Skip to main content

York Racecard - Saturday 20th August

Page 1

OFFICIAL RACECARD £3.50 SATURDAY, AUGUST 20TH SKY BET EBOR FESTIVAL 2022

A very warm welcome to the final day of the Sky Bet Ebor Festival 2022, featuring the most famous race of our season –the Sky Bet Ebor. This year’s renewal offers a purse of £500,000 making it Britain’s richest flat handicap, so no surprise that it has attracted a very high calibre field – have fun picking out the winner. Ahead of the Sky Bet Ebor we will welcome the riders in this historic race to the parade ring – do come and cheer them down the steps. It has been a week to savour so far, with both Baaeed and Alpinista putting on impressive displays in landing the Juddmonte International and Darley Yorkshire Oaks. Then Highfield Princess flew home in the Coolmore Wootton Bassett Nunthorpe Some major Newmarket operations have declared fancied runners, for example Ed Dunlop runs John Leper, a one time Derby favourite in his younger days The Sky Bet Race to the Ebor series sees three of the four contenders take up their slot, as Valley Forge (Andrew Balding), Gaassee(William Haggas) and Earl of Tyrone (Paddy Twoney) , are in the field (see pxx). Four other Irish handlers sit alongside Paddy Twomey in hoping to continue the recent Irish run of success Consider that Malton based David O’Meara is responsible for Get Shirty, and it could yet be a landmark day for Yorkshire. Leeds based Sky Bet are now our headline partners and share a vision for this Ebor Festival, we are delighted that the City of York which is of one of 13 races to carry their support has been upgraded to Group 2. As a commitment to this specialist distance, prize money of £400,000 means a Group One level of reward making for a classy field, headed by Sandrine, already a Group Two winner for Andrew Balding. We are delighted to welcome the 22 Sky Bet Ebor Community Sweepstake finalists to York as set out on page 62-64pp of the racecard. These good causes have been nominated by members of their community, shortlisted from a large field and each are assigned a runner in the Sky Bet Ebor The good cause connected to the winning horse will win £20,000 for their organisation, with all contenders earning a £1000 donation. Wherever they finish, we hope they thoroughly enjoy their Ebor day and all receive our thanks and admiration.

William Derby, Chief Executive and Clerk of the Course: York Racecourse

We have some top class racing today, made possible by both your support and the backing of our partners and sponsors. Look up to see the RAF Falcons Display team dropping in at 1.20pm, listen out for the Shepherd Group Brass Band, boogie into the evening with The Monotones, share a bottle of Mercier Champagne for just £43 a bottle; whatever, I just hope you thoroughly enjoy the racing and experience of the Sky Bet Ebor Festival.

Welcome Follow us on Twitter or like us on Facebook @yorkracecourse 1

Sky Bet Ebor Festival Welcome to York Races 1 Finding Your Way 4-5 A Guide to Places to Eat & Drink 6-7 Make The Most Of Your Visit 8-9 Visit the Ebor Fashion Lawn 10-11 Meet the Team & Officials 15 Yesterday’s Action 17 Puzzle Corner 19 How To Read 21 Parlez-Vous Racing? 22-23 Life and Times of an Edwardian Weighing Room 40-41 Away Racing: Sandown 42-43 Charles Clinkard Top Trainer at York Award 44 Doubling up Down Under 46-47 Living North Top Jockey at York 52 Away Racing: Sandown 54-55 Helping Yorkshire: Ebor Community Sweepstake 62-64 Race To The Ebor 66 How Might You Solve A Big Handicap 67 Fact File: The Sky Bet Ebor 68-69 Big Race Trends: The Sky Bet Ebor 70 Puzzle Corner Answers 92 Today’s Race Conditions 93 York Fixtures 2022 94 The Small Print 95 Knavesmire Notes 96 PROGRAMME OF EVENTS Time Event Location 11:15am Tour of the Weighing Room & Equine facilities Weighing Room Entrance 11-2:30pm York Gin Ebor Fashion Lawn Edwardian Weighing Room Lawn 1.00pm Punters Panel Winners Enclosure After Racing Monotones Melrose Stage 1:20pm RAF Falcons Look to the skies over the Knavesmire All Day Events Location Tours to the start 30 minutes before each race See Notice on Thatched Hut Shepherd Group Brass band Edwardian Weighing Room Lawn Murphy’s Marbles Bustardthrope Stage Ascot Gallery/Darcy & Wolf Jewellery Gimcrack Stand Portico 360° Selfies Stage by Melrose Stand Meet A Real Racehorse Clocktower Enclosure Test Cricket: England vs South Africa Selected Televisions All timings are approximate, listen for PA announcements for any updates. 2

York Racecourse wishes to express its thanks to this afternoon’s sponsors. Races 1 5 covered by All races covered by Sky Bet Third Race - 3.00pm The Sky Bet City of York Stakes (Group 2) 7f Pages 57-59 Sky Bet Second Race - 2.25pm The Sky Bet Melrose Stakes (Heritage Handicap) 1m 6f Pages 49-51 Sky Bet & Symphony Group First Race - 1.50pm The Sky Bet and Symphony Group Strensall Stakes (Group 3) - 1m 1f Pages 35-37 THE FAMILY OF JULIA GRAVES The Family of Julia Graves Sixth Race - 4.45pm The Julia Graves Roses Stakes (Listed Race) 5f Pages 83-85 Sky Bet Fifth Race - 4.10pm The Sky Bet Constantine Stakes (Handicap) 6f Pages 77-80 Sky Bet Fourth Race 3.35pm The Sky Bet Ebor (Heritage Handicap) 1m 6f Pages 71-75 Sky Bet Seventh Race - 5.20pm The Sky Bet Finale Stakes (Handicap) 5f Pages 87-90 3

4

5

We hope we have somewhere to cater for all tastes and Harrogate for fish, The Wensleydale Creamery for cheese).

1731 PIE SHOP (Ground Floor) A popular place to get a hot meal, or a Powerfood salad or sandwich served in cafeteria style. Collection point for G&P "meal deal".

The Gimcrack Restaurant offers a three-course meal for £37, Afternoon Tea offered for £12.50.

THE VOLTIGEUR RESTAURANT (Knavesmire Stand 3rd Floor) The UK’s foremost ‘Dine & View’ restaurant package.

SPECIALIST FOOD A series of counters and mobile units offering fish & chips, Yorkshire beefburgers, traditional Cornish Pasties, Ged Bell's Yorkshire Pork Pies, Greek street food, noodle pots and vegetarian/ vegan options.

ALCOHOL RACE ROBERTO LAWN AND BAR Offering champagne by the glass, draught beer and a decking area. Collection point for G&P Picnic Platters.

KNAVESMIRE STAND 6 bars, Ebar & 1731 Pie Shop (ground) THE FOOD COUR A range of hot/ snacks, tea, coffee and full bar available

recycle 10 tonnes of glass on a raceday None of the restaurants, are popular at busy times so we’d suggest going early Enjoy County Stand

The Edwardian Weighing Room, John Carr Terrace. Bustling informal lawns and terraces near the parade ring. Try Ged Bell’s local beef burgers or the new BBQ boxes. Or try toast the anticipated return of summer with a jug of Pimm’s or try our craft ales. The Princess Mary Bar (near County Stand entrance). Buzzy café serving boxed seafood platters and sandwiches. Ayala Champagne by the glass. Try Eat Between Our Races bistro, which is on the ground floor serving pulled meat/veggie sandwiches, beefburgers, thai curry & rice (vegan option) salads, as well as scrummy cakes. The Eclipse Restaurant (5th floor Ebor Stand) Home to our advanced booked meal deals. The Champagne Pavilion & Moët Rosé Roof Terrace; downstairs offers premium beers, artisan gin, Fever-tree tonics and a wide range of the finest champagnes, whilst the Terrace also offers Moët Rosé, vintage wines, premium beers, seafood and sandwiches.

A G IDE T PL CES T EAT & DRIN

Theakston Best ROBERTO

EBOR STAND Ebar, 4 bars & 2 buffets spread ov Fifth floors. Try Eat Between Our the ground floor serving sandwiches ECLIPSE RESTAURANT (5t An informal hot food option and popular advanced book packages.

THEAKSTON ALE BAR

VILLAGE BAR 6

CHAMPAGNE PAVILION & MOËT ROSÉ ROOF TERRACE

JOHN CARR TERRACE stand with modern canopy; full bar Ged Bell's local beef burgers BBQ range

for future days HOL FREE VIEWING EDWARDIAN WEIGHING

and

boxes. SEAFOOD OPTION CHILDREN ESPECIALLY WELCOME MEAL DEAL LOCATIONMD FOOD & DRINK FREE ZONES COUNTY STAND GRANDSTAND & PADDOCK RACING AREA CLOCKTOWER ENCLOSURE MD Clocktower Enclosure Has a

A reserved lounge with allocated seats. SOLD OUT today, yorkracecourse.co.uk ROOM Heritage craft ale. point Stand Picnic

Grandstand & Paddock 1731 Pie Shop offers a range of homemade pies, including vegetarian option, as well as sandwiches and Powersalad boxes.. Collection point for G&P “meal deal”. The Roberto Champagne Bar with its giant outdoor screen. House Champagne is available here at by the glass or pick up a jug of Pimm’s. This is also the Collection Point for Grandstand & Paddock Picnic Platters. If the weather plays its part then visit the Southern Terraces, an outside seating area with easy access to betting, bars, tasty treats and toilets. Here a large number of kiosks and specialist mobile vendors offer gourmet British beefburgers, Greek street food, noodle pots, Whitby scampi, fish & chips and specialist coffees. If the sun comes out, or just as a treat, try our locally produced luxury ice creams.

of units selling hot and cold items, sweets and ice cream. 7

PARADE RING RESTAURANT Situated on the top floor of the Weighing Room, provides a fine dining experience. SOLD OUT this afternoon.

service

OURT

Theakston Best is available in the refurbished Theakston Bar over Ground, First & Races, which is on sandwiches & scrummy cakes. th Floor) home to our packages.

budgets. We source many products locally, (e.g. Bleiker's Smoke House in You may notice that our sandwich packaging is biodegradable and that we restaurants, bistros and buffets mentioned below requires pre-booking although many Enjoy your food and do let us know how we can keep improving.

PRINCESS MARY SEAFOOD BAR Enjoy a sustaining seafood or salad box perhaps accompanied by a glass of chilled Ayala Champagne

for County

ffee VEUVE

MELROSE CLUB LOUNGE Great views of racing, Yorkshire platter, and an account bar SOLD OUT today, visit yorkracecourse.co.uk for future days

Plenty of fizz plus wines and premium beers to accompany that view upstairs

GIMCRACK RESTAURANT (1st Floor) Main County Stand dining room, luxury three-course meal for £37 & Afternoon Tea @ £12.50 hot/cold CLICQUOT CHAMPAGNE BAR

PREMIERRACINGLOUNGE

visit

over a

Collection

Platters.

Georgian

IN ASSOCIATION WITH SAWLEY KITCHEN

& new

8

FOLLOW THE RACING ACTION

MAKE THE MOST OF YOUR VISIT

CASH MACHINES & CASHBACK Cash machines are available at the northern end of the racecourse by the Frankel statue, the ground floor of both Ebor & Knavesmire Stands and a further machine is sited adjacent to the entrance to the Gimcrack Stand. Please note there is a charge for this service. If you place a minimum bet of £5 at a tote window, you can request £50 in cash back from your card.

Racing action from further afield can be followed in the William Hill Retail SP Shops around the course. There are also racecourse televisions around the grandstands that show racing from other racecourses on the Data and Away Racing channel.

CHAMPAGNE OF THE MEETING

Seek out one of the chaplains, they offer a friendly ear and can find a quiet spot for a chat.

Mercier Brut £43 Moët & Chandon Brut Impérial £62 Moët & Chandon Impérial Rosé NV £86

NEED A QUIET MOMENT?

Racegoers are invited to join our expert guide for a minibus trip to the start. To register for this free trip or to find out more, see our guide by the thatched hut near the Winner’s Enclosure before 1.15pm today.

CHILDREN Baby-Changing facilities are available in a purpose-built facility on the ground floors of both Knavesmire & Ebor stands. We welcome children in our main restaurants, and in the Gimcrack Restaurant we offer a half price option for under 12s. Wherever you can buy food we also can provide juice for children. Our Parent and Toddler room, situated opposite the main Ebor Stand entrance in the Library Rooms, allows parents and children some quiet time away. A microwave is provided to warm bottles and televisions provide coverage of racing. We welcome children in our main and in the Gimcrack Restaurant wewelcome

CHILDREN AT YORK RACES

POSITION OF STALLS Inside: Races: 1, 2, 4 & 7 Far Side: Races: 3, 5, & 6

YorkMix Family Sunday on September 4th featuring Pony Racing Series, Racehorse Corner as well as special appearances at intervals including Chase from Paw Patrol Book early to benefit from the offer price of £12 for a combined Grandstand, Paddock and Clocktower Enclosure.

TRIPS TO THE START

STOP THE CLOCK Check out the Official race time as soon as they cross the line, the digital timing clock at the Winning Post has been supported by Al Basti Equiworld Dubai and might give you a punting advantage later in proceedings.

There is a taxi pick up point at the Northern end of the racecourse adjacent to Campleshon Road. Private Hire vehicles will meet pre-booked customers, also at the Northern End.

ENCLOSURE TRANSFERS

BAR CLOSING TIMES Bars will remain open up to an hour after the last race. The serving of drinks in hospitality areas, will be as specified in your booking details. Have an enjoyable time with us but please respect our neighbours and the wider city as you leave the racecourse.

FREE WIFI 1) Search and 2)yorkracecourseselectEnteryourownemail address and home postcode to register 3) You’ll be directed to our home page featuring our partners for today, then just surf away. Given the nature of any WiFi network there will be peaks of demand by both time and location some websites will not be available.

DISABLED RACEGOERS

In the event of a situation which requires a partial or full evacuation of the stands, announcements will be broadcast and stewards will usher you to a place of safety; it is essential that you follow their instructions. Please take your belongings with you and proceed out of the area quickly and quietly. If we are unable to re-occupy the stands, you may be invited to return to your car or coach. Departure from car and coach parks will be under the direction of the Police. The foregoing is a precautionary tale.

Facilities such as disabled toilets and viewing platforms for racing and music stage are clearly signed. Our raceday stewards will be pleased to offer directions and assistance.

RETAIL THERAPY Feel in need of some retail therapy? Why not visit one of our retail partners. Blue Rider Gallery equestrian art specialists. (opposite the Princess Mary bar)

SHUTTLE BUS

Simply pay the difference between your admission price and the price point below. County Stand full price: £72 Grandstand & Paddock full price: £40 Transfers are available from the Racecourse Office.

Conversation Pieces equestrian prints. (by entrance to Gimcrack Stand)

The Racecourse Office Team will also be happy to help and can provide an access guide and map. Rachel Crabtree is a senior member of the team with special responsibility in this area.

York Racecourse always strives to ensure your safety, comfort and enjoyment. However, an incident may occur which is beyond our control. We have employed professionally-trained and experienced stewards.

The tote will be pleased to take your bet at their many windows or look out for a passing courier. Remember to try the small stake-big payout bets such as the Jackpot, Placepot or Trifecta.

The William Hill Betting Shops around the course offers a full SP service, so bets on racing and the wider sporting world. The colour of the main betting ring returns, set in front of the Knavesmire Stand, take on the challenge. Contactless payment is available for all the above options. Good luck.

TAXI/PRIVATE HIRE PICK-UP POINT

EMERGENCY PROCEDURES

A limited shuttle bus service to York station will collect from Knavesmire Road, at the northern end of the racecourse, it will operate whilst there are enough customers to make a bus viable. The service is provided by a commercial operator. A return service operates on raceday mornings.

WHERE CAN I PLACE A BET

TEST CRICKET: ENGLAND VS SOUTH AFRICA Available on selected televisions Stands Side. 360° SELFIE Check out this new free service, on the stage by the Melrose Stand. 9

Enter our style stakes and take to the catwalk today at the York Gin Ebor Fashion Lawn Located in front of the Edwardian Weighing Room Fabulous prizes across five categories each day! 11am to 2.30pm: Registration & participation 3.15pm: Shortlist announced (on the catwalk board & the big screen) 3.50pm: Shortlist final judging Winners announced! 10

Most Stylish Runner-Up: Luxury York Gin Hamper including an engraved bottle of York Gin and a selection of gifts; £100 voucher to spend with The 8thSign; Two County Stand badges for day 1 of the 2023 Dante Festival at York Racecourse.

Ben Fry, George Durdy, Jenny O’Hara & Phil Pinder

Most Stylish: Luxury York Gin Hamper including an engraved bottle of York Gin and a selection of gifts; £350 voucher to spend with The 8thSign; Two tickets to an EFL match of choice; VIP day for two on day 1 of the 2023 Dante Festival at York Racecourse in the Voltigeur Restaurant.

Best Dressed Child: A four pack of magical potions and magical sweets from The Potions Cauldron, plus Wizard Golf for four at The Hole In Wand in the Coppergate Centre, York. Only open to those in the County Stand and Grandstand & Paddock. Please note with any live event times may vary. The decision of the judges will be final. There is no other prize alternative.

GIN

Best Hat: A George Durdy Bespoke Hat. Up to a value of £200.00.

T H E 8T H SI GN

11

PRIZES

Most Stylish Couple: Luxury York Gin Hamper including an engraved bottle of York Gin each and a selection of gifts; Two seats in the Premier Racing Lounge on day 1 of the 2023 Dante Festival at York Racecourse.

YORK EBOR FASHION LAWN JUDGES

A RACECOURSE FOR ALL

Yes, I hope you found it. All our car parks have designated spaces near their front row. Can I get help with getting to/from the car park, taxi rank or shuttle buses? Yes, there is a complimentary buggy service to all these points, ask at racecourse reception or next time you arrive just call 01904 620911. Thank you for your patience as the buggies can only transfer 4 people at a time and it’s a big site. Can I bring a wheelchair? Yes, if you need to; but we also offer complimentary hire, again from Racecourse Reception (see told you they were the hub). As we hope you’ll appreciate, there are only so many wheelchairs on site, if you need to reserve in advance then call 01904 620911. Can I bring somebody to help? Yes, we appreciate that will come in various forms, we hope our “carer comes free” scheme is a help, before your next visit check it out online at www.yorkracecourse.co.uk or just ask the team today. Are there wheelchair viewing platforms? Yes, in all stand side area and Stands easiest thing to do is to ask our Stewards, though a map is available from, you guessed it, Racecourse Reception. Please use these in the spirit intended, with carers being prepared to step aside to allow space for those who need the view the most. What about toilets and are they part of the Radar scheme? Yes they are, all the permanent toilet blocks have a disabled capability, please ask for directions or check that map from you know where. Are their wheelchair height food and drink counters? Yes there are but not as many as we’d like, please ask a member of the team to assist you. Wheelchair height betting? Yes, there are some Tote counters set at a reduced height though a better plan might be to use the courier service that operates in areas such as the main Champagne Lawns; the Tote team themselves are always willing to help. There was one more thing? Please ask, we value your feedback so we can keep improving in this area. Examples of viewing platforms both around the Parade Ring and trackside

12

We want the racecourse to offer both a welcome and an enjoyable day to all our racegoers and in delivering that we recognise that some may need additional assistance from us. The first thing to say, please just ask for help, if the team don’t have an instant answer, then they know someone who will. The team in the Racecourse Reception (behind the Ebor Stand) act as the link to the rest of the team, as needed.

FAQS Is there disabled and blue badge parking?

K R BURKE (11 wins from 56 runners, 20%) runs LORD OF THE LODGE and LETHAL LEVI (4.10),

Grandstands 1m2f88y 1m4f 1m6f 7f&2m6f1m

Top Course Jockeys

Trainers In Form MOST WINS IN THE LAST 14 DAYS: C & M JOHNSTON (18 wins from 78 runners, 23%) runners listed above.

W HAGGAS (30 wins from 201 runners, 15%) runs BASHKIROVA (1.50), SOULCOMBE (2.25), SACRED (3.00), GAASSEE and CANDLEFORD (3.35). C & M JOHNSTON (29 wins from 246 runners, 12%) runs TEMPORIZE (2.25), FOREST FALCON (5.20).

NOTE: All statistics are up to and including 18th August. 5f& 2m4f 1m208y 6f 5f2m2f2m 89y 110y our gallery exhibition today by the Gimcrack Stand

Top Course Trainers

LOOKING FOR LYNDA (4.45). C APPLEBY (11 wins from 29 runners, 38%) runs WILD CRUSADE and AL NAFIR (2.25), AL SUHAIL (3.00), GLOBAL STORM (3.35).

LEADING TRAINERS AT YORK (2017-2022) WITH RUNNERS: R FAHEY (38 wins from 528 runners, 7%) runs ROUSING ENCORE (4.45), SPIRIT DANCER (5.20).

1m

LEADING JOCKEYS AT YORK (2017-2022) WITH RIDES: DANIEL TUDHOPE (33 wins from 293 rides, 11%) rides MARIE’S DIAMOND (1.50), GET SHIRTY (3.35), SUMMERGHAND (4.10), THUNDER MOOR (4.45). FRANKIE DETTORI (22 wins from 91 rides, 24%) rides MIGHTY ULYSSES (1.50), AL NAFIR (2.25), KINROSS (3.00), TRAWLERMAN (3.35), MUMS TIPPLE (4.10), SPECIAL ENVOY (5.20).

TOM MARQUAND (19 wins from 118 rides, 16%) rides BASHKIROVA (1.50), SHEER ROCKS (2.25), SACRED (3.00), CANDLEFORD (3.35), GOOD EYE (4.10), SWIFT ASSET (4.45), CARADOC (5.20). JIM CROWLEY (18 wins from 115 rides, 16%) rides ALFLAILA (1.50), JUMBY (3.00), BENAUD (3.35). Jockeys In Form MOST WINS IN THE LAST 14 DAYS: WILLIAM BUICK (10 wins from 42 rides, 24%) rides WILD CRUSADE (2.25), AL SUHAIL (3.00), GLOBAL STORM (3.35), SPANGLED MAC (4.10), FOREST FALCON (5.20). PAUL MULRENNAN (9 wins from 38 rides, 24%) rides EUCHEN GLEN (3.35). DAVID ALLAN (9 wins from 42 rides, 21%) rides listed above.

entrance 13

DAVID ALLAN (19 wins from 226 rides, 8%) rides ART POWER (3.00), LAMPANG (4.10), FISHABLE (5.20).

J & T GOSDEN (31 wins from 112 runners, 28%) runs MIGHTY ULYSSES (1.50), TRAWLERMAN (3.35), SPECIAL ENVOY (5.20).

A left-handed track which joins the straight course just under five furlongs from home. Races of seven furlongs start on a spur which joins the main circuit at a tangent after two furlongs.

W HAGGAS (14 wins from 42 runners, 33%) runners listed above. T EASTERBY (13 wins from 84 runners, 15%) runners listed above.

T EASTERBY (33 wins from 495 runners, 7%) runs ART POWER (3.00), LAMPANG (4.10), FISHABLE (5.20).

DANIEL MUSCUTT (8 wins from 41 rides, 20%) rides SAVVY KNIGHT (2.25), ROCKET RODNEY (4.45). JIM CROWLEY (8 wins from 25 rides, 32%) rides listed above. Weight Watcher The horses which have dropped most in the weights from previous winning handicap marks in the last two years: 4.10 GULLIVER (won off 102 down 4lb to 98); 5.20 FISHABLE (won off 92 down 3lb to 89). Classy Tips The following horses are running today in a race at least two grades lower than their previous race: 3.35 ENEMY (down 4 grades); 3.35 FANCY MAN (down 2); 3.35 GLOBAL STORM (down 2); 3.35 JOHN LEEPER (down 2); 3.35 LICENCE (down 2); 3.35 MAX VEGA (down 2); 3.35 QUENELLE D’OR (down 2); 4.10 LORD OF THE LODGE (down 3 grades); 4.45 BRAVE NATION (down 2 grades); 4.45 SWIFT ASSET (down 2).

YORK TRACKFACTS Visit

www.albastiequiworld.com

A message from Mr Malih L Al Basti As one of the largest suppliers of horse feeds, bedding and supplements in the GCC region, Al Basti Equiworld, Dubai strive to supply premium products at a fair price. Our support for horse racing around the world is well documented. New Zealand, the USA, Ireland, the UK, France and the UAE are all countries that we support and from where we source superb products. We are delighted to attach our name to the Al Basti Equiworld, Dubai Gr2 Dante Stakes, the Al Basti Equiworld, Dubai Gr2 Middleton Stakes and in August at the Ebor meeting, the Al Basti Equiworld, Dubai Gr2 Gimcrack Stakes. We wish the York Racecourse committee, all owners, trainers and jockeys the very best of luck throughout the 2022 season and look forward to some great racing on the Knavesmire.

Malih L Al Basti Owner & Founder Al Basti Equiworld, Dubai.

Medical Officers DR ROS RODEN MR CHRIS HARDING DR LIZ BULMAN DR JOHN ADAMS DR LIZ BettingCAMERONPOLGEMMAVeterinaryKIDGERSurgeonsDRANSFIELDABRILROBERTSRingManagersMARKRYANMALCOLMHARTSTEPHENRANNFarriersPETERWILKINSCOTTMACKIE OFFICIALS ADRIANStewardsSHARPE (Chief Steward) NEIL EDMINSON (Stewards’ Panel Chair) ALAN ClerkDIJudgeRYANSTUARTStartersCOLINSTEPHANIEDEMPSEYSWANNEYVICKERSTURNERCOLLEYCLARKoftheScalesWAYNEBURNELLKARLCURRANCommentatorSTEWARTMACHINVeterinaryOfficerMARKCOLLINSJOCELYNHABERSHON-BUTCHER LIFE PRESIDENT: THE EARL OF HALIFAX YORK RACE COMMITTEE BRIDGET GUERIN NICHOLAS WRIGLEY WILLIAM BETHELL THE LORD GRIMTHORPE CHRISTOPHER DENNY NICK CHEYNE MEET THE YORK MANAGEMENT TEAM WILLIAM DERBY Chief Executive & Clerk of the Course 01904 683932 Sarah.Pateman@yorkracecourse.co.uk CHRIS WARD Head of Finance 01904 683939 chris.ward@yorkracecourse.co.uk GAVIN PATTISON Facilities Manager 01904 620911 gavin.pattison@yorkracecourse.co.uk JAMES BRENNAN Head of Marketing & Sponsorship 01904 620911 james.brennan@yorkracecourse.co.uk KEVIN PINNINGTON General Manager Catering & Conferences 01904 638971 kevin.pinnington@yorkracecouse.co.uk FAY WAUDBY-GREEN Stableside Manager 01904 620911 fay.waudby@yorkracecourse.co.uk LOUISE DALY Commercial Manager Hospitality & Banqueting 01904 638971 louise.daly@yorkracecoursehospitality.co.uk NICK JOHNSON Hospitality Box Manager 01904 683933 nick.johnson@yorkracecourse.co.uk PHIL ATKINSON Head Of Operations 01904 620911 enquiries@yorkracecourse.co.uk ANTHEA LEIGH Racing Manager & Raceday Clerk of the Course 01904 620911 anthea.leigh@yorkracecourse.co.uk HARRIET ROCHESTER Marketing Manager 01904 620911 harriet.rochester@yorkracecourse.co.uk ADRIAN KAY Head Groundsman 01904 620911 adrian.kay@yorkracecourse.co.uk 15

16

RESULT 1st Quickthorn Coltrane

A fascinating field of six contested our first Group race of the day after Stradivarius and Trueshan were made non-runners. Small runner affairs can often be quite tactical and this one was no different as Tom Marquand bounced out in front on Quickthorn as he has done on his last few starts. He was given an uncontested lead and soon built up quite a healthy gap between him and his rivals, without using much energy. Favourite Coltrane bagged the rail under Rob Hornby while Tashkhan, Reshoun and Nate The Great were all content to sit in behind. Mostly Cloudy bought up the rear in search of a five-timer. The race progressed without much drama and swinging back for home Quickthorn had built up an impressive double figure length lead. Those in behind quickly began to pump away as Quickthorn became but a speck on the Ithorizon.became apparent that those in behind weren’t making any inroads on the long-time leader and Tom Marquand nursed away on Quickthorn all the way to the line, where he ran out an emphatic winner. Coltrane kept battling away to secure second, while a running on Reshoun was forced to settle for third but this race was all about Lady Blyth owned gelding, who may compete with some of the stayers not present yesterday.

