Skip to main content

Mail - Lilydale Star Mail - 13th August 2024

Page 1


Paris delivers world record AND...

Gold for O’Brien

In the space of 24 hours, Lilydale local Kelland O’Brien became both a world record holder and a gold medallist at the Paris Olympic Games.

As a member of Australia’s Men’s Team Pursuit, O’Brien, a decorated national cyclist who went to Lilydale High School and started his career at Lilydale BMX Club, helped bring the team closer to gold on Wednesday 7 August.

O’Brien, alongside his teammates Sam Welsford, Conor Leahy and Oliver Bleddyn, completed the pursuit race in an incredible three minutes and 42 seconds to claim gold over arch-rivals Great Britain.

Barely 0.2 of a second separated the two teams for almost the entire 4km before Australia broke their opponents on the final lap and won by over two seconds.

Having broken the world record the previous day with a time of 3:40.430, the Aussies were in a strong position ahead of the final and their slower time of 3:42.067 was enough to cross the line as champions.

O’Brien said the team had a plan and stuck to it, not putting too much pressure on themselves after the record ride on Tuesday.

“It was a heated battle as it always is, hats off to those guys they rode an amazing race, and we just stuck to our process and nailed it,” he said.

“I couldn’t be more proud of the boys and Tim (coach Tim Decker) for getting it done, we’ve said all along it’s going to be won on day three and it was.”

Returning to the world’s largest arena after an unfortunate incident of a handlebar malfunction at the Tokyo Olympic Games three years ago, that meant the team could only race for bronze, redemption was a huge motivator.

Welsford, a veteran of the sport who competed in Rio and Tokyo, said coming into the Wednesday final, it felt like the Aussie team were still the underdogs, something they wanted to prove wrong.

“I knew we were in a good spot, breaking the world record yesterday, and it was really nice to come here being a bit of the underdogs, I think a lot of people underestimated what we can do and we used that to our advantage,” he said.

Britain’s Daniel Bigham confirmed the surprise felt by his teammates Ethan Hayter, Charlie Tanfield and Oliver Wood.

“I genuinely feel we underestimated what the

Aussies would bring to the party. They have lifted it a huge amount and that cannot be deniedthat’s seriously impressive,” he said.

Coach Tim Decker never questioned the ability of his team, however, knowing full well their desire for gold particularly after Tokyo.

With two debutants in Leahy and Bleddyn, O’Brien and Welsford led the team with experience.

Speaking with Bicycling Australia, St Kilda Cycling Club president Tom Reynolds, where O’Brien is a member, said the 26-year-old showed his dedication and focus.

“People forget Tokyo and what happened. We were a very, very strong team there and we got a bronze medal and the resilience these boys showed and to move forward from that and come back and make this happen is high level history in track endurance cycling,” he said.

Continued page 2

Lilydale’s Kelland O’Brien celebrated the gold medal win on Wednesday 7 August. (AP Photo/Ricardo Mazalan)

Hunter numbers growing

The Game Management Authority (GMA), in partnership with the Arthur Rylah Institute for Environmental Research, has published its estimates of 2023’s deer harvest, gathering results from surveys of Victorian Game Licence holders.

The results estimate that 137,090 deer were harvested last year, an 11 per cent increase from 2022’s total of 123,400 and 59 per cent higher than the average since 2009 (86,400).

GMA Research Principal Dr Jason Flesch said the research was based on information gathered from randomly selected licenced deer hunters who voluntarily participated in the phone surveys.

“Throughout 2023, approximately 2,400 licenced deer hunters were surveyed about their hunting activity including how many deer were harvested, where hunting occurred, hunting methods used, and the species of deer harvested,” he said.

“This research helps build a stronger understanding of deer harvest trends and hunting activity in Victoria.”

The number of licensed hunters jumped up 3.6 per cent from 50,478 to 52,321, of which 60 per cent actively hunted last year at an estimated average of 4.3 deer over 10.5 days.

Head of Advocacy and Deer Management at the Australian Deer Association Sean Kilkenny said he was pleased with the increase in licence holders.

“This reflects a modern society being more connected and aware of where their food comes from, with more Victorians taking the next step and sustainably harvesting it themselves,” he said.

“Recreational deer hunting generates 100’s of millions of dollars and creates thousands of jobs for the Victorian economy, and with some many licence holders, it’s easy to see how,”

“The harvest numbers have been consistent

since the end of Covid, demonstrating the irreplaceable role that recreational hunters have in managing wild deer.”

The Yarra Ranges is included in the very far east side of the Port Phillip and Westernport

Early morning shake up

Woods Point was again the origin of a minor earthquake that shook Victoria in the early hours of the morning on Wednesday 7 August.

At about 3.48am, a magnitude 4.1 earthquake struck in the state forest near the Lazarini Spur Track with 2112 ‘felt’ reports coming in from across the state, including in Yarra Junction and Healesville.

The quake was relatively shallow, occurring at a depth of only 10km below the surface.

VICSES advises that minor damage may have occurred and encourages residents to stay safe by avoiding damaged buildings, roadways and bridges, fallen trees and powerlines.

Chief Scientist at the Seismology Research Centre Adam Pascale was another aftershock in the same sequence that started in September 2021.

“It is strange to think that aftershocks can still be happening three years later, but in geological time it’s just a blink in time,” he said.

“The stress on that fault had probably been building for thousands of years, so for it to settle back into a solid position to start building stress again without slipping is going to take years,”

“This is the third largest aftershock following the original magnitude 5.9, there was a 4.2 only minutes after the main shock, a 4.7 in late June 2023, and this 4.1 today.”

The Star Mail previously reported on the ‘blind’ fault line in the Woods Point area that was discovered by experts at The Australian National University (ANU) in 2023, about a year and a half following the magnitude 5.9 earthquake that hit in September 2021.

Lead researcher and a seismologist at the ANU Research School of Earth Sciences Dr Sima Mousavi said at the time the research was published that ‘it is important to understand their location and behaviour and potential hazards in order to properly assess earthquake risk and take appropriate measures to protect communities and infrastructure.’

The Seismology Research Centre has seismic stations situated around Victoria, including one that was within 35km of the epicentre of the Woods Point earthquake and 20-30 stations within 100km of it.

The Seismology Research Centre posts a weekly earthquake map of Australia on their social media accounts of the same name for anyone interested or seeking information about earthquakes.

Sambar Deer were the most commonly harvested species with an estimate of 106,500 deer, of which 53 per cent were female, streaks ahead of the next-highest at 27,500 Fallow Deer of which 59 per cent were female.

A study on the ‘Abundance of deer in Victoria’ was published by the Arthur Rylah Institute for Environmental Research in October 2023 in which 253 sites were set up, including 317 camera traps, on public land between September 2021 and May 2023. Deer were detected at 148 sites, and signs of deer at 186 in that period. From that, they were able to estimate a total abundance of 191,153, of which 123,061 were Sambar deer, 48,932 were fallow deer, 12,672 were red deer and 4243 were hog deer.

Referring to the abundance of deer stats, the GMA’s estimates would mean a very high proportion of the state’s deer population was harvested last year, even accounting for extra deer.

Fallow and Red Deer were harvested to a sustainable harvest proportion (estimated harvest divided by the estimated abundance) of 0.11 and 0.9 respectively. Fallow deer have an estimated maximum removal rate (maximum annual proportion of animals to remove to stop population growth) of 0.34 and while Red Deer don’t have a set rate, it is estimated to be between 0.3 and 0.46 like most other deer, according to a 2010 study that estimated the annual maximum population growth rates of different mammals.

Sambar deer, however, were harvested at an unsustainable rate of 0.5, above their maximum removal rate of 0.4 and estimated annual growth rate of 15 per cent according to a 202 study based in Victoria.

Catchment Management Authority (CMA), with most of the deer harvesting in this region coming from the Yarra Ranges and Nillumbik area. Between 2001 and 10,000 deer were harvested in the Port Phillip and Westernport CMA with up to 1000 of those using hounds while hunting.

The GMA’s report suggests the high proportions may indicate that there has been some overestimation of the recreational deer harvest, which could be caused by spotlighting on private property, a hound team’s total haul, or deer hunting in a different jurisdiction, such as New South Wales, being included.

Gold glory goes to Lilydale’s Kelland O’Brien

From page 1

“That was a nerve-wracking ride for all of us, with Great Britain leading for the first few laps before the Aussies started to peg them back. Cool heads and experience prevailed,” he said.

“Kell is one of the young legends at St Kilda, and we are proud to see him succeed again on the international stage and have redemption for Tokyo.”

Reynolds said this was certainly going to be a highlight in an already exciting and successful cycling career for O’Brien.

“Winning a gold medal has been one of Kell’s dreams since he started his cycling career, and his success on the track and on the road inspires all of us.

“His gold medal is the highlight of an incredibly busy year for Kell. He’s raced in more than a dozen

international stage and one-day races this year, with more to come.”

Australia’s pursuit gold is the first in the event for 20 years and comes after losing the gold medal ride to the British at London and Rio.

It is also Australia’s first gold medal in track cycling since Anna Meares, now the team chef de mission, beat her British rival Victoria Pendleton in the sprint final in 2012. The pursuit cycling gold medal was one of four golds to be won by Australia on Wednesday, making it the country’s best performance at the Olympics, overtaking the previous best of 17 in Athens 2004.

The medal tally, as of Thursday 8 August, put Australia third with 18 gold, 12 silver and 11 bronze.

The estimates are in for the 2023 deer harvest in Victoria. (File)
An hour of data from the Seismology Research Centre’s seismographs in Victoria, NSW, Tasmania and South Australia showed the early morning quake. (Seismology Research Centre)
Emotions ran high as O’Brien and his team made Australian history. (AP Photo/Thibault Camus)
O’Brien (right) and Oliver Bleddyn celebrate winning the gold medal against rivals Great Britain. (AP Photo/Thibault Camus)
Sam Welsford, Kelland O’Brien, Conor Leahy and Oliver Bleddyn, with coach Tim Decker (centre). (AAP Image/Joel Carrett)

Trio charged after guns and drugs bust

Three men from across the Outer East have been charged after drugs and guns were located at various properties.

Croydon Divisional Response Unit, with assistance from Echo taskforce and Knox detectives, conducted simultaneous search warrants on Monday 5 August in Kilsyth, Croydon and Lysterfield.

At about 5.45am, a 23-year-old man was arrested at a property located on Janette Maree Court in Kilsyth.

He has been charged with driving related offences and has been bailed to appear at Ringwood Magistrates’ Court on 4 October.

Police also executed a search warrant on Rosemary Avenue in Croydon Hills and allegedly located two sawn off shotguns and significant quantities of ammunition.

A 27-year-old Croydon Hills man was arrested at Doncaster East and has been charged with firearm related offences.

He has been remanded to appear at Ringwood Magistrates’ Court on 9 August.

During the third search warrant, officers allegedly located a large quantity of cocaine, steroids, prescription medication and a large amount of cash.

A 21-year-old Lysterfield man was arrested at the scene and has been charged with drugs and proceeds related offences.

He has been remanded to appear at Ringwood Magistrates’ Court on 4 October. Anyone with information is urged to contact Crime Stoppers on 1800 333 000 or submit a confidential report online

IN BRIEF

Chirnside Park man charged A Chirnside Park man has been charged with 30 offences after a seizure of over $60,000 of stolen cars, cash and jewellery following a series of alleged burglaries and car thefts across Melbourne’s east last month.

Detective Senior Sergeant Stephen Sheahan from the Yarra Ranges Crime Investigation Unit said police would leave no stone unturned when it comes to apprehending those who think they have the right to waltz into someone else’s home and take what is not theirs.

“Our community is a very safe place to live and we are extremely determined to make sure it stays that way,” he said. It’s alleged the incidents occurred between 1 July and 31 July including:

• A burglary in Chirnside Park on 1 July where a camera valued at $2000 was stolen.

• Two burglaries in Chum Creek on 3 July where cash, chainsaw, tools and a coffee machine valued at $43,500 were stolen.

• A burglary in Gladysdale on 22 July where cash, watches and jewellery valued at $5000 were stolen.

• A burglary in Brunswick on 27 July where a laptop, computers and concert tickets valued at $3000 were stolen.

• A burglary in Heathmont on 30 July where a motor vehicle, safe containing passports and jewellery valued at $7000 were stolen.

• A burglary in Healesville on 30 July where watches, jewellery and cash valued at $5000 were stolen.

• A burglary in Park Orchards on 31 July where jewellery, war medals and antiques valued at $2000 were stolen.

On 31 July, detectives arrested a 41-year-old Chirnside Park man as he was allegedly breaking into a property in Park Orchards. He was charged with 30 offences including burglary, theft, theft of motor vehicle and possessing a drug of dependence.

He was remanded to appear before Ringwood Magistrates’ Court on 27 August.

Police also executed three search warrants at properties in Healesville, Mooroolbark and Chirnside Park and seized stolen property including jewellery, watches, clothing, power tools, alcohol, high-end electric bikes and racing bikes, a Polaris four-wheel buggy, tree climbing work equipment and personal items of sentimental value to the victims.

Number plate theft spike

Yarra Ranges police are concerned by a spike in number plate thefts around the Yarra Ranges. Please ensure your number plates are fitted with anti-theft (one-way) screws.

Park your vehicle in a locked garage where possible. Or park off the street in your driveway so that the vehicle is closer to your house.

