





























SARAH DRABWELL General Manager, Sandown Park Racecourse
![]()






























SARAH DRABWELL General Manager, Sandown Park Racecourse
Welcome to Sandown Park Racecourse.
This racecard will provide you with all the information you will need for your time with us. Should you wish for information about future fixtures, please scan the QR code below. We hope you enjoy your visit.

Chairman
Nick Mustoe
EBF ebfstallions.com

CHASEMORE FARM chasemorefarm.co.uk

SPILLERS spillers-feeds.com
Race Conditions can be found at the back of the racecard
Directors of the Racecourse Committee
Emma Banks
Vikki Dunn
Brian Finch
Charles Hemphill
Guy Henriques
Anna Mackenzie
General Manager
Sarah Drabwell
Head of Racing & Clerk of the Course
Andrew Cooper
Acting Clerk of the Course
Jason Loosemore
Estates Manager
Craig Williamson
Deputy Estates Manager
Steve Mills
Safety Officer
Gareth Richardson
Commentator
Mark Johnson
Betting Ring Manager
Andrew Boardley
Designated Safeguarding Lead
Sarah Drabwell
Deputy Safeguarding Leads
Andrew Cooper &
Gareth Richardson
Stewards
Sophie Candy (Chief Steward)
Robert Webb-Bowen (Stewards’ Panel Chair)
Joseph Chan, Ben Ford, Lyndsay Glynn
Starters
Robert Supple
Kieran O’Shea
Judge
David Hicks
Clerk Of The Scales
Paul Champion
Veterinary Officer
Jane Harry
Veterinary Surgeons
Simon Knapp, C.V.O., B.Sc., B.VetMed., M.R.C.V.S.
Clive Hamblin, B.Vet.Med., M.R.C.V.S.
Jamie Knapp, B.V.M.S., M.R.C.V.S.
Veterinary Spotter
Melvin Stafford M.A., Vet.M.B., M.R.C.V.S.
Medical Officers
Dr Lucy Free
Dr Rob Cullen
Dr Peter Johnson
Dr Mark Gorvin
Dr Graeme Robertson
Dr Rizwan Ghani
Equine Welfare and Integrity Officers
Suzanne Feltham, Stuart Shilston, Helena Warbrick






FOURTH
FIFTH
SIXTH RACE


The Jockey Club would like to thank our Group Partners for their support in 2026










4 CONSTITUTION RIVER (FR) (34) 211-11 D 38-13 (3)
B c Wootton Bassett - Chuppy (FR) (Le Havre (IRE)) Ryan Moore
M Tabor/D Smith/Mrs J Magnier/Westerberg Aidan O’Brien, Ireland
S.A.R.L. LG Bloodstock
TIMEFORMVIEWSlammedRoyalAscotwinnerGenericby7lengthsonChesterreturn.AlessstrikingperformancevisuallywhenbeatingreopposingstablemateHawkMountainby 3/4lengthinPrixduJockeyClubatChantilly(10.4f,goodtofirm)sincebuthedeservescreditforovercomingapoordraw.Hardtobeat. TFR
Aquick wayto see a horse’s past performance. These are its recent finishing positions.
Look out for Letters:
C = Has won at this course
D = Has won over this distance
CD = Has won over this distance at this course
BF = Was a beaten favourite
INFORMATION ON THE FORM
- = New racing season
/ = Missed racing season
P = Was pulled-up and didn’t finish the race
F = Horse fell
U = Rider unseated
R = Horse refused to race
CO = The horse was forced out of a race by a loose horse
B = Horse was brought down
S = Horse slipped
r = The horse ran around a jump or took the wrong course in a flat race
d = Disqualified
Bold form
figures = performance in all-weather (Flat) or Point-to-Point (Jump) races
How the experts rate the horse’s chances:
2. BHA rating = the higher the number, the better the horse.
3. Timeform view and TFR rating
Look out for the summary of leading course trainers before each race
Listen out for any jockeys who are having a successful day.
6. Owner’s colours worn by the Jockey
7. Saddlecloth number
8. Horse’s name
9. Days since the horse last run
10. Horse’s age
11. Jockey’s weight (stone and lbs)
12. The horse’s breeding – father (sire) and mother (dam)
13. Horse’s owner
14. Horse’s breeder
15. Birthplace of horse
16. Draw – position of the horse in the starting stalls
17. Sponsor (if applicable)
Select your horse. Note their name and saddlecloth number
Choose your bet. ‘To win’ or ‘each-way’ are popular types of bet.
‘To win’ is for your horse to come first. ‘Each-way’ is for your horse to come first or to be placed. It’s two bets, so ‘£2 each-way’ = £4 total bet.
Decide the amount – or stake – you are comfortable to bet.
Place your bet. There are different places to bet on course; The Tote, racecourse bookmakers, betting shop or online. Each option offers a different experience.
Collect. Once ‘Weighed-in’ has been announced, present your betting slip and collect any winnings.


SATURDAY 3 JULY





HANDICAP STAKES (CLASS 4)
for three yrs old and upwards x Total prize fund
Owners Prize Money 1st £4748, 2nd £2375, 3rd £1187, 4th £593, 5th £297. (PenaltyValue £6019.10)
RACE FACTS - A CLOSER LOOK
LEADING COURSE TRAINER (20-25): R Hannon (15 wins from 150 runners, 10%) runs BEST RATE TRAINER-IN-FORM (LAST 14 DAYS): E Walker (10 wins from 36 runners, 28%) runs HAPPY BANNER
LONGESTTRAVELLER: FARASI LANE trained by M Hammond, Middleham, 245 miles.


