Page 1

CH_LX35_Cover_Spot.indd 1

1/12/16 12:19 PM


We A r e Lu xu ry

For more than 80 years, Coldwell Banker Previews International® has built a leading reputation for marketing the world’s most extraordinary homes. With almost 87,000 agents in 43 countries and territories, the sun never sets on our world — or your home. Discover the exceptional service and proven results that come from listing with a seasoned Previews® Property Specialist.

COLDWELLBANKERPREVIEWS.COM


Š2015 Coldwell Banker Residential Real Estate LLC. All Rights Reserved. Coldwell Banker Residential Brokerage fully supports the principles of the Fair Housing Act and the Equal Opportunity Act. Operated by a subsidiary of NRT LLC. Coldwell Banker, the Coldwell Banker Logo, Coldwell Banker Previews International and the Coldwell Banker Previews International logo are registered and unregistered service marks owned by Coldwell Banker Real Estate LLC. Real estate agents affiliated with Coldwell Banker Residential Brokerage are independent contractor sales associates and are not employees of Coldwell Banker Residential Brokerage.


Walk in with

Walk out with

Try out Sub-Zero and Wolf

products in full-scale kitchens. Talk details with resident experts. And get a taste of all that

your new kitchen can be.

subzero.com /chicago • 312-428-3160 222 Merchandise Mart Plaza, Suite 134 Chicago, IL 60654 Hours: Monday-Friday 9 a.m. to 5 p.m. Saturday 10 a.m. to 3 p.m. subzero.com /greaterchicago • 630-872-5100 196 Exchange Boulevard Glendale Heights, IL 60139 Hours: Monday-Friday 8 a.m. to 5 p.m. .


Photo: Michel Gibert. Special Thanks: TASCHEN, Camille Stoos. 1Conditions apply, contact store for details. 2Program available on select items, subject to availability.


Mah Jong. Modular sofa system upholstered in Rockford. Rug, design for Roche Bobois. Mah Jong. Cocktail tables, design Roche Bobois Studio. Doc. Pedestal table, design Fred Rieffel.

, design Hans Hopfer.

Manufactured in Europe.

路 Complimentary 3D Interior Design Service 1 路 Quick Ship program available 2


L E F T TO R I G H T: S H I F T G R I P, F L U T E BY T H E R O G E R T H O M A S C O L L E C T I O N C A B I N E T P U L L S A N D D O O R H A R DWA R E

roc kym ount a i n h a rd wa re.co m

HANDCAST BRONZE |


New York

Paris

London

Brunschwig & Fils Š 2016 brunschwig.com


T H E O R I G I N A L D E C O R AT I V E H I D E R U G


CUSTOM KYLE BUNTING RUG FOR MAISON DE LUXE INTERIOR DESIGN: BETH WEBB INTERIORS PHOTO: BETHANY NAUERT


STONINGTON, CT | $9,850,000 Lila Delman Real Estate International Melanie Delman — 401.284.4820 WEB ID: IWJZ8

luxuryportfolio.com CAPE COD, MA | $7,900,000 Robert Paul Properties Robert Kinlin — 508.648.2739 WEB ID: MDHZ8

WINCHESTER, MA | $2,500,000 Robert Paul Properties Bri Grady — 617.312.0764 WEB ID: YZQU8


PALO ALTO, CA | $21,000,000 Alain Pinel Realtors Derk Brill — 650.814.0478 WEB ID: SHCW8

EXCEPTIONAL HOMES. POWERFUL NETWORK.

VANCOUVER, WA | $2,600,000 Windermere Real Estate Donna Major — 360.903.9765 WEB ID: LZCC8

Finding your home is a personal process of discovery, and the accomplished global network of Luxury Portfolio brokers are ready to assist in the journey. Explore over 25,000 of the world’s finest properties marketed on luxuryportfolio.com each year. Enter the ST PETERSBURG, FL | $2,900,000

property Web ID for more detail.

Smith & Associates Real Estate Ali Bearnarth — 727.560.4377 WEB ID: DUOW8

HAMILTONTWP/CINCINNATI, OH | $999,000 Sibcy Cline Realtors Betsy Poling — 513.254.3301

© 2016 Luxury Portfolio International.® Offering is subject to errors, omissions, change of price, or withdrawal without notice. Equal Housing Opportunity.

WEB ID: UEMW8

CAPE COD, MA | $4,950,000 Robert Paul Properties Robert Kinlin — 508.648.2739 WEB ID: JRXZ8

CHARLESTON, SC | $1,895,000 Carriage Properties Lynn Hanlin — 843.729.3649 WEB ID: UBNW8


NANCY CORZINE FURNITURE • TEXTILES • LIGHTING • ACCESSORIES • INTERIORS


LOS ANGELES CHICAGO NEW YORK ATLANTA DALLAS DANIA DARIEN DENVER JAKARTA LAGUNA RUSSIA SAN FRANCISCO SCOTTSDALE SEATTLE

NANCYCORZINE.COM


luxury per formance fabrics and rugs I perennialsfabrics.com I perennialsrugs.com


 

       .   


RUGO RAFF Ltd. Architects

20 WEST HUBBARD STREET

|

FLOOR #5

|

CHICAGO, ILLINOIS 60654

PH. 312-464-0222

|

FA. 312-464-0225

WWW.RUGORAFF.COM


frankponterio.com LA K E FOR EST 847.234.5704 C H I CA G O 312.464.1133


CUSTOM HOMES DESIGNED AND BUILT bgdchomes.com | 312.255.8300


Interior Design Custom Home Designs Renovations

Where uptown sophistication

Meets Downtown Edge 40 East Hinsdale Avenue Suite 204 Hinsdale, Illinois 60521 630.537.1578 1242 North Wells Chicago, Ilinois 60610 312.291.8431 Info@DMondiInteriorDesign.com

Donna Hall ASID, NCIDQ “Top 15 Interior Designers in Chicago”


“I have a simple taste, only the best.” – OSCAR WILDE

Luxury never goes out of style, and no real estate company knows this better than @properties. As the #1 luxury brokerage firm in the Chicago marketplace, and an exclusive Luxury Portfolio affiliate, we connect you with affluent homebuyers all over the world. Choose @properties when only the highest standards will do.

Source: MRED $1 million+ sales, Chicago, 2015.


german luxur y since 1908

Eggersmann USA | 150 E 58th St, 10th Fl | New York, NY 10155 | 800.276.1239

www.eggersmannusa.com new york | dania beach | houston | chicago | dallas | scottsdale | toronto | pittsburgh | costa mesa | santa monica | sand city | maui


Transcendence Wool & Silk Rug Collection - Paramount

Très Jolie Rug Collection - Collette

Pinnacle Wool & Silk Rug Collection - Everest

Amour Reserve Rug Collection - Temptation


Amour Reserve Wool & Silk Rug Collection - Love Affair

888.726.2393 | www.samad.com


D E S I G N PO R T R A I T.

Michel, seat system designed by Antonio Citterio. www.bebitalia.com B&B Italia Stores New York: 150 E. 58th Street 10155 - Soho: 138 Greene Street 10012 - Coming soon: 135 Madison Avenue 10016 Other B&B Italia Stores: Austin - Dallas - Houston - Los Angeles - Miami - San Francisco - Seattle - Sun Valley - Washington DC - Mexico City - Belo Horizonte Please call 1 800 872 1697 - info.usa@bebitalia.com Time_Less Program: select B&B Italia pieces now in stock: www.bbitaliatimeless.com


Š2016 Wood-Mode, Inc. 9/&

Entertain with stately charm. BY WOOD-MODE

Now available in the U.S. and Canada. For exclusive video of this lifestyle collection, visit wood-mode.com/embassyrow.


PROMOTION

ZEPHYR VENTILATION The Lux Island range hood features an integrated design that discreetly mounts into the ceiling. Ideal for homeowners that want an unobtrusive view of the kitchen, Lux Island is equipped with perimeter aspiration and features tri-level LED lights. Priced at $2,099. zephyronline.com

STICKLEY Stickley’s 2016 collector’s edition piece can serve as a hall console, sofa table or home entertainment unit. Available in white oak or solid cherry, a distinctive Harvey Ellis inlay adorns each of the door fronts. Priced at $1,699. stickley.com/2016

NAT29_MustHaves_0126_sr.indd 3

MUST

HAVES ADD COMFORT AND VERSATILITY TO YOUR HOME WITH THIS COLLECTION OF MUST-HAVES.

MILGARD WINDOWS & DOORS Designed to perfectly complement the rich, warm wood interior of Essence wood windows, the new Essence series patio door is built with natural wood and a durable fiberglass exterior. milgard.com

SCANDIA HOME Discover the Scandia Down difference in Salzburg, Scandia’s newest destination for luxurious sleep. Sumptuous Polish goose down, the finest European sateen and superior American craftsmanship make Scandia Home’s Salzburg an ideal choice for any master bed. scandiahome.com

1/26/16 11:36 AM


Timeless Design for the Modern Age


PROMOTION

CAMBRIA

J. TRIBBLE

Transform your kitchen or bath into a seaside retreat with breathtaking beauty inspired by nature. Find 126 stunning natural stone designs, including the new Roxwell™, on the Cambria website.

A premier builder of custom-designed sink bases, J. Tribble’s handcrafted cabinets are an invaluable asset for distinctive homes nationwide.

cambriausa.com

TEAK WAREHOUSE For over 25 years Teak Warehouse has been selling high-end outdoor furniture at wholesale prices to the public and trade. Everything is available for national delivery and comes fully assembled. Featured here is the outdoor teak bar table and chairs. teakwarehouse.com

NAT29_MustHaves_0126_sr.indd 2

MUST

HAVES

FROM SLEEK SURFACES TO BEAUTIFULLY FINISHED FURNISHINGS, THESE ITEMS WILL REFINE AND INSPIRE.

jtribble.com

POWELL & BONNELL The Thicket console, with its handforged steel base, borrows its aesthetic from the namesake coffee table, with its twig-like quality and elegant marble top. The hand-forged elements, coupled with a variety of metal finishes and top options, make the Thicket console truly one of a kind. Price upon request. powellandbonnell.com

1/26/16 11:36 AM


F U R N I T U R E . L I G H T I N G . T E X T I L E S . R U G S . O B J E T S D ’A R T 8 0 0 . 5 7 0 .10 8 7 . E B A N I S TA . C O M

e b a n i s t a


PROMOTION

OFFICINE GULLO Officine Gullo presents a bespoke cooking suite handmade entirely of stainless steel and chromed brass, with matching breakfast island paired with contemporary wood cabinets. Timeless, beyond style. officinegullo.com

MUST

HAVES

ACHIEVE YOUR AESTHETIC AND MAINTAIN FUNCTION WITH THESE MUST-HAVES.

LEXINGTON HOME BRANDS Offering a fresh view of midcentury modern design, the Hudson end table from Lexington’s Take Five collection features a radial-matched rosewood top and polished acrylic architectural base. lexington.com

NAT29_MustHaves_0126_sr.indd 1

DACOR

SAMAD

Featuring the 30" Discovery fully integrated refrigerator with advanced LED lighting, deeper interior depth, all-metal interior, customizable fresh/frozen zone and FlushFit™ hinge for a seamless designer look. Available in timeless stainless or custom paneling.

Samad presents Bambera Indigo from the Seville rug collection. Composed of Mediterranean blues and deep taupes and embellished with vibrant fuchsias and turquoises, this colorful collection evokes the lively spirit of Seville, Spain.

dacor.com

888.726.2393

1/26/16 11:36 AM


BLACK STEEL COLLECTION

Italian Design meets Swiss Engineering in Solid Stainless Steel.

Hydrology 435 N. LaSalle Street Chicago, IL 60654 312.832.9000 www.hydrologychicago.com www.mgstaps.com


CONTENTS

Left: A roundup of the latest in tabletop. Page 122 Right: Copper Dome Pendant on Pulley Cord / Price upon request / bevolo.com. Page 150 Below left: Wayland Fanback Barstools / Price upon request / oandgstudio.com. Page 108

76 84 98 298

EDITOR’S LETTER MEMO CONTRIBUTORS INSPIRATION FOUND Motion drives our creative force this spring as we survey movement in the form of art, décor and beyond.

RADAR

108

MADE IN AMERICA The renaissance of American furniture design and the rebirth of the craftsman.

114

BEHIND THE BRAND Taking inspiration from his wide-ranging travels, designer Jiun Ho’s namesake furniture line marks an anniversary.

116

DEBUT Stitched in the fabric of Americana, the famed Biltmore estate serves as muse for a breathtaking new collection by Wildwood Lamps & Accents.

118

5 MINUTES WITH Multidisciplinary creative Susan Hable takes us behind the scenes of her latest partnership.

120

COLLABORATION Prolific rock star Lenny Kravitz teams up with Rocky Mountain Hardware to create a series of products destined to be a hit.

122

ROUNDUP Calming neutrals set a quiet but impactful tone in the latest tabletop offerings that celebrate the art of the handmade.

124

SCENE Our cheat sheet to all things new and fabulous in the local design community.

044 / LUXESOURCE.COM

CH_LX35_TOC.indd 44

1/21/16 5:07 PM


BRIGHT

D O D D

L O U N G E

NEW YORK

|

CHICAGO

b y |

D O U G L A S DALLAS

|

L E V I N E BOSTON

|

|

H A N D C R A F T E D 888.524.5997

|

I N

A M E R I C A

BRIGHTCHAIR.COM


CONTENTS

Right: An intriguing custom kitchen by Los Angeles designer Kishani Perera. Page 198 Center: Hahn Lounge Chair / Price upon request / brightchair.com. Page 150 Below: A selection of spring’s most fashionable textiles. Page 140

MARKET

140

MATERIAL Off-the-rack takes on a whole new posh meaning with spring’s latest fabric debuts that are worthy of shelf space in any high-end boutique.

150

TREND Explore a day in the life of four leading interior designers whose distinct styles provided the catalyst for an engaging array of home accents.

158

SPOTLIGHT We invite you to please be seated as seven industry pros discuss the art of combining beauty and function in chairs.

THE LOOK

186

KITCHEN + BATH Bold prints and statementmaking color make a big impact and cook up excitement in two of the home’s mostfrequented spaces.

198

THE REPORT This special section takes a look at new technologies that are shaking things up and enhancing efficiency in the kitchen and beyond.

048 / LUXESOURCE.COM

CH_LX35_TOC.indd 48

1/21/16 2:49 PM


R I V A

C O F F E E

T A B L E

Christian Liaigre at DAVID SUTHERLAND The Merchandise Mart 222 Merchandise Mart Plaza, Suite 1400 Chicago, IL 60654 T. 312 205 7700 www.davidsutherlandshowroom.com www.christian-liaigre.us


RAFA NADAL

NEW DEKTON XGLOSS ULTRASHINE SURFACES FOR INDOORS & OUTDOORS

LUMINA SOLID Collection

COSENTINO CENTER CHICAGO 1060 W DIVISION STREET ˆ BLDG B CHICAGO, IL 60642 PH: 312.649.4045

WWW.DEKTON.COM

DEKTON XGLOSS is the new family of polished Dekton surfaces that presents an extraordinary crystalline shine. A unique new finish, this polish offers a radiant sparkle unlike any other, while maintaining the well-known physical resilience of Dekton. THE BRIGHTEST DEKTON PROPOSAL.


  TEAK, CRAFTS & INNOVATION

Gloster Furniture · 1075 Fulp Industrial Road · South Boston, VA 24592 · Tel. 434 575 1003 · inquire@gloster.com · www.gloster.com


CONTENTS

234

FRENCH KISSED A self-professed Francophile conceives a sophisticated yet relaxed ambience in her Chicago home using soft pops of color and a blend of new and old elements that give the house a collected feel. Written by Laura Mauk / Photography by Meghan Beierle-O’Brien

248

THE THEORY OF RELATIVITY New to the design scene, textile maven Erin Chlaghmo references art, mathematics and the history of her craft when creating her striking wallpaper motifs. Written by Taryn Bickley / Photography by Cynthia Lynn

252

OUT OF THE BOX Using ingenuity and imagination, a designer devises her own Michigan retreat with a healthy mix of traditional and industrial elements—including shipping containers for the façade. Written by Lisa Skolnik / Photography by Michael Robinson

268

RIGHT ANGLE Traditional craftsmanship and high-tech systems are at the forefront of designer Casey Lurie’s intricate linear furnishings. Written by Tate Gunnerson / Photography by Kendall Karmanian

272

WOW FACTOR An elegant yet edgy vibe can be found around every corner of a Chicago condo that features custom furnishings and colors that connect the home to its scenic setting. Written by Jennifer Sergent / Photography by Jacob Hand

ON THE COVER: For her own family’s Chicago home, designer Wendy Labrum wanted the living room to feel like a Parisian pre-war apartment. A mix of pieces come together to achieve this look, including a Reagan Hayes sofa, a vintage striped armchair covered in Rose Cumming fabric, stools swathed in a Kravet textile and a pair of antique Maison Baguès floor lamps. Page 234 052 / LUXESOURCE.COM

CH_LX35_TOC.indd 52

1/21/16 2:50 PM


Jiun Ho

M a r a s

S w i v e l

L o u n g e

C h a i r

T h e

Prima Alpaca by Sandra Jordan

J i u n

H o

C o l l e c t i o n

V


35 EXCLUSIVE GOLD COAST RESIDENCES

EARLY 2016 DELIVERY from $2.2 million 312.542.1144 • 4EastElm.com


DESIGN CREATE BUILD INSPIRE

Please visit our website at www.mavrekdevelopment.com for additional information on our firm.


lexington.com


ORGANIC LO OMS N A T U R A L

H A N D

C R A F T E D

R U G S

Sustainable Rugs for LIFE Health, tradition and beauty are paramount to Organic Looms’ hand crafted rug collections. Made from the finest materials in their most natural state, each step of the process is connected to the artisan’s hand integrating sustainable fabrication techniques positively effecting our environment. Organic Looms is dedicated to complete customization tailoring every product to meet each client’s unique vision.

Mart Parc Building 401 North Wells Street Chicago, IL 60654 www.organiclooms.com 312.832.0900


MILGARD NEW Essence Series® Wood Sliding Door Try our new CEU – Maximizing Design Potential of Patio Doors

milgard.com/DoorCEU ©2015 Milgard Manufacturing, Inc.


Featured at Walter E. Smithe smithe.com


Residential Construction

info@jjordanhomesllc.com 630-455-0855


Residential Project in Hollywood (USA) designed by Vince Aghdasy and Hoda Tabassi Bath vanity: ESTATUARIO Silk - Flooring: CALACATTA Polished

Extraordinary Surface Interior and exterior applications: Flooring, Cladding, Countertops, Furniture.

distributed by

Resistant to stains, scratches, chemicals, extreme temperatures and UV exposure. Maximum format, minimum thickness, different finishes. More than 50 selections available. Design, Durability, Versatility, Sustainability.

Headquarters

Indiana

Wisconsin

www.stone-design.com

598 Mitchell Road: Glendale Heights, IL 60139

2185 N. Sherman Drive Indianapolis, IN 46218

2025 East Birchwood Cudahy, WI 53110

info@stone-design.com

+1 630 858 9658 / P: +1 800 424 1332

+1 317 546 2300 / P +1 800 450 9855

+1 414 744 8515 / P +1 800 669 4963


Better Living, by Design.

Visit: www.mieleusa.com/events for a Miele Experience Center closest to you!

The New and Improved Miele Experience Center Look, marvel, and explore. Be inspired by your local Miele Experience Center. Whether you are looking to upgrade your kitchen, learn about Miele’s latest innovations, attend a cooking or product demonstration, or shop our full line of appliances and accessories, the Miele Team will be there every step of the way. Discover more about our events and offerings: www.mieleusa.com/Events We look forward to your visit!


ONLINE

LUXESOURCE.COM CHECK US OUT ONLINE TO DISCOVER MORE ABOUT THE HOMES, TRENDS AND PRODUCTS FEATURED IN LUXE INTERIORS + DESIGN.

BRIGHT IDEA With its ethereal yet contemporary design, this Glendale pendant by Hudson Valley Lighting is sure to add elegance and intrigue to any space. Visit our online image gallery to view this piece and others like it. luxesource.com/market

French countryside join steel-framed glass doors and clean-lined furnishings to provide a stylish mix of traditional and modern in this idyllic abode outside of San Francisco. Want to see more? Find additional images at luxesource.com/los-altos.

UNDERSTATED ELEGANCE Comfort and style go hand in hand with Calligaris’ curvaceous Lazy chair. Unearth more statement-making products by scrolling through our comprehensive list of all things luxury at luxesource.com/market.

33 AWE-INSPIRING GARDENS FOR SPRING Spring has sprung! From lush, climbing bougainvillea and vine-covered trellises to crystal-clear ponds and greenery galore, the lavish features in these gardens are as functional as they are dreamlike. luxesource.com/inspiring-gardens

COM_LX6_LuxeSource_066.indd 66

ALSO FIND US ON instagram.com/luxemagazine

twitter.com/luxemag

pinterest.com/luxemagazine

facebook.com/luxemagazine

PENDANT PHOTO: COURTESY HUDSON VALLEY LIGHTING. LIVING ROOM PHOTO: PAUL DYER. CHAIR PHOTO: COURTESY CALLIGARIS. EXTERIOR PHOTO: MARK ROSKAMS.

A TRANSITIONAL LOS ALTOS HILLS HOME WITH FRENCH PROVINCIAL ROOTS Stone walls and beamed ceilings reminiscent of the

1/20/16 6:10 PM


DREAM IN STI C K L EY

Oak Knoll Bedroom

Family owned and ďŹ nely handcrafted in the USA for over 100 years. For the dealer nearest you or a catalog, visit stickley.com | L. & J.G. Stickley, Inc. | Manlius, NY 13104 | 315.682.5500


PAMELA LERNER JACCARINO EDITOR IN CHIEF

EXECUTIVE EDITOR ART DIRECTOR CONTRIBUTING ART DIRECTOR MANAGING EDITOR STYLE EDITOR SENIOR EDITOR PHOTOGRAPHY DIRECTOR FEATURES EDITORS

ASSISTANT MANAGING EDITOR SENIOR ASSOCIATE EDITOR ASSOCIATE MARKET EDITOR ASSOCIATE SITE EDITOR CONTRIBUTING EDITOR GRAPHIC DESIGNER PRODUCTION DESIGNER PHOTO RETOUCHERS

ARLYN HERNANDEZ MARTIN ELFERS CANDACE COHEN KELLIE GREEN CARA GIBBS BRIELLE M. FERREIRA OLIVIA LAMBERT JESSE BRATTER LISA BINGHAM DEWART BRITTANY KAPLAN CAREN KURLANDER SHANNON SHARPE SARAH RAMIREZ LACY MORRIS KATE BERGERON GENNIFER DELMAN MINDY PANTIEL ELLEN SCOTT MELISSA KELLY CHRISTIAN ABLAN MICHAEL WARNOCK

ADAM I. SANDOW CHAIRMAN AND CEO

ERICA HOLBORN PRESIDENT

PETER FAIN

PAUL SUH

CHIEF OPERATING OFFICER

CHIEF FINANCIAL OFFICER

CHIEF CREATIVE OFFICER CHIEF DESIGN OFFICER EXECUTIVE VICE PRESIDENT, INFORMATION TECHNOLOGY PRESIDENT, MEDIAJET

YOLANDA YOH BUCHER CINDY ALLEN JUAN LOPEZ MICHAEL J. RUSKIN

VICE PRESIDENT, DIGITAL DIRECTOR OF MANUFACTURING & DISTRIBUTION CONTROLLER DIRECTOR OF FINANCE FINANCIAL ADVISOR

PAMELA MCNALLY FERN E. MESHULAM BARBARA MABIE ANDREA EFLAND CHRISTOPHER FABIAN

DIRECTOR OF HUMAN RESOURCES DIRECTOR OF TALENT ACQUISITION DIRECTOR OF STRATEGIC PROGRAMS DIRECTOR OF CREATIVE OPERATIONS DIRECTOR OF INFORMATION TECHNOLOGY DIRECTOR OF OPERATIONS, MEDIAJET SENIOR PR & COMMUNICATIONS MANAGER EXECUTIVE ASSISTANT TO THE CEO EXECUTIVE ASSISTANT TO THE COO & PRESIDENT

LISA SILVER FABER SHARON JAUTZ MARILENE SCHOFIELD MICHAEL SHAVALIER MINDY MARKS ALEXANDER R. CRUZ RACHEL LEXIER STEPHANIE BRADY ELSIE GILMORE

Founded in 2003 by visionary entrepreneur Adam I. Sandow, SANDOW is more than just a media company, building brands and businesses that offer interactive experiences across print, digital, retail, licensing, consulting and events. It creates high-quality products and services that are custom-tailored to consumer and professional audiences in the luxury, design and beauty categories. With offices around the world, SANDOW’s portfolio includes Culture + Commerce, Fred Segal, Interior Design, Luxe Interiors + Design, Material ConneXion, NewBeauty and Worth. The company’s global headquarters are in New York City’s iconic Time & Life Building, with corporate headquarters in South Florida. sandow.com

GLOBAL HQ

CORPORATE HQ

1271 AVENUE OF THE AMERICAS, 17TH FLOOR, NEW YORK, NY 10020 917.934.2800

3651 NORTHWEST 8TH AVENUE, BOCA RATON, FL 33431 561.961.7600

ADVERTISING 561.445.3335

COM_LX6_Masthead_068-072.indd 68

REPRINTS 561.961.7618

SUBSCRIPTIONS 800.723.6052

sandow.com

luxesource.com

1/20/16 6:02 PM


Turn-of-the-century style gets a contemporary, masculine edge. The Rook™ Bath Collection by Brizo® blurs the lines between past and present—creating an arresting, modern interpretation of a stately aesthetic. Available exclusively in showrooms. brizo.com


TUFENKIAN SHOWROOMS

NEW YORK DALLAS

TUFENKIANCARPETS.COM

LOS ANGELES

CHICAGO

LONDON

PORTLAND

SAN FRANCISCO

DENVER

TUFENKIAN DEALERS

CA MENLO PARK: THE ORIENTAL CARPET CA SAN DIEGO: OUTRAGEOUS RUGS CA PALM SPRINGS: PRESTIGE RUGS CA SAN FRANCISCO: FLOORDESIGN CO DENVER: FLOOR COVERINGS BY CPA

FL WINTER PARK: CARPET SOURCE OF WINTER PARK GA ATLANTA: DESIGNER CARPETS KS KANSAS CITY: KDR DESIGNER SHOWROOMS MA NATICK/BOSTON: DOVER RUG AND HOME MA NEWBURYPORT: CEBULA DESIGN INC.

MO ST LOUIS: KDR DESIGNER SHOWROOMS OH COLUMBUS: K.A. MENENDIAN RUG GALLERY TX HOUSTON: POSTMODERN TRADITIONS UT SALT LAKE CITY: REGENCY ROYALE WA SEATTLE DESIGN CENTER/BELLEVUE ANDONIAN RUGS

FOR COMPLETE DEALER LISTING: 888.908.3773 OR VISIT TUFENKIANCARPETS.COM

AVENTINE BLUE SHOWN. ©2015 TUFENKIAN IMPORT EXPORT VENTURES, INC.