Coming towards the line Highfield Princess showed that she could mix it with the best of them over the minimum and picked up in the style of a proper speedster. She surged home under a Jason Hart drive to collar the Richard Fahey trained, The Platinum Queen and once in front she was not for catching. Emaraaty Ana secured a one-two-three for Yorkshire and a third for Kevin Ryan but it was all about Highfield Princess, who gave her connections yet another Group Loftysuccess.targets were mentioned after the race by John Quinn and based on that performance she would have a brilliant chance wherever she chooses to turn up next.

THE WEATHERBYS HAMILTON LONSDALE CUP (GROUP 2)

THE COOLMORE WOOTTON BASSETT NUNTHORPE (GROUP 1)

All the talk before hand was about the Sheikh Juma Dalmook Al Maktoum owned Royal Aclaim who had announced herself on the scene with an impressive win in the John Smith’s City Wall Stakes a month prior. As with all top end Group sprints, a good break is essential and there was a ferocious fight for the lead from those who broke well. Royal Aclaim was given a low draw and as such was nearest to the far side rail. The only juvenile in the field, The Platinum Queen blazed along from the front under Hollie Doyle and looked as though she may steal it coming into the final few furlongs. Newmarket winner Khaadem joined her as the other leader and the two would remain right up there to finish second and fourth respectively.

YESTERDAYS RACING CTION

9/4 2nd

5/4F 3rd Reshoun 25/1

RESULT 1st Highfield Princess 5/1 2nd The Platinum Queen 9/2 3rd Emaraaty Ana 12/1

• What is your current role at York Racecourse? General Manager of Stableside

The Gimcrack Restaurant offers a really fantastic 3 course meal or later in the day afternoon tea in a beautiful traditional setting that screams “proper” York Racecourse to me whilst not ignoring my Yorkshire roots I think it offers “proper” good value as well!

• How many years have you worked at York Racecourse? 15 years, starting as summer help in the Bookings Team

WAUDBY-GREEN

• If you could share a table in the Voltigeur with 5 people from racing over the years who would they be? These questions are getting harder! I’m going to go for a “girl power” table here, Katie Walsh, Clare Balding, Henrietta Knight, Denise Coates and York Racecourse’s very own Jane Richardson, what she’s forgotten about York Racecourse is more than I’ll ever know, so we need to make the most of her before her retirement!

Juddmonte International Day (17th August this year) which you can’t beat for the absolutely high-class racing, nothing gives me a bigger thrill then seeing some of my favourite horses throughout the year battling it out in the Group One feature, which regularly appears in the top 10 races in the world.

FAY

• What is the funniest, printable thing that you have seen/heard on the racecourse? When Marcus caught Brian the Snail, who had managed to get loose in the Stable Yard. Brian didn’t live up to his name, he was extremely fast!

17

• Who is your favourite racehorse, past or present? Absolutely this has to be Sea the Stars, I used to have a picture of him in my bedroom! For me he was the complete racehorse.

Mecca’s Angel

• Give us a hidden Gem of the Knavesmire

• What has been your favourite winning performance at York? This is really difficult; I think Mecca’s Angel winning her first Coolmore Nunthorpe, so giving Paul Mulrennan his first taste of Group 1 glory really sticks in my memory. She reeled in Wesley Ward’s American Raider, Acapulco, and was a real star that day.

• Which York Raceday would you attend if you were not working?

• As a member of the LGBT+ community, how do you find working in racing? Here at York, it simply isn’t a consideration, we all just work together as a team. My wife, Sophie, helps us out and is a familiar face at our office parties.

Exhibition of Original Equestrian Fine Art www.equestrianartuk.com E: info@equestrianartuk.com T: 0202 3642 8784 Exhibitions in 2022 at Cheltenham, Newmarket & York Located in the Blue Rider Gallery, adjacent to the County Stand ‘Gold Stars’, oil on canvas, 70 cms x 70 cms, by Vineta Sayer MA.

1. Luxury car manufacturer 2. Retired American professional boxer 3. To avoid making a decision 4. A shrewd warrior of the Middle Ages 5. A city in Scotland 6. Keep your friends close but your... 7. A title created three times in the Peerage Of Ireland, AKA The Great O’Neill 8. Last name of a former Australian cricketer 9. French sculptor in the early 1900’s 10. Pirates are often associated with this WHO AM I? Can you identify the horse, owner, trainer or jockey who has enjoyed big race success at York in the past from the clues provided?

1. Born in 1988, I was bought up in Newmarket and served my first jockey apprenticeship with Michael Wigham, with whom I won my first professional ride on at Lingfield in 2004. Point for the horse. I’ve won multiple Group Ones and obtained by first British Classic in 2021. If you know who I am, can you name the Classic and the horse?

YORKS RACING

19

Trained by a family who had many top level successes at York, I won today’s feature at some point in the last 15 years. I was ridden on all but two of my starts by the same jockey (he’s best known for riding arguably the most famous horse of all). CHALLENGE name the winning trainer of the 2020 Sky Bet And Symphony Group todays from these clues.

Strensall Stakes? CORNER P U Z Z L E Name

2. Sired by Tiger Hill, I began my racing career in 2012, where I finished second to Dr Houseman at Lingfield.

runners

Answers to today’s puzzles can be found on page 92. GUESS WHO? Can you

WHERE CAN I PLACE A B T

1. Place a bet with the tote. 2. You can go to the betting ring. 3. Use a William Hill Retail SP Betting Shop. With over 300 tote betting points located around the course, there is always one nearby. The main betting ring is situated in front of the Knavesmire Stand with an additional ring in Course Enclosure and sometimes a third set of bookies on Bustardthorpe Lawn.There are three William Hill Retail SP betting shops at York; one at the southern end of the stands, the second on the ground floor of the Knavesmire Stand and the third being the refurbished shop on the ground floor of the Melrose Stand. In addition, racegoers in the Clocktower Enclosure will find a William Hill Retail SP facility underneath the clock tower.

• Handicaps with 16 to 21 runners (inclusive) 1/5 odds a place 1,2,3,4

• Handicaps with 22 or more runners 1/4 odds a place 1,2,3,4

AWAY BETTING Many bookmakers will also take bets at the other race meetings today. They offer a comprehensive service, including bets settled TAX FREE at Starting Price (S.P.)

20

WAYS TO BET STRAIGHT Win Only EACH WAY A bookmaker taking each way bets will display the terms on which he/ she accepts such bets on the top of his/her board. This is a bet for your selection to win or be placed In conjunction with The RCA, the bookmakers have introduced standard each-way terms Bookmakers will provide these terms, or better, when offering each-way betting.

• Fewer than 3 runners all on to win

COLLECTING YOUR WINNINGS If your selection wins (or, in the case of a place bet, is placed), hand the ticket back to the bookmaker for settlement. NEVER destroy your ticket until after the “Weighed In” announcement has been made. There may still be a stewards enquiry and the first past the post, or placed horses, may be disqualified. On rare occasions even the horse coming fourth has been awarded the race. You may bet with confidence with any bookmaker as they have all been approved by the Administration Of Gambling On Tracks Limited, which administers the betting rings at each of Britain’s 59 racecourses. The AGT also offers a full late pay service, in case a bookmaker leaves the course before you have collected your winnings. Late Pay Claims should be sent to Administration Of Gambling On Tracks Limited, 3a, Kings Hall, Parsons Green, St Ives, Cambs, PE27 4WY.

BETTING WITHOUT THE FAVOURITE At reduced odds you can back a horse and collect if it wins or runs second to the horse nominated by the bookmaker as favourite.

• 8 or more runners 1/5 odds a place 1,2,3

PLACING YOUR BET WITH A BOOKMAKER Shop around for the best odds against your selection. When you have decided on where to place your bet, state the number of your chosen horse and the stake, for example “number 4, £2 win”. Listen to the bookmaker repeat the number of the horse and the stake to his/ her clerk and hand your stake to the bookmaker. You will then be given an itemised receipt that gives details of the bet and shows potential winnings. You should keep this ticket safe.

• Handicaps with 12 to 15 runners (inclusive) 1/4 odds a place 1,2,3

• 3 or 4 runners all on to win. Where a bookmaker wishes to depart from this default position he may offer place terms. This must be at 1/5 odds a place 1,2

STRAIGHT FORECAST Name the first and second in the correct order

There are various points and different ways to bet here at York.

In the unlikely event of a dispute with a bookmaker, please call upon the assistance of the AGT Betting Ring Manager. Their office is located near the Theakston Bar to the South of the main Betting Ring.

• 5 7 runners (inclusive) 1/4 odds a place 1,2

The BHA Handicappers allot ratings to horses once they have taken part usually in three races to enable the Handicappers to make a numerical assessment of each horse’s ability.

He has won four times from 1m to 1m 4f on good and yielding ground. Finished 4 1/2l behind Hukum when sixth of 10 at 11-2 on his latest outing over this course and distance (good) last month. Behind Fujaira Prince on that occasion but does get 6lb from that rival here. Official BHA Rating 108 SP: 14-1 A symbol here denotes the

You

Official BHA Ratings

Racing Post Standard Times is an independent assessment based on how long it should take a 90-rated horse to win on Good To Firm ground at York Race tactics, rail movements, and wind direction are amongst the many factors to also affect the time for each specific race.

Non-runner Ground The Trainer states the ground is not suitable for this horse, the official going has changed since the time of declaration. Vet The Trainer states the horse is subject to a Veterinary Certificate. Self Certificate The trainer has advised the authorities that the horse is not able to race today. to the must be 18 or over to place a bet may be asked to provide proof of your age when placing a bet If you cannot produce this your bet will not be accepted horse’s saddlecloth number horse’s name No. of days since last ran age weight st-lbs kg draw colour graphic Barons Selection previous performances /=new season -=new year C=course winner D=distance winner CD=course & distance winner BF=beaten favourite sex of horse c=colt male horse up to age 5 h=horse g=gelding Ms Dane O’Neill horse

The ratings published in the racecard for handicap races are the ratings that were used to calculate the weight to be carried by each horse, whilst in non-handicaps races the rating shown is that of each runner at the time that the entries for the race were confirmed. Any subsequently published change to a rating, either up or down, is shown in brackets following the rating.

The principal purpose of the ratings is to determine the weight to be carried by each runner in handicap races, with the Handicappers aiming to provide each participant with an equal chance based on its best recent form under its optimum conditions. A horse rated 100, for example, would be set to carry 1lb more than a horse rated 99 (ignoring any penalties or allowances).

Racecard You

holds an entry at QIPCO British Champions Day, Sat 15th Oct 21

Read

How

f=filly female horse up to age 5 m=mare form guide Probable coloursireSP of horse B = bay Br = brown Ch = chesnut Gr = grey Ro = roan dam 10 Sonnyboyliston (IRE) (42) 4 9-8 (60.8) (14) Ch g Power Miss Macnamara (IRE) Jockey: Ben Coen Owner: Kildare Racing Club Trainer: J. P. Murtagh, Ireland Form: 14-3316 Breeder:

Female horse up to four years old. Horse of either sex from its birth until 1 January the following year. 220 yards (one eighth of a mile). Castrated horse Description of the course conditions under foot. Unit of four inches in which a horse’s height is measured at the shoulder Betting term for the horse with the shortest odds (the favourite) Official responsible for declaring finishing order and distances between horses. Di Clark is in the hot seat this afternoon. Two-year old horse All horses in The Julia Graves Roses Stakes at 4:45pm ESSENTIAL PHRASES FOR THE BEGINNER

DISTANCE,

CONNECTIONS:....................

GOING:

FILLY: ......................................

JOLLY:

ALLOWANCE: .......................

DAM:........................................

CLERK

CLERK

JUVENILE:

JUDGE: ...................................

HAND:

...................

The racing silks worn by the jockeys. Male, ungelded horse, up to four years old. The owner and trainer of a racehorse Horse which tends to run well at a particular course Mother of a horse The length of a race. THE: An unmarked point 240 yards from the winning post. Describes a horse’s position in the starting stalls, drawn two days before a flat race.

RACING

COLOURS:..............................

DISTANCE:.............................

The following terms will provide any newcomer, keen to enhance their skills, with just enough of the jargon to sound like a ‘local’: SPEAK ENGLISH

Young horse which needs time to mature. OF THE COURSE:...Official in charge of running the racing programme, at York it is William Derby. OF THE SCALES:....Key in the delivery of a successful racing operation, Wayne Burnell & Karl Curran are in charge of things today.

language

The weight concession the horse is given to compensate for its rider’s inexperience. (Rider) on racecards, their names are usually prefixed by Mr, Mrs, etc. To indicate their amateur licence holder status.

ANTE-POST:..........................

Betting (usually for the most important races) days or even months before the race is due to take place.

COURSE SPECIALIST:..............

Young jockey tied by annually renewed contract to a licensed trainer while they are learning.

FOAL:......................................

FURLONG: .............................

It could be easy to be put off by the weird and wonderful words and phrases banded around the racecourse, but in fact, its all part of the fun. Like a tourist in a foreign country, the novice racegoer soon picks up enough of the language to get by, and then rapidly becomes fluent.

RACING

BACKWARD: .........................

DRAW: ....................................

GELDING:

COLT: ......................................

P RLEZ-VOUS R CING?

22

APPRENTICE:........................

AMATEUR: .............................

KNAVESMIRE:.......................The name for the piece of ground on which York Racecourse is situated. MAIDEN: Horse which has not yet won a race MARE: .....................................Female horse, five years and over OBJECTIONS: .......................Complaint by one camp against another regarding breach of rules during a race. ODDS ON: Where a bet’s winnings are less than the stake e.g winning a £2 bet wins you £1 so you get back £3. PACE: ......................................‘Up with the pace’ means close to the leaders. PENALTY:...............................Weight added to the handicap weight of a horse which has won since the weights were published. PHOTO FINISH: Electronic photo device which determines minimal distance in a close finish. PLATE: ....................................Shoe worn by horse for racing. RACEDAY CLERK OF THE COURSE:.................A key contact for racing professionals and in delivering the racing Anthea Leigh fills the role at York, follow her Clerking tweets @YorkClerk. SCHOOLED:...........................Trained to jump SHORT RUNNER: .................A horse that doesn’t stay the minimum distance, five furlongs on the flat or two miles over jumps. SIRE:........................................Father of a horse SPREAD A PLATE: ...............When a racing plate or horseshoe becomes detached from the animal’s hoof SP/STARTING PRICE:..........Official price of a horse at which bets are settled in the betting shops. STEWARDS ENQUIRY: Enquiry by panel of men and women responsible for seeing rules are adhered to into a race’s running. TIC-TAC: .................................Bookmakers hand-signalling method relaying odds. UNDER STARTERS’ ORDERS: Occurs when the race is about to start. VOICE IN THE SKY:..............The commentator, listen out for Stewart Machin this afternoon. WEIGH OUT/WEIGH IN:.....Weighing jockey before and after race to ensure correct weight has been carried. YEARLING: Horse of either sex from 1 January to 31 December of the year following its birth. 23

D ALLAN 3.00 Art Power (IRE) T Easterby 4.10 Lampang (IRE) T Easterby 5.20 Fishable T Easterby C BEASLEY 4.10 Commanche Falls M Dods W BUICK 2.25 Wild Crusade C Appleby 3.00 Al Suhail C Appleby 3.35 Global Storm (IRE) C Appleby 4.10 Spangled Mac (IRE) G Boughey 5.20 Forest Falcon (IRE) C & M Johnston N CALLAN 3.35 Quenelle D’or H Palmer 4.10 Silver Samurai M Botti G F CARROLL 3.00 Dr Zempf G M Lyons 3.35 Licence G M Lyons R COLGAN 3.35 Shanroe..........................................................K Thornton P COSGRAVE 2.25 Caius Chorister (FR) D Menuisier 3.35 Calling The Wind (IRE) R Hughes J CROWLEY 1.50 Alflaila Owen Burrows 3.00 Jumby (IRE) E J-Houghton 3.35 Benaud (IRE) J P O’Brien S DE SOUSA 1.50 Finest Sound (IRE) S & E Crisford 2.25 Temporize C & M Johnston 4.10 Saleymm (IRE) S & E Crisford L DETTORI 1.50 Mighty Ulysses J & T Gosden 2.25 Al Nafir (IRE) C Appleby 3.00 Kinross R Beckett 3.35 Trawlerman (IRE) J & T Gosden 4.10 Mums Tipple (IRE) R Hannon 5.20 Special Envoy J & T Gosden H DOYLE 2.25 Soulcombe W Haggas 4.10 Tabdeed.............................................................A Watson 5.20 Piecederesistance (IRE) M Hammond DAVID EGAN 2.25 Aimeric R Varian 3.00 Brad The Brief H Palmer 3.35 Enemy I Williams 4.10 Chairmanoftheboard (IRE) M Channon 4.45 Bolt Action (IRE) R Varian 5.20 Oneforthegutter I Williams S FEILDEN 4.10 Lord Of The Lodge (IRE) K R Burke S FOLEY 3.35 Ever Present (IRE) Mrs J Harrington C HARDIE 5.20 Geremia (IRE) J Goldie M HARLEY 3.35 Raymond Tusk (IRE) A King 4.10 Gulliver D O’Meara D E HOGAN 4.45 Brave Nation (IRE) M Bell R HORNBY 3.35 Max Vega (IRE) .............................................R Beckett 5.20 Lucander (IRE) R Beckett C HUTCHINSON 2.25 Adjuvant (IRE) M Bell 5.20 Soto Sizzler D Menuisier A KIRBY 3.00 Rohaan (IRE) P Evans 3.35 John Leeper (IRE) E Dunlop C LEE 4.10 Lethal Levi K R Burke 4.45 Looking For Lynda (IRE) K R Burke W J LEE 3.35 Earl Of Tyrone (IRE) Paddy Twomey 4.45 Treasure Trove (IRE) Paddy Twomey S M LEVEY 3.35 Fancy Man (IRE) R Hannon T MARQUAND 1.50 Bashkirova W Haggas 2.25 Sheer Rocks E J-Houghton 3.00 Sacred W Haggas 3.35 Candleford (IRE) W Haggas 4.10 Good Eye (SWE) Jessica Long 4.45 Swift Asset (IRE) R Hannon 5.20 Caradoc (IRE) E Walker P J MCDONALD 3.35 Alfred Boucher I Williams 4.10 Regional E Bethell 5.20 Phantom Flight......................................James Horton J MITCHELL 1.50 Cadillac (IRE) K P De Foy P MULRENNAN 3.35 Euchen Glen J Goldie D MUSCUTT 2.25 Savvy Knight (IRE) S P C Woods 4.45 Rocket Rodney G Scott OISIN ORR 4.45 Rousing Encore (IRE) R Fahey 5.20 Spirit Dancer R Fahey J PEATE 5.20 Cockalorum (IRE) R Fell D PROBERT 1.50 Masekela (IRE) A Balding 2.25 Soul Stopper A Balding 3.00 Sandrine A Balding 3.35 Valley Forge. A Balding 4.10 Tinto M Dods C RODRIGUEZ 4.10 Volatile Analyst (USA) K Dalgleish 5.20 Chichester..................................................... K Dalgleish R SCOTT 2.25 Mr Alan G Boughey 4.10 Aleezdancer (IRE) K Ryan 4.45 Squealer (IRE) N Tinkler RYAN SEXTON 4.10 Mr Wagyu (IRE) J J Quinn MP SHEEHY 2.25 Nusret J P O’Brien 3.35 Okita Soushi (IRE) J P O’Brien K SHOEMARK 1.50 Sonny Liston (IRE) C Hills 2.25 Inverness (IRE) C Hills 3.00 Pogo (IRE) C Hills 3.35 Gaassee (IRE) W Haggas 4.10 Royal Scimitar (IRE) C Cox 4.45 Katey Kontent C Cox J P SPENCER 3.35 Rodrigo Diaz D M Simcock 5.20 Injazati (IRE) C Fellowes D SWIFT 4.10 Ghathanfar (IRE) .........................................T Waggott D TUDHOPE 1.50 Marie’s Diamond (IRE) R Fell 3.35 Get Shirty (IRE) D O’Meara 4.10 Summerghand (IRE) D O’Meara 4.45 Thunder Moor (IRE) K Ryan JOCKEYS ollow a ider or rainer of your choosing: ALPHABETICAL INDEX 24

CHARLIE APPLEBY 2.25 Al Nafir (IRE) Frankie Dettori 2.25 Wild Crusade William Buick 3.00 Al Suhail William Buick 3.35 Global Storm (IRE) William Buick ANDREW BALDING 1.50 Masekela (IRE) David Probert 2.25 Soul Stopper David Probert 3.00 Sandrine David Probert 3.35 Valley Forge. David Probert RALPH BECKETT 3.00 Kinross Frankie Dettori 3.35 Max Vega (IRE) Rob Hornby 5.20 Lucander (IRE) Rob Hornby MICHAEL BELL 2.25 Adjuvant (IRE) Callum Hutchinson 4.45 Brave Nation (IRE) Dylan Hogan EDWARD BETHELL 4.10 Regional P J McDonald MARCO BOTTI 4.10 Silver Samurai Neil Callan GEORGE BOUGHEY 2.25 Mr Alan Rowan Scott 4.10 Spangled Mac (IRE) William Buick KARL BURKE 4.10 Lethal Levi Clifford Lee 4.10 Lord Of The Lodge (IRE) Sam Feilden 4.45 Looking For Lynda (IRE) Clifford Lee OWEN BURROWS 1.50 Alflaila Jim Crowley MICK CHANNON 4.10 Chairmanoftheboard (IRE) David Egan CLIVE COX 4.10 Royal Scimitar (IRE).................................Kieran Shoemark 4.45 Katey Kontent Kieran Shoemark SIMON & ED CRISFORD 1.50 Finest Sound (IRE) Silvestre De Sousa 4.10 Saleymm (IRE) Silvestre De Sousa KEITH DALGLEISH 4.10 Volatile Analyst (USA) Callum Rodriguez 5.20 Chichester Callum Rodriguez KEVIN PHILIPPART DE DE FOY 1.50 Cadillac (IRE) Jack Mitchell MICHAEL DODS 4.10 Commanche Falls Connor Beasley 4.10 Tinto David Probert ED DUNLOP 3.35 John Leeper (IRE) Adam Kirby TIM EASTERBY 3.00 Art Power (IRE) David Allan 3.35 Dark Jedi (IRE) Reserve 2 4.10 Lampang (IRE) David Allan 5.20 Fishable David Allan DAVID EVANS 3.00 Rohaan (IRE) Adam Kirby RICHARD FAHEY 4.45 Rousing Encore (IRE) Oisin Orr 5.20 Spirit Dancer Oisin Orr ROGER FELL 1.50 Marie’s Diamond (IRE) Daniel Tudhope 5.20 Cockalorum (IRE) Jonny Peate CHARLIE FELLOWES 5.20 Injazati (IRE) Jamie Spencer JIM GOLDIE 3.35 Euchen Glen Paul Mulrennan 5.20 Geremia (IRE) Cam Hardie JOHN & THADY GOSDEN 1.50 Mighty Ulysses Frankie Dettori 3.35 Trawlerman (IRE) Frankie Dettori 5.20 Special Envoy Frankie Dettori WILLIAM HAGGAS 1.50 Bashkirova Tom Marquand 2.25 Soulcombe.............................................................Hollie Doyle 3.00 Sacred Tom Marquand 3.35 Candleford (IRE)............................................Tom Marquand 3.35 Gaassee (IRE) Kieran Shoemark MICKY HAMMOND 5.20 Piecederesistance (IRE) ...................................Hollie Doyle RICHARD HANNON 3.35 Fancy Man (IRE) Sean Levey 4.10 Mums Tipple (IRE) Frankie Dettori 4.45 Swift Asset (IRE) Tom Marquand JESSICA HARRINGTON 3.35 Ever Present (IRE) Shane Foley CHARLES HILLS 1.50 Sonny Liston (IRE) Kieran Shoemark 2.25 Inverness (IRE) Kieran Shoemark 3.00 Pogo (IRE) Kieran Shoemark JAMES HORTON 5.20 Phantom Flight P J McDonald RICHARD HUGHES 3.35 Calling The Wind (IRE) Pat Cosgrave EVE JOHNSON HOUGHTON 2.25 Sheer Rocks Tom Marquand 3.00 Jumby (IRE) Jim Crowley CHARLIE & MARK JOHNSTON 2.25 Temporize Silvestre De Sousa 5.20 Forest Falcon (IRE) William Buick ALAN KING 3.35 Raymond Tusk (IRE) Martin Harley JESSICA LONG 4.10 Good Eye (SWE) Tom Marquand GER LYONS 3.00 Dr Zempf Gary Carroll 3.35 Licence Gary Carroll DAVID MENUISIER 2.25 Caius Chorister (FR)........................................Pat Cosgrave 5.20 Soto Sizzler Callum Hutchinson HUGHIE MORRISON 3.35 Not So Sleepy Reserve 1 JOSEPH PATRICK O’BRIEN 2.25 Nusret Mikey Sheehy 3.35 Benaud (IRE) Jim Crowley 3.35 Okita Soushi (IRE) Mikey Sheehy DAVID O’MEARA 3.35 Get Shirty (IRE) Daniel Tudhope 4.10 Gulliver Martin Harley 4.10 Summerghand (IRE) Daniel Tudhope HUGO PALMER 3.00 Brad The Brief David Egan 3.35 Quenelle D’or Neil Callan JOHN QUINN 4.10 Mr Wagyu (IRE) R Sexton KEVIN RYAN 4.10 Aleezdancer (IRE) Rowan Scott 4.45 Thunder Moor (IRE) Daniel Tudhope GEORGE SCOTT 4.45 Rocket Rodney Daniel Muscutt DAVID SIMCOCK 3.35 Rodrigo Diaz Jamie Spencer KARL THORNTON 3.35 Shanroe Robbie Colgan NIGEL TINKLER 4.45 Squealer (IRE) Rowan Scott PADDY TWOMEY 3.35 Earl Of Tyrone (IRE) Billy Lee 4.45 Treasure Trove (IRE) Billy Lee ROGER VARIAN 2.25 Aimeric David Egan 4.45 Bolt Action (IRE) David Egan TRACY WAGGOTT 4.10 Ghathanfar (IRE) Dale Swift ED WALKER 5.20 Caradoc (IRE) Tom Marquand ARCHIE WATSON 4.10 Tabdeed Hollie Doyle IAN WILLIAMS 3.35 Alfred Boucher P J McDonald 3.35 Enemy David Egan 5.20 Oneforthegutter David Egan S P C WOODS 2.25 Savvy Knight (IRE) Daniel Muscutt TRAINERS 25

Tote vs Starting Price? We’ll pay whichever is better on win bets! We’ll always pay at least SP on Win bets and if the Tote dividend is greater, we’ll pay out at that price. Tote.co.uk, Tote.ie, Tote App and selected UK racecourse customers only. Promotion applies to Tote Win and win part of each way bets on all UK & Irish races, staking limits apply. Full terms and conditions available at Tote.co.uk/promotions. 18+. BeGambleaware.org

