Page 1

DECEMBER 2016

BUCKIE, KEITH & DISTRICT THE NORTH’S FAVOURITE FREE WEE MAG

Are you dreaming of a white Christmas? Teeth whitening for only £199

Keith Dental

the friendly practice

Call our friendly team for more information on 01542 886251 59-61 Moss Street, KEITH AB55 5HF www.keithdental.co.uk/spot

HAPPY CHRISTMAS From Our Family to Yours 45-49 Church St, Buckie AB56 1BP

Tel: (01542) 832653

T VER AD SEE SIDE IN

BUCKIE

F U R N I T U R E AND CARPET CENTRE Beds Blinds Furniture and Flooring


Merry Christmas to all from the team at green moray renewables

Electrics Plumbing Solar PV & Thermal Biomass & Air Source Heat Pumps 01309 675595

Buckie Computer Solutions Alan Phimister t alan@buckiecomputersolutions.co.uk www.buckiecomputersolutions.co.uk

MOTORCYCLE TESTING

TRED-RITE TYRES LTD

7\UHV‡027·V6HUYLFLQJ ‡([KDXVWV‡%DWWHULHV‡%UDNHV

0FODUHQV%UDH%XFNLH$%76‡¬

! -, *"1),( 6 )*),( 6 "0$)"0 211&/),( *"1 --' ),(*& *5 )/&01-,& 501&+0 6 &,&/"* 2##&/ 6 ./-.&/15 +"),1&,",$& 0&/3)$& -+& /-

2"/",1&& 5-2

.&"$& -' +),%

4&# &+")*

For when you really need legal help based on 770 reviews

Independent legal advice is essential after a road traffic or work related accident. Our Inverness office is here to help you. We have years’ of experience helping anyone injured seek rightful and fair compensation.

Call us on: 01463 649004 or visit us at Moray House, 16 -18 Bank Street, Inverness, IV1 1QY.

Because if it matters to you, it matters to...


www.spotlighton.co.uk

The Free Community Information website - Free to view and Free to upload your listings. View our entire database of Clubs and Societies, Trades Listings, What’s On Diary, Restaurants, Reviews and articles, Schools, Holidays Tides, Useful Numbers and more... CLUBS & SOCIETIES BANFFSHIRE BEADERS Meets 3rd Thursday each month at Arradoul from 2pm - 5pm. Contact Janet Winterbourne on 01542 850420 for details. BANFFSHIRE FIELD CLUB 2nd Saturday of the month at St Rufus Church Hall, Turner Street, Keith. Explore natural, cultural & social heritage of the historic county of Banffshire. Visit www.banffshirefieldclub.org.uk BUCKIE AMATEUR SWIMMING CLUB Classes spanning all levels and coaching available. Ages 5-16. Contact David Eckersley: 832078. FOCHABERS WRVS LUNCH CLUB Thursdays, 12pm - 1pm at Bellie Church Hall, Fochabers. Freshly cooked 2 course lunch for £4. All welcome. Volunteer drivers wanted GRANGE BADMINTON CLUB Tuesdays 7pm - 9:30pm at King Memorial Hall, Grange Contact Tamsin Morrison on 870251 or tamsin.morrison@btinternet.com

)1 #! )1 6* ! 5* ! .,#( ,, *+) #& .&& * !

4 4 4 4 4 4

#(- + .+( # )'+ # " )) ,# +' #(&),, && ' - +# & 0#-"#( -" *)- #!"' ! 3#( , #, ,. $ - -) )+' & )*2+#!"- + ,-+# -#)(, ( -" + )+ -" + *+) . -#)( ) (2 &#,#(!, #-)+# & / +-#, + +-0)+% )+ (2 )-" + )(- (- 0#-").- -" *. &#," +7, *+#)+ )(, (- 0#&& )(,# + + " ) )*2+#!"-

page 4 - December 2016

GUIDE DOGS FOR THE BLIND Nairn & Moray Branch are looking for new branch volunteers. If interested, please contact Anna Temple or Anna Roberts. Tel: 01309 694866 HELGIN ROLLER DERBY Saturdays, 12pm - 2pm in Elgin Community Centre and Thursdays, 6:30pm - 8pm in Forres House Community Centre. Learn to roller skate with the newly formed Elgin Roller Derby team and find out more about how you can get involved. Beginners welcome. Open to males and females 16+. Find us on Facebook for more details. ISLA ART AND CRAFTS Mondays, 7pm - 9pm, Keith. Help, advice & tutorials from a professional artist and visiting tutors. For info or details of new venue call 01542 886070 or 01542 882391. KEITH SCOTTISH COUNTRY DANCE CLASS Every Thurs 7.30pm - 9.30pm, at St Rufus Church Hall, Turner Street, Keith. LIGHT AND LIFE Free Spiritual readings, Spiritual art, Personality styles, Dream Interpretation, Massage, Healing for body, soul & mind. Live music. Meets second Monday of the month in Costa Coffee, High Street, Elgin. 7pm - 9pm. Please check beforehand by calling Alyson on 07733 127539. LONG DISTANCE WALKERS ASSOCIATION (NORTH WEST GRAMPIAN LDWA) For all who enjoy the outdoors combined with cake. Centred on Moray but covering Thurso to Pitlochry and even the islands. A varied programme of walks is planned to attract a wide range of people with shorter options for families when possible. For more info visit www.ldwa.org.uk MACS MORAY AREA CANCER SUPPORT A support group which provides both practical and emotional support for anyone, of any age, affected by Cancer within Moray.

New members welcome. For more details call our Help Line on 07516 21915, e-mail us on : info@macsuk.org or visit us at www.macsuk.org or Facebook.

ROTARY CLUB OF BUCKIE Mondays at 5.45pm for 6:15pm Mill House Hotel, Tynet, Buckie. For more information visit www.rotaryclubofbuckie.org.uk

MORAY OSTOMATES 1st Saturday of every month until December, 1pm - 3pm at Moray Resource Centre, Elgin. Come along for a cup of tea and a chat. Phone Meggie on 01343 552449 or Kathleen on 01343 821628

ROYAL BURGH OF CULLEN PENSIONERS CLUB 1st Monday each month 7pm. For the welfare of the elderly in Cullen. Contact Bunty Gardiner 840653. RTR ASSOCIATION (MORAY FIRTH BRANCH) Meet monthly & arrange dinners and outings for ex-RTR personnel. Contact Peter on 01542 841740 or Clive on 01542 841529 for more info.

MULTIPLE SCLEROSIS MORAY By people with multiple sclerosis for people with multiple sclerosis A website with info & support for people with MS, their friends, family & carers. www.MSMoray.net

SJÖGREN'S SYNDROME AND LUPUS SUPPORT GROUP Meetings arranged on an adhoc basis. For more information call Sheena on 01343 820635 or Susan on 01343 842656

PARKINSON’S SUPPORT GROUP KEITH & DISTRICT Meet regulary in different places throughout the area. For more information on meetings call 01542 831449

STRATHISLA STRINGS 1st Wednesday every month from 7:30pm at The Crown, Reidhaven Street, Keith. A communtiy music group playing traditional music from a wide range of sources.

PET FOSTERING SCOTLAND Supporting pet owners in an emergency situation. Volunteers care for your pet in their own homes for short periods. Reg. charity SCO15672. Volunteers needed. Tel: 0844 811 9909 www.pfss.org.uk

WESTERN FRONT ASSOCIATION We hold 9 meetings per year on Saturday afternoons in Elgin Library. Open to anyone with an interest in WW1. Contact Derek Bird on 01343 870562 or email chairman.wfasnb@virgin.net www.wfascotlandnorth.org.uk

PORTGORDON VILLAGE HALL Meeting room, large & small hall complete with kitchen facilities for hire. Contact Denise Robson 01542 834401. PORTKNOCKIE SCOTTISH COUNTRY DANCING GROUP Winter dancing session commences Wednesday 2nd September, weekly through till May from 7pm in the Seafield Hall, Portknockie. Beginners are very welcome. The class is full of fun, friendship and is a great way to exercise. For more more info please call 07803 855786

If you would like details of your club or society included in this section, please let us know. All club listings are free. Not all clubs will be listed in every issue.

