Page 1

Til samtlige husstande

88. ĂĽrgang - Nr. 4

ONSDAG 22. januar 2014

www.aarsavis.dk Tlf. 98 62 17 11 Lokalavisen Aars ¡ Sønderup-Suldrup Avis ¡ Haverslev Avis ¡ Hornum Avis ¡ Vegger Avis

Se EM-ďŹ nale efter TVH-Stoholm HĂ…NDBOLD: NĂĽr Team Vesthimmerlands hĂĽndboldherrer søndag eftermiddag tager imod Stoholm i en sand nøglekamp i 1. division, bliver kampen spillet blot halvanden time inden, startøjtet lyder til den EM-ďŹ nale, hvor Danmark meget gerne skulle vĂŚre reprĂŚsenteret. Derfor kunne man ogsĂĽ frygte, at mange droppede kampen i Dronning Ingridhallerne. Det er der imidlertid ingen grund til at gøre, for man kan faktisk nĂĽ begge dele. Slutøjtet i 1. divisionskampen lyder formentlig stort set samtidig med startøjtet i EM-ďŹ nalen, og den kan ses pĂĽ storskĂŚrm i Dronning Ingridhallerne. - Jeg vil gerne opfordre alle til at komme og støtte os, for det har vi virkelig brug for. Efter vores kamp kan man sĂĽ se EM-ďŹ nalen i biograignende omgivelser, og der vil alle spillerne selvfølgelig ogsĂĽ vĂŚre til stede, sĂĽ man

Løssalg: 5,00 kr.

Aars fungerer - selv om Dankortterminaler svigter Mandagens nedbrud gav kun fĂĽ gener hos de handlende i Aars Af Torsten Hansen

TVH-trĂŚner Christian Back opfordrer alle til at støtte hans hold i søndagens nøglekamp mod Stoholm. Efter kampen kan man sammen med spillerne se EM-ďŹ nalen pĂĽ storskĂŚrm.

kan ogsü fü en snak med dem, siger Christian Back, der i den forgangne uge kunne se sit hold miste tre point, da Vejle trak sig pü grund af rod i økonomien. Vejlenserne exit betyder, at søndagens i forvejen yderst vigtige kamp mod Stoholm har füet endnu større betydning i kampen om at undgü nedrykning.

AARS: Det tyder pĂĽ, at selv om vi Danmark gĂĽr mere og mere over til at bruge Dankort og andre kort, nĂĽr vi skal betale, sĂĽ kan samfundet stadig fungere, selv om Dankort-terminalerne ikke virker. Mandagens lange nedbrud hos Nets kom ikke til at pĂĽvirke ret meget. En hurtig rundspørge til nogle af de forretningsdrivende i Aars viser, at de stort set ikke mĂŚrkede til, at dankortene ikke kunne bruges. Hos en del af butikkerne ďŹ k de slĂĽet systemet over til at virke off-line. Det betød, at dankortterminalerne kunne bruges, uden at de var i kontakt med Nets. Andre ďŹ k i stedet ere kontanter i kassen end normalt. - Det var smĂĽt, at vi mĂŚrkede

Nedbrud hos Nets, sĂĽ dankortet ikke virkede, ďŹ k ikke de store konsekvenser.

til nedbruddet, nür man ser pü antal handler. Vi havde enkelte kunder som først skulle hen og hÌve penge, og sü ikke kom igen. Men folk havde generelt hÌvet penge pü forhünd, siger Terese Christiansen, Intersport, Aars.

UDVALGTE SLUTHABITTER/BLAZER, VINDJAKKER OG MEYER BUKSER

-50% PĂ… NORMALPRISEN

SPURT

ALT

HOS KÆRE BĂ˜RN

ALT VINTER BĂ˜RNETĂ˜J 0-14 Ă…R SPAR NU

50-70%

MMeld eld dig ind dig ind i i kundeklubben kundeklubben pĂĽpĂĽ www.kaereboern.dk/aars www.kaereboern.dk

Alt hvad dit barn har brug for...

Himmerlandsgade 93 . Aars . Tlf. 98 62 19 50

Hos Intersport lykkedes det ikke i første omgang at fü systemet til at virke off-line, men efter nogle timer kom det pü plads. Hos LabTech Data var der heller ikke nÌvnevÌrdige problemer. - Vi kunne mÌrke, at kun-

derne havde hĂŚvet penge pĂĽ forhĂĽnd, eller var parat til at gĂĽ i banken for at hĂŚve. Alt i alt var det en nogenlunde normal dag, siger Morten Krog, LabTech Data. Stort set samme historie fortĂŚlles fra Expert. - I store dele af dagen mĂĽtte vi bede kunderne om at hĂŚve i automaten. Det fungerede ďŹ nt. Det var ikke noget der pĂĽvirkede vores salg, forklarer Troels Kjelstrup, Expert. Man kunne forestille sig, at de mange kontant-hĂŚvninger sĂĽ pĂĽvirkede bankerne. Men Jutlander Bank, der har tre hĂŚveautomater i midtbyen i Aars oplevede ikke problemer i den retning. Der var dog ekstra lang kø i selve banken for at hĂŚve penge. De ansatte i banken oplevede ogsĂĽ, at mange kunder ringede for at høre, hvordan de skulle forholde sig, og hvornĂĽr det holdt op.

Din KÆRE BĂ˜RN

MarkedsvHM%‡$DUV‡7OI.: 

Ma-fr:  17.3‡Lø:  - 14

-50% pĂĽ normalprisen

Himmerlandsgade 84-86 ¡ 9600 Aars


2 Ugens navne

Aars Avis

Aars Avis - egnens lokalavis siden 1927 Udgives af Aars Avis & Centraltrykkeriet A/S Ansvh. redaktør Thorkil Christensen aarsavis@aarsavis.dk Oplag: 17.991

Bryllup Vies i Aars Kirke lørdag, 25. januar: Nanna Louise Würtz og Anders Bo Larsen.

Runde fødselsdage

65

Jens Chr. Tolstrup, Mejsevej 48, Aars, fredag, 24. januar.

65

Inga Pedersen, Mejerivej 9, Mejlby, onsdag, 29. januar. I redaktionen: Lars Lindberg Torsten Hansen redaktion@aarsavis.dk

Pølsevogn var populær i Aars

Annoncemodtagelse: Aars Avis, Himmerlandsgade 150, 9600 Aars Tlf. 98 62 17 11 . Fax 98 62 27 99 annonce@aarsavis.dk Salgskonsulent Morten Freundlich Åbningstider: Mandag-torsdag kl. 8-16. Fredag kl. 8-15.00 Har De ikke modtaget avisen senest kl. 18.00? Henvendelse bedes rettet til Nordjyske Distribution torsdag kl. 8.00 - 16.00 - tlf. 98 92 89 00 - eller kontakt os på www.aarsavis.dk via kupon der findes under info-kontakt.

Himmerlandsgade 80 9600 Aars - Tlf. 98 62 34 88

Bedemand Birgitte og Hans Landry Det er vigtigt, at du ved dødsfald får præcis den hjælp og rådgivning, du har brug for - diskret og omhyggelig. Alle aftaler kan træffes i dit eget hjem.

Træf os personligt døgnet rundt

70 70 20 20 41 41 41 41

Aars Begravelsesforretning . Himmerlandsgade 26 . Aars www.hanslandry.dk

AARS: Selv om der var mange flotte biler at se på, så var det en speciel vogn en pølsevogn - der blev vist størst opmærksomhed, da Autocentrum Aars ved Vestre Boulevard forleden holdt indvielse og reception. Autocentrum er etableret af autoforhandler Erland Knudsen, som hidtil har drevet Vegger Autohandel og Himmerlands Autoteknik. De to firmaer er nu under samme tag i Aars med navnet Autocentrum. Der var stor søgning til lokalerne ved indvielsen - og derfor naturligt nok også stor søgning til pølsevognen som på dagen havde fået plads i den nyistandsatte værkstedshal. Erland Knudsen har brugt de seneste uger på at renovere og male udstillingshal, kontor og værksted, så det hele kom til at se rigtig indbydende ud til indvielsen.

Højgårdsvej 24, Farsø

Bil mistede samtlige hjul

Dorthe O. Nielsen www.farsobegravelse.dk

På betryggende måde ordner vi alt vedrørende

Claus Hylleberg

Medl. af

BEGRAVELSER OG BISÆTTELSER - overalt i landet!

VESTHIMMERLAND BEGRAVELSE

Jens Fiskers eftf. v/ Jens Møller

Vi hjælper med alt ved begravelse og bisættelse Nørrehedevej 5 9620 Aalestrup

Annette Rolighed

Jens Fisker

Vi er der når du har brug for os

Himmerlandsgade 76 9600 Aars

98 62 58 69

Off. bekendtgørelser (møder, indbydelser, taksigelser og lign.), forlystelser og loppeannoncer: Fredag inden kl. 9.

Slagter i Aars i nyt job Jan Bjørn, Aars, er tiltrådt som slagtermester i SuperBrugsen i Aalestrup. Jan Bjørn, 47 år, overtog i 2000 forretningen Byens Slagter i Aars og drev denne indtil for tre måneder siden. Han er uddannet som butiksslagter i Viborg og arbejdede senere på slagteri og hos en engrosslagter.

Alt indenfor: • Bryllup • Borddekoration • Begravelser m.m.

VI R IN BR GE UD!

Læs mere og se vore priser på: www.vesthimmerlandbegravelse.dk

Indleveringsfrister: Forretningsannoncer , større annoncer, samt fællesaverteringer med andre blade: Torsdag inden kl. 9.

Slagtermester Jan Bjørn.

AALESTRUP: Ejeren af en VW Up fik sig noget af et chok, da han mandag morgen ville tage sin bil på arbejde fra en P-plads på Engdiget i Aalestrup - det lod sig nemlig på ingen måde gøre. Natten mellem søndag og mandag havde ukendte gerningsmænd nemlig nappet alle bilens hjul, og den var i stedet klodset op på mursten.

98 64 18 69 Jens Møller

Dyrlæge Torben Dencker er pr. 31.12.2013 gået på pension. Torben Dencker har samtidig solgt sin anpart af Familiedyrlægerne A/S. Torben Dencker har været praktiserende dyrlæge i Farsø i perioden 1984-98, tilsluttet Dyrlægegruppen Vesthimmerland, 1998 -2006, indgået i Dyrlægerne Himmerland 2006 – 2009 og siden været partner i Familiedyrlægerne A/S, hvor han primært har arbejdet på Aars Dyrehospital og på Aalestrup Dyreklinik.

AARS: Onsdag, 26. februar kommer Steffen Elmer Jørgensen på Vesthimmerlands Museum, Søndergade 44, Aars, hvor han vil fortælle om Amtsarkiverne. Foredraget henvender sig særligt til slægtsforskere.

Fra politiets døgnrapport

Telf. 98 63 13 24

Dyrlæge har solgt anpart

Foredrag om Amtsarkiverne

FARSØ BEGRAVELSESFORRETNING Aftaler træffes gerne i hjemmet

Torben Dencker.

Små rubrikannoncer (køb og salg): Mandag inden kl. 11

Blomstertanken v/ Uno-X Aars Tlf. 98 62 10 96 Abonnementspris: 780,- pr. år. Løssalg 5.- kr. pr. nummer fra bladets ekspedition eller i Kvicklys kiosk, Aars.

22. januar 2014

Ugens portræt

Formanden har styr på det hele Selv om der er cirka 670 medlemmer i Aars Pensionistforening, så styres foreningen stort set af en person - formanden Per Drejer, Svalevej 6, Aars. 1. februar fejrer Aars Pensionistforening 75 års jubilæum, og der skal selvfølgelig holdes en stor fest i den anledning. Langt hovedparten af festen arrangeres af Per Drejer, så han har travlt i denne periode. Per Drejer har været formand for den store forening i nogle år, og det er en opgave han går meget op i. Ud over at arrangere festen, så har han også en stor finger med i spillet omkring de fleste andre aktiviteter i foreningen. Per Drejer er typen der sætte mange ting i gang. Når det så kører, så overlader han det til andre. Det betyder, at han ikke selv deltager helt så meget i det praktiske, det overlader han til andre. Arbejdet med at drive pensionistforeningen er noget Per Drejer går meget op i. Han nøjes ikke med at styre de lokale pensionister, han er også aktiv som kasserer i Aalborg Kredsen og også involveret i Hornums og Støvrings pensionistforeninger. Når Per Drejer sætter sig for at passe en opgave, så gør han det altid grundigt. Han passer sit arbejde, og det har han altid gjort. I dag bruger han stort set hele sin tid på pensionistforeningen i Aars. Men inden han blev pensionist, så var han faktisk ikke særlig aktiv i foreningslivet. Per Drejer stammer fra Guldagergård ved Simested. Der er han født og vokset op. Han begyndte at læse til lærer på Nørre Nissum Seminarium, men han har aldrig rigtigt fået brugt ud-

Per Drejer.

danneslen. I stedet kom han på kontoret hos entreprenør Buus i Suldrup. Der sad han i mange år og passede regnskabet. De sidste år inden pensionen kom dog til at gå lidt mere med undervisning. Han blev nemlig ansat på AMU Centret i Binderup. Når han ikke var på kontoret, så hyggede han sig hjemme i huset og haven. Per Drejer har haft hund og nød samværet med den. Han har også haft fugle og brugt meget tid på dem. I dag har han ikke selv dyr, men han stiller gerne op, når sønnen kalder og har brug for nogle til at passe familiens dyr. Sønnen bor på et nedlagt landbrug, og der er forskellige dyr, som skal passes, når familien rejser væk. Så kommer livet som landmandssøn op i Per Drejer. Selv holder han også af at rejse, og han er naturligvis med, når Aars Pensionistforening rejser. Han er også klar til at passe børnebørnene, hvis der er behov for det.

Fra politiets døgnrapport Overraskede indbrudstyve AALESTRUP: Mandag nat kl. 01.45 blev indbrudstyve overrasket af en nabo, da de forsøgte at komme ind gennem et vindue til en lejlighed på Borgergade i Aalestrup.

Anmelderen skræmte indbrudstyvene væk og kunne i den forbindelse konstatere, at der var tre personer der løb fra stedet. De var klædt i mørkt tøj og have mørke huer på.

Mærkedage i Aars Avis Aars Avis bringer gerne meddelelser og omtale af runde fødselsdage fra og med 50 år, bryllupsbilleder, omtale af sølv-, guld-, diamant- og krondiamantbryllup og jubilæer. Omtalen bringes kun forud for begivenheden og er gratis. Redaktionen respekterer også ønsker om undladelse af mærkedagsomtale. Meddelelserne kan sendes på fax 98 62 27 99 E-mail: aarsavis@aarsavis.dk eller ringes ind på tlf. 98 62 17 11.

Lokale meddelere: Jens Hejlskov, Haverslev, Mejlby Tlf. 98 65 42 82 E-mail: virkelyst@hejlskou.dk

Lokale meddelere: Kirsten Olsen, Vognsild, Østrup og Vestrup Tlf. 98 65 85 46 E-mail: olsen4@email.dk


Aars Avis

22. januar 2014

10. klassecenteret afprøver arbejdstid AARS: Det viser sig, at der er en af folkeskolerne i Aars som allerede har etableret forberedelsespladser til lærerne og også har taget forskud på, at lærerne skal være længere på skolen. Det er 10. KlasseCentret i Aars, der har valgt at gå en anden vej end de øvrige skoler. - Vi afprøver forskellige løsninger i denne tid. Vi ser på, hvad der virker bedst med hensyn til, hvor mange timer lærerne og eleverne skal

være på skolen, siger lederen af 10. KlasseCentret Henriette Qvist. I 10. KlasseCentret har hver lærer en arbejdsplads, hvor de kan forberede sig. De har også en computer. Alle skivebordene er i samme rum. De forskellige løsninger der prøves af skal ende med en beslutning om, hvad skolen vælger at benytte efter sommerferien. Beslutningen tages af Henriette Qvist til sommer.

† Vor kære bror Min kære ven, vor kære far, svigerfar, stedfar, morfar og oldefar

Hans Christian Lemvigh sov stille ind Aars, den 17. januar 2014

Søskende og svoger

Grethe Børn, svigerbørn, børnebørn og oldebørn

for opmærksomheden ved min 90 års fødselsdag. Ejner Lassen, Jyllandsgade

Hjertelig tak

* 5. maj 1956 er pludselig afgået ved døden. Hornum, den 12. januar 2014. Begravelsen har fundet sted. Ledelse og medarbejdere hos

AARS: Når et hjertestop indtræffer, betyder hurtig hjælp forskellen på liv og død. Derfor har Aars Tennisklub taget initiativ til at få hængt en hjertestarter op. Hjertestarteren, der er doneret af TrygFonden, kommer til at hænge udendørs ved indgangen til Aars Tennisklub, så den er tilgængelig hele døgnet. Ca. 3.500 personer falder om med hjertestop i Danmark hvert år, og 10 pct. af dem overlever. Hvis der er vidner til hjertestoppet, øger deres indsats med livreddende førstehjælp og stød fra en hjertestarter, inden ambulancen når frem, chancen for, at personen overlever. Hvert minut tæller, og den mest effektive behandling mod hjertestop er et elektrisk stød til hjertet. Derfor har Aars Tennisklub søgt om og netop

modtaget en hjertestarter fra TrygFonden, og med hjertestarteren følger et kursus, hvor medlemmer af tennisklubben og medlemmer af andre nærliggende idrætsklubber bliver uddannet i hjertelungeredning, og i hvordan man bruger hjertestarteren. - Vi er meget glade for, at Aars Tennisklub har taget initiativ til at få en hjertestarter hængt op, for jo flere der hænger rundt i landet, jo større er chancen for, at der er en i nærheden, hvis uheldet er ude. Vi ved, at chancen for at overleve et hjertestop øges, hvis man får stød fra en hjertestarter, inden ambulancen når frem, så derfor er det vigtigt at udbrede kendskabet til, både hvor hjertestarterne hænger, og hvordan man bruger dem, siger Grethe Thomas, projektchef for TrygFonden Akutindsatser.

TAK

Begravelsen finder sted fra Aars Kirke fredag den 24. januar kl. 11.00

John Westergaard Jensen

Hjertestarter hos Aars Tennisklub

Hans Lemvigh er død den 17. januar 2014.

Vor afholdte medarbejder

Jens Bigum, medlem af Tryghedsgruppens repræsentantskab (t.v.) og Gert Rasmussen, Aars Tennisklub, ved den nye hjertestarter.

SIDE 3

til alle for den store opmærksomhed som blev vist i anledning af min 100 års fødselsdag. Venlig hilsen Thala Kragh

Påtænkt opmærksomhed på min fødselsdag frabedes venligst. Anna Larsen, Keldgårdvej

Åbent hus I anledning af min 75 års fødselsdag vil jeg gerne se familie, familie gamle kollegaer, naboer og venner til åbent hus i

Messen, ssen, Aars lørdag d. 31. januar 2014 kl. 13.00-16.00 d venlig hilsen Med Ole Stenholt

www.aarsfrikirke.dk

Kipa Vinduer A/S, Hornum

Hjertelig tak

Vores elskede søn og barnebarn Vores elskede bror, svoger, onkel og nevø, og min elskede kæreste

for deltagelse ved vor kære mor Jonna Møller Jensens begravelse. Tak for de smukke blomster og kranse. En stor tak til hjemmeplejen for jeres kærlige omsorg af mor. På familiens vegne Hanne Jens

Jesper Carøe Simonsen * 4. maj 1991 har på tragisk og meningsløs vis forladt os Aars, den 13. januar 2014 Elsket og savnet du vil altid være i vores hjerter

Mor, far og mormor Dennis, Sanne og Alberte Klaus, Heidi, Mathias og Julie Karina og Poul Lars Ditte og Signe Begravelsen finder sted fra Aars Kirke torsdag den 23. januar kl. 11.00

BANKO

Tirsdag den 28. januar 2014 kl. 14.00 i Østrup Klubhus. Alle er velkomne. Østrup-Vognsild Pensionistforening

Ældre Sagen Madlavning, madglæde, hygge, M Kursusstart tirsdag d. 4. februar (i alt 10 tirsdage) fra kl. 16-19 i skolekøkkenet Østermarkskolen. Deltagerne betaler udgifter til råvarer.

TAK for venlig deltagelse og smukke blomster til min søster Sigrids bisættelse. Og rigtig mange tak for god hjælp af Bjarne, Sonja og Torben.

Hilda

HJERTELIG TAK for venlig deltagelse ved min kære mor og børnenes bedstemor

Tilmelding til: Ellionor Larsen, tlf. 98 62 25 86 efter kl. 17. Venlig hilsen Ældre Sagen Aars

Hjemmeservice

gi’r tryghed i hverdagen ... - nu også med pleje ...

Stella Andreasens Min kære hustru, vor kære mor, svigermor og bedstemor

begravelse.

Anna Marie Nielsen

Tak for blomster og dekorationer, tak til Plejecenter Solvang for kærlig pleje af mor. Tak for sms´er og telefonopkald.

er stille sovet ind Farsø, den 20. januar 2014

På familiens vegne Putte

Eskild Peter og Susanne Kirsten og Finn Anne-Sofie og Christina Bisættelsen finder sted fra Aars Kirke fredag den 24. januar kl. 13.00

Hjemmehjælp - Valget er frit - Valget er dit. Hvis du er bevilget hjemmehjælp - Kan du selv bestemme, hvem der skal gøre rent eller købe ind for dig. Ønsker du en personlig assistent, så kontakt Himmerlands HjemmeService

Himmerlands HjemmeService www.himmerlandsvikarservice.dk · Hjortskjærsvej 30 · 9600 Aars · Tlf.: 99 98 97 42


Aars Avis

SIDE 4

Vesthimmerlands Kommunes annoncer bringes i de Àeste tilfælde blot som en overskrift og en enkelt linie eller to. I de tilfælde ¿ndes hele nyheden ved at benytte linket til hjemmesiden. Borgere, der ikke har adgang til internettet, kan tilgå dette på kommunens biblioteker og hos Borgerservice i Aars.

D E T

S K E R

Ordinært byrådsmøde

Torsdag den 30. januar 2014 kl. 16.00 på Rådhuset i Aars Dagsorden kan ses på bibliotekerne og på www.vesthimmerland.dk/dagsorden Spørgetid Forud for byrådets møder holdes offentlig spørgetid i indtil 30 minutter. Spørgsmål skal være byrådet i hænde senest kl. 12 dagen før byrådsmødet. Regler for spørgetid kan også ses på www.vesthimmerland.dk/spoergetid Knud Kristensen Borgmester

Sundhedscenter Vesthimmerland tilbyder nye hold Lær at tackle kronisk sygdom forløb starter torsdag den 27. februar kl. 13.30 – 16.00. Informationsmøde vedr. forløbet foregår torsdag den 06. februar kl. 13.30. Rehabiliteringshold for erhvervsaktive borgere med hjertekarsygdomme og diabetes starter mandag den 03. februar kl. 16.30 – 19.00. Deltagelse i forløbet kræver lægehenvisning. For yderligere spørgsmål og tilmelding til Lær at tackle…, så kontakt allerede nu Sundhedscentret på tlf. nr. 99 66 82 00 og se også www.sundhedscentervesthimmerland.dk

Kun for mænd – Små Skridt til sundhed og vægttab Er du mand, vil du gerne ændre livsstil og tabe dig? Vi starter et nyt hold Små Skridt i Løgstør. Mandage kl. 17.00 – 19.00. Første gang den 27. januar. Tilmelding nødvendigt. Se mere på www.sundhedscentervesthimmerland.dk

Bamsekoncert på Løgstør Bibliotek Tag yndlingsbamsen med til en sjov koncert. Koncerten henvender sig til de 2-6 årige og deres familie, og efter koncerten serveres et børnevenligt måltid mad. Torsdag den 30. januar kl. 17.00. Billetter a 10/20 kr. købes på himmerlandsbilletten.dk. læs mere her www.vhbib.dk

Musik og Samvær - ALFA Vesthimmerlands Musikhus Kulturskolen starter nyt hold op for babyer, 2-8 mdr. og forældre. Opstart den 29. januar. Læs mere på: www.vesthimmerlandskulturskole.dk hvor du også tilmelder dig

M E D D E L E L S E R

22. januar 2014

HVALPSUND FAMILIE CAMPING holder åbent hus

søndag d. 26. januar kl. 10-15 for nuværende og nye campister. - Vi har stadig ledige pladser til sæson 2014!

Foredraget: ”Historien om Niels Bukh og Ollerup”

Miljøgodkendelse af kyllingeproduktion • Østergade 59, 9631 Gedsted Afgørelsen kan ses på www.vesthimmerland.dk/afgoerelser

Ændring af husdyrbrug • Sønderladevej 2, 9670 Løgstør Afgørelsen kan ses på: www.vestimmerland.dk/afgoerelser

Kommuneplantillæg, lokalplaner og landzonetilladelser Offentliggøres kun digitalt og kan ses på: www.vesthimmerland.dk/afgoerelser Her kan du læse om dine muligheder for at gøre indsigelse og klage.

Himmerlandsgade 27 . 9600 Aars Tlf. 99 66 70 00 . www.vesthimmerland.dk

Advokatvagten yder gratis vejledning vedr.: ■ Separation - skilsmisse ■ Bodeling ■ Ægteskab iøvrigt ■ Papirløst samliv ■ Forældremyndighed ■ Arv ■ Ansættelse ■ Forbrugerkøb ■ Leje ■ Fast ejendom ■ Erstatning ■ Forsikring ■ Håndværk og reparation ■ Tjenesteydelser ■ Offentlige myndigheder ■ Skat ■ Straf ■ Naboforhold ■ Konkurs, betalingsstandsning ■ Udlæg, tvangsauktion ■ Skøder, fast ejendom m.m. Rådhuset 1. torsdag i hver måned kl. 16,00-17,00 Kun personlig henvendelse

Onsdag d. 22. januar kl. 19.00 i Hobro Idrætscenter er

AFLYST PGA. SYGDOM Gunnar B. Hansen vil på et senere tidspunkt komme og fortælle den gode historie om den snart 100 år gamle skole.

