Skip to main content

SAEM 1997 Annual Meeting Program

Page 1

L)

F

s

s _a

S:

s

r=l

-S)

for Amdemic Ernergenc Mdfio hlety N,zfa5z

L9-22.

L9:>7


ti ti

n

-l

Be sure to orderyour set of Fundamentalsof ResearchVideotapes. ,

f

r

a

,

a

f

n

J

' ,'-''

i '

"rrr rllllli'i"'' r'l ''

l l "r'l '1i11'r" '

Have you or your colleaguesattended the Fundamentals of Researchlectures and wished you could take them home with you? Now you can. This year the nine-hour series will be professionally videotaped and made available to the membership at a cost of $395 per set. ihe videotapcs wili come with a set of the accompanyinghandouts and can be used in a variety of educational settings in your institution. l

.

:

,

,

,

.

Orderforms are avaiLableat ih.dSAEM negiitraii.onDesh.

f.r I

il f'


-t;

^^^ ro+a *lra ^ Meeting "yul"lti"-" form.-C"Tt )leted evaluation forms the Annual Attendeesafe ufged to complete should de returnedto the SAEMRegistrationdesk before leaving Washington,DC.

Feedback is critical to the development of successful Annual Meetings'

GeneralInformation...... KeynoteSpeakers Scheduleof Events Monday,May 19 Presentatlons Paper/Poster Didactics May 20 Tuesday, Presenlations. Paner/Poster Dihactics CORDMeeting.. May 2l Wednesday, Presentalions. Paoer/Poster Didacrics AACEMMeeting MeetiigAgenda AnnualBusiness Slateof Nominees FinancialReporl , | | Awaro.. i -r Leadersnlp Award AcademicExcellence "' ProposedConstirutionand BylawsAmendmenls Report.. Membership

May22 Thursday, Presentations....'.'.. Paner/Poster Didactics Exhibitors PositionsAvailable

I 4 T2 t6 " "'l9 """/J """'26 1 a

^ a

""""L1 """""""43 """"""46 ""'29 """'30 1 a

"""""""rr ..........34 """""35 """""'36 """40

47 52 55 44

T-shirt'-- , - . If you lihe the coterof thisprogram,you tlT -?"rchasea 1997AnnualMeeting and14-16($10)' 70-72, 6-8, 2-4, ($15) sizes children's and The t-shirtscomein small,medium,lorg, iid *-ii"g" at the sAEMRegisttationDesh' 5AEM polo shirtsoru iiio onoilabiefo7 sii.:ora"r7oi^s and shirtsare located limited' are Supplies


GnNERAIlxronuerroN Welcometo the 1997 Annual Meeting!This year 1,500 emergencyphysiciansare expectedto attend. The Annual Meetingconsistsof 545 original researchoral and posterpresentations, aswell as over 50 didacticsessions. The oral papers consistof 10 minute presentationsfollowed by 5 minutes for questionsand answers.The postersare scheduledfor 2.5 hours eachday, "walkalong" with one hour moderatedsessions.The sessionsare staggeredso that attendeescan participatein2 moderatedsessions eachday.Attendeeswho wish to participatein a moderatedsession,should meet at the first posterin the sessionat the designatedtime. However, the posterswill be availablefor viewing throughout the day.AIl researchpresentedat the Annual Meeting must be approved by InstitutionalReviewBoardsfor Human Studiesor Animal CareCommitteesand is so certifiedby authorsupon abstractsubmission. The didactic sessionsinclude workshops, lunch sessions,the Advanced ResearchSeries,the Fundamentalsof TeachingSeries,the Fundamentalsof ResearchSerles,and many others.A1l attendeesare lnvited to attend all paper,poster and didactic sessionsexcept thosewhich have limited enrollment or require pre-registration.If you are registeredto attend a limited enrollmentor lunch session, be sureto arrivea few minutesearly.Becauseof the popularity of thesesessions, many havebeen filled and i.ndividualshavebeenadded l " ow a i l l i s t ss h o u l do p e n i n g o s ccur. Flnally,SAEM is honored that Mary Pendergast, Harold Varmus,MD, and SenatorPaulWellstonewill addressthe Annual Meeting.

Registration and Information The SAEM RegistrationDesk will be open as follows: Sunday,May 18, 7:00 am - 7:00 pm Monday,May 19, 7:00 am - 5:00 pm Tuesday, May 20,7:00 am - 5:00 pm Wednesday, May 21,7:00 am - 5:00 pm Thursday,May 22,7:00 am - 4:00 pm Attendeesare required to check-in at the RegisrrarionDesk to pick up name badgeswhich are required for admissionto the Annual Meetingsessions.

Continuing Medical Education The L997 SAEMAnnual Meetingis jointly sponsoredby SAEM and Michigan State Unlversity,College of Human Medicine. Michigan StateUnlversity,Collegeof Human Medicine, is accreditedby the AccreditationCouncil for Continuing Medical Education(ACCME) to sponsorcontlnuing medicaleducation for physicians. MichiganStateUniversity,Collegeof Human Medicine, designatesthis Annual Meetingfor a maximum of 35.5 hours in categoryi credit towardsthe AMA Physician's RecognitionAward. Each physician should claim only those hours of credit that helsheactuallyspent at the Annual Meeting. CME certlficates will be mailed to attendeesafter the Annual Meetins.

Banquet The Annual Meeting Banquetwril be held on the eveningof May 22. Entenainment will include the presentation of the Imago ObscuraAward and the RidiculousAbstractCompetition. Tiansportationwill be provided with busesleaving at approximately6:00 pm and returningaround 10:00pm. A cocktailreception will proceed the Banquet. Each attendeewill receivetwo complimentarydrink tickets and a cashbar will alsobe available. This year'sselectedRidiculousAbstractpresentationswlll be: ARDDS: Acute ResidentDecompensationand Dystonia Syndrome, Bill Quirk, MD, University of California,San Franclsco Contrasting the Practices of Neurology and Emergency Medicinein an Era of Early Interventionfor Stroke:A Cerebral VascularAccident Waiting to Happen?, Paul E. Pepe, MD, MPH, AlleghenyUniversiry, Pittsburgh PrehospitalAdministration of EmergencyDepartmenrCoffee (EDC) in the Ventricular Fibrillation/PulselessVentricular TachycardiaCardiacArrest, Jonnathan Busko, BA

Schedule of Events -

Sunday,May 18

8:00am-4:30pm . R e g i o n aCl P CC o m p e L i t i o n Wester n Region,Cabrnet CentraI Region,H emisphere Midwest Region,Thoroughbred SouthernRegion,GeorgetownEast EasternRegion,GeorgetownWest . Research Directors'Workshop,Caucus 9:00 am-3:30pm . Medical Student Session,JeffersonWest l l : 0 0 a m - 2 : 0 0p m . AcademicEmergency MedicineEditorial Board,Adams 2:00-6:00pm . AAEM Boardof Directors,Edison 2 : 3 0 - 5 : 0 0p m . SAEM Boardof Dtrectors,Bancroft 3:30-4:30pm . MedicalStudentEducatorsInterestGroup, Adams 4 : 0 0 - 5 : 0 0p m . S A E MU n d e r g r a d u a C t eo m m i L t e eD.u p o n t 5:00-6:00pm . CPC Reception,BachTerrace 5 : 3 0 - 7 : 3 0p m . EMS SubspecialtyTaskForce,Dupont 6:00-8:00pm . SAEMBoardof Directorsand Committeeand TaskForce ChairsDinner, State

SAEM members are entitled to purchaseone ticket at the discountedrate of $20 for active,asiociateand inrernationalmembers; and $35 for medical student and resident members. Tickets for non-membersare $45. Tickets must be purchased by May 20. There are no refunds for banquet tickets since meal counts are required a week in advance of the Banquet.


Meet the AEM Editors Annual Meetingattendeesare invited to attenda Meet the Edi_ tors sessionwhich will be held on Wednesday,May2l at 5:00_ 6:30 pm This informa1 sessionwi]l introduce the incomins and outgoing editor-in-chiefsof AEM; provide an overviewoT AEMs goals;addressnarural history of manuscriptssubmitted to AEM; review the role of consultingreviewers,associateedi_ tors and the editorial board; discussavenuesfor contributor and reviewerinteractionwith editors;and providean opportu_ nity for questionsand answers.

Photography Competition Larry Stack, MD, the developer of rhe annual photography Competitionhas receivedmore than 250 entriesrhis vear.th! photographswill be displayedduring the Annual Mleting in the Exhibit Ha11.The photographswill be judged and awirds for the top three photographsin four catlgorieswill be announcedat the conclusionof the Annual Meetrns.

Annual Business Meeting/Elections SAEMwill conveneits Annual BusinessMeeting on Wednesclay, May 2I at 1:30-3:00pm. At this meetingSteveDronen,MD, \,iil tntroduceincoming president,John Marx, MD. Agendaitems for the businessmeeting wili rnclude election of officers,Board and committeemembers,presenLation of awards;amendmentsto the Constitutionand Bylaws;officers'reports;and other items of businesspresentedby the membership.Ail membersof the Societyare urgedto attend,however,only activemembersareeligibleto vote.

EMRA Reception On May 20 from 6:00 until 7:30 pm, EMRAmembers,alumni and fnends are invited to aftend this specialeventat the home of JamesA D'Orta, MD, EMRA Pastpresident.This historic home is located in WashrngtonsfashionableGeorgetownchstrict and was formerly the residence o[ Gover.ntrrAvercll Harriman and his wife, the Hon. PamelaHarriman.former ambassadorto France.Built in 1892, rhe eleganthousewas the site for many polittcal and diplomatic functions.Known as the Governor'sResrdence,the house was home to Governor ancl presidentlalcandiclateWilliam Scranronof pennsylvaniain the 1950's.A shuttle will operateberweenthe WashinqtonHilton and Tbwersand Dr. D'Orta'shome (3032 N Streer).Buseswiil departat 15-minuteintervalsbegrnningat 5:30 pm. Returning buseswili run on a simrlarschedule.

RegionalCPC Competition A11Annual Meeting attendeesare encouragedto attend rhe 1997 RegronalCPC Competrrionwhich will be held on May 1B from 8:00 am until 4:00 pm. Five regionalcompetitions,each consistingof the presenrationand discussionof the ten besr submittedcases,will be held. Therers no reqistrationfeeto attend. The Best Drscussantand Best presenrerrecipientsfrom each region will be announced during the CpC Receptionat 5:00-6:00pm. The CPC Competltionis sponsoredby ACEf; CORD,EMRA, and SAEM.

IssuesForum A11membersare invtted to participatein an IssuesForum on Tuesday, {ay 20 at 6:00-7:00p-. thir open lorum 1san opportunity for the membershipto exchangeideaswith the Boaid on the important issuesin academicemergencymedicineand the Societysactivities.

AACEM The Associationof Academic Chairs of Emergency Medicine (AACEM) will meet on Wednesday, May 2l from 9:00 am until 12:00 noon. AACEM wilL conveneits annual business meetingon May 21 from 12:00noon until l:30 pm.

Public Health and Education Committee DeborahMaiese,MPA, leadpersonof rhe Heaithy peopie2010 (HP 2010) Consorriumand SeniorprevenrionpoiicvAnalvstfor -of the Departmentof Health and Human Seryices,Offlce li_ seasePreventionand Heakh promotion,will addressthe SAEM Public Health and EducationThskForcecluringits meeringon May 22 at 2:00 pm. A11inreresredindir,rdualsare invited ro attend. Ms. Maiesewill presentinformation on the Hp 2010 goals,the priority focus areas,and the processof formulating n₏w measurableobjectivesfor the nations public heahh agendi. Shewill suggestways in which SAEM can play an activerole.

ProjectASSERT A meetingof Prqect ASSERTwill be held on May 22 at 4:OO pm. The membershipis invited to learn how to deveiopinter_ vention programs in the ED for referring patients to primary care,clinicalpreventiveservicesand substance aDuserrearment. The organizerslook forward to sharingthe lessonslearnedfrom ProlectASSERT. a SAMHSA(CSAT)federaldemonsrrarion sranr at the BostonMedicalCenterEmergencyDepartment.

Opening Cocktail Reception SAEMwil host an openingcocktailreceprionon Monday May 19 at 6:00-7:30pm. Al1Annual Meetingregisrrantsare Lnviredto artend. Hors d'oeurveswill be servedand a cashbar wrll be available.

Exhibits Exhibirswiil be availablefor viewing on May 20 and 2l in the Exhibit Hal1.The poster sessions,Innovati,cnsin Emerqencv MedicineEducationexhibirs,coffeebreaksur-rart-r.;i;;r";; cleskwill alsobe locatedin the Exhibit Hall. pleaseuf,. u., oppoltunity to view the exhibits.

Board of Directors Meetings The SAEM Boardof Direcrorswill meet on Sunday,May lg at 2:30-5:00pm andWednesday, May 2I at 7:00-9:00pm. Alllnterestedmembersand others are invited to attend ihis and all meetrngsol'the Board.

MessageBoard A, messageboard will be maintair-red ar the Regrstratron Desk. Phonemessages can be left at the SAEM RegisirationDeskby calling the Washington Hrlton and Towers at 202-483-3000 and requestingthe SAEM RegtstrationDesk.

Speakers'ReadyRoom A speakers'readyroom will be availablefor thosewho wish to checktheir sliclesin advanceof their presenration.The speakers'ready room will be availablesrarrrngMay 18 ar 7:00 im.

CORD The Council o[ Emergency Medicine ResidencyDirectors (CORD)will meet on Tuesday, May 20 ar l:00-6:00pm. The program will include educationalsessions,roundtablediscusslons,reports,electrons,and award presentations. A New program Directors'OrlenrartonWorkshop will be held on May 20 at 9:00-12:30and pre-registration is requlred.

EMRA Activities Boardof Directors,May 19, 1:00-4:30pm Representative Council, May 20, l:30-4:00 pm Boardof Direcrors,May 20,4:30-6:00pm AwardsReception, May 20, 6:00-7:30pm EMRA/SAEMLeadershipForum, May 2I, B:00am-12:00 EMRA/SAEMSpiveyResidenrResearchForum,May 2I, l 2 : 0 0 n o o n - 2 : 0 0p m


KnyNori' AnDRESS-

HRnor_rE. Vnnuus, MD

Mny f 9

Dr. Harold Varmuswas sworn in as the Director of the NationalInstitutesof Health (NIH) on November 23, 1993. Dr. Varmusis the first Nobel Laureateto serveas the Director of the NIH. He was Dreviously a professorof Microbiology,Biochemistry,and Biophysicsand the AmericanCancerSocietyProfessorof MolecularVirology at the University of Californialn SanFrancisco. He is an internationally recogntzedauthority on retro vlrusesand the geneticbasisof cancer.Dr. Varmusand his UCSF co1league,J. MichaelBishop,MD, shareda Nobel Prizein Physiologyor Medicinein 1989 for demonsrraring that cancergenes(oncogenes)can arisefrom normal cellular genescalled proto-oncogenes.Dr. Varmusls the author and editor of four books and over 300 scientificpapers. He is an editor for several professionaljournals and has servedon a variety of review and advisoryboardsfor government, biotechnologyfirms, and pharmaceuticalcompanies.In recentyears,his work hasassumedspecialre1, evanceto AIDS through a focuson biochemicalpropertiesof HI\{ and to breastcancerthroughinvestig a t i o no f m a m m a r yl u m o r si n m i c e . Dr. Varmus is a graduateof Amherst College (BA, 1961) and he majored in English Lirerature; HarvardUniversity(MA in EnglishLiteraturein 1962) and ColumbusUniversity(MD 1966). After an lnternship and residencyrn Internal Mediclne at Columbia PresbyterlanHospital in New York, Dr

Varmus served as a Clinical Associate for two years at the National Institute of Arthritis and Metabolic Diseasesin Bethesda, Maryland Dr. Varmus will speak on "NlH in the ER."

KSNNEDY LscruRE -

Mnv 20

Paul Wellstone'sexperienceas a teacherand GrassRoots Organizerin Minnesotaprovidesthe frame work for his progressivepoliciesand priorities as a Senator. During his flrst Senatererm, he helped Ieadthe fight to ensurethat peoplewould be able to take tlme off from work to carefor a sick child or aging parentwithout losing their jobs and to ensurethat health careis accessible and affordablefor all Minnesotanswhether they changejobs or have a preexistingcondition. He has been a leaderin seek, ing to reform the nation's health care system and working to ensure affordable comprehensivehigh quality care for all Americans. He introduced legislationto make any health carereform that passed the Senateas good as that which is provided to membersof Congress.SenarorWellstonewrote the Patient ProtectionAct to protect consumersand health careproviders. He also led the fight to protect Medicarefrom arbitrary cuts. in the summer of.1996, the Senateapprovedlegislationhe authoredto requirehealthinsurancepoliciesto covermentalillnessin the samemanneras other medicalproblems. SenatorWellstonegraduatedwith a BA ln PoliticalScienceand earneda PhD in PoliticalSciencern I969 from the Universityof North Carolinain ChapelHill. He taughtat CarletonCollegein Northfield Minnesotafor 21years. In 1990, underdogPaulWellstonerallied togethera dedicatedvolunteerforce SnNeron paul Wr'srJNr and transversedthe stateof Minnesotain his trademark"GreenBus; Bus" to becomethe only onlv Senate .senarecontenderto unseatan incumbent in that election. In 1996, Paul Wellstonemobllized his volunteersand field organizationro seneraiea massiveparticipationin the political process,now a model for the Natron. SenarorWellstonewill speakon "MedicalCareforlhe poor: I OO7 anrl Ra*'n-l

"

KnyNorE Annnnss-

}4AY22

As Deputy Commissioner/SeniorAdvisor to the Commissioner,Mary Pendergastis responsiblefor handling the most difficult and complexissuesand the most critical and precedentsettingsituationsrelating to FDA programs,strategies,and activities. Ms. Pendergast providesleadershipacrossthe agency on its highestpriority initiatives,and authoritativeadviceto the Commissioneron all FDA activities. Shealso representsthe agencyin meetingsand conferenceswith other US agenciesand foreign governments,the Congress,corporations,scientificacademicinstitutions,and consumergroups. Ms. Pendergastlead the FDAbefforts in resolvingcomplex issuesinvolving the protection of human subjectsand informed consentrequirements. Sheis the agency'sdriving force in the developmentof the regulation which permits a narrow exception to the lnformed consent requirements for certain emergencyresearchactivities. Shehas servedas the agency'sspokespersonon this and other regulatoryeffort aimed at assuringthe protection of researchsubjectswhile also encouragingsound scientiflc research. Ms. Pendergastrecelvedher BA degreefrom NorthwesternUniversity in 1972 and herJD degreeSuma Cum Laude from the University of lowa Collegeof Law in 1976. Shewas a fellow in ConstitutionalLaw at Yale Law School where she received her LLM degreein 1977. Prior to her currenr position, Ms. MRnvPexorncesr,Esq. Pendergastwas an AssociateChief Council for Litigation in the Office of the GeneralCouncil, Deparrment of Health and Human SeMces.Ms. Pendergastwill speakon "lnformed Consent:The Processof RegulatoryChange."


ScHruuLEoF Evexrs -

MoNoAy,Mnv f 9

7:00 FOT : Fundamentalsof Teaching ARS : AdvancedResearchSeries

7230 8:00 Welcomeand Introduction.InternationalBallroom Center

8:30 KeynoteAddress:Harold Varmus,MD, Director, NationalInstitutesof Health,InternationalBallroom Center

9:00 CoffeeBreak,ExhibitHall

9:30 Iqiury Prevention Trauma (abstracts (abstracts 001-010), 011-020), 10:00 Intemntional Ballroom East I nternational Ballro om West FOT CreativeTeaching p. 12 p.12 and Principles of Learning, 10:30 Thoroughbred p. 17

1l:00

11:30

FOT Audio-visualsand Teaching,Thoroughbred p. 17

ARS Multiple Logistic Regression Models, Georgetown p. 18

ResearchDirectors Lunch PharmaceuticalSupported Research, MonroeWest p. 16

Lunch SessionNHTSA and AcademicEmergency Medicrne.State p. 16

12:00 Lunch SessionWomenand Lunch SessionWhatWorks in Out-of-hospital Care, 12:30 Minoritiesin Academic EmergencyMedicine, Cabinet p. 16 Hemisphere 1:00 p . 1 6

ARS AssessingInter-Rater Reliabilities, Georgetown p. 18

l:30 2:00 2:30 3:00

Poster Session,ExhibitHall Injury Prevention(abstracts021-043) Trauma(abstracts044-053a) Shock(abstracts 054-065) Pediatrics(abstracts091-098) Neurology(abstracts091-098) ComputerModelingandTechnology(abstracts 099-108) p.12-15

FOT Effectivekcture ARS ConfidenceIntervals. Techniques,Thoroughbred Georgetown p.l7 p. 18 FOT LectureWorkshop, Consenatory p.17

ARS Cost-effectiveness Georgetown p. 18

3:30 4:00 4:30 5:00

Neurology (absrracts 109-116), InternationalBallroom East p. 15

Shock (abstractsII7-124), InternationalBallroom West p. 15

5:30 6:00 OpeningReception,Jefferson/Lincoln/Monroe

6:30 7:00

FOT BedsideTeaching, Thoroughbred p.17

ARS SurveillanceSystems, Georgetown p. 18 ARS SurveyResearch Designs,Georgetown p. 18


Tuesday,May 20

ScmxrrFrC'Pnpuns/PosrERs Scientific Papers: DomesticViolence (8:00- 9:00am)

Scientific Papers: InfectiousDisease (10:30- 12:00noon)

Moderator: Robert L. Muellemqn, MD, Truman Medical Center is Inelfective. Helen I37. DomesticViolence:TriageScreening E. StrausMD M5, CoohCountyHospital

Moderator: David A. Tqlan,MD, OliveView-UCLA VaccinationProgramCould 131. An ED-BasedPneumococcal SaveMoney and Lives,DantelR. Martin MD, Ohio State Unittersity

138. Efficacyof UniversalScreeningfor Intimate PartnerViolence (iPV): The Importanceof Patientand ProviderFactors, GregoryL. Larhin MD MS MSPH, Mercy Hospital of PittsburgLt 139. DomesticVolence:InterviewerGenderis Not a Factorin the Detection of Abuse, Helen E. StrqusMD MS, Cooh CountyHospital 140. Impact of a PoliceDepartmentSpecializedInvestigations Unit and MandatoryReportingon DomesticViolence-Related Homicides, Erih D. Barton MD MS, Brigham €"' Women's Hospital

Scientific Papers: Imaging/Diagnostics (8:00- 9:00am) Moderator: DietrichJehle, MD, Erie County Medical Center 141. TechnicalSkills and DiagnosticAccuracy of Emergency Physicians Performing ED Ultrasonography, Richard Lanoa MD, LincolnMedicaland MentalHealthCenter 142. ProspectiveTiial of Serial Ultrasound Examinationsin ' : the Evaluationol Blunt Abdominal Tiauma. IohnS. Rose MD, Untyersityof CahforniaDayis 147 Tlcpnf rho cannngramWaveformArea to DiagnosePulmonary Embolism,MeenaArunachlam,CarolinasMedical Center 144. Accuracy of Chest X-Ray InterpretationsBy Emergency Physicians,Amy A D eStefanoMD, EastCarolina Universig

Scientific Papers: Pediatrics (10:30- 12:00noon) Moderator: Norman C. Christopher,MD, Children\ Hospital Medical Center of Ahron 125. RectalMethohexitalSedationfor CT Imagingof Pedlatric Patientsin the ED, ElaineS. PomeranzMD,Universityof MicL'tigan I26. lntranasa]Midazolamfor the Sedationof YoungChildren Undergoing Laceration Repair, GregoryD. Hobbs MD, TexasA€sM Unittersity 127. Randomized, Controlled Trial of Octylcyanoacrylate (Tiaumaseal)Versus Butyl-2-cyanoacrylate(Histoacryl) in the Managementof PedlatricFacialLacerations,Martin H. OsmondMD, Uniyersityof Ottawa 128. NeurodevelopmentalOutcomes in Children Wlth Inflicted and Noninflicted Injury, Lorna E. Bell MD, Baylor Collegeof Medictne

132. TuberculosisExposureand Control in an Urban ED, Amy BehrmanMD, Universttyof Pennsylvania 133. ED SentlneiSurveiilancefor Animal Contactsand Rabies Prophylaxis,Gregory J. MoranMD, Olive-ViewUCAMedical Center 134. Clinical Predictorsof Bacteremiain Chemotherapy-lnduced Febrile Neutropenia: Can Data Upon ED PresentationPredict Bacteremia?AndrewT. McAt'eeMD, Brigham & WomenlHospital 135. Dohle Bodies, Toxic Granulation and Bands Do Not DetermineConcurrentBacteremiain ED Patients,Joseph SextonMD, St.Luhe'sHospital 136. Comparisonof LigaseChain Reactionto TissueCulture For Chlamydial Tiachomatis Detection in the ED, JonathanA. Malin MD, AlbanyMedicalCenter

Poster Session (1:30- 4:00pm) InfectiousDisease Moderator: StephanieB. Abbuhl, MD, University of Pennsylvania (I:30 - 2:30 pm) I45. ED Presentationof Patients With Active Pulmonary Tuberculosis- Is It Typical?PeterE. Soholove MD, Unitersity of Calit'orniaDavis 146. Validity of RadiographicFindings in PredictingPulmonary Tuberculosrsrn PatientsWith Known HIV Disease, Theodore J. GaetaDO, St.BarnabasHospital 147. High CD-4 Counts as a Predictorof TB in AIDS Patients With PositiveAFB Stains,DietrichJehleMD, StateUniversity of New YorhBuffalo l4B. Feasibilityof an ED-BasedHIV Risk ScreeningProgram with Referralof Patientsat Risk to OutpatientClinics for HIV Counselingand Testing,Michealb. RushMD,Ilniver sity of Mrssouri-Kansas l'19. IdentifyingLow Risk PatientsWith CommunityAcquired PneumoniaSeenin the ED: A ProspectiveTrial,Theodore I. BenzerMD PhD, Massachusetts GeneralHospital 150. Lack of lmprovementin EmergencyManagementof Bacterial Meningitis, Gary R. Pols/uss,Olive View-UCIA 151. AbsoluLeLymphocyteCount as a Predictorof Pneumocystis Carinli Pneumonia, Nathan I. ShapiroMD, Cooh CountyHospital

129. Valldationof the Ottawa Ankle Rules in Children With Ankle lnjuries, BlaheBulloch,Children's Hospital,Cincinnati

152. Demonstrationof the Feasibilityof Mass Immunizatton Against Influenza and Pneumococcusin a Public ED, Dayid SlobodhinMD MPH, CoohCountyHospital

130. Criteria For the SelectiveUse of Pelvic Radiographs During PediatricTiauma Evaluations,GreggA. DiGiulio MD, Chtldren's HospttalMedtcalCenter,Cincinnati

153. Does Group A B-hemolytic StreptococcalPharyngitis Occur in the 6 Month - 3 YearOld Child? WilliamWoods MD, Univ ersityof Virginia


Monday,May 19

Ssruss AuvnNcED''RESEARCH AssessingInter-rater Reliabilities for Clinical Researchlaculty (10:00 - I l:00 am) Ian Stietl,MD, Msc,Ilniversityof Ottawa GeorgeWells,MD, UniversityoJOttawa The educationalobjectiveof this sessionis to presentthe methods inter-raterReliabilitiesfor di.fferenttlpes of measureof assessing ments.After attendingthis session,the learner should be able to clinical researchsettings, apply thesemethods in their respecti.ve ln their statisticalanalyto incorporatethe reliability assessment sis, and to know strategiesfor improving inter-raterReliabilities. Clinical Researchoften involves subjective clinical judgments which contribute to inconsistentmeasurements(inter-raterreliability) of the samestudpng phenomena.If thesemeasurements havepoor reliabilities,they can weakenthe statisticalpower during dataanalysis.To prevent this from happening,it is necessary the inter-raterreliability for the concernedstud;r to assess

Developing Reliable Multiple Logistic Regression Models: How To Do It Right and How to Tell When SomeoneElse Hasn't (lI:00 - 12:00 noon) Center RobertL. Wears,MD,IJntuersi$of FloridaHealthScience The educationalobjectiveof this sessionis to give an overview of a consistentmethodologyfor developingreliableand reproduciblelogisticregressionmodels. After attendingthis session, the learnershould be able to: recognizewhen a logistic model is more appropriate than multiple univariate models, understandthe assumptionsof logisticregression,follow a consistent method for developingreliablelogisticmodeis,understandthe advantagesand disadvantagesof different methods of repre-senting variablesin logistic models, understand the role of interactionsamong variables,avoid inappropriaterelianceon automatedstepwisemethods, fit a logistic regressionmodel, interpretlogisticregressioncoefficientsin a clinical context,assessgoodnessof fit and select from competing models, use graphicalmethodsto identify problemsin logisticmodels,calibratea predictivemodel and adjustfor overfitting,and validate final modeisusing resamplingmethods.Logisticregressionis a powerful method for explaining or predicti,ng a dichotomous outcome from multiple independent and possibly interacting variables.However,llke any powerful tool, it is easiiymisused.

Confidence Intervals: Utility, Interpretation, and Calculation (1:30 - 2:30 pm) RogerLewis,MD, Harbor-UCIAMedical Center The educationalobjectivesof this sessionare to have the speaker review the characteristicsof confldenceintervals and their interpretation, detail their advantagesover other methods for repoiting researchresults, and illustrate methods for thelr calcuiation. After attending this session,the learner should be able to recognizesituations in which confidence intervals are an optimal method for reporting researchresults,determine the appropriate method of calculating the confidence interval, complete ihe calculation,and properly interpret the meaning of the resulting confidence interval. Confidence i.ntervalsare being used wiih increasingfrequency for the reporting of results from both laboratory-basedand cli.nicalresearchstudies.Confidenceintervals have a number of advantagesover P values:they allow the reader to interpret the statisticai significanceof the results, to quantify the precision of the researchresults, and to assessthe range of values consistentwith the study results

Cost-effectivenessMethods in Emergency Medicine Research(2:30 - 4:00 pm) Center RobertL. Wears,MD,IJniversityof FlortdaHealthScience DavidMagid,MD, MPH The educatlonal objective of thi.s session will be a focus on methodologic standards for valid cost-effectivenessresearch After attending this session,the learner shouid be able to recognize common errors in cost-effectivenessresearchprojects, distingulsh between cost-effective and cost-saving interventions, understand the impact of viewpoint and time horizon on research,understand the meththe results of cost-effectiveness ods of identifying costs,distinguish between chargesand costs, and between averageand incremental (marginal) costs,understand methods of quantity effectiveness,such as casesfound, caldeathsaverted,yearsof life saved,and quality adjustments, culate a marginal cost-effectivenessratio and understand its appropriateand inappropriateuses,understanddiscountingof costsand benefitsover time, recognizemethodsof expressing uncertainty about results such as sensi.tivityanalysis,understand the methodologic standardsfor publication of cost-effectivenessresearch,and recognize the primary ethical justificamethods.Soundinfortions and criticismsof cost-effectiveness of medical interventionsis mation on the cost-effectiveness necessaryfor informed clinicai and health policy decisionmaking, but much current work is methodologicallyunsound.

Planning and Implementing Surveillance Systemsin the ED (4:00 - 5:00 Pm)

Arthur Kellermann,MD, EmoryUniversi$ RobertSchwartz,MD,IJnLversi$oJPittsburgh Daniel Polloch,MD, Centerst'or DiseaseControl The educationalobjectivesof this sessionare to enable the learner to tap into these surveillance systems for research,as well as develop surveillance systemswhich are complete and which encompass a broad array of public health problems. Surveiliancesystemsare an invaluable source of epidemiologic information. Many surveillancesystemscurrently in place offer a wealth of information regarding injury and disease,and this information can be a useful sourceof researchdata.

Survey ResearchDesigns(5:00 - 6:00 pm) Arthur Sanders,MD, Universityof Aizona Edward Panaceh,MD, IJniversityof Caht'orniaDavis The educational objectives of this session are to enable the learner to designa reliable survey instrument which will answer the intended questions, as well as recognize llaws in various instruments. Surveyscontinue to be a common resourcefor information regarding m ny areasof scientific inquiry Recently surveyinstruments havebeen put under increasedscrutiny Can surveysprovide accurateunbiased information? What tlpes of survey minimize bias?Which survey designsshould be abandoned? What about those ubiquitous patient satisfactionsurveys? How can we better use validated outcome survey instruments (e.g.SF-36)in EmergencyMedicine?Recognizingthepitfalls and increasingthe reliability of survey instruments will be stressed. Various survey instruments will be illustrated with data regardingwhether or not they have panned out as worthwhile. Newer thoughts on survey researchwill be presented.

tI


Monday, MaY 19 GUSTO III - Results of an International Clinical Trial: Development of an EmergencY Medicine/Cafdiology Collaborative Research E l f o r t ( l : 3 0 - 3 : 3 0P m )

Moderator:W Bian GiblerMD,IJnit'ersityof Cinctnnati RobertM. Calit't',MD, FACC,Director,DuheClinicalResrarch Institute Unit E. MasnusOhman,MD, FACC,DuheClinicalResearch ChrisiopherB. Granger,MD, FACC,Duhe Clinical ResearchUnit The eclucationalobjectiveof this sessionls to inform participants o[ the final resultsfrom the GUSTOIII multicenter inteli-iationalclinical trial. This representsthe first presentationof the completetnal data for GUSTO lll; it will againbe given at the European Congressof Cardiologyin Stockholm, August, 1997. Four membeisof the SteeringCommltteefor GUSTOIII will clescribethis trial comparing reteplase(r-PA) versus tissue plasminogenactivator(t-PA)for the treatmento[ retttemyocf,rdial infarctjon (AMI). In this 15,000patient trial, r-PAanclt-PAwere adminisleredin a 2:1 randomizedschemefor patientswith AMI in emergency throughout the world. The primary objectlve1or departmenl-s

this trial was to determine if r-PA was superior to t-PA in decreasingmortality in patlents wlth AMl Preliminary data from angi,ographictrials indicated that r-PA was superior to tfA in priviiing TIMI grade lll flow (RAPID I EuII trials), suggestingthat r-PA may provide improved mortalit;r The purposeof this presentationis to inform participanisabout this'important trial evaluating a noveL thrombolytic agent' Discussionof efficacy,as well is hazardsassociatedwith this new therapy (particular}y hemorrhagic stroke) will be emphasizecl.pariicipantswill also be versedregardingstudy design for this ptotocol, and statisticalanalysisme-thodsused to interUnit servedas the pret the results.The Duke Clinical Research III and is one for GUSTO center world wide data coordinating world' in the centers coordinating data of the premier Finally, the developmentof further collaborationbetweenemergencymeclicineand caldiology will be discussedFuture therapy ior acute coronary s1'ndromesincluding new thrombolytic, antithrombin, and anti-plateletagentswill require evaluationin the emergencysetting. Substantial potential-exists for emergency pnytluttt and caidiologiststo work togeiherto investigatenovel apptouch.t to AMI and other acutecoronarys;mdromes'

FUNNAMENTATS OF TEACHTNG creative Teachingfor the Adult Learner (I0:00 lI:00 am)

ttl the'Hrulth Scicnccs WlIIiamP. Burdtch,UO, alleghenyIJnLversiLy can be t; Listmotivating iactors.for ac]ultlearners;clescribehow problem soiving are session thi, objectiver'-ot The educati.nal diseusston a guiding in used dynamrcs group techniques-of used as an organizingprinciple when teachingJ.,trq cite several jn the relationshipbetweenoblectivesand assessment education' among adult learners;and demonstrar-e

(lI:00 - 12:00 noon) Audio-Visualsand Teaching:How to Avoid the.Disasters

MD, StateIJn:ersity o/New Yorhat StonyBrooh PeterVLccelILo, conceptsenablingmore effectiveuse of audiovisual The educationalobjectiveof this sessioni, to t-r"tp"tticlentsunclerstandthe be able ro describethe importanceolAV materials;list the types (AV) materials. Arrer attendingthis session,rhe learnershoulcl "visualizingvirtues" accordingto the National MedicalAudlovisual staterhe three of projectecland non-prolecteclAV mate.rials; o[ differentAV materials. and disadvantages C.i*i, and compareth. u.luur''tuges

Providing Lip Service: Effective Lecture Techniques (I:30

- 2:30 pm)

of theHealthSciences Wtltiqmp {urdith, MD, AllegheryL}niversity variablesthat can result in a more elfectivelecture' The educationalobjectiveii thls ,.srior"ri. ib t .Lp ,tudents unclersrandthe materialthat is best presentedin a lecture Alter attendingthis session,the learnershould be'ableto starethe type of eclucational ol the lecture veisus other formats;list presentationskilis thal can improve and disadvantages format; comparethe aclvantages lectures' J"ti.g'" r..r"re, and desiirbe rhe componentsthat should exist withln all auclienceattenriveness

Lecture Workshop: Time to Practice . . . (2:30 4:30 pm)

wLIIiamP Burdich,vtf, lllegheny lJnittetsityof the Flealthscienccs of TexasSouthwestern MD,IJniversLty Kurt C. Ifteinschmidt, MichaelP Wainscott,MD, Llniversiryo! TexasSouthwcsfcrn MD, Harbor-LICIAMedicalCenter DianeM. Birnbqumer, ancl apply the content and presentationskills The educationalobjectiveof this sessionis to help studenrsbetter understancl able to list presentationskills that improve be shouid required for an e{iectivelecture.After artendingth'issession,rhe learner a short lecture with approprlatecontent, present lecture; of,a audienceattentivenessa"r-g , f..*re; describ'ethe components fee. Pre-registration required' and clemonsrrareeffecrrvepresenrarionskilLs.Lilited regilstration.$25 registraiion

Bedside Teaching: Developing The Art (4:30 - 5:30 pm)'

Hal Thomas,MD, OregonHealthictencesLlniversLty , , :imponant --, ---^-^,.^ ^{ bedside teaching' After atto effective The educationalobjective of this sessiono ,o n.ip sruclenrsknow the variables discussthe unique feaapproaches; t"achrr-rg of bedside tending thissession,the learnershould be able to iescribe the various types be appropriate' may teaching to bedside approaches specific srarerhe slruarlonsin which [;;J rures ro teachlngpr"..l;;;i';k

The Seriescontinues on MaY 21.