ALAN BLAUSTEIN PRESIDENT

JANICE BROWNE SENIOR VICE PRESIDENT, GROUP PUBLISHER

866.788.3461

DALLAS/FORT WORTH

PUBLISHER Sarah Walsh Wange, 972.865.8556 DIRECTORS Justine Battiste,

NEW YORK

PUBLISHER Adrienne B. Honig, 602.283.2400 DIRECTORS Gina Fetzer, Karlee Linman,

ARIZONA Heather K. Raskin

Shanan Koschak, Rolanda Polley

PUBLISHER Sharon Summer, 212.842.2035 ASSOCIATE PUBLISHER Amy McMillan Tambini DIRECTORS Donna Herman,

AUSTIN

HOUSTON

Kara Pfeiffer, Maritza Smith ASSOCIATE PUBLISHER Katherine Reagan, 512.687.1010 DIRECTOR Emily Fry

PUBLISHER Amy McAnally, 713.343.4556 DIRECTORS Carol Lamadrid, Brooke Rives

ORANGE COUNTY/SAN DIEGO PUBLISHER Shannon Ratcliffe, 657.242.9005 DIRECTORS Jenny Hoang, Alisa Tate

LOS ANGELES

CHICAGO PUBLISHER Kathleen Mitchell, 312.589.2010 DIRECTORS Tracy Colitte, Tarra Kieckhaefer

COLORADO

REGIONAL PUBLISHER Michael Peterson, 561.869.1263 ASSOCIATE PUBLISHER Michelle A. DeBerry DIRECTORS Terri Glassman, Ashley Kujawski,

Kimberly Moore

PUBLISHER Brooke Randolph McLaren, 213.226.9770 DIRECTORS Amanda Commins,

PA C I F I C N O R T H W E S T PUBLISHER Debby Steiner, 206.582.5500 DIRECTORS Bridgette Kingsbury, Karen Magistrale

Athena MacFarland, Jennifer Whitmer

MIAMI + PALM BEACH/BROWARD

SAN FRANCISCO

REGIONAL PUBLISHER Michael Peterson, 561.869.1263 ASSOCIATE PUBLISHER John Gallo DIRECTORS Harvey Dana, Jami Farid,

PUBLISHER Lisa Lovely, 415.696.5020 DIRECTORS Sara McGovern, Kimberly Veley

Marc Freindlich, Hillary Friedman, Susan Preville

NATIONAL NETWORK DIRECTORS ASSOCIATE PUBLISHER N AT I O N A L H O M E F U R N I S H I N G S D I R E C T O R EAST COAST DIRECTOR W E S T C OAS T D I R E C T O R S CONTRIBUTING MIDWEST DIRECTOR CONTRIBUTING TEXAS AND SOUTHERN DIRECTOR CONTRIBUTING EUROPEAN DIRECTOR

Michelle Blair, 917.934.2811 Blaire Rzempoluch, 917.287.4535 Amy McMillan Tambini, 917.848.3734 Debra House, 310.560.9469; Carolyn Homestead Menning, 310.927.0810 Steven M. Fisher, 847.274.6439 Tanya Scribner, 940.387.7711 Riccardo R. Laureri, 866.788.3461

MARKETING AND CREATIVE SERVICES DIRECTOR OF CLIENT SERVICES

Tanya Suber

IN TEGRA TED MA RKETIN G DIRECTOR MA RKETIN G MA N A GER

CLIENT SERVICES MANAGER P R O F I L E AC C O U N T M A N AG E R CLIENT SERVICES COORDINATORS

SENIOR GRAPHIC DESIGNERS PRODUCTION SPECIALIST ADVERTISING COPY MANAGER ADVERTISING COPYWRITER PA G I N AT I O N M A N A G E R ADVERTISING MANAGER

Jennifer Kimmerling Susan Mallek Emily Friedlander, Melissa Leone, Trinity Reback, Brittany Watson Stan Robertson, Svetlana G. Suarez Jamie Beauparlant Devon Cahan Roush Greta Wolf Jody M. Boyle Kristy Kilian

EV EN TS MA N A GER SALES ASSISTANTS

PRINT CENTER DIRECTOR DIGITAL PRINT CENTER MANAGER MANUFACTURING DIRECTOR NEWSSTAND CONSULTANT DISTRIBUTION PRINT MANAGEMENT

James Nolan Robert Sampogna Nicole Marshall Sydney Dulberg, Lauren Krause, Briana Rotello Bart Blackwell Christopher Ferris Leonard Sandow Ron Sklon Curtis Circulation Calev Print Media

@luxemagazine

@luxemag

Luxe Interiors + Design , (ISSN 1949-2022), Arizona (ISSN 2163-9809), California (ISSN 2164-0122), Chicago (ISSN 2163-9981), Colorado (ISSN 2163-9949), Florida (ISSN 2163-9779), New York (ISSN 2163-9728), Pacific Northwest (ISSN 2167-9584), San Francisco (ISSN 23720220), Texas (ISSN 2163-9922), Vol. 14, No. 2, March/April, prints bimonthly and is published by SANDOW, 3651 NW 8th Ave., Boca Raton, FL 33431. Luxe Interiors + Design (“Luxe”) provides information on luxury homes and lifestyles. Luxe Interiors + Design , SANDOW, its affiliates, employees, contributors, writers, editors, (Publisher) accepts no responsibility for inaccuracies, errors or omissions with information and/or advertisements contained herein. The Publisher has neither investigated nor endorsed the companies and/or products that advertise within the publication or that are mentioned editorially. Publisher assumes no responsibility for the claims made by the Advertisers or the merits of their respective products or services advertised or promoted in Luxe. Publisher neither expressly nor implicitly endorses such Advertiser products, services or claims. Publisher expressly assumes no liability for any damages whatsoever that may be suffered by any purchaser or user for any products or services advertised or mentioned editorially herein and strongly recommends that any purchaser or user investigate such products, services, methods and/or claims made thereto. Opinions expressed in the magazine and/or its advertisements do not necessarily reflect the opinions of the Publisher. Neither the Publisher nor its staff, associates or affiliates are responsible for any errors, omissions or information whatsoever that have been misrepresented to Publisher. The information on products and services as advertised in Luxe are shown by Publisher on an “as is” and “as available” basis. Publisher makes no representations or warranties of any kind, expressed or implied, as to the information, services, contents, trademarks, patents, materials or products included in this magazine. All pictures reproduced in Luxe have been accepted by Publisher on the condition that such pictures are reproduced with the knowledge and prior consent of the photographer and any homeowner concerned. As such, Publisher is not responsible for any infringement of the copyright or otherwise arising out of any publication in Luxe. Luxe is a licensed trademark of SANDOW © 2011. All rights reserved. No part of this publication may be reproduced or transmitted in any form or by any means, electronic or mechanical, including photocopy, recording or any information storage and retrieval system, without the written permission of the Publisher. ADDRESS SUBSCRIPTION REQUESTS AND CORRESPONDENCE TO: Luxe, PO Box 16329, North Hollywood, CA 91615. Email: subscriptions@luxemagazine.com or telephone toll-free 800.723.6052 (continental US only, all others 818.487.2005). ®

®

ADVERTISING 561.445.3335

COM_LX6_Masthead_068-072.indd 72

REPRINTS 561.961.7618

SUBSCRIPTIONS 800.723.6052

sandow.com

®

luxesource.com

1/20/16 6:02 PM


introducing:

SPRING 2016 COLLECTION


800.789.5401

MGBWHOME.COM


EDITOR’S LETTER

This issue is largely dedicated to homegrown design and to the independent makers and companies who are dialing into the made-in-America movement. To be sure, we live in a time where there are no clear-cut guidelines in design (perhaps there never were). Thanks to globalization, social media and the flood of visuals that pass our eyes daily, the sartorial choices we make for our homes are broad and vast, as they should be. Yet there is no denying the underlying current of old-school craftsmanship permeating the landscape. Call it “Americana Chic.” Stamp it “Made in America.” Today, homeowners are embracing all things artisanal, authentic and local. They want to know where the objects being brought into their homes are made and by whom. Makers in cities across the country (who we happily uncover in every issue of Luxe) are responding with thoughtfully crafted forms and materials that appeal to the new sensibility. Ultimately, of course, 21st-century design is a mix; a multicultural mash-up of ideas, with, perhaps, a pinch of Florence, a dose of Athens and, for good measure, a smattering of Detroit.

PORTRAIT: MATTHEW MILLMAN.

DOMESTIC PURSUITS

A PEEK INTO OUR PAGES Clockwise from top left: Aramis Sconce by Barry Dixon. Editor in Chief Pamela Jaccarino palling around with Consort’s Brandon Quattrone, left, and Mat Sanders at the historic Greystone Mansion in Beverly Hills, California. Trousdale collection by Lenny Kravitz for Rocky Mountain Hardware. Picchu table by Jiun Ho. Kintla chair by Caste Design. Wallcovering by Phillip Jeffries.

Pamela Jaccarino

pam@sandow.com Instagram: @pamelajaccarino

COMM_LX6_EditorLetter.indd 76

1/21/16 3:45 PM


TILE: Lux Sultan in Silver

SHOULDN’T ALL ROOMS BE LIVING?

annsacks.com 1.800.969.5217


Shown: Floor Tile: Soul White Polished; Washbasins and Bathtub: Ras

TILE

MOSAICS

KITCHENS

BATH

HARDWOOD & LAMINATE

CHICAGO | Luxe Home at the Merchandise Mart | 222 Merchandise Mart Plaza, Suite 149 | Chicago, IL 60654

1.877.PORSA.US | info@porcelanosa-usa.com | www.porcelanosa-usa.com


Classic Style, Global Sensibility

312.664.0644 tomstringer.com


Haiku Lights Featuring onboard occupancy and light sensors, this LED fixture conserves energy by turning off when you leave and dimming when it detects daylight.

Haiku Fans As room temperature changes, Haiku Fans adjust automatically to improve comfort while reducing HVAC energy use – night or day, winter or summer.

Haiku Wall Control Packed with sensors and a learning microprocessor, the Haiku Wall Control communicates with your fans, lights and HVAC system to create a more comfortable, efficient home.

A Home That Works For You Welcome to Haiku Home®, a suite of connected products that automatically keep your home comfortable, respond to your presence and conserve energy – effortlessly. Visit haikuhome.com/luxe to bring your Haiku products home.

haikuhome.com/luxe | 855-651-2968


memo KATHLEEN MITCHELL PUBLISHER

Welcome to the March/April issue of Luxe Interiors + Design! This past winter, JB Brickworks celebrated its 25th anniversary in grand style, and Luxe was there to share in the festivities. Along with family, friends and industry partners, we toasted owners Brent and Gina Shad on their accomplishments over the past 25 years, as well as to their continued success. We also joined Debra Dobbs of @Properties for an open house at 2450 N. Lakeview Drive. Guests toured the historic cooperative building and enjoyed an interactive panel discussion on the “Ages of Decadence” while sipping on custom cocktails and luscious appetizers. Finally, Arlington Design Center and CAI Designs hosted a book signing and meet-and-greet with author and designer Sarah Richardson. Afterward, attendees helped mark Arlington Design Center’s 10-year anniversary and joined in the annual Designer Appreciation Party. Enjoy our spring issue and we hope that you become inspired!

EVENT PHOTOS: WITTEFINI PHOTOGRAPHY.

GOOD COMPANY

Celebrating with JB Brickworks for its 25th anniversary party with live music, an open bar and tasty appetizers. See more event images at facebook.com/luxemagazine.

WE CONNECT THOSE WHO LOVE DESIGN LUXESOURCE.COM

WE’RE EVERYWHERE twitter.com/luxemag pinterest.com/luxemagazine instagram.com/luxemagazine facebook.com/luxemagazine

084 / LUXESOURCE.COM

CH_LX35_PubLetter_084.indd 84

1/21/16 2:44 PM


PROMOTION

MUST

HAVES CHICAGO

THESE UNIQUE PIECES MAKE THE PERFECT CONVERSATION STARTERS.

JEFFREY BRESLOW SCULPTURE Rose Garden Rocks!, one of many abstract steel and stone sculptures recently shown at Willis Tower, kindles a conversation between human creativity and the natural world. Jeffrey’s artistic intention is to inspire smiles. Priced at $8,500. jeffreybreslow.com

TRUMEAU DESIGN & DECOR Inspired by 19th-century Japanese Meiji-period originals, these brass cranes standing on turtles symbolize longevity and good fortune. They measure at a stately 58" tall and have various levels of patina. trumeaultd.com

PLUM INTERIORS Beautiful custom bed in white high-gloss paint by Plum Interiors. pluminteriorsltd.com

CH35_MustHaves_0118_sr.indd 2

1/21/16 10:59 AM


PROMOTION

MUST

HAVES CHICAGO

FIND THE FINISHING TOUCH FOR YOUR HIGH-END INTERIOR WITH THIS COLLECTION OF MUST-HAVES.

KATONAH ARCHITECTURAL HARDWARE The Art Deco knob, or as the French call it, le bouton (QC221). Utilizing artisanal methods from the 17th century, Bronzes de France has established its craft to please sophisticated American interiors today. Coordinating styles, finishes and cabinetry available through Katonah Architectural Hardware. katonahhardware.com

LEWIS FLOOR & HOME The Noor collection by Feizy Rugs blends placid tones and clean, modern designs to create serene settings. Available at Lewis Floor & Home in Northbrook. Price upon request. lewisfloorandhome.com

LAUREL H FELDMAN PHOTOGRAPHY & INTERIORS IN BLOOM is among the many large-scale photographs by interior designer and photographer Laurel Feldman. Her works of nature are always romantic and provocatively metaphysical. Signed and numbered. Acrylic mounted, 42" x 28". Custom sizes available. Priced at $2,500. 847.266.0067

CH35_MustHaves_0118_sr.indd 1

1/21/16 10:59 AM


FINE FITTED FURNITURE

5 0 1 NORT H W E L L S S T R E E T / C H IC AG O, I L PHON E : 3 1 2 4 6 4 .9 4 6 0 / FA X : 3 1 2 4 6 4 .9 4 9 3

60654


www.obrienharris.com


Large Photo: Global Views. Small Photos (left to right): Theodore Alexander; John Richard; Theodore Alexander.

Interior Design Showroom • LuxuryWindow Treatments • Fine Furnishings • Custom Home Building • Remodeling

28West Hinsdale Avenue, Hinsdale, Illinois 630.455.2500 trumeaultd.com


Sotheby’s International Realty and the Sotheby’s International Realty logo are registered (or unregistered) service marks used with permission. Each Offce is Independently Owned and Operated.


R E C Y C L I N G It is so rewarding.

BEFORE

AFTER

Photography by Matthew Gilson @ James Yochum Photography (bottom)


BEFORE

Photography by Bruce Van Iwegen @ Van Iwegen Photography (bottom)

AFTER

400 WEST ERIE STREET

I

SUITE 503

I

CHICAGO,ILLINOIS 60654

I

312.337.4977


Luxury | Comfort | Purpose

445 North Wells, Suite 302 | Chicago, Illinois www.robynshapiro.com Follow us on Pinterest and Facebook


Naturally more relaxing We are proud to present our ionian bath, the perfect balance of style and comfort. Its naturally white, smooth form is created from our signature Volcanic Limestone™ material, ENGLISHCASTŽ. A truly stunning addition to a world class collection.

To find your nearest Victoria + Albert dealer, visit www.vandabaths.com Featured product: ionian


CONTRIBUTORS

BEHIND THE SCENES GET TO KNOW A FEW OF OUR CONTRIBUTORS FROM ACROSS THE COUNTRY AS THEY TALK ALL THINGS DESIGN. PRODUCED BY SARAH RAMIREZ

LAURA MAUK

Writer / Washington, D.C. What made you want to become a writer? Curiosity. I love finding out why individuals think the way they do. I also enjoy stringing words together in what I hope is a painterly way that gives people understanding or lets them see something differently. If I could interview anyone, it would be… Frida Kahlo, Georgia O’Keeffe, Frank Lloyd Wright or Donald Judd. They were all revolutionaries with such unique visions and strong characters. Each of them led an interesting life, making iconic art and architecture in authentic and thoughtful ways. Is there anything intriguing you currently in the world of design? I love the way design continues to connect to nature with lots of glass, sunlight and simple, organic materials. Form and texture have evolved and, as a result, I feel that buildings and furniture today are much more dynamic. Photographer / New York

If you could shoot anywhere in the U.S., where would it be? I would love to have the opportunity to experience, and also photograph, James Turrell’s Roden Crater in Arizona. His work is all about light, space and how we as viewers perceive our surroundings. Most memorable Luxe assignment: A Hamptons house with the talented Jennifer Post. Light is a critical feature for every architectural or interiors shoot and, in this case, the changing weather conditions worked perfectly throughout our day—cloudy or sunny when we needed it! What type of architecture inspires you? Truly bespoke structures that elegantly solve problems and create energetic, livable spaces. I’ve had a longtime collaboration with architect Ali Tayar, and the houses he has designed—from Rhode Island to Beirut—embody this approach with refinement and finesse. Documenting these environments is both challenging and invigorating.

COM_LX6_Contributors_098.indd 98

JOE FLETCHER

Photographer / San Francisco Biggest influences: Creatives in the worlds of art, photography and film, especially the work of Edward Burtynsky, Robert Polidori, Thomas Demand and Jeff Wall. Most exciting thing happening in design today: The amount of design that’s shared worldwide via social media. What type of architecture do you find most impactful? Quiet, minimalistic architecture—designs that let nature do the talking. If I could splurge on anything… It would be on a trip to Greece for my family so we can enjoy the turquoise sea and fried cheeses in the shade. Or a piece by Thomas Demand.

LINDA HAYES

Writer / Colorado Favorite Luxe interview: It was for a home on Vancouver Island. On an early meeting with the architect, Brian Hemingway, the owner of the house watched him take out a pen and just start drawing; he told me that observing him was such a magical part of the process. The image that conjured up has always stuck with me. My biggest design influence comes from… The process of architecture and its ability to transform the simplest idea into an elegant, functional structure. It reminds me that creativity is about both the journey and the destination. Who is the most fascinating person you’ve ever met? Charles Smith, owner of Charles Smith Wines in Walla Walla, Washington. He’s a bigger-thanlife personality, an intuitive thinker and a brilliant marketer. He led the recent design of his new Seattle winery, as well as the restoration of his midcentury house, with local architect Tom Kundig. Impressive!

MAUK HEADSHOT: COURTESY LAURA MAUK. DINING ROOM PHOTO AND FLETCHER HEADSHOT: JOE FLETCHER; INTERIOR ARCHITECTURE AND INTERIOR DESIGN, DAVID TODD OLDROYD, ODADA. HAYES HEADSHOT: NORA FELLER. MCHUGH HEADSHOT: COURTESY JOSHUA MCHUGH.

JOSHUA MCHUGH

1/20/16 2:40 PM


FURNITURE

LIGHTING

www.powellandbonnell.com

TEXTILES


Š2016 California Closet Company, Inc. All rights reserved. Each franchise independently owned and operated.

for the love of home


californiaclosets.com

8 6 6 . 8 70 . 4 8 1 4

Š2016 California Closet Company, Inc. All rights reserved. Each franchise independently owned and operated.


The Lobby Collection

lisataylordesigns.com


OWN IT.

BALDWIN IS 70 YEARS BOLD! Visit 70yearsbold.com


FLOOR: HAMMERED GERMAN SILVER MARBLE AND MOTHER OF PEARL BASINS

BOSTON

CHICAGO

CONNECTICUT

888.845.3487

NAPLES


DALE CAROL ANDERSON INTERIORS

NEW YORK

PALM BEACH

ANTIQUE BLOND BARR FLAGSTONES WALL- ANTIQUE BOURGOGNE UNDERCUT

SAVANNAH

WWW.PARISCERAMICSUSA.COM

LOS ANGELES


RADAR WITH THE DEMAND UP FOR LOCALLY CRAFTED FURNISHINGS, FITTINGS AND DÉCOR, AMERICAN ARTISANS AND CRAFTSMEN ARE ANSWERING THE CALL.

LXCOM_Radar_Made_In_America_107.indd 107

1/21/16 6:49 PM


HOME GROWN FURNITURE PRODUCTION RETURNS STATESIDE IN WHAT IS PROVING TO BE A REBIRTH OF THE AMERICAN CRAFTSMAN. WRITTEN BY MIEKE TEN HAVE / PRODUCED BY ARLYN HERNANDEZ

F

or American furniture production, the yen for substantive, enduring quality— something commonplace only decades ago—has certainly reached a fever pitch in a day where genuineness in products is all but profuse. This nostalgic zeitgeist is ushering in a new wave of makers from various disciplines and perspectives, each bound by the desire to create in unique, original ways. “Design is the key,” says Sara Ossana of Warren, Rhode Island-based O&G Studio. “We’ve tapped into the idea that good design could save the continuity of craftsmanship.” Artist and furniture craftsman Ian Stell of New York City, known

LXCOM_Radar_Made_In_America_107.indd 108

for his highly unorthodox, mesmerizingly sculptural pieces, simply calls this widespread craving for authenticity an “American design renaissance.” “There’s a competition that has been intensifying,” he says, “and it’s pushing both quality and originality.” But what is American furniture design today? According to Brooklyn-based designer Asher Israelow, it is not bound by a style but rather an ethos. “There is no aesthetic correlation,” he says, “but it is aspirational; it’s forward-thinking. It’s reinventing the wheel. American designers are not necessarily bogged down by traditional craft techniques and apprenticeships that perhaps

our European counterparts are.” Israelow was studying architecture in school when on a whim, he took up woodworking while completing his thesis. “I’m entirely self-taught with wood. It became an obsessive hobby,” he says. Instead of becoming an architect, Israelow shifted gears to furniture because he believed it would provide more creative license. It is a circuitous route to furniture production that many young designers echo. Los Angeles-based Sabin Ousey was working in sales at Lawson-Fenning when he began making furniture for his own apartment as a creative outlet, prompting him to open his own company last January. His collection pays

THIS PAGE: O&G STUDIO BARSTOOLS PHOTO: SARA OSSANA. PREVIOUS PAGE: O&G PRODUCTION PHOTO: REENIE BARROW. OPPOSITE: CASTE DESIGN WOOD CARVER PHOTO: AL OLIVER. CASTE DESIGN POUF BENCH PHOTO: MARK BRYANT. CASTE DESIGN KINTLA CHAIR PHOTO: JONATHAN ALLEN.

RADAR / MADE IN AMERICA

1/21/16 6:03 PM


homage to various viewpoints, from Paul McCobb to Spanish Colonial motifs. “America, particularly California, lacks centuries of history, so it gives us an opportunity to forge a new aesthetic,” says Ousey. “Rather than copying tradition, we are playing with historic motifs. That is how new genres and trends emerge.” New York interior designer Eddie Lee finds an egalitarian quality in today’s design scene. “Furniture makers are coming from all different backgrounds these days,” he says. “That’s a very American concept.” Stephen Antonson, the Brooklyn plaster master who references Giacometti and Gio Ponti in his sculptural line of work, thinks there is something

LXCOM_Radar_Made_In_America_107.indd 109

to this “design first” ingenuity that separates the successful American designer. “You can go to the design shows and say, ‘oh, there’s the guy that studied woodworking in school: he’s made the most amazing dovetail you’ve ever seen,’ but it’s rather uninspired design-wise,” he says. Like Israelow and Ousey, Antonson never studied plaster or furniture making in school. “I think there’s a streak of naiveté that allows good designers to do weird things, to be open to doing something backward. That’s where innovation happens. You’re not trying to make this boring, perfect thing that is like all the other boring, perfect things.” Ty Best of Chicago’s Caste Design,

Above: Handmade in Montana and Chicago, Caste Design’s avant-garde furnishings include the pure-bronzeand-leather Kintla chair and laminate-plywood Pouf table. Opposite: O&G Studio is helmed by Jonathan Glatt and Sara Ossana. Their Windsor-inspired pieces, like the Wayland Fanback barstools shown here in three colorways, are made in their Warren, Rhode Island, workshop.

1/21/16 6:03 PM


RADAR / MADE IN AMERICA

None of this is to say that design traditions do not inform the current American furniture marketplace. Stickley, the pioneer of Mission and American Arts and Crafts furniture, has been around for over a century and has changed hands only once—from the original Stickley family to the Audi family in 1974—all the while employing their original, traditional woodworking techniques. That is not to say that the Manlius, New York-based company hasn’t propelled forward with every generation; Aminy Audi, the CEO of Stickley, credits this to the company’s diversification and a resistance to laurelresting. “We’ve added many different styles, from updated traditional to midcentury modern collections,” she says, adding, however, that it is the education of the consumer that matters most.

LXCOM_Radar_Made_In_America_107.indd 110

Clockwise from top: Los Angeles’ Sabin taps local craftsmen to manufacture its made-to-order offerings; the Rexford cabinet is shown. Black walnut and solid brass inlay comprises the Neversink table by Asher Israelow of Brooklyn. From the mind of interior designer Brad Ford, Field + Supply is a yearly modern makers craft fair in High Falls, New York; the U bench by Luur Studio, sold through The Future Perfect, is an example of what’s in store for fair goers. A peek at Israelow’s process.

SABIN VIGNETTE PHOTO: DAN COLLOPY. ASHER ISRAELOW PROCESS PHOTO: COURTESY ASHER ISRAELOW STUDIO. ASHER ISRAELOW TABLE PHOTO: KEVIN O’DONNELL. LUUR STUDIO BENCH PHOTO: COURTESY THE FUTURE PERFECT.

who formerly had a life and career in the fashion industry, also echoes the sentiment: “It sounds sort of Pollyanna, but I never knew about the possibilities of what could go wrong; I went into it head first without any hesitation.” Best’s refined, hand-hewn pieces, often in weighty materials like bronze and marble, are nationally distributed by Holly Hunt. He finds the isolation of rural Montana instead of community hotbeds like Brooklyn or Los Angeles to be the best source of unfiltered inspiration. “I think if I had more contemporaries opining on my designs, my work wouldn’t be so avant-garde,” he says.