If you notice someone tampering with number plates, call Triple Zero (000) immediately. Burglary in Taggerty

It is believed offender/s have attended a property along Maroondah Highway and stolen a red Polaris 950 and series of other tools and equipment on Tuesday 16 July.

Two cars were parked near the Maroondah Highway property at 4.30am which may be able to help with the investigation.

Contact Crime Stoppers on 1800 333 000 or submit a confidential report at crimestoppersvic. com.au

Search warrants found drugs and guns across three different properties.
Police arrested and charged three men early on Monday for a number of offences. (Supplied)

School funds for fire prep

Some of the Yarra Ranges’ highest bushfire risk schools have been granted funds to carry out preparation works ahead of the 2024-25 summer season.

Over 330 state schools shared in $8.4 million to carry out essential maintenance work through the Bushfire Preparedness (Vegetation) Program (BPVP).

In the urban and foothills area, these schools included Billanook Primary School ($29,251), Birmingham Primary School ($31,034), Croydon Community School ($19,684), Montrose Primary School ($30,606), Mount Evelyn Primary School ($28,273), Yarra Hills Secondary College ($29,405) and Yarra Ranges Special Development School ($29,575).

These schools were selected because of their listing on the Bushfire at Risk Register (BARR).

Yarra Hills Secondary College Mount Evelyn campus principal Leighton O’Donnell said the grants ensured school grounds are safe and up to standard heading into bushfire season.

“The College uses its gymnasium as the designated Shelter-In-Place building and completes ongoing safety assessments to make it prepared for the bushfire season,” he said.

“The Department of Education allocates funds annually to ongoing safety and maintenance works. These works include gutter cleaning of leaf matter on rooftops, tree lopping and branch removal, unblocking of drain pipes and clearing of ground vegetation.

“The staff, students and local school communities are alerted to the maintenance works and are given regular education and safety training through its emergency management procedures.”

The Yarra Ranges is home to 157 schools and early childhood education centres registered on the BARR which fall into either category two or three, meaning they are at the higher end of the risk scale.

The BPVP also provides a School Support Program, where an accredited Bushfire Planning and Design consultant visits a school twice a year to help them prepare for the upcoming bushfire season while also making sure they complete a Vegetation Management Plan every three years.

“We know how devastating bushfires are and just how long-lasting their impacts can be, and that’s why we’re continuing to support schools to be as fire-ready as possible,” education minister Ben Carroll said.

“These grants will help more than 330 schools at risk of fire clear vegetation – to protect their classrooms and facilities in the event of a bushfire.”

Yarra Ranges Shire Council postal election

My council, my vote

Vote by post this October

Ballot packs will be mailed to voters enrolled in the Yarra Ranges Shire Council general election from Monday 7 October. Complete and return your ballot material ASAP. Ballot material must be in the mail or delivered to the election manager by 6 pm on Friday 25 October

If you will be away

If you will be away when ballot packs are mailed, or your address has changed since Wednesday 7 August, you can request for your ballot pack to be redirected by completing the online redirection form at vec.vic.gov.au/redirections, or call 131 832.

Requests for redirection must be received by 5 pm on Monday 9 September.

Large print and braille ballot papers

Large print or braille ballot papers are available for voters who are blind or have low vision – please register by 5 pm Tuesday 10 September. To register, call 03 8620 1314 during business hours.

Early votes

If you will be away during the voting period (7 – 25 October), you can go to your local election office to vote in person, from 10 am on Wednesday 18 September.

The Yarra Ranges Shire Council election office is at:

Silvan Public Hall

271 Monbulk Road

Silvan

The program was first introduced in 2018 to help schools undertake essential vegetation clearance around school buildings prior to the bushfire season and in accordance with municipal fire danger periods.

How to nominate as a candidate

To nominate as a candidate, you must:

• be an Australian citizen and enrolled on the voters roll for Yarra Ranges Shire Council AND

• be eligible to become a councillor should you be elected AND

• have completed the mandatory candidate training before lodging your nomination with the election manager.

To nominate, complete the nomination form and lodge it with the election manager together with the $250 nomination fee. Nomination forms can be lodged by appointment during business hours from Monday 9 September until 12 noon on Tuesday 17 September at the election office. Visit vec.vic.gov.au for more information and to pre-complete your nomination form using the online Candidate Helper. The online Candidate Helper will be available from Tuesday 20 August.

If you use the online Candidate Helper, print your pre-completed form and make an appointment to lodge it with the election manager along with the nomination fee.

Call the election manager from Monday 9 September on 131 832 to make a nomination appointment.

Nominations close 12 noon Tuesday 17 September.

Candidate information sessions

6 pm Wednesday 4 September at Council Civic Centre, Conference Room A, 15 Anderson Street, Lilydale

11 am Friday 6 September at Council Civic Centre, Conference Room A, 15 Anderson Street, Lilydale

Candidate information kits containing nomination forms and other electoral information will be available online and from the election manager.

State-enrolled voters can register for free VoterAlert SMS and email reminders at vec.vic.gov.au

Schools prepping for bushfire season have been granted funds to make the process easier. (File: 388258)

No room for renewables

As Victoria seeks to move away from coal-fired power, the State Government wants communities to help guide the approach to renewable energy and transmission.

A long-term Victorian Transmission Plan is in the works, with the draft Victorian Transmission Plan Guidelines out now for feedback.

“VicGrid is changing the way renewable energy zones are planned so that regional communities, landholders and Traditional Owners have a real say in the process,” said VicGrid Chief Executive Alistair Parker.

“We’re developing a long-term strategic plan, the Victorian Transmission Plan, and we’re seeking input from local communities so we can get this right.”

The plan has drawn the ire of some however, with a number of regions throughout the state exempt from having to home future renewable energy infrastructure, including the Yarra Valley and Dandenong Ranges.

A study map included in the guidelines outlining areas for future investigation has almost the entire Outer East area excluded from wind projects due to a 2012 Victorian Planning Provision, with other areas on the edges still either being avoided or deprioritised.

The Yarra Valley and the Dandenong Ranges have largely been found to be less suitable for large-scale renewable development due to constraints including environmental sensitivity and the terrain, as well as because of the ban on wind farm development in the region in the planning provision.

Gippsland South MLA Danny O’Brien has been one outspoken critic, recently telling the Sentinel Times that the Victorian Government restated ‘its blanket ban on wind farms in city playgrounds like the Yarra Valley, Mornington and Bellarine Peninsulas’.

When contacted by the Star Mail, Mr O’Brien referred to his comments during a 20 February 2024 debate on the Climate Change and Energy Legislation Amendment (Renewable Energy and Storage Targets) Bill 2023.

“The guidelines specifically preclude the development of wind energy facilities in; Yarra Valley

and Dandenong Ranges, Bellarine and Mornington Peninsulas, the Great Ocean Road area within five kilometres of the high water mark, and Macedon and McHarg Ranges, the land within five kilometres of the high water mark of the Bass Coast, west of Wilsons Promontory,” he said.

“Is anyone seeing a pattern here, does anyone know what this is, these are all either Melbourne or Labor-held areas, for areas east of Wilsons Promontory, ‘Go your hardest. Build a thousand wind turbines there. We don’t care. It’s not relevant to us’.”

Parts of Mr O’Brien’s Gippsland South District are designated as Tier 1 (most suitable), Tier 2 (suitable) and Tier 3 (available) for investigation into potential as renewable energy zones, while south to south-east of Traralgon is also slated for an offshore wind study.

According to a map of existing renewable energy projects from Renewable Energy Projects Vic-

toria, the Outer East currently has only one project: an approved but not yet operational battery in Chirnside Park that has a maximum power output of one megawatt.

Mr O’Brien said this is the hypocrisy of this government.

“They will have wind farms, and they will sell it in Brunswick and Northcote and Fitzroy but not anywhere we want it – not anywhere in regional Victoria, where farmers and people who live in the rural parts of this state have to put up with them,” he said.

“No, they just want them out of the places they live and the places they holiday, like the Yarra Valley and the Great Ocean Road, but Gippsland –‘Oh, go your hardest’ – unless it is in Bass, because on the Bass Coast that is a bit sensitive, that is one of their marginal seats; they do not want it anywhere there.”

VicGrid’s initial study areas will be whittled

down into smaller zones following the start of the engagement process over the next twelve months, with only a relatively small proportion of the study area required for renewable energy zones.

The initial study area was developed through the Victorian Government undergoing a ‘strategic land use assessment’ which factored in community feedback alongside 60 statewide datasets covering agriculture, land use, biodiversity, cultural and social factors.

Consultation on the guidelines is open until August 25 and consultation on the study area in the guidelines is open until September 30.

People can find the plan, online feedback forms and details of upcoming sessions on the Engage Victoria website at engage.vic.gov.au/victransmissionplan.

To get a hard copy feedback form and replypaid envelope, call 1800 418 341 and one can be mailed out.

Greens name Emerald’s Dr Merran Blair as candidate

Dr Merran Blair has been named as the Australian Greens candidate for Casey in the upcoming 2025 Federal election.

A dietician born and raised in Emerald who currently works as a lecturer and practice academic at Monash University, Dr Blair said she has lived in and around Casey for most of her life.

“I did leave Victoria for just over a decade and spent the majority of this lime living in Ulladulla on the south oast of New South Wale, In the time that I was living outside of Victoria I also lived and worked in three other states of Australia, so I have a broad perspective of the challenges people face in different areas of the country,” she said.

“I returned to study as a mature-age student to complete my dietetics degree in 2017 and finished a PhD in employability in December 2023, I have been really fortunate to have this opportunity for a career change later in life,”

“Prior to returning to study I had a long series of insecure jobs, mostly in hospitality, and I have also run my own business twice, I got fed up with low-paying, insecure work and decided to get myself more set up with a career and obviously, that has come with sacrifices over the years that I have been studying, but I feel I am in a much better position now to give back to my community.”

Dr Blair will contest the seat of Casey where Jenny Game, the Greens candidate for the 2022 and 2019 elections, managed to achieve 12.94 and 10.94 per cent of the vote respectively.

Dr Blair said Casey was an extremely marginal electorate as just a 5.1 per cent swing in the vote would turn Casey Green.

“I am very excited to step up and represent our electorate and give back to our community, this is an amazing opportunity to finally have a representative in parliament who understands

that climate change is not going away unless we take urgent action,” she said.

“The people of Casey are more affected by climate change than many other electorates and we are sick of waiting for governments to take the issue seriously and act accordingly.

“We are also, much like the rest of the country, hurting from the cost of living crisis. Consecutive Labor and Liberal governments have dropped the ball on affordable housing, and they are scared to act to stop supermarket price gouging and to intervene in the cost of electricity. I look forward to pushing for action on these issues if I am elected.”

The Greens are the first political party or group to officially name their candidate for the Casey electorate, though serving Liberal MP Aaron Violi will be fighting to keep his seat. The Liberal Party has named its candidates for seats it will be contesting next year, including in the neighbouring Aston electorate which was won by Labor MP Mary Doyle during a by-election in April 2023.

Dr Blair said she plans to talk to as many residents of Casey as dhr can, to hear about their concerns and discuss changes both in the local area and federally that can improve their lives.

“There are a lot of local concerns about mental healthcare in our region, and I want to ensure more access to these services in our area, people shouldn’t have to shell out big dollars to see a dentist, psychologist or a GP - healthcare should be truly universal and free for all,” she said.

“Another major local issue is childcare, recent federal changes to the pay rate for early childhood educators is a great step in the right direction, we just need to make sure that these changes translate to adequate access to services for our residents.”

The Star Mail also asked Dr Blair which of the Green’s policies she was most passionate about, which she believes are most important for the Casey community, which she said were climate change and healthcare.

Dr Blair said she is extremely passionate about action on climate change and it baffles her why things are moving so slowly when the answers are right in front of them and underway.

“The current government’s insistence on opening new coal and gas projects is nothing short of negligent, currently, 40 per cent of Australia’s energy supply comes from renewable sources [according to the Clean Energy Council], up from 32 per cent in 2022 [according to statistics from the Department of Climate

Change, Energy, the Environment and Water], we need to be focussing on this and not living in the past and propping up the fossil fuel industry that is literally killing our planet,” she said.

“In Casey we are more prone to extreme weather events than many other electorates, in recent years we have been hit with multiple storms that have led to extensive electricity and internet outages, we are also very used to the threat of bushfires, but this is becoming more common. It used to be that every few summers would be high risk, but now, these high-risk seasons are more common and the bushfire seasons are longer and harsher and getting house insurance in some areas of Casey is either extremely expensive or not even possible,”

“Casey also has a high proportion of natural environments that need protecting from rising temperatures and the extinction crisis, we have a lot to lose to climate change in Casey, and we deserve better than a Labor or Liberal representative who is comfortable taking donations from coal and gas corporations.”

Dr Blair said her passion for healthcare is both from a health service sense but also a broader policy perspective.

“We are encouraged to think that individuals are responsible for their own health, but government policy has a much more significant impact on people’s health than anything else,” she said.

“If people are suffering from housing stress then they cannot be healthy. In the middle of a cost of living crisis, if people are having to make decisions about whether they buy petrol or put healthy food on the table, their health will suffer, my goal is to ensure policies that make it easier for all Australians to be healthy,”

“Currently, many decisions are being made that prioritise the needs of corporations above the needs of the residents of Casey, and all Australians, I want to see that changed so the government works for us, not big business.”