Monday, May 19

DruncrrcSrssroNs Lunch Session:Women and Minorities in AcademicEmergencyMedicine (I2:00-l:30 pnt) AssistantVicePresident,Divisionof Community LoisBergeisen, of AmericanMedicalColleges and Minority Health, Associqtion RitaCydulha,MD, MetroHealthMedicalCenter o[ VirgLnia MarcusMartin.MD. IJniversity Mary Ann Reinhart,PhD, Deputy ExecutiveDirector,ABEM The educationalobjectivesof this sessionare to provide the participantswith an understandingof the compositionof the dataset of women and minority residencyapplicantsto emergency medici.neand its implications; the composition of the ABEM data set on residencyfaculty; the statisticson women and minorities in academicemergencymedicine complled by the Associatlonof American Medical Colleges(AAMC); and what role, if any, academic emergency medicine has ln the AAMC's 3000 by 2000 initiative. This sessionwill begin to examine the question of women and minorities in academic emergencymedicine and academicmedicine from the process of applicationto medicalschool through promotion to department chair. Dr. Martin will discussthe residencyapplicant pool to emergencymedicine in regard to women and underrepresentedminorities. He will also discuss personal observationson minorities in academicemergencymedicine. Dr. Reinhartwill present data that describesthe facultiesof residency programs. She will also present data from the ABEM Longitudinal Study of Emergency Physicians regarding the careersof the study particpantsand relatedissues,particularly as they relateto women and minoritiesin academicemergency medicine.An open discussionwill follow. Ms. Bergeisenwill presentthe datacollectedby the AAMC on women and minoritiesin academicemergencyand academicmedicineas a whole. Shewill discussthe AAMCs 3000 by 2000 initiatlve and discusswhat role SAEM and academicemergencymedicine might play in helping to fulfill this initiative. Limited enrollment. $30 fee. Pre-registrationrequired.

Lunch Session:Determining What Works in Out-of-Hospital Care: Implications for EmergencyMedicine Research(12:00-1:30p-) MD,Unwersity ofMichigan lrt'ferlS Desmond,

RonaldF.Maio, DO, MS, University of Michigan D a n i e l WS p a i t eM , D , U n i v e r s i loy[ A r i z o n a The educationalobjectivesof this sessionare to identlfy sentinel conditionsthat can be used for outcomeevaluation;determine what methods to use to control for casemix for each of theseconditions;determinewhat outcomemeasuresareappropriate for these conditions; and disseminatethe project's findings. Lot'sof people are talking about outcomesresearchbut who in Emergency Medicine ls actually doing it? How can researchersidentify high priority areasi.n EmergencyMedicine outcomesresearch?What are the tools neededto conduct out"The comesresearchin EmergencyMedicine? A study entitled, EmergencyMedicine OutcomesProject (EMSOP),"funded by the Nationai Highway Tiaffic SafetyAdministration (NHTSA), was begun onJuly f, f996. The overallgoal of this threeyear study is to support and facilitate EmergencyMedicai Services (EMS) outcomesresearchand evaluation. The presentersfor this panel discussion are ali investigators on the project. Dr. Maio will briefly describethe project and the eventsleading up

to its development and implementations. Dr. Desmond will discussthe challengesfaced with when developing preciselerminology and also data acquisition. Dr. Spaitewill discussthe methodology used to determine rank order of conditions. Finally.Dr Maio will discusssome issuesregardingseverity measuresand outcomemeasures.The floor will then be open for discussion. The focus of the discussionwill be whether the approachtaken by the NHTSA project is applicable/appropriate for other areasof EmergencyMedicineOutcomesResearch. Whether or nol you have an interestin EMS we think you'll find this presentation informative and thought provoking. Limited enrollment. $30 fee. Pre-registration required.

ResearchDirectors' Lunch: Pharmaceutical Supported Research:When Should You Believe the Results?(I2:00-I:30 p-) Moderator: JernsHedges,MS,MD, OregonHealthSciences University CoreySlovis,MD, VanderbiltUniversrtyMedicalCenter Center Martin J. Smilhstein,MD, OregonHealthSciences The educationalobjectivefor this sessionis to providethe audience with opposing viewpoints on the controversialtopic of pharmaceuticallysupported researchin emergencymedicine. The debate format will be utilized with an introductory 5 minute comment from the moderator. Eachviewpointwill be allowed l0 minutes to make their initial argument. The moderator will once more be given 5 minutes for comment followed by another 10 minutes to eachside for rebuttal. The remaining time period will be given to the moderatorand the audience for questions. Limited enrollment. $30 fee. Pre' registration required. Lunch

Session: NHTSA

and Academic

EmergencyMedicine: Update on Crash Injury Researchand Safe Communities (12:00-l:30 pm) Moderator:RobertMuelleman.MD. TTumanMedicalCenter and SusanGorcowshi,Director,Ot'ficeof Communicqtions NHTSA Programs, fraft'tc Sat'ety Outreach, and Administrator,Research RalphJ. Hitchcoch,ActingAssociate NHTSA Development, of and EvaluationDivision,Ot't'ice JamesFell, Chiet',Research Research and Traft'rcRecords,Trat't'icSat'etyPrograms,NHTSA The educationalobjectivesof this sessionare to providean opportunity for the participate to learn of the National Highway Tiaffic Safety Administration's (NHTSA) researchpriorities in the areasof crash worthi.ness,crash avoidanceand driver behavior and how emergencymedicine can contribute,become aware of NHTAb outreach efforts on the airbag issue;understand the new safe communities concept and how emergency physicians can particlpate; and to learn who to contactat NHTSA if the participant is in obtaining more information. NHTSA is headquarteredin Washington, DC, and its Administrator, Ricardo Martinez, MD, is an emergencyphysician. NHTSA officialswill update participantson crash iniury researchpriorities. Marry emergencyphysicianshave developeda fruitful relationship with NHTSA. This sessionwill be an opportunity for other emergencyphysicians to learn about these enrollment. $30 fee' Preopportunities. Limited registration required.

t

l

J I

I


I

Monday, May 19 101. Heart RateVariabilityAnalysisin the ED, BrianA. Nester DO, Albert EinsteinMedicalCenter I02. (movedto IEME exhibitson May 22) 103. PumplessArteriovenousExtracorporealCO2 Removalin HypercarbicStates:Predictionof EfficacyDuring Apnea Using a MathematicalModel, SteyenA. ConradMD PhD, LouisianaStateUniversity 104. OperativeVersusNon-OperativeManagementof Blunt Abdominal Tiauma: Role of Ultrasound-Measured Intraperitoneal Fluid Levels, O. John Ma MD, IJniversityof North Carolina 1 0 5 . R o u t i n eP u l s eO x i m e t r yi n r h e t D : A F i f r h V i r a l S i g n ? AndrewBazahis,MichiganStateUniversityKalamazoo 106. ED Clinical Trlal of a Fiberoptic-Enhanced Endotracheal TubeFor Intubation Monitoring, TirbePlacementConfir, mation, and Difficult Airway Managemenr,CharlesV PollackJr MA MD, MaricopaMedicalCenter 107. Utillty of Telemedicinein the ED, lohn BrennanMD, NorthwestCoyenantMedicalCenter 108. Hand-Held Metal Detectorto Aid in the Removalof SubcutaneousNeedleFragments,Eric Grat'steinMD,St.Paul's Hospital

Pap.ers:NeurologicEmergencies fcientific (4:00- 6:00pm)

ll3.

Preventionof Neurologic Damageby PostischemicHyperbaric Oxygen Tieatment in Stroke, Milena Miljhovic LolicMD, RonaldReaganInstituteoJEmergencyMedicine

I14. Thrombolytic Therapy For Acute Ischemic Stroke: Results of a ConsecutiveScreeningFor Eligibility,RobertE. O'ConnorMD, MedicalCenterof Delaware 115. ParamedicAccuracyin the Applicationof the NIH Stroke Scaleto Victlms of Stroke,WadeS. SmithMD PhD, Ilniversityof CaliforniaSanFrancisco I 1 6 . C a r d i a cE f f e c r s W i t hH i g h - D o s eH. i g h - R a t leV F o s p h e n y toin SeizureTherapy,Edward P Sloan MD MPH, Univer sity of Illinois Chicago

Scientific Papers: Shock (4:00- 6:00pm) Moderator: EmanuelP Riyers, MD, MPH, Henry Ford Hospital 117. HemorrhagicShockPotentiatesMlld TiaumaticBrain Injury, ToddE GlassMD, LeBonheurChildren'sMedicalCenter 118. Hepatic Blood Flow and Oxidative Metabolismis More Sensitiveto HemorrhagicShock than Periphal Skeletal Muscle,Brran T. WilliamsMD, ColoradoEmergency MedicineResearch Center 119. TissuePerfusionin TiaditionalVersusDelayedResuscitation Schemes,RichardH. StnertDO, StateUniyersityof New YorlzBroohlyn 120. Hypovolemic Resuscitation:Panaceaor Oxymoron For SevereHemorrhagicShock?W JosephMessickMD, CaroIinasMedicalCenter

Moderator: Michelle H. Biros, MS, MD, Hennepin County Medical Center i09. OxidativeMetabolismDoesNot Recoverwith Reperfusion Following Global Cerebral Ischemia, CharlesCairns,MD, ColoradoEmergency MedicineResearch Center

121. Activation of Myocardial Pyruvate Dehydrogenaseimproves Heart Function and Metabolism After Hemorrhagic Shock,I eureyA Kine MD, CarolinasMedicalCenter

110. CanineCardiacArrest Damagesthe Abiliry of Brain Mitochondria to AccumulateCA2+ and PotentiatesReleaseof the MitochondrlalApoptosisFacrorCyrochromeC, Gary FiskumPhD, GeorgeWashtngtonIJniversity

I22. Coadministration of Superoxide Dismutase Enhances Protectionof S-Nitroso-N-Acetylpenicillamine in Splanchnic Ischemia-Reperfusion Injury, ChnstopherI. Doty, ThomasJeft'erson Univer sity

111. Effectof lntracellular Calcium Overloadon CalpainActivity in Cultured Neurons, RobertW NeumarMD PhD, WayneStateUniversity

123. Fetuin Mediates the Macrophage-pacifying Activiry of CNI-1493, Haichao Wang PhD, North ShoreIJnitersity Hospital

112. The Beta-BlockerCarvedilol and Its Merabolite SB211475 ProtectCorticalNeuronsFrom Hemoslobin-Mediated Oxidative Injury, RaymondF. ReganMD, Thomas let'fersonUniversity

124. High MolecularWeight HemodialysisImprovesLeft Ventricular Contractility During Endotoxin Shock in Anesthetized Canines,let'feryA Kline MD, CarolinasMedical Center


Monday,MaY 19 Children ReConsciousSedatlonWith Midazolam For GregoryJ' ED' in the Repair Laceration *oin* Simple Center Medical Francis Sainl iudo, l,lO, Seda68. IntramuscularKetamrnefor Pediatric Procedurai l'022 Cases' with Efficacy and Safety ED: the ;i;; StevenM. GreenMD, LomaLtndaUnittersity

67

69

70

Comforting Trial of Nltrous Oxide and Midazolam Vs Children' Jan D' Durins Laceration Repair in Young UnfuersttY LuhmannMD, Washington By Pediatric Managementof Febrile lnfants and Children and EmerDirectors Medicine Fellowship f*.ti.".u With Comparison Directors: Residency *...n" u.ii.ine Chrtstopher's St' MD' Belt'er A' Robeit ehnes, C"ia Frr.i..

in Acute Short-TermOutcomesA[ter OurpatientTherapy Hospital Children's MD, Steveis At,h- a, Martha ;;i;; oJPhtladelphia Emergency:The Per8 5 Office Preparednessfor Pediatric DouglasCarlson Physi'cian' Care Primary sDectiveoi the '!v4D, n Untuer sitY W ashingto lmprove Outcome 8 6 . Failure of Adjunctive Bicarbonateto Green i" S.".t. p"aiatric DiabeticKetoacidosis'StevenM' MD, Loma Ltnda U niversitY

84.

Effect of Time Ear-rectal Temperature Differences: The Temperature' JamesM' to Core Body ;;;-c;;p^tison University Washington Chamberliin MD, George for the MeaValidation of a PracticalResearchlnstrument Children' and lnfants in Outcome ,lrr.-"r,, of Neurologic SoutI'twestern Texas of Uni'tersity MD, Ohada iii.,I

87

88

HospitalJor Children

7L 72

Pediatric ED' Capnoqraphy During Sedation in the University Kemedl K'.McQuillenMD. Brown B-hemolytic Multlvariate Predicti.veModels For Group-A

iiffi"l"..rr I ).

74

(GABHS) ln children'Magdy Pharl'ngitis

Afti;MD, duPont Hospitalt'or Children ScreeningFor UT] in.FebrileYoungGirls' Cost-E[[ective Cont"t MD, Children'sHospitaloJPhiladelphia ii, With Asthma: Ad,missionChestRadiographsfor Children LowisiMunizMD' E' Antonio nr. tft.y ReallyNecessiryi ana StateUnittersitY Rule For Acute Knee Injuries in Children: Is a Decision

Ii;;i;s;;;;r-ir"lpr"rl

Hnin l{hineMD, JacobiMedtcat

Center

76

7 7.

89.

PostreducFluoroscopyReplaceStandard, Can Bedsid.e Fractior',nudiogtuphsin the Managemg."!:f ftg]"ric and Hospital Children's tui"rl cni.oll 2. shanet'f tvtb, HealthCenter tnjuries' P r o s p e c t i v eA n a l y s i s o f P e d i a t r i c- C - S p i n e Uni"tersity Hoplzins MD, Johns ChriitopherAmalfiiano

lnluries Basedon 78. RiskFactorFor Ped'iatricCervicalSpine ThomasKrsch Daiabase' Tiauma it . Nutionut Pediatric Universi$ HoPhins MD MPH, Johns

Pediatrics

lJni"versityof Moderator: ThomasE. Terndrup, MD' Stdte (3:00 4:00 Pm) New Yorh, SYracuse Coma Score 7S. pr.ii.irve Value of rhe Admlssion Glasgow SubmerWith Children on th. Neurologic Outcome of N' Demetils Managemen:' for ;i;; hJtt, lmilications .MpU, IJCIA Center Medtcal Olive-View t<yiori" l"tp Trauma Cen[er: 80. SleddingRelated.Injuries at.a Pediatric Dyrilp.a of Mechanisms and lncidenle, Severity ]njury MD' ChilBailey Chnstine ('95196), Mary r Wint. S.u.r. dren'sHosPtmt of Young Utility of Laboratory Testsin the ED Evaluati'on Med' Albany MD' Reddy Chridren With Seizures,IJsha P ical Center lnfant Porcine 82 Predicting Fracture in Infant Bone: An oJ PierceMD'lJniversity C' Mary Abuse, i'ri"J.1r." Child Pittsburgh of Health Care 8 3 . What Constitutes Child Abuse?A Survey proiessionals and Lay Persons,CarenD Geppert' Method-

8i

ist HosPital

90.

Far Between' Cardiac Arrhythmias in Children: Few and Center Medicql Lourdes oJ Lady our illrJ sordrritiMD, AmongParDecayof Knowledgein PediatricCnticalCare Unittersity amedics, EustdctaS,VO, OrcgonHealthSciences

Neurologic Emergencies

nashmi IJ-.Kothqri, MD,IJnwetsity of Cincinnati ioderatoi ( 1 : 3-0 2 : 3 0 P m ) PreventsApoptottc O1'. Hyp.tUuric Oxygen (HBO) Therapy andNecroticNeuronalDeathFoliowingExperi"mental MD' George CtoUut Cerebral lschemia' RobertRosentlml UniversitY Washington on Neurologic 9 2 . Effects of Hyperbaric Oxygen Therap-y in Rats' Ischemia Cerebral roial 'ccute ,q.fier o;;.;t". Dtego San MedtcalCenter JoeIA. RoosMD, Naval Tau Phosphory9 3 . Effectsof Ischemiaand Okadaic Acid on HersheyMedical S Milton ;',t'f"" Kti;t K, Burhhart MD, Center Neurotoxicity in 9 4 . Effect of Magnesium on Hemoglobin ReganMD' Raymond Cultures, Cel1 c"trical r"i""". si$ niv er U on er s eu ThomasJ to Hypercapnia Effects of Ethanol on Cerebral Response ZinhMD' BrianJ' lnjury' Brain Tiaumatic in i*o.ri-.tttal IJn:irsitY oJMichigan Padents?J' Acute Stroke ln[ervention: Where Are the Virgtnta of MD,IJniverstty HuJJ Stephen 9 7 . Analysi.sof Time lntervals in the Emergencylvianagement f or EMSSys-of puri.nr, With Acute Stroke: lmplications oJ Department Franctsco San MD, i.*t,-S Matshal Isaacs PublicHe althParamedic Hemorrha9 8 New ScoringSystemto Clinically Differentiate the Acute in Validate to Fallure Stroke: ni. f.o* kcf,emic Center Medical state Bay D O, Mandel Adam Z*. i""i"e,

96

Computer Modeling/Technology. - - th IsraeI ioil, {"," r- c rij1,"v w."n"tledge,MD''PhD'Be

Hospital (3:00 - 4:00 Pm) gg. Criteria-basedxxpert Systemto EvaluateAcid-baseDisHersheyMedorders,Atanl. Htrshb"il'to MPH' MrttonS ical Center of TieatingDyspepsiain the ED' Laura 100. Cost-Effectiveness Ward,MercYHosPitalof Ptttsburgh


rvr()Ir(ray,rvray ry 33

FactorsPredictiveof Driver and Passenser SeatBelt Use: An Evaluationof the Ontario Heahh Su.rr.u.Brian H. RoweMD. SudburyGeneralHospital

3+.

Cyclist, Environmentai,and Vehicle FactorsAssociated With Bicycle Tiauma in a Northern Urban Community, Bnan H. RoweMD, SudburyGeneralHospital

35.

Non-useof BicycieHelmetson MackinacIsland,Mary J. HughesDO, MichiganStateILniyersity

36.

Coffee Thble Injuries Encounreredin a pediatric ED, KathleenM. CronanMD, duPontHospitalt'or Children

37.

PediatricTiampolineInjuries,BrianL. EdeherMD, ButterworthHospital

38.

Characteristics and Ourcomesof Self-InflictedPediatric iryuries:The Roieof Method of SuicideAuempr, Guohua Li MD, JohnsHophtnsUniversity OccupationalInjury Visits to an ED - Opportunity for Prevention,John Allegre, MD, Morristown Memorial Hospital

39.

40.

CalcuiatlngPost-lnjury Death RaresUsing Hospital DischargeData,N ClayMann PhD MS,OregonHealthSciences Untuersity

4L

ExcellentFollow-Up of Problem Drinkers Identified in the ED, RobertWoolard,MD, BrownIJniversity

42.

Bicycle Couriers: A Unique Urban Road Hazard, B. TilmanJolly MD, GeorgeWashingtonlJniversity

43.

Recommendationsfor Agriculturai SafetyMeasures:Do EmergencyPhysiciansPracticeinjury Prevention?Prem C. ShuhlaMD MS, Universityof Wisconsin

Trauma Moderator:John A. Maw, MD, Carolinas Medical Center (l:30 - 2:30pm) 44. Quantitation of MicrocirculatoryBlood Flow Enhancement By a Surfactant- One Mechanismof Action to Explain Improved Early Wound Heaiing By Surfactants, PauIW. PaustianMD, Eisenhower Army MedicalCenter 45.

PreliminaryWork Uslng a SwineModel of Multiple Liver Lacerationsto Create a Profound Hemorrhasic Shock State,JamesE. ManningMD, tJniversityof Norti Carolina

46.

SelectiveAortic Arch Perfusionto TiearProfoundHemorrhagic Shock:PreliminaryWork Using a SwineModel of Multiple Liver Lacerations,James E. M anningMD, IJniver sityof North Carolina

52

Acute Ethanol Intoxication is AssociatedWith Acidosisin TiaumaPatients,PatnciqL. ILtnterMD, UntuersigoJMiclngan

53

Arrests and Convictions For Legally Intoxicated Drivers Evaluated For Tiauma, Josephl. Kaplan MD MS, Jotnt Military M edicalCenter s

53A.. EMRS Best Paper: Clinical Predictorsof the Circulatory Statusof an Injured Adult, Dr: FtonaLec'\ry, NorthWestern Inlury ResearchCentre

Shock Moderator: SusanStern, MD,IJniyersity of Michigan ( 3 : 0 0- 4 : 0 0 p m ) 54. RegionalOrgan Blood Flow During HemorrhagicShock in Rats, C. Andrew Eynon MBBS.Albert EinsteinMedical Center 55.

Effectof NPC 205, an AdenosrneA- I Antagonist,on Regional Blood Flows During HemorrhagicShock in Rats, C. AndrewEynonMBBS,Albert EinsteinMedicalCenter

56.

Beat-to-Beat Analysisof Hemody'namics After Aortotomy ShowsDisadvantageous PhysiologicResponseto Uncontrolled Hemorrhage, Geir Iyar Elglo MD, IJnitersity of TexasMedicalBranchGalyeston

57.

Hematocrit Variations and Other Metabolic Derangementsin Acute HemorrhagicShock,Yrtzchah A. GlichMD. MountSinaiMedicalCenter

58.

RegionalOrgan Blood Flow During Anaphylactoid-Like Circulatory Shock Following IV Administration of a Nanoparticulate D r u g D e l i v e r y D i s p e r s i o ni n D o g s . LawrencedeGaravillaPhD.AlbertEinsteinMedicalCenter

59.

Alterationsof Hormone MediatedHeparocyreCalciuim, Prostanoid,and Hepatic Gluconeogenesis During Sepsis, MichaelBeuhler,UnitersityMedicalCenter

60.

TNF Induces the Releaseof a 30 kDa Protein From Rat Pituitary Cells,HaichaoWangPhD,NorthShoreL)niversity Hospital

6I

Developmentof a Model EvaluatingEnd-Organ Injury Following HypotensiveResuscitationof Acute Hemorrhage,ZbigniewChowanshi MD,IJniversityof Michigan

62.

Hypothermia Due to Fluid Resuscltationin a Porcine Model of HemorrhagicShock, David C. Lee MD, North ShoreUniversityHospttal

63.

Effectof KW-3902, an AdenosineAl ReceptorAntagonist, on Survival Following Experimental Hemorrhagic Shock in Rats,LawrencedeGaravillaPhD. Albert Einstein MedicalCenter

64.

Antioxidants are More EffectiveAgainst Ischemia/Reperfusion Injury When Used Synergistically, LanceB. Becher MD, Universityof Chicago Oxidative Injury Causedby Peroxynitrite,Xin-liangMa MD PhD, ThomasJeffersonlJniversity

47.

Correlation Between Central and Femoral Venous OxygenSaturationAfter Hemorrhage,BonnyI . BaronMD, StateUniyersityoJNewYorhBroohlyn

48.

IsolatedPrehospitaiHyporensionin Blunt Trauma,Diane M. SasmithMD MPH, New YorhHospital

49.

Motor VehicleOccupant CompartmentDamageand Severity of Injury to Children, I(hajistaQazi MD, Children's HospitalMedicalCenterof Ahron

65.

50.

Role of LaboratoryTestsin DetectingUnsuspectedIntraabdominal Injury in Pediatric Blunt Tiauma patients, JamesF.HolmesMD, TJniversityof California Dayis

51.

Introduction of a Modified LaboratoryTesrprotocol in Tiauma Patients,DianeM. RealiMD, SaintFrancisMedical Center

Pediatrics Moderator: LeonardR. Friedland, MD, TernplelJnfuersity Children'sHospital (I:30 - 2:30 pm) 66. PreliminaryReport of an Ongoing RandomizedDouble Blinded Tiial of Propofoland MidazolamFor procedural Sedationin the Pediatric ED, CharlesJ. Hatel Jr MD, MedicalCollegeoJWisconsin


Monday, May 19

ScTNTIFIc PnpsRS/PosrERs Scientific Papers: Injury Prevention (9:30am - 12:00noon)

16.

Valueof PhysicalExaminationin PenetratingNeck Tiauma, BonnyJ. BaronMD, StateIJniversityof New YorhBroohlyn

Moderator: StevenR.Lowenstein,MD, MPH, IJniver sity of Color ado l. Risk Factors AssociatedWith Adolescent Firearm lnjuries: A Prospective Case Control Study, Elizabeth EdgertonMD, Harbor UCLA

I7.

Field Hypotensionin Tiauma Patientsis an Independent Predictorof the Need for EmergentTherapeuticSurgery AnthonyJ. Lot't'redo , Hqrbor UCIA

I8.

SecondaryTriageol LheInjuredPediatricPatientWithin the Tiauma Center:Support For a Selective,Fiscally-ResponsibleTwo-StageSystem,RichardJ. GaborMD, BaystateMedicalCenter

19.

TiiagePerformancein Elderly TiaumaPatients:A Universal Deficiency,MatthewH. Ma MD, JohnsHoplttnsHospital

20.

Comparlsonof Outcomesof PatientsTieatedin Urban Tiauma Centersand a Rural Tiauma System,Maianne MD, Harbor UCIA Gausche

2.

Effect of a Community BasedDomesticViolenceAdvocacyProgramin the ED on ResourceUtilization and Recidivism, RobertL. MuellemanMD, University of MissourtKansasCity

3.

Motor VehicleDriver RestraintSystem:A Cost- EffectivenessAnalysis, JamesE. WeberDO, tJntuersityof Michigan

4.

Deaths From Air Bags:A Detailed DescrlptiveReview, Mary Pat McKay MD, George WashingtonUniversity

5.

Mortality Reduction With Airbag and SeatbeltUse in Head-On Collisions,CameronCrandallMD. Untversityof New Mexico

6.

Effect of a Communi.ty-basedPolice SurveillanceProgram on Snowmobilelnjuries and Deaths,Bian H. Rowe MD, SudburyGeneralHospital

7.

Low Ratesof Arrest Among lntoxicated Drivers in MVAis, at the Sceneand ClinicallyEviin Spiteof PolicePresence dent Inebriatton,MichaelLahnMD, JacobiMedicalCenter

8.

Statusof Injury Educationin AmericanMedicalSchools, Y,noxH. ToddMD,MPH, EmorYUntuersitY

9.

Elderly NIDDM PatlentsExhibit Impaired Video Drir,rng Abihty After a 28 Hour Fastin the Absenceof HypoglyceoJNm Mexico S.KaminMD,Unh'ersity mic S;'rnptoms,John

10.

Failure of the Mandatory Domestic Violence Reporting Law to IncreaseMedical PersonnelReferralto Law Enforcement, CarolynJ. SqchsMD MPH, UCIA

Scientific Papers: Trauma (9:30am - 12:00noon)

Poster Session(1:30- 4:00pm) Injury Prevention Moderator: Deirdre Anglin, MD Los Angeles Countyl Llnirersity of Southern California (I:30 - 2:30 pm) 2I. Domestlc Violence in an Urban PrehospitalTiansport Population,JohnDutton,BostonUniversity 22.

ED-BasedStudy of Risk Factors for DomesticViolence AgainstWomen, DemetriosN, KyriacouMD MPH, OliveViewIJCA MedicalCenter

23.

Demographicsof Domestic Violence in a LargeMetropolitan City Over the PastTen Years,Enh D BartonMD Hospital MS.Brighamâ&#x201A;Ź>Women's

24.

InfluChildhood Fire RelatedDeath Sociodemographic Unwersity MD, Washington A. Wich Nancy ence,

25.

Firearm lnjuries in a Major Metropolitan Area: Who, What, When, Where and Why, ZoanneClachMD, Emory Unwersity

26.

FirearmSuicides:What We Know and Don't KnowAbout the Gun? TraciTymusMS,MedicalCollegeof Wisconsin

27 .

ElectronicSurveillanceof Firearm Injuries, DonsPowell MD, EmoryUnwersity

Moderator: ThomasM. Scalea,MD,IJniversity of Maryland 1I. Comparisonof lnfection RatesBetweenOctylcyanoacrylate TissueAdhesiveand SutureWound Repairin a ContaminationWound Model,lamesV QuinnMD, Unnterstty of Michigan

28.

ReImpact of PhysicianTiaining on Child Maltreatment MD, porting: A Multi-SpecialtyStudy,LrndaL. Lawrence Unit'ormed Sewices Univer sitY

29.

Effect of Fluid Resuscitationon the Rate,Volume, and Duration of Uncontrolled Intrathoracic Hemorrhage, John C. SahlesMD,IJniversity of Calit'orniaDattis

Washlngton,DC, Youth Curfew: Effecton Tiansportsfor Assault and Motor Vehicle Iniury, Harry MoscovitzMD, George Washington U niver sitY

30.

Tiauma Documentationin Casesof PurposefulAssault, MD, DenverHealthMedicalCenter Km Feldhaus

31.

Injuries lnvolving PoweredPersonalWatercraft,JohnH GouldMD, DuPontHospitalt'or Children

12.

13.

I4.

15.

Effect of Delaying Fluid Resuscitatlonon Bleedingin a SheepModel of Uncontrolled PulmonaryVascuiarHemMD,IJn:ersity of Caht'orniaDattis orrhage,JohnC. Sahles RetinalVenousOxygenSaturationCorrelateswith Blood Volume Changes in Anesthetized Swine, Kurt R. D enninghot'fMD, IJniversity of Al abama Birmingham Sodium Dichloroacetate Reduces Serum and Cerebrospinal Fluid Lactic Acid Concentralions in PatientsWlth SevereClosed Head Iniury, Carol H. Schultz MD, Universityof Michigan

Injury Prevention Modeiator: H. Range Hutson, MD, Brigham andWomen's Hospital(3:00 - 4:00 pm) 32. Factors AssociatedWith Inlury While Snowmobilingin Children in a Northern Ontario Community, Bian H. RoweMD, SudburyGeneralHospital


Thursday, May 22

7:00 SAEM InterestGroup Chairsand Board of DirectorsBreakfast, Adams

SAEM Program Committee Bancroft

7230 8:00 8:30 9:00

1998SAEM Annual Meeting Program Committee,Bancrofl

9:30 10:00

Managementof the AsthmaticPatient, Hemisphere p.52

SAEM ClinicalTrials CenterTaskForce, Adams

10:30 11:00 11:30 12:00 12230 1:00

Abuse SAEM Substance TaskForce,Adams

1:30 2:00

SAEM Public Health and Education,Adnms DeborahMaiesewill speak from 3:00-4:00

2230 3:00 3:30 4:00

ProjectASSERTDiscussion Adams

4:30 5:00 5:30 6:00 6:30 7:00


ScHnuuLEon EveNTS-

THURsDAv,Mev 22

7:00 FOR : Fundamentalsof Reserach

7:30 8:00 8:30 9:00

Respiratory (abstracts39L-396), Lincoln East p.47

HealthCareDelivery/Policy (abstracts397-402),Lincoln LincolnWest p.47

Clinical Practice (abstract403-408), MonroeEast p.47

FOR Introductionto Statistics, Georgetown p. 53

9:30 CoffeeBreak.ExhibitHall

10:00 10:30 11:00 1l:30

Administration (abstract409-412), Lincoln East p.47

FOR EthicalConsiderations in HumanSubjectResearch, Georgetown p. 53

CPR (absrracts413-416), LincolnWest p.47

Geriatrics (abstracts417-420), MonroeEast p.47

Ethics (abstracts 42L-424), Monroe West p. 48

Adviserto the Commissioner,FDA, Esq., Commissioner/Senior KeynoteAddressMary K. Pendergast, InternationalBallroon East

12200 12:30 1:00

Lunch SessionClinical Trials Research, Map p.52

Lunch Session InflammatoryBasisof Asthma,Military p.52

Lunch SessionMonitoring Methodsto Detect States, Hypoperfusion Caucus p.52

Lunch SessionLunchwith ResearchExperts, Thoroughbred p.s4

1:30 2:00 2230 3:00

FOR DataCollectionForms and Management, Georgetown p. 53

PosterSession,ExhibitHall Respiratory(abstracts425-446) 447-474) Clinical Practice(abstracts Administration (abstracts475-488) cPR (abstracts489-497) Geriatrics(abstracts498-506) IEME Exhibits(abstracts507-526) p. 48-51

FOR Art of Scientific Presentation, Georgetown p. 53

3:30 4:00 4:30 5:00

Respiratory (abstracts527-532), Lincoln East p.51

5:30 6:00 Banquet

6:30 7:00

HealthCareDelivery/Policy (abstracts 533-538), Lincoln West p.51

Clinical Practice (abstracts539-544), MonroeEast p.51

FOR AbstractPreparation andManuscriptWriting, Georgetown p. 53 Resuscitatiot Out-of-hospital Research.Monroe West p.52


Wednesday,May 21

7:00 SAEM GeriatricTask Force.Hamilton SAEM Program Committee, Bancroft

InternationalEM Interest Group,Dupont

EMRA/SAEM Leadership Forum: Chief Residents' Forum andAcademicCareel Options,Monroe p.43

SAEM PoliticalAffairs Committee.Adams

7230 8:00 8:30 9:00

AACEM Meetrng,Map p.46

SAEM DomesticViolencce TaskForce,Bancroft

9:30 10:00

SAEM GME CoMMittEC. Adams

PainControl Standardizing Military Research, p.43

10:30 11:00 11:30 12:00

PainManagement Interest Group,Dupont

AACEM AnnualBusiness EMRA/SAEM Resident ResearchForum: Creativity Meeting,Conservatory andImagination, Monroe p.43

SAEM ResearchCommittee Adams

12:30 1:00 1:30 2200 2:30 3:00

AcademicEmergency Medicineand Federal Government,Lincoln West p.44 StatusEpilepticus, JeffersonWest p.44

AsthmaResearchInterest Group, Farragut

CORDBoardof Directors. Edison

3:30 SAEM WorkforceTask Force,Dupont

4:00 4:30

Injury ControlInterest Group, Farragut

5:00 5:30 sion CPR/Ischemia/Reperfu InterestGroup,Dupont

6:00 6:30 7:00


Q!ryquLE oF Evrxrs -

WrnxESDAl-,Mev 21

7:00 FOT :Fundamentals of Teachins

7:30 8:00 8:30 9:00

Pediatrics (abstracts 254-259), Lincoln East p.27

Ischemia/Reperfusion (abstracts260-265), Lincoln West p.27

Education (abstracts 266-271) JeffersonEast p.27

FOT CaseStudiesin ChallengingTeaching Situations, JeffersonWest p.45

EMS/Ourof-hospital (abstracts 280-287), LincolnWest p.27

Toxicology/Environmental Injury (abstracts 288-295), JeffersonEast p.28

FOT Instructionof ProceduralSkills, JeffersonWest p.4s

9:30 Coffee Break. Exhibit Hall

10:00 Clinical Decision 10:30 Rules/Guidelines (abstracts272-279), Lincoln East 11:00 p . 2 7

FOT Residents asTeachers. JeffersonWest p. 45

11:30 12:00 12:30 1:00

Lunch Session Clinical Applications of Antibody Therapeutics, State p.44

Lunch SessionResidency Development in Australia, Korea,andHongKong, Hemisphere p.43

EducatorsLunch MeasuringKnowledgeand Skills, Thoroughbred p.43

SAEM PastPresidents and Boardof DirectorsLunch. 1919Grill

1:30 2:00

SAEM Annual BusinessMeeting,Lincoln (Elections,Award Presentations, President'smessage, ConstitutionandBylawsamendments) p.29-40

2:30 3:00 3:30 4:00 4:30

Poster Session,Exhibit HaU Education(abstracts296-322) Toxicology/Environmental Injury (abstracts 323-350) (abstracts351-362) EMS/Out-of-hospital Clinical Practice(abstracts363-376) HealthCareDeliveryiPolicy(abstracts377-390) p.28,4l-42

Substance Abuse, JeffersonEast p.44

5:00 5:30 6:00 6:30 7:00

Meet theAEM Editors Map

FOT AdvancedClinical SkillsAssessment, Conservatory p.45


rr

Tiresday,May 20

7:00 Clinical Skills Interest Group, Chevy Chnse

RRC-EM Specialist Site Visitor Workshop, Slate

SAEM EthicsCommittee. Adams SAEM Program Committee, Bancroft

7230 8:00

How to Write a GoodGrant ApplicationWorkshop,Map p.23

8:30 AbuseInterest Substance Group,Dupont CORD New Program Directors'Orientation Workshop,Caucus

9:00 9:30

ACEP ResearchBoot Camp Farragut

10:00

SAEM SouthernRegional Organizational Meeting, Dupont Committee. ACEP Research Farragut SAEM EMS TaskForce. Adams