CHESTER Race 1 1.55 7f 1y 1 Frankness (GB) 9-8 2 Balalaika (IRE) 9-2 3 Pedro And The Bear (IRE) 9-2 4 Tellus (GB) 9-2 5 Tillybob (IRE) 9-2 6 Witchford (GB) 9-2 Race 2 2.30 6f 17y 1 All The Time (IRE) 9-2 2 Can To Can (IRE) 9-2 3 Oneforsue (GB) 9-2 4 Queen of Uplands (IRE) 9-2 5 Sugar Hill Babe (IRE) 9-2 Race 3 3.05 1m 6f 87y 1 Loft (GER) 10-0 2 Rajinsky (IRE) 9-7 3 Reshoun (FR) 9-7 4 Vindolanda (GB) 9-2 5 River of Stars (IRE) 8-6 6 Typewriter (IRE) 8-6 Race 4 3.40 7f 127y 1 Safe Voyage (IRE) 9-12 2 Fools Rush In (IRE) 9-12 3 Boardman (GB) 9-12 4 On A Session (USA) 9-10 5 Percy’s Lad (GB) 9-8 6 Fame And Acclaim (IRE) 9-7 7 Absolute Ruler (USA) 9-4 8 Bullace (GB) 9-4 9 Titan Rock (GB) 9-3 10 Positive Impact (IRE) 8-13 11 Paws For Thought (IRE) 8-13 12 Cassy O (IRE) 8-6 13 Trumble (IRE) 8-6 Race 5 4.15 5f 110y 1 Ancient Times (GB) 9-11 2 Hyperfocus (IRE) 9-11 3 Khunan (GB) 9-9 4 Roman Dragon (GB) 9-5 5 Sampers Seven (IRE) 9-5 6 Scot’s Grace (IRE) 9-4 7 Lullaby Bay (GB) 9-3 8 Gabrial The Devil (IRE) 9-3 9 Glory Fighter (GB) 9-1 10 Lihou (GB) 9-0 11 King of Tonga (IRE) 8-11 Race 6 4.50 5f 15y 1 Le Beau Garcon (GB) 9-11 2 Catch Cunningham (IRE) 9-9 3 Ballet Steps (GB) 9-9 4 Antiphon (IRE) 9-9 5 Glamorous Express (IRE) 9-7 6 Mytilda (IRE) 9-6 7 The Dunkirk Lads (GB) 9-4 8 So Smart (IRE) 9-3 9 Frisky (GB) 9-0 10 Motashaweq (IRE) 8-11 11 Lucky Shake (FR) 8-9 12 Riversway (GB) 8-8 13 Sheikh Maz Mahood (IRE) 8-8 Race 7 5.25 1m 7f 196y 1 Call My Bluff (IRE) 10-2 2 Emiyn (FR) 10-1 3 Cogital (GB) 9-13 4 Heart of Soul (IRE) 9-12 5 Mancini (GB) 9-3 6 Bollin Neil (GB) 9-0 7 The Gadget Man (GB) 8-13 8 The New Marwan (GB) 8-11 9 Overhaugh Street (GB) 8-11 10 Mister Camacho (IRE) 8-2 SANDOWN PARK Race 3 3.15 7f 1 Al Rufaa (FR) 10-1 2 Tomfre (GB) 10-0 3 Gisburn (IRE) 9-10 4 Final Watch (GB) 9-7 5 Prontissimo (GB) 9-7 6 Global Esteem (IRE) 9-1 7 Zainalarab (GB) 8-11 Race 4 3.50 1m 1f 209y 1 Belloccio (FR) 9-12 2 Palavecino (FR) 9-11 3 Fantastic Fox (GB) 9-9 4 Ajero (IRE) 9-9 5 Victory Chime (IRE) 9-8 6 Arqoob (IRE) 9-4 7 Dubai Horizon (IRE) 9-2 8 Protagonist (FR) 9-1 9 Good Birthday (IRE) 9-0 10 Migdam (FR) 9-0 11 Yorkshire Lady (GB) 8-12 12 Dual Identity (IRE) 8-11 13 Croeso Cymraeg (GB) 8-9 14 Asgoodassobergets (FR) 8-9 15 Knight of Honour (IRE) 8-9 16 Secret Box (GB) 8-6 17 Vee Sight (GB) 8-2 Race 5 4.25 7f 1 Aunt Violet (USA) 9-2 2 Beautiful Star (IRE) 9-2 3 Catch A Star (IRE) 9-2 4 Chelsea Green (IRE) 9-2 5 Cruise (IRE) 9-2 6 Daydream Dancer (IRE) 9-2 7 Delightfully Yours (IRE) 9-2 8 Gentle Whinny (IRE) 9-2 9 Mubhijah (GB) 9-2 10 Orange Martini (GB) 9-2 11 Queen Fleur (IRE) 9-2 12 Sentimentality (GB) 9-2 13 Tomouh Dubai (IRE) 9-2 Race 6 5.00 7f 1 Priors Dell (GB) 9-11 2 Seductive Power (IRE) 9-7 3 Gulmarg (IRE) 9-6 4 Urban Sprawl (GB) 9-3 5 The Toff (IRE) 9-1 Race 7 5.35 5f 10y 1 Beyond Equal (GB) 9-11 2 Neptunian (IRE) 9-10 3 Chipstead (GB) 9-10 4 Impeach (IRE) 9-9 5 Just Glamorous (IRE) 9-8 6 Josies Kid (IRE) 9-8 7 Isle of Lismore (IRE) 9-5 8 Four Adaay (GB) 9-3 9 Marnie James (GB) 9-2 10 Yimou (IRE) 8-13

Celebrating the racehorse and their welfare is at the heart of what we do • 18 days of flat racing • Approximately 1,400 horses • Running in 127 races Equine Welfare Investment £2,000,000 management of 10 hectares of racing surface • 3 equine specialist vets on duty at every raceday • Pre and post race examinations by a minimum of 6 BHA Equine Welfare Officers • A team of 12 equestrian experts providing pre, during and post-race support • 2 experienced farriers, specialising in racehorses • Mobile water provision across all equine related areas including on the racecourse Equine Expertise 365-day York Racecourse annually into equine related activity, including: • 2 state of the art veterinary care boxes • 3 kilometres rubberised non-slip horse walkways • 16 temperature controlled horse showers • 178 high specification stables • 3 Misting fans to aid horse cooling • 3 horse ambulances including London 2012 Equisave Horse ambulance

British Racing • All licenced participants, including racecourses are required to meet BHA regulation standards in respect of the track, equine facilities and equine welfare Over since 2000 has been invested into advancing equine veterinary science and education via the Horseracing Betting Levy Board 6,000 Racing Grooms dedicate themselves 365 days a year to the 14,000 racehorses in mainland UK £35 million since 2012 has been awarded in grants by The Racing Foundation specifically to horse welfare initiatives £2.3million • Retraining of Racehorses (RoR) is British Horseracing’s official charity for the welfare of horses who have retired from racing • York Racecourse supports the charity New Beginnings, who are accredited by the RoR

FINALE PROPER ENJOY A To book your raceday experience go to yorkracecourse.co.uk October Finale Friday 7 - Saturday 8 October

Today’s Runners & Riders

32

THE 1731 PIE SHOP

Refurbished since last summer, discover the bright new look, complete with 86” HD televisions that will keep those sipping a glass of Moët in touch with the action, as they relax on some Andy Thornton furniture.

COUNTY STAND GARDEN

A new name and a new look for the counter service restaurant on the ground floor of the Knavesmire Stand. Its name gives a clear indication of its homemade signature dishes, as well as being a nod to the founding season on the Knavesmire.

WHAT IS DIFFERENT AT YORK TODAY?

Returning smarter after its juvenile season, a different perspective on the action, serving fizz, as well as a full bar service plus tasty cold food.

COUNTY STAND CHAMPAGNE PAVILION

STABLESIDE Facilities for horses have been improved with a further unloading ramp, additional and improved horse showers as well as an improved equine walkway from the stables to the main racecourse ROBERTO VILLAGE BAR With twenty serving stations, a quick refresh between races and easy access to Bustardthorpe Lawn and the Betting Ring. 33

to

for some

The last day of the Sky Bet Ebor Festival starts with a race that is part of the Pattern pyramid which denotes Listed, Group 3 (like this one), Group 2 and Group 1. This race is open to 3yo+ horses and is over a trip of nine furlongs. Check out punters panel at 1pm tips (or someone blame.) YEAR’S RACE Winner: REAL WORLD Trainer: Saeed bin Suroor Jockey: Marco Ghiani Age/Weight: 4-9-5 Runners: 7 SP: EvensF Real World was well supported at short odds for this Group 3 to begin the final day last year, and he duly obliged for the Godolphin team. Real World travelled smartly into the race tracking the leaders, and when he took the lead there was no horse who could keep up with him as he hit the line over a length in front. Time: 1m 49.19s 1m 48.50s 1m 46.76s Echo Of (05-Sep-07) trainer (17-22):

LAST

Course record:

the

by

THE TALE OF THE CLOCK Race Average

All times are based where possible on the corresponding race over the last ten years RACE FACTS & STATISTICS Leading course

the best contests,

Racing Post Standard Time:

35 The Sky Bet & Symphony Group Strensall Stakes (Group 3) One Mile About One Furlong (1,700 metres) See page 93 for conditions of this race. RACE DESCRIPTION

J & T Gosden (31 wins from 112 runners, 28%) runs MIGHTY ULYSSES Trainer-in-form (last 14 days): W Haggas (14 wins from 42 runners, 33%) runs BASHKIROVA Longest Traveller: MASEKELA trained by A Balding, Kingsclere, 216 miles. NOTE: All statistics are up to and including 18th August Last Winning Winning Runs Racecard 6 Career Total Career Distance Going Since No. Runs Horse Wins Places Runs Winnings Range Range Wins 1 17-215 BASHKIROVA 4 1 7 74692 8-9F G-ST 1 2 5-36122 CADILLAC 4 3 14 148750 7-10F G 2 3 13-26D1 FINEST SOUND 4 9 18 36682 7-10F G-GF 0 4 504028 MARIE’S DIAMOND 7 9 48 114005 5-8F G-HV 15 5 46-1021 ALFLAILA 3 3 10 47281 6-8F G-GF 0 6 14-2459 MASEKELA 2 2 9 31797 6-7F G-S 5 7 1-51251 MIGHTY ULYSSES 3 1 6 40289 8F G-GF 0 8 1-4303 SONNY LISTON 1 5 5400 7F G 4 KNAVESMIRE TIP Mighty Ulysses arrives following a comfortable Listed triumph at Newmarket and was a close-up fifth in the St James’s Palace Stakes at Royal Ascot, but BASHKIROVA could well bounce back. William Haggas’ filly kept on well when scoring on her penultimate outing at Epsom in June and has been freshened up since her fifth in the Duke Of Cambridge. Alflaila did it well in Listed company at Pontefract, but was a length and a half behind Mighty Ulysses on the July Course BASHKIROVA MIGHTY ULYSSES 1st Race 1.50 Distance: 1m 1f Race Type: Group Three Prize Money: £150,000 Age: 3+ Stalls: Inside Rail

Light

Owner: Chelsea Thoroughbreds The Big Bear Trainer: Charles Hills, Lambourn Form: 1-4303 Breeder: Tally-Ho Stud A winner at 7f on good ground. Third of 7 behind Rocchigiani beaten 1 1/2l at 12-1 on his latest outing in the Group 3 Bonhams Thoroughbred Stakes at Goodwood over 1m (good to firm) last month. That was a pleasing effort and improvement should not be ruled out for him. Official BHA Rating 106 SP: 14-1 Kieran Shoemark Mark Wilson No Horse Age st-lb (kgs) Draw

B c Lawman (FR) Stars In Your Eyes

Owner: Sheikh Abdullah Almalek Alsabah Trainer: Kevin Philippart de Foy, Newmarket Form: 5-36122 D Breeder: Sunderland Holdings Inc

Owner: The Wolf Pack & Partner Trainer: Roger Fell, Nawton Form: 504020 Breeder: Mr Tony Ashley Winner of seven races from 5f to 1m on ground varying from good to firm to heavy Beaten 19l behind Anmaat at 50-1 when eighth of 10 on his latest outing in the Group 3 Rose Of Lancaster Stakes at Haydock over 1m 2f (good) earlier this month. Others are preferred. Official BHA Rating 102 SP: 40-1 Daniel Tudhope 5 Alflaila (GB) (27) 3 9-0 (57.2) (2) B c Dark Angel (IRE) Adhwaa Owner: Shadwell Estate Company Ltd Trainer: Owen Burrows, Lambourn Form: 46-1021 Breeder: Shadwell Estate Company Limited He has won three times from 6f to 1m on good to firm and good ground. A winner at 7-2 at Pontefract over 1m (good) last month, beating Marie’s Diamond by 1 1/2l. Has also won at Ascot this season. He gets a three-year-old allowance and would be dangerous to dismiss. Official BHA Rating 109 SP: 9-2 Jim Crowley Selwen Pandu 6 Masekela (IRE) (23) 3 9-0 (57.2) (8)

B f Pivotal Russian Finale

1st Race 1.50 The Sky Bet & Symphony Group

He has won four times from 7f to 1m 2f on ground varying from good to firm to good to soft. A winner at 5-2 at Thirsk over 7f (good) on his latest outing earlier this month, beating Symbolize by a neck. That was a pleasing effort but he faces stiffer competition in this. Official BHA Rating 108 SP: 11-1 Silvestre De Sousa Aslam Khan 4 Marie’s Diamond (IRE) (14) 6 9-7 (60.3) (4) B or Br h Footstepsinthesand Sindiyma (IRE)

He has won four times from 7f to 1m 2f on good ground. Beaten 9l by Grocer Jack when second of 5 at 15-8 on his latest outing at Newbury over 1m 2f (good to firm) last month. More will be needed to score in this but he should not be dismissed down in trip Official BHA Rating 111 SP: 6-1 Jack Mitchell Jordan Smith 3 Finest Sound (IRE) (15) 5 9-7 (60.3) (3) B g Exceed And Excel (AUS) Amplifier Owner: Sheikh Mohammed Obaid Al Maktoum Trainer: Simon & Ed Crisford, Newmarket Form: 13-2631 Breeder: Sheikh Mohammed Obaid Al Maktoum

B c El Kabeir (USA) Lady’s Purse Owner: Mick and Janice Mariscotti Trainer: Andrew Balding, Kingsclere Form: 14-2450 Breeder: Coolawn Stud Successful at 6f and 7f on good and soft ground. Beaten 12l behind New London at 33-1 when 9th of 10 on his latest outing in the Group 3 Gordon Stakes at Goodwood over 1m 4f (good to firm) last month. His recent efforts have been disappointing and others appeal more. Official BHA Rating 106 SP: 22-1 David Probert Angela Cheshire 7 Mighty Ulysses (GB) (44) 3 9-0 (57.2) (1)

Strensall Stakes

1 36 1 Bashkirova (GB) (66) 4 9-7 (60.3) (7)

Distance: 1m 1f Race Type: Group Three Prize Money: £150,000 Age: 3+ Stalls: Inside Rail

Owner: Cheveley Park Stud Trainer: William Haggas, Newmarket Form: 110-215 D BF Breeder: Cheveley Park Stud Limited

She has won four times at 1m on ground varying from good to firm to soft and on the all-weather Finished 5l behind Saffron Beach when fifth of 7 at 5-2jt-fav on her latest outing in the Group 2 Duke Of Cambridge Stakes at Ascot over 1m (good to firm) in June Has claims. Official BHA Rating 106 SP: 17-2 Tom Marquand Inzar Alam 2 Cadillac (IRE) (35) 4 9-7 (60.3) (5) B c Lope de Vega (IRE) Seas of Wells (IRE)

B c Ulysses (IRE) Token of Love Owner: Mr Saeed Suhail Trainer: John & Thady Gosden, Newmarket Form: 1-51251 Breeder: Hascombe & Valiant Stud Ltd He has won three times at 1m on good to firm and good ground. Won on his latest outing when 11-10fav at Newmarket over 1m (good to firm) last month, beating Alflaila by 1 1/2l. St James’s Palace Stakes fifth who boasts leading credentials for a top yard. Official BHA Rating 113 SP: 13-8 Frankie Dettori Jay Conlon 8 Sonny Liston (IRE) (22) 3 9-0 (57.2) (6)

1 37 NUMBER OF DECLARED RUNNERS 8............................................................................................(EXACTA) Blinkers worn by No 2. Tongue Strap worn by No 3. Sheepskin Cheek Pieces worn by No 3. PROBABLE S.P.’S 13-8 Mighty Ulysses (GB), 9-2 Alflaila (GB), 6-1 Cadillac (IRE), 17-2 Bashkirova (GB), 11-1 Finest Sound (IRE), 14-1 Sonny Liston (IRE), 22-1 Masekela (IRE), 40-1 Marie’s Diamond (IRE) RESULT & PRIZE MONEY INFORMATION 1st £85065 2nd £32250 3rd £16140 4th £8040 TIME DISTANCES York has the Longest and Best Preserved city walls in England, and now a race named after them the Listed John Smith’s City Walls Stakes. THINGS YOU MIGHT NOT KNOW ABOUT YORK HBLB PRIZE MONEY Thank you to the Horserace Betting Levy Board for providing £2,213,003 for the season. Everyone at York is grateful for their support. FIRST RACE PRESENTATION & BEST TURNED OUT The trophy for this race will be presented to the winning owner after the race by Simon Bernholt Chief Regulatory and Legal Officer Flutter UK & Ireland. Sky Bet have generously given £200 to the racing groom responsible for the best turned out horse in this race and £200 to the groom responsible for the winning horse 7. Mighty Ulysses holds an entry in the Queen Elizabeth II Stakes (sponsored by QIPCO) on Saturday 15th October, for which supplementary entries can be received by noon on Monday 10th October for a stake of £70,000

11th September 2022 | 8.45am Go behind the scenes of Malton’s historic racing yards Meet trainers, horses and stable staff Afternoon activities on Highfield Gallops Free entrance for under-16s BOOK TICKETS: MALTONOPENDAY.CO.UK Previous Winners - Last Ten Runnings Trainer Jockey SP Runners Time Going 2021 Real World Saeed Bin Suroor Marco Ghiani Evens 7 ran 1m 47.66s G 2020 Certain Lad Mick Channon Hollie Doyle 10/1 9 ran 1m 52.39 G/S 2019 Zaaki Sir Michael Stoute Ryan moore 7/2 6 ran 1m 48.68s G/F 2018 Lord Glitters David O’Meara Daniel Tudhope 2/1F 8 ran 1m 48.03s G/F 2017 Mustashry Sir Michael Stoute Jim Crowley 5/2F 7 ran 1m 47.85s G 2016 Scottish Charlie Appleby William Buick 5/1 10 ran 1m 46.61s G 2015 Mondialiste David O’Meara Daniel Tudhope 4/1F 9 ran 1m 50.33s G 2014 Custom Cut David O’Meara Daniel Tudhope 11/2 7 ran 1m 50.83s G 2013 City Style Charlie Appleby Silvestre De Sousa 9/1 7 ran 1m 51.75s G/S 2012 Dubai Prince Mahmood Al Zarooni Frankie Dettori 4/1 7 ran 1m 47.73s G The Sky Bet and Symphony Group Strensall Stakes Real World - Winner Of Last Year’s Race 38

THE SPORT WE LOVE INTO THE SPORT FOR ALL BECAUSE IT’S BETTER WHEN WE’RE racingtogether.co.uk/allintherace #ALL RACE

Newly opened 1907 2022 2014 In service LIFE & TIMES OF AN EDWARDIAN WEIGHING ROOM 40

Open for County Stand racegoers to enjoy a cup of tea or sample our locally brewed craft ales whilst discovering the heritage of the building. 2022 2014 In service 41

Owner: Mamba Racing & Partner Trainer: Marco Botti, Newmarket Form: 305141 D Breeder: Ile Flottante Syndicate

Owner: Cheveley Park Stud Trainer: Sir Michael Stoute, Newmarket Form: 40-2200 Breeder: Cheveley Park Stud Limited Successful twice at 7f on good ground and on the all-weather Beaten 10l behind Lily Pond at 12-1 when seventh of 9 on her latest outing in a Group 2 at Curragh over 1m 1f (good) last month. Yet to win outside of novice company, and unlikely to change that today. Official BHA Rating 102 SP: 33-1 5 Random Harvest (IRE) (14) 4 9-6 (59.9) (2) B f War Front (USA) Seta (Pivotal) Jockey: Saffie Osborne

The Jrl Group Atalanta Stakes (Group 3) About One Mile (1,600 metres) SANDOWN SANDOWN SANDOWN

Owner: Lady Bamford Trainer: Ed Walker, Upper Lambourn Form: 202132 D Breeder: Lady Bamford Successful twice at 1m on good to firm and soft ground. Beaten 1/2l by Rising Star when second of 10 at 11-1 on her latest outing at Haydock over 1m (good) earlier this month. The fourth has won a Group 3 since, so at least the form is working out, but others preferred.

Official BHA Rating 96 SP: 20-1 6 Rising Star (GB) (14) 4 9-6 (59.9) (11) B f Fast Company (IRE) Ile Flottante (Duke of Marmalade (IRE)) Jockey: Luke Morris

Official BHA Rating 103 SP: 14-1 2 Mrs Fitzherbert (IRE) (77) 4 9-6 (59.9) (5) B f Kingman Stupendous Miss (USA) (Dynaformer (USA)) Jockey: George Rooke Owner: Sonia M. Rogers & Anthony Rogers Trainer: Hughie Morrison, East Ilsley Form: 4114-16 D Breeder: Airlie Stud & Mrs S. M. Rogers She has won three times from 1m to 1m 1f on good to firm ground and on the all-weather Finished 7l behind Bashkirova when sixth of 10 at 10-3 on her latest outing in a Group 3 at Epsom over 1m (good) in June Wouldn’t write her off just yet, and could go well at a price.

Winner of six races from 7f to 1m on good to firm and good ground and on the all-weather A winner at 13-2 at Haydock over 1m (good) on her latest outing earlier this month, beating Random Harvest by 1/2l. Others look open to more progress, but has place possibilities. Official BHA Rating 97 SP: 12-1 7 Roman Mist (IRE) (24) 4 9-6 (59.9) (12) Gr f Holy Roman Emperor (IRE) Drifting Mist (Muhtathir) Jockey: Hector Crouch

Owner: Hot To Trot Racing 1 Roman Mist Trainer: Tom Ward, Upper Lambourn Form: 2-21300 D Breeder: Kildaragh Stud

Distance: 1m Race Type: Group Three Prize Money: £80000 Age: 3+ 42

Winner of five races from 1m to 1m 1f on good to firm and good ground and on the all-weather Beaten 7l behind Oscula at 50-1 when 10th of 15 on her latest outing in a Group 3 at Goodwood over 7f (good to firm) last month. Likely to struggle once again here.

Owner: Jastar Capital Ltd & WH Bloodstock Trainer: Jane Chapple-Hyam, Newmarket Form: 21-2111 Breeder: China Horse Club International Ltd She has won four times at 7f on good to firm and good ground and on the all-weather Won on her latest outing when 4-7fav at Newmarket over 7f (good to firm) last month, beating Micks Dream by 4l. Clearly progressing, but might be flying a bit too high here. Official BHA Rating 96 SP: 8-1 4 Potapova (GB) (34) 4 9-6 (59.9) (3) B f Invincible Spirit (IRE) Safina (Pivotal) Jockey: Richard Kingscote

Official BHA Rating 101 SP: 66-1 No Horse Age st-lb (kgs) Draw 2.05

Official BHA Rating 105 SP: 16-1 3 Nizaaka (FR) (22) 4 9-6 (59.9) (10) B f New Bay Dusky Queen (IRE) (Shamardal (USA)) Jockey: Jason Watson

1 Bounce The Blues (IRE) (24) 5 9-6 (59.9) (1) Ch m Excelebration (IRE) Jazz Up (Cadeaux Genereux) Jockey: Dane O’Neill Owner: Mrs Barbara M. Keller Trainer: Andrew Balding, Kingsclere Form: 302-220 Breeder: Kilnamoragh Stud Successful twice at 7f on soft and yielding ground. Beaten 4 1/2l behind Oscula at 16-1 when seventh of 15 on her latest outing in a Group 3 at Goodwood over 7f (good to firm) last month. More exposed than most, so the percentage call is to look elsewhere.

8 Serenading (GB) (28) 6 9-6 (59.9) (6) Br m Iffraaj Constant Dream (Kheleyf (USA)) Jockey: Kevin Stott

Owner: Sheikh Mohammed Obaid Al Maktoum

Trainer: Kevin Ryan, Hambleton Form: 32-214 D

Breeder: Manor Farm Stud & J. E. Rose

Breeder: Sheikh Mohammed Obaid Al Maktoum

Owner: Mrs Tabor, Mrs MV Magnier, Mrs Shanahan Trainer: John & Thady Gosden, Newmarket Form: 1201 CD Breeder: Whatton Manor Stud Successful twice at 1m on good to firm ground. A winner at 4-1 over this course and distance (good to firm) on her latest outing last month, beating Oscula by 3 1/2l. Has also won at Ascot this season. That race has worked out pretty well, so looks a big player here. Official BHA Rating 105 SP: 2-1 11 Laurel (GB) (22) 3 9-0 (57.2) (4) B f Kingman Promising Lead (Danehill (USA)) Jockey: Non Runner Owner: Juddmonte Trainer: John & Thady Gosden, Newmarket Form: 1 D Breeder: Juddmonte Farms Ltd NON RUNNER SP: 12 Mise En Scene (GB) (90) 3 9-0 (57.2) (7) B f Siyouni (FR) Gadfly (Galileo (IRE)) Jockey: Cieren Fallon Owner: Qatar Racing & RacehorseClub.com Trainer: James Ferguson, Newmarket Form: 1140-0 Breeder: The Gadfly Partnership Successful twice at 7f on good ground. Beaten 16l behind Homeless Songs at 14-1 when 11th of 14 on her latest outing in the Group 1 Tattersalls

Owner: Mr John E Rose & Manor Farm Stud Trainer: James Fanshawe, Newmarket Form: 524054 D

Official BHA Rating 107 SP: 9-2 10 Grande Dame (GB) (49) 3 9-0 (57.2) (9) B f Lope de Vega (IRE) Minwah (IRE) (Oasis Dream) Jockey: James Doyle

Irish 1,000 Guineas at Curragh over 1m (good yielding) in May. Difficult to know what to expect here, and likely best watched. Official BHA Rating 107 SP: 14-1 NUMBER OF DECLARED RUNNERS 12...........................................................................................(EXACTA) STEWARDS NOTE MRS FITZHERBERT: Following its run on 4/6/2022 it was reported that the horse was found to be in season. FONTEYN: Following its run on 28/7/2022 it was reported that the horse ran too freely PROBABLE S.P.’S 2-1 Grande Dame (GB), 9-2 Fonteyn (GB), 8-1 Nizaaka (FR), 12-1 Rising Star (GB), 14-1 Bounce The Blues (IRE), Mise En Scene (GB), 16-1 Mrs Fitzherbert (IRE), 20-1 Random Harvest (IRE), 33-1 Potapova (GB), 50-1 Serenading (GB), 66-1 Roman Mist (IRE) RESULT & PRIZE MONEY INFORMATION 1st £45368 2nd £17200 3rd £8608 4th £4288 TIME ............................................................................... DISTANCES ....................................................................................... No Horse Age st-lb (kgs) Draw SANDOWN SANDOWN SANDOWN NON-RUNNER (SelfCert(Stiff) 43

A winner at 1m on good ground. Finished 3 1/2l behind Nashwa when fourth of 8 at 18-1 on her latest outing in the Group 1 Nassau Stakes at Goodwood over 1m 2f (good to firm) last month. Hasn’t looked the easiest ride, but looks the one to beat here down in grade

B f Farhh Luzia (Cape Cross (IRE)) Jockey: Andrea Atzeni

She has won four times from 7f to 1m 1f on the all-weather Finished 4l behind Jumbly when fourth of 9 at 100-1 on her latest outing in the Group 3 Valiant Stakes at Ascot over 1m (good to firm) last month. Wasn’t disgraced there, but this doesn’t look any easier Official BHA Rating 96 SP: 50-1 9 Fonteyn (GB) (23) 3 9-0 (57.2) (8)

TOP TRAINER AT YORK AWARD www.charlesclinkard.co.uk EventReady The Championship will be determined by the number of winners recorded and in the event of a tie, placed efforts will prove the deciding factor. The winner will receive the coveted Charles Clinkard Trophy and a smart pair of shoes! 2022 STANDINGS Karl Burke 9 Kevin Ryan 6 Simon & Ed Crisford 4 Michael Dods 4 Richard Fahey 4 Grant Tuer 4 Desert Order completed an excellent double for trained Charlie Appleby on day three of the Sky Bet Ebor Festival. 2021 Champion: Tim Easterby 44

£10 Per month for 1 year OnLY On SUNdAY SUN OFFER MUST FEEND R M T EN Newandreinstatingcustomersonly.12-monthminimumtermapplies.Offeravailableuntil23:59on21.08.22.Offerpriceis£10permonthforthefirst 12months.Afterthe12-monthpromotionaltermthesubscriptionwillreverttothefullpriceof£24.98permonth.OffernotavailableonVirginMedia Forfulltermsvisitracingtv.com/eboroffer w instatingcu rsonly 12 thminimum 23:59on Offer mo 12-month re t mon Of r av leon Media. orvisitracingtv.com/eboroffer racingtv CALL03448551881

As recently as 2019, the last running not severely impacted by the pandemic, three thoroughbreds graced both the Sky Bet Ebor and the Lexus Melbourne Cup; with the Charlie Fellowes trained, Prince of Arran, being placed second in “the race that stops the nation” after a top ten finish at York.

