Page 1

FLIP FOR YOUR LEADING LOCAL GUIDE TO EVERYTHING HOME & GARDEN

the western weekender

WesternProperty Property FRIDAY, MAY 17, 2019

INSIDE: YOUR OPEN HOMES AND RENTALS GUIDE FOR THE WEEKEND

Quality Custom Homes… You Can Afford!

● Custom Designed New Homes to suit any Budget ● Custom Designed New Duplex / Dual Occupancy Homes ● Custom Designed Knock Down & Rebuild For an Obligation Free Appointment Ph: 1300 882 770 info@jadcohomes.com.au www.jadcohomes.com.au

WW36877

Your HOME


House & Land Was $879,000 Now

$648,674* Lot No: 2203-04 Home: 2 Land Size: 240m2

4

2.5

2

2

House & Land Was $879,000 Now

$648,674* Lot No: 2203-04 Home: 4 Land Size: 240m2

4

2.5

2

2

TURNKEY HOUSE & LAND PACKAGES

FOR UNDER $650,000*

+ 4 BED + 2 BATH + 2 CAR + LANDSCAPING & FENCING + MASTERPLANNED COMMUNITY TO $10,452 IN STAMP + UP DUTY SAVINGS ON THE LAND ELIGIBILITY CRITERIA APPLIES† TO $10K IN FIRST HOME + UP BUYER GRANTS ELIGIBILITY CRITERIA APPLIES†

That all stacks up.

House & Land Was $879,000 Now

$648,274*

Only 5 packages available at this price. Each full ‘turnkey’ package includes:

Lot No: 2203-04 Home: 5 Land Size: 240m2

4

2.5

2

2

• Premium facade • Clever storage solutions

• Stainless steel appliances • Landscaping to front & rear • Colorbond sheet roofing • A letterbox • Professionally prepared • Lapped & capped fencing • Coloured concrete driveway

House & Land Was $879,000 Now

Lot No: 2203-04 Home: 8 Land Size: 240m2

2.5

2

interior and exterior colour schemes

For full details visit Celestino.net.au/TheGables or our Sales Centre, open 10am–4pm, 7 days at 121 Old Pitt Town Road, Box Hill.

$648,674* 4

• High ceilings throughout

2

*Celestino Realty Pty Limited (trading as Ray White (Box Hill)) is the agent for the seller of the land. Conditions apply to the house and land package. Please refer to the land sale and building contracts. Pictures are illustrative only. Land sale price does not include stamp duty or other fees (payable by purchaser). This price shown is for the land and house with the standard inclusions and build conditions. Variations to the house may cost extra. Please refer to our website for further details. †Amount is quoted for Home 18. Savings vary for each home. For eligibility criteria and stamp duty savings please refer to https://www.nsw.gov.au/improving-nsw/projects-and-initiatives/first-home-buyers/

House & Land Was $810,000 Now

$649,224* Lot No: 2203-04 Home: 18 Land Size: 305m2

4

2

2

2

Celestino.net.au/TheGables Ph 9188 5222 2

Western Property Magazine

WW37327

CEL0740_FP_WM

Friday, May 17, 2019


Proud

NEWS FEATURE

TO BE AT THE TOP Raine & Horne St Marys has proven to be home to some of Australia’s leading real estate agents, with Sales Manager Peter Diamantidis placing 35th in a national ranking of Australia’s best performing agents. The prestigious Real Estate Business (REB) Top 100 ranking lists agents across Australia according to a range of metrics, including number of sales, total sales volume, and average sales price. According to Mr Diamantidis, to be placed in the upper half of a ranking normally dominated by agencies from Sydney’s Eastern Suburbs, is a testimony to the hard work and experience shown by the staff at St Marys Raine & Horne. “I think it’s experience,” he said. “We are in a tougher market than we were say 15 to 24 months ago and we just have adapted our business a lot differently, we are more buyer driven, they can see our results in the local area. Our office and myself are getting better results.” As stated by REB Editor Tim Nearly: “The REB Top 100 Agents 2019 is the industry benchmark

Western Property ISSUE NUMBER 258

Produced by The Western Weekender

Having been in business since 1974, Raine & Horne St Marys is a seasoned agency which has proven to meet clients’ wants and needs. For any enquiries contact Raine & Horne on 9623 5666 or visit their office at 210 Queen St, St Marys. – Emily Kowal

for success in real estate sales and an accolade all agents aspire to”. Raine & Horne St Marys is no stranger to achievement, having also received the 2019 NSW and ACT Raine and Horne ‘Best Agent’ award for dollar value and number of transactions. The awards recognise those who

have sold the highest amount of properties within the agency’s area and the price of the sales. “To receive these awards and rankings in our area is unheard of. We have been ranked the highest in western Sydney and this is very hard to achieve,” Mr Diamantidis said.

EDITORIAL CONTACT Troy Dodds • 4722 2998 troy.dodds@westernweekender.com.au

SALES DIRECTOR ARTWORK Chris Pennisi • 0421 121 985 Jennifer Zuleni • 4722 2998 chris.pennisi@westernweekender.com.au artwork@westernweekender.com.au

Western Property Weekly Market Wrap Proudly sponsored by Ray White Penrith 1. 31 Adelaide St, Oxley Park ...................................... $950,000 A Plus Realty Parramatta

2. 274 Great Western Hwy, Emu Plains .................. $910,000 Dukes Estate Agents

3. 24 Shellbourne Pl, Cranebrook ............................. $780,000 Upside

4. 7 Hascombe Way, St Clair ....................................... $755,000 Australian Real Estate St Clair

5. 18 Wattlebird Cr, Glenmore Park.......................... $745,000 Ray White Glenmore Park

Friday, May 17, 2019

Properties Sold This Week 22

3

Current Median Sale Price $680,500 $519,000

Properties Total Real Estate Currently For Sale Sales This week 763

317

$14,814,000 $1,454,000 Western Property Magazine

WW36216

THIS WEEK’S TOP 5 SALES

3


R E G I S T E R E D L A N D N O W A V A I L A B L E W I T H S P E C TA C U

HILLSIDE LOTS. YOU’LL NEVER BE BUILT OUT. 800m 2 – 1,200m 2 mulgoasanctuary.com.au Park image is Artist’s Impression. To the best of our knowledge no relevant information has been omitted from this advertisement. Whilst all care has been taken correct but is not guaranteed. Changes may be made during development and dimensions and specifications may be changed without notice. Purchasers must rely 4

Western Property Magazine

Friday, May 17, 2019

in on


C U L A R M O U N TA I N V I E W S A N D F A N TA S T I C L I F E S T Y L E

n ely

Register now, there are only a few of these exclusive homesites remaining. You’ll overlook beautiful mountain and bushland views – never to be built out. These prestige lots range from 800m2 to 1,200m2. It’s the perfect place for your new dream home. This enviable lifestyle can be yours. Hurry, the word is out and homesites at Mulgoa Sanctuary are selling fast. Visit our Sales Centre Sunday 10am–2pm to see a range of house and land packages. Or register your interest at mulgoasanctuary.com.au.

 Just minutes from Glenmore Park Town Centre shopping.  Close to schools and sporting fields.  Minutes to the Penrith CBD.  Convenient to the M4. in presenting the benefits of Mulgoa Sanctuary, we encourage all potential purchasers to inspect for themselves. The information provided herein is believed to be on their own enquiries. All areas, dimensions, levels and service locations are approximate and subject to final survey. Please refer to contract of sale. WW37134 Friday, May 17, 2019

Western Property Magazine

5


GLENMORE PARK, 39 NINDI CRESCENT

BED

So Much To Offer This lovely four bedroom home presents an excellent entry point into the market and offers so much space accompanied by easy maintenance. Fantastic open plan living boasting good size lounge and dining areas, lovely renovated kitchen with Caesarstone benchtops and family room opening onto an under cover alfresco area. With a neat and easy backyard, ducted air and a single lock-up garage this home has got the lot. Love to show you through this home but I would get in early.  Ensuite, bathroom and kitchen all stylishly renovated, all the hard work has been done  From the front you can look through the bush views to the large lake & water fountain  Set on a 499sqm (approx.) block with a private rear yard – great for the kids or entertaining  Level, easy block perfect for those looking to downsize or allows the option for an elderly relative to live there with ease

BATH

2

1

CAR

PRICE

For Sale Now $649,000 - $709,000 or Auction 11th June, 2019

VIEW

Sat 18th May 11.30am - 12.00pm

CALL

Helena Crumpton (O’Farrell) 0415 119 019

SOUTH PENRITH, 49 BICKLEY ROAD

BED

Location, Location, Location! This immaculate home is perfect for first home buyers, those downsizing or investors who appreciate quality. It enjoys a sunny north south aspect, boasts space, privacy and comfort. With a renovated kitchen, air conditioning, plantation shutters and double garage with drive through option. Enjoy entertaining in the back garden under the large under cover area or potter in the lovely established garden at the front of the home. This will quickly become someone’s ‘home sweet home’. Lovingly cared for and surrounded by stylish homes in a quiet area close to everything. What more can you want especially for families who value a nice neighbourhood? With so much to offer this could also be the perfect home to put your new style into if you wish. Can’t wait to show you, private inspections welcome.  A home to be proud of that has a lovely feel about it - A MUST TO INSPECT  This charming home offers separate lounge, formal dining and kitchen/family - room for everyone  Nestled on a 641sqm (approx.) block opposite a green space area which gives a fantastic feeling of space  Only a short stroll to Southlands Shopping Centre, schools, buses and easy access to M4 - great position

4

3

BATH

1

CAR

2

PRICE

For Sale Now $589,000 - $639,000 or Auction 11th June, 2019

VIEW

Sat 18th May 2.00 - 2.30pm

CALL

Helena Crumpton (O’Farrell) 0415 119 019

Property Central Penrith 4728 4000 352 High Street, Penrith Property Central Mulgoa 4773 8470 Shop 3/1216 Mulgoa Rd, Mulgoa Disclaimer: We have been furnished with the above information by a third party. Property Central gives no guarantees or undertakings concerning the accuracy, completeness for up-to-date nature of the information provided. All interested parties are responsible for their own independent enquiries in order to determine whether or not this information is in fact accurate.

6

Western Property Magazine

WW37511

Friday, May 17, 2019


SOUTH PENRITH, 47 BICKLEY ROAD

BED

4

BATH

2

Stunning Resort-Style Living Set amid beautiful gardens this home is the pinnacle of relaxed living. Designed around the stunning resort-style secluded back garden this home is the perfect blend of indoor and outdoor living with living rooms and main bedroom all opening onto the pool area. This immaculate home with impressive multiple light-filled living spaces will suit varied living options. Delightful kitchen and good sized rooms, this home is gorgeous by day or night and definitely warrants an inspection. * Agent Declares Interest  Amazing style throughout, perfect home for entertaining, lots of natural light, great northly aspect  Also boasts ducted air, savvy fire, outdoor speakers, plantation shutters. See you at the open  With the outdoor bar, in-ground pool and tropical framed deck areas, this home lets you feel like you are on holidays  Peacefully nestled on a level 809.6sqm approx. block overlooking greenspace and close to everything with easy M4 access

PRICE

For Sale Now $869,000 - $949,000 or Auction 4th June, 2019

VIEW

Sat 18th May 3.00 - 3.30pm

CALL

Helena Crumpton (O’Farrell) 0415 119 019

Property Central Penrith 4728 4000 352 High Street, Penrith Property Central Mulgoa 4773 8470 Shop 3/1216 Mulgoa Rd, Mulgoa Disclaimer: We have been furnished with the above information by a third party. Property Central gives no guarantees or undertakings concerning the accuracy, completeness for up-to-date nature of the information provided. All interested parties are responsible for their own independent enquiries in order to determine whether or not this information is in fact accurate.

Friday, May 17, 2019

WW37514

Western Property Magazine

7


Making a move? Call Nick today for all your property needs.

Nick Rigas 0401 560 116 nickrigas@theagency.com.au

14 Illoura Way, Jordan Springs

Be instantly impressed with this contemporary home built by Edgewater Homes and created for perfect family entertaining. Its highlights include a wide open living and dining space blending to a timber entertainers’ deck with in-built-barbecue and Jacuzzi, complemented by a gourmet stone and gas kitchen with grand island bench. Enjoy a media room, a private master bedroom with ensuite, built-in/walk-in wardrobes plus air conditioning and an automatic double garage. Set on a 450sqm block, this home is a walk to Illoura Reserve and moments to Jordan Springs shopping, buses, schools and amenities.

8

Western Property Magazine

4

2

2

450 SQM

For Sale Price Guide $775,000 - $825,000

Nick Rigas 0401 560 116

View Saturday 11:15 - 11:45am Wednesday 6:00 - 6:30pm

theagency.com.au

WW37447

Fine quality family home with generous dimensions and a streamlined design

Friday, May 17, 2019


48 Currawong Crescent, Leonay

BUY OF THE WEEK

Just Listed

Loving LEONAY Tell us about the home and suburb? Leonay is without question the best estate in the Penrith District. The golf course plays a big part in achieving this as does the Nepean River. The streets are reasonably quiet but with Currawong Crescent this is particularly true. The property on offer at 48 Currawong Crescent has its own special advantages. The block is about 1/4 acre in the old money and has been developed to its maximum advantage. Besides offering a five or six- bedroom facility, it has seal covers for vehicles and still offers a further three off-street parking areas. The space at the side of the home can be utilised to provide

carports for two cars in tandem and still allow easy access to the rear garden. The same owner who built the home is still living here

6

5

Open for Inspection: Saturday, May 18 at 12.15pm-1pm Contact: RE/MAX Lifestyle Marketing Gizzelle Powell • 0428 934 618

which is testimony to it being a great place to live. There is ample room for a pool and it is a wonderfully private home.

g the Penrith Servicin area for 60 Years

3

Who does this property suit? Buyers looking to upgrade or just someone who wants to live in one of Penrith’s best districts.

Boxes

Boxesfrom from

$ .50

11

$ .50

$AVE @ HITCHENS • Removals • Truck Hire • Box Shop 1 MONTH FREE STORAGE

AWESOME AUTUMN SPECIALS PAY 5 MONTHS GET 1 MONTH FREE

3m x 3m first floor 3m x 3m ground level 3m x 4.5m ground level

Now $150 per month Now $200 per month Now $250 per month *Conditions apply

Friday, May 17, 2019

Western Property Magazine

WW33735

142 Old Bathurst Rd, Emu Plains Ph 4735 7000 www.hitchens.com.au

9


FAMILY FIRST!

4

• Situated in the impressive Mulgoa Rise Estate sits this near new 4 bedroom home that the next family will assure to adore to call their own. • Entering the door you will be greeted with high ceilings, open plan living, modern finishes and space that will assure a growing family pride when calling this place home. • 4 spacious sized bedrooms all with built-in wardrobes with the huge master bedroom hos ng an ensuite for complete privacy for Mum and Dad. • Moving into an estate like Mulgoa Rise offers a family the opportunity to grow and create long-las ng rela onships with the current families who have built and moved in looking to do the same thing. • Enjoy your morning coffee while taking in views of the suburb and surrounding landscapes from your under cover alfresco area while thinking life could not get much be er! • With close proximi es to the M4, nearby schools, Glenmore Park shopping centre, day cares and Penrith CBD the newest owners of this precious home can enjoy a lifestyle that’s convenient and comfortable for the en re family to enjoy. Call now, to book an inspec on and lock in this opportunity to be the new proud home owner!

PRISTINE PRESENTATION! • This near new home cks the boxes, set on a larger block of 330sqm this home comes with 2 living rooms, ensuite to main bedroom and an adaptable open plan living space makes entertaining inside or under the alfresco area easy! • With immaculately presented gardens, well-sized bedrooms and quality inclusions moving here makes for easy living! • Posi oned in Northridge surrounded by other neatly presented proper es within walking distance to the local spor ng fields and easy access to the Northern road and future Badgerys Creek airport this is the one you’ve been looking for, so call now!