10:30 1l:00 11:30 12:00 12:30 1:00

EMRA Representative State Council(l :30-4:OO),

CORD Meeting, InternntionalBallroom East p.26

1:30 SAEM Academic Development TaskForce, Adams

2:00 2230

SAEM/ACEPOfficers Meeting,Bancroft

EMRA Boardof Directors (4:30-6:00), Edison

3:00 3:30

Domestic Violence Interest Group, Dupont

EMF/ACEPTeaching FellowshipWine & Cheese Reception,Map

SAEM ManagedCareTask Force.Adams

4:00 4:30

SAEM Womenand MinoritiesTaskForce. Banuofi ShockTraumaInterest Group,Dupont

ResearchDirectorsInterest Group,Farragut

5:00 5:30 6:00 6:30 7:00


oF EvENrs ScHEUULE 7:00

TursuAy, Mnv 20 FOR : Fundamentalsof Research

7:30 8:00 8:30 9:00

DomesticViolence (abstracts137-l4O), InternationnlBallroom East p. 19

MedicalUseof the Internet, Evidence Based Medicine. Imaging/Diagnostics (abstractsl4l-144), Georgetown Monroe p.23 Int ernationnl Ballroom West p . 2 3 p. 19

Kennedy Lecture: Senator Paul Wellstone, International Ballroom Center

9:30 10:00 Coffee Break. Exhibit Hall

10:30 11:00 11:30

InfectiousDisease Pediatrics (abstracts (abstractsL25-130), 131-136), InternationalBallroon East InternationalBallroom West p. 19 p. 19

Non-BloodHemoglobin Solutions, Monroe p.23

12200 12:30 1:00

Lunch SessionEthical Challengesin the Pediatric Patient,Cabinet p.24

Lunch SessionDomestic ViolenceResearch, Hemisphere p.24

ABEM Lunch with Residents,Thoroughbred p.24

SAEM/PhysioControl Lunch (by invitation), Chew Chase

BayesianClinical Decision Making,Monroe p.24

FOR GettingStartedin Research,Georgetown p.25

TraumaticBrain Injury Research, Monroe p.24

FOR How to Do a Chart Review,Georgetown p . 25

1:30 2:00 2230 3:00

Poster Session,ExhibitHaIl 145-153) InfectiousDisease(abstracts (abstracts1,54-167 Imaging/Diagnostics ) (abstracts168-187) Cardiovascular (abstracts188-199) PainManagement (abstract s 200-212) Clinical DecisionRules/Guidelines (abstracts213-237) EMS/Out-of-hospital p.19-22

3:30 4:00 4:30

Cardiovascular (abstracts238-245), JeffersonWest p.22

5:00 5:30 6:00 6:30 7:00

SAEM IssuesForum. Monroe

AcademicMentoringin Action, Consenatory p.23

Feverin Children, Pain Management (abstracrs246-253), Monroe InternntionalBallroom West p . 2 4 p.22

FOR ResearchDesign, Georgetown p.25 FOR Evaluationof the MedicalLiterature, Georgetown p.25


Monday, May 19

7:00

t

SAEM ProgramCommittee, Banuoft

7:30 8:00 8:30 9:00

Health Services Research Interest Group, Dupont

ACEP Academic Affairs Committee. Edison

9:30 ACEP Scientific Review Committee, Farragut

SAEM/EMRA Officers Meeting,Adams

10:00 10:30 11:00

SAEM PediatricTraining TaskForce.Adams

NeurologicEmergencies InterestGroup,Dupont

11:30 12:00 12.30 1:00

EMRA Boardof Directors (1:00-4:30),ChevyChase

1:30

GUSTOIII: Resultsof an Infernafional Clinical Trial

2200

I nternational Ballro om East p.17

SAEM AAMC Liaison Committee,Adams

2230 3:00

SAEM/ABEM Officers Meeting, Bancrofi

Shock/TraumaInterest Group,Dupont UltrasoundInterestGroup, Edison CORD EKG TaskForce. Farragut

3:30 4:00

OutcomesResearchInterest Group, Dupont

SAEM EducationCommitter Adnms

PediatricInterestGroup, Edison

SAEM Publications Committee,Bancroft

4:30 5:00 5:30 6:00

PediatricFellowship DirectorsD:twrer.Ruth Chis' SteakHouse

6:30 7:00


Tuesday,May 20 Imaging/Diagnostics Moderator: Allan Wolfson, MD, IJniversity of Pittsburgh (3:00 - 4:00 pm) 154. Roleof EmergencyRoomUltrasoundVs. lntravenousPyelogram in the Evaluation of SuspectedRenal Colic, RichardJ. Hffier MD, I|niverstg of SouthernCaltfornia 155. Correlationof Ultrasonic Determinationof Urinary VolumesWith Actual VolumesObtainedBy Catheterization, Kent O'BnenMD, Ahron GeneralMedicalCenter 156. TransvaginalUltrasound By EmergencyPhysiciansDecreasesPatient Time in the ED, StephenBurgherMD MedicalCenter LCDRUSN MC, PortsmouthNaval I57. Doesthe lnstitution of an ED Tiaining Programin EmergencyUltrasoundChangethe Number of SonogramsOrdered From Radiology?MichaelB. Heller MD, St. Luhe's Hospital

170. DiagnosticUtiilty of Serum Markers in Acute Coronary Ischemla,Bian O'Neil MD, WayneStateUni:versity 171. Impact of BedsideWhole Blood Rapid Assayof Cardiac Tioponin-T Testing on Clinical Decision- Making, M. BaxterMD, Universi$oJCincinnati Stephen 172. Conparison o[ a New Dual Assay for Myoglobin and Carbonic AnhydraseIII VersusCK-MB for the Early Diagnosis of Acute Myocardial Infarcti.on,GerardX. Broganlr MD, UniversityMedicalCenter to Detect 173. Comparisonof the l2-Lead Electrocardiogram Acute Ml or UnstabieAngina in PatientsWith and Without Ongoing Chest Pain, StevenA. PaceMD, Madigan Army MedicalCenter L74. ED Diagnosisof Acute PosteriorWall MyocardialInfarction Usi.ngLeft PosteriorChest Lead, Marc PollachMD, YorhHospital

158. Use of the SonographicMurphys Sign DetectedBy Bedside EmergencyUltrasoundin PredicLingCholecystiLis, GeneralHospital Carlo L. RosenMD, Mqssachusetts

175. QT Dispersion- A UsefulAdjunct For Detectionof Myocardial Infarction in the Chest Pain Center, ChetqnShah MD. SparrowHospital

I59. Use of EmergencyUltrasonographyFor Measuringthe Sizeof the Abdominal Aorta, DavrdFM BrownMD, Mass' achusettsGeneral Hospital

176. ED Screeningof ChestPainPatientsUsing ElectronBeam Comuted TomographyScanning,DennisA. LaudonMD, Mayo Clinic

of IndeterminateUltrasounds:Does it 160. Subclassification Identify High Risk Patients?RobertG. Dart MD, Boston MedicalCenter

A. Hogan I77 . ED StressTestingin Acute Chest Pain, Teresita MedicalCenter MD, Resurrection

161. PanoramicViews of the Mandible in ConjunctionWith a Towne View in the Evaluation of Mandibular Injury, JamesLarsonMD, Universityof Calit'orniaSan Diego 162. New Methods in Digital RadiographyImprove Ability to Clear the Cross-TableLateral Cervical Spine in Tiauma University Patients,TimothyJanchar,Georgetown 163. EmergentMagneticResonancelmaging DisciosesOccult Injuries Accompanying Distal Radial Fracturcs,Jeremy BrownMB MS, BostonMedicalCenter 164. Effectof a Tiaining Programin ED Fluoroscopyfor Detection of Glassin Soft Tissue,MatthewR. Levine,NorthwesternUniversity 165. Effect of PerfusionScanningwith Tc-99m Sestamibion Diagnostic Probability Estimatesfor Unstable Angina and Myocardial Infarction , RaywinR. Huang PhD, Wayne StctteUnlversLty 166. Serum Amylase Offers No Additional Benefit to Serum RobertJ. Lipasein the ED Diagnosisof Acute Pancreatitis, VissersMD, Brighamâ&#x201A;ŹeWomen'sHospital 167. Serum CreatineKinase- A New BiochemicalMarker for Ectopic Pregnancy?Joan K. KnightMD, MedicalCollegeof Wisconsin

Cardiovascular Modercttor:RobertJ. Zalenshi,MD, Wayne State University ( 1 : 3 0- 2 : 3 0 p m ) 168. Are TypicalCoronaryRisk FactorsAssociatedWith Acute MI or l)nstable Anglna in ED PatientsWith Chest Pain? StevenA. PaceMD, MadiganArrny MedicalCenter 169. GenderDifferencesin CardiacMarkers:is There a Need for SeparateCutoffs? Henry C. ThodeJr PhD, Unittersity MedicalCenter

Cardiovascular Moderator:Judd E. Hollander, MD,lJniversity of Pennsylvania (3:00 - 4:00 pm) Predic178. Can the Acute CardiacIschemiaTime-Insensitive tive Instrument ldentify Patientswho Benefit from Noninvasive TestingAfter an MI Has Been Ruled Out? Robert I. ZalenshiMD, WaynestateunLversity 179. Reducing Admissions for Chest Pain to an Inner-City Municipal Hospital Using PhasedImplementationof a Prediction Rule - Results PhaseI, Peter C. Wyer MD, LincolnMedicaland MentalHealthCenter lB0. Acute IschemicCoronarySy'ndromeRule-Outin the Low Risk Patient:Descriptionand Evaluationof a LimitedResourceProtocoI,RobertH. BaevshyMD, BaystateMedical Center 181. FASTMK: A CanadianRegistryof PatientsWith AcuteMyocardiallnfarction,Jim ChistensonMD, St.Paul'sHospital lB2. Can EmergencyUitrasonography be Used to ScreenFor Critically Enlarged Abdominal Aortic Aneurysms?Da''tid GeneralHospital FM BrownMD, Massachusetts 183. Role of SIow lnfusion Calcium Channel Blockersin the Emergency Management of Supraventricular Tachycardia, SweeH. Lim, SingaporeGeneralHospital 184. Comparisonof StandardVersusGoalDirectedTherapyin of CritlcallyI1lED Patients,DouglasS.Ander Resusciation MD, Emory University 185. CardiovascularReguiationDuring ExperimentaiShock (Acute Hemorrhage)in Rats Does Not Appear to Use 'Hard-Wired'Reflexes,But RatherExperience-Dependent Adaptations of the Entire CardiovascularSystem,Bnan A. N esterD O. Albert EinsteinMedicalCenter


Medical Univefpity of South Carolina Charleston,SouthCarolina

Faculty OPPortunities

emergency board-certified is seeking servic.es of Emergency of southcarolina(MUSC)Department university TheMedical us News by hospitals 100 top in the tllryd ue-en ir"as o#t.rtiuw carefacility for ourrgti n.o t.u.hinghospiiar. physicians ICU' onlyLevelI ftaumacenter,LevelIII Neonatal is hometo thearea's years.MUSC andworldReportro,t*o consecutlve sertransport Ouremergency prOgrams. Transplant andPancreas largestNeprrorotogv/Renal BurnICUandoneofthearea,s patients'It operates ground,fixedwing,ani helicoptertransportof ciitically-illand injured ofTers vice,MEDUCARE radius' a 200-mile andcovers around-the-clock patientsannually'TheDepart44,000 has12full-timeEMfacultyandevaluates services of Emergency TheDepartment Hospital(172-beds)' Memorial l,luoi.arcenterandcharleston twofaciliiiesiMu"sc mentserves medicine musthaveemergency abilityandstrongclinicalskilis.Physicians leadership excellent mustpossess candidates medicine' in emergency **iO.n.vtrainingor beboardcertified &reas: we havemultiple exciting facutty opportunitiesin two certiflcation Medicine . go*a Certifiedby AmericanBoardof Emergency -! n-^.^n^-^..r^,rinino certilication Medicineflorrifinqr. . Board certified by AmericanBoard "r n*.tg;ry Medicineand Pediatric Emergency facultypracticeplan.If youhavea commitment in the400+physician benefits salaryandexcellent we offera competitive thetbp,call-orwriteus todav!Call(803)792to ;;; to seeit alt,workwith the best,advanc..*;;;;gi;9dt.1.. {^4 of southcarolina'171 university Medicat committee, b1g9,or contactsteueni. sa.f, MD,crrairmin,r?cultyseaich Ashley Avenue, charleston' sc 29425-6711 M/F/V/D Acti.nEmproyer, opoor,unity/Affirmative Eouur


Ads

ALBERT, Dr

we are seeking an experlenceclEmergencyMeclicinereslclency-trainecl indivldual to <lirectour EmergencyMedicine Reslclencyn "i.a_. The program has a.PCY2,3, 4 configuration,and is approved for 56 residencypositions.The residency hashaclonly two clirectorsin its tweity-year historyz, both of whom are current members oFthe futt,time seniorfacul$l ' The program has never had other than full accreclitationfrom the RRC,ancl for more than a decadehas outperformeclall other resiclencyprograms at the meclicalschool in the NRMp. with the recent tormation of a new acaclemicclepartment anclthe recruitment of a Chairfollowing an 18-monthnationalsearch,the resiclencyis in theprocess of converting Froma hospital-basecl configuration to one that is acaclemicaltyclepartment-baseci. Previously,_and for many years, the residencywas locateclprincipallyat o.nesite (JacobiHospital,a Level I Traumi center). Duri;;th";ast year it has expancledto a second hospital (Montefiore Meclical Center,the AcaclemicMedical ienter for Einstein),ancl within the next two years we anticipateexp-ansion to encompasstwo aclclitionalhospitals,one public (Northcentral Bronz Hospital)and one not-for-profit (The EinsteinHospital).The four-hospitalcomplex, all within a two-mile raclius,anclall unclerthe same acaclemicDepartmentof EmergencyMedicine, sees over 200'0oo visits annually,thus proviclingan extraorclinaryr breacrthanclclepth of personal,eclucational' and acaclemicopportunitiesfor, respectively,provision oF*r" to an enormous spectrum of patients and illnesses,residencytraining, stucrentteaching, ancrcrinicarinvestigation. Listedbelow are the qualitiesanclskills that.we value highly in our department. Although we clo not expect any single incliviclualto possessall of these charactErisiics, the optimal cancliclatewoulcl have some measureof the tollowing attributes: I Interpersonalskills,warmth, anclempathy, specificallyin interactions with patients.This is an essential characteristicit one is to serve ut u rirong role moclei for young cloctorsin training. I Declicationto provision of care for the poor ancrunderservecr. I Bedsicleclinicalexpertise,accompanieclby the abilig to exflicitty communicateone,s clinicalthinl<ing at a level comprehensibleto the resiclentor stuclent, ancl to clo so in a fashionthat ctoesnot mal<ethat indiviclualfeel inaclequate. I Maturity, both within and outsiclethe clinicalarena. I Leadershipskilrssufficientto function at the reveroFa Vice-chair. I Evidenceof significantongoing engagement in clinicalinvestigation through originat publicationsin peer-reviewedlournals. I Micaromanagerial organizationalsl<ills,e.g., a vision of how to reconfigure a training program, previously basedat a single hospitat, into one toundEd on the concept of an integrateclacademic clepartment. ) Sufficientself-esteem(not to be confuseclwith arrogance)io remain un]ntimiclatectby all of the foregoing. Thisinclivictuat will have a unique reporting.relationship,clirectlyto the Chair,anclwill be accountableto no one else' There are currently severalrrightytalentecl physiciansacting as Residencysite Directors at teachhospitalwho are anxious to begin worl<with an incliiziclual who brings a fresh perspectivealong with her or him' The salarylis a competitive acaclemic salaryr,benefitsare excellent,anclfull acaclemic appointmentin the he Departmentof Emergency medicine at appropriate ranl<can be expectecl. Please submit cv's to: E' .fohnGaltagher'MD, Professoranclchair, Department oFEmergencyMeclicine,Atbert Einsteincollege of Meclicine,Montefiore MecticalCenter,Bronx, New york 10467


Ads

Chiefof Medicine Emergency I Levelltrauma/Level a nationallyrecognized Medicalcenter(SPRMC), St.Paul-Ramsey Medicine' a Chiefof Emergency is currentlyseeking burncenterin St.Paul,Minnesota, in the organizations oneof thelargesthealthcare spRMCis partof HealthParrners, has Medicinedepartment anEM TheEmergency patients. Midwestservingover700,000 urban, asmedicalcontrolfor facilitiesandserves program,state-of-the-art residency andruralEMSsYstems. suburban anddirectionto theEmergency leadership physician Thishighlyvisiblepositionprovides budget qualityassurance' in theareasof programdevelopment, Medicinedepartment anddeliveryof comprehensive andin thedevelopment activities andacademic maintenance services. medicine emergency andhave medicine shouldbetrainedandboardcertifiedin emergency Qualifiedcandidates skills' andmanagement provenleadership thatdemonstrates careerandclinicalexperience skills,andeligibilityfor strongcommunication andresearch, to teaching A commitment is required'Knowledge of Minnesota appointmen*oih.fr.ulty of theUniversity academic workingin a LevelI trauma andexperience careenvironment in a managed andexperience facilityis preferred. in Washington' theSAEMconference To learnmoreaboutthisopportunitywhileattending (202)483-3000' pleasecontactDr. FelixRnt .t at thewashingtonHilton andTowers May 18-22' Dr. Ankelwillbe in Washington forwardyourcv to: Forconsideration, areverycompetitive. salaryandbenefits P.o.Box1309,Minneapolis, Ann.:SandyLachman, Services, Physician HealthPartners, Formoreinformationcall(612)883-5338 Or fax yourcv to (6t2)883-5395. MN 55440. EO/AAEmployer' or e-mailto: sandy.j.lachman@healthpartners'com'

tttE 7lE

HealthPartners

MedicalCenter St. Paul-RamseY missionis to improuethehealth HealthPartners' andour cornmunitY of our members


Ads

AcnonrucEmnncexcy Mnuqxn FacumyPosnlox

Brighamand Women'sHospital

HarvardMedicalSchool THnDnpnnrmexr

I EmergencymedicineresidencyPG1-PG4with 12 positionf year,fully supported I Wellestablishedacademicfacility of 16 FTE, residencytrainedin emergency medicineat leadingprogramsacrossthe USA I State-of-the-art(c. 1996) EmergencyDepartmentwith 45,000 patientvisits I Level 1 trauma center I Nationallyrecognizedinformaticssupport and clinical computersystem I Full hospitaldepartment,outstandingpersonaland professionalsupport t) Partnershipin researchand educationwith Massachusetts GeneralHospital I Free-standingDivisionof EmergencyMedicineat HarvardMedicalSchool, reportingdirectly to the Dean

THnPosrrron I Full-timefaculty position r) Excellentacademicsupport I Appointmentat HarvardMedicalSchool t) Academicrank commensuratewith experience/achievement I Unparalleledresearchopportunities I Competitivesalary,outstandingcomprehensivebenefitpackage

THeEuccesspqlCnNornATe 0 Residencytrainedemergencymedicinespecialist I Establishedtrack record in academicemergencymedicineor strong commitmentto academicemergencymedicineas proven by performancein residencytraining,fellowship,or faculty position

THnOppoRrunny I Emergencymedicineresearchis flourishingat HarvardMedicalSchool I Unparalleledopportunityfor nationaland internationalcareerdevelopmentand exposure I Come and see what it could mean to you to be a part of it Brigham and Women'sHospital is an equal opportunityemployer. Inquiriesshould be accompaniedby a curriculumvitae and may be addressedto: Ron M. Walls,MD, FACEP Chairman,Department of EmergencyMedicine Brigham and Women'sHospital 75 Francis Street Boston. Massachusetts 021,15


Ads

NORTH SHORE HEALTH SYSTEM of Department Medicine Emergency

Nonrn SHonBU NIVERSITYHOSPITAL 3OOCOMMUNITY DRIVE, MANHASSET,NEW YORK I IO3O

ResearchDirector -

(5 l6) 562-3090

Emergency Medicine

seeks a Research North Shore Health System, Long Island, one of New York's leading health care networks, in Manhasset. Director for its Emergency MedicilneResearchprogram at North Shore University Hospital scienceresearch The successfulcandidatewill possessspecialinterestand accomplishmentin clinical and/orbasic Prepared/certified and other academic and schojarly activities. we would welcome applicants who are Board range of clinical A wide interest. of tieta in a scientific expertise uodltional *ith physicians Emergency Medicine diverse and basic scienceresearchresourcesand opportuniti"r u." available. our researchprogram is active-and as well skills and would be enhanceJby an individual wiih exceptional leadership,motivational and development as experiencein grant writing. MD, MD/PhD or PhD candidateswould be considered. academicmedical North Shore University Hospital in Manhassetis a voluntary, non-profit, tertiary care' 700-bed setting on Long centeraffiliated with lriew york University School of Medicine. It is locatedin a beautiful suburban Island,lessthan 15 miles from midtown Manhattan. for growth' Please We offer an excellent salary in associationwith an outstandingbenefit package andpotential Medicine, North forward resumesand inquiiies to: Andrew E. Sama,MD, Chairman, Department of Emergency ShoreUniversity Hospitil, 300 Community Drive, Manhasset,NY 11030' Phone: 6616\ 562-309b;Fax: (516) 562-3680.Weore an Equal Opportunity Employer

Yorh'Health of Netu StateUniversity iscurrentlv at Broohlyfl Center Science

Medicine. ofEmetgency fortheDepartmeirt Chair loranew searching butwillbeare' Center Hospital County atKings isbased TheChaii andtheBrookdale Center Science attheHealth chair academic oional isoneofthelargest Hospital County Kings Center, Medical Hospital 120,000 withapproximately States intheUnihd hospital municipal TheBrookvisitsperye4r. pediatric Room Emergency ahd60,000 adult hospitals voluntary isoneofthelargest Center Medical Hospital dale areLwelI vislts andbothhospitals Room Emergency with85,000 withMaimonides isalsoaffiliated Theprogram Centers, Trauma Medical Center. pr0gram, curresidency hasitsownACGME-approved Thedepartment andis of52residents ofthefullcompliment with39residenh rentlv students. ofmedical intheteaching involved extensively inEmergency beboard-certified should candidate Thesuccessful andbring experience andacademic clinical significant have Medicine, experience administrative achievement, ofscholarly record inastrong ability. andleadership position send acurshould forthisexciting andcandidates Nominees to: references names olthree vitae and riculum MD,Chait t. Lucenle, Frank Commillee Seatch Medicine Emergency Box97 ofMedicine, Gollege SUNY-HSCB Avenue 450Clarkson NY11203 Brooklyn, employel 0ppoftunity isanequal SUNY-HSCB

NEW GRADqATES!

EACUHY POSITION Entrv level academic Position . AvailableJuly, 1997 . Diversefaculty of 26 with distinctEM residency credentials r Protectedtime r Very structuredresidencyProgramin 2-4 format . Strongresearchsupport r Limitednight and weekenddutY r Uniquefaculty developmentprogram r GreatResidents! Sr. Research Physician . Experiencedinvestigatorwith track recordof publicationsand/or extramuralfundingto join i?esearchDivisionin major public hospitalwith sevenfull-timeresearchfaculty,Ph.D' Co-director and grants/datacoordinator.RushMedical Collegeaffiliation,170,000 adult/ pediairics/traumavisits and a 12-bed bbservationUnit. Candidatemust be EmergencyMedicineBC/BE. Send CV to Robert Simon, MD, Professorand Chairman, Department o Emergency Medic-ine, 1900 W. Polk St., 10th floor,Chicago,IL 60612


f

l-

@

F.ftwtsr

ffi

!,r"1 emirW*nrgtnrgsniifint

University Emergency Medicine Foundation (UEMF)is seehing a Director for the Davol Emergency Department (ED). The Davol ED at Rhode Island Hospital (RIH) is the Iargest of rhree Emergenclyl"puttments,servedby UEMF,in Providence,Rhode Island.The Director will be responsiblefor att op"ruiiont of the Davol ED,which is an urban , terriary cardiac referral center and Ievel t tiauma center. RIH is a 700bed hospital, the major teaching hospital of Brown University. The Brown University Emergency Medicine residencytraining program with 48 residents is based at RIH. Davol ED has Zo,O00annual viiits with urgent and observation care. Eighteen board certified emergency physicians staff Davol ED. Responsibilities of the Director will include executive leadership in opeiations and direction of new initiatives. Servingas the Director of Davol ED is an excellent administrative opportunity to worh with a Iarge progressiveacademic group in an attractive environment. Candidatei must be BC in EM with signitilant administrativeexperience.The Directorwill report to the Presidentof UEMFwho is the physician-in-Chief of EmergencyMedicine at RIH and Chair of the Section of EM at Brown University. Salary and fringe benefitsare competitive.Send letter of interestand CV to, Robert H. \7oolard, MD Chief, EmergencyMedicine 595 Eddy Street Providence,RI Oggoj

Medical Collegeof Virginia Hospitals Virginia CommonwealthUniversity Newlyestablished academic Departrnent of Emergency Medicineat theMedicalCollegeof VirginiaHospitalsA/CU isseeking highlydedicated andinspiredBC/BPEmergency MedicinePhysicians. This iJa fu[-ti;, academic position with responsibilities for patientcare,teaching,researchandadministration.The departmentis startinga Residency Program andis seekingleaders to assistin thedevelopment of theprogram. MCVHospitals is a 81l-bed,LevelI TraumaCenterwith over100,000 visitsperyear. MCVH operates a Life Flight Helicopter Service, PediatricTransportserviceanda regionalpoisoncenter.the Emergency Department hasa renewed commitrnent to provideworld classpatientcareanda superbteachingenvironmentfir residents, All positions carryappointnents to thefacultyat theMedicalCollegeof Virginiaandprovidea competitivesalaryand excellent benefits.Individualsinterested in "makinga differencei'ir, - eiciting environment shouldforwarj their currentcurriculum vitaeto: JosephP. Ornato,MD, FACC Departmentof EmergencyMedicine MCV Hospitals/VCU 401North l2th Street Richmond,Virginia 23298-0401 I-888-240-MCW (6288) Fax: (804)828-4686 MCVA/CU ir o EEO/AAcmploya.Womcq mircritia, & pâ&#x201A;Źmro wirh dirlbiliria uc moungcd o apply

IvIq/ HOSPITALS WsiiCarllrdt[i|Eiy


of DePartment Theacademic of of theUniversity llledicine Emer$ency academic full'time has System Health Pennsylvania andresearch teaching care, positions withpatient forboardcertified/prepared available responsibilities physicians at residency'trained medicine emergency Pennsylvania of the University of Hospital boththe must Candidates Centet. Medical andPresbyterian fac' medicine to emer$ency qualifyforappointment of School of Pennsylvania ultyof theUniversity shills professor have must and asassistant Itedicine The andresearch. in teaching andinterests of the attheHospital Depafiments Emer$ency (HUP) andthe of Pennsylvania University (Pilt0) treatorer75'000 Center Medical Presbyterian I Trauma l,evel is a HUP patients and annually timeforreseatch. will haveprotected Faculty Center. are Positions arecompetitive. andbenefits Salaries and Clinisian-fducator in the Clinical, available vitaeshouldbefor' Curriculum trasks. research of wardedtorlryifiiamG.Baxt,illD,Chair;Department of of theUniversity Hospital lledicine; Emergency PA Philadelphia' Streeh Spruce 5400 Pennsylvania; (Fax215/662-t951). AA/E0E r9t04

CAIL FOR ABSTRACTS 1998AnnualMeeting May 'l$-2,'t Sheraton Chicago Hotel and Towers Chicago, lL for reviewfor oral The ProgramCommitteeis acceptingabstracts Authorsare invitedto submitwork in all and pos[erpresentation. pediatrics, Medicineincludingresuscitation, aspectsof Emergency trauma,EMS,shock,basicscimedicaltoxicology,administration, ence, injury preiention,health policy research,education,infecneurologictrauma,and methodology. tiousdisease, formsareavailablefrom the SAEMhomepage Abstractsubmission or upon requestto the SAEMoffice' They at hftp//www.saem.org will also be publishedin the December1997 issueof Academic Ei"rg"nry Medicineand the Novemberand Decemberissuesof the S-nfM Newsletter. For further information,contactSAEMat or 5.17-485-0801fax' saem@ix.netcom.com 517-485-5484, maybesubmitted.Thedatamustnot of originalresearch Only reports in manuscriptor abstractform or presentedat a havebeenpublish"ed nationalmedicalscientificmeetingpriorto the 199BSAEMAnnual presented at othernationalmeetingswithMeeting.Originalabstracts .1998 AnnualMeetingwill be considered' in 30 dlys priorto the toauthorsto submittheir manuscripts SAEMstronglyencourages AcademicEliergencyMedicine (AEM). AEM will-notify authorsof a decision,egardingpublicationwithin 60 daysof receipt' mustbe submittedon the officialabstractform and must Abstracts be receivedby lanuary 9, 1998. Sendabstractsand correspondenceto: SAEMAnnualMeetingAbstracts Avenue ' Lansing,Ml 48906 901 NorthWashington

tEN toR FAGUrfl.lErA RE'IDEXGy RE'EARGH DIREGTOP

anticipated Position July1997for experienced in andexpertise MDor PhDwithinterest to research services clinicaUoutcomes/health andiuniorfacultyin residents assist of activeclinicalresearch advancement faculty; Research progrant.MD/PhD/MPH in place. akeady funding labs,some fellows, with25+ faculry30EM program Multi-site EDvisits.Verycompetitive 100,000+ residents, localMPHopportunities. andschedule, salary atAssociate for appointment suitable Shouldbe levelor above. Professor of MD,Chief D.Powers, to: Robert Reply of School Medicine UCONN Medicine, emeigency Hartford, Hospital, c/oDipt.bMs/ttuu*u,Hartford (tax), (s60)545-4t87,545-5132 CT06115. Hilton at rulton contact or conmct rpowers@harthosp.org. rpowers@harthosp.org. email: email: Meeting. duringSAEM

'LlntVers(xyr

t

of

fults stsstppi fulebtca[ Center {he Qepartment of CmergencY fulebictne has openingsat a[[ [ene[sfor emergencAmebicinerestbencytrafueb facu[ty. \ile U esub [tsl4eb emergency mebictneres(bencywtth 6 restbentsper Uear. Actine research progratn-s'GQ reno,lat[on unber','Jay.Ar atnbulance anb rnebicaltoxico[oqyprograwr.SerJes as dte on[y .tel/e[ I trauwra center [n anb tl,restate. CxceTent coLnpensdtion benefits.Contact'Robert Qa(-It'AIO' f AC't?. Chair anb ?rofessor, Qepartwrent of Gwtergency il'ebictne'

25OO'North State Street' A S 39216-4505: ,fackson. 601-964-5517. aoe A /+/O/N


Ads MEDICAL COLLEGE OF GEORGIA: PediatrlcEmergencyMedicine The Departmentof EmergencyMedrcine has openings lbr two pecliatnc EmergencyMedicineattendings.Must be board certified or prepared in Pediatric Emergency Medicine. Administrative experienced desired.An established EmergencyMedicineResidencyprogramwith B residentsper year. Inrerest in starting a pEM fellowship. Active researchprogramswlth good extramuralsupport. Spacious,new ultramodernED facilitiesNew adjacentChildrens Hospital and pediatnc ED to be completedin 1998. Level I rraumacenrerfor pediatricsand adults.Thecompensation and bene[itsareexcellentand highly competitive. ContactLarry Mellick, MD, FAAB FACEII Chair and professor, Dept.of EmergencyMedlcine,1120 15rh Street,AF-t-044, Augusra, GA 30912;706-72I-3332.EqualOpportuniryAffirmariveEmploycr

NEW YORK CITY (BROOKLYN) SUNy: ResidencyWantecl:EM trainedor boardcertifiedfacultymembersat ail academiclevels.Kings Countyhas a busy ED with large rrauma volume; facuhy rncmbcis may alsowork at affiliatedhospitals.We have opportunities in both chnicaland animalresearch. We havesignificanrparticipationin medicalschoolteachingduring the lsr, 2nd and 4th years;we havea rwoyearold four-yearEM residencywirh 13 residcnrspcr year.Send CV and lettersto RonaldB. Low, MD, Departmentof EmergencyMedicine,Box 1228,SUNYHSC, 450 ClarksonAve., Brooklyn NyC, New York 11203.Phone(718) 245-2969,fax (7lB) 245-4799.e matl low@hscbklyn.edu.

STATEUNIVERSITY OF NEW YORK AT BROOKLYN: New york City - FacultyPosition- seekingEmergencyMeclicrneResidency Trainedor BoardCertifiedfaculty lbr our fully accrediteclemcrgency medicine resrdency 24-30 hours/weeko[ clinicalresponsibility, most ttf it at KingsCountyHospilal,one ol'the busiesttrauma centersjn the countryWe sllpportboth clinicalanclanimalresearch. We are allliatecl with an accreditedpecliatricemergencymedicine fellowship.Contacr MichaelLucchesi, MD (718) 245-4790or fax CV to (718) 245-+7c)g

Departmentof EmergencyMedicine Open Rank: The University of Cincinnati Department of Emergency Medicine has a full-time academic position available with research, teaching, and patient care responsibilities. Significant research experience in cardiovascular, neurovascular, or toxicologic emergencies preferred. Candidate must be residency trained in emergency medicine with board certification/preparation. Salary, rank, and track commensurate with accomplishments and experience. The University of Cincinnati Department of Emergency Medicine established the first residency training program in Emergency Medicine in 1970. The Center for Emergency Care evaluates and treats 66,000 patients per year and has 40 residents involved in a 4-year curriculum. Our department has a long history of academic productivlty, with outstanding institutional support. Please send Curriculum Vitae to W. Brian Gibler, MD, Chairman of Emergency Medicine, University of Cincinnati Medical Center,231 BethesdaAvenue, Cincinnati, OH 45267 -0769.

Universltyof lllinois at Chlcago TEXASTECH: The Departmenro[ EmergencyMedicine in El paso, Texas is seekingan AssistantDirector for the residencyprogram.Depanmentstaflsa busy ED (50,000 visits) and Levcl 2 TraumaCcnLer with high acuity.Proviclesmedical direction for El paso EMS & West TexasPorsonControl Centcr.Our 14 yr. old EmergencyRestclency is fully accredited. Salaries& benefitscompetitive.Corrtu.t Matthew J. Walsh,MD, TexasTech Univ, Dept. Emergency Medicine, 6090 Surety Dr.,Ste.412, El Paso,TX, 79905.915-77I-6482(phone)915771-0296(Fax)or E-mail:mwalsh@whc.net.

UNIVERSITYOF CALIFORNIA, San Francisco: Full-time faculty positionavailable for residency-trainecl, board certifiedemergencyphysicianwith previousteachingexperienceanclcommitmentto acaclemic career. Mix of clinical,research,educational,and administrativeresponsibilitiesavallable.Fligh acuity university ED with EM resicler-rts anddiversemix o[ communityand tertiarycarepatients,servingone oI thetop-raLed medicalcenrersin the US. pleasesend yor_rrCV and descnptionof interesrsto Michrel Callaham,MD; Box b208, University of California,San Francisco CA 94143-0208 (e-mail mlc@itsa.uc sf.edu). TheUniversityof Californiais an equalopportunity employer.

UNIVERSITYOF MISSISSIPPIMEDICAL CENTER: The Deparrmentof Emergency Medicinehas openingsat all levelsfor emergency medicineresidencytrained faculty.Well establishedemergencymedicineresidency with 6 residentsper year.Active researchprograms.ED renovation underwayAir ambulanceand medicaltoxicologyprogram. Ser,,es asthe only Level I trauma center in the state.Excellentcom, pensation and beneflts.ConracrRoberrGalli, MD, FACEB Chair and Professor, Departmentof Emergency Medicine, 2500 North State Street, MS 39216-4505;601-984-5577EO9. M/F/DN Jackson,

TheUniversity oJlllinois Department of Emergency Medicine isseeking a board-certified emergency physician withstrong administrative, 0rganizational andfinancial t0 serve skills asAssociate Chief/Director of 0perati0ns to startJuly1,1997. The Department has16full-time EMlaculty, andthectinicalservice patients evaluates 40,000 annually. The productive Department isacademically wlthactive pr0grams research involving clinical trials, clinical toxicoloqy, neur0phy$i0logy andiniurypreventi0n. TheDepartment supports anintegrated residency program in EMwithtwoaffiliated hospitals, a comprogram bined EM/lM withtheDepartment of Internal Medicine, Toxicology, EMSandMedical Education Fellowships. TheAssociate Chief willhave responsibility fordirection of clinical activities; develOpment andmonitoring pathways, quality of clinical improvement programs; andbenchmarking andfor serving asanactive liaison withourexternal billing agency andmanaged caredepartment. Theposition carries a tenure-track (clinical) academic appontment attheassistant professor orassociate level dependingonqualifications. Salary andbenefits arecompettIrve. Contact GaryR.Strange, MD,FACEP, Head, Department of Emergency Medicine, University of lllinois College of Medicine. 1819 W PolkSt.,Room 618CMW, MlC724. Chicago, lllinois,60612. TheUniversity of lllinois isan Equal 0pp0rtunity/Aff irmative Acti0n employer.


il

Ads

z I-

F -l

I=

IT

o F \t' & I

II]

z -

T -

FACULTY POSITIONS Medicineat TheSectionof Emergency in Ann Arbor Michigan of the University for full time cliniis seekingphysicians facultypositionsin cal and instructional Academicrank Emergency Medicine. by credentials. will be determined will include Clinicalresponsibilities patientcareactivityat UM and affiliated hospitalsincludingFooteHospitalin Jackson,Michigan.Responsibilities includehouseofficertrainingand providingdirectpatientcarein a setting providingboth primaryand tertiarycare Applicantsshouldhaveresiexperience. dencytrainingand/orboardcertification Medicine. Excellentfringe in Emergency package. If interested,please benefit sendcurriculumvitaeto: WilliamC. and Section Barsan,M.D.,Professor Head,EmergencyMedicine,UMMC, 1500E. MedicalCenterDrive,Ann The University of Arbor,MI48109-0014. affirMichiganis an equalopportunity mativeactionemployer.