RHYTHM & RHYME GYM TOTS Wed 9.30 - 10.15am & 10.20 11.05 am. Fun baby & toddler sessions. Movement, music, songs, soft play and healthy snack. Call Wendy tel: 832133

tel: 01309 690063

admin@winterburnmedia.co.uk


“We live in uncertain times” - I seem to have heard that refrain quite a lot recently but I do wonder whether there is a temptation to often fear the worst before it has actually happened. History does of course remind us that times do change and some regimes are worse than others so we can be forgiven for thinking the worst but fortunately this is most often not the norm! How we deal with the fear of the unknown affects us daily. A healthy degree of caution is always recommended but also is keeping a sense of perspective. A wise writer once said - “whosover will add a day to his life by worrying?” Probably right!

TM

Window & Conservatory Blinds Beautiful Blinds at

PUBLISHER ..............David Nelmes ADVERTISING ..............Susan Innes ACCOUNTS ...................Wendy Day PRODUCTION .........Linda J Donald

Super Prices Call for an appointment today! CALL US NOW ON 01542 840 700 Or email: ian@blindpassion.co.uk www.buckieblinds.co.uk

January Issue Deadlines Editorial - Friday 02/12/16 Advertising - Wednesday 07/12/16

Experience the magic of

Christmas at Decora

The North of Scotland's largest Christmas Store A one-stop shop for festive inspiration including: Decorations | Trees Gift Ideas | Furniture and much more to dress your home in style

See our Xmas store and bear band on our Facebook page


www.spotlighton.co.uk

The Free Community Information website - Free to view and Free to upload your listings. View our entire database of Clubs and Societies, Trades Listings, What’s On Diary, Restaurants, Reviews and articles, Schools, Holidays Tides, Useful Numbers and more... PASTORAL LETTER & CHURCH MEETINGS

Merry Christmas! What does that greeting mean to you, and what does it stir up in us? To a lot of people, it is the time of year to get together with family, or friends or maybe a quiet time with your partner. To others, this time of year is a lonely time, spending it on their own, or possibly it is the first Christmas without a loved one. But this is the time of year where we can look to help others. It is often called the season of goodwill to all people, and we can find opportunities to show kindness to those who are less fortunate than ourselves. One of the annoyances at this time of year is the commercialism of it all, starting as early as November, and often earlier. This takes away from the value of the season, and by the time Christmas comes along, often we can be fed up of it, which is a great shame. There are many reasons to

celebrate this time of year, but the central theme is the birth of the Lord Jesus Christ. I like what the Bible says in Isaiah 9, “For unto us a child is born, unto us a son is given; and the government shall be upon his shoulders, and his name shall be called Wonderful, Counsellor, Mighty God, Everlasting Father, Prince of Peace. Of the increase of his government, and of peace, there will be no end.” Often, the question is asked, ‘Where is the peace that God speaks about?’ The problem is that some people don’t want peace nor do they respect other people’s freedom, and choose to maim and kill. God gives us a choice, whether to live under His government and rule, or to choose to live without Him, with all the consequences that come with it. Above everything else this year, my sincere wish is for people to give themselves to the Lord, repenting of their sin, and

Holy Trinity Scottish Episcopal Church Seafield Avenue, Keith. Sunday, Family Eucharist at 11:30am & Wednesday Morning Prayer at 9:30am. Last Thursday of each month a Service of Prayer & Reflection at 7pm. Tel: 01542 882782. Keith, Church of Scotland - North, Newmill, Boharm & Rothiemay. North Church: Sundays 11am. Boharm Church: Mulben Village Hall. First Sunday of the month at 9.30am. Rothiemay Church: Last Sunday of the month at 9:30am. Rev Alastair H Gray. Call 01542 886390 or visit keithnorthchurches.org Keith, Church of Scotland - St Rufus, Botriphnie, and Grange. St Rufus Church: Sundays 10.15am. Botriphnie Church: Alternate Sundays 11.45am. Grange Church: Alternate Sundays 11.45am. Keith, St. Thomas’ Church RC Vigil Mass: Sat 6:30pm. Sunday Mass: 10:30am. Confessions on request. Tel: 01542 882352. Portessie Methodist Church Portessie, Buckie. Sunday services at 11am & 6pm. Portgordon Community Church Sunday Morning Worship - 11am in the Portgordon Community Centre. Contact Pastor Willie Aitken on

page 6 - December 2016

accepting Christ as their Lord and Saviour. The lyrics of one of John Lennon’s songs says, ‘All we are saying is give peace a chance.” Jesus said this in John 14:27a, “Peace I leave with you; my peace I give to you. Not as the world gives do I give to you.” What if that could be a reality, what if we choose to accept this wonderful life, free from aggravation? Well, it can be your reality right now, just ask Jesus to come into your heart. It is the simplest thing we can do, yet it is the most profound thing we can do. I hope and pray that this Christmas, and the years ahead will be filled with blessings. Merry Christmas to you. Pastor John Coppard Riverside Church, Buckie.

01542 835007 or visit www.portgrdoncommunitychurch.com Portknockie Church of Christ Sunday 11am: breaking of bread. 6pm: gospel service. Friday 7pm: prayer meeting and Bible study. Ladies fellowship (September - March) every second Monday 7pm. Wednesdays 8am: prayer breakfast. Contact the leader Mr Stewart Gray on 01542 836007. Portknockie Church of Scotland Sundays 11.15am. All welcome. Call Morag Ritchie: 01542 840951 or Heather Reid: 01542 840921. Rathven Church of Scotland Sunday 9.45am led by the minister Rev Isabel Buchan or an authorised local preacher. Contact Rev Isabel Buchan on 01542 832118 or Ann Grant on 01542 831607. Riverside Christian Church Buckie. Sundays 10.30am. Tel: 01542 833923. Website: www.riversidebuckie.org St Peters Church RC St Andrews Square, Buckie. Saturday Vigil 6.30pm. Sunday Mass 10am. Resident priest: Rev Tad Turski. Tel: 01542 832196. Listed H - S and regularly rotated. If you are a member of a church not listed or to amend existing details, email tamsyn@spotlighton.co.uk

tel: 01309 690063

admin@winterburnmedia.co.uk


J.R HENDERSON & SONS LTD MEMORIALS OF DISTINCTION

Memorials Inscriptions Plaques and Vases Renovations 4ELs.EW%LGIN2D %LGIN WWWELGIN MARBLECOUK

EVERYTHING TO KEEP YOU COMFORTABLE THIS WINTER Variable angle lift & tilt on seat lift Single motor tilt-in space action Simplicity of just two handset buttons

21 West Road, Greshop Industrial Estate, Forres IV36 2GW (Behind Lidl) 0QFO.POEBZ'SJEBZBNUPQNt&BTZQBSLJOHEJTBCMFEUPJMFUGBDJMJUJFT 01309 676677 tTBMFT!XIFFMDIBJSDBSFDPVL

Fireplaces & Stoves Kitchen Worktops in Granite, Quartz & Silestone 9-5 Mon-FrL‡-4 Sat Traditional and Contemporary designs supplied and fitted New Elgin Road | Elgin | Moray | IV30 6BA