Bedste hilsner Gymnastikkens Venner Hobro

Ældre Sagen afholder søndagscafé søndag den 26. januar kl. 14.00 i Aktivitetscenteret Aars Bymidte. Tidligere efterskolelære Svend Brøndum fra Haubro, holder foredrag på dialekt om "sjov og alvor". Entre inkl. kaffe og kage kr. 35.- for medlemmer (husk medlemsbevis). Ikke medlemmer kr. 50.-. Venlig hilsen Ældre Sagen Aars

RECEPTION/ ÅBENT HUS I anledning af 2x50 års fødselsdag vil det glæde os at se familie, venner og forretningsforbindelser fredag den 7. marts 2014 på Aars Hotel. Der er receptions buffet fra kl. 15.00 og aften buffet fra kl. 19.00. Af hensyn til køkkenet vil vi gerne vide, hvornår du/I har lyst til at komme. Hilsen Malene og Peter Berntsen Vesthimmerlands Maskinskovning SU: Senest den 27. februar 2014. Peter 21 42 90 01 - Malene 23 61 57 01

Generalforsamling i Vesthimmerlands Volleyballklub 10. februar 2014 kl. 18.00 i mødelokalet i Østermarkshallens cafeteria.

Generalforsamling i Aars IK

Bestyrelsen

AARS VENSTRE

Der indkaldes herved til

ORDINÆR GENERALFORSAMLING I AARS IDRÆTSKLUB

Aars og Omegns Venstrevælgerforening afholder

GENERALFORSAMLING på Kimbrerkroen tirsdag den 11. februar 2014 kl. 19.30. Dagsorden iÁg. vedtægterne. Bestyrelsen Aars og Omegns Venstre.

tirsdag den 11. februar kl. 19.00 i klubhuset på Lyngsøvej 2B. Dagsorden ifølge vedtægterne. Forslag der ønskes behandlet på generalforsamlingen, skal være formanden i hænde senest 4 dage før.

Hovedsponsor

Bestyrelsen

Høring af miljøgodkendelse til udvidelse af husdyrbrug • Mølgårdsvej 69, 9640 Farsø Ansøgning med bilag kan ses på www.vesthimmerland.dk/ afgoerelser

Advokatvagt i Aars

Aars Pensionistforening

75 års jubilæumsfest lørdag d. 1. feb. kl. 11.30 på Kimbrerkroen, Aars Festmenu og underholdning v/Richard Ragnvald pris kr. 150 for medlemmer. Tilmelding senest 24. januar til Per Drejer tlf. 98 62 38 17/21 65 52 43 De der ønsker at støtte foreningen kan indsætte bidrag på konto 9217 2071700278

Gundersted Borgerforening afholder generalforsamling tirsdag den 28. januar 2014 kl. 19.00 i Gundersted Multihus Dagsorden ifølge nye vedtægter. Se opslag hos købmanden. Bestyrelsen

Aars Pensionistforening afholder generalforsamling på Kimbrerkroen tirsdag den 11. februar 2014 kl. 13.30. Dagsorden ifølge vedtægterne. Forslag der ønskes behandlet, skal være formanden i hænde senest 10 dage før generalforsamlingen. Efter kaffen taler formanden for sundhedsudvalget Palle Jensen, Farsø. Bestyrelsen


Aars Avis

22. januar 2014

SIDE 5

Appetit på livet

UDSALG

SPAR

75%

95

49 SPAR 150,-

6 stk.

Proptrækkersæt med 3 dele Proptrækker, folieskærer og ekstra skrue. Normalpris 249,95

Køkkenrulleholder

Encore vinglas

Håndskåret ud af europæisk egetræ. Behandlet med fødevaregodkendt dansk bivoks. Normalpris 199,95

Hvidvin 38 cl eller rødvin 53 cl. Normalpris 299,95 SPAR 150,- 6 STK. NU

14995

95

79

SPAR 170,-

SPAR

80%

95

49

Skål 24 cm. Perfekt til brød, frugt eller snacks. Sort plastik. Leveres med 2 udskiftelige bomuldsposer i sort og offwhite. Markedspris 249,95

SPAR

68%

SPAR 200,-

1,8 liter

95

249

SPAR 150,-

PRISMATCH PÅ ALLE VARER

3 dele

Findes varen billigere i andre butikker, matcher vi prisen* Chill serveringskande Rustfrit stål. Tåler opvaskemaskine. Design af Seidenfaden Design.

SPAR

50%

1,8 liter. Normalpris 399,95 0,5 liter. Normalpris 299,95 SPAR 150,- NU 14995

Himmerlandsgade 69 | 9600 Aars Tilbuddene gælder i perioden fra onsdag d. 22. til og med tirsdag d. 28. januar 2014. Priserne er inkl. 25% moms. Der tages forbehold for pris- og afgiftsændringer, trykfejl, manglende leverancer samt udsolgte varer.

*Gælder ikke netbutikker og udenlandske butikker. Tilbuddet skal være aktuelt og kunne dokumenteres. Gælder kun hos Imerco Aars.


Aars Avis

SIDE 6

22. januar 2014 fessoren, der er en af landets mest efterspurgte foredragsholdere. Steen Hildebrandt er da også hele ti gange blevet kåret som årets MBA-underviser (master of business administration) på Aarhus Universitet.

Sammensmeltning

KAFFE OG KAGE MELLEM KRUDT OG KUGLER Ruth Brik Christensen FOREDRAG I TESTRUP GL. SKOLE Tirsdag d. 4. februar 2014 kl. 19.30

Kom og oplev et levende og humoristisk foredrag om Ruth´s oplevelser blandt danske soldater i bl.a. Irak, Afghanistan og Libanon. Ruth var som leder på soldaterhjem derude - en lyttende ”mor” for soldaterne i de mange svære situationer. Alle er velkommen Gratis entre - Kaffe kr. 30,-

Testrup Menighedsråd

Professor Steen Hildebrandt, ti gange kåret som årets MBA-underviser på Aarhus Universitet. taler torsdag, 6. februar om vækst, bæredygtighed og musik i Vesthimmerlands Musikhus Alfa.

Hildebrandt taler om vækst og musik i Aars Aarhus-professor lægger vejen forbi musikhuset AARS: Professor Steen Hildebrandt bliver torsdag, 6. februar, manden der åbner rækken af spændende og atypiske erhvervs-musikarrangementer i Vesthimmerlands Musikhus Alfa - på initiativ af KulturInVesthimmerland-projektet (KIV). Folkene bag KIV betragter den landskendte Aarhus-

VESTHIMMERLANDS GYMNASIUM & HF

professor i organisations- og ledelsesteori, som noget af et scoop at kunne præsentere i Aars. Det sker nemlig som første nordjyske stoppested efter, at Hildebrandt, 22. januar - på sin 70 års fødselsdag - udsender sin seneste bog ”Vækst og bæredygtighed – omstilling og nye muligheder”. Tema-arrangementet i Alfa har fået overskriften ”Krisen er ovre! - efter sigende” og handler i høj grad om, hvordan erhvervsliv og samfund igen bør til at fokusere på vækst, men også - og

lidt atypisk - om de ledelseserfaringer, der kan hentes i musikken. Hildebrandt mener, at erhvervslivet også kan tage ved lære af for eksempel dirigenters ledelsesform. Helt i tråd i øvrigt med KIV’s formål, der netop er at lade kunstens kreativitet møde erhvervslivets produktivitet. - Hildebrandt er jo en mand, der forstår at brænde igennem og gøre tør teori underholdende og vedkommende for et bredt publikum,” forklarer Hardy Jensen fra KIV om arrangementet med pro-

KulturInVesthimmerland er opstået som et lokalt initiativ, der skal få kultur og erhvervsliv til at smelte bedre sammen. Bagved står erhvervsgruppen for Alfa, fra før musikhuset blev til. KulturInVesthimmerland får støtte fra Kulturaftalen hos Region Nordjylland. Herfra vil man med inspiration fra kunstens og musikkens verden optimere de medvirkende virksomheders muligheder og kompetencer og skabe fuld udnyttelse af deres ressourcer. Sammen med Hildebrandt ”optræder” i øvrigt også denne eftermiddag korlederen Mads Bille, som i Herning har skabt et fantastisk sangmiljø omkring blandt andet Den Jyske Sangskole, ligesom han er udnævnt til leder af det kommende Sangens Hus, der breder sig med afdelinger over hele landet. For Steen Hildebrandt er vækst naturligvis et væsentligt og meningsfuldt mål for samfund og erhvervsliv: - Men vækst handler også om dannelse, uddannelse, miljø, klima, livskvalitet, bevidsthed, menneskeligt nærvær og samvær, samarbejde og empati. Uden vækst, ingen bæredygtighed. Uden bæredygtighed ingen vækst. Evner vi at se ud over det gamle industrisamfund og dets forældede ledelsestænkning, skriver Steen Hildebrandt i foromtalen til sin nye bog. Svaret får deltagerne at høre torsdag 6. februar i musikhuset Alfa.

RECEPTION

Til elever i 9. og 10. klasse & forældre

Kom og vær med til at sige goddag til Jette

ORIENTERINGSAFTEN på Vesthimmerlands Gymnasium og HF MANDAG D. 27. JANUAR 2014, KL. 19.00 Her er en god mulighed for at høre om gymnasiets forskellige studieretninger og hf-tilbud, møde elever og lærere, stille spørgsmål til studievejlederne og se skolens lokaler og fællesområder. Jyllandsgade 52 · Aars · Tlf. 98 62 25 77 · www.vhim-gym.dk

Jette Poulsen er ny rektor på Vesthimmerlands Gymnasium & HF. Vi vil gerne sige velkommen til Jette med en reception i ”badekarret” torsdag den 6. februar 2014 kl. 13:30 til 16:00. Vi serverer lidt mad og drikke, og der vil blive forskellige former for underholdning. Alle er velkomne! Med venlig hilsen Bestyrelsen v/Keld Jørgensen

VESTHIMMERLANDS GYMNASIUM & HF Jyllandsgade 52 • 9600 Aars • Tlf. 98 62 25 77 • adm@vhim-gym.dk • www.vhim-gym.dk


Aars Avis

22. januar 2014

SIDE 7

ALT S KAL V ÆK

K

TOTAL OPHØRSUDSALG ALT

Æ V L A SK

ALT BRUGSKUNST

÷70% på normalprisen

ALLE ANDRE SENGE

ALLE TÆPPERESTER

YDERLIGERE NEDSAT MED

÷80% ÷20%

NU

på normalprisen

RØV

ALLE MØBLER YDERLIGERE NEDSAT

÷20%

ERKØ

B

ELEVATIONSSENG 90x200 cm med skumkerne - incl. topmadras 40 mm latex eller celcius. Førpris 2 stk. 17.995,-

NU 2 STK.

6.500,-

alle Park

O S

nningen

Præstegårdsvej 5 Torvegade 4 9600Løgstør Aars 9670 Telefon Telefon 98 2767 5228 1000 94 www.garant.nu www.garant.nu

VINYL

YDERLIGERE NEDSAT

YDERLIGERE NEDSAT

÷15% ÷15% ÅBNINGSTIDER ÅBNINGSTIDER MANDAG 10.00 MANDAG- -FREDAG: FREDAG: 9.30- 17.30 - 17.30 LØRDAG: LØRDAG:10.00 9.30--13.00 13.00

Tavsen H ansVej

D Gru UL R. n E

s g ade

DE

ej Stubs V

Engvej

Jylland

Kærvej

GA

AARS L Ø G STØ R

Øste

Gr ø

S

Tokesvej

ND

Præstegårds vej

Søndergade

r Rolighedsvej Pe de

J

HIMMERLA

ng leva l ø M Grønnevej M øllevej

VE GS

lle M øti en s

stermarken

te n ymid ve j B

Per alle sens Plads

v Far vej

TRÆGULV

B

F O R G U LV E , TÆ P P E R O G G A R D I N E R


Aars Avis

SIDE 8

22. januar 2014

Fordebat pĂĽ vej om nyt erhvervsomrĂĽde ved Aars Planen forventes politisk behandlet inden sommer

Af Torsten Hansen AARS: Den kommende omfartsvej syd om Aars ĂĽbner mulighed for, at byen kan udvikle sig i omrĂĽdet øst for Aggersundvejen og syd for Roldvej. Allerede da byudviklingsplanen for Aars blev drøftet for et par ĂĽr siden, kom der forslag op om at gøre omrĂĽdet til et nyt erhvervsomrĂĽde. De tanker er nu tĂŚttere pĂĽ en virkeliggørelse. Ă˜konomiudvalget skal i dag onsdag tage stilling til, om der skal igangsĂŚttes en fordebat, hvor der kan indkaldes ideer og forslag til planlĂŚgningen af omrĂĽdet. Administrationen ind-

stiller, at der skal sendes et debatoplÌg i offentlig høring allerede om en uge.

Ny omfartsvej ArealudlÌgget krÌver udarbejdelse af kommuneplantillÌg, lokalplan samt miljørapport. Planen er derefter, at der hen over forür og sommer udarbejdes forslag til plangrundlag samt miljørapport, som forventes behandlet politisk efter sommerferien 2014. Høringen af planforslagene igangsÌttes umiddelbart efter den politiske behandling. Det forventes, at et endeligt plangrundlag kan vedtages marts 2015.

Omrüdet sydøst for Aars kan blive nyt erhvervsomrüde.

Vi ĂĽbner dørene pĂĽ Ă˜stergade 5, Ă˜strup, 9600 Aars, â€?Den gamle Smedjeâ€?. Her vil der vĂŚre mulighed for at se og høre om de forskellige BAXI produkter.

(QHUJLGDJH (QHUJLGDJH

Der vil blive anvist til adresser, hvor man kan se div. anlĂŚg i drift.

GRJMDQXDU GRJMDQXDU D. 24. OG 25. JANUAR   IUDNO  -16.00 FRA KL. 10.00

Vi har kaffe pĂĽ kanden, sĂĽ kom og fĂĽ et godt tilbud med hjem.

BAXI DBK m/Scandpell

BAXI TPK 24 m/Scandpell

Dobbeltkammerkedel til fastbrĂŚndsel og trĂŚpiller med aut. tĂŚnding

A-mÌrket kedel med løs trÌpillebrÌnder.

Pluspunkter DBK

Pluspunkter TPK

• Effektiv forbrÌnding.

• Høj virkningsgrad (91%).

• EnergimÌrke A.

• Automatisk tÌnding.

• Automatisk start af trÌpillebrÌnder.

• Markedets laveste el.forbrug.

• Mekanisk manuel rensning af røgrør.

• Modulerende drift.

• Svingbeslag for let adgang til rensning.

• Mekanisk manuel rensning.

• Stor lüge.

• Valgfri brÌnder montering.

• Stor fyrboks.

• Magasinstørrelse fra 350—730 ltr.

BAXI WGB K15E

BAXI ALAZIO II

A-mĂŚrket vĂŚghĂŚngt kondenserende gaskedel.

Luft-vand varmepumpe

Pluspunkter WGB K15E

Pluspunkter Alezio-II H

• Høj virkningsgrad

• Høj SCOP-vÌrdier (op til 4,2).

• Indbygget varmtvandsbeholder

• Modulerende drift 30-100 %.

• Modulerende drift

• Høj betjeningskomfort.

• Høj betjeningskomfort

• Med kombi beholder eller for separat beholder.

• Inklusiv vejrkompensering

• Kombination med andre varmekilder.

• EnergimÌrke A

• Vejrkompensering.

• Med lavenergipumpe

• Støjsvag drift 36 db(A).

• Miljøvenlig forbrÌnding

• Maksimale fremløbstemperatur 55°C.

Vølund kommer med et udvalg af deres varmepumper og en Pelux 100.

Nür du køber en energibesparende løsning hos os, sørger vi bl.a. for : • At søge energibesparelse hjem. • Søger tilladelser hjem. • Bilag til hündvÌrker-fradrag. • Rigtig projektering. Der vil kunne søges reduktion i elprisen, ved varmepumpe drift.

*5275,$1$6‘VWHUJDGH$DUVZZZJURWULDQDVGN•7OI

7URY UGLJKHG¹1 UKHG¹5HVSHNW¹.YDOLWHW¹8GYLNOLQJ



Fredag vil VIVA Energi ogsĂĽ vĂŚre tilstede og fortĂŚlle om de stadig fordelagtige investeringer i solcelleanlĂŚg.


Aars Avis

22. januar 2014

SIDE 9

Kom ind til NYT SYN og få trafiksikret dit syn i.Scription® fra ZEISS Mange kommende elever og deres forældre lagde torsdag aften vejen forbi Erhvervsskolerne Aars, hvor de blev klogere på de mange uddannelser, skolen tilbyder.

Info-aften blev en succes på Erhvervsskolerne Aars Mange mødte op, selv om konkurrencen var hård Af Lars Lindberg AARS: Da Erhvervsskolerne Aars torsdag aften holdt orienteringsaften, dukkede mange kommende elever og deres forældre op. Cirka 150 unge og voksne mødte op for at høre mere om de mange uddannelser Erhvervsskolerne tilbyder, og der var god søgning til alle uddannelser. Efter en fælles velkomst kunne gæsterne selv vælge, hvilke uddannelser, de ville høre om, og ifølge Gert Husum, der er uddannelseschef for de gymnasielle uddannelser, stod ingen lokaler tomme. - Vi blev positivt overrasket over, hvor stor søgning der var til de nye eux-fag, hvor

man både får et svendebrev og en studenterhue. Vi tilbyder fagene ”Mad til mennesker”, ”Klejnsmed” og ”Entreprenør- og landbrugsmaskinuddannelsen”, og der var stor interesse for dem alle, sagde Gert Husum. Han glædede sig desuden over, at der også var stor interesse for HTX-uddannelsen ”Bioteknologi/HTXagro”. - Det er en af de uddannelser, som vi er alene om at tilbyde i Himmerland, og derfor vil vi selvfølgelig gerne have, at der er nogen, som vil tage den, og alt tyder på, at det er tilfældet. Der var i hvert fald mange besøgende, der gerne ville høre om det, sagde Gert Husum, som dog først i marts kan kon-

statere, om han har ret. Der er nemlig ansøgningsfrist til uddannelserne på Erhvervsskolerne 1. marts, men Gert Husum er ikke bekymret. - Det var en meget positiv orienteringsaften, hvor der var en god spredning på, hvad gæsterne ville høre om. Mange benyttede også muligheden for at høre om flere uddannelser, så alt i alt kan vi kun være tilfredse, sagde Gert Husum, der påpegede, at orienteringsaftenen var oppe mod hårde odds. - Vi kæmpede både mod håndboldherrerne, der spillede EM, og vejrguderne, som drillede, så set i det lys synes jeg, det er flot, at så mange kom til arrangementet, sagde han.

i.Scription

Se skarpere end nogensinde - også når du kører bil Klarere farver, større kontrast og skarpere syn er gode nyheder for sikkerheden i trafikken - især om aftenen og natten. Ny, banebrydende teknik fra ZEISS kan give dig et mere præcist og afslappet syn end nogensinde. Kig forbi til en synsundersøgelse i særklasse eller læs mere på nytsyn.dk.

Læs mere på nytsyn.dk

Nyt Syn Aars

Anlægsvej 6 - 9600 Aars Tlf. 98 62 10 90 - nytsyn.dk

GRATIS refleksvest til alle børn - bare kig ind!

R E K K U L I V

FOR AT RENOVERE

N E K K I T U B TØM ALT NEDSAT R E R A V S R Å R O F OGSÅ NYE


Aars Avis

SIDE 10

22. januar 2014

TV-PROGRAMMER ONSDAG 22. JANUAR 06.00 06.30 07.15 08.00 12.00 12.30 13.00 13.30 15.15 17.00 17.50 18.00 18.30 20.00 20.40 21.30 22.30 23.15 00.15 01.00

Der er noget i luften Hairy Bikers - det bedste britiske Til undsætning Formiddagsprogrammer Antikduellen Skattejægerne Hammerslag Inspector Morse: Mistænkt Hercule Poirot. 2 afsnit Downton Abbey TV Avisen Price inviterer Nyhedsblok med Aftenshowet 7-9-13 Livet med flerlinger TV Avisen med Penge og Sporten Vegas. Amr. dramaserie Ryggen mod muren Water Rats Natfjernsyn

06.00 06.30 11.30 12.00 12.20 12.50 13.35 14.30 15.15 16.05 17.00 20.00 20.25 22.15 22.50 23.25 00.15 00.45 01.40

Nyhederne, Sporten og Vejret Go’ morgen Danmark Grænsepatruljen Nyhedsblok Liebhaverne Fed forvandling Hjemme bedst Hus til stregen The Good Wife Venner. 2 afsnit Nyhedsblok med Go’ appetit EM håndbold: Studiet EM håndbold: Danmark - TBA, direkte Nyhedsblok EM-håndbold: Studiet Sexforskerne Det sejeste sjak - Shipping Wars Grænsepatruljen. 2 afsnit Natfjernsyn

TORSDAG 23. JANUAR 06.00 06.30 07.15 08.00 12.00 12.30 13.00 13.30 15.15 17.00 17.50 18.00 18.30 20.00 20.30 21.30 22.30 23.40 00.25

Der er noget i luften Hairy Bikers - det bedste britiske Til undsætning Formiddagsprogrammer Antikduellen Skattejægerne Hammerslag Inspector Morse: Afsporet Hercule Poirot. 2 afsnit Downton Abbey TV Avisen Price inviterer Nyhedsblok med Aftenshowet Bonderøven DR1 Dokumentaren: Det store Svinerige TV Avisen med Bag Borgen og Sporten Taggart: Kompensation Water Rats Natfjernsyn

06.00 06.30 11.30 12.00 12.20 12.50 13.35 14.30 15.15 16.05 17.00 20.00 20.50 22.00 22.35 23.10 00.05 00.30 01.25 02.00 02.25

Nyhederne, Sporten og Vejret Go’ morgen Danmark Grænsepatruljen Nyhedsblok Liebhaverne Sæt skønheden fri Hjemme bedst Hus til stregen The Good Wife Venner. 2 afsnit Nyhedsblok med Go’ appetit Savnet Station 2 Uopklaret Nyhedsblok EM-håndbold: Studiet Besat af skrammel Det sejeste sjak - Shipping Wars Grænsepatruljen. 2 afsnit Sky Cops Modern Family Natfjernsyn

FREDAG 24. JANUAR 06.00 06.30 07.15 08.10 09.10 12.00 12.30 13.00 13.30 15.15 17.00 17.50 18.00 18.30 19.00 20.00 21.00 21.25

Der er noget i luften Hairy Bikers - det bedste britiske Blod, sved og luksusvarer Hairy Bikers Formiddagsprogrammer Antikduellen Skattejægerne Hammerslag Inspector Morse: Den bitre bryg Hercule Poirot. 2 afsnit Downton Abbey TV Avisen Bonderøven TV Avisen med Sporten og Vejret Disney Sjov X Factor TV Avisen med Vores vejr Til jackpot os skiller. Amr. romantisk komedie fra 2008 23.00 Basic. Amr. thriller fra 2003 00.35 Natfjernsyn

06.00 06.30 11.30 12.00 12.20 12.50 13.35 14.30 15.15 16.05 17.00 19.20 20.15 20.40 22.50 23.20 00.55 02.30 02.55 04.00

Nyhederne, Sporten og Vejret Go’ morgen Danmark Grænsepatruljen Nyhedsblok Liebhaverne Sæt skønheden fri Hjemme bedst Hus til stregen The Good Wife Venner. 2 afsnit Nyhedsblok EM håndbold: Semifinale, direkte Nyhedsblok EM håndbold: Semifinale, direkte EM håndbold: Studiet Den Sorte Madonna. Dansk action-komedie fra 2007 In Your Dreams Et helvedes hus Boligkonge i Las Vegas Nyhederne og Vejret

LØRDAG 25. JANUAR 06.00 06.30 09.10 09.50 10.40 11.10 12.10 12.55 13.35 14.35 16.30 17.30 18.30 18.58 19.05 20.00 21.00 22.35 00.05 01.35 03.15 04.45 05.30

Der er noget i luften Det vilde Afrika. 3 afsnit På sporet Jamie Oliver i Venedig. Bri. madserie fra 2010 Bonderøven bygger Mig og Tourettes Hunden, der reddede vores ægteskab 7-9-13 Arvingerne Tootsie. Amr. komedie fra 1982 med bl.a. Dustin Hoffman X Factor Kongerigets Klogeste TV Avisen med Sporten og Vejret Held og Lotto De kære dyrebørn. Eng. naturserie fra 2008 Kongerigets Klogeste Kriminalkommissær Barnaby: Han søges her, han søges dér Kommissær George Gently. Eng. krimiserie fra 2009 Dødbringende ferie. Eng. krimikomedie fra 2010 Cirque du Freak: The Vampire’s Assistant. Amr. adventure-drama fra 2009 Water Rats. 2 afsnit Naboerne. 2 afsnit Shamwari nationalpark

06.00 07.40 08.05 08.30 09.00 12.00 12.10 13.00 13.55 14.50 16.50 17.05 17.50 17.55 19.00 19.30 19.45 20.00 20.55 22.50 23.25 00.10 01.55 02.20 04.00

Morgen TV - mest for børn Shaggy & Scooby-Doo Turtles Ninjago Go’ morgen Danmark Nyhederne Felix jagter vejen til succes Den blå planet Hundeejer i kort snor For min søsters skyld. Amr. drama fra 2009 SuperMatchen: EM-studiet SuperMatchen Nyhedsblok SuperMatchen Nyhederne Regionale nyheder LørdagsSporten Klipfiskerne. Familiequiz med bid i Dum og dummere. Amr. farce fra 1994 med bl.a. Jim Carrey EM-håndbold: Studiet Touch. Amr. dramaserie Red Riding Hood. Amr. thrillerdrama fra 2011 med bl.a. Amanda Seyfried Jail - bag fængselsmurerne i USA Evig kærlighed. Eng. romantisk drama fra 2004 med bl.a. Daniel Craig Nyhederne og Vejret

SØNDAG 26. JANUAR 06.00 06.30 09.10 10.45 10.50 11.00 12.00 12.50 13.50 15.15 16.50 18.30 19.00 20.00 21.00 21.40 21.50 23.55 00.40 02.10 03.10 04.10

Der er noget i luften Det vilde Afrika. 3. afsnit Halifax OBS Det søde liv - Citronpandekager På ø-eventyr med Anne & Anders - Ærø DR1 Dokumentar: Sikke tømmermænd DR1 Dokumentaren: Det store Svinerige Hun så et mord: Den sidste frie mand Kriminalkommissær Barnaby Spy Kids 2 - Drømmenes ø. Amr. adventure-komedie fra 2002 TV Avisen med Sporten og Vejret Vores planet. Naturserie fra BBC Arvingerne. Dansk dramaserie med bl.a. Trine Dyrholm 21 Søndag Sporten Agent 007 i ilden. Eng. actionthriller fra 1965 med bl.a. Sean Connery Whitechapel: Gangstertvillingerne. Eng thrillerserie fra 2010 Dødbringende ferie. Eng. krimikomedie fra 2010 Damages. Amr. dramaserie Blod, sved og luksusvarer Natfjernsyn

06.00 07.40 08.05 08.30 09.00 12.00 12.10 12.55 13.55 14.55 16.45 17.20 18.10 18.15 19.20 19.40 20.00 21.00 22.40 23.35 00.40 01.05 01.55 02.50 04.00

Morgen TV - mest for børn Shaggy & Scooby-Doo Turtles Ninjago Go’ morgen Danmark Nyhederne Årgang 0 Zirkus Nemo 2012 - Nu med zebra! EM-håndbold: Studiet EM-håndbold: Bronzekamp, direkte EM-håndbold: Studiet EM-håndbold: Finalen, direkte Nyhederne EM-håndbold: Finalen, direkte Nyhederne Regionale nyheder Pengene på bordet Klassefesten. Dansk komedie fra 2011 med bl.a. Nicolaj Kopernikus Klipfiskerne Station 2 Uopklaret Jail - bag fængselsmurene i USA Destination: Kidnapning - når ferien udvikler sig dramatisk Med livet som indsats - styrtet ned med redningshelikopter i Kirgisistan Boligkonge i Las Vegas Nyhederne og Vejret

DR 2 ONSDAG 22. JANUAR 06.30 11.05 11.30 12.00 12.30 13.00 17.00 18.10 18.40 19.30 20.00 20.40 22.30 23.00 23.50 00.15 01.10

DR2 Morgen med DR2 Nyheder Madmagasinet Bitz & Frisk DR2 Uden køn DR2 12.00 - Nyheder DR2 Undersøger Eftermiddagsprogrammer DR2 Dagen med DR2 Nyheder DR2 Uden skrald Kontinenternes rejse Når mænd er værst Sådan er det bare Sagen genåbnet Deadline Reklameplads til salg! The Daily Show Mig og millionerne Natfjernsyn

TORSDAG 23. JANUAR 06.30 11.05 11.30 12.00 12.30 17.00 18.10 18.40 19.30 20.00 21.00 21.30 22.00 22.30 23.00 23.50 00.15

DR2 Morgen med DR2 Nyheder Penge Jersild i tiden DR2 12.00 - Nyheder Eftermiddagsprogrammer DR2 Dagen med DR2 Nyheder Min verdenshistorie Kontinenternes rejse Når mænd er værst Debatten Fauli, fed og færdig? Absurdistan Med Martin Breum i Arktis Deadline Afrika med atomkraft The Daily Show Natfjernsyn

FREDAG 24. JANUAR 06.30 11.05 11.30 12.00 12.30 13.00 17.00 18.10 18.40 19.30 20.00 21.45

DR2 Morgen med DR2 Nyheder Kontant Med Martin Breum i Arktis DR2 12.00 - Nyheder Lige til stregen Eftermiddagsprogrammer DR2 Dagen med DR2 Nyheder Lige til stregen Kontinenternes rejse Når mænd er værst En ny dag i livet. Amr. drama Husker du - Highlights fra 1960’erne 22.30 Deadline 23.00 Nordwand - dødens bjerg. Tysk actiondrama 01.00 Natfjernsyn

LØRDAG 25. JANUAR 06.30 07.30 08.00 08.01 09.00 12.00 12.01

Debatten Nyheder fra Grønland DR2 8.00 - Nyheder Kvinder på vilde eventyr Formiddagsprogrammer DR2 12.00 - Nyheder Vin - og hvordan man sælger den!. Dokumentarserie

SØNDAG 26. JANUAR Dokumania DR2 8.00 - Nyheder Skavlan Formiddagsprogrammer DR2 12.00 - Nyheder Legionen Eftermiddagsprogrammer 25, fed og færdig! Sheriffen og pebermøen Javel, hr. minister. 2 afsnit Jimmys bondegård The Tunnel Jeppesen møder... Deadline 2. sektion Palme Natfjernsyn

DR1 lørdag kl. 20.00: ”Kongerigets Klogeste” Mads Steffensen er vært, når nogle af de skarpeste hjerner dyster i forskellige intelligenser.