1 BEST RATE (GB) (12) 432411 D 4 10-4 (1)
Br B g Camacho - Nardin (Royal Applause) Seamus Cronin J
O J Palmer-Brown & Partner Richard Hannon, Marlborough T
B Petches Farm Ltd
TIMEFORMVIEWKnockingonthedoorbeforebelatedlyopeninghishandicapaccountwhenover1matAscotearlierthismonthpriortofollowingupfroma2lblowermark ina6-runnerhandicapatPontefract(1m,good,10/11)12daysago,quickeningclearunderhands-and-heels.Cangiveanotherboldbid. TFRHHHHI BHA87
2 FARASI LANE (IRE) (11) 465551 CD
8 9-10 (3)
Br B g Belardo (IRE) - No Such Zone (Oasis Dream) Oliver Carmichael (5) J
O Mr Anthony Bithell Micky Hammond, Middleham T
B Wicklow Bloodstock Ireland Ltd Micky Hammond Racing S
TIMEFORMVIEWLandedback-to-backhandicapsatWolverhamptoninMarchforDrRichardNewland&JamieInsolebeforenotchinghisthirdwinoftheseasonondebutfor thisyardina7-runnerhandicapatRipon(1m,good)11daysago,respondingwelltoedgeatightfinish.Just1lbhigherbutthislookstougher TFRHHHII BHA79
3 HAPPY BANNER (IRE) (20) 62-3322
4 9-7 (4)
Br B g Starspangledbanner (AUS) - Lady Clinch (IRE) (High Chaparral (IRE)) AshleyLewis J
O Mr Robert Black Ed Walker, Upper Lambourn T
B Mr Chris Clinch James Hambro & Partners Llp S
TIMEFORMVIEWIt’selevenrunssincehislastwinbuthe’sfinishedplacedonhislast5outings,sportingfirst-timecheekpieceswhensecondof8inhandicap (3/1)atEpsom(8.5f,goodtofirm)20daysago Beatenonlybyanunexposed3-y-othereandhecanbeinthemixagain. TFRHHHHI BHA76
4
(IRE) (25) 444543
Br B g Lucky Vega (IRE) - Lilli Milena (IRE) (Dansili)
O The Horse Watchers 4
3 9-7 (5)
Toby Moore (7) J
Michael Appleby, Oakham T
B Moyglare Stud Farm Trade Access Panels Ltd S
TIMEFORMVIEWFollowedupdebutwinforJosephO’BrienwithsuccessonstabledebutatSouthwellinJanuary.Hasprovedconsistentwithoutreallythreatening towinahandicapsincebutisofstronginterestnowfinallytakingonhiselders,withthestepupintriplikelytosuitaswell. TFRHHHHH BHA84
(12) 0124
3 9-4 (2)
Br B g Cable Bay (IRE) - Prufrock (IRE) (Roderic O’Connor (IRE)) Laura Coughlan J
O Rich Clothier & Jennifer Gray Kathy Turner, Sherborne T
B Mr Rich Clothier & Miss Jennifer Gray Wyke Farms Ltd S
TIMEFORMVIEWWellheldinadeepraceover11/4matNewburyondebutbutshowedmuchimprovedformtogetoffthemarkina7fChepstowmaidennexttime.Runner-upat Windsoronlatestoutbutseemedanchoredbyhisopeningmark(now2lblower)atWolverhampton12daysagoandhe’llneedtoimprovetotakethis. TFRHHIII BHA81
DECLAREDRUNNERS5 2025:GREATBLASKET(IRE)596WarrenFentiman10-3(DrRichardNewland&JamieInsole)6ran Hood worn by No 5. Tongue Strap worn by No 3. Sheepskin Cheek Pieces worn by No 2, 3.
Probable S.P’s: 15-8 Best Rate (GB), 3-1 Happy Banner (IRE), 7-2 Farasi Lane (IRE), 5-1 Jungle Ruler (IRE), 14-1 Brocklesby Bill (GB)
JUNGLE RULER should benefit from the weight allowance he receives from his elders on this belated first start outside of his age group and can make his first start at 1m a winning one. The hat-trick seeking Best Rate looks the obvious threat, with the in-form Happy Banner also considered.

Racing Post Standard Time: 1 min 41.10 secs Record Time: 1 min, 39.21 secs - El Hayem - 8th July 2017, Good to Firm
Sprint Course - Far Side (Rail 2 yards in) Remainder - Inside
DISTANCE TIME HORSE AGE WGT GOING DATE
5f 58.57 Battaash 38-12 Good to Firm July 8, 2017
5f 2yo59.48 Times Time 29-3 Firm July 22, 1982
7f 1m 26.36 Mawsuff3 9-0 Firm June 14, 1986
7f 2yo1m 26.56 Raven’s Pass 29-0 Good to Firm September 1, 2007
1m 1m 39.21 El Hayem4 8-12 Good to Firm July 8, 2017
1m 2yo1m 41.98Anshan 29-5 Good to Firm August 19, 1989
1m 1f 1m 55.64 Connemara Coast 38-11 Good to Firm June 17, 2023
1m 2f 2m 2.14 Kalaglow4 8-11 Good May 31, 1982
1m 6f 3m 1.08 Just Hubert 38-9 Good to Firm July 25, 2019 2m 3m 29.38 Caucus 69-0 Good to Firm July 6, 2013















for three yrs old and upwards x Total prize fund £11500
Owners Prize Money 1st £4748, 2nd £2375, 3rd £1187, 4th £593, 5th £297. (PenaltyValue £6019.10)
RACE FACTS - A CLOSER LOOK
LEADING COURSE TRAINER (20-25): R Hannon
(15 wins from 150 runners, 10%) runs WHEELS OF FIRE TRAINER-IN-FORM (LAST 14 DAYS): R Hannon (8 wins from 49 runners, 16%) runs WHEELS OF FIRE LONGESTTRAVELLER: JUSTCALLMEPETE trained by T Carroll, Cropthorne, 126 miles.