Tel: 01343 547289 e-mail: info@elgin-marble.co.uk

www.elgin-marble.co.uk

T H E

ELGIN MARBLE C O M PA N Y

Craftsmen in marble since 1919


www.spotlighton.co.uk

The Free Community Information website - Free to view and Free to upload your listings. View our entire database of Clubs and Societies, Trades Listings, What’s On Diary, Restaurants, Reviews and articles, Schools, Holidays Tides, Useful Numbers and more... USEFUL INFORMATION

Local & Bank Holidays and Special Days St Andrew’s Day Shortest Day Christmas Day Boxing Day Boxing Day (subst. day) New Year’s Eve New Year’s Day New Year’s Day (substitute) Burns Night

Wed 30th Nov 2016 Wed 21st Dec 2016 Sun 25th Dec 2016 Mon 26th Dec 2016 Tues 27th Dec 2016 Sat 31st Dec 2016 Sun 1st Jan 2017 Mon 2nd Jan 2017 Wed 25th Jan 2017

Valentine’s Day Shrove Tuesday Ash Wednesday Mothering Sunday British Summertime Starts

Tues 14th Feb 2017 Tues 28th Feb 2017 Wed 29th Feb 2017 Sun 26th Mar 2017 Sun 26th Mar 2017

§ Buckie, Cullen, Findochty, Keith & Portknockie ‡ includes Fochabers, Garmouth, Kingston, Mosstodloch & Spey Bay

School Term Dates for 2016/2017 (all dates inclusive) Winter Term Ends Thurs 22nd Dec 2016 Christmas Holiday Starts Fri 23rd Dec 2016 Christmas Holiday Ends Fri 6th Jan 2017 Spring Term Starts Mon 9th Jan 2017 Mid Term Holiday Fri 10th Feb 2017 Mid Term Holiday Mon 13th Feb 2017 Spring Term Ends Fri 31st Mar 2017 Spring Holiday Starts Mon 3rd Apr 2017

Spring Holiday Ends Summer Term Starts May Day Holiday In-Service Day In-Service Day Occasional Day Keith Occasional Day Buckie Summer Term Ends Summer Holiday Starts

Fri 14th Apr 2017 Mon 17th Apr 2017 Mon 1st May 2017 Thurs 18th May 2017 Fri 19th May 2017 Mon 5th Jun 2017 Mon 12th Jun 2017 Fri 30th Jun 2017 Mon 3rd Jul 2017

Useful Contacts Police Station ......................................................................101 Buckie Leisure Centre ........................................01542 832841 Keith Community Centre ....................................01542 882222 Keith Swimming Pool ........................................01542 882222 Keith Resource Centre ......................................01542 886174 Keith Library........................................................01542 882223 Keith Sports & Com. Ctr ....................................01542 882222 Moray Council Access Point, Keith ....................01542 885500 Registrar ............................................................01542 885525 Keith Tourist Info. Ctr ..........................................01542 888423 Keith Community Bus ........................................01542 886390 Babs Dial A Bus..................................................01542 835800 National Rail Enquiries ......................................03457 484950 Dial ‘M’ For Moray Buses ..................................03001 234565

SCHOOLS Botriphnie Primary School ..................................01542 810207 Cluny Primary School ........................................01542 831417 Crossroads Primary School................................01542 870221 Cullen Primary School ........................................01542 840279 Findochty Primary School ..................................01542 832287 Keith Primary School ..........................................01542 882802 Millbank Primary School ....................................01542 831113 Milne’s Primary School........................................01343 820977 Mosstodloch Primary School ..............................01343 820476 Newmill Primary School ......................................01542 882788 Portessie Primary School ....................................01542 832288 Portgordon Primary School ................................01542 831198 Portknockie Primary School................................01542 840244 Rothiemay Primary School ................................ 01466 711220

page 8 - December 2016

St Peters RC Primary School ..............................01542 831339 St Thomas RC Primary School ..........................01542 882256 Buckie High School ............................................01542 832605 Keith Grammar School ........................................01542 882461 Milne’s High School ............................................01343 820611

DOCTORS NHS 24 ................................................................................111 Ardach Health Centre..........................................01542 831555 Seafield Medical Centre ......................................01542 835577 Seafield & Cullen Medical Group ........................01542 835577 Keith Medical Centre ..........................................0345 337 9944 Dr Grays Hospital, Elgin ......................................0345 4566000

DENTISTS 8 to 8 Dental Buckie ..........................................01542 833087 Buckie Dental Practice ......................................01542 831163 The Keith Dental Practice ..................................01542 886251 8 to 8 Dental Keith ..............................................01542 882507

PHARMACIES Bairds Pharmacy, Keith ......................................01542 882512 Clarks Pharmacy, Fife-Keith ..............................01542 882533 Cullen Pharmacy ................................................01542 840220 Listermac Pharmacy, Union St ..........................01542 840268 Listermac Pharmacy, W. Church St....................01542 833321 W.S. Taylor, Buckie ............................................01542 831116 Normac Pharmacy, Buckie ................................01542 831147 To add a contact or for amendments to existing details, please email linda@winterburnmedia.co.uk or call 01309 690063

tel: 01309 690063

admin@winterburnmedia.co.uk


Words by the Wayside "But as many as received him (Jesus Christ), to them gave He power to become the sons of God."

NOW OPEN State of the art Gym and Juice Bar in Buckie town centre. The gym has over 70 machines, including Olympic, free and fixed weights, ladies only area and cardio training zone. Our Juice Bar has a selection of Fresh Fruit Juices, Smoothies and Protein shakes – perfect for a post workout refuel, or a healthy snack. Come along for a tour of the facility or to try out our Juice Bar. OPENING TIMES 6am-9pm Mon to Friday 7am-9pm Saturday 8am-6pm Sunday 23-27 High Street Buckie, AB56 1AL 01542 834115 info@motion-fitness.co.uk

Hiland Protein Scottish Premium Protein and Supplements Now available at Motion Fitness Order now via Email : info@motion-fitness.co.uk By phone : 01542 834115 On Facebook : @hilandproteinscotland ‡ :KH\3URWHLQ ‡0DVV*DLQHU ‡'LHW:KH\ ‡&UHDWLQH0RQRK\GUDWH ‡3UH:RUNRXW

(John 1:12)

Reader, you don't become a Christian because you were born into a Christian home or country and you cannot earn your salvation with God by good works or an upright moral life, nor by joining a church or passing a Theological course. To become part of God's family you must repent of your sin and receive Jesus Christ as your Saviour. Are you a Christian? www.wordsbythewayside.co.uk Registered Scottish charity SC041290

ACL McLeod Chimney Sweep Traditional Chimney Sweep Gutter Cleaning Supplier and Fitter of different Cowls

Telephone 01340 831546 or 07887 611532

Email address: acmcleod@msn.com

R McGregor M O N U M E N TA L E N G R AV E R Additional inscriptions, Regilding, Raised lead lettering, Cleaning of headstones also re-fixing done in any cemetery Phone:01309671982 ‡ Mobile:07740950580 42 Randolph Lane Forres


www.spotlighton.co.uk

The Free Community Information website - Free to view and Free to upload your listings. View our entire database of Clubs and Societies, Trades Listings, What’s On Diary, Restaurants, Reviews and articles, Schools, Holidays Tides, Useful Numbers and more... PARLIAMENT BLOG & TIDE TIMES

With the colder winter nights now upon us it’s time keep an eye out for our elderly and more vulnerable neighbours. With over 13000 households in Moray living in fuel poverty it is important that home owners explore all avenues to upgrade their home heating or insulation, with free advice being available from the Energy Saving Trust (http://www.energysavingtrust.org.uk/scotl and) or by calling 0808 808 2282, calls are free and they are available Monday to Friday from 8am to 8pm, and on Saturday from 9am to 5pm. The festive time is one best shared with family, friends and loved ones so let us take a moment to remember those who are away from home at this time, perhaps working offshore or protecting us serving in the armed forces or indeed those who are in hospital, along with the doctors and nurses caring for them.

