Page 1

Fall/Winter 2015 volume 62

Blues Tastes So Good B.B.King Blues Club & Grill in NYC The Perfect Order by Sam Roselli

Tomatoes by Lou Piancone

800.275.9500 • www.performancefoodservice.com/metrony


The Mark of Quality in Non-Food

ǚ'ƼƷ%,

First Mark™ products are manufactured to exacting specifications and designed to meet the changing needs of the foodservice professional. DESCRIPTION

BRAND

METRO #

PACK/SIZE

Resealable Freezer Bag, 2 gal cap., 13 x 15.625

First Mark

425936

1/100 ct

Resealable Freezer Bag, 1 gal

First Mark

425935

1/200 ct

Resealable Sandwich Bag, 6.5 x 5.875

First Mark

425887

1/500 ct

16 Gallon Can Liners, black, 24x32

First Mark

241347

25/20 ct

23 Gallon Slim Jim Can Liners

Silver Source 294868

10/25 ct

45 Gallon Can Liners, black, 40x46

First Mark

358747

10/10 ct

55 Gallon Can Liner, clear, 38x60

First Mark

194634

10/10 ct

60 Gallon Can Liners, black 38x58

First Mark

358758

10/10 ct

White Table Cover, 40 x 300 roll

First Mark

425946

1/1 rl

Red Gingham Table Cover

First Mark

425947

1/300 ft


It’s not just that, since 1978, we’ve had 10 exacting standards by which to judge the taste and quality of our beef. It’s that we still believe the best way to meet those standards is through dedicated family ranchers. Ranchers who have committed themselves to raising not just Angus beef, but the best Angus beef ever made. With no shortcuts and a virtual obsession with flavor and juiciness.

Certified Angus Beef ® brand. From our family ranchers to your family table.


Empire’s Treasure Yellowfin Tuna Steaks and Portions

Çž%Ćź&ơ-"'ơƚơ'V('/'"' • Tuna steak, loin and block products are specially and minimally processed to help maintain the fresh qualities of the tuna - even after freezing. High quality product, sourced from Indonesia with CO2 added to preserve color. This proccess results in a better appearance, a two-year frozen shelf life, and an eight-day shelf life for thawed product. • Year-round supply, 100% net weight product, individually vacuum-packed, 100% usuable product. • YellowďŹ n Tuna is an excellent source of lean protein, vitamins and minerals and rich in heart-healthy Omega-3 Fatty Acids making it a perfect menu addition for health conscious consumers. • An assortment of saku blocks, steaks, and loin cuts. • YellowďŹ n Tuna can be used raw in sashimi or sushi or grilled, baked, broiled, or steamed. When cooked, the meat has a ďŹ rm texture, off-white color and a mild avor. DESCRIPTION

METRO #

PACK/SIZE

Tuna Saku Block, 8-12 oz, frozen 420826 1/10 lb Additional info for Tuna Saku Block: Also called Ahi in Hawaii. High fat content-darkest and fattiest of tuna, XQFRRNHGPHDWLVQDWXUDOO\UHG0HDWWXUQVĂ€UPDQGRIIZKLWHZKHQFRRNHG Tuna Steak Sashimi, 6 oz, frozen 420829 1/10 lb Tuna Steak Sashimi, 8 oz, frozen 420830 1/10 lb Additional info for Tuna Steak Sashimi: 0LOGPHDW\Ă DYRUVLPLODUWRVZRUGĂ€VK6HUYHUDZDVVDVKLPL DQGLQVXVKL&DQEHVHUYHGUDZLIKDQGOHGSURSHUO\6DVKLPLJUDGHW\SLFDOO\PHDQVLWKDVEHHQIUR]HQXQGHU DIRUPXODE\WKH)'$0RVWĂ€VKLVUHTXLUHGE\ODZWREHIUR]HQWREHVHUYHGDVVXVKLVDVKLPLLQWKH8QLWHG 6WDWHV9DULRXVSDFNVL]HVKHOSRSHUDWRUVFRQWUROSRUWLRQVZLWKOLWWOHWRQRZDVWH&DQDOVREHEDNHGJULOOHG URDVWHGEURLOHGRUVWHDPHG,QGLYLGXDOO\YDFXXPSDFNHGSRUWLRQV 4


