works every time, every day. Our products are from stock we have trained designers that offer a FREE Planning & Design Service At Howdens its not all about Kitchens, we offer a full range of doors, flooring, skirting & appliances. We will also beat any like for like quote.

FREE PLANNING & DESIGN SERVICE MANY FANTASTIC OFFERS IN STORE

OVER 70 KITCHENS

HOWDENS ELGIN

WOOD FLOORS

LAMINATE FLOORS

VINYL FLOORS

HARDWARE

APPLIANCES

SINKS

DOORS

BATHROOMS

TAPS

STAIRPARTS

QUARTZ

GRANITE

36 Tyock Industrial Estate, Elgin IV30 1XY Tel: 01343 541250 Email: elgin@howdens.com

CALL US NOW

Tel: 01343 541250


SpotLIGHTon .co.uk

What’s on, Clubs, Eating out, Trades Listings and much more...

Useful Information Maundy Thursday Good Friday First Day Of Passover April Fool’s Day Easter Sunday Easter Monday Last Day of Passover Yom HaShoah Isra & Mir’aj

Local & Bank Holidays and Special Days

Thurs 29th Mar 2018 Fri 30th Mar 2018 Sat 31st Mar 2018 Sun 1st Apr 2018 Sun 1st Apr 2018 Mon 2nd Apr 2018 Sat 7th Apr 2018 Wed 11th Apr 2018 Fri 13th Apr 2018

Yom HaAtzmaut Thurs 19th Apr 2018 St George’s Day Mon 23rd Apr 2018 Lag B’Omer Thurs 3rd May 2018 Early May Bank Holiday Mon 7th May 2018 Ascension Day Thurs 10th May 2018 Pentecost Sun 20th May 2018 ANZAC Day Wed 25th April 2018 § Elgin, Lhanbryde & Urquhart ‡ Hopeman, Burghead & Lossiemouth

for 2017/2018 (all dates inclusive) Spring Term Ends Thurs 29th Mar 2018 Spring Holiday Starts Fri 30th Mar 2018 Spring Holiday Ends Fri 13th Apr 2018 Summer Term Starts Mon 16th Apr 2018 Occasional Day Lossie Fri 4th May 2018 April 18.pdf 1 09/03/2018 & Milne’s, Knockomie Fochabers May Day Holiday Mon 7th May 2018

In-Service Day Thurs 17th May 2018 In-Service Day Fri 18th May 2018 Summer Term Ends Fri 29th Jun 2018 Summer Holiday Starts Mon 2nd Jul 2018 for 2018/2019 (all dates inclusive) Summer Holiday Ends Fri 10th Aug 2018 12:00 In-Service Day Mon 13th Aug 2018 Autumn Term Starts Tues 14th Aug 2018

School Term Dates


K McGregor

CARPENTER & JOINER Hairy Bairns Dog Walking Feb 18.pdf

1

09/01

New Builds Kitchens FORRES ‹ KINLOSS ‹ BURGHEAD ‹ LOSSIEMOUTH ‹ ELGIN

Renovations

Hairy Bairns Dog Walking & Pet Services

uPVC Doors Windows Cladding Commercial Work

à ® FULLY INSURED à ® FIRST AID TRAINED à ® SECURITY CHECKED

All trades supplied Free Estimates

Tel: Email: Web:

No Job Too Small

à ® DOG WALKING (30/60 MINS) à ® POP IN PET VISITS à ® PET SITTING

07391 042872

hbpetservices@hotmail.com Forres Tree Services Jan17.pdf 1 hairybairnsdogwalking.weebly.com

14/12/2016

FORRES TREE SERVICES LTD FULLY QUALIFIED AND INSURED

sTree Surveys sTree Removal sTrEE0RUNING

07799 414872 s 01343 818220 AK Cleaning Services Apr 17.pdf 1 kmcgregorjoinery@gmail.com

22/02/2017

s!LL(EDGEWork s3TUMP2EMOVAL s(ArDWOOD&IrEWOOD

01343 890 765

10:12

www.forrestreeserVICESCOMsINFO FORrestreeservices.com

A K Cleaning Elgin ‘For all your cleaning requirements in Moray’

01343 552177 / 07789 811418

Commercial and Contract Cleaning Other Services:

Domestic Cleaning

One-off Cleans

Offices

Laundry

Rental Properties

Holiday Homes

Ovens

Ironing

Carpet Cleaning

Community Halls akcleaningelgin@yahoo.com


Review

NOT JUST ANOTHER ICE-CREAM SHOP Portsoy Ice-cream shop is in the heart of Portsoy Village, Banffshire

W

e heard about this amazing ice-cream shop from a few people so we decided to go check it out for ourselves. When we arrived we noticed that there was a lovely seating area, which was perfect, as the weather was not great outside and so we decided to sit in. We went over to the counter to have a look and noticed the huge variety of ice-creams, hot and cold sauces, lots of different toppings and the amount of different ways you can have your ice-cream. What stood out for me were the waffles, especially the Bubble Waffles. After much thought we decided to have the Sharing Platter which consists of 6 scoops of ice-cream (your own choice), two hot sauces, frozen berries, marshmallows and waffles. The Sharing Platter definitely had more than enough on it for two people with six different ice-creams. We chose Bubblegum, Creme Egg, After Eight, Honeycomb, Vanilla and Raspberry Ripple, underneath which, were the waffles with chocolate sauce. This was accompanied on the side by Salted Caramel hot sauce, Fudge hot sauce, and marshmallows. We also wanted to try the Bubble Waffle which looked amazing – this has a scoop of ice-cream, hot sauce with fudge and marshmallow toppings. The Bubble Waffle was a delight to eat and it was so good I ate most of it. Our visit to the Portsoy Ice-Cream shop was certainly a treat and I will be going again very soon. I now know why people

talk about this ice-cream shop and say it's different from the rest. Both the ice-cream and waffles are home made, the staff are so friendly and very helpful. If you would like to take ice-cream home they offer a selection box which has 16 scoops of your choice, the box can keep the ice-cream perfect for 1.5 hours of travel. The Portsoy Ice-Cream shop does even more offering hot chocolate, coffee, tea and milkshakes. They also cater for birthdays, weddings and lots of other different types of events. There are gifts in the shop and selections of jam, marmalade and chutney. It really is an amazing place to visit and a treat for all the family, I will definitely be recommending the Portsoy Ice-Cream Shop. After your ice-cream there is so much more to explore in Portsoy. Written by: Susan Innes

CONTACT DETAILS 24 Seafield Street, Portsoy, AB45 2QT Tel: 01261 842279 shop@portsoyicecream.co.uk www.portsoyicecream.co.uk


XÌYkÌ ÀkA•ÌHÌ/OkÎÌÌ XÌœÎÌ ÀŠ˜ÄÌ XÌœ•k•AckÌ ØOO‘kÌ:Ay|kÌ œ˜kÄ XÌYkc̑AÎÎkÄ`Ì/•œœÏŠkÄÌA˜cÌ/ˆAkÄÌ XÌœ•k•AckÌ k‘€ŠA˜Ì:Ay|kÄ

Seafield Affordable Luxuries March 24 18.pdf 1

Street, Portsoy, AB45 12/03/2018 15:41 2QT Tel: 01261 842279 UÊshop@portsoyicecream.co.uk UÊwww.portsoyicecream.co.uk