46

The two courses offer valuable prize money and are widely regarded as a proper test of the racehorse, so it is not easy to land a major prize at either never mind, both. That honour so nearly went the way of Rekindling, who gave Joseph O’Brien a first major success in the Melbourne Cup of that November having been placed fourth in the Al Basti Equiworld Dante Stakes in the northern hemisphere in the May of 2017 Prince of Arran Heartbreak City (r) Purple Moon (r)

Whilst Australia’s premier racecourse might be more than 10,500 miles from York, operating in a different hemisphere; the links between the Knavesmire and Flemington are actually very close.

What’s more, in three of the last four prior to that, the Lexus Melbourne Cup the Sky Bet Ebor winner has made the top ten.

Rekindling Cross Counter

Not only do the teams at the two venues regularly share best practice but their signature contests are interwoven by the participants.

Though the current Covid-19 crisis thankfully seems to beeasing, there is still a real challenge of doing the double There have been a couple of near misses in recent times. Both Heartbreak City in 2016 and Purple Moon in 2007, headed down under as champions to find only one better in their bid for a famous double

DOUBLING UP DOWN UNDER

A year later and Cross Counter gave the Godolphin operation their first victory at Flemington, however the Charlie Appleby trailblazer had only managed a close up second on the Knavesmire in the Sky Bet Great Voltigeur of that August. It had been the opposite way around for Max Dynamite in 2015, when the Ricci family owned gelding partnered Frankie Dettori into the York Winner’s Enclosure in the Weatherbys Hamilton Lonsdale Cup, to just miss out in Australia, behind Prince of Penzance.

* Winners of 2020 & 2021 opted to skip a trip down under due to the ongoing Covid 19 Pandemic As well as the star horses, the same sense of fun is shared by the occasions that host the feature races. In 2019, York Racecourse was honoured to be the only European host to the Lexus Melbourne Cup on its charitable global tour Over a memorable few days, the unique trophy was the star of numerous racegoers selfies as well as visiting racing yards and the East Yorkshire village that shares its name Though for many followers on Social media, it was the appearance with the irrepressible Yorkshire Terriers that captured their hearts.

FUN TIMES REMEMBERED

Muntahaa 47

In more than quarter of a century since Vintage Crop so memorably became the first European trained of Melbourne’s big race, only two other raiders have come home with the famous three-handled trophy. Whether any of this week’s champions will join that elite list, only time can tell, but York has certainly been an important part of the career of many who have already come close How the last decade of Sky Bet Ebor winners fared in the Lexus Melbourne Cup 2021 : * 2020: * 2019: Mustajeer....................... 22nd 2018: Muntahaa: 9th 2017: Nakeeta: 5th 2016: Heartbreak City 2nd 2015: Litigant n/a 2014: Mutual Regard............. 14th 2013: Tiger Cliff n/a 2012: Willing Foe ran 5th in 2014

RACE DESCRIPTION A competitive heritage handicap for 3yo run over a mile and three quarters; more significantly the first contest in the 2023 Race to The Ebor Series, see page 66 for details. Designed for close competition, the handicapper is the independent assessor who rates horses on past performance seeking to get them crossing the line together, by handing out differing weights. The horse considered by the handicapper as the best, on past performance, will carry the most weight; Wild Crusade carries the top weight today.

The Sky Bet Melrose Stakes One Mile About Six Furlongs (2,800 metres) See page 93 for conditions of this race.

Check out the Press Selections Board adjacent to the Winners Enclosure for some tips (or someone else to blame).

LAST YEAR’S RACE Winner: VALLEY FORGE Trainer: Andrew Balding Jockey: David Probert Age/Weight: 3-8-8 Runners: 22 SP: 10/1 Clearly very well-handicapped from a rating of just 83, the Andrew Balding-trained three-year-old galloped into the lead two furlongs out in last year’s Sky Bet Melrose and held on gamely from those in behind in a bunched finish.

All times are based where possible on the corresponding race over the last ten years RACE FACTS & STATISTICS Leading course trainer (17-22): W Haggas (30 wins from 201 runners, 15%) runs SOULCOMBE Trainer-in-form (last 14 days): C & M Johnston (18 wins from 78 runners, 23%) runs TEMPORIZE Fancy That: W Haggas won this race in 2012 and 2019 The stable runs SOULCOMBE today. A Balding won this race in 2020 and 2021. The stable runs SOUL STOPPER today. C Appleby won this race in 2017 and 2018. The stable runs AL NAFIR and WILD CRUSADE today. Longest Traveller: NUSRET trained by J P O’Brien, Ireland. NOTE: All statistics are up to and including 18th August Last Winning Winning Runs Racecard 6 Career Total Career Distance Going Since No. Runs Horse Wins Places Runs Winnings Range Range Wins 1 92 1121 WILD CRUSADE 3 2 6 29186 12F GF-ST 0 2 632-411 SOUL STOPPER 2 1 6 15816 12-14F G 0 3 241 AIMERIC 1 1 3 9702 12F G 0 4 611111 CAIUS CHORISTER 5 9 30138 11-12F G-GF 0 5 113 TEMPORIZE 2 3 12960 12F GF-ST 1 6 21-2 AL NAFIR 1 1 3 3780 8F ST 1 7 11143 SAVVY KNIGHT 3 1 5 17178 10-12F G 2 8 14-6258 MR ALAN 1 1 7 3780 8F GS 5 9 4-22321 NUSRET 1 4 6 6555 12F G 0 10 61-6033 INVERNESS 1 1 6 13085 8F GF 4 11 853143 SHEER ROCKS 3 1 8 24785 7-10F F-GF 2 12 9-33418 ADJUVANT 3 9 25326 7-12F G-GF 1 13 0-55114 SOULCOMBE 2 6 12408 12F GF-S 1 KNAVESMIRE TIP Plenty in with chances, but SOUL STOPPER looks capable of completing the hat-trick after following his breakthrough Salisbury success with an impressive victory at Chester and although this demands more, he might be up to it. Soulcombe looked a little unlucky at Glorious Goodwood last time and could easily make amends, while Al Nafir is a well-bred colt who still looks open to plenty of progression. Caius Chorister has been one of the most improved horses in training but now faces her stiffest test by far. SOUL STOPPER SOULCOMBE 2nd Race 2.25 Distance: 1m 6f Race Type: Heritage Handicap Prize Money: £150,000 Age: 3 Stalls: Inside Rail

49

THE TALE OF THE CLOCK Race Average Time: 2m 57.87s Racing Post Standard Time: 2m 57s Course record: 2m 51.89s by Tuning (19-Aug-98)

3 Aimeric (GB) (35) 8-13 (56.7) (10) B c Frankel Aris (IRE) Jockey: David Egan Owner: Sheikh Mohammed Obaid Al Maktoum Trainer: Roger Varian, Newmarket Form: 241 Breeder: D. Farrington And Canning Downs

A winner at 7-4 at Chester over 1m 4f (good) on his latest outing last month, beating El Habeeb by 1/2l to break through at the third attempt. Did well that day and although this is a much more difficult test, it would be foolish to rule him out on his handicap debut.

Official BHA Rating 92 SP: 12-1 4 Caius Chorister (FR) (22) 8-13 (56.7) (13) B f Golden Horn Corpus Chorister (FR) Jockey: Pat Cosgrave

Official BHA Rating 102 SP: 7-1

Winner of five races from 1m 3f to 1m 4f on good to firm and good ground. A winner at 5-1 at Goodwood over 1m 3f (good to firm) on her latest outing last month, beating Paradias by a neck. Goes for the six-timer and a massive 39lb higher than at the start of that sequence.

Owner: Sheikh Mohammed Obaid Al Maktoum Trainer: Andrew Balding, Kingsclere Form: 632-411 D Breeder: Mildmay Bloodstock Ltd Successful at 1m 4f and 1m 6f on good ground. Won on his latest outing when 10-11fav at Chester over 1m 6f (good) last month, beating Mister Camacho by 5l. Tough race to try and get the hat-trick up in, but he’s thriving at present and looks set to give it a good go Official BHA Rating 93 SP: 8-1

2 50 1 Wild Crusade (GB) (42) 9-9 (61.2) (4)

Owner: Godolphin Trainer: Charlie Appleby, Newmarket Form: 21-2 Breeder: Springbank Way Stud A winner at 1m on the all-weather Beaten 1l by Judith when second of 4 at 7-4 on his latest outing at Newmarket over 1m 2f (good) in June This well-bred son of Dubawi surely has more to come, so looks a big player here on his handicap debut. Official BHA Rating 92 SP: 8-1 7 Savvy Knight (IRE) (30) 8-13 (56.7) (12) B g Caravaggio (USA) Seagull (IRE) Jockey: Daniel Muscutt Owner: Mr Julian Hui Trainer: S. P. C. Woods, Newmarket Form: 11143 BF Breeder: Mrs T. Mahon He has won three times from 1m 2f to 1m 4f on good ground. Last of 3 behind Australian Angel beaten 4 1/2l at 8-11fav on his latest outing at Sandown over 1m 6f (good) last month. Has won three times this season. First-time cheekpieces need to have the desired effect. Official BHA Rating 92 SP: 18-1 8 Mr Alan (GB) (65) 8-13 (56.7) (9) Ch g Ulysses (IRE) Interlace Jockey: Rowan Scott Owner: Amo Racing Limited Trainer: George Boughey, Newmarket Form: 14-6250 Breeder: Cheveley Park Stud Limited

Official BHA Rating 92 SP: 9-1 5 Temporize (GB) (21) 8-13 (56.7) (2) B g Postponed (IRE) Party Line Jockey: Silvestre De Sousa Owner: Mr S. R. Counsell Trainer: Charlie & Mark Johnston, Middleham Form: 113 BF Breeder: Mr Stuart Counsell Successful twice at 1m 4f on good to firm ground and on the all-weather Third of 4 behind Old Port beaten 7l at 11-10fav on his latest outing at Newmarket over 1m 4f (good to firm) last month. Disappointed on his handicap debut and could come up short again.

B g Dubawi (IRE) Rumh (GER) Jockey: William Buick Owner: Godolphin Trainer: Charlie Appleby, Newmarket Form: 02-1121 Breeder: Godolphin He has won three times at 1m 4f on good to firm ground and on the all-weather A winner at 7-4 at Ascot over 1m 4f (good to firm) on his latest outing last month, beating Warren Point by 2 1/2l. Has a lot of ability, but giving away this much weight won’t be easy.

Official BHA Rating 92 SP: 28-1 6 Al Nafir (IRE) (64) 8-13 (56.7) (6) Ch c Dubawi (IRE) Nightime (IRE) Jockey: Frankie Dettori

2nd Race 2.25 The

A winner at 1m on good to soft ground. Beaten 4l behind Secret State at 50-1 when eighth of 19 on his latest outing at Ascot over 1m 4f (good to firm) in June Clearly has ability, but takes on some unexposed rivals and he doesn’t look as well treated as some Official BHA Rating 92 SP: 40-1 No Horse st-lb (kgs) Draw Sky Bet Melrose Stakes Distance: 1m 6f Race Type: Heritage Handicap Prize Money: £150,000 Age: 3 Stalls: Inside Rail

B g Postponed (IRE) Perfect Spirit (IRE) Jockey: David Probert

Owner: Mr Clive Washbourn Trainer: David Menuisier, Pulborough Form: 611111 Breeder: Clive Washbourn

2 Soul Stopper (GB) (42) 9-0 (57.2) (3)

Official BHA Rating 91 SP: 12-1 10 Inverness (IRE) (24) 8-10 (55.3) (1) B c Highland Reel (IRE) Four Eleven (CAN) Jockey: Kieran Shoemark

Official BHA Rating 89 SP: 16-1 11 Sheer Rocks (GB) (14) 8-10 (55.3) (7) Ch c Iffraaj Paradise Cove Jockey: Tom Marquand

Official BHA Rating 88 SP: 22-1 13 Soulcombe (GB) (24) 8-4 (52.6) (11)

Draw SECOND RACE PRESENTATION

.................................................................................. TIME DISTANCES No

run on

BEST

was

SOULCOMBE

time by No 13. Sheepskin Cheek Pieces worn first time by No 7. Blinkers worn by No 13. Tongue Strap worn by No 9. Sheepskin Cheek Pieces worn by No 1, 8. Running for

PROBABLE

The

ADJUVANT:

No 8. STEWARDS NOTE SAVVY KNIGHT: Following

will

Owner: Sir Martyn Arbib,Ben Arbib,Chris Budgett Trainer: William Haggas, Newmarket Form: 0-55114 Breeder: Pursuit of Success LLC Successful twice at 1m 4f on good to firm and soft ground. Finished 1 1/2l behind Secret State when fourth of 13 at 9-2 on his latest outing at Goodwood over 1m 4f (good to firm) last month Unlucky not to get closer that day and off just 2lb higher, he’s a big player. Official BHA Rating 83 SP: 9-2 NUMBER OF DECLARED RUNNERS 13...........................................................................................(EXACTA)

2 51 9 Nusret (GB) (34) 8-12 (56.2) (5)

B g Frankel Ribbons Jockey: Hollie Doyle

Tongue Strap worn first the first Gelding its 21/7/2022 reported that the trainer could not explain the poor run. Following its run on 27/7/2022 it reported that the horse was denied a clear run late-on. : Following its run on 27/7/2022 it was reported that the horse was slowly into stride S.P.’S 9-2 Soulcombe (GB), 7-1 Wild Crusade (GB), 8-1 Soul Stopper (GB), Al Nafir (IRE), 9-1 Caius Chorister (FR), 12-1 Aimeric (GB), Nusret (GB), 14-1 Sheer Rocks (GB), 16-1 Inverness (IRE), 18-1 Savvy Knight (IRE), 22-1 Adjuvant (IRE), 28-1 Temporize (GB), 40-1 Mr Alan (GB) £36255 £9060 Horse st-lb (kgs) & TURNED OUT trophy for this race be presented to the winning owner after the race by Beth Gildersleve – Managing Director of Technology Sky Betting and Gaming. Sky Bet have generously given £200 to the racing groom responsible for the best turned out horse in this race and £200 to the groom responsible for the winning horse

time since

3rd £18135..................................................................... 4th

Official BHA Rating 89 SP: 14-1 12 Adjuvant (IRE) (24) 8-9 (54.9) (8) B g New Bay Levanto (IRE) Jockey: Callum Hutchinson (5) Owner: Mr A. C. Bound Trainer: Michael Bell, Newmarket Form: 0-33410 Breeder: John O’Connor

Owner: Mr Simon Munir/Mr Isaac Souede Trainer: Joseph Patrick O’Brien, Ireland Form: 4-22321 Breeder: Hesmonds Stud Ltd Won at 9-4 at Curragh over 1m 4f (good) on his latest outing last month, beating Over The Rainbow by 1 3/4l for his first victory in six attempts. Going the right way and although his mark looks no gift, runners from this yard always have to be respected on these shores.

it was

RESULT & PRIZE MONEY INFORMATION 1st £77310 2nd

B c Golden Horn Serres (IRE) Jockey: M. P. Sheehy (3)

Owner: Anthony Pye-Jeary and David Ian Trainer: Eve Johnson Houghton, Blewbury Form: 053143 Breeder: Biddestone Stud Ltd He has won three times from 7f to 1m 2f on ground varying from firm to good. Third of 10 behind Hamaki beaten 1/2l at 8-1 on his latest outing at Ascot over 1m 4f (good to firm) earlier this month. Likely he’s still progressing, but others are preferred for the win.

Owner: Steven Rocco & Partners Trainer: Charles Hills, Lambourn Form: 61-6033 Breeder: Knockainey Stud A winner at 1m on good to firm ground. Third of 13 behind Secret State beaten 1 1/2l at 12-1 on his latest outing at Goodwood over 1m 4f (good to firm) last month. Winner of that race was second in a Group 2 here on Wednesday, so another bold showing can’t be ruled out.

He has won three times from 7f to 1m 4f on ground varying from good to firm to good to soft. Beaten 5l behind Secret State at 18-1 when eighth of 13 on his latest outing at Goodwood over 1m 4f (good to firm) last month. Needs to find a bit more to take this.

TOP JOCKEY AT YORK Noble Style gave William Buick his first winner of day three in the Al Basti Equiworld Dubai Gimcrack. 2022 STANDINGS Andrea Atzeni 6 Clifford Lee 6 Kevin Stott 5 Connor Beasley 4 PJ McDonald 4 Daniel Tudhope 4 The Championship will be determined by the number of winners recorded and in the event of a tie, placed efforts will prove the deciding factor. The winner will receive the acclaimed Living North Trophy. the magazine for Yorkshire Be sure to get your copy of the current magazine In shops now! Yorkshire’s biggest and brightest magazine. It’s the only read you need! livingnorth.com PLUS homes & gardens • food & drink health & beauty • the arts travel • kids • fashion • what’s on • sport • property • win win win the magazine for Yorkshire Home FrontTHE HILARIOUS SOAP BOX CHALLENGE, INTERIORSSEA-INSPIRED AND RIGHT ROYAL STAYCATIONS SUMMER SPECIAL HOW TO EVERKEEP YONE ALLHAPPY HOLIDAY Glory DaysThe Best Fish & Chips, MasterChefYorkshire’s Champion, and GreatestSheffield’s Icons Captured in Print LOVING LOCAL YoDiscover rkshire’s HiTruly ddenOnGems Your Doorstep LNY_103_FrontCover.inddFor more details visit www.livingnorth.com/events SAVE THE DATE at York Racecourse, 10-13th November 2022

WIN A VIP TRIP AND OVERNIGHT STAY TO QIPCO BRITISH CHAMPIONS DAY SATURDAY 15 OCTOBER / ASCOT RACECOURSE ENTER ONLINE AT BRITISHCHAMPIONSDAY.COM OR SCAN QR CODE *T&Cs Apply 53

Solario Stakes (Group 3) About Seven Furlongs (1,400 metres)

Owner: Mr Mohamed Saeed Al Shahi Trainer: Patrick Owens, Newmarket Form: 11 D Breeder: Newlands House Stud Foaled 17 Mar Half-brother to Born To Boom, won at 1m. Successful at 6f and 7f on good to firm ground. Won on his latest outing when 3-10fav at Yarmouth over 7f (good to firm) last month, beating Zebra Star by 3 1/2l. Remains unbeaten and may surprise a few up in class.

Owner: Mr Man Bun Lee and Miss Sally Wall Trainer: Peter Chapple-Hyam, Newmarket Form: 1 D Breeder: Awbeg Stud Foaled 27 Feb. Dam a lightly raced maiden. A winner at 12-1 at Ascot over 7f (good to firm) on his racecourse debut last month, beating Berkshire Phantom by 5l. So impressive on debut and really could be anything. Well respected. Official BHA Rating SP: 9-2 2 Desert Hero (GB) (51) 9-3 (58.5) (6) Ch c Sea The Stars (IRE) Desert Breeze (Dubawi (IRE)) Jockey: Cieren Fallon

Owner: King Power Racing Co Ltd Trainer: Andrew Balding, Kingsclere Form: 401 D Breeder: Barronstown Stud Foaled 27 Mar A winner at 5-1 at Goodwood over 7f (good to firm) on his latest outing last month, beating Classic by a neck, his first win from three starts. Still open to more improvement and this stiff 7f is expected to suit. One to watch out for. Official BHA Rating 88 SP: 7-1 6 Wahaaj (IRE) (25) 9-3 (58.5) (3) B c Gregorian (IRE) La Belle Maison (IRE) (Titus Livius (FR)) Jockey: Louis Steward

The Fasig-Tipton Night Of The Stars

Official BHA Rating 93 SP: 12-1 No Horse st-lb (kgs) Draw 2.40

Official BHA Rating 87 SP: 8-1 7 Lady Bullet (IRE) (64) 9-0 (57.2) (2) B f James Garfield (IRE) Lil’s Joy (IRE) (Lilbourne Lad (IRE)) Jockey: Kieran O’Neill

Owner: The Three Bullets Trainer: Alice Haynes, Newmarket Form: 116 Breeder: Rathbarry Stud Foaled 14 Jan. Successful at 5f and 6f on good to firm and good ground Finished 4l behind Meditate when sixth at 20-1 on her latest outing in the Group 3 Albany Stakes at Ascot over 6f (good to firm) in June Not disgraced that day and might outrun a big price again.

SANDOWN SANDOWN SANDOWN

Owner: Godolphin Trainer: Charlie Appleby, Newmarket Form: 41 D Breeder: St Albans Bloodstock LLP

1 Defence of Fort (IRE) (42) 9-3 (58.5) (4) Ch c Starspangledbanner (AUS) Signs And Signals (IRE) (Kodiac) Jockey: Jason Watson

Owner: John Brown & Megan Dennis Trainer: Charlie & Mark Johnston, Middleham Form: 110 D Breeder: Tinnakill Bloodstock & I. Thompson Foaled 27 Feb. Successful twice at 7f on good ground. Beaten 11l behind Marbaan at 6-1 when eighth of 9 on his latest outing in the Group 2 Vintage Stakes at Goodwood over 7f (good) last month. Had won at Ayr and Haydock previously and might be able to bounce back. Official BHA Rating 92 SP: 12-1 4 Silver Knott (GB) (17) 9-3 (58.5) (5) B c Lope de Vega (IRE) God Given (Nathaniel (IRE)) Jockey: James Doyle

Owner: The Queen Trainer: William Haggas, Newmarket Form: 1 D Breeder: The Queen Foaled 29 Jan. Dam a lightly raced maiden. A winner at 4-1 at Haydock over 7f (soft) on his racecourse debut in June, beating Captain Winters by 2 3/4l. The second has won since and he must be taken seriously for the in-form William Haggas yard Official BHA Rating SP: 11-4 3 Dornoch Castle (IRE) (25) 9-3 (58.5) (1) Ch c Gleneagles (IRE) Crown Light (Zamindar (USA)) Jockey: Richard Kingscote

Distance: 7f Race Type: Group Three Prize Money: £60000 Age: 2 54

Foaled 21 Mar Dam won six times between 1m 2f and 1m 6f including a Group 2 race. Won on his latest outing when 1-2fav at Kempton over 7f earlier this month, beating Theme Park by 2l, his first win from two starts. Improving colt who left a lasting impression at Kempton. Official BHA Rating SP: 7-2 5 The Foxes (IRE) (21) 9-3 (58.5) (7) B c Churchill (IRE) Tanaghum (Darshaan) Jockey: Andrea Atzeni

NUMBER OF DECLARED RUNNERS 7 (EXACTA) PROBABLE S.P.’S 11-4 Desert Hero (GB), 7-2 Silver Knott (GB), 9-2 Defence of Fort (IRE), 7-1 The Foxes (IRE), 8-1 Wahaaj (IRE), 12-1 Dornoch Castle (IRE), Lady Bullet (IRE) RESULT & PRIZE MONEY INFORMATION 1st £34026 2nd £12900 3rd £6456 4th £3216 TIME DISTANCES SANDOWN SANDOWN SANDOWN 55

Proudly supports PACE YOURSELF ALLOWONE SOFT DRINKBETWEEN EVERYALCOHOLICDRINK Ukraine Appeal As the war in Ukraine passes through its 175th day of suffering for the people and horses in the country, our thoughts and prayers remain with them. We are proud to fly the Ukraine flag and to have offered some financial support, with a £5,000 donation to trainer Gay Kelleway’s Ukraine Appeal. If you feel able to add to that sum, please visit the justgiving page, which has more details of the good work being done here: www.justgiving.com/crowdfunding/ savinghorsesinukrainehub Thank you for this support and for the other ways you may have already shown your solidarity. 56

RACE

57

THE

LAST YEAR’S RACE Winner: SPACE BLUES Trainer: Charlie Appleby Jockey: William Buick Age/Weight: 5-9-6 Runners: 9 SP: 11/8F The Charlie Appleby trained Space Blues proved too good for his rivals as he made his return to the winner’s enclosure in this contest last year, travelling strongly into the race and powering clear of those in behind in stylish fashion. TALE OF THE CLOCK Race Average Time: 1m 23.51s Racing Post Standard Time: 1m 22.90s record: 1m 21s by Shine So Bright (24-Aug-19) All based where corresponding race ten

About Seven Furlongs (1,400 metres) See page 93 for conditions of this race. DESCRIPTION Again, part of the Pattern pyramid, this race has been elevated to Group 2 status (though it boasts Group One rewards); it is for 3yo+ over seven furlongs. allowances are in play for this race, as well as penalties for previous high-level wins, see how Sandrine and Dr Zempf benefit due to being a younger horses. Rohaan is an example of one carrying an extra burden. Look for C (has won at York) or D (has won over this distance) against the horse’s name, noting Pogo as one that carries both.

times are

over the last

years RACE FACTS & STATISTICS Leading course trainer (17-22): T Easterby (33 wins from 495 runners, 7%) runs ART POWER Trainer-in-form (last 14 days): W Haggas (14 wins from 42 runners, 33%) runs SACRED Fancy That: A Balding won this race in 2014 and 2019. The stable runs SANDRINE today. Longest Traveller: DR ZEMPF trained by G M Lyons, Ireland. NOTE: All statistics are up to and including 18th August Last Winning Winning Runs Racecard 6 Career Total Career Distance Going Since No. Runs Horse Wins Places Runs Winnings Range Range Wins 1 36131-0 AL SUHAIL 4 5 14 96062 7-8F GS-GF 1 2 348514- ART POWER 5 2 15 88048 5-6F G-ST 1 3 5002-11 BRAD THE BRIEF 8 1 19 133987 5-6F G-ST 0 4 363301 JUMBY 5 5 16 101301 6-7F G-GF 0 5 549-382 KINROSS 4 2 17 163963 7-8F GS-ST 6 6 501135 POGO 7 10 35 196437 7-8F G-GF 2 7 878144 ROHAAN 8 1 24 269614 6-7F GF-ST 2 8 8/171-55 SACRED 3 3 10 86370 5-7F G-GF 2 9 28-1513 DR ZEMPF 3 1 8 58592 6-7F G 1 10 23-5731 SANDRINE 4 2 9 194729 6-7F G-ST 0 KNAVESMIRE TIP Sandrine lines up in receipt of weight from all of her rivals and is a big player on the evidence of her Lennox Stakes defeat of Kinross, with Pogo (third) and Sacred (fifth) in behind. The latter might get a lot closer this time if ridden with less restraint, but the verdict is for last week’s Hungerford Stakes winner JUMBY, who is on really good terms with himself and has clearly come out of that Newbury contest bouncing. JUMBY SANDRINE 3rd Race 3.00 Distance: 7f Race Type: Group Two Prize Money: £400,000 Age: 3+ Stalls: Farside

possible on the

The Sky Bet City Of York Stakes (Group 2)

Weight

Course

B g Dubawi (IRE) Shirocco Star Owner: Godolphin Trainer: Charlie Appleby, Newmarket Form: 36131-0 D Breeder: Meon Valley Stud

Has won eight races from 6f to 7f on ground varying from good to firm to heavy and on the all-weather Finished 1l behind Highfield Princess when fourth at 12-1 on his latest outing in the Group 1 Prix Maurice de Gheest at Deauville over 6f (good to soft). Noted. Official BHA Rating 114 SP: 11-1 Adam Kirby Wendy Steele 8 Sacred (GB) (25) 4 9-5 (59.4) (8) B f Exceed And Excel (AUS) Sacre Caroline (USA)