Dr Merran Blair, the Greens’ candidate for Casey in 2025. (Supplied)
As Victoria moves away from coal-fired power, the Outer East will have little role to play in homing new renewable energy sources. (File)

Pothole prevention slashed

A local has raised questions about the Victorian Government’s road maintenance policy as potholes plague the Outer East.

The recent data has revealed the government spent $37 million on road resurfacing works in the 2023-24 financial year, which is a huge drop from the previous year’s $201.4 million.

Quality Fabrication and Engineering is a manufacturer of road maintenance equipment located in Woori Yallock, and the general manager, Glenn Hardiman, claimed that the pothole issue facing drivers would have been greatly reduced if the government had not slashed funding on preventative road maintenance, in particular, road resurfacing and waterproofing.

“Contractors spray bitumen onto the existing road surface, then aggregate crushed rock is spread over the bitumen, this creates a non-slip uniform surface and creates a waterproof seal preventing water penetrating the road and creating potholes,” he said.

“In the last three years, the Department of Transport and Planning has slashed the funding for spray sealing regional roads significantly, and this has exposed a significant proportion of the road network to the winter wet season, which has resulted in an exponential growth in the number of potholes and emergency temporary repair works.

“As we are heading towards the end of winter, it can be revealed that critical road resurfacing activities did not occur over the 23-24 summer. For the first time since the late 80s, our rural road network has not had contracted bitumen surfacing crews actively waterproofing our pavements.”

Road areas resurfaced or rehabilitated in both regional Victoria and outer suburban Melbourne have plummeted over the last five years.

Star Mail contacted the Department of Transport and Planning and confirmed Yarra Ranges roads are not classed as regional roads but as greater metropolitan roads.

Road area per square metre in outer suburban Melbourne resurfaced or rehabilitated has kept decreasing, with 0.729 million square metres in 2022-23, 0.603 million square metres in 2023-24 and the figure dropping to 0.542 million square metres for 2024-25 according to the Australian Flexible Pavement Association.

The following is the road areas resurfaced or rehabilitated in regional Victoria:

• 2019-20: 18 million square metres, approximately 2400 kilometres of two-lane roads

• 2020-21: 20 million square metres, approximately 2600 kilometres of two-lane roads

• 2021-22: 15 million square metres, approximately 2000 kilometres of two-lane roads

• 2022-23: 9.029 million square metres, approximately 1200 kilometres of two-lane roads

• 2023-24: 0.343 million square metres, approximately 45.8 kilometres of two-lane roads

• 2024-25: 3.163 million square metres, approximately 421.8 kilometres of two-lane roads

The figure for 2022 to 2025 has been documented by the Australian Flexible Pavement Association while the figure for 2019 to 2022 has not officially been documented, but Mr Hardiman claimed the number has been collected by Victorian spray seal and maintenance companies.

Mr Hardiman said the government keeps blaming the unprecedented weather events, which is not entirely the case.

“Although the extreme rain in 2022 undoubtedly had an effect on parts of the road network, it is the unprecedented lack of preventative maintenance which is allowing a significant deterioration on the rest of the road network,” he said.

“They [roads] are falling apart, they have not

been receiving the necessary preventative maintenance, they just get temporary patches, which is understandable in the wet months.

“Two, three days or a week later, the pothole or road hazard reappears. The biggest concern in the industry is that this lack of preventative maintenance will continue in the upcoming maintenance program, which will only further exaggerate the issue.

“The deteriorating road network is not only an inconvenience to the motorists, the condition of our roads is now a very real safety issue.”

The recent My Country Road survey by the RACV has also proven that many Victorians have the same concern as Mr Hardiman.

According to the survey, potholes and poor road condition were the top issues identified, with an overwhelming 64 per cent of participants identifying these as the primary safety issue, up from 46 per cent in 2021, and improving the road surface ranked the top solution with 60 per cent of participants voting this.

The Melba Highway from Coldstream to Yea received the most responses regarding safety concerns while the Warburton Highway also featured among roads with many safety concerns. Star Mail contacted the Department of Transport and Planning.

Reserve Bank leaves interest rates on hold, as expected

Australian borrowers have avoided extra loan repayment pain after the Reserve Bank of Australia opted on Tuesday to leave interest rates steady, in a widely expected move.

The key interest rate has been unchanged at 4.35 per cent since November 2023, a level the central bank believes is high enough to slow the economy and tame still-elevated inflation.

Any case to lift interest rates at the August meeting fizzled out after June quarter inflation date landed broadly in line with the central bank and market expectations.

In the post-meeting statement, the board kept its options open on future moves, preferring not to rule anything in or out.

“Inflation in underlying terms remains too high, and the latest projections show that it will be some time yet before inflation is sustainably in the target range,” the statement said.

“Data have reinforced the need to remain vigilant to upside risks to inflation and the board is not ruling anything in or out.”

Refreshed economic forecasts from the RBA have headline inflation brushing the top of the

two-three per cent target band at three per cent by the end of the year, a sizeable 0.8 percentage point revision to reflect government energy subsidies and cost-of-living help.

Yet as those rebates expire in mid-2025, headline inflation is expected to jump back up to 3.7 per cent by the end of next year, before eventually returning to target again by late 2026.

Trimmed mean inflation, which removes major price changes at either end and helps the central bank look through temporary price bumps like expiring energy bill relief, was much closer to May’s predictions though was nudged a little higher over the forecasting period.

The trimmed mean is still falling back within target by December 2025, the same as predicted in May.

Higher interest rates have already slowed the economy substantially but stalling progress on inflation suggests interest rate cuts are at least a few months away.

The central bank remains focused on delivering a “soft landing”, which involves weakening the economy enough to beat inflation without causing a recession and a surge in unemployment.

Quality Fabrication and Engineering design engineer David Taylor stands in front of aggregate spreading trucks used for spray sealing/water proofing for road surfacing. (Stewart Chambers: 424148)
The key interest rate has remained unchanged at 4.35 per cent since November 2023. (Joel Carrett/AAP Photos)

Life saved with new defib within days of donation

Saving the life of a person just days after a donated portable defibrillator was gifted to Mooroolbark Police Station proved the importance and necessity of this equipment.

Through the generosity of Community Bank Mooroolbark, the local police station was fitted with both a community accessible automated external defibrillator (AED) and a portable defib to be kept within a divisional van.

Senior Sergeant Cassandra Forbes said the need stemmed from a few moments where, as first responders, police officers could have assisted a person instantly without waiting for paramedics.

“We had a couple of incidents where the van had been the first responder to incidents where an AED would have been handy to have on board, not that the delay in the ambos caused any detrimental effects but it would have been beneficial if we had had a defib there,” she said.

Having previously worked at a police station where a similar donation of a defib led to lives saved, Acting Senior Sergeant Cal Cunningham said he saw the value in gaining one for Mooroolbark.

“We managed to get a defib donated [at Heidelberg] and that stemmed from my personal experience of going to a number of incidents where we had to do CPR on members of the public being the first responders but not having a defib,” he said.

“I’ve seen firsthand the importance and what a life saving tool a defib is.”

Community Bank Mooroolbark branch manager Ash Wijey said donating defibrillators to community groups and sporting clubs has been a longstanding part of the bank’s

dedication to supporting the health and wellbeing of people in the area.

“When we received the proposal, within 24 to 48 hours our board’s subcommittee approved it,” he said.

“Obviously they saw the benefit to the community straightaway. So rapid response right there. That’s what our business model is anyway, as long as it benefits the community, and in this case, it’s saving lives.”

Within days of having the newest addition to the divisional van equipment, Acting Snr Sgt Cunningham said Croydon police officers responded to a job which required an AED and with Mooroolbark’s van so close, the person was saved.

“In these cases, minutes and seconds make a difference,” he said.

Snr Sgt Forbes said it is a rarity for police cars to carry a defib but more and more community accessible AEDs at police stations are appearing.

“Having two donated is a huge gift to us and to the community. We’re all first aid qualified but we don’t really get the chance to use a defib that often because the ambos or the fireys will get there and they’re the ones that do that piece of the work but everyone’s stretched for resources and now we can offer our help when out on the road,” she said.

Acting Snr Sgt Cunningham said the AED at the station will be added to the GoodSAM app so people can quickly locate it if they need to.

Mooroolbark Police Station is open 24 hours, with the AED accessible at any time of the day for the community to use. The AED is located at the top of the entrance ramp outside the station’s entry door.

The police station can be found on the corner of Hull and Cambridge Roads.

Muddy fine

A long track of mud left on a road by construction vehicles has led to a $5769 fine from EPA Victoria.

Elite Group Vic Pty Ltd had been working on a site in Research Drive Croydon when EPA officers noticed a trail of mud leaving the site and extending around the corner to Dorset Road.

Trucks were leaving the site leaving thick tracks of sediment out on to the road because of poor onsite controls.

“Once it rains, that construction site sediment is going to wash into storm water drains down to the Bungalook Creek,” acting EPA north metropolitan regional manager Chloe Bernett said.

“The only thing we want going down our stormwater drains is rainwater. Everyone has a duty to protect the environment, so for not doing their job properly and containing the site sediment, Elite Group has earned themselves nearly $6000 in fines.”

Acting Senior Sergeant Cal Cunningham, Mooroolbark Community Bank branch manager Ashley Wijey and Senior Sergeant Cassandra Forbes stand with the new defib at Mooroolbark Police Station. (Stewart Chambers: 420178)
Mooroolbark Community Bank staff and Mooroolbark Police Station members worked together to bring this lifesaving equipment to the region. (420178)
Muddy tyres which left a trail of dirt along Research Drive in Croydon led to an EPA fine. (Unsplash)

Positivity shines through

With the likelihood of homelessness increasing, services from across the Yarra Ranges wanted to commemorate the dedicated awareness week with positivity.

Each year during the first week of August, support services from across the region join together to remember, reflect and connect with or about the many people who have fallen into homelessness.

Under the warm winter sun on Wednesday 7 August, lunch was served to a gathered group of those in and around homelessness at Melba Park in Lilydale.

As the regular meeting spot of Holy Fools’ Street Angels lunch it seemed only right to make this the location of the National Homelessness Week lunch.

Founder and chief executive officer of the outreach organisation, Neal Taylor, said unfortunately despite some steps forward, the situation is worsening.

“The issue is getting worse, and we’re starting to see more and more families, not necessarily homeless but at very strong risk of homelessness, battling exorbitant rentals or high mortgages,” he said.

“Often there’s loss of income with a parent, one of the primary parents may be sick or lose their job.”

Anchor chief executive officer Heidi Tucker said this was exactly the scenario and demographic presenting more and more often to the organisation’s homelessness case workers.

“We’re seeing people now coming in who absolutely can’t afford their rent and looking at homelessness who work. So we’re actually now having a lot of contact with what we would call the working poor in this area,” she said.

“The Yarra Ranges, historically, has had reasonable rents, cheaper than further into Melbourne but that is not the case anymore.

“Not only that, landlords are also selling up with the interest rate rises so that perfect storm for people who are renting means that rents are going up but also properties are getting scarcer.”

Another cohort of the population representing the increase in homelessness, Mr Taylor said, was older men, particularly “we’re seeing a lot more men in cars”.

One man, who Mr Taylor estimates was in 70s, was sleeping in his car during the weeks when temperatures dropped below zero. He has since found nightly accommodation at the Winter Shelter.

Ms Tucker confirmed too that across the state the number of older women also becoming homeless continues to rise.

“The fastest growing group of people becoming homeless is older women, and what we know about them is that they’re very ashamed,” she said.

“They may have lived in a house, in a home, being the mother, wife, etc, for many years, and all of a sudden, they actually don’t have a home. They’re living in their car. We’ve heard from women who actually keep that a secret from their family for quite a long time.”

Ms Tucker and Mr Taylor agreed that housing was first and foremost the key to delivering better outcomes for people in homelessness.

“We need to see more community housing. We need to see more permanent housing, but we need to start to see even more emergency accommodation. There’s just nothing, and it’s terrible that we’ve got lots of buildings that are just sitting empty,” Mr Taylor said.

Ms Tucker said when the most recent social and affordable housing project in Croydon saw some of Anchor’s clients find homes it was “like unblocking a drain” because “we all felt like there’s hope”.

“We’re certainly turning our attention to prevention. Houses and more accommodation and social housing, solve homelessness, but they also stop homelessness,” she said.

“What we know is that once people become homeless, they start not looking after themselves, they start perhaps alcohol and drug using, their mental health deteriorates very quickly and their sense of the world means that it’s a long way to get back up that mountain again. So don’t let them fall is really our motto.”

This is particularly important for young people, Ms Tucker said, because research from Canada shows that “50 per cent of people that are homeless as adults were homeless as children”.

For Mr Taylor, community help will form a huge part of the solution, particularly now that State Government laws around granny flats and bungalows have changed which could see someone get off the street for minimal rent.

More than that though, he said advocacy to all levels of government about tiny house and caravan laws or to repair and maintain current public housing stock, may go a long way in helping house a family or individual

And of course any dollar people can spare to donate to organisations like Holy Fools and An-

chor, Mr Taylor said “helps us do what we do” and ensures people receive the support they need.

“There’s lots of things people can do from supporting and donating, and even volunteering, to just advocating and writing letters,” Mr Taylor said.