08

Table of Contents 08 The Perfect Order 29 Tomatoes 17

10

Blues Taste So Good B.B. King Blue’s Club & Grill in NYC

The Two-Sided Business of Ordering

a Chef P

From the Farm...to The Can.. to The Table

29

CONTENTS

trick S

impso

n

17

Advertisers’ Guide.........................................07

The

FEATURES

orde

ring

proc

ess

Mac Pearce Greatly Missed ......................................................47 The Driver’s Seat........................................................................ 54

r 2015 Fall/Winte me 62 volu

ON O N THE COVER: It’s time for a hearty bowl of Tomato Soup Tomato Soup, ready to use Campbell....26723.....24/7.25 oz Tomato Soup Campbell.....26091.....12/50 oz Tomato Soup with Tomato Pieces, low sodium Campbell.....1718......12/50 oz

Tastes Blues o o d& Grill in NYC SongG Blues Club B.B.Ki

rder erfect O ThemP lli se Ro by Sa atoes Tom u Piancone by Lo

800.275.950

0 • www.perf

ormancefoods

ervice.com/m

etrony

Got News? We welcome news about your operation, staff or you! Share your news with us by emailing Tim Harper at Tim.Harper@pfgc.com To read this issue and earlier volumes of Culinary Edge Magazine, go to www.performancefoodservice.com/metrony. Also, access our website for valuable Manufacturer Rebates and Coupons. From the homepage, simply click Featured Manufacturers and Rebates and print on demand.

EXECUTIVE EDITOR/ART DIRECTOR Kay Liddell

s: ha atoe Tom

e t tim rves

& pa

g ckin

MAGAZINE COORDINATOR Sharan Vincenty GRAPHIC DESIGN Tim Harper Deann Magaw EDITORIAL CONTRIBUTORS Audrey Nash Sam Roselli Ed Carpenito COPY PROOFING Sharan Vincenty Lee Ann Vietri CULINARY EDGE EDITORIAL BOARD Ed Carpenito Chef Robert Conti Michelle Kelly David Klein Kay Liddell Audrey Nash EDITORIAL OFFICE Sue Nissley Performance Foodservice Louis M. Piancone 1 Ikea Drive, Elizabeth, NJ 07207 Sam Roselli 1.800.275.9500 Ivan Shulman www.performancefoodservice.com/metrony


Get Inventive with Soups Beef and Bean Chili

and expand your menu. Soups can be one of your most SURĂ€WDEOHLWHPV!

Cheesy Chicken Tortilla

Cream of Potato with Bacon

Minestrone Chicken Noodle

Make This!

From This!

Golden Broccoli Cheese

Italian Wedding

FROZEN CONCENTRATED TUBS

METRO NY #

PACK/SIZE

Golden Broccoli Cheese, trans fat free - NEW Cheesy Chicken Tortilla, trans fat free - NEW Beef and Bean Chili, trans fat free Chicken Noodle Soup, trans fat free Cream of Potato with Bacon Soup, trans fat free Italian Wedding Soup, trans fat free Minestrone Soup, trans fat free

374515 374529 374513 374505 374514 374516 374517

3/4 lb 3/4 lb 3/4 lb 3/4 lb 3/4 lb 3/4 lb 3/4 lb


Advertisers Guide Advance Pierre™ Foods ....................................................... 45

+HULWDJH2YHQ3LHV ................................................. 14

Allegiance ................................................................ 32

Hormel - Austin Blues.......................................................... 30 Jennie-O ............................................................................. 44 Kellogg’s............................................................................. 48 Kraft ................................................................................... 50 Lamb Weston ...................................................................... 61 Leidy’s ................................................................................ 57 Miss Vickie’s ....................................................................... 52 Nestle Professional ............................................................. 65 Ocean Spray ....................................................................... 60 PAM.................................................................................... 56 Perdue................................................................................ 53