DISCLAIMER: Whilst we deem this information to be reliable the agent cannot guarantee its accuracy and accepts no responsibility for such. Interested persons should rely on their own enquiries.

10

Western Property Magazine

2

View: By Appointment $799,950 - $849,950 25 Ewan James Drive, Glenmore Park

3

• Kick back, relax and enjoy living comfortably!

2

2

1

View: By Appointment $590,000 - $620,000 47 Portsmouth Circuit, Jordan Springs

www.ResponseRE.com

WW37129

Friday, May 17, 2019


IDEAL POSITION, SUMMER FUN!

3

• Centrally located to Penrith and the CBD, with transport services at your doorstep, this is a fantasƟc opportunity to step into the market! • Whether you’re invesƟng or looking for that special place to call home, this one Ɵcks the boxes! • Featuring ducted air-condiƟoning, spacious living area & the bonus of a study and side access there’s room for everyone to enjoy! • Invite your friends and family over for a dip in the pool whilst you get the BBQ going! • The potenƟal for this property is endless; make sure it’s on your must see list. Call now to inspect!

DOWNSIZER’S DELIGHT!

2

View: Saturday 12:00 - 12:30 $520,000 39 Ceres Street, Penrith

3

1

• PosiƟoned at the end of a whisper quiet locaƟon and ideally located within walking distance to the local shopping village and Claremont Meadows Public School, downsizing here or starƟng out will surely delight!

View: By Appointment

• Featuring a spacious lounge/& dining room makes for enjoyable entertaining, along with a well sized outdoor area and internal access to the garage makes this property the complete package!

$425,000

• With easy access to both St Marys and Penrith town centres and excellent access to the M4 with the new Kent Rd on ramp this is the property you’ve been waiƟng for, so call now!

1/32 Toomung Circuit, Claremont Meadows

DISCLAIMER: Whilst we deem this information to be reliable the agent cannot guarantee its accuracy and accepts no responsibility for such. Interested persons should rely on their own enquiries.

Friday, May 17, 2019

1

www.ResponseRE.com

1

WW37130

Western Property Magazine

11


NEST OR INVEST!

3

1

• Posi oned in a whisper quiet loca on with echoes of bellbirds and na ve wildlife in the nearby nature reserve, you’ll want to put your own touches to make this place home!

View: By Appointment

• With great sized side access and spacious backyard this property makes for bringing the big toys home, or the poten al to build a shed or granny flat (STCA).

$475,000

• Well located to nearby schools, Cambridge Gardens Shopping Centre and with easy access to the northern road this is the one to make your own, call now!

11 Rivendell Crescent, Werrington Downs

OPPORTUNITY PLUS!

3

• Response Real Estate is proud to present the perfect opportunity for the intelligent investor or the excited first home buyer to get their foot into the property market and seize this great property. • In a whisper quiet loca on this home offers an opportunity for a homeowner to add their own touches. • Offering ample space and side access to bring the toys home or poten al for the savvy investor to build a granny flat (STCA). • Ideally posi oned to nearby schools, Cambridge Gardens shopping centre and with superb access to the Northern Road for easy access to Penrith CBD. • This is a perfect opportunity to lock in a home that has the poten al to reap great rewards for the new homeowner.

DISCLAIMER: Whilst we deem this information to be reliable the agent cannot guarantee its accuracy and accepts no responsibility for such. Interested persons should rely on their own enquiries.

12

Western Property Magazine

1

1

1

View: Saturday 1:00 - 1:30 $550,000 - $590,000 3 Grange Crescent, Cambridge Gardens

www.ResponseRE.com

WW37131

Friday, May 17, 2019


GRANNY FLAT POTENTIAL ΈSTCAΉ

3

1

1

• If you are a first home buyer or investor looking for a property that’s nestled away in a loca on that offers absolute View: Saturday 10:00 - 10:30 tranquillity on the foot of the Blue Mountains, then this one is certainly for you. $525,000 - $575,000 • This perfect, first home opportunity is posi oned in an ideal cul-de-sac loca on that is situated on a corner block. It offers 1 Apsley Court, ample space that has terrific side access into the backyard. • With several neighbouring parks, this is going to be ideal for Cranebrook a family looking for a home that’s going to make spor ng ac vi es for the kids an absolute breeze! • As this home sits on an excellent corner block posi on, with perfect side access, the intelligent investor is going to want to book an inspec on at this property as it offers the opportunity to build a granny flat (STCA). • Whether you are a first home buyer looking to start the journey of ge ng into the first family home or the clever investor looking for a great opportunity, this home offers poten al to all! You do not want to miss out, call now and book your inspec on!

RELAX AND ENJOY THE VIEW

3

1

1

• Nestled in the quiet street of a no through road this View: By Appointment is the ideal place for your family to create those cherished memories. With the poten al to build a granny flat (STCA) this property is sure to appeal to the $525,000 savvy investor.

8 Highview Avenue,

• Make yourself your coffee or breakfast and enjoy the Penrith morning sunshine in the sunroom. What a way to start the day. Outdoor entertaining made easy and fully fenced yard to let the kids or pets play all day.

• Having the convenience of Penrith sta on 1.7kms away will make anyone’s commute quick and easy.

NEST OR INVEST!

1

3

• This wonderfully positioned home is ready to move View: By Appointment straight in or leased to one lucky tenant! Set on a spacious 765sqm block of land with plenty of covered parking and additional side access, makes this property $545,000 - $585,000 ideal to bring home the big boy’s toys or the work tools. 14 Caloola Avenue, • Polished floorboards throughout, updated kitchen and bathroom with covered entertaining area, you’ll love Penrith this neat and tidy home. • You will love the easy access to the Northern Road as it will save you time each day, being a short drive to Nepean Hospital and the M4 motorway. • With room for a potential granny flat or opportunity to build a duplex (STCA) this makes the property more attractive with the possibility for a dual income! Call to inspect!

YOUR DREAM HOME AWAITS!

450M2 LAND

• Build your dream home on this 450sqm parcel of land, $479,000 - $526,000 located in this beau ful cul-de-sac. • Des ned to be one of the most amazing suburbs in Western Sydney, Caddens Hill offers you the opportunity to enjoy the perfect family lifestyle.

19 Redhaven Street, Caddens

• Approximately 5kms from the centre of Penrith CBD, it’s ideal for a day out to enjoy shopping with friends, then catching up for drinks at one of the many bars, cafés or restaurants. • With the land being only 3.2km to Penrith Hospital and 1.6km to the University of Western Sydney it makes this loca on a superb investment. Local spor ng fields, shopping centre and parks just make this the ideal place for you to build your dream home. Be quick call now!

DISCLAIMER: Whilst we deem this information to be reliable the agent cannot guarantee its accuracy and accepts no responsibility for such. Interested persons should rely on their own enquiries.

Friday, May 17, 2019

3

www.ResponseRE.com

WW37132

Western Property Magazine

13


y Displa n pe O w o N

34 Luxury Boutique Apartments Commencing Soon Display suite open Wednesday and Saturday 11-3pm Apartment 102 - $345,000 1 Apartment 103 - $449,000 2

1 2

1 1

by WW37141

14

Western Property Magazine

Friday, May 17, 2019


3

1

1

View

Saturday 10:00 – 10:30am

Price

$499,950 - $539,950

Peter Diamantidis 0404 051 702

2

2 Rochford Street, St Clair • • • •

Three bedroom torrens title home Currently leased for $400 per week Single garage Located close to local shops, schools & public transport • Property requires some TLC but is priced to sell • Ideal investment or first home

1

1

View

By Appointment

Saturday 10:00 – 10:30am

Price

$399,950 - $429,950

Price

$399,950 - $429,950

Peter Diamantidis 0404 051 702

peter.d@stmarys.rh.com.au

10 Kungala Street, St Marys • Two bedroom home positioned in the heart of St Marys • Property requires an overhaul but location is key • 398sqm block • Located 200m from train station & 150m from shopping village

Peter Diamantidis 0404 051 702

peter.d@stmarys.rh.com.au

3

12 Kungala Street, St Marys • Three bedroom home located in the heart of St Marys • Original kitchen and bathroom • Carport & parking space • Currently rented for $350 per week • Requires some TLC but cannot be beaten on location • Close to St Marys Village Shopping Centre & railway station

1

View

peter.d@stmarys.rh.com.au

3

1

2

2

View

By Appointment

Price

$549,950 - $579,950

17 Lockyer Avenue, Werrington County • Three bedroom home positioned on 660sqm of land • Timber floors throughout • Updated kitchen & bathroom • Double carport with side access • Tenant currently paying $445pw • Located close to all amenities

Peter Diamantidis 0404 051 702

peter.d@stmarys.rh.com.au

St Marys 9623 5666

210 Queen Street, St Marys rh.com.au/stmarys WW33674

Friday, May 17, 2019

Western Property Magazine

15


2

1

1

View

Saturday 11:00 – 11:30am

Price

$399,950

Jack Turner 0434 554 430

4

4/165 Adelaide Street, St Marys • • • •

Two bedroom single level villa Built in wardrobes to both bedrooms Updated kitchen with ample cupboard space Large open plan living area with air conditioning • One and a half sized garage with internal access • Fully fenced and easy to maintain courtyard • Close to all amenities

2

1

View

Saturday 1:15 – 1:45pm

Price

$524,950

Peter Diamantidis 0404 051 702

2/32-34 Lethbridge Avenue, Werrington • • • • • • •

peter.d@stmarys.rh.com.au

Brand new four bedroom townhouse Daikin ducted air conditioning throughout Built-in oak wardrobes to all bedrooms Ensuite to main bedroom First class fixtures & fi ings Two allocated car spaces Private landscaped courtyard

2

View

Saturday 2:00 – 2:30pm

Price

$524,000

Peter Diamantidis 0404 051 702

jack.turner@stmarys.rh.com.au

4

2

7/52 Cam Street, Cambridge Park • Brand new four bedroom townhouse • Luxurious finishes & open plan living area that flows through to a private, landscaped courtyard • Daikin ducted air conditioning • Oak built in wardrobes to all bedrooms • Ensuite to main bedroom • Two allocated car spaces • Located close to all amenities & a short drive to Penrith CBD

peter.d@stmarys.rh.com.au

2

1

1

View

Saturday 11:00 – 11:30am

Price

$415,000 - $425,000

Jack Turner 0434 554 430

2/134 Brisbane Street, St Marys • • • • •

Single level Separate tiled living area Modern kitchen with dining area Built-in wardrobes to both bedrooms Ensuite access into main bathroom from one bedroom • Single car garage with internal access • Private easy to maintain courtyard • Currently leased to great tenant wanting to stay on

jack.turner@stmarys.rh.com.au

St Marys 9623 5666

210 Queen Street, St Marys rh.com.au/stmarys WW33675

16

Western Property Magazine

Friday, May 17, 2019


2

2

1

View

Saturday 1:00 – 1:30pm

Price

$359,950 - $379,950

4

27/14-20 Parkes Avenue, Werrington • • • • • •

Two bedroom first floor apartment Spacious open plan living and dining area Split system air conditioning Built-in wardrobes to both bedrooms Ensuite to main bedroom Single basement parking space & storage cage

Saturday 1:00 – 1:30pm

Price

$479,950 - $499,950

Peter Diamantidis 0404 051 702

1

View

Saturday 2:00 – 2:30pm

Price

$564,950

Peter Diamantidis 0404 051 702

3

11/117-119 Jamison Road, Penrith • Brand new four bedroom townhouse • Brand new kitchen with gas cooking & dishwasher • Daikin ducted air conditioning • Mirrored oak wardrobes to all bedrooms • Oak flooring to ground level & carpet upstairs • Conveniently located close to all amenities

peter.d@stmarys.rh.com.au

5/41 Brisbane Street, Oxley Park • • • • •

Spacious four bedroom townhouse Ducted air conditioning & security alarm Built in robes to three bedrooms Walk in robe & ensuite to main Drive through garage with additional undercover parking • Large courtyard • Currently tenanted at $490 per week

peter.d@stmarys.rh.com.au

jack.turner@stmarys.rh.com.au

2

2

View

Jack Turner 0434 554 430

4

2

1

View

Saturday 10:00 – 10:30am

Auction

Saturday 01/06/19 2:00pm Onsite

Peter Diamantidis 0404 051 702

25 Vincennes Avenue, Tregear • Three bedroom brick veneer home located close to all amenities • Positioned on 570sqm (approx.) with a 16m frontage • Updated kitchen, separate lounge & dining areas • Side access & enough space to build a granny flat (subject to council approval) • Good sized backyard with sunny northerly aspect

peter.d@stmarys.rh.com.au

St Marys 9623 5666

210 Queen Street, St Marys rh.com.au/stmarys WW33676

Friday, May 17, 2019

Western Property Magazine

17


$490pw 7/117-119 Jamison Road, Penrith

4

2

2

$310pw 28 Athel Street, North St Marys

3

1

1

• Brand new four bedroom townhouse • Ducted air cond & built-in robes to all bedrooms • Single garage with second car space

• Freshly painted three bedroom home with new blinds • Built-in wardrobes • Single carport & fully fenced easy to maintain yard

$370pw

$560pw

19/2-6 Regentville Road, Jamisontown

16 Cultivation Road, Austral

2

2

1

• Modern apartment with BIR to both BRs • Split system air cond to open plan living area • Single allocated basement car space

4

2

1

• Brand new four bedroom home close to Leppington station • BIR’s to three bedrooms, ensuite & WIR to main bedroom • Ducted air conditioning & single garage

$410pw

$460pw

6 Grevillea Drive, St Clair

8 Carpenter Street, Colyton

3

1

1

4

2

1

• Three bedroom home with modern kitchen • Mirrored built-in wardrobe to main bedroom • Enclosed sunroom & carport with drive through access

• Updated home with BIRs to all bedrooms • Updated bathroom & ensuite to main BR • Granny flat fenced & leased separately

$415pw

$370pw

2/140 Brisbane Street, St Marys

19 Melbourne Street, Oxley Park

3

2

2

3

1

1

• Three bedroom townhouse with split system AC • BIRs to all bedrooms & ensuite to main • Tandem double garage & easy to maintain yard

• Three bedroom home with BIR to main • Updated kitchen & modern bathroom • Large backyard & single carport

$270pw

$470pw

6/162 Great Western Highway, Kingswood

9/32-34 Lethbridge Ave, Werrington

2

1

1

4

2

2

• Two-bedroom unit with BIRs to both • Updated bathroom, good sized balcony & single garage • Located close to Kingswood station, shops & uni

• Near new townhouse with ducted AC • BIRs to all bedrooms & ensuite to main • Single automatic garage with drive through access

$540pw

$290pw

8a Dunlop Avenue, Ropes Crossing

8a Weaver Street, Erskine Park

4

2

1

• Four bedroom home located close to all local amenities • Built-in wardrobes to all & ensuite to main • Split system AC, alarm system & single garage

1

1

• Modern one bedroom granny flat close to all amenities • Split system air cond & updated kitchen & bathroom • Mirrored BIR to bedroom & easy to maintain courtyard

$330pw

$450pw

34/4-12 Chapman Avenue, Werrington

1/67 College Street, Cambridge Park

2

1

1

4

2

2

• Well presented two bedroom townhouse with BIR to main • Split system AC & internal access to single garage • Located close to train station & shops

• Brand new four bedroom townhouse • Ducted air conditioning & single garage • Built-in robes to three bedrooms & ensuite to main