Recognising the difficulty and paying tribute to the people who have found themselves homeless, Ms Tucker said was one important aspect of the lunch but also to create a positive, supportive environment.

“We’re trying to dispel the stigma and misconceptions that actually people don’t go out to make themselves homeless. It’s not their fault.

“This sort of thing where you bring people together and people are just really friendly and there’s lots of nice things on offer, it makes people feel like we still care.

“It’s a very isolating experience being homeless and very, very lonely because people who become homeless, they lose their community, they often lose their family through maybe no fault of their own.”

The theme of National Homelessness Week 2024 was Homelessness Action Now.

Introducing Stable One’s new CEO Katherine Kirkwood

Winter Shelter Network, chief executive officer Katherine Kirkwood to share a bit more about her new role and the plight of homeless people in the Outer East.

Ms Kirkwood recently took over from Stable One’s founder and former Woori Yallock resident Jenny Willetts OAM, who has relocated back to the UK to care for her elderly parents.

Ms Kirkwood said her connection with Stable One came about through two friends who had previously volunteered at the Yarra Valley Winter Shelter.

“In 2019 I attended a fundraising event ‘Unpack’ which left a huge impact on me, at this ‘dinner’, each person was allocated a number and this number dictated ‘where’ you would be getting your food from for the evening – perhaps it would be a sausage in bread from the ‘community bbq’, perhaps it would be a mug of soup from the ‘soup kitchen’, or perhaps it would be a pack from the Foodbank,” she said.

“As some of us, hungry as we were, wondered how we would open the canned food with no can opener, or how we would eat the 2-minute noodles if we had no access to boiling water (thank goodness for the tea/coffee urn in this instance), one fortunate person on each table was provided with silver cutlery and a served with a delicious choice steak with a side of steamed vegetables, the disparity between the ‘haves’ and the ‘have nots’ was made glaringly

obvious,”

“As someone with a Christian faith, I felt that God convinced me to step out of my comfort zone in order to understand the issues of poverty and homelessness on a more personal level - in the Bible, Jesus overwhelmingly calls us to care for the poor.”

Ms Willetts brought together members of local Christian churches in Lilydale, Mt Evelyn, Wandin and Yarra Glen banded to address the absence of crisis accommodation in the Yarra Ranges in 2017 and went on to found Stable One.

Ms Kirkwood said it was as a volunteer bookkeeper that she began her journey with Stable One in 2020, and then became employed in the role.

“While Stable One was running its program at The Lodge in Yarra Junction, I volunteered as a shift worker, spending time with our guests and other volunteers and during this time, I worked alongside the founder of Stable One, Jenny Willetts,” she said.

“Over the past few years my role with Stable One grew from simply bookkeeping, to assisting Jenny with other tasks including newsletters, social media, and networking with others interested in our shelter model,”

“I have learned an enormous amount from Jenny, and I felt it was a great privilege when she suggested that I step into her role.”

Stable One currently has seven venues across the state providing services for the homeless in Victoria and also partnered with the Emmaus Christian Community, Habitat for Humanity Victoria and Servants Community Housing to announce ‘The Village’ this year - a plan for 11 long-term rental homes in Bayswater North for people experiencing homelessness.

Ms Kirkwood said in her years working and volunteering for Stable One she has also learnt a great deal from our guests about homelessness.

“It is a privilege to hear their stories, and to be able to come alongside them at their most vulnerable and help to provide them with what they need – not simply food and shelter, but also care and connection,” she said.

“Our 150 plus volunteers are passionate about providing more than a place to stay, together we seek to create an atmosphere of belonging for our guests,”

“It’s a place where they can feel safe, and

perhaps learn to trust people again, it’s a place where they can have good, positive conversations, it’s a place where they can been seen and heard, and even relax and have a little fun.”

While Stable One has a strong core of 150 volunteers, the organisation is currently seeking anyone who would be willing and able to fill their overnight shifts, which are run from 11pm to 6am, split into smaller shifts.

Ms Kirkwood said we all know that a home is much more than a house, people need connection, community, support, positive relationships and the list goes on.

“This Homelessness Week, Stable One has participated in the Houses At Parliament campaign, guests and volunteers have been folding origami houses to contribute to a state-wide total of 60,000 paper houses to represent the 60,000 additional, affordable and appropriate social homes that are needed in Victoria,” she said.

“But I think what gets lost in these numbers sometimes is that the ‘houses’ are just a start –people actually need more than just a roof over their head to live life well, a roof and walls are an excellent start, but unless we also provide solutions to this epidemic of loneliness and isolation we are experiencing, the problem of homelessness won’t be solved,”

“Each of us needs to be willing to walk alongside those who are struggling, be the one that gives a word of encouragement, or a helping hand to someone when they need it, take the time to invest in someone else’s story by walking alongside them, unconditionally.”

Tasty Az’s Jack, Julz and Megan with Holy Fool’s Neal Taylor, Cr Tim Heenan, Anchor CEO Heidi Tucker, Stable One CEO Katherine Kirkwood and Jim Fuller House’s Kate Coleman. (Mikayla van Loon: 424162)
The Homelessness Week lunch brought many services and community members together on Wednesday 7 August. (424162)
Tasty Az barista Jack was busy making coffees for the attendees of the Homelessness Week lunch. (424162)
For National Homelessness Week, the Star Mail reached out to the new face of the Stable One
L-R: Holy Fool’s Neal Taylor, Cr Tim Heenan, Anchor CEO Heidi Tucker, Stable One CEO Katherine Kirkwood and Jim Fuller House’s Kate Coleman at a National Homelessness Week lunch. (Mikayla van Loon: 424162)

Replenishing the rail trail

Conservation and revegetation was the objective of a joint planting expedition along a Lilydale section of the Warburton Rail Trail on Tuesday.

The initiative brought together members of Yarra Ranges Council’s (YRC) bushland management team and Box Hill Institute’s (BHI) conservation and ecosystem management students to plant over 1000 Indigenous species on 6 August.

Rehabilitating the undergrowth, the bushy shrubs and canopy began by first removing both English Ivy and angled onion, introduced weeds that harm native plants.

YRC bushland management officer Ben O’Leary said preparation of the site took the best part of 12 months to ensure new plants would have the best chance possible.

“The preparation is critical. If we’re not doing the preparation work, you can put all the plants in you want, but the likelihood is they’ll probably fail,” he said.

“We’ve had a team of contractors come in periodically and treat those weeds to make sure that the site’s ready to go, and that way all those weeds are not so much of an issue this time next year.”

Ben said the 16 students helped plant a variety of species that were “all indigenous and of local provenance” with seeds having been collected locally and grown by Mooroolbark’s Candlebark Community Nursery.

For one student, Jarvis Lewis-James, who is also a volunteer with the nursery, it was a nice cyclical moment.

“Working at the nursery, growing these plants is really fulfilling, because a lot of these I actually collected the seed from originally, so getting to come out and actually plant them is really cool,” he said.

Almost halfway through his diploma, Jarvis has developed a keen interest in the range and function of plants and their impact on the environment.

“I find plants particularly interesting because there’s such a wide diversity of them, and the more you learn about them, the more you find out about the specific ecological niches they fit into,” he said.

“As a part of that you get to learn more about the local landscape, the geology and the way that impacts the vegetation that grows in those areas. I find all that kind of information really, really interesting.”

Combining both passion for Australian fauna

and a desire to help, Sarah Byatt said getting to restore and rehabilitate a small part of the land near where she lives was a huge privilege.

“It’s really important that some people are trying to help the populations grow, and try to be mindful of how we coexist with the place where we live,” she said.

“It’s upsetting when you see people who don’t care about those things and don’t have respect for the land that we live in.”

Midway through her diploma, Sarah said getting out of the classroom to do something handson and practical was a great way to cement the theoretical learnings.

“You learn about how animals behave and how it all works and you don’t really get that in a classroom,” she said.

“You can read papers all day about how certain species behave but it’s completely different seeing it in person and there’s a more intrinsic understanding that you gain.”

Working to replenish the popular walking, biking and running destination of the Warburton Trail, Sarah said even if every person helped pick up rubbish, it would go a long way to restoring the natural corridor.

“I think everyone does feel upset when they

see rubbish. You can ignore it all you like but I think everyone understands that it’s not healthy and it’s not sustainable and it’s not where we want to be.

“It’s really important to just think about the future, even selfishly if you have to, even if you’re like, ‘well, I hate the way it looks’ then help fix it. Help help it get better. Help it grow.”

For fellow student Jack, getting to live out his childhood passions of being in nature, having grown up camping often, he said he has since developed a greater appreciation for the Yarra Ranges’ environment.

“You don’t realise how lucky we are and how much [the environments] do differ. Before coming into the course I’d just look at the bush and assume it’s all the same. It’s amazing to think about how many actual plants we tangibly have down here,” he said.

BecausetheWarburtonRailTrailisconsidered a wildlife corridor, Ben said this project aimed to put habitat back for local fauna, as well as protect the waterways, with a total of 1200 plants planted by the YRC team and BHI students.

This project, however, only formed one part of a much larger planting program.

“Our team will put in about 70,000 plants this year across public land and then we’ve got an-

other team at the council putting 70,000 plants, thereabouts, on private land,” Ben said.

“So we’re working with as many schools, TAFEs and community groups as we can. It’s really nice to be able to work with Box Hill TAFE because it’s the next generation of environmental practitioners.”

For each individual looking to help or have an impact in their own backyard, Jarvis and Ben gave some advice.

“Don’t just plant native, plant local. Go to local, indigenous nurseries and get plants that are local to the area. They’ll grow better. They help protect our genetic diversity here,” Jarvis said.

“The problem we’re seeing in a lot of reserves is hybrids between garden variety native plants and the local indigenous forms, and it’s leading to a massive loss in genetic diversity. So it’s really, really important that you plant local.”

Ben said if people want to lend a hand, be a caretaker or learn about the local environment, there’s a number of Friends of groups and webinars to join.

To enquire about volunteering, go to yarraranges.vic.gov.au/Community/Volunteer/Environmental-volunteering

Students gain inside look at major pipeline project

Future tradies were given an inside look at one of Melbourne Water’s biggest pipeline upgrade projects happening in the outer east last week.

Learning about the installation of a new underground water pipeline that will service 400,000 Melburnians when finished, the invited a group of Swinburne Vocational Education and Training (VET) students visited the Kilsyth to Croydon Water Main Renewal project on Monday 6 August.

The Kilsyth to Croydon water mains project is replacing ageing sections of a 4.5km underground water pipeline with two new water mains, each spanning an impressive 1.35m in diameter.

The students – studying electrical, plumbing and welding TAFE courses - didn’t have to travel far for the visit, with the pipeline currently being laid near the fence line of the Swinburne Croydon campus as part of a staged rollout over 18 months.

“We were thrilled to give the students a firsthand experience of being onsite at a major infrastructure project. The Kilsyth to Croydon mains project is crucial for improving our water infrastructure, and we hope the visit inspires the next generation of tradespeople,” Melbourne Water senior project manager Luis Plata said.

Mr Plata said the visit helped lift students’ understanding of the complexities of major water infrastructure projects and how their training and skills could help deliver such projects.

“We’re committed to providing opportunities for students to engage with real-world projects and foster interest and skills in the water sector,” he said.

“Installing new water pipelines between Kilsyth and Croydon will reduce water disruptions due to leaks and allow us to provide a safe

and reliable water supply now and into the future.”

Swinburne’s director of trades and engineering technologies Bryan Ornsby said students were able to build on the skills they learnt in the classroom during the field experience.

“The site visit with Melbourne Water was so valuable for our students,” he said.

“Seeing the practical application of what they are learning in the classroom brings their studies to life and highlights the contribution they can make to major infrastructure projects in their future careers in construction.

“The students got real insight into the complexities of large-scale construction projects and an understanding of how this project will enhance water distribution to the 400,000 people who live in the region.”

The visit included a site induction, learning about personal protective equipment, observing channelling and pipeline laying, and having the opportunity to ask the crew questions.

The Kilsyth to Croydon project commenced in 2022 and is scheduled to complete on schedule by the end of 2024.

The pipeline project began in 2022 and is expected to be completed by the end of 2024. (Supplied)
Swinburne TAFE students spent a day onsite with Melbourne Water learning about a new underground water pipeline stretching from Kilsyth to Croydon, which will improve water supply for 400,000 people in the region. (Supplied)
Box Hill Institute’s students joined Yarra Ranges Council to plant 1200 indigenous plants along the Warburton Rail Trail. (Mikayla van Loon: 424056)

HOTTER THAN HELL 2024

Hotter than Hell at Lilydale

Grab a pair of Vans and your best mates, and get set for some classic summer festival vibes like the good old days.

That’s right,...we’re back…., returning to Mt Evelyn later this year for a monster 2024 edition of Hotter than Hell with one stage, no clashes and affordable prices with tickets from $85.

An undisputed and unstoppable force on the Aussie alternative landscape, Hotter Than Hell’s 2024 headliners Regurgitator need very little introduction. Boundlessly inventive, and armed with everything from rock, rap, funk, and thrash (and even a kid’s album for good measure), Regurgitator’s live show remains to this day as infa-

mous as their genre-defying earworms.

It’s no stretch to declare Unwritten Law as genuine honorary Aussies, with the group hitting our shores repeatedly since 1996. And 2024 certainly won’t be Unwritten Law’s first Hotter Than Hell rodeo, as the band shares, “With the last Hotter Than Hell being the last tour we did before the world shut down, it holds a special place in our hearts. We’re thrilled to come be a part of it again! We’ll be playing the Black album in full and that’s always been a good time”.