American Roland ................................................................ 23 American Roland ................................................................ 39 AMOY ................................................................................. 64 Angela Mia ......................................................................... 13 Annie’s Euro American Bakery ............................................. 12 Barilla ................................................................................ 51 Baywinds Lobster ................................................... 41

Brill .................................................................................... 16 Butterball ........................................................................... 63 &HUWLÀHG$QJXV%HHIŠ............................................ 72 &HUWLÀHG$QJXV%HHIŠ............................................ 71 &HUWLÀHG$QJXV%HHIŠ............................................ 3 &HUWLÀHG$QJXV%HHIŠ............................................ 49

Calavo ................................................................................ 42 Campbell’s ......................................................................... 36 David’s Cookies .................................................................. 27 Eastern Fish - Sail Shrimp ................................................... 28 (PSLUH·V7UHDVXUH<HOORZÀQ7XQD ......................... 4 (PSLUH·V7UHDVXUH6LOYHU6RXUFH%HHU%DWWHUHG )ORXQGHU ........ 66 )LUVW0DUN ................................................................ 2

5LGJHFUHVW&KLFNHQ%UHDVW ................................... 69 5LGJHFUHVW:HVW&UHHN6LOYHU6RXUFH7XUNH\ .... 34

Schreiber Foods International, Inc. ...................................... 43 Thomas Foods International ................................................ 58 :HVW&UHHN7RSSLQJV 6\UXSV ............................ 62 :HVW&UHHN)UR]HQ6RXSV ..................................... 6 :HVW&UHHN)UXLW7RSSLQJV ................................... 70 :HVW&UHHN3RWDWRHV ............................................. 59 :HVW&UHHN3RUN .................................................... 26

White Toque ........................................................................ 38

2015 Fall Culinary Expo at MetLife


tâ&#x20AC;&#x2122;s 8:20 p.m. on a Satuday night. As the kitchen doors swing open, the sounds of that nightâ&#x20AC;&#x2122;s headlining band SXVKHVLWVZD\LQEOHQGLQJZLWKWKHFDFRSKRQ\RIJULOOVĂ&#x20AC;ULQJ appliances operating, and a variety of chefs interacting in a verbal shorthand of kitchen lingo. Despite the controlled chaos of the dinner rush in the busy New York City restaurant of B.B. King Blues Club & Grill, Executive Corporate Chef Wenford Patrick Simpson focuses his attention on preparing the plate in front of him, weaving ingredients together in a WDSHVWU\RIVSLFHVDQGĂ DYRUV :KLOHDWHDVHLQWKLVHQYLURQPHQW&KHI3DWULFN¡VĂ&#x20AC;UVWIRUD\LQWR the kitchen began in St. Annâ&#x20AC;&#x2122;s Parish, Jamaica in his childhood home. His mother worked two jobs and so as the elder brother, he was responsible for taking care of his younger sister after school. His cooking ventures at 9 and 10 began conservatively, but as he matured, he began to spend more and more time in the kitchen. â&#x20AC;&#x153;This is when I found the love for cooking.â&#x20AC;? Chef Patrick recalls one day when his sister brought some friends home. He was busy in the kitchen making what turned out to become a curried cabbage dish. â&#x20AC;&#x153;This is not something you would normally cook in Jamaica and my sister and her friends laughed and laughed. I said to them, â&#x20AC;&#x2DC;You laugh at me now; Iâ&#x20AC;&#x2122;m going to be a great chef someday.â&#x20AC;&#x2122; I took that anger and turned it into something positive.â&#x20AC;? As much as they teased him, they devoured the cabbage dish.

chef Wenford Patrick Simpson

Soon, his talents in the kitchen caught the attention of his VFKRROZKLFKĂ&#x20AC;UVWVHQWKLPWRDEDNHU\IRUDQLQWHUQVKLS+H recalls his frustrations: â&#x20AC;&#x153;I didnâ&#x20AC;&#x2122;t really learn anything. They only make bread and beef patties. I didnâ&#x20AC;&#x2122;t want to do just dinner rolls for the rest of my life.â&#x20AC;? After the internship, he conveyed his frustrations to his teacher, who presented him with a rare second internship, this one with Club Caribbean.