1/21/16 6:04 PM


“When people understand the work and quality behind one of these pieces, they realize it is a lifetime investment. It is something they can pass on to a future generation.” O&G Studio is a contemporary example of modernizing a deeply ingrained American motif—the Windsor chair, whose roots stem from our earliest English colonists. Ossana and partner Jonathan Glatt electrify the genre with unexpected colors and proportions. “It’s something intrinsic to the American design community,” Ossana says, “our history allows us to question authority.” New York-based interior designer Brad Ford, who has become a kind of pied piper for independent craftsmanship, says, “The U.S. has become one of the most dynamic places for burgeoning design talent.” Last October, Ford held his second-annual Field + Supply fair in High Falls, New York. “Growing up in a small town in Arkansas and being a creative kid, I always loved going to the arts and crafts fairs,” he says. “It created a sense of community that is now so often lacking.” Ford decided to take this concept and elevate it by cherry-picking some of the best American designers across various disciplines, like Israelow, Apparatus and The Future Perfect. “With Field + Supply, we want the work to be serious but the experience to be anything but,” he says, adding, “It is important that design not be alienating. Consumers are more and more responding to the meaning and soul of something that is made by hand. It automatically separates itself from other mass-produced furnishings.” Ford is so confident in the shifting consumer paradigm that this fall, he opened Fair, a showroom at the New York Design Center highlighting elevated craft and design, representing many of the American designers he curated for Field + Supply. No matter the aesthetic, whether historically referential or avant-garde, the independent American furniture maker offers a quality that an outsourced big-box manufacturer simply can’t. “My clients want to understand and know the object that they have a personal relationship with; our local makers give us that,” says interior designer Celerie Kemble, who is deeply involved in keeping artisan traditions afloat—particularly with The Alpha Workshops, the nation’s only nonprofit organization providing creative HIV-positive individuals with industry-specific training and employment in the decorative arts. “People are increasingly caring about these pieces that they live with. Furniture is a very intimate thing, and so, too, should be the process.”

LXCOM_Radar_Made_In_America_107.indd 112

From top: Each of Stephen Antonson’s plaster creations, like the Angele chandelier and Macklin center table, is crafted by hand in his Brooklyn studio. Century Furniture’s Thompson chest by designer Thomas O’Brien is fabricated in Hickory, North Carolina. Stickley has been making hardwood furnishings, like the Elroy chair shown here, in America since its inception in 1900.

STEPHEN ANTONSON CHANDELIER AND TABLE PHOTOS: FAMES FINLEY. CENTURY FURNITURE DRESSER PHOTO: COURTESY CENTURY FURNITURE. STICKLEY CHAIR PHOTO: COURTESY STICKLEY.

RADAR / MADE IN AMERICA

1/21/16 6:04 PM


SOLID BRONZE COLLECTION

www.ashleynorton.com | (800) 393 1097


RADAR / BEHIND THE BRAND

WORLD CLASS

INFORMED BY HIS VORACIOUS APPETITE FOR TRAVEL, JIUN HO’S SCULPTURAL LINE OF FURNITURE CELEBRATES AN ANNIVERSARY.

Above: In his San Francisco studio, designer Jiun Ho stands near one of his No More Play tables, part of the Jiun Ho Collection V line and inspired by Alberto Giacometti’s sculpture of the same name.

For Jiun Ho, the San Francisco designer behind the furniture collection that bears his name, it all comes down to narrative. “I want to tell a story,” he says of the line, now celebrating its 15th anniversary. More often than not, the stories stem from his travels (he spends at least three months a year traveling the world, with recent stops in Kyoto and Sicily). “I take a lot of pictures to remind me of my experiences,” he notes. “There are times when I look at things and say ‘that could be a base for a dining table’ and there are times when I have to look at the photo, take a step back and create from there.” He points to the Maras chair in his newly introduced Jiun Ho Collection V as an example. “If you look at the lines of the chair and the stonework found at Machu Picchu and Sacsahuamán in Peru, you can see where the inspiration comes from.” The rest of the 16-piece collection similarly draws on Ho’s wide-ranging travels and experiences, as well as weaves together the narrative threads of previous introductions and makes graceful allusions to modern art. When first launching his business, though, the designer’s primary objective was not building a furniture brand, but rather to create unique spaces and user-friendly experiences. Then a client asked him if he would sketch some furniture. “I said, ‘Sure, I can give it a try,’›” he recalls. “I came up with 35-40 pieces.” Connecting with a factory based in Southern California, Ho began manufacturing the pieces (most of which have been made in the United States ever since) and a brand was born. As the company has evolved, so has Ho’s approach. “We create the trends; we don’t let them drive us,” he says. “We focus on timeless, elegant shapes and forms and emphasize the tranquility, balance and pureness of the pieces. That, and attention to detail, is what’s important to us.”

PRODUCT PHOTOS: PATRIK ARGAST.

WRITTEN BY LISA BINGHAM DEWART PRODUCED BY KATE BERGERON PORTRAIT BY BRADEN SUMMERS

Right: Ho’s Maras chair and Picchu table, also from Jiun Ho Collection V, draw on South American influences.

COM_LX6_JiunHo_114.indd 114

1/20/16 6:07 PM


NEW YORK . LONDON . HARROGATE . OSLO +1 (212) 360 8000 | LAPICIDA.COM/US


RADAR / DEBUT

HISTORY REPEATING AN ICONIC AMERICAN ESTATE SERVES AS A MUSE FOR WILDWOOD LAMPS & ACCENTS’ LATEST COMPENDIUM OF LIGHTING.

ARCHITECTURAL ANTIQUES: COURTESY AUTHENTIC PROVENCE.

WRITTEN AND PRODUCED BY CARA GIBBS PHOTOGRAPHY BY CLAUDIA URIBE

Steeped in rich, historical references, the Biltmore Estate has been inspiring design and architecture since its reveal in 1895 by George Washington Vanderbilt II, grandson of famed industrialist and philanthropist Cornelius Vanderbilt. The 250-room French Renaissance château set upon 8,000 acres of pristine Ashville, North Carolina, land was designed as a country retreat for the family and remained so well into the 20th century. With certainly no shortage of inspiration to draw from—the house itself features over 100,000 square feet comprised of 35 bedrooms, 43 bathrooms and 65 fireplaces— the artisanal team behind Wildwood Lamps & Accents turned to the estate as a muse for their most recent collection, receiving unparalleled access to the pieces that made this sprawling house a home. One such piece uncovered during the brand’s creative pursuit was an ancient cinnabar box belonging to George’s wife, Edith Stuyvesant Dresser Vanderbilt. Quickly recognizing the potential in the raised floral relief etching, the Wildwood team developed big plans for the motif: Aptly named after the lady of the house, the resulting Edith lamps (shown) are conveyed in three colorways that each take on a different persona. The Edith lamp in Red, for instance, reflects a traditional Asian-like feel, while the Powder Blue hue professes a more serene garden-esque vibe; Oyster proves to be the chameleon of the group, able to live in both modern and traditional environments. All flaunting brushed finishes, modern silhouettes and sleek drum shades, this versatile collection effusively transcends aesthetics, genres and eras—taking its place as a graceful classic with a firm foothold in today’s interiors.

COM6_Radar_Biltmore_116.indd 1

1/20/16 6:04 PM


RADAR / 5 MINUTES WITH

SOUTHERN SENSIBILITIES

ATHENS, GEORGIA-BASED CREATOR SUSAN HABLE LENDS HER DESIGN TALENT AND ARTISTIC VISION TO A CHIC NEW HOME COLLECTION. WRITTEN AND PRODUCED BY LACY MORRIS PHOTOGRAPHY BY CHRIS BRANTLEY/WHITE ORANGE PRODUCTIONS

You are involved in a little bit of everything—painting, textiles, furniture, interiors. What led you to where you are today? I’ve always been an artist, and after working for several small businesses, mostly in jewelry, I realized that it was time to start my own design company. My sister, Katharine Hable Sweeney, and I launched Hable Construction in New York City in 1999, but in 2009, I decided to make the move to Athens. This was an eye-opening experience in that I realized how productive having my own studio was for my art. Describe your design aesthetic. I don’t play by the rules and I don’t discriminate where I turn to for inspiration—one day it’s Egyptian metalwork and the next it’s a Japanese kimono. I look to different cultures for inspiration in my color palettes and patterns. Tell us about your relationship with Hickory Chair. We started working together about six years ago on an exclusive fabric collection, and we’ve grown from there. Our common goals were to create quality products and make as many pieces domestically as possible. Why do you think it’s so important to keep production stateside? It is crucial for me to see the furniture being prototyped with my eyes on the product, and I work with the designers and engineers to make sure that all of the details that make the pieces special are being executed as they should. It’s such a luxury to see the hands that go into making each piece of our collection. We love the blue mirrored console for Hickory Chair’s sister company, La Barge (shown). It’s part of 25 new pieces we are adding to the original collection for the brand, and it is made with gilded wood and blue glass. I had seen that blue shade in a few midcentury pieces, but nothing current; we searched all over until we finally tracked it down abroad. I’m crazy about simple design that is also chic, and I think this geometric piece fits the bill and would be fantastic in a foyer. What’s next? An additional collection for Hickory Chair will come later this year. The pieces are incredible, with a lot of new silhouettes, and our focus continues to be on the sculptural aspect of each design. Visually, the new collection will tell a more transitional, modern story. Incorporating an artistic approach to design, I work hard to let the tiniest of details speak for the entire product.

COM_LX6_Radar_Habel_118.indd 118

1/21/16 12:28 PM


We Make

ELECTRIC ...Too.

bevolo.com • (504) 522-9485 • 521 Conti • 318 Royal • French Quarter • New Orleans


RADAR / COLLABORATION

HEAVY METAL

ROCK ‘N’ ROLL LEGEND AND DESIGN AFICIONADO LENNY KRAVITZ TEAMS UP WITH THE SKILLED CRAFTSMEN AT ROCKY MOUNTAIN HARDWARE TO CREATE A HARMONIOUS COLLECTION THAT HITS ALL THE RIGHT NOTES. WRITTEN AND PRODUCED BY CARA GIBBS

Clockwise from top left: Thumblatch entry hardware with grip in silicon bronze dark lustre. Multipoint escutcheon with lever in silicon bronze rust. Passage escutcheon with knob in silicon bronze light. Passage escutcheon with lever in silicon bronze dark lustre. Entry hardware with lever in white bronze brushed.

COM_LX6_RadarLennyKravitiz_120.indd 120

Why hardware? I was attracted to the partnership with Rocky Mountain Hardware because of the high-quality products they produce—handcrafted hardware made with time-honored casting methods. It was a pleasure to work with all of the talented artisans that created these pieces. What was it about Beverly Hills’ Trousdale Estates that inspired you? I moved to Los Angeles when I was 11 years old and it was then that I was first exposed to midcentury modern design. The Trousdale area boasts amazing midcentury architecture created by such a diverse group of architects. What I loved about these

homes in contrast to the boxy apartments that I was accustomed to in New York was that they had clean lines, open floor plans and, in a lot of cases, an abundance of glass. They were like the glamorous homes I had seen in Hollywood movies. And this collection represents that. Tell us more about the artistry and techniques. At Rocky Mountain, they still cast and finish each piece by hand, which is so impressive; they really bring to life this high level of artistry. With Trousdale, we wanted to generate products that married that craftsmanship with a modern aesthetic. The texture came out of wanting a more tactile experience with each piece, as well as serves as a way to visually emphasize the handcrafted nature. Give us a peek at your creative process. It’s a combination of sketching, looking at historical references and listening to music. “Hollywood Swinging” by Kool & the Gang was definitely inspirational in making this line. Finishes can truly transform a piece—taking something from traditional to totally rock and roll. Take us through the finishes. Trousdale will be offered in all of the Rocky Mountain finishes. Personally, I will be using the bronze light finish on a home I’m building in the Bahamas.

PORTRAIT: MATHIEU BITTON. HARDWARE PHOTOS: COURTESY ROCKY MOUNTAIN HARDWARE.

Lenny Kravitz has made no efforts to conceal his passion for interiors—establishing New Yorkbased Kravitz Design and producing several successful product lines. His latest collaboration with Rocky Mountain Hardware is yet another notch on his already-impressive design belt. In tune with both the artist’s modern aesthetic and love for classic design, the Rocky Mountain brand was more than prepared to bring Kravitz’s ideas to life. The resulting Trousdale collection combines a powerful ensemble of textures and shapes that culminates in a truly harmonious and showstopping array of hardware. We sat down with Kravitz as he discussed his latest collection.

1/21/16 2:51 PM


Scala Luxury FURNITURE COUTURE PARCHMENT GOATSKIN - SHAGREEN - BRASS

w w w. s c a l a l u x u r y. c o m


RADAR / ROUNDUP

TABLE MANNERS

SERENE AND NEUTRAL, THIS SEASON’S TABLETOP WARES DELIGHT IN THE BEAUTY OF NATURAL MATERIALS, GIVING CREDIT TO THE ART OF QUALITY CRAFTSMANSHIP AND THE HANDMADE. PRODUCED BY KATE BERGERON AND CARA GIBBS PHOTOGRAPHY BY CLAUDIA URIBE

FIND IT: CHICAGO Clockwise from top left: Tall ZigZag Hourglass Planter / $150 / andrewmolleur.com. Chrome Diamond Vase, Medium, and White Diamond Vase, Large / Tube Series Collection / $200 and $250 / bzippyandcompany.com. Light Up Candle Holder / $114 for set of two / fruitsuperdesign.com. Terracotta Pour Vase / Terracotta Series Collection / $225 / bzippyandcompany.com. Crystal Dish in Violet / Crystal Series / $260 / vitreluxe.com. The Nesting Bowl Large in Soft Pink / $42 / feltandfat.com. Low ZigZag Hourglass Planter / $75 / andrewmolleur.com. Small Rock Vase in Lotus / Shifting Sands Collection / $300 / ksdsporcelain.com. The Nesting Bowl Small in Lapis Lazuli and The Nesting Bowl Medium in Blue-Grey / $22 and $32 / feltandfat.com. Black & White Marbleized Plate / Price upon request / ateliersap.com. Reflections Bowls by BDB / Price upon request / 312.810.3183 / gatherhomeandlifestyle.com. Natural Linen Napkins / Price upon request / charveteditions.com. Oslo Cutlery Set in Matte Gold by Canvas Home / $100 / 844.350.7467 / 350west.com. Background paint: Tissue Pink / Classic Color Collection / benjaminmoore.com.

122 / LUXESOURCE.COM

CH_LX35_Radar_Tabletop_122.indd 122

1/20/16 3:47 PM


Loc ati o n: Pacific Palisades , CA l Arc h itect: Abramson Teiger Contractor: A J Eng i nee ri ng & Constru cti on Prod u ct: G ra b i l l Arc h itectu ra l Wi nd ows & Doo rs Photo C red it: Rog e r Davi es Photog ra p hy

A NEW VIEW OF LUXURY PELLA CRAFTED LUXURY SUITE 100 , LUXEHOME AT THE MERCHANDISE MART

WIND OWS l D O O RS l BLINDS l SHADE S

P E L L AC R A F T E D L U X U RY. C O M • 3 1 2 . 8 9 7. 3 6 0 0 Mon d ay – F r i d ay 9 am – 5 : 3 0 p m , Sat urd ay 1 0 am – 5 p m & by ap p o i n t m e n t

© 2016 Pe l l a Co rpo rati o n


RADAR / SCENE

WISH LIST

BAIGELMAN GLASS

Petra Bachmaier and Sean Gallero, the artistic duo behind Chicago-based Luftwerk, have created a site-specific series of art installations, entitled solarise: a sea of all colors, at the Garfield Park Conservatory. Created in response to the conservatory itself, and with its collection of plants in mind, the installation, on view through September 22, pays homage to landscape architect Jens Jensen, who originally designed the historic structure. Five distinctive installations—The Beacon, Portal, Florescence, Seed of Light and Prismatic—encourage viewers to interact with color, light and nature all while illuminating the area’s natural settings and highlighting Jensen’s design and the architectural importance of the building and grounds. garfieldconservatory.org; luftwerk.net

BLUEPRINT N°9 WALTON

Sophistication and elegance reign supreme in the latest residential building in Chicago’s Gold Coast neighborhood, where Jim Letchinger, president of JDL Development, has devised a timeless structure with everything needed for convenient, present-day living. Within the 35-story tower, each of the 66 condominium homes (featuring two to five bedrooms each) will boast exquisitely designed kitchens, marble bathrooms with heated floors, expansive living spaces and private terraces. Other modern amenities have been thoughtfully considered, too, and include an indoor lap pool, hot tub, steam room, sauna, massage room, fitness facility, around-the-clock valet parking, guest apartment suites, a covered dog run and private wine storage. The luxury accommodations will be completed in late 2017. 9walton.com

ON DISPLAY PHOTOS: TOP, LUCAS BRIFFA; BOTTOM, JOHN FAIER. WISH LIST PHOTO: HEATHER AHRENS. BLUEPRINT RENDERING: COURTESY JDL DEVELOPMENT.

ON DISPLAY

Colorful, sculptural and handcrafted in the United States, Aaron Baigelman and Heather Ahrens’ new line of practical glassware is turning heads. “We draw inspiration from different sources,” Ahrens says of the Chicago duo’s striking vessels, cocktail glasses, wine glasses and carafes (which change seasonally as they’re continuously refined). “I’m inspired by smaller, exceptional fashion designers and Aaron has studied with some of the best glassblowers in the world. Function was also key when creating our glassware series.” Sold in 10 stores across the country, the line is also on view by appointment only in the pair’s Humboldt Park studio. baigelmanglass.com

124 / LUXESOURCE.COM

CH_LX35_Scene_124-126.indd 124

1/20/16 3:49 PM


Jacquard® Vanity with Solid/Expressions™ Vanity Top Derring™ design on Carillon Round Wading Pool® Artifacts® Faucet with Column Spout and Prong Handles ®

Find your signature style with personalized design services and experience inspirational KOHLER® kitchen & bathroom collections firsthand. Take your project from start to finish with cabinetry, tile, plumbing and designer advice at your nearest KOHLER Signature Store.

KOHLER Signature Store by Studio41 Burr Ridge, IL 630-413-4096 KohlerSignatureStoreBurrRidge.com

KOHLER Signature Store by Studio41 Chicago, IL 312-818-5408 KohlerSignatureStoreChicago.com

G E T I N S P I R E D AT I D E A S . K O H L E R . C O M

KOHLER Signature Store by Studio41 Glenview, IL 847-906-2571 KohlerSignatureStoreGlenview.com


RADAR / SCENE

COLLABORATION STUDIO K/SABINE HILL

KAREN HEROLD

LYNDSEY GLASENER

Tell us a little about the new collection. What was the inspiration behind the line? I used to be a fashion designer and have always had an affinity for materials. As a designer today, I like to create spaces that are more restrained and that just feel good. For this collection, I merged the two, designing a classic tile collection that’s understated with softer shades for palettes that complement each other; it’s a very modest line without a lot of crazy colors or shapes. Most of my interior designs are very reminiscent of older times, and these tiles project that same idea. Why did you want to create a cement tile collection? I love the fact that cement tiles age really gracefully and change with time. It’s as if they get more beautiful as they develop a patina, which is very much in line with my design aesthetic. What’s next on your radar? Our design studio is currently working on several new restaurants that will be unveiled soon.

How does this collection differ from other players in the current Sabine Hill line? It’s a solid cement tile with faux-grout lines that make each tile appear to be part of a larger mosaic. We handmade metal molds for it to work, which was an extremely difficult and complicated process, but this innovative technique gave us a result that showcases the range of what we can do. What made you want to collaborate with Karen on a tile collection? I have always loved Karen’s work and style, which is raw and edgy yet flows so nicely. The idea evolved after the two of us talked about it for some time. Karen and her team are fabulous; they understood the process, and we were able to move things along quickly. So what’s in store for Sabine Hill in the upcoming year? We just finished designing 12 new patterns in collaboration with San Diego-based designer Paul Schatz that are headed to the Coverings trade show in April.

HEROLD HEADSHOT AND STUDIO K OFFICE PHOTOS: ERIC KLEINBERG. GLASENER HEADSHOT: COURTESY SABINE HILL. TILE PHOTOS: ANDREWS BRADDY PHOTOGRAPHY.

Inspired by a traditional French brasserie, Karen Herold, principal of Chicago’s Studio K, and Lyndsey Glasener, owner of Wisconsin-based cement tile company Sabine Hill, teamed up to create The Brasserie Collection—a new 18-pattern tile line that can be used both indoors and out and is infused with classic mosaic patterns and contemporary color palettes. Here, the duo share their insight into creating this modern and elegant surface collection. studiokcreative.com; sabinehill.com

126 / LUXESOURCE.COM

CH_LX35_Scene_124-126.indd 126

1/20/16 3:49 PM


230 W Huron Street, Chicago, IL 60654 | 312.380.0058 | moderneliving.com


A DV E RT I S E M E N T

1

2

3

4

5

s

f

HUBBARD

WOODS

DESIGN

DISTRICT

m

s u

s

B o

8 i

An oasis of exceptional design on Chicago’s North Shore located on Green Bay Road in Winnetka. shophwdd.com

( a


A DV E RT I S E M E N T

6

7

9

1

8

10

11

12

BEDSIDE MANOR LTD. Floral but not flowery, romantic yet modern, Montalcino by Oliveri Home achieves the perfect balance. In the Chicago area, these sophisticated,

sustainable Italian linens of the highest quality are available only at Bedside Manor. (920 Green Bay Road · 847.441.0969 · shopbedside.com) furnishings featuring the Isabella sofa and chair. (906 Green Bay Road · 847.446.8000 · mmintinteriors.com)

3

2

MMINT INTERIORS Luxury home

ROBBINS ARCHITECTURE is a boutique architectural firm. For more

than 20 years, it has created unique spaces that bring openness, light and warmth into people’s homes. (976 Green Bay Road · 847.446.8001 · robbins-architecture.com) 4 DUXIANA Home of the legendary DUX Bed from Sweden and fine European linens, quality down, headboards and bedroom accessories. Visit DUXIANA and discover the difference a DUX bed can make in your life. (984 Green Bay Road · 847.784.9320 · duxiana.com) 6

5

PAGODA RED Chinese antiques and contemporary art. (911 Green Bay Road · 847.784.8881 · pagodared.com)

MATERIAL POSSESSIONS Bring new energy and style to your home with timeless accessories and furniture from Material Possessions. (954 Green Bay Road · 847.446.8840 ·

materialpossessions.com)

7

BENVENUTI AND STEIN is a single-source, design-build firm offering award-winning design, custom cabinetry and full-service construction that has

served Chicago’s North Shore for more than 38 years. (899 ½ Green Bay Road · 847.866.6868 · benvenutiandstein.com) 8 SUSAN KROEGER Any season is the perfect time to freshen up your interior décor. Spend this year with a design that reflects your personality or gift the perfect addition to someone you care about. (886 Green Bay Road · 847.446.7611 · susankroeger.com)

9

MARIGOLDS is a delightful potpourri of Asian antiques, antique wicker furniture, Americana, exclusive hand-painted pottery and decorative items. (916 Green

Bay Road · 847.501.2755 · marigoldswinnetka.com) 10 ROBERT BRYAN HOME is a home furnishings store offering interior design services. Complete your look from a large selection of furniture, lamps, wall décor, unique finds and home accessories. Featured is an end table with honed black marble and walnut with gold-finished metal. (894 Green Bay Road · 847.446.5522 · robertbryanonline.com) 11 SKÄNDAL This darling Marimekko tunic from Helsinki, Finland is made of 100-percent silk, perfect for transition months. Skändal specializes in fine Scandinavian apparel, accessories and gifts. Don’t miss your chance to get a sneak peak at the brilliant new spring collections or order this piece online. Priced at $275. (907 Green Bay Road · 847.386.7900 · shopskandal.com) 12 SAWBRIDGE STUDIOS This is the Middlebury vase from Simon Pearce’s new Pure collection of lead-free crystal. Priced at $750. (897 Green Bay Road · 847.441.2441 · sawbridge.com)


CELEBRATING 25 YEARS OF CUSTOM MASONRY & LANDSCAPE DESIGN Over the past 25 years, J.B. Brickworks, Inc. has designed, managed, and installed over 3,000 projects in Illinois, Wisconsin, and Michigan. Building a reputation on quality construction methods, detailed craftsmanship, and unsurpassed service, JB has been the preferred hardscape contractor for many discerning architects, builders, landscape firms, and homeowners. Our staff consists of knowledgeable, skilled, and detailed individuals who will ensure your project is completed on time, on budget, without compromise. J.B. BRICKWORKS, INC. (847)634-6437 | info@jbbrickworks.com | www.jbbrickworks.com


Where Designers Love to Shop Home to thousands of fabrics, furnishings, wall coverings, lighting, flooring, art and accessories Let our designers make your home a place you love to live in!

MARIETTA CALAS

847.634.3190

Expressive Interiors by Marietta Calas

expressiveinteriors.net

ILENE CHASE Ilene Chase Design

847.828.0305 ilenechasedesign.com

KELLY GUINAUGH Interior Enhancement Group

847.705.9569 interiorenhancementgroup.com

The ADC has teamed up with some of the most talented designers in the area to bring you experience, knowledge and creativity to design your home exactly how you envision it to be. To find a designer, visit our website at arlingtondesigncenter.com.


om

3441 & 3425 N. Ridge Avenue and 601 W. Campus | Arlington Heights, IL 60004 847.394.1373 x26 | arlingtondesigncenter.com


䄀瘀愀椀氀愀戀氀攀 琀漀 琀栀攀 琀爀愀搀攀 眀眀眀⸀挀愀椀搀攀猀椀最渀猀⸀渀攀琀 椀渀昀漀䀀挀愀椀搀攀猀椀最渀猀⸀渀攀琀


䄀爀氀椀渀最琀漀渀 䠀攀椀最栀琀猀 簀 㠀㐀㜀ⴀ㌀㤀㠀ⴀ㐀㜀㠀㔀 䄀爀氀椀渀最琀漀渀 䠀攀椀最栀琀猀 䰀椀最栀琀椀渀最  簀 㠀㐀㜀ⴀ㔀㤀 ⴀ㤀㠀㌀㔀 䌀栀椀挀愀最漀 簀 ㌀㄀㈀ⴀ㜀㔀㔀ⴀ㤀㄀㘀㌀ 䐀攀渀瘀攀爀 簀 ㌀ ㌀ⴀ㈀㠀㈀ⴀ㠀㄀   匀挀漀琀琀猀搀愀氀攀 簀 䌀漀洀椀渀最 匀漀漀渀


Tabac media cabinet in walnut and steel

MODERN I NDUSTRY Furniture for Life Phone | 312.420.2708

CHICAGO

www.modernindustrydesign.com


BESPOKE

KITCHEN RANGES + APPLIANCES, CABINETRY & ACCESSORIES

Officine Gullo USA

|

www.OfficineGullo.com

|

800.781.7125 Made in Florence, Italy


MARKET Fashionable fabrics, sleek seating and a diverse array of designer-driven home accents lead the way into spring. PRODUCED BY KATE BERGERON + CARA GIBBS

COM6_MarketOpener_139.indd 139

1/20/16 3:00 PM


MARKET / MATERIAL

WINDOW SHOPPING THIS SPRING, THE LATEST TEXTILE LINES SHOW OFF SUMPTUOUS TEXTURES AND SWOON-WORTHY DETAILS SURE TO LEAVE ANY HOME DRESSED TO IMPRESS. STYLING BY CARA GIBBS / PHOTOGRAPHY BY CLAUDIA URIBE LOCATION OLA FEROZ

COM_LX6_Material_140-146.indd 140

1/21/16 11:23 AM


ON DISPLAY Clockwise from top left: Fiddle Leaf Fig in Gray Natural Lilac and Shelby in Blush Green Red / ferrickmason.com. Zuma in Black / Kelly Wearstler for Groundworks / leejofa.com. Omaha Kinship in Indigo Ikat / eskayel.com. Ikat Stripe in Teal / Trade Routes Collection / thibautdesign.com. Tomasina in Berry / Eileen K. Boyd Vol. 2 Exclusively for Duralee / duralee.com. Elveden in Orchid / Elveden Collection / villanova.co.uk. Molokai in Seasalt / Equator Collection by Mokum / jamesdunloptextiles.com. Chevron in Taupe / ankasa.com. Chair cushion fabric: Crochet in Pale Blue / Raoul Dufy for Christopher Farr Cloth / christopherfarrcloth.com. Pillow fabric: Tomasina in Berry / Eileen K. Boyd Vol. 2 Exclusively for Duralee / duralee.com.