Making your dreams a reality

BATHROOMS

KITCHENS

20% OFF

BATHROOMS

BROCHURE PRICE

KITCHENS

20% OFF BROCHURE PRICE

MORGAN HARRISON, *0F:BGKH:=% ALVES, IV30 8UR

HEATING

20% OFF BROCHURE PRICE

BEDROOMS HEATING FULL PROJECT MANAGEMENT FROM START TO FINISH - FREE PLAN AND DESIGN SERVICE - ALL TRADES AVAILABLE

)*,-,1.)*/+)01*,1212,* INFO@AFFORDABLELUXURIES.CO WWW.AFFORDABLELUXURIES.CO 601299


Roof Wizard ROOF WIZARD ROOFING SERVICES

• •

((B Buuck ckiie) e) L Lttdd •

• •

• • • • •

20YR

UP TO

GUARANTEE

• • • • •

...on Slating ï Tiling ï Fascias Guttering Flat Roof Single Ply & Firestone Rubber ï EPDM Systems ï General property maintenance service Fairtrades and HomePro Guarantee you 100% peace of mind! Chartered surveyor ref on request

ï

Ray Plasterer Feb 18.pdf

1

15/01/2018

Keith Dufftown Railway April 18 2.pdf 09:36 ï ZZZURRIZL]DUGFRXNîHQTXLULHV#URRIZL]DUGFRXN

The Whisky Line Keith & Dufftown Railway Open weekends from Easter to September, plus: Fridays from June to September

Tel: 07790 099473 Ponderosa April 18.pdf

1

09/03/2018

(IGH1UALITY&INISHs&REE.O/BLIGATION1UOTES

There is a full season of events including: Å‚ Easter Bunny Challenge 13:00 Å‚ Spring and Autumn Whisky Festivals

Å‚ 1940s weekend 16th - 17th June Å‚ October Ghost trains

West Beach, Stotfield Rd, Lossiemouth 01343 812056

Å‚ Santa specials in December

Come in from the beach to warm up

‡6RXSV%DFRQ5ROOVDQG6DQGZLFKHV ‡+RPH%DNLQJ See website for more info

‡7DNH$ZD\)RRG$YDLODEOH ‡&DUGSD\PHQWVDFFHSWHG

Garden bedding plants

SOLD HERE

Dogs welcome

Open 7 days per week 10am - 5pm

www.keith-dufftown-railway.co.uk Dufftown Station, Dufftown, Tel: 01340 821181 AB55 4BA

KDRA is a registered charity No SCO46348

We welcome charters and group bookings and have disabled facilities at both stations.

1

0


www.planwell.co.uk

Permaroof ermaroof METAL ROOF SHEETING METAL LA ASTS A LIFETIME!

Supplies BUY DIRECT FROM THE MANUFACTURER MANUFACTURER

Permaroof

BARGAIN PRICE ROOF SHEETING

SHEDS

GARAGES

DIY & FLA FLATT ROOFING

INSUL A ATED TED ROOF SHEETS FROM

ONLY ONL Y

£17.00

+V VA AT A T per square metre

SPECIAL OFFERS ROOF SHEETS FROM ONLY

£7.90

Roofcoat

+ VA VAT per

Square Metre!

Xtra

SIMPLE “BRUSH ON” APPLICATION APPLICATION THIS MONTH’s SPECIAL OFFER 20kg DRUM (1 Coat covers 20 square metres)

£219 ALL MAJOR

CREDIT CARDS ACCEPTED

SAVE SA VE

£40

NOW ONL ONLY Y

£ 1 7 9! per Drum

offer only available while stocks last

CONTACT US TODA CONTACT TODAY Y FOR A GREA GREAT T DEAL

0800

02 88 272

Planwell Roofing Supplies Ltd, “The Roofing Centre”, March Road Industrial Estate, Buckie AB56 4BU Fax: 01542 832182 Email: enquiries@planwell.co.uk


Luxury Residential Homes At Riverview Country oun Park, Forres. Move in today from just ÂŁ74,995

• Two and three bedroom bungalow-style homes • Fully furnished and ready to move in • Live in a friendly park community exclusively for the more mature resident • Home Exchange Welcome – 100% market value • No agents fees or stamp duty to pay -Ń´Ń´|o7-‹=oulou;bm=oul-াomou|o-uu-m]; a show home viewing on

01683 263 781 Or visit www.RiverviewCountryPark.co.uk

Riverview Country Park, Mundole, Near Forres, IV36 2TA

Prices range from ÂŁ74,995 to ÂŁ170,000 !;vb7;mা-Ń´o7];v-Ń´vo-ˆ-bŃ´-0Ń´;-|Ń´;m7;ˆomo†m|u‹-uhġ m;-uŃ´;m;-]Ń´;vġ;u|_v_bu;ġ Ć?Ć“Ć•+


SpotLIGHTon FREE Listings, FREE to View, FREE to upload

1 april - 30 september

Promote your events in the SpotLight ‘What’s On’

You can now go online at www.spotlighton.co.uk Register an account and put your event online and in the magazine - both for free Any events uploaded to the website by the closing date will be automatically printed in the magazine. *May Issue Deadline: Friday 30th March*

Alternatively, you can still Email: linda@winterburnmedia.co.uk or Telephone: 01309 690063

Inclusion of events in What’s On is free. We do not accept submissions for classes, courses or workshops.

Contact venues & organisers first as there may be changes to events.

Rolling Events

highland folk museum: britain's first open air museum 10.30am - 5.30pm (mar - aug) & 11am 4.30pm (sept - oct). highland folk museum, kingussie road, newtonmore. free but donations welcome. how highland people lived & worked from 1700s - 1960s! we have an cafe, gift shop & a fantastic children’s playground. call 01540 673551 or email at highland.folk@highlifehighland.com www.highlifehighland.com/highlandfolkmuseum morayvia tbc, north road, kinloss. adults £5; children £3. history of military aviation in moray. call 01309 691916 or email admin@morayvia.org.uk www.morayvia.org.uk admin@winterburnmedia.co.uk

1 april - 31 october

falconer museum, forres tues - sat, 10am - 5pm & sun, 1pm - 5pm, tolbooth street, forres. free. call 01309 673701 or museums.forres@moray.gov.uk www.falconermuseum.co.uk moray motor museum 11am - 5pm, bridge street, elgin. open every day during season. a superb collection of veteran, vintage, classic cars & motorbikes. call 01343 544933 or email at info@moraymotormuseum.org lossie fisheries & community museum 10am 4.45pm, pitgaveny quay, lossiemouth. an insight into the life & danger of the fishing industry past & present. call 01343 813772

2 april - 31 october

nairn museum mon - fri, 10am - 4.30pm & sat, 10am - 1pm, viewfield house, nairn. free. call 01667 456791. www.nairnmuseum.co.uk

27 aprilPetstay - 12 may April 18.pdf

28 march - 31 october

31 march - 31 october

visitor centre burghead 12pm - 4pm, burghead a former coastguard lookout, the centre covers the history of the area from about 400ad to the present call 01343 835518 nelson tower with panoramic views over the moray firth 2pm - 4pm. exhibitions of local photographs & nelson memorabilia. entry by donation. the red ensign flying from the tower mast signifies that the tower is open! www.forresheritage.org

07/03/2018 08:57 inverness science festival various1events throughout inverness

Earn from £84 to £175p/w looking after dogs in your own home

PetStay ‘Im off to PetStay for my Holidays’

t Meet your carer before you book tExperienced dog carers tAll routines kept tKinder and less stressful for your dogs

tVets recommend PetStay tVery competitive rates tInsured and licensed tA real alternative to kennels

PetStay Highland & Moray www.petstay.net 01463 741267 catriona@petstay.net

tel: 01309 690063

April 2018 - page 23


SpotLIGHT Garden

Brought to you by:

Last Chance to Scarify Moss Quite a bit of unkind weather for

We have 3 crews doing this all day

the grass this winter. Round here,

every day at the moment. It is hard,

that usually means moss. Keeping

dirty work and will generate an

moss at bay is a never-ending task,

amazing volume of waste. Think

a maintenance item, not a one-off

about this before you consider

project. I sometimes like keeping

tackling this yourself.

the grass clean to cleaning the windows. Our service is like the

A scarification at this time of year

window cleaner in some ways. We

should be followed by a spring

come once a quarter, and we

feed to help it recover.

clean-up the grass. The price is probably similar too.