Our health and wellbeing is something often taken for granted but if we take the time to look out for others we can all make the coming new year a happy and prosperous one. May I extend my warmest greetings for a Merry Christmas and wish everyone a very Happy New Year when it comes.

It’s nearly Christmas and so the first thing to say is all the very best of the season to you and yours! If you have time off at Christmas and New Year with family and friends then make the most of it and use the time well. If you are working during the holiday period, possibly even on Christmas Day, then a huge thank you whether you are in the emergency services, working in health or social care, hospitality workers serving up Christmas dinners, retail staff dealing with the huge rush of Christmas shopping and Boxing Day sales, farm workers making sure animals are fed and watered in all weathers or road workers out gritting. Whatever line of work you are in a huge thank you for keeping everything moving!

With Christmas fast approaching and there having been much hype around so-called Black Friday sales and big discounts from online retailers – often to the detriment of local shops – I wanted to take the opportunity to highlight my support for our local businesses. While I appreciate that household budgets are stretched more than ever at this time of year – we should do everything we can to shop at local businesses which are often at the heart of our communities. I hope shoppers throughout Moray can find time to support our local, independent businesses when carrying out their Christmas shopping this year. I know that local spending will be very much appreciated by local retailers and their staff. I would like to wish all readers a very merry Christmas and a happy, prosperous new year. 2017 is another year that holds a lot in store and I hope that whatever you have planned for the coming year works out well for you.

Angus Robertson MP

Richard Lochhead MSP

Douglas Ross MSP LOW TIDE TIMES FOR BUCKIE IN DECEMBER Walking on the beach should be possible 2 hours either side of these times 1 2 3 4 5 6 7

TH F SA SU M TU W

AM 06.41 07.13 07.47 08.23 09.04 09.55 11.00

page 10 - December 2016

PM 19.01 19.36 20.12 20.52 21.39 22.38 23.51

8 9 10 11 12 13 14 15 16 17 18 19

TH F SA SU M TU W TH F SA SU M

AM 12.18 01.10 02.21 03.20 04.12 05.00 05.48 06.34 07.18 08.01 08.40 09.19

PM 13.37 14.45 15.42 16.35 17.26 18.17 19.07 19.56 20.44 21.31 22.21

tel: 01309 690063

20 21 22 23 24 25 26 27 28 29 30 31

TU W TH F SA SU M TU W TH F SA

AM 10.03 10.59 00.23 01.32 02.31 03.20 04.00 04.37 05.13 05.49 06.25 07.01

PM 23.17 12.15 13.42 14.49 15.39 16.20 16.58 17.36 18.14 18.51 19.30

admin@winterburnmedia.co.uk


recipe

Chef’s Confidential

Savoury Feta Cheese Muffin Muffins tick all the boxes—they’re loved by kids and adults alike, they can be sweet or savoury but always provide a satisfying snack, they come in handy individual portions, and they provide a truly endless variety of recipe possibilities. They’re simple to make, and a great way to experiment with new flavour combinations. This month’s recipe is supplied by The Peppermill Restaurant in Forres. Ingredients: (makes 12) 4 cups plain flour 1 cup wholemeal flour 4tsp baking powder 1tsp bicarb. soda 350ml oil 350ml yoghurt 5 eggs splash of milk 200g feta cheese 1 bag of spinach, cooked Method line a 12 hole muffin tray with muffin cases, or grease well. preheat the oven to 180 degrees. Sieve the flours, baking powder and bicarb. together in a mixing bowl, and add the spinach and feta and coat in the flour mixture. Mix the oil, eggs, yoghurt and milk together and add 3/4 to the flour mixture, adding more if needed. specks of flour should remain in the mixture and it should not be overmixed. divide the muffin mixture into the prepared muffin tray (fill the cases to the top) and bake until well risen and firm to touch.

118 High Street, FORRES IV36 1NP‡¬


The Trading Post Buckie Extra Thick Foam Cantebury Draught Strip - 5m Kettle - /

Â…49

Â…99 Power Steam Intellitemp Steam Generator Iron

9 Cordless Lithium Drill Driver

morphy richards

SAVE

Â…99

Â…99 N: Halogen Heater

Automatic locking

Dulux Pure Brilliant :KLWH /

Forte Dehumidifier 10L White/Black

LED Slimline loodlight with LED Bulbs 3,5: +DORJHQ3,5)ORRGOLJKWV 99

Â…99

Â…99

Â…99

Â…

: : :

Pack of 2

8 Sachets

Â…99

:

Â…99 Electronic 5HSHOOHU

Optical Smoke Alarm Long Life

Â…99

Â…99

Â…99

Â…99 Digital Carbon Monoxide Alarm

Internal powerpack Liner

Â…99

Â…99

Â…99

Â…99

Â…99

:DWW/('5HFKDUJHDEOH Spotlight

Double

Â…99

Zip Firelighters 40 Blocks

never need to change the battery

Machine washable Single

Â…99

Flame-failure protection device

20L Black/Silver

Heated Underblanket

Ultrasonic and electromagnetic repeller

Gas Cabinet Heater

Â…99

Sure Set Mouse Trap

Mouse Killer Bait

Â…99

SAVE

£14

Â…99

NEW

P7HOHVFRSLF Extension Ladder

£120

50m Portable Doorchime

‡5HDOLVWLF flame effect ‡N:DQG N:IDQ

£3999

Spiralizer

Â…99

Bampton Log Basket

Vista Electric Stove

Â…99

Â…99

01542 832369

Â…99

NEW

Ascot HALF Dome Sparkguard PRICE Fire retardent finish Ash Vacuum Cleaner - Electric 1m hose

Â…99 Loop Companion Set

26 East Church Street, Buckie AB56 1AB


Harrison’s Heating Taking care of all your plumbing requirements

t%FEJDBUFE)FBUJOH%JWJTJPO t/BUVSBM(BT -1(0JM t4FSWJDJOH3FQBJS8PSL.BJOUFOBODF t-BOEMPSE$FSUJöDBUFT t/FX#PJMFS4VQQMZ*OTUBMMBUJPOT t3BEJBUPS4ZTUFN1PXFS'MVTI *VTWL[P[P]L9H[LZ‹-HZ[ -YPLUKS`:LY]PJL -JOLXPPE1MBDF&MHJO*7);PS

SUPPORTING YOUR LOCAL COMMUNITY FROM OUR INVERNESS AND HUNTLY DEPOTS

Home Heating Oil Marine Gas Oil Tractor Diesel Commercial Fuels Oil Storage Tanks Call us for a free quote on 0800 224224 www.highlandfuels.co.uk


DOWNSIZE YOUR HOME UPSIZE YOUR LIFESTYLE Have you considered a residential park home at Grosvenor Park, near Forres?

More and more people are discovering park home living and the benefits that come with it. With all the features of a bungalow, a brand new fully furnished park home offers a low cost, low maintenance alternative to a traditional home.

All this and more included in your residential park home…

Making the move is easy • Stay all year round • All homes are fully furnished and ready to move in • Development created exclusively for the over 50’s

Stunning, open plan interiors

• No agent’s fees or stamp duty to pay • Move in, in just 7 days • Live in a beautiful park setting with like-minded neighbours

Where else can you get a brand new, fully furnished home from just

£69,995 to £140,000

Modern, fully fitted kitchens

Luxurious bedrooms with fitted wardrobes

Riverview Country Park Creating Communities

Call to let us know you’re coming on 01343 812000 www.RiverviewCountryPark.co.uk Grosvenor Park at Riverview Country Park, Mundole, Forres, IV36 2TA


findhorn foundation & wastebusters (camping equipment only), waterford, forres.