MANDAG 27. JANUAR 06.30 11.05 11.30 12.00 12.30 17.00 18.05 18.30 19.30 20.00 20.30 21.30 22.00 22.30 23.00 23.55 00.15

DR2 Morgen med DR2 Nyheder Bag Borgen Danmark på piller DR2 12.00 - Nyheder Eftermiddagsprogrammer DR2 Dagen med DR2 Nyheder Absurdistan Jonathan Dimbleby i Sydamerika Når mænd er værst Min verdenshistorie Sådan er det bare Smag på Afrika Jersild i tiden Deadline Iran - A-bombe for en hver pris The Daily Show Natfjernsyn

TV2 lørdag kl. 20.00: “Klipfiskerne” Felix Smith inviterer indenfor til en ny omgang Klipfiskerne!

TIRSDAG 28. JANUAR 06.30 11.05 11.30 12.00 12.30 13.00 17.00 18.05 18.30 19.30 20.00 21.00 22.30 23.00 23.55 00.15 01.00

DR2 Morgen med DR2 Nyheder Horisont 2. sektion DR2 12.00 - Nyheder Kålkællingerne Eftermiddagsprogrammer DR2 Dagen med DR2 Nyheder Kålkællingerne Jonathan Dimbleby i Sydamerika Når mænd er værst The Tunnel Dokumania Deadline Libyen - dagbog fra revolutionen The Daily Show Nigel Marven i Yannan Natfjernsyn

MANDAG 27. JANUAR 06.00 06.30 07.15 08.10 09.10 12.00 12.30 13.00 17.50 18.00 18.30 20.00 20.40

22.30 00.05 00.50

Der er noget i luften Hairy Bikers - det bedste britiske Blod, sved og luksusvarer Hairy Bikers Formiddagsprogrammer Antikduellen Skattejægerne Eftermiddagsprogrammer TV Avisen Price inviterer Nyhedsblok med Aftenshowet Kender Du Typen? DR-Dokumentar: Sikke tømmermænd TV Avisen med Horisont og Sporten Lewis S.7 eps. 1-3 Water Rats Natfjernsyn

06.00 06.30 07.15 08.10 09.10 12.00 12.30 13.00 17.50 18.00 18.30 20.00 20.40 21.05 21.30 21.55 22.20 22.30 00.00 00.45

Der er noget i luften Hairy Bikers - det bedste britiske Blod, sved og luksusvarer Hairy Bikers Formiddagsprogrammer Antikduellen Skattejægerne Eftermiddagsprogrammer TV Avisen Price inviterer Nyhedsblok med Aftenshowet Hammerslag Skattejægerne Kontant TV Avisen Madmagasinet Bitz & Frisk Sporten Beck: Øje for øje Water Rats Natfjernsyn

21.30

06.00 06.30 11.30 12.00 12.20 12.50 13.35 14.30 15.15 16.05 17.00 20.00 20.50 21.25 22.00 22.35 23.10

Nyhederne, Sporten og Vejret Go’ morgen Danmark Grænsepatruljen Nyhedsblok Liebhaverne Sæt skønheden fri Hjemme bedst Hus til stregen The Good Wife Venner. 2 afsnit Nyhedsblok med Go’ appetit Badehotellet Sæt pris på dit hjem En kur der dur Nyhedsblok Natholdet World Trade Center. Amr. drama fra 2006 01.20 Natfjernsyn

TIRSDAG 28. JANUAR 06.00 06.30 11.25 12.00 12.20 12.55 13.45 14.40 15.00 15.15 16.05 17.00 20.00 20.50 21.25 22.00 22.35 23.10 01.00

Nyhederne, Sporten og Vejret Go’ morgen Danmark Grænsepatruljen Nyhedsblok Liebhaverne Sæt skønheden fri Hjemme bedst Hus til stregen Sandheden om parforholdet The Good Wife Venner. 2 afsnit Nyhedsblok med Go’ appetit og Go’ aften Danmark Årgang 0 De ustyrlige Station 2 Politirapporten Nyhedsblok Natholdet Broken Arrow. Amr. actionfilm Natfjernsyn

Tv 3

13.00 Eftermiddagsprogrammer 15.20 DR2 Tema: Selvsving Galla 17.40 Hunden, der reddede vores ægteskab. Brit dokumentar 18.25 Lockerbie - en terrorists død 19.15 Ekstreme togrejser 20.00 DR2 Tema: Av for h......! 22.30 Deadline 23.00 Skavlan 00.00 Natfjernsyn 06.30 08.00 08.01 09.00 12.00 12.10 13.00 16.05 17.15 19.00 20.00 21.00 22.00 22.30 23.00 23.30 00.30

DR1 fredag kl. 21.25: ”Til jackpot os skiller”

DR1 søndag kl. 20.00: “Arvingerne”

TV2 søndag kl. 21.00: “Klassefesten”

ONSDAG 22 JANUAR 05.40 De fantatiske 5 fra USA 06.25 The Vampire Diaries 07.10 Top Model All Stars 08.00 Formiddagsprogrammer 10.55 Bedste Bud 12.00 Masterchef UK 13.00 Fra Skrot til Slot 14.00 Eftermiddagsprogrammer 17.00 NCIS 18.00 Bedste Bud 19.00 Masterchef USA 20.00 Bones 21.00 The Mentalist 22.00 Ramsay’s Kitchen Nightmares 23.00 NCIS 00.00 Bones 00.55 The Mentalist 01.50 Revenge 02.40 Unnatural History 03.25 Natfjernsyn TORSDAG 23. JANUAR 05.40 De fantatiske 5 fra USA 06.25 The Vampire Diaries 07.10 Top Model All Stars 08.00 Formiddagsprogrammer 10.55 Bedste Bud 12.00 Masterchef UK 13.00 Fra Skrot til Slot 14.00 Eftermiddagsprogrammer 17.00 NCIS 18.00 Bedste Bud 19.00 Masterchef USA 20.00 Kræsne købere 21.00 The Kardashians. Amr. underholdningsserie 22.00 Ramsay’s Kitchen Nightmares 23.00 NCIS 23.55 Bones 00.55 The Mentalist 02.40 Unnatural History 03.25 Natfjernsyn FREDAG 24. JANUAR 05.40 De fantatiske 5 fra USA 06.25 The Vampire Diaries 07.10 Top Model All Stars 08.00 The Kardashians indtager New York 09.00 The Mentalist 09.55 Hospitalet. 2 afsnit 10.55 Bedste Bud 12.00 Masterchef UK 13.00 Fra Skrot til Slot 14.00 The Kardashians indtager New York 15.00 Luksusfælden 16.00 Bones 17.00 NCIS 18.00 Bedste Bud 19.00 Masterchef USA 20.00 What Women Want. Amr. romantisk komedie 22.35 Payback. Amr. actionthriller fra 1999 00.40 The Patriot. Amr. actionthriller 03.45 Natfjernsyn LØRDAG 25. JANUAR 05.55 Vanvittige vaner. 2 afsnit 06.45 NYC Prep 07.40 Verdens strengeste forældre 08.35 How To Live With Your Parents. 2 afsnit 09.30 Justin Bieber: Never Say Never

Læs Aars Avis før aftenens tv-udsendelser!

11.40 Ceremony. Amr. romantisk komedie fra 2010 13.35 What Women Want 16.00 How I Met Your Mother. 4 afsnit 18.00 Bones 19.00 The Mentalist 20.00 xXx. Amr. actionthriller fra 2002 22.30 xXx2: The Next Level. Amr. action/fantasy/krimi fra 2005 00.25 Fighting. Amr. actiondrama 02.35 Natfjernsyn

SØNDAG 26. JANUAR 06.10 How I Met Your Mother 06.30 Alletiders barnepige. 4 afsnit 08.20 Ceremony 10.10 According to Jim. 4 afsnit 12.10 Undercover Bridesmaid. Amr. drama fra 2011 13.55 Big. Amr. komedie fra 1988 med bl.a. Tom Hanks 16.00 Two and a Half Men. 2 afsnit 17.00 How I Met Your Mother. 4 afsnit 19.00 Ekstremt fed - et år til at redde livet 20.00 Luksusfælden 21.00 Just Go With It. Amr. romantisk komedie fra 2012 23.20 Forfulgt 00.20 NCIS 01.20 Bones 02.10 Unnatural History 03.00 Natfjernsyn MANDAG 27. JANUAR 05.50 De fantatiske 5 fra USA 06.35 The Vampire Diaries 07.15 Top Model All Stars 08.05 Formiddagsprogrammer 11.00 Bedste Bud 12.00 Masterchef USA 12.55 Fra Skrot til Slot 14.00 Eftermiddagsprogrammer 17.00 NCIS 18.00 Masterchef USA 19.00 MasterChef 20.00 Ramsay’s Kitchen Nightmares 21.00 Tattoo Salonen 22.00 Paradise Hotel 22.50 Real Housewives of Beverly Hills 23.45 NCIS 00.45 Bones 01.35 The Mentalist 02.30 Natfjernsyn TIRSDAG 28. JANUAR 06.00 De fantatiske 5 fra USA 06.45 The Vampire Diaries 07.25 Top Model All Stars 08.10 Formiddagsprogrammer 11.05 Masterchef USA 12.05 MasterChef 13.05 Fra Skrot til Slot 14.10 Eftermiddagsprogrammer 17.00 NCIS 18.00 Masterchef USA 19.00 MasterChef 20.00 Luksusfælden 21.00 Ekstremt fed - et år til at redde livet 22.00 Paradise Hotel 22.50 Real Housewives of Beverly Hills 23.45 Just Go With It 02.10 NCIS 03.05 Natfjernsyn


Aars Avis

22. januar 2014

Venstres byrådsgruppe vil nu forsøge at stoppe byggeriet af Netto på dette område ved Aars Rutebilstation.

Venstre vil stoppe nyt Netto-byggeri i Aars Økonomiudvalget skal drøfte stop for Netto-byggeri Af Torsten Hansen AARS: Diskussionen om hvorvidt der skal opførelses en ny Netto-forretning på området ved Aars Busterminal foregår stadig. Selv om salget af grunden ikke direkte berører Vesthimmerlands Kommune vil Venstre i byrådet nu forsøge at få stoppet byggeriet.

Byrådsmedlem Per Bisgaard har på vegne af Venstresbyrådsgruppe ønsket at få Netto-forretningen på dagsorden på Økonomiudvalgets møde i dag onsdag. Begrundelsen for at få punktet på dagsordene lyder: ”I forlængelse af en række orienteringspunkter på ØKmøder i løbet af 2013, om ovennævnte 3 temaer, uden konkrete beslutninger, øn-

sker Venstre, at diskutere ovenstående i et pkt. på det førstkommende øk-møde. Vi ønsker at drøfte muligheden for at den foreslåede opførelse af en detailvareforretning på terminalgrunden ikke realiseres - med begrundelsen, at det primært vil ødelægge de gode forhold, som i øjeblikket eksisterer for busterminalen, sekundært at det vil skabe større trafik-

problemer i området og sidst men ikke mindst, at det vil betyde store ekstraordinære investeringer, som der ikke er budgetteret med. Punktet er kommet på dagsordenen. Økonomiudvalget skal derfor tage stilling til følgende forslag: ”Vi foreslår, at der indledes en dialog med firmaet Calum om at undersøge mulighederne for en udvidelse af den eksisterende Nettobutik på Søndergade, således at der ikke for nuværende bliver behov for at ændre på forholdene på busterminalgrunden ved Markedsvej. I dialogen vil det være naturligt at diskutere et evt. køb af grunden og/eller kompensation til Calum for afholdte udgifter.” Hvis Netto opføres på området, så vil det også betyde en økonomisk ekstraudgift til kommunen på cirka tre millioner. Pengene skal bruges til at ændre busterminalen, og vurderingen fra mange lyder, at resultatet kun bliver ringere end det er i dag. Ud over en drøftelse af hvorvidt Netto skal opføres på arealet, så har Økonomiudvalget også et punkt på, der netop handler om eventuel arealerhvervelse. Det er et lukket punkt, men det tyder på, at det netop er det areal Netto ønsker at bygge, som Vesthimmerlands Kommune vil drøfte om de kan komme til at købe. Sagen behøver ikke at komme i byrådet. Økonomiudvalget kan selv afgøre den.

SIDE 11

Hvis der skal bruges lidt penge af kortkassen eller gode venner skal nydes, måske et bestyrelsesmøde eller forretning. Så kom på hotellet og gå en tur ned af trappen til vores vinkælder, sæt jer og lad os om resten. Starter Vagtel æg og cremant, evt. lån et svær Menu Fisk Fugl Kød Ost Sødt 4 stk. 100 kr. sedler inkl. æg og bobler

Minimum 4 pers. og max 8 da kælderen ikke er større, er I flere kan I selvfølgelig sidde i restauranten Bordbestilling dagen før.

Himmerlandsgade 111 · 9600 Aars · Tlf. 98 62 16 00 · www.aarshotel.dk

Aars Avis - når det skal være lokalt!

G A D R Ø L G A ED R F G A D S R TO


Aars Avis

SIDE 12

22. januar 2014

Vesthimmerland Værksted Søren Laigaard Christensen . Tandrupvej 8

Tlf. 98 62 37 50

.

9600 Aars

.

www.vesthimmerlandvaerksted.dk Rep. og service af køretøjer/maskiner/motorbåde

UDSALGSUGE I GENBRUGSBUTIKKEN Halv pris på alt undtagen enkelte afmærkede varer Torsdag den 23. - onsdag den 29. januar.



Testamenter Omkring 50% af alle ægtepar og ugifte samlevende har behov for at oprette et testamente. Vi tilbyder en gratis vurdering af din/jeres behov for at oprette testamente og/eller ægtepagt. Beslutter du/I jer herefter til at oprette et testamente eller ægtepagt aftales der en fast pris. Ring og aftal en tid.

Advokatfirmaet Stenum Jørgen Stenum (H) Bitten Kjærsgaard (L)

Søndergade 22, 9600 Aars Tlf. 9862 2911 Fax 9862 4320 Mail: aars@adv-stenum.dk

En af de fire finalister i Danmarks Bedste Landbrugsmaskinmekaniker er Jesper Fogtmann. Han er lærling i en maskinforretning i Bredebro.

Danmarks bedste lærling kåres i Aars Erhvervsskolerne Aars laver egen konkurrence Af Torsten Hansen AARS: I denne tid kæmpes der i konkurrencen Skills rundt om i landet, hvor elever dyster om at være de bedste til netop deres fag. Men ikke alle fag er repræsenteret i Skills. Det gælder blandt andet landbrugsmaskinmekanikeruddannelsen. Den uddannelse tilbydes kun på Erhvervsskolerne Aars og rammer en forholdsvis smal gruppe. Selv om uddannelsen ikke er en del af Skills, så skal eleverne på Erhvervsskolerne Aars ikke snydes for at konkurrere om at være de bedste. Lørdag og søndag, 8. og 9. februar afholdes derfor

konkurrencen Danmarks Bedste Lærling – Landbrugsmaskinmekaniker på Erhvervsskolerne Aars. Her konkurrerer de fi re dygtigste lærlinge om retten til at kunne kalde sig Danmarks bedste. - Jeg håber, konkurrencen bliver en stor oplevelse for både publikum og for de elever, der deltager. En konkurrence som denne kan forhåbentlig medvirke til at vise omverdenen, hvor dygtige og alsidige de er og være med til at give dem en endnu større faglig stolthed. Jeg håber, at både elever og publikum får en interessant og spændende oplevelse, og at konkurrencen her kan være en reklamesøjle for vores branche

fremover, siger Per Hedtoft, konsulent hos Dansk Maskinhandlerforening, der sammen med Dansk Metal, LandbrugsMedierne og Erhvervsskolerne Aars arrangerer konkurrencen.

Fire opgaver Selve konkurrencen består af i alt fire opgaver med tre timer til hver opgave, to lørdag og to søndag. Hver deltager er på samme tid i gang med hver sin opgave, der består af en lang række underopgaver, som hver især giver point. Vinderen er den finalist, der sammenlagt scorer flest point i alle de fire opgaver, som strækker sig over et bredt spektrum af udmålinger og fejlfi nding på trak-

torer og landbrugsmaskiners hydrauliske og elektriske anlæg. - Der er en bred vifte af opgaver til konkurrencen, for det er mange forskellige problemstillinger, eleverne kommer til at løse ude i erhvervslivet, når de er udlært. Det skal konkurrencen afspejle, forklarer Karsten Poulsen, der er faglærer på Landbrugsmaskinmekanikeruddannelsen på Erhvervsskolerne Aars. - Som skole kan vi godt tillade os at være stolte over den alsidighed og det høje faglige niveau, vi uddanner elever på, og det vil vi som skole også gerne være med til at vise overfor branchen og for andre interesserede, supplerer hans kollega Henrik Skadhauge, der også er faglærer på uddannelsen. Idet uddannelsen kun tilbydes i Aars, så går der elever fra hele landet på skolen. Derfor er det elever fra hele landet der har kunnet deltage i konkurrencen. En jury har udvalgt de fi re finalister. Fælles for samtlige deltagere i konkurrencen er, at eleverne har afsluttet sjette skoleforløb, men endnu ikke har fået deres svendebrev.

Alle kan følge med Samtlige opgaver foregår indendørs på Erhvervsskolerne, og en lille afspærring er, alt hvad der skiller deltagerne fra publikum, så der bliver rig mulighed for at følge med i, hvad den enkelte deltager er i færd med. Under konkurrencen vil der desuden være kommentatorer, som forklarer, hvad fi nalisterne skal forsøge at løse og der vil være skærme, som viser, hvad de forskellige opgaver går ud på. Konkurrencen begynder med en kort præsentation, hvorefter de første runder afvikles. Søndag eftermiddag kåres en vinder af konkurrencen.

Handel, håndværk, industri og service

Den nye udgave af AARS BOGEN er under udarbejdelse og vil også i 2014-udgaven indeholde et foreningsregister. Alle foreninger i Aars og omegn, som ønsker at blive optaget i AARS BOGEN 2014 eller har rettelser til tidligere optagelse, skal indsende nedenstående kupon i udfyldt stand senest den 31. januar 2014. Optagelsen er gratis!

Alle erhvervsdrivende i Aars og omegn har mulighed for at blive optaget i fagregistret Handel, håndværk, industri og service. Optagelsen kan ske enten i annonceform eller som tekstlinjer. Prisen for annoncer er afhængig af størrelse: 30-45 mm = 45,00 kr. pr. mm. 50-95 mm = 39,00 kr. pr. mm. 100 mm og derover = 33,00 kr. pr. mm. Alle priser er + moms. Tekstlinjeoptagelser, standardoptagelse = 2 linjer 400,00 kr. + moms. Yderligere linjer 125,00 kr. + moms. Henvendelse vedrørende optagelse i fagregistret sker til AARS BOGENs kontor, tlf. 98 62 17 11. Vor konsulent er gerne til rådighed med hjælp til udformning af annoncer. Sidste frist for annoncebestilling/tekstlinjeoptagelse er 31. januar 2014.

Aars Vejviser

personregister - rettelse/tilføjelse n 2 s

Personer, som ikke tidligere har haft deres telefonnummer optaget i AARS BOGEN eller har rettelser til det allerede optagne telefon20 13 nummer, bedes give meddelelse herom på neden-stående kupon, der skal være AARS BOGENs kontor i hænde senest den 31. januar 2014. Optagelsen er gratis! Værd at vide Foreningsregis ter

Personregiste

r

– den lokale vejvis er

Foreningsregister

AARSBOGEN 20 13

AARS BOGEN - AARS VEJVISER

Find din lokale fagmand!

Handel, håndvæ industri, service rk,

Gaderegister

By- og kommu nekort

BEMÆRK! Rettelse/tilføjelse omfatter KUN telefonnumre. Rettelse af personnavne og stillingsbeskrivelse m.v. skal ske ved henvendelse til folkeregistret.

Kupon - foreningsregister - 2014 Foreningens navn: ________________________________________________________

Kupon - personregister - 2014

Kuponen indsendes til

_________________________________________________________________________________

Navn: _________________________________________________________________________

Formand: ____________________________________________________________________

Adresse: _____________________________________________________________________

Adresse: _____________________________________________________________________

Telefon: _____________________________________________________________________

Telefon: _____________________________________________________________________

Sæt kryds Kasserer: ____________________________________________________________________ Adresse: _____________________________________________________________________ Telefon: ______________________________________________________________________

!ARS6EJVISER

Aars Avis & Centraltrykkeriet A/S Himmerlandsgade 150, 9600 Aars Telefonnumre i

P Ny optagelse P Rettelse


Aars Avis

22. januar 2014

SIDE 13

KONFIRMAND 2014 by Marcus

Kunstmaler Henning Wieben, Nibe, er en af de kunstnere der gennem flere år har deltaget på Tidens Kunst i Aars.

102 udstillere klar til Tidens Kunst i Aars

INTROPRIS! -20% PÅ KONFIRMANDAFTENERNE PÅ ALT I KATALOGET

Der er stadig enkelte ledige pladser til kunstnere AARS: Udstillingen Tidens Kunst, som afvikles i dagene 14. til 16. februar i Messecenter Vesthimmerland har endnu få ledige stande. 102 kunstnere har tilmeldt sig udstillingen. De vil fremvise mange kunstarter. Publikum kan forvente at se værker indenfor bronze, skulpturer, sten og billedkunst. Interessen fra kunstnerne er på højde med tidligere år. Der er cirka 40 procent gengangere, og de resterende er nye. Igen i år kommer kunstnerne ikke bare fra Nordjylland, men resten af resten landet er også godt repræsenteret.

Der er niende år Tidens Kunst afvikles, og det er således blevet en tilbagevendende event i Messecenter Vesthimmerland. Da Kimbrernes Y’s Mens Club i Aars etablerede udstillingen Tidens Kunst var hensigten at prøve at vise tidens strømning i kunsten, hvor kunstnere fik mulighed for at vise deres kunst på udstillingen. Den ambition er generelt lykkedes. Tidens Kunst er ikke tænkt som en konkurrent til egnens gallerier. Det er heldigvis også blevet sådan, at mange publikumsgæster udvælger, hvad der har interesse, og

besøger herefter de enkelte kunstneres gallerier. Den første udstillingsdag ved Tidens Kunst, fredag, er der, som tidligere år, fernisering. Denne aften doneres overskuddet fra sidste års udstilling til velgørende formål. I år er Farsø Sygehus blandt modtagerne. Som noget nyt i år får alle publikumsgæster en let anretning efter ferniseringen. Kimbrernes Y’s Mens Club i Aars forventer at Tidens Kunst bliver en publikumssucces. Sidste år kom næsten 1600 gæster for at se udstillingen, og arrangørerne forventer et besøgstal i samme størrelse.