He has won four times from 7f to 1m on good to firm and good to soft ground. Beaten 12l behind Storm Damage at 10-11fav when 13th of 16 on his latest outing at Meydan over 7f in March. Would come as no surprise if he bounced back to form today. One to note. Official BHA Rating 115 SP: 7-1 William Buick Vinod Pillay 2 Art Power (IRE) (308) 5 9-8 (60.8) (10) Gr h Dark Angel (IRE) Evening Time (IRE)

Owner: Anthony Pye-Jeary and David Ian Trainer: Eve Johnson Houghton, Blewbury Form: 363301 D Breeder: Ballylinch Stud

She has won three times from 5f to 7f on good to firm and good ground. Finished 1 3/4l behind Sandrine when fifth of 11 at 9-4fav on her latest outing in the Group 2 Lennox Stakes at Goodwood over 7f (good) last month. Possibly just given too much to do that day. Player. Official BHA Rating 112 SP: 9-2 Tom Marquand Jane Flanagan No Horse Age st-lb (kgs) Draw Sky Bet City Of York Stakes Distance: 7f Race Type: Group Two Prize Money: £400,000 Age: 3+ Stalls: Farside

Winner of five races from 5f to 6f on varying ground. Finished 2 1/4l behind Creative Force when fourth at 3-1fav on his latest outing in the Group 1 Qipco British Champions Sprint Stakes at Ascot over 6f (good to soft) in October last year Interesting on his return. Official BHA Rating 114 SP: 16-1 David Allan Mr Liam Pearson 3 Brad The Brief (GB) (91) 5 9-8 (60.8) (1)

3 58 1 Al Suhail (GB) (168) 5 9-8 (60.8) (7)

B g Dutch Art Kenzadargent (FR) Owner: Chasemore Farm Trainer: Hugo Palmer, Malpas Form: 5002-11 Breeder: Chasemore Farm Has won eight races from 5f to 6f on ground varying from good to heavy and on the all-weather A winner at 9-2 in the Group 2 Greenlands Stakes at Curragh over 6f (good yielding) on his latest outing in May, beating Mooneista by 1/2l. Arrives in great nick. Official BHA Rating 117 SP: 11-1 David Egan 4 Jumby (IRE) (7) 4 9-8 (60.8) (6)

He has won four times from 7f to 1m on good to soft and soft ground and on the all-weather. Beaten a neck by Sandrine when second of 11 at 4-1 on his latest outing in the Group 2 World Pool Lennox Stakes at Goodwood over 7f (good) last month. Capable type at this level. Official BHA Rating 112 SP: 6-1 Frankie Dettori Jordan Colloby 6 Pogo (IRE) (7) 6 9-8 (60.8) (2) B h Zebedee Cute Owner: Gary and Linnet Woodward Trainer: Charles Hills, Lambourn Form: 501135 C D BF Breeder: Thomas Foy Winner of seven races from 7f to 1m on ground varying from good to firm to good to soft. Finished 2 3/4l behind Jumby when fifth of 9 at 5-2fav on his latest outing in the Group 2 BetVictor Hungerford Stakes at Newbury over 7f (good to firm) last week. Expect better today. Official BHA Rating 114 SP: 14-1 Kieran Shoemark Damian Lybech-Harris 7 Rohaan (IRE) (13) 4 9-8 (60.8) (3) B g Mayson Vive Les Rouges

B g Kingman Ceilidh House Owner: Mr Marc Chan Trainer: Ralph Beckett, Kimpton Down Form: 540-302 D Breeder: Lawn Stud

Owner: King Power Racing Co Ltd Trainer: Tim Easterby, Malton Form: 340514- C Breeder: Owenstown Bloodstock Ltd

B c New Bay Sound of Guns

Winner of five races from 6f to 7f on good to firm and good ground. A winner at 9-1 in the Group 2 BetVictor Hungerford Stakes at Newbury over 7f (good to firm) on his latest outing last week, beating Dubai Poet by 1 3/4l. Another bold showing looks assured this afternoon. Official BHA Rating 112 SP: 9-1 Jim Crowley Nadeem Ikram 5 Kinross (GB) (25) 5 9-8 (60.8) (5)

Owner: Chris Kiely Racing Ltd & Mr J Tomkins Trainer: David Evans, Abergavenny Form: 000144 D Breeder: Liam Phelan

Owner: Cheveley Park Stud Trainer: William Haggas, Newmarket Form: 0/101-55 D BF Breeder: Cheveley Park Stud Limited

3rd Race 3.00 The

Owner: Mr P. M. Brant Trainer: G. M. Lyons, Ireland Form: 20-1513 D Breeder: Stratford Place Stud

He has won three times from 6f to 7f on ground varying from good to yielding. Third of 5 behind Order Of Australia beaten 4l at 13-2 on his latest outing in the Group 2 Romanised Minstrel Stakes at Curragh over 7f (good) last month. Interesting in a first-time tongue-tie Official BHA Rating 111 SP: 40-1 G. F. Carroll 10 Sandrine (GB) (25) 3 9-0 (57.2) (4) B f Bobby’s Kitten (USA) Seychelloise

Gr c Dark Angel (IRE) Souvenir Delondres (FR)

Owner: Miss K. Rausing Trainer: Andrew Balding, Kingsclere Form: 23-5031 D Breeder: Miss K. Rausing She has won four times from 6f to 7f on ground varying from good to firm to heavy and on the all-weather A winner at 12-1 in the Group 2 Lennox Stakes at Goodwood over 7f (good) on her latest outing last month, beating Kinross by a neck. Gets weight all round. Big player. Official BHA Rating 110 SP: 5-1 David Probert Kathleen Maher

NUMBER OF DECLARED RUNNERS 10 ..........................................................................................(EXACTA) Tongue Strap worn first time by No 9. Hood worn by No 1. Tongue Strap worn by No 8. PROBABLE S.P.’S 9-2 Sacred (GB), 5-1 Sandrine (GB), 6-1 Kinross (GB), 7-1 Al Suhail (GB), 9-1 Jumby (IRE), 11-1 Brad The Brief (GB), Rohaan (IRE), 14-1 Pogo (IRE), 16-1 Art Power (IRE), 40-1 Dr Zempf (GB) RESULT & PRIZE MONEY INFORMATION 1st £226840 2nd £86000 3rd £43040................................................................... 4th £21440 ................................................................................. TIME DISTANCES No Horse Age st-lb (kgs) Draw York Racecourse wishes to thank the European Breeders’ Fund for their generous support of twenty-two races over the course of the York season. THIRD RACE PRESENTATION & BEST TURNED OUT The trophy for this race will be presented to the winning owner after the race by Steve Birch Chief Commercial Officer Sky Betting and Gaming. Sky Bet have generously given £200 to the racing groom responsible for the best turned out horse in this race and £200 to the groom responsible for the winning horse 1. Art Power, 3. Brad The Brief, 7. Rohaan and 10. Sandrine hold an entry in the QIPCO British Champions Sprint Stakes on Saturday 15th October, for which supplementary entries can be received by noon on Monday 10th October for a stake of £37,500 6. Pogo holds an entry in the Queen Elizabeth II Stakes (sponsored by QIPCO) on Saturday 15th October, for which supplementary entries can be received by noon on Monday 10th October for a stake of £70,000

3 59 9 Dr Zempf (GB) (34) 3 9-3 (58.5) (9)

TAKE TO THE SKIES IN 2023 IN AID OF MACMILLAN CANCER SUPPORT The Macmillan Jump of Their Lives - Saturday 29 April 2023 Applications are open for the second staging of a thrilling tandem skydive over the East Yorkshire coast near Bridlington. All to help raise vital funds. See yorkracecourse.co.uk Previous Winners - Last Ten Runnings Trainer Jockey SP Runners Time Going 2021 Space Blues Charlie Appleby William Buick 11/8F 9 ran 1m 22.60s G 2020 Safe Voyage John Quinn Jason Hart 4/1 8 ran 1m 25.47s G/S 2019 Shine So Bright Andrew Balding James Doyle 6/1 9 ran 1m 21.00s G/F 2018 Expert Eye Sir Michael Stoute Frankie Dettori EvsF 9 ran 1m 23.10s G/F 2017 Talaayeb Owen Burrows Chris Hayes 9/1 18 ran 1m 24.08s G 2016 Nemoralia Jeremy Noseda Jamie Spencer 15/8F 10 ran 1m 22.86s G 2015 Fadhayyil Barry Hills Paul Hanagan 5/1J 14 ran 1m 23.12s G/S 2014 Absolutely So Andrew Balding Oisin Murphy 6/1C 13 ran 1m 22.43s G 2013 Sirius Prospect Dean Ivory Robert Winston 5/2 6 ran 1m 26.84s S 2012 Gordon Lord Byron Tom Hogan William Buick 5/1 9 ran 1m 24.25s G/S The Sky Bet City Of York Stakes Space Blues - Winner Of Last Year’s Race 60

yorkracecourse.co.uk See 7 races and come and meet Chase from PAW Patrol on YorkMix Family Day at intervals. Sunday 4 September © 2022 &TM Spin Master Ltd. All rights reserved

3 Max Vega (IRE) Organisation: Active Independence Location: Doncaster A disabled persons led charity Helping with welfare benefits, housing, care packages and equipment .The money would support its ‘Art of Wellbeing’ group, funding it for the next 2 years.

Working with our partners at Sky Bet and others, we invited nominations from Yorkshire based charities and causes. Out of the 150+ entries, 22 were shortlisted and who are joining us today. They have each be assigned a runner in the Sky Bet Ebor and the charity or community group attached to the winning horse will receive a prize of £20,000. The second placed horse will earn £5,000 for its connected cause, and £2,000 to the third, with all the others benefitting from a £1,000 donation.

Providing adults with learning disabilities the opportunity to handcraft wooden products, which they then can sell. If successful, funds would go towards a new boiler and an extension to provide more space and storage

Organisation: Jennyruth Workshops Location: Ripon 5 Ever Present (IRE)

62

6 John Leeper (IRE) Organisation: Ryedale Food Bank Location: Malton Supplying food parcels. If successful, funds would buy food, toiletries and special items for over Christmas.

1 Get Shirty (IRE) Organisation: Independent Domestic Abuse Services (IDAS) Location: York A domestic abuse service, supporting over 20,000 people annually with refuge accommodation, peer mentoring and group work. Winning the sweepstake would enable the charity to support more people

2 Enemy (GB) Organisation: SVH Inc. CIC Location: Huddersfield A wellbeing specialist, helping businesses to support employees. Winnings would fund the necessary training to become a Suicide First Aid Instructor

The Ebor Community sweepstake is an innovative initiative, which seeks to thank, celebrate and reward some of the countless thousands who have helped others in the county.

Helping Yorkshire EBOR COMMUNITY SWEEPSTAKE

4 Fancy Man (IRE) Organisation: St Leonard’s Hospice Location: York Providing care and support for people who are terminally ill, as well as their family Funds would be used to provide awnings, allowing patients to spend more time with their families outside

7 Okita Soushi (IRE) Organisation: Yorkshire and Humberside Asbestos Victim’s Support Group Location: Bridlington Supporting people affected by asbestos related disease Any funding would employ a bereavement support.

11 Raymond Tusk (IRE) Organisation: Proud n Diverse Location: Leeds

13 Licence (GB) Organisation: The Pocklington Canal Amenity Society Location: Pocklington

The kitchen makes food parcels/hot meals, delivered doorstep. If successful, the funds to support even more people

Providing a safe space and support to the LGBTQI+ community’s. Any money won would go towards providing more staff

This charity enables people to keep their pet if they are ill or hospitalised. Any funds would go the running costs.

9 Rodrigo Diaz (GB) Organisation: Yorkshire and Allied Air Forces Memorial Location: Pocklington

10 Shanroe (GB) Organisation: Dementia Dreammakers Sheffield Location: Sheffield

15 Gaassee (IRE) Organisation: Support Dogs Location: Sheffield

Their work improve the lives of people with challenging medical conditions through specialist assistance dogs. Any money won would help more families.

The Society is restoring the Pocklington Canal for the benefit of all. Any funds would buy building mate rials for their project around Sandhill Lock.

12 Candleford (IRE) Organisation: Swinton and District Excelsior Band Location: Malton

14 Earl Of Tyrone (IRE) Organisation: Keep Your Pet Location: York

Providing free music tuition and instrument loaning. Any funds won would go towards instruments, to give more people the chance.

Welcoming more than 50,000 visitors each with world-class displays and heritage aircraft. The Control Tower, is in need of repair

Organisation: MA’KELLY’S KITCHEN Location: Keighley 8 Global Storm (IRE) 63

The team facilitate life enhancing experiences for people living with dementia. The money would be used to make some of those dreams, become a reality

17 Euchen Glen Organisation: Antibiotic Research UK Location: York

21 Alfred Boucher (GB) Organisation: Leeds Society for Deaf & Blind People Location: Leeds This charity supports deaf, hard of hearing, blind, deaf blind and partially sighted people, promoting independence. A sensory garden would be created if successful.

Organisation: Norton Hive Community Library and Hub Location: Rotherham 16 Calling The Wind (IRE) 64

This charity tackles the threat of antibiotic resistant infections. The funding would be used to support its Patient Support Service, research activities, public engagement and organisational development activities.

19 Trawlerman (IRE) Organisation: The Sporting Memories Foundation Location: Bradford Delivering social and inclusive physical activities that improve the mental and physical wellbeing of older people If successful, the money would enhance the digital archive of images, memorabilia to trigger fond memories.

20 Quenelle d’Or (GB) Organisation: Ella Dawson Foundation Location: Huddersfield Established in memory of Ella, providing psychological, physical, nutritional support to young adults living with cancer If successful, the donation, would employ a fulltime Cancer and Exercise Rehabilitation Specialist.

22 Valley Forge (GB) Organisation: Joseph Rowntree Theatre Location: York A volunteer run theatre, providing affordable entertainment. Funds would contribute to the ‘Raise the Roof’ appeal and install LED lighting and solar panels.

THE SKY BET EBOR See all the details, information, runners and riders for the big race on pages 71-75.

The hub and library provides access to computers to support people applying for blue badges and grants etc, as well as a library service for those in need. Funds would restore the car park.

18 Benaud (IRE) Organisation: The Friends of Nunroyd Park Location: York Committed to maintaining the park through litter picking and planting, including a orchard. Funds would enable more benches.

• Nine racecourses • Over 120 training yards, training over 2,000 horses • The Northern Racing College • Goffs Bloodstock Sales • Making for an industry worth over £230 million* to the County alone. (according to independent survey by Sheffield Hallam University) Racecourses: Beverley, Catterick, Doncaster, Pontefract, Redcar, Ripon, Thirsk, Wetherby & York Northern Racing School Major Training Centres: Middleham, Malton & Hambleton Goffs UK 81

66

VALLEY FORGE

FIGHT VALLEY FORGE

To complement this initiative York Racecourse invested in Britain’s largest set of starting stalls, able to accommodate 22 runners, an increase of two participants on the 2018 configuration and used for the very first time in 2019 as Mustajeer scooped the pot in the Sky Bet Ebor. With three from four taking up their berth, we will see if the winner of the big race, hails from one of the trials today.

Wednesday 11

Already a memorable week for the William Haggas team that clearly target these contests and for the second successive year the yellow and black silks of Sheikh Ahmed Al Maktoum qualified through the Sky Bet Jorvik, courtesy of Gaassee this season, he also takes up his spot. At the start of June, Earl of Tyrone entered the mix for County Tipperary based Paddy Twomey, he starts today as likely market leader. The Crisford family trained, Without A Fight, took the Sky Bet Grand Cup and so the 4th slot, but we already know that Flemington in November is his target, so he has swerved this opportunity.

EARL OF TYRONE Sky Bet Grand Cup (Listed, 4YO+) York 1m 6f Saturday 11 June 2022 A

This season sees the latest staging of the famous race as part of a an extensive partnership with Leeds-based Sky Bet.

Sky Bet Ebor (Handicap 4YO+) 1m 6f Today

York

Sky Bet Melrose Handicap (3YO only) 1m 6f August 2021

By virtue of winning last season’s Sky Bet Melrose, the Andrew Balding-trained Valley Forge held the first ‘golden ticket’ and takes his place.

York

Saturday 21

York

The winners of the four races above were guaranteed a start position in the Sky Bet Ebor this afternoon provided they are entered and confirmed in the normal way. In a further boost to connections, if these horses are running today and fail to finish in the top eight places, they will have their entry fee to the race (worth £5,000) refunded, the top eight receive £5,000 or more in prize money.

2022 GAASSEE

WITHOUT

Sky Bet Jorvik Handicap (4YO+) 1m 4f May Sky Bet Stakes (Handicap, 4YO+) Curragh 1m 6f Wednesday 1 June 2022

Today sees the fruition of a series entitled the “Race To The Ebor” which includes four high-class staying contests.

In the event that any of the “Race To The Ebor” winners were set to carry the lowest weight in the Sky Bet Ebor, that horse’s weight would be raised to the equivalent of the lowest-weighted horse that was set to run through the established entry process, which explains the weight allocated to Valley Forge..

The

Once a horse has raced three times they are given an official rating (often referred to as a handicap mark) by the British Horseracing Authority. This provides a numerical guide to each horse’s level of ability. Ratings usually start at around 40 for a modest performer with the mighty Frankel finishing his career in the 140s. The ranking operates the opposite way around from a golf handicap, so each time a horse runs this rating is adjusted either upwards for a good performance or down for a weaker effort, so that it reflects the horses most recent form.

HOW MIGHT YOU SOLVE

BIG HANDICAP?

Each of these rating points are meant to reflect 1lb in weight, so looking at today’s race, Global Storm is rated 106 is considered 1lb “better” than Shanroe who is rated 105. If these horses were to race carrying the same weight theoretically Spirit Catcher should win every time as he is the better horse. Races which were too predictable wouldn’t make good viewing and therefore the handicap is designed to set a level playing field. So in this example Global Storm carries 1lb more than Shanroe, which should in theory see them cross the line together and that rule applies to all of the twenty-two runners but, despite dead heats being a possibility, you won’t ever see all seventeen runners cross the line together so how to separate them in advance? Horses which won or ran well last time will attract the interest of the handicapper and a rise of 6 or 7lb can often follow. Sometimes this can prove a step too far as horses then struggle to concede weight to lower rated rivals. Eventually as the horse continues to run without winning their rating will come back down to a winnable mark and the whole cycle begins again. The art is working out which category your horse falls into.

67

A SKY BET EBOR

4) GROUND If you thought the debates over draw were intense then try talking about the impact of ground to a racing anorak. In simple terms, different horses run better on different types of surface, just like some human athletes might prefer cross country to the track. Trawlerman is one who will enjoy a quicker surfaces. However Benaud wins have come on a surface that is a little softer. So make sure to check the weather and the ground description.

Whilst all of these strategies may throw up the odd winner, a safer and more prudent approach would be to apply some straightforward methodology.

2) THE DRAW Where a horse is drawn in the stalls can be an important factor, particularly in a sprint and is perhaps one of the most debated topics in racing. Some punters swear that being drawn close to a rail is an advantage as it keeps a horse focused on running around a bend like for this one, they would lobby for the horse drawn with the shortest way home. However here at York, in recent seasons those drawn down the centre of the track have often held the upper hand, the counter logic being that their jockey can keep an eye on the competition on both flanks. Most times, over the longer distance the pace of the race sorts out any benefit accrued from the bend. Perhaps Earl Of Tyrone can use this to his advantage.

Narrowing down the field of twenty-two declared runners is easier than you think if you follow a few simple guidelines, to hopefully identify the winner of this and the other handicaps. Before we start, it is important to understand what a handicap is.

Don’t forget to ensure you keep an eye and an ear out for non-runners, there will be announcements over the PA system and the screens around the course will be updated with non-runner information, as they have to be in it to win it!

3) DISTANCE Having a runner who has already shown their liking for a particular trip can be invaluable. Calling The Wind, Shanroe and Rodrigo Diaz have all won over today’s disrance

5) YORK RECORD “Horses for courses” is not a popular phrase by accident, just like football teams have a lucky ground. This year we have plenty of horses that have won at the course and distance, Valley Forge is the only horse to have completed the double.

6) CONCLUSION Following these simple rules has helped to narrow down the shortlist. Going on a hunch that ‘good’ will be the description, the Ger Lyons-trained Licence might well continue his consistent form to claim first place. He’s got a good draw in 19 and good ground should be right up his street. The Irish have a good record in recent years and his improver could take some beating.

1) FORM Here at York it often pays to side with horses in form but it is also important that they look like they still have a bit of improvement left. There are a few who come here without having the best of recent records and so might be best ignored today; Raymond Tusk, Quenelle D’Or & John Leeper.

This afternoon’s Sky Bet Ebor looks a tricky betting proposition for novice racegoers with twenty-two closely matched runners set to go to post. Is it best to plump for a lucky number, an interesting name or a set of jockey silks you like the look of?

Simply it is York’s most famous race, and shares its name with the Roman city, EBORACUM that is now known as York. It is the biggest gambling heat of the week here on the Knavesmire and the oldest race of the Festival, first run 1843. Sea Pigeon

FACT FILE: Where have four decades gone, Sea Pigeon was a most popular winner in 1979 The nine-year-old gelding, once ante-post favourite for the Derby and a future dual Champion Hurdle winner, represented Yorkshire trainer Peter Easterby and humped 10 stone to victory He was ridden to victory by jump jockey Jonjo O’Neill now a highly successful trainer

When Sergeant Cecil won another great race on Knavesmire? He won the 2005 Sky Bet Ebor on his first visit to York and added the Stobart Rail Northumberland Plate and the Cesarewitch in the same year to make history by becoming the first horse to land the three premier staying handicaps.

Pagan was the first winner of the race, ridden by Slim Templeman and trained by John Scott. The 6-1 shot carried 7st 13lbs and was a popular winner. Soon the betting public was hooked and York’s fortunes blossomed.

The gelding always raised his game on the Knavesmire and later added the Yorkshire Cup, the Weatherbys Hamilton Lonsdale Cup and the rearranged 2006 Doncaster Cup to his triumphs here.

68

They were in 2009 and 2010 when Sesenta and Dirar won for Willie Mullins and Gordon Elliott respectively and again in 2014 when Mutual Regard won for Johnny Murtagh. But overall, runners from over the water don’t have the greatest of records, after a lean spell in the later years of last century and first decade of this, illuminated only by the Aidan O’Brien-trained Mediterranean in 2001, fortunes have been better of late With the ill-fated Heartbreak City’s impressive triumph in 2016 and Mustajeer winning 2019’s race, this new era was confirmed as Sonnyboyliston took the prize back to Ireland for Johnny Murtagh. Today the Emerald Isle is represented by five yards and six horses: Earl Of Tyrone, Licence, Benaud, Ever Present, Okita Soushi and Shanroe Mutual Regard

FIRST WINNER?

Distance One mile & six furlongs (2,800m) Prize money £500,000 The Sky Bet Ebor

WERE YOU HERE THE DAY WHEN… OR FOR THE POST MILLENNIUM GENERATION…

WILL IRISH EYES BE SMILING?

WHY IS IT SPECIAL?

Saeed bin Suroor

The recently-retired Luca Cumani was the trainer to follow, having won it three times Vicious Circle (1999), Mephisto (2004) & Purple Moon (2007). Johnny Murtagh has won two of the last ten renewals, including the 2014 renewal, and with Sonnyboyliston last year, but isn’t represented today. Three other trainers with runners today have tasted past success John & Thady Gosden (Trawlerman) and Ger Lyons (Licence).

HOW DO YORKSHIRE STABLES FIGURE?

David O’Meara 69

Yorkshire-trained horses have a good overall record, although Moyenne Corniche became only the fourth winner in the past 26 renewals when triumphing six years ago for Brian Ellison. The late Jimmy Fitzgerald saddled Sapience to score in 1989, the now record-breaking Mark Johnston’s Quick Ransom was the hero in 1992 and Les Eyre won with Far Ahead in 1997. But with none of the above represented in this year’s Sky Bet Ebor, only David O’Meara (a yard that had the winner and two further places in Thursday’s big handicap), can join that list today with top weight Get Shirty WHO ARE THE SPONSORS?

LEADING TRAINER?

Sky Bet is the UK’s most popular online bookmaker We’ve been making betting better for years and we’re home of First Race Specials and the Soccer Saturday Price Boost. We’re hugely passionate about sport which is why we sponsor the English Football League and recently extended our partnership with York Racecourse which includes the sponsorship of a lucky 13 races this week. The much missed Lester Piggott, whose statue is now on the Edwardian Weighing Room Lawn, leads the way with five victories. When it comes to the current crop, there are three to have won the race before, Jim Crowley (Benaud), Frankie Dettori (Trawlerman) and Jamie Spencer (Rodrigo Diaz), all three will be looking to make it two wins.

THE 3-YEAR-OLD QUESTION?

Lester Piggott

LEADING RIDER?

With the Sky Bet Ebor becoming one of Europe’s richest and best handicaps, it was the right time to consider how the race best fits in to the overall racing programme. For the three-year-olds, the established Pattern programme has a proven rhythm and it is not the intention to alter running plans for the best of the Classic crop The investment in the Sky Bet Great Voltigeur keeps the pathway to a record level of £200,000 for the Cazoo St Leger The Ebor will now focus on stayers aged four and upwards. The Race to The Ebor also links the more valuable Sky Bet Melrose with next season, so retaining a 3-y-o connection. In practical terms, the stats show that as the quality of the Ebor has increased, only two horses aged three actually made the stalls in the last decade (prior to the switch), with the last classic generation winner back in 2001, when Mediterranean took the spoils.

S 2012

G 2016

The seven-year-old Litigant became the oldest winner since Sea Pigeon back in 1979 when landing the spoils four years ago but the group to focus on is the five and six-year-olds, who between them have landed seven of the last ten renewals. They represent over half of the twenty-two runner field this time around.

Horses rated between 99 and 108 may have won the race nine times in the last ten renewals but as the weights continue to compress, you need to be rated that high to even get in nowadays. The highest rated winner in recent years was Muntahaa, who won off a mark of 109 in 2018, with the three two winners, Mustajeer, Fujaira Prince and Sonnyboyliston, rated 108.

CONCLUSION

G 2020

KEY TRENDS Drawn stall 10 or higher Five or Six-year-old Top five finish last time Rated 105+

Joseph Tuite Oisin Murphy 33/1 19 ran 3m 0.16s Regard Johnny Murtagh Louis Steward 20/1 19 ran 2m 56.48s Tiger Cliff Lady Cecil Tom Queally 5/1 14 ran 3m 3.36s Willing Foe Saeed bin Suroor Frankie Dettori 12/1 19 ran 3m 0.75s G/S EBOR by independent analyst. All trends ten year based Muntahaa

PREVIOUS WINNERS

BIG RACE TRENDS THE SKY BET

G 2015

2018

Statistics supplied

an

BETTING Whichever way you look at it, this is not a race in which following the favourite has proved a fruitful strategy there have only been three winning favourites since 1998. In the last ten years, we have had winners at 20/1, 25/1 and 33/1 so the best advice is to back your selection regardless of the starting price.

G 2013

are

OFFICIAL RATINGS

unless stated.

2021

G 2014 Mutual

S 2019

DRAW Usually in races such as this, being drawn on the rail is an advantage but that hasn’t proved the case in the Sky Bet Ebor. The fact that eight of the last ten winners have been drawn in stall 10 or higher suggests that is in fact the higher drawn horses which seem to be favoured. With victory in the Ebor being held in such high esteem, those jockeys drawn low have shown a tendency to break far too quickly from the stalls in order to take advantage of their draw but only end up setting a furious early pace which can often set the race up for more patiently ridden rivals.

AGE

RECENT FORM Unexposed, dark horses do not win the Ebor. Nine of the last ten winners had achieved a top five finish on their most recent start. We can take this trend one step further when you consider that seven of the last ten winners had achieved a top two finish on either or both of their two latest starts.