The name Jebediah likely conjures memories of endless summers and riff-soaked good times in the 90s, immediately snatching attention with

their 1996 hit Jerks of Attention, the group swiftly cultivated heavy airplay on triple j. Jebs then solidified their legendary status with their debut studio album Slightly Odway, boasting the beloved anthem Leaving Home, which they’ll be playing in full.   Storming onto the Aussie alternative radar back in the early 2000s, Perth rockers Little Birdy packed a punch throughout the decade. This will mark Little Birdy’s first return to a festival stage in well over a decade, with BigBigLove set to be performed in its entirety!

“It’s been a long time since we played those youthful songs as a band so we are all excited by the idea of revisiting them,” said Little Birdy vocalist and guitarist Katy Steele.

“I also love the concept of us playing the record in its entirety. These shows should be so much fun!”

Founding member of Australian rock royalty Magic Dirt and an all-round Aussie icon, Adalita will be wowing Hotter Than Hell fans in Mt Evelyn, bringing her acclaimed solo work to the stage this October. With her highly respected solo career launching in 2011, Adalita has gone on to support Blondie and The Pretenders and also perform for His Holiness The Dalai Lama, with her most recent 2022 solo album Inland showcasing her enduring songwriting prowess and magnetic delivery.

Jebediah will be back to rock Hotter than Hell once again. (Supplied)
Magic Dirt singer Adalita Srsen walks the red carpet ahead of the 2018 Australasian Performing Right Association (APRA) Music Awards at the International Convention Centre in Sydney, Tuesday, April 10, 2018. (AAP Image/Brendan Esposito)

Where to pick up your FREE Star Mail

CHIRNSIDE PARK Meadowgate Milk Bar3 Meadowgate Drive

CHIRNSIDE PARK Coles Supermarket239-241 Maroondah Highway

CHIRNSIDE PARK Woolworths Supermarket239-241 Maroondah Highway

CHIRNSIDE PARK Caltex Safeway239-241 Maroondah Highway

CHIRNSIDE PARK EG Fuelco Service StationChirnside Park Shopping Cr Little

Chipping Drive, 241 Maroondah Highway

CHIRNSIDE PARK 7 - Eleven 242 Maroondah Highway

CHIRNSIDE PARK Chirnside Park Country Club 68 Kingswood Drive

CROYDON NORTH Croydon Hills Milk Bar158 Nangathan Way

CROYDON NORTH Eastfield Milk Bar11 The Mall

KILSYTH Woolworths SupermarketChuringa SC, Russo Place

KILSYTH Woolworths SupermarketCanterbury Road Kilsyth

KILSYTH Kilsyth Laundrette Unit 7/87 Colchester Road

LILYDALE Aaron Violi MP Office 110 Main Street

LILYDALE Lilydale Marketplace SC33-45 Hutchinson Street

LILYDALE Lilydale Village SC51-59 Anderson Street

LILYDALE Woolworths SupermarketMarketplace, 33 Hutchinson Street

LILYDALE Coles Supermarket Lilydale VillageCastella Street & Maroondah Highway

LILYDALE Lilydale Community Centre7 Hardy Street

LILYDALE Lilydale Lakeside Conference and Events Centre1 Jarlo Drive

LILYDALE United Petrol Service Station473 Maroondah Highway

LILYDALE Caltex Lilydale346 Main Street

LILYDALE Caltex Woolworths31 Hutchinson Street

LILYDALE BP Service Station87 Warburton Highway

LILYDALE Shell Service Station469 Maroondah Highway

LILYDALE 7 - Eleven LilydaleCnr Maroondah Highway & Cave Hill Road

LILYDALE Coles Express469 Maroondah Highway

LILYDALE Hutch & Co Cafe251 Main Street

LILYDALE Round Bird Can't Fly170 Main Street

LILYDALE The Lilydale General110 Beresford Road

LILYDALE Yarra Valley Smokery96 Main Street

LILYDALE Bee Seen Cafe178 Main Street

LILYDALE Blue Turtle Cafe222 Main Street

LILYDALE Gracious GraceCastella Street

LILYDALE Melba Coffee House33-45 Hutchinson Street

LILYDALE Lilydale Munchies7/75 Cave Hill Road

LILYDALE Point of View CafeLilydale Lakeside - Jarlo Drive

LILYDALE Freda's Cafe2 Clarke Street

LILYDALE Barry Plant Real Estate88 Main Street

LILYDALE Ray White Real Estate164 Main Street

LILYDALE Hello Harry245 Main Street

LILYDALE Noel Jones Real Estate 281 Main Street

LILYDALE Professionals Real Estate111-113 Main Street

LILYDALE Grubs Up1 Industrial Park Drive

LILYDALE Mc Donalds RestaurantMaroondah Highway

LILYDALE Olinda Creek HotelMaroondah Hwy

LILYDALE Crown Hotel Maroondah Hwy

LILYDALE Yarra Ranges Council 61 - 65 Anderson Street

MONTROSE Montrose Authorised Newsagency 912 Mt Dandenong Road

MONTROSE IGA Supermarket Mt Dandenong Road

MONTROSE Bell Real Estate 896 Mt Dandenong Tourist Road

MOUNT EVELYN Fast Fuel 1 Hereford Road

MOUNT EVELYN IGA Supermarket 38- 40 York Road

MOUNT EVELYN Post Office 12 Station Street

MOUNT EVELYN Authorised Newsagency 1A Wray Crescent

MOUNT EVELYN Red Robyn Milk Bar 35 Hereford Road

MOUNT EVELYN Library 50 Wray Cresent

MOUNT EVELYN Milkbar 28 Birmingham Road

MOUNT EVELYN Bendigo Bank 2/35-39 Wray Cres

MONTROSE IGA Supermarket916 Mt Dandenong Road

MOOROOLBARK Coles Supermarket15 Brice Avenue

MOOROOLBARK Bendigo BankUnit 19/66 - 74 Brice Ave

MOOROOLBARK Corner Milk Bar38 Bellara Dive

MOOROOLBARK Fang & Yaoxin Mini Mart108 Hayrick Lane

MOOROOLBARK BP Mooroolbark103 Cardigan Road

MOOROOLBARK Coles Express2 Cambridge Road

MOOROOLBARK Professionals Real EstateBrice Avenue

MOOROOLBARK L J HookerBrice Avenue

MOOROOLBARK Fletchers Real Estate 1/14 Manchester Road

MOOROOLBARK Mc Donalds RestaurantManchester Road

MOOROOLBARK 7-Eleven Manchester Road

MOUNT EVELYN York on Lilydale138 York Road

WANDIN NORTH Wandin Newsagency Shop 2 /18 Union Road

Students put to the test

Eight students from four local primary schools put their minds, writing ability and confidence to the test in the second annual Wandin Rotary Primary Schools Speech Contest.

Held at Wandin Yallock Primary School on Thursday 1 August, students from Wandin Yallock, Wandin North, Coldstream and Woori Yallock Primary School had to present a speech to a judging panel from the Wandin Toastmasters group.

Youth Chair at Wandin Rotary Peter Johnson said they were happy to have the school competing again and they were all very enthusiastic about it.

“It’s great for the kids to get the opportunity to do public speaking, the schools are running sort of in-house school competitions to select two for our competition and then the winner of ours goes on to compete against other Rotary Clubs winners,” he said.

“Wandin Toastmasters were great as well, they’re very well organised and they’re very supportive of the Rotary program for the Primary School Speech Contest, they’ve done quite a few schools for a few Rotary Clubs in the district and the district finals are in October.”

The following students competed, having chosen their respective topics:

• Nikita (Coldstream Primary School) - Mysteries of the Deep Sea

• Evan (Wandin North Primary School) - If you could have one superpower, what would it be.

• Saveria (Wandin Yallock Primary School)What planet would you visit and why?

• Mila (Woori Yallock Primary School) - If I could change the world

• Jaylen (Wandin North Primary School) - Mysteries of the Deep Sea

• Nate (Coldstream Primary School) - A much needed invention.

• Molly (Woori Yallock Primary School) - The best part of living on Earth.

• Elias (Wandin Yallock Primary School) - Mysteries of the Deep Sea.

In first place was Molly, who received a $70 bookstore gift card, an individual trophy and will compete in the district finals. Mila and Nate received a $50 and $30 bookstore gift card for finishing second and third respectively.

Mr Johnson said students had a list of 15 topics to choose from.

“The criteria that the Toastmasters looked at is being able to speak without referring to notes, making good eye contact with the people in the audience and confidence and they could speak for up to three and a half minutes so timing their speech is important,” he said.

“It’s a good opportunity for students to participate in public speaking, there are competitions within schools in other areas such as sport, for example, but for students who might not be that way inclined, this is an opportunity to compete in something that they may have a passion for and are interested in, and it’s a good development for future life.”

The judging panel consisted of Judith Talanoa (Chief Judge), Judy Murphy, Nola Sharp and Marlene Sinclair.

All students were presented with a certificate of participation for competing, while the winning school (Woori Yallock Primary School) was also engraved onto the perpetual shield.

Seville Primary School was also invited to compete but was unable to attend.

Rotarians, toastmasters and competing students. (Garry Byrne)
L-R: Place-getters Nate, Molly and Mila with Marlene Sinclair of Wandin Toastmasters.

Checkmates for 20 years

What began as a father establishing a chess club for his passionate son has grown into two decades worth of friendly competition and learning.

Preparing to celebrate 20 years of Croydon’s Chess Club on 22 August, vice president Richard Goldsmith said with every age group represented, it keeps the game thriving.

“We meet multiple nights a week with beginners, juniors, youth, intermediate and senior clubs,” he said.

“So we’ve always got one club but multiple tiers to cater for multiple levels of chess standards.”

As one of the only surviving clubs in the Outer East, particularly after the pandemic, Mr Goldsmith said it is not uncommon for people to travel distances to play each week or to use Croydon’s model to start building their own competition in their own community.

“We’ve had people that come out from deep in the Valley to come and play chess, and they’ve now subsequently built their own chess club after modelling it off us,” he said.

Because of the lack of venues and competitions locally in the early 2000s, father and keen chess player Stephen Frost went about establishing Croydon’s very own, giving his son Jared the opportunity to improve and play competitively.

Growing within years, Mr Goldsmith said the club quickly outgrew venues, which landed them at Croydon RSL as a co-tenant around 2008 or 2009. It has been the club’s home ever since.

As a universal sport that translates across languages and cultures, Mr Goldsmith said in his eyes it’s one of the only games or sports that can achieve that kind of cohesion.

“It’s probably the one sport where many cultures, and particularly cultures who don’t want to pick up a football, netball, or some of the staple sports, but they can play chess, or use chess as the main sport they learn,” he said.

“That brings the strong Indian and strong Chinese cultures as well as the Australian cultures together in a very good, family, friendly, safe environment.”

With so much undiscovered about chess, Mr Goldsmith said “more books have been written about the sport of chess than any other game” as people try to understand and perfect moves.

That’s also what makes the complex game so popular, not only is it competitive but strategic, making it a sport that players can continue to improve and conquer the next level.

But with advancements in technology, the human mind is starting to be overtaken by artificial intelligence (AI).

“The elements at this stage have not been fully explored. If you use compounding interest over the board, for instance, I give you a piece of rice, and you double that piece of rice for every square that’s on the board, there’s only 64 squares,” Mr Goldsmith said.

“By the time we got to the last square, the amount of rice I would owe you would cover the

surface space of England, the entire UK, three feet deep in rice.

“That is the probability of the game application. So the game has a very high level of application and can be manipulated in many ways. So much so that the human mind’s gone to a certain level, and AI is being integrated now.

“The AI is pushing how far the human mind can calculate the game, and the AI is demonstrating it can go even further. So the super computers are starting to teach the best players on the planet how to play the game even more differently.”

Well before the introduction of AI however, Croydon Chess Club welcomed one of the best players in Australia and the world as a senior club

coach, enhancing the next generation of players.

“We’ve got an international master down at the club called Guy West, and in the chess world, he’s been five or six times the Australian champion,” Mr Goldsmith said.

Croydon Chess Club will host an open tournament style celebration on 22 August, welcoming everyone to join in the fun, whether a past player, a new prospect player or someone looking for a new hobby in retirement.

For more information about the club and its week night sessions, go to croydonchess.com

Please contact Ian Birchall secretary@croydonchess.com.au to see if any of the 42 seats are available to play.

Three new run yards making a difference at Animal Aid

A local animal welfare organisation has constructed three new run yards to boost dog enrichment and welfare.

The new run yards have been in use since early August.

The secure environments enable dogs to enjoy unsupervised time ensuring they can relax and unwind away from their kennels, which is immensely beneficial for their overall well-being.

Animal Aid chief executive officer Mark Menze said the idea of run yards is to get the dogs out of their kennels.

“Being able to put them [the dogs] in a larger open space and letting them have some time to stretch, relax and destress is really beneficial for them,” he said.

“Ultimately, what that means is that they move through the adoption process quicker, which means we can help more animals because it’s creating space.”

This development not only offers an improved experience for the dogs but also gifts the dedicated volunteers and staff more flexibility.

Animal Aid received the Animal Welfare Grant 2023 from Animal Welfare Victoria for this construction.