ILLINOIS: Double-boardedEM and Pediatricsor PediatricEM, faculty is being sought by a major medical center tn suburban Chicago. Practiceboth specialtiesin a well-established,University of Illinois EM program.This 63,000 census,high-acuity,traumaunit includes20,000 pediatric visits integratedinto the ED. Faculty care for both adults and children, as well as train 27 EM residents and other housestaff. Protected time for educalion, researchand administration. Applicant should be boarded or board-preparedfrom residencytraining in above Submit CV to StewartReingold,MD, EmergencyMedicine specialtres. Department,Christ Hospital,4440 \M 95th St , Oak Lawn, IL 60453.

MADIGAN ARMY MEDICAL CENTER: Outstandingopportunity for Board-CertifiedEmergencyMediclne Physician.Full-time (160 hours a month), temporaryposition.Work flexible shifts in the heart of the scenicPacificNorthwest.New, state-of-the-artfacility,dynamic EmergencyResidencyProgram. Call JoanneJohnson, Civillan PersonnelOllice. l-206-967 -2131.

MEDICAL COLLEGE OF GEORGIA: The Departmentof Emergency Medicine has openings for two EmergencyMedictne attendings.Must be boarclcertlfiedor preparedin EmergencyMedicine.Adminlstrative EmergencyMedicine Residency experienceddesired.An establishecl programwith B resrdentsper year.Active researchprogramswith good extramuralsupport.Spacious,new ultramodernED facilities.New adjacent ChilclrensHospital and pediaLricED to be completedin 1998. LevelI traumacenterfor pediatricsand adults.The Augustaateaoffers an excellentlami1yenvironmentin conjunctionwith a wide varietyof social,cultural,and recreationalopportunities.The compensationand benefitsare excellentand highly competitive.Contact Larry Me11ick, MD, FAAP,FACEB Chair and Professor,Department o[ Emergency Medicine,1120 15th Street,AF-1044,Augusta,GA 30912;706-72Il pportunitA y l f i l m a t i v eE m p l o y e r 3 3 3 2 .E q r t aO

Emergency Medlclne ResldencyFaculty POSltlOnS

Avallable:

of TheBowmanGrayschoolof Medtctne

Wake Forest University is seeklng candldates fior positions at the lnstructor, asslstant and/or associateprofesJor level ln the Emergency Medlcine Residency Training Program. Positions av ailable include instructor, Residency Dlrector and Pedlaftlc Emergency Department Director. The traintng progrim is well establlshed wlth n f ndgEM approval. The hospltal ls a level I Trauma Centerwtth ln excess of 50,000 pattent vlsits perYear and a full compliment of training programs in addition to Emer$encYMedicine. The Emergency Medicine residency training program is conftgured as a PGYI-III program with eight residents per year. AII positions are tenure uacl with Wake Forest University. Salary and beneflts are exftemely competitive. Candidates must be residency ftained and either Board Cerlified or eligible to sit for the boards in EmergencYMedicine or Pediaftlc Emergency Medicine. The Bowman Gray School of Medicine is an Equal OpportunitYl Aflirmative Action Employer. Interested applicants should contact: Earl Schwartz, MD, Chairman, Dept of EmergencYMedicine, Medical Center Boulevard, Winston-Salem, North Carolina 27 I57 -1089. Phone: (910) 716-4626. Fax: (910) 716-5438. E-mail: eschwart@bgsm.edu

':;

l 1


l r _

Ads

PosiiroNs AvnrnBLE FELLOWSHIPPOSITIONS HENRY FORD HOSPITAL-Weatherby Health Care Resuscitation ResearchFellowship: This well-establishedfellowship program has receivedpermanentsponsorshipfrom WeatherbyHealth Care. Research activitiescenteraround resuscitationof critlcaliy il1 patients including cardiacarrestlrctims. Clinical studresinvolve evaluationof pathophysiology of shock and new therapeutic intewentions. Laboratory studies involveuse of MR technologyand molecular biology to study cerebral responsein the critlcaily il1 and injured. Fellow has option for clinlcal experienceas stafflfacultyin teniary care ED wrth residencyprogram. Competitivesalary with excellent benefits. Contact Richard Nowak, MD, Departmentof EmergencyMedicine, Henry Ford Hospital, 2799 W GrandB1vd.,Detroit,MI 48202 or call (313) 876-1909. HARTFORDHOSPITAI-/UCONN SCHOOL OF MEDICINE: Comprehensivetraining in toxicology aval1ab1e in diverse program combining the resourcesof CONN. Connecticut Poison Control Center, Hartford Hospital,ConnecticutChlldrens Medical Center,and the John Dempsey Hospltal.Activetoxrcologyclinic and inpatient consultservice.Additional features: HBO program(Norwalk), pharmacyand clinica7lorensiclaboratories,abundantteaching,supervisedbench,anlmal and clinical research. Salanes initiatedat PGY4with benefits;additional clinical-per diem for qualifledindMduals. Contact Marc Bayer,MD, or CharlesMcKay,MD, Department of EmergencyMedicine,Hartford Hospital/CONN Schoolof Medicine,B0 Se)'mourStreet,Hartford, CT, 06102,5037; phone 860545-54II;fax860-545-532 1; or e-mailcmckay@harthosp.org UNIVERSITYOF CALIFORNIA, SAN DIEGO: The Divisionof MedicalToxicologyoffersa 2-yearfellowship in Medical Toxicology Fel]owship fulfills guidelinesestablishedby the ACMT Experienceincludes thenewCaliforniaPoisonControl System,inpatient admitting and consult services at threeareahospitals,outpatient.referralclinic, hyperbaric chambeqongoing clinical and bench research,and supervision and

UNIVERSITY OFVIRGINIA VIRGINIA EMERGENCY MEDICINE CENTER RESEARCH DIRECTOR TheDepartment of Emergency Medicine at the University of Virginia is seeking a boardcertified/prepared faculty member at professor theassistant orassociate leveltodirect itsEMResearch (formative Center stages). Job responsibilities includecoordinating interdepartmental, regional and statewideemergency medicine research and overseeing VirginiaEmergency MedicineResearch Center development. Faculty members at UVaDepartment of Emergency Medicine are actively involved (toxicologic, inresearch pediatric, cardiovascular, EMS, neurologic, andpsychiatric) underthedirection of a faculty research director, TheEDcensus is 60,000, including 14,000 children. Thedepartment includes pediatric a chestpaincenter, ED,active airandgroundtransport programs anda poisoncontrol center: TheUVaHealth Sciences Center is a tertiary careand levelI trauma centerlocated at the footof the BlueRidge Mountains. SendCVto M. L. Martin, MD,Chair,Department of Emergency Medicine, University of VirginiaHealthSciences Center, P.O.Box10014, Charlottesville, VA 22906-0014. The University of Virginia is an affirmative action, equalopportunity persons, employer. Women, minorities, disabled andveterans are encouraged toapply.

teaching by four ACMT certified physicians and two ABAI certlfied pharmacrsts.Fellows will meet criteria necessaryfor eligibility for the ABEM subspecialtyboard examrnationin toxicology Interestedindir,rduals should contactRrchardF C1ark,MD, UCSD Medlcal Center,200 W Arbor Dr., #8676,SanDiego,CA 92103-8676,or call 619-543-6835. UNIVERSITY OF PITTSBURGH: The Department of Emergency Medicine and the Center for Injury Researchand Control are offenng a fellowship in Injury Control. Candidatesshould be residencytrained and board cerrified,/eligiblein Emergency Medlcine. The fellowship will focus on developing expertise in injury control methods including surveillance, research,interventional programs, and policy Fe1lows will assumelimrted clinical responsibilities in the University of Pirtsburgh Medical Center EmergencyDepartment and affiliated institutions. An apporntmentof lnstructor of EmergencyMedlcine with Universrtybenefitsand CME a]lowanceis provided.ContactJeffreyH. Coben, MD, Director, Center for Injury Researchand Control, 230 McKee Place, Suite 400, Pittsburgh, PA 15213. The University of Plttsburghis an AffirmatrveAction, Equal Opportunity Employer. UNIVERSITY OF PITTSBURGH: The Department of Emergency Medicrneoffersa two-year fellowship in Medical Toxicology Candidates should have an MD/DO and completed an EmergencyMediclne Residency (equivalentexperienceconsrdered).Appointment to instructor in Medicrne;non-tenure stream.Experiencesinclude adult, pediatric, and occupationaltoxicology,(inpatient and outpatient), researchopportunities and PiLLsburghPoison Center.Fellows wili assumelimited clinical responsibrlitiesin the Universlty of Pittsburgh Medical Center EmergencyDepartmentand Affiliated institutions. ContactJohnBemtez,MD, Fellowship Director, Toxlcology Tieatment Program, Room NE-583, MUH University of PittsburghMedical Center,200 Lothrop Street,Piusburgh, PA I52I3 or call 412-648-6800. The University of Pittsburghis an Affirmative Actron, Equal Opportunity Employer.

Universitv of Afabama at Birminqham Department of EmergencyMedicine TheUniversity ofAlabama School ofMedicine, seeks full{ime physicians Emergency Medicine board certified tofillcritical positions academic intheresearch, teaching andpatient care pr0grams. TheDepartment ofEmergency Medicine isthe net,vest member ofthehighly successful University of Alabama, School ofMedicine Academic Community. Weare anticipating anEmergency Medicine Residency Program. The Department Medicine 0fEmergency hasresponsibility for medical student education 0nallthree campuses inthe University ofAlabama School ofMedicine. Inaddition, the pr0gram hasanEMTTraining Program in Birmingham and Huntsville. Thenewdepartment hasbeen highly successful in developing a research inthishlghly base collaborative institution.TheUniversity ofAlabama atBirmingham hasovertwo hundred million inresearch dollars funds, andtheSchool of programs. Medicine ranks16among all NlH{unded UABhas recently embarked upon successful efforts togainfoundation andindustry support. TheUniversity ofAlabama at Birmingham hasan851-bed teaching hospital, Level1 trauma patients center with40,000 annually. Varying academic c0mbinati0ns willbetailored totheindividual selected. Salary andrankis commensurate withaccomnlishments andexoeriyourcurriculum ence. Please send vitae toMarlon L.Priest, MD,University ofAlabama atBirmingham, 19th 619South Street, JTN260,Birmingham, AL35233.


LYNX Medical Systems,Inc 15325SE 30th Place,Ste200 Bellevue,WA 98007-6595

(206)6414+5r

LYNX Medicai Systems,Inc. introduces the Best PracticesTool Suite-softwaredesigned to help standardizecare and improve patient oulcomes. BestPracticesoffers: Problem-specificclinical worksheets for 800+age-gender-filteredpresenting probIems, worksheet options, including regionalization and clinical tips, electronic patlent encounter 1og,on-line coding capabllities (summer 1997).

(4ro) 944-8500 Megatech Medical, Inc. 1720 Belmont Avenue Baltimore, MD 2L244 Megatechwill display their group of emergencydepartment products which include: Ortho Glass-Fiberglasssplinting system, Dlrracastcastingproducts, and Aircastankle and leg braces' (303),186-6400 MICROMEDEX,Inc. 300 Ste Way, S. Syracuse 6200 Englewood, CO 80f I1 MI-ROMEDEX offers knowledgebasesfor pharmacology,emergency and acute care,toxicology,and patient-education. fu the on.-itop solution for your information needs. MICROMEDEX provides the most comprehensivecollection of clinical informaiion r.tout."t availabletoday A variety of delivery platforms and integratedtechnologiesensureour knowledgefits your systemrequirements, allowing the flexibility critical to health care systems. Mosby-Williams and Wilkins 10192 Durhams Ferry Place Mechanicsville, VA 23116 MedicalBooks,Journals,and Multimedia

(804)559-218+

(+12) 578-3222 National Association of EMS Physicians 230 McKee Place, Ste 500 Pittsburgh, PA 15213 The National Association of Emergency Services Physicians (NAEMSP) fosters excellenceand provides medical leadership with the goal that all individuals and communities receivehigh quality out-of-hospitai emergencymedi.calcare'

(908) 218-6943 Ortho-McNeil Pharmaceutical 1000 Route 202 Raritan, NJ 08869 Ortho-McNeil Pharmaceuticalinvltes you to visit our booth, where representativeswill be happy to discussthe featuresand benefits of leVeQUtN (levofloxacln tablets and injection).

(206) 8674569 Physio-Control CorPoration Willows Road NE ll8ll Redmond. WA 98052 We are a worldwide manufacturer of emergencycardiac resuscitation devicesfor the hospital, clinic, speciaityphysician' occupational health and prehospital markets. Products include oui family of LIFEPAK@ defibrillator/monitor/pacemakers, AEDs, QUIK-COMBOTMelectrode system and Data Management Systems. (615) 327-1027 Therapeutic Antibodies, Inc. 103 Ste South, Avenue, 1207 lTth Nashville, TN 37212 TherapeuticAntibodies, Inc (TAb) is an international bi.opharmaceuticalcompany specializingin the research,development, and productior of polyclonal antibodies, precisely--tailoredto treat medi.calconditions for which there are generailyno satisfactory treatments. TAb is developing a range of antidotes for drug overdoseand reptile and arthropod envenomation. (703)8r8-8982 W.B. Saunders CompanY 5135 Doyle Lane Centerville, VA 20120 Publisher of Textbooks,Clinical References,and Periodicals. (203) 866-1144 Weatherby Health Care 25Yan Zant Street Norwalk, CT 06855 WeatherbyHealth Careis the Nation'sleader in the recruitment and placement of Emergency Physiclans. Visit booth #40 to learnmore about salaryand practicetrends. (.6L7) 229-0020 Zoll Medical Corporation Avenue 32 Second Burlington, MA 0f803 ZOLL Medical Corporation designs, manufactures, and markets and integrated line of small, lightweight, easy-to-usenoninvasive cardiac resuscitation devices that include monitors, manual and automated defibrillators and noninvasive external oacemakers. ZOLL alsooffers Multi-Function Electrodeswith a patented preconnect feature assuringrapid deiivery of defibrillation and pacing theraPies.


| -

ExruuroRS American Academy of Emergency Medicine (800) 88,1-2236 6ll E. Wells Street Milwaukee,WI53202 The AmericanAcademyof EmergencyMedicine is a professionalnon-profit organizationof board certified Emergency Medicinephysiclansdedj.cated to the principle that everyindividualshouldhaveunencumberedaccessto quality emergency careprovidedby specialists in EmergencyMedicine.The Academy also supports fair and equitable practice environments necessary to allow the specialistin EmergencyMedicineto deliverthehighestqualityof patientcare. Annals of Emergency Medicine

(972) 550-09rr

P OB o x 6 1 9 9 l l Dallas,TX7526l AnnalsoJEmergency MedicLne is the official journal of the AmericanCollegeof EmergencyPhysiciansand the specialty'sleading clinicaland scientificj ournal. Annalspublishesthe latestin research, ciinicalstudies,casereports,and issuesin emergency medicine. Annalsstaffwill be availableto answer questionsand journalpoliciesand procedures. discuss

(+r0) 847-9355 BRCHealth Care 600 WashingtonAve., Ste I00 Towson,MD 21204 EmSTAf,a BRCHealth Care technology,is the leading emergencydepartmentpatient tracking and clinical documentation system on themarkettoday. EmSTAf facilitatesthe automation ofclericaland clinicalprocesses while generatingan electronic medical recordfor eachpatient. Cook Critical Care PO Box 489 925 SouthCurry Bloomington,lN +7+02

(8r2) 339-2235

(800) +38-2476 DanielStern and Associates 211 North Whitfield St., Ste 240 Pittsburgh,PA 15206 Since1970,DanielStern and Associateshas provided recrurtmentandconsultingservicesbasedupon the principleso[ professionalism, quality, and courtesy Like you, we also maintain a strongcommitmentto the specialtyof EmergencyMedicine. Our specialty-trained consultantsarepleasedto providea comprehenslve line of servicesincluding full- and part- time placement,consultingln the areasof compensatlon,staffinglevels, andcontracts,aswell as,marketing and PA,/NPplacement. (3r7) 276-2554 Eli Lilly and Company Lilly CorporateCenter, DC 1843 Indianapolis,IN 46285 You are cordially lnvited to visit the Eli Lilly and Company boothwhereour salesrepresentatives will be availableto dis(abciximab,Centocor),Lilly cussREOPRO@ EmergencyMedicine (800) 798-f 822 ext. 3295 Residents'Association lI25 ExecutiveCircle Irving,TX 75038 TheEMRAbooth will featuremembershio materials and informationaboutthis exciting4,500 membei organizationfor residentsand medicalstudents.

(609)848-3817 Emergency Physician Associates,Inc 307 South EvergreenAve., Ste 201 Woodbury, NJ 08096 EmergencyPhysiclanAssoclates,Inc. is a multihospital,interstaie group practice of EmergencyMedlcine physicians founded in 1978. EPA providesmanagementservicesand staffsits client hospitals with experienced Emergency Department Directorsand physiclans,as well as qualified physicianassistants. EPAbpracticesettingsrangefrom rural to urban, academic to communlty, and urgent care to trauma to suit a wide variety of needs. (8r7) 633-6665 EMERGISOFTTM I202 Corporate Drive West Arlington, TX 76006 In addition to a proven Tracking System, EMERGISOFTTM gives you the ability to createan electronicchart while also providing powerful departmentalmanagementtools such as Reporting. QA, Log.and other Management EMF/ACEP TeachingFellowship Program (972) 550-0911 ext. 3280 ll25 Executive Circle Irving, TX 75038 The EMF/ACEPTeachingFellowshipProgramconsistsof two ten-day sessions. The first session focuseson curricuium developmentand instruction, teachingmethods, and evaluatlon. The secondsessionfocuseson academicsurvival skills, administrationand management.Participantswill be involved in didacticsessions,small group discussions,hands-onexperience,role playing.and independentstudy Ethicon, Inc Route 22 West Somerville, NJ 08876

(908)2r8-25r7

(303),152-6800 Fischer Imaging Corporation 12300 N. Grant Street Denver, CO 802,1f The FischerImaging Digital Tiaumex is opening the door to new opportunitiesin generalpurposeand trauma radiologlz (847) 564-5400 FluoroScan Imaging Systems,Inc. 650 B Anthony Trail Northbrook, IL 60062 FluoroScanis a world leaderin the desisnand manufactureof mini surgicalc-arm fluoroscopicimagingryrt.-r. FluoroScan ls speciallydesignedfor extremityimaging rn orthopedicsand can be usedin the operatrngroom, surgicenter,or in the office. (8f 6) 966-4000 Hoechst Marion Roussel I0236 Nlarion Park Drive Kansas Ciry, MO 64137 HoechstMarion Rousselinvites you to visit our booth, where our representatives will be happy to discussCardizem@LyoJectrMSyringe(diltiazemHCI). (9I4) 297-7770 Laerdal Medical Corporation 167 Myers Corners Road Wappingers Falls, NY 12590 l-aerdal,dedicatedto helping savelives with products for CPR Tiaining, Airway Management,AdvancedLife Support Tiaining, SpinalMotion Restriction,and AutomatedExternalDefibrillatlon.


Thursday, ll4ay 22 Lunch Session:Lunch With the Experts (I2:00-l:30 pm)

William G. Barsan, MD, IJniversity of Michigan e, MD, WashingtonUnit ersity David M. Jat'J paul E. fipi, tlO, MPH,AlleghenyCampus,AllegtrcnylJn:ersity of theHealthSciences Ian G. Stiell,MD, MS, Untuersttyof Ottawa RobertL. Wears,MD, MS,IJniversttyo.fFlorida,Jachsonville BrianJ. Zinh, MD, TJntuersityof Michigan to successfulcompletionof researchprojects'and The educationalobjectivesof this seJsionare to gain an understandingof the barriers issues surrounding the design and analysls of methodologic merhods for overcomirrglhor" barriers, und gu"i. an understanding*of This sessionwill allow junior faculty researchprojects,by discussionof the artendJ., o*r researchwith"an establishedlnvestigator. ln their own department or investlgators who may be initiating researchprojects of their own, and may not have accessto expe-rienced each i'nvestigators, Established investigators. established with and problems institutlon, to informaily discusstheir own research'ideas proresearch of completion and planning,.implementation, the regarding with an areaof expertise,will be present,o u.rr*., questions based questions be expectedto bring jecrs.participantsin this sessionwlll seiecttt. ,,-,LJ.ii ur. utlyvJt.-frori the followin"glist, and will required' Pre-registration fee. enrollment. $3b Limited experiences. on their own ideasand

PANEL OF EXPERTS Panel Member Information

Panel Member

Area of Expertise

Wiiliam G. Barsan,MD

StrokeResearch

William Barsanis Professorand Head of the Sectionof Emergency Medicineat the Universityof Michigan. Dr. Barsanis an intefnationaliyrecognizedleaderin EmergencyMedicineand-has participatedin numerstudiesrelatedto stroke ous friH-funded and pharmaceutically-funded injury-and intracerebral head of treatment and management,the diagnosis hemJ.rhage,and cerJbralresuscitation.He has authorednumerouspeerreviewed a-rticlesin these areasand has extensiveeditorial experience.

David M. Jaffe,MD

PediatricEmergency MedicineResearch

David Jaffeis the Director of the Division of EmergencyMedicine, Deparimentof Pediatrics,in the WashingtonUni'versltySchoolof Medicinein St. Louis and the MedicalDirector of EmergencyServicesat St. Louis Childrens Hospital. Dr. Jaffeis a renownedexpert in pediatric emergencymedicine reslarch and has conducted researchin a wide vari.ty oIur.ur. He has extensivepublication and editorlai experience.

PaulE. Pepe,MD, MPH

L.mergency Lvleorcal Services Research

lan G. Stiell,MD, MS

OutcomesResearch Health Services Research,Clinical DecisionResearch

RobertL. Wears.MD, MS

GeneralResearch Design,Statistical Methods,Cost-Benefit Computer Research, Simulation

BrlanJ.Zink, MD

LaboratoryAnimal Models of Disease

paui Pepeis the chairman of Emergencyl4edicine at the AlleghenyCampus of the AlleghenyUniversityof the Health Services.He is an internationallv renownJd expert in EMS research,with nearly 400 published scientific pup"r, and abstiacts. He brings to the sessiona wealth of personalexpeiience in all aspectsof EMS research. Ian Stiel1is an AssociateProfessorin the Division of EmergencyMedicine and the Departmentof Epidemlologyand Community Medicine,ljniversity of Ottawa. Dr. Stiellis a clinical epidemiologistwhoseresearchfocuseson health servicesresearch,clinical decisionrules and technologyassessmenr. Bestknown for his work in developing the ottawa Ankle Ruies,he is also involved in researchinvolving radiography of the knee, the evaluation of minor head injury, and the prehospitaltreatmentof cardiopulmonary arrest. He has receivedexiensi.vefunding from governmental agenciesin Canada. Robertwears is a Professorin the Divlsion of EmergencyMedicineat the Universityof Florida Health sciencescenter,Jacksonville.Dr. wears' expertrsecenterson researchdesign,medical decision-making,medical information systems,statisticalanalysisof researchstudies,cost-benefitresearch, and computer simulation methodology. Dr. Wearshas been a frequent lecturerat the SAEMAnnual Meetingon thesetopics. He is the Statistics Editor for Annalsof EmergencyMedictneand a reviewer for multiple other journals. Brian Zlnk is an AssistantProfessorin the Section of EmergencyMedj.cine at the University of Michigan in Ann Arbor, Michigan Dr' Zink has worked exrensivelywith animal models of head injury and hemorrhagic shock, receiving grant support from the NIH and the Emergency MedicineFounliion. He-is currently supportedby the NlHNational Institute of Alcohol Abuseand Alcoholism.


Thursdav.Muy 22

FuxnAMENrArs oF REssnRcH EthicalConsiderationsin Human SubjectResearch(8:00 - 9:00 am) MD, CarolinasMedicalCenter lelfreyW. Runge. The educationalobjectiveof thrs sessionis to discussthe mechanicsof initiating a researchproject which go beyond the devel.opmen-t of-a researchprotocol. It is essentialto obtain researchapprovalsandionsent from your instituti6n, as well as from individualswho may volunteerro becomeyour researchsubjects.In tlie enthusiasticquestfor knbwledge,researchers may somet i m e so v e r l o o ko r f o r g e L b a s i cp r i n c i p l e so f h u m a nr i g h r sa n d w e l f a r e .

Introductionto Statistics(9:00 - l0:00 am) Roger Lewis.MD. PhD.Harbor-IJCIA The educationalobjectiveo[ this sessionis to discussthe statisticalconceptsand methods that must be understoodif the rnvestigatoris to be able to communicatewrth a biostatrsricran and productivelycollaboratein the design and analysiso[ a clinical study Early in the courseof planning a project, a researcherneedsto make an appraisalof the outcom. pururnlr"., to be measured.,the feaslbilityof doing the study in a given patienr population, the numbeiof patlentsneededfor statisticalcomparison, and the analyticalmeansof addressingthe researchquestion. Early statisticalconsuliationcan assistwlth thesequestions,but the researcher must provide the information the statisticianneedsfor crltical and analyticalreview of the proposal.

Data,^D*ata Everywhere . . . Data Collection Forms and Data Management(t:30 - 2:30 pm)

Susan S. Fish,PharmD,MPH, BostonlJnittersity Theeducationalobjectiveof this sessionis to discussthe art of datacolleciionform developmentwhjch is centralto any research qroject. It soundseasy,but,it's_not!Examplesof winners and losers,many from the speaker'sown experlences, will be used to illustratehow to avoid headachesfrom data coilection. Once the form is c1eve1opecl, then what? How to manasethe data is dependenton the type of data aswell as the funding available.DaLamanagementfbr an unfunded, or poorly fundeidprojectwill be stressed.Examplesfrom emergencymedicineprojectswill be used to ihow how ro keep control of th.'i--.trse"amount of datathat hasbeen collected.

J_iqrylLeplTeLtation of Data . . . The Art of Scientific Presentation (2:30 - 3:30 pm)

Michelle Biros,MS,MD, HennepinCountyMedicalCenter Theeducationalobjectlveoftiis sessionrs to focuson the developmentofa good researchpresentation.Basedon one researcher's personalmistakes,observations,and contemplatlon,this sessionwill discusscommon errorsand misconceptionsabout research presenlations, and how to avorclthem. There rs an art to the oral or graphicalpresentatlonof researchfindings. While experienceis the best teacherand practicemakesperfect,there are some mistakesthat one can learn to avoid from-otherswho irave madetheml

AbstractPreparation and Manuscript Writing (3:30 - 4:30 pm) lamesMenegazzi,PhD, Universig of Pittsburgh Theeducationalobjectiveof this sessionis lo cover the presentationof researchfindings in abstractform, as well as the fundamentalsof_manuscript preparation. The researchis done and now the word needsto g.iour to clinicians.The structuredabstract formatwill be_emphasized with the eight essentialcomponentsof a successfulabstrac-t presented,alongwith ten simple rules for writinga good abstract. Examplesof well written abstractsand their counterpartswill be given. A1so,the fundamentalprincrplesassociated with manuscriptpreparationwill be reviewed.


Thursday, May 22

C Post-EDManagement of the Asthmatic Patient: What's right? What's wrong? Where's the data? ( 1 0 : 0 0 - 1 1 : 0 a0 m ) MD, HenryFordHospital Moderator:RichardNowah, Barry Brenner,MD, BroohlynHospitalCenter CarlosCamargo,MD, HawardMedicalScLrool Rita Cydulha,MD, MetroHealthMedicalCenter MichaelMcDermott,MD, CoohCountyHospital The educational objectives of this sessionare to have the participant understand the controversiessurrounding the decislon to admit or dischargeasthmaticpatientsfrom the ED; comprehend the appropriate criteria for admission of asthmatic patlents to the observationunit, generalmedicine floor or ICU; and, develop an aggressiveapproach to post-dischargetherapy and medicalfollow-up. O.K. So,you'vemaxi.mallytreatedthe asthmaticpatient who was looking so bad when helshe cameto the ED. Now it's time to make your decision. I.C.U.? Floor bed? Clinical decisionunit? How about home? What kind of dischargemedications? How often? What kind of follow up? What's the literature to support your decision? Is there any? Shouldn't there be?This interactive panel discussionwill examine thesecontroversialissues.Five well known emergencyphysician/asthmaexperts present their views and so do you.

Lunch Session:Clinical Trials Research: Methods for Success(12:00-l:30 pm) EdwardP Sloan,MD, MPH, Universityof lll|nois MD, Universig of Illinois Max D, Koenigsberg, MedicalCenter MD, Runge, Carolinas Jeff lohn Blue, PharmD,BaxterHealthcare The educational objective of thls sessionis to addressthe means by which emergencyphysicians can become skilled at conducting clinical trials. Participation ln clinical trials is a meansby which emergencyphysicianscan be involved in quality researchefforts and develop an areaof academicexpertise. Physicianswho have particlpated in clinical trials researchwill discusshow it can benefit patient careand an academiccareet. Representativesfrom indultry will give their perspectlveson what they look for in a relationship wlth physician investigators. Severalimportant aspectsof this type of research,including budget and staffingissues,inter-departmentalinteractions, and the role SAEM may play in fosteri.ngparticipation by its memberswill be discussed.Participantswill better understand the scope of clini.caltrials researchas well as the potential for benefit for academic emergency physicians. Limited enrollment. $30 fee. Pre-registrationrequired.

Lunch Session:Inflammatory Basis of Asthma: Opportunities for Future Research ( 1 2 : 0 0 - I : 3 0p m ) oJthe Universrty EmilM. Shobelot'f Moderator: , MD,Allegheny HealthSciences PeterJ. Barnes,DM, DSc,FRCP,Director,National Heart and Lunglnstitute,Irnpeial Collegeof the Unitedl{tngdom The educational objectives of this sessionare to have the participant acquire a broadenedunderstandj.ngof the inflammatory basis of the asthmatic response;be able to discern the area of controversyin pathophysiologicbasis of asthmaand its therapy; and develop an appreciation for the importance of the aggressivetreatment of both asthmatic bronchospasmand in-

SEssroNs flammation with advancedtherapeuticinterventions. Professor Barnes is a consultant physici.an at Brompton Hospital in London and the author of more than 500 articlesrelated to asthma. He will dlscusscurrent state of the art understandings of the inflammatory basis of asthmaand the implications these data may have on acute and post-ED care of asthma for cllnicians practicing on the cutting edge. He will also give his insights into areasof current and future asthma research. Thi.s sessionis a rare opportunity to hear the world's leading authority on a critically i.mportant topic in asthma research.Limited enrollment. $30 fee. Pre-registration required.

Lunch Session:Use of Newer Monitoring Methods to Detect Hypoperfusion StatesPrior to Hemodynamic Decompensationand to Guide Therapy During Resuscitation(12:00-I:30 pm) Jay Falh, MD, OrlandoReglonalMedicalCenter JamesManning,MD,IJniversity of Nortlt Carolinaat ChapelH|II EmanuelRivers,MD, Henry Ford Hospital The educational objective of this sessionis to review laboratory parametersand monitoring technologiesthat may allow for earlyrecognitionof impending hemodlnamic decompensation as well as guide therapy to either prevent cardiovascularcollapse or promote successfuiresuscitation.Areas of research neededto further defi.nethe role of theseiaboratoryparameters and technologies in clinical practice will be discussed. Hemodynamic decompensation in criticaily il1 and injured patientsis often precededby a period of systemichypoperfusion and metabolic derangementsthat are not readily detected by standardly monltored noninvasive parameters.Laboratory parametersand newer monitoring technologiesthat may allow for earlier diagnosis of hypoperfusion statesinclude noninvasive cardiac output, central venous oximetry, transcutaneous oximetry,serum lactate,and basedeficit determination.Other monitoring technologies may provide important information that can guide therapy during hemodynamic collapseand cardiac arrest.Theseinclude capnometry central venous oximetry, ventricular fibrillation power, spectrum analysis,and invasive hemodyrLamicmonitoring. Limited enrollment. $30 fee. Preregistration required.

Rationale and Strategiesfor SuccessfulOut-ofHospital ResuscitationResearch(4:30-5:30 pm)

PaulE. Pepe,MD, MPH, AlleghenytJntuersigof tLreHealthSciences The educational objectlves of this session are to explain the rationale and necessityfor well-designedstudies in the out-ofhospital emergencycare setting; review the logistics, polltical, and scientific obstaclesin performing out-of-hospital studies; analyzethe qualifiers and necessaryconditions for successful performance bf scientific studies in the out-of-hospital setting; "public consent" and for and provide strateglesfor achieving hospital emergency in out-of the effecting sound clinical trials caresetting. The speakerwill review the rationale and necessity for well-designed researchin the uncontrolled out-of-hospital setting and then analyze the qualifiers and conditions for achievingsuccessin such endeavors,despiteclear obstacles. In addition. the speaker will discuss issues of informed consent and then provide strategiesand insights for effectingcompliance from EMS personnel as well as for achieving acceptablepublic disclosureregardingcontrolled clinical trials in the EMS settlng.