I treat my work very personally. Each dish I createâ&#x20AC;Ś I want it to be a piece of art.


ABOUT B.B. KinGs

B.B. King Blues Club & Grill, owned by Danny Bensusan, is renowned as a premier live music venue in New York City. Since its opening 2000, the venue has hosted music legends such as Aretha Franklin, James Brown, Alicia Keys, The Allman Brothers, Gipsy Kings, ZZ Top, & Jay Z. Also nestled within the NYC location is Lucille’s Bar & Grill, named for B.B. King’s famous guitar. Other locations include: • The Blue Note, with locations in: NYC, Nagoya (Japan), Tokyo, Milan. Locations in Hawaii and Beijing will be opening in 2016. • Highline Ballroom, 16th Street, NYC • Subrosa, Gansevoort Street, NYC • The Howard Theatre, Washington, DC

CHOPPED SALAD romaine lettuce, cherry tomatoes, diced avocado, cucumber, corn, goat cheese, topped with bacon, balsamic vinaigrette

SWEET & SPICY CATFISH BITES hand breaded, deep fried, with a sweet & spicy dipping sauce

POPCORN SHRIMP chili lime sauce, diced mango

Pan Seared Salmon chard lemon butter sauce with mash potato puree 9


This is where Chef Patrickâ&#x20AC;&#x2122;s talents were honed and he soon began working on the line in the kitchens. His penchant for learning caught the resortâ&#x20AC;&#x2122;s attention and he was offered a job there after his schooling was completed. â&#x20AC;&#x153;I graduated on a Sunday, and started work on Monday,â&#x20AC;? he recalls. This was followed by his tenure at Jamaica Grand Hotel and Sandals, where a friend encouraged him to take the opportunity to test for a job with the Royal Caribbean Cruise Line. His aptitude was evident when he completed the 45-minute test in 20 minutes. Still, months passed and he did not hear back from the cruise line. â&#x20AC;&#x153;I totally forgot about it,â&#x20AC;? Chef Patrick said. One day at work at Sandals, he was paged to the front desk where two men in suits were waiting to fast-track KLPWRWKH5R\DO&DULEEHDQRIĂ&#x20AC;FHVLQ0LDPL´,QHYHUWUDYHOOHG and I told them I didnâ&#x20AC;&#x2122;t even have a passport.â&#x20AC;? Still, with the companyâ&#x20AC;&#x2122;s help, he was in Miami by the end of that week. He was with Royal Caribbean for eight years, moving up the ranks from chefâ&#x20AC;&#x2122;s assistant to supervisor. Next on his career path, Chef Patrick started his own business, then he sailed ZLWK'LVQH\&UXLVH/LQHVRQWKHLUĂ&#x20AC;UVWVKLS&KHI3DWULFNUHFDOOV his fortune in being able to travel the world, meeting different people and exploring a diversity of cultures, all of which impacted his cooking repertoire.