KONFIRMANDAFTENER KL. 18.00-21.00

DEN 28. JAN DEN 30. JAN DEN 4. FEB DEN 6. FEB DER ER RIFT OM PLADSERNE! BOOK EN TID NU PÅ AARS@MARCUS.DK ELLER PÅ TELEFON 9866 3377

SCAN koden og se hele kataloget..!

www

.m ar

cu s.

dk

Marcus Aars Søndergade 31F 9600 Aars Tlf. 9866 3377


Aars Avis

SIDE 14

KĂ˜R-SELV-LÆSERREJSER MED

Lokal mĂŚgler vil styrke positionen

Som lÌser af Aars Avis für du disse sÌrlige lÌsertilbud. Oplys rejsekoden AARSAVIS ved bestilling – sü für du automatisk rabatprisen.

PWFSOBUOJOHFS

,6/ 

Børnerabat

1 barn 0-5 ür gratis. 2 børn 6-14 ür ½ pris.

8 dage i Italien

Hote iglio lG

Pris pr. person i dobbeltvĂŚrelse

Montecatini Terme

2.499,-

Hotel Giglio ★★★ Velkommen til en af Italiens mest kendte kurbyer, Montecatini Terme. Her bor I centralt pĂĽ det klassik indrettede hotel med solterrasse og swimmingpoolen pĂĽ Hotel Nizza et Suisse til fri afbenyttelse. Rundt i omrĂĽdet har I nogle af landets største sevĂŚrdigheder og pladser – og i selve Montecatini Terme har I blandt andet bjergbanen fra 1890 til Montecatini Alto. Oplev for eksempel ogsĂĽ Pisas smukke dĂĽbskapel eller det skĂŚve tĂĽrn i Pisa (55 km), hvor I kan vandre de 296 trappetrin op til toppen og nyde udsigten over byen. I det toscanske bjerglandskab finder I oliven- og citronlunde og cypresser tĂŚt mellem middelalderbyer, der byder pĂĽ en uovertruffen rigdom af kultur og italienske traditioner. Vinmarkerne strĂŚkker sig hele vejen ned til den charmerende by Siena, hvor I kan smage den italienske specialitet panforte.

Pris uden rejsekode kr. 2.799,-

tPWFSOBUOJOHFS tYNPSHFOCVGGFU tYSFUUFSTNJEEBH tSBCBUQ�FOUSFUJM wellnesscenter tYSVOEWJTOJOHPH  QS“WFTNBHOJOHIPT  5FOVUFEJ#BEJB

Bettina SĂŚderup - nyansat hos ejendomsmĂŚglerďŹ rmaet Agriteam ApS. i Aars.

Statsautoriseret ejendomsmĂŚgler og agronom Ib Bjerregaard siger, at

OBS: Turistskat EUR 1,- pr. person fra 10 ür pr. døgn.

Pris pr. person i dobbeltvĂŚrelse

Miniferie i Mols Bjerge

799,-

Pris uden rejsekode kr. 949,-

Børnerabat

AARS: Agriteam Aars ApS., ejendomsmĂŚglerďŹ rmaet Ib Bjerregaard, med kontor i Aars og virke i Midt- og Nordjylland, har ansat Bettina SĂŚderup for at styrke ďŹ rmaets kompetencer inden for sagsbehandling og omsĂŚtning af landbrugsejendomme. Bettina SĂŚderup, 30 ĂĽr, bor pĂĽ et landbrug i udkanten af Aars, og kommer fra en stilling som sekretĂŚr hos advokatďŹ rmaet KĂźhnel og Kringelbach. Tidligere var hun ansat pĂĽ Agri Nords ejendomskontor - ligeledes som advokatsekretĂŚr. Bettina SĂŚderup har derfor erfaring med tinglysning og omsĂŚtning af fast ejendom generelt, og har en sĂŚrlig viden om handel med landbrugsejendomme. - Jeg er rigtig glad for igen at arbejde med det, jeg er bedst til og bruge min viden i det daglige arbejde. Jeg kender Agriteam fra tidligere. Her fĂĽr jeg ogsĂĽ direkte kundekontakt, siger Bettina SĂŚderup.

det krĂŚver mere og mere at gennemføre de enkelte handler og at ďŹ rmaet fĂĽr ere og ere kunder i et større og større geograďŹ sk omrĂĽde. - Jeg kan derfor ikke følge med og servicere alle, som jeg gerne vil. Med ansĂŚttelsen af Bettina SĂŚderup kan jeg blive aastet og er glad for at have fĂĽet en medarbejder, der kender omrĂĽdet fagligt og geograďŹ sk sĂĽ vi kan servicere kunderne endnu bedre i fremtiden, ssiger Ib Bjerregaard. PĂĽ sigt er det meningen, at Bettina SĂŚderup skal uddannes som statsautoriseret ejendomsmĂŚgler, men i begyndelsen vil Ib Bjerregaard selv tage sig af alle de større landbrugshandler og alle vurderinger. EjendomsmĂŚgler ďŹ rmaet Ib Bjerregaard beskĂŚftiger sig primĂŚrt med formidling af store og smĂĽ landbrugsejendomme. Firmaet har et indgĂĽende kendskab til lokalomrĂĽdet Midt- og Nordjylland, og har en stor faglig viden om landbrugets driftsgrene. Arbejdet sker i et landsdĂŚkkende samarbejde, hvor der løbende er omkring 300 landbrugsejendomme til salg.

"OLPNTU Valgfri i perioden 1.4.-16.10.2014.

3 dage pĂĽ Djursland

1 barn 0-5 ür gratis. 2 børn 6-14 ür ½ pris.

22. januar 2014

tPWFSOBUOJOHFS tYNPSHFOCVGGFU tYSFUUFSTNJEEBHCVGGFU t'SJBEHBOHUJMIVMMFST HPMGCBOFPHTQPSUTIBMMFSOF

Hotel Fuglsøcentret

Hotel Fuglsøcentret Hotellet ligger midt i Mols Bjerge med den flotteste udsigt over 4FGMFSFPQIPMETNVMJHIFEF S Q�XXXIBQQZEBZTOV omrüdet, og kun 1 km fra Fuglsø Strand. Her für I den bedste oplevelse af den flotte natur, ved at fÌrdes til fods ad de "OLPNTU afmÌrkede vandrestier og skovveje gennem det skønne terrÌn Mandag til fredag frem til 11.4. og – eller pü en travetur langs de brusende bølger ved Fuglsø Vig. valgfri i perioden 14.4.-19.12.2014.

4 dage i Mecklenburg-Vorpommern

Stem nu til TryghedsGruppens reprÌsentantskab og fü indydelse pü trygheden i Nordjylland. LÌs mere og stem pü tryghedsgruppen.dk/valg2014

Pris pr. person i dobbeltvĂŚrelse

Nordtysk herregĂĽrdsferie

1.149,-

1SJTVEFOSFKTFLPEF  1SJTVEFOSFKTFLPEFLS  1SJTUJMMÂ?H 

Gut Gremmelin

FMMFSPWFSOBUOJOH

FS

t PWFSOBUOJOHFS t Y“LPMPHJTLNPSHFOCVGGFU t YSFUUFSTNJEEBHBG  MPLBMF “LPMPHJTLFS�WBSFS t YFOUSFUJM  4DIMPTT(à TUSPX

3JOHPHI“S (VU(SFNNFMJO Hotellet giver dig god samvittighed: Her betyder ferie, at du gør noget godt for dig selv – og miljøet. Den smukke herregürd fra 1800-tallet er i dag moderne indrettet og klassificeret som BIO- "OLPNTU hotel med en klar holdning til, hvad man byder gÌsterne. Og her Valgfri frem til 10.4. samt i perioden 22.4.-29.8.2014. serveres der kun økologiske mad af lokale rüvarer.

Afbestillingsforsikring kan tilkøbes. Ekspeditionsgebyr kr. 79,-. Børnerabat ved 2 voksne.

www.happydays.nu eller ring 70 20 34 48 Bestil nu pĂĽ

Teknisk arrangør:

Husk rejjsekode:

AARSAVIS

Ă…bent hverdage kl. 8-17.

TryghedsGruppen er hovedejer af forsikringsselskabet Tryg og stĂĽr bag TrygFonden. Vi skaber vĂŚrdi og tryghed gennem langsigtede investeringer og almennyttige uddelinger. Du kan stemme til TryghedsGruppens reprĂŚsentantskab, hvis du er forsikringstager i Tryg eller Nordea Liv & Pension.


Aars Avis

22. januar 2014

SIDE 15

Kvickly Aars tilbyder SLAGTEREN TILBYDER Rødvinsmarineret svinekam

Pizza 3 varianter. Skine, okse, pepperoni. Min 650 g

Min. 1800 g

Pr. stk.

Pr. stk.

3995

10000

Pr. stk.

3500

Spar 90,-

Spar

20,-

Spar

24,95,-

BAGEREN TILBYDER Stort weekendbrød

Gammeldags fastelavnsboller

Lyst fuldkornsbrød

creme eller hindbær

Pr. stk.

Frit valg

Pr. stk.

00

20

500

1500

Spar

Spar

10,00,-

GRØNTAFDELINGEN TILBYDER Store flotte Änglamark gulerødder 750 g. Danmark tulipaner

Settesoli - Nero D’avola Bag in boks. 3 ltr.

Pr. stk.

00

E T PA RT I BEGR Æ NS

89

5

3500

795

25,-

TIRSDAGE

Kvicklybagerens hjemmebagte emmebagte rugbrød Store skrabe æg

fra bageren

Coop juice

ONSDAGE Yoggi letmælksyoghurt

Flere varianter

00

8

Vælg mellem flere varianter Max 5 liter pr. kunde

Flere varianter

Pr. stk.

Pr. stk.

1200

Pr. stk.

15

00

TORSDAGE

Max 5 bakker pr. kunde

FREDAGE

Bagerens hjemmelavet hindbærsnitter

Delikatesse pålæg

Pr. stk.

Pr. stk.

500

900 Max 5 liter pr. kunde

Max 5 liter pr. kunde

Kims chips

Frugtmarked

Spar

7,-

10 stk. i bakke

Formfranskbrød

Thise økologisk mælk

Kartofler

Pr. pose

60,-

Pr. stk.

00

20 stk. Spar

Spar

MANDAGE

11,00,-

LØRDAGE Bøfmarked

Flere varianter

Pr. 100 g

Pr. stk. 4 kg.

9

00

Pr. stk.

00

6

1 lag

1

900

30

Max 20 stk. pr. kunde

Kylling

SØNDAGE

Pr. bk.

800 g

00

40

Pr. pose

00

10

1000

Max 5 poser pr. kunde

Bakkedal 250 g

800 g

800 Max 5 bakker pr. kunde

Vi tager forbehold for trykfejl, manglende leverancer, afgiftsændringer og udsolgte varer

Min. 1200 g

DAGSTILBUD GÆLDER TIL OG MED UGE 15 KUN I KVICKLY AARS

Åbningstider

Kvickly Aars

Man-fredag 08.00-20.00 Lørdag 08.00-18.00 Søndag 08.00-18.00

Markedsvej 3 9600 Aars Tlf. 96 37 76 00

Tilbuddene gælder fra onsdag d. 22. januar til og med lørdag d. 25. januar.

Nyrøget kylling


Aars Avis

SIDE 16

22. januar 2014



 GLQ O L W  OS HU

W

SX P R F KMÂ

‡,GLWRPUnGHKYHUXJH ‡3ULYDWHRJHUKYHUY ‡9LN¥UHJHUQHWLOGLJ ‡(JHWY UNVWHG ‡/\QKXUWLJVHUYLFH ‡6DOJDIQ\WRJEUXJW ‡1HWY UN ‡$QWLYLUXV ‡%DFNXS ‡:LQNRPSDV ‡3ULQWHUO¥VQLQJHU ‡+MHPPHVLGHU ‡6HUYHURJNOLHQWHU

FREDAGS TAPAS I RESTAURANT ELLER �SELV HENTER� VÆLG MELLEM



4 frÌkkerter med 2 salat/grønsags ting (tjek vores hjemmeside med fredagens 4 frÌkkerter)

89,- eller

  IUDNU NLQHU  V D  P UD 1\H  IUDNU RRNVI 1RWHE VPDVNLQHU UY (UKYH RPV H[FOP

Serrano skinke, pate, anderielette, 2 slags ost

99,Brød og smør kr. 10,-

GHWOLOOHFRPSXWHUILUPD

HIIHNWLYSFGN 

Dette rĂŚkkehus i Ă˜strup ejes af Aars Boligforening. Nu ønsker boligforeningen at sĂŚlge lejlighederne.

Boligforening vil sĂŚlge boliger i Vegger og Ă˜strup Salget er en del af en renoveringsplan til 37,5 mio. kroner

Himmerlandsgade 111 ¡ 9600 Aars ¡ Tlf. 98 62 16 00 ¡ www.aarshotel.dk

Af Torsten Hansen

www boostingbusiness www.boostingbusines g s.dk dk k kontakt@boostingbusiness.dk @boostingbusin g

AARS: Aars Boligforening stĂĽr foran en større renovering af boliger, der alle er opført fra 1980 til 1984. Det drejer sig om en helhedsplan for afdeling 101 Solvangsparken, der bestĂĽr af ďŹ re afdelinger. Den samlede pris for renoveringen er opgjort til 37,5 mio. kroner, men den kunne faktisk have vĂŚret noget større. Afdelingen Solvangsparken bestĂĽr i dag af 51 boliger, men syv af boligerne ønsker Aars Boligforening ikke at renovere. Foreningen vil hellere forsøge at sĂŚlge de syv boliger. - Vi har døjet med at leje de

syv boliger ud, og vi mener at huslejen vil blive for høj, hvis vi renoverer dem, forklarer forretningsfører Jens Damgaard, Aars Boligforening. De syv boliger ligger henholdsvis pĂĽ MøllevĂŚnget 15 i Vegger og Nygade 34 i Ă˜strup. Der er ikke tale om, at Aars Boligforening trĂŚkker sig ud af Vegger og Ă˜strup. I begge byer har boligforeningen andre boliger der fungerer ďŹ nt. Alle de 51 boliger er pĂĽ 60 kvadratmeter og beboes primĂŚrt af pensionister. De boliger foreningen ellers har i de to byer er generelt lidt større. PĂĽ trods af det er der ikke planer om at slĂĽ

nogle af boligerne sammen til fÌrre og større. - Vi tror ikke pü, at det bliver bedre ved at slü dem sammen. Det gÌlder heller ikke i Aars og Hornum, hvor de øvrige 44 boliger ligger. Samtidig er det ogsü vores holdning, at vi skal have büde store og smü boliger at tilbyde, forklarer Jens Damgaard. Boligerne i Hornum og Aars ønskes fremtidssikret. Det skal bl.a. ske ved, at skabe større tilgÌngelighed til huse og udenomsarealer og modernisere de enkelte boliger med nyt tag, køkken, bad, gulv og vinduer. Bygningerne skal efterisoleres og bringes op pü nutidigt niveau.

Landsbyggefonden

UDSALG og andre gode tilbud fra i dag

Intropris

Hjørnesofa NU

4.999,-

m/chaiselong og ĂĽben ende. Corsica stof. Ben i sort. L 300 x D 200 cm Normalpris 8.999,-

Otiumstol

Reclinerstol m/elregulering ryg. Inkl. fodskammel. Drejefod. Mørkeblüt stof. Normalpris 6.295,Lev. ogsü i lÌder mod tillÌg

MAGASINER   F LY E R S HJEMMESIDER FOLDERE   P L A K AT E R LOGODESIGN BANNERE BEACHFLAG ROLL-UPS Himmerlandsgade 150

5.999,-

m/el-regulerbar ryg. Sort lĂŚder. Normalpris 6.395,-

NU

GIV DEN

4.999,-

G AS

E N I L N el O rofession me d en p g snin webR Slø E KIDEGOD VI E

TIL DET!

KOM OG TĂ˜M VORES SKOVBY UDSTILLING i bøg og valnød

á25%

pĂĽ udstllingsmodeller MĂ˜BLER SENGEUDSTYR

TÆPPER VINYL

Farsø Boligmontering Nørregade 74 ¡ 9640 Farsø ¡ Tlf. 98 63 24 88

|

9600 Aars

|

Tlf. 20 30 65 43

Ľ‚ĤPĂ˜ÂľÄŻĂ­ÂľÄŻP̂Ä&#x;Â?į´í‚Â?ÄŻÄąĂƒĂ˜dÄ˝ÂƒÄŻpįĽ‚ĤPĂ˜ÂľÄŻĂ­ÂľÄŻP̂Ä&#x;Â?į´í‚Â?ÄŻÄąĂƒĂ˜dÄ˝Âƒ

For fĂĽ ĂĽr siden ønskede Aars Boligforening at nedlĂŚgge udlejningsboliger i Gundersted. Det satte Landsbyggefonden sig imod. For at undgĂĽ en gentagelse af det senarie har Aars Boligforening valgt at tage Landsbyggefonden med pĂĽ rĂĽd fra start. - De indstiller planen til godkendelse i Bolig, By og Land Ministeriet. SĂĽ vi skulle ikke komme i den slags problemer denne gang, siger Jens Damgaard. De 44 boliger der skal renoveres er seks rĂŚkkehuse beliggende Kirkevej 22 og 24, Hornum, og 38 rĂŚkkehuse beliggende Solbakken 1 - 77, Aars. Finansieringen af helhedsplanen afhĂŚnger af den model som Landsbyggefonden ďŹ nder egnet i det pĂĽgĂŚldende tilfĂŚlde. Den kan f. eks. bestĂĽ af lĂĽneoptagelse, tilskud, driftsstøtte og kapitaltilførsel. Ă˜konomiudvalget i Vesthimmerlands Kommune har sagen pĂĽ dagsordenen i dag onsdag. Derefter skal sagen i ByrĂĽdet. ByrĂĽdet skal pĂĽ nuvĂŚrende tidspunkt alene tage stilling til om helhedsplanen kan anbefales.


Aars Avis

22. januar 2014

SIDE 17

§

ADVOKATHUSET Kurt Kvist Henrik Ejlersen Ejler Ejlersen Ole Anders Petersen

§

Møderet for Højesteret

Tlf. 98 64 28 22 Vestergade 21 - 9620 Aalestrup - Fax 86 62 82 11

SKIUDSALG hos Golf & Ski • • • • • •

Restparti ski sælges nu til kr 1.499,- m. bindinger Restparti snowboard nu til kr 1.599,- m. bindinger Restparti skihjelm nu til kr 199,Slibning og voksning af ski og snowboard Udlejning af komplet alpin til voksen og barn Orion ski med støvler 2499,-

Se mere info og priser på www.golfogski.dk Der var mødt mange 4H børn frem, da den nye filialdirektør i Nordea, Aars, Steffen Ludvigsen kom og overrakte 4H Gården 10.000 kroner fra Nordea Fonden.

4H Gården i Aars får fondspenge AARS: Nordea Fonden har givet 10.000 kroner til 4H Gården i Aars.

4H Gården har ansøgt om penge til at købe rideudstyr for.

Bestyrelsesmedlem Henning Bach, 4H Gården, fortalte ved overrækkelsen, at det er

Orienteringsaften på gymnasiet i Aars Gymnasiet slår dørene op for kommende elever AARS: Mandag aften slår Vesthimmerlands Gymnasium og HF dørene op for et arrangement, hvor kommende elever og deres forældre kan få svar på alle de spørgsmål, de måtte have om de to ungdomsuddannelser, gymnasiet kan tilbyde: stx og hf. Aftenen bliver indledt af vicerektor Ralf Leimbeck, der vil give en almen

orientering om gymnasiet, af brudt af musikindslag og information om elevaktiviteter uden for skoletiden. Efterfølgende er der to orienteringsrunder, hvor man selv kan afgøre, hvilke studieretninger, man vil høre nærmere om. På stx drejer det sig om retningerne Natur og videnskab (x-klasserne), Sprog og kultur (a-klas-

serne), Samfund og sprog (s- og t-klasserne), Krop og sundhed (k-klasserne) og Musik og kreativitet (mklasserne). På hf kan man vælge mellem Almindelig hf eller hf med Sport. Hver stand er bemandet med både lærere og elevambassadører. I pausen mellem de to orienteringsrunder byder gymnasiet på kaffe og so-

s e r o v e s g Kom o n e k k i t u b i s g bad Skagenshstu o r e n e k k ø k algi

Golf & Ski www.golfogski.dk

nødvendigt med støtte udefra for at kunne fortsætte de fantastiske tilbud til børnene.

Oustrupvej 73, 9600 Års

Åbent hver torsdag fra kl 16.30-20.00 eller efter aftale!

davand, og her er det også muligt at snakke med en studievejleder og prøve at sammensætte sin egen studentereksamen ved hjælp af et lille computerprogram, der tager højde for alle mulige fagkombinationer. Der vil desuden være læsevejledere til stede i pausen, der kan fortælle om de støttemuligheder, der er for elever med indlæringsvanskeligheder. I anden orienteringsrunde kan man endvidere få hjælp til det sprogvalg, man står overfor ved indgangen til gymnasiet. På VHG er mulighederne tysk, fransk og italiensk.

SÆT

Se mere på www.st-ajstrup.dk eller ring på tlf. 98 35 53 11

Michael: 40633918 Ulf: 21810118

TILBUD I uge 5 giver vi

50% på massevis af tilbehør til hund og kat.

Kom og gør en god handel og få professionel rådgivning omkring dit kæledyrs behov på:

AARS DYREHOSPITAL Industrivej 4 - 9600 Aars . Tlf. 98 62 31 00 www.familiedyrlægerne.dk

- tryghed for dig & dit dyr



I KALENDEREN

4. MAJ 2014 KL. 10.00

no det) - fyldt m(eendeste sted du kan se det i hele lan

Fra udstillingen i St. Ajstrup

Løbet skydes i gang på Boosting Business/Aars Avis Hvem? For glade motionister og gale løbetosser

Hvad? Rundeløb Halvmarathon Helmarathon

Sponsorer:

St. Ajstrup

Læs mere og tilmeld her

v/Nibe

KØKKEN- OG HVIDEVAREBRUGSEN Brugsvej 7, St. Ajstrup · 9240 Nibe Mandag - fredag kl. 9.00 - 17.30 - Lørdag og søndag lukket

etning Bundsolid forr ed! at handle m

Hvorfor? Et evt. overskud går til et godt formål

AARS

MIDTFJORD

www.boostingbusiness.dk


Aars Avis

SIDE 18

22. januar 2014

Pengeyngler-etiket fra kunstner i Aars Af Thorkil Christensen AARS: Kimbrerfestens Pengeynglervin 2014 er nu på gaden - og etiketten, der pryder flasken i år er udført af den lokale kunstner Nadja Adelborg, gift med værten på Aars Hotel, Morten Nørgaard. Nadja Adelborg er billedkunstner og gæster på hotellet kan glæde sig over nogle af hendes billeder som smykker restaurant og selskabslokaler. Man kan også opleve Nadja Adelborgs billeder i det kendte Galleri Wolffsen i Aalborg. Nadja Adelborg har

ØSTRUP

Tømrer- & Snedkerforretning ApS Søren B. Andersen Østergade 29 · Østrup · 9600 Aars Telefon: 20 21 88 77 info@ots-aps.dk CVR-nr: 26109892 www.ots-aps.dk

atelier ved privatboligen på vatbolig Ingemannsvej i Ingema Aars, og det er til her motivet m etiketten på etik Pengeyngler Pe nes vin er ne skabt. I år er sk ddet en italivin eensk ssom Pengeyynglerne iintroducerrer. Vinen er en Rosso Piceno fra Castru Kunstneren Nadja Adelborg har udført etiketten til Pengeynglernes italienske vin 2014.

Vecchiu og den er velegnet til både grillmad og ost. Det er en årgang 2010, som ifølge Pengeynglerne er særdeles velsmagende. Der er tradition for, at Pengeynglerne hvert år fi nder et parti vin som de sælger videre for at skaffe overskud som led i Kimbrerfesten. Der er mange faste lokale aftagere af Pengeynglernes vin, og for at det kan blive ved, er det vigtigt, at de hvert år fi nder en vin af god kvalitet og med en smag som de fleste kan lide. Sådan er det også i år. Der har været Pengeynglere i forbindelse med Kim-

ADVOKATFIRMAET A DVOKATFIRMAET

JAN POULSEN

Boligadvokat

Møderet for højesteret

Aagade 8 . 9620 Aalestrup Kc]%0/-+(/((›=Xo0/-+)+,/ Kontortid: Mandag - fredag kl. 8.30-16.00 - advokatkontoret dvokatkontor der hjælper dig...

E-mail: jpo@advokatjanpoulsen.dk www.advokatjanpoulsen.dk

BYENS MALER JOHN T. LAURSEN

Er din stue blevet trist og grå er det Byens Maler du bør tænke på Alt male- og tapetserearbejde udføres GL. SKOLEVEJ 7 . 9600 AARS DAG: MOBIL 40 20 38 82 . AFTEN TLF. 98 62 38 82

Hus boligfrak drag

s%L INSTALLATION s!LARMOGOVERVÍGNING s !IRCONDITION s 6ENTILATION s 3OLCELLEROGSOLFANGER s "OSCH6ARMEPUMPER - 5 års garanti

Døgnvagt 98 63 19 11

Mere end 50 elever fra Vesthimmerlands Gymnasium og HF knokler i disse dage for at blive klar til deres store indsamlingsshow på lørdag. Her driller undertråden, men ellers går det planmæssigt fremad, og skolens syersker lover, at alle kostumer bliver klar til lørdagens show i ALFA.