Thursday, Mray22 523. Evidence-Based Emergency Medicine Curriculum For Off-Service Residents Rotating in the Emergency Deparrment,P Greg GreenoughMD, UCIA

534. Imbalanceof Power: potential Biasin the interpretation of Informal Cost-Effectiveness Studies, RobertL. Weqrs MD, Universityof Florida

524. TeachingEvidenceBased Medicine: A proposed Short Course for Emergency Medicine Facuhy StephenR. HaydenMD, Un:ersity oJCatiforniaSan Dijgo

535. ExpectedValueAnalysisof Hand Held Nebulizer(HNN) Vs. Metered Dose Inhaler (MDI) For Manasemenrof Acute Asthma Exacerbations in the ED, Anne-MarieSesti RPH,Uniyersityof Cincinnati

525. ComputerizedTemplate-drivenLog to Document Emer_ gencyMedlcineEducationFor Residenc y programs,paul Kv elaMD, Resurrection-Michael Reese 526. DiscussionProvoking Video on rhe Tiansition of the Senior EmergencyMedicine ResidentInto the Role of EfficientClinician and Insrructor, Nader BahadoryDO. Universityof Connecticut

Papers: Respiratory 1..i.^"ttfr^.^ (4:00- 5:30pm) Moderqtor:Ritq K. Cydulha, MD, Metrohealth Medical Center 527. Use of the Alveolar-ArterialOxygen Gradient in the As_ sessmenr of Acute PulmonaryEmbolism, TimothyL.Net'f MD, Butterw orth Hospttal 528. PartialLiquid VentilationIncreasesBronchoalveolar TNF 6 Following HemorrhagicShock,JohnG. younger li! t_ MD, Universityof Michigan 529. Estrogen-WithdrawiAlters the Kinetics of Contractile Subtypesof Muscarinic-CholinergicReceprorsin Rabbit Bronchial Smooth Muscle, Emit M. ShobilofJMD, Ail.eghenyUniversityof the Health Sciences 530. Effectiveness of Inhaled Albuterol Delivery bv Conven_ tional \brsus Continuous Nebulization, CarlosCamargo MD DrPH, Massachusetts GeneralHospital 531. Comparisonof Circulaireto ConventionalSmall Volume NebulizerFor the Tieatmentof Bronchospasmrn the ED, HowardA. SmithlineMD, Baystate MedicalCenter 532. HelioxDriven Albuterol via ReservoirBaq Nebulizerfor Acute Asthma, EdwardA. MichelsonMD, Northwestern University

Scientific Papers: Health Care Delivery/Policy (4:00- 5:30pm)

Moderator:SteyenDronen, MD,llniversity of Michigan 533. InadequateLiteracy is a Barrier to Asthma Knowledee and Self-Care, MarhV WilliamsMD, EmoryIJniversity

536. Decreased ED Utilization by Chronic Inebriates Following Placemenl in ResidentialShelters, Steyep SternerMD, HennepinCountyMedtcalCenter 537. Outcomesof ED BasedAccerleratedTieatmentprotocol Therapyof InfectrousDiseasepatients, Rebecca R. Roberts MD, CoohCountyHospital 538. PediatricRisk of Admission(pRISA):A Severityof Illness Method to Predict the probability of Hospitalizarion From the ED, JamesM. Chamberlain MD, GeorgeWashing_ ton University

Scientific Papers: Clinical pracrice (4:00- 5:30pm) Moderator: Michael Callaham, MD, IJniversity of California, San Francisco 539. GI Bleeds:Going, Going, Gone? BorisLibsterDO, Our Lady of LourdesMedicalCenter 5,10. Clinical Efficacy of Two Dosing Regrmensof Affinity Purified,Mixed MonospecificCrotalidAntivenom Ovine Fab (CroTAb), RicltardC. Dart MD phD, RochyMountain Poisonâ&#x201A;ŹeDrug Center 541. Nitric Oxide Levels During Acute VasoocclusiveSickle Cell Crisis, Bernard L. Lopez MD, ThomasJet'ferson University 542. Serum Creatine Kinase as a predictor of Ectopic P_regnancy, MichaelC. PlewaMD, St.VincentMercyMedicat Lenrcr 543. Accuracyof VenousBlood For the prediction of Arterial pH and PCO2 in Adults presenringro the ED, KeithA. LafJertyMD, AlleghenyIJniversityof the Health Sciences 544. Use of a Standard2 ozCatheterTip Syringeto Confirm EndotrachealTube Placement,Brian SaavedraMD, Universityof CaliJorniaDafis


Thursday, May 22 490. Retentlon of Basic Life Support Knowledge and Skills in Adolescentsand Lay Adults: A ProspectiveComparison, BradleyS. ButlerMD,MaicopaMedical Center 'The Chain of Survival' For 491. Effect of Adding Links to PrehospitalCardiacArrest: A Contrast of Outcomesin 1975 and 1995 at a SingleInstitution, Samuell.Strattln MD, Harbor-IJCIA MedicalCenter 492. Do Survivors of CardiacArrest Have Good Quality of LIfe? Gralnm NicholMD, Unive rsity of Ottawa 493. Limited Role of Advanced Cardiac Life Support Drugs For In-Hospital Cardiac Arrest Resuscitation,GeorgeA. WellsPhD, Universityof Ottawa 494. Myocardiallnjury CausedBy CardiopulmonaryResusciOschatzMD,Universityof Vienna tation,Elisabet'h 495. Outcome Following Extracorporeal Cardiopulmonary MD,IJniversityof Michigan Resuscitation , JohnG. Younger 496. P\asma Epinephrine Levels and Hemodynamic ParametersAfter EpinephrineApplicationVia the Combitube Positionin a SwineModel,JuliaKoJlerMD, in Esophageal Untuersityof Vienna 497. Elfect of Aortic Occlusion, Counterpulsation,and Occlusion/Counterpulsation, on CPR Hemodlnamics During CardiacArrest, N ormanA. ParadisMD, ColumbiaUnittersity

Geriatrics Moderator: Robert H. Woolard, MD, Rhode lsland Hospital (l:30 - 2:30pm) 498. Head CT Scanfor Older ED Patients,ChrisJ. Michalahes DO, StateIJnittersityof New YorhBut't'alo 499. Closed Head Tiauma: A Comparisonof an Elderly to a Non-elderiy Population,J. TobiasNagurneyMD, MassachusettsGeneral Hospital 500. Rapid NeuropsychologicalAssessmentof ln;ured Geriatric ED Patients:A ComputerizedTool for the Bedside, Mana MicaloneMD, BrownUniversity and Outcomesof Older PersonsPresent501. Characteristics ing to an lnner City ED, RobertA. MullihenMD, Universtty of Chicago 502. Abdominal Pain in Geriatric EmergencyPatients:Variables AssociatedWith SignificantDisease,CatherineA. Marco MD, l ohnsHophinsUnittersity 503. Elder Mistreatment:A National Survey of Emergency MedicinePhysicians,TimotlryR. VeenstraMD,Butterworth Hospttal

Innovation in EmergencyMedicine Education Exhibits Moderator: GloriaKuhn, DO, Grace Hospital ( 3 : 0 0- 4 : 0 0 p m ) I02. Topic SpeclficUse of the Internet for the lnstruction of Ultraiound and Echocardiography,Bian K Cohen MD, BroohlynHospitalCenter5}7. Fiberoptic-Enhanced EndotrachealTubeFor BedsideTeachingof lntubation Skills, CharlesV PollachJr. MA MD, MancopaMedicalCenter 508. Use of the IntubatingFiberscopeas a Tool to SafelyTeach and SuperviseEndotrachealIntubation , J. Marh Woodard MD, VanderbiltUnit ersity 509. Use of Electronic Mail to Tiansmit High-Resolution 'Poor Man'sTelemedicine,Bonnie Vlsual Medical Data.A Samuelson MD, Vqnderbilt University 510. DisasterMedicineon the lnternet:Teachingand Information Dissemination,RobinR. HemphillMD, Joint Military MedicalCenters 5l l. Use of ElectronicConferencingin EmergencyMedicine Education,Antonto I. SalibaMD,NewYorkMedicalCollege 5I7. Ilttlization of a Departmental Intranet in Emergency B. Zemnich,NewYorhMedicalCollege Medicine,Candrce 513. Entry Level Informatics System Facilitates Point of ServiceEvidenceBasedEmergencyCare - A Hands on Demonstration, Peter Wyer MD, Lincoln Medical and MentalHealthCenter 514. ED of the Future:Presentinga Unifled BusinessParadigm for the Specialty,and a FinancialABC, David Eitel MD MBA, YorhHospital 515. Interactive Web-BasedWorkstation for EMS Medical Control, Jet'freyM. Galvin MD, BostonUnitersity 516. Use of A Computer-Generated,Problem-SpecificED ResidentEducationin Chart to EnhanceProblem-Based the EmergencyDepartment,AndrewZechnichMD,Oregon H ealth Sciences U nitter stty 517. Nuts and Bolts: A Method For EffectiveDaily Medical StudentFeedbackand Evaluation,KevrnPKilgoreMD,St. MedicalCenter Paul-Ramsey 518. Curriculum For a MandatoryEmergencyMedicineMedical Student Clerkship, Ltsa Chan MD, Albany Medical Center 519. EnhancingMedical Student ConsultationRequestSkills in the EmergencyDepartment,StevenGo MD, University of MissouriKansasCity

504. Presenceof Muitiply-resistantBacteriain Nursing Home ResidentsPresentingto the ED, David BarlasMD, North ShorelJniversily HospiLal

520. Value of PatientAssessmentSheetsin TeachingDisease PatternRecognitionduring ProblemBasedLearning,Paul J. ManosDO, WayneStateUniversitY

505. Elderly Bias in the Use of NeuromuscularBlockadein EmergencyIntubation, Marhl. Sagann,MD, Brighamand womensnosDttcll

521. Acquiring Clinical ReasoningCompetency:Group Versus Individual PracticeUsing PatientManagementComputer Simulations, Dane M. ChapmanMD PhD, Washington Unwersity

506. Are Loop DiureticsAssociatedWith Low ThiamineLevels in Elderly Nursing Home PatientsAdmitted Through the ED, lason Chu MD, State lJniversity of New Yorh Stony Brooh

522. New Systemfor Documentatlonof Proceduresand Resuscitationsby Emergency Medicine Residents,James CisehMD, William BeaumontHosprtal


Thursday, May 22 450. TubeCondensationShould Not be Used as an Indicator of EndotrachealTube Placement,JohnJ. Kelly DO, Albert EinsteinMedicalCenter

in the ED, HaroldH. 47L. OraI LoadingWith Carbamazepine OsbornMD, LincolnMedicaland MentalHealthCenter

451. ED Use of CBC to Predict Opportunistic Infection, NathanI. ShapiroMD, CoohCountyHospital

472. Do PatientsWith Acute Medical Conditi.onsHave the Capacity to Give Informed ConsentFor EmergencyMedicine HowardA. SmithlineMD, BaystateMedicalCenter Research?

452. Evahating and Managing the Patient With Presumed Sinusities:What is most Cost-Effective?DouglasF. Smtth, Unwersityof Cincinnati

473. Conslderationof the Paramedics'Perspectivein Determining PoliciesFor On-SceneTerminationof Resuscitation Efforts, Robert H. McCurren,Baylor College of Medicine

453. HIV Presentationsin the ED, Wtlliqm K. ChiangMD, BelleweHospitalCenter

474 . Bnef ED Intervention DemonstratesBenefitsof Di.scussing Advanced Directives,BenKermqnMD, BostonUnfuersity

454. Patternsof Therapy and Compliance for PatientsPresentingin the ED with Known HIV-I Serostants,MatyHosprtalCenter Anne Aarts,Bellevue 455. ClinicalPredictorsof GangrenousCholeystitisin ED Patients,SilvioChavezMD, LongIslandJewishMedicalCenter 456. CanTrmpanicMembraneThermometersBe UsedAccuratelyin the ED? BarnetEshinMD PhD, MorristownMemortalHospital 457. EtomidateFor Rapid SequenceIntubation in the ED, DanLelC. SmithMD, BaystiteMedicalCenter '158. FalsePositiveRateof Thoracic Outlet SyndromeShoulder Maneuversin Healthy Subjects,MichqelC. PlewaMD, MedicalCollegeof Ohio 459. Penetrating Injuries of the Distal Phalanx: Are X-rays Necessary? let't'reyC. HemstreetMD, UntversttyoJRochester 460. impact of ED Blood Storageon Clinical Practice,Andrew MD, CarolinasMedicalCenter W. Asimos

Clinical Practice Moderator:Knox H. Todd, MD, MPH, Emory Unittersity (3:00- 4:00 pm) 461. Evaluationof Bedrestin ThreatenedMiscarriage,Dennis L. SmithDO, Darnall Army CommunrtyHospital 462. SerumMyoglobin in the Assessmentof Rhabdomyolysis ln the ED, Paul M. Wox MD, tJniversityof Rochester 463. EducationalProgramsin an Academic ED Can Modify TesfOrdering,AndrewSucovMD, Unitersityof Rochester 464. Utrlization of Lumbosacral Spine Radiographsfor EvaluatingLow Back Pain in the ED, Alan L. WeinerMD, Uniwrsity of Connecticut 465. Predlctors of UnsuccessfulTieatment for Congestive Health Failure in the ED ObservationUnit. WiIIiam E Peacock MD, Cleveland ClinicFoundaLion 466. Dextrosers Absorbedby Rectumin HypoglycemicRats, DouglasMcGeeDO, AlbertEinsteinMedicalCenter 4 6 7 . S e l e c t i n gL h e E D P r e s e n t i n gP r o b l e m : A g r e e m e n t BetweenTiiage Nurses and Physlcians Nchard Grazer MD, OregonHealthSciences Unitersity LevelsUseful in Excluding the dx of a 468. Are Progesterone Normal Intrauterine Pregnancyin PatientsWith hCGs lessthan 1,000mIU/M l? Robert Dart MD, BostonMedical Center 469. Doesa Clinical Pneumonia PathwayAffect Time to Antibiotic Administration,Length of Stay,or Mortality? Eric WilltamsMD, YorhHospital 470. Effectof 50 CC of 50o/oDextrosein WaterAdministration on the Blood Glucoseof Non-diabeticVolunteers.Diana Kessler DO, St.BarnabasHospital

Administration Moderator: Edward A. Panaceh, MD, University of California, Davis (1:30 - 2:30 pm) 475. No RelationshipBetweenED Activity and TiiageCategor.AlexandraHospital ization, Drew B. Richardson,Princess 476. Using StatisticalProcessControl to Demonstratelmpact of OperationalInterventionsUpon Quality and Service lndlcators in the ED, RobertA. SchwabMD, Truman MedicalCenter 477. Can Unstratified ED ReadmissionRatesbe Used as a Quality-ControlIndicator?StevenM. FriedmanMD MPH, Hospital Bngham6 Women's 478. More SatisfactoryMeasureso[ ED Patient Satisfaction, Knox H. Todd,MD, MPH, Emory University 479. Staffing,Census,and ReimbursementChangesin AcaMedicalCenter demic EDs,Marc R. SalzbergMD,Baystate '180. California/ACEPWorkforce Task Force lnitial Report: The OrangeCounty Registry,Amy PengBAMSIUUniverlrvine sityof Cahfornia 481. Physician Assistants:Productivity and Profitabiiity, AndrewG. WilsonJr MD, William BeaumontHospital 482. Study of ED Infectious Waste Dlsposal Costs, Philip 5. MeadMD, AlleghenyUniversityof theHealthSciences 483. Evaluationof a Model for ResourceUtilization Profiling of AcademicEmergencyMedicineAttending Physicians, AndrewW AsimosMD, CarolinasMedicalCenter '184. Misrepresentationof Literature Citations By Emergency MedicineAttending Applicants,PeterHellbergMD,BaystateMedicalCenter 485. ResearchSupport and Publication in High Circulation Journalsby Authors in EmergencyMedicine, Medicine, and Surgery, Geot't'reyW. RutledgeMD PhD, Beth Israel D eaconessM edical Center ,186. Initiation of ED BasedDilatation and Evacuation(D&E) RN MS,BostonUniversity Procedures, JoanMeunier-Sham 487. Comparisonof PublishedResearchin EmergencyMedicine and Non-EmergencyMedicine Journals, Adam J. SingerMD, UnwersityMedtcalCenter 'tBB. ED DischargeDiagnosesWith the Highest RelativeRisk For a Revisit Resultingin Hospital Admission, Michael KohnMD,IJnwersityoJCaliforniaSanFrancisco

CPR Moderator: James E. Manning, MD, University of North Carolina (3:00 - 4:00 pm) 489. Video Self-instructionVersusTiaditional CPR Tiaining, MD MPH, EmoryUnntersity DouglasWLoweryt


22 Thursday, lN[4ay 4I9. lmmunologic Responseto TetanusToxoid in the Elderly: One Year Followup, Kumar AlagappanMD, Long Island JewishMedical Center 420. Blood Lact^te to Improve the Triage and Tieatment of Geriatric PatientsAcutely Presentingto the ED, David P. Milzman MD, Georgetown UnfuersitY

Scientific Papers: Ethics ( I 0: 00- l l : 0 0 a m ) Moderator:James G. Adams, MD, Brigham andWomen\ Hospital 421. ObservationalStudy of ConfidentialityBreachesand Inappropriate Comments in a University Hospital ED, EdwardJ. MlinehJr MD, IJniversity of N ebrasha 422. Patient'sAttitudes Regarding the Practice of Procedures on the Newly Deceased,CraigA. Manifold DO, Joint Military MedicalCenters 423. Positive-outcomeBias and Other Limitations in the Selection of ResearchAbstracts for a Scientific Meeting, Miclnel L. Callaham MD, Ilniversity of Caht'ornLaSan Franctsco 424. Characteristicsof Unpublished Researchand Reasonsfor Failure to Publish, EllenJ. Weber MD, IJni''tersityof Caltt'ornia San Franctsco

Poster Session (1:30- 4:00pm) Respiratory Moderator: Emil Shobeloff, MD, Allegheny University ( 1 : 3 0- 2 : 3 0 p m ) 425. Estrogen Withdrawl (EW) Alters the Density ol Cholinergic-MuscarinicReceptor Subtypes in Rabbit MD, Lung, Tiachea, and Bronchi, Emil M, Shobelot'f AllegLreny Untuersig oJthe HealtLtSciences 426. Serum Estradiol Levels in Women With Acute Asthma Exacerbation,Bjta K. CydulhaMD, MetroHealthMedical Center 427. Effect of the Menstrual Cycle on ED Vislts and Response to Therapy in Patientswith Acute Asthma,JamesD, Yates MD, BroohlynHospitalCenter 428. Circadian Pattern of Asthma Exacerbationin the ED, Andrew T. McAt'eeMD, Bngham€t Women'sHospital 429. SeasonalVariation of ED Asthma Vislts in an Urban Population, RobertSilvermanMD, Long Islandlewtsh Medical Center 430. Proposed EPA Ozone Guidelines and ED Visits for Asthma:Too High or lrrelevant,RonaldB.Low MD, State UniversityoJNew YorhBroohlYn 431. Acute Asthma and Accessto an Outpatient Physician' AntonA. Wray MD, BroohlynHospitalCenter 432. I:IE4 Urine Excretion During an Acute Asthma Eplsode, RobertSilterman MD, LongIslandI ewishMedicalCenter 433. Comparison of Peak Expiratory Flow Rate (PEFR)With SpeakingTime in PatientsPresentingto the ED With an Acute Exacerbation of Asthma, TheophileG. Koury MD, Eastern Virginia M edical School 434. PulmonaryFunction of Patientswith SevereAsthma Discharged From the ED, RobettSilvermanMD, Long Island IewishMedicalCenter

435. Chest Radiograph Utilization in Adult ED Asthmatics: Are there Objective Clinical VariablesWhich Predict Abnormal Studies?ScottT. Milne MD, Universityof Cincinnati

Respiratory ModZrator: Robert Silverman, MD, Long lsland J ewish Medieal Center (3:00 - 4:00 Pm) 436. Does Addition of Continuously Nebulized Ipratropium Bromide to Albuterol Result in Improved Outcome in Patients with Acute Bronchospasm?EllenJ. WeberMD, IJniversig of CaliforniaSan FrancLsco 437. lnhaled Corticosteroids for Asthma: Are ED Visits a Missed Opportunity for Prevention? Anita Singh,Massachusetts Gener al Hospital 438. Asthma Follow-up Program: Take Your Meds and See Gincherman, Your Doctor: Is That Good Enough?Yevgeniy University oJPennsylvania 439. Heliox in the Treatment of Acute Exacerbationsof Chronic ObstructivePulmonary Disease,ScottResweber MD, LouisianaStateUniversity 440. PneumoniaPredictsIntubation in C.O.PD. PatientsReceiving Non-Invasive Mechanical Ventilation, MichaelE. SilvermanMD,MedicalCenterof Delaware 441. Yariation in DiagnosisAmong Elderly PatientsAdmitted For Obstructive Airway Disease, Rita K Cydulha MD, M etroHealth M edical Center 442. Comparisonof AssociatedPain, ProceduralEase,amd TestingAccuracy BetweenArterial and Earlobe Capillary Blood Gas Sampling, Enc C. NagerMD, MedicalCenterof Delaware 443. Effectsof NeuromuscularBlockadeon GasExchangeand Pulmonary Mechanics of Dogs During Percutaneous TianstrachealVentilation, T. Paul Tran MD, Universityof Nebrasha 444. Comparison of the SuccessRate and Accuracyof Rapid SequenceIntubation to Orotracheallntubation Without Paralytic Agents, John C. SahlesMD, Universityof California Davis 445. Cricoid Palpation During Endotracheal lntubation: A Clinically Useful Maneuver to Determine Intratracheal Placement,GregoryD. Bell MD, Untuersityof Connecticut 446. ProspectiveComparison of the Rapid Four Step Technique Versus the Standard Technique For Cricothyrotomy,JamesF.HolmesMD,IJniversity of CaliforniaDavis Clinical Practice Moderator: Joseph F. Waecherle, MD, University of Missoun, KansasCity (l:30 - 2:30 pm) 447. Cricothyrotomy Technique: Standard Technique Versus the Rapid Four-StepTechnique,Daniel P Davis MD, Universttyof CaliJorniaSanDiego 448. Comparison of a Novel Cricothyrotomy Device With Standard Surgi.calTechnique,Aaron E. BaLrMD, UniversityoJCalit'orniaDavis 449. Complication Rate of ED Intubations: First Report of the National Emergency Airway Registry (NEAR), Ron M. WallsMD, BrigLtam€t Women'sHospital


Thursday, Mray22

SctEI ITIFICPnpnnslPosTERS Scientific Papers: Respirarory (8:00- 9:30am) Moderator: Richard M. Nowah, MD, Henry Ford, Hospital 391. Asthmatic ED Parients'Baselinepeak Expiratory Flow Rates:Are They Normal? LowellW. GersonphD, North_ eqsternOhioUniversities Collegeof Medicine 392. Impalrmentof PeripheralTissueOxygenationand Cellular Oxidation in PatientsWith Nocturnal Asthma, CharlesB. CairnsMD, ColoradoEmergency MedicineResearch Center 393. Rapid Onset of Flare predicts Rapid Recovery from SevereAcure Asthma in the ED, prescottG. WoodiuffMD. M assachus ettsGeneral H ospital 394. First Multicenter Asthma Research Collaboration (MARC-l), CarlosCamargoMD DrpH, Massachusetts Gen_ eral Hospital 395. Comparisonof Ipratropium Bromide vs placeboin the EmergencyTieatmentof Acute Asthma,David M. Schrech MD MS,MuhlenbergRegional MedicalCenter 396. EducationalMetered Dose inhaler (MDI) prorocol For Asthma Managementin the ED: Does it Affect patient Outcomes? KentN. Hall MD,IJniversityof Cincinnati

Scientific Papers: Health Care Delivery/Policy (8:00 - 9:30 am)

Moderator:Robert A. Lowe, MD, MpH, lJniversity of Pennsyhtania 397. What is an Emergency? Allen Smolenshi, MetroHealthMed_ icalCenter 398. Effectof PatientInsuranceSratuson HCW Effort in the ED,RichardE. RothmanMD phD,JohnsHophinslJniversity 399. Comparisonof the Costsof Non-Ursent Care For Medi_ caid Patients in the ED and Three Communrty Health CLinics, JamesMitchinerMD MpH, St.JosephMercyHospital 400. ED Asthma Care in the ChicagoArea: Resultsfrom the ChicagoAsthma SurverllanceIiitiarive (CASI),MichaelE McDermottMD, CoohCounty Hospital 401. After-HoursTelephoneAdvice in the United Statesand Canada,StephenLloyd MD MSc,McMq.sterlJniversity 402. Systemto Reducethe Cosr Impact of HCFA Documenration Rules For TeachingED Attendings,John Weigand MD, SummaHealthSystem

Scientific Papers: Clinical pracrice (8:00- 9:30am) Moderator:Charles V. Pollach,Jr, MA, MD, Maricopa MedicalCenter 403. Study of PhysicianCommunicarion and patient Reren_ tion, Km GuishardMD, BroohlynHospitalCenter 404. ED WorkplaceInterruptions:Are Emergencyphysicrans 'Multitasking?' TedK. Collison,MethodistHospital 405. Effect of Melatonin on Circadian Rhythms Following Shift Work in EmergencyMedicine, KennethM. RiceMi, Butterworth Hospitql

406. Efficacyof Melatonin in Facilitating Emergencyphysi_ cians'Adjustmenr ro, and RecoveryFrom, Night Shifts, Lauie BethGesellMD,IJniversityof Cincinnati 407. hrigation is Not BeneficialFor CleanNon-contaminated Facial Lacerations,I udd H ollanderMD, IJniver sityMedical Center 408. Prospective,Randomized, Controlled Trial of a New TissueAdhesive(2-Octyl Cyanoacrylate)\krsus Standard Wound ClosureTechniquesFor LacerationRepair, Adam SingerMD, UniversityMedicalCenter

Scientific Papers: Administration ( I0:00- II:00 am) Moderator: William G. Bqrsan, MD, tJniyersity of Michigan '109. Inconsistencyof ED Tiiage,Richard C. WuerztvlO,Milton S HersheyMedicalCenter 410. ED Tiiageand Acuity: Developmentof a NationalModel (Canada),JamesDucharme,Atlantic Healflt Sciences Corporation 411. Effectof the New MedicareRule For Teachingphysicians on Academic Emergency physicians, Robert M. McNamaraMD, AlleghenytJniversityof the Health Sciences ,112. Importance of ED Admissions for Hospital Revenue. GaborD. KelenMD, JohnsHophinsIJniversity

Scientific Papers: CpR ( 10:00- l1:00^am ) Moderator: James T. Niemann, MD, Harbor-UCLA 413. Outcome From PrehospitalCardiacArrest Due to Non_ ventricularArrhythmias: Contribution of SuccessfulRe_ suscitatlonto Overall SurvivorshipSupportsthe Current Practiceof Initiating PrehospitalACLS,SamuelJ. Stratton MD, Hqfuor-UCIA MedicalCenter 414. Cost-Effectiveness of Firefightersand police as First Re, sponder-Defibriilatorsin New york City, paul GennisMD, JacobiMedicalCenter 415. Pilot Study of lnrravenous Magnesium Sulfate in the Tieatment of RefractoryVentricular Fibrillation in the Pre-Hospital Setring, Robert Lavery MA, Morristown MemonalHospital 416. Comparisonof Three perfusionMethods for performins SelectiveAortic Arch PerfusionDuring CardiacArresf JamesE. ManningMD, Universityof North Carolina

Scientific Papers: Geriatrics ( I0:00- ll:00 am ) Mo-derqtor: Carey Chisholm, MD, Methodist Hospital of lndiana 417. Emergency Physician Recognition of Depression in GeriarricED Patients:A prospectiveStudy, StephenW MeldonMD, MetroHealthMedicalCenter 418. Clinical Presentationof Geriatric patientsWith Serious Cervical Spine Injury, JenniJerE. Dow MD, yorh Hospital


ffi

ASSOCIATIONOF ACADEMIC CHAIRS OF EMERGENCYMEDICINE 901 N. WashingtonAvenue,Lansing,Michigan 48906-5137 (517) 485-5484 FAX (517) 485-0801

AACEM Annual Meeting Wednesday,Mray2I, IggT Washington Hilton and Towers Washington, DC B:30* 9:00am

Continental Breaklhst

9:00- 10:00am

"Evolving RoIe of the Academic Chair" RobertDicls.lefSeniorVicePresident,DiyisionoJHealth CareAft'airs,AAMC

l 0 : 0 0- l 0 : 1 5 a m Break 1 0 : 0 0- 1 2 : 0 0

"The Impact of Medicare Teaching Requirements and Audit Activities on Academic Medicine" RobertD'Antuono,AssistantVicePresident, Divisionof HealthCareAt'Jairs, AAMC RobertDichler,SeniorVicePresident,DivisionoJHealth CareAffairs,AAMC NicholasBenson,MD, Chair,DepartmentoJEmergencyMedicine,EastCarolinaslJniversity

12:00- l:30 pm

Annual BusinessMeeting and Lunch l. 2. 3. 4.

6:00 pm

@

President's Report,John Prescott, MD Treasurers Report,MarkHenry,MD Electionof Officersfor 1996-97, SandraSchneider, MD New Business

Annual Banquet (imiteclto actiyemembersof AACEM)


Wednesday,May 2 l

FUNuAMENTALS OF TEACHING CaseStudies in Challenging Teaching Situations (8:00 - 9:30 am) ufl, uL DavisMeilcal Center Maderatar: PeterE. Soholove, ,EdwqrdA. Panacel?, MD, UC Davis MedicalCenter CareyChisholm,MD,,MethodistHospitaloJIndiana Corq Slovis,MD, MethodistHospitalof lndiana The educationalobjectiveof this sessionis to addresschallengingteachingsituationsthat may be encounteredln the emergency department.After attendingthis session,participantswill be able to identify challengingteachingsituationsthat commonly arise during the clinical teachingof emergencymedicine,statetechniquesthat may be used to improve teachingin thesesituations, and list the educationalhurdles that are encounteredat variousstagesof residencytraining. How do you deal with the resident that thinks he has norhing to learn,but is lacking in clinicaljudgment? How do you help the medicalstudentthat is very knowledgeable, but is ineffectivedue to a lack of confidence?What approachis best for teachingthe residentthat has a solid knowledoehqse hrt ic frrrctretedby difficulty with proceduralskills? How can you best teachemergencymedicine to the off-service rotator? How can you best teach during a resuscitation?Casescenariossuch as thesewill be used to stimulatean interactive a u d i e n caen d e x p e r tp a n e ld i s c u ' s i o n .

Hands-OnInstruction of ProceduralSkills (10:00 - ll:00 am) MichqelP Wainscot|MD, Untversityof TexasSouthwestern The educatlonalobjectiveof this sessionis to help students know the pnnciples that enablethe most effectlveteachingof pro"Why" "How to" for versusthe ceduralskills. After attendingthis sesslon,the learner should be able to compareteachingthe procedures;list the principleso[ teachinga skill, describethe role rrf a performancechecklistfor a procedure,statethe four leve1sof understandingand indicatewhich one is best for a teacherto lunction within when teachinga new skill.

ResidentsAs Teachers:"Why's and How's" (ll:00 - 12:00 noon) DianeM. Birnbaumer, MD, Harbor-UCIAMedicalCenter Kurt C. Kleinschmidt,MD, UniversityoJTexasSouthwestern The educationalobjectiveof this sessionis to help studentsunderstandthe importanceo[ teachingto their professionaldevelopment and learn techniquesenablingthem to be better teachers.After attendingthis session,the learnershould be able to state how residentsbenefit from teaching,list the barriers to residentsbeing good teachers,determinewhy residentscan be better teachersthan faculty,identify the developmentaldifferencesbetweenstudents,residents,and faculty,and describehow to teach residentsto be better teachers.

AdvancedClinical Skills AssessmentTechniquesfor Faculty (3:00 - 5:30 pm) WilILamRennie , MD, Longlsland JewishMedicalCenter LindaSpillane,MD, Universityof Rochester MD, North ShoreUntuersityHosl2ital losryhLaMantLa, RitaCydulha,MD, MetroHealthMedicalCenter Theeducationalobjectiveof this sessionls to demonstrateapproachesto effectiveobservationof residents'clinical skills and techniques for interaction and feedback. After attending this session,the learner should be able to define the specialproblems tools for the direct observationof clinieniounteredwith the observalionof residents'perfori-rance,use a variety of assessment calskills,describetechniquesfor feedbackand teachingin clinical skiils observalion,and definestrategiesfor interactionbetween the faculty observerand the patient. Initial sessionswill highlight the specialproblemsof clinical observationas relatedlo residents'interpersonalskills, physicalexaminarionskills, and proceduralskills. Participantswiil then be divided into three groups "standardizedpatients"and "standardizedresidents." for practiceevaluationof eachof thesethree skills. Group sessionswill use Pre-registration required. Limited enrollment. $25 registration fee.


Wednesday,May2l Lunch Session: Clinical Applications of Antibody Therapeutics: Snakebites and Beyond (12:00-1:30pm) ofColorado Richard C.Dart,MD,PhD,Untuersity R. StephenPorter,TherapeuticAntibodies,Inc. The educational objective of this session is to explore and describefor the participants, potential new therapeutic options for polyclonal antibodies.Theseinclude new antibodies for tricyclic antidepressants,exotlc snakebites, and cytokines like Tumor NecrosisFactor,among others. Limited enrollment. $30 fee. Pre-registrationrequired.

SubstanceAbuse and Academic Emergency Medicine: Practice Implications and Research Opportunities (3:00-4:30 pm) Phillip Brewer,MD, YaIeUniversig EdwardBernstein,MD, BostonUnittersity JamesCallahan,DPA,ExecutiveVicePresident,AmencanSociety oJAddictionMedicine RichardFullef MD, Director, Division of Clinical and Prevention National Instituteon AlcoholAbuseand,\lcoholism Research, The educationalobjectivesof this sessionare to increasethe participant'sunderstandingof the extent to which the abuseof alcohol and other substancesresults in emergencydepartment presentationsand impacts overall ED management;the need for trai.ningand fluency in techniquesof screeningand intervention, including direct, brief intervention as well as an organizedreferral system; and the researchopportunities in substanceabuse, including govemment and private sourcesof researchfunding.

Academic EmergencyMedicine and the Federal Government: The Future is Now (3:00-4:00 pm) MichaelCetta,MD, BellevueHospital KennethIserson,MD, University oJAnzona MD, CarolinasMedicalCenter RobertW Schat'ermeyer, MicLreleWagner,MD, BethIsrael Hospital RobertWelch,MD, WayneStateUniversity Representativ e/ACEP WashingtonOlfice

The educational objectivesof this sessionare to discussemergency medicine teaching attending documentation issues,including a brief update on the OIG audit of teaching hospitals; discuss recent and cunent GME issues, including the threeyear limitation on full direct GME funding, current proposals for GME funding reform, the possibleimpact of an IMG ban on ED staffing, and the effect on EMRPsof the recent changesand current uncertainities;give a brief overview of current managed careissues,as they impact on emergencymedicine, and academic emergencymedicine in particular; and discuss reimburs"practice expenseplan"); and ment issues(lab testing, Medicare how to find this information on the internet.

Status Epilepticus: Controversy in Mechanisms, Definitions, Clinical Studies and Therapy (4:00-5:30pm) ThomasP Blech,MD, Universttyof Virginia David M. Treiman,MD, UCIA Center J. StephenHut'f, MD, UniversityoJVirgnia HealthSciences EdwardP Sloan,MD, Universityof Illinois The educational objective of thls sessi.onis to help the physician incorporate the latest findings into statusepilepticus treatment and have insight into contemporary theories of status epilepticus. Status epileptuicus (SE) is a frequently encountered cllni.cal problem but many basic questions do not have clear answers.Current theories developedfrom animal models and human studies in basic mechanismsand pathophysiology of status epileptlcus will be outlined. Clinical classificationsof status epilepticus including nonconvulsive SE and subtle SE will be describedin detail. A staging system and evolutionary scheme for generalizedstatus epilepticus will be summarized. Limitations of conventional EEG will be addressedand a s1nopsisof EEGand video-EEGas applicableto cdtical careof status epilepticus will be presented. Recent clinical studies will change treatment recommendations for status epilepticus. A s1'nopsisof the methods, results, and limitations of a large cooDerativetrial will be presented.Problems and treatment of refractorySEwili be outlined.


Wednesday,May 2l

DrMCtrc SEssroNS StandardizingPain Control Researchin EmergencyMedicine (10:00-12:00pm) Moderator:SarahStahmer,MD, Hospitalof the lJniversityof Pennsylvania JamesDucharme,MD, SaintJohn RegionalHospital WilliamCordell,MD, MethodistHospitalof Indiana,Inc. JamesJones,MD, GeisingerMedicalCenter Dr. MitchellMax, National Inst|tutesof Health I(nox Todd,MD, Emory University The educationalobjectivesof this sessionare to identify the appropriatedesign for the speclfic pain/analgesicquestlon; identify which outcomes are relevant for evaluating analgesicregimens; discuss the effects of confounders on pain assessmentand treatment response;and describe commonerrorsin dataanayisis.In addition, the panelwill presenta preliminary draft of guidelines for pain control researcn.

Lunch Session:EmergencyMedicine ResidencyDevelopment in Australia, Korea, and Hong Kong (I2:00-l:30 p*) Moderator: StatelJniversity Jim Holliman,MD, Pennsylvania Dr.JohnVinen,RoyalNorth ShoreHospital,Australia Dr. Kam Chah-Wah,TuenMun Hospital,Hong Kong Dr.DongPLee,KeimyungUniversity, Korea The educationalobjectlvesfor this luncheon sessionare to relatethe history of development of emergencymedicine residencytraining programs in Australia, Hong Kong, and Korea;describesome of the difficulties wrth residencyprogramdevelopmentin eachof the three countries,and detail how thesedifficultieswere overcome;compareand contrast the current emergencymedicine residencyprogramsin the three countries; and stimulate further interest in international emergencymedlcine and facilitate emergencymedicine physician interaction with the residencyprograms of the threecountries.Limited enrollment. $30 fee. Pre-registration required.

EducatorsLunch: Measuring I(nowledge and Skillsin EmergencyMedicine (12:00-1:30pm) Commission JohnBoulet,PhD,Educational t'or Foreign MedicalGraduates WllliamBurdich, MD, AlleghenyTJniversity of theHealthSciences The educational objectives of this session are to list the sourceof measurementerror and cite ways to reduce that error; discussthe ways measurementerror is expressed; deflne"validity"as appli.edto educationmeasurement,and indicatethe different tlpes of evidenceused to support the claimof measurementvalldity; and use conceptsof "reiia"validity" bility" and to design researchln emergencymedicine education. How do we know whether students and residentsare achieving our education objectives? Education testing and assessmentof many kinds are used in emergencymedicine. How confident are we about the inferenceswe draw from these tests? How much measurement error is there in the assessmentswe use? Through a series of vignettes, fundamental concepts of educationmeasurementas applied to emergencymedicine will be discussed.Limited enrollment. $30 fee. Pre-registration required.

EMRA Leadership Forum Chief Residents'Forum (8:00-10:00am) Moderator:Rita Cydulha,MD, MetroHealthMedicalCenter Meldon,MD, MetroHealthMedicalCenter Stephen CareyChisholm,MD, Met'hodistHospitalof Indiana RobertJorden,MD, MaricopaMedtcalCenter The educationalobjective of this sessionis to discussthe role of the chief resident, scheduling:navigatingthe waters without losing your sanity,traps of being chief, and dealingwith the problem resident.At the end of this sessionpartlcipantsshould be able to discussthe various roles of the chief residentand describetheir ooinion of what their role should be in the coming year.They also should be able to identify the admi.nistrativeand interpersonalpitfalls of schedulingand dealing with problem residents.The Chief Residents'Forum is an educational sessiondesignedto preparenewly-electedchief residentsfor the administrativeand interpersonalresponsibilitiesof their position.

Academic Career Options in EmergencyMedicine (10:00-I2:00noon) Moderator:StevenDronen,MD, Uniyersttyof Michigan Dayid Shlaf MD, Universityof New Mexico MichelleBiros,M5, MD, HennepinCountyMedicalCenter JudithTtntinalll,MD, MS, UnwersityoJNorth Carolinaat ChapelITIII DonaldYealy, MD, Universityof Pittsburgh The educational objective of this sessionis to describecareertracks in academicemergencymedicine, such as the tenure, research(basic science and clinical), clinician educator, and resident education tracks. Panelmemberswill describetheir vision of the future of academic emergencymedici.neand identify priorities for residentsinterestedln academicpositlons. At the end of the session,residentswill be able to describethe different types of academi.cpositions in emergency medicine, identify factorsthat will affect thelr ability to obtain these positions, and describe the requirements for academic advancementin emergencymedicine. Many uncertainties lie ahead for academicmedicine as American attempts to cope with unlimited requestsfor limited health careresources.As a young specialty,emermedicineis at a critical time of academicde nt.

EMRA/SAEM ResidentResearchForum: The Role of Creativity and Imagination in Research(12:00-l:30 pm) WtlliamH. Cordell,MD, MethodistHospitalof Indiana The educationalobjectiveof this sessionis to determlnethe creativepro"Ladies cessof research. and Gentlemen.I stand before you now becauseI neverstoppeddawdling like an eight-year-oldon a spring morning on his way to school. Anything can make me stop and look and wonder, and sometimeslearn. I am a very happy man. Thank you." This was Dr. Felix Hoenikker'sentire Nobel Pize acceptance speechin Kurt Vonnegut'sCat'sCradle. Creativityhas been describedas the abillty to look at the samething as everyoneelse,but seesomethingdifferent. Creativityis not monopolizedby artists,authors,and musicians, but is a skill that can be enhancedthrough practiceand coaching.What doesthis haveto do with research?Researchis a creativeprocess.Each stepdependson creativethinking - generatingideas,transformingideas into questions,study logistics,data analysis,and formulatlon and presentationof conclusions.Using interactivetechniques,Dr. Cordell wiil discussthe researchprocess,generationof ideas,brainstorming, and "enhancers" other creatMty including computer programs,mind mapping techniques,and the time-testeduse of Oreo cookies.