1 JUSTCALLMEPETE (GB) (48) 451315
Br B g Bated Breath - Firenze (Efisio)
(6)
Alexandra Egan (7) J
O Peter Clarke Racing Partners Tony Carroll, Cropthorne T
B Jan & Peter Hopper
TIMEFORMVIEWWonhandicapsatBathinAprilandWindsorinMaybeforerespectablefifthof8atNewburylastmonth. Hasa7lbclaimerbackaboardhereandshouldbecompetitiveifcopingwithfirsttrydownat5f
2 WHEELS OF FIRE (IRE) (58) 010640 D BF 4 9-12 (4)
Br B g Mehmas (IRE) - Azagba (FR) (Deportivo) Joe Leavy J
O Mrs Fitri HayRichard Hannon, Marlborough T
B C. Marnane JMH Group S
TIMEFORMVIEWWonatMusselburghinAprilbutbelowparlast2starts,finishingseventhof8atWindsorinJuneonlateststart. Freshenedupby58daysoffsinceandholdsclaimsifbackinform.
3 ATTICUM (GB) (39) 021-553 D 3 9-10 (3)
Br B c Ardad (IRE) - Peace Dreamer (IRE) (Sir Prancealot (IRE)) Jack Mitchell J
O Mrs Susan Hadida Robert Cowell, Newmarket T
B Mrs Susan F. Hadida Robert Cowell Racing S TIMEFORM VIEW Won minor event at Yarmouth over 5f last year but not kicked on in handicaps this time around, strugglingtogotheearlypacewhenthirdof6atRedcar39daysago Morerequired. TFRHHIII BHA85
4 NOVELETTE (IRE) (59) 32115-5 CD 3 9-9 (2)
Br B f Sioux Nation (USA) - Restless Endeavour (IRE) (Dandy Man (IRE)) Callum Rodriguez J
O M Tabor, D Smith & Mrs J Magnier Simon & Ed Crisford, Newmarket T
B Manor Farm Bloodstock Ashford Stud S
TIMEFORMVIEWWonoverC&DlastJulybeforefloppingonsoftgroundonnextandfinal2-y-oouting.Lookedrustywhenfifthof7ina handicapatNottinghamonreturnfrom9monthsoffinMayandcandobetterwiththatoutingunderherbelt. TFRHHHII BHA84
5 HYPNOTISED (GB) (96) 441-0 D
3 9-6 (7)
Br B g No Nay Never (USA) - Sleep Walk (Oasis Dream) Lewis Edmunds J
O Juddmonte Harry Charlton, Beckhampton T
B Juddmonte Farms Ltd Juddmonte Farms Inc S
TIMEFORMVIEWLookedpromisingwhenbeatingasubsequentwinnerinmaidenover5fatSouthwellinSeptember.Possiblyneededrunwhenseventhof9overC&DinApril after7monthsoffandhisall-weatherformsuggestshe’sonagoodmarksocouldbeabigplayerifreadytogoafterfurther3monthsoff TFRHHHHH BHA81
6 RAGE OF THUNDER (IRE) (20) 2-00513 BF 4 9-4 (1)
Br B g Inns of Court (IRE) - Stormy Clouds (IRE) (Sir Prancealot (IRE)) Jason Watson J
O B D Haynes, G L Moore, Alan Jamieson Gary & Josh Moore, Horsham T
B Tally-Ho Stud KM Elite Products Ltd S
TIMEFORMVIEWWonover6fatNewburyinJune,thenthirdof8atEpsom20daysago.Sufferedanothertardystartonthatoccasionbut travelledwellandranon.Wellcapablefromthismarkbutstartingissuesremainaconcern,especiallybackdownat5f TFRHHHII BHA75
7 ARMY
(IRE) (306) 52140- D 3 9-0 (5)
Br Ch g Soldier’s Call - Elegant Drama (IRE) (Dandy Man (IRE)) Edward Greatrex J
O Rhonehurst Stables Warren Greatrex, Upper Lambourn T
B Rathbride Farm Warren Greatrex Racing S TIMEFORMVIEWWonmaidenatLeicesterlastJunebutstruggledwhenlastof7atHaydockinSeptemberonfinal2-y-o startandhe’sbeenabsentsince.Facesastifftaskonreturn. TFRHIIII BHA75
DECLARED RUNNERS 7 2025: NOVELETTE (IRE) 2 9 3 Hollie Doyle 10-3 (Simon & Ed Crisford) 5 ran Blinkers worn by No 1. Running for the first time since Gelding No 5, 7. Stewards Note: RAGE OFTHUNDER: Following its run on 9/7/2026 it was reported that the horse was slowly away.
Probable S.P’s: 5-2 Rage ofThunder (IRE), 9-2 Justcallmepete (GB), 5-1 Hypnotised (GB), 7-1 Wheels of Fire (IRE), Novelette (IRE), 10-1 Atticum (GB), 18-1 Army Bugler (IRE)
HYPNOTISED is in good hands and looks well worth a chance to bounce back from a tame reappearance given the strength of his all-weather form and the fact that his likely main rivals, Justcallmepete and Rage of Thunder, both have drops in trip to contend with.
RACE RESULTS


The Horserace Betting Levy Board (HBLB) has allocated £77.1m in prize money for 2026.
Since 2000 HBLB has invested £1.5bn in prize money to support the British horseracing industry


































for novice two yrs old x Total prize fund £13000
Owners Prize Money 1st £5547, 2nd £2773, 3rd £1387, 4th £693. (PenaltyValue £7020)
RACE FACTS - A CLOSER LOOK
LEADING COURSE TRAINER (20-25): J & T Gosden (31 wins from 142 runners, 22%) runs LANCASTER TOWER TRAINER-IN-FORM (LAST 14 DAYS): R Beckett (8 wins from 41 runners, 20%) runs DANCING DUNES
FANCYTHAT: C Appleby won this race in 2018 and 2022. The stable runs QUEST FOR STARS today.
LONGESTTRAVELLERS: LANCASTER TOWER trained by J & T Gosden & QUEST FOR STARS trained by C Appleby - both Newmarket, 81 miles.
1QUEST FOR STARS (FR) (20) 1 D