Danmarksindsamlingen får støtte af VHG-elever De musikalske elever er gået i gang med øvelserne Af Lars Lindberg AARS: Det er lørdag formiddag, og for mange gymnasieelever er det allerførst på dagen - men ikke for en stor gruppe elever fra Vesthimmerlands Gymnasium og HF. De har været oppe længe, og morgenrusten er forlængst banket af deres stemmer. Gymnasiet i Aars har nemlig valgt at støtte Danmarksindsamlingen, og det gør de ved at lave et stort show i Vesthimmerlands Musikhus ALFA lørdag aften, hvor de vil optræde med

både alvorlige, humoristiske og musikalske indslag. Mere end 50 elever er involveret i showet, og de er i disse dage ved at finpudse de indslag, de selv har skrevet tekst og musik til. I dag er de forskellige grupper i fuld sving. I flere af musikhusets lokaler bliver der øvet på de musikalske indslag, som spænder bredt - publikum kan således se frem til at høre både pop, funk og rock ved lørdagens show. VHG’erne har organiseret sig i en række grupper, som arbejder selvstændigt, og det er således kun styregruppen

bestående af fire elever, som har det store overblik. Det er Morten Jensen, Camilla Sandø, Anna Bruun og Anna Fuglsang, som sidder i styregruppen, og de har store forventninger til showet. - Der er plads til 400 mennesker i ALFA’s store sal, og det er målet at sælge alle billetter, lyder det korte svar fra Morten Jensen. I forhold til det det hele handler om, nemlig penge, er målet, at VHG efter showet kan give en check på mindst 10.000 kroner til Danmarksindsamlingen, der i år har titlen ”Når mor mangler”. For at få så mange penge

brerfesterne i Aars hvert år siden 1987, men salget af vin begyndte først nogle år senere. I år består Pengeynglerholdet af Allan Hansen, Sparekassen Himmerland, Anita Skjødt Jensen, Danbolig Vesthimmerland, Louise Holmager, Grønthjørnet og Camilla Hornbæk, som netop er vendt tilbage til Aars efter et ophold i Aarhus. Overskuddet fra salget af vinen og fra Pengeynglernes øvrige aktiviteter i løbet af året afsløres for offentligheden ved Kimbrerfesten i Aars Lystanlæg i september.

som muligt i kassen har eleverne valgt at sælge to slags billetter. Man kan således købe en billet, der ”kun” giver adgang til showet, men graver man lidt dybere i pengepungen, kan man få en billet, der samtidig fungerer som en lodseddel, og det er fine præmier, man kan vinde. - Vi har hele tiden haft for øje, at vi skulle samle så mange penge ind til Danmarksindsamlingen som muligt, så vi har fået en række lokale virksomheder til at sponsorere nogle gode præmier, og vi har fået dem gratis. Derfor kan vi også sige, at alle indtægter går fuldstændig ubeskåret til indsamlingen, fortæller Camilla Sandø. I forbindelse med showet vil man i pausen kunne købe snacks og drikkevarer, ligesom man vil kunne besøge en række boder, og der er ingen grund til at være nærig, for de penge man bruger, går også til forældreløse børn i en række udviklingslande. Denne formiddag kan det være svært at se, hvordan eleverne skal blive klar til lørdagens show, men styregruppen lover, at der er styr på det hele. I denne uge bliver de sidste kostumer syet færdigt, og så står den ellers på timevis af øvetimer i musikhuset, inden det for alvor går løs lørdag. Skulle man ikke have mulighed for at overvære selve showet, men har man lyst til at støtte den gode sag, kan man allerede nu via skolens hjemmeside indbetale penge til Danmarksindsamlingen.

www.oegaard.dk

Cimbrer Bilerne I/S Industrivej 46 - 9600 Aars

Taxi & Busser Turist i ind- og udland Ring og få tilbud

Tlf. 98 62 24 94 - 98 62 33 00 4 - 8 - 14 - 17 - 34 - 47 - 53 pers.

Eleverne er inddelt i mange små grupper, som arbejder selvstændigt, og det er kun styregruppen bestående af Anna Bruun, Anna Fuglsang, Camilla Sandø og Morten Jensen, der har det store overblik.

Lørdagens show vil indholde en række musikalske indslag fra mange forskellige genrer, og det er eleverne selv, der har skrevet både musik og tekst.


Aars Avis

22. januar 2014

SIDE 19

Aars Pensionistforening fylder 75 år Richard Ragnvald er hovednavnet ved den store jubilæumsfest i Aars Af Torsten Hansen AARS: 75 år er en helt almindelig alder for et medlem i Aars Pensionistforening. Men 75 år er ikke en helt almindelig alder for en forening i Aars. Ikke desto mindre kan netop Aars Pensionistforening fejre 75 års fødselsdag 1. februar i år. Fødselsdagen fejres med en stor jubilæumsfest på Kimbrerkroen i Aars. Festen indledes med fanemarch og velkomsttaler. Ud over den nuværende formand Per Drejer så taler borgmester Knud Kristensen også. Festens højdepunkt bliver underholdning af Richard Ragnvald.

resseret i at give foreningen en gave i anledning af fødselsdagen, er der oprettet en jubilæumskonto, hvor der kan indbetales et beløb.

Historien

Blandt Aars Pensionistforenings mange aktiviteter er rejser.

- Vi forventer omkring 200 til jubilæumsfesten, og det skal nok blive godt, siger for-

mand for Aars Pensionistforening Per Drejer. Naturligvis byder festen

også på spisning, taler, kaffe og måske også dans. Skulle nogen være inte-

Der findes ikke meget nedskreven historie om Aars Pensionistforening. Men et kig i gamle Aars Aviser fra 1939 afslører, at foreningen ikke altid har heddet Aars Pensionistforening. Den 3. februar 1939 står der i Aars Avis, at der er stiftet en ny forening dagen før. Foreningen kalder sig en lokal forening for Aldersrentenydere. Allerede første aften indmeldte der sig 28 medlemmer. Carl Poulsen blev valgt

som formand, mens Godtfred Olsen både blev næstformand og sekretær. Foreningens formål var oprindeligt at søge rentenydernes berettigede krav i henhold til de til enhver tid gældende lovbestemmelser og i øvrigt varetage de gamles økonomiske interesser.

Kulturel forening I dag er Aars Pensionistforening i højere grad en kulturel forening med mange aktiviteter. Foreningen arrangerer møder, rejser, sport og kurser. I den nærmeste tid afvikler foreningen generalforsamling (11. februar) og 11. marts holdes der hyggeeftermiddag. Blandt udflugterne kan nævnes en tur til Horsens Statsfængsel 4. juni. Samtidig planlægges en længere rejse, hvornår og hvortil afgøres på et rejsemøde i februar.

Sprød harpeklang bag duggede ruder Intim stemning til refernisering i Aars Af Lars Lindberg

Indehaver af Part2 Galleri, Peer Poulsen, havde besøg af harpenist og operasanger Manuela Rauff, da han lørdag holdt refernisering på sin vinterudstilling.

AARS: Lørdag eftermiddag inviterede indehaver af Part2 Galleri i Aars, Peer Poulsen, til refernisering på sin vinterudstilling, og det blev en alternativ en af slagsen. En refernisering - hvis der reelt er noget, der hedder det - hører i sig selv til sjældenhederne, men det måske til lejligheden opfundne begreb dækkede over, at ferniseringen faktisk havde været holdt én gang. Da den blev holdt i december, faldt det dog sammen med stormen Bodils rasen, og derfor var det så som så med gæster i galleriet. At der var tale om ferni-

sering nummer to, var dog ikke den eneste grund til, at arrangementet var specielt. Specielt var det nemlig også, at gæsterne kunne nyde harpemusik og operasang, mens de så på de mange farverige malerier. Det var harpenist og operasanger Manuela Rauff, der sørgede for musikken, og hendes sprøde harpetoner og glasklare stemme fyldte på smukkeste vis de intime lokaler, og hun havde ikke været i gang længe, før duggen drev ned af galleriets små vinduer. Manuela Rauff er født og opvokset i Aars, og nu er hun tilbage i byen efter noget af et eventyr. For adskillige år siden

rejste hun til Firenze, og hun faldt pladask for Europas kunsthovedstad. Derfor valgte hun at blive boende i byen, hvor hun blev konservatorieuddannet operasanger og harpenist. Efter otte år i Firenze flyttede hun tilbage til Danmark, hvor hun boede i både Randers og Århus, inden hun atter søgte til sin fødeby. Her opdagede hun ved en tilfældighed Part2 Galleri, der fi k hende til at mindes de mange små gallerier i Firenze, og da Peer Poulsen spurgte, om hun ville spille til referniseringen, slog hun straks til. Noget hverken hun, han eller ferniseringsgæsterne fortrød.

7.X var bedst til at sørge for varmemester og Frøken Frys Specialklasse fra Aars Skole vandt landsdækkende konkurrence Af Lars Lindberg AARS: Det kræver en indsats af de større at holde et varmeværk kørende. Det ved eleverne fra specialklassen 7.X på Aars Skole - de har nemlig gjort det i en grad, så de har vundet en landsdækkende konkurrence. Tirsdag formiddag fik eleverne og deres lærere overrakt præmien - en check på 3000 kroner - og det var noget, der lunede hos de hårdtarbejdende elever. - Det er en kæmpe sejr for dem. De har virkelig brugt lang tid på konkurrencen, og

derfor betyder belønningen også meget for dem. Vi har indprentet dem, at når man påbegynder noget, så gør man det også færdigt, og det betyder rigtig meget for dem, at de nu kan se, at de mange timer, de har brugt ved computeren, har været det hele værd, fortæller deres Natur og Teknik-lærer Dan Korsgaard, imens eleverne fejrer deres knusende sejr i den store konkurrence med saftevand og kage. 7.X har længe arbejdet med temaet affald og genbrug, og de har blandt andet været på ”Skraldeskole”. Derfor var det også op-

lagt, at klassen tilmeldte sig, da fjernvarmeskolen.dk udskrev konkurrencen, hvor danske skoleklaser kunne vise, hvor dygtige de var til at køre et varmeværk. Konkurrencen foregik på nettet, og eleverne skulle sørge for, at deres virtuelle varmeværk blev drevet bedst muligt. De skulle blandt andet sørge for, at deres værk ikke brugte for mange fossile brændstoffer i forhold til affald og halm, for så fik de problemer med kunden Frøken Frys, der godt kunne blive arrig, hvis de slap for meget CO2 ud.

De skulle også sørge for, at varmemesteren altid havde kaffe på kanden og frisksmurte ostemadder indenfor rækkevidde, for ellers fik han horn i panden og gik hjem. Eleverne fra 7.X viste sig at være gode til både drift af varmeværk og madlavning, og da alle deltageres point var talt op, havde klassen vundet konkurrencen med stor margin ned til nummer to. Et resultat der glædede både lærere og elever. - Det er en gruppe elever, som ofte slipper for at gøre noget færdigt, hvis de ikke gider mere, men det har de

7.X fra Aars Skole med det synlige bevis på deres førsteplads i en landsdækkende konkurrence.

ikke fået lov til denne gang. Derfor blev de rigtig trætte af spillet til sidst, men nu hvor de har vundet konkurrencen, er de pavestolte, og det er super fedt, at de har fået en god oplevelse, når de

har knoklet så hårdt for det, siger Dan Korsgaard. 7.X skal inden længe besøge varmeværket i Aars, og så kan de måske give ledelsen på stedet et par gode råd med på vejen.


Aars Avis

SIDE 20

22. januar 2014

Har blik for orden

Mere plads til dæk hos Toyota i Aars AARS: Pladsen til at opbevare sommer og vinterdæk er blevet for trang hos Toyota i Aars. Det er en væsentlig årsag til, at bilforhandleren i Aars nu udvider forretningsarealet. Toyota bygger til værkstedet, men det er ikke kun værksted, der skal være på den nye plads. I dag opbevarer Toyota Aars cirka 200 sæt hjul på loftet, og der kan ikke være flere. Men for fortsat at kunne tilbyde kunderne opbevaring bliver en del af nybygningen til et hjul-ho-

tel. En anden del af nybygningen bliver afsat til klargøring af biler. Den opgave er hidtil løst i salgsområdet, hvilket ikke er optimalt. Tilbygningen er ikke det eneste tiltag, der er sket hos Toyota Aars den seneste tid. To af de bærende kræfter har valgt at gå på pension. De er blevet afløst af sælger Thomas Løkkegaard, der kommer fra N.J. Jensen, Nørresundby, og lagerchef Charnette Madsen, der oprindelig er udlært hos Toyota Løgstør.

T G A V N G DØ

Rektor Kirsten Holmgaard var genstand for stor opmærksomhed i ”badekarret” på Vesthimmerlands Gymnasium & HF i Aars, da hun forleden sagde farvel efter 21 år.

Rektor i Aars sagde farvel i badekarret Kirsten Holmgaard rost for 21 år på gymnasiet Af Thorkil Christensen

Brug den organiserede håndværker til

snedkerarbejde - tømrerarbejde Køkken- og garderobeskabe Specialopgaver - så SNEDKERMESTER

AARS: Der blev sagt behørigt farvel - og tak for 21 års samarbejde med rektor Kirsten Holmgaard på Vesthimmerlands Gymnasium forleden. Det foregik i ”Badekarret” på gymnasiet, hvor et par hundrede samarbejdspartnere, lærere, politikere, rektorkolleger og andre var samlet til reception. Kirsten Holmgaard har valgt at stoppe for at gå på pension, og der blev fra mange sider rettet en tak for en flot indsats til hende. Det blev bl. a. nævnt, at hun altid har haft begge ben på jorden og har stået for ordentlighed, og som een sagde: ”Folk med begge ben på jorden hænger ikke på træerne”. Skolens bestyrelse havde arrangeret afskedsreceptio-

nen, som også bød på forskellige former for underholdning. Bestyrelsesformand, tidligere kommunaldirektør Keld Jørgensen, Aars, slog fast, at Kirsten Holmgaards eftermæle vil være, at hun var en utrolig respekteret leder, og at hun i løbet af de 21 år har gjort Vesthimmerlands Gymnasium & HF til en vigtig og betydningsfuld institution. - Det har ikke handlet om, hvad der var bedst for hende, men hvad der var bedst for skolen, der er en institution som er fulgt med tiden, bl. a. takket være, at Kirsten Holmgaard har vist vejen og har taget hånd om opgaverne i et godt samarbejde med bestyrelsen, sagde Keld Jørgensen. Vicerektor Ralf Leimbeck havde regnet sig frem

til, at Kirsten Holmgaard havde været rektor på Vesthimmerlands Gymnasium i helt præcis 7777 dage. Han glædede sig over Kirsten Holmgaards åbenhed, ærlighed og klarsyn i det daglige arbejde. Tidligere amtsrådsmedlem Chr. Bach Iversen, Vester Hornum, var på talerstolen da Kirsten Holmgaard for 21 år siden tiltrådte som rektor. Han betegnede sig derfor ved afskedsreceptionen som ”en røst fra fortiden”, som dengang, på amtsrådets vegne, udtrykte gode ønsker for fremtiden. - Jeg håber, at du har været glad for at være her. Du har hvilet i dig selv - haft en indre ro, som har medvirket til at få tingene i dagligdagen til at hænge sammen, sagde Chr. Bach Iversen.

Det blev nævnt, at Kirsten Holmgaard har udvist et nærmest husmoderagtigt blik for god orden på skolen. Hendes interesse for kunst blev også omtalt, og der blev udtrykt glæde over, at gymnasiet i dag har kunstværker af bl. a. Per Kirkeby, Allan Otte og ”Mormor”. Lektor Jørgen Jørgensen, Aars, som er underviseren på skolen med størst anciennitet, og som har arbejdet under alle skolens rektorer, takkede for det gode samarbejde, og havde skrevet en sang på melodien ”Mormors kolonihavehus”. Jørgen Jørgensens tale, og teksten i sangen satte meget rammende Kirsten Holmgaards virke på plads. Nordjyske rektorkolleger omtalte Kirsten Holmgaards indsats i rektorforeningen, og sagde at her kæmpede hun altid de nordjyske skolers sag. Der var desuden et par underholdningsindslag af elever fra 2.M. Eleverne sang bl. a. ”Sidste time”. Kirsten Holmgaard sluttede med en tak til hver enkelt: - En dag som i dag luner og glæder. Nu slutter perioden som rektor efter 21 år, og det har aldrig været kedeligt. Det job som jeg fi k ligner slet ikke det jeg har i dag. Arbejdet er aldrig blevet rutine og det har været meningsfyldt, at være med til at flytte unge fra A til B - og at være med til at gøre Vesthimmerlands Gymnasium til et godt sted at være, sagde Kirsten Holmgard og takkede alle - også kommunen - for god lokal opbakning gennem årene. Kirsten Holmgaard er flyttet til Aarhus og træder af med udgangen af måneden. Rektorjobbet overtages af Jette Rygaard Poulsen, der kommer fra Aalborg.

Keldgårdvej 70 . Værksted: Gislumvej 28 - 9600 Aars Tlf. 98 62 39 33 og 21 73 40 89 Tilbud uden forbindende!

Tømrer- & Snedkerfirma

Lyt nu denne gang!

Vi tilbyder bl.a. følgende opgaver:

120.000 himmerlændinge har dårligere service

Husk op til 30.000 kr. i skattefradrag

Første klasses arbejde til aftalt tid.

Kirsten Moesgaard, Farsø, regionsrådsmedlem, medlem af Udvalget for Sundhed og Sammenhæng skriver: Som regionsrådsmedlem er jeg valgt af borgerne til at varetage borgernes interesser, også når det gælder sygehusdækningen og servicen i regionen. Vi har en flot formålsbestemmelse i vores sygehusplan, der går ud på, at alle borgere i regionen skal have den samme gode service.

A/S

renovering ombygning tilbygning nye vinduer og døre inventar

Det er flotte ord. De er så flotte, at de endnu nu blot er tomme ord. Vi har nemlig IKKE den samme gode service i hele regionen. Hele det store Himmerlandske område har ikke den samme service, som i resten af regionen, hvor akut syge borgere bliver indlagt i en fællesakutmodtagelse (FAM). I Himmerland indlægges akut syge patienter i en almindelig akutmodtagelse (AMA), som er noget helt andet, end en FAM I en FAM bliver patienten mødt med et hold af speciallæger, herunder også psykiatrisk. Her bliver man hurtigt udredt af højt specialiserede læger inden for de forskellige specialer. I AMAen i Hobro bliver akut syge patienter ikke mødt af et sådan hold af speciallæger. Som tingene fungerer bliver patienterne ofte

mødt af vikarer, studerende og ikke af speciallæger med de ekspertiser, som vi ser i resten af regionen. Det betyder, at ca. 120.000 borgere i Region Nordjylland slet ikke får den samme gode service, som i resten af regionen. Forholdene er nu så kaotiske i AMAen - efter bare to år, at ledelsen er kørt uhjælpeligt fast. AMAen blev - på trods af mange advarsler - tvunget igennem. Og nu - efter bare to år - smider ledelsen håndklædet i ringen. Nu må regionsrådet træde i karakter og sørge for, at forholdene i Himmerland rettes op. Ledelsens løsningsforslag går ud på, at man ødelægger et særdeles velfungerende diagnostisk center, daghospital og palliationsafdeling - alt sammen liggende i moderne tidssvarende lokaler i Farsø for at lægge slør

ud over det fejlslagne projekt med AMA i Hobro. Nu må leldelsen i Hobro og regionsrådet lytte til speciallægerne og andre faggrupper i Farsø. De giver deres mening til kende og kommer med konstruktive løsningsanvisninger. Lyt nu denne gang!! Akut syge patienter i Himmerland skal nu have samme service, som borgerne i resten af regionen. De skal indlægges i FAM i Aalborg og mødes af de samme kompetente speciallæger, som i Aalborg, Vendsyssel, Thy og Mors. Farsø Sygehus skal have fred og ro til at fortsætte med udbygningen af diagnostisk center, daghospital og palliation, og vi skal beholde den medicinske afdeling, så patienterne fra Vesthimmerland kan indlægges i medicinsk afdeling i Farsø subakut, ligesom de akutte patienter, når de er udredt i FAM i Aalborg returnerer til Farsø Sygehus, så længe indlæggelse af påkrævet.


Aars Avis

22. januar 2014

SIDE 21

v. Finn Ovesen

Nørage r

S uldr up

tlf. 98 55 10 06

tlf. 98 37 90 00

ÅBNINGSTIDER ALLE UGENS DAGE KL. 7.00-20.00

H ave rs le v tlf. 98 65 40 13

v. Finn Ovesen

BEMÆRK vores kampagneaviser fremover kører fra lørdagg til og med fredag! KOLONIAL

FROST FR ROST

Om a

SUPPEHØNS

MARGARINE 500 g Flydende/Stege/Bage

3.000 g

7

Fr it v a lg ALI KAFFE

FFORÅR I LUFTEN?

145 g

50

00

T JULEØL

RES

- Vi skaber forårsstemning med disse forårsbebudere!

Pr. s t k .

14

95

95

Max. 6 pk. pr. kunde!

6 stk .

20

00

Pr. pk .

+ pant

Frit valg

29

95

Fastelavnsboller

RØDKÅL RØD DKÅ KÅL

m/u creme

950 g

Pr. s tk . 3 s tk . KUN

1000 00

20

GRØNT TILBUD

FR A BAGEREN!

SALTUM VAND

He r re gårds

BELLIS/IRIS/ CROCUS/PERLEC HYACINTER/ HYACINTER/ PRIMULA

NON-FOOD N-FO OOD

L o t us

ØL + VAND

33 cl. Frit valg

14

TWIST

JULETUBORG/ KØKKENRULLER KØKK X-MAS DS. + FL. 8 stk.

350 g

Pr. pk .

BLOMSTERHJØRNET B

SPAR 30.00

Pr. s t k .

95

SLIK K

GRØNNE DRUER Stenfri

15

00

500 g BROCCOLI 500 g

700

Pr. st k .

Pr. s t k .

10

00

TI RESTPAR Sp a r CHOKOLADESMØRCREME 400 g i glas

½

PRIS

Pr. g l.

11

24 s t k .

Kun

29

95

+ pant

TORSDAG

BRIKETTER 10 kg

00

KÆRGÅRDEN 200 g

95

Pr. s t k .

3 stk.

Kun

FREDAG

SLIK

100

6 pk .

20

00

00

6

Max. 6 stk. pr. kunde!

Pr. 100 g K im´s

95

6

SNACK/CHIPS

3 ps.

00

45

Da n s k e KARTOFLER KARTOFLE KARTOFL KA A ARTOFLE R

1200

3 kg

Kun

LØRDAG

2 BASSER + 4 RUNDSTYKKER

00

FLØDE

25

1/2 ltr.

Pr. s t k .

11

TILBUDDENE GÆLDER ALLE 3 BUTIKKER FRA ONSDAG TIL OG MED SØNDAG (HVOR IKKE ANDET ER ANGIVET)

95


Aars Avis

SIDE 22

22. januar 2014

Bliver Rasmus fra Aars Udsolgt til øllaugets danmarksmester i Skills nytårsmiddag Kan blive Danmarks bedste industritekniker AALBORG: Når statsminister Helle Thorning-Schmidt i morgen skyder DM i Skills 2014 i gang, skal Rasmus Ellgaard Klysner Jensen fra Aars kæmpe med om titlen som landets bedste industritekniker. Det er en benhård konkurrence. Rasmus Ellgaard Klysner Jensen skal både kunne klare den fagligt krævende opgave og det store

LÆS OGSÅ AARS AVIS PÅ www.aarsavis.dk

pres fra publikum. Rasmus Ellgaard Klysner Jensen, der til daglig er i lære hos Maskinfabrikken Fuglsangs Eftf. A/S i Klarup og går på erhvervsskolen Metal College Aalborg, tager i morgen arbejdstøjet med til Aalborg. Her ligger Gigantiums flere end 10.000 kvadratmeter, der danner rammen for dette års danmarksmesterskaber for unge på erhvervsuddannelserne. Afslutningsceremoni og præmieoverrækkelse afholdes lørdag, hvor Rasmus Ellgaard Klysner Jensen fi nder ud af, om DM-titlen er i hus. Undervisningsminister

. CYKLER . EL-SCOOTER . SCOOTER REPARATION AF ALLE MÆRKER

ÅBNINGSTIDER: Tirs.-ons.-tors. kl. 11-17 · Mandag og fredag efter aftale

Christine Antorini overrækker præmier til vinderne. Det er fjerde gang, der holdes DM for unge på erhvervsuddannelser, og hele 48 forskellige fag er repræsenteret. Mesterskaberne giver de unge talenter en unik mulighed for at vise det høje faglige niveau. Det er både muligt at se konkurrencerne og prøve forskellige fag af på egen krop. I løbet af de tre dage forventes i omegnen af 30.000 publikummer at lægge vejen forbi DM i Skills 2014. Fra metalindustrien deltager de tre konkurrencefag personvognsmekaniker, klejnsmed og industritekniker. Desuden vil publikum kunne opleve en håndfuld demonstrationsfag i løbet af de tre dage. Statsministeren åbner DM i Skills 2014 ved åbningsceremonien torsdag.

VESTHIMMERLAND: Nu er tiden kommet til, at medlemmerne af Tordenkalvens Øllaug skal smage alle de øl de bedst kunne lide i 2013.

Ved øllaugets nytårsmiddag på fredag, 24. januar serveres de øl som medlemmerne gennem året har valgt som de bedste ved de afviklede møder.

Hospitalsklovnen ”Tut” besøgte i sidste uge Aktive Kvinders medlemmer fra Aars og Aalestrup.

”Tut” besøgte Aktive Kvinder VESTHIMMERLAND: De to lokale foreninger af Aktive Kvinder, henholdsvis i Aars og Aalestrup, havde i fælleskab arrangeret en aften i

selskab med hospitalsklovnen ”Tut” som i det normale liv – og tøj hedder Gitte Brønager Jørgensen. 70 medlemmer fra Aars og

reklame

SULDRUP: Fra i dag bliver det nemmere at hente og sende pakker i postbutikken i Suldrup hos Dagli’Brugsen. Her får kunderne nu mulighed for at hente alle slags pakker og købe pakkeporto i hele butikkens åbningstid alle

Aalestrup var mødt op mandag aften på Knabergården, og de gav ikke færre end 6.500 kroner til hospitalsklovnens prisværdige arbejde. Aars Avis, Himmerlandsgade 150, 9600 Aars Tlf. 98 62 17 11

SULDRUP

Længere åbent i budskab postbutik i Suldrup

Vi formidler dit med en iøjnefaldende

Udsigten til de mange gode øl har fået medlemmerne til at melde sig til nytårsmiddagen hurtigere end normalt. Allerede halvanden uge inden var alle de 40 pladser besat. Dermed fortsætter trenden med at mødeprocenten overskrider 50. Tordenkalvens Øllaug har lige nu 72 medlemmer.

ugens dage. Før kunne pakker, der for eksempel kræver betaling, alene hentes i et begrænset tidsrum. - Vores kunder bruger i dag posthuset til at hente og sende pakker og almindelige breve samt købe frimærker. Det

indretter vi nu posttilbudene efter hos Dagli’Brugsen i Suldrup og gør det muligt at hente alle slags pakker og købe pakkeporto i hele butikkens åbningstid. Til gengæld er der nogle af de postprodukter, som kunderne sjældent gør brug af, der bliver taget af hylderne. Det gælder bl.a. rekommanderede breve, som ikke længere kan sendes fra butikken, siger Gordon Dalsgaard, kundechef i Post Danmark.