The main task of the off-season is scarifying out moss and thatch, and it is best done either at the end of a season (autumn) or just before a new season starts (spring). Some enthusiasts do it twice ! The general advice is don’t scarify once the grass has started growing. New grass in the spring will be damaged by the rather traumatic and invasive scarification process.

Alastair Watt

For more information about our annual lawncare plans from just ÂŁ11.25 per mth, plus useful downloads and photos, go to www.greenthumb.co.uk. Although GreenThumb is a multi-award winning national franchise, and is the runaway leader in the sector with half a million customers, we are the family-run local franchise covering the wider Moray Firth area. Contact Alastair or Fiona for a FREE LAWN ANALYSIS on 01463 229786, or email us at: inverness@greenthumb.co.uk


PRICES FROM

£11.25 MONTH

1st Treatment

FREE

01463 229786 www.greenthumb.co.uk Email: Inverness@greenthumb.co.uk


28 april - 31 october

elgin museum mon - fri, 10am - 5pm & sat, 11am 4pm, high street, elgin. call 01343 543675 or email at curator@elginmuseum.org.uk

until 30 june

moray supports refugees: appeal for warm clothing, tents & equipment for adults, children & babies living in refugee camps. for collection points contact christine preece at chrispreece1@hotmail.com or call 07982 161282. please bring all you can spare! attention bird watchers!: scotland's swifts are in trouble get in touch for more info. call cally on 07411 808573 or email huntlyswiftgroup@gmail.com

80s & 90s disco in aid of the highland hospice & the inverness ice centre 9.30pm - 1am, the mosset tavern, forres. £5 entry fee on the door. fancy dress optional

30 friday - 2 april (monday)

cadbury easter egg hunt at brodie castle: become a nature detective to follow bunny’s clues & finish your adventure with a delicious chocolatey treat 10am 4pm, brodie castle. £4. call on Natural Spice DEC rebecca 17.pdf harrison 1 07/11/2017 01309 641371 or at raharrison@nts.org.uk www.nts.org.uk/events

atural N

until 31december

year of young people/bliadhna na h-oigridh 2018 a platform for our young people (8 to 26yrs). opportunities to showcase lives & talents, voice opinions, etc various events all over scotland. email yoyp2018@gov.scot. www.young.scot/yoyp2018

March 2018

N atu

Est.1996

S pic e

OPEN: Sun - Thurs 4pm - 1am Fri & Sat 4pm - 2.30am

27 tuesday

WE DO

Curries, Kebabs, Pizzas and Calzones

quiz night 7pm for 7.30pm start, holy trinity church, elgin (opposite aldi). £3 per person (incl refreshments). teams of 2 to 4 people. please call to register, but you can turn up on the night call lynne taylor on 07968 855768 port of invergordon - cruise liner list 2018 provisional v1 - aidavita 9am - 7.30pm

MUNCHIE BOX £10.95

MEAL FOR 1 from £10.95

PIZZA MEAL FOR 2

MEAL FOR 2 from £19.95

from £12.50

29 thursday

an introduction to understanding finance: third sector interface moray 9.30am - 12.30pm, venue tbc free. overview of key finance considerations for small to medium groups & organisations. please book via info@tsimoray.org.uk

30 friday

charity ceilidh, with footerin aboot, presented by uhi event management students in aid of children 1st, scotland 7pm, eight acres hotel, elgin. £15. to book please call 01343 576226 (mon - fri, 9am 4pm) quoting "ceilidh" grampian transport museum: opens for the 2018 season. range of transport exhibits, from 1800s, to some of fastest cars ever made 10.30am, montgarrie road, alford. call 01975 562292 www.gtm.org.uk moray rock garden club: around the world in eighty plants; speaker - john owen 7.30pm, new elgin hall annex, land street, elgin. call alan souter (convener) on 01340 871504 the iona fyfe band@the drouthy cobbler, elgin 8pm 10pm. www.thedrouthycobbler.co.uk page 26 - April 2018

ral Spice Elgin

01343 552323 01343 540800 www.naturalspiceelgin.com Delivery available 187C High Street, Elgin (Opposite Playhouse Cinema) keith & dufftown railway: easter bunny weekend 10am - 4pm, dufftown. for information email info@keith-dufftown-railway.co.uk www.keith-dufftown-railway.co.uk/easter easter eggsplorer 9.30am - 4pm, elgin cathedral £7.50. easter egg hunt. call 01343 547171 or email at elgincathedral.vo@hes.scot easter eggsplorer trail 9.30am - 5pm, fort george, ardersier. included in normal admission price. search for clues around europe's most outstanding fort. find the clues to win an easter egg. call john gibbon on +447756763907 or email at john.gibbon@hes.scot

31 saturday

the arc sessions: skerryvore@fochabers institute tbc

tel: 01309 690063

admin@winterburnmedia.co.uk

14:


BRODIE CASTLE - a truly amazing great day out Events 2018 Friday 30 March - Monday 2 April, 10am-4pm Cadbury Easter Egg Hunt Q Saturday 21 - Sunday 22 April, 11am-4pm Daffodil Weekend Q Saturday 5 May, 8pm Music at the Castle with The Marvel of Peru Q Sunday 8 July, 3pm Outdoor Theatre The Midnight Gang Q Friday 10 August, 6:30pm Outdoor Theatre Romeo & Juliet Q Sunday 12 August, 2pm-4pm Historic Wheels Rally Q Saturday 8 Sunday - 9 September, 10am-4pm Exclusively Highland Food & Craft Fair Q Friday 23 Sunday - 25 November, 10am-4pm Exclusively Highland Christmas Craft Fair Q Saturday 15 Sunday - 16 December, 12pm-3pm Festive Fun Weekend Q Sunday 16 December, 3pm & 5pm Christmas at the Castle with The Marvel of Peru Q