“We are deeply grateful to the Victorian Government for making our vision of new run yards a reality,’ Mr Menze said.

“At Animal Aid, we are always looking for opportunities to make our animals’ lives better.

“Our volunteers and staff are now better equipped to provide exceptional care, fostering a happier, healthier environment for everyone.”

Croydon Chess Club vice president Richard Goldsmith said everyone is welcome to celebrate 20 years of chess in Croydon. (Stewart Chambers: 424127)
Animal Aid digital media coordinator Jessica Walley and an eight-year-old German Shorthair Pointer enjoying their time at the new run yard. (Supplied)

Benefits of strength

If we want to get serious about the idea of ‘aging well’, we need to talk about lifting weights and the immense benefits of strength training in keeping us healthy and fit through our older years.

The body of research evidence in support of strength training as we age only continues to grow.

The benefits are numerous and, most importantly, it’s safe and effective for all ages, body types and abilities. Strength training is now recognised as being able to reduce, delay or reverse many effects of aging and plays a crucial role in our health and well-being.

Lifting weights and going to the gym is definitely not just for young people.

Firstly, resistance exercises importantly increase our muscle mass and improve bone density.

The stronger we get, the more we can do. It doesn’t matter how old you are, research has shown that muscle mass and bone density can be improved at all ages and stages of life.

Physiotherapists, like myself, are constantly prescribing strengthening exercises to treat a multitude of musculoskeletal disorders, such as back pain and osteoarthritis.

In fact, the research in this space is so strong

Healthy living

Physiotherapist, Leads the team at Form & Practice Mount Evelyn and Olinda

that strength training is considered one of the most important treatments for minimising the impact of osteoarthritis and preventing or delaying the need for drastic joint replacement surgeries.

We know that getting strong will also significantly reduce the risk of falls and other injuries by improving our balance and ability to steady ourselves in unstable environments.

Strength training can also improve our metabolism, help us to lose weight and play an important part in managing chronic diseases like cardiovascular disease and diabetes.

So, go out there and get strong.

Not a bore, but not a thrill

Borderlands

Starring Cate Blanchett, Ariana Greenblatt and Jamie Lee Curtis

Rated M 3/5

Despite persistent rumours of the “video game movie curse”, there are now many good movies based on video games, but sadly, Borderlands, directed by Eli Roth, isn’t one of them.

Bounty hunter Lilith (Cate Blanchett) travels to the lawless planet of Pandora to find Tina (Ariana Greenblatt), a powerful man’s missing daughter, and uncover an ancient treasure.

Normally a prestigious dramatic actor, Blanchett takes extremely well to a swaggering, over-the-top action hero role as Lilith.

The fun ensemble cast play very thinly-written characters, and Jamie Lee Curtis has almost nothing to do as the eccentric scientist Tannis.

The film has a grungy yet vibrant aesthetic in keeping with the games, but also abrupt, erratic pacing and flimsy world-building.

The humour, while not particularly crude or obtrusive, is quite blunt, and while I found Jack Black amusing as the cynical yet chipper robot sidekick Claptrap, your tolerance may vary. Macguffins are common in video games – say, finding items as a path to a greater goal – but don’t translate well to film, with Borderlands

piling Macguffins upon Macguffins.

The disappointing action sequences are severely choppy and lack weight or tangible danger.

The film only really has one good action scene, and I’d bet it was directed by Tim Miller during his reshoots (not Roth, who is inexperienced in action cinema), as this lone scene conveys a decent sense of force and cause-andeffect.

The film’s climax is an admittedly cool blast of godlike power, but getting to it is rather tedious.

Lighthearted but empty-headed and neither unpleasant or very exciting, Borderlands is playing in most Victorian cinemas, but you’d probably be better off playing the source games.

A review of The Desert Knows Her Name by Lia Hills

The Desert Knows Her Name, by Upwey author Lia Hills, was recently launched at Belgrave Library.

Connect to the land with Lia Hills’ new biij PASSION FOR PROSE

An interview with the award-winning poet and novelist was provided by The Star Mail’s journalist Gabriella Vukman on May 25.

“I always hold a launch out here in the hills in order to celebrate with the local community who are very supportive,” Hills was quoted as saying.

“I often write on my back verandah surrounded by huge messmates and I am very much embedded in the natural world.”

The author’s third novel is exquisitely lyrical and reads like a piece of nature writing.

Set in the fictional town of Gatyekarr in Wimmera, the desert-like region in western Victoria, the story begins with a girl walking barefoot out of the desert and finding sanctuary with Beth, a regenerative farmer and seed collector.

As the girl can’t or won’t speak, Beth enlists the help of local pub owner Nate in trying to decipher the mysteries surrounding her arrival. But the emergence of the “desert girl” unsettles the community, right on the eve of a festival celebrating the town’s 150 years of history.

Old tensions erupt, revealing dark secrets.

Through the eyes of Beth and Nate, we see the town struggling to remember and reconcile with its violent past.

Meanwhile, there are gossips, speculations and wild rumours, not to mention those outsiders hoping to benefit from the situation.

With that said, this is not an ordinary novel relying on the “small town with a dark secret” trope.

Instead of the thrill of action-packed investigation and ultimate revelation, readers are invited to engage with the characters and observe their connections with the land, where

all answers are hidden.

Indeed, the third and omnipresent narrator of the story may well be the land itself, which offers a reverse chronology tracking the girl’s journey out of the desert. Its voice mixed with the mesmerising sounds and movements of local flora and fauna, the land gently and consistently asks us to listen:

“The wind calms and the land speaks. What came before. What will follow. Listen deeply, ever deeper. You remember how and why.”

These sentences at the end of the story echo the words of poet John Shaw Neilson quoted on the book’s first page: “The silent shall speak, and the ears of / The deaf shall be shaken with sound.”

Not just Neilson, but those wildlife and plants indigenous to the Wimmera region are meticulously researched and vividly presented in the story, especially throughout Beth’s narration.

The character’s devotion to reviving the farm has helped instil a sense of responsibility and urgency to protect the nameless and silent girl – a symbol of the land.

But whether or not the girl is identified is beyond the point, as it is how those around her respond to her presence that is the story’s focus.

As Hills explains: “What would be the story they would project onto her and how does that relate to their relationship with the land?”

Highly recommended.

Local theatre gets rave review for production

The 1812 Theatre

The Sweet Delilah Swim Club

Set in North Carolina where five women come together each year to catch up. Moan, enjoy each other’s company and have a good time. The 1812 set of the interior of the beach cottage was superb. Audience left was the entrance door, across a balcony which gave the impression of looking out to sea. The interior was the main room of the cottage with a door to the audience right leading to the kitchen and rear of the stage was a hallway leading to the necessary facilities.

The play is set over 33 years.

The cast was Sheree Hollinger, played by Laell Raiteri, who booked the cottage each year. A first class performance by Laell.

Jacinta Howden played Lexie Richards. Lexie was always in physical trouble, first in a sling and then in a leg brace etc. She had many marriages and survived them all. A tricky job to play in the various slings and casts but Jacinta kept up the standard and did a wonderful portrayal.

Dinah Grason was played by Bev Shields. A lawyer who always had a liking for gin and was often at the cupboard with a cocktail shaker. A good portrayal of such a character.

Vernadette Simms was played by Hannah Bolt. Vernadette’s children were always in a perpetual state of incarceration. Hannah really caught the essence of the character.

Jeru Neal McFealey was played by Malanie Bouette. Jeri has been a Nun and now was out of the convent with a surprise for the other members of The Sweet Delilah Swim Club.

A successful evening by The 1812 Theatre with a high standard of production and enjoyed by the opening night audience.

Six

The Six Wives of Henry VIII Melbourne’s Comedy Theatre was the venue

for SIX

A story told in music of the six wives of Henry VIII.

Wednesday 7 August saw the opening night. A great crowd assembled outside the theatre for opening night drinks. Many people dressed for the part with many fans of the production present.

A short show, from 7.30pm to 8pm with no interval.

The six wives were represented by Kimberley Hodgson as Catherine of Aragon, Deidre Khoo as Anne Boleyn, Loren Hunter as Jane Seymour, Zelia Rose Kitoko as Anna of Cleves, Chelsea Dawson as Katherine Howard, and Giorgia Kennedy as Catherine Parr.

The orchestra was drums, two guitars, keyboard, and bass.

The production ran smoothly, costuming was good, the audience really had the feel of the era but rather brief the outfits were. The singing was great, each wife sang about their life with Henry and also spoke about him.

The girls worked well together each taking their turn and the joint movements were perfectly timed. Good choreography. Overall a wonderful night of entertainment and a show not to be missed.

Gemco Theatre

Don’t forget the 27th Dandenong Ranges One Act Play Festival 2024 happening 17 and 18

LUXURIOUS 9-ACRE COUNTRY RETREAT

THIS spectacular country retreat situated only minutes from Emerald and The Patch townships pairs a lush natural landscape with a luxurious family home. A 9-acre haven for flora and fauna with exquisite Warburton Ranges outlooks, 3 paddocks, stables, 12car workshop, machinery sheds, and more, this gorgeous getaway will satisfy cravings of complete privacy and serenity.

At the heart of this prized property resides the immaculate residence framed by paved patios and picturesque views. The beautiful kitchen with shaker cabinets, Westinghouse wall oven, gas cooktop, Bosch dishwasher, and modern matte black tapware flows into the dining area and snug/family room. The adjoining lounge with magnificent wood fire steps out to the deck that soaks up these picture-perfect surrounds.

In addition to wonderful living areas, there are beautiful bedrooms on offer. The main bedroom boasts deck access, a walk-in robe, and a luxurious ensuite with dual sinks. The family bedrooms each feature built-in robes and cosy carpet underfoot.

For versatility, there is an enticing lower level studio with separate entry and powder room that is ideal for older kids, guests, or those who work from home.

This one-of-a-kind property is a showcase of rural living in style. Guaranteed to impress, prompt inspection is recommended. Join us for a tour today.

Welcomed to the vibrant heart of Lilydale, Elders Real Estate proudly announces its return, now positioned at the corner of Main and Clarke Street. With a distinguished legacy spanning over 185 years across Australia, Elders Real Estate has solidified its presence in Lilydale through a dynamic merger of RT Edgar and Harcourts. This exciting fusion brings together a wealth of experience and unparalleled “Lifestyle” credentials that set them apart in the real estate industry. While Elders is renowned for its expertise in rural and regional properties, their Lilydale branch is equally adept at delivering exceptional service for residential and commercialrealestatethroughoutLilydale,Mooroolbark,andMountEvelyn.

Aspartoftheirnewspringpromotion,theyinvitethoseconsideringsellingtheirpropertytoseizethechance towin$25,000byrequestingapropertyappraisaltoday.ExperiencethetrustedexcellenceofEldersReal Estate—wheretraditionmeetsinnovationintheheartofyourcommunity.

Meet the Team in Lilydale.

Taylor BranchManager

As Branch Manager and Licensed Estate Agent in Lilydale, Richard offers over 30 years of unmatched experience. His deep industry knowledge and local market insight allow him to guide clients through every stage of their real estate journey. Renowned for exceptional, personalised service, Richard ensures top-notch care and expert guidance, makinghimakeyassetinachievingpropertygoals.

ElizaHoughton LicensedAgent

Raised in the world of real estate with her father Andrew serving as a long-time Director in the Yarra Valley, Eliza naturally found her way into the industry. Her dynamic personality, exceptional networking skills, and consistent ability to build trust with vendors has forged her enviable reputation and ongoing success, making her a standout professionalinthefield.

TaylaMcCormack Reception/Administration

Tayla embarked on her career in customer service and administration over five years ago. Her exceptional communication skills and meticulous attention to detail enhance every facet of her work. As a vital support to the Elders team, Tayla consistently delivers outstanding customer service, effectively assisting both existing and potentialclientswithprofessionalismanddedication.

Houghton LicensedAgent

With a lifetime immersed in the Yarra Valley, Andrew possesses unparalleled expertise in the local market. Beginning with Elders in 1995, he went on to pilot the highly successful RT Edgar Yarra Valley for over 20 years. Andrew’s clients benefit from his deep knowledge and expert negotiation skills, consistently delivering exceptionalresultsandstrategicadvantage.

BenRose Specialised PropertyAdvisor

Ben is a fully licensed Real Estate Agent, Certified Property Valuer, and Certified Business Valuer, who brings over 17 years of industry experience to each transaction. His expertise ensures optimal outcomes in real estate and business dealings. Specialising in, but not limited to, the rural lifestyle and agribusiness sector, Ben’s lifetime experience in the wine industry further enhances his comprehensive understanding and ability to deliver exceptionalresults

Boastinga40-yearcareeracrossdiverserealestatesectors, Gerard excels with a vast network, stellar communication skills, and expert negotiation abilities. His profound knowledge of the Yarra Valley market, paired with current insights into the foreign buyer sector, equip him to deliver exceptional results for vendors. Gerard’s expertise ensures strategicadvantageandsuperiorserviceineverydeal.

LeeBrouwers

Our dedicated Property Manager for Lilydale, combines over 20 years of Yarra Valley experience with a reputation for reliability and efficiency. Her personal experience as an investment property owner enriches her understanding of landlord needs. Lee excels in fostering strong relationships with clients and tenants, ensuring exceptional care and professionalism in property management, and is a trusted expertinoptimisingpropertyinvestments

227-229 Main Street Lilydale

Richard
Andrew
GerardKennan LicensedAgent

THE HILLS DREAM – A RENOVATED HOME WITH HUGE DECK AND STUDIO

MOVE in ready and nothing to do except enjoy your new place to call ‘our home.’