Wednesday,May2l 353. Impact of System Optimization on ResponseIntervals During the Ontario Prehospital Advanced Life Support (OPALS)Study,RoxanneE. Ward RN, Untuersi$ of Ottawa

372. Comparisonof Men and Women Seenin an ED With Appendicitis, ChnstopherE RichardsMD, Universityof Calijornia SanDiego

354. Increasein PrehospitalConversionRateof All PSVTPatients with Adenosine, L.l. Mornson MD, University oJ Toronto

373. Gender Differencesin the Prevalenceof Atypical Chest Pain During Myocardial infarction, RichardL. Summers MD, Universityof Mississrppi

355. Prehospi.talStroke Management:How Much Do They Know? MichaelB. PtphinMD, Universityof Cincinnati

374. Associationof Risk Factors With Coronary Artery Stenosis ln Young Women With Acute Myocardial Infarction, Asltraf N ashed,MD, MornstownMemonal Hospital

356. Impact of a ConcealedCarry l-aw on an Urban EMS System,Bnan S.Zachaiah MD, tJni'tersig of TexasSouthwestern 357. Doesthe Hobble RestraintPositionResultin Respiratory Compromise?TheodoreChan MD, Universityof Calit'ornia SanDtego 358. Accuracy of Urban Field ParamedicsEstimating Blood Loss, ShawnD . EvansMD , Universityof CaliforniaSanDLego of PatientsWith 359. Accuracyof Out-of-HospitalAssessment RespiratoryDistress,RobertL. Norton MD, OregonHealth University Sciences 360. Concert Medicine - Spectrum of Injuries and Medical Complications Encountered at 405 Major Musical Evenis,JefJT. GrangeMD, Loma Linda lJni,tersity 36I. Short-termOutcome of Hlpoglycemic Diabetic Patients Who RefuseTiansport After PrehospitalTherapy,Allyson KreshahBA EMT, Hospitalof the tJni,ersity of Pennsylvania Intubation By RespondingALS 362. Succinylcholine-assisted Ground Units: Resultsof a 4-year Pilot Study For the Stateof Pennsylvania, S'haronPitzer,BA, YorhHospital

Clinical Practice Moderator: M. Andrew Levitt, DO, Highland General Hospital (4:30 - 5:30 pm) 363. Comparisonof Staplesand SuturesFor Closureof Scalp Lacerations,Ed Giarrusso,UniversityMedicalCenter 364. Comparisonof Topical Lidocaine,Epinephrine,and TetMD, racaine(LET) Solution vs Gel, Morns R. Gieselman St.JohnsHospital 365. Impact of a Wound Care Pathway on Wound Management and PatientSatisfactionin the ED, MicheleDorfman, Universityof Pennsylvania 366. Finding a Needlein the Foot: ExperimentalComparison of Four RemovalTechnlques,KsvinM. OmilusihMD,ButterworthHospital 367. Warning Patients of Outpatient Medicatlon Induced Sedation:Pre-printedInstructionsIncreaseCompliance, Andre M. PennardtMD, Joint MilLtaryMedtcalCenters 368. Use of Propofolfor ConsciousSedationin the ED, Francis X. ChuidianMD, BroohlynHospitalCenter 369. Effectivenessof Patient Discharge Teaching Among ED RN Health Care Providers, ElizabethL. Thomas-Bauer MSN FNPC,CooperHospital 370. Concussionin Young Athletes: Are DischargeInstructions Appropiate? Kurt Mayberry MD, Butterworth and DeVos Children\ H ospit al 37I. Effect of PhysicianGender in Womens' PerceivedPain and EmbarrassmentDuring ED Pelvic Examination, Alda of NewMtxico Ml(llus MD, University

375. Evaluati.onof Two Clinical StrategiesFor Rapidly RulingOut Acute Myocardial lnfarction in the ED, Gerard X. BroganJr MD, UnwersityMedicalCenter 376. Validationof PredlctedOptimal Depths of Nasotracheal Intubation Prior to Chest X-Ray, David B. Reed MD, HennepinCountyMedicalCenter

Health Care Delivery/Policy Moderator: Arthur L. Kellermann, MD, MPH, Emory IJniversity (3:00 - 4:00 pm) 377. Impact of Physician Tiaining on Chart Documentation Under the Medicare Part B GuidelinesFor TeachingPhysician Billing, LeonardA. NitowshiMD, MedtcalCenterof Delaware 378. Forecasting Medical Costs: Effects of Inflation and Changing DiseasePrevalence,William J. Megs MD PhD, E astCarolina Univer stty 379. Health CareCostsof SexuallyTiansmittedDisease(STD) Managementof Women in a County TeachingHospital, M. AndrewLevitt DO, HighlandGeneralHospital 380. MarginalCost of Healthcareat an Urban Public Teaching R. RobertsMD, CoohCountyHospital Hospital, Rebecca 381. Early Return Visits to the ED: Who is at GreatestRisk? JamesA. GordonMD, Unwersttyof Michigan 382. FactorsEffectingthe Frequencyof PreventiveHealth MeaUniversity suresin ED Patients,EvelynL. BaherVanderbLlt 383. ReducedHospltal and ED Utilization During the 1995 Sneciel Olvmnics World Games as a Result of a DecentralizedMedical ServicesModel, PhillipA. Brewer MD, YaleUniversity 384. FrequentED Users:Patternsof Use Over Time, TanyaM. Kne MD, Universityof Rochester 385. OutoatientVs ED AdmissionSourceas a Risk Factor for AppendicealRupture,RobertG. BuchleyMD, NavalMedical CenterSanDiego 386. ED Substance Abuse lntervention Reduces Overail Hospital Chargesand Utllization, VincentD. HayesMD, BostonUniversity 387. Alcohol in the ED: An Economic Perspective,Enc L. GeneralHospital LegomeMD, Massachusetts 388. Ethanol Intoxication Amongst College Students: Increasing Accidental Iryuries and ED Utllization, Holly C ousins,Georgetown UniversitY 389. Use of PracticeGuidelines(PG)in EDsin the US: A Comparison of Academic and Community EDs, Kent N. Hall MD, Universityof Cincinnati 390. WITHDRAWN


Wednesday,May2l of an EmergencyMedicine 316. Limitationsand Effectiveness ResidentProcedureLog on the Web, PierreBorczuhMD, MassachusettsGeneral Hospital 317. MultimediaVs StandardACLSLearning:ImmediateEducationalOutcomes,Jim ChistensonMD, St.Paul'sHospttal 318. Organ Procurementin an Urban Level I ED, Janna L. ChaoMD,IAC-USC MedicalCenter

j

I

319. Evaluationof Study Methodologyand Reportingof Statistical Analysis in Clinical StudiesPresentedas Abstracts at SAEMAnnual Meetings,1992-1996,MicheleB. Wagner MedicalCenter MD, BethIsraelDeqconess 320. Impact of Requiri.ngEMS Observationto Senior Emergency Medicine Clerkship, TimotlryJanchar,Georgetown Universtty Satisfactionwith their ChosenSpe321. ResidentPhysi.cian's cialty, Edward A. PanacehMD, Untversity oJ Cahfornia Davis 322. Resident Tlme Study: Part I - Educational Activity, University PamelaAshleyBS,OregonHealthSciences

ToxicologylEnvironmental Inj ury Moderator: Sandr a M. Schneider,MD, Strong Memorial Hospital(3:00 - 4:00 pm) 323. Opioid Toxicity Recurrencein Adult Opioid Overdose Patients, William A. WatsonPharmD, Truman Medical Center 324. Nalmefene'sEffect on Urine Opioid Screening,Alan B. StorrowMD, JotntMilitary MedicalCenters 325. GeneruIizedPharmacokineticsFor Application to Overdoses,Including SustainedReleasedProducts,WiIIiamJ. Megs MD PhD, EastCarolinaUnittersity 326. Outcome of Nerium Oleander Exposures, Edwqrd P PharmD,PittsburghPoisonCenter Krenzeloh 327. Reviewof 627 Exposuresto DigitalisSpecies(Foxglove), PoisonCenter EdwardP KrenzelohPharmD, PittsburgL't 328. Aspirin Deaths - A Regional Perspective,John E Kerr, Unw ersityof Pittsburgh 329. RiskFactorsFor HepaticIn;ury Following Sub-Acuteand Chronic AcetaminophenIngestion,G. RandallBondMD, of Virginta University 330. ProspectiveEvaluation of Home Tieatment of Mild to Moderate Pediatric Acetaminophen Exposures,Chisty M. RosaMD, Un:ersity of CaliJorniaSanDiego 331. AcetaminophenOverdoseManagementAfter Admission, RichardKozahMD, Un:erstty of CaldorniaIrtine 332. Disordersof Magnesiumand Phosphorousin Acute lbuprofen Ingestions, Fred Harchelroad MD, Allegheny GeneralHospital 333. CariovascularEffectsof Sodium Bicarbonatein a Porcine Model of Calcium Channel Blocker Overdose,David A. TanenMD, NavalMedicalCenterSanDiego

336. Comparisonof Physostigmine,Sodium Blcarbonate,and Hyrertonic Salinein the Tieatment of Experimental Diphenhydramine Toxicity, loel S. Holger MD, St. PaulRamseyMedicalCenter

Toxicology/Environmental Inj ury Moderator Lewis R. Goldfranh, MD, Bellevue Hospital Center (4:30 - 5:30 pm) 337. Acute Altitude Exposure and Intracranial Pressurein Rabbits,Alan B. StorrowMD, JointMilitary MedicalCenters 338. Histopathologic Evaluation of Neutralization Therapy For Acute Acid Injury of the Esophagus,Craig H. Thomalan, UniversityMedtcalCenter 339. Direct Effects of Lithium Chloride (liCl) on Cardiac Function in the lsolated, SpontaneouslyBeating Rat Heart, Daniel L. Savitt MD, BrownUnittersity 340. Comparisonof Advice Given by PoisonControl Centers for Acetaminophen Overdose,RichardKozahMD, Univerlrvine sityoJCali[ornLa 341. Clinical Parametersas Predictorsof RecurrentAlcohol RelatedSeizures,Mels K. RathlevMD, BostonUniversi$ 342. RapidDetectionof ToxicAlcoholsUsing an Alcohol Oxidaxe Reaction Test, Jason Hach MD, BellevueHospital Center 343. Carbon Monoxide Exposure in a PediatricPopuiation, SharonR. SmithMD, WashingtonUniversity 344. Oxygen Concentrationsin PatientsUndergoing Hyperbaric Therapy for SevereCarbon Monoxide Poisoning: Are They Getting HyperbaricTherapy?BernardKnoblich MD, Henry Ford Hospital 345. Effects of Cocaine on Blood Loss in Trauma Patients, Gary W. FausoneMD, New YorhMedicalCollege 346. DoesTransportationBy AmbulanceDecreaseTime to GI Decontamination After Overdose? Brandon WolseyMD, IJnfuersityof New Mexico 347. Prospective,Double-blinded Study to EvaluateOcuiar Irrigation Solutions With and Without the Morgan TherapeticLens in Healthy Subjects,JamesB. JonesMD, MedicalCenter Geisinger and TopicalOxymetazolinein the Pre348. Pseudoephedrine vention of Barotrauma During Air Tiavel, NrcholasJ. VanDeelenMD, Butterworth Hospital 349. Does Thallium Bind to Sodium PolystyreneSulfonate (Kayexelate)?TimothyDoughertyMD, AlleghenyUnittersity of theHealthSciences 350. Accurate Prediction of 6 Hour Medical Clearanceof OverdosePatientsat2 or 4 Hours,SharonM.ValentineRN MS, UniversityMedicalCenter

EMS/Out-of-hospital

334. Abnormal Urlnalysis Following RattlesnakeEnvenomation, RichardF.Clafu MD, IJntuersityof CaliJorniaSanDiego

Moderstor: Theodore R. Delbridge, MD, MPH, Unhersity of Pittsburgh(3:00 - 4:00 pm) 351. EndotrachealDrug Delivery Followed by a 90 Degree Body Tilt in a Swine Model of CardiacArrest, CarolAnn of Pittsburgh Kllian MD, TJnittersity

335. Associationof RattlesnakeBlte Location to Severityof Clinical Manifestations,StevenT MossMD. Universityof Calit'orniaSan Diego

352. PrehospitalTriageof AMI Patients:PotentialImpact on Hospital Admission Patterns, Philip D. Anderson,Boston Unittersity


lllll' ,111 lrlr,i. ,,,

Inlernofionol 68

TBERSHIPREPORT Medicol Sfudenl ExcellenceAwotd

Current Membership: 4,005

Honorory ,t0

4) 1& El

? ? 3 BW Interest GroupMembership: 768 (49) AsthmaResearch (41) CPR/lschem ialReperfusion Disaster Medicine(40) Domestic Violence(45) (42) InjuryPrevention (94) lnternational (54) MedicalStudentEducators (22) Emergencies Neurologic (57) Outcomes Research (21) PainManagement Pediatric EM(64) (19) Photography (78) Research Directors (35) Shockfirauma Substance Abuse(B) (24) Technology (75) Ultrasound


determinedby the Boardof Directors.The annualmembership will be payable within 30 days of requestby the Secretaryfireasurer. The Boardof Directorsmay establishprocedures and policiesregardingnonpaymentof duesand assessments. Section2:The Boardof Directorsshall adopt such membership schedulesas is necessaryto encourageparticipationby the interestedoublic. ARTICTEV . PARLIAMENTARY AUTHORITY Ruleof order.Any questionof order or procedurenot specifically delineatedor providedfor by these bylaws and subsequent amendmentsshall be determined by parliamentary usageas containedin Robert'sRulesof Order (Revised). ARTICTEVI - STANDINGCOMMITTEES Section 1: Duties of Committee Chairs. The Chair-Electand the appointedChairsshall assistthe President-Elect in determiningthe committeegoalsfor the coming year and oversee theircompletion. All Chairsare responsible to the Boardand may be removedfor cause prior to completion of term of officeby majorityvote of the Board.Vacantpositionswill be filled by the Presidentfor the remainderof the term. Section2: Termsof Office.Termsof officefor CommitteeChairs and memberswill begin at the annual businessmeeting.The President shallappoint eligibleAe,seeia+ien Societymembersto fill vacancies and unexpiredtermson standingand ad hoc committeesuntil the nextscheduledelectionor appointmentdate. Section3: NominatingCommittee.The NominatingCommittee shallconsistof the President-Elect, as Chair,the lmmediatePast President, a memberof the Boardof Directorselectedfor a oneyearterm by the Board,and three elected memberswho may not be membersof the Boardof Directors.The lattershall serve staggered two-yearterms.lt shall be the task of this committee to selecta slateof officersto fill the naturallyoccurringvacancies on the Board of Directorsand electedpositionson the standingcommitteesof the Aseeeia+ie++ Society not otherwise designated and providedfor by thesebylaws.The Nominating Committeewill seekthe candidatesapprovalfor formal nominationand shall place their namesin nominationbeforethe membership for electionat the businesssessionof the annual meetingThe NominatingCommitteewill alsoprovideslatesfor any awardsofferedbv the Boardof Directors. Section4: Membership Committee. The Board of Directors shall constitutethe MembershipCommittee.The Secretary/ Treasurer shall serveas Chair of the MembershipCommittee. The MembershipCommitteehas the responsibilityfor establ i s h i n gt h e q u a l i f i c a t i o nfso r e a c h m e m b e r s h i p classification. Applicantsreviewedby the ExecutiveDirectorand Secretary/ Treasurer not meetingthe qualificationsfor electionto a requestedclassification of membershipshallrequirepresentation to and approvalby the majorityof the MembershipCommittee,beforemembershipin that classification can be granted.

'rvhen a)' be reappeintedfer subsequentterms,,\ Researeh membersef the Preeram€emmittee,Subeerrmittees shall be fe"medin aeeerdaniewith the Pelieiesand Preeedures l,1an range;in eenfermitr-,rvithinstruetiensfrem the Bea-def Diree L

' l

Reeemmendatiens frem the Preeram€emmittee€hair mustbe Section6 5: Constitutionand BylawsCommittee.The Constitution

and BylawsCommitteeshallconsistof a Chairandtwo othermembers,electedfor staggered three-yeartermsso thatthe memberwith the leastremainingtenureshallserveasChairduringtheirfinalyear on the Committee.ThisCommitteeshallstudythe potentialmerits, adverseconsequences and legalimplicationsof all proposedconstitutionalamendments or changesin the bylawsand reporttheir findingsand recommendations to the Boardof Directorsprior to formalconsideration of the proposedchangesby the membership. The membersof the Committeemay suggest appropriateconstitutionalamendments and bylawschangesto the Boardof Directors.

tiaisen md b)'the eemrnittee€hair fer ere )'eartermsand 'ri.he

'rvhema)' be reappeintedfer subsequent terms,The €emmit tee shallfesterresearehin emer8eneymedieine,The €emmit iean ,ovl'ema)' be reappeintedfer up te three eenseeuti,o'e terms; input frem the Be terms, )'eartermsand ,ovhema)' be reappeintedfer subsequent The effieialemergeneyrnedieinedeletateste the AAr\,1€'it'ill at the Miyeyear*

Eleetvt'ithinButfrem the BeardL;aisenand €en-mittee€hair fer ene yeartermsand rvhe ma)' be reappeintedfer subsequent terms, The Cemmitfue ehair mat' net serve fer mere than fhree eansee.rfireyears,The €emmittee shall festerfederal and te: Seetien llt €emmiU eemmitteeshall eensistef a €hairi appeintedte a ene ).ear sp te threeeenseeutive termsand membersaepeintedbr-the PresidentEleet with input frern the Beard tiaisen and the €emmittee Chair fer ene year terms and 'o,o'he mar-be reap "fti+tegshalkster internati€n+l ree ifi..eme+ Mi+e+<r.ft Section#! 6: Liaisonsto other orsanizations.The President may appoint liaison representativ6s to other organizations. The liaisonrepresentative must be a memberof the-Aeseeb tiea Society and be aware of the Aeeeejatrbr* Society organi, i s s i o n sp, o l i c i e s a , n d s t r u c t u r ef.h J l i a i z a t i o n a lp o s i t i o n sm son representative shall issueat leastbiannualreportsto the Boardof Directorson organizationalactivitiesand issuesrelevant to the A,sseeia+ie+Society. ARTICIEVII . DISSOTUTIONOF THE SOCIETY Section /: Dissolutionof this A,sseeiatier+ Societvcan onlv be initiatedby a majorityvote of all membersof the'Boardof Directorsand mustbe approvedby two-thirdsof the activemembershippresentand voting at any annualor specialmeeting. Section2: Dissolutionshall be achievedin compliancewith Article VIII of the Constitutionand Bvlaws of the Societv,


Closedmeetingsof the Board and ExecutiveCommitteeand ExecutiveDirectormay be convenedby orderof the President. Section8: Duties of the PresidentThe Presidentshall serveas the spokespersonfor the A.sseeiatieaSociety and preside over the educationalprogramand businesssessionof the annual meeting of the AeeeeiatierVSociety and the meetings of the Boardof Directors.lt shallbe the duty of the Presidentto seethat the rulesof order and decorumare properlyenforcedin all deliberationsof the'A.seeeia*ien, Societytosignthe approvedminutesof each meeting,and to executeall documentswhich may be requiredfor the Acseeiatie+Societvunlessthe Boardof Directorsshall haveexpresslyauthorizedsomeother personto perform suchexecution.The President shallmake executivedecisions regardingcommittee positions, committee tasks, interorganizational activitiesand Board tasks.The Presidentshall overseeandtakeultimateresoonsibilitv for an annualevaluation of the ExecutiveDirector.The Presidentshall serveas Chair of the Boardof Directorsand with the Secretaryfireasurer shall set the agendafor the Board meetingsand the annual business meeting.The President shallserveas an ex-officiomemberof all committees. The President shallappointmembersto fill vacanciesand unexpiredtermson the Boardof Directorsand standine and ad hoc Committeesuntil the next scheduledelection.The President shallappointa Boardliaisonto each committee.The President may appointtaskforceswith limitedspecificgoals. Section 9: Duties of the President-Elect.The President-Elect,in the absenceof the Presidentshallbe the spokesperson for the,A,r seeia+ienSocietvand suoervisethe Board.The President-Elect shallserveasChairof the NominatineCommitteeand ex-officio memberof all committees.The President-Elect shall, in conjunctionwith committeeChairs,developcommitteetasksfor the presidencyyear, review committee member performanceand make committeemembershipappointments for the presidency year.The President-Elect shallalsoappointtheChairsof the nonelectedstandingcommitteesand developthe long-rangeplanyear. ning session of the Boardduringthe President-Elect Section 10: Duties of the SecretarylTreasurer. lt shall be the duty of the Secretaryfireasurer to be the spokespersonof the 'A.sseeia th Societyand to presidein the absenceof both the President and President-Elect. The Secretarv/Treasurer shallkeeoa true and correctrecordof the proceedingsof the annualbusinessmeeting and meetingsof the Boardof Directors,shallpreservedocuments belongingto the Aesee.iatiea Societyand issuenoticeof the annual businessmeetingand meetingsof the Boardof Directors. The Secretary,/Treasurer shall keep an account of the Aceeeia+ie+r Societywithits membersand maintaina currentregisterof members with datesof their election to membershipand preferred mailing address.The Secretaryfireasurer shall be responsiblefor reportingunfinishedbusinessrequiringaction from previous meetingsof the membershipor Boardof Directorsand in conjunctionwith the Presidentshallbe responsible for the agendaof the annual businessmeeting and meetingsof the Board of Directors.The Secretaryfreasurer shall collect the dues of the 'q,sse€+ati€e Society make disbursementsof expenses,ano overseethe financial accountsand recordsof the Aceeeiatie+Society, The Secretaryfireasurer shallchair the MembershipCommittee. The financialrecordwill be presented to the membershio at the annualbusinessmeeting,biannuallyto the Boardof Directors, and at such times as reouestedbv the Presidentof the Aeseeia tie+ Sociefy. The financial records of the Aceeejati.e+r Societv shallbe reviewedannuallvbv two othermembersof the Board of Directorsappointedby the President, or a certifiedaccountant or financialconsultantretainedby the Boardof Directors. Section 11: Duties of Members-at-Large.Members-at-Large shall representthe membershipin conductingthe A,sseei+ lted+ Society'sbusiness, abide by the Constitutionand Bylaws of the A.sseeja+ie+Society and representthe A.sseeiatienSociety in activitiesrelatedto academicemergencymedicine. Section 12: Duties of the Immediate Past President.The lmmediatePastPresidentshallaid the NominatineCommitteein

identifyingcandidatesfor special recognitionby the Society. fhe ImmediatePastPresidentshall assumewhateverdutiesare and otherwise assignedby the Presidentor the President-Elect serveas a Memberof the Boardof Directors. Section 13:Absenteeism/termination of office.Absencescan be approvedor excusedonly by the President. Two unexcusedabsences from scheduledBoardof Directorsmeetings,annualbusiness meeting, or specialmeetingsof the Boardof Directorsduring any term asa memberof the Boardof Directorsshallconstitutea resignation. Such resignationshall be effectivetwo weeksafternotificationby the President. Any memberof the Boardof Directorsmay voluntarily resignand such resignationwill becomeeffectiveimmediately. Section 14: Duties of the ExecutiveCommittee:The Executive Committeeshallconductthe businessof the Boardof Directors a n d a c t i n l i e u o f t h e B o a r do n r o u t i n ei s s u e sA. l l a c t i o n sb y t h e ExecutiveCommitteeare subjectto reviewand approvalby the full Boardof Directorsat their next meeting. ARTICTE III - MEETINGS Section1. Annual business meeting.A formal businessmeetingof the membershipof the A*eeeia{ier+Society shall be convened annually in conjunctionwith the annualscientificand educational meetingof the A.sseeia*ie+Society, Businessitemspresentedas informational or for vote by activemembersshallincludebut not be limitedto: (1) a financialreportfrom the Secretaryfreasurer, (2) amendmentsto the Constitutionand Bylaws of the A.seeei+ @ Society(3) electionof Officers,membersof the Boardof Directors,and the Chairsand membersof the appropriatestanding committees of the Asseeiatie+ Society (4) reports of committee activities,(5) transactionof other businesswhich may come before the membership,and (6) a "Stateof the A,s'seeiatie++" Society addressby the President. Wheredictatedby the Constitution and Bylaws,the Aeeeeia+ier+ Societyshall be governedby a majority vote of active membersin attendanceat the annual business meeting.The Presidentof the AeeeeiatienSociety shall preside over the meetingand the Secretaryfireasurer will circulateagenda itemsto the membership30 daysbeforethe annualbusiness meeting.The Chairsof the Constitutionand BylawsCommittee parts and NominatingCommitteewill presideoverthe respective of the annualmeeting.The annualbusiness meetingshallbe held at a time and placedeterminedby the Boardof Directorsof the Aceeeia{ienSocietyapproximatelyone year in advance. Section2; Betweenannualbusinessmeetings,within the guidelines of the A€re€i€+le{r+Society's Policies and Procedures Manual and the Constitution and Bvlaws. the A,sseeia+iea Societyshall be governedby the Boardof Directors.Actionsof the Boardof Directorsshallbe determinedby a majorityvoteof thoseof its memberspresentat its meeting. Section3: Annual scientific and educational assembly.The A,sse eiatien Societyshall sponsoran annual scientificand educational meetingor assembly to meetitspurposeand objectives. ltsmission shallbe to fosterresearch and educationin academicemergencymedicinein accordancewith the Policiesand Procedures manual.The researchand educationalprogramsof the annual meetingshallbe open to the public and the generalmembership of the Aceee.ia*ie+Society. All meetingsof standingand ad hoc committeesare ooen to the oublic and membersof the A.sseeia M Society.Programsfor the annual meetingshall be arranged by the ProgramCommitteeand approvedby the Board.A final noticeof the time, place,and programof the annual assembly shalI be sentto alI membersof the Aeeeeia+ie+r Societvbv the Secretaryflreasurer at least30 days beforethe meeting. Section 4: Special meetings sponsored or cosponsored by the ,atm&+ien Society. The A,sseeiatier+Society may sponsor or cosponsorother scientificor educationalmeetinssof interestto the membershipto meet its purposeand objectives.Suchmeetingsshallbe convenedby the President, Boardof Directors,and ProgramCommitteeChair and publicized at least30 days in advance by the Secretary/Treasu rer. A R T I C L EI V - F I N A N C E S Section/; The annualmembershioduesfor all membersshallbe


ARTICTE VI - ANNUALMEETING Section /: There shall be an annual meetins of the Assed*ie+ Society.This meetinsshallconsistof in educationa l a n d s c i e n t i f i cp r o g r a ma n d J b u s i n e ssse s s i o n . Section2:The Boardof Directors,by majorityvote,may call, upon 30 daysnotice,a specialmeetingof the membershipor standing committeeto conductany businessthat the Boardof Directors shallplace beforethe membershipor standingcommittee. Section3: A specialmeetingmay be called by the membership upon petitionby 100 or more activemembersstatingthe reason(s) for the meeting.The Secretaryflreasurer shall call such a meetingwithin 30 days of receivingthe petition at a time and place designatedby the President. Section4:The Boardof Directorsmay call and conductany special meetingby mail. For purposesof notice,the meetingdate shallbe a date setfor the returnof mail ballotsand it shallbe calledthe voting date.@bnâ&#x201A;Źr atre+#rsâ&#x201A;Źti+ Approval or disapproval of any matter before the Boardby mail ballotshallbe achievedby affirmativevote of a majorityof voting activemembersunlessotherwiseprovidedby anotherprovisionof thisconstitution. Only thosemail ballotsreceivedat the businessofficeof the Aceeeia+ien Societywithin30 dayssubsequent to the votingdateshallbe counted.' A R T I C I EV I I _ A D O P T I O NO F A M E N D M E N T S Section/: The constitutionand bvlaws mav be adopted or a m e n d e da t a n y a n n u a lo r s p e c i am l e e t i n go f i h e m e m b e r s h i p . Section2; Proposedamendmentsto the constitutionand bylawsshall be submittedin writing to the Secretary/Treasurer

by at leastthreemembersat least60 daysprior to the meeting at which they are to be considered.The Secretaryfreasurei shall mail the proposedamendmentsto the membershipat least30 daysprior to that meeting. Section3: The Boardof Directorsmay,by resolution,propose amendmentsto the constitutionand bylaws;providedthe proposedamendmentsare mailedto the membershipat least30 days prior to the meetingat which they are to be considered. Section4: Adoptionof a constitutionand bylawsamendment shall be by a majorityvote of the activememberspresentand v o t i n ga t a n y a n n u a lo r s p e c i a m l eeting. ARTTCIEVilt - D|SSOIUT|ON Upon the dissolutionof the corporation,the Boardof Directors shall,afterpayingor makingprovisionfor the paymentof all of the liabilitiesof the corporation,disposeof all of the assetsof the corporationexclusivelyfor the purposesof the corporation in such manner/or to such organizations organizedand operatedexclusivelyfor charitable,educational,religiousor scientific purposesas shall at the time qualify as an exempt organizationor organizations underSection5Ol(c)(3) of the Internal RevenueCode o! 1954 (or the corresponding provision of any futureUnitedStateslnternalRevenueLaw),asthe Board of Directorsshall determine.Any such assetsnot so disposed of shallbe disposedby a Courtof CompetentJurisdiction in the Council in which the principalofficeof the corporationis then locatedexclusivelyfor such purposesor to such organization or organizations, as said court shall determine,which are organizedand operatedexclusivelyfor such purposes.

BYLAWS ARTICI.EI - MEMBERSHIP Section1:ApplicationProcess. Membershipapplicationforms may be obtained from the ExecutiveDirector of the Aeeeeia {+* Society.The Applicantmust returnthe completedapplicationforms and supportinglettersto the ExecutiveDirector. T h e q u a l i f i c a t i o nosf a p p l i c a n t sf o r m e m b e r s h i pw i l l b e r e viewedby the ExecutiveDirectorand Secretaryflreasurer. Approval of applicants by the Executive Director and Secretaryffreasurer shall constituteelectionto one of the membership categories, effectiveimmediately. Section2: Dues.Annual dues for active,associate,resident/ fellow,and medical student, memberswill be established by the Boardof Directors.Honoraryano emeritus memberswill not pay dues. Membershipin the A.sseeia+ienSociefy may be terminatedfor nonpaymentof dues. ARTICLEII - BOARD OF DIRECTORS Sectionl: Members.The Board of Directorsshall consistof the President,the President-Elect, the lmmediatePastPresident, the Secretaryfireasurer, and six Members-at-Large. EMRA,AACEM, and CORD may each appoint an ex-offiiio memberto the Board. Section2: Responsibilities. Membersof the Boardwill meetregularlyto perform the businessof the Asseeia+ie,aSocietv, All scientificand educationalmeetingsof the Aseeeia+ienSociety are to be approved by the Board. Membersof the Board may serveon committees of the Aeeeeiatiet Societv but no Board member may serve as a standing committee Chair, with the exceptions of the President-Elect ierving as Chair of the NominatingCommitteeand the SecretaryrTreasurer servingas Chair of the MembershipCommittee.The entire Boardservesas the MembershipCommittee.Membersof the Board mav be appointedto serveas Chairsof ad hoc committeesand taskforces. Section3: Electionof Officers.(a) The President-Elect shall be electedfor a term of one year with automatic successionto President the following year.During this two year period,the electedmemberwill serveas an officer of the Asseeia*ie.*Society. Followingterms of President-Elect and President, this

memberwill automaticallyassumethe positionof lmmediate PastPresident. Electionas President-Elect shallconferBoardof Directorsmembershipfor a minimum of three years.(b) The Secretary,/Treasurer shall be electedto a threeyear term. An active membermay not serveconsecutivetermsas Secretaryflreasurer,President-Elect, President,or ImmediatePastPresident. Section4: Electionof Members-at-Large. Members-at-Laree shall be electedto three-yearterms,the termsbeing staggeredl Members-at-Large may not servemore than two termsconsecutively. Section 5: Nominees for Election. Nominees for the above officesshall be selectedby the NominatingCommitteeand must have agreedto stand for election prior to their formal n o m i n a t i o nf o r e l e c t i o na t t h e b u s i n e s s e s s i o no f t h e a n n u a l meeting.Alternativenominationsmay be offered from the floor, but only with the advance permission of the nominee who agrees to run for office prior to or at the businesssession of the Annual Meeting, and must be physically presentfor the vofe. Electionshall be by majorityvote of the activememoerspresentand votingat the businesssessionof the annualmeeting. Section 6: Termsof Office. Termsof office will begin at the conclusion o f t h e a n n u a lb u s i n e sm s e e t i n eT. h e P r e s i d e nsth a l l appoint eligible Aesee+a++en Societymembersto fill vacancies and unexpiredterms on the Boardof Directorsand standing and ad hoc committeesuntil the nextscheduledelection. Section7: Meetings.Meetingsof the Boardof Directorsor ExecutiveCommitteewill be convenedin accordancewith the Policiesand ProceduresManual. Specialmeetingsmay be convenedat the President's discretionor by petition of six membersof the Boardof Directors.A final noticeof time and place of such meetingsshall be sent to all membersof the Board by the Secretaryfireasurer at least 7 davs before the meeting.Six membersof the Boardof Directorswill constitute a quorum. Any Member of the Assee'ia+i.er+ Societymay submit agendaitems.Suchitemsmustbe submittedwithin 30 daysof the meetingdate.Meetingsof the Boardof Directorsare open to all membersof the Aceeeja+iel+ Societv and to the public.


new languagein bold face and old lanThe proposed amendmentsin the Constitution andBylaws are indicatedwith guage crossed out.