COM_LX6_Material_140-146.indd 141

1/21/16 11:23 AM


MARKET / MATERIAL

DRESS CODE Drapes, from left: Dimat in Grey / John Robshaw II Exclusively for Duralee / duralee.com. Papagayo in Multicolore / The Maya Collection / pierrefrey.com. Fiddle Leaf Fig in Green Mist Blue / ferrickmason.com. Expedition in Everest / Rugged Elegance 2015 Collection / delecuona.co.uk. Tiebacks, from left: Kullervo in Pink & Red, Kullervo in Black & White, Kivet in Black & White, Tiiliskivi in Orange & Beige / us.marimekko.com.

COM_LX6_Material_140-146.indd 142

1/21/16 11:18 AM


CREATE

your OWN ORIGINAL


MARKET / MATERIAL

RETAIL THERAPY

COM_LX6_Material_140-146.indd 144

Top shelf, clockwise from top left: Arun in Antique Teal / Temple of Dawn Collection / jimthompsonfabrics.com. Samoa Diamond in Sea Oyster / Mary McDonald II Collection / fschumacher.com. Chiltern Linen in Color 013 / fermoie.com. Bunsun in Indigo / John Robshaw II Exclusively for Duralee / duralee.com. Wild Geese Linen in Indigo / Mulberry Home for Lee Jofa / leejofa.com. Spots in Black and Natural / rebeccaatwood.com. Hanging, left to right: Hedera in Green / Vintage 2 Prints / sanderson-uk.com. Willow Silk Twill Panel / The Fabric Collection / degournay.com. Wolf in Dusk / Rugged Elegance 2015 Collection / delecuona.co.uk. Floridita in Peacock Electric Blue / Cubana Collection by Matthew Williamson / osborneandlittle.com. Condotti in Peonie / The Roger Thomas Collection / sharris.com. Tracery in Lapis / John Robshaw II Exclusively for Duralee / duralee.com.

1/21/16 11:18 AM


7KH6FDQGLD'RZQ'LijHUHQFH HEIRLOOM QUALITY

EUROPEAN CRAFTSMANSHIP

AMERICAN HERITAGE

VISIT SCANDIA HOME AT THESE LOCATIONS: %(9(5/<+,//6&$ 1%HYHUO\'ULYH 

3$/2$/72&$ 7RZQ &RXQWU\9LOODJH 

.$16$6&,7<02 &RXQWU\&OXE3OD]D 

%,50,1*+$00, 3LHUFH6W 

1257+%522.,/ 1RUWKEURRN&RXUW0DOO 

,1',$1$32/,6,1 8QLRQ&KDSHO5G 

&+,&$*2,/ 10LFKLJDQ$YH 

-$&.621:< 1RUWK&HQWHU 

(',1$01 *DOOHULD0DOO 

ALSO FIND SCANDIA PRODUCTS AT: *UDFLRXV+RPH 1HZ<RUN1< )HDWKHU<RXU1HVW $XVWLQ7;

3LRQHHU/LQHQV :HVW3DOP%HDFK)/ *DWWOHÅ&#x2013;V &LQFLQQDWL2+

7KUHDGFRXQW 0LDPL)/ *DWWOHÅ&#x2013;V 3HWRVNH\0,

%ORFN%URV$W+RPH 3HSSHU3LNH2+ /DEUD]HO+RPH :HVW+DUWIRUG&7

&DVDGL/LQR 'DOODV7;

.XKO/LQVFRPE +RXVWRQ7; 7KH/LQHQ*DOOHU\ 2PDKD1(

VFDQGLDKRPHFRP

7KH/LQHQ.LVW $YRQ&2 %RQVRLU)LQH/LQHQV :HOOHVOH\0$

/RQJRULD&ROOHFWLRQ +RXVWRQ7; %HGVLGH0DQRU &KDUORWWH1&

0DUWKD6PLWK)LQH/LQHQV /D-ROOD&$ *UDPHUF\)LQH/LQHQV $WODQWD*$


MARKET / MATERIAL

THREAD COUNT From left: Brittany Stud in Flannel / The Roger Thomas Collection / sharris.com. Drops in Multicolor / Dominique Kieffer by Rubelli / donghia.com. Medici in Black Sheep / The Roger Thomas Collection / sharris.com. Greta in Jet from The Portrait Collection and Frame in Rose Gold from The Tailor Collection / evitavonni.com. Persia in Black on Taj Ecru / quadrillefabrics.com. Mirafiore in Smeraldo / Rubelli Venezia 2015 Collection / donghia.com. Tigre in Ebony / Tribal Collection by Mokum / jamesdunloptextiles.com. Baratillo in Tierra / Peruano Collection / zakandfox.com. Ground: Omaha Kinship in Indigo Ikat / eskayel.com.

COM_LX6_Material_140-146.indd 146

1/21/16 11:18 AM


Fine Solid Bronze Architectural Hardware 208.788.3631

â&#x20AC;˘

www.sunvalleybronze.com

Made in the USA


NATALIE

HAVANA

IBIZA SECTIONAL

KINGSTON

KANE DRUM

RAW CONCRETE & BATYLINE

ROPE

AUSTIN

WATERFALL

VILLAGE & MODERNO

GOMMIARE MILLAR BENCH


Teak Warehouse introduces the exclusive GOMMIARE ORGANIC LIVING OUTDOOR COLLECTION FEATURED: COPENHAGUE DEEP SEATING

TRESTLE & SOPHIA

LUXE

ZAMBEZI

COCO

SOHO GRANDE

BAY

ROUND PEDESTAL & ZAMBEZI

WWW.TEAKWAREHOUSE.COM Teak Warehouse are manufacturers with over 125,000 sq. ft. of high-end outdoor furniture at wholesale prices to the public. Everything is in stock, fully assembled and ready for nationwide white glove delivery. Sunbrella速 cushions are included as shown.

866.937.8325

800.343.7707

OPEN DAILY TO THE PUBLIC & TRADE


MARKET / TREND 4

ON THE CLOCK

3

WE SIT DESK-SIDE WITH FOUR SAVVY DESIGNERS WHOSE HIGH STYLES AND DISTINCT AESTHETICS ARE ALWAYS ON POINT. WRITTEN BY KATE BERGERON

2 1

9

BLACK OUT

5

NICOLE HOLLIS, SAN FRANCISCO Trademark: I’m all about simplicity with an edge: black, texture, cut and form. Morning routine: Up at 5:30 a.m., I check online auctions, design blogs, The New York Times and email. Post bath and meditation, it’s family time with my husband and 4-year-old; no better way to start the day. Dream office: I surround myself with beautiful objects in my studio, but it’s constantly changing—the smallest thing can inspire. We have huge windows overlooking the San Francisco skyline, and the sunsets are spectacular. Desktop items: My tools of the trade (color pencils, scratch paper and drawings), a rusty horseshoe, brass door hardware and a rock from a trip to Hawaii. Personal stationery: Custom letterpress with original artwork by Marta Elise Johansen. Mood board: Torn pages from fashion and art magazines and auction catalogues. On trend: Eighties fashion is back and inspiring interiors. I’m hooked on neon, shredded and studded accents.

COM_LX6_Market_Trend_150-156.indd 150

7

6

8

PORTRAIT : KRISTEN LOKEN.

1. Resin Atelier Boulder Vase in Black & Snow $280 / dinosaurdesigns.com 2. Black Twist Bag $1,800 / j-w-anderson.com 3. Lunar Light Choker in Black $350 / larabohinc.com 4. Black Rosette Eau de Parfum $385 / siperfumes.com 5. Neo Vessel in Black Nero Kinitra $2,400 / apparatusstudio.com 6. Bertoia Diamond Chair in Gold $2,043 / knoll.com 7. Alicia Adams Alpaca Wool Throw $395 / barneys.com 8. Ben Medansky Small Vessel 02 $1,380 / thefutureperfect.com 9. Gap Pendant, Tall & Short, by Nur Design Price upon request / woud.dk

1/20/16 2:55 PM


HANDCRAFTED

F U R NIT U R E

B A U S M A N A N D C O M P A N Y.C O M


MARKET / TREND 1

9

PORTRAIT : KARA TRAIL.

2

CLASSIC COMEBACK

3

HALLIE HENLEY, HOUSTON Trademark: My style is glamorous with a modern twist. Morning routine: Cuddling with my 9-month-old daughter, Scarlett. If she has her bottle and I have my coffee, I’ve already started off the day happy. Desktop items: My MacBook Pro, Kayce Hughes artwork I picked up from Rivers Spencer in New Orleans, a Moleskine sketchbook where I keep my notes and my father’s Montblanc pen. Personal stationery: Number Four Eleven in Savannah and Lavender & Mint in Houston. Mood board: Mine is a result of falling down the Instagram rabbit hole, and it’s where you’ll find work from artist Alexis Walter and architect Bill Ingram, to name a few. Never too many… Monogrammed linens. Can’t live without… My red lipstick. Guilty pleasure: Fabric. Sources of inspiration: Vintage out-of-print design books, estate sales and old classic movies—I can definitely credit Auntie Mame as being a push toward a life in design. On trend: Chintz is the new ikat. And wallpaper (everywhere!).

8

1. Peinture Wallcovering Price upon request / frenchamericanwallpaper.com 2. Copper Dome Pendant on Pulley Cord Price upon request / bevolo.com 3. LV 1080 in Burnished Bronze Price upon request / sabaxter.com 4. From top: Hanabi Burst, Gita Stripe, Plume Redux, all in Midnight Prices upon request / robertallendesign.com 5. Moravia Chair by Thom Filicia $2,277 / vanguardfurniture.com; thomfilicia.com 6. Marcelle Bud Vase $295 / aerin.com 7. Cordelia Desk in Orange Lacquer $2,200 / worlds-away.com 8. Domed Cuff, top, and Rolling Bracelet, both in 18k Yellow Gold $9,100 and $14,200 / sidneygarber.com 9. Ceramic Plates in Black by Eric Bonnin and Hand-Forged Brass Spoon Prices upon request / spartan-shop.com

4

7

5 6

COM_LX6_Market_Trend_150-156.indd 152

1/20/16 2:56 PM


Š2016 Snaidero USA

since 1979

Urban Luxury LOFT by Michele Marcon Design | Made in Italy Los Angeles | Miami | New York | Chicago | Edmonton | Fort Lauderdale | Honolulu | Houston Long Island | Maui | Naples | San Francisco | Toronto | Vancouver | Washington D.C. | Westchester BogotĂĄ | Caracas | Costa Rica | Panama City | Puerto Rico 1.877.762.4337 | www.snaidero-usa.com | Member of USGBC


MARKET / TREND 2 3 1

MOOD SWING

ALEXANDRA KAEHLER, CHICAGO

Trademark: My style is masculine balanced with feminine and old mixed with the new. I believe that these juxtapositions are what make a home complete. Morning routine: Spending a couple of early hours with my daughter is the perfect way to start the day. Dream office: Mine is just that; our new office feels so fresh with tons of natural light and shelves upon shelves full of materials and samples for easy access to inspiration. Desktop items: I like a clean work space; clutter slows me down. But I’d be lying if I said there wasn’t a stray paper or two lying around. Personal stationery: Letterpress by Gadabout. Mood board: Clippings of new artists and collaborations, as well as personal photos from my travels (picturesque landscapes, striking outfits I see on the street). Never too many… Pairs of shoes. Can’t live without… Chicago pizza. Guilty pleasure: Chicago pizza. On trend: I’m loving rooms painted entirely in one color—walls, trims, window frames, all of it.

4

7

5

9

8

COM_LX6_Market_Trend_150-156.indd 154

6

PORTRAIT : CYNTHIA LYNN.

1. Gothic Drop Pull Price upon request / ashleynorton.com 2. Bleecker Rug in Ash Price upon request / feizy.com 3. Branching Mini-Globe Pendant in Brushed Brass with White Hand-Blown Glass $3,500 / lindseyadelman.com 4. Grady Ladders $450 each / hawkinsnewyork.com 5. Thick Boulder Band $685 / uhurujewelry.com 6 Marais Bench by Suzanne Kasler Price upon request / hickorychair.com 7. Bloom in Violet Grey on White Paper Weave Price upon request / phillipjeffries.com 8. Big Basket $400 / dougjohnston.net 9. Puiforcat Rose Gold Champagne Beaker $2,600 / justoneeye.com

1/21/16 12:13 PM


Sunbrella速 is a registered trademark of Glen Raven, Inc.

sunbrella.com


MARKET / TREND 1

2

3

WILD CARD

ASHLEY DARRYL, NEW YORK Trademark: I call my style “disciplined eclecticism,” because I love to mix periods while keeping everything minimal and not overly decorated. Morning routine: My dad always tells me “look good, feel good, do good,” so I try to start my day by dressing in whatever I feel comfortable and confident in. Dream office: My desk faces a large window overlooking Sixth Avenue; the hustle and bustle in the streets makes me excited everyday. Desktop items: A John Derian four-leaf clover paperweight and piles of lined notebooks. Personal stationery: Connor. Mood board: Flower arrangements. I love seeing bouquets with color palettes I may not have put together on my own. Never too many… Plants and flowers. Can’t live without… A cozy throw blanket. Guilty pleasure: Compartés chocolate bars and Diptyque candles. Sources of inspiration: Designers Steven Gambrel and Billy Baldwin (I look to their books often) and vintage furniture. On trend: I’m more into designing a home around patterns, colors and décor with longevity.

4

10

5

1. Rider Structured Bag in Cheetah-Printed Haircalf $650 / loefflerrandall.com 2. Aramis Sconce by Barry Dixon $1,350 / arteriorshome.com 3. Mohair Ochre Throw $350 / abchome.com 4. Rosolina Table $7,750 / casaintl.com 5. Copper Origami Planter $1,090 / workof.com; treyjonesstudio.com 6. Feldspar Wallpaper in Emerald City $250 a roll / flatvernacular.com 7. Hex Weight Trio $98 / iacolimcallister.com 8. Comma Mouse Pad by Grégoire de Lafforest $685 / avenue-road.com 9. Hahn Lounge Chair Price upon request / brightchair.com 10. Relic Pillow No. 12 $90 / faycetextiles.com

8

9

7

COM_LX6_Market_Trend_150-156.indd 156

PORTRAIT : RENÉ CERVANTES.

6

1/20/16 2:57 PM


BR I L LIANCE

©2015 Swarovski Lighting, Ltd.

BY

H A N D

True to our company´s heritage, Schonbek proudly handcrafts crystal lighting of exceptional beauty, as we have for more than 140 years. swarovski-lighting.com

Eclyptix EC1328N-401A


MARKET / SPOTLIGHT

Game of THRONES THERE’S OFTEN A FINE LINE BETWEEN BEAUTY AND FUNCTION. HERE, TOP DESIGNERS SHARE THEIR STANCE ON SEATING THAT ACCOMPLISHES BOTH. WRITTEN BY CARA GIBBS PHOTOGRAPHY BY CLAUDIA URIBE

ANNE HEPFER

ANNEHEPFER.COM

Displaying restraint… Kara Mann’s benches are cool and current yet also possess a timelessness to them that isn’t over-designed. The main lines of the piece… Are defined in solid black, providing a frame to emphasize the natural wood grain of the base; from a creative perspective I think it’s brilliant and beautiful. The attention to detail and beautiful finishing… Is an example of Baker’s trademark of uncompromising standards towards well-made furnishings. Luxury is a by-product of superior quality and sophisticated design. I always examine… Circulation, scale and the language spoken between pieces when creating areas conducive to conversation. Kara has done a wonderful job… Designing a versatile, clean, perfectly proportioned line, and I am excited to use her pieces in our clients’ spaces.

COM_LX6_Spotlight_158-164.indd 158

1/20/16 5:56 PM


IT TAKES TWO

COM_LX6_Spotlight_158-164.indd 159

THE PIECE: Better Together Benches THE DESIGNER: Kara Mann for Milling Road FIND IT: millingroad.com THE INSPIRATION: Using sultry silhouettes and sexy color palettes, Chicago-based designer Kara Mann has infused a sophisticated edge into her debut line for Bakerâ&#x20AC;&#x2122;s revamped Milling Road brand. Celebrating relaxed glamour with earthy elements, these benches stay true to the designerâ&#x20AC;&#x2122;s unexpected approach while paying homage to high handcrafted standards.

1/20/16 5:56 PM


MARKET / SPOTLIGHT

GEORGIA ON OUR MIND THE PIECE: Georgia Chairs THE DESIGNER: Kate Spade New York FIND IT: katespade.com THE INSPIRATION: Flaunting Kate Spade’s signature bows and polka dots, the Georgia chair playfully collides the two elements with ultra-refined results—just one example of this much-anticipated debut collection with E.J. Victor.

COM_LX6_Spotlight_158-164.indd 160

LINDSAY CHAMBERS

LINDSAYCHAMBERS.COM

I find this collection to be… Confident, playful and feminine. It has a timeless Hepburn-like quality without alienating those who lean toward masculine design. I’m at my creative best when… I am pushing the boundaries, and Kate Spade’s new furniture line does just that, apparent in the bow tie back detailing—a distinct motif of the company reinterpreted for an instant-classic dining chair. I am attracted to the bold… Example of Kate Spade’s ability to marry two of their most signature elements together: bows and polka-dots. The chairs embody… The brand’s embrace on the interiors world, displaying both formality and playfulness alongside masculine and feminine notes. The sweep of the legs is very distinctive… And the black-and-white polka-dot pattern speaks to confidence and individuality.

1/20/16 5:56 PM


LAURA BURLESON LAURABURLESON.COM

Fashion, design, art and architecture… Are all variations on a creative theme. Some of the best furnishing collections are born from fashion icons, often causing a tidal wave of symbiotic brand revival. I absolutely love the Hooker-Rowley collaboration for that exact reason—an unexpected brand pairing that stops you in your tracks. The Fleur de Glee bench is… Unmistakably Rowley in pattern yet shows off the refined upholstery elements for which Hooker is known. Add in the modern lines and jewelrylike metalwork detailing and you’re poised for perfection. As a fluent Francophile… I love the name and inherent playfulness associated with the bench. Whimsical upholstery meets modern metal—it’s the juxtaposition that makes us stop and ponder. Interiors should not exist on a single axis… But reflect the many moods and facets of personalities. Without creativity… Design becomes predictable and expected. Here, I’m so attracted to the hard, modern silhouette coupled with the floral, feminine pattern.

COM_LX6_Spotlight_158-164.indd 161

SITTING PRETTY THE PIECE: Fleur de Glee Bench THE DESIGNER: Cynthia Rowley FIND IT: hookerfurniture.com THE INSPIRATION: Fashion designer Cynthia Rowley rocks the design world yet again with her latest foray into furnishings. Part of a collection comprised of sporty, curious and pretty categories, the Fleur de Glee bench is clad in one of the designer’s iconic floral prints and resides in the pretty realm.

1/20/16 5:56 PM


MARKET / SPOTLIGHT

BRIAN PATRICK FLYNN

FLYNNSIDEOUT.COM

Every single thing… About the Morehead chair is for me. From its hefty, almost updated Parsons-style lines to its somewhat Postmodern personality and early 1980s appeal, it is as much a comfy spot to sit in as it is sculptural art. Silhouette is important… For the overall balance of a room and area of perspective. What’s interesting about these chairs is how strong and grounded their profiles are. Since they are so straight, they work beautifully with curved pieces, like say a Tulip table. Locally made forever pieces… Are what everyone is after these days. Hands down, these pieces are new and now, all while combining a classically architectural frame with a perhaps retro-style fabric choice that speaks to today’s lifestyle. The best way to describe my aesthetic… Is transitional with an edge, which fits to perfection with many of the pieces offered by Highland House. The lines are clean and draped in classicism, but the textiles are fit for modern-day tastes—the perfect mash-up of timeless and fresh.

COM_LX6_Spotlight_158-164.indd 162

MEET ACUTE THE PIECE: Morehead Chairs THE DESIGNER: Highland House FIND IT: highlandhousefurniture.com THE INSPIRATION: An ode to the classic 1970s Parsons silhouette, the Morehead chairs are upholstered in a custom geranium weave by American Silk that is exclusive to Highland House. The retro vibe paired with the ultrasophisticated hand of the fabric is the perfect aperitif to the brand’s other luxurious offerings.

1/21/16 5:14 PM


HIDE AND SEEK THE PIECE: L1499-01 Chair THE DESIGNER: Lee Industries FIND IT: leeindustries.com THE INSPIRATION: Modern design meets natural material in this hair-on-hide sling chair that proves simplistic form and comfort do go hand in hand.

HOLLISTER & PORTER HOVEY HOVEYDESIGN.COM

A Cartier Love bracelet got a fur coat... Was our first impression of Lee Industries’ insightful take on a classic sling chair. We’re so attracted to the mix of... Organic and industrial, soft and hard, furry and shiny. Those foils create aesthetic interest and can translate in almost any setting. This single chair can add... Softness and warmth to a stark modern space or bring a maximalist room a sense of calm modernity. Where design really gets fun and memorable... Is when you start collecting valuable—not necessarily expensive—well-crafted treasures that have a history, a story and a sense of place. We love seeing the emergence of creative artisans in America and abroad. Luxury is a contract... Between maker and acquirer. The passion and talent of a great craftsman is married to the owner appreciating and understanding the beauty of an object that is made with a heart and soul.

COM_LX6_Spotlight_158-164.indd 163

1/21/16 5:14 PM


MARKET / SPOTLIGHT

LINC THELEN

LINCTHELEN.COM

I would describe this daybed as… Swanky, bohemian, versatile, handsome and sexy. Studio Van den Akker exemplifies… Beautiful and clean-lined furniture steeped with historical references, yet the collection is extremely versatile for today’s modern lifestyle. This daybed speaks to the evolution of midcentury designs, paying homage while offering a fresh and modern point of view. Creating intimate conversational arrangements… Is key to a well-designed space. I think good design should be full of surprises—sometimes the surprises are obvious, other times subtle. The Charles daybed belongs… In a living room where it can act as the perfect anchor connecting two seating groups; because there is no back, guests can sit comfortably and face either direction. It would also be stunning in a foyer paired with a massive piece of artwork.

COM_LX6_Spotlight_158-164.indd 164

BENCH PRESS THE PIECE: The Charles Daybed THE DESIGNER: Rob Copley and Sean Robins FIND IT: studiovandenakker.com THE INSPIRATION: Emulating a straight-off-the-set-of-Mad-Men vibe, the Charles daybed, custom-designed and made in the USA, keeps midcentury modern at top of mind.

1/20/16 5:56 PM


IF YOU KNOW A TRUFFLE GUY IN FRANCE, YOU’RE A DACOR CHEF. Dacor is built for the world’s most demanding chefs. And you, mon petit chou, are exactly the breed of culinary enthusiast Dacor appliances are designed to please. For three generations, we’ve worked tirelessly to equip the passionate chef with precise, undeniably gorgeous cooking appliances. Complete your dream kitchen with a free Dacor Dishwasher, Ventilation System or Instant Savings with our It’s Your Choice offer, for a limited time. Learn more at www.dacor.com/Promotions/Its-Your-Choice Tested and recommended by the Master Chefs of Le Cordon Bleu.®

dacor.com

MADE IN U.S.A.


®

NEW COLLECTION FEATURING

DESIGNS BY ROY HAMILTON

© 2 016 C H E L L AT E X T I L E S . A L L R I G H T S R E S E R V E D .


SPECIAL ADVERTISING SECTION

OPEN-AIR DESIGN IN THE OUTDOOR LOOKBOOK 2016

THE MODERN AGE For homeowners across the country, outdoor living has become a necessity. In responding to the movement, industry leaders are creating spaces that withstand the elements while achieving durability, environmental consciousness and the desired aesthetic. Read on to discover the latest in design and technology for the alfresco environment.

Hubbardton Forge

Woodard

NAT_LX29_OutdoorLifestyle_1_28_NoAds.indd 1

1/28/16 4:37 PM


SPECIAL ADVERTISING SECTION

LaCANTINA OUTDOOR LIVING

DOORS

A pioneer of the folding and multi slide door industry, LaCantina Doors has brought the desire for alfresco living to the forefront of the residential market, making indoor-outdoor living possible without sacrificing convenience, function or design. The company’s variety of door types and materials, including folding, sliding or swinging and aluminum or wood, enables the achievement of any aesthetic. “High quality, effortless performance, energy efficiency and durability are key elements found in all of our products,” says Lee Maughan, LaCantina’s general manager and vice president. 2

by BUILD LLC.

3

O N TR E N D Size: Larger panels 1

ENVIRONMENTALLY SMART. LaCantina doors are made in a state-of-the-art facility in California to ensure that the best quality, consistency and highest manufacturing standards are upheld. “Driven by design, our experience specializing in the development and refinement of these products allows us to take advantage of new technologies and offer the best options available,” Maughan says. Additionally, the company designs its products with the environment wholly in mind, with energy efficiency, recycled materials and active participation in conservancy organizations at its core. “LaCantina’s doors come standard with low-e, double-paned tempered glass,” he says. “We are also a member of the Forest Stewardship Council and U.S. Green Building Council and offer LEED points for certification.”

NAT_LX29_OutdoorLifestyle_1_28_NoAds.indd 2

Form: Narrow stile and rail profiles Materials: Aluminum and wood Most In Demand: Systems that are energy-efficient and versatile

“

We create products that open spaces and allow for more natural light and fresh air, promoting greener living.

1. C  ontemporary Clad sliding system with a square profile, clear anodized exterior finish and mahogany interior. 2. A  luminum Wood multi slide system with bronze anodized exterior finish and vertical-grain Douglas fir interior. 3. A  luminum Thermally Controlled multi slide system with clear anodized exterior finish.

1/28/16 4:38 PM


MAD E FO R LIVI N G

L ACANTINADOORS.COM

O P E N S PAC E S 速

|


SPECIAL ADVERTISING SECTION

WOODARD OUTDOOR LIVING

2016 marks Woodard’s 150th anniversary, a testament to the quality of its products and service. Founded in Owosso, Michigan, where its handcrafted outdoor furnishings and accessories are still manufactured today, Woodard’s unique business model has lent itself to more than a century of success. “Our longevity can partly be attributed to offering a diverse array of designs and the ability to customize (including COM). With carefully curated collections offered in a host of finishes and textiles, we are able to satisfy our clients’ style preferences and provide timely delivery. It’s a recipe for success that retailers, interior designers and consumers appreciate,” shares a Woodard professional. During its tremendous tenure as a premier outdoor furnishings manufacturer, the company has seen trends in design and lifestyles come and go, to only return again. While the variables have been myriad over the past 150 years, the constant hallmarks of quality- and comfort-driven products have given Woodard its longstanding position at the top of its field.