Br B c Sea The Stars (IRE) - Singforthemoment (IRE) (No Nay Never (USA)) ConnorPlanas J
O Godolphin Charlie Appleby, Newmarket T
B Ind. N. Singforthemoment 2024 Emirates S
TIMEFORMVIEW€700,000yearling,SeaTheStarscoltwhowasverymuchyardsecondstring(18/1SP)butprovedarealprofessionalinmakingawinningstartin7-runner noviceatDoncaster(7f,firm)justunder3weeksago,verymuchhavingtherunofthingsbutrespondingwell.Penalisedbutsuretoprogress. TFRHHHHH BHA-
2
9-4 (6)
Br B c Torquator Tasso (GER) - Delegation (FR) (Mount Nelson) Edward Greatrex J
O Mr M. J Rembaum Ralph Beckett, Kimpton Down T
B B. Holubova
TIMEFORMVIEWEUR115,000yearling,TorquatorTassocolt.Half-brothertoseveralwinners,includingsmart11/4m-11/2mwinnerDardanos,useful11/4m-11/2m winnerDelgardo DamFrench/German11/4m-11/2mwinnerYard4-23thisseasonwith2-y-odebutantsattimeofwriting. TFRHHHII BHA-
9-4 (7)
Br B c Lope de Vega (IRE) - Folk Dance (Golden Horn) Joe Leavy J
O Mr Ryan Kent Brian Meehan, Manton T
B Dunchurch Lodge Stud Company Sirecam Europe S
TIMEFORMVIEW200,000gnsfoal,LopeDeVegacolt.Dam1m-11/2mwinneroutofsmart11/4m-11/2mwinner(stayedeasy13/4m) FolkOpera.Stableyettohavea2-y-odebutwinnerthisyearsoeasytolookelsewhere. TFRHHIII BHA-
4 KING HIGH (GB) (-)
9-4 (1)
Br B c Kingman - Bella Nouf (Dansili) Callum Rodriguez J
O ValmontOwen Burrows, Lambourn T
B The Bella Nouf Partnership Tote S TIMEFORMVIEWFoaledMay27.200,000gnsfoal,320,000gnsyearling,Kingmancolt.Half-brothertoseveralwinners,includingsmart winnerupto11/4mRunningLionanduseful2-y-o6f/7fwinnerMajesticGlory Marketsupportshouldbenoted. TFRHHHII BHA-
5 LANCASTER TOWER (GB) (-)
9-4 (2)
Br B c Kingman - Castle Lady (IRE) (Shamardal (USA)) Robert Havlin J
O HM The King & HM The Queen John & Thady Gosden, Newmarket T
B King Charles III
TIMEFORMVIEWKingmancolt.Half-brothertouseful1mwinnerCrownEstateand1mwinnerPortcullis.Dam,French1m(includingPouled’EssaidesPouliches) winner,outofsistertoBreeders’CupClassicwinnerRaven’sPass.Yard2-5thisseasonwith2-y-odebutantsattimeofwriting. TFRHHHHI BHA-
9-4 (5)
Br B c Saxon Warrior (JPN) - Dawn Wall (AUS) (Fastnet Rock (AUS)) Callum Hutchinson J
O Mick and Janice Mariscotti Andrew Balding, Kingsclere T
B Rockhart Trading LtdKingsclere Stud S
TIMEFORMVIEWFoaledMarch23.70,000gnsyearling,SaxonWarriorcolt.Half-brotherto2-y-o1mwinnerAlbulaand11/2mwinnerBardofAvon.Dam,usefulAustralian 1m(Group3)-9fwinner,closelyrelatedtosmartwinnerupto1mOsaila.Yard3-35thisseasonwith2-y-odebutantsattimeofwriting. TFRHHHII BHA-
9-4 (3)
Br Br c Twilight Son - Desert Liaison (Dansili) Lewis Edmunds J
O OTI Racing P Inglett S de Zoete &Partner Harry Charlton, Beckhampton T
B Hungerford Park Stud Tattersalls S
TIMEFORMVIEWTwilightSoncoltwhowasverygreenwhenseventhof10innoviceatNewbury(6f,firm)ondebutearlier inthemonth.Likelytoneedmoretime. TFRHHIII BHA-
DECLARED RUNNERS 7 2025: OXAGON (FR) 2 9 2 Luke Catton 10-3 (John &Thady Gosden) 8 ran
ProbableS.P’s: 2-1 Quest ForStars (FR), 3-1 LancasterTower(GB), 7-2 King High (GB), 10-1 Dancing Dunes (GER), 14-1 Grove Street (GB), 16-1 Montalbano (IRE), 50-1 Secano (GB)
Charlie Appleby’s colt gets








for three yrs old x Total prize fund £8500
Owners Prize Money 1st £3510, 2nd £1755, 3rd £877, 4th £439, 5th £219 (PenaltyValue £4448.90)
RACE FACTS - A CLOSER LOOK
LEADING COURSE TRAINER (20-25): R Millman
(13 wins from 50 runners, 26%) runs NEXT GUILIAN TRAINER-IN-FORM (LAST 14 DAYS): R Millman (8 wins from 25 runners, 32%) runs NEXT GUILIAN LONGESTTRAVELLER: SOGNIAMO trained by D O’Meara, Upper Helmsley, 187 miles.


1 NEXT GUILIAN (GER) (16) 3-065
Br B g Guiliani (IRE) - Next Holy (IRE) (Holy Roman Emperor (IRE)) Lewis Edmunds J
O Mr J. H. Frost Rod Millman, Cullompton T
B Gestut WittekindshofRod Millman Racing Ltd S TIMEFORMVIEWShowedimprovementwhenfifthof11inanoviceatWindsor16daysago,settlingbetterthanonprevious starts.Morerequiredmakinghandicapdebutbuthisstablecontinueinexcellentform.
2 SANTIAGO BOY (GB) (23) 0540
Br B g Mayson - Atlantic Isle (GER) (Tamayuz)
O Rosehill Racing III
(1)
Jason Watson J
Charles Hills, Lambourn T
B Boocock Trading Ltd Wishanger Estates Ltd S
TIMEFORMVIEWMakeshandicapdebutafterfailingtoimpresslast2starts,missingthebreakandhangingleftunder pressureonlatter First-timeblinkersnowreachedfor.
3 SYDNEY ROCK (GB) (16) 222-00 9-9 (4)
Br Ch f Australia - Star Rock (Fastnet Rock (AUS))
O Arbib Bloodstock Partnership
Ashley Lewis (5) J
Oliver Cole, Whatcombe T
B Arbib Bloodstock Partnership P. F. I. Cole Ltd S
TIMEFORMVIEWPromisewhenrunner-upall3startsasa2-y-oandhadexcusesforfailingtobeatarivalyetthistimearound,missingbreakoveraninadequate triplasttime.Thereturntothistripissuretohelpsoshecoulddomuchbetterif,aslookslikely,shegetsherownwayinfront. TFRHHHHH BHA70
4 HOME HERO (IRE) (27) 644-300
Br Ch g El Kabeir (USA) - Lady’s Purse (Doyen (IRE))
9-9 (2)
Robert Havlin J
O Sustainable Building Sevices(UK) & Owen Hugo Palmer, Malpas T
B Coolawn Stud Coral Racing Limited S
TIMEFORMVIEWBesteffortwhenthirdinfairlystrongraceatChesterover11/4monreappearanceinMaybutgonethewrongwaysince, includinginfirst-timecheekpieceslasttime.Nowdropsbackintripandtriedinvisorwhichcouldsparkarevival. TFRHHHII BHA70
5 SOGNIAMO (GB) (12) 0-105
9-8 (9)
Br B f Oasis Dream - Grace And Favour (Montjeu (IRE)) Callum Rodriguez J
O Aurelius Racing David O’Meara, Upper Helmsley T
B Coln Valley Stud Glide Property Finance Ltd S TIMEFORMVIEWCausedashock80/1winonstabledebutinMayafterleavingMarcusTregoningbuthasstruggledin handicapssince. TFRHHIII BHA69
6 GALBA (GB) (47) 3-0363
9-8 (6)
Br Br c Lope Y Fernandez (IRE) - Mystic Jade (Raven’s Pass (USA)) Jack Mitchell J
O Mr Kevin Frost Kevin & Lauren Frost, Newark T
B Fernham Farm Ltd Kevin Frost Racing S TIMEFORMVIEWShowedimprovedformwhenthirdof10inahandicapover7fatthiscourseonfinalstartforRichardHannoninJune.Sincepurchased for£25kandswitchedtoastableingoodformsothatmaynotstallhisprogressandthisstepbackupto1mwillsuit. TFRHHHHI BHA69
7 TERRANOBLE (GB) (67) 0-3160 9-6 (7)
Br B c Ubettabelieveit (IRE) - Carmenere (Dawn Approach (IRE)) Rob Hornby J
O Ms Imelda CoakleyDenis Coakley, West Ilsley T
B Llety Farms Denis Coakley Racing S TIMEFORMVIEWWonaweakall-weathernoviceinJanuaryandhasfailedtobeatarivalinhandicapsonturfsincesois veryhardtomakeacasefor.
8 INGEMAR (GB) (23) 500 8-13 (8)
Br Ch g Victor Ludorum - Alpen Glen (Halling (USA)) Joe Leavy J
O Martin Hughes and Partners
B Jocelyn Targett
Brian Meehan, Manton T
Old Oak Holdings Ltd S
TIMEFORMVIEWNotwithouthopeonpedigreebutprovedmuchtoofreeinqualifyingforamark.Nowmakeshandicap debutwithhoodappliedandcouldprogressifsettling.
9 BENNYWORTH (IRE) (13) 206040
8-8 (3)
Br B g Supremacy (IRE) - Scat’s Rose (CAN) (Scat Daddy (USA)) Tyler Heard J
O Dark Blue Bloodstock Jim Boyle, Epsom T
B Yeomanstown Stud Jim Boyle Racing S TIMEFORMVIEWWinlessin9careerstartsandlittletorecommendhimjudgedonrecenteighthof9atEpsom13daysago, slowlyawayandgoingwithlittlefluency
TFRHIIII BHA55
DECLARED RUNNERS 9 2025: EARTHWATCH (IRE) 3 9 9 Cieren Fallon EVENS (William Haggas) 7 ran Hood worn first time by No 8. Blinkers worn first time by No 2. Visor worn first time by No 4.
Probable S.P’s: 5-2 Galba (GB), 5-1 Home Hero (IRE), 6-1 Next Guilian (GER), 7-1 Sydney Rock (GB), 8-1 Santiago Boy (GB), 10-1 Sogniamo (GB), 12-1 Ingemar (GB), 40-1 Terranoble (GB), Bennyworth (IRE) SYDNEY ROCK has struggled on both starts this year but there are valid excuses, particularly her last outing over an inadequate 6f where a slow start didn’t help The return to 1m should prove much more suitable given her breeding, and she could prove hard to peg back if getting herway out in front. Galba showed improved form when third here last month and can build on that starting out for a new yard, while Home Hero also merits some respect.
TIMEFORM PREDICTION:

Find out more about today’s race sponsor at
Racing Post Standard Time: 1 min 41.10 secs Record Time: 1 min, 39.21 secs - El Hayem - 8th July 2017, Good to Firm



Working alongside the Racecourse Association (RCA), bookmakers have introduced standard each-way betting terms across Jockey Club Racecourses. Bookmakers will provide these terms, or better, when offering each-way betting.
Fewer than 3 runners: win bets only, no places offered
3 or 4 runners: all to win. Where a bookmaker wishes to depart from this default position he may offer place terms for 3 or 4 runners, this must be at 1/5 odds a place 1-2
5 to 7 runners (inclusive): 1/4 (one quarter) odds for finishing 1st or 2nd
8 or more runners: 1/5 odds for finishing 1st, 2nd or 3rd
Handicap races with 12 to 15 runners (inclusive): 1/4 odds for finishing 1st, 2nd or 3rd
Handicap races with 16 to 21 runners (inclusive): 1/5 odds for finishing 1st, 2nd, 3rd or 4th
Handicap races with 22 or more runners: 1/4 odds for finishing 1st, 2nd, 3rd and 4th
forthreeyrs old and upwards fillies and mares x Total prize fund £8500
Owners Prize Money 1st £3510, 2nd £1755, 3rd £877, 4th £439, 5th £219 (PenaltyValue £4448.90)Weights raised 2lb and paragraphs 27to 31 ofthe Weights and Handicapping Code compliedwithwhere applicable.
RACE FACTS - A CLOSER LOOK
LEADING COURSE TRAINER (20-25): E Walker
(7 wins from 60 runners, 12%) runs SPIRIT OFATHENE TRAINER-IN-FORM (LAST 14 DAYS): E Walker (10 wins from 36 runners, 28%) runs SPIRIT OFATHENE LONGESTTRAVELLER: ENAMORUS trained by H Palmer, Malpas, 184 miles.