Promote your events in the SpotLight ‘What’s On’ You can now go online at www.spotlighton.co.uk Register an account and put your event online and in the magazine - both for free Any events uploaded to the website by the closing date will be automatically printed in the magazine. Now there’s clever!! *January Issue Deadline: Friday 2nd December* Alternatively, you can still Email: linda@winterburnmedia.co.uk or Telephone: 01309 690063 Inclusion of events in What’s On is free. We do not accept submissions for classes, courses or workshops. Contact venues & organisers first as there may be changes to events.

Rolling Events until 4 December pop-up craft shop in aid of marie curie cancer care (back for 4th year) every thurs, fri, sat & sun 11am 3pm at the wee cabin, firwood, nethybridge. free. for info contact janet taylor on 01479 821601 or email janet.taylor77@btinternet.com

until 31 December Moray supports refugees: appeal for warm clothing, tents & equipment for adults, children & babies living in refugee camps this winter. collection points at the sorting centre, chanonry estate, elgin (near blind spot) thursdays 2pm - 4.30pm & fridays 11.30pm - 2pm; babalou,high street,forres; reboot, greshop road, forres; the drop off caravan, pineridge, admin@winterburnmedia.co.uk

NOVEMBER 2016 28 monday rachel sermanni@the drouthy cobbler, elgin 8pm. www.thedrouthycobbler.co.uk

29 tuesday adam sutherland & marc clement@the drouthy cobbler, elgin 8pm. www.thedrouthycobbler.co.uk

30 wednesday the drouthy cobbler comedy club 7.30pm. visit www.thedrouthycobbler.co.uk alzheimer scotland - musical memories 1.30pm 3pm at new elgin & ashgrove hall, land street, elgin £1 (incl teas & coffees). an opportunity for anyone with dementia & their carers to meet & in the enjoyment of music, singing & memories. for info contact: shirley mackenzie on 01343 552080/07584 408209.

DECEMBER 2016 1 thursday earthtime xmas crackers 4pm - 5pm at aberlour library. free. all children welcome to make xmas crackers from recycled material with earthtime. need to book a place. contact: 01340 871693. bullet for my valentine@ironworks, inverness. tbc, www.ironworksvenue.com.

3 saturday earthtime xmas crackers10.30am - 11.30am, cullen library. free. all children welcome to make xmas crackers from recycled material with earthtime. need to book a place. contact: 01542 841140. christmas craft fair & coffee morning 9.30 am 12pm, portessie public hall. adults £2.50, children £1.00. various craft and local charity fundraising stalls, hall sales table and raffle. donations welcome. contact: alison on 01542 836095 oer email portessiepublichall@hotmail.co.uk.

tel: 01309 690063

December 2016 - page 15


garden

GreenThumb

UK FRANCHISE OF THE YEAR RUNNER UP

2013

Lichen – fungus on the lawn explained ! I’ve mentioned this before. One of the joys of our wonderful environment up here is the clean air, and one of the organisms which thrives locally (but rarely in Glasgow) is dog lichen. There are hundreds of species here, growing on trees, rocks and on the grass ! It is particularly at home on ground which has become compacted and is low on nutrients. It is one of the most common questions we get from baffled homeowners, and many have found that the garden centre people aren’t sure how to deal with it. We shift it by aerating the ground with a big hollow-core tining machine which removes thousands of cores from

grass. As with all things in nature, it’s about competition. There are no chemical products which remove lichen. Golf courses do this all the time, and so do we. Aerating the ground over winter should be part of routine lawncare in any case. The freeze/thaw, freeze/thaw weather we get compacts most ground round here which prevents tender new plant roots spreading, even if the grass has had a spring feed. The ground is too solid.

For more information about our annual lawncare plans from just £11.25 per mth, plus useful downloads and photos, go to www.greenthumb.co.uk. Although GreenThumb is a multi-award winning national franchise, and is the runaway leader in the sector with half a million customers, we are the family-run local franchise covering the wider Moray Firth area. Contact Alastair or Fiona for a FREE LAWN ANALYSIS on 01667 460012, or email us at: the ground allowing air to circulate. A regular feeding programme for the lawn strengthens the grass and this tips the balance of conditions back in favour of the

inverness@greenthumb.co.uk

Alastair Watt


Prices from just

ÂŁ11.25 per month


grandmaster flash@ironworks, inverness 7.30pm. visit www.ironworksvenue.com moray conservative & unionist association christmas coffee morning 10am - 12pm, new hall, st giles church, elgin. adults £3, children free. festive stalls. raffle. all welcome. buckie choral union annual christmas concert 7.30pm, methodist church, north pringle street, buckie. £10 adults £5 children from members. special guests - the bel canto youth choir. all welcome. xmas rock & roll bingo 7pm, keith golf club. £10 (incl 4 games & food). all welcome. tickets from keith play centre.

3 saturday - 4 sunday brodie castle christmas craft & food fair 10am - 4pm, brodie castle. £4. exclusively highlands return to brodie castle with over 40 stalls of wonderful wares and fabulous foods. contact: rebecca harrison on 01309 641371 or email raharrison@nts.org.uk. visit www.nts.org.uk.

4 sunday christingle service in inchberry hall 6.30pm 7.45pm, inchberry hall. delightful candlelit nativity, community kirk evenng service with appeal for children & adults alike. www.wherecanwego.com.

7 wednesday friends of grant lodge, agm. 7pm, elgin museum hall speaker, rona walker, historic environment scotland, will talk about the new exhibition in elgin cathedral. refreshments. moray, banff & badenoch decorative & fine arts society (mbbdfas): 'the brilliant british humour in the forgotten art of the picture postcard' - lecture by dr james taylor. 11am, st columba's church, duff avenue, elgin.new members welcome. contact: membership@nadfas-in-elgin.org.uk or visit www.nadfas-in-elgin.org.uk.

7 wednesday - 10 saturday elgin amateur dramatic society: cinderella 7.30pm each evening; sat 10th matinee at 2pm, elgin town hall. £11 adult or £9 child/concession, 10% discount for parties of 10 people or more. for info visit www.elgindrama.co.uk.

8 thursday christmas reminiscence fochabers 3pm - 4pm, fochabers library. free. all welcome to christmas memories of fochabers with members of the fochabers heritage group. call 01343 821434.

9 friday 2manydjs@ironworks, inverness. tbc. visit www.ironworksvenue.com. martha reeves & the vandellas@ironworks, inverness. 7pm. visit www.ironworksvenue.com.

page 18 - December 2016

10 saturday “a banffshire baker at large on the bbc." 2.15pm 3.45pm, st rufus' church hall, turner street, keith. members £2 & visitors £3. speaker: norman calder contact: dr alistair mason on 01261 812941 or email alistair.mason@btinternet.com. visit www.banffshirefieldclub.org.uk. stars for thought christmas tree lights switch on 4pm, north church, mid street, keith. all proceeds to the sunshine playgroup. carol singing. hot chocolate & star shortbread after the event. raffle & star for thought labels for sale (£1). spey bay kids' christmas party 2pm, spey bay community hall. open to all children in the spey bay catchment area. all children must be accompnaied by a responsible adult. contact:fiona stedman on 07947 338430. we were giants@mad hatters, inverness. tbc, free let's go back to the 80's@ironworks, inverness. tbc, visit www.ironworksvenue.com. winterslam@ironworks, inverness. 7pm, ironworks, inverness.visit www.ironworksvenue.com. fochabers, bellie & speymouth parish annual christmas sale 10am - 12pm, bellie church hall, the square, fochabers. usual stalls. comae & see santa! inchberry hall folk music christmas concert (idca): emily smith, multi award winning scottish folk singer - folk music band doors open at 7pm for 7.30pm 10pm, inchberry hall. tickets - see website. contact: http://www.wherecanwego.com. keith show: bring a party to a party tbc, longmore hall, keith. £30. 3 course dinner & dancing to current affair. contact: tina craib on 01542 882978 or email info@keithshow.org.uk.