Year

A genuniely top-class renewal of this famous Heritage Handicap and with A genuinely top-class renewal of this famous Heritage Handicap and with 9 of the 22 runners rated at least 105, it's a sensational race in prospect. The trends point to a highly-rated five or six-year-old who's been in good form and the David Simcocktrained RODRIGO DIAZ certainly ticks all those boxes. A real consistent performer this season, he's never run over course and distance but is rated 105 and has finished in the first two on his last two starts. Direct dangers look to come from across the pond with a whole host of Irish challengers. Joseph O'Brien sends over two, including the JP McManus owned Benaud, who finished behind Earl Of Tyrone, in one of the four Ebor trials. Ger Lyons saddles the Juddmonte owned Licence, who looks very unexposed but does have a few lb to find on some of his rivals. - LAST TEN RUNNINGS Winner Trainer Jockey SP Runners Time Going Sonnyboyliston Johnny Murtagh Ben Coen 10/1 20 ran 2m 56.10s Fujaira Prince Roger Varian Andrea Atzeni 11/2F 21 ran 3m 4.22s Mustajeer Ger Lyons Colin Keane 16/1 22 ran 2m 52.97s G/F Muntahaa John Gosden Jim Crowley 11/1 20 ran 2m 53.48s G/F Nakeeta Iain Jardine Callum Rodriguez 12/1 19 ran 2m 56.54s Heartbreak City A J Martin Adam McNamara 15/2 20 ran 2m 56.13s Litigant

2017

70

RACE DESCRIPTION Probably our most famous race, the Sky Bet Ebor, is open to 4yo+ horses and over a trip of a mile and three quarters. This race is theoretically open to any horse regardless of its official mark. The highest rated, still set to carry the most weight in this race today, are Get Shirty and Enemy. The runners are undoubtedly amongst the best in their class in Britain so remember to follow their progress in future contests, they could star in the Lexus Melbourne Cup Perhaps take a close up look in the Parade Ring before they go to post to make your final selection.

LAST YEAR’S RACE

71

The Sky Bet Ebor One Mile About Six Furlongs (2,700 metres) See page 93 for conditions of this race.

THE TALE OF THE CLOCK Race Average Time: 2m 58.28s Racing Post Standard Time: 2m 57s Course record: 2m 51.89s by Tuning (19-Aug-98) All times are based where possible on the corresponding race over the last ten years

FACTS & STATISTICS Leading course trainer (17-22): J & T Gosden (31 wins from 112 runners, 28%) runs TRAWLERMAN Trainer-in-form (last 14 days): W Haggas (14 wins from 42 runners, 33%) runs CANDLEFORD and GAASSEE Longest Travellers: EVER PRESENT trained by Mrs J Harrington; SHANROE trained by K Thornton; LICENCE trained by G M Lyons; OKITA SOUSHI & BENAUD trained by J P O’Brien; EARL OF TYRONE trained by Paddy Twome; all Ireland. NOTE: All statistics are up to and including 18th August Last Winning Winning Runs Racecard 6 Career Total Career Distance Going Since No. Runs Horse Wins Places Runs Winnings Range Range Wins 1 6-12111 GET SHIRTY 7 6 22 199283 10-15F G-S 0 2 941358 ENEMY 3 6 18 69926 7-14F GS-ST 3 3 532-156 MAX VEGA 3 4 15 78251 8-12F G-S 2 4 1 13553 FANCY MAN 4 3 14 48795 7-12F S-ST 4 5 1121-4 EVER PRESENT 3 1 5 80625 13-15F G-GF 1 6 8-47225 JOHN LEEPER 2 1 13 24107 10F G-ST 10 7 13-232 OKITA SOUSHI 1 3 5 6429 12F GF 4 8 0-13434 GLOBAL STORM 4 8 20 67797 9-14F F-S 4 9 24-6932 RODRIGO DIAZ 4 6 16 16111 11-14F GF-ST 8 10 14/140-1 SHANROE 4 3 8 44749 13-14F G-S 0 11 8-12570 RAYMOND TUSK 5 7 30 199928 8-16F G-ST 4 12 D331-18 CANDLEFORD 3 1 9 68097 10-12F GF-ST 1 13 1-274 LICENCE 1 1 4 6429 9F G 3 14 23-3111 EARL OF TYRONE 3 3 12 49916 12-14F G 0 15 3111-13 GAASSEE 4 2 6 45708 10-12F G-ST 1 16 32-3433 CALLING THE WIND 5 11 29 47479 10-21F G-ST 7 17 663403 EUCHEN GLEN 12 9 50 370964 10-16F G-S 11 18 427-791 BENAUD 3 1 13 21712 8-12F 0 19 16-1001 TRAWLERMAN 3 2 8 72132 10-14F GF-ST 0 20 3215-50 QUENELLE D’OR 3 4 14 37152 11-12F GS-ST 3 21 93-8221 ALFRED BOUCHER 5 10 28 77913 7-16F G-S 0 22 36-5177 VALLEY FORGE 3 2 11 86997 12-16F G-GF 2 23 14/72-95 NOT SO SLEEPY 4 11 44 90588 8-12F G-S 4 24 609172 DARK JEDI 5 10 36 48501 7-13F G-S 2 KNAVESMIRE TIP With only one winning favourite in the last 10 years, it is easy to look for value and EVER PRESENT ticks a lot of boxes. Not a lot went right for Jessica Harrington’s raider in Listed company at Down Royal last month, but that first run since a big handicap win at Leopardstown last autumn will have blown away any cobwebs. Gaassee remains full of potential and got going too late when third behind Get Shirty in the Old Newton Cup Licence and Okita Soushi are also unexposed four-year-olds, while Candleford is respected on his Royal Ascot demolition job EVER PRESENT GAASSEE 4th Race 3.35 Distance: 1m 6f Race Type: Heritage Handicap Prize Money: £500,000 Age: 4+ Stalls: Inside Rail Trifecta Rollover Race.

RACE

Winner: SONNYBOYLISTON Trainer: J P Murtagh Jockey: Ben Coen Age/Weight: 4-9-8 Runners: 20 SP: 10/1 An absolutely thrilling renewal of the Sky Bet Ebor Handicap last year saw Sonnyboyliston just get the better of Quickthorn as he battled on gamely all the way to the line to take the prize back to Ireland for Johnny Murtagh and his team.

He has won three times from 1m to 1m 4f on ground varying from good to soft Finished 5l behind Rebel’s Romance when sixth of 8 at 20-1 in the Group 3 L’Ormarins Queen’s Plate Glorious Stakes at Goodwood over 1m 4f (good to firm) last month. Looks up against it. Official BHA Rating 109 (-1) SP: 28-1 Rob Hornby India Burney 4 Fancy Man (IRE) (22) 4 9-11 (62.1) (14) B c Pride of Dubai (AUS) Fancy (IRE)

He has won three times from 1m 5f to 1m 7f on good to firm and good ground; has also won a NH flat race. Finished 4l behind Perotan when fourth of 6 at 4-1 on his latest outing at Down Royal over 1m 6f (good) last month. May be thereabouts if putting his best foot forward. Official BHA Rating 107 SP: 20-1 Shane Foley 6 John Leeper (IRE) (22) 4 9-9 (61.2) (13) B c Frankel Snow Fairy (IRE)

Owner: Tracey Bell & Caroline Lyons Trainer: Ian Williams, Alvechurch Form: 041350 D Breeder: Ecurie Des Monceaux & Skymarc Farm Inc

4 72 1 Get Shirty (IRE) (49) 6 9-12 (62.6) (24)

B or Br g Elusive Pimpernel (USA) Persian Memories (IRE) Owner: Anamoine Ltd Trainer: Mrs J. Harrington, Ireland Form: 1121-4 Breeder: Windflower Overseas Holdings Inc

He has won three times from 7f to 1m 6f on good to firm and good to soft ground and on the all-weather Beaten 14l behind Kyprios at 66-1 when eighth of 9 on his latest outing in the Group 1 Al Shaqab Goodwood Cup Stakes at Goodwood over 2m (good) last month. Opposable Official BHA Rating 110 (-1) SP: 40-1 David Egan 3 Max Vega (IRE) (22) 5 9-11 (62.1) (1) Ch g Lope de Vega (IRE) Paraphernalia (IRE)

He has won four times from 7f to 1m 4f on soft ground and on the all-weather Third of 8 behind Rebel’s Romance beaten 2 3/4l at 17-2 in the Group 3 L’Ormarins Queen’s Plate Glorious Stakes at Goodwood over 1m 4f (good to firm) last month. May be too high in the handicap Official BHA Rating 109 SP: 40-1 Sean Levey 5 Ever Present (IRE) (29) 6 9-9 (61.2) (6)

Owner: The Pickford Hill Partnership Trainer: Ralph Beckett, Kimpton Down Form: 532-156 Breeder: Tullpark Ltd

B g Muhaarar Prudenzia (IRE)

B g Teofilo (IRE) Soccer Mom (GER) Owner: Akela Thoroughbreds Limited Trainer: David O’Meara, Upper Helmsley Form: 6-12111 D Breeder: Haras du Mont Dit Mont

Race 3.35 The

Owner: Godolphin Trainer: Charlie Appleby, Newmarket Form: 0-13434 D Breeder: Grenane House Stud He has won four times from 1m 1f to 1m 6f on ground varying from good to heavy Finished 4l behind Rebel’s Romance when fourth of 8 at 8-1 in the Group 3 L’Ormarins Queen’s Plate Glorious Stakes at Goodwood over 1m 4f (good to firm) last month. Unlikely to threaten. Official BHA Rating 106 SP: 33-1 William Buick Malik Kashif No Horse Age st-lb (kgs) Draw 4th Sky Bet Ebor Distance: 1m 6f Race Type: Heritage Handicap Prize Money: £500,000 Age: 4+ Stalls: Inside Rail

Owner: Mr Michael Pescod Trainer: Richard Hannon, Marlborough Form: 1-13553 Breeder: Longfield Stud

Won seven races from 1m 2f to 1m 7f on ground varying from good to firm to soft. Successful at 10-1 at Haydock over 1m 4f (soft) on his latest outing last month, beating Enfranchise by 1 1/2l. Won over this trip at Royal Ascot but a further 5lb rise could see him struggle Official BHA Rating 110 SP: 18-1 Daniel Tudhope Stablehand 2 Enemy (GB) (25) 5 9-12 (62.6) (16)

Owner: Anamoine Ltd Trainer: Ed Dunlop, Newmarket Form: 0-40225 Breeder: Anamoine Ltd Successful twice at 1m 2f on good ground and on the all-weather Finished 5l behind Rebel’s Romance when fifth of 8 at 18-1 on his latest outing in the Group 3 L’Ormarins Queen’s Plate Glorious Stakes at Goodwood over 1m 4f (good to firm) last month. One to watch. Official BHA Rating 107 SP: 25-1 Adam Kirby Fletcher Yarham 7 Okita Soushi (IRE) (44) 4 9-8 (60.8) (22) B c Galileo (IRE) Amicus (AUS) Owner: Mr Toshihiro Matsumoto Trainer: Joseph Patrick O’Brien, Ireland Form: 13-232 Breeder: Coolmore A winner at 1m 4f on good to firm ground. Beaten 10l by Shoshone Warrior when second of 7 at 4-5fav on his latest outing at Leopardstown over 1m 7f (good) last month. Interesting on his return to handicap company and should not be dismissed. Official BHA Rating 106 SP: 14-1 M. P. Sheehy (3) Tommy Beaton 8 Global Storm (IRE) (22) 5 9-8 (60.8) (10) Ch g Night of Thunder (IRE) Travel (USA)

He has won three times from 1m 4f to 1m 6f on good ground. A winner at 9-4 at Limerick over 1m 4f (good) on his latest outing in June, beating Raise You by 1 1/4l. Four-timer not out of the question now back up in trip and he merits a lot of respect. Official BHA Rating 103 SP: 7-1 W. J. Lee Anna Barlow 15 Gaassee (IRE) (49) 4 9-5 (59.4) (15)

He has won four times from 1m 3f to 1m 6f on good to firm ground and on the all-weather Beaten 10l by Coltrane when second of 7 at 11-2 on his latest outing at Sandown over 2m (good) last month. Will need to find more in this company and it’s easy to look elsewhere. Official BHA Rating 105 SP: 50-1 Jamie Spencer 10 Shanroe (GB) (22) 8 9-7 (60.3) (3)

4 73 9 Rodrigo Diaz (GB) (50) 5 9-7 (60.3) (21)

B g Kingman Dorcas Lane Owner: Barnane Stud Trainer: William Haggas, Newmarket Form: D331-10 BF Breeder: Barnane Stud Ltd He has won three times from 1m 2f to 1m 4f on good to firm ground and on the all-weather. Beaten 4l behind Soapy Stevens at 3-1fav when eighth of 16 on his latest outing at Newmarket over 1m 6f (good to firm) last month. He should not be taken lightly Official BHA Rating 104 SP: 11-1 Tom Marquand Riyaz Shaikh 13 Licence (GB) (16) 4 9-5 (59.4) (19)

Owner: Sheikh Ahmed Al Maktoum Trainer: William Haggas, Newmarket Form: 3111-13 C BF Breeder: Godolphin

He has won four times from 1m 2f to 1m 4f on good and soft ground and on the all-weather Third of 17 behind Get Shirty beaten 1 3/4l at 11-8fav on his latest outing at Haydock over 1m 4f (soft) last month. This trip is an unknown but his pedigree suggests it could suit. Official BHA Rating 103 SP: 9-2 Kieran Shoemark Safid Alam 16 Calling The Wind (IRE) (50) 6 9-5 (59.4) (11)

B g Multiplex Pugnacious Lady (in 4lb ex)

B h High Chaparral (IRE) Dancing Shoes (IRE)

B g Authorized (IRE) Al Jasrah (IRE)

Owner: Mrs J. A. Wakefield Trainer: Richard Hughes, Upper Lambourn Form: 32-3433 D Breeder: Mount Brilliat Broodmares 11 Llc

Owner: Quantum Leap & Australian Bloodstock Trainer: David Simcock, Newmarket Form: 24-6032 D Breeder: Raffles Dancers (NZ) Pty Ltd

Winner of five races from 1m to 2m on ground varying from good to firm to good to soft and on the all-weather Beaten 7l behind Get Shirty at 40-1 when 13th of 17 on his latest outing at Haydock over 1m 4f (soft) last month. Could find a few too good. Official BHA Rating 104 SP: 100-1 Martin Harley Abigail Ward 12 Candleford (IRE) (43) 4 9-6 (59.9) (17)

He has won four times from 1m 4f to 1m 6f on ground varying from good to soft; has also won two hurdles and three NH flat races. A winner at 2-1 at Galway over 1m 6f (soft) last month, beating Sandhurst by 1/2l. Carries a 4lb penalty for that success, so more is needed. Official BHA Rating 101 SP: 40-1 Robert Colgan Adam Clinton 11 Raymond Tusk (IRE) (49) 7 9-6 (59.9) (12)

B g Golden Horn Kitty Wells

Owner: Mr Brian Smyth Trainer: Karl Thornton, Ireland Form: 14/140-1 D Breeder: Mickley Stud

B g Frankel Emollient (USA)

B c Sea The Stars (IRE) Oojooba

Winner of five races from 1m 2f to 2m 5f on good ground and on the all-weather Third of 7 behind Coltrane beaten 11l at 5-1 on his latest outing at Sandown over 2m (good) last month. One to look out for now dropping in trip, but he faces stiff competition. Official BHA Rating 103 SP: 28-1 Pat Cosgrave James Meunier No Horse Age st-lb (kgs) Draw

Owner: Juddmonte Trainer: G. M. Lyons, Ireland Form: 1-204 Breeder: Juddmonte Farms Inc A winner at 1m 1f on good ground. Finished 6l behind Gear Up when fourth of 8 at 8-1 on his latest outing in the Group 3 Grant Thornton Ballyroan Stakes at Leopardstown over 1m 4f (good) earlier this month. A very unexposed type who is capable of making his presence felt. Official BHA Rating 103 SP: 20-1 G. F. Carroll Archie McCabe 14 Earl of Tyrone (IRE) (64) 4 9-5 (59.4) (8) Ch g Australia Affirmative Owner: Robert J. W. Moran Trainer: P. Twomey, Ireland Form: 23-3111 D Breeder: Moran Stables

Owner: The Unlikely Lads Trainer: Alan King, Barbury Castle Form: 0-12500 Breeder: Lynch-Bages & Rhinestone Bloodstock

VALLEY FORGE: Following its run on 30/7/2022 it was reported that the horse suffered interference in running.

He has won three times from 1m to 1m 4f on yielding and yielding soft ground. Won on his latest outing when 4-7fav at Bellewstown over 1m 4f (yielding) in June, beating Taipan by 6l. This is a tougher ask but he could be involved in the finish. Official BHA Rating 102 SP: 25-1 Jim Crowley Najib Ishrat 19 Trawlerman (IRE) (21) 4 9-3 (58.5) (20) B g Golden Horn Tidespring (IRE) (in 4lb ex)

4 74

Has won 12 races from 1m 2f to 2m on ground varying from good to firm to heavy Third of 13 behind Trawlerman beaten 1 1/4l at 20-1 at Goodwood over 1m 6f (good to firm) last month. He was denied a clear run on that occasion and improvement seems likely Official BHA Rating 102 (+3) SP: 16-1 Paul Mulrennan Jennifer Burns 18 Benaud (IRE) (51) 4 9-4 (59.0) (18)

PROBABLE S.P.’S 9-2 Gaassee (IRE),

Owner: Robert Allcock Trainer: Ian Williams, Alvechurch Form: 03 0221 C Breeder: Robert Allcock Winner of five races from 7f to 2m on ground varying from good to firm to soft A winner at 5-1 here over 2m (good) on his latest outing earlier this month, beating Frankenstella by 3l. Carries a 4lb penalty today for that success, but remains of interest Official BHA Rating 96 SP: 25-1 P. J. McDonald 22 Valley Forge (GB) (21) 4 9-2 (58.1) (7) B g Dansili Lixirova (FR)

Owner: Mr John P. McManus Trainer: Joseph Patrick O’Brien, Ireland Form: 420-001 Breeder: Thomas Downey

Owner: Mr George Strawbridge Trainer: Andrew Balding, Kingsclere Form: 36-5100 CD Breeder: George Strawbridge He has won three times from 1m 4f to 2m on good to firm and good ground. Beaten 3 1/2l behind Trawlerman at 6-1 when seventh of 13 on his latest outing at Goodwood over 1m 6f (good to firm) last month. Not favoured by today’s weights and others are preferred. Official BHA Rating 93 (-1) SP: 33-1 David Probert Ellie Morrison

Br g Australia Kawaha (IRE)

17 Euchen Glen (GB) (21) 9 9-4 (59.0) (2)

NUMBER OF DECLARED RUNNERS 24..........................................................................................(EXACTA) Hood worn by No 19 Tongue Strap worn by No 2, 7, 9, 10, 14, 15, 18. Sheepskin Cheek Pieces worn by No 8, 16. STEWARDS NOTE EUCHEN GLEN: Following its run on 30/7/2022 it was reported that the horse was denied a clear run.

Owner: Godolphin Trainer: John & Thady Gosden, Newmarket Form: 16-1001 D Breeder: Godolphin

Owner: Mr W. M. Johnstone Trainer: Jim Goldie, Glasgow Form: 663403 C D Breeder: W. M. Johnstone

He has won three times from 1m 2f to 1m 6f on good to firm ground and on the all-weather A winner at 6-1 at Goodwood over 1m 6f (good to firm) on his latest outing last month, beating Bague D’or by 1l. One to look out for under a 4lb penalty. Official BHA Rating 97 (+4) SP: 16-1 Frankie Dettori Benario De Paiva 20 Quenelle d’Or (GB) (44) 4 9-2 (58.1) (4) B f Golden Horn Quenelle

Owner: Lady Derby & Lady Ritblat Trainer: Hugo Palmer, Malpas Form: 3215-50 Breeder: Stanley House Stud Has won three times from 1m 3f to 1m 4f on good to firm and good to soft ground and on the all-weather. Well beaten at 9-1 behind Rosscarbery when last of 12 in the Group 3 Irish Stallion Farms EBF Stanerra Stakes at Leopardstown over 1m 6f (good) last month. Opposable Official BHA Rating 100 SP: 80-1 Neil Callan 21 Alfred Boucher (GB) (3) 6 9-2 (58.1) (9) Gr g Aussie Rules (USA) Policy Term (IRE) (in 4lb ex)

B g Authorized (IRE) Jabbara (IRE)

7-1 Earl of Tyrone (IRE), 11-1 Candleford (IRE), 14-1 Okita Soushi (IRE), 16-1 Euchen Glen (GB), Trawlerman (IRE), 18-1GetShirty(IRE),20-1EverPresent(IRE),Licence(GB),25-1JohnLeeper(IRE),Benaud(IRE),AlfredBoucher(GB),28-1MaxVega(IRE), CallingTheWind(IRE),33-1GlobalStorm(IRE),ValleyForge(GB),40-1Enemy(GB),FancyMan(IRE),Shanroe(GB),50-1RodrigoDiaz(GB), 80-1 Quenelle d’Or (GB), 100-1 Raymond Tusk (IRE), 500-1 Not So Sleepy (GB), Dark Jedi (IRE) RESULT & PRIZE MONEY INFORMATION 1st £300000................................................................ 2nd £89950 ................................................................................ 3rd £47500 4th £25000 TIME DISTANCES No Horse Age st-lb (kgs) Draw

FOURTH RACE PRESENTATION & BEST TURNED OUT

THE RAY GILPIN AWARD FOR THE TOP JOCKEY OF THE WELCOME TO YORKSHIRE EBOR FESTIVAL

The trophy for this race will be presented to the winning owner after the race by Conor Grant Chief Executive Officer Flutter UK & Ireland. Sky Bet have generously given £500 to the racing groom responsible for the best turned out horse in this race and £500 to the groom responsible for the winning horse 1. Get Shirty, 7. Okita Soush, 14. Earl Of Tyrone and 19. Trawlerman all hold an entry in the British Champion Series Long Distance Cup (sponsored by QIPCO) on Saturday 15th October, for which supplementary entries can be received by noon on Monday 10th October for a stake of £37,500

This award remembers Ray Gilpin, a popular figure in both the Weighing Room & Press Room who sadly passed away in 2015 A proud welshman, you’ll notice the armband worn by the rider in front, is in scarlet. The colour of the scarf that Ray always wore to the races. William Buick will wear the armband today after win number three yesterday, with Ryan Moore and Tom Marquand both on two wins. Ray Gilpin (1942-2015)

4 75

77 The Sky Bet Constantine Stakes Six Furlongs (1,200 metres) See page 93 for conditions of this race. RACE DESCRIPTION Getting the hang of handicaps? Well this is a brand new one, your vital statistics are; 3yo+ rated 0-105, going six furlongs. The £100,000 prize money as well as handicap rating band means that it will attract some pretty smart types (like for the cricketers at Lords a score of over 100 denotes a top performer). The best will be the highest rated Commanche Falls and so will carry most weight. If you are looking for a tip then perhaps follow the racecourse tipster, Baron Ferdinand, who has marked his selections with a red bi plane THE TALE OF THE CLOCK No corresponding race last year Racing Post Standard Time: 1m 10.20s Course record: 1m 8.23s by Mince (09-Sep-12) All times are based where possible on the corresponding race over the last ten years RACE FACTS & STATISTICS Leading course trainer (17-22): T Easterby (33 wins from 495 runners, 7%) runs LAMPANG Trainer-in-form (last 14 days): T Easterby (13 wins from 84 runners, 15%) runs LAMPANG Weight Watcher: SUMMERGHAND won off a handicap mark of 108, his rating is now down 11lb to 97. Longest Traveller: MUMS TIPPLE trained by R Hannon, Marlborough, 212 miles. NOTE: All statistics are up to and including 18th August Last Winning Winning Runs Racecard 6 Career Total Career Distance Going Since No. Runs Horse Wins Places Runs Winnings Range Range Wins 1 70-20U1 COMMANCHE FALLS 9 22 292854 6F G-S 0 2 533002 TABDEED 5 4 20 57536 6F G-GF 12 3 001410 MR WAGYU 15 16 65 172726 6F G-S 1 4 2 42623 REGIONAL 2 5 11 17640 5-6F GF 7 5 282510 SALEYMM 3 2 10 24844 7-9F GF-ST 1 6 0-10103 LAMPANG 5 3 22 43140 6F G-GF 2 7 128450 LORD OF THE LODGE 6 6 26 66315 6-7F GF-ST 5 8 181005 VOLATILE ANALYST 6 20 104339 6-7F GS-ST 3 9 400-300 GULLIVER 8 17 70 191087 6-7F G-ST 18 10 5-00341 MUMS TIPPLE 4 3 23 79337 6-7F G-ST 0 11 2-41940 GOOD EYE 2 2 12 22629 6-7F G 3 12 831107 SILVER SAMURAI 5 8 25 41751 6-8F G-S 2 13 006594 SUMMERGHAND 13 18 68 211278 6F G-ST 11 14 142119 LETHAL LEVI 6 6 17 96885 6F G-GF 1 15 043820- ROYAL SCIMITAR 1 3 11 4140 6F G 10 16 311112 SPANGLED MAC 5 2 8 25406 6-7F GS-ST 1 17 0-61135 TINTO 8 14 62 72605 5-6F F-ST 2 18 211437 GHATHANFAR 7 17 49 41690 5-7F G-ST 3 19 4-03063 CHAIRMANOFTHEBOARD 4 6 30 29318 6F G-S 6 20 1-53761 ALEEZDANCER 4 1 13 19889 5-6F GS-S 0 KNAVESMIRE TIP A chance is taken on MR WAGYU, who, in an open contest, receives a tentative vote. John Quinn’s charge was a winner from 4lb lower at the Curragh last month and with talented apprentice Ryan Sexton claiming 5lb, he looks primed for a big run. There was little to separate Commanche Falls (winner) and Tabdeed in the Stewards’ Cup at Goodwood, and both ought to remain competitive, along with Summerghand. Others to consider are Volatile Analyst, Gulliver, and Lampang. MR WAGYU COMMANCHE FALLS 5th Race 4.10 Distance: 6f Race Type: Heritage Handicap Prize Money: £100,000 Age: 3+ Stalls: Farside NEW RACE COURSE RECORD HOLDER: MINCE

Owner: Richard Gilbert & Keith Dalgleish Trainer: Keith Dalgleish, Carluke Form: 101005 CD Breeder: Pollock Farms et al

Winner of five races at 6f on varying ground. Beaten a short head by Commanche Falls when second of 28 at 12-1 on his latest outing at Goodwood over 6f (good to firm) last month. First-time cheekpieces are employed, and, being 2lb better off with that rival, can go well.

Winner of six races from 6f to 7f on varying ground on the all-weather Finished 13l behind Lion Tower when last of 5 at 12-1 on his latest outing at Redcar over 7f (good to firm) earlier this month. Won a similar C&D event last October (from 5lb lower). Not ruled out.

5th Race 4.10

The Sky Bet Constantine Stakes Distance: 6f Race Type: Heritage Handicap Prize Money: £100,000 Age: 3+ Stalls: Farside

Official BHA Rating 103 SP: 20-1 7 Lord of The Lodge (IRE) (25) 5 9-5 (59.4) (12) B h Dandy Man (IRE) Archetypal (IRE) Jockey: Sam Feilden (7)

Breeder: Red House Stud & Ketton Ashwell Ltd

Official BHA Rating 104 SP: 14-1 4 Regional (GB) (21) 4 9-6 (59.9) (5) B g Territories (IRE) Favulusa Jockey: P. J. McDonald Owner: Future Champions Racing Regional Trainer: Edward Bethell, Middleham Form: 2-42623 D Breeder: Razza del Sole Societa Agricola SRL Successful at 5f and 6f on good to firm ground Third of 28 behind Commanche Falls beaten 1 3/4l at 13-2 on his latest outing at Goodwood over 6f (good to firm) last month. Career-best effort last time and there looks to be no reason why he won’t go well again. Official BHA Rating 103 SP: 14-1 5 Saleymm (IRE) (22) 4 9-6 (59.9) (18) B g Dubawi (IRE) Talmada (USA) Jockey: Silvestre De Sousa

Official BHA Rating 103 SP: 22-1 6 Lampang (IRE) (14) 5 9-6 (59.9) (9)

Owner: Sheikh Ahmed Al Maktoum Trainer: Simon & Ed Crisford, Newmarket Form: 202510 C Breeder: Godolphin He has won three times from 7f to 1m 1f on good to firm ground and on the all-weather Beaten 10l behind Orbaan at 10-1 when 14th of 18 on his latest outing at Goodwood over 1m (good to firm) last month. Won here over 7f last month but he’ll need more now dropped in trip

Owner: Mrs Elaine M. Burke Trainer: K. R. Burke, Leyburn Form: 120450 D Breeder: Mountarmstrong Stud

Official BHA Rating 101 SP: 66-1 No Horse Age st-lb (kgs) Draw

Breeder: Redgate BStock & Peter Bottowley BStock Has won nine races at 6f on ground varying from good to firm to soft. A winner at 25-1 at Goodwood over 6f (good to firm) on his latest outing last month, beating Tabdeed by a short head. Returned to form with that success and a 6lb rise might not be beyond him.