However, the land beckoned once more, and by then, his family had relocated to New York and he wanted to be there as his young daughter grew up. â&#x20AC;&#x153;I wanted to work on land againâ&#x20AC;Ś I wanted to work in a restaurant. I wanted to come home to my family.â&#x20AC;? He settled with his family in NYC and took a position as Executive Chef for Negril Restaurant. While there, his cooking style continued to evolve and he was garnering a reputation for complex desserts and American-Jamaican inspired dishes. While at Negril Restaurant, the world was devastated by the World Trade Center bombings and the restaurant, which was close to the towers, was forced to begin laying off employees. He began working for B.B. King Blues Club & Grill on 42nd Street, a music venue known for sumptuous pub fare and a stage that draws well-known rock and R&B artists. He shares his time between the blues club and sister restaurant, the Highline Ballroom, also known for its music and food talents. Chef Patrick has cooked for a variety of VIPs, including Magic Johnson, Air Supply, Stephen Baldwin, Mike Tyson, Keith Sweat, Washington DC Mayor Murial Bowser, Donald Trump and Hillary Clinton. Although these are a small list of celebrities he has cooked for, and is constantly building on this list, one familiar face is missing.

All My Customers are vips.

Steve Buma Director of sales

chef wenford patrick simpson

mike hedden account manager

ddd

www.chefwenfordpsimpson.com chefwpsimpson@gmail.com twitter.com/chefwpsimpson instagram.com/chefwsimpson pinterest.com/chefwsimpson www.linkedin.com/pub/wenford-simpson youtube.com/c/chefwenfordsimpson/ www.facebook.com/pages/Chef-Wenford-P-Simpson


5HĂ HFWLQJXSRQWKHGHDWKRIEOXHVJUHDW%%.LQJ&KHI Patrick muses: â&#x20AC;&#x153;You just canâ&#x20AC;&#x2122;t prepare yourself (for losing a friend). He was a real cool guyâ&#x20AC;Ś he was so passionate about his craft.â&#x20AC;? Friendly and personable, he was most comfortable on the stage of the club. â&#x20AC;&#x153;Just give him his stageâ&#x20AC;Ś give him his Lucille,â&#x20AC;? he says, referring to BB Kingâ&#x20AC;&#x2122;s beloved guitar. â&#x20AC;&#x153;Itâ&#x20AC;&#x2122;s where he found peace within himself. I kind of understood him as an artist.â&#x20AC;? The blues legend left behind an amazing legacy. â&#x20AC;&#x153;It was real tough, but we still feel like heâ&#x20AC;&#x2122;s here. We all work to let his name stand for great music and great food. He still lives on.â&#x20AC;? While paying tribute to BB King, Chef Patrick continues to grow his own name for creating memorable food, blending Ă DYRUVDQGPRXWKZDWHULQJSODWHV´0\EHVWGD\VDUHZKHQ Iâ&#x20AC;&#x2122;m in the kitchen,â&#x20AC;? he says. â&#x20AC;&#x153;I treat my work very personally. Each dish I createâ&#x20AC;Ś I want it to be a piece of art. It doesnâ&#x20AC;&#x2122;t matter if a plate is going to a booth or a VIP. I give each one the same attention.â&#x20AC;? Chef Patrick has been featured in the Go Green East Harlem Cookbook, as well as the Taste of Ebony and Tasting Panel magazines. He has participated in a number of events including numerous appearances at Bloomingdales and Macys, a special appearance in the NBC holiday menu broadcast, and participation in the Taste of Times Square, iFood TV, and Island Insider TV. Currently, he is in the process of putting together his own cookbook and is also developing his own food line and cookware line. Besides his resort and cruise training, he has also had additional tenures with Mo Bay Restaurant, Amy Ruthâ&#x20AC;&#x2122;s Home-Style Southern Cuisine and Baton Rouge Restaurant. Consequently, his aspirations are as diverse as KLVĂ DYRULQIXVHGGLVKHV His main focus remains his enthusiasm to guide and teach other cooks and chefs to thrive in the kitchen. His career has already inspired his sister, and his daughter shows the same Ă DLULQWKHNLWFKHQWKDWKHGLGDWKHUDJH+LVFXVWRPHUVDUH a testament to the passion he has when cooking. â&#x20AC;&#x153;I love to interact with my customers. If youâ&#x20AC;&#x2122;re enjoying the meal, thatâ&#x20AC;&#x2122;s all I want. All my customers are VIPs.â&#x20AC;?