$450pw

$245pw

19 Brockamin Drive, South Penrith

46/64 Putland Street, St Marys

4

1

2

• Four BR home with large L-shaped living area • Built-in wardrobes to two bedrooms • Covered patio, garden shed & double carport

2

1

1

• Two bedroom unit with updated kitchen & bathroom • Internal laundry, balcony & single garage • Located close to all amenities

Strata Management

Qualified Staff | Complete Strata Service

Services including establishing records for new Strata Schemes. Obligation free consultation. For further information contact Helen Turner 0407 415 793 or Bruce Kilgour 0418 275 571

St Marys 9623 5666

210 Queen Street, St Marys rh.com.au/stmarys info@stmarys.rh.com.au 18

Western Property Magazine

WW33677

Friday, May 17, 2019


$315pw

$495pw

15/37 Hythe Street, Mount Drui

50 Fowler Street, Claremont Meadows

2

2

1

3

2

1

• Well presented two bedroom unit close to all amenities • Updated kitchen & bathroom & split system AC • BIRs to both bedrooms & single garage

• Three bedroom terrace home with ducted AC • Master suite with WIR, ensuite & private balcony • Single carport & car space

$420pw

$450pw

4/86 Brisbane Street, Oxley Park

3

2

2

3/47 Australia Street, St Marys

4

2

2

• Brand new 3 br townhouse with garage & car space • Split system air conditioning to living area • BIRs to 2 bedrooms, WIR & ensuite to main

• Near new four bedroom townhouse with ducted AC • BIRs to three bedrooms & ensuite to main • Internal access to single automatic garage

$420pw

$480pw

27/39-41 Gidley Street, St Marys

3

2

2

3/117-119 Jamison Road, Penrith

4

2

2

• Three bedroom apartment with mirrored BIRs • Ensuite to main bedroom • Two allocated basement parking space & storage cage

• Four bedroom townhouse with ducted air conditioning • Built-in robes to all bedrooms & ensuite to main • Single automatic garage with drive through access

$510pw

$320pw

13 Tussock Street, Ropes Crossing

6/6-8 Parkes Avenue, Werrington

4

2

2

2

1

1

• Modern four bedroom with split system AC • Large master bedroom with WIR & ensuite • Internal access to double automatic garage

• Well presented first floor two bedroom unit • Updated kitchen & internal laundry • Balcony & single garage

$430pw

$370pw

4/152 Adelaide Street, St Marys

142 St Clair Avenue, St Clair

3

1

2

3

1

1

• Three bedroom townhouse with BIRs to all bedrooms • Ducted AC upstairs & split system AC downstairs • Single carport & single garage

• Three bedroom home with BIR x2 • Split system AC & carport behind gates • Granny flat fully fenced and leased separately

$430pw

$220pw

57 Boronia Road, North St Marys

19a Brockamin Drive, South Penrith

4

1

2

1

1

• Four spacious bedrooms • Separate living area • Ultra modern kitchen with ample storage & dishwasher

• Modern studio flat • Fully fenced & easy-to-maintain yard • On street parking

$250pw

$275pw

6/65 Park Avenue, Kingswood

23/40-42 Victoria Street, Werrington

1

1

1

2

1

1

• Well presented one bedroom unit close to Kingswood station • Updated kitchen & large covered balcony • Single garage under complex

• Two bedroom unit with split system AC • Mirrored built-in wardrobes to both bedrooms • Single carport & swimming pool in complex

$420pw

$510pw

5/27 Hobart Street, Oxley Park

1/33 Sydney Street, St Marys

2

1

1

• Near new two bedroom townhouse with BIRs to both bedrooms • Split system air conditioner to living area • Internal access to single garage

4

2

2

• Modern four bedroom townhouse with ducted AC • BIRs to three bedrooms & WIR & ensuite to main • Double garage with internal access

Strata Management

Qualified Staff | Complete Strata Service

Services including establishing records for new Strata Schemes. Obligation free consultation. For further information contact Helen Turner 0407 415 793 or Bruce Kilgour 0418 275 571

St Marys 9623 5666

210 Queen Street, St Marys rh.com.au/stmarys info@stmarys.rh.com.au Friday, May 17, 2019

WW33678

Western Property Magazine

19


SA T1 O 8TH PE MA N HO Y@ M 10- E 10: 30A M

starrpartners.com.au

glenmore park

4

2

Botanical Oasis

4583m2

Expressions of Interest 9 Prunus Close, Glenmore Park

Penrith|Glenmore Park 4724 6600

tregear DA Approved and Plenty of Opportunity AUCTION ON SITE 25/5/19 @ 3:30PM IF NOT SOLD PRIOR

What an absolutely incredible opportunity this one is! Sure to impress any keen developer, this expansive R2 zoned 2,148m2 block of land truly bursts with potential. Already complete with approved plans to build six dwellings, including four duplexes and two freestanding five bedroom homes, with a builder of your choice. All you will need to do is sit back, and rake in the returns! With the zoning allowing the potential to build a childcare facility, health consultation facilities, a veterinary hospital, boarding houses or plenty of other home business ideas (subject to council approvals). This truly is a fantastic opportunity. For any further information or to register for a site inspection, be sure to contact us today!

glenmore park Delightful Duplex What an absolutely incredible find this one is! Located in a family friendly pocket of Glenmore Park you will have access to all the nearby schools and parks, ideal for a growing family. With the additional bonus of having a fully equipped town centre for all your shopping needs, and a reliable public transport system, you will almost forget that Penrith’s vastly expanding CBD is only minutes away! This delightful duplex offers an abundance of open living space, upstairs ducted air-conditioning, and a generous sized backyard. We just know that you will love this one! Whether you are looking to move in, or take on a new investment, you simply must inspect this one before it’s too late!

3

2

1

$569,950 - $589,950 OPEN HOME: Sat 18/5 at 10-10:30am 61A Kiber Drive, Glenmore Park

Penrith|Glenmore Park 4724 6600

SA T 1 OP 8TH EN MA HO Y @ ME 1-1 .30 PM

SA T 1 OP 8TH EN MA HO Y @ ME 3-3 :30 PM

Be prepared to get blown away by this rare beauty! Positioned in a prime location, this charming home has an impressive surprise up its sleeve. Positioned on 4,583m2 of land, with truly immaculate gardens, you will surely fall in love with this stunning botanical oasis. With this spacious home also offering the modern day comforts such as ducted air-cond, ceiling fans, plush carpets, and spacious living arrangements, the family really will have all the space they could dream of. Offering a wide variety of schools, public transport options and direct access to the town centre, you really will have everything right at your fingertips. Be sure to give us a call and arrange an inspection for this truly spectacular family home!

4

2148m2 DA Approved Development Site OPEN HOME: Sat 18/5 at 3-3:30pm 125 Ellsworth Drive, Tregear

Penrith|Glenmore Park 4724 6600

jamisontown Whisper-Quiet Location What an absolute beauty this one is! Positioned in a whisper quiet cul-de-sac of Jamisontown, only seconds across from a peaceful nature reserve, this home really is an absolute dream. Offering a vast array of nearby shopping and dining options, an abundance of quality local schools, and plenty of local parks all within your reach, will make this incredible home absolutely perfect to raise a family. With the added convenience of the nearby Penrith CBD, and direct access to the M4, travel will be an absolute breeze! Featuring all the creature comforts such as ducted air-conditioning, covered parking, and picture perfect gardens, this immaculate home is sure to impress the whole family. Be sure to inspect this inviting home at the next inspection!

3

1

2

$589,950 - $619,950 OPEN HOME: Sat 18/5 at 1-1.30pm 9 Grafton Place, Jamisontown

Penrith|Glenmore Park 4724 6600

WW33845

20 Western Property Magazine

Friday, May 17, 2019


Glenmore Park Realty will be hosting a morning tea to support Cancer Council Australia When: Time: Where:

23rd May 2019 10am - 11am The Coffee Club Glenmore Park

Please RSVP by 20th May 2019 on 4733 1222 nsw.cancercouncilfundraising.org.au/GlenmoreParkRealty1

glenmorepark REALTY

Shop 7B Glenmore Park Town Centre Glenmore Parkway Glenmore Park

www.glenmoreparkrealty.com.au

4733 1222

Friday, May 17, 2019

WW33747

Western Property Magazine

21


N E P

O

OPEN HOUSE

CAN I HAVE YOUR ATTENTION PLEASE!! STYLE: Built by Beechwood Homes. RESIDENCE: This home is situated in Blue Hills with 4 bedrooms + study. The master bedroom with walk in robe and ensuite. Built in robes to all other bedrooms. Formal lounge + dining + family + rumpus. Double garage with drive thru access + covered entertaining. FEATURES: Inspect this home first and you will be surprised by the size and everything that this home has to offer as well as the great position. The home is within walking distance to popular parks in Blue Hills. The property is currently tenanted with tenants in a lease until October 2019 currently paying $580 per week. Why not purchase now while the tenants are helping pay the mortgage until you move in. The home has ducted air conditioning, downlights and extensive tiling throughout. INSPECTIONS ON SATURDAYS ONLY . . . DON’T MISS OUT!

PRICE:

$799,000

13 Branksome Way, GLENMORE PARK OPEN:

Saturday 11.00 - 11.30am

N E P

O

OPEN HOUSE

FAMILY HOME IN FIRST STAGES ON A LARGE 751SQM BLOCK! STYLE: Beechwood Homes.

PRICE:

RESIDENCE: The home is located in a quiet cul-de-sac, consisting of 4 bedrooms with ensuite & robe to the main and robes to all other rooms. Lounge, dining, large rumpus area, large outdoor under cover area and double garage with drive through access.

17 Staples Place, GLENMORE PARK

FEATURES: From the moment you walk into this home you will be surprised . . . all the hard work has been done, the home only needs a new family. There is tiling to ceilings in bathrooms, a modern colour scheme, extensive tiling in main living areas, completely renovated kitchen with soft close drawers, stone benchtop and gas cooking. Other features include ducted a/c, under cover entertaining areas, alarm, ceiling fans and a cubby house. Located a short distance from the Mulgoa Road entry, parks, shops, sporting fields and public transport. CALL TODAY TO ARRANGE YOUR INSPECTION!

glenmorepark 22

REALTY

Shop 7B Glenmore Park Town Centre Glenmore Parkway Glenmore Park

www.glenmoreparkrealty.com.au

4733 1222

Western Property Magazine

OPEN:

$799,000

Saturday 12.00 - 12.30pm

WW33748

Friday, May 17, 2019


EW

N

OPEN HOUSE

LARGE FAMILY HOME IN A GREAT LOCATION STYLE: Domain Homes

PRICE:

RESIDENCE: 4 bedrooms, study, 2.5 bathrooms, lounge, dining, family room, separate meals area, 2 rumpus rooms, in-ground pool and a double drive through garage. FEATURES: Perfectly positioned in the prestigious “Blue Hills� precinct of Glenmore Park, this home is perfect for the growing family. Featuring 4 large bedrooms, main with parents retreat, ensuite (which is the size of a main bathroom) and a walk-in robe. In the heart of the home, the welldesigned kitchen includes gas cooking, generous storage and ample bench space which overlooks the light-filled meals area. The rest of the living areas are a great combination of formal and informal areas. Externally you will find the sparkling inground pool, entertaining area and still enough room for the kids to run and play.

glenmorepark REALTY

Shop 7B Glenmore Park Town Centre Glenmore Parkway Glenmore Park

www.glenmoreparkrealty.com.au

4733 1222

Friday, May 17, 2019

$949,000 - $999,000

7 Kingsfield Avenue, GLENMORE PARK OPEN:

Saturday 2.00 - 2.30pm

WW33749

Western Property Magazine

23


EW

N

OPEN HOUSE

LARGE FAMILY HOME IN BLUE HILLS! STYLE: Built by Windcrest Homes

PRICE:

RESIDENCE: 5 bedrooms, 3 bathrooms, formal lounge, formal dining, family room, rumpus + triple garage with drive through access. FEATURES: This home is positioned at the end of a cul-de-sac in the popular ‘Blue Hills’ area and consists of 5 good size bedrooms, the main with ensuite + walk-in robe and the other 4 with built-in robes. The large kitchen is central to all living areas and includes gas cooktop, oven, corner pantry, dishwasher and has an abundance of bench space. The upstairs rumpus has a projector and screen ready for the perfect movie night. Outdoors you have an under cover entertaining area and inground saltwater pool complete with waterfall and pond area. Other features include ducted air conditioning, alarm system, solar heated in-ground pool, automatic garage doors, ceiling fans and ample storage throughout the home. If you have been looking for that perfect home, this is the one! All set on a great 706sqm block.

glenmorepark 24

REALTY

Shop 7B Glenmore Park Town Centre Glenmore Parkway Glenmore Park

www.glenmoreparkrealty.com.au

4733 1222

Western Property Magazine

$989,000

4 Suntop Place, GLENMORE PARK OPEN:

Saturday 1.00pm - 1.30pm

WW33750

Friday, May 17, 2019


EW

N

OPEN HOUSE

NOT A THING TO DO!! STYLE: Built by Westminster Homes. RESIDENCE: 3 bedrooms all with built in robes. Lounge + dining + family room. Single garage + double carport. Large covered entertaining area overlooking the backyard. FEATURES: This is the home you have been waiting for! It has been totally renovated and is immaculately presented. The bathroom has been stylishly renovated with freestanding bath, subway tiles to the ceiling + two shower heads. The kitchen has also been renovated with stone benchtops, modern appliances, convection oven + overhead cupboards. New flooring and new blinds. This home is positioned in a cul-de-sac close to schools, parks and public transport. Off street parking for 4-6 cars. The property has two entertaining areas and a garden shed plus plenty of room in the backyard for the kids to play. This home was recently sold in February. The images used are from the original sale. THIS PROPERTY WOULD MAKE A SENSATIONAL FIRST HOME OR DOWNSIZE . . . DON’T MISS OUT!

PRICE:

$669,000

35 Yuroka Street, GLENMORE PARK OPEN:

Saturday 12.00 - 12.30pm

PRICE:

$579,000

N E P

O

OPEN HOUSE

ONE OF A KIND, ALL THE HARD WORK HAS BEEN DONE! STYLE: Single level clad home. RESIDENCE: Consisting of 3 bedrooms with built-in robes, kitchen, bathroom, lounge, dining and laundry. Large tandem garage. FEATURES: Calling all first home buyers and downsizers. As you walk up to this property you will be pleasantly surprised by the presentation and how well the home is positioned on the block. Allowing off street parking for at least 5 cars and a large 12 x 5 metre Colorbond garage with automatic door. Upon walking into the house you will notice that there is not a single thing to do! Every room has been updated, the kitchen is only 2 years young. The modern bathroom is neat and tidy plus the laundry has an extra toilet for convenience. Externally you have a generous size under cover area and a completely fenced yard. Out the front you have a gorgeous deck, perfect for capturing the beautiful afternoon sunsets. Other features include full insulation, under floor ducted air conditioning, a water tank, fish pond and so much more. Don’t miss the opportunity to view this perfect home!

glenmorepark REALTY

Shop 7B Glenmore Park Town Centre Glenmore Parkway Glenmore Park

www.glenmoreparkrealty.com.au

4733 1222

Friday, May 17, 2019

56 Thirteenth Street, WARRAGAMBA OPEN:

Saturday 3.00 - 3.30pm

WW33751

Western Property Magazine

25


kristen@riseconveyancing.com.au www.riseconveyancing.com.au PO Box 88, Emu Plains | 0447 484 907 26

Western Property Magazine

WW37022

With over 20 years of experience in Conveyancing, Kristen has extensive knowledge to ensure a smooth property transaction. Whether you are looking at buying or selling a house, unit, vacant land or new development, Rise Conveyancing is dedicated to providing you with quality advice clearly outlining your rights and obligations. Rise Conveyancing is more than your traditional conveyancing firm, we tailor our services to meet your needs by offering advice in plain English, a mobile service as well as after hours appointments and fixed price packages ensuring you have financial certainty from the start of your transaction.