10 saturday - 11 sunday christmas market at logie steading 10am - 3.30pm, logie steading, south of forres off the a940. free, free parking. two day market: over 30 stalls including jewellery, christmas trees, wreaths, gifts, festive produce. bbq. hot drinks. for info contact: panny@logie.co.uk. visit www.logie.co.uk.

11 sunday christmas at the castle: the marvel of peru 3pm & 5pm, brodie castle. £15. a festive ensemble of baroque music & your favourite carols to join in with by the marvel of peru. booking advised. contact: rebecca harrison on 01309641371 or email raharrison@nts.org.uk. visit www.nts.org.uk/events.

12 monday light & life 7pm - 9pm, costa coffee, high street. elgin free. spiritual readings & art, personality styles, dream interpretation, massage, healing for body, soul & mind. contact: alyson sim on 07733 127539.

14 wednesday christmas tombola doors open 6.30 pm, eyes down 7.30 pm., portessie public hall. £1. star prize £75 of

tel: 01309 690063

admin@winterburnmedia.co.uk


18 sunday

grocery vouchers. please bring a cup. contact: rosella on 01542 833969 or email portessiepublichall@hotmail.co.uk. the drouthy cobbler comedy club 8pm. visit www.thedrouthycobbler.co.uk. alzheimer scotland - musical memories 1.30pm 3pm, new elgin & ashgrove hall, land street, elgin £! (incl teas & coffees). an opportunity for anyone with dementia & their carers to meet & share in the enjoyment of music, singing & memories. contact: shirley mackenzie on 01343 552080/07584 408209. frightened rabbit@ironworks, inverness 7pm. visit www.ironworksvenue.com.

spey bay christmas carol service 6.30pm - 8pm, spey bay community hall. an evening of christmas carols & music from the youngters from take note. service led by rev morris smith, locum. andrew mill & four fingered fre@hootananny, inverness. 9.30pm celebrate christmas with cantare 7pm, elgin town hall. £8 adults. £4 children. "cantare" - elgin ladies choir - sing songs and carols to celebrate christmas. tickets from cathedral windows

15 thursday

amy henderson & brian o headrha@hootananny, inverness 9.30pm.

seated singing & moving christmas exercises 11am12pm, dufftown library. free. join kath todd for a christmas themed all seated gentle exercise & singing session. contact: 01340 820272.

16 friday mad ferret band@hootananny, inverness 9.30pm, root system/fighting caravanshootananny, inverness 9.30pm, all welcome. gary beck@ ironworks, inverness 10pm. visit www.ironworksvenue.com.

17 saturday stagestars scotland keith: breakfast with santa 10am - 12pm, stagestars scotland keith. £15 (u2s free with paying adult). luxury continental breakfast. festive family activities, fun with the elves & treats from santa. contact: seonaid or email seonaid@stagestars-scotland.com. caman@hootananny, inverness 9.30pm winters winding walk & festive lunch hosted by nw grampian ldwa 9.30am, fochabers square. £20 (lunch). 12 mile walk along part of the speyside way. gordon castle cafe for festive lunch. booking essential. contact: tracy davidson at tracydavidson@hotmail.com. visit www.ldwa.org.uk/northwestgrampian. keith show: bring a party to a party tbc, longmore hall, keith. £30. 3 course dinner & dancing to ziggy & toni. contact: tina craib on 01542 882978 or email info@keithshow.org.uk.

17 saturday - 18 sunday bring a party to a party: save the date christmas 7.30pm - 12.30am, the fisherman's hall, buckie hosted by buckie christmas kracker. dancing to cover to cover. meal prepared by silver spoon catering. meet cinderella 10am -4pm (hourly slots), brodie castle. £6. come along and meet one of your favourite princesses and take away a magical gift. booking advised to ensure your place. contact: rebecca harrison 01309 641371 or email raharrison@nts.org.uk. visit www.nts.org.uk/events.

admin@winterburnmedia.co.uk

22 thursday 23 friday elephant sessions@ironworks, inverness tbc. visit www.ironworksvenue.com ho-ro@hootananny, inverness 9.30pm.

27 tuesday red hot chilli pipers@ironworks, inverness 7.30pm. visit www.ironworksvenue.com ragin ceilidh band@hootananny, inverness 9.30pm.

31 saturday the red hot highland fling 8pm, northern meeting park, inverness. free. legendary family friendly (no tickets required) hogmanay concert. hogmanay dance 9pm - 1am at rothes fc social club. £10. visit rothesfcsocialclub.co.uk.

This space could have been promoting your business! SpotLight covers six areas along the Moray Firth Coastline from Buckie & Keith across to Inverness and then down to Aviemore - and all the places inbetween! Contact us for details of rates and sizes:

tel: 01309 690063

(01309) 690063 December 2016 - page 19


ali paterson ltd. windows U doors U roofline telephone

01343 842752 07974 447268 mobile

ali-paterson@hotmail.co.uk

ELGIN

Samaritans are looking for new volunteers. Could you volunteer with us? To find out more about volunteering with Elgin Samaritans email us at elginsams@outlook.com

Call Till 8pm, Email or Scan the Code to the Left Via Your Messenger App • LARGE SECURE STORAGE WAREHOUSE • • POLICE & FIRE ALARM & 24HR CCTTV •

www.andersons-removals.com info@andersons-removls.com SC394424


HARRISON'S WINDOWS 16 Linkwood Place, Elgin – IV30 1HZ

WINTER DEALS PVC - FRONT AND BACK DOOR SUPPLIED AND FITTED

ONLY £1,000 inc VAT

GUARA

NT E E

G U A RA

NTEE

COMPOSITE DOOR - SUPPLIED AND FITTED

ONLY £999 inc VAT

DECEMBER SPECIAL - SEVEN WINDOWS AND 2 GLAZED DOORS FOR

ONLY £4999 inc VAT

10 year guarantee on our windows and doors with 2 year workmanship

CALL HARRISON’S TODAY ON

01343 551331 Mon-Fri 9am-5pm Saturdays 10am-2pm


Allan Murdoch Autobody Repairs Over 25 Years Experience %RG\5HSDLUV‡5HVSUD\V‡,QVXUDQFH:RUN‡%RG\NLWV )UHH(VWLPDWHV‡&RPSHWLWLYH5DWHV‡4XDOLW\$VVXUHG &RXUWHV\&DU$YDLODEOH‡6SHFLDOLVWLQ1RQIDXOW$FFLGHQW5HSDLUV

:RUNVKRS  0RELOH  22 Perimeter Road, Pinefield Estate, Elgin www.allanmurdochautobodyrepairs.co.uk

MOT AND GARAGE SERVICES Now Open Fochabers new MOT Centre


Words by the Wayside "And the Lord Jesus said unto another, ‘Follow me’, But he said, ‘Lord, suffer me first…’ " (Luke 9:59)

Christian, as followers of our Lord Jesus Christ, we should not be saying to Him "suffer me first" but "Lord, what will thou have me to do?" Accept the calling, don't kick against the pricks of your conscience, embrace God and His will and His ways, and the joy of the Lord will be your strength. Christian, surrender your will, be nothing, that God might be all. www.wordsbythewayside.co.uk Registered Scottish charity SC041290

Don’t suffer this year...

FLU VACCINES ONLY

£20!