Renovated to a high standard, this classic split-level hills residence has all your, ‘I wants’ and is the perfect place to relax and ideal for entertaining, with a large living and dining area flowing off the modern kitchen and out to the expansive deck overlooking the treetops.

Featuring: 3 bedrooms, full ensuite to main.

Large open-plan living/dining with an open fireplace.

• Opening on the deck for that classic indoor/ outdoor lifestyle.

• Adjoining kitchen with stone bench tops and stainless-steel appliances including dishwasher.

Main bathroom with soaking tub. Separate laundry and toilet.

• Great studio/yoga retreat, or work-fromhome option.

• Plenty of off-street parking.

• Landscaped tiered grounds.

• Split system, wood heater and ducted heating.

Sealed driveway.

The location is quiet, yet you are near to Emerald Township with its cafes, supermarkets, speciality shops, health professionals, community hub, sports facilities, schools and so much more. Monbulk is also not far away, with Aldi and all the shops you need. Privacy is assured with a peaceful treetop outlook. You best make a time to view it, because this will go quickly! Call Mick Dolphin 0429 684 522 or Anthony Iorlano 0494 142 438 today.

PRIVATE1415SQMALLOTMENTCLOSETOTOWN

Alargefamilyhomeofapprox.20squaresthatstandsproudonthehighsideoftheroad boastsanever-popularopen-plandesign.Themainbedroomhasbalconyaccessandis separatefromtheotherbedroomstotherearofthehomeplusthereis ahandystudyor potentialnursery.IncludesDGH,combustionwood fireand aMASSIvE under-housespan 7m x7mcarportwhichofferspotentialfor agarage/studio/workshoparea.Ifyouare lookingfor apropertytoaddvalueorjustenjoyasis,thiscouldbetheone!

GrantSkipsey 0418528102

Nestledina primelocationwithbreathtakingviews,thisfabuloushomespanningover twolevelsisdesignedtocatertothediverseneedsofa modernfamilyandthetoplevel featuresopen-planliving,diningandthekitchenwithfloorboardsthroughout,wood firein theliving, astudynookanda largedeck.Thelowerlevelincludesa fourthbedroomwith itsownprivatepatio,a powderroomanda largerumpusroom.Thepropertyincludes twodriveways,doublecarport,a fullyfencedrearyardand37,000ltwatertanks.

JanBrewster 0409558805

BUSINESS/HOMECOMBINATIONON1275SQM

OncetheSelbyGeneralStore,thislocallandmarkhasbeenrenovated,updated& refurbishedandnowprovidesa greatopportunitytocreatea newbusiness/residence inthiscommunity.Thepropertyincludes acontemporarybathroomplus asecondtoilet, livingspace,laundry,kitchenwith a900mmstove,dishwasher,S/Sbenchesanda cool room.Theretailareaisopenplan,withductedheating &a splitsystemandhassome lovelycharacterfeaturesincludinghighceilings,strapping &somepressedmetalceilings

MickDolphin 0429684522

AnthonyIorlano 0494142438

greatcharacterfeaturesthroughoutthatyoucanmakeshinewhenyouaddyour finishingtouches.Thenear700sqmallotmentisgentlysloping,hasestablished gardens and affordsa nice outlook.Thispropertymight beidealifyou arelookingtodownsize or turnintoaninvestment.Situated in agreatlocation,you areminutestoMonbulk Township,schools,shopsand plentyofwalks/rides/hikesinthisbeautifulcountryside.

AnthonyIorlano 0494142438

HOME FOCUS

EXECUTIVE STYLE LUXURY LIVING

WELCOME to this stunning, modern, two storey home that epitomizes executive living, an absolute gem for the buyer looking for a home exuding style and luxury in the heart of the Yarra Valley.

Nestled in a very private location, standing majestically on well over 1 acre, this home is just a few years young and has been beautifully designed throughout.

Step inside to discover an open plan kitchen featuring sleek, seamless cabinetry, high quality appliances, and a spacious walk in pantry. This kitchen is not just for cooking; it’s the heart of the home, where entertaining takes centre stage. The adjoining dining and living areas are warmed by a built in wood fire, creating a cozy ambiance perfect for gatherings. Floor to ceiling windows draped in flowing curtains frame breathtaking mountain views, adding an element of romance to every occasion.

As you ascend the striking catwalk to the master suite, you’ll feel as though you’ve entered a gallery exuding style and flair. The master bedroom is truly outstanding, offering generous space and an inviting feeling like no other.

The luxurious ensuite will make you feel like you are on a weekend away and the expansive walk in robe has a wealth of cupboard and hanging space.

Downstairs, the versatile theatre room can easily transform into another bedroom, complete with its own walk in robe, ensuring comfort and convenience for family and guests alike. An inviting entry leads from the internal garage, emphasizing practicality and easy living. Year round comforts are well and truly covered with electric zoned heating, split system, evaporative cooling and a crackling wood fire too.

Outside, you’ll be enchanted by beautifully maintained gardens and an alfresco living area, perfect for enjoying warm summer evenings or entertaining friends.

If modern, luxury living in a private slice of the Yarra Valley is your dream, this breathtaking home is waiting for you. Don’t miss the opportunity to make it yours!

Please contact Agent to arrange a Private Inspection.

4LittleJoeCourt,Wesburn$1,275,000-$1,400,000

ExecutiveStyleLuxuryLivingintheYarraValley

Thisstunning,modern,twostoreyhomeintheheartoftheYarraValley,idealforthoseseekingluxury andstyleisnestledonoveranacre.Beautifullydesignedthroughoutandfeaturinganopenplan kitchenwithhighqualityappliancesanda spaciouswalk-inpantry,thediningandlivingareaopens uptoalfrescoentertainingwith amagnificentmountainbackdrop.Witha totalof3 bedrooms, 3bathroomsandlotsoflivingoptionstocomplimentthisexecutivefamilyhome.Upstairs,the hugemastersuiteboastsa luxuriousensuiteandexpansivewalkinrobe,a versatiletheatreroom downstairsforthemoviesbuffsortheoptionofanadditionalbedroom.Outside,enjoythewell maintainedgardensandbreathtakingValleyvista.Thisspectacularhomeiswaitingforyou,don’t misstheopportunitytomakeityours!

RebeccaDoolan M 0401832068

Escapetoyourriversideparadise!

Nestledonover1&1/2acresoflushland,andenjoyingadjacentriverreserve,thisenchanting propertyoffers alifestyleoftranquillityandleisure.Asthedayfadesintoevening,retreattoyour expansiverearveranda.Youcanunwindamidstnature’sbeauty,perhapsindulgingina soothing soakintheoutdoorclawfootbath.Inside, acozyambiancebeckons,courtesyoftheslow combustionwoodfireandsplitsystem,ensuringyear-roundcomfortforyourfamily.Thewarmthofa lovelytimberkitchenprovidesamplespacetocookup afeast.Withtwoinvitingbedroomsandan additionalprivatestudioorguestroom,completewithitsownlittledeck,thepropertyoffersversatility andseclusion.Safetyandsecurityareparamount,thankstothefencedbackyard,providingpeace ofmindforbothchildrenandpetsalike.Don’tmissout...Yourriversideparadiseawaits!

Timefora ChangeofScenery

Here’syourchancetofinallysecureyourweekendgetawayor agreatfamilyhome,situatedin picturesqueandprivatesurroundingsona largeblockit’stheidealplacetoslowdownandenjoy therelaxedlifestyle.Thehomeoffersaflexiblefloorplanwithbedroomsspreadover 2levels,the spaciousliving/loungearealooksouttothecolourfultreedoutlook.A greatsizekitchenwithplenty ofbenchandcupboardspaceplusa separatemealsareaandformaldiningarea.Headoutside andimmerseyourselfintheoutdoorsandexploreandenjoythesurroundswithestablishedgardens andpathwaystomeanderaround,entertainallyearroundwith acoveredareaideallypositioned toenjoyandadmirethefilteredvalleyviewsandtreedbackdrop.A greatpropertythatoffersthe wholefamily agreatlifestylewithplentyofspacetoenjoy.

ontheproperty.Theheartofthehomeisa sprawlingkitchenthatboastsa generouslysizedisland bench,amplestorage,and alargemealsarea.Offeringplentyofspacewitha hugemaster bedroomfeaturingtriplerobes,alongsidethreeadditionallargebedroomsthatcancomfortably accommodatemultiplebedsorbedividedtocreateextraroomsasneeded.A separatelivingarea nearthebedroomsprovidesanidealretreat,perfectforteenagersorextendedfamilystays.Seton atranquilhalfacreallotmentwithestablishedgardens,thereisamplespaceforchildrentoexplore andforyoutorelaxandunwind.Whetheryou’relookingfor apermanentresidenceora holiday retreat,thishomeisa greatchoiceforthoseseekinga blendofcomfort,charm,andnaturalbeauty.

CHARMING PERIOD RESIDENCE

SET on a spacious 1,283sqm (approx.) block, this wonderful character cottage could be the perfect everyday home or prized weekend getaway. Situated within walking distance of Belgrave’s bustling shopping, dining, and entertainment precinct, this home will slip into any lifestyle with ease.

The vintage charm of this residence begins at the covered verandah and French door entry. Step into the lounge with high ceilings, natural timber floors, and leadlight doors out to the wrap-around deck that captures treetop outlooks. The dine-in kitchen

boasts mid-century cabinetry paired with a modern freestanding gas range. With 2 lovely bedrooms on this level and a classic bathroom with pedestal sink, claw foot tub, and walkin rain shower, there are an endless array of design features here to admire.

On the lower level, the second living area is accompanied by a guest WC and large 3rd bedroom with study nook and separate entry. WITH further features including gas ducted heating, tool shed, and a blank canvas garden, this delightful property will make a lasting impression. Join us for a tour today.

HOME FOCUS

PRIVATE AND IMMACULATE FAMILY HOME

THIS immaculate and much loved, 5-bedroom property is situated on 4574 sqm of beautifully manicured gardens and offers the perfect blend of tranquillity, luxury, comfort and lifestyle.

The moment you enter this home you will feel the ambience created by polished timber flooring, the toasty wood fire, large windows letting in an abundance of sunlight and views of the stunning, seasonal garden, which offers colour and privacy year-round. Add to this zoned living, the walk to town location, abundant shedding and the fabulous, entertainer’s kitchen, perfect for cooking up a feast – all you have to do is move in and enjoy! Other features of this stunning property include:

5 Bedrooms

2 Bathrooms

• Entertainers kitchen, with large island bench with stone benchtops, double farmhouse sink, and storage galore

• 9ft Ceilings

• Sun drenched front verandah

Very private yard, with front gates

3 Car garage, 3.3m tall with roller doors Garden sheds

• Fully fenced back yard

• New retaining walls

• Caravan/Trailer parking

• Combined 30,000 ltr water tanks

Stunning gardens

This property has it all so don’t miss out

- CALL TO ARRANGE A PRIVATE INSPECTION

TODAY! Call Karen Peele 0419 430 950.

Please note: All property details shown are correct at time of publishing. Some properties may have been sold in the preceding 24 hours and we recommend that you confirm open for inspection times with the listing agent direct or the listing office.

ModernFamilyHome,CountryLivingon3.6acres.

Nestledona picturesque3.6acrepropertyon anothroughroadinGembrook,thisbeautiful 4bedroom,2 bathroomhomeoffers aperfectblendofcountrylivingwithmodernamenities. Steppinginsidetotheopenplankitchen/diningareawithfloatingfloors, acentralwoodheater, spaciouskitchenwithlargeislandbench/breakfastbar,withintegratedoven,electricstovetop &s/s dishwasher.ThemasterbedroomwithWIRandmodernensuite,centralbathroom,a further3 good sized,carpetedbedroomsallwithBIR& largedoubleglazedwindowstoletinlotsofnaturallight throughoutthehome.Outsideyouwillfindanadditional40ftcontainer,4 carcarport,3 watertanks fora combined55,000ltrsofwaterstorage, 3fencedpaddocks& raisedveggiepatches.

Nestleddowna quietroad,thislovelybrickhomecanbefoundonapproximately1/3ofanacre offlatland.Enteringthroughthefrontdoorintothekitchenwithgasstove,electricoven,D/W& plentyofstorage.Lookingouttotheopenplanlounge/diningarea,withslidingdoortotheprivate courtyard.Thehomealsohasductedheatingthroughout.Downthehallwayare2 bedrooms, leadingintothelaundry.Tothefrontofthehouseisthemasterbedroomwithdoublerobes &adjoins thebathroomwithseparatetoilet.Outsideleadstoa largegarage/workshopwithconcretefloor& power.Besidethegarageisa 10,000ltrwatertank &garden.Thegardenhaslotsofroomforthekids toplay &islinedwithtreestoallowprivacy.