Owner: Doug Graham, Ian Davison, Alan Drysdale Trainer: Michael Dods, Darlington Form: 00-20U1 D

Ch g Havana Gold (IRE) Puzzled (IRE) Jockey: Hollie Doyle

B g Dandy Man (IRE) Black Mascara (IRE) Jockey: David Allan Owner: King Power Racing Co Ltd Trainer: Tim Easterby, Malton Form: 0-10103 D Breeder: Rosetown Bloodstock Ltd

Winner of five races at 6f on ground varying from good to firm to good to soft. Third of 10 behind Manaccan beaten 1 1/2l at 6-1 on his latest outing at Ascot over 5f (good to firm) earlier this month. Appeals more over this trip and he merits consideration.

Official BHA Rating 109 SP: 10-1 2 Tabdeed (GB) (21) 7 9-8 (60.8) (17)

Br g Lethal Force (IRE) Joyeaux Jockey: Connor Beasley

Winner of six races from 6f to 7f on good to firm ground and on the all-weather Well beaten at 200-1 behind Sandrine when last of 11 on his latest outing in the Group 2 World Pool Lennox Stakes at Goodwood over 7f (good) last month. He’s respected back in a handicap Official BHA Rating 102 SP: 50-1 8 Volatile Analyst (USA) (14) 5 9-4 (59.0) (16) B g Distorted Humor (USA) Gentle Caroline (USA) Jockey: Callum Rodriguez

Official BHA Rating 105 SP: 10-1 3 Mr Wagyu (IRE) (21) 7 9-7 (60.3) (6) Ch g Choisir (AUS) Lake Louise (IRE) Jockey: Ryan Sexton (5) Owner: The New Century Partnership Trainer: John Quinn, Malton Form: 001410 CD Breeder: Danny O’Sullivan Has won 15 races at 6f on ground varying from good to firm to soft. Beaten 5l behind Commanche Falls at 10-1 when 10th of 28 on his latest outing at Goodwood over 6f (good to firm) last month. Likes it here and Ryan Sexton’s 5lb claim is a bonus.

5 78 1 Commanche Falls (GB) (21) 5 9-12 (62.6) (13)

Owner: Lone Star Investments Trainer: Archie Watson, Upper Lambourn Form: 533002 D

Ch g Footstepsinthesand Colomone Cross (IRE) Jockey: Frankie Dettori

Official BHA Rating 97 SP: 12-1 14 Lethal Levi (GB) (21) 3 8-13 (56.7) (8) B g Lethal Force (IRE) Dartrix Jockey: Clifford Lee Owner: Mr J. A. Knox and Mrs M. A. Knox Trainer: K. R. Burke, Leyburn Form: 142110 D BF Breeder: Joshua A. Knox

10 Mums Tipple (IRE) (7) 5 9-0 (57.2) (14)

Official BHA Rating 98 SP: 50-1

5 79 9 Gulliver (GB) (21) 8 9-1 (57.6) (20)

He has won four times from 6f to 7f on good to firm and good ground and on the all-weather Won on his latest outing when 2-1jt-fav at Newmarket over 6f (good to firm) earlier this month, beating Above by 3l. A 6lb rise makes things tougher but he’s no forlorn hope

Official BHA Rating 97 SP: 18-1 11 Good Eye (SWE) (3) 7 9-0 (57.2) (15) Br g Eishin Dunkirk (USA) Lovely Eyes (IRE) Jockey: Tom Marquand Owner: Oldies But Goodies Trainer: Jessica Long, Sweden Form: 2-41040 D Breeder: Arvidssonper O Equo Bloodstock H B Successful at 6f and 7f on good ground. Beaten 4l behind Bergerac at 12-1 when 10th of 22 on his latest outing here over 5f (good) earlier this month. Turned out quickly following that creditable effort and has place claims. Official BHA Rating 97 SP: 40-1 12 Silver Samurai (GB) (28) 5 9-0 (57.2) (4) Gr g Cable Bay (IRE) High Tan Jockey: Neil Callan Owner: What A Time To Be Alive 1 Trainer: Marco Botti, Newmarket Form: 031100 D BF Breeder: Seaton Partnership Winner of five races from 6f to 1m on ground varying from good to firm to soft. Beaten 2 1/4l behind Gale Force Maya at 4-1fav when seventh of 15 on his latest outing over this course and distance (good to firm) last month. Needs to resume his progress.

Owner: Marian Lyons & Patricia Zanelli Trainer: Richard Hannon, Marlborough Form: 5-00341 CD Breeder: Abbey Bloodstock Limited

Official BHA Rating 95 SP: 33-1 16 Spangled Mac (IRE) (14) 3 8-11 (55.8) (3) B g Starspangledbanner (AUS) Intermittent Jockey: William Buick Owner: Mr Adrian McAlpine Trainer: George Boughey, Newmarket Form: 311112 D Breeder: Intermittent Partnership Winner of five races from 6f to 7f on good to firm and good to soft ground and on the all-weather Beaten 3/4l by Adaay In Asia when second of 9 at 15-2 on his latest outing at Ascot over 6f (good to firm) earlier this month. Could land a telling blow.

B g Sayif (IRE) Sweet Coincidence Jockey: Martin Harley Owner: Withernsea Thoroughbred Limited Trainer: David O’Meara, Upper Helmsley Form: 400-300 CD Breeder: S. A. Douch

Official BHA Rating 97 SP: 14-1 13 Summerghand (IRE) (7) 8 9-0 (57.2) (2) B g Lope de Vega (IRE) Kate The Great Jockey: Daniel Tudhope Owner: Mr Hamad Rashed Bin Ghedayer Trainer: David O’Meara, Upper Helmsley Form: 006504 D Breeder: Airlie Stud Has won 13 races at 6f on varying groundon the all-weather Finished 3l behind Intrinsic Bond when fourth of 14 at 6-1 on his latest outing at Ripon over 6f (good to firm) earlier this month. Now 11lb lower than his last handicap success and must go on the shortlist.

Official BHA Rating 97 SP: 12-1 No Horse Age st-lb (kgs) Draw

Winner of six races at 6f on ground varying from good to firm to good to soft. Beaten 6l behind Many A Star at 5-6fav when 9th of 12 on his latest outing at Goodwood over 6f (good to firm) last month. He’s been highly progressive this season and is another to consider Official BHA Rating 99 SP: 18-1 15 Royal Scimitar (IRE) (336) 4 8-12 (56.2) (10) B g Territories (IRE) Prequel (IRE) Jockey: Kieran Shoemark Owner: AlMohamediya Racing Trainer: Clive Cox, Hungerford Form: 043020- D Breeder: Yeomanstown Stud A winner at 6f on good ground, but that win was over two years ago Beaten 10l behind Staxton at 8-1 when 13th of 24 on his latest outing at Ayr over 6f (good) in September last year. It will take a mighty effort to win this on his return from a 336-day absence.

Has won eight races from 6f to 7f on ground varying from good to firm to soft and on the all-weather Beaten 7l behind Commanche Falls at 50-1 when 13th of 28 on his latest outing at Goodwood over 6f (good to firm) last month Entitled to be in the shake-up

3rd

Draw FIFTH RACE PRESENTATION

5 80 17 Tinto (GB) (21) 6 8-11 (55.8) (7)

18 Ghathanfar (IRE) (3) 6 8-9 (54.9) (19)

Owner: David Kilburn, David Hudd & Chris Wright Trainer: Mick Channon, West Ilsley Form: 4-03063 D Breeder: Belmont Bloodstock Ltd & Luke Jesse He has won four times at 6f on ground varying from good to soft. Third of 5 behind Aleezdancer beaten 2 1/2l at 4-1 on his latest outing at Ripon over 6f (good to soft) earlier this month. A winner from this mark last October but others hold more pressing claims. Official BHA Rating 91 SP: 22-1 20 Aleezdancer (IRE) (19) 3 8-7 (54.0) (11) B g Fast Company (IRE) Clifton Dancer Jockey: Rowan Scott Owner: Jack Berry and John Matthews Trainer: Kevin Ryan, Hambleton Form: 1-53061 D Breeder: Rathasker Stud He has won four times from 5f to 6f on good to soft and soft ground. A winner at 9-4 at Ripon over 6f (good to soft) on his latest outing earlier this month, beating Dakota Gold by 3/4l. Not yet fully exposed but he’ll need to pull out more from a career-high mark. Official BHA Rating 93 SP: 14-1

PROBABLE S.P.’S 10-1 Commanche Falls (GB), Tabdeed (GB), 12-1 Summerghand (IRE), Spangled Mac (IRE), 14-1 Mr Wagyu (IRE), Regional (GB), Silver Samurai (GB), Aleezdancer (IRE), 18-1 Mums Tipple (IRE), Lethal Levi (GB), 20-1 Lampang (IRE), 22-1 Saleymm (IRE), Ghathanfar(IRE),Chairmanoftheboard(IRE),25-1Tinto(GB),33-1RoyalScimitar(IRE),40-1GoodEye(SWE),50-1LordofTheLodge(IRE), Gulliver (GB), 66-1 Volatile Analyst (USA) £51540 2nd £24170 £12090 4th £6040 Horse Age st-lb (kgs) & BEST TURNED OUT

NUMBER OF DECLARED RUNNERS

Has won eight races from 5f to 6f on ground varying from firm to soft and on the all-weather Finished 2 1/4l behind Commanche Falls when fifth of 28 at 33-1 on his latest outing at Goodwood over 6f (good to firm) last month. Needs more if he’s to come out on top.

Winner of seven races from 5f to 7f on good to firm and good ground and on the all-weather Beaten 3l behind Bergerac at 16-1 when seventh of 22 on his latest outing here over 5f (good) earlier this month. Could go well if coping with the quick turnaround.

Official BHA Rating 92 SP: 22-1 19 Chairmanoftheboard (IRE) (19) 6 8-8 (54.4) (1) B g Slade Power (IRE) Bound Copy (USA) Jockey: David Egan

The trophy for this race will be presented to the winning owner after the race by Lisa Sewell Chief People and Operations Officer Flutter UK & Ireland. Sky Bet have generously given £200 to the racing groom responsible for the best turned out horse in this race and £200 to the groom responsible for the winning horse

20..........................................................................................(EXACTA)

B g Compton Place Amirah (IRE) Jockey: David Probert Owner: Mr Foster Watson Trainer: Michael Dods, Darlington Form: 0-61135 D Breeder: Llety Farms

Br g Invincible Spirit (IRE) Cuis Ghaire (IRE) Jockey: Dale Swift Owner: Mr W. J. Laws Trainer: Tracy Waggott, Spennymoor Form: 211430 C D Breeder: Shadwell Estate Company Limited

Sheepskin Cheek Pieces worn first time by No 2. Blinkers worn by No 11. Visor worn by No 3, 13, 18. Tongue Strap worn by No 4, 5, 6, 9. Sheepskin Cheek Pieces worn by No 1, 9, 15 Running for the first time since Gelding No 15 NOTE VOLATILE ANALYST: Following its run on 6/8/2022 it was reported that the horse lost both front shoes.

RESULT & PRIZE MONEY INFORMATION 1st

Official BHA Rating 94 SP: 25-1

STEWARDS

TIME DISTANCES No

LETHAL LEVI: Following its run on 30/7/2022 it was reported that the horse was slow into stride ROYAL SCIMITAR: Following its run on 18/9/2021 it was reported that the horse would not face 1st time blinkers.

THE YORK GIN EBOR FIZZ Created to celebrate the 2022 Sky Bet Ebor Festival The York Gin Ebor Fizz is available at the Edwardian Weighing Room and the York Gin Bar at the County Stand Garden. 81

83 The Julia Graves Roses Stakes (Listed Race) Five Furlongs (1,000 metres) See page 93 for conditions of this race. RACE DESCRIPTION The final leg in our Pattern Race journey this week, this Listed race is for 2yo horses over five furlongs. The shorter distance usually makes for a tight finish. Weight allowances mean the boys carry more weight to reflect their greater strength; Treasure Trove is one of the two fillies who start from the lower mark today. Maybe an inform yard is the way to go, check out the table before this race LAST YEAR’S RACE Winner: ATTAGIRL Trainer: K R Burke Jockey: Daniel Tudhope Age/Weight: 2-8-9 Runners: 9 SP: 7/2 Under a great ride by Daniel Tudhope, the filly picked her way through the field to deliver a late challenge to give Karl Burke his first win in the race at his local track. THE TALE OF THE CLOCK Race Average Time: 59.12s Racing Post Standard Time: 57.50s Course record: 57.11s by Big Time Baby (20-Aug-16) All times are based where possible on the corresponding race over the last ten years RACE FACTS & STATISTICS Leading course trainer (17-22): R Fahey (38 wins from 528 runners, 7%) runs ROUSING ENCORE Trainer-in-form (last 14 days): K R Burke (11 wins from 56 runners, 20%) runs LOOKING FOR LYNDA Longest Traveller: TREASURE TROVE trained by Paddy Twomey, Ireland. NOTE: All statistics are up to and including 18th August Last Winning Winning Runs Racecard 6 Career Total Career Distance Going Since No. Runs Horse Wins Places Runs Winnings Range Range Wins 1 21212 ROCKET RODNEY 2 3 5 28962 5F G 1 2 163 BOLT ACTION 1 1 3 5400 5F G 2 3 147 BRAVE NATION 1 3 3942 5F GF 2 4 216461 LOOKING FOR LYNDA 2 1 6 14901 5F G 0 5 31165 ROUSING ENCORE 2 1 5 17247 5-6F G-GF 2 6 3 SQUEALER 1 1 7 5166 SWIFT ASSET 1 4 5400 5F GF 2 8 6185 THUNDER MOOR 1 4 10800 5F G 2 9 1166 KATEY KONTENT 2 4 15390 5F GF 2 10 335132 TREASURE TROVE 1 1 6 6050 5F 2 KNAVESMIRE TIP ROCKET RODNEY has proven to be an admirably consistent performer and he was only beaten a neck into second by Little Big Bear in the Windsor Castle at Royal Ascot. Since then, the son of Dandy Man has won at Listed level and only found one too good in the Molecomb last time. A reproduction of that level of form today would give him a big chance. Treasure Trove and Brave Nation are others with strong form claims, while Rousing Encore and Bolt Action complete the shortlist. ROCKET RODNEY TREASURE TROVE 6th Race 4.45 Distance: 5f Race Type: Listed Prize Money: £85,000 Age: 2 Stalls: Farside

1 Rocket Rodney (GB) (24) 9-5 (59.4) (6) B g Dandy Man (IRE) Alushta Jockey: Daniel Muscutt

Foaled 28 Apr A winner at 5f on good to firm ground. Finished 7l behind Royal Scotsman when sixth of 8 at 20-1 on his latest outing in the Group 2 Richmond Stakes at Goodwood over 6f (good to firm) last month. Has an each-way chance today. Official BHA Rating 95 SP: 14-1 8 Thunder Moor (IRE) (24) 9-2 (58.1) (10) Ch c Dandy Man (IRE) Play Mate Jockey: Daniel Tudhope Owner: Bronte Collection 1 Trainer: Kevin Ryan, Hambleton Form: 6105 CD Breeder: Ballyhane Foaled 3 Mar A winner at 5f on good ground. Finished 4l behind Trillium when fifth of 8 at 40-1 on his latest outing in the Group 3 Molecomb Stakes at Goodwood over 5f (good to firm) last month. Could make the frame but needs to find some improvement to be successful.

3 Brave Nation (IRE) (44) 9-2 (58.1) (3) B c Sioux Nation (USA) Suite (IRE) Jockey: Dylan Hogan Owner: Mr Brian Goodyear Trainer: Michael Bell, Newmarket Form: 140 D Breeder: Basil Brindley Foaled 27 Mar. A winner at 5f on good to firm ground. Beaten 8l behind Persian Force at 6-1 when last of 7 on his latest outing in the Group 2 July Stakes at Newmarket over 6f (good to firm) last month. It is far too soon to be writing him off Official BHA Rating 99 SP: 10-1 4 Looking For Lynda (IRE) (15) 9-2 (58.1) (5) Ch c Unfortunately (IRE) Designated Jockey: Clifford Lee Owner: Mr D Bardsley & Mrs E Burke Trainer: K. R. Burke, Leyburn Form: 216461 D Breeder: Springfield House Stud&Hollymount Stud Foaled 17 Mar Successful twice at 5f on good ground. A winner at 6-5 at Musselburgh over 5f (good) on his latest outing earlier this month, beating New Definition by a neck. Has also won at Nottingham this season. May find a few too good this afternoon.

2 Bolt Action (IRE) (22) 9-2 (58.1) (2) B c Kessaar (IRE) Tisa River (IRE) Jockey: David Egan

Owner: Victorious Racing & Fawzi Nass Trainer: Roger Varian, Newmarket Form: 163 D BF Breeder: M. Al-Qatami & K. M. Al-Mudhaf Foaled 16 Feb. A winner at 5f on good ground. Third of 16 behind Rumstar beaten 1 1/2l at 10-3fav on his latest outing at Goodwood over 6f (good to firm) last month. Had shown promise when sixth in the Windsor Castle at Royal Ascot prior to that defeat. Official BHA Rating 95 SP: 13-2

Owner: Victorious Racing Trainer: George Scott, Newmarket Form: 21212 D BF Breeder: R. W. Stapleton Foaled 30 Jan. Successful twice at 5f on good ground. Beaten 1 1/4l by Trillium when second of 8 at evens fav on his latest outing in the Group 3 Molecomb Stakes at Goodwood over 5f (good to firm) last month. Has won at Sandown and Goodwood this season. Strong form claims. Official BHA Rating 105 SP: 3-1

Official BHA Rating 90 SP: 18-1 5 Rousing Encore (IRE) (19) 9-2 (58.1) (8) B c Acclamation Jolie Chanson (FR) Jockey: Oisin Orr Owner: Mr Paul K. Spencer Trainer: Richard Fahey, Malton Form: 31165 D Breeder: Hunting Hill Stud Foaled 28 Mar Successful at 5f and 6f on good to firm and good ground. Finished 3 1/2l behind Voce Del Palio when fifth of 24 at 9-2 on his latest outing at Naas over 6f (yielding) earlier this month. Has won at Pontefract and Beverley this season. Merits consideration. Official BHA Rating 99 SP: 7-1 6 Squealer (IRE) (12) 9-2 (58.1) (7) B g Mehmas (IRE) Sunny Hollow Jockey: Rowan Scott Owner: MARTIN WEBB & SYPS (UK) LTD Trainer: Nigel Tinkler, Malton Form: 3 Breeder: Tally-Ho Stud Foaled 9 Apr Half-brother to Wolf Hunter, won multiple times between 6f and 1m 4f Third of 8 behind Not For Profit beaten a head at 4-1 on his racecourse debut at Ripon over 5f (good) earlier this month. That was a promising effort but this is a much tougher assignment.

B c Profitable (IRE) Flick Show (IRE) Jockey: Tom Marquand Owner: J Palmer-Brown, N. Woodcock and partner Trainer: Richard Hannon, Marlborough Form: 5166 D Breeder: J. & S. Quigley

The Julia Graves Roses Stakes Distance: 5f Race Type: Listed Prize Money: £85,000 Age: 2 Stalls: Farside

Official BHA Rating 93 SP: 22-1 No Horse st-lb (kgs) Draw 6th

6 84

Official BHA Rating SP: 33-1 7 Swift Asset (IRE) (23) 9-2 (58.1) (1)

Race 4.45

earlier this month. A consistent performer who is likely to be thereabouts once again. Official BHA Rating 100 SP:

Owner: S R Hope & S W Barrow Trainer: Clive Cox, Hungerford Form: 1166 D

outing

on

10 Treasure Trove (IRE) (7) 8-11 (55.8) (4) Ch f Siyouni (FR) Pichola Dance (IRE) Jockey: W. J. Lee

Ch f Havana Grey Showstoppa Jockey: NON RUNNER

on good yielding ground. Beaten a short head

Breeder: Whitsbury Manor Stud NON RUNNER

NUMBER OF DECLARED RUNNERS 10 ..........................................................................................(EXACTA) STEWARDS NOTE SWIFT ASSET: Following its run on 28/7/2022 it was reported that the horse’s bit slipped out late-on. PROBABLE S.P.’S 3-1 Rocket Rodney (GB), 7-2 Treasure Trove (IRE), 13-2 Bolt Action (IRE), 7-1 Rousing Encore (IRE), 10-1 Brave Nation (IRE), 14-1 Swift Asset (IRE), 18-1 Looking For Lynda (IRE), 22-1 Thunder Moor (IRE), 33-1 Squealer (IRE) RESULT & PRIZE MONEY INFORMATION 1st £48203 2nd £18275 3rd £9146 4th £4556 TIME DISTANCES No Horse st-lb (kgs) Draw The Family of Julia Graves RU DNON-RUNNER (SelfCert(BadScope) Largest Gothic cathedral in Northern Europe York Minster This massive Gothic cathedral took 250 years to build, from 1220 till its consecration in 1472 THINGS YOU MIGHT NOT KNOW ABOUT YORK SIXTH RACE PRESENTATION & BEST TURNED OUT The trophy for this race will be presented to the winning owner after the race by Ian Graves and his nieces Katie Taylor, Megan Taylor and Mollie Taylor. The Family of Julia Graves have generously given £100 to the racing groom responsible for the best turned out horse in this race and £50 to the racing groom responsible for the winning horse. FAMILY OF JULIA GRAVES

6 85 9 Katey Kontent (GB) (8) 8-11 (55.8) (9)

Foaled 7 Mar

Breeder: Merry Fox Stud Limited A winner at 5f by Mauiewowie when second of 7 at 9-2 her latest at Curragh over 5f (good) 7-2

Owner: Merry Fox Stud Limited Trainer: P. Twomey, Ireland Form: 335132 D

BEST DRESSED FINAL THE BEST DRESSED WINNER FROM EACH OF YORKSHIRE’S NINE COURSES WILL REPRESENT THEIR COURSE IN THE FINAL WHICH WILL BE JUDGED BY PUBLIC VOTE. VISIT WWW.GORACING.CO.UK FOR MORE DETAILS WHAT IS THE PRIZE? • A TWO NIGHT STAY FOR TWO PEOPLE IN A TRADITIONAL SHEPHERD’S HUT • USE OF A LAND ROVER VEHICLE FOR TWO DAYS • HIS AND HERS DUBARRY BOOTS, PLUS A PAIR OF RM WILLIAMS BOOTS AND BELT. SPONSORED BY

87 The Sky Bet Finale Stakes One Mile And Two Furlongs About 88 Yards (2,000 metres) See page 93 for conditions of this race. RACE DESCRIPTION A farewell competitive heritage handicap Such races are designed for close competition so, the handicapper, is the independent assessor who rates horses on past performance seeking to get them crossing the line together, by handing out differing weights. This one is for 3yo+ horses run over a mile and a quarter, with Soto Sizler at the top of the scale The high handicap rating band of 0-105 means that it too will attract some pretty smart types Known as “the get out stakes” in punting circles, it could be time for a pin or your favourite colour If you win this race you can claim bragging rights until YorkMix Family Sunday on 4 September Thank you for your support this week. LAST YEAR’S RACE Winner: MIGRATION Trainer: David Menuisier Jockey: William Buick Age/Weight: 5-9-8 Runners: 13 SP: 3/1F William Buick got his second victory of the day as he found the gap at the right time to hit the front, and the line just came soon enough to hold off the fast-finishing Sinjaari who was making eye-catching headway against the rail to create a tense finish. THE TALE OF THE CLOCK Race Average Time: 2m 9.89s Racing Post Standard Time: 2m 7.50s Course record: 2m 5.29s by Sea The Stars (18-Aug-09) All times are based where possible on the corresponding race over the last ten years RACE FACTS & STATISTICS Leading course trainer (17-22): R Fahey (38 wins from 528 runners, 7%) runs SPIRIT DANCER Trainer-in-form (last 14 days): C & M Johnston (18 wins from 78 runners, 23%) runs FOREST FALCON Longest Traveller: LUCANDER trained by R Beckett, Kimpton Down, 251 miles. NOTE: All statistics are up to and including 18th August Last Winning Winning Runs Racecard 6 Career Total Career Distance Going Since No. Runs Horse Wins Places Runs Winnings Range Range Wins 1 1-71250 SOTO SIZZLER 5 6 26 123593 10-12F G-GF 3 2 218010 FOREST FALCON 5 4 21 79733 8-10F G-GF 1 3 22-7153 LUCANDER 5 6 23 59556 8-10F G-S 2 4 31115-3 INJAZATI 3 3 7 33402 10F G-ST 2 5 0-36003 CHICHESTER 3 6 22 30609 8-10F GF-ST 6 6 49-8241 SPIRIT DANCER 3 7 15 19028 10F GF-ST 0 7 524788 CARADOC 4 5 22 69682 8-10F G-GF 13 8 2113 PHANTOM FLIGHT 2 2 4 9018 8F G-GS 1 9 2121 SPECIAL ENVOY 2 2 4 11502 10-11F GF-S 0 10 9-54247 FISHABLE 3 5 18 16308 10F G-S 8 11 13/33-21 PIECEDERESISTANCE 2 2 6 17362 8-10F GF 0 12 P44987 COCKALORUM 5 11 39 28016 9-10F G-S 12 13 380229 GEREMIA 3 4 16 13009 12-16F ST 8 14 26-4600 ONEFORTHEGUTTER 1 1 8 4266 6F G 7 KNAVESMIRE TIP A fiercely-competitive handicap which was won last year by Lucander, who is back this season and races off a mark 5lb higher He was third over C&D last month, despite being left with plenty to do, and looks all set for another big run. Improving three-year-olds have done well in recent years and Special Envoy could have a say after his Windsor success over further, but preference is for PHANTOM FLIGHT A winner at Redcar and Haydock, he stepped up to this trip at Newmarket last month when third after being denied a clear run, and if he gets a better passage here, he may come home in front. PHANTOM FLIGHT SPECIAL ENVOY 7th Race 5.20 Distance: 1m 2f Race Type: Handicap Rating: 0-105 Prize Money: £80,000 Age: 3+ Stalls: Inside Rail

Official BHA Rating 98 SP: 15-2 5 Chichester (GB) (21) 5 9-4 (59.0) (12) B g Dansili Havant Jockey: Callum Rodriguez

Owner: Sheikh Hamdan Bin Mohammed Al Maktoum Trainer: Charlie & Mark Johnston, Middleham Form: 210010 D Breeder: Roundhill Stud

He has won three times at 1m 2f on good to firm and soft ground and on the all-weather Won on his latest outing over this course and distance last month, beating What’s The Story by 1 3/4l. An easy winner that day and an added 4lb may not stop him going close Official BHA Rating 97 SP: 15-2

He has won three times from 1m to 1m 2f on good to firm ground and on the all-weather Third of 4 behind Protagonist beaten 4 1/2l at 6-1 on his latest outing at Doncaster over 1m 2f (good) last month. Dropped 3lb since that run and quite capable if the race falls his way.