18 20 w er e st e n n Ea th de ng to ar ni k in l G pe e fu O A pe Play

Become a member of NTS and visit for free FOR MORE INFORMATION CONTACT:

brodiecastle@nts.org.uk Tel: 01309 641371

nts.org.uk The National Trust for Scotland is a Scottish charity, SC007410


Mosset Tavern, Forres 5-8 April 2018 80 beers from 18 Scottish brewers Four live bands on stage Street food with a Cajun-Scottish twist Day pass: £10 • Weekend: £20 Info and tickets: www.foottapper.co.uk


call mhairi marwick on 07810 174377 or email at thearcsessions@hotmail.com the guns n roses experience plus special guests, lizzy planet@elgin town hall 7.30pm the south@the ironworks, inverness 8pm www.ironworksvenue.com little halo@elgin ex-service men's club 8pm elgin easter family fun day 10am - 4pm, elgin city centre. free. take part in the great elgin easter egg hunt. lots of fun & games for the kids - crazy golf & bubbles the clown. call embrace elgin bid on 01343 550652 forres crafters spring craft fair: craft tables with a variety of locally handmade crafts 10am - 4pm, tolbooth, forres. free. email forrescrafters@gmail.com so you think you know about dinosaurs 2.30pm, one touch theatre, eden court, inverness. with dinosaur aficionado, dr ben garrod. aimed primarily at ages 512yrs but suitable for all ages. call 01463 234234 mfr cash for kids texas scramble: raising funds for children in the highlands 7.30pm - 3.40pm, maverston golf club, garmouth road, urquhart ££60 per team (incl bacon rolls with tea/coffee) various competitions - beat the pro, nearest the pin & longest drive, etc. moray & aberdeenshire. www.brsgof.com kids' easter craft day: decorate your own easter hat or paint a ceramic egg ! i've got bonnets for the girls & cowboy hats for the boys! 9am - 3pm (please book in advance), the pantry, lossiemouth. £5 messy play lossiemouth-eggstravaganza party 10.30am - 11.30am, lossiemouth sports & community centre. please book at website. messy easter fun with egg rolling, easter rice & feathers, gloopy ducks, bunny tails & spaghetti nests. www.messarounduk.com

April 2018

moray road runners 10k: miltonduff 12.15pm 1.30pm (registration); 2pm (start), miltonduff village hall. predominantly online entry at entry central, (close on 28th march 2018). entries will be accepted on the day (£2 extra) community service sunday (last of the season) 6.30pm, inchberry hall, orton, fochabers. rev bob anderson. all welcome easter sunday service 6.30 am, the biblical garden, elgin. join us for a short service to celebrate easter Black Dog QPmaggie April 18 .pdf on 101343 02/03/2018 day. all welcome. call sharp 843111 or email m.jsharp@btopenworld.com www.biblicalgarden.co.uk

Mosaic Workshops at Black Dog Mosaic Studio, Lhanbryde, Elgin Regular Classes Monday and Wednesday evening 7pm - 9pm Saturday mornings 10am - 12pm Courses run in blocks of 6 at £150 (includes all materials and equipment) Next start dates Monday 30th April and 11th May Wednesday 2nd May and 13th June Saturday 26th May and 28th July Places limited to 6 per class. Book early as places go fast. Any missed sessions can be slotted in to another day/time throughout the course. No drawing or artist skills required.

1 sunday

little light 2pm, forres town hall. £7/£6 concs/£5 u16s family theatre, staged in a bedouin tent, using puppetry, music & dance to tell a magical story about a lonely boy. call david till on 01309 691170 uhallpromo@gmail.com. /www.universalhall.co.uk easter sunday fun 2pm - 4pm, the marine park, stotfield road, lossiemouth. enter your decorated eggs for the 'best dressed eggs' competition, prizes for all wearing easter bonnets & hats. electric vehicles gathering 10am - 4pm, grampian transport museum, montgarrie road, alford. call 01975 562292 or email at marketing@gtm.org.uk www.gtm.org.uk easter for sceptics 11am, burghead free church free. all welcome princesses of pop@the ironworks, inverness tbc www.ironworksvenue.com admin@winterburnmedia.co.uk

Jo 07787358092 blackdogmosaics@yahoo.co.uk Facebook Blackdogmosaics

3 tuesday - 6 friday

fochabers fiddle week tbc, fochabers tickets from www.fiddleweek2018.eventbrite.co.uk

4 wednesday

elgin u3a members: legal issues with an emphasis on how they pertain to 3rd agers; speaker caragh gilhooly 2pm - 4pm, elgin town hall - supper room free. all members friends & interested parties welcome. call sheila hollis (sec) on 01343 544858 or email at secretary@elginu3a.org.uk. www.u3a-elgin.org.uk/ elgin writers' group: work in progress tbc, elgin library. bring a piece of work you are having trouble

tel: 01309 690063

April 2018 - page 29

1


with & want some help with or comments on what you have written so far. www.elginwriters.wordpress.com easter funtime 1pm, grampian transport museum, montgarrie road, alford. normal admission charges easter themed crafts, activities & more. call 01975 562292 or email at marketing@gtm.org.uk www.gtm.org.uk

4 wednesday - 8 sunday

model railway exhibition open all day, grant arms hotel, the square, grantown on spey. free donations welcome. demonstrations 10am to 12pm, 2pm to 4pm, 7pm to 9pm. call patsy burr on 01479 851440 or email patsyclarsach@msn.com

5 thursday

vivaldi's la favorita: an evening of classical music from the dunedin consort 7.30pm, universal hall, findhorn. £14/£12 concs/£10 u16s. call david till on 01309 691170 or at uhallpromo@gmail.com www.universalhall.co.uk thursday open mic night 7.30pm - 10pm, copper dog pub, the craigellachie hotel. acoustic music sessions hosted by max mcpherson. please book if dining. call lesley anne parker on. 07887 846495 or at lesley@leap-scotland.com Rothes Pharm March 18.pdf 1 01/02/2018 sound of the sirens@the drouthy cobbler, elgin 8pm, www.thedrouthycobbler.co.uk

K.D Herbert MRPharmS

federation of holistic therapists (fht): before i go solutions; speaker - jane duncan rogers on how to prepare well for a good end of life 6.30pm - 8.30pm, the inkwell, francis place, elgin. call sandra ream on 07751 316663 or email at sandra@willowbankholisticmassagemoray.co.uk

5 thursday - 8 sunday

forres foot-tapper: the 'real' ale festival 5pm - 12.30am (9th), the mossett tavern £10 - day ticket; early bird weekend ticket. with toetapping bands & great grub. tickets from the website. free entry to the meet the brewer event (thurs). call gordon brailsford on 01309 672981 or email at info@mossettavern.com. www.foottapper.co.uk

6 friday

siobhan miller@universal hall, findhorn 8pm, £12/£10 concs/£8 u16s. call david till on 01309 691170 or email at uhallpromo@gmail.com www.universalhall.co.uk sigma: the quest for dark matter; how to detect dark matter in the universe speaker - dr anne-marie weijmans, st andrews university. 7pm doors open; 7.30pm start, birnie village hall. non-members welcome. www.sigma-astro.co.uk 12:06

26-28 High Street, Rothes › 01340 831233

FREE COLLECTION AND DELIVERY OF PRESCRIPTIONS 1

2

3

Phone: 01340 831233

Order your prescriptions

Delivered FREE Home or work

Collection from the following surgeries:

5RWKHV0HGLFDO&HQWUHs0DU\KLOO3UDFWLFHs(OJLQ&RPPXQLW\6XUJHU\s0RUD\&RDVW0HGLFDO3UDFWLFH /LQNZRRG0HGLFDOs$EHUORXU0HGLFDO3UDFWLFHs5LQQHV0HGLFDO*URXSs)RFKDEHUV0HGLFDO3UDFWLFH page 30 - April 2018

tel: 01309 690063

admin@winterburnmedia.co.uk


6 friday - 7 saturday

skipinnish 8pm, eden court (empire theatre), inverness. call 01463 234234

7 saturday

findhorn scottish teas 2pm, findhorn village centre homebaked cakes and savouries, fresh tea & coffee. sit in or takeaway. call mo hyde on 01309 692339 or email at findhornvillagecentre@gmail.com alexander chapman campbell: album launch@ universal hall, findhorn 7.30pm, £10/£8 concs/£6 u16s. call david till on 01309 691170 or email hallpromo@gmail.com. www.universalhall.co.uk megan@alexanderchapmancampbell.com port of invergordon - crusie liner list 2018 provisional v1 - aidavita 9am - 7.30pm inverness whisky & gin festival 1pm, bogbain farm, inverness. call 01463 772800 acfa cadet force pipe & drums in concert@the ironworks, inverness 1pm www.ironworksvenue.com the quo experience@ the ironworks, inverness 7.30pm. www.ironworksvenue.com elvis tribute@elgin ex-services club 8pm b.straits@the ironworks, inverness 11pm. www.ironworksvenue.com sassy boys charity night for climb uk 7.30pm, lossiemouth fc social club. all welcome coffee morning 10am - 12pm, holy trinity episcopal church hall (opposite aldi). adults: £2.50; children: 50p (incl refreshments) stalls, raffle, jewellery, tombola, produce, books etc.