Lucilleâ&#x20AC;&#x2122;s Grill, named â&#x20AC;&#x153;Best Great Bar That Youâ&#x20AC;&#x2122;d Never Suspect Was a Great Barâ&#x20AC;? by the New York Press, where local acts from the New York music scene jam away with no cover price every night of the week. The mahogany framed, bi-level bar & grill offers a unique atmosphere, complete with signature saxophone beer taps. Colorful contemporary art and iconic photography of all the legendary blues masters in the rich history of this uniquely American music form adorn the restaurant walls.â&#x20AC;?

TSE Group LLC 237 West 42nd Street New York, NY 10036 (212) 997-4144 www.bbkingblues.com Danny Bensusan, Owner Wenford Patrick Simpson, Executive Chef

11


(. Ç&#x192;ĆśÇ&#x2022;ơ0Ç&#x2021;+2!Ç&#x2018;-ơ$ '"/".ơ%V!((%ơ- Ç&#x192;*.", '"/".ơ% ơ' (.ơ/ơ Vơ$ Seduce your taste buds with (.Ç&#x161;V!,ơ$A contrast of mango

No need to worry about calories with this delicious slice! Two layers of no sugar added white cake with QDWXUDOO\VZHHWVWUDZEHUU\Ă&#x20AC;OOLQJ Ă&#x20AC;QLVKHGZLWKRXU no sugar added whipped topping. 233759.....2/16 sl

'"/".ơ% Ɲ-%%/-Vơ$

An American classic. Weâ&#x20AC;&#x2122;ve made the perfect serving of rich red velvet cake, layered in sweet FUHDPFKHHVHĂ&#x20AC;OOLQJĂ&#x20AC;QLVKHGZLWKDGDUNFKRFRODWH feather garnish. 59709.......24/5.25 oz

this elegantly smooth dark chocolate mousse dessert, topped with our hand crafted chocolate ganache with edible gold luster. 242926........24/5.25 oz

ơ,)Ç&#x2021;+2 &('ÇĄ()

/LJKW UHIUHVKLQJ<HOORZVSRQJH cake, layered in lemon mousse, European raspberry preserves, Ă&#x20AC;QLVKHGLQDOHPRQJOD]H JDUQLVKHG with mini white chocolate curls.

and guava cheesecake accented with a light mango mousse garnished with roasted almonds.

233754........24/6.5 oz

'"/".ơ%.1(Ƹ(&

One of our favorites! Rich chocolate cake base, Ă&#x20AC;OOHGZLWKPLONFKRFRODWHPRXVVH ZKLWH chocolate mousse. Weâ&#x20AC;&#x2122;ve topped this with KDQGFUDIWHGFKRFRODWHJDQDFKHGUL]]OHGLQ white chocolate sauce 233756.......24/4.25 oz

261937.....24/5.5 oz

'"/".ơ%ơ'.-Ƹ.ĆžÇ&#x2021;1)%(,"('

Please contact KeyImpact Sales Brokers, for samples, more information or demonstrations, John DePoto: jdepoto@kisales.com or Elizabeth Esteves: eesteves@kisales.com

An explosive combination of fudge brownies, layered in velvety smooth peanut butter mousse, rich chocolate cake Ă&#x20AC;QLVKHGZLWKEURZQLHFKXQNVSHDQXWEXWWHUFKLSV  GUL]]OHGLQFKRFRODWHIXGJH266551.....24/6.5 oz

12


Create Authentic, Easy Italian Dishes Using Angela Mia® Frozen Alfredo Sauce makes it easy to create a variety of signature authentic Italian dishes. Operators can effortlessly prepare versatile dishes from appetizers and entrees to pasta stations, all with one product.

Alfredo Sauce

.FUSP/: #94628

Pack Size: 4/80 oz.