Salon Jytte

Kontakt os for et uforbindende tilbud! HME A/S • Evaholmvej 24 • Hornum • DK-9600 Aars Tel: +45 98 66 11 00 • www.hme.dk

Al vognmandskørsel udføres

MALEREN... WALTHER BACH’s Eftf. v/Berit Asp Madsen

Containerservice Mobilkraner op til 80 tons

TLF. 22 72 46 11

AARS MOTORSERVICE v/ Jørgen Christensen Hjortkjærsvej 11 · 9600 Aars

TELEFON 98 62 45 22 HUSK EFTERSYN AF PLÆNEKLIPPER ÅBNINGSTIDER: Mandag-fredag Lørdag

HORNUM 98661741 MANDAG LUKKET!

7.30-17.00 9.00-12.00

Lastvognskraner m/u grab Blokvognstransport Udtrækkelig sættevogn Mandskabskurv op til 60 m Sand og grus leveres Arbejde med gummiged udføres Udlejning af skibscontainere, rulleskøjter, donkrafte, 7 tons truck m.m.

Aars Bogtryk & Offset Himmerlandsgade 150 9600 Aars Tlf. 98 62 17 11 E-mail: aarsbogtryk@aarsavis.dk

Brochurer • Brevpapir • Visitkort • Kuverter • Fakturaer • Logoer

Hjortkjærsvej 23, 9600 Aars

Bogtryk/Offset

Tlf. 98 62 17 11


Aars Avis

22. januar 2014

SIDE 23

Aars Avis, Himmerlandsgade 150, 9600 Aars Tlf. 98 62 17 11

SULDRUP

Praktisk økologi i de himmerlandske haver

En uge med både plusser og minuser for TVH

Ny forening holdt første møde i Suldrup

Holdet mistede tre point og vandt to

SULDRUP: Har du lyst til at dyrke din have mere miljøbevidst, men har svært ved at finde hoved og hale i hvordan, det kan gøres? Eller er du allerede fuldbefaren økolog, som blot mangler nogle at vende dagligdagens haveproblemer med og få inspiration fra? Så er hjælpen nu blevet nemmere at finde i Himmerland, hvor et lokalt netværk af Landsforeningen Praktisk Økologi for nylig blev etableret. Det første møde blev holdt på Brunholm Gårdbutik i Suldrup midt i november. Der var deltagere fra alle dele af Himmerland med mange forskellige baggrunde: nogle er ret nye indenfor økologien, mens andre har været engageret i rigtigt mange år. Nogle har et lille frimærke, og andre har stor have eller en lille ejendom. Nogle har interesse for dyrehold, og andre fokuserer på grøntsager. Et godt sammensurium med fælles interesse og lyst til fællesskabet. En del af mødet gik med at finde ideer til kommende arrangementer, og der kom mange bud, som skal realiseres i tiden fremover. Der blev blandt andet foreslået ”Åbne haver”, som for så vidt ikke behø-

HÅNDBOLD 1. division, herrer HØJ-Team Vesthimmerland 17-20 (8-12) Af Lars Lindberg

Landsforeningen Praktisk Økologi har startet en lokalforening i Himmerland. I arbejdsgruppen sidder set fra venstre Svend MørkJensen, Karen Steffensen, Mie Larsen og Kirsten Hansen.

ver at være på baggrund af ens have, men lige så godt kan være på baggrund af et spændende projekt, man har gang i. Der blev også foreslået, at man kan invitere til et drivhusbesøg og erfaringsudveksling. Eller blot mødes og snakke i en have for at inspirere hinanden selv om man måske ikke synes, man har noget bemærkelsesværdigt at vise frem. Fællesskabet og den gensidige inspiration er lige så vigtig, som det at have noget specielt at vise. Et andet forslag var ”Bæredygtig havedag” ved den lokale Brugs. En sådan dag kan arran-

NØRAGER

geres i fællesskab med lokale biavlere, pindsvinevenner, frøsamlere og mange andre Muligheden for ”Aftenskolekursus” og foredrag om urtehave og om hønsehold til husbehov blev også nævnt. Der er allerede mange med i netværket, men der bliver aldrig for mange. Alle med lyst til at være med i et økologisk lokalt netværk kan deltage, uanset om man er medlem af Praktisk Økologi eller ej. Arbejdsgruppen i Praktisk Økologi Himmerland har udarbejdet et idékatalog samt forberedt forårets tre møder med foredrag og havebesøg så skynd dig at komme på banen, hvis du vil være med fra starten. Aars Avis, Himmerlandsgade 150, 9600 Aars Tlf. 98 62 17 11

Det kom som et chok for mange, da Vejle i sidste uge trak klubbens herrehold fra 1. division på grund af brok i økonomien. Også i Team Vesthimmerland blev meddelelsen modtaget med stor overraskelse. En følelse der senere blev ændret til skuffelse, da Dansk Håndbold Forbund besluttede, at Vejle blev dømt som taber i alle sæsonens kampe - både dem holdet nåede at spille og dem, der endnu ikke er spillet. For TVH-herrerne var det noget af en streg i regningen, for vesthimmerlændingene havde præsteret at hente tre point i deres to kampe mod vejlenserne - point der med ét slag forsvandt fra regnskabet. - Det er simpelthen ikke i orden, for de point man har hentet, kan sgu ikke bare fjernes. Vi har forholdt os til det pointtal, vi kunne læse i tabellen, og så holder det ikke en meter, at de pludselig er væk, siger TVH-træner Christian Back, som tilføjer, at han ikke bare er skuffet, fordi det koster hans hold tre point. - Det er bittert for os, men det er jo endnu værre for en hold som SUS Nyborg. De havde hentet fi re point mod Vejle, men nu er de pludselig med i sovsen i bunden.

Det er helt uacceptabelt, mener Christian Back, som kraftigt vil opfordre forbundet til fremover blot at dømme en konkursramt klub til at tabe holdets resterende kampe. - Det er ikke nogen perfekt løsning, da det gør det til en fordel af møde sådan et hold sidst på sæsonen, men så undgår man da at tage point fra hold, der allerede har vundet dem og forholdt sig til tabellen udfra det, siger han. Er TVH-træneren utilfreds med de tre mistede point, så glæder han sig til gengæld over, at det i weekenden lykkedes hans drenge at gøre det grimme ved HØJ i en sand nøglekamp. I Ølstykke-hallerne besejrede TVH de direkte konkurrenter i nedrykningskampen med 20-17, og det resultat lunede gevaldigt i TVH, der takket være de to tiltrængte point sneg sig op på den niendeplads i tabellen, der går fri af nedrykningsspillet nu hvor Vejle er taget ud af regnestykket. - Efter et par kampe hvor jeg har savnet vildskaben fra spillernes side, skal jeg love for, at var tilbage, hvor de skal være. De råbte og skreg, da vi gik på banen, og de formåede at bringe vildskaben med ind i kampen, siger Christian Back, der trods den fi ne tænding fra start så sit hold komme bagud med 0-3. Derefter satte gæsterne sig dog tungt på kampen, der som de få mål antyder

udelukkende blev vundet i forsvaret. - Vi har drillet nogle af de store hold ved at tilpasse vores spil efter deres svagheder, men den her gang vandt vi på vores egne styrker. Vi fokuserede fuldstændig på at lukke dem ned i deres angrebsspil, og det lykkedes til punkt og prikke, og så betyder det ikke en pind, at vi selv kun scorede 20 mål, siger Christian Back, der håber, at hans mandskab kan følge den vigtige udebanesejr op med endnu en sejr, når en anden direkte nedrykningskonkurrent, Stoholm, gæster Dronning Ingridhallerne på søndag. - Der hersker ingen tvivl om, at det bliver endnu en kamp, der skal vindes på benhårdt kollektivt arbejde og tænding oppe i knoppen. Vi skal ganske enkelt op i det højeste gear endnu en gang, for de her kampe er blevet ekstra vigtige nu, hvor mange hold har fået fjernet point. Taber vi, får Stoholm færten af, at stregen ikke er så langt væk, men vinder vi, er der pludselig lidt luft til den absolutte bund, siger Christian Back. Skulle det lykkes at besejre Stoholm, vil TVH have syv point ned til den direkte nedrykningsstreg, og så skal det gå endog meget galt i de resterende kampe, hvis ikke vesthimmerlændingene som minimum skal sikre sig to overlevelseskampe mod en modstander fra 2. division, når grundspillet slutter.

AARS HÅNDBOLDKLUB Idrætscenter Østermarken

Lørdag 25. januar 2014 The Reminders spiller i Kig Ind i Nørager.

The Reminders spiller i Kig Ind i Nørager

Kl. 12.20 U-14 Drenge 2. Division - IK Vest, Ranum Kl. 13.20 U-14 Pige 1. Division - Aalborg KFUM Kl. 14.20 U-18 Drenge 1. Division Team Vesthimmerland - Brønderslev IF

Idrætscenter Østermarken

Tirsdag 28. januar 2014 Kl. 19.15 U-18 Pige 2. Division Team Vesthimmerland - Løgstør HK

Gruppen leverer musik som det lød i 60erne

Idrætscenter Østermarken

NØRAGER: The Reminders, der står for 60er musik, som det lød for 50 år siden, spiller i Kultur- og Medborgerhuset Kig Ind i Nørager fredag, 31. januar. Da Jørgen de Mylius hørte The Reminders til Danmarks mesterskaberne i KB Hallen for nogle år siden, sagde han bl.a.: ”The Reminders har den absolut mest originale 60’er lyd - det vækker minder!”. Når The Reminders

Søndag 2. februar 2014

går på scenen toner fra første sekund en rå, livsglad stemning frem. Her er virkelig tale om en sound, der er noget nær det tætteste, man i dag kommer på den lyd, orkestrene havde dengang. De spiller f.eks. Elvis Presley, Beatles, Chuck Berry, Monkies og Buddy Holly. Det oser simpelthen af 60er nostalgi, når The Reminders ruller sig ud. En

aften med The Reminders er en levende påmindelse om de bands, der kom til at præge en hel generations livsstil. Gruppen består af Christian Grishauge, trommer og vokal, Uffe Kristensen, guitar og vokal, Jan B. Larsen, bas og vokal, Lars Ulrik Mølbæk, guitar og vokal samt Palle R. Nielsen, elpiano og vokal. Aftenen starter med spisning.

Kl. 11.55 U-16 Drenge 2. Division Team Vesthimmerland - Thy Håndbold Kl. 13.05 U-16 Pige 1. Division Team Vesthimmerland - Thy Håndbold Hovedsponsor:


Aars Avis

SIDE 24

22. januar 2014

Stor medaljehøst Diplomturneringen BADMINTON: I weekenden deltog otte unge spillere fra Aars Badmintonklub i Diplomturneringen (Bibifant Cup) i Støvring. Diplomturneringen er en turnering for nybegynder i U9 og U11 rækkerne, og den er skabt via et samarbejde mellem badmintonklubberne i Støvring, Svenstrup, Suldrup, Farsø og Aars. Det er anden sæson, at klubberne laver dette koncept, hvor man skiftes til at mødes i de fem klubber i løbet af sæsonen. De unge spillere havde i weekenden godt gang i ketsjerne, og der blev kæmpet til den sidste bold. Det vigtigste element

i denne turnering er ikke nødvendigvis at vinde, men at få nogle gode oplevelser og personlige sejre i bare at have deltaget. Spillerne som var mødt op til denne dag i Støvring, fik sig nogle rigtig godt oplevelser med hjem, og de var fuld ud tilfreds med dagens indsats. Det blev en super dejlig dag for de unge spillere, og alle fik overrakt medaljer og sponsorgaver. Aars Badmintonklub høstede derudover to guldmedaljer (Ida Fischer & Bastian B.S. Jensen) og en sølvmedalje (Oliver Pagh Frederiksen). Alle 3. og 4. pladser fik en fin bronzemedalje.

De unge mennesker fra Aars Brydeklub gjorde en flot figur, da de i weekenden deltog i et stort internationalt stævne i Kolding. På billedet ses fra venstre træner Daniel Phillips, Frederik Mathiesen, Aleksander Dollerup, Marie Johansen Stuhr og Clara Johansen Stuhr.

Aars Brydeklub med helt fremme i Kolding De unge spillere fra Aars Badmintonklub sig endnu en god oplevelse, da de i weekenden deltog i Diplomturneringen i Støvring. Fra venstre ses: Sofie Rasmussen Jensen, Line Dam Ibsen, Sainthami Ranganathan, Ida Fischer, Oliver Pagh Frederiksen, Oliver Fur Herman, Bastian B.S. Jensen og Shampajan Ranganathan.

Start 2 Run Går du med tanker om, at komme ud at løbe - har du ikke nogen at løbe med og gerne vil løbe sammen med andre - så kom og være med. Igen i år kan Aars Trim Motion tilbyde dig en målrettet træning til, at kunne løbe 5 km. ved dette års Sportmaster løb den 29. april 2014. Udgangspunktet er, du aldrig tidligere har løbet, din fysik ikke er en hindring for dig og du har et gå på mod til at gøre en indsats. Vi forestiller os en træningstime en gang om ugen og du derefter selv yder en træningstime når du har tid til det. Træningstimen bliver torsdag kl. 17.00 - 18.00 - vi starter fra vores klubhus på Sports allè her i Aars. Bedste holdstørrelse er 8 til 12 deltagere. Mød op torsdag den 30. januar 2014 med passende løbetøj og sko. Bestyrelsen Aars Trim Motion Hovedsponsor:

Gjorde fin figur ved stort internationalt stævne BRYDNING: Aars Brydeklub deltog i weekenden i den 14. udgave af Kolding Cup. Til dette års stævne var der 25 klubber repræsenteret fra i alt otte lande. Ud over klubber fra Danmark deltog brydere fra Sverige, Norge, Tjekkiet, Slovakiet, Belgien, Holland og Italien. I alt var der deltagelse af 170 brydere og Aars Brydeklub havde udtaget fi re brydere til at kæmpe i det store stævne. I 35 kilo-klassen for drenge mellem 10 og 14 år deltog Aleksander Dollerup. Han havde en hård dag på madrassen, da han fra nytår er rykket en klasse op. Derfor var der til weekendens stævne også meget hårdere modstand, end han var vant til. Der var 10 tilmeldte i klassen, og selv om Aarsbryderen kæmpede det bedste, han havde lært, måtte han tage til takke med en samlet ottendeplads. I 29 kgs klassen for pus-

linge mellem syv og 10 år var der Frederik Mathiesen, der skulle holde fanen højt for Aars. Her var otte brydere indvejet og Frederik Mathiesen havde en rigtig heldig lodtrækning, da han kom i gruppe med to brydere fra Herning og en fra Thor Nykøbing. Frederik Mathiesen lagde ud med at besejre Rasambek Bisultanov fra Herning i en yderst spændende og seværdig kamp, inden han vandt mere overbevisende over Liam Azzam fra Thor Nykøbing. I den sidste kamp i gruppen ventede Lucas Hessel fra Herning, og her var Frederik Mathiesen bagud på point, da han fi k sin modstander lagt ned i et fald, og det sikrede Aarskæmperen sejren. I fi nalen mødte han Michal Rázi fra Team Kladno Tjekkiet, og så sluttede festen for Frederik Mathiesen, der allerede efter et minuts brydning måtte konstatere, at han måtte ”nøjes” med sølvmedaljen. I 30 kilo-klassen for pi-

ger stillede Marie Johansen Stuhr op til sit første Cup-stævne. I sin første kamp mødte hun Emelie Toft fra Jyden i Aalborg. De to piger, der er gode veninder udenfor måtten, har mødt hinanden et utal af gange tidligere, og det er endnu aldrig blevet til en sejr til Aars-bryderen, der da heller ikke fi k pyntet på statistikken i Kolding. I sin anden kamp skulle Marie Johansen Stuhr møde den svenske pige Saga Svensson, der også viste sig at være en for stor mundfuld for Aars-pigen. Hun kunne dog rejse hjem fra Kolding nogle erfaringer og en bronzemedalje rigere. I 40 kilo-klassen var det Clara Johansen Stuhr, som forsvarede Aars Brydeklubs ære - og det gjorde hun rigtig flot. I sin første kamp besejrede hun Camille Rasmussen Fra FFi Frederikshavn, inden der gik brok i den kamp nummer to. Clara Johansen Stuhr var således efter første pe-

riode nede med 0-8 mod Filippa Melsvik fra Næstved, men så vågnede hun i den grad til dåd. Hun indledtre et flot comeback, og i anden periodes sidste sekunder fi k hun udlignet til 12-12, hvilket gav hende sejren, da hun havde lavet kampens sidste point. I sin tredje kamp mødte Clara Johansen Stuhr Sille Buch fra Alsia Sønderborg. Den dygtige sønderjyde har tidligere voldt Aars-bryderen store problemer, og det gjorde hun endnu en gang. Selv om Clara Johansen Stuhr var godt med i kampen, måtte hun således se sig slået. I sin sidste kamp mødte hun Josefi ne Merstrand fra Nørre Åby, og den noget tungere pige blev for stor en mundfuld for Clara Johansen Stuhr, som dog kunne glæde sig over, at hun fi k en bronzemedalje med hjem fra Kolding. Alt i alt var det en god weekend for bryderne fra Aars, men selv om der var medaljer med hjem, er der også noget, der skal arbejdes videre på de næste par måneder men henblik på de danske mesterskaber, som af holdes sidst i marts.


Aars Avis

22. januar 2014

SIDE 25

Kathrine Poulsen, Anders Borg Andersen og Steffanie Bisgaard fra Aars Badmintonklub spillede sig alle videre til landsmesterskaberne ved weekendens udtagelsesstævne.

tredjeplads i mix med xmakker. U17C Andreas Krogh Kristiansen andenplads i single og andenplads i double med Kristian Pedersen. U17C Kristian Pedersen tredjeplads i single. U17C Lukas Helligsø tredjeplads i single og førsteplads i double med Morten Worsøe. U17C Morten Worsøe femteplads i single. U17C Simon Børgesen syvendeplads i single tredjeplads i double med x-makker. U17B Jacob Holk Pedersen udgår desværre på grund af en skade. U17A Simon Fløj Thomsen førsteplads i single, andenplads i double med xmakker og niendeplads i mix med Mathilde Nielsen. Simon Fløj Thomsen opnåede ved stævnet point nok til en oprykning, så han fremover spiller i Mesterrækken i U17 rækken. Alt i alt et super flot resultat af de unge spillere fra Aars. Alle spillere er udtaget til at deltage i Landsmesterskaberne i Fredericia og Vejen i marts.

ANTIK & DESIGN 31/1 – 1-2/2

VINTERCIRKUS Torsdag 6. februar kl. 18.30 HIPPIE GALLA BURNIN’ RED IVANHOE

YOUNG FLOWERS Fredag 7. februar kl. 21.00

JONATAN SPANG’S

BRYLLUP Lørdag 8. februar kl. 20.00

DANSK SLAGERPARADE Søndag 9. februar kl. 14.00

DAS FEUERWERK DER VOLKSMUSIK Fredag 7. marts kl. 20.00

SYNGEPIGERNE FRA BAKKENS HVILE Lørdag 8. marts kl. 18.00

ROSA FRA ROULADEGADE Søndag 9. marts kl. 10.00

Unge badmintonspillere klar til landsmesterskaber

ASKEPOT

OPERAEN I MIDTEN Torsdag 13. marts kl. 18.00

DET GÅR NED

Hentede 25 medaljer ved weekendens kval-stævner BADMINTON: I weekenden lykkedes det flere spillere fra ungdomsafdelingen i Aars Badmintonklub at få en plads på podiet ved DGI`s Udtagelsesstævne til Landsmesterskaberne. Der blev spillet i fi re forskellige haller i både Nordog Midtjylland afhængig af de forskellige rækker, og Aars Badmintonklub hentede ikke færre end 25 medaljer – otte af guld og 17 af sølv. Aars-spillernes placeringer blev følgende: U11D Malte Hermann fjerdeplads i single og andenplads i double med xmakker. U11C Albert Mathiesen andenplads i single. U11B Albert Mathiesen andenplads i double med xmakker og fjerdeplads i mix med Anne Klausholm. U11B Anna Klausholm tredjeplads i single og førsteplads i double med Sarah Skriver. U11B Sarah Skriver andenplads i single og andenplads i mix med x-makker. U11A Viktor Gottlieb Nielsen syvende i single og femteplads i double med xmakker. U13D Oliver Jensen 11.-plads i single og fjerdeplads i double. U13C Jonas Poulsen syvendeplads i single og andenplads i double med Magnus Buus Nørgaard. U13C Magnus Buus Nørgaard syvendeplads i single.

- vejen til oplevelser

PHARFAR, JIMILIAN, 8BALL FEAT. GUSTAV MFL.

Fredag 14. marts kl. 20.00

MICHAEL LEARNS TO ROCK Lørdag 15. marts kl. 20.00

DAGENS MIDDAG PÅ HOTELLET ELLER ”SELV HENTER” I resten af januar og hele februar Hver mandag - fra kl. 17.00 Hakkebøf med bløde løg, surt, hvide kartofler og sovs

Simon Fløj Thomsen fra Aars Badmintonklub spillede sig i weekenden op i Mesterrækken i U17-rækken, da han vandt et stævne i A-rækken. Her ses han med klubkammeraten og mix double-makkeren Mathilde Nielsen.

U13A Thorbjørn Jensen Rohde syvendeplads i single, femteplads i double med xmakker og femteplads i mix med x-makker. U13M Laura Fløj Thomsen syvendeplads i single, tredjeplads i double med xmakker og femteplads i mix med x-makker. U15D Anders Borg Andersen andenplads i single. U15D Kathrine Poulsen førsteplads i single. U15C Anders Borg Andersen andenplads i double med Thomas N. Jensen. U15C Thomas N. Jensen niendeplads i single. U15C Steffanie Bisgaard førsteplads i single og førsteplads i double med Kathrine

Poulsen. U15C Laura Nykjær tredjeplads i single og tredjeplads i double med x-makker. U15B Mads Nielsen tredjeplads i single, andenplads i double med x-makker og-

Hver tirsdag - fra kl. 17.00 Stegt flæsk med persillesovs, hvide kartofler og rødbeder Hver onsdag - fra kl. 17.00 Flæskesteg med rødkål, surt, sødt, franske, brunede, og hvide kartofler, og sovs

79,Husk at forudbestille Husk vores stjerneskud Man til onsdag

60,-

FRIENDS IN LOW PLACES Tribute to Garth Brooks Lørdag 22. marts kl. 20.00

EMMELIE DE FOREST AKUSTISK KONCERT

Torsdag 27. marts kl. 20.00

LINDA P´S HOVEDPINE Fredag 28. marts kl. 19.00

LINDESNES TREKKSPILLKLUBB Lørdag 29. marts kl. 18.00

FRANK

HVAM Fredag 4. april kl. 20.00

SIGURD BARRETT OG BJØRNEN BJØRN

ONE CHANCE

Søndag 6. april kl. 10.00

22.-29/1 • kl. 20.00

Vind præmier på Følg os på www.tinghallen.dk

THE WOLF OF WALL STREET

Tingvej 2 · 8800 Viborg Billetkontor 86 62 61 00 Billetnet 70 15 65 65

22.-28/1 • kl. 19.30 www.aarsteaterbio.dk

Tlf. 98 62 11 75

Himmerlandsgade 111 · 9600 Aars · Tlf. 98 62 16 00 · www.aarshotel.dk

tinghallen.dk


Aars Avis

22. januar 2014 5832

SIDE 26

Renault lagersalg. Spar mindst 20% nu hos Hessel. Ejner Hessel åbner lagersalg. Meget lidt brugte Renault. Kun kørt 6-9 md. Under 20.000 km. Topudstyrede. Hessel har selv serviceret bilerne fra de var nye. Og de er stadig næsten som nye. Men priserne fortæller en anden historie. Typisk sparer du 50-100.000 i forhold til nyprisen. Hos Hessel kalder vi den slags for en rigtig, rigtig god handel Du skulle prøve! Se rigtig gode eksempler her - og resten på hessel.dk

Renault Megane 1.5 dCi 110 hk diesel Expression Sport Tourer: Navigation, 2 zone klima, 16” alufælge, fartpilot, læderrat, bluetooth, lys og regnsensor, mm., 28.6 km/l Førpris 294.900,- NU 214.900,- SPAR 80.000,Renault Grand Scenic 1.5 dCi 110 hk diesel Expression 7 sæder: Navigation, 2 zone klima, fartpilot, læderrat, 16 alufælge, lys og regnsensor, mm, 24.4 km/l Førpris 346.900,- NU 254.900,- SPAR 92.000,Renault Clio1.5 dCi Dynamique 90 hk diesel: Navigation, klimaanlæg, fartpilot, lædererat, 16” alufælge, lys og regnsensor, bluetooth, 29,4 km/l. Dette er topmodellen i begrænset antal. Førpris 232.900,- NU 179.900,- SPAR 53.000,1. reg. 2013 gældende for alle biler

Ejner Hessel A/S er autoriseret forhandler og serviceværksted for Mercedes–Benz, smart og Renault.

SJÆLLAND: Næstved tlf. 7311 7100 • Ringsted tlf. 7311 7200 • Slagelse tlf. 7311 7300 JYLLAND: Hjørring tlf. 7211 5300 • Randers tlf. 7211 5100 • Ringkøbing tlf. 7211 6400 • Silkeborg tlf. 7211 6500 Thisted tlf. 7211 6900 • Aalborg tlf. 7211 5200 • Aars tlf. 7211 6800 • Århus tlf. 7211 5000


Aars Avis

22. januar 2014

SIDE 27

SUNDHED & VELVÆRE

KLINIK FOR FODTERAPI

Bilferie uden rødt og grønt kort MOTOR: Tager du bilen på ferie, behøver du ikke have et rødt kort med dig for at sikre dig vejhjælp. Holder du dig indenfor EU’s grænser, kan du også lade det grønne kort blive hjemme. Husk blot telefonnummeret til SOS International – så er du dækket ind. Tidligere var det nødvendigt at have et fysisk rødt eller grønt kort med til bilen som bevis for, at den var henholdsvis kasko- og ansvarsforsikret, hvis turen gik udenfor landets grænser. Det behøver du ikke længere. - Den eneste forskel er, at du ikke behøver at have kortet med. Dækningen er uforandret. Der er imidlertid fortsat mange af vores kunder, som ringer og spørger efter både rødt og grønt kort. Men de fleste gange er det faktisk ikke nødvendigt. Det eneste, du behøver at have med på bilferien, er telefonnummeret til SOS International, siger Lene Koudal Cinicola, der er salgsleder i Topdanmark i Aalborg-området.