BethanySullivan M 0438844968

CharmingGembrookHomeon 1Acre

ThisCharminghomefeatures aspaciousentrywaywithinternalaccesstothedoublegarage.A large,masterbedroomwithWIW& ensuite.Theopenplankitchen,withanabundanceofbench space,storage &walkinpantry,wallmountedoven& microwave,with alargeislandbench,granite benchtops,integrateds/sd/w.Thekitchenoverlooksthedining/loungeareawithgaslogfire,though thehomedoeshaveGDH.A further2 goodsized,bedroomswithBIR,centralbathroom,& laundry. Anundercoverentertainingarea,fencedareawithraisedveggiepatches,10,000ltrwatertank& 6x 8mgaragewithpower.

PrivateFamilyHomewithGreatViews

Perfectlylocatedon aquietstreetinEmerald,with astunningoutlook,this4BRhomehaslotstooffer. Aspaciousentrywayleadsyoutotheopenplanloungewithtimberfloors,largewindows &S/Sfor comfortallyearround, &toastywoodfire. Asecondcarpetedlounge/rumpus/studyrunsthewidthofthehome.Theopenplankitchen/ diningarea,withlotsofbenchspace,abundanceofstorage,integratedoven,gasstovetop,D/W &s/ssinkwithviews& accesstothesecludedbackgarden.Downthehallyouwillfind 3goodsize bedroomsallwithtimberflooring& BIR. Acentralbathroom,laundry &separatetoilet.Attheend ofthehallwayisthemasterBedroomfeaturingtimberflooring,WIW &en-suite.Sealeddualaccess driveway,shed/workshop,carport.

PUZZLES

To solve a Sudoku puzzle, every number from 1 to 9 must appear in: each of the nine vertical columns, each of the nine horizontal rows and each of the nine 3 x 3 boxes. Remember, no number can occur more than once in any row, column or box.

ACROSS

1 UK broadcaster (1,1,1)

3 Surplus (11)

9 Products of a calculator (7)

10 Seraphic (7)

11 Hormonal disease (8)

12 Brand (6)

14 Belonging to him (3)

15 Unkempt (11)

17 Travel review site (4,7)

19 A metal (3)

20 People of the Czech Republic (6)

21 Unblemished (8)

24 Treachery (7)

25 Japanese paper art form (7)

26 Heavy construction vehicles (11)

27 Vapour (3)

DOWN

1 (Of the eyes) inflamed to redness (9)

2 Pirate’s sword (7)

3 Food dressing (5)

4 Desiring ownership (10)

5 US politician, Paul – (4)

6 Astronomical unit of distance (5-4)

7 Forbidden by law (7)

8 Type of agave (5)

13 Daughter of Zeus (10)

15 1974 Charles Bronson film (5,4)

16 Ancestral lines (9)

18 Wrong (2,5)

19 Indonesian sea cucumber dish (7)

20 Thicket (5)

22 Counterparts (5)

23 Keyboard error (4)

SPORT

Kilsyth Football turns 100

It was a packed house when past and present supporters of the Kilsyth Football Club came together last week to celebrate the club’s centenary. The function was held at the Dorset Gardens Hotel, which was built in 1967 by former Kilsyth player Wally Elms, and marked 100 years since Kilsyth FC branched out on its own in 1925 at the old

chester Road ground.

In welcoming guests, event organiser, Mike O’Meara, observed that while Kilsyth was not the oldest club in the outer east, it was amazing to think that an organisation that emerged from what was a little hamlet had not only survived but thrived to become such a strong community presence a century later.

Mr O’Meara said he was thrilled to see every era from the 1950s to the present represented on the night, embracing all segments of the club –men’s and women’s teams, juniors, netball, veterans, officials, life members, members and supporters.

1958 coach and highly decorated player, Lloyd Holyoak, and members of the legendary Baldwin and Collier families were among the many distinguished club identities attending. Other guests included Casey MP Aaron Violi, Croydon MP David Hodgett, Cr Len Cox, and former State Member for Kilsyth Dympna Beard.

The evening featured a video snapshot of the club’s history down through the decades, illustrating the theme that each generation in turn has stewardship responsibility to hand on the club in better condition than when they found it.

Among an impressive display of club memorabilia, the highlight was a brass bell donated by the family of a former coach, Jack Fisher. The bell had been used as a match siren prior to the introduction of a more modern device in the 1950s. It is believed to have been used to begin the club’s first home game played against Glen Waverley on Saturday 30 May 1925.

The function was not entirely about the past. The audience heard from coach Simon Caldwell on Kilsyth’s approach to developing a pathway for junior players to move into the men’s and women’s senior ranks. He pointed out that the Cougars have junior and senior teams playing in finals this year.

and off the field for many years. He emphasised the club’s commitment to providing a place where local children can learn to become part of their community through sport.

President Quentin Van Veen thanked those who have contributed to the life of the club on

“We know that this is the recipe for the long term success of our club, and will see the Kilsyth Cougars remain part of this wonderful commu-

nity for another 100 years,” he said. Mr O’Meara, a past Kilsyth FC president, is writing a history of the club. Anyone with past club records, photos, memorabilia, and most of all stories, is invited to get in touch with him through the club.

Memorabilia lined the walls, showing the history of the club.
It was a crowded room as past and current members and players celebrated 100 years of Kilsyth Football Club. (Field of View Photography)

SPORT

Excitingly close matches

Round 12 results for Lilydale Tennis Club in the Eastern Region Tennis Competition.

Junior Open Singles Doubles 1 Lilydale v Burnt Bridge

After round 11 Lilydale was sitting outside the top four without a win yet for the season.

Lilydale was represented by Joshua Jamieson, Ryan Taylor and Ari Marappan.

Lilydale played at home this week against Burnt Bridge. The two teams were well matched, and some great games and rallies were played all day. In the end Burnt Bridge were too strong and won the day 4 sets to 2 – winning 34 games to Lilydale 21.

• Result: 7-6 (7-3), 4-6, 0-6, 4-6, 6-4, 0-6 Junior Open Singles Doubles 8 Lilydale v Mt Evelyn

After round 11 Lilydale was sitting just outside the top four on the ladder.

Lilydale was represented by Ivy Pieper, Olivia Mason and Haady Aziz.

Lilydale played away this week against top four team Mt Evelyn. Lilydale had a great match, and it was tied 3 sets each. Mt Evelyn took the match points - winning 27 games to Lilydale 25.

• Result: 6-3, 3-6, 6-2, 2-6, 6-2, 4-6 Open Rubbers 11 v Yarra Glen

After round 11 Lilydale was sitting outside the top four on the ladder.

Lilydale was represented by Noah Burow and David Halkidis.

Lilydale played at home this week against Yarra Glen. In a very exciting match, it was Lilydale who came away with the win 3 sets to 2– winning 26 games to 22

• Result: 6-7, 6-4, 6-2, 2-6, 6-3, 1-0 (super tiebreak)

Open Rubbers 20 v Nunawading Blue After round 11 Lilydale was sitting outside the top four on the ladder.

Lilydale was represented by Rishabh Chowdhury and Levi Daly.

Lilydale played away this week against top placed Nunawading. It was a tough day out for Lilydale. Lilydale were competitive but Nun-

Barkers go down to leaders

Barkers (eighth) hosted league leaders Argonauts, paying their first visit to the Kennel, which was bathed in late winter sunshine. Barkers made three changes to the side which lost 0-5 at Chisholm, with Max Burrows, Ross Clark and Harry Rushton replaced by Geordie Scott, Liam Seaye and Ryan Smith. For the visitors, Scott Jamieson became the first ex-Socceroo to grace the hallowed turf of Esther Park since Danny Allsopp for Croydon in 2013.

Jerome Valadon provided some early trickery on the left to win Barkers a free-kick on the byline, but it was wasted. A minute later, Argonauts’ Zach Lemke found league top scorer Mitch Cooper on the right. He crossed and the shot was deflected for a corner on the left. The corner found Tyson Holmes, who squeezed a shot in off the near post to give Argonauts an early lead.

Barkers settled though, and on 12 minutes Valadon got a touch in the box, it struck a Bayside player, and despite Barkers’ penalty appeals, play was waved on.

Bayside almost doubled the lead on 23 minutes when a corner from the left was flicked on by a defender’s head towards his own goal and hit the near post. Up the other end, Barkers won a free kick on the right. Seaye put the ball in for Scott, but his header went wide under pressure.

Bayside then took control for a while. On 27 minutes a free kick was floated from the left but eluded a crowded goal area. Then a long clearance

left Jesse Devers clear, but Mark Naumowicz raced out of his box to clear. The ball went upfield to Valadon, who found himself with only keeper Carl Darling to beat, but he did well to block. Half-time: Barkers 0-1 Argonauts, a deserved lead.

Barkers began the second half well with Daniel Aye going on a solo run, beating four men before slipping the ball to Valadon on the overlap, but he was offside. Then on 49 minutes Bayside’s Noam Kolakofsky’s first touch took him away from his marker, and he found Leigh Kissas, whose shot was blocked point-blank by Naumowicz.

Again Bayside dominated for a while, with Cooper, Jamieson, Lemke and Devers all testing the home keeper. Barkers held out and as the game wore on, began to put Bayside under pressure as they sought an equaliser.

Valadon ran clear and shot just past the far post, then Maxim Solovyev got through a ton of running to chase down the Bayside left winger and get a saving tackle in. Barkers couldn’t break through, and indeed Bayside’s Liam McKenna almost doubled the lead at the death.

Full time: Barkers 0-1 Argonauts. This was a much-improved Barkers display compared to the Chisholm game, but in the end the league leaders were too strong.

The Barkerettes were due to host Alphington, but the visitors forfeited the fixture, giving Barkers three points. They are five points clear of Collingwood, who have a game in hand, and Barkers have three games remaining.

awading proved too strong on the day taking the match 4 sets to 1 – winning 29 games to Lilydale 9.

• Result: 6-1, 4-6, 6-1, 1-0 (super tiebreak), 6-0, 6-1

Lilydale Tennis club welcomes all players of

any age and ability. For information on how to join Lilydale Tennis Club please visit play.tennis.com.au/lilydaletennisclub. For all coaching enquiries (Juniors and Adults) please contact Andrew at Pro Touch Tennis Academy ptta.com. au/contact

Little athletics team shine

25 Yarra Ranges Athletes raced at Bundoora on a beautiful sunny Saturday. Racing in the LAVic State Cross Championships after qualifying through the recent region championships. The support for each athlete as they raced to the finish line is what sets our great club apart from the rest. Cheering for everyone doing their best!

Congratulations to the club’s two multi class athletes Micah and Bradley for winning Gold in their respective races. YRA also had four athletes who finished on the podium with a top eight finish. Well done to Mitch, Zoe, Kristina and Riley.

Three teams finished well, U13 girls fifth, U11 girls sixth and U10 girls fourth. Full results are:

• 10 Girls 1.5km: Victoria James 05:31 (12th); Amelia Sketchley 05:50 (27th); Milly Hall 05:51 (28th); Etta Thomas 06:19 (56th); Indi Budin 07:02 (74th);

• 11 Girls 2km: Caitlyn McKerlie 08:07 (32nd); Alice Sabo 08:26 (41st); Isla Haisma 08:37 (46th); Tess Hewatt 08:47 (48th);

• 12 Girls 2km: Pippa Congreve 08:20 (37th); Holly Yorke 08:38 (44th)

• 13 Girls 3km: Brienna Coffey 12:07 (24th); Lily Clarke 12:23 (25th); Janna Rodriguez 13:24 (35th);

• 14 Girls 3km: Tori Kincaid 13:07 (14th);

• 15 Girls 3km: Zoe Clarke 11:20 (4th)

• 16 Girls 3km: Kristina Nackovski 14:00 (6th);

• 9-10 multiclass 1.5km: Micah Friend 09:07 (1st);

• 13-17 Multiclass 2km: Bradley McMeeken 09:36 (1st);

• 9 Boys 1.5km: Riley Yorke 05:13 (8th);

• 11 Boys 2km: Archie Budin 07:24 (43rd); Theodore Lewis 07:33 (50th);

• 12 Boys 2km: Ilikimi Tove 07:15 (37th);

• 14 Boys 3km: Mason James 11:28 (20th);

• 15 Boys 3km: Mitchell Pointon 10:19 (8th);

Big thanks to Laura Yorke, Brooke James and Jace McMeeken for doing duty’s. Thanks to all parents and athletes for a great fun day of Cross Country.

Next Saturday YRA are at Margaret Lewis Reserve, Coldstream for more club cross country fun.

The seniors head to Myrniong for the next round of the XCR season, a cross country relay. Cross country training for all club members is at Morrison Reserve on Tuesday evenings from 5.30pm and Thursdays from 5.30pm at the Victoria Road Primary School gym. Yarra Ranges Athletics welcomes and encourages all athletes of any age or ability. New members and anyone interested in trialling are always welcome Go to www.lavic.com.au or www.athsvic. org.au or email info@yarrarangesathletics. org.au for information about events and registration.

For information on training, how to join or trial, photos, results and updated news, visit the website at yarrarangesathletics.org. au or check us out on Facebook. Run, Jump, Throw…too easy!

The Barkers faced another loss at home with the league leaders too strong. (File: 343538)
Yarra Ranges Athletics under 11 girls team Alice, Tess, Isla and Caitlyn. (Supplied)
Burnt Bridge players Taylah, Ethan and Charlie, alongside Lilydale’s Ryan, Josh and Ari. (Supplied)

They are successful in local business... but what do our Tip-Stars know about Footy? Follow them every week and give them the feedback they deserve...

Turn static files into dynamic content formats.

Create a flipbook