FORRES POP UP CAFE RESTARTS FEBRUARY 2017 CONTACT US FOR DETAILS THANK YOU FOR JOINING US THIS YEAR!

CONTACT US: 07989 331651, moraywellbeinghub.org.uk moraywellbeinghub

wellbeingmoray

DENTURE

REPAIRS

01542 835525 28 LAND STREET, BUCKIE AB56 1QS. e: denturamics@btconnect.com

Occupational Health Vaccines are FREE for:

t)PNF$BSFSTt t4PDJBM$BSF4FSWJDFTt t/)4&NQMPZFFTt

We offer private vaccinations administered in our private consultation room. For an appointment contact.

CLARK’S PHARMACY

12 Regent St, Keith Tel: (01542) 882533 28-30 Seafield St, Cullen Tel: (01542) 840220 Balvenie St, Dufftown Tel: (01340) 820228

CAR VALETING DETAILING SERVICE PAINT CORRECTION CARS, VANS, TRUCKS & MOTORCYCLES FULLY INSURED MOBILE SERVICE

CALL TODAY: 07877

316809

WWW.PITSTOP-VALETING-TINTS.CO.UK


Making Whole Family Recovery Possible Arrows is a holistic service for individuals affected by alcohol and drugs. We support both Adults experiencing drug and alcohol problems, and children and families affected by a loved one’s substance use. The range of supports available in Arrows are both individual and group centred and can be used as part of a whole family approach to recovery or one to one support personally tailored and unique to each family’s circumstances.

program. Arrows work to improve coping strategies and parenting approaches through supporting effective communication, providing whole family activities, play and positive experiences.

As Recovery is personal the confidential nature of treatment and support with Arrows is upmost and we support individuals to understand the boundaries of sharing information, as well as making informed choices when involving loved ones within our whole family approach.

Friends, family or others connected to an individual may recognise their drug or alcohol issue first. Being in a close relationship with someone struggling with an addiction can be frustrating, painful and sometimes a lonely journey.

Worried about your substance use and its impact on your family and relationships? Individuals experiencing drug and alcohol issues may feel isolated from loved ones, unable to seek support from those closest to them or pressurised into establishing positive changes which can lead to deterioration within relationships, and creating further challenges for recovery. Arrows can support you to involve loved ones in your recovery at a pace and level that suits you. We can guide you to have conversations with loved ones inviting their involvement within your recovery plan. Many of our activities, groups and events are family inclusive; we provide focused support through couples and family counselling. Arrows work with parents experiencing substance issues to support their role as a parent within their recovery treatment

Arrows can support parents to recognise the needs of their children throughout their recovery journey, how to support them through the changes involved and in hearing their views within the family’s support.

Worried about a loved one and their substance use?

We can work with you using a range of CBT based tools, helping you cope and support your loved one. Many of these skills are valuable for the family even if your loved one does not enter treatment or has already begun the treatment process. Arrows can support friends and family to understand and discuss problematic substance use with their loved one to help prevent situations escalating.

Linking with Carers Support Family members often don’t recognise themselves as unpaid carers even though they are entitled to the carer supports available. Arrows and Quarriers Carers Support Service (Moray) can work with you on a joint register to ensure access to the training, short breaks and group supports available through their Service.

Talk to us Arrows - A Quarriers Service, 23 High St, Elgin, IV301EE $BMMt5FYU arrows@quarriers.org.uk

Opening hours .POEBZ'SJEBZBNQN 5IVSTEBZBNQN  SMART recovery Thursdays 5.30-6.30pm


Concerned about your own or someone else’s alcohol or drug use?

You’re not alone. Talk to us. Call 01343 610500 Text 07812 228547 Email arrows@quarriers.org.uk 6XSSRUWLQJ)DPLOLHVWR É É É É É

8QGHUVWDQGWKHUHFRYHU\SURFHVV 'HYHORSSRVLWLYHFRPPXQLFDWLRQVWUDWHJLHV *DLQQHZVNLOOVDQGFRQILGHQFH ,PSURYHWKHTXDOLW\RIIDPLO\UHODWLRQVKLSV %HLQYROYHGLQSRVLWLYHDFWLYLWLHVDWKRPHDQGLQ WKHLUFRPPXQLW\

Arrows )JHI4USFFU &MHJO  .PSBZ*7&& www.quarriers.org.uk/arrows

Quarriers is a registered charity no.Sc001960


PUZZLE PAGE

All answers printed in next issue of Spotlight

FOOTBALL CLUB

FIXTURES DECMBER 2016 3rd Dec (H) Montrose

10th Dec (H) Berwick Rangers

17th Dec (A) Arbroath

24th Dec (A) TBC

Inverness CT

3rd Dec (A) St Johnstone

10th Dec (H) Hamilton Accies

17th Dec (A) Kilmarnock

24th Dec (A) Rangers

Ross County

3rd Dec (H) Hearts

Elgin City

Buckie Thistle

3rd Dec (A) Fort William

28th Dec (H) Motherwell

17th Dec (H) Aberdeen

24th Dec (H) Partick Thistle

28th Dec (A) Celtic

17th Dec (A) Forres Mechanics

24th Dec (H) Cove Rangers

31st Dec (H) Rothes

10th Dec (A) 17th Dec (A) Wick Academy Strathspey Thistle

24th Dec (H) Fort William

10th Dec (A) Dundee 10th Dec (H) Nairn County

Clachnacuddin

3rd Dec (H) Formartine Utd

Forres Mechanics

3rd Dec (A) Deveronvale

10th Dec (A) Fraserburgh

17th Dec (H) Buckie Thistle

24th Dec (A) Keith

31st Dec (H) Formartine Utd

3rd Dec (A) Strathspey Thistle

10th Dec (H) Fort William

17th Dec (A) Nairn County

24th Dec (H) Forres Mechanics

31st Dec (A) Cove Rangers

Lossiemouth

3rd Dec (H) Wick Academy

10th Dec (H) Huntly

17th Dec (A) Inverurie Locos

24th Dec (H) Brora Rangers

31st Dec (A) Deveronvale

Nairn County

3rd Dec (H) Fraserburgh

10th Dec (A) Buckie Thistle

17th Dec (H) Keith

24th Dec (A) Formartine Utd

31st Dec (A) Clachnacuddin

3rd Dec (A) Inverurie Locos

10th Dec (H) Brora Rangers

17th Dec (A) Deveronvale

24th Dec (H) Fraserburgh

31st Dec (A) Buckie Thistle

3rd Dec (H) Keith

10th Dec (A) Formartine Utd

17th Dec (H) Clachnacuddin

24th Nov (A) Wick Academy

31st Dec (A) Fort William

Keith

Rothes Strathspey Thistle


Santa

...is coming

We have a large selection of sofas available to order for guaranteed delivery before Christmas. We also have sofas in stock for delivery now.

ORDER YOUR SOFA NOW FOR FREE DELIVERY IN YOUR AREA BEFORE CHRISTMAS

MONDAY-SATURDAY 9.30am-5pm

CLOSED DAILY 1-2PM (Open all day Saturday)

45-49 West Church Street, Buckie (01542) 832653 | buckiefurniture@gmail.com

Free Hearing Tests Free 30 day Hearing Aid Trial Ear Wax Removal Hearing Protection Tinnitus Advice Hearing Aid Repairs

17 Cluny Square Buckie AB56 1HA 01542 831423 www.morayhearing.co.uk

Showroom UNIT 1,TYOCK, ELGIN

BUCKIE

F U R N I T U R E AND CARPET CENTRE Beds Blinds Furniture and Flooring

Christmas Gift Vouchers now available

HORIZON BLINDS

ALL THE LATEST TRENDS & STYLES, MADE TO MEASURE! Call now for a FREE no-obligation Quote in the comfort of your own home.