CONSTITUTION ARTICTEI - NAME " T h e . S o c i e t yf o r t h i s o r g a n i z a t i o ns h a l l b e , The name of hereinafterreferredto as, Academic Emergency-Medicine," "The A,seeeia*ie# Society ARTICLEll - oBfEcTlvEs Society is to Section 7; The objective of this Acsee+a+ien patient by Ploinjured ill or the acutely i.orou" the care oi and the r,jiing research,educatinghealthcare professionals p u b l i c ]f o s t e r i n gr e l a t i o n s h i pwsi t h o r g a n i z a t i o nwsi t h a s i m i t h e s p e c i a l i z e od r m u l t i d i s c i p l i n e iui prlpot", andsupporting .uri, oi such patiehisthro-ughresearchand education' The Sbcietywill funttion as a scientific and educaA,seeeiat+en tional organizationas defined in Section501 (c) (3) of the lnternalRevenueCode,as amended. Society shallpursueits purposeby: Section2; The Ass,eeia*ien (1) sponsoringforums for the presentationof peer-reviewed (2) sponsoringand icientific and educationalinvestigations, h e a l t hc a r ep r o f e s s i o n a l s p r o g r a m f s o r c o n v e n i n ge d u c a t i o n a l a n d t h e l i y p u b l i c ,( 3 ) p r o m o t i n ga c a d e m i cd e v e l o p m e nat n d e d u c a t i o n ' o fi t s m e m b e r s h i pt h r o u g hs p e c i a l i z e dp r o g r a m s / (4) servingin an academiccapacityto developand promote for the care of the iurthe, th"e most appropriate'measures s ith other a c u t e l yi l l o r i n j u r e d'pua t i e n t(, 5 )d e v e l o p i n gl i a i s o n w ( 5 ) p ublishing p u r p o s e , a n d s i m i l a r * i t t t oieanizations reiearchand educationaldata in the scientificand educational literatura e n d o t h e rm e d i aa v a i l a b l et o t h e l a y p u b l i c ' A. Section3: This €€ff€ra+ion Society is organized as a corpor.purposes, includand'scientific aiion e*clrsivelyfor educational organizato distributions purposes, of making the ine, for such underSection501 (c) tiols that quaiify'asexemptorganizations (3) of the tnternil RevenueCode of 1954 (or the corresponding provisionof any future United StatesInternalRevenueLaw)' B. No part of lhe net earningsof the corporationshall inureto to its members,Directors,.Ofih" b"nufitof, or be distributable ii."tt ot othei privatepersons,exceptthat the corporationshall compensation be authorizedand empoweredto pay reasonable in for servicesrenderedand to makepaymentsand distributions No hereof' A paragraph in foith purposes set the of frrtl'rerance part of ihe activitiesof the corporationshall be the substantial to influ.ence or otherwiseattempting lirrying on'of propaganda, and the cbrporationshallnot participatein, or interleeislation, of statements) ve"nein (includingthe publishing-or-distribution on beha-ifof any candidatefor public anv politicalcam"paign "ifi.i,. N"t*itnstandiig any other provisionof thesearticles,the coroorationshallnot carryon any otheractivitiesnot permitted to be carriedon (1) by a'corporationexemptfrom Federallncometax underSection501 (c)(3)of the lnternalRevenueCode provisionof any futureUnitedStates of 1954(or corresponding RevenueLaw) or (Z) bv 5 corporation,contributionsto which are deductibleunderSection170(c)(2) of the InternalRevenue Code of 1954 (or the correspondingprovisionof any future United StatesInternalRevenueLaw). A R T I C T EI I I - M E M B E R S H I P Thereshall be se\€n six classesof memSection1: Classifications. p s, residenVfe||ow, honorary,inte+ i ate, emeritu ve, assoc bershi : acti and medicalstudent' Section2: Qualifications. (1) Candidatesfor,active memberDO, shipshallbeia) individualswith an advanceddegree.(MD, Phb, PharmD,DSc,or equivalent)who hold a medicalschool or universityfacultyappointmentand who.activelyparticipate teachor criticalcarein an administrative, in acute,emergency,

capacity,or (b) individualswith similardegrees ing,or research inictiue militaryservice(U.S.or abroad)who activelyparticior criticalcare in an administrative, oate in acute,emergency, otherwisemeet capacity.Individuals.who ieaching,or research oualificiiionsfor activemembershipas definedabovebut who do not hold a universityfacultyappointmentmay petition.the for activememberMembershipCommitteefor consideration rnio rtitrt.'(2) Candidatesfor associatemembershipshall be officials,members educators, h"alth ptofessionals, Sovernment public at largewho of the members groups, or of lay or civic in pursuingthepuror desireto participate rnavhauean ini'eresi bor'"r und obiectivesof the AceeeiatieeSociety(3) Candidates or fellowsin ior resident/Gllowmembershipmustbe residents mediemergency in interest programs an have who residencv crnre.G)Cantidatesfor medicalstudentmembershipmustbe medicalstudentswho havean interestin emergencymedicine' (5) Candidatesfor emeritus membershipshall be (a) active memberswho seeksuchstatusand who havegiven 15 contin,orr v"utt of activeserviceto the AeseeiafienSocietyandhave attainedthe ag,eof 65 yearsor (b) other activememberswho are invitedfor suchemeritusstatus underspecialiircumstances (6) Candidatesfor honorary Committee. Membership bv the rerbetship shallbe individualswho have made outstanding to the purposeand objeci"i"ut.n ot'"aucationalcontributions tives of the Aeseeiatie't SocietY ;6bershie sh

Section3: Member Rightsand Privileges.AII membersmay have of the ihe privilegeof the flo"orand of servingon the.committees

SocietY. Asd€rn+r€{+, @*+

ry Pnlvactive

serveuon the Boardof may sstvs and llrcry rightsanu votingrlS,nrs havevotlnB shallnave shall r"*n"" members

oire,aors,as officersof tLe Society,or as commifteechairs'

Society shall not discriminate,on Section4: The Ars€€€iat.r€{+ penden origin' national a t i o n ao l rigin. orr n e l i g i o no creed, the h:sic of race. *s<= gender, , rreligion basis race, seg BOARD OF DIRECTORS, ARTICIElV - OFFICERS, DIRECTOR COMMITTEE,EXECUTIVE EXECUTIVE Section/: The officersshall be the President,President-Elect, and Secretary/Treasurer. Section2; The Boardof Directorsshallserveas the governing n.av. in" Boardo{ Directorsshall consistof the aboveoffiand six Members-at-Large' cers,the lmmediatePastPresident, shall consist of the Committee Executive Section3; The ImmediatePastPresidentand SecPresident,President-Elecr, retaryfreasurer. Section4: The ExecutiveDirector recommendsand particioatesin the formulationof new policiesand makesdecisions within existingpolicies as they have been approvedby the Boardof Directors. ARTICLEV - COMMITTEES The standingcommitteesshallbe: (1) NominatingCommittee, (2) MemberihipCommittee,(3)Constitutionand BylawsComrn1ft"u,(5) Edueatien€emmitteei (6) Resggreh€ernmitteei(i) tiaisen €emmittee te the Asseeiatienef '\meriean f'ledieal committeesmaYbe fuAdditional createdby the Boardof Directorsand ad hoc committeesand task forcei may be createdby the Presidentto aid in the A'se'a e+a+ienbSocieity'sefforts to achieve and further its goals'


If rftIAt

f rrrrrrtAYt\r J----'-

Awnnu AcnnEMIc ExcnTLENCE

I

Arthur L. Kellermann, MD, MPH Memphis,where from 1985 through 1993 Dr. Kellermannbeganhis emergencymedieinecareerar the university of Tennessee, as MedicalDirector of the Emergency served he also he servedas chief of the Divisio"noiErr-r.rg.n.y Medicine. During thii time of lhe Memphis Fire Department Director as Co-Medical and MeclicineDepartmentar the RegionalMeciicalcenter ar Memphii this earlywork at the local and that I beiieve research, recognized nationally his for known EMSBureau. Although he is now best coma specialjoinl- Senat-e statelevel remainslhe most deeply satisfyingto him. In recognition-o[theseefforts,he was awarded c trlt Lcgislrtulc. b y t h c l e n n c s s eS mendation Center for Injury ConLrol ln 1993, he was recruireclto rhe Rollins school o1'publicFlealrhar Emory Universiryto establlshtire Division o[ Emergency of the Chief of Acting rclle aclditional the he assumecl 1995, ln where he cu.ently servesas Director. of thc Emory department Mecllcine. Due in t*g. pottt ro his eflbrts, the Division is slateclro become the newesl academic UniversitySchoolof Medicine. has establishedhim as alead' Dr. Kellermannis perhapsbest known ibr his researchon hanclgunviolence. Tlris rnfluentialwork resultsof handgun vjolence clinical the with deal commonly physiciins Emergency subjecr ing internationalauthority on the health inquiry of public Dr. KellermannsmaJorcontriburion in this arealias been io make this tctpica legitimateobiect between the associ'ation In a seriesof articlesdating from the mid-1980'.s,Dr. Kellermannand l-iiscollaboratorscharacterized as firearms of myth the debunking research published he recent-ly, Molc firearmownershipln the hJme, homicicle,anclsuicicle. protectionfrom home burglarY. his colleaguesregardingthis The following quote from rhe presidentof a rrrajorluncling olganrzationsummarizedt]re vrew of impressivebody of work. .. of.havinga gun ,,(Iheg tf therelatttc rishsandbenet'tts of Dr Kcllermann.His studLes Lo theseminalreseurch ret'erwith respecL constantly eteryleadcitedby are they in this.field; done the to fu are considered McdkLnc oJ England linesL \letu i, ii't,o*, pwbtrhid in tie lournal excellenttpatLtyoJtheres,eatchandanalysts,butthe ingscholarindlournal.What*ar1^poitqntaboittheseartLcleswasn()tiustthe arecited stctistics of gun ownership.Dr. Kellermann's euects so-called.pro.tectiie oiitrtytn developawholenewJramewolihfurassessingthe an issue about authority with to speah re noL able we we iimpty pultltthrd, *rru ,o o7rn that peiple sometimes forgetLlut unLilhis aittcles preventton." to thet'ieldof gun lioLence soes-senticl of variety of sub.lects to his landmark firearm research,Arthur has concluctedimportant clinical researchon a wide acldition In of asthma, Lreatment emergency on the in publications rmporrancero emergencymedicine. Thesernvestigationshave resulred methods,and the poitable pulse oxim"etry,emergencydepartmentcliug screening,cardiopulmonaryresuscitation,defibrlllation p r c g n x n c ; l . d i a g n o s iosf e c t o p i c accessto,.and'use o[, A third area ofArthurs researchhas involved heaithservjcesutilization. In particular,he has investigated. N_t"Ej4:!!:..:?,'^!.Y:!.:::' ,!. publications twrn with .rrr.rg.rl.y servicesby th. poo, and unemployed. Beginningin 1988 -dumpd,.pu::-:i' and rie imencan Journalif rublic Health,he brought natronalattentionto the problem of e1e1qe1.y lif' patients'accessto outpaing." More ,...rrily, he 1eda multi-institutronalMedicaidAccessStudy Group,thatexaminedMedicaid his work with GaryYoung. recently, More oJ Medicine. Jou'rnal rienLcare,resultingin a 1994 rcporLpublishedin rhe Ntw Englund inJAM'A This published was departmentvisits Lhereasonsfo, um"bulatoty...rg.n.y ti'.i .1. *rg*r, u?J o,1..o charactcrizing his colleagues' by justify recognition this alone efforts these and specialty to our line of lnqui?ycomprisesasimportant coitribution enthuFinally,I would like to recognizeArrhurs rremendousability to serveas a mentor. H: lu: a natural ,?ltllt,:.::Ti:nicate would lt collaborative{ashion in a truly rhis toward the many tasksthat we thce,and he does siasmand emotional.o--]t-"r1, is richKellermann Dr. Arthur above, reasons the For all medicine. be difficult to find a betterrole model lor a careerrn academic E x c e l l c n e e A c a d e m r c l o r A w a r d H a l l y d . s e r u i n go f r h e S A E M l q 9 7 Jayme , D.MpH K n o xH . T o d dM


LtnosRSHrPAwnnn

I

,

I

Jerris R. Hedges,MD, MS I am one of the fortunateoneswho has felt the influenceo[ JerrisHedges. My own relationshipwirh Jerrisbeganin 1982 when he becamea colleagueat the University of Cincinnati. Although he left Cincinnari1n 1988, his shadowand wake remained. To this day,I still find rnyselfasking. "How wouldJerrls have hand]edthis situation?" But this illustratlon is only one of hr-rndreds.WhereverJerrishas beenand whateverhe has done, he has left a lastinginrpression on thosehe has known. His accomplishments, intellect,and characterhaveservedas a model for othersto emulate. ln ihis conlext, he ls a faragon of Lhefinest kincl of leac1er, one who leadsby example. Hrs inlluenceon othershas been wlde rangingand it is this quality which makesDr. Jerris R. Hedgescleservingof the l997 LeadershipAward. Born in-Olympia,Washington,Jerrisatter:rded the Unrvcrsityo{'Washingtonwhere he obtaineda bachelorsdegreei1 the Deparrment of Aeronauticsand Astronauticsand a mastersclegreern rhe Depar-tmentof ChemicalEngineering.He c"ontinuedhis g*duate educationat the University of Washingtonanclobtainecl his meclicalclegreein 1976. He ihen enieredthe emergencymeclictne training program at the MedicalCollegeof Pennsylvania, completinghis residencyunder rhe guidanceof Dr. navld iAzugn.t in 1979. Following a brief solourn into privatepractice, Jerris joinecl the emergencyrnedicinelaculiy at the Universityof Ciniinnati. Slnce1988,Jerrishasbeenon-theFacultyat the Oregor.r ITealLh sciencesUnrversitywherehe currentlyr.rues a, professor and Vice-Chairof the Departmentol'EmergencyMedicine. Dr. Hedgesis a man well known for his accomplishments.Within the Societyfor AcaclemicEmergencyMedicine,he has served as ProgramChair,member of the Boardof Directors,and Presrclent.Amor-rghis many contributionsto ihe organization,he oversaw the expansiono[ the Annual Meetingto inc]ucleposterpresentatrons, ihe clevelopmentof theme meetings,and the creation of the SAEM.1ournal, AcademicEmergency Medicinc. His-intellectualpursuits have extendedbeyond the conl'rnesclf a singleplaceor institurion He has managedto reacha broader audience.throughhls prodrgiousundertakingsas an author anclediror. His ralentsas a collaboratorhaveled to a steadystream of freshideas. He haswritt-enover 130 articlesin peer reviewedjournals and dozensof othersin non-refereedpublications.With co-editorJim Roberts,Jerrls shepherdedthe groundbreakingtext, ClinicalProcedures in EmergencyMedicine.ihroughthree edi, tions. He also servedas co-edrtorof the most recent edition of Emergency Med.icine Concepts and ClinicalPracticeir-rd,, , .u,-rtributing editor to severalYearBoohsol Emergency Medicinc. He has actedas a reviewerand guestedltor for a number of professionaljournals, and he has been an edrtorialboard memberof Emergency Medictne& AmbulatoryCare,Journal-of Emergency Medicine,Annalsof Emergency MedLcine, andJournalof AccLdent and. Emergency Medicine . Of greatimportanceto SAEM,he has been the Editor-in-Chieffoi AcademicEmergency Mediciiesiirce1993. It has been the deft leadershlpskills of Jerris Hedgeswhich has allowed this imporrantjournal to rrti'irr. and flourlsh. He has nurtured this journal to the point that it is publishedmonthly and is acceptedby all the ma.1orabstractservices. Impressiveas his achievem:.nPmay b.e,Jerns has personalvirtues which endearhlm to all who know him. The respecthe gives to-others,the generosityof his time, his selflessmodesty,the warmth of his presence.and his unclerstatedwit are iemindeis of r,rhat a specialman he is. Dr. Hedgeshas been an exceptionalpersonfor the lield o1emergencymediclne. Wb are fortunatero havebenefitedfrom his talents as he syst_ematically strengthenedour specialty We are forevergratefuland privilegedto be able to honor him and we offer h i m o u r h e a r t f e lct o n g r a t u l a t i o na s r h e r e c i p i e nol l t h e l 9 e 7 L e a d e r s h iApw a r d . RichardC. Levy,MD, MPH


;:H!{iff;?'

Consulfing Service 21,419 Newsfeffer Adverfising 47,568 Journol 28,977

6eriofric Gront 91,759

Physio Confrol Gronf 50,000

EMF Confributions

12.655

Prinfing 31.810

Revenues:$I,2ZT,168

Depreciofion Posfoge/ 15,172 Shipping Newsleffer Other 36,788 40,156 Administrotion Expenses 73.616

Telephone/ Conference Colls 18,410 Consulfing Service 14,334 AAMC

10,973

Expenses:$ 1,028,63I


Wbdnesday,,May 2I N ominating Committee (continued) Judith E' Tintinalli' MD, MS, is Professorand _chairmanof rhe departmentof emergencymedicineat the University of North Carolinaat ChapelHill. Dr. Tintinalli has been a member of SAEM since I977 and was the-recipientof the I996^Leadership Award. she servedas programChairman(i9g4-g6) and as the president of the AmericanBoardof EmerqenryMedicine(1989-90) and'the Council of n-.rg.n.i v.aj.i". Residency Directors(i988-9I). Dr. Tintinalli graduatedfrol stareuniversity medicalinoot in I969, completed lal'ne an internal medicine internship at Detroit GeneralHospital in 1970 and an internal medicine residencyat the University of Michiganin I974.

Constitution and Bylaws Committee Phil Henneman, MD' is the vice Chair at Harbor-UCIA MedicalCenterand Associareprofessor of Medicine at UCIA school of Medicine.He graduatedfrom HarvardMedicalschool in l9B0 ";t.;-;il*d residencies in EmergencyMedicine.(Denver GeneralHospital) and Internal Medicine (presbyterian-si. r-ukes).He has been a member of sAEM since 1985. He has servedon the Membershipand public Health and Education Committee(1989-91), the Researchcommiuee (1989-92),and chairedihe task Force on Subspecialization in EmergencyMedicine.(1990-91)and Developinga NarionalDatabasefor Emergency (rgg2-g3). M;ilil. He was electedto the Nominating committee'(lggz-qi and presentlyis on the-TaskForce on Emergency Medicine in AcademicMedical centers. He is a manuscriprconsultarufor e"cademic E;;G.;;y Medicine, t.dicine, AmericanJournal of EmergencyMedicine, Journal of EmerlencyMedicine, l:lt:^:luf:iq.l:t and JAMA. He is an oral examinerfor the Americangoard of Emergencyl,tedicine

C' James Holliman, MD is an AssociateProfessorof Surgeryand EmergencyMedicine pennsylvania at State University,and Director,center for InternationalEmergeicf v.di.in.. ite graduated from medicalschoolin r979^ftom w-ashingtonUniversityin St. Louis, and coLpleted a Burn Res&rch Fellowshipi" isez, as well a slrgery Residencyin 1983 from the university of Utah. Dr. Holliman has served 1s ^Ge1e1{ as the Chair of the SAEMWorkforceTaskForce(lgg5-97), and as a -.-b., of the internationaiCommittee(1993-96).He is also the current chair of the SAEM InternationalEmergencyMedicineInterest Group. since t9g4, he has servedas an ACEP Councillor, and Chair of the ACEP PublicationsCommittee and EducationCommirree. He ls a Reviewer for Academic Emergency Medicine and Prehospital and Disaster Medicine and is InternationalEditor of the Hong Kong Journil of EmergencyMedicine.Dr. Holliman was a recipientof the 1995 CPC BestFaculty DiscussanrAward.


2I Wednesday,,May Board of Directors (Continued) Debra G. Perina, MD, is an AssociateProfessorof EmergencyMedicine at the University of Virginia and the Medical Direcror for PegasusFlight Operations.In 1983 she graduatedfrom medical school at the West Virginia University.Shecompletedan emergencymedicineresidencyin 1986 at RichlandMemorialHospita}. TaskForce.Dr. Perinahas servedon From 1993-1997 shehas been a member of the Core Content Revisi.on the Constltution and Bylaws Committeesince 199'1and as the chair of the Committeein 1996-97. Since 1994 Dr. Perina has been a member of the ACEP Academic Affairs Committee and currently serveson the CORD Boardof Directors.

Brian Zink, MD is AssistantProfessorin the Sectionof EmergencyMedicine,Departmentof Surgeryat the University of Michigan Medical Center.He graduatedfrom medical school at the University of Rochesterin 1984 and completedan EmergencyMedicineResidencyfrom the Universityof CincinnatiMedicalCenterin 1988. Dr. Zink has been a member of the SAEM Board of Directorssince 1996 and currently chairs the RegionalMeetingsTask Force. Dr. Zink was a member of the SAEM ResearchCommitteefrom 1989-i993 and a member of the Constitutionand BylawsCommitteefrom 1993-96.He hasbeen the coordinatorfor the SAEM ResearchConsultingServicesince 1993. Dr. Zink is a reviewerfor AcademicEmergencyMedicine.

Nominating Committee Donna L. Carden, MD, is an AssociateProfessorof the Departmentof internal Medicine and an Assistant Professorin the Department of Physlologyand Biophysicsat LouisianaStateUniversity Medical Center, Shreveoort.Dr. Cardenhas been a member of SAEMsince 1983 and in 1996-97 she has been a member of the Academic DevelopmentTask Force, she served on the Program Committee (1993-1995). Dr. Carden graduatedfrom medlcal school tn 1979 from the Medical Collegeof Ohio at Toledo, and at Henry Ford Hospltal completedan EmergencyMedicine/lnternalMedicinelnternship in 1980, an EmergencyMedicine residencyin 1982, and an Internal Medicine Residencyin 1983. Dr. Carden completed a Postdoctoral ResearchFellowshipin 1991 at the LouisianaStateUnlversityMedlcal Center.

Robert K. Knopp, MD, is the Director of Educationand the ResidencyDirector in the Departmentof EmerMedical Center.Dr. Knopp was the recipientof the 1994 SAEM LeadergencyMedicine at St. Paul-Ramsey ship Award and in 1989was the recipi.entof the EMM Award for Excellencein Teaching.Dr. Knopp hasbeen CommunicationsTaskForce a member of SAEMsj.nce1976 and servedas the Chair of the Physician-Patient (1994-1996)and a memberof the EthicsCommittee(1990-1996),servingas the Chair (1990-1993).Since 1993 he has been a reviewerfor AcademicEmergencyMedicine. He has been an associateeditor since 1994 and a member of the Edltorial Boardsince 1981 for Annals of EmergencyMedicine.He servedon the ABEM Board of Directors(1988-i993) and as an examiner(I981-1993). Dr. Knopp graduatedfrom the University of Minnesotamedlcal school in 1969, completedan internship from Highland Hospital in 1970, and an emergencymedicineresidencyat ValleyMedical Centerin 1976.

John E. Prescott,MD, is Professorand Chair of the Departmentof EmergencyMedicineat WestVirginiaUniversity School of Medicine, and director of the West Virginia University Center for Rural EmergencyMedicine. Dr. Prescottis the Presidentof the Associationof AcademicChairs of EmergencyMedicine(1996-97) and an ex officio member of the SAEMBoardof Directors(L996-97). He has been a member of SAEMsince 1985 and this year servedas chair of the Rural EmergencyMedicineTaskForce. He has servedon the West Virginia ACEP Board of Directors (I991-96), the ACEP Rural EmergencyMedicine Sectionand the ACEP Government ServicesChapter (1986-88). Dr. Prescottgraduated from GeorgetownUniversity Medlcal Schoolin lgBI and completedan internship/transitionalyear (1981-82) and an EmergencyMedicine residency ln l9B4 at BrookeArmy Medical Center.


Wednesday,May 2I

Srnrn oF NoMINEES The No,minatingCommitteeand Board of Di.rectorsare pleasedto presentthis slateof candidates.The following generalguidelines were useq: 1. Nominations were sought from the membershi.pthrough advertisementsin the Newsletter. "Cal1for Nominations"ln the Newsletterwere considered. 2. All memberswho respondedto the 3. Wheneverpossible,a,siateof two or more candidatesis presentedto the membershipfor eachposition. 4. The goard bf Directorsbelievesit is important to have a singlebal1otfor eachposition under considerationrather than pairing up nominees.Thus, the most qualifiedcandidatesfor eachposition can be selectedby the membership. 5. Eachposition will be open for additionalnominationsfrom the floor at the annual businessmeeting. 6. Biographicalinformation regardingeachnomineeis presentedto the membershipprior to the elections. President-Elect

Scott Syverud,MD

Edward Bernstein,MD Board of Directors (two 3-yearpositions) Rita Cydulka, MD Debra Perina,MD Brian Zink, MD

Nominating Committee Member (two 2-yearpositions)

Donna Carden,MD RobertKnopp, MD John Prescott,MD Judith Tintinalli, MD

Constitution and Bylaws Committee Member (one 3-yearposition)

Phil Henneman,MD JamesHolliman, MD

President-Elect Scott Slwerud, MD is AssociateProfessorof the Departmentof EmergencyMedicine at the Universityof Virginia. He graduatedfrom medical school in lg8I from the StateUniversity of New York, Syracuseand completed an Emerge.rcyMedicine Residencyin 1985 at the University of Ci.ncinnati.He completeda ResearchFellowshipthere in 1984 and servedas chief residentin 1985. He has servedon the SAEMBoard of Directorssince 1994. He was the EMRA representativeto the UAEM ExecutiveCouncil and the STEM Boardof Direcrors(1984-85),a member of the UAEM GovernmentalAffairsCommittee(1986-87),the chlef residentsprogram organizerin 1990 and a member of the SAEM ProgramCommittee(I9BB-93). He has been a Reviewer for-AcademicEmergencyMedicine,Annals oJ EmergencyMedicine, the Amencanlournal oJ EmergencyMedtcine,and JAMA.

Board of Directors Edward Bernstein, MD is AssociateProfessorof EmergencyMedicineand Public Health and Vice Chair for Academlc Affairs at Bosron University School of Medicine and Boston City Hospital. He graduatedfrom StanfordUniversitySchoolof Medicine.He has servedon the SAEMBoardof Directorssince 1995,and from Igg3-95 served as Chair of the SAEM Public Health and Education Committee. He has served on the GeriatricTaskForcesince l99l and the SAEMPatient-PhysicianCommunicationTaskForce(1994-96).He currently chairs the Access to Care Task Force. He has served as a Reviewer for Academic Emergency Medicineand Annals of EmergencyMedicine. He was the New Mexlco ACEP ChapterOfficer and servedas President(1982-86), and from 1986-88he servedas Chairmanof the STEM Public EducationCommittee.

Rita K. Cydulka, MD, is an AssistantProfessorof EmergencyMedicineat CaseWesternReserveUniverslty and ResidencyDirector at the Department of EmergencyMedicine at MetroHealth Medical Center. Dr. Cydulka has been a member of SAEMsince 1988 and currently servesas Chair of the TaskForceon Women and Minorities in Academic EmergencyMedicine. Sheis the lncoming Chair of the Asthma ResearchInterest Group. She servedon the ResidencyCommittee(1992-1996),the EducationCommittee(1992-1993),and rhe M:uftiCenrerTrialsTaskForce(1996-1997).Since199I shehasbeenan examinerfor the AmericanBoard of EmergencyMedicine,since 1995 a reviewerfor AcademlcEmergencyMedicineand since 1996 a reviewer for Annali of EmergencyMedicine. Dr. Cydulka graduatedfrom Northwestern University Medical School in 1980 and completeda residencyin I9B4 at NorthwesternUniversit;r


Wednesday,M uy 2T

ffi I

ANNUAL BUSINESSMEETING Wednesday,May2L, L:30-3:00pm AGENDA

Elections, SteyeDronen,MD, President The slateof nomineesand biographicalinformation on eachcandidateis published on pages

2 . A m e n d m e n t st o t h e C o n s t i t u t i o na n d B y l a w s .M a r c u sM t t r t i n - M D .S e c r e t a r y / T r e a s u r e r The Constitutionand Bylawsand proposedamendmentsare publishedon pages a. Constitution,Article III - membership,Section1: amendmentwould deleteinternationalactiveand internationai associatemembershipcategoriessuch that therewould be no differencebetweenlnternationaland U.S. members. b. Constitution,Article III - membership,Section3: amendmentwouid specifythat only activemembersare eligible to serveas committeechairs. c. Constitution,Articie V - committeesand Bylaws,Article VI - standingcommittees,Section5-11; amendments would deletethe EducationCommittee,ResearchCommittee,Liaison Committeeto the AAMC, the GovernmentalAffairs Committee,and Committeeon InternationalAffairsas standingcommittees. d. Edltorial Changes:throughout Constitutionand Bylawschange"association"to "society"and "pastpresident"to "immedlate past president."

3

Awards Presentations,StetenC. Dronen,MD, and DonaldM. Yealy,MD Hal Jayne Academic ExcellenceAward, Arthur L. Kellermann,MD, MPH, EmoryIJniversity LeadershipAward, JernsR. Hed.ges. MD, MS,OregonHealthSciences TJntverstty Physio Control EMS Fellowship'. GuillermoJ. PierluLsi,MD, Universityof Pittsburgh 1996 Annual Meeting Awards: Best Oral Clinical SciencePresentation:RebeccaR. Roberts,MD, Cook County Hospital Best Oral Basic SciencePresentation:CharlesCairns,MD, University of Colorado Best Poster: David A. Talan,MD, Universityof CaliforniaLos Angeles Best Innovations in Emergency Medicine Education Exhibit: Anna Bradham,MD, VanderbiltUniversity Selectedfor presentation at the AAMC Annual Meeting: RichardLichenstein,MD, Medical Coilegeof Pennsylvaniaand Hahnemann University Best Education Presentation:William P Burdick, MD, Medical Collegeof Pennsylvaniaand HahnemannUniversiry Best Oral Resident/Fellow Presentation:Edward W Cetaruk,MD, Universityof Colorado Best Resident/Fellow Poster: ClaudiaM. Beck,MD, Universityof Louisville Best Pediatric EmergencyandCritical Care Presentation:KathyN. Shaw,MD, MS, ChildrensHospiLalof Philadelphia Best Medical Student Presentation:Rebecca Stroh,ThomasJefferson Universiry Best Technology Presentation:David M Schreck,MD, MS, MuhlenbergRegionalMedical Center Secretary/Treasurer's Report, Marcus Martin, MD, Secretary/ Treasurer A review of SAEMmembershipand flnancesis publishedon pages12 and 13 of the 1996-97Annual Reporr. President'sAddress,StevenC. Dronen,MD Introduction of 1997-98 President:John A. Marx, MD New Business

B.

Adjournment

Note: Award reclpients, newly elected members, and the Board of Directors are asked not to leave the Annual Business Meeting before participating in a brief photo session. Photos will be published in upcoming issues of the Newsletter.


Wednesday,May 2l 284. Termination of Nontraumatic CardiacArrest Resuscita_ tion in the Field: A National Survey, Datid JaslowMD, George Washingt on IJniyer sity 285. Cost-benefit Analysis of Air and Ground Tiansporr, kchard C. WuerzMD, Milton S HersheyMedicalCentir 286. Does Point-of-Care-Testing in the Out_of_HospitalSet_ ting Influence patient Cari, William FelegiDO, iJniversity of Medicineand Dentistryof NewJersey 287. Effectiveness of prehospitalAdministration of Subcutan_ eousNaloxonein patientsWith SuspectedOpioid Over_ dose,Karen Wanger,BntishColumbii embulaice Seryice

Scientific Papers: Toxicology/Environmental Injury (f 0:00 am - 12:00noon)

Moderator: Richard C. Dart, MD, phD, RochyMountain Poison â&#x201A;Ź> Drug Center 288. Inhibition of DermonecroticArachnidismWith Interleu_ kin (IL-8) MonoclonalAntibody (man), WitliamD, Whet_ stoneMD, Universityof Michigan 289. Cyanide:Death by Free Radicals? TerryL. Vanden Hoeh MD, Universityof Chicago 290. Alterationsin pharmacokineticsof Carboxyhemoglobin pressure,GregoryD.liy Mo f1$ryed by OxygenUnder PhD, Brown lJniversity 29I. lnhibition of Calcium SignalsBy imipramine is Not Me, diated By GilGo proteins in Isolated Cardlomyocytes, JohnA. WattsphD, CarolinasMedicalCenter

292. High- Dose Calcium Chloride ReversesVerapamil_in_ ducedMyocardialDepressionof Contractilityand Oxida_ tive Metabolism, Lada Kohan MD, ColoradoEmergency M edicineResearch Center 293. Investigation of Flumazenil to Antagonize Gamma_ hydroxy-butyrare Inroxicarion in a Muriie Mod,el,Wayne A. SatzMD, AlleghenylJniversityof theHeatth Sciences' 294. N-AcetyicysreineEnhances Nirric Oxide_Medicated Vasodilation in the Rat Mesenteric Artery. Bernard"L. LopezMD, ThomasJet'ferson lJniversity 295. Poison Center Consultation:influencing the Appropri_ areness of Emergent NAC Therapy, dory Ciryfaltou, RoclzyMountain poisonâ&#x201A;Źe Drug Centii

Poster Session (3:00- 5:00pm)

tclucatron Moderator: David T. Overton, MD, Michigan State Untuersity-KCMS(3:00 - 4:00 pm) 296. Impact of MedicareRule IL_372 on Teachinein the ED: Perceptionsof EmergencyMedicineResidenithysicians, Walter C. RobeyIII MD, EastCarolinalJniverstty 297. Prevalenceof Emergency Ultrasound Curriculums in lqergency Medicine Residencies,ThomctsC. RoepheMD, Richland Memorial Hospi tal 298. Documentation of Clinical procedures rn an EM Residency:A Dictation CompurerBasedModel, Michael Beeson MD, SummaHealthSystem 299. Comparisonof InserviceScoresand Faculty Evaluations with Performance-Based Assessmentof EM Residents, William P BurdichMD, AlteghenyrJniversityof the Health Sciences

300. Where All Our Children Are Above Averaqe:Does the CORD ResidencyRecommendarionForm GilveUseful In, tormation? Bnan K. NelsonMD, TexasTechlJniversity 301. Interrater Reliability of Faculty Clinical Evaluations of EM ResidentsComparing a Fixed Referenceto a Relative ReferencePerformance Scoring System, James G. Ryan MD, North ShorelJniversity 302. Analysis of Emergency Medicine Resident productivity By Patient Load, Relative Value Units, and Levei of Tiaining, Neil B.JasaniMD, MedicalCenterof Delaware 303. University and Community Hospital Fourth_yearMedi_ cal Student Eme^rgency Medicine Clerkship Experiences: Is There a Significant Difference?ElizabethA. deLahunta MD, UniversityoJ Rochester 304. Developmentof a Slmple, euantitative MechanlsmFor Assessment of MedicalStudentperformance,JonathanN. Adler MD, Massachusetts GeneralHospital 305. TeachingStudentsin an EmergencyWalk in Clinic does nor Delay Care,Marni J . BonniiMD', IJniversityof Alabama Birmingham 306. Tiauma Responsein the ED: A Survey of Emergency MedicineResidencyprograms,GlenH. TtnhofJ MD,-Medical Centerof Delaware 307. Failure ro SuccessfullyBlind Research in Emergency Medicine,Marh HauswaldMD, UniversityoJ NewMexico 308. Acid Base Made Easy, Michael E. ChansleyMD, Cooper Hospital

Education Moderator: NicholasJ. Jouriles, MD, Metrohealth Medical Center (4:30 - 5:30 pm) 309. EconomicImpact of ResidentEducationon an Academic ED, Andrew SucovMD, IJnittersityof Rochester 310. TeachingEmergencyMedicine (EM) ResidentDlctation: ReimbursemenrImpact, MargaritaE. penaMD, St, Johns Hospital 311. First Year EM Residents,CareerSatisfaction,perceived Levelsof professionalCompetence,and perceivedprob_ Iems;Resuhsfrom the ABEM LongitudinalStudyof Resi_ dents in EmergencyMedicine, Hizen p. Ham piD, Amer_ ican BoardoJEmergencyMedicine 312. First YearResidents'Motivations,Goalsand Expectations as Described in the ABEM Longitudinal Study of Residentsin EmergencyMedicine,-Mary Ann Reinhart PhD,AmencanBoardof EmergencyMedicine 313. Validity of Clinical SkillsAssessment of EmergencyMedi_ cine ResidenrsUtilizing Standardizedpatieits, tNilliam RennieMD, LongIslandlewish MedicalCenter 314. InterraterReliabilityof Faculty Observationof Residents, Clinicai Skills: Comparisonoi a Tiaditional RatingScale with a Performance-BasedChecklist, JosephLivlantia MD, North ShoreIJniyersityHospital 315. Redefiningthe proceduralSkills of an EmergencyMedi_ cine SpecialistBasedon Frequency of perfo-nnanceand Maintenanceof Competence,K. Farion, Universityof Toronto


Wednesday,May 2l

ScmNTrFrcPnpsns/PosTERS Scientific Papers: pediatrics (8:00- 9:30am) Mod.erator: SusanFuchs,MD, Childrens Memorial Hospital, Chicago 254. NebulizedRacemicEpinephrineVersusAlbuterol in the Tiearmenrof Bronchiolitis,Joltn R. BichJordMD, Baylor Collegeof Medicine 255. Useof NebulizedEpinephrine(l:1000) andAlbuterolon Infants and Children with Acute Wheezing, Thomqs Abramo,MD, Uniyersityof TexasSouthwestern 256. Effectiveness of lpratropium Added to pediatricAsthma Tieatment,JosephJ. Zorc MD, JohnsHophins[Jniversity 257. Predicting UTI in Febrile young Children in the ED, KatW N. ShawMD, Cltildren\ Hospitalof philadelphia 258. Applicability of an EstablishedOutpatlenr Managemenr ProtocolFor Febrile 0-l Month O1d Infants,M. bouslas BaherMD, ChildrensHospitalof philadelphia 259. ProspectiveEvaluationof the Centor Criteriain Children With SoreThroat, \MilliamB. Tisol,MichiganStateIJniversity

Scientific Papers : Ischemia,/Reperfusion (8:00- 9:30 am) Moderator: Robert W. Neumar, MD, phD, Wayne State University 260. Evidenceof PeroxynitriteFormationAfter MyocardialIs_ chemiaReperfusionin the Rabbit, Xn-Iiangi,4aMDphD. ThomasJefJerson IJniver sity 261. Peroxynitrite,the Product of Nitric Oxide and Superox_ ide, CausesMyocardialInjury in the IsolatedRat Heart, BernardL. LopezMD, Thomas JeffersonI)niversity 262. Residual Celiular Oxygen During IschemraAugments ReperfusionInjury, Terry L. VandenHoeh MD, IJruversity oJChicago 263. Ischemic Preconditioning Improves Functional, Meta_ bolic, and MorphologicalRecoveryfrom IschemicAcure RenaiFailurein the Rat, CharlesB. CairnsMD. rJniversitv of Colorado 264. Lack of Delivery Dependent Cerebral IschemiaDurinq the 'No-reflow' Period Following CardiacArrest and ReI suscitation,RobertSilbergleit MD, GeorgeWashington tJni_ versity 265. CardiacArresVResuscitarion: Neurologic Effectsof Hy_ poxic Resuscitation,YolandaC. HaywoodMD, Geoige WashingtonUniversity

Scientific Papers: Education (8:00- 9:30am) Moderator: Dane M. Chapman, MD, phD, Washington University 266. Is ThereEvidencefor Evidence-Based Mediclne? JelfreyJ BazananMD, Universityof Roclrcster 267. Procedural Competency in Emergency Medicine: The CurrenrRangeof ResidentExperience,Stephen R. Hayden MD, Universityof CaliforniaSan Diego

268. Changing Status of Academic Emergency Medicine, I99L-I996, E. John GallagherMD, Albert EinsteinCollege of Medicine 269. EM ResidentResearchRequirementsand Director Char_ acteristics,MichelleBlandaMD, SummaHealthSystem 270. Does Clinical Preceprorshlpof Medical StudentsChange ED Efflciency?LisaChanMD, Albany MedicalCenter 27I. DomesticVioienceEducationin Medical School,DoesIt Make a Difference? Carolyn E. Haase MD, Washington University

Scientific Papers: Clinical Decision Rules/ Guidelines (10^:00am - 12:00 noon) Mod.erator:E.John Gallagher,MD, Montefiore Medical Center 272. ProspectiveRandomizedControlled Trial of Computerized Protocolsfor DiagnostlcTest Ordering: Effecr on Throughout Time, Cosr, and Satisfaction,{usan Mathias RN BSN CEN,Universigof pittsburgh 273. TelephoneTirageProrocols:StandardizedDecisionMak_ ing or a FalseSenseof Security?David WqchterMD, Ilni_ versityof New Mexico 274. Yariation in ED Use of Cervical Spine Radiography For Alert Stable Tiauma patients, Ian G. StiellMD. Ilniiersitv oJOttawa 275. Multlcenter Implementation of the Ottawa Knee Rule, Ian G. StieIIMD, Universityof Ottawa 276. Cost-BenefltAnalysisof Implemenrationof OrrawaKnee RuIe, Graham NicholMD, rJniversityof Ottawa 277. ChestPain in the ED: Utilization of a pracriceGuideline to Identify Low Risk PatientsWho Are Candidatesfor OutpatientEvaluation,Wyatt W.DecherMD, Mayo Clinic 278. PredictingNonurinary Bacteremiain patienrsWith Evi_ dence of Urinary Tiact Infections, Elizqbethlsrael MD. WashingtonUniversity 279. Application of the Artificial Neural Network to the Febrile Infant, William G. Baxt MD, rJniversityoJpennsylvania

Scientific Papers: EMS/Out-of-hospital (10:00am - 12:00noon) Moderator: Robert O'Connor,MD, Medical Center of Delaware 280. PrehospitalAdult and PediatricTiauma Care:Is There a Difference?Tim R. PaulMD, DenverHealthMedicalCenter 281. MulticenterProspectiveValidationof prehospitalClinical Spinal ClearanceCrireria, RobertM. DomeierMD. St. losephMercy Hospital 282. Modifiable FactorsAssociatedWith Improved Cardlac Arrest Survival in a Muiticenrer BLS-D EMS Svstem. ValerieJ. DeMaroBSc,IJniversityof Ottawa 283. Survival of Hispanic Vicrims of Out-of-HospitalCardiac Arrest: Further Support for a RacialMortality Gradient? Gary Lombardi,MD, JacobiMedicalCenter


COUNCIL OF EMERGENCYMEDICINE RESIDENCYDIRECTORS

[6Ril

Tuesday,MaY 20, 1997 l:00 - 6:00 pm

AGENDA Call to Order and BusinessMeeting

;'il;ilil;;iN.-'il;;,

MD ;;;, a;,,vChishotm,

2. PresidentsAddress,CareyChisholm,MD

; d#il/#;;;;;i

2:00-3:00

R;p;;,SamKeim,MD

MD 4. ABEM d.port, GeraldP Whelan,MD, and BroohsF BocTt'' 5. RRC-EMRePort,Connie Greene,MD 6. ERASRepori,PamDYne,MD 7. Elections (2-Yearterm) a. President-elect (2-yearterm) Secretary/Treasurer b. (3-yearterm) member-at-large Board c. Awards o[ B. Presentation MD, PharmD, Geisinger a. ResidentAcademicAchievementAward:JamesB'.Janu,, MedicalCenter b. FacultyTeachingAward: PeterDeblieux,MD' Address:MarcusMartin, MD 9. lncoming President's "Workforce Issues and GME Funding" PhD,SeniorVicePreident, Divisionof Medical MichaelWhitcomb,

3:00-3:15

Break

3:15,4:15

ilCounseling Skills for Program Directors" Program patriciaBroJts,ACSWCCSWCEAP,Dtrector,EmployeeAssisLance Inc' Ho spital of Indiana, M ethodLst MedicalCenter Medicine,St.Paul-Ramsey Robertlkopp,MD, ProgtiamDirector,Emergency MercyMedical L. Margulies,MD, Chairman,DEartment of EmergencyMedicine' 'Jrt'frry -' Committee Being ienter, Pait Chait ACEP \NIII

4:15-4.30

Break

: t:'.1

4:30-6:00

Hennepin CountY Medical

oJ Medical Cottege Director,EmergencY Current Medicine,HennepinCountyMedrcalCenrLer, Emergency


Tuesday,Muy 20

FUxuAMENTALS oF RESEARCH Getting Startedin Research(f :30 - 2:30 pm) Michelle Biros,MS, MD, HennepinCounty Medical Center The educationalobjectiveof this sessionis to define a researchquestion,translatethe questioninto a project,and take the first stepsto start a researchproject or a researchcareer.We are all motivatedto do researchfor differentreasons,and our sourcesof inspiratron for a researchquestion var;z However, researchersall possessa basic desire to learn and to know

How to Do a Chart Review (2:30 - 3:30 pm) S(evenR. Lowenstein, MD, MPH, IJniversityo.fColorado The educational objectiveof this sessionis Lolocuson the research useol medicalrecordand lraumaregistr;dara. Chartreviews are often used to conduct researchin emergencymedicine. However,the reliability of data abstractedby chart reviewis seldom examinedcritically Pitfallsand problems,such as missingchails, misslngor conflicting data, pooriy trained abstractors,bllnd, ing, bias, and inter-rateragreementwill be discussed."Numerator nonsense,"a flaw found in many researchstudiesbasedon trauma registrieswill also be discussed. Publishedarticlesfrom the emergencymedicine literature will be used to iilustrate methodologicalerrors. This sessionwill presenteight critical strategiesthat can improve the validity and reproducibilityof medical recordreviews.