TR EN DS I N O UTDOO R FU R N I S H I N G S

“

The seating comfort of outdoor furnishings rivals that of indoor upholstered furniture.

1

1

The new neutral. Gray reigns supreme, with bold color pairings in the form of accent pillows, especially in red. A color combination of note. Woodard’s No. 1 frame finish, textured black, creates a striking look when complemented by its bright white fabric. More table space. Woodard has experienced an increase in demand for dining tables that seat 8 to 10 people. These are often paired with low-maintenance sling or cushionoptional iron and aluminum chairs that make cleanup a breeze. Fire features. Woodard now offers four heights of fire tables: chat, dining, counter and bar. Fresh designs with existing pieces. Many of Woodard’s collections are designed for reconfiguring. The Metropolis sectional, for example, has seven components that can be combined into dozens of arrangements. An open-air must-have. Umbrellas are important for any open patio and can be custom fabricated in an array of sizes and fabrics. 1. T  he Jax collection combines elegance with a modern aesthetic. Shown in graphite, available in 30-plus finishes. 2. T  he comfort of wicker without the upkeep, Isabella’s oversize seat is as sumptuous as it is carefree.

2

NAT_LX29_OutdoorLifestyle_1_28_NoAds.indd 7

3

3. S  alona seating surrounds a fire table with a hammered top to add warmth to this dining space.

1/28/16 4:38 PM


Celebrating 150 Years of Quality Furniture Craftmanship in 2016

ALL WEATHER IRON WOVEN ALUMINUM SEATING DINING FIRE TABLES ACCENTS woodard-furniture.com


SPECIAL ADVERTISING SECTION

HUBBARDTON FORGE OUTDOOR LIVING

The Shard LED sconce features thick, handpoured, clear glass blocks embedded with gray shards.

At Hubbardton Forge, the quest for quality and longevity begins with diligence. The lighting company’s craftspeople aim to satisfy each client’s unique lighting needs, whether uplighting, downlighting, a combination of both or creating dark sky-friendly systems, which aim to minimize the harmful effects of light pollution. The Vermont-based lighting manufacturer

“

has led the industry since its inception more than 40 years ago in the realms of sustainable,

Outdoor living spaces are extensions of the indoor spaces.

environmentally conscious design and myriad uses of steel and other metals. “We understand that people are bringing art and design into their homes or workplaces when they invest in Hubbardton Forge lighting,” shares the company’s design director David Kitts.

2

1

3

1. The Collage LED outdoor sconce has geometric layering, and the Planar dining pendant was inspired by Frank Lloyd Wright’s Fallingwater home. 2. T  he Halo outdoor sconce incorporates a thick, handblown glass and two intersecting rings of metal. 3. T  he Double Axis LED outdoor sconce features handcrafted metal bands embracing a thick glass rectangle.

NAT_LX29_OutdoorLifestyle_1_28_NoAds.indd 5

LIGHTING THE OUTDOORS SUSTAINABLY + ARTFULLY Form and function. Advances in finishes, materials and technology allow Hubbardton Forge to bring lighting outdoors that isn’t exclusively functional or an accent piece but a potential focal point for outdoor spaces. Industry pioneers. Hubbardton Forge is one of the first businesses in Vermont to use powder coating and aqueous metal cleaning and the first in the world to beta test a phosphate-free bioremediation cleaner. In other words, the firm is committed to thinking globally while acting locally. LED. In 2015, Hubbardton Forge introduced dining pendants using an LED light guide platform. These thin light emitting surfaces create a consistent diffused light, perfect for highlighting decorative elements and bright enough for functional applications.

1/28/16 4:38 PM


All Designs and Images ©2016 Hubbardton Forge®. All Rights Reserved.

N ew 2016 Ursa LED Outdoor Sconce and Celesse Pendant

designers and makers of fine hand-crafted lighting • castleton, vermont usa • 800-826-4766 luxe@vtforge.com • hubbardtonforge.com


SPECIAL ADVERTISING SECTION

ELDORADO OUTDOOR LIVING

STONE

For more than 40 years, Eldorado Stone has demonstrated an undeniable passion for creating authentic products that not only elevate quality and design, but also attainability. The company, known for its artisan fire bowls, has become a staple in the outdoor living industry. “As the outdoor industry continues to evolve and as outdoor space has become a permanent fixture into our lives, Eldorado Stone has remained on the forefront of design and product by offering luxury items to meet design trends,” says the company’s president Brent Spann. “The fire bowl line is versatile, from large and grand to sleek and minimalist.”

2

“

Creative interior and landscape designers are creating spaces that mimic each other’s spaces, further blending the lines of where the indoors start and the outdoors end.

1

ELDO R ADO STO N E’ S O UTDOO R TR E N DS TO N OTE 3

1. The monolithic square design of Talus creates an impressive contemporary centerpiece. 2. L  yra exudes a modern, linear design with a gently sloped fire feature. 3. T  he subtle curves of Equa create a pleasing shape ideal for intimate conversation spaces or a personal retreat.

NAT_LX29_OutdoorLifestyle_1_28_NoAds.indd 4

• Fire features are being incorporated into the patio or poolside hardscape rather than being separated from the main space. • A focal point, aka “conversation space,” around the fire feature is a new, much-welcomed standard. • Spaces are being built to extend the outdoor living season through shading, heating and fabrics (draping to use space during rain). • Colors continue to trend to modern gray (dark and light), along with cream, with small pops of color. • Fixtures mimic indoor fixtures (outdoor furniture and décor resembles indoor furniture and fabrics). • Complete outdoor bathrooms are being added to eliminate the need to enter the primary living space.

1/28/16 4:38 PM


THE ART OF FIRE.

Each Eldorado Firebowl has been hand-crafted by our artisans through an extensive four-step finishing process, guaranteeing a one-of-a-kind creation with subtle variations in color and texture similar to natural limestone. Select from our extensive collection of traditional to modern designs with your choice of 4 colors in either honed or travertine finishes. Gather your friends and family, and experience your new â&#x20AC;&#x153;great roomâ&#x20AC;? that just happens to be outside. eldoradostone.com/firebowls


SPECIAL ADVERTISING SECTION

FLEETWOOD OUTDOOR LIVING

WINDOWS + DOORS

Through dedication to architectural integrity, attention to detail and a mastery of green building, Fleetwood Windows & Doors has become a market leader for progressive, indoor-outdoor windows and doors that are environmentally sound, technologically advanced and aesthetically striking at once. “Fleetwood employs several engineers to be certain that designs and processes remain on the cusp of available technologies,” says Mark McCoy, Fleetwood’s VP of sales. “The custom nature of Fleetwood requires more personal craftsmanship for many of its processes.”

MATERIAL OF CHOICE: ALUMINUM Fleetwood’s pursuit for “building it better, not cheaper” has positioned the company as the only aluminum door and window manufacturer that makes much of its own hardware. Commercial products use standard market hardware, such as rollers, locks and handles, that are commonly mass-produced. Fleetwood creates high-grade stainless steel hardware, whereas commercial products typically use zinc. 1. F  leetwood products create dramatic openings and seamlessly blend indoor and outdoor space. 2. S  imple, clean designs accentuate the beauty of the surrounding architecture and showcase spectacular views. 3. F  leetwood’s extensive product line includes sliding doors, hinged and folding doors, windows and impact-rated products.

1

“

Only Fleetwood’s pocket doors allow for the largest view when closed and a 100-percent open space when pocketed.

2

NAT_LX29_OutdoorLifestyle_1_28_NoAds.indd 3

3

1/28/16 4:38 PM


SPECIAL ADVERTISING SECTION

PRIDE OUTDOOR LIVING

FAMILY BRANDS

Creating an outdoor space that is personal and built upon the homeowner’s living style is key.

Outdoor furnishings have undergone subtle but well-received transformations over the

ACHIEVING OUTDOOR LUXURY

past few years, starting with the movement toward more pared-down, contemporary designs and neutral palettes. At the forefront of today’s outdoor furnishings—a leader not only in aesthetics but also composition—is Pride Family Brands. The contemporary, luxury

Soft colors, minimalist designs. “The new neutral follows the trend of simplicity, with whites and grays appearing in cushions,” Lowsky says. High-end finishes. Outdoor finishes have historically sacrificed design for durability, but today’s options, including platinum and jasmine, achieve a luxurious, modern motif. Made-to-last materials. “With a natural resistance to corrosion and rust, aluminum offers strength and easy care,” Lowsky says. “It also offers a range of style options, including cast, wrought and extruded designs.” Warmth + ambience. Fire table designs in classic and contemporary styling remain a highly popular addition to today’s outdoor spaces, along with accessories to extend the enjoyment of gathering around the fire.

outdoor furnishings and accessories purveyor has been providing best-in-class products for more than four decades, giving way to artisanal outdoor environments that speak to practicality and design. “The functionality of each piece, whether action seating, state-ofthe-art fire features or intricate cast elements, is a result of the total attention to detail for which Pride Family Brands is known,” shares the company’s CEO Steve Lowsky. “Further,” he adds, “our hundreds of options in design, finishing, fabrics and details enable each piece to deliver personal outdoor artistry.”

2

1

1. Villa Bianca is handcrafted with classical features, intersecting back and arm elements, an open profile and Empire-style legs. 2. The Eclipse Collection showcases a handcrafted linear styling that incorporates a slender profile and angled arms and legs.

3

3. Clean lines, crisp angles and tailored seating come together in the Park Place Collection’s sectional seating.

NAT_LX29_OutdoorLifestyle_1_28_NoAds.indd 6

1/28/16 4:38 PM


R

AMERICANSALE.COM LAKE ZURICH | CAROL STREAM | NAPERVILLE | ROMEOVILLE | ORLAND | BRIDGEVIEW | MERRILLVILLE | LANSING

Dial 708.623.1476 to schedule a complimentary consultation with a Product Design Specialist and mention this LUXE ad when you visit our stores to receive exclusive promotions.


R G RUGGUY G GALLERIEZ, INC

RugGuy Galleriez, Inc, is a proud partner with GoodWeave. â&#x20AC;&#x153;My factories in Nepal and India have been working with GoodWeave to eradicate child labor in the rug industry. A percentage of each rug sold goes directly to GoodWeave International.â&#x20AC;? -Mark Readel, President

Art for the Floor, a soul for your room.

TM

Made-to-Order stair runners.

Engineered shape, design and color to fit any staircase. Hand-knotted in Kathmandu, Nepal. Made from 100% Himalayan wool & fine organic silk. AcanthusDeluxe-Champagne/Charcoal

Long-lasting quality. Luxurious feel. Original, bespoke design.

312.933.8321 | Mark@TheRugGuy.com | www.TheRugGuy.com


Exceptional food, wine and service in a comfortable setting. 444 N. Wabash Avenue, Chicago 路 312.626.2444 路 BennysChopHouse.com


Shop where the designers shop!


“I often travel across 15 time zones for my clients, so I depend on my Hastens Proferia from Chicago Luxury Beds to give me the most restorative sleep after exhaustive travel. And with clients who are as busy as I am, I know the one thing that I have to include in every bedroom design is a bed from Chicago Luxury Beds.” — Hunter Kaiser, HK Creative for Life

OUR COLLECTION

lincoln park showroom

river north showroom

1919 n. clybourn avenue

440 n. wells street

773.661.0851

312.527.5337

complimentary parking

near the merchandise mart

CHICAGOLUXURYBEDS.COM


Distributed exclusively by avanti Gallery

P (847)681-8000 E INFO@AVANTIGALLERY.COM W WWW.AVANTIGALLERY.COM


THE LOOK Our expanded kitchen and bath coverage features seriously chic spaces with plenty of print-heavy palettes, gorgeous color and tech-savvy additions. PRODUCED BY BRIELLE M. FERREIRA

COM_LX6_TheLookOpener_185.indd 185

1/21/16 2:48 PM


THE LOOK / KITCHEN + BATH

KITCHEN + BATH

OUTSIDE THE LINES COLOR REENERGIZES THE HOME’S MOST-FREQUENTED ROOMS FOR STUNNING SPACES THAT SHUN TRADITION AND DARE TO SHAKE THINGS UP. WRITTEN BY BRIELLE M. FERREIRA

Typically, when whipping up a confectionary masterpiece, you don’t want to break the mold; it’s a vital part of keeping those baked goods looking their best. But that’s where following form in the kitchen should end: The best kitchen design is equal parts functional and unexpected, which is why incorporating color is becoming such an important element for a truly remarkable space. So, while crisp white cabinetry in both the kitchen and bathroom isn’t going anywhere soon, mixing in bold hues—whether it’s on the island and appliances in the kitchen or in the form of a statement-making wallpaper in the powder bath—is fast becoming the not-so-secret ingredient to cooking up spaces that will stand the test of time. Here, we celebrate the color-happy palettes and products that are taking the workhorse rooms of the home from bland to beautiful.

HAUTE DISH TAYLOR BORSARI

Designer Taylor Borsari channels Morocco in a Coronado, California, kitchen that dazzles with heavy doses of color, pattern and glammed-out gold. taylorborsari.com Share your design vision. The house was a historic remodel, and the kitchen was a blank space aside from the blue La Cornue oven. My first goal was to integrate the color of the range so it felt like part of an overall story rather than a random dash of color. I think many are nervous to jump into a bold range choice, but this is proof that it can be done without being too overwhelming.

Best ways to introduce pattern into the kitchen? I love patterned backsplashes! This is an area where you can really set the tone for a kitchen, and it’s an obvious area you can have a lot of fun with. Even tonal or monochromatic patterns can add interest. In this kitchen, we also added the carved island, which gave us a nice, ethnic twist to help balance the backsplash, as well as the very colorful range.

COM_LX6_TheLook_KitchenBath_186-194.indd 186

How can color revive and freshen up a kitchen? Color is a great addition to everyday life. White is classic and timeless, of course, but it is also a very safe option. This kitchen is a bit of a hybrid of pattern and color, and I think it is so much more interesting as a result. Plus, as more spaces are openplan these days, embracing a little more color in kitchens allows you to connect rooms more cohesively.

1/21/16 2:45 PM


PHOTOS: KARYN MILLET.

The island, which is painted in Benjamin Mooreâ&#x20AC;&#x2122;s Brick Red, is surrounded by stools from Ballard Designs beneath a handsome vintage chandelier. The striking backsplash tiles are from Mosaic House.

LUXESOURCE.COM / 187

COM_LX6_TheLook_KitchenBath_186-194.indd 187

1/21/16 2:45 PM


THE LOOK / KITCHEN + BATH

BLACK

BEAUTY Bringing color into the kitchen doesn’t have to mean looking to the rainbow for inspiration: quiet black matte can be just as impactful and statement-making, as demonstrated by the latest addition to Brizo’s high-fashion faucet line. Featuring a hidden pull-down wand, the Solna faucet makes a big impression with its articulating arm and fashion-forward finish. brizo.com

It’s no surprise that open shelving continues to be wildly popular in today’s kitchen, but for lovers of color, this modern design device is even more effective. Stacking brightly colored bowls, glasses, mugs and ceramics can infuse happy hues into the most neutral of kitchens, making it the perfect solution for homeowners who are looking to play it a little safer but still want to incorporate an element of fun and whimsy into their rooms. This vignette from designer Emily Henderson shows that there are no rules when it comes to styling your shelves; just don’t be shy to share your favorite pieces, regardless of color scheme or theme. stylebyemilyhenderson.com

FREE & CLEAR Snaidero’s newest introduction, Code, in collaboration with designer Michele Marcon, is challenging the kitchen’s status quo with its innovative paint-by-number system. In Code, consumers can opt for cabinets in varying finishes and colors with an easy online ordering system that makes it a breeze to mix and match for infinite layout solutions. It’s about as personal as you can get in the kitchen. snaidero-usa.com

BAKE OFF OFFICINE GULLO Crafted from heavy-gauge stainless steel and solid brass, Italian manufacturer Officine Gullo’s Grand Villa oven range is serious about both cooking and its own good looks. And the best part? The oven can be fabricated in literally any RAL color—Europe’s version of the popular Pantone system—for endless opportunities for inspiration and customization. officinegullousa.com

BLACK BEAUTY PHOTO: COURTESY BRIZO. SHELF LIFE PHOTO: TESSA NEUSTADT. BAKE OFF PHOTO: COURTESY OFFICINE GULLO. FREE & CLEAR PHOTO: COURTESY SNAIDERO.

SHELF LIFE

188 / LUXESOURCE.COM

COM_LX6_TheLook_KitchenBath_186-194.indd 188

1/21/16 3:04 PM


signature

discover your

style

DOWNTOWN CHICAGO

BURR RIDGE

GLENVIEW

KOHLERSIGNATURE.COM


THE LOOK / KITCHEN + BATH

Wash UP

While Duravit’s L-Cube vanity, designed by Christian Werner, takes its cues from one of geometry’s simplest shapes, it is far from ordinary. Refined down to its most fundamental form, it’s the unassuming details that sing here: from the handle-free façade to the elegant shadow gap between the countertop and the shelving—not to mention the line’s nearly exhaustive color options, like the pretty peachy version shown here. duravit.us

EVERYDAY

ART Last year’s trend toward metallics continues to be prevalent this year, and it’s easy to see why in the presence of Groupwork’s latest line of fi xtures for the bathroom, Simplify. Australian designer Sarah Trotter’s newest initiative, created in collaboration with architect Murray Barker and artist Esther Stewart, turns something as practical as a towel rack into a veritable work of art. groupworkstudio.com

MAKE A SPLASH Not content to let pristine porcelain tubs lie, the creative team at Aquabrass recently released its Kanvas collection of highly artistic freestanding tubs, each hand-painted and signed by the artist responsible for the striking scenes depicted on their glossy white finishes. From cool graffiti patterns to multicolor mosaic-inspired prints, the limited-edition series promises you’ll have a lot more to soak in than bubbles during bath time. aquabrass.com

WASH UP PHOTO: COURTESY DURAVIT. EVERYDAY ART PHOTO: COURTESY GROUPWORK. MAKE A SPLASH PHOTO: COURTESY AQUABRASS.

GROUPWORK

190 / LUXESOURCE.COM

COM_LX6_TheLook_KitchenBath_186-194.indd 190

1/21/16 2:45 PM


WALK RIGHT IN Shop the world’s largest collection of premier boutiques for home building and renovation. 30 Boutiques. 1 Location. Merchandise Mart, Chicago M-F 9–5 SAT 10–3 312.527.7939 LUXEHOME.COM

KITCHEN

BATH

TILE

CABINETRY

APPLIANCES

HARDWARE

FLOORING

WINDOWS

DOORS

PAINT

LUXEHOME BOUTIQUES INCLUDE: Amiel.US Ann Sacks Artistic Tile Bentwood of Chicago Carlisle Wide Plank Floors The Chopping Block Christopher Peacock de Giulio kitchen design Devon&Devon

Dream2O Ernestomeda Chicago Exquisite Surfaces FANTINI | THE GALLEY Farrow and Ball GRAFF Katonah Architectural Hardware Keeler Lefroy Brooks Chicago

Miele Experience Center Monogram Design Center NEFF of Chicago Paris Ceramics Pella Crafted Luxury Plain & Fancy by Dandamudi’s Poggenpohl Porcelanosa Tile/Kitchen/Bath/Hardwood ROHL

Scavolini Store Chicago The Shade Store Sherwin-Williams Color Studio SMEG USA Studio Snaidero Chicago Sub-Zero and Wolf Showroom Valcucine Chicago Waterworks Wood-Mode Lifestyle Design Center


THE LOOK / KITCHEN + BATH

Sconces from Galerie des Lampes and an art piece, Jay Hodgins’ Straumi 8, add an air of modern elegance to the room. The chair is custom by Anne Hepfer, upholstered in fabric from Kravet and trim from Samuel & Sons.

This serene vanity space by Toronto designer Anne Hepfer is transformed with color. Benjamin Moore’s Coventry Gray on the cabinetry acts as both statement-maker and pretty neutral against the softer walls painted in Benjamin Moore’s Stonington Gray. “The cabinetry is tailored but feminine, with some round detailing to maintain traditional character but in a cleaner more current design,” explains Hepfer. Far from traditional, though, is what she sees as the next big thing in powerful palettes: “I have a feeling that gray is here to stay for a while, so we’re popping spaces with bold hits of color—fuchsia, canary yellow, teal—and, of course, black and white accents. I’m loving the play of contrast and unexpected combinations!” annehepfer.com

PHOTO: VIRGINIA MACDONALD.

VANITY PROJECT

192 / LUXESOURCE.COM

COM_LX6_TheLook_KitchenBath_186-194.indd 192

1/21/16 2:45 PM


YO U R S TYL E IS OUR PA S S I O N

222 MERCHANDISE MART PLAZA, SUITE 1499 CHICAGO, IL 60654 | WWW.DEAURORA.COM


THE LOOK / KITCHEN + BATH

“USING COLOR ALLOWS US TO CREATE BATHROOMS THAT TRANSFORM INTO UNEXPECTED, JEWEL-LIKE SPACES.”

“We love designing with black and white in our projects; although it’s a classic color combination, there are endless variations on this palette that feel current.”

“BY LIMITING OUR USE OF VIBRANT COLOR TO SMALL DOSES, WE WERE ABLE TO CREATE A REALLY SPECIAL MOMENT, WHILE ALSO MAKING SURE THE SPACE FELT TIMELESS.” -AIMEE WERTEPNY, projectinteriors.com

-DAVID JOHN DICK, discinteriors.com Clockwise from top left: This bathroom by the team at Studio Gild features wallpaper from Élitis. Aimee Wertepny worked with designer Jennifer Kranitz on this colorful vanity sporting handpainted silk paper from Porter Teleo; the stool is from Bernhardt Interiors. The modern wallpaper from Holland & Sherry in this bathroom from DISC Interiors joins pretty sconces from Visual Comfort and a mirror from Made Goods in defining the chic space.

STUDIO GILD PHOTO: MIKE SCHWARTZ. PROJECT INTERIORS PHOTO: TONY SOLURI. DISC INTERIORS PHOTO: COURTESY DESIGNER.

-JENNIE BISHOP, studiogild.com

194 / LUXESOURCE.COM

COM_LX6_TheLook_KitchenBath_186-194.indd 194

1/21/16 2:46 PM


Beauty through all seasons. Inspiration around each corner. Space that’s uniquely you.

WWW.M A R I A N I L A N D S C A P E . COM

847-234-2172

Image © Linda Oyama Bryan

DESIGNED BY MARIANI. FOR YOU.


NEFF of Chicago

Custom Cabinetry and Design Studio

Luxehome at The Merchandise Mart | Suite 145 | Chicago | 312.467.9585

www.neff-of-chicago.com


THE LOOK / THE REPORT

PHOTO: MATT WINQUIST.

This clean, modern Phoenix kitchen by designer KT Tamm features high-end cabinetry from Bulthaup and a string of edgy, artistic lighting pendants from Studio Italia Design.

198 / LUXESOURCE.COM

COM_LX6_TheReport.indd 198

1/21/16 5:54 PM


Report THE

A CLOSER LOOK AT WHAT MAKES THE KITCHEN AND BATH SOME OF OUR FAVORITE ROOMS IN THE HOME. WRITTEN BY BRIELLE M. FERREIRA

MADE TO ORDER Kitchens and bathrooms spent the first part of their lives inside the home hidden away, separated from the pretty living and family rooms where all the action was happening. Today, though, the kitchen and bath are front and center, with gorgeous new options that transform the rooms into gallery-like spacesâ&#x20AC;&#x201D;with faucets that double as works of art, tiles that look like they belong in a museum, and lots of great new technology that ensures these spaces are as hardworking as they are good-looking. On the following pages, Luxe examines all the ways the kitchen and bath have been transformed for modern living.

COM_LX6_TheReport.indd 199

1/21/16 5:54 PM


1

MATERIAL MAGIC For this handsome Santa Monica, California, kitchen by architect May Sung, materials take center stage to great effect thanks to the wonderful grain and texture of the reclaimed wood on the island and perimeter cabinetry, which contrast powerfully with the limestone backsplash tiles from Walker Zanger. “We wanted to create an oasis that is masculine and bring in natural material, without looking like a lumberjack’s cabin,” says Sung. “All of the material had to be genuine and true to that vision.” gsubuda.com

PHOTO: MANOLO LANGIS.

THE LOOK / THE REPORT

200 / LUXESOURCE.COM

COM_LX6_TheReport.indd 200

1/21/16 5:54 PM


630.963.9322 apexwoodďŹ&#x201A;oors.com

Architecture by Bill Massey of Massey Associates Architects www.masseyassociates.com

ST E P INTO A PE X . ST E P ON TO AR T.


3

SPLASH ZONE PHOTO: JOE SCHMELZER. COOL BREW PHOTO: COURTESY MIELE.

THE LOOK / THE REPORT

COOL BREW

Sure, the classic French press has its own rustic charm, but nothing says, “I’m serious about my coffee,” like a brew station that can deliver rich espresso, sweet lattes and foamtopped cappuccinos at the touch of a button. Miele’s CM6310 Countertop Coffee System does just that and then some; with four user profiles to account for different tastes and an integrated cup warmer, it’s just like having your own barista at home— misspelled name on a paper cup not included. mieleusa.com

2

SPLASH ZONE

A backsplash represents the founding principles of a kitchen: It should be both beautiful and functional. But, in the case of the New Ravenna tile backsplash in this kitchen by Los Angeles-based designer Kishani Perera, it goes one further: being totally statement-making. Luckily, the vast expanses of white on the cabinetry make it, and the warm, chevron-patterned wood flooring that accompanies it, visually stimulating but not overwhelming. kishaniperera.com

202 / LUXESOURCE.COM

COM_LX6_TheReport.indd 202

1/21/16 5:55 PM


Hickman Design Associates 312-733-9520

www.hickmaninteriors.com Follow Us on Pinterest


THE LOOK / THE REPORT

4 BRASS

THIS PAGE: BRASS TACKS PHOTO: CASEY KEASLER. OPPOSITE: GILDED CAGE PHOTO: COURTESY HUDSON VALLEY LIGHTING. TAKE A DIP PHOTO: COURTESY PATRICIA MCDONAGH.