8 sunday

ibfa highlands & islands bodybuilding competition 2018@the ironworks, inverness 12pm, categories ranging from miss bikini & men's fitness to mr & miss highlands. www.ironworksvenue.com the dublin legends "seven drunken nights & more tour 2018" 7.30pm, eden court (empire theatre), inverness. all welcome

9 monday

elgin & district parkinson’s support group: shirley catto on her role as the parkinson's nurse specialist in moray 7.30 pm - 9.30 pm, st sylvester's hall 19 institution road elgin. meetings are free to attend. call gillian gibson on 01343 541056 or email at elginanddistrictpsg@gmail.com. www.parkinsons.org.uk port of invergordon - crusie liner list 2018 provisional v1: astoria 8am - 4pm

9 monday - 12 thursday

national theatre connections 2018: performances 6.30pm, one touch theatre, eden court, inverness

10 tuesday

elgin flower club: spring is in the air; speaker - jo goldsworthy, stonehaven 7.30pm, elgin high church hall, visitors - £4 admin@winterburnmedia.co.uk

elgin community council monthly meeting: presentation by inspector jarrod leach on hate incidents/hate crimes 7pm - 9pm, council chamber, council hq, high street, elgin. call patsy gowans 07497 111510 or patsy.gowans1@btinternet.com

11 wednesday

the arts society speyside lecture: fakes & forgeries: case studies demonstrating the lengths forgers will go to pass off works of art as legitimate 11am coffee & tea available from 10.15am, the williamson hall, duff avenue, elgin. new members welcome/£7 for visitors. call membership secretary on 07789 880481 moray stamp club: gb postal rates & gb minithemes; speaker - jeff dugdale 2pm - 4pm, activities room, elgin library. email (secretary) Benromach Aprilmichael 18.pdf ellison 1 07/03/2018 at michael56101@gmail.com www.moraystampclub.wordpress.com

benromach distillery will be hosting

the forres harriers 10k Part of the North District 10K Series

sunday may 13th at 2:30pm. Registration from 1pm – 2pm in Forres Town Hall Race starts at 2.30 from outside Benromach Distillery no entries on the day If you are interested in participating, or would like additional information, please check out the Event registration site: www.entrycentral.com/Benromach10k

13 friday

culloden: the battle in history & memory; speaker prof murray pittock. annual 1745 association commemoration talk 8pm, culloden battlefield visitors' centre

14 saturday

red riding hood's magic purse@ universal hall, findhorn 2pm. £7/£6 concs/£5 u16s. puppets & shadow theatre. call david till on 01309 691170 or uhallpromo@gmail.com. www.universalhall.co.uk quiz night 7pm , pluscarden hall £3 at the door room to ride 100km: huntly audax 9am - 5.20pm, huntly. £5 (closing date 11th april 2018). huntly development trust offers 4 routes through huntly, banff, cullen, keith, the cabrach, alford & clatt email donald boyd at donald.boyd@huntly.net www.huntlydevelopmenttrust.org/room-to-ride-2018 in the shadow of the princes: discussion panel. 1.30pm, culloden battlefield visitors' centre hybrid theory@the ironworks, inverness 7.30pm

tel: 01309 690063

April 2018 - page 31

11:40


www.ironworksvenue.com exklusive presents spartaque, spektre@the ironworks, inverness 11pm, www.ironworksvenue.com hopeman to lossiemouth cliff walk 10.30am, meet at recreation ground in hopeman. approx 6 mile walk along the cliff path. good path, fairly level. call 07840 285438 or email at morayfieldclub@gmail.com family quiz night in aid of the highland hospice & inverness ice centre 6pm, the mosset tavern, forres £2.50 per person & teams up to 6 Belly Dance Classes April 18.pdf foootball juniors elgin of new in aid nightKyle prize bingoLucy club 6.30pm for 7.30pm, new elgin hall. £2. half time refreshments & raffle

BELLY DANCE CLASSES Are you free on Wednesday night? Come and have some fun! Every Wednesday 6pm - 7pm Elgin Museum Hall

15 sunday

To find out more contact:

www.lucykylenlp.com

lucykylecoaching 07398 140904

the gathering storm 4pm, culloden battlefield visitors' centre. ticket incl one take away hot soup. tour the battlefield & discover the stories of those who played a role in the preparation for the battle buckie 10k & junior run registration online or at buckie high school small hall. (entry via emergency exit) 12pm - 1.30pm. junior on the day only; junior start - 1pm; 10k - 2pm. www.entrycentral.com/event

16 monday

the storm breaks: a battle remembered 11am, culloden battlefield visitors' centre. ticket incl take away hot soup. follow in the footsteps of the armies as they meet for the final engagement of the '45.

17 tuesday

lossie hae a news! 1.30pm - 3pm, hersbruck court sheltered housing, ramsay lane, lossiemouth have a cuppa & a news, quizzes, dominoes, bingo, crafts, etc for anyone living with dementia. call sharon finlay on 07584 408209 or email at sfinlay@alzscot.org

18 wednesday

elgin writers' group: write on the night; evocative writing using smell as a starter 7.30pm - 9.30pm, elgin library. closing date of article comp on current social issue. www.elginwriters.wordpress.com

19 thursday

the circus of horrors: the never ending nightmare 7.30pm, elgin town hall. an amalgamation of bizarre, brave & beautiful acts all woven into an alice in horrorland type story

20 friday

talisk@ universal hall, findhorn 8pm,£13/£11 concs/£9 u16s. call david till on 01309 691170 or page 32 - April 2018

uhallpromo@gmail.com. www.universalhall.co.uk moray rock garden club: scotland's alpine & subalpine habitats & conserving our montane scrub; speaker - dr graham sullivan 7.30pm, new elgin hall annex, land street, elgin. call alan souter (convener) on 01340 871504 birchwood highland's dinner with the stars 2018: featuring a number of local guest chefs as well as a main course prepared by comedian & broadcaster hardeep singh kohli 6.30pm, bogbain farm, inverness. £60. call 01463 772800 1 07/03/2018 the night tour@the ironworks, run with14:43 raintown: inverness 7.30pm. www.ironworksvenue.com

21 saturday

moravian orienteering saturday league in conjunction with moray & nairn schools league: oakenhead near lossiemouth 10.15am - 11.15am (registration); 10.30am, oakenwood nr lossiemouth www.moravianorienteering.org change your world conference tbc, eden court, inverness. www.changeyourworld.me the savage haggis@elgin ex-service men's club 8pm, all wecome 90s rave@the ironworks, inverness 10pm www.ironworksvenue.com 2018 mcdonald & munro speyside stages: a 45 mile stage rally. starting in elgin the event uses forestry stages & the cooper park. elgin 8.55am, cooper park, elgin. www.speyside-stages.co.uk gary barlow@aberdeen exhibition & conference centre 6.30pm - 10.30pm. www.ticketmaster.co.uk tmsa: gaberlunzie 8pm, royal hotel, keith. £8 call sandy mccombie on 01542 882638 lhanbryde community challenge tombola in aid of community centre repairs 6.30pm for 7.30pm, lhanbryde community centre. adults £1.50, children £1. raffles, lucky squares, bring your own cup