Rødt kort er papirløst Rødt Kort-ordningen giver dig automatisk, via din bils kaskoforsikring, vejhjælp i udlandet. Tidligere var det nødvendigt at medbringe det røde kort, som bevis for at

din bil var kaskoforsikret. Sådan er det ikke længere. - Går din bil i stå, eller bliver du involveret i et færdselsuheld og har brug for hjælp, er det nok bare at ringe til SOS International for at få hjælp, siger Lene Koudal Cinicola. Har du en smartphone, kan du også vælge at downloade det røde kort som mobilapplikation, hvorfra du kan kontakte SOS International direkte. Udenfor EU og Norden kan grønt kort være nødvendigt Det grønne kort er et bevis på, at bilen er ansvarsforsikret. Men går din rejse indenfor EU, Andorra, Island, Kroatien, Norge eller Schweiz, er det imidlertid ikke nødvendigt at have kortet med sig. - Efterspørger en lokal politibetjent det grønne kort, kan SOS International hjælpe med at forklare, at det ikke er nødvendigt. Derfor er det vigtigste bare, at du har telefonnummeret med til SOS International, siger Lene Koudal Cinicola. Går rejsen udenfor EU eller de fem nævnte lande, skal du imidlertid altid medbringe det grønne kort. Skal du til Kosovo, skal du være opmærksom på, at myndighederne i landet ikke accepterer det grønne kort.

Forsvaret køber 128 Nissan Navara MOTOR: Der var stor glæde hos Nissan i Danmark, da Forsvarets Materieltjeneste meddelte, at de havde valgt Nissan Navara pick-up i forbindelse med et udbud i sommeren/efteråret 2013. I alt er der leveret 128 styk, der er tilpasset specielt i henhold til Forsvarets krav. Blandt andet med hard top og special konstrueret ladindsats. Landechef hos Nissan i Danmark, Ralph Gonsalves, udtaler: - Vi er meget stolte over at have vundet dette udbud. Vi oplever det klart som et kvalitetsstempel af vores Nissan Navara pick-up. Det er en rigtig arbejdshest, der ikke står tilbage for noget. Den er suveræn i terrænet og alligevel også behagelig at køre på landevejen. Og der er ingen tvivl om, at de hos Forsvaret ved, hvad de vil have, og hvad bilerne skal kunne klare. Nissan har lang erfaring med at producere pick-up modeller. Faktisk blev den første bygget helt tilbage i 1934 under navnet Datsun, som Nissan dengang hed. Og i dag er Nissan da også blandt de førende leverandører inden for denne type varevogne. De seneste opdateringer

på Nissan Navara indholder en opdatering af den populære 2.5 dCi motor med 190 hk og en ny 3.0 V6 diesel luksus udgave med 231 hk. I Danmark fås Navara både i en King Cab og Double Cab udgave. Begge med mulighed for at laste helt op til 3.000 kg. på krogen. Navara er udstyret med Nissans anerkendte elektronisk styret firehjulstræk, der trækker på de bageste hjul ved normale omstændigheder, men automatisk fordeler trækkraften op til 50% på alle fire hjul, når 4WD tilvælges. Ligesom der er mulighed for tilvalg af lavt gear, når der skal bruges ekstra kræfter i terrænet til at forcere bakker og andre forhindringer. - Total markedet i Danmark for pick-up modeller er ikke så stort. Det er jo en special model, der primært anvendes professionelt. Sidste år blev der solgt i alt ca. 500 totalt, hvoraf Nissan ligger i top 3 som leverandør. Salget af de 128 Navara til Forsvaret vil ikke kunne ses i statistikken, da de ikke registreres på normale vilkår. Men vi er i sagens natur stolte over den store ordre, siger Ralph Gonsalves.

Her er det vigtigt, at du tegner en ansvarsforsikring ved grænsen. Uanset hvad er det vigtigt, at du altid har bilens originale registreringsattest med. Nogle lande stiller sig nemlig ikke tilfreds med en fotokopi af bilens registreringsattest.

- Registreringsattester består af en del I og del II. Det er del I, du skal have med dig. Kan du ikke finde din registreringsattest, kan du bestille en ny hos SKAT. Har du campingvogn gælder det samme – husk registreringsattest og forsikringspapirer, siger Lene Koudal Cinicola.

TIL LEJE

HUS UDLEJES 2

160 m . 2 km fra Aars. 5.000 kr. pr. md. + forbrug. Tlf. 23 44 55 77

TIL LEJE Bolig på landet ca. 3 km fra Aars. Gerne ældre lejere. Forhør nærmere. Tlf. 98 62 12 88

Til leje i Aars 2

Hus på 110 m med garage og have. Kr. 5.250,- + forbrug. 3 mdr.s depositum. Ingen husdyr. Ring efter kl. 16.00 på tlf. 98 62 40 17

CENTRALT I AARS Dejlig lys 3-vær. stuelejlighed på 63 m2, adgang til have og skur. Henv. Læsø Tømrerforretning tlf. 21 45 10 36

TIL LEJE 2 vær. lejlighed på 63 m2. Egen køkken og bad. Nær bymidten og grønt område. Husleje kr. 3.175 + forbrug. 3 mdr.s dep. Tlf. 30 20 80 23

V. Hornum Parallelvej 12 B. Rækkehus 98 m2, 3 vær. + garage samt egen have. IndÁytningsklar nu. Husleje 4.300 kr. + forbrug. Dep. 3 mdr.s husleje.

Tlf. 25 52 49 41

HUS UDLEJES I GISLUM 140 m2, 3 vær., stue, køkken og 2 badevær. Leje 4.700 kr. + forbrug. Dep. 20.000 kr. Tlf. 22 72 46 43

Anne Grethe Nielsen Himmerlandsgade 73, Aars

Udebehandling efter aftale

Tlf. 96 98 01 01 Tilskud fra Danmark Overenskomst med Sygesikringen

Klinik for fodterapi

Statsaut. fodterapeut Inge Merete Vestergaard

Blærevej 2, 9600 Aars Tlf. tid kl. 8.00-9.00 på 98 62 11 18 - 40 53 98 62 Fodbehandling - Bøjlebehandling - AÁastninger - Indlæg - Kompressionsstrømper - Støttestrømper - Vejledning - Også udebehandling - Sygesikringsoverenskomst. Tilskud fra Danmark

Tlf. 98 62 13 40 Træffetid: Man.-tors. 9-12 og 13-16 - Fred. 9-12

Bogtryk/ Offset Tlf. 98 62 17 11

KLINIK FOR FODTERAPI v/Statsautoriseret Fodterapeut Karina Levo

Himmerlandsgade 103 C, 9600 Aars

Lejlighed til leje i Haverslev Istandsat 1 vær. 38 m2. 2.500 kr. + forbrug. 3 mdr. depositum. Karsten N. Øxenholt Tlf. 41 18 68 98

Hus i Hornum udlejes Stort pænt hus med 4 værelser udlejes pr. 1. februar. Huset er gennemrenoveret for 4 år siden, og har bl.a. nyt køkken og 2 badeværelser. Husleje 5.500,- kr./mdr. Henvendelse på tlf. 20 40 01 92 el. 27 28 82 47 - bedst efter kl. 16.00

Hus i Vognsild udlejes Velbeliggende lækkert hus på 119 m2 i Vognsild udlejes. Derudover 1 disponibelt rum, samt stor garage. Moderniseret i 2005. IndÁytningsklar. Månedlig husleje kr. 5.000 excl. forbrug. Depositum 3 mdr.s husleje. Henvendelse på tlf. 24 94 64 88 (eller 98 62 64 59 efter kl. 17.00)

Lejligheder i rolige og grønne omgivelser

Telefon 29 32 87 22

www.meldgaardboligudlejning.dk

AARS BOLIGFORENING KIRKEGADE 2 - 9600 AARS TLF. 98 62 24 13 Bliv medlem... www.aarsbo.dk Kontortid: Mandag-onsdag 9.00-16.00 Torsdag 10.00-17.00 Fredag 9.00-12.00

KLINISK TANDTEKNIKER

Statsaut. fodterapeuter Lonnie Andersen, Helle Viborg og Vibeke Brix Bymidten 1, 9600 Aars

- Indkørsel fra Søndergade - Parkering lige ved døren Kørerr også Kør og ogs g å på på Kører u ude ud d beh deb de beh behand handlin and nd dlin ling g udebehandling

RING FOR AFTALE PÅ

TLF. 20 60 30 70

Tilskud fra Sygesikring Danmark og udvidet helbredstillæg

BLANDEDE

SKROTHANDEL Niels 30 42 70 40

Nordvestvej 14, 9600 Aars

Himmerlands Kloakservice & Aars Maskinstation og Kloakservice Vi klarer alt indenfor spuling af kloakker og gylle samt tømninger af tanke Torupvej 8 · 9610 Nørager · Tlf. 98 62 20 18 og Tlf. 98 55 11 15 · Mobil. 40 36 21 15

Opstaldning af heste i Hornum med halvpension. Ridebane og luftefolde. Henvendelse Tlf. 23 70 56 14

FARVEKOPIER * A3 - A4 * overhead-film * tryk på trøjer Aars Bogtryk & Offset Farvekopicenter Aars Himmerlandsgade 150 9600 Aars Tlf. 98 62 17 11

KØB OG SALG

NEVE EDB

Keldgårdvej 117 9600 Aars Karsten Neve Salg, service og reparation af computere,netværk, printere, udstyr og programmer.

Telefon 98 62 51 15 PRIVAT/ERHVERV

Kirkens Korshær Hornum Genbrug

Jernbanegade 1 B Brugbare effekter samt dødsboer afhentes Tlf. 98 66 14 26 Mand.-fred. 11.00-17.00 Lørdag 10.00-13.00 1. lørdag i md. 10.00-16.00


Aars Avis

SIDE 28

Landsdelens bedste

LOPPEMARKED finder du i

HIMMERLANDS AVISERNE

Købes: Jern og skrot kontant. Afhentning v/mindst 250 kg.

Købes: +¼KZIVLY Å`[[LIVLY ÄULYL PUKIV T¼ISLY THSLYPLY [¤WWLYSHTWLY\YLZWLQSLWVY JLS¤UNSHZMHQHUJLÄN\YLYZ¼S] N\SK ZHTSPUNLY UPWZ ZTr[PUN ;VWWYPZIL[HSLZRVU[HU[ Tlf. 21 64 80 90

SÌlges: Komfur, vaskemaskine, køleskab, fryser, spisebord i eg m. 6 stole. Tlf. 53 97 96 33

SÌlges: BrÌnde. Blandet løvtrÌ, 1 meter stykker, ca. 25 m2, kr. 250 pr. rm. Tlf. 61 11 91 10 eft. kl. 16

SĂŚlges: Selvskovning nĂŚr Lerkenfeldt (gran). Tlf. 98 65 31 49

Tlf. 29 66 45 60 send sms

SĂŚlges:/ÂĽPTPUPIPN Tlf. 23 48 12 71

Købes: Skrot: Jern, biler, metaller købes kontant pü stedet. Mindre mÌngder afhentes gratis dog min. 300 kg. Hurtig afhentning. Campingvogne modtages. Tlf. 25 47 13 12

Købes: ;`ZRLYOQLSTL    LM[LYS`ZLZ7YPZRY:HT[[` ZRLRPRRLY[LY___ VN NHZTHZRLY RHZRL[[LY I¤S[L T]R¥ILZ Tlf. 61 85 26 98

Købes: Flinteøkser og stenøkser med hul til skaft samt andre ting fra stenalderen, f.eks. segl, mejsler, knive, dolke og pilespidser købes. Tlf. 98 37 33 46

SÌlges: Terrassedør, 10 dobbelte termoruder. 215 x 95 cm, kr. 1.000. Sort Winther herrecykel 28�, som ny. Ny pris kr. 3.500. Nu kr. 1.700. Tlf. 40 94 87 99

Købes: Gl. jern og metal købes/ afhentes. Evt. nedskÌring. Tlf.: 40 28 61 89

SÌlges: :RYP]LIVYK THOVNUP RHU IY\NLZ ZVT ZWPZLIVYK :V MHIVYKZ¤ILOHUKSL[I¼NRY Z[`RRL[

SÌlges: Fodboldstøvler Adidas Absolado LZ TRX FG i gule. Str. 40 2/3. Brugt 3 gange, 3 mdr. gamle. SÌlges da de er for lille. Købt for kr. 600,-. Pris kr. 300,-

Tlf. 51 20 40 85

Tlf. 40 32 01 03 SÌlges: 5 smü kattekillinger søger nyt hjem. 4 hanner og 1 hun kat. 1 sort – 1 grüstribet – 2 sort/ hvid hanner. Hunnen er grüstribet/hvid. Kr. pr. stk. 50,-.

Tlf. 20 35 92 22

AARS AVIS FARSĂ˜ AVIS

SÌlges: 4 stk. vinterdÌk pü alufÌlge 195/65/15 max kørt 1000 km. Sidder pü en Audi 80. Pris kr. 2.000,-. Tlf. 60 44 89 63

FOLKEBLADET STĂ˜VRING NIBE AVIS VESTHIMMERLANDS AVIS VESTHIMMERLANDS FOLKEBLAD Ă˜STHIMMERLANDS FOLKEBLAD

22. januar 2014

SÌlges: BrÌnde - nÌsten kun løvtrÌ, tørt, har ligget i tør lade i 3 ür, savet og kløvet i ca. 30 cm. Pris afhentet kr. pr. m3 500,-. Aars egnen. Leveret i Vesthimmerland kr. 600,-. Tlf. 24 89 28 88

SĂŚlges: 7OPSPWZ Ă…HKZR¤YT š rYNHTTLS[ Tlf. 98 57 15 26 SĂŚlges: Tørt brĂŚnde, bøg+eg og ask, 6 rummeter, kr. 2.500.Traktor MF31, kr. 9.500. TrĂŚpiller og trĂŚbriketter fra 1500.- pr. palle. Tlf. 22 20 38 24 SĂŚlges: Hobby Classic campingvogn 545, 1993, fortelt og solsejl medf. synet til 100 km i Tyskland. Pris 32.000 kr. Tlf. 25 21 46 38 Købes: Transporter, gerne med kort tid til syn. Tlf. 40 73 19 97

BEMÆRK CAMPINGVOGNE, BILER, MOTORCYKLER, LANDBRUGSMASKINER Skal med under bilmarkedet eller køb & salg!

SÌlges: El scooter Easy-Go, den kraftigste. 4 hjulet kan køre overalt. 2 nye litium batterier. Pris kr. 9.000,Tlf. 20 95 11 85 SÌlges: BrÌnde. Gran kr. pr. m 200,-. Løv kr. pr. m 295,-. Kan evt. leveres mod mere betaling. Tlf. 28 59 12 49/21 26 43 30 SÌlges: Fint gl. spisebord m. skuffe 122x74x76 kr. 500,-. Afsyret egetrÌssybord (tobak) kr. 300,-. Billige Kgl. og B&G figurer bl.a. Optimist, Pessimist, Undulat, SÌler, Piner, brun bjørn, lÌsende børn mm. Tlf. 61 77 37 51 SÌlges: Nyere brugt AEG vaskemaskine og Bosch opvaskemaskine. Evt. levering. Tlf. 42 52 19 63

Købes: Palisander spisestue, bord, stole, skÌnk i palisander købes og skrivebord i palisander. Tlf. 40 73 19 97 Købes: Tyskerhjelme 1939-45 efterlyses. Pris 1000 kr. Tyske kikkerter 7x50, 8x60, 10x80 og gasmasker, kasketter, bÌlter mv. købes. helm1420@gmail.com Tlf. 61 85 26 98 SÌlges: Komplet og velholdt forstÌrkeranlÌg til orkester eller bankospil. SÌlges billigt. Tlf. 98 68 63 54 SÌlges: PS Vita med wifi, 4gb hukommelseskort og skydespillet Call of Duty: Declassified. Original emballage + tilbehør. FremtrÌder og fungerer som ny - er nÌsten ikke brugt. Kr. 1.000,Tlf. 30 11 60 11

SÌlges: 4 stk. mørkebrune højryggede kurvestole med lyse hynder fra IdÊ Møbler. 800,-. Tlf. 22 88 15 55

LOPPEMARKED til til 101.262 88.050 husstande husstande

20 ord for 50 kr.

HIMMERLANDS AVISERNE

Annoncen mĂĽ fylde op til 20 ord! Er der over 20 ord, skal der indrykkes en ekstra annonce - ogsĂĽ med max. 20 ord.

BETALING: Kontant ved levering af annoncen Annoncer til loppemarkedet kan ikke indtelefoneres!

Indryk en loppemarkedsannonce     og kom ud til 101.262 husstande!   Annoncen sendes til:

Aars Avis, Himmerlandsgade 150, 9600 Aars senest fredag kl. 9.00 Mrk.: ÂťLoppemarkedÂŤ Betaling vedlagt:

� Kontant � Check ANNONCETEKST: � SÌlges � Købes � Byttes � Gives vÌk

SÌlges: 4 stk. stülfÌlge 15� incl. nÌsten nye Minerva vinterdÌk 195/60R15. Har tidligere siddet pü en Toyota Corolla HB. Pris 1.900 kr. Tlf. 27 58 07 87

SÌlges: Prima tørt heste wraphø i minirundballer, 80 kr. pr. stk. Tilfredshedsgaranti Tlf. 41 98 44 08 SÌlges: Loppemarked i opvarmet hal. Bjergegaardsvej 4, Aalestrup, lørdag og søndag. 1/2 pris pü alt. Tlf. 21 94 30 52

HUSK:

Indlevering af loppeannoncer SENEST FREDAG KL 9.00

7),)6 MRHIRHYPEZIVHMRERRSRGI

,ZEH/%2PSTTIQEVOIHIXFVYKIWXMP# 0STTIQEVOIHIX IV JSVFILSPHX 46-:%8) (IV OER ERRSRGIVIW QIH O F WEPK F]XXI SK ¨KMZIW ZÂ&#x;O§ EJ RÂ&#x;WXIR EPPI &69+8) IJJIOXIV  1SQWVIKMWXVIVIHI TIVWSRIVSKZMVOWSQLIHIVOER-//)FVYKIPSTTIQEV OIHIXQIRLIRZMWIWXMPEZMWIRW ZVMKIWTEPXIV ,ZMPOIIJJIOXIVOER-//)ERRSRGIVIW# (Y OER -//) FVYKI PSTTIQEVOIHIX XMP ERRSRGIVMRK EJ )NIRHSQQIWSQQIVLYWIKVYRHIFMPIVGEQTMRKZSKRI QSXSVG]OPIVSKPERHFVYKWQEWOMRIVLIVYRHIVSKWoXVEOXS VIV (MWWIXMRKLIRZMWIWXMPLIRLSPHWZMWEZMWIRW).)2(317 13836SK0%2(&69+77-()6IPPIVIZXXMPVYFVMO OIR/Â’&3+7%0+ (YOER-//)MRHV]OOIERRSRGIV QIHERKMZIPWIEJHEXSSKOPSOOIWPÂ&#x;X(MWWIERRSRGIVLIR ZMWIWXMPVYFVMOOIR&)/)2(8+Â’6)07)6 ,ZSVWXSVQoERRSRGIRZÂ&#x;VI# %RRSRGIR Qo ,Â’.78 J]PHI  SVH (IX J VWXI SVH JIOW¨7‘0+)7§SKXMPWPYX¨XPJRYQQIV§VIKRIWLZIV JSVIXSVHSKWOEPHIVJSVXÂ&#x;PPIWQIH9ERWIXSQIX SVHIVJSVOSVXIXIPPIVWOVIZIXLIPXYHXÂ&#x;PPIVHIXJSV IXSVH,EVHYJPIVIIJJIOXIVXMPWEPKIRHIRERRSRGI OER VYQQI IV HY ZIPOSQQIR XMP EX MRHV]OOI JPIVI ERRSRGIVLYWOHSKXIPIJSRRVYRHIVLZIVERRSRGI ,ZEHOSWXIVIRPSTTIERRSRGI# /92OVTVERRSRGIJSVLZIVMRHV]ORMRK %RRSRGIRFIXEPIW/328%28ZIHMRHPIZIVMRKIRIPPIV ZIH GLIGO ,YWO &VIZI WIRHX QIH TSWXZÂ&#x;WIRIX Qo -//)MRHILSPHIOSRXERXIV ,ZSVFPMZIVERRSRGIRMRHV]OOIX# %RRSRGIR MRHV]OOIW M  EZMWIV M ,MQQIVPERH XSXEP STPEKIOWTP %EVW%ZMW*EVW %ZMW:IWXLMQ QIVPERHW *SPOIFPEH 0 KWX V :IWXLMQQIVPERHW %ZMW %EPIWXVYTÂ’WXLMQQIVPERHW*SPOIFPEH/SRKIVWPIZ *SPOIFPEHIX7X ZVMRKWEQX2MFI%ZMW ,ZSVRoVWOEPERRSRGIRMRHPIZIVIW# %RRSRGIRWOEPZÂ&#x;VIEZMWIRMLÂ&#x;RHIWIRIWXJVIHEKOP YKIRJ VMRHV]ORMRKIR%RRSRGIVHIVQSHXEKIW WIRIVIMRHV]OOIWYKIRIJXIV%RRSRGIVXMPPSTTIQEV OIHIXOER-//)MRHXIPIJSRIVIW

Telefon:

Afsenders navn og adresse:

:Â&#x;V STQÂ&#x;VOWSQ To EX HIV OER ZÂ&#x;VI Â&#x;RHVIHI MRHPIZIVMRKWJVMWXIV M JSVFMRHIPWI  QIH LIPPMKHEKIRI oVIX MKIRRIQ 0STTIER RSRGIVRI FVMRKIW LIV M JÂ VWXOSQQIRHI RYQQIVIJXIVMRHPIZIVMRK


Ulrik Lemvig • Mobil 22 43 14 46 • www.soettrupms.dk

rd’s Markservice a a g j ø H Sjørupvej 44, Sjørup, 9640 Farsø Tlf. 22 99 83 65 (21 48 61 53)

Flytning af gylle . . . . . . . . . . . . . . . 575,- pr. time Udkørsel af gylle med 25 t vogn med slanger og sort/grønjordsnedfÌlder.

ENTREPRENĂ˜R- OG DRÆNINGSMESTER IB NIELSEN, Farsø Tlf. 98 63 23 50 - Biltlf. 20 47 23 50 Aut. kloakmester Per Nielsen, 30 60 66 81 De danske landmĂŚnd er pĂĽ ingen mĂĽde tilfredse med randzoneloven, men sanglĂŚrken og andre fugle har gavn af de uopdyrkede 10 meter omkring ĂĽer og vandløb.

Randzoner giver Àere ynglende sanglÌrker

Spuling, af drÌn og kloakker samt alle former for entreprenørarbejde udføres

HIMMERLANDS FUGESERVICE v/ Peer Juhler Faldvejen 25, 9670 Løgstør Tlf. 98 67 88 77 . Mobil 30 41 21 52

Randzoner er ikke sü skidt, at de ikke er godt for noget I løbet af de seneste cirka 40 ür er bestanden af sanglÌrker i Danmark mere end halveret, og i Sverige har nedgangen for sanglÌrken, der er en af de mest udbredte ynglefugle i Nordeuropa, vÌret tilsvarende dramatisk i det dyrkede landbrugsland. Men nu dokumenterer en undersøgelse lavet af Sveriges lantbruksuniversitet (SLU), at randzoner uden giftsprøjtning, gødskning og pløjning er vÌrdifulde hündsrÌkninger til en art som sanglÌrken. SLU püviser, at bestanden af sanglÌrker voksede med cirka 30 procent i de omrüder, hvor der blev udlagt brede brÌmmer langs vandløb og søer i det dyrkede land. Fremgangen fandt sted, fordi fuglene ¿k lettere ved at ¿nde føde af insekter pü grund af de sprøjtefri randzoner.

Randzoner mangler Den svenske forskning er med til at sĂŚtte en streg

under betydningen af de dyrkningsfri brÌmmer, der i Danmark blev indført 1. september 2012 ved Lov om Randzoner, men som ifølge NaturErhvervsstyrelsen endnu mangler at blive ført ud i livet en lang rÌkke steder landet over. Mod slutningen af 2013 kom det frem, at der mangler mindst 12.000 af de 50.000 hektar, som loven foreskriver skal udlÌgges som ti meter brede brÌmmer uden dyrkning, gødskning og giftsprøjtning langs üer, bÌkke og søer. - Randzonerne er vigtige for agerlandets fuglearter med sanglÌrken som den talrigeste. Ogsü vibe, tornirisk, bomlÌrke og til en vis grad stÌr og Àere arter af rovfugle drager nytte af de udyrkede, sprøjtefri zoner, som levner levevilkür til insekter og smüdyr. Randzonerne er utvivlsomt med til at kompensere for det store tab, der skete, da alle danske brakarealer blev opdyrket omkring

2008, siger Henrik Wejdling, der er medlem af DOF’s hovedbestyrelse og foreningens landbrugsekspert.

Lolland er vÌk Da EU’s braklÌgningsordning blev ophÌvet, kom cirka 130.000 hektar braklagte jorder i Danmark under plov. Det fjernede i løbet af bare et ürs tid et naturmÌssigt livsgrundlag pü størrelse med Lolland for mange af det danske agerlands fuglearter. - I Sverige er der püvist en nøje sammenhÌng mellem bestandsudviklingen hos vibe, sanglÌrke og tornirisk og sü udbredelsen af brakarealer. Da brakordningen i EU blev indført, voksede antallet af ynglepar for de pügÌldende arter i det svenske landskab. Da den blev ophÌvet, ¿k arterne tilsvarende tilbagegang. I Danmark har vi set, at bomlÌrken tilsyneladende har draget nytte af brakarealerne, og i Nordtyskland er der püvist et større antal fouragerende rovfugle i brakom-

rüder sammenlignet med i dyrkede terrÌner, siger Henrik Wejdling. - Der er ingen tvivl om, at randzonerne kan afbøde en del af tabet af brakordningen og give bedre levevilkür for Àere af agerlandets fugle, lyder det fra DOF’s landbrugsekspert.

Renere vand og ny natur Randzoneloven er som udgangspunkt indført som et led i EU’s sükaldte vandrammedirektiv. Loven skal primÌrt bidrage til at reducere udledningen af kvÌlstof, fosfor og sprøjtemidler fra dyrkede marker til søer og vandløb. Som en sidegevinst vil randzonerne skabe ny, sammenhÌngende natur. De udyrkede brÌmmer vil ogsü gavne mange vandfugle i fjorde og kystnÌre omrüder, fordi de holder nÌringsstoffer tilbage, der ellers forringer kvaliteten af det marine miljø.