Friday, May 17, 2019


OPEN HOMES & RENTAL PROPERTY GUIDE OPEN HOMES ADDRESS

SUBURB

TIME

OPEN HOMES

AGENT

ADDRESS Thursday 16th May

SUBURB

TIME

AGENT

Emu Heights

11-11.30am

Property Central

Emu Plains

1.30 - 2pm

Jim Aitken & Partners Emu Plains

13 Branksome Way

Glenmore Park

11-11:30am

Glenmore Park Realty

7 Devaney Avenue

Glenmore Park

11-11:30am

Glenmore Park Realty

17 Staples Place

Glenmore Park

12-12:30pm

Glenmore Park Realty

35 Yuroka Street

Glenmore Park

12-12:30pm

Glenmore Park Realty

4 Suntop Place

Glenmore Park

1-1:30pm

Glenmore Park Realty

7 KingsďŹ eld Avenue Glenmore Park

2-2:30pm

Glenmore Park Realty

17/47 Camellia Ave

Glenmore Park

10-10:30am

Starr Partners Penrith/Glenmore Park

61A Kiber Dr

Glenmore Park

10-10:30am

Starr Partners Penrith/Glenmore Park

8 Kenneth Slessor Dr Glenmore Park

11-11:30am

Starr Partners Penrith/Glenmore Park

7 Harwood Circ

Glenmore Park

11.30 - 12pm

Jim Aitken & Partners Glenmore Park

9 Tugra Close

Glenmore Park

12.30 - 1pm

Jim Aitken & Partners Glenmore Park

32 Monteray Terr

Glenmore Park

1.30 - 2pm

Jim Aitken & Partners Emu Plains

39 Nindi Crescent

Glenmore Park

11.30-12pm

Property Central

50 Waterford Way

Glenmore Park

11.30-12pm

Property Central

Hebbersham

2-2.30pm

Ray White Werrington County

9 Grafton Pl

Jamisontown

1-1:30pm

Starr Partners Penrith/Glenmore Park

41 Hatchinson Cres

Jamisontown

9:30-10am

Penrith Professional Real Estate

EMU HEIGHTS 36 Wedmore Road

PENRITH 50 Rodley Ave

Penrith

5 - 6pm

Jim Aitken & Partners Emu Plains

EMU PLAINS

12 Vista St

Penrith

5 - 6pm

Jim Aitken & Partners Emu Plains

1/2 Willow Tree Av

OPEN HOMES

Saturday 18th May

BLACKETT 46 Parkes Crescent

Blackett

10-10:30am

REMAX Lifestyle Marketing

CADDENS 65 Barnea Avenue

Caddens

10 -10.30am

Ray White Glenmore Park

CAMBRIDGE GARDENS 3 Grange Cres

Cambridge Gardens 1-1:30pm

ResponseRE Penrith

CAMBRIDGE PARK 7/52 Cam St

Cambridge Park

2-2:30pm

Raine & Horne St Marys

8 Brady Place

Glenmore Park

11-11.30am

Ray White Glenmore Park

5/44-46 Luttrell St

Glenmore Park

11-11.30am

Ray White Glenmore Park

62 Shearwater Dr

Glenmore Park

12-12.30pm

Ray White Glenmore Park

12 Cascade Avenue

Glenmore Park

2.30-3pm

Ray White Werrington County

65 Cambridge St

Cambridge Park

2:30-3pm

REMAX Lifestyle Marketing

18 College Street

Cambridge Park

3:30-4pm

REMAX Lifestyle Marketing

34 Worcester

Cambridge Park

4:30-5pm

REMAX Lifestyle Marketing

CLAREMONT MEADOWS

GLENMORE PARK

HEBBERSHAM 14 Merrina Street,

JAMISONTOWN

33 Falcon Cres

Claremont Meadows 11-11:30am

Raine & Horne St Marys

12 Werona Avenue

Claremont Meadows 9:30-10am

REMAX Lifestyle Marketing

1 Apsley Crt

Cranebrook

10-10:30am

ResponseRE Penrith

1 Fishburn St

Jordan Springs

11-11:30am

Starr Partners Penrith/Glenmore Park

117 Lakeview Dr

Cranebrook

11-11:30am

Penrith Professional Real Estate

4 Patanga Cres

Jordan Springs

11.30 - 12pm

Jim Aitken & Partners Jordan Springs

34 Tornado Cres

Cranebrook

10:45-11am

Penrith Professional Real Estate

1 Nelson Street

Jordan Springs

11.30 - 12pm

Jim Aitken & Partners Jordan Springs

105 Goldmark Cres

Cranebrook

10.30 - 11am

Jim Aitken & Partners Jordan Springs

4 Flagship Ridge

Jordan Springs

12.30 - 1pm

Jim Aitken & Partners Jordan Springs

5 Britten Close

Cranebrook

1.30 - 2pm

Jim Aitken & Partners Penrith

29 Adina Street

Jordan Springs

12.30 - 1pm

Jim Aitken & Partners Jordan Springs

15 Waterside Blv

Cranebrook

1.30 - 2pm

Jim Aitken & Partners Jordan Springs

11 Montague Drive

Jordan Springs

10-10.30am

Property Central

20 Gannet Drive

Cranebrook

1.30 - 2pm

Jim Aitken & Partners Penrith

17 Jardine Way,

Jordan Springs

11-11.30am

Ray White Werrington County

32 Antonia Crescent Cranebrook

9-9.30am

Property Central

KINGSWOOD

12 Lapwing Way

1:30-2:15pm

REMAX Lifestyle Marketing

17/56 Park Ave

Kingswood

9:30-10am

Penrith Professional Real Estate

CRANEBROOK

JORDAN SPRINGS

Cranebrook

Friday, May 17, 2019

Western Property Magazine

27


OPEN HOMES ADDRESS

SUBURB

TIME

OPEN HOMES

AGENT

ADDRESS Saturday 18th May

KINGSWOOD

SUBURB

TIME

AGENT

74 Fragar Road

South Penrith

12.30-1pm

Property Central

SOUTH PENRITH

35 Gladys St

Kingswood

9:30-10am

Penrith Professional Real Estate

47 Bickley Road

South Penrith

3-3.30pm

Property Central

9/9-13 Rodgers St

kingswood

11:45-12:15pm Penrith Professional Real Estate

49 Bickley Road

South Penrith

2-2.30pm

Property Central

18 Edna St

kingswood

12:30-1pm

Penrith Professional Real Estate

ST CLAIR

1/11 George St

Kingswood

10.30 - 11am

Jim Aitken & Partners Penrith

2 Rochford St

St Clair

10-10:30am

Raine & Horne St Marys

4 Walsh Place

Kingswood

11.30 - 12pm

Jim Aitken & Partners Penrith

ST MARYS

13 Elizabeth Cres

Kingswood

11.30 - 12pm

Jim Aitken & Partners Emu Plains

10/51-53 Mamre Rd St Marys

11-11:30am

Raine & Horne Penrith

1/3-5 Garner St

St Marys

12-12:30pm

Starr Partners Penrith/Glenmore Park

St Marys

11-11:30am

Raine & Horne St Marys

LEONAY 49 Deloraine Drive

Leonay

12.30 - 1pm

Jim Aitken & Partners Emu Plains

4/165 Adelaide St

48 Currawong Cres

Leonay

12:15-1pm

REMAX Lifestyle Marketing

1-9/165 Canberra St St Marys

11:30am-12pm Raine & Horne St Marys

5/27 John St

St Marys

12-12:30pm

Raine & Horne St Marys

10 Kungala St

St Marys

10-10:30am

Raine & Horne St Marys

5/41 Brisbane St

St Marys

12:30-1pm

Professionals St Marys

4 Knox St

St Marys

11-11:30am

Professionals St Marys

239 Shepherd St

St Marys

12-12:30pm

Professionals St Marys

24 Australia Street

St Marys

10:30-11am

REMAX Lifestyle Marketing

125 Ellsworth Dr

Tregear

3-3:30pm

Starr Partners Penrith/Glenmore Park

25 Vincennes Ave

Tregear

10-10:30am

Raine & Horne St Marys

Warragamba

3-3:30pm

Glenmore Park Realty

34 Terrymont Rd

Warrimoo

1 - 1.30pm

Jim Aitken & Partners Glenbrook

Worrimoo

2-3pm

REMAX Lifestyle Marketing

MINCHINBURY 5 Cuvee Place

Minchinbury

4-4:30pm

REMAX Lifestyle Marketing

MOUNT DRUITT 16 Vincent St

Mt Druitt

11-11:30am

Professionals Erskine Park

NORTH ST MARYS 39A Debrincat Ave

North St Marys

10:45-11:15am Raine & Horne St Marys

ORAN PARK

TREGEAR

23 Willmington Loop Oran Park

9.30 - 10am

Jim Aitken & Partners Glenmore Park

OXLEY PARK 3/22 Braddon St

Oxley Park

12-12:30pm

Raine & Horne St Marys

WARRAGAMBA

5/41 Brisbane St

Oxley Park

1-1:30pm

Raine & Horne St Marys

56 Thirteenth St

18 Canberra St

Oxley Park

11-11:30am

Professionals St Marys

WARRIMOO

PENRITH 1 Lemongrove Rd

Penrith

12-12:30pm

Starr Partners Penrith/Glenmore Park

31 The Avenue

86/40-50 Union Rd

Penrith

1-1:30pm

Starr Partners Penrith/Glenmore Park

WERRINGTON

11/117-119 Jamison Rd Penrith

2-2:30pm

Raine & Horne St Marys

2/32-34 Lethbridge Ave Werrington

1:15-1:45pm

Raine & Horne St Marys

6/38 Castlereagh St

Penrith

10:15-10:45am Penrith Professional Real Estate

27/14-20 Parkes Ave Werrington

1-1:30pm

Raine & Horne St Marys

5/20 Thurston St

Penrith

10-10:30am

Penrith Professional Real Estate

32 Albert Street

11:15-11:45am REMAX Lifestyle Marketing

23/79-81 Union Rd

Penrith

11.30 - 12pm

Jim Aitken & Partners Penrith

WERRINGTON COUNTY

30/13-19 Robert St

Penrith

12.30 - 1pm

Jim Aitken & Partners Penrith

15 Glencoe Ave

Werrington County

12:30-1pm

Penrith Professional Real Estate

6/33 Robert Street

Penrith

12.30 - 1pm

Jim Aitken & Partners Emu Plains

21 Hume Crescent

Werrington County

1.30-2pm

Property Central

8 Fox Place

Penrith

2.30 - 3pm

Jim Aitken & Partners Penrith

10 Cofton Court

Werrington County

12-12.30pm

Ray White Werrington County

50 Rodley Ave

Penrith

2.30 - 3pm

Jim Aitken & Partners Emu Plains

WILLMOT

10 Vista St

Penrith

2.30 - 3pm

Jim Aitken & Partners Emu Plains

34 Captain Cook Dr

Willmot

10-10:30am

Professionals St Marys

40-42 Barber Ave

Penrith

10-10:30am

REMAX Lifestyle Marketing

9 Arnhem Pl

Willmot

12-12:30pm

Professionals Plumpton

10-12pm

REMAX Lifestyle Marketing

OPEN HOMES

Cnr Colless & Lethbridge Penrith

ROPES CROSSING 24 Finsbury Circuit

Sunday 19th May

CAMBRIDGE GARDENS Ropes Crossing

12:15-1:15pm

REMAX Lifestyle Marketing

SHALVEY 5 Rosewall Pl

Werrington

20 Coronation Gr

Cambridge Gardens 12 - 12.40pm

Jim Aitken & Partners Emu Plains

Cambridge Park

11.30 - 12pm

Jim Aitken & Partners Penrith

CAMBRIDGE PARK Shalvey

1-1:30pm

Professionals Plumpton

SOUTH PENRITH

12 Weatherby Av

CRANEBROOK

4 Robyn Av

South Penrith

10-10:30am

Raine & Horne Penrith

5 Etchell Place

Cranebrook

12.30 - 1pm

Jim Aitken & Partners Jordan Springs

168 Jamison Rd

South Penrith

1:30-2pm

Penrith Professional Real Estate

5 Britten Close

Cranebrook

1.30 - 2pm

Jim Aitken & Partners Penrith

28

Western Property Magazine

Friday, May 17, 2019


PROPERTIES FOR RENT SUBURB

DESCRIPTION

RENT

AGENT

CADDENS Caddens

4 br house

$630pw

4730 1777 Jim Aitken & Partners Jordan Springs

CAMBRIDGE GARDENS

SUBURB

DESCRIPTION

RENT

AGENT

Kingswood

2 br unit

$270pw

9623 5666 Raine & Horne St Marys

Kingswood

2 br Granny Flat

$380

0490 103 153 REMAX Lifestyle Marketing

2br Duplex

$300pw

02 4725 5555 ResponseRE Penrith

3 br house

$450pw

4722 5000 Jim Aitken & Partners Penrith

2 br unit

$310pw

9673 4422 St Marys Professionals

LETHBRIDGE PARK

Cambridge Gardens

3br House

$360pw

02 4725 5555 ResponseRE Penrith

Lethbridge Park

Cambridge Gardens

4br House

$430pw

02 4725 5555 ResponseRE Penrith

LONDONDERRY

Cambridge Park

3 br house

$410pw

4733 6999 Jim Aitken & Partners Glenmore Park

MOUNT DRUITT

Cambridge Park

4br House

$520pw

02 4725 5555 ResponseRE Penrith

Mount Druitt

Cambridge Park

4 br townhouse

$450pw

9623 5666 Raine & Horne St Marys

NORTH ST MARYS North St Marys

3 br house

$310pw

9623 5666 Raine & Horne St Marys

Claremont Meadows

1br Villa

$260pw

02 4725 5555 ResponseRE Penrith

North St Marys

4 br house

$430pw

9623 5666 Raine & Horne St Marys

Claremont Meadows

3 br terrace house

$495pw

9623 5666 Raine & Horne St Marys

OXLEY PARK

Claremont Meadows

3 br Terrace Home

$490

0490 103 153 REMAX Lifestyle Marketing

Oxley Park

3 br townhouse

$420pw

9623 5666 Raine & Horne St Marys

Oxley Park

3 br t/house

$400pw

4728 4000 Property Central

Londonderry

CAMBRIDGE PARK

CLAREMONT MEADOWS

COLYTON Colyton

4 br house

$395pw

4722 5000 Jim Aitken & Partners Penrith

PENRITH

Colyton

3 br house

$370pw

9623 5666 Raine & Horne St Marys

Penrith

2 br granny flat

$330pw

4722 5000 Jim Aitken & Partners Penrith

Colyton

4 br house

$460pw

9623 5666 Raine & Horne St Marys

Penrith

2 br unit

$340pw

4722 5000 Jim Aitken & Partners Penrith

Penrith

3 br house

$350pw

4722 5000 Jim Aitken & Partners Penrith

Cranebrook

3 br duplex

$390pw

4722 5000 Jim Aitken & Partners Penrith

Penrith

2 br house

$370pw

4722 5000 Jim Aitken & Partners Penrith

Cranebrook

3 br house

$460pw

4722 5000 Jim Aitken & Partners Penrith

Penrith

3 br house

$420pw

4733 6999 Jim Aitken & Partners Glenmore Park

Cranebook

3br House

$680pw

02 4725 5555 ResponseRE Penrith

Penrith

2 br unit

$430pw

4722 5000 Jim Aitken & Partners Penrith

Cranebrook

2br House

$360pw

02 4725 5555 ResponseRE Penrith

Penrith

1br House

$250pw

02 4725 5555 ResponseRE Penrith

Cranebrook

4br House

$460pw

02 4725 5555 ResponseRE Penrith

Penrith

2br Unit

$300pw

02 4725 5555 ResponseRE Penrith

Cranebrook

4br House

$590pw

02 4725 5555 ResponseRE Penrith

Penrith

2br Unit

$310pw

02 4725 5555 ResponseRE Penrith

Cranebrook

2 br house

$330pw

9623 5666 Raine & Horne St Marys

Penrith

4br Townhouse

$490pw

02 4725 5555 ResponseRE Penrith

Cranebrook

3br house

$380pw

4725 3100 Penrith Professionals Real Estate

Penrith

3br House

$520pw

02 4725 5555 ResponseRE Penrith

Penrith

2 br house

$300pw

9623 5666 Raine & Horne St Marys

Emu Heights

3 br house

$420pw

4733 6999 Jim Aitken & Partners Glenmore Park

Penrith

4 br townhouse

$480pw

9623 5666 Raine & Horne St Marys

Emu Heights

4br house

$470pw

4725 3100 Penrith Professionals Real Estate

Penrith

3 br house

$430pw

4728 4000 Property Central

Penrith

2 br unit

$340pw

4732 4000 Property Central

Emu Plains