21 saturday - 22 sunday

runbalmoral: a festival of running, for people of all ages. book online tbc, balmoral castle. call 01339 742555. www.runbalmoral.com/content daffodil weekend walks & exhibition 11am - 4pm, brodie castle. £5. the garden team will be leading guided tours & talking about the history of the daffodil collection at brodie castle. call rebecca harrison on 01309 641371 or raharrison@nts.org.uk www.nts.org.uk/events

22 sunday Lucy Kyle Belly April 18.pdf

lyon & turnbull valuation day raising funds for marie curie 12pm - 4pm, moray college, uhi. valuation 1 1

07/03/2018

COMPASS TO YOUR DREAMS Do you feel stuck on your way to your dreams? This workshop will get you cracking on. One day hands on interactive hands on workshop. To find out more contact:

www.lucykylenlp.com

tel: 01309 690063

lucykylecoaching 07398 140904 admin@winterburnmedia.co.uk


1

REGION

100s

5

OF WHISKY INSPIRED EVENTS

DAYS

Spirit of Speyside Whisky Festival 27 April – 1 May 2017

3rd #dram17 - 7th May 2018

Tickets available at www.spiritofspeyside.com item £5, 2 items £8, etc. refreshments, stalls, music & raffle. call ros lewis on 07768 383500 or email at roslewis@me.com cream teas 2pm - 4pm, pluscarden hall 2018 spring round up: tranquility wild west town first ever open day!!! a reconstruction of a small frontier town in the old american west 1.30pm - 4.30pm, drumblair, nr the glendronach distillery, aberdeenshire. free. email alistair baranowski on tranquility_town@hotmail.co.uk www.facebook.com/tranquilitywildwesttown

24 tuesday

the moray tenants forum 2pm-4pm, to be confirmed call 0300 123 4566 or email at tenantparticipation@moray.gov.uk

25 wednesday

anzac day remembrance service 10am, dallachy memorial, bogmoor. all welcome. please note that b9104 will be closed from 10am - 10.30am noel gallagher's high flying birds 6.30pm - 10.30pm, aberdeen exhibition & conference centre www.ticketmaster.co.uk

25 wednesday - 28 saturday

st giles theatre group: joseph & the amazing technicolor dreamcoat 7.30pm & sat 2.30pm & 7pm, elgin town hall admin@winterburnmedia.co.uk

26 thursday

#dram18

spynie soup & sweet lunch: hosted by duffus, spynie & hopeman church on last thurs of each month in aid of church funds 12pm - 2pm, spynie village hall. donation £3. . everyone welcome. call elsie watson on 01343 543914 or email at elsie.watson121@btinternet.com

27 friday

billy nasty@the ironworks, inverness 11pm www.ironworksvenue.com

28 saturday

28th junior highland games: supporting children 1st (elgin) & nspcc scotland 11am - 2pm, gordonstoun school, duffus. teams of children from all over ne of scotland take part in traditional games. stalls & activities. display of morgan cars, etc. email at hughesy@gordonstoun.org.uk songs of roma@universal hall, findhorn 8pm, £13/£11 concs/£9 u16s. call david till on 01309 691170 or email uhallpromo@gmail.com www.universalhall.co.uk kinloss church coffee morning: fundraiser for free style swimming club 10am - 12pm, kinloss church of scotland, kinloss £2.50. home bakes. raffle. sales tables. call janis thomson on 01343 850245 or email at janis@the-meadows.co.uk

tel: 01309 690063

April 2018 - page 33


otland@ the ironworks, inverness 7.30pm. www.ironworksvenue.com

29 sunday

car boot sale (inchberry & district community association) 8.30am - 1pm, inchberry hall, orton, fochabers. no booking required, just turn up early before 9am with a car & table. teas/coffees, soft drinks, butteries, bbq. www.wherecanwego.com etape loch ness: chosen charity macmillan cancer support 6.15am, inverness. £63 (sold out) a cycle sportive offering the chance to cycle 66 miles around the loch on traffic free roads. 18yrs + MRD Flooring Jan 17

.pdf

1

14/12/2016

13:25

......

CARPETS t VINYLS t WOOD t LAMINATES Moray Artifical grass April 18.pdf

1

Bandstand Bar, Braeval Hotel, Crescent Rd, Nairn IV12 4NB 12/03/2018 11:31

VISIT OUR SHOWROOM AT: £äÊÀiŜ«Ê,`]ÊœÀÀiÃÊ6ÎÈÊÓ1 Êä£Îä™Êș{nÎxÊUÊÜÜÜ°“À`vœœÀˆ˜}°Vœ°ÕŽÊU i“>ˆ\˜vœJ“À`vœœÀˆ˜}°Vœ°ÕŽ

Tel: 01667452341 e: info@braevalhotel.co.uk www.braevalhotel.co.uk

As market leaders in luxury gardens, we know why people choose artificial grass. People want to have their lawns hassle-free! We make our grass as it is meant to be. A pleasure to walk on, beautiful to look at and durable. The unique feature of Royal Grass is the special V-shape of our fibres with MiNT-Technology. Thanks to this shape the fibres stand up proudly and yet at the same time remain soft – a pleasure to touch. Please call or email us for no obligation quotes for your own special space.

01542 835330

info@morayartificialgrass.co.uk

www.morayartificialgrass.co.uk


The Monthly

BOOK CLUB Junior Fiction Tin by Padraig Kenny A science fiction fairy tale, set in a astonishingly realised mechanical world, Tin is a heart-stopping adventure about friendship, courage and finding your identity.

Junior Fiction

Stay Away From The Hazel Wood by Melissa Albert Her mother is stolen away - by a figure who claims to come from the cruel supernatural world where her grandmother's stories are set. Alice's only lead is the message her mother left behind: STAY AWAY FROM THE HAZEL WOOD

Adult Fiction Adult Fiction

Surprise Me by Sophie Kinsella An astute, laugh-aloud funny, and thought-provoking novel from bestselling novelist Sophie Kinsella about the hidden layers that exist in even the closest relationships.

Adult non-Fiction Coal Black Mornings by Brett Anderson Brett came from a world impossibly distant from rockstar success, and in Coal Black Mornings he traces the journey that took him from a childhood as 'a snotty, sniffy, slightly maudlin sort of boy raised on Salad Cream and milky tea and cheap meat' to becoming founder and lead singer of Suede.

Hangman by Daniel Cole 18 months after the 'Ragdoll' murders, a body is found hanging from Brooklyn Bridge, the word 'BAIT' carved into the chest. In London a copycat killer strikes, branded with the word 'PUPPET', forcing DCI Emily Baxter into an uneasy partnership with the detectives on the case, Special Agents Rouche and Curtis.

Adult non-Fiction Votes For Women by Janni Murray This is the perfect introduction to the female pioneers who spearheaded the women’s movement and the fight MVY^VTLU»ZZ\MMYHNL°


We offer a free, no obligation initial consultation

PROFESSIONAL CLEANING FOR ALL YOUR COMMERCIAL AND DOMESTIC REQUIREMENTS

Helping Hands provides an extensive range of cleaning services for the commercial & domestic sector at very competitive rates. Whatever your cleaning requirements, we tailor a handmade package to suit you. We believe that keeping your workers happy and relaxed in their office or working environment is the priority for any employer. Any manager knows that a clean office and productivity go hand in hand. Your home is unique, which is why our cleaning services are individually tailored to meet your needs. Our team of fully vetted, professional staff are trained to provide a high level of personal service – and we guarantee outstanding results every time.