1 KIMEKO GLORY (GB) (27) 205450 CD 4 10-0 (10)
Br B f Kameko (USA) - Applause (IRE) (Danehill Dancer (IRE)) Taryn Langley (5) J
O La Bosh Charles Hills, Lambourn T
B Overbury Stallions Ltd Wishanger Estates Ltd S
TIMEFORM VIEW Three-time winner for Brian Toomey last year and good efforts when runner-up on first 2 starts for currentyard Hasn’tkickedonsinceandothersarepreferredatpresent.
2 CELESTIAS COMET (IRE) (25) 0-66551 D 4 10-0 (3)
Br Ch f Saxon Warrior (JPN) - Tobairin (IRE) (Teofilo (IRE)) Jonny Peate J
O Mr & Mrs Dowling and Mr & Mrs MarneyJames Fanshawe, Newmarket T
B Prospect Stables Pegasus Stables LLP S
TIMEFORMVIEWHoodedwhenlandingtheoddsin1mSouthwellnovicelastautumn.Hadslippedintheweightsandwasproducedperfectlyfromoffasoundgallop toreadilynotchafirsthandicapsuccessina6-runnereventatNottingham(11/4m,good,15/8)25daysago Nottakenlightlyafter3lbrise. TFRHHHHI BHA71
3 AMMOONY (FR) (72) 54-221 D 3 9-9 (4)
Br B f Zarak (FR) - Les Vertus (FR) (Shakespearean (IRE)) Jack Mitchell J
O Mr Khalifa Dasmal Tom Clover, Newmarket T
B Haras Du Hoguenet,Mr A Gaudu,Mr J P Stab T Clover Racing Limited S
TIMEFORMVIEWBeattherestdecisivelywhensecondof9atLingfield(11/4m)onhandicapdebutbeforegoingoneplacebetterinan8-runner handicapatRedcar(11/4m,goodtofirm)72daysago Opentofurtherimprovementandshouldgocloseafter6lbrise. TFRHHHHI BHA75
4 TAKE AVIEW (GB) (30) 343
3 9-8 (1)
Br B f Sea The Stars (IRE) - Time Chaser (Dubawi (IRE)) Lewis Edmunds J
O Juddmonte Harry Charlton, Beckhampton T
B Juddmonte Farms (East) Ltd Juddmonte Farms Inc S
TIMEFORMVIEWWell-bredfillywasanencouragingthirdof14ina11/4mmaidenatNewburyinAprilbutdidn’tgowithanythinglikethesamepromisewhenfourthatSalisbury nexttimeandtookanotherbackwardsstepwhenthirdof5innovice(9/2)atPontefract(1m,goodtofirm)lastmonth.Makeshandicapdebut. TFRHHHII BHA74
5
DE VEGA (IRE) (15) 3-35021 D 3 9-7 (6)
Br B f Lope de Vega (IRE) - Legal Lyric (IRE) (Lawman (FR)) Callum Rodriguez J
O Michael PTudor & Mr J. P. M. O’Connor Dr Richard Newland & Jamie Insole, Droitwich T
B John O’Connor Coulthursts Ltd S
TIMEFORM VIEW Runner-up at Ripon last month and didn’t need to improve on that form to get off the mark in a 4-runner handicap (7/4) atLeicester(11/4m,goodtofirm)15daysago,travellingfluentlybeforeassertinggradually Up3lbinadeepercontesthere TFRHHHII BHA73
6
(GB) (16) 11-1232 D BF 3 9-7 (7)
Br B f A’Ali (IRE) - Rosalie Bonheur (Siyouni (FR)) Rob Hornby J
O Mrs Judy Maitland Jones & Partners Jonathan Portman, Upper Lambourn T
B Mrs Judy Maitland-Jones Pump Technology Limited S TIMEFORMVIEWCompletedahat-trickofhandicapsuccessesatLingfieldinApril.Hasremainedingoodformintotheturfseason,placedforthethird outinginarowwhensecondof5inhandicapatWindsor(11/4m,goodtofirm)16daysago Shouldgiveanothergoodaccount. TFRHHHII BHA73
7 COME ON EIBHLIN (IRE) (25) 463345 3 9-5 (2)
Br B f Space Blues (IRE) - Absolutely Right (IRE) (Teofilo (IRE)) Robbie Downey J
O Hold My Beer, Gee Gees Racing & N. Clark Dylan Cunha, Newmarket T
B David MooneyAerocom UK Ltd S TIMEFORMVIEWHoldingherformwellindefeatatpresent,thoughhintedataquirkysidewhenfifthof9inhandicap(10/3) atBeverley(8.5f,good)25daysago Tonguestrapon1sttime.Othersmorepersuasive. TFRHHHII BHA71
8 PERSHALLA (GB) (6) 120050 4 9-5 (9)
Br B f Persian King (IRE) - Hulcote (Frankel) Robert Havlin J
O Pershalla Partnership
Amanda Perrett, Pulborough T
B Clearwater Stud Tattersalls S TIMEFORMVIEWCausedasurpriseinafirst-timehoodwhenwinningatKempton(11/2m)inApril.Mostlyrespectableeffortssincebuthasn’tbeenseentobesteffectonher last2outings,runningintotroublejustasshestartedtobuildmomentumwhenlastof7inhandicap(14/1)atthisC&D(good)6daysago
9 ENAMORUS (IRE) (25) 323-503
Br Ch f Mehmas (IRE) - Perfect Light (IRE) (Galileo (IRE))
O The Gene Genies III
39-5 (5)
Jason Watson J
Hugo Palmer, Malpas T
B Chasemore Farm Coral Racing Limited S
TIMEFORMVIEWPlacedall3startsat2yrsandproducedherbestefforttodateinfirst-timecheekpieceswhenthirdof9inhandicapatBeverley (8.5f,good)25daysago,comingoffthebridlesomewayoutbutstickingtohertask.Worthatryatthisevenlongertrip TFRHHHII BHA71
SPIRIT
(GB) (18) 031-2
Br B f Time Test - Spirit of Appin (Champs Elysees)
39-4 (8)
Ashley Lewis (5) J
O Much More Racing Ed Walker, Upper Lambourn T
B Wellsummers Farm
TIMEFORMVIEWHasimprovedwitheachrunandgotoffthemarkingoodstylein8-runnerall-weathernoviceatLingfield(1m)inDecember Onlyjustdeniedmakingher handicapdebutaftera7-monthbreakwhenrunner-upina5-runnereventatSalisbury(11/4m,goodtofirm,9/4)18daysago,Cangoonebetter TFRHHHHH BHA70
DECLARED RUNNERS 10 2025: KIMEKO GLORY 3 9 6 Hector Crouch 15-2 (Brian Toomey) 10 ran
Tongue Strap worn first time by No 7. Hood worn by No 2, 8. Tongue Strap worn by No 4.
Sheepskin Cheek Pieces worn by No 9.
Stewards Note:
COME ON EIBHLIN: Following its run on 4/7/2026 it was reported that the horse hung left-handed throughout.
Probable S.P’s: 7-2 Spirit of Athene (GB), 5-1 Ammoony (FR), 6-1 Melody de Vega (IRE), 13-2 Celestias Comet (IRE), 8-1 Lady Milton (GB), 12-1 Take A View (GB), Come On Eibhlin (IRE), Enamorus (IRE), 33-1 Pershalla (GB), 40-1 Kimeko Glory (GB)
SPIRIT OFATHENE only narrowly failed to make a successful handicap debut earlier in the month but can be expected to improve further with race fitness now on her side. Redcar winner Ammoony is another likely improver on her return from a short break, with Nottingham winner Celestias Comet also shortlisted in a race where it’s hard to rule many out.
TIMEFORM PREDICTION: 1.SPIRIT OFATHENE 2.AMMOONY (FR) 3.CELESTIAS COMET (IRE)

Find out more about today’s race sponsor at spillers-feeds.com
Racing Post Standard Time: 2 mins 7.00 secs
Record Time: 2 mins, 2.14 secs - Kalaglow - 31st May 1982, Good
The team at Sandown recognise how important you are to our business. Our Customer Promise is that we are committed to delivering the best experience we can for you by:
Being welcoming and friendly
Treating you with respect
Being flexible to your needs
Being committed to consistently delivering quality & value
Providing clear and relevant information in a timely and appropriate manner
Encouraging and valuing your feedback to help us improve your experience
All we ask is that if you feel like we haven’t delivered on this promise or would like to offer us any feedback on your experience, please do let us know by emailing us at: sandown.information@thejockeyclub.co.uk
for three yrs old x Total prize fund £11500
Owners Prize Money 1st £4748, 2nd £2375, 3rd £1187, 4th £593. (PenaltyValue £6019.10)Weights raised 1lb and paragraphs 27to 31 ofthe Weights and Handicapping Code compliedwithwhere applicable.
RACE FACTS - A CLOSER LOOK
LEADING COURSE TRAINER (20-25): J & T Gosden (31 wins from 142 runners, 22%) runs OUTFLANK TRAINER-IN-FORM (LAST 14 DAYS): O Sangster (7 wins from 25 runners, 28%) runs KAKIRRA LONGESTTRAVELLER: OUTFLANK trained by J & T Gosden & LASTVERSE trained by J Parrboth Newmarket, 81 miles.