3 br townhouse

$485pw

4735 8888 Jim Aitken & Partners Emu Plains

Penrith

2 br Apartment

$340

0490 103 153 REMAX Lifestyle Marketing

Emu Plains

5 br house

$510pw

4739 1111 Jim Aitken & Partners Glenbrook

PLUMPTON

Emu Plains

5 br house

$680pw

4735 8888 Jim Aitken & Partners Emu Plains

Plumpton

3 br home

$400pw

9673 4422 St Marys Professionals

Emu Plains

4 br duplex

$600pw

4728 4000 Property Central

PROSPECT Studio Apartment

$320

0490 103 153 REMAX Lifestyle Marketing

1 br granny flat

$290pw

9623 5666 Raine & Horne St Marys

3br House

$450pw

02 4725 5555 ResponseRE Penrith

1 br flat

$320pw

4733 6999 Jim Aitken & Partners Glenmore Park

ROPES CROSSING

Glenmore Park

4 br house

$500pw

4733 6999 Jim Aitken & Partners Glenmore Park

Ropes Crossing

4 br home

$520pw

9673 4422 St Marys Professionals

Glenmore Park

3 br townhouse

$410pw

9673 4422 St Marys Professionals

Ropes Crossing

4 br house

$540pw

9623 5666 Raine & Horne St Marys

Glenmore Park

4br Townhouse

$520pw

02 4725 5555 ResponseRE Penrith

SOUTH PENRITH

Glenmore Park

3 br house

$485pw

4730 4000 Property Central

South Penrith

3 br house

$400pw

4722 5000 Jim Aitken & Partners Penrith

Glenmore Park

4 br house

$650pw

4737 9911 Ray White Glenmore Park

South Penrith

2br House

$320pw

02 4725 5555 ResponseRE Penrith

South Penrith

3br House

$360pw

02 4725 5555 ResponseRE Penrith

CRANEBROOK

EMU HEIGHTS

EMU PLAINS

Prospect

ERSKINE PARK Erskine Park

Richmond

GLENMORE PARK Glenmore Park

RICHMOND

JAMISONTOWN Jamisontown

3 br house

$380pw

4733 6999 Jim Aitken & Partners Glenmore Park

South Penrith

3br Villa

$380pw

02 4725 5555 ResponseRE Penrith

Jamisontown

3 br house

$450pw

4733 6999 Jim Aitken & Partners Glenmore Park

South Penrith

4 br house

$450pw

9623 5666 Raine & Horne St Marys

Jamisontown

3 br house

$460pw

4733 6999 Jim Aitken & Partners Glenmore Park

South Penrith

3 br Townhouse

$415

0490 103 153 REMAX Lifestyle Marketing

Jordan Springs

4 br home

$550pw

9673 4422 St Marys Professionals

ST CLAIR

Jamisontown

3br House

$400pw

02 4725 5555 ResponseRE Penrith

St Clair

3 br home

$410pw

9673 4422 St Marys Professionals

Jamisontown

3br House

$430pw

02 4725 5555 ResponseRE Penrith

St Clair

3 br house

$410pw

9623 5666 Raine & Horne St Marys

Jamisontown

2 br apartment

$370pw

9623 5666 Raine & Horne St Marys

ST MARYS St Marys

3 br home

$330pw

9673 4422 St Marys Professionals

4br House

$500pw

02 4725 5555 ResponseRE Penrith

St Marys

3 br townhouse

$390pw

9673 4422 St Marys Professionals

St Marys

3 br townhouse

$410pw

9673 4422 St Marys Professionals 02 4725 5555 ResponseRE Penrith

JORDAN SPRINGS Jordan Springs KINGSWOOD Kingswood

3 br house

$315pw

4722 5000 Jim Aitken & Partners Penrith

St Marys

3br House

$380pw

Kingswood

3 br townhouse

$360pw

4733 6999 Jim Aitken & Partners Glenmore Park

St Marys

3 br townhouse

$430pw

9623 5666 Raine & Horne St Marys

Kingswood

4 br townhouse

$450pw

4722 5000 Jim Aitken & Partners Penrith

St Marys

4 br townhouse

$450pw

9623 5666 Raine & Horne St Marys

Kingswood

2br Granny Flat

$270pw

02 4725 5555 ResponseRE Penrith

St Marys

3br townhouse

$350pw

4725 3100 Penrith Professionals Real Estate

Kingswood

2br Granny Flat

$320pw

02 4725 5555 ResponseRE Penrith

St Marys

3br house

$380pw

4725 3100 Penrith Professionals Real Estate

Kingswood

3br House

$350pw

02 4725 5555 ResponseRE Penrith

WERRINGTON

Kingswood

3br House

$390pw

02 4725 5555 ResponseRE Penrith

Werrington

2 br unit

$285pw

9673 4422 St Marys Professionals

Kingswood

3br House

$400pw

02 4725 5555 ResponseRE Penrith

Werrington

2 br townhouse

$330pw

9623 5666 Raine & Horne St Marys

Kingswood

3br Townhouse

$420pw

02 4725 5555 ResponseRE Penrith

Werrington

3b House

$370pw

4725 3100 Penrith Professionals Real Estate

Kingswood

3br Townhouse

$460pw

02 4725 5555 ResponseRE Penrith

WERRINGTON COUNTY

Kingswood

1 br unit

$250pw

9623 5666 Raine & Horne St Marys

Werrington County

3 br house

$420pw

Friday, May 17, 2019

9623 6366 Ray White Werrington County

Western Property Magazine

29


NOBODY IN THE WORLD SELLS MORE REAL ESTATE THAN RE/MAX.®

18 Colless Street, Penrith

2

2

1

GREAT LOCATION, QUALITY FINISHES AND BIGGER THAN USUAL APARTMENTS . . .

CHILDCARE FACILITY ON SITE Whether buying to invest or to occupy, if great location, quality finishes and bigger than usual apartments with secure parking appeals, then you should set some time aside to look at these apartments. With expected completion within a couple of months, we can show you the open plan styling, large balconies and so much more now. Call into the complex on Saturday mornings between 10:00am and 12:00pm and meet with Phil Haley. Corner of Colless and Lethbridge Street. We prefer to show each family through privately so call Phil on 0412 355 020, to make an appointment.

Hunter Valley

5

3

1

Sale : Contact Phil Inspection: Sat 10:00 - 12:00pm PHIL HALEY M: 0412 355 020 E: shaley@remax.com.au

Excellent Investment: Dual Living! 5

3

2

• Separate entries

TWO RENTAL INCOMES

• Soundproof firewall

Affordable entry to the property market plus investment. Side by side house & granny flat Sale : $585 Turnkey Package Growth corridor Inspection: Contact Agent 8 mins to Maitland CBD 43 mins to Newcastle LITSA MELETI Limited stock M: 0466 969 164 Potential rental return: $660 - $700pw E: litsameleti@remax.com.au

• Only pay one set of council rates • Turn key home • Two rental income returns, or live in one and rent out the other Approximate rental return: $600-$660pw

Sale : $459,990 Inspection: By Appointment GIZZELLE POWELL M: 0428 934 618 E: gizzellepowell@remax.com.au WW37380

Put Our Winning Team to Work

Phil Haley 0412 355 020 0

30 Western Property Magazine

Li Litsa Meleti 0466 04 969 164

Gizzelle Powell 0428 934 618

Paul Tanner 0410 587 553

Victor Borg 0439 755 081

Olivia Johnstone 0490 103 153

Louise Anger 0488 094 993

Iouri Tcherkas 0434 708 899

Friday, May 17, 2019


NOBODY IN THE WORLD SELLS MORE REAL ESTATE THAN RE/MAX.®

1 Amazon Place, St Clair

5

2

2

ANOTHER HOME SOLD BY GIZZELLE POWELL

PROFESSIONAL AND INFORMATIVE, POLITE AND HARDWORKING Litsa went out of her way and was always accessible during our journey of selling of our property. We would recommend Litsa if you were think of selling. Zoran and Katherine.

SOLD : $710,000 LITSA MELETI M: 0466 969 164 E: litsameleti@remax.com.au

Penrith

1

1

1

LUXURY APARTMENT

7/24-28 Australia Street

2

1

CONVENIENCE AND LIFESTYLE LIVING

Located within the Golden Triangle of Penrith and Kingswood this beautifully finished one bedroom apartment is a great starter or an addition to any portfolio. Potential rental return: $400 - $430 p/w • Quality timber look tile flooring in living space and carpets in bedrooms • Kitchen and laundry fitted with stone Sale : $420,000 benchtops and porcelain tiling Inspection: Contact Agent • Smeg stainless steel gas cooktop, PAUL TANNER & GIZZELLE POWELL range hood, dishwasher and M: 0410 587 553 / 0428 934 618 electrical oven E: ptanner@remax.com.au

If you’re downsizing and wanting to stay in a place that you are comfortable and familiar with then look no more. This stylish villa offers low maintenance, lifestyle living in an exceptionally convenient location. In an ideal lifestyle location, the property is a short walk to St Marys Train station, shops, cafes and eateries as well as a variety of nearby transport options. Call Gizzelle now for further information or for your private inspection before you miss out. The benefits of buying this property are: • Two bedrooms all fitted with built-in robes Sale : Just Listed • Modern well-designed kitchen Inspection: Contact Agent • Lovely bathroom • Split system air conditioning GIZZELLE POWELL • Under cover alfresco M: 0428 934 618 • Low maintenance courtyard • Over 55s complex E: gizzellepowell@remax.com.au

RE/MAX HOT PROPERTIES

HOT PROPERTIES IN CAMBRIDGE PARK

WW33793

Put Our Winning Team to Work

Friday, May 17, 2019

Phil Haley 0412 355 020 0

Li Litsa Meleti 0466 04 969 164

Gizzelle Powell 0428 934 618

Paul Tanner 0410 587 553

Victor Borg 0439 755 081

Olivia Johnstone 0490 103 153

Louise Anger 0488 094 993

Iouri Tcherkas 0434 708 899

Western Property Magazine

31


NOBODY IN THE WORLD SELLS MORE REAL ESTATE THAN RE/MAX.®

12 Lapwing Way, Cranebrook 4

2

2+2

For Lease 54 FOWLER STREET CLAREMONT MEADOWS OH: SATURDAY 10:30-10:45AM 3 BED, 2.5 BATH, 1 GARAGE • Three bedrooms all with built-in robes and access to balconies • Main bedroom with ensuite, walk-in robe and balcony • Modern kitchen with Caesar stone benchtops and separate dining area • Ducted air-conditioning • Spacious Alfresco • Single garage + 1 allocated space • 600m from M4

5/1-2 THE CRESCENT, PENRITH OH: SATURDAY 11:00-11:15AM 2 BED, 1 BATH, 1 GARAGE

BE SURE TO INSPECT THIS BEAUTIFUL HOME, FIRST OR LAST You will not be disappointed when you check this beautiful home built in one of the most prestigious estates in Penrith. Generous by nature this near new home offers an open plan design with combined living and dining area, exquisite modern kitchen features 40mm Caesarstone benchtop, ample cupboard, 900mm gas cooktop and breakfast bar. Ample car accommodation is available with a remote-control Sale : Just Listed double garage plus car spaces on the driveway Inspection: Contact Agent for the family’s extra vehicle. This beautiful home is probably one of the best homes in the suburb GIZZELLE POWELL and we don’t believe it will be in the market for long. So, don’t put off visiting it, contact us now to make a M: 0428 934 618 E: gizzellepowell@remax.com.au time to pop by for your private inspection.

South St Marys

4

2

2

• Renovated bathroom • Freshly painted • Your own balcony • Your own laundry • Single lock-up garage • Penrith train station 1.9km drive away

Call Olivia today to book your private viewing OLIVIA JOHNSTONE M: 0490 103 153 E: olivia.johnstone@remax.com.au

24/ 2 Park Road, Wallacia

2

1

1

FOUR BEDROOMS TWO BATHROOMS Double garage as well as room to park a truck, caravan and a 4WD. Benefits include: • DA approval for 3rd Bathroom • Front and back verandahs • Conveniently located with shops, train, M4 Call Litsa for your Private Preview

Wallacia

IMMACULATE OVER 55s

Sale : Just Listed Inspection: Contact Agent LITSA MELETI M: 0466 969 164 E: litsameleti@remax.com.au

6

3

10+

• Easy access unit at Regal Oaks • Modern Kitchen & bathroom • Balcony to the master bedroom • Ducted aircon • Newly carpeted

Minchinbury

Sale : $310,000 - $330,000 Inspection: Sat 10.15-10.45am LITSA MELETI M: 0466 969 164 E: litsameleti@remax.com.au

6

2

4

UNDULATING AND PEACEFUL LAND

GREAT FAMILY HOME

• Set on 56 acres approx. • Generously proportioned home with further separate accommodation • Amazing vistas only 20 minutes approx. drive to Penrith, Sydney is 1 hour 11 minutes away and new airport 12 minutes Sale : Contact Agent approx. drive • 2 large sheds Inspection: 9.30-10am • Solar heated indoor pool LITSA MELETI & PHIL HALEY • Water bore with flow 20/22 ltr/sec plus M: 0466 969 164 / 0412 355 020 Irrigation Licence: water pumping rights from Nepean River for 12 Meg/litres E: litsameleti@remax.com.au

This two-storey home offers a wealth of accommodation, including 6 Bedrooms plus Multiple Living areas, two bathrooms, lock up garage and sparkling salt water swimming pool that is perfect for the whole family. The benefits: • 6 bedrooms all with built-in robes Sale : $799,000 • Ensuite to main bedroom Inspection: Sat 10.00-11.00am • Contemporary kitchen LITSA MELETI & PAUL TANNER • Lots of cupboards for storage • 2 + living areas M: 0466 969 164 / 0410 587 553 • Saltwater swimming pool E: litsameleti@remax.com.au WW33794

What’s your Property worth? 32

Western Property Magazine

Book your FREE Appraisal now with one of our Winning Team on 4732 6007 Friday, May 17, 2019


THE BANNABY 5

$249,950 ON YOUR LAND

including standard site costs & BASIX. #Loadings may apply.

YES! It’s the

ENS.

OPTIONAL ALFRESCO 3.09 X 2.50 CONCRETE FINISH

BATH. FAMILY 5.00 X 3.00

W.C.

P’TRY L’DRY

DINING/STUDY 2.70 X 2.11

KITCHEN

W.C.

W.I.R.

BED 1 4.50 X 3.22

BATH. LINEN

STUDY NOOK

ST.