For further details call

Helping Hands

on 01343 831346


+HDWLQJFRVWVDUHRQWKHXSDJDLQ 5HSODFH\RXUROGVWRUDJHKHDWHUV2XUHOHFWULFKHDWLQJVROXWLRQV FRXOGVDYH\RXPRQH\

/RZSRZHUXVHDJHQRVHUYLFLQJYHU\FRQWUROODEOH$1'DFRV\ZDUPWK *HUPDQ&KDPRWWHH&OD\&RUH+HDWHUV $UHPDUNDEO\ FRV\KHDWZLWKVRPHRIWKHEHVWUXQQLQJFRVWVRIDQ\KHDWLQJ V\VWHPFXUUHQWO\DYDLODEOH'XHWRWKHIOH[LELOLW\RIWKHV\VWHPZH KDYHPDQ\FXVWRPHUVZKRVWDUWHGZLWKRQHDQGKDYHFRPHEDFNIRU PRUH8VLQJPDLQO\UDGLDQWKHDWWKHVHVOLPDGDSWDEOHKHDWHUVFDQ EHVXSSOLHGRQIHHWRQFDVWRUVRUFDQEHZDOOPRXQWHG6WRUDJH KHDWHUSUREOHPV"$QLGHDOUHSODFHPHQW

<RXFRXOGVDYHXSWR RQ\RXUKHDWLQJ ELOOV6HHRXUZHEVLWH IIRRUPRUHLQIIRR

6L[<HDUV<RXQJ:LWK+XQGUHGVRI+DSS\&XVWRPHUV (OVFR+HDWLQJ/WG)RUPRUHGHWDLOVDQGD)5((LQIIRRSDFNRQDOORXULQQRYDWLYHKHDWLQJ SURGXFWVZZZHOVFRFRXNRUSKRQH-RKQRQ STS March 18.pdf

1

12/02/2018

15:28

Words by the Wayside â&#x20AC;&#x153;...the Father sent the Son to be the Saviour of the world.â&#x20AC;? (1st John 4:14)

Reader, the Lord Jesus gave His life a ransom for all. Because of His work on the Cross of Calvary the â&#x20AC;&#x153;whosoeverâ&#x20AC;? can be saved (and that means YOU!) We all either accept and receive Him as our Saviour or we refuse the provision God has made for us in Christ. We alone are responsible. The Lord would have all men to be saved; those who come to Him, He never turns away. Come to Him now.

W W

www.wordsbythewayside.co.uk Registered Scottish charity SC041290

Before

After

U All Roofing Works U Guttering Work U Exterior painting works U General Building works U Landscape & Gardening For a Free Quote:

Mob: 07765 634475 Tel: 01343 508150 Email: ststewartproperties@gmail.com

www.stsproperties.co.uk


GS E IN BL EW LA VI AI AV

Making care mean more in Nairn

Offering high quality, personalised nursing care in a homely environment

St Olaf Room Sui te

St Olaf Care Home

Meaningful Activities St Olaf Care Home offers luxury suites along with a range of services, including: s 24-hour nursing care for the elderly and those living with Dementia sFine Cuisines - Nutritious meals catering for all dietary needs sLarge, dual aspect deluxe rooms

sEvent and activities programme sHairdressing and beauty salon sEasily accessible and landscaped gardens sPrivate resident transport

Contact home manager Liz to arrange a visit on 01667 454 544

Liz MacRae

St Olaf Care Home Manager

Email: stolaf@meallmore.co.uk Web: www.meallmore.co.uk Facebook: www.facebook.com/meallmore

St Olaf Care Home, Cawdor Road, Nairn IV12 5EF


The Perfect Wedding Venue The Muthu Newton Hotel W

NAIRN

W

The Chapel

The Wedding

Call our wedding planner who will be delighted to help you with arrangements for your special day The Muthu Newton Hotel offers the perfect Wedding Venue We are licensed to host civil ceremonies & partnerships with receptions up to 250 guests. For further information call: 01667 453144 email: nwt.sales@muthuhotel.com


CAR VALETING DETAILING SERVICE PAINT CORRECTION CARS, VANS, TRUCKS & MOTORCYCLES FULLY INSURED MOBILE SERVICE

CALL TODAY:Massage 07877 316809 March 18.pdf 1 Therapeutic

WWW.PITSTOP-VALETING-TINTS.CO.UK

02/02/2018

Therapeutic Massage Call Julie on

11:33

Still Life Studio Picture Framer & Gallery is Moving

07712910101

and changing its name to

Also Regular Classes in:

The Gallery in Aberlour

Meditation, Tai Chi, Qigong & Kung Fu

www.morayquanshu.co.uk archie@morayquanshu.co.uk Ali Paterson BB Jan 17.pdf 1 14/12/2016

incorporating Spey Sport 10:13

Fishing & Shooting essentials Contact Brian Doran 07990551221

ali paterson ltd.

Our old premises will remain open & operate as The Artistâ&#x20AC;&#x2122;s Studio offering studio/gallery rental to artists Contact Alan Paterson 07896903655

windows U doors U roofline telephone

01343 842752 07974 447268 mobile

Boyle Plumbing Apr 18.pdf 1 06/03/2018 ali-paterson@hotmail.co.uk

Andrew Boyle

PLUMBING SOLUTIONS

The Gallery in Aberlour

10:53

& Spey Sport

PLUMBING & HEATING ENGINEER

79 High St, Aberlour AB38 7AY

COVERING ALL OF MORAY

01340 871457 / 07766704910

M: 07709 444310 E: boyleplumber@btinternet.com

Opening 28th April 2018

Contact Kerry Doran


SpotLIGHT LIGHT Puzzles

Sudoku

C r o ss w o rd

Easy

Medium

Find Spot!

Easy

Medium

Can you find 10 of me hidden in this issue? Solutions to last monthâ&#x20AC;&#x2122;s puzzles


GET OUT AND ABOUT Rascal P321

Roma

8FTUPDLBXJEFSBOHFPG NPCJMJUZQSPEVDUTUPIFMQ ZPVHFUPVUBOEBCPVU Quickie 2

Call: 01309 676677 Quote: PR0318GPSEJTDPVOUPGGBMM QPXFSFEQSPEVDUT

21 West Road, Greshop Industrial Estate, Forres IV36 2GW (Behind Lidl) 0QFO.POEBZ'SJEBZBNUPQNt&BTZQBSLJOHEJTBCMFEUPJMFUGBDJMJUJFT 01309 676677 tTBMFT!NPPSJOHTNFEJRVJQDPN


Making Whole Family Recovery Possible Arrows is a holistic service for individuals both Adults experiencing drug and alcohol problems, and children and families The range of supports available in Arrows are both individual and group centred and can be used as part of a whole family approach to recovery or one to one support personally tailored and unique to each familyâ&#x20AC;&#x2122;s circumstances.

program. Arrows work to improve coping strategies and parenting approaches through supporting activities, play and positive experiences. Arrows can support parents to recognise the needs of their children throughout their recovery journey, how to support them through the changes involved and in hearing their views within the familyâ&#x20AC;&#x2122;s support.