1 LASTVERSE (IRE) (26) 353-01
(2)
Br B g Camelot - After (IRE) (Danehill Dancer (IRE)) Jack Mitchell J
O Trevor and Ruth Milner Joseph Parr, Newmarket T
B Coolmore Tote S
TIMEFORMVIEWShowedimprovedformtogetoffthemarksportingfirst-timecheekpiecesin4-runnerhandicapatChepstow(11/2m,goodtofirm)earlierinthemonth,helped bybeingallowedtosethisownfractions.Hasmovedyardssince(20,000gns)butunexposedovermiddledistancesandcanprogressagain. TFRHHHII BHA77
2 OUTFLANK (IRE) (40) 3-336 9-7 (1)
Br B g Churchill (IRE) - Enrol (Pivotal) Faleh Bughenaim J
O Wathnan Racing
John & Thady Gosden, Newmarket T
B Rabbah Bloodstock Limited Damsa Holding Company W.L.L S
TIMEFORMVIEWRantoasimilarlevelwhenthirdonall3startsinmaiden/novices.Failedtoprogresssportingfirst-timeblinkerswhenlastof6on handicapdebutatNewmarket(11/2m,goodtofirm)justunder6weeksagoandhopespinnedonthisstepupto13/4m. TFRHHIII BHA75
3 KAKIRRA (IRE) (20) 401111 8-12 (4)
Br B g Australia - Moonlife (IRE) (Invincible Spirit (IRE)) Rob Hornby J
O Adams, Harris and Naylor Ollie Sangster, Marlborough T
B Loughtown Stud
TIMEFORMVIEWMuchimprovedsincesenthandicapping,displayingplentyofresolutiontobringupthe4-timerin5-runnereventatNewbury (13.3f,firm)justunder3weeksago Atoughandlikeablesort,heremainsofinterestfroma5lbhighermark. TFRHHHHH BHA66
4 BOILERMAKER (FR) (11) 00-4232 BF 8-12 (3)
Br Ch g Teofilo (IRE) - Craic Agus Spraoi (IRE) (Intense Focus (USA)) Lewis Edmunds J
O W G & A G Vestey, E Gerber and P Inglett Harry Charlton, Beckhampton T
B Elwick Stud Tattersalls S
TIMEFORMVIEWDidn’tshowmuchin3noviceeventsat1mbutdifferentpropositionswitchedtohandicaps/uppedintrip,againturnedoveratshortoddssportingfirst-time cheekpieceswhensecondof5inhandicapatDoncaster(11/2m,firm)11daysago Looksamatteroftimebeforehegetsoffthemark. TFRHHHHI BHA66(-1)
DECLARED RUNNERS 4
2025: SCARLET MOON 3 9 6 Hollie Doyle 18-1 (Archie Watson) 6 ran Blinkers worn by No 2. Sheepskin Cheek Pieces worn by No 1, 4. Stewards Note:
OUTFLANK: Following its run on 19/6/2026 it was reported that the horse would prefer a slower surface.
Probable S.P’s: 9-4 Kakirra (IRE), 5-2 Last Verse (IRE), Boilermaker (FR), 13-2 Outflank (IRE)
Impossible to rule out any ofthe quartet but KAKIRRA hasn’t looked back since being switched to handicaps/upped in trip and with the ceiling of his ability yet to be ascertained, Ollie Sangster’s 3-y-o can stretch his winning sequence to 5. Boilermaker can edge out stable-switcher Last Verse for the forecast spot.
TIMEFORM PREDICTION: 1.KAKIRRA (IRE) 2.BOILERMAKER (FR) 3.LASTVERSE (IRE)


We hope that you have enjoyed your visit to Sandown Park and we look forward to welcoming you back in the future. Please help us to maintain and improve our customer service standards and the racegoing experience at Sandown Park by letting us know if you have any thoughts on how we can improve
Contact the Racecourse Office during racing today. Alternatively you can e-mail us your thoughts at: sandown.information@thejockeyclub.co.uk