Allcastle Advantage

ROBE

P’DR FOYER

With Allcastle Homes luxury is still affordable. The Allcastle Bannaby 5 offers you 5 bedrooms, built in robes, an integrated open-plan kitchen, dining area and family room, plus a double garage, all for an unbelievably affordable price.

Double Storey Dream Home!

OPTIONAL BATH + ENSUITE

#

On your land, includes standard site costs & BASIX.

DOUBLE GARAGE

PORCH

ROBE

ROBE

BED 2 3.06 X 3.00

BED 5 3.62/3.00 X 3.00/2.55

BED 3 3.00 X 3.00

LINEN

YES!

A 5 bedroom home UNDER $250,000

W.I.R.

BED 4 3.62 X 3.38/2.55

CONCRETE FINISH

Don't miss out, call now and make it home with Allcastle Homes. Homeworld Kellyville: 18 Hartigan Avenue, Kellyville..8824 7620 or 9629 4788 or 9629 4772 or 9629 4799 Burns Road, Kellyville:...........................................................................................................................9629 4700 Homeworld Leppington: Jadeite Street, Emerald Hills...........................................9854 5730 or 9854 5750 Edmondson Park: Village Square Estate, 21 Clement Road, Edmondson Park.............................9629 4713 Marsden Park: McLoughlin Street, Marsden Park.............................................9854 5790 or 9854 5770 Oran Park: Webber Loop, Oran Park......................................................................................................9854 5780 Shell Cove: 36 Apollo Drive, Shell Cove.................................................................................................9854 5740

A U S T R A L I A N O W N E D family building company

allcastlehomes.com.au

3R]SYVPERHMRGPYHIWWXERHEVHWMXIGSWXW&%7-<ERHEYXLSVMX]VIUYMVIQIRXW0SEHMRKWQE]ETTP],SQIW[MXL)HKIJEGEHIERHXMPIHVSSJEWWXERHEVH YRPIWWWTIGMƤIH %VIEPSEHMRKWERHLERHPMRKGLEVKIWETTP]XSGIVXEMRGSYRGMPEVIEW ERHFPSGOW)EGLQSHIPLEWERMRHMZMHYEPMRGPYWMSRWPMWX4VMGIWEWTIV7]HRI]1IXVSFEWITVMGIPMWX4LSXSKVETLWQE]HITMGXMXIQWWYGLEWJYVRMXYVIƥSSVGSZIVMRKWPMKLXƤXXMRKWPERHWGETMRKVIXEMRMRK[EPPWJIEXYVI[EPPWJIRGMRK window furnishings, decorator items, upgrades, water features, pergolas not supplied by Allcastle Homes. Note: Photos within this advertisement may depict items not included. Please check with your sales consultant. *Smooth Durasheet *'I\XIVREPTEMRXIHƤRMWL[MXLNSMRXMRK%PPGEWXPI,SQIW4X]0XH&02'=4%

WW36520

Friday, May 17, 2019

Western Property Magazine

33


WW37032

34

Western Property Magazine

Friday, May 17, 2019


WW37033

Friday, May 17, 2019

Western Property Magazine

35


AGENT IN FOCUS

Holmes FOR HOMES TREVOR HOLMES STARR PARTNERS

LIST YOUR PROPERTY WITH ME 0466 496 944

Why did you become a real estate agent? To learn the process of buying, refurbishing and selling property. Working in real estate would get me into the heart of that process. Tell us about the first house you sold? It was a three bedroom semidetached suburban property over in the UK. Actually, what I remember more about that time was receiving three offers on the property – one in the main room; one in the living room and the third in the kitchen. That was quite an introduction to real estate at the time since they don’t conduct open homes over there in the UK like we do in Australia.

What do you love most about being an agent? I know it’s easy to use the word fun, but I really do enjoy it. There are thousands of people in Sydney, all with different needs and personalities, many with a story to tell, which can be both interesting and funny – and I love making new friends, of course dressing up as James Bond 002750 for my latest property video not only helps break the ice in those conversations, but also makes my day extremely fun. Why should people choose you over other agents? I understand that the end result depends on the agent you employ and begin with the end

in mind, I set out to achieve the best outcome for every client who engages my services. What has been your biggest ever real estate achievement? Many to choose from of course, but of a personal note, having achieved the landmark of selling over 1000 properties recently – this in itself is a testament to my abilities and the knowledge that this brings. What should people do to ensure their home sells for the best possible price? Seek professional advice as early as you can. A plan can be put in place, to help guide you with your decision making.

Helping you make better choices in the Blue Mountains, Penrith and Glenmore Park talk to us today  4739 9749 Blaxland  4721 1733 Penrith  4737 2417 Glenmore Park  MortgageChoice.com.au/rob.lees

Home loans | Financial planning | Risk and General insurance | Car loans | Business lending Mortgage Choice Limited ACN 009 161 979. Australian Credit Licence 382869. Mortgage Choice Financial Planning Pty Limited ACN 158 645 624. AFSL 422854.

36

Western Property Magazine

WW36658

Friday, May 17, 2019


C O U N N ST D RU E R C TI O N

Ultimate Lifestyle Living Enjoy a life of culture, community and convenience Apartment A106 - 1 bed 1 bath 1 car - $427,000 Apartment A105 - 2 bed 2 bath 1 car - $499,000 Apartment A110 - 3 bed 2 bath 2 cars - $632,000

Display Suite Now Open

Wednesday, Saturday & Sunday 11:00am â&#x20AC;&#x201C; 2:00pm genevajordansprings.com.au | 0404 055 333 98 Lakeside Parade, Jordan Springs

Images are computer generated and indicative only. Completed apartments may vary from images show. WW37543

Friday, May 17, 2019

Western Property Magazine

37


integrity. knowledge. results.

OPEN HOUSE Sat 18th 11.30am to 12.00pm 7 Harwood Circuit

OPEN HOUSE Sat 18th 1.30 to 2.00pm 32 Monteray Terrace

GLENMORE PARK

$949,000

DUAL INCOME OPPORTUNITY

6

Yes! You are getting two homes in the family-orientated suburb of Glenmore Park, making it an ideal residence for a dual income. All areas have been well considered and will be sure to impress even the most fastidious of buyers. Please call today! Web ID: 1870806

3

2

751m2

+ Currently rented at $950p/w + Multiple living areas + Ducted/split system air con + Under cover entertaining area + Walking distance to public school + Close to M4 Motorway + Family friendly location

OPEN HOUSE Sat 18th 12.30 to 1.00pm 9 Tugra Close

GLENMORE PARK

$899,000 - $949,000

POSITION PERFECT

Ideally positioned neighbouring picturesque parkland is a luxurious residence that will make you the envy of your friends. The popular design ensures care free living, spacious enough to provide each occupant the space they deserve. The block size is generous, enjoys side access with ample space for cars, trucks, boats and trailers. Web ID: 1852252

4

2

4

904m2

+ Wonderfully high ceilings + Ceiling fans + Ducted air conditioning + Solar panels + Manicured gardens + Irrigation system + Covered side access

OPEN HOUSE Sat 18th 9.30 to 10.00am 23 Willmington Loop

GLENMORE PARK

$749,000 - $799,000

FAMILY HOME!

Occupying approx. 836m2, this property is the ultimate choice for those looking to store caravans, boats, trailers and more. Tucked away in a quiet cul-de-sac, the elements are in place for easy family living, with the well-loved home creating a welcoming ambience. Web ID 1850209

4

2

4

836m

2

+ Multiple car accommodation + Ducted air conditioning + Back-to-base alarm system + Caesarstone benchtops + 900mm s/steel free-standing oven + Huge side access + Close to all amenities

ORAN PARK

CONTACT AGENT

A TOUCH OF CLASS

Offering sophistication and style, this modern executive home has been expertly crafted with expansive open plan and family-friendly layout. Five generous sized bedrooms complete with built-in robes, the expansive master bedroom features a large walk-in robe and immaculately kept modern en-suite with frameless shower. Web ID: 1825476

5

2

2

661m2

+ Double glazed windows + Nine foot ceilings + Floor-to-ceiling tiles + Three phase 7kW solar system + Double garage with bluetooth + Remote electric blinds + 3000L underground water tanks

Glenmore Park

Penrith

Cranebrook

Jordan Springs

Emu Plains

Emu Plains

Glenbrook

Blaxland

Springwood

4733 6999

4722 5000

4730 1122

4730 1777

4735 2121

4735 8888

4739 1111

4739 8800

4751 8888

30 Mulgoa Road

429 High Street

WW33835

38

Western Property Magazine

Shop 9 Borrowdale Way

Shop 3/56-66 Lakeside Parade

Lennox Centre

91 Great Western Highway

5 Wascoe Street

134D Great Western Highway

7 Great Western Highway

jimaitken.com.au Friday, May 17, 2019


integrity. knowledge. results.

OPEN HOUSE Sat 18th 12.30 to 1.00pm 4 Flagship Ridge

OPEN HOUSE Sat 18th 11.30 to 12.00pm 4 Patanga Crescent

JORDAN SPRINGS

$835,500 - $865,500

EXTRA-LARGE FAMILY HOME

5

The moment you walk into this uniquely designed Clarendon home you will surely be impressed. The well-appointed floorplan has been designed to accommodate two families, complete with two master bedrooms that both offer ensuite and walk-in robes. Web ID: 1577828

4

2

380m2

+ Open plan living areas + Kitchen with walk-in pantry + Stainless steel appliances + Ducted air conditioning + Floating timber floorboards + Alarm system + Double garage, remote access

JORDAN SPRINGS

$739,000 - $769,000

OUT OF THE BOX

Offering 4 bedrooms with BIRs to three bedrooms, walk-in robe and ensuite in the main, floor-to-ceiling tiles in both bathrooms, three living areas & computer nook. The kitchen will make your friends envious with its great food preparation area, large island bench & walk-in pantry. This home is the whole package. Web ID: 1871473

4

2

2

405m2

+ Gas cooktop & dishwasher + 40mm Caesarstone benchtops + Alarm system + Alfresco area with kitchenette + Ducted air conditioning + Plantation shutters throughout + Double garage, remote access

OPEN HOUSE Sat 18th 1.30 to 2.00pm 15 Waterside Boulevard

CRANEBROOK

$549,950

WATERSIDE TOWNHOUSE

This tri-level townhouse located in the Waterside Estate has just become available. All bedrooms are double sized with an even larger main bedroom which boasts an en-suite and walk-in robe. With the ample space of a tri-level property this has first home buyer or investor written all over it. Web ID: 1864060

3

1

1

+ 3 bedrooms plus built-in robes + 4 split system air conditioners + 2 bathrooms, floor-to-ceiling tiles + 3 toilets incl. powder room + Natural gas & dishwasher + Single garage, remote access + Open plan living

CRANEBROOK

$829,000

SERENITY ON THE BOULEVARD

4

This 4 bedroom home oozes comfort and offers the ideal location. Boasting great size bedrooms with ensuite and walk-in robe to the main, two large living areas, alfresco area, ducted air conditioning, solar panels, alarm, gas cooking, NBN and rear access to the double garage. Web ID: 1836127

2

2

433m2

+ New carpet throughout + Built-in robes to three bedrooms + Modern kitchen with island bench + Separate formal lounge + Double garage, remote access + In-ground saltwater pool + Rear lane garaging

Glenmore Park

Penrith

Cranebrook

Jordan Springs

Emu Plains

Emu Plains

Glenbrook

Blaxland

Springwood

4733 6999

4722 5000

4730 1122

4730 1777

4735 2121

4735 8888

4739 1111

4739 8800

4751 8888

30 Mulgoa Road

WW33836

Friday, May 17, 2019

429 High Street

Shop 9 Borrowdale Way

Shop 3/56-66 Lakeside Parade

Lennox Centre

91 Great Western Highway

5 Wascoe Street

134D Great Western Highway

7 Great Western Highway

jimaitken.com.au Western Property Magazine

39


integrity. knowledge. results.

OPEN HOUSE Sat 18th 1.30 to 2.00pm 1/2 Willow Tree Avenue

EMU PLAINS

$699,000 - $749,000

MORE HOUSE THAN TOWNHOUSE!

4

This is the needle in the haystack for this style of property in Emu Plains. The floor plan is remarkably spacious and incorporates all the luxuries of a freestanding home. Enjoying a modern feel throughout, you will be doing well to find something comparable on the market at present. Call to book your private inspection. Web ID: 1854065

2

1

+ Downstairs bedroom/bathroom + Separate lounge room + Family/meals area + Ducted A/C/ceiling fans + Dome-style alfresco zone + Landscaped backyard + Solar panels

EMU PLAINS

$549,000 - $569,000

BUY NOW â&#x20AC;&#x201C; BENEFIT LATER

This townhouse presents an excellent opportunity for either an astute investor or owner occupier looking for great value. Located with easy access to Lennox shops, schools and transport, you can enjoy the convenience and low maintenance lifestyle allowing more quality time to enjoy life. Call today to book your private inspection. Web ID: 1844101

3

2

1

+ Split system A/C + Position perfect + Currently tenanted + Popular complex + Council: $379.50pq + Water: $172.04pq + Strata: $727.70pq

OPEN HOUSE Sat 18th 2.30 to 3.00pm 50-54 Rodley Avenue

OPEN HOUSE Sat 18th 12.30 to 1.00pm 49 Deloraine Drive

LEONAY

$649,000 - $679,000

FIRST HOME FEVER

Affordable opportunity to obtain your first home or add to your investment portfolio. Nestled in a peaceful pocket of a leafy suburb, you wonâ&#x20AC;&#x2122;t believe the value on offer. All bedrooms come complete with built-in robes, split system air conditioning controls comfort and you will love the oversize lounge room space. Web ID: 1814886

3

1

698m2

PENRITH

$499,000 - $529,000

READY TO MOVE IN!

50 RODLEY is a newly completed boutique CBD development located in the best street in Penrith. 50 RODLEY has unparalleled views over the Blue Mtns, Penrith Stadium & Penrith Paceway. Ideally located central to the Penrith CBD, only a short stroll to Westfield, Penrith Train Station, Panthers and Nepean Village Shopping Centre. Web ID: 1444392

+ Ceiling fans + Combustion fireplace + Modern kitchen + Built-in wardrobes + Internal laundry + Peaceful position + Great size yard

2

2

1

+ Gourmet kitchens + NBN ready + Secure basement storage + Air conditioning + Westinghouse appliances + Basement parking + Outdoor entertaining areas

Glenmore Park

Penrith

Cranebrook

Jordan Springs

Emu Plains

Emu Plains

Glenbrook

Blaxland

Springwood

4733 6999

4722 5000

4730 1122

4730 1777

4735 2121

4735 8888

4739 1111

4739 8800

4751 8888

30 Mulgoa Road

429 High Street

WW33837

40 Western Property Magazine

Shop 9 Borrowdale Way

Shop 3/56-66 Lakeside Parade

Lennox Centre

91 Great Western Highway

5 Wascoe Street

134D Great Western Highway

7 Great Western Highway

jimaitken.com.au Friday, May 17, 2019


integrity. knowledge. results.

OPEN HOUSE Sat 18th 1.30 to 2.00pm 5 Britten Close

OPEN HOUSE Sat 18th 11.30am to 12.00pm 4 Walsh Place

CRANEBROOK

$599,000 - $649,000

MUSIC TO YOUR EARS

Located in a premium part of North Cranebrook, this completely renovated and updated home is ideal for the young family with two large living spaces, good sized bedrooms and the quintessential backyard for children and pets. Accompanying the garage is under cover parking for three cars. Web ID: 1788119

3

1

4

507m2

+ 900mm gas cooktop + 40mm Caesarstone benchtop + Stainless steel dishwasher + Updated bathroom + Built-in robes to all bedrooms + Immaculate presentation + Split system air-conditioning

OPEN HOUSE Sun 19th 11.30am to 12.00pm 12 Weatherby Avenue

KINGSWOOD

$635,000 - $665,000

WOW! WHERE TO START?