DEN 25.-26. JANUAR KL. 10-16 ,0(66(&(17(59(67+,00(5/$1' 0(66(9(-$$56

n N HS YKG U H H P  V HVV Â / ZP Z Z

ALT FUGEARBEJDE UDFĂ˜RES Nybyggeri - betonelementer - døre - vinduer - køkken - bad - epoxy

Siger kloakken stop? Ring Oudrup op!

af g puling

S

rør

naler/

ylleka

www.oudrup-stenleje.dk Slamsuger med højtryksspuling og TV-inspektion

9PUN[PS2HSSL;SM :RHSR]HSP[L[LU]¤YLP[VWYPUN6\KY\WVW

Tegn en annonce i

VORT LANDBOBLAD - vi er det eneste lokale landboblad i Danmark og kommer rundt til

21.634 husstande.


VORT LANDBOBLAD

LANDBRUGSNYT

SIDE 30

Gudstjenester Udgives af Aars Avis & Centraltrykkeriet A/S, Aars. Redaktion: Thorkil Christensen (ansvarsh.), Lars Lindberg - tlf. 98 62 17 11 Torsten Hansen - tlf. 98 62 17 11. E-mail: redaktion@aarsavis.dk Annonceekspedition: Himmerlandsgade 150, 9600 Aars, tlf. 98 62 17 11, fax 98 62 27 99. E-mail: annonce@aarsavis.dk Indleveringsfrister for annoncer: Forretningsannoncer og andre større annoncer samt annoncer med farver eller korrektur senest torsdag kl. 9.00. Andre annoncer modtages indtil mandag kl. 11.00. Oplag: 21.634 ekspl. Bladet udsendes hver onsdag. Tryk: OTM Avistryk A/S Har De ikke modtaget avisen senest kl. 18.00? Henvendelse bedes rettet til Nordjyske Distribution torsdag kl. 8.00 - 16.00. - Tlf. 98 92 89 00

STILLINGER KØB OG SALG Medhjælper / 2. årselev

Halm sælges

Vi har et landbrug med 280 køer og 300 Ha og vi søger en frisk og selvstændig m/k til at arbejde i stalden. Venlig hilsen Annika & Gunnar Schmidt, Sommerlyst tlf. 40 10 89 72

Byg-, hvede-, rughalm samt ammoniakbehandlet halm sælges og leveres. Hø leveres.

Skovsgård, Skellerup, Hobro. Tlf. 98 55 52 22

OFFICIELLE Vikarservice Landbrug Erhverv Transport

Haveservice Hjemmehjælp - valget er frit - valget er dit

Haveplan Omlægning Vedligehold

Hjemmeservice

Har du brug for hjælp...

Frit valg Privat Erhverv

www.himmerlandsvikarservice.dk Landbocentret Aars . Tlf. 99 98 97 40

Agro Nord 2014 Agro Nord Kødkvæg 2014 Tilmelding af malkekvæg og kødkvæg Agro Nord afholdes for malkekvæg onsdag den 5. marts. Agro Nord Kødkvæg afholdes for kødkvæg lørdag den 8. marts. Udstillingen finder sted i Messecenter Vesthimmerland, Aars samt A/S Nordjysk Agrocenter i Aars. Tilmelding af malkekvæg og kødkvæg senest den 7. februar. Tilmeld dig elektronisk på www.agronord.dk/dk/tilmelding. Arrangører Messecenter Vesthimmerland, A/S Nordjysk Agrocenter, De fem nordlige Dansk Holstein Avlsforeninger, Kødkvægsforeningen Himmerland.

VORT LANDBOBLAD når det skal være lokalt!

Er du bare ferm til det der med at skrive sange, så kan det blive dig, der vinder konkurrencen om at skrive den bedste moderne landbrugssang.

Konkurrence: Skriv om landbruget på nydansk Kulturfond giver Àotte præmier til sangskrivere Vi kender nok mange af dem - fra skoletiden, fra højskolesangbogen eller måske fra festlige lejligheder - de mange sange, der handler om livet på landet i Danmark. Det er sange, som har været med til at give os en fælles forståelse af, hvem vi er. Langt de Àeste er skrevet i første halvdel af forrige århundrede, og nogle er endnu ældre. Disse sange synges stadig på grund af deres ¿ ne melodier og teksternes poetiske kvaliteter. Men det siger sig selv, at som spejling af det nutidige landbrug er de ikke anvendelige.

Det er på tide med fornyelse, mener Landbrugets Kulturfond. Derfor udskriver fonden en konkurrence om at skrive en moderne sang om landbrug. Forfatter Finn Slumstrup, der er medlem af bestyrelsen i Landbrugets Kulturfond siger: - Vi skal synge om landbruget på nudansk. Jeg elsker Jeppe Aakjær, men det kan ikke være rigtigt, at vi næsten altid skal vende tilbage til ham, når vi vil synge om det landlige Danmark. Derfor opfordrer vi vor tids sangskrivere til at lade sig inspirere af landbruget: Giv os en folkelig sang, som vil

blive brugt og ikke være til at komme udenom, når man skal lave næste udgave af Højskolesangbogen! Landbrugets Kulturfond lægger pris på, at sangen er egnet til fællessang og at teksten rummer almene kvaliteter. Dommerkomiteen består af efterskolelærer Karen Hanne Munk, pianist og undervisningskonsulent Jesper Moesbøl, maleren og digteren Hans Tyrrestrup samt Finn Slumstrup. De to sidstnævnte er medlemmer af bestyrelsen i Landbrugets Kulturfond.

L&F glæder sig over Àere danske ambassader Fire nye vækstmarkeder får danske ambassader Fire nye lande i Sydamerika, Asien og Afrika får en dansk ambassade og udenrigsindsatsen styrkes på vækstmarkederne i Kina, Sydafrika og på centrale EU-ambassader. Samtidig lukkes der ambassader i Cypern, Luxembourg, Schweiz, Slovenien og Slovakiet, og repræsentationen i Libyen og et handelskontor i Milano. Det står klart, efter udenrigsminister Holger K. Nielsen og Handels- og Europaminister Nick Hækkerup præsenterede en række repræsentationsændringer i udenrigstjenesten. Hos Landbrug & Fødevarer hilser man de nye ambassadeåbninger velkommen. Selvom organisationen aldrig har ønsket at udenrigstjenesten skulle beskæres, bifalder direktør Susie Stærk Ekstrand i høj grad de nye prioriteringer. -Vi er glade for, at den danske udenrigstjeneste i højere grad kommer til at afspejle

de globale forandringer, der lige nu ¿nder sted i verden. Vi bakker fuldt ud op om, at der skal være mere fokus på verden og EU og mindre på Europa. Landene udenfor Europa spiller både en større rolle politiske og økonomisk, siger Susie Stærk Ekstrand. Landbrug & Fødevarer hilser især de nye ambassader i Afrika og Asien velkommen. - Danske eksportvirksomheder har brug for kompetente råd og vejledning fra fagpersoner. Derfor er udenrigstjenestens repræsentationer af vital betydning for, hvor stor succes danske virksomheder får på vækstmarkederne. Afrika og Asien er store vækstcentre - ikke mindst for fødevarevirksomhederne. Derfor er Landbrug & Fødevarer meget glade for, at der bliver opprioriteret i Asien og Afrika, siger Susie Stærk Ekstrand. Hun understreger at styrkelsen af de store EU-repræ-

sentationer og vækstmarkederne er helt centrale for at øge eksporten, også selvom det har betydet at andre områder skulle nedprioriteres. - Der er fortaget nogle hårde prioriteringer, men når jeg ser på resultatet kan jeg kun være glad for de prioriteringer, der er fortaget både i forhold til ambassader og i forhold til styrkelsen af den fagpolitiskekspertise på EU-repræsentationerne og på vækstmarkederne. Jeg forudser, at det kommer til at have en stor betydning for danske virksomheder og dansk eksport, siger Susie Stærk Ekstrand. -Nu handler det om at forholde sig til den situation, vi står i og få det bedste ud af de eksisterende midler. I den proces er det afgørende, at alle arbejde mod de samme målsætninger om at øge dansk eksport i fremtiden, slutter hun

Søndag den 26. januar 2013 Aars Kirke 10.00 Aars Frikirke 10.00 Skivum Kirke 11.00 Giver Kirke ingen Blære Kirke ingen Gislum Kirke 19.00 Vognsild Kirke ingen Haubro Kirke ingen Ulstrup Kirke 11.00 Gundersted Kirke 9.30 Veggerby Kirke 10.30 Sønderup Kirke 10.30 Suldrup Kirke 9.00 Bislev Kirke 11.00 Ejdrup Kirke 9.30 Løgstør Kirke 9.30 Aggersborg Kirke ingen Kornum Kirke 11.00 Løgsted Kirke ingen Salling Kirke 11.00 Oudrup Kirke ingen Næsborg Kirke ingen Vindblæs Kirke ingen Ranum Kirke 9.30 Malle Kirke ingen Vilsted Kirke ingen Overlade Kirke ingen Farsø Kirke 10.30 Vester Hornum Kirke ingen Hyllebjerg Kirke ingen Flejsborg 9.00 Louns Kirke ingen Alstrup Kirke ingen Strandby Kirke 10.30 Ullits Kirke 9.00 Foulum Kirke ingen Svingelbjerg Kirke ingen Trængstrup Frimen. ingen Kgs. Tisted Kirke ingen Binderup Kirke 9.00 Durup Kirke ingen Rørbæk Kirke ingen Grynderup Kirke ingen Stenild Kirke 10.30 Brorstrup Kirke 14.00 Ravnkilde Kirke 10.00 Aarestrup Kirke 19.30 Haverslev Kirke ingen Aalestrup Kirke 10.00

Aars Landboauktion var i uge 3 tilført 16 SDM kælvekvier, 2800-7900, 2 SDM kælvekøer, 6000-7000, 1 DRK kælveko, 4600, 2 kry. kælvekvier, 4600-6600, 4 kødkvæg, 3300-4600, 9 kvier under 12 mdr. malkerace, 100-2700, 8 kvier under 12 mdr. kødkvæg, 700-5000, 9 tyre over 3 mdr. malkerace, 800-1200, 18 tyre over 3 mdr. kødkvæg, 4000-6900, 20 tyre under 3 mdr. malkerace, 200-900 og 1 foldtyr, 5600. Omsætning: 276500 kr.

Smågrisenoteringen Beregnet notering uge 4 Basis 384,83 (393,18). SPF+Myc 389,83 (398,18). SPF 393,83 (402,18). Økologi 698,52 (704,93). UKtillæg 17. Vægt reg. kr./kg 30-40 kg 6,03 (6,10) kr.


VORT LANDBOBLAD

LANDBRUGSNYT SIDE 31

Styr på udviklingen i Agri Nord Carl Chr. Pedersen, der er formand Agri Nord, reagerer på et læserbrev bragt i Vort Landboblad i sidste uge:

”Der hersker kaotiske tilstande på Agri Nords kontor i Aars”. Det påstår en gruppe af tidligere og nuværende medlemmer af Agri Nord i Àere medier blandt andet i et læserbrev i Vort Landboblad. De kommer samtidig med en hård kritik af ledelse og bestyrelse. Det billede kan jeg slet ikke genkende. Deres kritik må bunde andet steds og skyldes manglende kenskab til, hvad der sker i Agri Nord som helhed og i Aars i særdeleshed. Vi har naturligvis mistet kunder i den seneste tid, men vi har fastholdt 55-60 procent af omsætningen i økonomiafdelingen i Aars, og langt hovedparten af de kunder, som har Àyttet økonomirådgivning, er fortsat medlemmer. Hvilket betyder, at vi i Agri Nord forventer at omsætte for cirka 110 millioner i 2014. Der er ingen tvivl om, at dele af baglandet i Aars aldrig har kunnet af¿ nde sig med tanken om den nuværende konstruktion - sammenlægningen af Vesthimmerland og Hobro-Aalborg Landboforeninger.

Fusionen var dog en demokratisk proces, hvor et Àertal stemte for en fusion, og de betingelser der fulgte hermed. Det er ingen hemmelighed, at Agri Nord havde en svær start tilbage i 2008, men vi har vendt skuden og yder både konkurrencedygtig rådgivning og driver en sund forretning. Siden de 32 opsigelser i oktober har der været Àere tilbud/krav om fusion og nu senest dette læserbrev med angreb på ledelse og bestyrelse. Deres udmelding kan kun tolkes på en måde: De kræver Agri Nord til fusionsbordet for enhver pris. Jeg vil i øvrigt i den sammenhæng nævne, at en fusion tidligere er opgivet mellem Vesthimmerland og Landbonord med henvisning til en væsentlig dyrere rådgivning - altså ikke en fusionsgevinst som nu påstået. De har ret til at ønske en fusion, men det er fortsat Àertallets stemme, som er afgørende, og jeg oplever en meget stor opbakning til Agri Nord som selvstændig forening. Jeg er valgt som formand, for at få Agri Nord til at lykkes. Det er i al beskedenhed en succes, hvor vi har skabt et fantastisk godt rådgiverteam og et stærkt politisk ståsted. Vi har i dag 170 medarbejdere, der servicerer med-

lemmer og kunder med de behov der måtte være. Vi er en forening i konstant udvikling, der lokalt varetager de udfordringer, der er fagligt og politisk i landbruget. Et helt uundværligt link i forholdet mellem landmanden og offentlige myndigheder. Vi har ansat de fornødne kompetencer til alle opgaver, så vi lokalt og på landsplan kan varetage de opgaver, vi er en del af. Vi har været igennem en turbulent periode umiddelbart efter opsigelserne, men vi er igen inde i en yderst positiv udvikling. Alle opgaver bliver løst af kompetente medarbejdere – også på kontoret i Aars. Det eneste kaotiske er byggerod, fordi vi benytter muligheden for at renovere huset i Aars. Centralisering af rådgivningen ved yderligere fusioner ser jeg ikke som en løsning på nuværende tidspunkt. Det er uhyre vigtigt for landbruget i Nordjylland, at Agri Nord har et hold af folkevalgte, der dækker den faglige og politiske dagsorden sammen med dygtige medarbejdere. En funktion der er nødvendig for at fuldende en stærk og lokalt engageret forening. Vi arbejder med en lang række lokale sager såsom lodsejernes rolle i indsatsplanerne for vandindvindingen i Mariagerfjord, Rebild, Vesthimmerland og Aalborg

samt for høje byggesagsgebyrer i Vesthimmerland. Vi taler de lokale lodsejeres sag. Det har været nødvendigt for os i Agri Nord at få juridisk assistance. Konklusionen er klar: Ja - Markedsføringsloven er overtrådt! Derfor nødvendigheden af at anlægge et erstatningskrav mod Landbonord. Det har været nødvendigt at slå en juridisk streg i sandet for at beskytte Agri Nord som forening, og for at beskytte de dygtige medarbejdere, der er kernen i vores forening. Jeg står som formand på mål for den strategi, bestyrelsen har vedtaget. Jeg står vagt om foreningen Agri Nord. At være den lokale spiller med en skarp pro¿l. At være bindeleddet til vores hovedorganisation L&F, til vores samarbejdspartnere og til Bæredygtigt Landbrug. At fastholde de værdier der er i foreningen i form af viden og fast ejendom. Alt sammen til gavn for vores medlemmer, hvis interesser vi er sat i verden for at varetage. Jeg ser rigtig mange gode kræfter, der arbejder for, at landbruget får den plads og de rammevilkår, som er nødvendigt for at skabe det moderne landbrug. Der er mange veje i den proces - bare målet er det samme: En stærk økonomi hos den danske landmand.

Seniorer fører an Hvordan gik 2013? Folketingskandidat for Venstre i Himmerlandskredsen, Per Bisgaard, Parkvænget 8, Aalestrup, skriver:

Alder er bestemt ingen hindring, når der skal kæmpes for dansk landbrug. Dejligt at læse i søndagens udgave af Nordjyske, hvorledes de ¿ re seniorer Bent Hjorth Knudsen, Erik Ugilt Hansen, Christian Mejdahl og Niels Busk, med hver deres kompetencer stiller sig kritisk overfor de danske miljømyndigheders håndtering af vandmiljøet i Danmark. De har alle haft landbruget tæt inde på livet i et langt liv - såvel praktisk som teoretisk, og deres viden om erhvervet er ikke at kimse af. Det er det helt rigtige tidspunkt, de har fundet for deres kritik af systemet, for det er netop nu, at genbehandlingen af de meget omstridte vandplaner ¿ nder sted. Skulle de famøse vandplaner blive implementeret

i det omfang, som den siddende regering først havde planlagt, så ville måske helt op til 50 procent af den dyrkede jord i Nordjylland/ Himmerland blive taget ud af produktion - og eksistensgrundlaget ville forsvinde for mange tusinde mennesker og efterlade affolkede områder og byer. Der står meget på spil; ikke blot for landbruget, men for hele det danske samfund. De ¿ re seniorer påpeger, at det ikke blot er under den nuværende regering, men såvel VK-regeringen som den tidligere Nyrup-regering har et stort ansvar for embedsværkets fejlfortolkninger, der har kostet det danske landbrug enorme økonomiske omkostninger. Det er ikke det rette øjeblik for en politisk tvekamp mellem partierne på de to À øje - skal dansk landbrug overleve og opleve vækst i fremtiden, så er det nu bremsen skal slås i for de helt urimelige vandplaner.

Hvordan klarede de bedste mælke- og svineproducenter sig i 2013? Og hvad er det ikke mindst, de er så gode til, siden de klarer sig bedre end den gennemsnitlige producent? Der er ofte stor spredning på regnskabstallene bedrifterne imellem. Til Agri Nord Økonomis årsmøde bliver der mulighed for at se på regnskabstallene for sidste år. Som noget nyt er eftermiddagens program inddelt i to – et for mælkeproducenter og et for svineproducenter. Her vil der blandt andet blive set på benchmarking på de forskellige driftsgrene.

I kvægdelen vil der blandt andet blive set på grovfoderstyring, mens svinedelen eksempelvis ser på kornhandel mellem naboer. Det vil også være indlæg fra adm. direktør for Landbrugets Finansieringsbank, Jesper Lyhne. Han vil blandt andet fortælle om, hvilke muligheder der er i banken, når det kommer til ¿nansiering af investering, etablering og generationsskifte. Årsmødet foregår onsdag 5. februar i Skalborggaard Hallen. Det er gratis at deltage men tilmelding er nødvendig.

Ikke færre end 25.297.087.378 glas mælk forventer Arla at producere i 2014.

Arla vil servere 25 milliarder glas mælk 25.297.087.378 gange vil Arla i år kunne fylde et 250 milliliters glas med drikkemælk. Det er de mængder, som Arlas anlæg rundt omkring i hele verden vil producere i år. Det svarer til lidt over halvdelen af hele Arlas forventede produktion for 2014. Blev alle mælkeglassene stillet op på række, ville de nå rundt om jorden 47 gange. Og blev de stablet oven på hinanden, ville de nå op til månen næsten syv gange. - Drikkemælk har altid været den bærende del af Arlas produktion - især i Europa - og i år forventer vi at lave mere drikkemælk end nogensinde før. Flere nye forbrugere i vækstlande i især Asien og Afrika har fået øjnene op for den særlige ernæringsværdi, der er i mælk, og derfor er den globale efterspørgsel på mælk større end vi har set tidligere, siger koncerndirektør Jais Valeur, der er ansvarlig for Arlas globale produktion og varemærker. På globalt plan anbefaler myndighederne to-tre portioner mælk eller andre mejeriprodukter som en del af en sund kost.

Ifølge FN’s fødevareog landbrugsorganisation (FAO) er mælk en af de mest unikke fødevarer, der anses for at have stor betydning for human ernæring, da mælk indeholder 22 næringsstoffer og udgør et væsentligt bidrag til kroppens behov for calcium, vitamin B2, vitamin B12, jod, kalium og fosfor. - I Arla mener vi også, at mejeriprodukter spiller en vigtig rolle i en afbalanceret kost. Men de sundhedsmæssige fordele er kun en brik i det samlede billede. Samtidig med at Arla tilfredsstiller den voksende globale efterspørgsel på mejeriprodukter, ønsker vi også at være det mest naturlige og bæredygtige globale mejeriselskab. Det betyder, at Arla skal tilbyde naturlige fødevarer med høj næringsværdi til mennesker i hele verden, samtidig med at der bruges så få af naturens ressourcer som muligt, siger Jais Valeur. Medtælles al produktion i Arla - ikke kun drikkemælken - forventer Arla at bearbejde over 11 milliarder kilo mælk fra selskabets 12.300 andelshavere i Danmark, Sverige, Storbritannien, Tyskland, Belgien og Luxembourg.

Årsmøde i Agri Nord Planteavl Benchmarking på kartoffelproduktion, gode råd om sikker majsdyrkning og erfaringer med frøgræs er blot nogle af de emner, som er på programmet til årsmøde i Agri Nord Planteavl.

Formiddagens program er delt i to spor, hvor man vælger oplæg om enten grovfoder eller salgsafgrøder. Eftermiddagens program byder på oplæg ved chefkon-

sulent Jørgen Evald Jensen om landbrugets udfordringer med miljø. Derudover kommer Ivar Ravn, direktør for Videncentret for Landbrug, Planteproduktion.

Årsmøde foregår i Skalborggaard Hallen, 23. januar, og det er gratis at deltage. På agrinords hjemmeside kan man læse hele programmet.


VORT LANDBOBLAD

LANDBRUGSNYT

SIDE 32

DIGITAL FARVE PRINT og alm. fotokopiering Claus Nørgaard, der er formand for Agri Nord Svin, talte ved årsmødet i Skalborggaard Hallen i torsdags.

A3 - A4 - A5 Svineformand: Løsgående søer i løbeafdelingen er en ommer

Storformat Overhead film Tryk på t-shirts Aars Bogtryk & Offset Farvekopicenter Aars Himmerlandsgade 150 9600 Aars

Tlf. 98 62 17 11

Agri Nord Svins formand opfordrede politikerne til at ændre reglerne Torsdag afholdt Agri Nord Svin Årsmøde. De omkring 170 tilhørere i Skalborggaard Hallen hørte om den aktuelle situation i dansk svineproduktion. I sin beretning talte formand for svineudvalget Claus Nørgaard om årets gang i svineproduktionen, hvor kravet om løsgående søer blev en realitet. - Selvom det ikke er alle, der mener det, gav 2013 politisk medvind til landbruget. Politikerne ved godt, at vi har bevaret vores eksportindtægter på trods af krisen, og de har meldt ud, at svinesektoren skal der satses på. Så håber vi bare, at forslaget fra natur og landbrugskommisionen bærer frugt og bliver baseret på faktisk udledning og ikke antal dyr, sagde Claus Nørgaard Valget af Dan Jørgensen som ny fødevareminister kom for Claus Nørgaard som en overraskelse.

- Velkommen til udfordringerne i erhvervet. Overimplementering og særbyrder er nogle af de største trusler i dansk svineproduktion. Danmark er i forvejen et af de lande i EU, hvor det er sværest at producere hvilket forringer konkurrenceevnen. Vores europæiske kolleger må udbringe 170 kilo kvælstof pr ha, i Danmark er tallet 140 kilo. Det betyder, at indholdet af protein i dansk korn er faldet med 2 procentpoint igennem de sidste 20 år. Det betyder et tab på 18 kroner per gris fra foster til slagtning. Hvis proteinindholdet i kornet steg ville vi kunne reducere importen af sojaskrå. Et nyt eksempel på dansk enegang er kravet om løsgående søer i løbeafdelingen fra 2015. Det vil koste millioner og er simpelthen en ommer!! Kære politikere på Christiansborg – se nu at komme i gang, lød

opråbet fra Claus Nørgaard. Han opfordrede tilhørerne til at huske den eksterne smittebeskyttelse og advarede imod den farlige bakterie Salmonella Choleraesuis som nu er set i Danmark. Han håbede ikke, at det var svinepest eller mund og klovsyge, man ser næste gang. Endelig glædede Claus Nørgaard sig over, at også dansk kvæg har fået fokus på smitterisiko.

Økonomi - I 2014 er der udsigt til højere kødpriser og lave foderpriser. Gennemsnittet fra Landbrug & Fødevarer spår at noteringen kommer til at ligge omtrent på samme niveau som i 2013 hvilket ikke helt er nok til dækningsbidraget. Faktorer som kan påvirke noteringen i 2014 er godt grillvejr og stigningen i den japanske yen. Desuden

plejer VM i fodbold også altid at hjælpe på forbruget af svinekød til grill. Der er stadig udfordringer vedr. ¿nansieringen. Det er stadig vanskeligt at udnytte en del miljøgodkendelser på grund af manglende opbakning fra pengeinstitutterne, vi ser en nedslidning af vores produktionsapparater og håber på en opblødning, sagde Claus Nørgaard. Som afslutning på beretningen ønskede Claus Nørgaard tillykke til svinerådgiver Niels Nørgaard som har været ansat på kontoret i 40 år. På årsmødet var der valg til svineudvalget. På valg var Gorm Jessen, Rasmus Midtgård og Steen S. Christensen. Alle tre udvalgsmedlemmer blev genvalgt for en toårig periode.

Friland kan nu sælge økologisk kød i Kina Er så vidt vides de første i verden, der bliver godkendt Kun et par måneder efter, at repræsentanter for det kinesiske kontrolorgan WIT var på kontrolbesøg i Danmark, har Friland nu opnået at blive godkendt til at sælge økologisk svinekød i Kina. Godkendelsen betyder, at Friland - såvidt det vides - er den første virksomhed i verden, som kan sælge udenlandsk svinekød med det kinesiske øko-mærke.

Friland har igennem snart et par år haft en mindre eksport af økologisk svinekød til Hong Kong, hvor reglerne for økologiske fødevarer er anderledes, men med den nyerhvervede godkendelse kan Friland sælge økologisk svinekød til hele Kina - som er verdens største marked for svinekød. - Kinas høje vækst, kombineret med kinesernes meget store forbrug af svinekød, gør det til et interessant

marked for Friland. Samtidig har vi store fordele ved, at vi gennem Danish Crown allerede har et salgsnetværk i Kina, så vi har relativt et godt kendskab til markedet, siger direktør Henrik Biilmann. Allerede i september sidste år underskrev Friland i Beijing en hensigtserklæring med den økologiske abonnementsordning, Organic and Beyond Cooperation, om

levering af økologisk svinekød, og sammen med eksportsalgschef Marc Ridout planlægger Henrik Biilmann yderligere en tur til Riget i Midten for at følge op på kontakten og tage kontakt til nye kunder. Arbejdet med at opdyrke det kinesiske marked for økologisk svinekød sker i tæt samarbejde med ESS-Food, som er fast repræsenteret i Kina.

Aars avis 2014 01 22