Worried about a loved one and their substance use? Friends, family or others connected to an individual

nature of treatment and support with Arrows is upmost and we support individuals to understand the boundaries of sharing information, as well as making informed choices when involving loved ones within our whole family approach.

Worried about your substance use and its impact on your family and relationships? Individuals experiencing drug and alcohol issues may feel isolated from loved ones, unable to seek support from those closest to them or pressurised into establishing positive changes which can lead to deterioration within relationships, and creating further challenges for recovery. Arrows can support you to involve loved ones in your recovery at a pace and level that suits you. We can guide you to have conversations with loved ones inviting their involvement within your recovery plan. Many of our activities, groups and events are family inclusive; we provide focused support through couples and family counselling. Arrows work with parents experiencing substance issues to support their role as a parent within their recovery treatment

a close relationship with someone struggling with an addiction can be frustrating, painful and sometimes a lonely journey. We can work with you using a range of CBT based tools, helping you cope and support your loved one. Many of these skills are valuable for the family even if your loved one does not enter treatment or has already begun the treatment process. Arrows can support friends and family to understand and discuss problematic substance use with their loved one to help prevent situations escalating.

Linking with Carers Support Family members often donâ&#x20AC;&#x2122;t recognise themselves as unpaid carers even though they are entitled to the carer supports available. Arrows and Quarriers Carers Support Service (Moray) can work with you on a joint register to ensure access to the training, short breaks and group supports available through their Service.

Talk to us Arrows - A Quarriers Service, 23 High St, Elgin, IV301EE CBMMt Text 07812 228547 arrows@quarriers.org.uk

Opening hours Monday - Friday 9am-6pm, Thursday 9am-9pm Saturday 10am - 5pm SMART recovery Thursdays 6.30-7.30pm


Concerned about your own or someone else’s alcohol or drug use?

You’re not alone. Talk to us. Call 01343 610500 Text 07812 228547 Email arrows@quarriers.org.uk 6XSSRUWLQJ)DPLOLHVWR  

8QGHUVWDQGWKHUHFRYHU\SURFHVV    'HYHORSSRVLWLYHFRPPXQLFDWLRQVWUDWHJLHV    *DLQQHZVNLOOVDQGFRQILGHQFH     ,PSURYHWKHTXDOLW\RIIDPLO\UHODWLRQVKLSV      %HLQYROYHGLQSRVLWLYHDFWLYLWLHVDWKRPHDQGLQ          WKHLUFRPPXQLW\   Arrows )JHI4USFFU &MHJO      .PSBZ*7&& Quarriers is a registered charity no.Sc001960   www.quarriers.org.uk/arrows

É É É É É


The Garden TOM ANGEL IS A GARDEN DESIGNER AND CHARTERED HORTICULTURIST BASED IN AVIEMORE. TOM PROVIDES GARDEN DESIGN AND HORTICUL-

THE MOUNTAIN GARDENER, HAVING

TURAL SERVICES AS

PREVIOUSLY RUN HIS OWN COMMERCIAL GARDENING BUSINESS FOR TWELVE YEARS.

TOM ALSO BLOGS AS THE MOUNTAIN GARDENER WHICH YOU CAN FIND ON HIS WEBSITE AT WWW.THEMOUNTAINGARDENER.CO.UK

A

pril tends to be the month when everything in the garden starts to wake up, and on the first of the sunny days my phone starts to ring off the hook and it’ll be November before I know it! I love it though, this time of year, especially so as I’ve been doing lots of work in my own garden that will start to show itself soon enough – plants and trees that have gone in ‘bare root’ will suddenly burst into life, belying their straggly appearance when they arrived in cardboard boxes a couple of months ago! I’ll be looking to spend some time in the garden before the spring growth spurt kicks in (usually some time in May, and it lasts about 6-8 weeks). During the spring growth spurt, you have to work hard to stand still sometimes, so a bit of extra effort now will pay dividends.

‡ Do gently hoe over your borders to disrupt any emerging weeds under the soil. ‡ Do dig well-rotted horse or cow manure into your beds. ‡ Do cut your lawn if it needs it, but just a light cut for the first one. ‡ Do prune Forsythia sp. once it has finished flowering. ‡ Do scarify your lawn with a spring-tine rake for smaller areas, or hire a machine for larger areas. ‡ Do add a lawn feed to your grass. ‡ Do treat decks and hard surfaces for moss.

46

‡ Don’t apply lawn mosskiller by hand, however careful you are it will create ugly black streaks that take ages to recover. Use a spreader. ‡ Don’t go overboard with your lawn feed if you have large areas of grass and no time to cut it. I only ever use an autumn feed on my lawn which has a bit less nitrogen in. ‡ Don’t forget to top-dress plant pots – skim a bit of old compost away, and add some new compost. ‡ Don’t forget to start spraying roses to help keep pests away. You can get organic sprays that use things like garlic. Once the overnight temperatures are over 6C, the grass will start growing in earnest, so be sure your mower is working nicely. Mow at least once a fortnight to prevent weeds setting seed. If you do scarify, as advised above, don’t mow it for a few days afterwards as it is a stressful process for the grass.

I’LL BE ADDING SOME MORE BLOG ARTICLES OVER THE COMING WEEKS ABOUT HOW TO DO VARIOUS JOBS IN THE GARDEN, SO KEEP AN EYE ON MY WEBSITE AT WWW.THEMOUNTAINGARDENER.CO.UK. IF YOU HAVE ANY QUESTIONS, OR IDEAS FOR USEFUL THINGS YOU WOULD LIKE TO READ ABOUT HERE, OR ON MY BLOG, THEN JUST DROP ME A LINE.


TIMBER BUILDINGS UK

TIMBER BUILDING SPECIALISTS

LODGES SUMMER HOUSES SHEDS GARAGES FIELD SHELTERS LOG STORES FULL HOUSE KITS CUSTOM AND COMMISSIONS

FULL PLANNING AND DESIGN AVAILABLE HIGH QUALITY, ENERGY EFFICIENT LOW CARBON BUILDS ALL OUR TIMBER BUILDINGS ARE CONSTRUCTED USING ONLY THE BEST QUALITY MATERIALS AT A COST THAT SUITS YOU UNIT 6 SHORELINE COMMERCIAL CENTRE COVESEA, LOSSIEMOUTH IV31 6SP TEL: 07375766357 EMAIL: timberbuildingsuk1@gmail.com


30%OFF New Year Promotion on kitchen and bathroom products *terms and conditions apply*

K I T C H E N S

| B A T H R O O M S | B E D R O O M S | HE A T I N G

SY S T E M S

Local family run company based in Elgin offering fully project managed home improvements including Kitchens, Bathrooms, Bedrooms, Windows, Doors and Central Heating Systems in Moray, Highlands and Aberdeenshire. Our showroom in Elgin displays a wide range of high quality Kitchen and Bathroom products which are available to both trade and retail customers. All products can come supply only however we also offer a supply and installation service. We offer a free design and quote service with no obligation. So why not pop in today and make an appointment or, call 01343 551331 "Great job done on new bathroom. Hassle free work with no problems and excellent customer service."

- GARETH RICHARDS

Providing high range kitchen, bathrooms and heating systems for over 16 years â&#x20AC;&#x201C; All trades fully project managed from start to finish

FREE Quotations FREE Plan and Design Come and visit our showroom

01343 551331 Open 6 days a week Monday - Fridays 9am-5pm Saturdays 10am-2pm 16 Linkwood Place Elgin IV30 1HZ

terms and conditions apply to all promotions

Elgin apr 18 web  
Elgin apr 18 web  
Advertisement