Located in a great location in Kingswood, this property has a plethora of uses and available setups to accommodate a wide range of family situations. In addition to what the house offers, this property also has easy side access to a great workshop space, with a convenient under cover entertainment area. Web ID: 1844037

5

3

2

590m2

+ Walking distance to transport + Covered entertaining areas + Separate in-law/student accomm. + Close to public & private schools + Immaculate presentation + Quiet cul-de-sac location + Split system air conditioning

OPEN HOUSE Sat 18th 12.30 to 1.00pm 30/13-19 Robert Street

CAMBRIDGE PARK

$539,000 - $579,000

RESIDE & RELAX

3

If you have been looking for a home with size, value money and a little bit extra to offer, then this will definitely make your short list. This house offers generous sized living areas which are flattered by a generous rumpus room, with an in-ground swimming pool, perfect for the long summer days. Web ID: 1836887

1

1

+ Solar panels + 3 bedrooms, all with BIRs + Fully insulated Colorbond roof + Separated living/rumpus areas + In-ground pool + Private courtyard + Ample storage space

PENRITH

$399,000 - $419,000

WHY WAIT FOR NEW?

2

This executive style apartment contains a modern, open style floor plan that flows onto a large alfresco space. Upon inspection you will be impressed by the quality kitchen & spacious feel throughout. Currently tenanted this will suit the investor or savvy owner occupier. Web ID: 1868263

2

1

+ Split system air conditioning + Generous open plan living areas + S/S appliances + Ensuite to main bedroom + Basement parking + Internal laundry + NBN ready

Glenmore Park

Penrith

Cranebrook

Jordan Springs

Emu Plains

Emu Plains

Glenbrook

Blaxland

Springwood

4733 6999

4722 5000

4730 1122

4730 1777

4735 2121

4735 8888

4739 1111

4739 8800

4751 8888

30 Mulgoa Road

WW33838

Friday, May 17, 2019

429 High Street

Shop 9 Borrowdale Way

Shop 3/56-66 Lakeside Parade

Lennox Centre

91 Great Western Highway

5 Wascoe Street

134D Great Western Highway

7 Great Western Highway

jimaitken.com.au Western Property Magazine

41


4

2

2

3

4 Robyn Avenue, South Penrith

View

Saturday 10:00am – 10:30am • Charming updated 4 bedroom family

View

Price

$679,000 - $699,000

Price

Gary Rosse o 0414 321 000

home • Generous land size of 645m2 • Large under cover entertaining area • Family friendly location, opposite parkland reserve • Close to local shopping centre, schools, public transport

4

View

By Appointment

Price

Contact Agent

2

Lori Howell 0428 968 742

3

View

By Appointment

Price

Contact Agent

2

Lori Howell 0428 968 742

lori@rhpenrith.com.au

10/51-53 Mamre Road, St Marys

Saturday 11:00am – 11:30am • Brand new 3 bedroom townhouse $479,950 - $489,950

• Spacious, open plan and ready to move in • Quality stainless steel appliances, Caesarstone benchtop • 3 toilets, main bedroom with en-suite • Remote control garage, internal access

gary@rhpenrith.com.au

4

79-87 Mayo Road, Llandilo • • • • • • •

First time offered in over 40 plus years 2.02ha (5 prime acres) Town water Substantial home with multi living areas Perfect for large/extended family Llandilo’s most desirable street addresses DA approval Dual Occupancy

2

View

By Appointment

Price

Contact Agent

3

Lori Howell 0428 968 742

lori@rhpenrith.com.au

5

1

Gary Rosse o 0414 321 000

gary@rhpenrith.com.au

5

2

Orchard Hills • • • • • •

First time offered Exquisite executive residence Flawless in presentation Open floor plan with the WOW factor Located in exclusive street address Manicured lawns, gardens set on 4000m2

lori@rhpenrith.com.au

5

Penrith • Huge block of 999sqm in prestigious location • Immaculately presented with character and charm infused with modern and contemporary • In-ground pool with multiple undercover alfresco entertaining • Private and secured • Heaps of room for 6 plus vehicles

3

View

By Appointment

Price

Contact Agent

2

Lori Howell 0428 968 742

Claremont Meadows • • • • • •

Outstanding contemporary masterpiece Over 352m2 in size, all quality and style Open plan living, theatre room Heated inground salt water pool Alfresco entertaining areas Underground basement

lori@rhpenrith.com.au

Penrith 4732 1000

1/282 High Street , Penrith www.rh.com.au/penrith 42

Western Property Magazine

WW37516

Friday, May 17, 2019


Raine Horne P enrith RENTALS $420pw

$370pw

5/68-70 Castlereagh Street, Penrith

24/46-48 Mulgoa Rd, Jamisontown

3

2

1

2

2

• Located in quiet block of 6 • Private courtyard • En-suite to main bedroom

• 2 bedroom double story unit • Air conditioning, ensuite to main • Private courtyard

$360pw

$430pw

2/84-86 Castlereagh Street, Penrith

1/74-76 Irwin Street, Werrrington

3

1

1

3

2

2

• Double storey unit • Internal access from garage • 1 bathroom with additional toilet

• Brand new 3 bedroom townhouses • Built-ins to all, ensuite • Remote control garage

$450pw

$420pw

A709/48-56 Derby Street, Kingswood

3/55 Mamre Road, St Marys

2

2

1

4

2

2

• Brand new luxury top floor unit • Wrap around balcony • Master bedroom with en-suite

• Architecturally designed • Open plan living • Extra car space and private courtyard

$430pw

$300pw

2/5 Australia Street, St Marys

30/42-42 Victoria Street, Werrington

3

2

1

2

1

1

• Modern with ducted air conditioning • Main bedroom with WIR & en-suite • Double length garage

• Quiet apartment complex • Close to Werrington Train Station • Top floor, spacious open plan

$300pw

$450pw

35 Pelsart Avenue, Willmot

229 Lieutenant Bowen Drive, Bowen Mountain

3

1

1

3

1

• Well maintained family home • As new kitchen and meals area • Awesome backyard for the kids

• Quiet location under 10 mins to North Richmond • Rich in wooden textures • Separate dwelling perfect teenage retreat

$480pw

$530pw

25 Jason Avenue, South Penrith

80 Jubilee Drive, Jordan Springs

2

1

1

4

2

2

• Newly renovated home • Close to shopping centre • Ducted air

• Perfect family home • Opposite park with playground • Modern and stylish

$400pw

$440pw

2/72 Cam Street, Cambridge Park

10/100-102 Great Western Highway, Kingswood

2

2

1

• Near new 2 bedroom townhouse • Great location close to station • Ducted air, alarm, intercom

4

3

2

• Brand new townhouse • Open plan living • Main bedroom with en-suite

Penrith 4732 1000

1/282 High Street , Penrith www.rh.com.au/penrith Friday, May 17, 2019

WW37517

Western Property Magazine

43


Outer Western Sydney OPEN HOME

239 Shepherd Street, St Marys

Great House Loads Of Potential Wide frontage approximately 22m & an approx 625m2 block in a great location. This 3 bedroom home, with aluminum windows is freshly painted with polished floorboards, single lock-up garage, side access & natural gas cooking & heating

3

1

$509,999 INSPECT Saturday 18th May at 12:00pm-12:30pm ADDRESS 239 Shepherd Street, St Marys CONTACT Professionals St Marys 02 9673 4422

FOR SALE

Immaculately presented family home Fully renovated three bedroom brick home situated on a large 625m2 block in a prime location close to all amenities. Immaculately presented featuring • 3 bedrooms with built-ins • 2-way bathroom • Air-con • Single lock-up garage • Ceiling fans • 2 toilets • Bar • Pergola • Garden shed

Erskine Park

3

Great opportunity for first home buyers or investors to secure a well maintained home at a great price. Set on a level approx. 556sq metre block, this solid home is a must to inspect. Features: • Side access to 2 car tandem garage • Ceiling fans • Air conditioning • Modern kitchen with dishwasher • Spacious lounge area • Built-in to main • Rear awning • Convenient to transport, schools & shops. Much loved family home being sold by “Upsizing vendors”. Inspect today to avoid disappointment.

1

3

$649,950 INSPECT By Appointment ADDRESS Erskine Park CONTACT Professionals Erskine Park 02 9834 3555

FOR SALE

Opportunity knocks . . .

1

Lethbridge Park

3

1

2

$445,000 INSPECT By Appointment ADDRESS Lethbridge Park CONTACT Professionals St Marys 02 9673 4422

OPEN HOME

5 Rosewall Place, Shalvey

Space Style Quality Imposing 4 bedroom residence that is designed to accommodate and impress a large family. Features ducted air conditioning, pool, main bedroom with walk in robe and ensuite, modern kitchen with dishwasher expansive open plan lounge and family areas that flow on extensive undercover entertaining patios. All set in a quiet cul-de-sac on 589m2 block. A must view for the growing family looking to upgrade on a budget.

4

2

$589,950 - $599,950 INSPECT Saturday 18th May at 1:00pm-1:30pm ADDRESS 5 Rosewall Place, Shalvey CONTACT Professionals Plumpton 02 9677 1277

FOR SALE

Be In The Heart Of Town! The owners have downsized and moved so are very motivated to sell, the price reflects this! • 4 bedrooms, ensuite and walk-in robe to main • 3 bathrooms plus a powder room/large laundry • Lounge room, dining plus bar • Spacious kitchen with family room, rumpus room overlooking the pool • Double garage all set on 569m2 in a cul-de-sac

3

St Marys

4

3

2

All Offers Considered INSPECT By Appointment ADDRESS St Marys CONTACT Professionals Erskine Park 02 9834 3555

FOR SALE

Silverdale

Vacant Land - New Approved Project About To Start . . . The opportunity is yours . . . Savannah Estate is already about 35% $350,000 - $419,000 sold, leaving about 50 lots from 450m2 to 883m2 to choose from and priced from just $350,000 to $400,000.00. The project is INSPECT Contact Agent approved and about to commence with completion anticipated in the second half of this year 2019. It is your chance to secure a nice ADDRESS Silverdale CONTACT Professionals St Marys piece of land within this well positioned elevated subdivision to build a home of your choosing in this peaceful, tranquil 02 9673 4422 environment when ever you are ready to do so . . . Enquire now to get all the information to help you decide which lot is for you . . .

professionalsouterwesternsydney.com.au WW33753

44

Western Property Magazine

Friday, May 17, 2019


Outer Western Sydney FOR SALE

St Clair

4

Grand Proportions With Split Level Charm • 629sq mtr block • Double door formal entry • Wellmanicured lawns & gardens • 4 double sized bedrooms, 3 with BIRs as well as an ensuite • Massive light-filled combined formal lounge & dining • Meals/ living room • Alfresco wraparound entertainment area • Large solid timber kitchen • Massive 10m x 4.5m garage • Potential rental return of $500-$550pw.

2

6

$769,000 INSPECT ADDRESS CONTACT OFFICE

By Appointment St Clair Professionals Erskine Park 02 9834 3555

FOR SALE

Located In The Heart of Windsor No need for the car as this complex is only minutes walk to some great cafés, restaurants, Windsor shopping centre, railway station and the banks of the Hawkesbury River. Brand spanking new and ready to occupy, all government bonus’s & incentives are available...Most units offer an ensuite • Open plan living / dining • Separate Laundry • Balcony

OPEN HOME

Lovely, Large & Great Location Inside of this St Marys brick veneer home is bound to impress all buyers who are looking for a property that is ready to live in • Large main bedroom with walk-in robe • Fully renovated bathroom • 2nd living area ideal for indoor entertaining • Ducted air conditioning • Study / 4th bedroom

2

2

2

Invest Your Time In This!

4 Knox Street, St Marys

1

The Barracks Boarding House . . . offers a very rare and unique investment opportunity to secure a nice, well established and well located registered and approved boarding house for ten (10) tenants. 100% occupancy at $170 a week each. This outstanding Heritage property is set in an ideal location and offers an outstanding opportunity . . .

OPEN HOME

INSPECT By Appointment ADDRESS Windsor CONTACT Professionals St Marys 02 9673 4422

2

$549,000 - $569,000 INSPECT Saturday 18th May at 11:00am-11:30am ADDRESS 4 Knox Street, St Marys CONTACT Professionals St Marys 02 9673 4422

North St Marys

Returning $88,400 a year (9.315% return)

Windsor

From $425,990

3

FOR SALE

1

3

$949,000 INSPECT By Appointment ADDRESS North St Marys CONTACT Professionals St Marys 02 9673 4422

34 Captain Cook Drive, Willmot

3

• 3 bedroom brick veneer home • New tiles throughout • New paint • Single garage • 563 square metre land • Move straight in or your tenant • Return of up to $350 per week Grab this opportunity now before someone else does . . .

OPEN HOME

12

1

1

Contact Agent INSPECT ADDRESS CONTACT OFFICE

Saturday 18th May at 10:00am-10:30am 34 Captain Cook Drive, Willmot Professionals St Marys 02 9673 4422

16 Vincent Street, Mt Druitt

When Location Counts This solid 3 bedroom home is situated in a prime location close to schools, station and Westfields. It would be a shrewd purchase for astute buyers. Set on a level approx 715m2 block and zoned R2. We have geniune Vendors instructing us to sell. Offers invited.

3

1

1

Price on Application INSPECT Saturday 18th May at 11:00am-11:30am ADDRESS 16 Vincent Street, Mt Druitt CONTACT Professionals Plumpton 02 9677 1277

professionalsouterwesternsydney.com.au WW33754

Friday, May 17, 2019

Western Property Magazine

45


Penrith Greater Region and Blue Mountains AUCTION

3

Auction 18th May at 11am On Site • Great size 3 bedroom home with fire damage to hallway and 3rd bedroom • Great size backyard with carport, across from parklands with mountain views • Family area within walking distance to local schools, sporting fields and shops

FOR SALE

1

1

Auction 18th May 11am

• 2 bedroom unit with an updated kitchen and bathroom • Single garage with private east facing balcony • The current rent is $260 per week • Walking distance to Kingswood train station, university and hospital

1

AUCTION

1

$309,000 - $339,000 INSPECT Saturday 18th May at 9:30am - 10:00am ADDRESS 17/56 Park Avenue, Penrith CONTACT Professionals Penrith 4725 3100

2

1

• Solid 3 bedroom house in original condition, needs a little TLC • Fantastic 663m2 approx. allotment, potential granny flat development (STCA) • Close to schools, various shops & schools • Auction on site, 25th May at 11am

FOR SALE

1

Simply move in & enjoy!

• Beautifully presented & and renovated 2brm $365,000-$379,000 apartment • Within walking distance to everything the CBD has INSPECT Saturday 18th May at 10:15am - 10:45am to offer ADDRESS 6/38 Castlereagh Street, Penrith • Offering uninterrupted views of the Blue Mountains CONTACT Professionals Penrith • The brand new bathroom is stunning with the highest 4725 3100 quality fixtures and fittings, you won’t find better • Be sure to call Richard on 0409 551 803 to book your inspection today.

Attractive & spacious 2 bedroom unit • Renovated modern kitchen & bathroom • 2 Great sized bedrooms • 2 Undercover balcony areas • Split A/C units • Single lock-up garage

1

1

$309,000 - $339,000 INSPECT Saturday 18th May at 10:00am - 10:30am ADDRESS 5/20 Thurston Street, Penrith CONTACT Professionals Penrith 4725 3100

168 Jamison Road, South Penrith

NSW Housing Auction MUST SELL!