B g Raven’s Pass (USA) Malmoosa (IRE) Jockey: William Buick

Winner of five races from 1m to 1m 2f on good to firm and good ground. Beaten 11l behind Ajero at 4-1 when 11th of 16 on his latest outing at Goodwood over 1m 1f (good to firm) last month. Has won at Goodwood and Redcar this season and may well be happier back up in trip Official BHA Rating 101 SP: 12-1 3 Lucander (IRE) (29) 5 9-6 (59.9) (1) B g Footstepsinthesand Lady Sefton Jockey: Rob Hornby Owner: Mrs M. E. Slade & Mr B. Ohlsson Trainer: Ralph Beckett, Kimpton Down Form: 22-0153 CD Breeder: Mr John Connolly Winner of five races from 1m to 1m 2f on ground varying from good to firm to soft. Third of 5 behind Spirit Dancer beaten 2 1/2l on his latest outing over this course and distance last month. Left with plenty to do that day and he could go well if kept nearer to the pace. Official BHA Rating 99 SP: 14-1 4 Injazati (IRE) (137) 4 9-5 (59.4) (9) Ch c Night of Thunder (IRE) Mathanora (IRE) Jockey: Jamie Spencer Owner: Mr Mohamed Obaida Trainer: Charlie Fellowes, Newmarket Form: 31115-3 D BF Breeder: Rabbah Bloodstock Limited

Owner: Sir Ian & Ms Catriona Good Trainer: Keith Dalgleish, Carluke Form: 0-36003 D Breeder: Mrs James Wigan & London TB Services Ltd

B g Mastercraftsman (IRE) Jalousie (IRE) Jockey: Callum Hutchinson (5)

Official BHA Rating 97 SP: 33-1 6 Spirit Dancer (GB) (29) 5 9-4 (59.0) (3) B g Frankel Queen’s Dream (GER) Jockey: Oisin Orr Owner: Done Ferguson Mason Trainer: Richard Fahey, Malton Form: 40-0241 CD

He has won four times from 1m to 1m 2f on good to firm and good ground, but last win was over two years ago Beaten 6l behind Forest Falcon when eighth of 18 on his latest outing at Goodwood over 1m 2f last month. Coming down the handicap slowly but others appeal more. Official BHA Rating 92 SP: 14-1 8 Phantom Flight (GB) (43) 3 8-12 (56.2) (5) B c Siyouni (FR) Qushchi Jockey: P. J. McDonald

Owner: John and Jess Dance Trainer: James Horton, Middleham Form: 2113 Breeder: St Albans Bloodstock LLP

The Sky Bet Finale Stakes Distance: 1m 2f Race Type: Handicap (0-105) Prize Money: £80,000 Age: 3+ Stalls: Inside Rail

Official BHA Rating 105 SP: 33-1 2 Forest Falcon (IRE) (21) 4 9-8 (60.8) (13)

Owner: Mr I. J. Heseltine Trainer: David Menuisier, Pulborough Form: 1-01250 D Breeder: D. A. Yardy Winner of five races from 1m 2f to 1m 4f on good to firm and good ground. Beaten 8l behind Forest Falcon at 20-1 when 15th of 18 on his latest outing at Goodwood over 1m 2f (good) last month. His stable won this last year bur he needs a career best off this mark.

7 88

1 Soto Sizzler (GB) (25) 7 9-12 (62.6) (2)

Breeder: Sir Alex Ferguson & Mr Niall McLoughlin

7 Caradoc (IRE) (25) 7 8-13 (56.7) (8)

B g Camelot Applause (IRE) Jockey: Tom Marquand Owner: Mr P. K. Siu Trainer: Ed Walker, Upper Lambourn Form: 524000 D Breeder: P & B Bloodstock

Successful twice at 1m on good and good to soft ground. Third of 12 behind New London beaten 3 1/2l at 14-1 on his latest outing at Newmarket over 1m 2f last month after being denied a clear run. He has won at Haydock and Redcar this season and may have more to come Official BHA Rating 98 SP: 5-1 No Horse Age st-lb (kgs) Draw 7th Race 5.20

He has won three times at 1m 2f on good ground and on the all-weather Third of 11 behind Baryshnikov beaten 4l at 6-5fav on his latest outing at Pontefract over 1m 2f (soft) in April. Better ground will suit him here and he may improve for his first start of the season.

Breeder: Britannia T’Breds & The Hon R J Arculli He has won three times at 1m 2f on good and soft ground. Well beaten at 15-2 behind Claim The Crown when last of 7 on his latest outing at Ripon over 1m 2f (good) last month. Not at his best that day and he clearly has to bounce back to have any say here

B c Frankel Marlinka Jockey: Frankie Dettori

B g Fastnet Rock (AUS) Gerika (FR) Jockey: Cam Hardie

Official BHA Rating 85 SP: 20-1 14 Oneforthegutter (GB) (20) 3 8-6 (53.5) (10) B c Muhaarar Rainbow Springs Jockey: David Egan Owner: Tracey Bell & Caroline Lyons Trainer: Ian Williams, Alvechurch Form: 26-4600 Breeder: Michael E Wates CBE A winner at 6f on good ground. Beaten 14l behind Fools Rush In at 13-2 when 12th of 13 on his latest outing at Chester over 1m (good to soft) last month. Struggling recently and although dropped another 2lb in the handicap, he needs to do a lot more here.

Official BHA Rating 92 SP: 33-1

NUMBER OF DECLARED RUNNERS 14 ..........................................................................................(EXACTA)

GEREMIA: Following its run on 4/8/2022 it was reported that the horse was slowly away

ONEFORTHEGUTTER: Following its run on 31/7/2022 it was reported that the horse did not handle the track.

B g Dutch Art Sweet Stream (ITY) Jockey: David Allan

10 Fishable (GB) (47) 5 8-10 (55.3) (7)

7 89 9 Special Envoy (GB) (26) 3 8-12 (56.2) (14)

11

Tongue Strap worn by No. 10. Sheepskin Cheek Pieces worn by No. 1, 5, 10. STEWARDS NOTE SOTO SIZZLER: Following its run on 26/7/2022 it was reported that the horse was slowly away PHANTOM FLIGHT: Following its run on 8/7/2022 it was reported that the horse was denied a clear run 2 out.

PROBABLE S.P.’S 5-1 Phantom Flight (GB), 11-2 Special Envoy (GB), 15-2 Injazati (IRE), Spirit Dancer (GB), 12-1 Forest Falcon (IRE), 14-1 Lucander (IRE), Caradoc (IRE), 18-1 Piecederesistance (IRE), 20-1 Geremia (IRE), 25-1 Cockalorum (IRE), 33-1 Soto Sizzler (GB), Chichester (GB), Fishable (GB), Oneforthegutter (GB) No Horse Age st-lb (kgs) Draw

FISHABLE: Following its run on 4/7/2022 it was reported that the trainer could not explain the poor run.

Owner: Mr James Fyffe & Mr Scott Fyffe Trainer: Jim Goldie, Glasgow Form: 300220 Breeder: Societa Agricola La Tesa SRL He has won three times from 1m 4f to 2m on the all-weather Beaten 3 1/2l behind Scampi at 7-1 when 9th of 11 on his latest outing at Doncaster over 1m 4f (good to firm) earlier this month. Might find this trip on the short side with stamina seemingly his forte.

Official BHA Rating 88 SP: 18-1 12 Cockalorum (IRE) (16) 7 8-8 (54.4) (6) B g Cape Cross (IRE) Opinionated (IRE) Jockey: Jonny Peate (5) Owner: K Hardy & R Fell Trainer: Roger Fell, Nawton Form: P44000 D Breeder: Jim Bradley Winner of five races from 1m 1f to 1m 2f on ground varying from good to soft. Beaten 2 1/4l behind Scampi at 14-1 when seventh of 11 on his latest outing at Doncaster over 1m 4f earlier this month. Potentially well handicapped dropping back to a more suitable trip. Official BHA Rating 87 SP: 25-1 13 Geremia (IRE) (16) 4 8-6 (53.5) (4)

Official BHA Rating 89 SP: 33-1

Owner: Juddmonte Trainer: John & Thady Gosden, Newmarket Form: 2121 D Breeder: Elite Racing Club Successful at 1m 2f and 1m 3f on good to firm and soft ground. Won on his latest outing when evens fav at Windsor over 1m 3f (good to firm) last month, beating Pub Crawl by 1 3/4l. Has won twice at Windsor this season but a 6lb rise for his last success makes life tougher Official BHA Rating 98 SP: 11-2

Piecederesistance (IRE) (27) 4 8-9 (54.9) (11) B g Gleneagles (IRE) Positive Step (IRE) Jockey: Hollie Doyle

Owner: Mr B Guerin & Habton Racing Trainer: Tim Easterby, Malton Form: 0-54240 D

Owner: Ryder and Alex Sugden Trainer: Micky Hammond, Middleham Form: 13/33-21 D Breeder: Highpark Bloodstock Ltd Successful at 1m and 1m 2f on good to firm ground. A winner at 7-2 at Pontefract over 1m 2f (good to firm) on his latest outing last month, beating Colinton by 1/2l. Upped in grade but he is on an upward curve and a fast run race will suit him better than most.

7 90 RESULT & PRIZE MONEY INFORMATION 1st £41232 2nd £19336 3rd £9672 4th £4832 TIME DISTANCES SERVING THE FINEST HIMALAYAN SALT DRY AGED STEAKS IN THE HEART OF YORK CITY CENTRE BOOK ONLINE: TOMAHAWK-STEAKHOUSE.CO.UK YORKBEVERLEY NEWCASTLE CHESTER SEVENTH RACE PRESENTATION & BEST TURNED OUT The trophy for this race will be presented to the winning owner after the race by Michael Afflick Flutter UK&I Creative and SBG Brand & Sponsorship Director Sky Bet have generously given £200 to the racing groom responsible for the best turned out horse in this race and £200 to the groom responsible for the winning horse.

STABLESIDE B&B Rooms stablesideyork.co.uk PUZZLE CORNER ANSWERS Guess Who? Mick Channon Who Am I 1. Adam Kirby, Broughton Knows Epsom Derby, Adayar 2. Tiger Cliff Yorks Racing Challenge 1. Cadillac 1:50 2. Sonny Liston 1:50 3. Temporize 2:25 4. Savvy Knight 2:25 5 Inverness 2:25 6. Enemy 3:35 7. Earl Of Tyrone 3:35 8. Benaud 3:35 9. Alfred Boucher 3:35 10. Treasure Trove 4:45 92

The Sky Bet & Symphony Group Strensall Stakes (Class 1) (Group 3) (CLASS 1) Distributed in accordance with the Stakes and Prize Money Code £85065 to the winning horse

THIRD RACE 3.00 The Sky Bet City Of York Stakes (Class 1) (Group 2) (CLASS 1) Distributed in accordance with the Stakes and Prize Money Code £226840 to the winning horse The second to receive £86000, the third £43040, the fourth £21440, the fifth £10760 and the sixth £5400 for three yrs old and upwards. Enter by noon, June 28th and pay £1400 stake, Scratch by noon, July 26th or pay £1600, Confirm by noon, August 15th and pay £1000, Supplementary Entry by noon, August 15th and pay £32000 stake, Declare by 10.00 a.m. August 18th. Weights: 3-y-o colts and geldings 9st 3lb; fillies 9st 4-y-o and up colts and geldings 9st 8lb; fillies 9st 5lb SKY BET has generously sponsored this race and will present a memento to the winning owner All number cloths to be carried in this race have been sponsored and will carry the name/logo of SKY BET The sponsorship payment of £500 will be distributed equally amongst all horses starting in this race in accordance with paragraphs 24 to 27 of the Stakes and Prize Money Code 40 entries, 14 at £1400, 15 at £3000, 11 at £4000 Closed June 28th, 2022. Owners Prize Money Winner £178240; Second £73160; Third £36600; Fourth £18280; Fifth £9160; Sixth £4560 Penalty Value: £226840 A SS For race details see page 57 FOURTH RACE 3.35 The Sky Bet Ebor Stakes (Class 2 Handicap) (Heritage Handicap) (CLASS 2) Distributed in accordance with the Stakes and Prize Money Code £300000 to the winning horse The second to receive £89950, the third £47500, the fourth £25000, the fifth £14300, the sixth £7500, the seventh £4750 and the eighth £2850 for four yrs old and upwards. Enter by noon, July 5th and pay £875 stake, Scratch by noon, July 26th or pay £1000, Confirm by noon, August 15th and pay £625, Declare by 10.00 a.m. August 18th. Lowest weight 8st 2lb; Highest weight not less than 9st 12lb Penalties, after July 16th, 2022, a winner of a race 4lb Of 2 races 7lb NOTE: Any horse rated above 110 shall initially be treated as having that rating and the highest weight allotted shall be 9st 12lb Subsequently, the excess over 110 in any rating shall be allotted to that horse without limitation to the highest weight to be carried.. SKY BET has generously sponsored this race and will present a memento to the winning owner All number cloths to be carried in this race have been sponsored and will carry the name/logo of SKY BET The sponsorship payment of £500 will be distributed equally amongst all horses starting in this race in accordance with paragraphs 24 to 27 of the Stakes and Prize Money Code The British Horseracing Authority will amend paragraphs 28 to 32 of the Weights and Handicapping Code and the Declaration of Jockey section of the Race Entries Code in the event that raising of the weights at the 24-hour stage proves necessary

PLEASE NOTE: The winners of the following “Race to the Ebor” races will be guaranteed a starting place in the 2022 Sky Bet Ebor (Class 2) (Heritage Handicap) and will not be subject to elimination, provided it is entered and declared in the normal way Sky Bet Melrose Handicap (Class 2) run at York on Saturday, 21 August, 2021, Sky Bet Jorvik Stakes (Class 2) run at York on Wednesday 11 May 2022, Sky Bet Premier Handicap run at The Curragh on Wednesday 1 June 2022, Sky Bet Grand Cup (Listed) run at York on Saturday 11 June 2022. PLEASE ALSO NOTE: If at the declaration stage the winner of a “Race to the Ebor” race is set to carry the lowest weight in the 2022 Sky Bet Ebor, its weight will be raised to the next lowest weight The winner, second and third placed horses of this race will be eligible to make a late entry to the 2022 Melbourne Cup to be run at Flemington Racecourse on Tuesday, 1 November, 2022 (closing date 2nd August) if an entry is made by Tuesday 23rd August 2022 (UK time). PLEASE NOTE: In accordance with the provisions of paragraph 9 of the Weights and Handicapping Code a horse must have run three times or more in order to qualify to run in this race. 65 entries, 23 at £875, 13 at £1875, 29 at £2500 Closed July 5th, 2022. Owners Prize Money Winner £233850; Second £78250; Third £41300; Fourth £21800; Fifth £12400; Sixth £6450; Seventh £4100; Eighth £2550 Penalty Value: £300000 19 Eliminated Under Rules (I)9 and (I)10 SS For race details see page 71.

The British Horseracing Authority has granted special permission to the York Racecourse Executive to stage a public Draw at which the stall numbers for declared runners will be allocated. The Draw will be broadcast live and will be overseen by a British Horseracing Authority official. Further details of the draw procedure will be published in due course This race will utilise York Racecourse’s 22-bay starting stalls. This race will be restricted to 22 runners plus two reserves. The two reserves will be nominated as R23 and R24. The procedure for the allocation and operation of the reserves protocol will be as detailed in the notice headed ‘Reserves’ which has been published in The Racing Calendar and which also appears in the important notices following the Standard Conditions on the Racing Bulletin area of the BHA Racing Administration Internet site www.racingadmin.co.uk. Trainers are reminded of the provisions of paragraph 41 of the Race Entry Code which require that they must notify the Racing Calendar Office immediately when the decision has been made not to run. This will maximise the list of runners and determine whether the weights will need to be raised. The British Horseracing Authority has modified the Declaration of Jockey section of the Race Entries Code and the Division of Races section of the Race Administration Code of the Rules of Racing for the purposes of this race.

For

The second to receive £32250 the third £16140 the fourth £8040 the fifth £4035 and the sixth £2025 for three yrs old and upwards. Enter by noon, August 15th and pay £1500 stake, Declare by 10.00 a.m. August 18th. Weights: 3-y-o colts and geldings 9st; fillies 8st 11lb 4-y-o and up colts and geldings 9st 7lb; fillies 9st 4lb Penalties, after 2021, a winner of a Group 3 race 3lb Of a Group 2 race 5lb Of a Group 1 race 7lb. SKY BET and THE SYMPHONY GROUP have generously sponsored this race and will present a memento to the winning owner All number cloths to be carried in this race have been sponsored and will carry the name/logo of SKY BET The sponsorship payment of £500 will be distributed equally amongst all horses starting in this race in accordance with paragraphs 24 to 27 of the Stakes and Prize Money Code The winner of the 2022 Sky Bet and Symphony Group Strensall Stakes will be granted an automatic invitation to the Bahrain International Trophy (Group 3) on 18th November 2022 at Sakhir Racecourse For more details contact the International Racing Bureau. 12 entries at £1500 Closed August 15th, 2022. Owners Prize Money Winner £66840; Second £27435; Third £13725; Fourth £6855; Fifth £3435; Sixth £1710 Penalty Value: £85065 A SS For race details see page 35 SECOND RACE 2.25 The Sky Bet Melrose Stakes (Class 2 Handicap) (Heritage Handicap) (CLASS 2) Distributed in accordance with the Stakes and Prize Money Code £77310 to the winning horse The second to receive £36255, the third £18135, the fourth £9060 the fifth £4530 and the sixth £2265. for three yrs old only Enter by noon, August 15th and pay £750 stake, Declare by 10.00 a.m. August 18th. Lowest weight 8st 2lb; Highest weight not less than 9st 9lb Penalties, after August 13th, 2022, for each race won 6lb NOTE: Any horse rated above 105 shall initially be treated as having that rating and the highest weight allotted shall be 9st 9lb Subsequently, the excess over 105 in any rating shall be allotted to that horse without limitation to the highest weight to be carried.. SKY BET has generously sponsored this race and will present a memento to the winning owner The British Horseracing Authority’s Development Fund has generously contributed £20000 towards the prize money for this race. All number cloths to be carried in this race have been sponsored and will carry the name/logo of SKY BET The sponsorship payment of £500 will be distributed equally amongst all horses starting in this race in accordance with paragraphs 24 to 27 of the Stakes and Prize Money Code 2023 Sky Bet Ebor: Race to the Ebor The winner of the 2022 Sky Bet Melrose Handicap Stakes will receive a guaranteed start position for the 2023 Sky Bet Ebor Although the start is guaranteed, the horse must still be entered in the 2023 Sky Bet Ebor in the normal way, paying the corresponding entry stake and fees at the scratching and confirmation stages. In the event that the horse is set to carry the lowest weight in the 2023 Sky Bet Ebor, the horse’s weight will be raised to the equivalent of the next highest horse in the weights. PLEASE NOTE: In accordance with the provisions of paragraph 9 of the Weights and Handicapping Code a horse must have run three times or more in order to qualify to run in this race. 23 entries at £750 Closed August 15th, 2022. Owners Prize Money Winner £60945; Second £30480; Third £15240; Fourth £7620; Fifth £3810; Sixth £1905 Penalty Value: £77310 SS For race details see page 49.

FIFTH RACE 4.10 The Sky Bet Constantine Stakes (Class 2 Handicap) (Heritage Handicap) (CLASS 2) Distributed in accordance with the Stakes and Prize Money Code £51540 to the winning horse The second to receive £24170, the third £12090, the fourth £6040, the fifth £3020 and the sixth £1510. for three yrs old and upwards. Enter by noon, August 15th and pay £500 stake, Declare by 10.00 a.m. August 18th. Lowest weight 8st 2lb; Highest weight 9st 12lb Penalties, after August 13th, 2022, for each race won 3yo 6lb; 4yo to 6yo 5lb; 7yo and up 4lb NOTE: Any horse rated above 110 shall initially be treated as having that rating and the highest weight allotted shall be 9st 12lb Subsequently, the excess over 110 in any rating shall be allotted to that horse without limitation to the highest weight to be carried.. SKY BET has generously sponsored this race and will present a memento to the winning owner All number cloths to be carried in this race have been sponsored and will carry the name/logo of SKY BET The sponsorship payment of £500 will be distributed equally amongst all horses starting in this race in accordance with paragraphs 24 to 27 of the Stakes and Prize Money Code PLEASE NOTE: In accordance with the provisions of paragraph 9 of the Weights and Handicapping Code a horse must have run three times or more in order to qualify to run in this race. 37 entries at £500 Closed August 15th, 2022. Owners Prize Money Winner £40630; Second £20320; Third £10160; Fourth £5080; Fifth £2540; Sixth £1270 Penalty Value: £51540 Weights raised 1lbs and paragraphs 27 to 31 of the Weights and Handicapping Code complied with where applicable 11 Eliminated Under Rules (I)9 and (I)10 SS For race details see page 77 SIXTH RACE 4.45 The Julia Graves Roses Stakes (Class 1) (Listed Race) (CLASS 1) Distributed in accordance with the Stakes and Prize Money Code £48203 to the winning horse The second to receive £18275, the third £9146, the fourth £4556, the fifth £2286 and the sixth £1147. for two yrs old only Enter by noon, August 15th and pay £425 stake, Declare by 10.00 a.m. August 18th. Weights: Colts and geldings 9st 2lb; fillies 8st 11lb Penalties, a winner of a Listed race 3lb Of a Pattern race 5lb THE FAMILY OF JULIA GRAVES has generously sponsored this race and will present a memento to the winning owner 17 entries at £425 Closed August 15th, 2022. Owners Prize Money Winner £37876; Second £15547; Third £7778; Fourth £3885; Fifth £1947; Sixth £969 Penalty Value: £48203.50 A SS For race details see page 83. SEVENTH RACE 5.20 The Sky Bet Finale Stakes (Class 2 Handicap) (CLASS 2) Distributed in accordance with the Stakes and Prize Money Code £41232 to the winning horse The second to receive £19336, the third £9672, the fourth £4832, the fifth £2416 and the sixth £1208. for three yrs old and upwards, Rated 0-105 (also open to such horses rated 106 and 107 see Standard Conditions). Enter by noon, August 15th and pay £400 stake, Declare by 10.00 a.m. August 18th. Lowest weight 8st 2lb; Highest weight 9st 12lb Penalties, after August 13th, 2022, for each race won 3yo 6lb; 4yo to 6yo 5lb; 7yo and up 4lb SKY BET has generously sponsored this race and will present a memento to the winning owner PLEASE NOTE: In accordance with the provisions of paragraph 9 of the Weights and Handicapping Code a horse must have run three times or more in order to qualify to run in this race. 35 entries at £400 Closed August 15th, 2022. Owners Prize Money Winner £32504; Second £16256; Third £8128; Fourth £4064; Fifth £2032; Sixth £1016 Penalty Value: £41232 SS race details see page 87.

93 FIRST RACE 1.50

Today’s Race Conditions

Official Cars • Competitive daily, weekly and weekend rentals. • Large selection of low mileage vehicles including MPVs and commercial. • Car and Van sales available upon request. • Delivery & collection service available. • 10% Discount on production of this advert YORK LEEDS (01904) 644919 (0113) 2721177 Clifton Garage Unit 8 Clifton Hunslett Trading Estate YORK LEEDS www.budget.co.uk Better Price Better Service Better Call 01904 620911 yorkracecourse.co.uk REMAINING FIXTURES 2022 SEPTEMBER MEETING Sunday 4th September YorkMix Family Raceday OCTOBER FINALE Friday 7th October Willam Hill Finale Friday Saturday 8th October Coral Sprint Trophy 94

Abandoned Racing

All persons visiting York Racecourse are admitted subject to Racecourse Regulations and the Rules of Racing. The Racecourse reserves the right to refuse admission or remove from the racecourse any person refusing to comply with the Rules and Regulations or whose presence is a source of danger or annoyance to others. A full set of entry rules can be viewed at www.yorkracecourse.co.uk.

Enquiries/Objections

Alcohol And Public Order

3. Respect the privacy of others. Cigarettes and e-cigarettes

The Small Print An A-Z of information for racegoers 95

In the event of racing being abandoned, refunds on badges and tickets purchased will only be paid in the following circumstances. a) before the first race 100% refund. b) before the completion of three races 50% refund. c) therafter no refund applies. Refunds cannot be made on racedays. To obtain a refund, racegoers who purchased their admission on the day should send the ticket they were given on entrance with their full name and address to: York Racecourse, York, YO23 1EX within 30 days.Racegoers who booked in advance direct with the track and so paid by card will receive an automatic refund. A similar process will apply for those who paid in advance by cheque. Please visit the racecourse website www.yorkracecourse.co.uk for more information.

Race Results and Photographs will also be displayed on the York Racecourse television monitors. Radios and Mobile Telephones

Litter Racegoers are requested to place all litter in the receptacles provided. If you do not need your racecard please place it in a bin as you leave the racecourse. Noise So that the horses have the best chance to perform and so your fellow racegoers have the opportunity to enjoy them please do not cause any distractions; the waving of flags or banners, use of radios or making of sudden noises are examples of things to avoid. Racegoers are reminded of Public Health England advice that shouting increases the risk of the spread of diseases, so to consider wearing your face covering when part of a cheering crowd.

In any race where Photo Finish has been called by the Judge, this information will be displayed on the Giant Screen. An announcement will also be broadcast.

Dogs

Photo Finishes And Stewards’

The use of all types of communication equipment is strictly controlled at all racecourses. Members of the public may not use two-way radios, scanning receivers etc., for any purpose at the racecourse.

York Racecourse reserves the right to refuse or, to require anyone to leave who does not observe the above code.

First Aid There are first aid posts in the Edwardian Weighing Room, other such buildings have been designated as isolation rooms, should they be required. Dress Standards Most racegoers like to make racing at York a special occasion and choose to dress accordingly. Gentlemen in the County Stand are required to wear a jacket, collared shirt and tie. It has always been the case that shorts and t-shirts have been welcome in Grandstand and Paddock.All racegoers are reminded that the removal of shirts is not encouraged and that basic decency and not causing offence to fellow racegoers by clothing choices, is required.

Drugs A zero tolerance policy on drug abuse is in force, be warned, North Yorkshire Police and our own team are watching with some canine help, sniffing.

Track Safety For your own safety and the welfare of the horses, jockeys and stable staff please keep off the track. Anyone trespassing on the track: Will be liable to arrest and prosecution Will be ejected immediately Will be banned from all future York race meetings May face a nationwide racecourse ban

The Racecourse takes its responsibilities under Licensing Laws very seriously and puts in place training and measures to exceed these obligations. Racegoers are urged to drink responsibly. Alcohol cannot be brought into the stands side enclosures. York Racecourse reserves the right to expel any person found to be drunk or behaving in a disorderly manner. The “Challenge 25” initiative will be in operation to ensure that only those aged 18 and over are served with alcohol. Thank you for your support of this obligation. Cameras Please feel free to take a souvenir photo of your day. However we would remind you that the preparation and performance of the sport must be ensured, so please note:1. Kindly refrain from flash photography. 2. Avoid taking photos in restricted areas used by the sporting professionals i.e. Saddling Boxes, Stables, Unsaddling Boxes & Weighing Room.

Parade Ring For safety reasons children under the age of twelve are not permitted into the Parade Ring or Unsaddling Enclosure.

The current smoking legislation regarding smoking in public places applies at the racecourse. The use of e-cigarettes is permitted, however they will be treated the same as tobacco products. Common Courtesy/Entry Conditions

Racegoers are requested to leave their pets including all dogs at home. Guide and Assistance dogs are welcome.

SAFE JOURNEY OME… Thank you for your support this year If you have any comments, please email to feedback@yorkracecourse.co.uk Please could we request that a special effort is made to respect our neighbours, with particular regard to noise in the surrounding streets. We look forward to welcoming you back again on Sunday 4th September for our Family Raceday, which features the Listed Garrowby Stakes. Follow us on Twitter or like us on Facebook @yorkracecourse Knavesmire Notes Keep a note of any horses that catch your eye this afternoon. You never know, they may be future winners here at York. ...................................................................................................................... ...................................................................................................................... MAKE A NOTE OF YOUR SELECTIONS FOR THIS AFTERNOON’S RACES Race 1 Race 2 Race 3 Race 4 Race 5 Race 6 Race 7 96

HamILTon 8TH may 1 yoRK 22nd may 2 muSSeLbuRgH 5TH june 3 ponTefRacT 19TH june 4 HaydocK 7TH auguST 5 Sandown 21ST auguST 6

Turn static files into dynamic content formats.

Create a flipbook