TACKS

Touches of gold and brass are slowly taking the place of chrome and polished nickel in contemporary bathrooms, thanks to their easy warmth and timeless aesthetic. In this space by designer Casey Keasler, from the creative Portland studio of Casework, brass faucets from Kohler join mirrors—replicas of 1930s French wall consoles from Restoration Hardware—in creating a can’t-look-away sink area. The golden hues are the perfect complement to the cabinetry’s bold teal color. “The brass helped create a certain richness,” says Keasler. “I like a clean, quiet space where everything is done for a reason and not because of a trend.” casework.it

COM_LX6_TheReport.indd 204

1/21/16 5:55 PM


5 GILDED CAGE

The old-timey good looks of the Heirloom sconce from Hudson Valley Lighting prove that great design doesn’t start on the front lines of trends. Inspired by memories of early 20th-century America and the onset of the Industrial Age, this fixture boasts architectural style in spades, in addition to quirky appeal thanks to its sweetly monogrammed on/off paddle tab switch. Pair it with an Edison-style bulb for picture-perfect retro style. hudsonvalleylighting.com

6

TAKE A

DIP

It’s hard to replicate the drama of a freestanding claw foot tub, but this pretty space by Boston designer Patricia McDonagh makes it look simple. Clad in a warm envelope of artistically veined Calacatta marble, the tub has a starring role in this simple, traditional bathroom. It’s yet another reminder that the right materials—in addition to a visually stunning bath filler—are all that’s needed to glam up a small space. patriciamcdonagh.com LUXESOURCE.COM / 205

COM_LX6_TheReport.indd 205

1/21/16 5:55 PM


8

THE LOOK / THE REPORT

A IS FOR

APP

Forego analog living in the kitchen with this lineup of cool timesaving tech additions to your cooking arsenal. These app-enabled new products are designed to ensure you ace every recipe and on-the-fly grocery-shopping trip in the New Year and beyond.

7

THE BUTLER As kitchens’ roles in the home continue to expand—from utilitarian outpost to entertaining hotspot—so, too, have their square footage, and with that comes an increased interest in the once-forgotten butler’s pantry. One look at this space by New Jersey-based designer Heidi Piron, though, with its custom gray paint job and Rejuvenation hardware, makes it easy to see why this onetime kitchen staple is making a comeback. heidipiron.com

DROP SCALE Swap out those old, messy measuring cups for this handy digital scale that makes it easy to follow app-provided recipes by weighing important ingredients. getdrop.com

HIKU This handy magnetized kitchen tool sticks to your refrigerator and helps you craft your grocery list thanks to barcode-scanning and voice-recording functions. hiku.us

THE BUTLER PHOTO: CHRISTIAN GARIBALDI. A IS FOR APP PHOTOS, FROM TOP: COURTESY PANTELLIGENT; COURTESY DROP SCALE; COURTESY HIKU.

PANTELLIGENT No more guesswork on how to grill the perfect steak or salmon; this digital pan is connected to an app that tells you exactly when to go for the flip. pantelligent.com

206 / LUXESOURCE.COM

COM_LX6_TheReport.indd 206

1/21/16 5:55 PM


THE LOOK / THE REPORT

10 WINED

UP

The only thing better than a glass of wine at the end of a long day is wine on tap, which is why Dacor’s Discovery WineStation is a dream come true for vino enthusiasts. Designed to keep up to four bottles fresh and preserved for up to 60 days, the station is fully automated and temperature-controlled for the perfect pour every time; plus, its handsome stainless-steel finish and LCD displays allow it to blend in seamlessly with the kitchens’ large appliances. dacor.com

9

Christopher Peacock’s collection of custom-made kitchen cabinetry is well-known for its high-quality construction and artisanal attention to detail, but that’s not all that makes its tony offerings great. The company is as committed to cutting-edge cool as it is to craftsmanship, and its line of 90 custom paint colors formulated by the oft-celebrated Fine Paints of Europe is proof positive of that. Available exclusively to owners of Christopher Peacock kitchens, the paints are applied on-site by company-approved installers for a truly enviable, unique finish. peacockhome.com

PALETTE PERFECT PHOTO: COURTESY CHRISTOPHER PEACOCK. WINED UP PHOTO: COURTESY DACOR.

PALETTE PERFECT

208 / LUXESOURCE.COM

COM_LX6_TheReport.indd 208

1/21/16 5:55 PM


Hinsdale

Oak Brook

Western Springs

2014 Crystal Key Recipient


SPECIAL ADVERTISING SECTION

INTERIOR DESIGNERS

SUSAN BRUNSTRUM SWEET PEAS DESIGN Studio: 507 East Park Avenue • Libertyville, Illinois • 847.816.1296 Home Office: 100 East Bellevue Place • Chicago, Illinois • 312.572.9090 susan@sweetpeas-inspired.com sweetpeas-inspired.com

More than a decade ago Susan Brunstrum launched Sweet Peas Design as a way to combine her creativity and entrepreneurial spirit—and she’s never been more excited and inspired. “From a one-woman firm in my home, I have nurtured Sweet Peas Design into an award-winning, full-service studio with a team of six and a discerning clientele,” she says. “Our LivableLuxe style has become known as ‘the little black dress of design.’ It is relaxed, elegant, comfortable and refined, the perfect fit for any occasion.” Professionalism, creativity and attention to detail are at the heart of the Sweet Peas Design studio. “We believe that design is a process, not a product. It is our journey with our clients that leads to the best results,” she says.

A home should tell the story of those who live there.

How would you describe the personality of your business? Like me, Sweet Peas Design is confident, überorganized, instinctive, solution driven, tuned in to our clients and naturally creative. Who or what inspires you most? Art, architecture and nature inspire me, but anything that touches my senses has the power to move me. And of course, Coco Chanel for her style and business sensibility. What is one thing your clients would be shocked to know about you? I have always wanted to go on a cattle drive out West. When my two children were younger, we visited a dude ranch several times. We loved horseback riding and cattle penning. Plus, who can resist a good-looking cowboy?

1

2

What projects have brought you the most satisfaction and why? Our philanthropic work. My team and I designed the living room and family room for a Waukegan-based family for NBC/LX.TV’s George to the Rescue program. The look on the father’s face at the “reveal” brought tears to my eyes. What are your favorite hobbies? Fashion, touring art galleries and boxing with my trainer. I love the rhythm of it, and I’ve developed a mean uppercut. You want me in a dark alley with you if things get rough!

3

1. Vintage paint palettes and brushes that I purchased at the Paris flea market a few years ago. Just think of the art they may have created!

How do you think your clients would characterize you? The Energizer Bunny. They wonder if I ever sleep.

2. I wear my late husband's wedding ring on my left thumb and his Movado watch every day without fail. 3. A channeled teapot that was my mother's. These objects are a few of my most precious possessions.

SweetPeasDesign.indd 1

1/21/16 12:25 PM


SPECIAL ADVERTISING SECTION

SweetPeasDesign.indd 2

1/21/16 12:25 PM


SPECIAL ADVERTISING SECTION

TRENDS IN RENOVATION ARCHITECTURE, DESIGN, BUILD + OUTDOOR LIVING The design-minded and novices alike are reaching similar conclusions when it comes to updating their homes: quality, utility and comfort prevail. Formal living may have lost some of its allure in lieu of more open, welcoming spaces that exude hearth, togetherness and camaraderie; and less, in regard to square footage, is sometimes moreâ&#x20AC;&#x201D;when done right. Read on and discover what the experts are saying about the latest trends in residential renovations.

CH_LX35_TrendsRenovation_1_28_NOADS.indd 1

1/28/16 12:05 PM


SPECIAL ADVERTISING SECTION

GENSBURG TONIOLO HARTING ARCHITECTS This newly built custom home in Michigan’s Harbor Country exemplifies the thoughtful blend of classical architecture with modern interpretations, vernacular and materials.

Some of the industry’s most esteemed professionals were asked about the state of residential remodeling in regard to design and lifestyle. What we learned is that the two are analogous: how people live, day to day, directly reflects their interiors and exteriors. Homeowners who love to entertain are among the biggest influencers, creating a new niche in the design industry—from fully equipped outdoor kitchens and comfortable outdoor entertaining areas to sprawling interior kitchen islands to open, family room-style spaces.

REINTERPRETING CLASSICAL HOMES

Cover images provided by (top to bottom) Sexton Development and Ilene Chase Design

Chicago’s North Shore abounds with character-filled, historically rich homes. The need for contemporizing many of these architecturally noteworthy residences is imminent but often requires near-surgical delicacy and broad insight into the style

luminary and one of the firm’s principals Jeffry Harting. “Do they entertain frequently or infrequently? We carefully attempt to thread the renovation and additions into the

and provenance of the home. Acclaimed architecture firm

fabric of the existing home.” The decline of superfluous

Gensburg Toniolo Harting Architects of Northbrook brings

spaces is a trend to note, especially formal living rooms,

valuable insight into the craft of historic renovations, starting with

which are converting into more intimate dens or libraries. In

what today’s homeowners are looking to accomplish aesthetically

new construction, the formal living room is often replaced

and structurally and how to achieve such changes. “Always

by an entertaining family room that is open yet defined

establish how the family lives in the house,” advises architectural

from the kitchen. Overall, residential informality and

MARCH/APRIL 2016

trends in renovation

CH_LX35_TrendsRenovation_1_28_NOADS.indd 2

1/28/16 12:05 PM


105 Revere Drive, Suite F2 | Northbrook, Illinois 60062

847.715.9395 | gtharchitects.com


SPECIAL ADVERTISING SECTION

comfort are decidedly in demand. “Clients are becoming more sensitive to a simpler lifestyle within their homes. Whether it be a historic renovation and addition or a new home, the house is about

THE PROS WEIGH IN ON RENOVATIONS, INSIDE + OUT

responding to everyday needs and livability,” Harting says.

THE OUTDOOR RENAISSANCE

"The family room is becoming the informal standard for entertaining friends and family and is no longer subjected to large televisions and sectional sofas."

Residential outdoor spaces have become true extensions of a home. Homeowners’ perspectives on how these spaces should be used have

–Gensburg Toniolo Harting Architects

“What’s trending today is using sustainability in all areas of landscape design.”

changed drastically over the past decade, with greater value placed on the quality of private, open-air living. In addition to embracing

–Chalet

environmentally conscious landscape ideals, the emergence of hardscape design has never been more popular. Chalet, the near-100year-old Wilmette-based landscape company, has experienced firsthand the evolution of the “yard” and its functions in the residential spectrum. Today, according to Robert Milani, a senior landscape

“With a push for eco-friendly design, we have been challenged to work with ‘regifted’ materials. We embrace the history and unique quality of these materials and turn them into current, functional, fantastic products.” –Ilene Chase Design

architect with the company, homeowners have become more educated on maximizing the possibilities of their landscape. “Many

“We are veering away from building rooms that are only used two or three times a year.”

request a landscape plan that accommodates their property for a

–Orren Pickell Building Group

variety of reasons, such as for entertaining, dining and family

“Successful remodeling has always been about two things: a solid plan and patience.”

gatherings,” he says. Other trends, Milani notes, include fire features,

–The Design Coach

CHALET

Top: A bluestone walkway directs visitors past a topiary focal point into the entrance garden. Classic lines, symmetry and manicured Green Velvet Boxwood hedges complement the home’s formal architecture.

Left: This garden

was created in a woodland area formerly overgrown with buckthorn. Native plants such as Trillium and Jack-in-the-Pulpit were preserved.

MARCH/APRIL 2016

“Lighting is one of the most overlooked elements of any home on both an interior and exterior level and, if designed and installed properly, can do wonders.” –Sexton Development

“Our clients are more conscious of the indoor air quality, which requires that we use natural fibers and products that are more environmentally sound.” –Michelle's Interiors

“Never choose the lowest bid. The lowest bid is almost always a sign that something has been overlooked.” –Lynch Construction Corp.

trends in renovation

CH_LX35_TrendsRenovation_1_28_NOADS.indd 3

1/28/16 12:05 PM


Providing quality service and inspiration to the north shore for nearly a century Lake Avenue at Skokie Boulevard, Wilmette, IL ChaletNursery.com

847.256.0561


SPECIAL ADVERTISING SECTION

outdoor kitchens, garden elements (pergolas, arbors), patios/terraces and vegetable/potager gardens. As for the environmental improvements to landscape design, Milani explains the merits of permeable paving, among other philosophical and methodical changes within the industry. “Hardscape materials, such as brick pavers, traditionally were impermeable; water would run off and overtax our storm sewers and increase erosion and flooding. Using permeable paving allows water to pass directly through joints within the paving,” he says. “In general, our clients request beautiful landscapes that perform well without the use of additional fertilizers, pesticides and maintenance. Sustainability not only reduces overall cost but also reduces the carbon footprint to the environment.”

THE ALLURE OF PRACTICALITY “My clients are looking for more functional design today,” shares highly regarded designer Ilene Chase. Indeed, discerning homeowners appreciate a realistic and concrete methodology applied to interior restorations. Ilene Chase Design delivers timeless

ILENE CHASE DESIGN

Above: Set in the North Shore, this custom master bathroom showcases Marmara marble through a unique design that creates art on the shower wall.

Below: This idyllic

1960s-inspired home gives way to the classic black and white finishes that showcase the lakefront property.

LIGHTING IS LIKE THE JEWELRY AND ACCESSORIES TO A GREAT OUTFIT MARCH/APRIL 2016

trends in renovation

CH_LX35_TrendsRenovation_1_28_NOADS.indd 4

1/28/16 12:05 PM


Live

FOR THE WAY YOU

888-PICKELL |

P ICKELL B UILDERS.COM

ARCHITECTURE • CUSTOM HOMES • REMODELING • KITCHEN & BATH DESIGN • INTERIOR DESIGN • HOME MAINTENANCE


SPECIAL ADVERTISING SECTION

ORREN PICKELL BUILDING GROUP

Top: The Lansdowne estate, a 14,500-square-foot European-inspired home designed by Benjamin Marshall in 1911 and renovated by Orren Pickell, stands as a proud monument to Chicago’s fine architectural legacy.

Right: Lansdowne’s kitchen renovation features Orren

Pickell’s custom Signature Collection cabinetry, a pewter range hood, high-end appliances and stone countertops.

Bottom: Lansdowne’s master bath renovation includes Orren Pickell’s

custom Signature Collection cabinetry, high-end plumbing fixtures and statuary marble floors, shower surround and countertops.

and classic design elements to the client who desires a unique and custom-finished home. “At Ilene Chase Design (ICD), we challenge ourselves with each project to provide a custom, high-end look while always being conscious of the function of the space.” As a seasoned interior designer who has worked on numerous remodels, Chase reflects on her personal experiences with clients who are about to begin the endeavor. “I sit down with my client for as much time as they need to review their reasons for the remodel. I want to make sure that every possible wish-list item is covered,” she says. “I am upfront with my clients about how to update their home to the current trends of building before they finalize their plans.” For the many homeowners who seek a small refresher before committing to a large-scale renovation, Chase recommends a new color palette on the walls or updated light fixtures. “Paint can be a drastic game changer. It can add drama or lighten up a space; it can make an old house feel new. My other great quick fix is lighting. This can completely change the style of your home.”

SMART CHANGES For Orren Pickell, president and CEO of the prominent Northfield-based home building firm Orren Pickell Building Group, most renovations are gradual, beginning with the kitchen

MARCH/APRIL 2016

CH_LX35_TrendsRenovation_1_28_NOADS.indd 5

trends in renovation

1/28/16 12:05 PM


SPECIAL ADVERTISING SECTION

DETERMINE THE BEST USE OF EVERY OUNCE OF A LIVING SPACE

or master bathroom and evolving to other spaces or elements within the home. The North Shore’s residentially rich communities continue to undergo gradual improvements, mostly in the realm of modernizing interiors of its homes to accommodate changes in lifestyles and design preferences. “There are a lot of renovations happening on the North Shore,” Pickell says. “I have found that once the kitchen and master bathroom are finished, we focus on some of the new trends in floor plans, which often leads to tearing down walls and making rooms bigger and more functional for the family.” The builder of more than four decades notes his clients are making greater commitments to their homes, opting for renovations that adhere to “aging in place” principles. “Many of our homeowners are now planning to stay in their homes as long as possible. This means that we’re designing and building homes for homeowners who plan to grow old in that home, and because of this, we have been building the master bedrooms on the first floor, making doorways and hallways wheelchair accessible and creating multipurpose spaces designed for varying uses as the family ages,” he explains. As for the “less-is-more” movement—eliminating nonessential rooms—Pickell has seen an increase among his clientele for such floor plans. “The whole concept is that homeowners want to have a smaller home, with every room being used, at minimum, on a weekly basis, resulting in less maintenance for the long term,” he says.

DESIGN WISDOM Nearly two decades of industry experience, in addition to a thriving design firm in Lake Geneva, has afforded Philip Sassano a unique perspective into the art and science of remodeling a home. “The best piece of advice I can give is to assemble a dedicated team early in the process. Unfortunately, sometimes the team isn’t assembled early enough, which leads to bad financial decisions, wasted time and creative opportunities missed,” he says. “When it comes to remodeling or new construction, I advise clients to have a significant number of lifestyle discussions with their designbuild team before they break ground or begin demolition.” Sassano’s company, The Design Coach, applies its design talent to a wealth of projects—from large additions to small upgrades room by room and everything in between. A strong emphasis from clients is to make the best use of living space—inside and out—with a focus on versatility and longevity. “We’ve seen an increased priority on no wasted

THE DESIGN COACH

Left: Vintage lanterns anchored by burlap chargers complete this lakeside tablescape.

MARCH/APRIL 2016

trends in renovation

CH_LX35_TrendsRenovation_1_28_NOADS.indd 6

1/28/16 12:05 PM


SPECIAL ADVERTISING SECTION

SEXTON DEVELOPMENT This pool deck, with an integrated hot tub and covered porch, is tucked behind this private English country manor, featuring a slate roof, country green windows and copper gutters and downspouts.

space or unused rooms. Designing interiors with a kind of functional flexibility is important,” he says. “Clients know they may only get one chance to remodel certain spaces: They want to know that the rooms can evolve with their lifestyle.” As for less construction-centered interior changes, Sassano delivers sage advice to readers: “We like to

TAKE ADVANTAGE OF EVERY OUTDOOR AMENITY YOUR LOT HAS TO OFFER

think fabric finishes a room. However, for a big impact, look at your ceilings and floors. Sometimes a little applied design on those areas can completely change the identity of a space.”

ENDURING ELEMENTS Drew Daniels of Sexton Development, a luxury custom home builder and general contractor in Lake Bluff, admits to being a little “old school” when it comes to trends and styles. His preference for traditionalism has resulted in a greater sense of timelessness in the homes he builds and remodels. He makes a strong case against “of-the-moment” design. “At some point, pretty much anything that is new and trendy is going to look outdated. Everything in the ’80s looks like it was built in the ’80s, and everything in the ’90s looks like it was built in the ’90s,” he says. “You can almost never go wrong with a classic design.” With a large repertoire of work throughout Chicago’s North Shore communities, Sexton Development has observed and responded to significant

MARCH/APRIL 2016

trends in renovation

CH_LX35_TrendsRenovation_1_28_NOADS.indd 7

1/28/16 12:05 PM


SPECIAL ADVERTISING SECTION

changes in standards of living, starting with sustainable building. “Without a doubt, the most substantial change in the industry is the integration of home automation and home control solutions. Younger homeowners expect it, and older homeowners should really consider it for the future resale of their homes,” Daniels says. However, he is quick to point out that the backbone of home automation systems is a strong network and a reliable Wi-Fi signal, which he feels is an afterthought on too many projects. Daniels goes on to say, “With the sheer number of handheld devices and new Wi-Fi-accessible home control products being offered to

A HOME SHOULD REFLECT ITS INHABITANTS

enhance life at home, a robust and reliable network must be the builder’s responsibility to guarantee the functionality of these products throughout the home.”

ATTAINABLE BEAUTY

MICHELLE'S INTERIORS

Top: This kitchen and family room, featuring high ceilings with wood detailing, is a wonderful space for cooking, entertaining and lounging.

Bottom: Warm colors and rich, layered rugs make this

living room, previously two unused spaces, ideal for entertaining.

“There are some wonderful new products that have been created to make homes beautiful without costing a fortune,” enthuses Michelle Rohrer-Lauer, owner of the esteemed Chicago interior design firm Michelle’s Interiors. In her robust career as a designer, Rohrer-Lauer has discovered myriad ways to enhance a home’s interior and has remained at the forefront of innovations within the industry. “Tile companies have created flooring that looks and feels better than ever before. Materials are more diverse, and so many companies have become more conscious of using recycled product. Technology has become part of our clients’ necessity, and because of that, we incorporate it into the design of every space we do.” For Rohrer-Lauer, whose work reveals a clean sophistication, simultaneous comfort and luxury is always an objective. “Our clients want their home to be cozy with clean lines that reflect their lifestyle. They want fabulous fabrics and artsy influences while still being in a very livable space where they can curl up with their legs on the sofa, play a game with their children or enjoy a glass of wine,” she explains. This very aesthetic, or more so, lifestyle, is one in which Rohrer-Lauer thrives. Her interiors speak to a contemporary audience—regardless of age—that appreciates streamlined, elegant design infused with high practicality. Her experiences in remodels prompt her to advise homeowners to consider the luxuries too, which often are unknown to them at the time of the renovation. “Clients may not be aware of the products that can improve their home, such as adding heated floors, heated shower seats, motorized window treatments, accent lighting and attention to the mud rooms.”

MARCH/APRIL 2016

trends in renovation

CH_LX35_TrendsRenovation_1_28_NOADS.indd 8

1/28/16 12:05 PM


S I M P LY. FA B U LO U S. D E S I G N .

New Construction

Interior Design

Renovation/Remodel

Chicago (312) 291-4466 www.MichellesInteriors.com Suburbs (847) 223-2660


SPECIAL ADVERTISING SECTION

FAMILY-FOCUSED RENOVATIONS Lynch Construction Corp. in Lake Bluff, under the auspices of Jeff and Joan Lynch, has meticulously transformed many residences to accommodate today’s shifts in lifestyle and people’s overall engagement with their homes. The firm was actually founded to fill a void in the North Shore for this purpose: to bring quality craftsmanship and design to the classic, turn-of-the-century homes that need updates, additions and beyond. “These houses cannot be served by Home Depot or your average contractor,” Joan says. “Instead, a new type of company was needed:

limited to just the interior of the house,” she notes. The Lynches also remark on the subtle but still impactful infusion of modern materials and accents into many of the area’s long-existing residences. “Old is new again; the appreciation and reimagining of midcentury modern houses is really exciting,” Jeff shares. “We are seeing an interest to revitalize and update these forgotten houses through the addition of adding warm materials (natural woods and stone) to the modern palette of glass and steel. The homes are livable and cutting-edge while being steeped in history and culture.” WRITTEN BY DEVON ROUSH

a construction company that embraced architects, project managers, carpenters and cabinetmakers. This has provided us unprecedented control of quality and budget.” While the Lynch Construction team notes the uniqueness of each home and client, there is a collective movement toward expansive gathering spaces. “The embrace of ‘living’ spaces tends to be most enduring. This could be a large kitchen with an ample seated island or a true family room,” she explains. “People more than ever want a space that they can enjoy with their friends and family. Entertaining is important.” One trend the Lynches have noticed is the extension of these gathering spaces into the backyard, as people now more than ever have a strong desire to embrace their whole site. “We have designed and built many screened-in porches and outside patios with built-in fireplaces and seating walls. Renovations are no longer

LYNCH CONSTRUCTION CORP.

Above: Working within the confines of a 1970s addition, Lynch Construction Corp. used existing attic space to add a dramatic ceiling to the family room.

Below: Removing a wall and adding windows opened up the existing

space to create a modern, open floor plan.

MARCH/APRIL 2016

trends in renovation

CH_LX35_TrendsRenovation_1_28_NOADS.indd 9

1/28/16 12:05 PM


ELEGANCE RESTORED

www.lynchconstruction.biz

847.295.1825


DON’T KNOCK ON WOOD, BET ON CONCRETE.

T he B O R E A L I S out d oo r con cr e te slab offe r s all th e str e n gth & du r abili ty o f mo dern T e cho - B l o c s t o ne s with ou t th e h igh le ve l main te n an ce of n atu r a l wo o d. De s i g n, art and s ci e n ce came toge th e r to cr e ate th e e ve r lastin g B O R E A L I S .

THE BEAU T Y O F W O O D , SE T I N ST ONE.

REDEFINING LANDSCAPE PRODUCTS ORDER YOUR FREE DESIGN CATALOGUE 1001 LANDSCAPE IDEAS

techo-bloc.com • 1 877-832-4625


BOREALIS SLAB by TECHO-BLOC


MAR/APR

2016

PRODUCED BY BRITTANY KAPLAN

CH_LX35_FeatureWellOpener_233.indd 233

1/21/16 3:14 PM


french kissed A DESIGNER INJECTS A PARISIAN SENSIBILITY INTO HER OWN CHICAGO HOME WITH CHIC FURNISHINGS AND SOFT POPS OF COLOR. WRITTEN BY LAURA MAUK / PHOTOGRAPHY BY MEGHAN BEIERLE-O’BRIEN

INTERIOR DESIGN / WENDY LABRUM, WENDY LABRUM INTERIORS HOME BUILDER / ABEL MARIN, PRO-DONE RENOVATION CORP.

CH_LX35_Pedine_234-247.indd 234

1/20/16 3:42 PM


LUXESOURCE.COM / 235

CH_LX35_Pedine_234-247.indd 235

1/20/16 3:42 PM


In the entry of designer Wendy Labrumâ&#x20AC;&#x2122;s Chicago home, the walls are covered with hand-painted silk wallpaper from de Gournay in New York. A vintage French stool from Modern Drama pulls up to a mirrored console designed by Labrum. The vintage French mirror is from Jayson Home and the lamp is from Circa Lighting.

236 / LUXESOURCE.COM

CH_LX35_Pedine_234-247.indd 236

1/20/16 3:42 PM


D

esigner and self-professed Francophile Wendy Labrum doesn’t have to go very far to get her Paris fix. In fact, she doesn’t even have to leave the house. That’s because Labrum’s home, a classical-style residence in Bucktown she and her husband, Brandon, recently purchased and renovated, displays dramatic arrangements of both vintage and contemporary French furnishings that—like the effortlessly chic and iconic way French women dress—are as casual as they are sophisticated and as edgy as they are timeless. “I believe that good design will always be influenced by French design,” Wendy says. “Probably because they’ve been doing it longer.” Wendy, Brandon and their young daughter had previously been living in a condominium near Wrigley Field when they decided a change of scenery was needed. “We knew our family was going to keep growing and that we’d eventually need more space,” says Brandon. And

CH_LX35_Pedine_234-247.indd 237

the five-bedroom house they ended up moving into met all of their current and future requirements. For example, the couple, who now have three young children, can easily access the area’s vibrant offerings. “It’s a great walking neighborhood and has a bit of a New York SoHo feel,” Brandon says. “Plus, it’s family-friendly yet still provides great nightlife, restaurant and shopping options.” The house offered another convenience, too: simple architecture. “It was a blank canvas,” Wendy says. “I was able to add architectural elements and create spaces with personality.” In many of the rooms, Wendy designed cased entries, as well as built-in bookshelves for the family room. “I heightened all of the doorways to add drama and incorporated panel molding throughout,” she says. “I love pre-war millwork and wanted to give the house character.” In the kitchen, Wendy started from scratch. “I completely gutted it,” says the designer, who replaced a window that previously looked to the neighbor’s house with solid wall

The living room features a Reagan Hayes-designed sofa with a Bergamo Fabrics textile from Donghia, French stools upholstered in leopard print by Kravet and a vintage armchair dressed in a Rose Cumming striped silk from Dessin Fournir. Antique Maison Baguès floor lamps and a Lucite-and-brass coffee table complete the scene.