First Race 5.45 - THE SPILLERS FUTURE CHAMPIONS APPRENTICE HANDICAP STAKES (CLASS 4) Distributed in accordance with the Stakes and Prize Money Code £6019 to the winning horse The second to receive £2824, the third £1411, the fourth £706 and the fifth £351. for three yrs old and upwards, Rated 66-85 (also open to such horses rated 86 and 87; such horses rated 65 and below are also eligible - see Standard Conditions) £57 stake if the horse is rated 66 or higher, or £11 stake if the horse is rated 65 or lower with £46 extra if the horse is declared to run Declare by 10.00 a.m. July 27th. Lowest weight: 4-y-o and up 8st 11lb; 3-y-o 8st 3lb Highest weight: 4-y-o and up 10st 2lb; 3-y-o 9st 8lb Penalties, after July 18th, 2026, for each race won 3yo 6lb; 4yo to 6yo 5lb; 7yo and up 4lb To be ridden by Apprentice Jockeys, Overseas Jockeys eligible under Rule (B)42 and Professional Jockeys eligible to claim a weight allowance under paragraph 52 ofthe Weights and Handicapping CodeAllowances: Jockeys who, priorto July 26th, 2026, have not ridden more than 50 winners in races under the Rules of Racing or the Rules of a recognised Racing Authority 3lb Jockeys who have not ridden more than 25 such winners 5lb Jockeys who have not ridden more than 10 such winners 7lb (Only one of these allowances may be claimed) SPILLERS has generously sponsored this race 9 entries, at £57 - Closed July 23rd, 2026. Owners Prize Money.Winner£4748;Second£2375;Third£1187;Fourth£593;Fifth£297.(PenaltyValue£6019.10)ASS SEE PAGE 12 FOR THIS RACE.
Second Race 6.15 - THE SPILLERS HANDICAP STAKES (CLASS 4) Distributed in accordance with the Stakes and Prize Money Code £6019 to the winning horse The second to receive £2824, the third £1411, the fourth £706 and the fifth £351. for three yrs old and upwards, Rated 66-85 (also open to such horses rated 86 and 87; such horses rated 65 and below are also eligible - see Standard Conditions) £57 stake if the horse is rated 66 or higher, or £11 stake if the horse is rated 65 or lower with £46 extra if the horse is declared to run Declare by 10.00 a.m. July 27th. Lowest weight: 4-y-o and up 8st 9lb; 3-y-o 8st 5lb
Highest weight: 4-y-o and up 10st; 3-y-o 9st 10lb Penalties, after July 18th, 2026, for each race won 3yo 6lb; 4yo to 6yo 5lb; 7yo and up 4lb SPILLERS has generously sponsored this race. 11 entries, at £57Closed July 23rd, 2026. Owners Prize Money. Winner £4748; Second £2375; Third £1187; Fourth £593; Fifth £297. (PenaltyValue £6019.10) SS
SEE PAGE 16 FOR THIS RACE.
Third Race 6.50 - THE CHASEMORE FARM EBF NOVICE STAKES (CLASS 3) (GBB RACE) Distributed in accordance with the Stakes and Prize Money Code £7020 to the winning horse The second to receive £3295, the third £1648 and the fourth £824. for novice two yrs old, which are E.B.F eligible. Enter by noon, July 23rd and pay £65 stake, Declare by 10.00 a.m. July 27th. Weights: Colts and geldings 9st 4lb; fillies 8st 13lb Penalties, for each Restricted Novice or Maiden race won 4lb For each other race won 7lb (Sellers and Claimers excluded for the purposes of penalties) THE TRUSTEES OF THE E.B.F have kindly contributed towards the prize money for this race CHASEMORE FARM has generously sponsored this race 16 entries at £65. - Closed July 23rd, 2026. Owners Prize Money. Winner £5547; Second £2773; Third £1387; Fourth £693 (PenaltyValue £7020) SS
SEE PAGE 20 FOR THIS RACE.
Fourth Race 7.25 - THE SPILLERS WINNERS HANDICAP STAKES (CLASS 5) Distributed in accordance with the Stakes and Prize Money Code. £4448 to the winning horse The second to receive £2087, the third £1042, the fourth £521 and the fifth £260 for three yrs old only, Rated 51-70 (also open to such horses rated 50 and below). £42 stake if the horse is rated 51 or higher, or £8 stake if the horse is rated 50 or lower with £34 extra ifthe horse is declared to run Declare by 10.00 a.m. July 27th. Lowest weight 8st 4lb; Highest weight 9st 9lb Penalties, after July 18th, 2026, for each race won 6lb SPILLERS has generously sponsored this race 16 entries, at £42. - Closed July 23rd, 2026. Owners Prize Money. Winner £3510; Second £1755; Third £877; Fourth £439; Fifth £219. (PenaltyValue £4448.90) SS
SEE PAGE 24 FOR THIS RACE.
Fifth Race 8.00 - THE SPILLERS FILLIES’ HANDICAP STAKES (CLASS 5) Distributed in accordance with the Stakes and Prize Money Code £4448 to the winning horse The second to receive £2087, the third £1042, the fourth £521 and the fifth £260 for three yrs old and upwards fillies and mares only, Rated 56-75 (also open to such fillies and mares rated 55 and below). £42 stake if the horse is rated 56 or higher, or £8 stake if the horse is rated 55 or lower with £34 extra if the horse is declared to run Declare by 10.00 a.m. July 27th. Lowest weight: 4-y-o and up 8st 11lb; 3-y-o 8st 2lb Highest weight: 4-y-o and up 10st 2lb; 3-y-o 9st 7lb Penalties, after July 18th, 2026, for each race won 3yo 6lb; 4yo to 6yo 5lb; 7yo and up 4lb SPILLERS has generously sponsored this race 13 entries, at £42. - Closed July 23rd, 2026. Owners Prize Money. Winner £3510; Second £1755; Third £877; Fourth £439; Fifth £219. (PenaltyValue £4448.90)Weights raised 2lb and paragraphs 27to 31 oftheWeights and Handicapping Code complied with where applicable. SS
SEE PAGE 26 FOR THIS RACE.
Sixth Race 8.30 - THE SPILLERS SPECTACULAR HANDICAP STAKES (CLASS 4) (GBBPLUS RACE) Distributed in accordance with the Stakes and Prize Money Code. £6019 to the winning horse The second to receive £2824, the third £1411 and the fourth £706. for three yrs old only, Rated 61-80 (also open to such horses rated 81 and 82; such horses rated 60 and below are also eligible - see Standard Conditions) £57 stake if the horse is rated 61 or higher, or £11 stake if the horse is rated 60 or lower with £46 extra if the horse is declared to run Declare by 10.00 a.m. July 27th. Lowest weight 8st 4lb; Highest weight 9st 9lb Penalties, after July 18th, 2026, for each race won 6lb SPILLERS has generously sponsored this race 8 entries, at £57 - Closed July 23rd, 2026. Owners Prize Money. Winner £4748; Second £2375; Third £1187; Fourth £593 (Penalty Value £6019.10) Weights raised 1lb and paragraphs 27 to 31 of the Weights and Handicapping Code complied with where applicable. SS
SEE PAGE 28 FOR THIS RACE.
UNIBET VETERANS' CHASEDAY
VIRGIN BET SCILLY ISLES SATURDAY
GRAND MILITARY GOLD CUP DAY
ROYAL ARTILLERY GOLD CUP DAY
BETFAIR IMPERIAL CUP DAY
BET365 FLAT SEASON OPENER
BET365 JUMP FINALE
BRIGADIER GERARD EVENING
AFTERNOON RACING
GENTLEMEN'S DAY LADIES DAY
CORAL-ECLIPSE DAY
AFTERNOON RACING
MINISTRY OF SOUND CLASSICAL LIVE AFTER RACING
BILLY OCEAN LIVE AFTER RACING
EVENING RACING
FAMILY FESTIVAL FRIDAY
BETMGM 80S DAY
AFTERNOON RACING
AFTERNOON RACING
JUMP SEASON OPENER
BETFAIR TINGLE CREEK FESTIVAL
BETFAIR TINGLE CREEK FESTIVAL BOOK TICKETS NOW | THEJOCKEYCLUB.CO.UK/SANDOWN *Allfixtures&sponsorscorrectatthetimeofprinting