ResearchDesign(3:30 - 4:30 pm) EdwardA. Panaceh,MD, IJniversityoj California, Dayis The educationalobjectiveof this sessionis to presenta standardizedsystemfor understandingthe spectrumof researchdesigns. It will also go over each design type commonly used in emergencymedicineand explain its advantages, Iimiradisadvantages, tions and ideal applicationto researchquestions.The focuswlll be on clinical research,althoughdesigntypesapplicableto basic researchwill be listed. This sessionis designedto be very practicaland will illustrateexamplesusing actualemergencymedicine studies.Transforminga specificresearchquestion into a researchprotocol requiresa knowledgeof the basic types of research designand waysof categorLzing rhem.

Pitfalls with the Evaluation of the Medical Literature (4:30 - 5:30 pm) CarolynFrey, PhD,Senior Biostatistician,WeisCenterfor Research The educationalobjectiveof this sessionis to discussspecificcharacteristics of published studiesthat may reducethe reliability of the conclusions,and how theseproblemsmay be detected. The principlesinvolved with the critical evaluarionof the literature will alsobe discussedwith the use of actualexamplesfrom referredjournals.Oneof the most important stepsin any research project involves a critical evaluationof the medical literaturewith the goal of identifying weaknessesand omissronsin work alreadyperformed.

The Series continues on}4ay 22. The set of gdour videotapes of the Fundamentals of ResearchSeries can be ordered at the SAEM Registration Desk.


Tuesday,May 20 Lunch Session:Ethical Challengesand Controversiesin the Emergencf Pediatric Patient(I2:00-l :30 pm) Moderator:ZachKasutto,MD, 5t. Chnstopher\Hospttal t'or Children JamesAdams,MD, Brighamâ&#x201A;Źv Women\Hospital MedicalCenter Mihe Gerardi,MD, St. Barnaba.s Hospitalof Philadelphia MD, Children's StevenSelbst, The educationalobjectiveof the sessionis to identify and clarify ethical issuesthat are unique to the pediatric patient in the emergency setting. By the end of the session pafiicipants should be able to recognizethe roiesof autonomy.beneficence, confidentiaiity, and consent in pediatrics; describe the ethical justification for allowing parental decision making, and the limits of this power; describethe ethicaljustificationfor a11owing pediatric patient decision making and its limits; and describe situations where a minor may have the right to exclude his or her parentsfrom the decisionmaklng process.A senesof ethically and legally challengingcasesinvolving pediatric patients ln the emergencysetting will be presented.Lunch sessions have limited enrollment and are $30 per ticket.

Lunch Session:Domestic Violence Research: Expanding the Horizon (12:00-1:30pm) Moderator:Deirdre Anglin,MD, LosAngelesCountyand Universityof SouthernCalit'ornia Schoolof Nursing PhD,RN, FAAN,JohnsHopLans Campbell, Jacquelyn PtttsburgLt MD, of H. University Coben, Jeurey BethKaplan,MD, Universityof Calit'ornia,San FrancLsco Judy Linden,MD, BostonMedicalCenter The educationalobjectivesof thrs sessionare to expioredirections domestic violence researchby emergencyphysiciansmay take beyond descriptivestudies,make emergencyphysiciansawareof the variety of methodologies,techniques,and settingsthat apply to domesticviolence research;and make emergencyphysicians involved in domestic violence researchaware of funding resources.Previousresearchon domesticviolencein the Emergency Medicine literature has focusedon descriptivestudies.This session will explore directlonsdomesticviolenceresearchmay take beyond descriptive studies, and the methodologiesand techniques useful in expanding the range of this research.New approacheswill be highlighted: outcome and intervention studies,multicenteredstudies,and perpetratorstudi"es.Domesticviolence researchopportunities both in the emergencydepartment and in other arenas,as well as collaborationwith multidiscipiinary teamswill be discussed.Funding resourcesfor domesticviolence researchwill also be addressed.Dr. Campbell,a nationally recognizedleaderin the field of domesticviolenceresearch,will speaker. In addition, three emergencyphysicians be the key'rLote involved in domesticviolenceresearchwill discusstheir projects. Dr. Coben has a CDC funded study evaluatingbatterers'programs.Dr. Kaplanis desigmngan outcomestudy of an emergency department-baseddomestlc violence intervention program. Dr. Linden is studyng a model intervention for victims of domestic violence utilizing the readi.nessto change concept. Limited enrollment. $30 fee. Pre-registration required.

ABEM Lunch with Residents(12:00 - I:30 pm) ABEM wili offer an opportunity, over lunch, to obtain the Board'sperspectiveon current eventswhich havean impact-on EmergencyMedicine residents.The luncheon will also provide an opportunity for residentsto ask questionsand to discuss issuesof importancewith directorsof the Boardand ABEM staff members.Pre-registration is requested to assure an adequate number of lunches are ordered, but not required to attend the presentation and discussion portion of the session. There is no charge to attend this session.

BayesianClinical DecisionMaking (1:30-2:30 pm) MD, MS,MBA,HarvardUniversity DonaldRucher, MD, PhD,BethIsraelHospital Rutledge, Geot't'rey The educational objectives for this session are to review the basicsof the clinical application of Bayesiandecisiontheory, including the use of 2 x2 bedsideclinical teachingtables;show how test liklihood ratios allow a clinician to perform probability calculationswithout pen or paper; and demonstratethese methods with examplesfrom the practice of emergencymedicine. Bayesiandecision making allows clinicians to interpret test results (al1of which have some uncertainty) using knowledgeof the underl;nngprobabllitiesof diseaseto cometo more accurateand often unexpectedconclusions. Understanding the principles of Bayesian probability offers the emergency physician a tool to explain and teach many of the tough diagnosticissuesseenin emergencymedicine.

Traumatic Brain Injury Research- Preclinical Promise,Clinical Flops (2:30-4:00pm) Moderator:Brian Zinh, MD, Universityof Michigan Micl'telleBiros,MD, HennepinCountyMedicalCenter AnthonyMarmarou,PhD, MedicalCollegeof Virglnia PhD, MedicalCollegeof Virginia John Povlis'hoch, The educationalob.lectivesof this sessionare to provide participants with an increasedknowledge of traumatic brain injury researchboth at the laboratory and cllnical level, a betterunderstandingof the difficulties and prtfalis encounteredin clinicaltrials of traumatic brain lnjury; a knowledge of strategiesto improve the clinical applicability of laboratory researchin traumatic brain injury; and ways of improving the designof clinical studies.A number of agentsand therapieshave been identified in the laboratorysettingwhich havelooked extremelypromising as potential treatmentsfor traumatic brain injury Subsequent clinical trials have found theseagentsto be ofno benefit,or perhaps even to be harmful. Exampleslnclude calcium channelantagonists,and free radicai scavengersand antioxidants. ln this session,the speakerswili eachaddressone of the following reasonswhy promising preclinical therapiesmay not be effectivein clinical managementof traumatic brain injury: I) limitations of animal models of traumatic brain injury 2) selectionof pharmaceutical agentsfor clinical traumatic brain injury trials, 3) climcal trails study design;a) patient selectionand inclusion criterta, b) timing and dosagestrategies,and c) outcome measures.

State of the Art: Fever in Children-New Research Since the PracticeParameters(4:00 - 5:30 pm) Moderator:Larry Barat't',MD, UCIA Jet'freyAttner,MD, Albert EinsteinCollegeof Medtcine,NewYork Kathy Shaw,MD, Children'sHospitalof Philadelphia The educationalobjectiveof thls sessionis to addressthe issue of lever researchin children. The practlce guidelines for the managementof fever in infacts and children 0-36 months of age without a sourcewere published in Annalsin July 1993. Sincethen, severalissueshave developed.More recentstudies (Baker et al) have shown that it is safeto follow another course (no treatment). The incidence of H. Influenzea has dropped while resistant S. pneumoniae have developed, ls ceftriaxone (and the practice guidelines) to blame?Recentstudiesby Shaw et alhave shown that the prevalenceof UTIs is hlgher than bacteremia,yet which rapid diagnosticmethod (dipstick for leukocyte esterase,nitrates, mi.croscopicurinalysis vs enhancedU/A) is the best. The discussantswill address these lssues based upon their and others'research.


Tuesday,May 20

Dnncrrc Snssrol,rs Evidence BasedMedicine: An Approach to Keeping Up With Current Medical Knowledge (8:00-9:00am) Moderator:StephenR. Hayden,MD,IJniyersttyof Cahfornia,San Dieso Whit is evidencebasedmedicine?Why is thereso much inrerest in it lately?Is evidencebasedmedicinepractical?How can ittre appliedin emergencymedicine?The educationalobjective of this sessionwill be to define the new evidencebasedmedicine paradigm and show how this approach differs from traditional chnical decisionmaking. At the end of this didacticsession the participantwlll be able to describethe skills required to practiceevidencebasedmedicine include the anatomy of a good clinical question, efficient ltterature search strategies, techniquesof these results to answer clinical questions.Evidencebasedmethods of evaluatinsthe medical literaturewill b e c o n t r a s t ew d i t h o t h e ra p p r o a c h eosI k e e p i n gu p w i r h c u r rent medical knowledgesuch as CME conferences,rewardlng programsfor textbooksand journals, gertinginvolved in teaching situations,and electronicmedia. practicalmethods of incorporatingevidencebasedmedicineinto emergencymedicine residencieJwillbe developedand resourcesu,riilubl. ro learn more about evidencebasedmedicinewill be presented.

How to Write a Good Grant Application: What Does it Take to Get Funded? (8:00-12:00noon) LianeReiJ-Lehrer, PhD, President,Tech-WriteConsultants/ Erimon Associates The educationalobjectiveof this sessionis ro teach the skills requiredto write a fundablegrant proposal.Grant writing is a long and arduous process.But with some luck and skill-,the processcan be productive,leadingto a funded project. In this session,the instructor will provide an insider'svlew of the review process,emphasizingthe importance of providing the information that the reviewers need and want to k;ow. Practicalguidelinesfor the planning, ourlining, draftrng,revising, and finishing stagesof proposal preparation,including generalstrategiesfor good expositorywriting will be provided. The processof tracking rhe application, submitting revised applications,and surviving reviewers'commentsto use [hem constructivelywill also be addressed.Although rhis sessron usesthe NIH grant processas a model, the skiils are applicable to all types of grant proposals. Dr. Reif-Lehreris the aurhor of the Grant Application Writers Handbook, and the narrator of the two video cassettesenes Getting Funded: It TakesMore Than Just a Good ldea. She is an instructor,scientist,experiencedgrant writer, consultantto researchers, member of NIH study sections.and the author of overfifty publications,many on the ropic of granrsmanship.Dr. Relf-Lehrerreceivedher PhD in chemistryfrom the University of Californiaat Berkeley,and was an NIH post,doctoralfellow at Harvard Medical School. She was formerly Associate Professorat HarvardMedicalSchooland SeniorScientistat the SchepensEye ResearchInstitute. She is currently presidentof Tech-WriteConsultants/ErimonAssociates,a consulting firm for grant writing and related subjects.Limited enrollment. $ 75 registration fee. Pre-registrationrequired.

AcademicMentoring in Aclion (10:00-I2:00noon)William Barsan,MD, Universityof Michigan Rita Cydulka,MD, MetroHealthMedicalCenter MarcusMqrtin, MD, Universityof Virgtnia RobertMcNamara,MD, AlleghenyIJniversityof theHealth Sciences Arthur Sanders, MD, Universityof Arizona Tintinalll, MD, Universityof North Carolina Judith The educationalobjectiveof this sessionis to move from rhe theoreticalaspectsof mentoring to addressingneeds of individuals in a group consultarivesetring.By the end of the session, participantswill be able to define credenrialsneededfor advancementin most academicsettings,preparea statementof five year academicgoals;list their objectivesfor the upcoming academic year, and organize a CV to highlight academic achievements.Participantswill be askedto come to the session with a preparedstatementof one and five yeargoalsand a copy of their curriculum vitae. Smallgroupsled by senioracademicranswill dlscussand offer suggestionsfor eachpartlcipant. A plenary sessionbefore and after the small groups will identify credentialsmost commonly necessaryfor advancementand innovatlveways to pursuethesecredentials.A diversepanei of discussantswill also addressissuespertlnent to minority and women physicianswho are under representedin the academic world, aswell as the rmportanceof mentoring.Limited enrollment. Pre-registrationrequired.

Future of Non-blood Hemoglobin Solutions (10:30- 12:00noon) Moderator:ThomdsM. Scalea,MD,I|niversity of Maryland RobertCaspari,MD, Somatogen, Inc. StevenGould,MD, NorthfieldLaboratories, lnc. ChuchCairns,MD, UniversityoJColorado Ed Sloan,MD,IJniversityof Illinois The educationalobjectivesof this sessionare to addressthe issue of what is the state-of-the-arrof non-blood hemoglobinsolutions; what are the differencesbetween the various solutions; is there data suggestingthat theseproducts will be useful in the clinical setting and what will be their indications for use; how closeare we to perfectinga safeproduct; and what other options do people seein the future for resuscitationand blood substitutes.

Medical

Use of the Internet:

Getting

the Most

for Your Time on the Web (8:00-9:00am) JohnD. Halamha,MD, BethIsraelHospital CeoJJrey Rutledge, MD. PhD.Berhtsrail Hospital T h e e d u e a t i o n ao lb j e c r i voel t h i ss e s s i o ins l o h i g h l i g h r h eb e s t medical resourceson the Internet and to presentan overview of new Internet technologies,focusingon rheir applicationin medical resources.The wealth of medical resourceson the World Wide Web is now so extensive, yet dlsorganized and unmonitored,that undirectedweb browsingis no longer prac, tical. As of August 1996, an Alta Vista searchon the word Medicineyieldedover 50,000 web pages.A practicalapproach to medical resourceson the web in 1996 is to understandthe typesof resourcesavailableand to use this knowledqeto focus the searchfor information.


Tuesday,May 20 22L AutomatedAiarms for Urban 9-l-l EMS Response:Evaluating the Feasibilityof SendingFirst RespondersWithout Ambulances,Craig B. Key MD, Unwersityof Texas MedicqlSchoolat Houston )))

T lcc nf en ". ^ - - Fmeroen6y "'--..b'-

Medical Dispatch

System to Reduce

the Number of InappropriateSceneResponses Made By Advanced Llfe Support Personnel,E. David BaileyMD, MedicalCenterof Delaware - )r ? E - - . ^ - - ^ - . r \ 4 ^ . l i c a l S e r v i c e T r a n s n o r t a t i o nI n d e x (EMSTI):A MathematicalIndex for Improving the Effectivenessof EMS Dispatch Response,RaywinR. Huang PhD, WayneStateUniyersity 224. Emergency Physician Staffed On-Site Facility at Air Shows Reducesthe Number of PatientsTiansoortedto Hospitals,DianeDaddarioMD, Brown[Jniversity 225. UnnecessaryPrehospitalUse of Full Spinal Immobilization, TerranceP McHugh MD, RtchlandMemorial Hospital

Scientific Papers: Cardiovascular (4:00- 6:00pm) Moderator: W. Brian Gibler, MD, University of Cincinnati 238. CardiacAcute lschemic Rule Out (CAIRO) Tiial - A ProspectiveMulticenterStudy of a 3-12 Hour Diagnostic Protocol for Chest Pain Patientsat Low Risk for MI, AntoinetteMangloneMD, AlbertEinsteinMedicalCenter 239. Chest Pain PatientsWith Known Coronary DiseaseCan Be Evaluated Safelyin a Chest Pain Center, ChetanShah MD, SparrowHospttal 240. Prevalenceand DiagnosticImpact of PsychiatricDisorders in Chest Pain Center Patients, Marh J. Lowell MD, Universig of Michigan 24L Evaluation of a New Assayfor GlycogenPhoshorylaseBB Versus CK-MB for Predicting Ischemic Complications in ED ChestPain Patients,GerqrdX. Broganlr MD, Uniyerr sityMedicalCente 242. Effect of Cocaine on Specificity of Cardiac Markers,Judd E. HollanderMD, UniyersityMedicalCenter

EMS/Out-of-hospital Moderator: Paul E. Pepe,MD, MPH, Allegheny lJniversity (3:00 - 4:00 pm) 226. Pre-hospitalCervical Spine Clearance:Agreement Between EMTs and Emergency Physicians, StephenW MeldonMD, MetroHealthMedicalCenter 227. Can PrehospitalProvidersClinicallyClearthe C-Spine? DonnqM. Fehrenbach DO, AlbanyMedicalCenter 228. On-Hill Reduction of Anterlor Shoulder Dislocations Pnor to Radiographyin an Alpine Skier Populationis a High Yield/Low-Risk Procedure, Iain MacPhail MD, ParamedicAcademy,JusticeInstituteof BC 229. Paramedics,PediatricTiauma Casesand Proceduresin Oregon,Ivkchelle McCall BS,OregonHealthSciences University 230. Out-of-Hospital VascularAccess: Unnecessary Procedures and ExcessiveCosr-,Marianne GauscheMD, Harbor UCIA 231. AssessingMass CasualtyTiiage Capabilitiesof Various Military Medical Personnel,John T.Janouseh MD, DarnaII Army CommunityHospital 232, WITHDMWN 233. Use of NHTSA Uniform Pre-hosoitalData Elementsin StatewideEMS Databases,JefJrey S. DesmondMD,IJniversity of Michigan 234. Developmentof the CardiacArrest MethodologyFor the fJntarin Prehncnilzl Advanced Life Support (OPALS) Study,ian G. StiellMD, Untyersityof Ottawa

243. Independent Predictive Value of Non-Standard ECG Leadi on the Decision to Administer Thrombolytic Therapy to Patientswith SuspectedAcute MyocardialInfarctions,JamesM. PribbleBS,WayneStateUniyersity 244. Is There a High Prevalenceof Occult Valr,ularPathology in IVDAb?Gary TamhinMD, HighlandGeneralHospital 245. Hypertonic Saline Tieatment of SevereHyperkalemiain Non-NephrectomizedDogs, lustin Kaplan MD, Albert EinsteinM edical Center

Scientific Pap-ers: PainManagement (4:00- 6:00pm) Moderator: Paul M. Paris, MD, University of Pittsburgh 246. Controlled Trial of Fentanyl Analgesia in ED Patients With Abdominal Pain: Can Tieatment Obscure the Diagnosis?AngeloGrtlloMD, MedicalCenterof Delaware 247. Omission of Analgesiain ED Patientswith Suspected Appendicitis, StephenH. Thomas MD, Massachusetts GeneralHospital 248. Ethnicity and ED Analgesia,Knox H. ToddMD MPH, EmoryUnwersity 249. Intramuscular Ketorolac Versus Oral Ibuprofen ln ED Patients With Acute Pain, Martha L. NeighborMD, San Fr ancisco General H ospital 250. LocaIAnesthesiaFor Lacerations:Pain of Infiltrationasa Function of Injection Site, SteyenSoharisMD, Albany MedicalCenter

235. Reliability of Citizen Estimatesof ResponseTimes in Casesof CardiacArrest, Eric D. IsaacsMD, Universityof CalforniaSanFrancisco

251. Randomized Controlled Trial of the Effectivenessof Counter-Irritation on Venipuncture-AssociatedPain, AdamsonMD, UniyersityoJPittsburgh Sharlene

236. Factorslnfluencing HospitalTiansportof Patientsin Cardlac Arrest, John L. Hich MD, HennepinCounty Medical Center

252. Effectivenessof 50oloNitrous Oxide/5)o/oOxygen During LacerationRepair in Young Pediatric Patients,JohnH. BurtonMD, MaineMedicalCenter

237. Performanceof Six Automatic External Defibrillarors Using an EstablishedRhythm Library, ColleenMcDevitt BA, OregonHealt'hSciences Untuersity

253. Cornparisonof lV KetorolacWith IV Prochlorperazineas the lnitial Tieatmentof Migraine Headachesin the ED, MichaelB. SeimMD, EastCarolinaUniversity

t l I


Tuesday,M:ay20 186. Tiace Amounts of Albumin Protect Against Ischemia/ PenerfircinnTnirrryifl IsolatedRat Hearts,JohnA. Watts PhD, CarolinasMedicalCenter

204. Acute Ankle Injury With Low Risk of Fracture: Patient PreferenceFor ImmediateX-RayVs Follow-up, Marh A. MedicalCenter DavisMD MS,BethIsraelDeqconess

187. Myocardial BioenergeticChangesWith Reperfusionof Ventricular Fibriliation, Marh G. AngelosMD, Ohio State University

),O5 Emersencv Phvsicians'Attitudes Towards and Use of Clinical Decision RulesFor Radiography,Ian G. StiellMD, Unitersity of Ottawa

Pain Management Moderator: Donald M. Yealy,MD, Uniyersity of Pittsburgh (l:30 - 2:30pm) 1BB. Patient SatisfactionWith Pain Management:What is Important? Daniel Pice, Universityof Pennsylvanta 189. Impact of lmplementationof a Pain Scaleon Pain Managementin the ED, DantelPnce ,Untuersigof Pennsyhtania 190. Comparisonof Patient and Practitioner'sAssessmentof Pain From Commonly PerformedED Procedures,Adam J. SingerMD, UniversityMedicalCenter l9l.

Consciousand DeepSedationPracticesin AcademicEDs, JohnS. RoseMD, Universityof CaliJorniaDavts

192. Opioid AnalgesicUse and Serious Outcome in Acute Abdomlnal Pain,Jacques S. LeeMD, Unwersityof Ottawa 193. TooicalAnestheticFor IV Placementin the PediatricED: TriageIdentificationand the ChancesFor Success, Jcmes Callahan,MD, Children\Hospitalof Philadelphia 194. Influence of Order on Pain of Infiltration of Buffered Lidocaine,JoelM. Bartt'ieldMD, AlbanyMedtcalCenter 195. Pain of Local Anaesthetics:Rate of Administration and Buffering,Melindalasani MD, St.Chistopher'sHospitalfor Children 196. Peri-CrainalInjection of LocalAnestheticsis an Effective Abortive Tieatmentof Headaches,B. TomasBrofeldtMD, Unitersity of CaliforniaDafis 197. EmergencyManagementof Migraine: Is the Headache Really Over? JamesDucharme,Atlanttc Health Sciences Corporation I98. Nonlinear Changesin the Visual Analog ScaleWith Tieatment of Pain,NchardL.SummersMD,University of Mississippi 199. Analgesic Efficacy of Intranasal Butorphanol Versus Intravenous Morphine in Acute Ureteral Colic, W Larry Haith DO, BrownUntuersity

Clinical Decision Rules/Guidelines Moderator: Dayid Seaberg,MD, Unittersity of Florida ( 3 : 0 0- , 1 : 0 0p m ) 200. Impact of Framing Biason PatlentPreferenceFor X-Ray After Acute Knee ln;ury, Arshiya A. Batg, Beth Israel D eacone ss Medical Center 201. Varlation in ED Use of Computed Tomography for PatientsWith Minor Head Injury, KathenneVandemheen BScN,UniversityoJOttawa 202. Validation of the Ottawa Knee Rules in an American Urban TeachingED, DeborahB. DierchsMD, tJniversityof Cincinnati 203. Application of the Ottawa Ankle Rules by Advance PracticeNurses in an ED Fast Track System,JosephA. SalomoneIII MD, TrumanMedicalCenter

206. Willingnessof the GeneralPopulation to Accept a Less Than PerfectOutcome,ChqrlesK. BrownMD, EastCarolinaUntuersig 207. UnexplainedS1'ncope: When is HospitalizationNecessary? 'W. Dorotlry BrownMD, Naval MedicalCenterSanDiego 208. Cranlal CT Scansin PatientsPresenting24 Hours or Greater after Blunt Head Tiauma, Pierre BorczuhMD, MassachusettsGeneraI H ospital 209. Outcome Measuresin Clinical Wound Studies: Reliability of CosmesisScalesWith a Determination of a Mlnimal Clinically lmportant Difference,James V. QuinnMD, Universityof Michigan 210. PresentingEmergencyCytokineScoreMeasuredat Tiiage in the ED and Admission Rate,Alan P TuttleMD, Henry Ford Hospital 211. Evaluationof Blunt AbdominalTiauma:A DecisionAnalysis,CharlesK. BrownMD, EastCarolinaUniversity 2I2. Thrombolytic Therapy in Young Women with Acute Myocardial Infarction, SangeetaGarg MD, Mornstown MemorialHospital

EMS/Out-of-hospital Moderator: Yincent P Verdile, MD, Albany Medical College (I:30 - 2:30pm) 213. Outcome of PatientsWho RefuseOut-of-hospitalMedical Assistance, JonathanL. BursteinMD, UniversityMedical Center 2I4. Do PatientsRefusingTiansport RememberDescriptions of Risks SeveralDays After Initial ALS Assessment?Terri A. SchmidtMD, OregonHealthSciences University 215. EMS Initiated Refusaland AlternatlveMethods of Tiansport: A National Survey,DavidJaslowMD, GeorgeWashingtonUnwersig 2I6. PrehospitalTieatmentof Hypoglycemia:Refusalof Tiansport and PatientOutcome,StetenJ. Socranslry MD, Medical CoIIege of Wisconsin l a t i e n t sS i g n e d O u t 2 I 7 . O u t c o m e S t u d y o f P r e h o s p i t aP Against Medical Advice (AMA) By Fleld Paramedics, Gary M. VilheMD, Unwersityof Calit'ornia SanDiego 2I8. Time SeriesForecastsof Ambulance Run Volume, Dcn TandbergMD,Universityof NewMexico 219. Time SavedWith the Use of EmergencyWarning Lights and SirensWhile Respondingto RequestsFor Emergency Medical Aid, JefferyD. Ho MD, HennepinCountyMedical Center 220. Safetyof Flrst ResponderOnly Utilization For Motor Vehicle IncidentsWhen the 9-l-l Caller is Unable to Answer Standard Medical Priority Dispatch Questions, Craig B. Key MD, University of TexasMedical Schoolat Houston


Tuesday,May 20 Imaging/Diagnostics Moderator: Allan Wolfson, MD, IJniversity of Pittsburgh (3:00 - 4:00 pm) 154. Roleof EmergencyRoomUltrasoundVs. lntravenousPyelogram in the Evaluation of SuspectedRenal Colic, RichardJ. Hffier MD, I|niverstg of SouthernCaltfornia 155. Correlationof Ultrasonic Determinationof Urinary VolumesWith Actual VolumesObtainedBy Catheterization, Kent O'BnenMD, Ahron GeneralMedicalCenter 156. TransvaginalUltrasound By EmergencyPhysiciansDecreasesPatient Time in the ED, StephenBurgherMD MedicalCenter LCDRUSN MC, PortsmouthNaval I57. Doesthe lnstitution of an ED Tiaining Programin EmergencyUltrasoundChangethe Number of SonogramsOrdered From Radiology?MichaelB. Heller MD, St. Luhe's Hospital

170. DiagnosticUtiilty of Serum Markers in Acute Coronary Ischemla,Bian O'Neil MD, WayneStateUni:versity 171. Impact of BedsideWhole Blood Rapid Assayof Cardiac Tioponin-T Testing on Clinical Decision- Making, M. BaxterMD, Universi$oJCincinnati Stephen 172. Conparison o[ a New Dual Assay for Myoglobin and Carbonic AnhydraseIII VersusCK-MB for the Early Diagnosis of Acute Myocardial Infarcti.on,GerardX. Broganlr MD, UniversityMedicalCenter to Detect 173. Comparisonof the l2-Lead Electrocardiogram Acute Ml or UnstabieAngina in PatientsWith and Without Ongoing Chest Pain, StevenA. PaceMD, Madigan Army MedicalCenter L74. ED Diagnosisof Acute PosteriorWall MyocardialInfarction Usi.ngLeft PosteriorChest Lead, Marc PollachMD, YorhHospital

158. Use of the SonographicMurphys Sign DetectedBy Bedside EmergencyUltrasoundin PredicLingCholecystiLis, GeneralHospital Carlo L. RosenMD, Mqssachusetts

175. QT Dispersion- A UsefulAdjunct For Detectionof Myocardial Infarction in the Chest Pain Center, ChetqnShah MD. SparrowHospital

I59. Use of EmergencyUltrasonographyFor Measuringthe Sizeof the Abdominal Aorta, DavrdFM BrownMD, Mass' achusettsGeneral Hospital

176. ED Screeningof ChestPainPatientsUsing ElectronBeam Comuted TomographyScanning,DennisA. LaudonMD, Mayo Clinic

of IndeterminateUltrasounds:Does it 160. Subclassification Identify High Risk Patients?RobertG. Dart MD, Boston MedicalCenter

A. Hogan I77 . ED StressTestingin Acute Chest Pain, Teresita MedicalCenter MD, Resurrection

161. PanoramicViews of the Mandible in ConjunctionWith a Towne View in the Evaluation of Mandibular Injury, JamesLarsonMD, Universityof Calit'orniaSan Diego 162. New Methods in Digital RadiographyImprove Ability to Clear the Cross-TableLateral Cervical Spine in Tiauma University Patients,TimothyJanchar,Georgetown 163. EmergentMagneticResonancelmaging DisciosesOccult Injuries Accompanying Distal Radial Fracturcs,Jeremy BrownMB MS, BostonMedicalCenter 164. Effectof a Tiaining Programin ED Fluoroscopyfor Detection of Glassin Soft Tissue,MatthewR. Levine,NorthwesternUniversity 165. Effect of PerfusionScanningwith Tc-99m Sestamibion Diagnostic Probability Estimatesfor Unstable Angina and Myocardial Infarction , RaywinR. Huang PhD, Wayne StctteUnlversLty 166. Serum Amylase Offers No Additional Benefit to Serum RobertJ. Lipasein the ED Diagnosisof Acute Pancreatitis, VissersMD, Brighamâ&#x201A;ŹeWomen'sHospital 167. Serum CreatineKinase- A New BiochemicalMarker for Ectopic Pregnancy?Joan K. KnightMD, MedicalCollegeof Wisconsin

Cardiovascular Modercttor:RobertJ. Zalenshi,MD, Wayne State University ( 1 : 3 0- 2 : 3 0 p m ) 168. Are TypicalCoronaryRisk FactorsAssociatedWith Acute MI or l)nstable Anglna in ED PatientsWith Chest Pain? StevenA. PaceMD, MadiganArrny MedicalCenter 169. GenderDifferencesin CardiacMarkers:is There a Need for SeparateCutoffs? Henry C. ThodeJr PhD, Unittersity MedicalCenter

Cardiovascular Moderator:Judd E. Hollander, MD,lJniversity of Pennsylvania (3:00 - 4:00 pm) Predic178. Can the Acute CardiacIschemiaTime-Insensitive tive Instrument ldentify Patientswho Benefit from Noninvasive TestingAfter an MI Has Been Ruled Out? Robert I. ZalenshiMD, WaynestateunLversity 179. Reducing Admissions for Chest Pain to an Inner-City Municipal Hospital Using PhasedImplementationof a Prediction Rule - Results PhaseI, Peter C. Wyer MD, LincolnMedicaland MentalHealthCenter lB0. Acute IschemicCoronarySy'ndromeRule-Outin the Low Risk Patient:Descriptionand Evaluationof a LimitedResourceProtocoI,RobertH. BaevshyMD, BaystateMedical Center 181. FASTMK: A CanadianRegistryof PatientsWith AcuteMyocardiallnfarction,Jim ChistensonMD, St.Paul'sHospital lB2. Can EmergencyUitrasonography be Used to ScreenFor Critically Enlarged Abdominal Aortic Aneurysms?Da''tid GeneralHospital FM BrownMD, Massachusetts 183. Role of SIow lnfusion Calcium Channel Blockersin the Emergency Management of Supraventricular Tachycardia, SweeH. Lim, SingaporeGeneralHospital 184. Comparisonof StandardVersusGoalDirectedTherapyin of CritlcallyI1lED Patients,DouglasS.Ander Resusciation MD, Emory University 185. CardiovascularReguiationDuring ExperimentaiShock (Acute Hemorrhage)in Rats Does Not Appear to Use 'Hard-Wired'Reflexes,But RatherExperience-Dependent Adaptations of the Entire CardiovascularSystem,Bnan A. N esterD O. Albert EinsteinMedicalCenter


ililrrl'riiil{!lll:,1 'lt:r,1!lli; ll:,1i11

!lllr-i111!lllr..:li'r.-,

ill:-,rirl:iililllr,,i1ii

i,

-'rl1trli

' .,t1l1l:1.,,,r,,,,,,-.... rlil. -...,""''riiiit r':1':orrrjj..... lr'riii. d

-

l


wnsHINGToN HnroN AND Towtns MEETING,,,,,,,RC)OM

TERRACELEVEL (l level below lobby)

CONCOURSELEVEL (2 levels below lobby)


Turn static files into dynamic content formats.

Create a flipbook
SAEM 1997 Annual Meeting Program by Society for Academic Emergency Medicine - Issuu