1/20/16 3:42 PM


In the dining room, square-back leather Oly chairs mingle with circleback vintage Louis-style chairs from 1stdibs that are covered with Manuel Canovas striped silk from Cowtan & Tout. A vintage Marie Therese chandelier hangs above an existing table; the silk drapery fabric is by Rose Cumming from Dessin Fournir.

space, which now displays upper cabinetry and a hood. “There was plenty of natural light without that window,” she says. “Closing it up allowed me to have a larger island and a bigger range.” Wendy also designed a built-in banquette for the breakfast area and covered an adjacent wall with Calacatta marble tile. “Everything we installed was top-notch,” says general contractor Abel Marin. “Wendy’s design made the house so inviting. You walk in and it feels like home.” For however fine the furnishings are, they’re also relaxed. It’s a dichotomy that’s not easily achieved and a concept that makes both the French style and Wendy’s design so successful. “I love glamour,” she says. “But the home also had to be livable.” Therefore, the designer covered a chesterfield in the media room with treated ivory leather that can be easily wiped clean and upholstered two vintage Louis-style chairs in the living room with charcoal cottonvelvet. “Velvet is durable,” she says. “I chose fabrics that look gorgeous but can also handle wear and tear.” In the entry, a vintage French stool features a black leathercovered seat cushion. “My kids sit on that stool to put their shoes on,” Wendy says. “The leather is original, but it’s weathered so I don’t have to worry about it.” In addition, much of the furniture that isn’t vintage was custom-made for comfort and to accommodate the entire family. For example, because Brandon is 6 feet 5 inches tall, deep sofas were needed. “I wanted pieces with the right shapes and scales,” says Wendy of the custom furnishings. Throughout the design, lighter colors are tempered with splashes of black, smooth and soft textures mingle near more rustic ones, and the historical French furniture—some of which she had shipped directly from Paris—keeps good company with notable contemporary pieces. “I love mixing periods and blending old with new,” Wendy says. “It makes a home feel well-collected and the contrasting of the colors and textures gives a room individuality.” In the living room, Wendy offset a contemporary sofa covered in lavender cotton-sateen with a vintage chair 238 / LUXESOURCE.COM

CH_LX35_Pedine_234-247.indd 238

1/20/16 3:42 PM


CH_LX35_Pedine_234-247.indd 239

1/20/16 3:42 PM


upholstered in black-and-white-striped silk and a pair of antique Maison Baguès floor lamps topped with black shades. A vintage Louis Philippe mirror above the custom fireplace surround plays off a modernist Lucite-and-brass coffee table. Opposites attract in the family room, too, where a contemporary sofa joins a vintage French armchair upholstered in black leather and a braided jute rug. Outside in the rear yard, Wendy designed a massive pergola framed by bright white drapery fabric. Boxwoods in planters dot the gray-stained decking and there’s an acute feeling of being in a storied garden somewhere deep in France. “I love our outdoor space,” Brandon says. “It’s become the backdrop for weekend breakfasts with the kids, grilling with friends, lazy Sunday afternoons and impromptu dance parties.” As the home was completed, Wendy soon realized she might be even more of a Francophile than she thought. While the French are indeed masters of style, they also invented the phrase joie de vivre, which means joy of living, and it seems the designer achieved two goals for her family when she reimagined the interiors of their new home—good design and great joy. “In my ideal world, I’ll one day have a beautiful pre-war apartment in Paris that I can fill with antiques and contemporary pieces,” she says. But for now, to Wendy and her family, this house is pretty perfect. 240 / LUXESOURCE.COM

CH_LX35_Pedine_234-247.indd 240

1/20/16 3:43 PM


Left: For the butlerâ&#x20AC;&#x2122;s pantry, Labrum customized white cabinetry with polished-nickel hardware from Katonah Architectural Hardware. The coordinating marble countertop was purchased through Terrazzo & Marble Supply Companies. Opposite, top: A Visual Comfort chandelier from Circa Lighting hangs in the kitchen, where custom stools from Thomas Hayes Gallery in Hollywood, California, are clad in Jerry Pair leather from David Sutherland. Appliances are from Abt and the tile backsplash is by Ann Sacks. A Rohl faucet adds shine. Opposite, bottom: The breakfast area features a marble tile-covered wall and a built-in bench for seating. A pendant from Urban Archaeology suspends above a Labrum-designed table and vintage Milo Baughman chairs covered in an Edelman Leather material. Window treatments were fashioned with Fabricut linen.

CH_LX35_Pedine_234-247.indd 241

1/20/16 3:43 PM


CH_LX35_Pedine_234-247.indd 242

1/20/16 3:43 PM


Above: Labrum selected Benjamin Mooreâ&#x20AC;&#x2122;s Jamestown Blue paint for the walls and blue silk Vervain drapery fabric from Fabricut for the windows of the media room. A vintage armchair upholstered in navy leather from Edelman Leather sits beside a brass-accented bookshelf. Left: The media room features a vintage Louis Philippe mirror and an ivory Labrum-designed sofa upholstered in a material from Edelman Leather; a second custom sofa by Labrum is covered with linen-velvet from Fabricut. A vintage brass Mastercraft coffee table and sheepskin-topped ottoman from Bradley rest on a Stark rug.

LUXESOURCE.COM / 243

CH_LX35_Pedine_234-247.indd 243

1/20/16 3:43 PM


A bed designed by Labrum is swathed in Great Plains linen-velvet from Holly Hunt and covered with bedding by Leontine Linens in the master bedroom. Antique mirrored dressers from Bungalow 5 in New York and a vintage Venini chandelier, purchased through 1stdibs, lend elegance.

244 / LUXESOURCE.COM

CH_LX35_Pedine_234-247.indd 244

1/20/16 3:43 PM


Below, left: Whimsical paper from Romo covers the walls of the powder room, giving the space a playful and feminine feel. An Oly mirror hangs above a marble countertop from Terrazzo & Marble Supply Companies, with legs from Urban Archaeology. Newport Brass fixtures complete the look. Below, right: In the master bedroomâ&#x20AC;&#x2122;s sitting area, vintage chairs designed by Milo Baughman are upholstered with a Pierre Frey linen-velvet from Holly Hunt and flank an Oly ottoman. A custom silver silk carpet by Labrum, fabricated by Direct Rug Import, plays off silver silk draperies from Fabricut.

CH_LX35_Pedine_234-247.indd 245

1/20/16 3:43 PM


TERRACE PHOTOS: MOMOKO FRITZ.

CH_LX35_Pedine_234-247.indd 246

1/20/16 3:43 PM


Above: Vintage dining chairs with cushions covered in Perennials fabric from David Sutherland surround a glasstopped table on the terrace. A stone wall is the backdrop for a sconce from Bevolo Gas and Electric Lights in New Orleans that provides an old-world sensibility. Left: The terrace acts as an outdoor oasis in the busy city. A pendant from Bevolo Gas and Electric Lights hovers above Restoration Hardware furniture, and Perennials white drapery fabric from David Sutherland hangs against a custom pergola designed by Labrum. The planters are from Jayson Home.

LUXESOURCE.COM / 247

CH_LX35_Pedine_234-247.indd 247

1/20/16 3:43 PM


CH_LX35_SM_Chlaghmo_248-251.indd 248

1/20/16 3:50 PM


THE THEORY OF

RELATIVITY WITH THE LAUNCH OF HER NEW WALLPAPER COMPANY, DESIGNER ERIN CHLAGHMO LOOKS TO MATHEMATICS AND A LOVE OF TEXTILE HISTORY TO SHAPE HER DISTINCTIVE WORK. WRITTEN BY TARYN BICKLEY / PHOTOGRAPHY BY CYNTHIA LYNN

LUXESOURCE.COM / 249

CH_LX35_SM_Chlaghmo_248-251.indd 249

1/20/16 3:50 PM


B

eing the new kid on the block isn’t always easy, but for wallpaper designer Erin Chlaghmo, it’s a role that she is ready to play. This is largely due to her time assisting other designers with their textile production, as well as her own experience as a screen printer. “Having that knowledge really helped to inform my designs,” says Chlaghmo, who owns Chicago-based Relativity Textiles—a company name that was inspired by Albert Einstein’s research and his theory of relativity, being that Chlaghmo’s initials just happen to be EMC. Launched this past fall, Chlaghmo’s wallpaper— sold locally through Solid + Pattern, as well as Supply in Austin, Alt for Living in New York and Style Revolutionary in Australia—features four patterns and 21 colorways that illustrate both the designer’s knack for scale and space and her love of global textiles; she spends every summer in Morocco and counts Japan, Iran and India as places of influence. “There’s a history behind what inspires me,” says Chlaghmo, who categorizes her wallcoverings as a product of her path in the visual arts. While working toward her master’s degree at the School of the Art Institute of Chicago in 2006, Chlaghmo was “painting and making collages,” she says, “and really trying to make sense of my life experiences.” Using any available medium, she eventually found her voice through textiles. That voice was aided by mentor Christine Tarkowski, whom Chlaghmo helped with screen printing fabrics for a show at the Chicago Cultural Center. Additionally, while assisting artist Carlos Rolón to recreate his childhood living room at the Museum of Contemporary Art Chicago, she was able to form a relationship with Artisan Handprints, who now produce her intricate wallcoverings. “Designing wallpaper is an extension of my practice as a painter and screen printer,” she says. “Pattern carries such a strong cultural significance, and whether putting it in a museum or a home, it creates conversations.” According to Chlaghmo, being hired to produce Rolón’s wallpapers was a pivotal launching point for her career. Other factors have influenced Chlaghmo’s work, too. For example, her father—a math teacher—taught her about tessellations, a mathematical practice of making puzzle pieces that repeat infinitely. This collision between math and art runs throughout her designs, often congruent with her love of global history. “It’s this understanding of how things are made that informs how a pattern is built,” she says. “My love of this process stimulates each design and also my devotion to elevating other cultures.”

250 / LUXESOURCE.COM

CH_LX35_SM_Chlaghmo_248-251.indd 250

1/20/16 3:50 PM


Chicago designer Erin Chlaghmo, of Relativity Textiles, at work in Artisan Handprints (bottom left), where her wallpaper is produced. Silk screens (left) showcase numbers on the side for color print order, while cans of vinyl ink (bottom right) await production. Chlaghmoâ&#x20AC;&#x2122;s Kanoko wallpaper print is shown both in process (below) and on a spec sheet (opposite).

CH_LX35_SM_Chlaghmo_248-251.indd 251

1/20/16 3:50 PM


INTERIOR DESIGN / SUSAN FREDMAN, FREDMAN DESIGN GROUP LLC ARCHITECTURE / TERRI CRITTENDEN, FREDMAN ARCHITECTURE GROUP LLC HOME BUILDER / JOHN CRITTENDEN, STONE’S THROW BUILDERS

CH_LX35_Fredman_252-267.indd 252

1/20/16 3:03 PM


OUT OF THE BOX USING AN ATYPICAL BUILDING MATERIAL—STEEL SHIPPING CONTAINERS—AN INTERIOR DESIGNER FLEXES HER CREATIVE CHOPS IN HER OWN MICHIGAN RETREAT. WRITTEN BY LISA SKOLNIK / PHOTOGRAPHY BY MICHAEL ROBINSON

LUXESOURCE.COM / 253

CH_LX35_Fredman_252-267.indd 253

1/20/16 3:32 PM


A gabled roof from Big C Lumber and a classic wood-siding façade temper this cottage’s steel architectural detailing to help it blend in with the neighboring homes. Built of steel shipping containers, this structure was conceived by interior designer and homeowner Susan Fredman, along with architect Terri Crittenden and general contractor John Crittenden.

F

amed for its pristine beaches and picturesque cottages, Michigan’s Harbor Country is a quick 90-mile ride from Chicago and consists of a cluster of charming towns that hug Lake Michigan. Interior designer Susan Fredman has built and furnished a few dozen homes in Harbor Country, including her own weekend retreat in the area’s Union Pier community. A fine artist by training, Fredman considers all the places she designs like one of her paintings, yet the home she completed for herself and her partner, Terri Hawley, took Fredman’s artistic skills in an inventive new direction given the home’s noteworthy construction material: steel shipping containers. “It’s new to my palette,” the designer says of the material, which she mixed with the more traditional wood, concrete and glass, “but I felt that I could take a more creative license in my own home.” Fredman decided on building a shipping container home when she saw one years ago and was smitten with its industrial vibe, sustainable attributes and strength. “It’s a way to recycle the containers; plus, they’re fireproof, impervious to water and stronger than traditional building materials,” she says. “I was sold. And who better to try it out on than myself?” A new home would also mean that Fredman and Hawley could embrace a more streamlined aesthetic. “We had a fairly traditional cottage and were ready for a move to something more sustainable and far less conventional,” says the designer. Despite Fredman’s passion for the project, it took several years to design and execute the home. And there was a lot of new ground to cover for the designer and her team, which included architect Terri Crittenden and general contractor John Crittenden, who is with Fredman’s construction firm, Stone’s Throw Builders. The hardest part of the process was figuring out the potential of the containers—what they could or couldn’t do with them—to make sure the house would be structurally sound. “All of the research we did on building with shipping containers 254 / LUXESOURCE.COM

CH_LX35_Fredman_252-267.indd 254

1/20/16 8:21 PM


CH_LX35_Fredman_252-267.indd 255

1/20/16 3:03 PM


turned up in one book,” says Terri Crittenden. “We had to be analytical about every aspect of the design because we were forging new ground. We felt like pioneers.” Because the surrounding homes were classic cottages, the team needed to decide just how industrial to go in terms of style. “We decided to give the house a hybrid wood-and-steel façade that blends traditional and industrial design elements so it wouldn’t feel so out of place,” Fredman says. And given the size constraints of the containers, the team had to think outside of the box—literally—to get the kind of expansive, architecturally intriguing spaces Fredman cherishes in her residences. Steel shipping containers are built to standard sizes, but they come in two lengths and two heights, “which gave us some leeway,” John Crittenden says. To forge the lightfilled home rife with long sight lines and soaring ceilings, the team massed six containers (three side by side on

CH_LX35_Fredman_252-267.indd 256

two different parts of the house), cut out the walls, tore off the tops and added 20-foot-high ceilings punctuated with clerestory windows. Next, they stripped the sides off two other containers, joined the bases, added wooden support columns and wrapped them with screens to form a screened-in porch. Three more containers were then combined to build a guesthouse. Inside, muscular concrete walls, burnished cedar beams and custom oak cabinetry give the living spaces definition, decorative might, and storage and seating options. “This is a smaller house, so there are built-ins everywhere to give us places to store everything and different areas to sit,” Fredman says. Case in point: A cantilevered ledge underscoring the great room fireplace also doubles as a place to perch. Concrete clads some of the floors, along with wide rift-cut oak planks. And, in the master suite, broad wood floorboards climb up the bedroom ceiling, providing

1/20/16 3:03 PM


Opposite: In the foyer, wood-and-steel joints connect the shipping containers and extend the walls that were built to yield high ceilings. Fredman turned a massive oak tree felled during construction into a sturdy bench to anchor the space. A lighting fixture, which was originally a silo top, hangs above. Below: Tailored pieces from Fredman’s furniture line, 350 West—including a sofa covered in Kravet fabric—are mixed with new pieces in the great room, such as a pair of Made Goods chairs, a Moroccan carpet from Oscar Isberian Rugs and a Dedon side table purchased through Fredman Design Group.

LUXESOURCE.COM / 257

CH_LX35_Fredman_252-267.indd 257

1/20/16 3:03 PM


CH_LX35_Fredman_252-267.indd 258

1/20/16 3:03 PM


Above: Thanks to the cottage’s relatively trim footprint, Fredman maximized built-in cabinetry to accommodate all of her family’s storage needs. The bar area near the great room features custom oak cabinetry wearing Emtek hardware and holds a variety of glassware and beverages. Left: Burnished-oak cabinetry designed by Fredman and wide-plank oak floors from Rode Bros. offer earthy counterpoints to the kitchen’s corrugated-steel container wall. Mondo Collection barstools pull up to a countertop from Marble Emporium, while a Marie Christophe chandelier provides interest. Faucets from Hydrology and Wolf appliances add shine.

LUXESOURCE.COM / 259

CH_LX35_Fredman_252-267.indd 259

1/20/16 3:03 PM


CH_LX35_Fredman_252-267.indd 260

1/20/16 3:32 PM


Left: The dining room was added to the main six-container structure and defined with a concrete floor. Fredman mixed genres here by topping a rustic wood base she’s owned for many years with a sleek marble top and then surrounded the table with curved Oly chairs. Opposite: Three steel shipping containers—with Marvin windows and doors—were combined to build a guesthouse for visitors. The courtyard accommodates a small pool by Bontrager Pools. Fredman collaborated with Green Mansions in New Buffalo, Michigan, on the landscape.

LUXESOURCE.COM / 261

CH_LX35_Fredman_252-267.indd 261

1/20/16 3:32 PM


“WE GAVE THE HOUSE A WOOD-AND-STEEL FAÇADE THAT BLENDS TRADITIONAL AND INDUSTRIAL DESIGN ELEMENTS.” -SUSAN FREDMAN

CH_LX35_Fredman_252-267.indd 262

1/20/16 3:03 PM


Opposite: For a new take on the classic screened-in porch, Fredman stripped the walls off two shipping containers, joined them at the base, added wooden support columns and wrapped them with steel mesh. Bleu Nature chairs and a built-in bench surround a dry rock bed. The Zen-inspired landscaping softens the structureâ&#x20AC;&#x2122;s industrial edge. Below: Cedar deck boards underfoot and oak beams overhead temper the steel-mesh walls and the concrete fireplace surround in the screened-in porch. Rustic pieces with a streamlined feel include a coffee table by La Lune Collection and seating, also by Bleu Nature, covered in Kravet fabric.

LUXESOURCE.COM / 263

CH_LX35_Fredman_252-267.indd 263

1/20/16 3:03 PM


A vintage industrial workstation topped with storage bins was turned into an intriguing and highly functional guest bathroom fixture by outfitting it with a sink from GO Home in Flushing, New York, and plumbing from Hydrology. A circular rug adds a dose of color to the space.

264 / LUXESOURCE.COM

CH_LX35_Fredman_252-267.indd 264

1/20/16 3:04 PM


In a guest bedroom, Fredman paired a haberdashery-inspired upholstered headboard of her own design—featuring Romo fabric—with a mixed-media nightstand by artist Floyd Gompf. The nightstand is topped with a table lamp from Fredman Design Group, while Matteo linens and a rug from Fredman’s collection soften the setting.

CH_LX35_Fredman_252-267.indd 265

1/20/16 3:04 PM


Sleek spa-quality fixtures including sinks, faucets and an angular tub, all from Hydrology, get a softer demeanor thanks to burnished-oak cabinetry by Fredman, a bench from Ann Sacks and an alpaca carpet from Oscar Isberian Rugs.

an added sense of warmth to the space that belies the home’s heavy metal DNA. “We spend a lot of time in this space and wanted it to feel like a haven,” Hawley says. Artwork and cherished furnishings found spots in the home, as well, such as a metal cabinet that houses a dishware collection in the kitchen and a coffee table made from meticulously cut tree branches that holds court in the screened-in porch. Plenty of extraordinary new pieces increase the glamour quotient of the space, too—most notably a pair of jaunty wingback chairs made of resin in the great room and an epic wire chandelier in the kitchen. Other items were modified, like the great room’s coffee table, while many furnishings came from Fredman’s store,

CH_LX35_Fredman_252-267.indd 266

including some of the sofas in the home, as well as the Kravet easy chairs and matching ottomans in the media room and a settee upholstered in a menswear patchwork fabric in the guesthouse. Today, Fredman and Hawley are thrilled by the community’s response to their new home. “People literally stop their cars in front of the house and start snapping pictures,” Fredman says. And it was even more clear that all their hard work to get the project done was worth it when two more container homes were built in Union Pier after theirs went up. “I feel like we started a trend in the Midwest,” says Fredman, “and I can see us living here for years to come.”

1/20/16 3:04 PM


Wood floor boards add warmth to the master bedroom, as does a Fredman-designed bed topped with Matteo linens and anchored by a Tai Ping Carpets rug made of recycled shoelaces. Nightstands, also by Fredman, offer extra storage and sport lamps from Bleu Nature. The window shades were made from a Kravet material; artwork above the bed is by Jennifer Webster.

LUXESOURCE.COM / 267

CH_LX35_Fredman_252-267.indd 267

1/20/16 3:04 PM


CH_LX35_SM_Lurie_268-271.indd 268

1/20/16 3:52 PM


RIGHT

ANGLE GUIDED BY AN ARTISTIC WORLDVIEW, DESIGNER CASEY LURIE CREATES CONTEMPORARY FURNISHINGS INFORMED BY TRADITIONAL JOINERY TECHNIQUES. WRITTEN BY TATE GUNNERSON / PHOTOGRAPHY BY KENDALL KARMANIAN

LUXESOURCE.COM / 269

CH_LX35_SM_Lurie_268-271.indd 269

1/20/16 3:52 PM


Chicago designer Casey Lurie, shown in his Rogers Park workshop (far right), creates bespoke furniture, lighting and objects. Hand planes and other tools (right) are used to fashion such pieces as the Primo shelving system (below) as well as his Steps stool (opposite), which is shown with an isometric drawing.

W

“TO MAKE FURNITURE WITHOUT SCREWS OR NAILS IS SO APPEALING TO ME.”

CH_LX35_SM_Lurie_268-271.indd 270

orking with wood is very satisfying,” says designer Casey Lurie, who creates handcrafted bespoke furniture, lighting and objects for design professionals and private clients worldwide. Enchanted by all things artistic as a child, Lurie chose to attend the California Institute of the Arts and soon began making furniture to support his creative ambitions. “A lot of my early work focused on the intersection of human and architectural scales, such as everyday wares and buildings, respectively,” says Lurie. “Furniture seemed to be the perfect intermediary between the two.” Having apprenticed as a cabinetmaker, Lurie appreciates the history of woodworking and approaches the creation of each piece—using both traditional craftsmanship and high-tech systems— from an artistic lens, tinkering with designs by hand before building a prototype. “To make quality pieces you have to devote a lot of time to them and prototyping helps me to understand the materials,” says Lurie, who recently conceived a lamp for Design Within Reach. The designer’s career took an exciting trajectory when Teruo Kurosaki, founder of Japanese furniture company Idée, discovered his work at a show and offered him a job in Tokyo. “The job and experience of living in that culture were incredible,” Lurie says. Echoes of that experience can be found in his current designs, which have a linear simplicity and rely on intricate, hand-cut joinery. “To make furniture without screws or nails is so appealing to me,” he says. Lurie’s Primo shelving system, for example, is assembled like a puzzle and held together by tension. And, the drawers in his Secretariat desk fit perfectly into the metal sawhorse frame, gradually increasing in size from top to bottom. Lurie’s refined, angular designs are also influenced by the tools he uses, as he prefers traditional hand tools whenever possible. “This way, there’s nothing between your hands and the chisel,” Lurie says. “Being connected to something that has such a rich tradition is fascinating.” Sounds like the perfect angle.

1/20/16 3:52 PM


LUXESOURCE.COM / 271

CH_LX35_SM_Lurie_268-271.indd 271

1/20/16 3:52 PM


WOW FACTOR GIVEN CARTE BLANCHE BY HIS CLIENTS, A DESIGNER IMPARTS EDGY GLAMOUR INTO A NEW CHICAGO CONDO OVERLOOKING LAKE MICHIGAN. WRITTEN BY JENNIFER SERGENT / PHOTOGRAPHY BY JACOB HAND

CH_LX35_Michael_272-281.indd 272

1/20/16 3:38 PM


INTERIOR DESIGN / NAME HOME BUILDER / NAME LANDSCAPE ARCHITECTURE / NAME

INTERIOR DESIGN / ANTHONY MICHAEL, ANTHONY MICHAEL INTERIOR DESIGN, LTD. HOME BUILDER / ADAM PISER, DOMAIN CONSTRUCTION LLC

LUXESOURCE.COM / 273

CH_LX35_Michael_272-281.indd 273

1/20/16 3:38 PM


A

s interior designer Anthony Michael describes it, the views from this Lincoln Park high-rise were like none other he’d seen in the city, as it captures vistas of Diversey Harbor to the East and the skyscrapers to the South. “There aren’t many places in Chicago that you can get a lake, park and city all in one view,” he says. But turning your gaze back inside, there wasn’t much beyond a sea of white walls and an awkward layout. Michael had previously been commissioned to decorate one of the building’s model units, where he redesigned the floor plan and infused it with a cream, fuchsia and black palette. Homeowners Judi and John Simms remembered that model when they purchased one of the building’s prime corner units—and asked Michael to work the same magic for them and their teenage daughter. The Simmses gave Michael little direction beyond several inspiration photos that Judi describes as luxury mixed with glamour. The only things the couple brought with them from their previous residence were their two cats, an eclectic art collection that included a portrait of Queen Elizabeth II with her eyes closed and John’s framed vintage sports photographs and memorabilia. There was only one real requirement: The master suite had to be divided into two bedrooms for the husband and wife. “I’m a horrible sleeper,” John says. “I told Anthony, ‘You have to make this like a cave.’ If I have even a sliver of light, it’ll wake me up.” Michael took that information and decided on a design plan, making sure that every fabric selection was tightly woven and highly durable, so the furnishings would be ideal for parties, teenagers and their cats, Dudley and Jake. And the painting of Queen Elizabeth II—now the centerpiece in Judi’s serene, creamy white bedroom—played a large part in Michael’s aesthetic approach everywhere else. “Judi likes things that are unique, unusual and bring about an emotional response,” he says. “They wanted a wow factor, but the style is really traditional with a twist.” Underlying much of the design are special backdrops such as the wallpaper-like mural by decorative painter Steven Hettrich, who covered the daughter’s bedroom in

“THERE AREN’T MANY PLACES IN CHICAGO THAT YOU CAN GET A LAKE, PARK AND CITY ALL IN ONE VIEW.” -ANTHONY MICHAEL

CH_LX35_Michael_272-281.indd 274

a field of blue flowers, as well as a textural Maya Romanoff wallcovering that cloaks Judi’s bedroom. The pièce de résistance, however, is the bold Ellie Cashman Design paper in the powder room, a large-scale floral motif inspired by paintings of the Dutch Golden Age. “It looks as if an Impressionist painting exploded,” Michael says. The wow factor extends throughout the unit, including in the entry. Here, Michael switched out the white closet doors with a set of antique Tibetan doors that he asked general contractor Adam Piser to install in a shadow-box frame, making the closet look more like a large piece of art. “Anthony’s constantly coming up with new ideas that have never been done before, and it’s my job to turn them into reality,” Piser says. The doors and their frame, which conceals the tracking that allows them to slide apart, were “typical Anthony,” Piser adds. Michael then went one step further just down the hall with a design for the studded glass sliding door leading into the media room—a modern adaptation of the entry’s Tibetan ones but installed as a single oversize sliding barn door. Additionally, the designer conceived the door to have a large industrial slider. “That slider helped to fuse the ancient touches with the modern ones found throughout the home,” Piser says. Just past the media room lies the main focal point: a living room and parlor surrounded by the vast lake and city views and centered with a monumental smoked-glass fireplace—a design that Michael had never tried—which reflects throughout the large space. “The owners always like to push the limits,” Michael explains, which is why they went for his striking fireplace idea. In a more practical sense, he says, “I needed a visual room divider to some degree, and I also wanted to play up the views without distracting from them.” Hence, the designer used lake tones of gray, white and blue in the rugs, draperies and furnishings to punctuate the colors of the vista. He then incorporated an ottoman that adds a punch of chartreuse in the area to keep things interesting. Michael also designed the rooms to have multiple purposes through clever uses of built-in storage. This is most notably seen in the dining area, which also doubles as a study, where he designed an architectural divide to separate the dining area and living room and incorporated space on each side for closets. Furthermore, he conceived a banquette—inspired by the old supper clubs of the 1950s that featured tufted, tight and high banquettes—which provides an arresting backdrop for both mealtime and working at home. “I love the largeness of the piece, yet it’s still cozy enough to envelop you in its arms,” Michael says. The Simmses couldn’t be more pleased with the renovation, which took about 18 months to complete. “We probably spend more time at home than we ever did in our lives,” John says, adding that he is sleeping better than ever in his midnight gray, Ralph Lauren-inspired gentleman’s retreat. “This home is so luxurious,” Judi adds, “and whatever room you’re sitting in, there’s a magnificent panoramic view.”