6/38 Castlereagh Street, Penrith

Fully Renovated

2

• Fully renovated 2 bedroom unit with carport • Great CBD location walking distance to Penrith CBD, train station and Westfield shopping district • Great tenant wanting to stay on paying $290 per week • Strata fees $720 per quarter

INSPECT Saturday 18th May at 10:45am - 11:00am ADDRESS 34 Tornado Crescent, Cranebrook CONTACT Professionals Penrith 4725 3100

2

5/20 Thurston Street, Penrith

Fully renovated 2 bedroom unit

17/56 Park Avenue, Penrith

More Space Than You’d Expect

FOR SALE

FOR SALE

34 Tornado Crescent, Cranebrook

3

1

1

Auction 25th May 11am INSPECT Saturday 18th May at 1:30pm - 2:00pm ADDRESS 168 Jamison Road, South Penrith CONTACT Professionals Penrith 4725 3100

16/65-66 Park Ave, Kingswood

2

1

1

$319,000 - $349,000 INSPECT By Appointment ADDRESS 16/65-66 Park Ave, Kingswood CONTACT Professionals Penrith 4725 3100

penrithprofessionals.com.au 02 4725 3100 253 High Street, Penrith

WW33834

46

Western Property Magazine

Friday, May 17, 2019


F L I P FO R P E N R I T H ’ S B I G G E ST A N D B E ST R E A L E STAT E G U I D E

the western weekender

Home & Garden FRIDAY, MAY 17, 2019

INSIDE: JO PULETUA’S INTERIOR STYLE ADVICE

Fresh

WW37470

APPROACH


Thereâ&#x20AC;&#x2122;s never been a better time to install a ÂŽ Geostone driveway

For every m3 of Geostone product purchased by 31 May 2019, receive $20.00 cash back* *Terms and conditions apply. Visit www.geostone.com.au, your local display centre or call 131188

WW37505

2

Home & Garden Magazine

Friday, May 17, 2019


INTERIOR STYLE

Living

JO PULETUA INTERIOR STYLE & DESIGN CONSULTANT AT HARII.COM.AU @HARII.BOHEME

If you’re a style conscious pet parent, you no longer have to settle for the mess they can often create in your home. Plenty of new products on the market allow you to forgo the daily mess from your fur or feather babies and keep your home looking chic. If you’re not sure where to start, check my tips out below to get your home back to looking stylish, whilst sharing it with your animal loved ones... Create a space of their own Much like ourselves, our pets like to have their own place to Friday, May 17, 2019

WITH YOUR PETS

relax. If you don’t like the look of crates or climbing trees, try incorporating these features into the design of your home. For example, are there any unused corners or voids in your home that can serve as a built-in Kitty scratching corner? With a bit of ingenuity, you can add a built- in space for your pet into end tables, entrance tables, kitchen cabinetry, and even bookcases! Feeding time Dogs and cats both should have bowls that are within neck height. These days, food bowls come in great looking styles that allow you

to match with your décor. For a more bespoke solution, you could use an unused bottom drawer in your kitchen or even laundry area as a stow away feeding area. If you’re feeling handy, get some plywood, cut it down to the size of the drawer, cut holes big enough for the bottom of the bowls to sit in, but not big enough for the top lip of the bowl to fall into, paint with a weather- proof gloss paint and glue or nail into your drawer for a special pull-out feeding bay. Friendly floors Floorboards are good options over carpets in most pet-friendly

homes. Whilst they are generally easier to clean, certain floorboards can be more pet-proof than others. As a pet owner, you may want to opt for a floorboard that is long- lasting and scratch resistant. Vinyl flooring or tile floors are the most popular option as they are less likely to scratch and stain compared to hardwoods. They can also come in a variety of designs and styles to imitate stone or wood depending on your style preference. If your heart is still set on authentic hardwood flooring, there are some great, hardy engineered wood or wood-like tile options available as alternatives! Home & Garden Magazine

3


WW37469

4

Home & Garden Magazine

Friday, May 17, 2019


Driveway

NEWS FEATURE

MAKEOVER

Imagine improving the appearance of your beloved home and increasing its value without even touching it. According to research by Holcim Australia, increasing the market value of your home is the number one reason to renovate. For most homeowners, ‘renovating’ is typically for the interior of the home; maybe a new kitchen or an on-trend bathroom. However, home buyers can determine a home’s value before entering it. When renovating, it’s easy to overlook the very first thing most people see – the driveway. Holcim’s study of 407 homeowners revealed homes with an exposed aggregate concrete driveway add at least five per Friday, May 17, 2019

“ When renovating, it is easy to

overlook the very first thing most people see – the driveway ”

cent or more to the home’s value versus plain concrete or paving. Geostone decorative concrete from Holcim is the perfect product to make your home’s first impres-

sion a strong one that won’t easily be forgotten by potential buyers. Geostone is a unique fusion of reinforced concrete and the natural beauty of carefully selected

Australian stone. Together they make a tough, durable product that can deliver a flowing, seamless look and is hardwearing, low maintenance and stain resistant, once sealed. To find your perfect match, Geostone comes in a range of finishes. The ‘exposed’ finish is a durable option for driveways, pathways and landscaping; the ‘polished’ finish is for stunning indoor living areas; or ‘honed’ for underfoot comfort and durability from patios to pool-sides. Sourced from the great outdoors and designed for the great outsides, Geostone can increase the value of your home in numerous ways. For more info, phone 13 11 88 or visit www.geostone.com.au. Home & Garden Magazine

5


SIMON’S HOUSE

Window TINTING SIMON STEVENSON SIMONSHOUSE.COM.AU

I’ve lived in my house for 10 years with a whole wall of east facing windows. The summer heat in the room, even with blinds, was unbearable from first thing in the morning. I was getting my car windows tinted one day and spoke to Mal from Forest Window Tinting, he suggested getting my house windows done. I did a year and a half ago, and it was one of the best decisions I’ve made! I can now have my blinds open all day long and enjoy the beautiful sunny days! I went with a reflective tint which has also given privacy during the day, the living room is bearable and my energy bills have been reduced.

Even if you have blinds or curtains, the heat gets in the room, but tint stops it at the glass before it gets in! Did you know that the windows and glass in your home are the biggest source of heat loss in the winter and heat gain in the summer? In addition to saving on energy bills, there are many other benefits to having your windows tinted,

like protection against glare and heat. It’s a whole lot easier to see my TV now too! Protection against sun damage and fading for your furniture and floors. And added privacy is definitely a bonus. With so many films available, there’ll be one to suit you. Clear tint offers protection but still allows you to keep your view, so there’s no change to the look of your home. Security and safety films help protect from break ins or severe weather by helping hold the glass together, making it stronger and less likely to shatter. Reflective and frosted tints give you more protection and privacy. You know what THAT means? You can dance around to ABBA and the neighbours won’t complain!

IS YOUR KITCHEN LOOKING TIRED? Replace your doors, drawers, benchtops, splashbacks & appliances

BEFORE

AFTER

WW37125

Call 1800 DREAM DOORS (1800 373 263) or visit us at DREAMDOORS.COM.AU

6

Home & Garden Magazine

Friday, May 17, 2019


Lifestyle Lodges P/L ABN: 22 105 002 060

BUILDER LIC: 264711C

THE COMPLETE BUILDERS • Garage Conversions • Renovations • Maintenance Work • Wall Removals

• Open Plan Conversions • Structural Works • Garage Pier Removals • Colorbond Awnings

‘We Do It All’ • Granny Flat Constructions • Mezzanine Floors • Factory Fit Outs • Outdoor Entertaining Areas

WW37474

For a $500 discount on any quote call 0411 642 055 and MENTION THIS AD to book in your FREE Quote

www.lifestylelodges.com.au Full of ideas but need help with the finance? We’re partnered with Educated Finance, the place for all your finance needs! Call us on 1300 338 228 / 1300 EDUCATED

➨ Monthly Specials

22 Coombes Drive, Penrith Phone 4723

9100

COME & SEE OUR FRIENDLY STAFF FOR ALL OF YOUR LANDSCAPING NEEDS

200mm 2 20 00m mm x 5 50 50mm 0mm mx2 2400mm 400m 40 0mm 0m mm

Treated Pine SLEEPERS

$

13.50 each Forest Blend MULCH $

35m

3

10%

off all Link Edge Aluminium GARDEN EDGING All expire on 31/5/19

Friday, May 17, 2019

Home & Garden Magazine

WW37135

Open 6 days Mon-Fri 6:30am-5:00pm, Sat 7:00am-2:00pm

• Sand Soil Mulch www.nepeanlandscapesupplies.com.au • Aggregate • Sleepers • Decking • Pavers • Blocks • Tools • Bulk Bags • Cement • Decorative Gravel

7


r Get you ng r ey i FREE K e! Instor

Itâ&#x20AC;&#x2122;s Time to Winterise! Was $50

Now $40!

Remember to strip out all PHOSPHATES from your pool water before winter starts. Algae feeds on Phosphates!

Pool Magic Phosphate Remover Range: One Shot Phosphate Tablets

Ultra Pure Phosphate Granules

Liquid p Phosphate Remover

Quick Dissolve Phosphate Tablets

2/133 Russell St,Emu Plains

P: 4735 5322

WW37546

8

Home & Garden Magazine

Friday, May 17, 2019


Want to feature your products for the home to a large audience? Call us on 4722 2998 WW36480

Friday, May 17, 2019

Home & Garden Magazine

9


WW37277

WW37399

PEST MANAGEMENT SERVICES Email: envirocare1@bigpond.com

For a free no obligation quote call Dave 0403 011 058 dave@penrithcityawnings.com

TOTAL SATISFACTION GUARANTEED WE CARE FOR YOUR ENVIRONMENT

Ph 1800 600 760

www.penrithcityawnings.com

>> Domestic and Commercial >> Decorative Finishes >> Roof Restorations

DECKS • RENOVATIONS • BATHROOMS • CARPENTRY WWW.CHRISLAWLERBUILDING.COM.AU ABN 568 649 24654

JDN BRICKLAYING 0405 312 281

Licence No. 151503C | ABN: 54 518 520 984

E: platinumspaservice@gmail.com www.platinumspaservices.com.au

LN: 336266C

D & J Concrete Resurfacing & Landscaping

PATIOMAN

WW36708

Same Day Service or it's FREE!* Specialists in: Emergency & General Plumbing, Electrical, Hot Water, Lighting, Drain Clearing & More!

WW36277

We do Shower screens Mirror wardrobes Security doors & grills Aluminium windows Sliding doors & flyscreens

“Our reputation is important to us, check out our reviews online. online.” SENIORS DISCOUNT AVAILABLE

Call us Now!

4504 8234 *If Service Today are unable to attend the same day the service call fee is waived only before midday. Lic No: 273814C.

Lic No. 829 19C

ALUMINIUM & GLASS

Over 25 years industry experience. Guaranteed 24/7 fast response. Fully licensed. Lifetime labour warranty.

servicetoday.com.au

Call Barry on

0408 022 374

Fax: 9670 2656 Email: nulookguttering@hotmail.com

STOP LEAKS

WW35958

P PER50 PA PAPER50

WW36119

JUST MENTION

Call us on

9833 9006

IS YOUR SHOWER OR BALCONY LEAKING?

Jason 0417 221 822 Mark 0417 223 288 10

Home & Garden Magazine

All garden and lawn services provided including: * Mowing and edging * Bindi and weed eradication * Lawn fertilisation * Watering system installation * General cleanup * Tree pruning * Hedge trimming * Gutter cleaning * Bushfire hazard reduction * Removal of all clippings

Call Steve on 4735 3142 or 0416 116 602

Garage doors Pty. Ltd.

A.B.N: 92 099 831 955 | A.C.N: 099 831 955

Specialising in: - Domestic Garage Doors - Remote Controls - Repairs and Service

Lawrie Sandona Mobile: 0414 822 723 A TEAM TILE REGROUTING SOLUTIONS Grout replacement Damage tile replacement Leaking showers

No tile removal required – Full grout and seal

Guaranteed No Mess No Fuss

0412 000 893 www.1choicebm.com.au

FREE QUOTES

Available 7 days NO OBLIGATION WW37275

Call Allen: 0400 123 454

WW33822

WW36282

WW36642

Glenmore Park Lic No. 44995C Over 30 years experience

DUCTED SYSTEMS SPLIT SYSTEMS REPAIRS VENTILATION

NU LOOK Ezy Glide Lic 416722C

Get

50OFF!

$

Specialising in Carports, Awnings, Glass Rooms, Rumpus Rooms, Screened Rooms, Wooden Decks Call Peter Dunn 4735 5055 or 0416 035 645 www.patioman.com.au

• • • •

Penrith Valley Garden Care

Metal fascia & gutters e ye2a0rs New home extensions xperience and existing homes *Fascia cover gutters *Downpipes

We specialise in concrete resurfacing & landscaping such as spray-on paving, colour sealing, concrete resealing, concrete grinding, non-slip coating, pressure cleaning, concrete garden edging, roof restoration, returfing.

Call Darren on 0403 374 216

“Specialists in Landscape Gardening & Design”

0419 993 866

ABN: 18342307434

or Email: djconcreteresurfacing@gmail.com

ROWLANDS HORTICULTURAL SERVICES

CALL NOW

SALES INSTALLATION SERVICE MAINTENANCE

HEATING & COOLING SPECIALISTS

For domestic, commercial and body corporate work call Peter Rowlands today for quality, value and service

‘GET LAID RIGHT’

4735 6411

• • • •

www.visionpainting.com.au

WW36761

• Spa Filters • Chemicals • Spa Heaters • Maintenance • Friendly Advice • Service & Repair • Electronic Control Panels • Spa Pumps, Air & Water Jets / Blowers

Plumber & ELECTRICIAN

AIR CONDITIONING

WW36281

WW36109

700 981

>> Exterior Texture Coatings >> Heritage and Federation Work >> All General Painting

RHS

www.sapphireservices.com.au

Lower Mountains

WW34221

S P A• S E R V I C E S For all your spa service needs

0423 001 458 WW37509

A new coat of paint can add value and rejuvenate the appearance of your home. It therefore makes sense to invest in maintaining your most valuable asset.

WW36021

WW35019

0405 107 506

WW37464

Matt: 0407

TODAY

WW36229

Licence #R71555

0424 135 877

CALL US

LOOKING FOR A RELIABLE BUILDER?

George Larin

No Job too big or small Renovation specialist

Electrical & Hot Water Specialists

WW36118

P LASTERER

LOCAL ELECTRICIAN

FREE Measure & Quote Buy Direct & Save $$$$ Ph 9892 2522 Mob: 0451 966 966 www.bvkitchens.com.au Two Great LocaƟons Yennora 2161 Lithgow 2790

WW36020

• Carports• Patio Awnings • Folding Arm Awnings • Glass & Screen Enclosures • Insulated Roof Systems & DIY Kits

KITCHENS, BATHROOMS, LAUNDRIES & APPLIANCES

WW36089

PENRITH CITY AWNINGS

WW37398

Builder’s Lic. No: 121977C

HOME & GARDENS TRADES DIRECTORY

CALL PHIL:

0413 577 817

www.dixonscranes.com.au

WW36475

Contact us today for a free quote! Joseph 0431 244 190 Lic No: 281706C

For all your air conditioning needs

FREE QUOTES preferredair@outlook.com Call John on 0406 121 226 WW37512

Friday, May 17, 2019

Profile for Western Sydney Publishing Group

Western Property May 17 2019  

May 17, 2019 edition of Penrith's leading real estate magazine. Perfect for buyers, renters, sellers, investors and browsers. Also incorpora...

Western Property May 17 2019  

May 17, 2019 edition of Penrith's leading real estate magazine. Perfect for buyers, renters, sellers, investors and browsers. Also incorpora...