(01343) 552 555 www.horizonblinds.co.uk


techno

New website a boost The new Spotlight website is now up and running and it is aleady proving a great source of information and fellowship for the Moray and Highland community. Our aim is to bring the great knowledge and support we gather from the public for our magazines to a webbased forum that can be accessed any time and from anywhere Most of the website is free to use and you don’t have to register. If you do want to register, it is free and will provide you with a localised search function, as well as the ability to post your own information! Clubs and Societies have their own page and people can register and claim their own listing or post a new one for free. Then it will go into our next magazine issue automatically. We have this same resource for

Trades, Places to Eat and people wanting to post Events and Articles. Check today to see if your listing is already online. There are many types of Articles which we encourage the public to submit for publication to the website. Subjects

Alastair Watt


to the community!

range from Weddings to Gardening to Parliament Blogs. We have tonnes of local information such as Restaurant Reviews, Useful Contacts and Dates and an aspect we are particularly proud of - our Diary of Events which is updated daily.

In addition we have a new Jobs page specially dedicated to the Moray and Highland area which can be used by recruiters and jobseekers alike. Recruiters can have single or recurring job space or even banners to grab extra attention. Jobseekers are welcome to search the job list or even upload their CV free of charge. We offer limited advertising space on the website to stay true to our goals but if you do want to advertise we would love for you to contact us to see what is available. The website has already had thousands of visitors and is growing on a daily basis so go to www.spotlighton.co.uk today and see what is happening in your community!


Domestic, Commercial & Industrial Garage Doors Supplied & Installed

Keith Dental

the friendly practice

Your smile,

01309 671477 or 01309 692244 *DUDJH'RRU$XWRPDWLRQ‡&DU3RUWVDQG3DWLR5RRIV ‡6HFXULW\6KXWWHUV‡'ULYHZD\*DWHV 0DQXDORU$XWRPDWLF  ‡*DUDJH'RRU5HSDLUV 'RRUVLQVWRFNIRUWUDGHFXVWRPHUV

it’s as precious as you are. Ask us about a new FRESH healthy smile. Ring the friendly practice on 01542 886251

59-61 Moss Street,KEITH AB55 5HF www.keithdental.co.uk/spot

Email: info@scotengineering.co.uk Web: www.scotengineering.co.uk

the actual wheel brakes. Soon we were testing its range, finding out the most economical way of driving it and finding out how to I’ve been watching the development recharge the batteries away from of electric cars for quite a few years home. now, always wanting to be able join Although Nissan claim that it will do this silent revolution, but not wanting up to 124 mile on a single charge, to buy into something that was not yet we’ve found that 85 miles isa more cost effective and practical to do. At realistic range, especially if you want last, that time has come and we are to go at a decent speed. now the proud owners of a Nissan Often, it’s only by trying things out Leaf car. that you learn the best way to do It was less than 2 years old and only things, so we set off on a 330mile had 14,500 miles on the clock, so was round trip to Edinburgh. It was a long still looking and feelingpretty new to 6 hour journey down there, but we me, but cost less than £9,000, whereas reduced this to 5 hours coming back new ones are about £18,000. Since the by improving our rechargeing regime. launch of the 3rd generation Leaf, the Most people are not aware that the second hand market for the older EV rapid chargers get the batteries up ones has really taken off, which I to 80% within about 20 minutes assume is down to Leaf owners before going into trickle mode for the upgrading to the latest model with last 20%. This means that it can take extended range! over an hour to fully charge the It was a joy to drive for the first time, batteries, which is not ideal, so we effortlessly gliding around the country ended up only recharging to 90% on roads at the touch of a single pedal, our way back to Forres, which barely needing the brake due to the dramatically reduce our trip time. generative braking technology as the We’ve now had it for 6 months and foot comes of the accelerator. Even have clocked up over 9000 miles, when the brake is needed, it does mainly on short commutes towork and more regeneration before applying ferrying the kids around. In fuel terms

Is The Electric Car Revolution Coming to the North Of Scotland?

this would have cost us over £900 in our 65mpgSkoda, but has instead it has cost us about £350 in electricity, a saving of over 60%! We are alsoexpecting to make big savings in maintenance because EVs have about 18 moving parts, whereas a typical diesel or petrol car has over 2000. In terms of savings, we think it will pay for itself within 8 years. The economics of owning an EV really starting to add up, and I hope that continuing improvements will help to make this a “No brainer” for most of us. Interestingly, it is predicted that most new vehicles will be electric within the next 10 years and other countries such as Japan and Norway are already well ahead of the UK in this respect. So come on Forres, lets not get left behind, start embracing the electric revolution and save yourself a fortune, as well as the planet! There is a great deal of information on the web, but I would definitely recommend the ‘FullyCharged’ YouTube channel is one of the best places to catch up on all the latest electric cartechnology. Peter Mitchell, EV owner Dallas, Forres


We outshine the rest

Solar panels are a long-term investment, so you want to be sure that you Sunpower are the world’s leading manufacturer of solar panels, and AES Solar are the longest established installer in Western Europe. Sunpower cells were used on round-the-world record holder Solar Impulse

by Don’t settle for second best. Invest wisely with world-class products and service. Call AES Solar today to get a free no-obligation survey.

Lea Road, Forres IV36 1AU

01309 676911 info@aessolar.co.uk


4

44

44

44

4

25% me imp OF ro F

all ho

vem ent s

Kit che ns Bat hro om s B edr oom THEPROJECT ONE ON NE FULLY s H MANAGED eat STOP S T OP SHOP ing ALL FTRADES FULL SERVICE FROM ROM OM ST START TART ART TO FINISH FINISH FROM START TO FINISH

Providing high range kitchen, bathrooms and heating systems for over 10 years

Come and visit our showroom

FREE Plan and Design FREE Quotations 01343 551 331

H A R R  I S O N S 

www www www.harrisonselgin.co.uk ww.harrisonselgin.co.uk .harrisonselgin harrisonselgin.co co.uk

.2,01*24 .0,41+,4//,2*4$4100/+.(+4

)))-4%.,1(*442/+,202*4 /%2434/(..*41%24/(4)-43 Â&#x153;Â&#x201C;iĂ&#x152;Ă&#x20AC;>`iĂ&#x160;­ Â&#x153;Ă&#x20AC;Ă&#x152;Â&#x2026;Ă&#x160; >Ă&#x192;Ă&#x152;ÂŽĂ&#x160;Â&#x2C6;Â&#x201C;Â&#x2C6;Ă&#x152;i`Ă&#x160;/Ă&#x2030;Ă&#x160;>Ă&#x20AC;Ă&#x20AC;Â&#x2C6;Ă&#x192;Â&#x153;Â&#x2DC;½Ă&#x192;Ă&#x160;UĂ&#x160;- Ă&#x17D;Â&#x2122;{Ă&#x17D;Ă&#x17D;äĂ&#x160;-VÂ&#x153;Ă&#x152;Â?>Â&#x2DC;`Ă&#x160;UĂ&#x160;,i}Â&#x2C6;Ă&#x192;Ă&#x152;iĂ&#x20AC;i`Ă&#x160;"vvÂ&#x2C6;Vi\Ă&#x160;ÂŁĂ&#x2C6;Ă&#x160;Â&#x2C6;Â&#x2DC;Â&#x17D;Ă&#x153;Â&#x153;Â&#x153;`Ă&#x160;*Â?>Vi]Ă&#x160; Â?}Â&#x2C6;Â&#x2DC;]Ă&#x160;6Ă&#x17D;äĂ&#x160;ÂŁ<°

SpotLight on Buckie, Keith & District December 2016  
Read more
Read more
Similar to
Popular now
Just for you