1/20/16 3:38 PM


Interior designer Anthony Michael had a sofa custom-made to fit into the living room bay window of this Chicago residence, giving homeowner Judi Simms a cozy place to curl up with a book. The sofa joins chairs by Schnadig International Corporation and a Bernhardt coffee table.

LUXESOURCE.COM / 275

CH_LX35_Michael_272-281.indd 275

1/20/16 3:38 PM


276 / LUXESOURCE.COM

CH_LX35_Michael_272-281.indd 276

1/20/16 3:38 PM


Above: In the parlor space, which is used for small gatherings, Michael designed a fireplace enclosed in smoked glass to divide the large living room into two distinct areas. Christopher Guy chairs encircle a custom coffee table, also conceived by Michael and fabricated by Keith Clayton Furniture. A Stark rug runs underfoot. Opposite: Michael used layers of draperies throughout the living room to both break up the windows and absorb sound. A Mattaliano chair holds court with another custom sofa by Michael and a Haute Hides zebra rug. The custom ottoman features a pop of color with a chartreuse Keleen Leathers material.

CH_LX35_Michael_272-281.indd 277

1/20/16 3:38 PM


The custom tufted banquette in the dining area allows for multiple purposes, including a dining space, a place for homework or a casual perch for conversation. A Century Furniture table pairs with sculptural Julian Chichester chairs; a chandelier designed by Michael illuminates the scene.

“THE OWNERS WANTED A WOW FACTOR, BUT THE STYLE IS REALLY TRADITIONAL WITH A TWIST.” -ANTHONY MICHAEL

CH_LX35_Michael_272-281.indd 278

1/20/16 3:38 PM


LUXESOURCE.COM / 279

CH_LX35_Michael_272-281.indd 279

1/20/16 3:38 PM


In the small powder room, Ellie Cashman Designâ&#x20AC;&#x2122;s floral wallpaper makes a big impact. Equally bold elements also stand out, including Maestrobathâ&#x20AC;&#x2122;s Pert Rho Lux gold-leaf sink atop a custom altar table featuring a gildedgesso finish. The white mirror is by Barry Dixon for Arteriors.

CH_LX35_Michael_272-281.indd 280

1/20/16 3:39 PM


Above: In Judi’s master bedroom, which looks out to stunning views of the city, Maya Romanoff wallpaper creates a textural backdrop for such pieces as the artwork from WJC Design in Jacksonville Beach, Florida. Left: Michael framed a sconce from Circa Lighting over a custom mirror in the wife’s master bedroom so that it would integrate with the grid of framed intaglios above the bed. The Hickory Chair bed, which includes a Hästens mattress, is dressed in John Matouk & Co. linens.

LUXESOURCE.COM / 281

CH_LX35_Michael_272-281.indd 281

1/20/16 3:39 PM


WWW.

MICHAEL-ABRAHAM

. C OM


M I C H A E L A B R A H A M A R C H I T E C T U R E 1 4 8 B U R L I N G T O N A V E . C L A R E N D O N H I L L S , I L 6 3 0 . 6 5 5 . 9 4 1 7


portfolio

PROMOTION

P R O M OT I O NS | PRO D UCTS

UPTOWN SOPHISTICATION MEETS DOWNTOWN EDGE

SUSTAINABLE RUGS FOR LIFE

EXQUISITE DESIGN

Donna Mondi and her team use a mix of classicism and modernity, infusing interiors with elements from different periods and styles to create timeless, unpredictable surroundings. Layered textures, edgy styling and avant-garde elements create an unexpected balance with an emphasis on quality.

Health, tradition and beauty are paramount to Organic Looms’ handcrafted rug collections. Made from the finest materials, each step of the process is connected to the artisan’s hand. Organic Looms’ rugs are marked by soft, plush textures and durability while offering complete customization.

Mariani Landscape is a top 100 design, installation and maintenance company operating from two locations in the Chicagoland area. Mariani Landscape has been nationally recognized for the unique design and installation of many awardwinning landscape projects.

dmondiinteriordesign.com | 312.291.8431

organiclooms.com | 312.832.0900

marianilandscape.com | 847.234.2172

BRING NATURE INTO YOUR HOME

60 EAST MONROE, SUITE 7201

TIMELESS. ELEGANT. COMFORTABLE. PERSONAL.

Sprigzz was designed imagining a dormant tree’s branches slumbering on the forest floor. Hand-knotted in Kathmandu, Nepal of all-natural, undyed sunpat and bleached nettle. Produced in a GoodWeave-certified factory. Available in sizes from 2 x 3 to 20 x 45. “Art for the floor, a soul for your room.™”

The Penthouse at The Legacy: Situated on the 72nd floor with unprecedented 360degree views of Lake Michigan, Millennium Park, Chicago Yacht Club and many of Chicago’s iconic landmarks. Completed in 2014, this masterpiece leaves no detail left undone. Pricing available upon request.

Michael Abrams blends urban style with a distinctive sense of tradition, creating luxurious spaces shaped for modern living. Drawing upon his artistic sensibilities and classical influences, he works directly with his clients to understand their lifestyle goals. As a full-service design firm, he creates interior spaces that are seamlessly executed and client inspired.

therugguy.com | 312.933.8321

jamesonsir.com | 312.929.1560

michaelabrams.com | 773.248.3039

Organic Looms

Mariani Landscape

Donna Mondi Interior Design

RugGuy Galleriez, Inc.

CH35_Portfolio_0121_sr.indd 1

Nancy Tassone | Jameson Sotheby’s International Realty

Michael Abrams Interiors

1/21/16 10:52 AM


PROMOTION

FIND A DESIGN PRO NEAR YOU LUXESOURCE.COM/DESIGNRESOURCES OUR LOCAL DESIGN RESOURCE DIRECTORY IS AN INVALUABLE TOOL TO SEARCH AND CONNECT WITH DESIGN PROS, OFFERING SERVICES FROM INTERIOR DESIGN AND ARCHITECTURE TO LANDSCAPING AND BUILDING.


PROMOTION

Jameson | Sothebyâ&#x20AC;&#x2122;s International Realty

advertiser index ANTIQUES

ARCHITECTURAL MOLDINGS

FABRICS + WINDOW COVERINGS (continued)

FURNITURE + ACCESSORIES

Pagoda Red 847.784.8881 | Winnetka pagodared.com

JP Weaver 818.500.1740 jpweaver.com

Chella Textiles 805.560.8400 chellatextiles.com

B&B Italia 800.872.1697 bbitaliatimeless.com

Perennials perennialsfabrics.com

Bausman & Company bausmanandcompany.com

Sunbrella sunbrella.com

Bedside Manor 847.441.0969 | Winnetka shopbedside.com

APPLIANCES

ART + FRAMING

Dacor dacor.com

Jeffrey Breslow Sculpture 312.526.3700 | Chicago jeffreybreslow.com

Miele mieleusa.com

Bernhardt bernhardt.com

DECORATIVE PLUMBING

FLOOR COVERINGS

Kohler us.kohler.com

Apex Wood Floors 630.963.9322 | Downers Grove apexwoodfloors.com

Bright Chair 888.524.5997 brightchair.com

Kyle Bunting kylebunting.com

Christian Liaigre christian-liaigre.us

Fleetwood Windows & Doors fleetwoodusa.com/luxe

Lewis Floor & Home 847.835.2400 | Northbrook lewisfloorandhome.com

deAurora 312.644.4430 | Chicago deaurora.com

Gensburg Toniolo Harting Architects 847.715.9395 | Northbrook gtharchitects.com

LaCantina Doors lacantinadoors.com

Nourison nourison.com/starlight20

Ebanista 800.570.1087 ebanista.com

Kathryn Quinn Architects kquinnarch.com

Milgard Windows & Doors 800.MILGARD milgard.com/DoorCEU

Organic Looms 312.832.0900 | Chicago organiclooms.com

Haiku Home 855.651.2968 haikuhome.com/luxe

Michael Abraham Architecture 630.655.9417 | Clarendon Hills michael-abraham.com

Pella 312.897.3600 | Chicago pellacraftedluxury.com

Rugguy Galleriez, Inc. 312.933.8321 therugguy.com

Hancock & Moore hancockandmoore.com

Robbins Architecture 847.446.8001 | Winnetka robbins-architecture.com

FABRICS + WINDOW COVERINGS

Samad 888.726.2393 samad.com

Holly Hunt hollyhunt.com

Brunschwig & Fils brunschwig.com

Tufenkian tufenkiancarpets.com

J. Tribble Collection 888.652.6116 jtribble.com

Officine Gullo USA 800.781.7125 officinegullo.com Sub-Zero Wolf subzero-wolf.com

ARCHITECTS

Rugo / Raff Ltd. Architects 312.464.0222 | Chicago rugoraff.com

LX_CH35_AdIndex.indd 1

DOORS + WINDOWS

1/25/16 1:28 PM


PROMOTION

Arlington Design Center

advertiser index FURNITURE + ACCESSORIES

(continued)

FURNITURE + ACCESSORIES

(continued)

HARDWARE

HOME BUILDERS + REMODELERS (continued)

Jiun Ho jiunho.com

Randolph & Hein 866.844.9921 randolphhein.com

Ashley Norton Architectural Hardware 800.393.1097 ashleynorton.com

Lynch Construction 847.295.1825 | Lake Bluff lynchconstruction.biz

Lee Industries leeindustries.com

Robert Bryan Home 847.446.5522 | Winnetka robertbryanonline.com

Baldwin Hardware 70yearsbold.com

Mavrek Development Chicago mavrekdevelopment.com

Lexington Home Brands lexington.com

Roche Bobois roche-bobois.com

Katonah Architectural Hardware Chicago | New York | Katonah katonahhardware.com

Middlefork Development 312.214.0400 | Chicago middleforkcapital.com

Lisa Taylor Designs lisataylordesigns.com

Sawbridge Studios 847.441.2441 | Winnetka sawbridge.com

Rocky Mountain Hardware rockymountainhardware.com

Orren Pickell Building Group 888.PICKELL pickellbuilders.com

Marge Carson margecarson.com

Scala Luxury scalaluxury.com

Sun Valley Bronze 208.788.3631 sunvalleybronze.com

Riordan Signature Homes 708.783.1133 riordanhomes.com

Material Possessions 847.446.8840 | Winnetka materialpossessions.com

Stickley stickley.com

Mitchell Gold + Bob Williams 800.789.5401 mgbwhome.com

Susan Kroeger 847.446.7611 | Winnetka susankroeger.com

Chicago Audio Video Design 847.370.2942 | Crystal Lake chicagoav.net

INTERIOR DESIGN SHOWROOMS

Mmint Interiors 847.446.8000 | Winnetka mmintinteriors.com

Walter E. Smithe smithe.com

Digital Living 708.434.1197 digliving.com

Arlington Design Center 847.394.1373 | Arlington Heights arlingtondesigncenter.com C.A.I. Designs 312.755.9163 | Arlington Heights caidesigns.net

HOME AUTOMATION

Sexton Development sextondevelopment.com

Modern Industry 312.420.2780 | Chicago modernindustrydesign.com

HARDSCAPES

HOME BUILDERS + REMODELERS

Moderne Living 312.380.0058 | Chicago moderneliving.com

JB Brickworks 847.634.6437 jbbrickworks.com

Benvenuti and Stein 847.866.6868 | Winnetka benvenutiandstein.com

Powell & Bonnell powellandbonnell.com

Techo-Bloc 877.832.4625 techo-bloc.com

BGD&C 312.255.8300 | Chicago bgdchomes.com

INTERIOR DESIGNERS

J. Jordan Homes 630.455.0855 | Hinsdale jjordanhomesllc.com

The Design Coach Chicago | Lake Geneva | Naples thedesigncoach.com

Primitive Living + Collecting 312.575.9600 | Chicago beprimitive.com

LX_CH35_AdIndex.indd 2

The Merchandise Mart/LuxeHome 312.527.7939 | Chicago luxehome.com

1/25/16 1:28 PM


PROMOTION

Michael Abrams Interiors

advertiser index INTERIOR DESIGNERS (continued)

INTERIOR DESIGNERS (continued)

KITCHEN + BATH (continued)

KITCHEN + BATH (continued)

Donna Mondi Interior Design 312.291.8431 | Chicago dmondiinteriordesign.com

Sweet Peas Design 312.572.9090 | Chicago 847.816.1296 | Libertyville sweetpeas-inspired.com

Kohler Signature Store by Studio 41 312.755.2510 | Chicago kohlersignature.com

Studio 41 847.985.1700 | Schaumburg 630.357.1320 | Naperville shopstudio41.com

Frank Ponterio Interior Design 312.464.1133 | Chicago 847.234.5704 | Lake Forest frankponterio.com

Tom Stringer Design Partners 312.664.0644 tomstringer.com

Kohler Signature Store by Studio 41 847.635.8071 | Glenview kohlersignature.com

Victoria + Albert vandabaths.com

Hickman Design Associates 312.733.9520 | Chicago hickmaninteriors.com

Trumeau Design & Décor 630.445.2500 | Hinsdale trumeaultd.com

MGS Milano mgstaps.com

Wood-Mode Fine Custom Cabinetry wood-mode.com Zephyr 415.552.8033 zephyronline.com

Ilene Chase Design 847.828.0305 | Chicago ilenechasedesign.com

KITCHEN + BATH

NEFF of Chicago 312.467.9585 | Chicago neff-of-chicago.com

James Thomas 312.738.7300 | Chicago jamesthomaschicago.com

The ABL Group 847.579.1600 | Highland Park theablgroup.com

O’Brien Harris 312.464.9460 | Chicago obrienharris.com

LANDSCAPING

Jessica Lagrange Interiors LLC 312.751.8727 | Chicago jessicalagrange.com

Abruzzo Kitchen & Bath 847.885.0500 | Schaumburg abruzzokitchenandbath.com

Orren Pickell Building Group 888.PICKELL pickellbuilders.com

Chalet 847.256.0561 | Wilmette chaletnursery.com

Laurel H. Feldman Interiors & Photography 847.266.0067 laurelfeldman.com

Avanti Gallery 847.681.8000 | Highland Park avantigallery.com

Poliform 888.POLIFORM poliformusa.com

Mariani Landscape 847.234.2172 marianilandscape.com

Michael Abrams Interiors michaelabrams.com

Brizo brizo.com

Porcelanosa 877.PORSA.US porcelanosa-usa.com

LIGHTING

Michelle’s Interiors 312.291.4466 | Chicago michellesinteriors.com

Eggersmann USA 800.276.1239 eggersmannusa.com

Snaidero USA 877.762.4337 snaidero-usa.com

Bevolo Gas & Electric Lights 504.522.9485 bevolo.com

Nancy Corzine nancycorzine.com

J. Tribble Collection 888.652.6116 jtribble.com

Plum Interiors 847.707.1208 | Northfield pluminteriorsltd.com

Kohler us.kohler.com

Robyn Shapiro Design Chicago robynshapiro.com

Kohler Signature Store by Studio 41 630.655.8096 | Burr Ridge kohlersignature.com

LX_CH35_AdIndex.indd 3

Studio 41 773.395.2900 | Chicago 312.321.5900 | Chicago shopstudio41.com Studio 41 773.846.8300 | Chicago 847.266.1900 | Highland Park shopstudio41.com Studio 41 847.824.6280 | Glenview 847.676.4767 | Lincolnwood shopstudio41.com

Hubbardton Forge 800.826.4766 hubbardtonforge.com John Pomp johnpomp.com

Schonbek swarovski-lighting.com

1/25/16 1:28 PM


PROMOTION

Trumeau Design & Décor

advertiser index LIGHTING (continued)

OUTDOOR LIVING (continued)

RESTAURANTS

STONE + TILE (continued)

The Urban Electric Co. 843.723.8140 urbanelectricco.com

Pride Family Brands pridefamilybrands.com

Benny’s Chop House 312.626.2444 | Chicago bennyschophouse.com

Paris Ceramics 888.845.3487 parisceramicsusa.com

RETAIL

Stalwart Systems, LLC 847.972.1193 | Niles stalwartsystemsusa.com

LUXURY BEDDING Bedside Manor 847.441.0969 | Winnetka shopbedside.com

Teak Warehouse 800.343.7707 | 866.937.8325 teakwarehouse.com Woodard woodard-furniture.com

Marigolds 847.501.2755 | Winnetka marigoldswinnetka.com

Chicago Luxury Beds 312.527.5337 | Chicago chicagoluxurybeds.com

PIANOS

Skändal 847.386.7900 | Winnetka shopskandal.com

Duxiana 847.784.9320 | Winnetka duxiana.com

Steinway & Sons 800.STEINWAY steinwayspirio.com

STONE + TILE

REAL ESTATE

Ann Sacks 800.969.5217 annsacks.com

@properties atproperties.com

Antolini Luigi antoliniprecioustone.com

Chicago Botanic Garden Glencoe chicagobotanic.org

@properties - 4 East Elm 312.542.1144 | Chicago 4eastelm.com

Cambria cambriausa.com

ORGANIZATIONAL SOLUTIONS

@properties - Debra Dobbs 312.307.4909 | debradobbs.com woodgateestate.com

Dekton by Cosentino dekton.com

California Closets 866.870.4814 californiaclosets.com

Coldwell Banker Previews International Chicago coldwellbankerpreviews.com

Eldorado Stone 800.925.1491 eldoradostone.com/firebowls

OUTDOOR LIVING

Jameson | Sotheby’s International Realty 312.215.9701 nancytassone.com

Lapicida 212.360.8000 lapicida.com/us

Luxury Portfolio Fine Property Collection luxuryportfolio.com

Neolith thesize.es

Scandia Home scandiahome.com

MUSEUMS

Gloster gloster.com

LX_CH35_AdIndex.indd 4

1/25/16 1:28 PM


APRIL 15 – 17, 2016 PREVIEW EVENING APR IL 14 HONORARY CHAIR MARTYN LAWRENCE BULLARD KEYNOTE SPEAKER APR IL 15 Visit chicagobotanic.org to purchase tickets

One of the treasures of the Forest Preserves of Cook County


DESIGNER SHOW HOUSE This past November, Luxe Interiors + Design, the City of Beverly Hills and Friends of Greystone gathered to celebrate the VIP Preview of the Maison de Luxe designer show house at the historic Doheny Greystone estate in Beverly Hills, California. Over 500 VIP guests perused the reimagined rooms of this iconic estate while in sheer awe of its creativity, beauty and historic architecture. The Entertainologist, Lulu Powers, transformed the courtyard area into a decadent party atmosphere with dramatic lighting and luxurious furniture, exclusively provided by Frontgate. Guests enjoyed cocktails and assorted wines by Fantesca Estate & Winery indulged in delicious hors d’oeuvres. The evening was enhanced by a special award dedication to Luxe Editor in Chief Pamela Jaccarino by the mayor of Beverly Hills, Julian A. Gold, M.D., for her commitment to the restoration of the Doheny Greystone estate. World-class pianist Alexander Borghese provided entertainment throughout the evening by tickling the ivories of Steinway & Sons’ Special Collection Red Pops piano, which was front row center in the estate’s grand hall. Luxe extends its gratitude to the participating designers, sponsors, vendors and showrooms for their generous support of this project.


gatherings

PROMOTION

PHOTOGRAPHY BY GINDA PHOTOGRAPHY

ARLINGTON DESIGN CENTER EVENT

Arlington Design Center and CAI Designs welcomed friends and industry partners to an evening with celebrity author and designer Sarah Richardson. Guests enjoyed a meet-and-greet and book signing, as well as Arlington Design Center’s annual Designer Appreciation Party and 10-year anniversary celebration.

PHOTOGRAPHY BY WITTEFINI PHOTOGRAPHY

LUXURY OPEN HOUSE

Debra Dobbs of @Properties and Luxe Interiors + Design hosted a luxury open house with a tour of a historic Chicago cooperative building at 2450 N. Lakeview Drive, followed by a panel discussion on the “Ages of Decadence.” Attendees networked with industry professionals while enjoying small bites and signature cocktails.

CH35_Dobbs_CAI.indd 1

1/20/16 5:20 PM


_ȇɜȐɕɜɜȐ Woodgate Estate is one of the most unique and stunning homes in Chicagoland. The home and landscape seamlessly integrate the inherent JGCNKPISWCNKVKGUHQWPFKPPCVWTGVJGUKIJVCPFUQWPFQHYCVGTCPFCPCDWPFCPEGQHPCVWTCNNKIJVVTGGURNCPVUCPFƃQYGTU'CEJURCEGYCUETCHVGF HQTCURGEKƂERWTRQUGCPFVJGJGCNKPIGHHGEVUCTGHGNVWRQPGPVGTKPI#PEJQTGFD[CEGPVTCNYCVGTHCNNCPFCPGPENCXGQHNWUJVTGGUVJGITGCVTQQO HGCVWTGUHQQVJKIJEGKNKPIUCPFTQCTKPIƂTGRKVU6JGICTFGPUFGUKIPGFD[TGPQYPGF,CRCPGUGICTFGPFGUKIPGT*QKEJK-WTKUWQHHGTGZQVKEVTGG URGEKGUYCVGTHGCVWTGUCPFXKPVCIG#UKCPCTVKHCEVU#PGZSWKUKVGQWVFQQTRQQNCPFYCVGTHCNNNGCFVQCPGPEJCPVKPICETGEKTENGYCNMVJTQWIJC PCVWTGRTGUGTXG4GNCZKPIUVTQNNUVGPPKUCPFOGFKVCVKQP9QQFICVG'UVCVGQHHGTUWPNKOKVGFRQUUKDKNKVKGUVQEQPPGEVYKVJPCVWTGCPFOQFGTPNKXKPI &KUEQXGTOQTGCVYYYYQQFICVGGUVCVGEQO

debra@debradobbs.com | 312-307-4909


SET IN

MOTION “JUST AS ONE CAN COMPOSE COLORS, OR FORMS, SO ONE CAN COMPOSE MOTIONS,” SAID ARTIST ALEXANDER CALDER, WHOSE DELICATELY BALANCED MOBILES HAVE LONG BEEN ENTRANCING ART AFICIONADOS. REDEFINING WHAT SCULPTURE COULD BE BY INTRODUCING MOVEMENT—AND MOREOVER, LIFE—CALDER’S TRULY PLAYFUL CREATIONS AWAKEN OUR SENSE OF WONDER THIS SPRING AS WE EXPLORE ALL THINGS KINETIC.

Clockwise from top left: Kaze Textile in East / zakandfox.com. Masterpiece Le Chronographe Squelette / mauricelacroix.com. Triple Gong, circa 1948, from the “Alexander Calder: Performing Sculpture” exhibit at Tate Modern through April 3 / tate.org.uk. Sushi Mirror (Brown) by Fernando and Humberto Campana / carpentersworkshopgallery.com. Dunes and Duchess Wave Table Lamp in We’d Rather Be Royal Blue / shopcandelabra.com. Bridge of Aspiration, designed by WilkinsonEyre, that connects London's Royal Ballet School to the Royal Opera House / wilkinsoneyre.com. Isaac Newton's First Law of Motion. The Clock Clock White, 2010 / humanssince1982.com.

TRIPLE GONG PHOTO: COURTESY CALDER FOUNDATION, NEW YORK / ART RESOURCE, NY © ARS, NY AND DACS, LONDON 2015. MIRROR PHOTO: COURTESY CARPENTERS WORKSHOP GALLERY. BRIDGE PHOTO: COURTESY WILKINSONEYRE. CALLIGRAPHY: ELLEN SCOTT. CLOCKS PHOTO: TIM MEIER.

INSPIRATION FOUND

298 / LUXESOURCE.COM

COM_LX6_InspirationFound_298.indd 298

1/21/16 2:48 PM


Designed by Erika Anderson in collaboration with John Cannon of Cannon Frank


abruzzokitchenandbath.com | Schaumburg | 847.885.0500


WALK RIGHT IN Shop the world’s largest collection of premier boutiques for home building and renovation. 30 Boutiques. 1 Location. Merchandise Mart, Chicago M-F 9–5 SAT 10–3 312.527.7939 LUXEHOME.COM

KITCHEN

BATH

TILE

CABINETRY

APPLIANCES

HARDWARE

FLOORING

WINDOWS

DOORS

PAINT

LUXEHOME BOUTIQUES INCLUDE: Amiel.US Ann Sacks Artistic Tile Bentwood of Chicago Carlisle Wide Plank Floors The Chopping Block Christopher Peacock de Giulio kitchen design Devon&Devon

Dream2O Ernestomeda Chicago Exquisite Surfaces FANTINI | THE GALLEY Farrow and Ball GRAFF Katonah Architectural Hardware Keeler Lefroy Brooks Chicago

Miele Experience Center Monogram Design Center NEFF of Chicago Paris Ceramics Pella Crafted Luxury Plain & Fancy by Dandamudi’s Poggenpohl Porcelanosa Tile/Kitchen/Bath/Hardwood ROHL

Scavolini Store Chicago The Shade Store Sherwin-Williams Color Studio SMEG USA Studio Snaidero Chicago Sub-Zero and Wolf Showroom Valcucine Chicago Waterworks Wood-Mode Lifestyle Design Center

Luxe Magazine March 2016 Chicago  
Read more
Read more
Similar to
Popular now
Just for you