Convenient and high-quality, Angela Mia Alfredo Sauce is made with real cheese, just like authentic made-from-scratch alfredo sauce, and can be used in a wide range of pasta dishes and much more. A delicious blend of Parmesan and Romano cheese, cream, butter, garlic, paprika and coarse ground pepper all combine to make an authentic alfredo sauce. This perfect balance of ingredients gives Angela Mia Alfredo Sauce consistent flavor and lower sodium levels than leading competitors’. These benefits are ideal for operators who want high quality, versatile products, with convenient heat-and-serve capabilities. Angela Mia Alfredo Sauce’s convenient pouch packaging makes it easy to prepare the sauce by steaming or boiling. The sauce holds well once heated and does not separate, so operators can count on consistently delicious sauce that pairs perfectly with Angela Mia Frozen Filled Pasta like tortellini and ravioli. It can also be combined with Angela Mia’s classic red sauces for a creamy custom blend that consumers will love.

Anthony Palermo | (732) 567-1197 | apalermo@acosta.com Joe Youngs | (201) 446-3553 | jyoungs@acosta.com 13

www.acostafoodservice.com

07022015 vcm

For further information, samples or product demonstrations, please contact:


pies • pie shells • cheesecakes • cobblers

Enjoyment for Everyone Heritage Ovens wide variety of delicious dessert favorites brings the taste of home-baked goodness to any meal occasion.

Premium-Quality Pies •

available in Thaw-and-Serve and Ready-to-Bake formats

specially formulated crusts optimize the flavor of each pie and are made with 100% vegetable shortening for tender texture

pre-baked pies are shrink-wrapped with an easy-tear strip to prevent crust breakage when opening

Oven-Ready Cobblers •

high fruit-to-filling ratios deliver exceptional flavor

golden, flaky crusts made with 100% vegetable shortening

New York Style Cheesecakes •

light, tart cream cheese flavor baked into a smooth, dense cheesecake and set on a graham cracker crust

pre-cut for ultimate convenience


Heritage Ovens Product Listing Fruit Pies Grand Apple Pie 10”, Unbaked ...................................... 199363..................... 6/54 oz Traditional Apple Pie 10”, Thaw & Serve ......................... 199366..................... 6/48 oz

Cream & Meringue Pies Chocolate Cream Pie 10”, Thaw & Serve ..........................199371 ................... 6/27 oz Grand Lemon Meringue Pie 10”, Thaw & Serve ................199379 ................... 4/46 oz

Open Face Pies Pumpkin Pie 10”, Unbaked, trans fat free ........................199358 .....................6/46 oz Sweet Potato Pie 10”, Baked ............................................199367 .....................6/40 oz Southern Pecan Pie 10”, Baked .......................................199368 .....................6/36 oz Pumpkin Pie 10”, Baked ...................................................199369 .....................6/43 oz

Pie Shells Pie Shell Vegetable Shortening, Unbaked ..........................199360.................... 20/10 in Deep Dish Pie Shell Vegetable Shortening, Unbaked ........199362.................... 20/9 in

Cheesecakes NY Style Cheese Cake 10”, 16 slices..................................999982 ...................4/68 oz

For more information, contact your Performance Foodservice Representative.

15


Fresh Ideas to Create a Unique Bakery Experience

Salted Caramel Pecan

6¡PRUHV7UXIà H

Raspberry Centerfuls Cookies Dough Pucks

5HG9HOYHW&DNH7UXIĂ HV

DESCRIPTION

METRO #

PACK/SIZE

5HG9HOYHW&DNH7UXIĂ HVSHWLWHIUR]HQ 6DOW\&DUDPHO3HFDQ7UXIĂ HSHWLWHFDNH 6 PRUHV7UXIĂ HSHWLWHFDNH 5DVSEHUU\&HQWHUIXOVÂ&#x152;&RRNLH'RXJK3XFNVIUR]HQ

357052 407845 407860 407137

R] R] R] R]

16


Lou Piancone Import Specialist Performance Foodservice - Metro N< 908-436-4964

Harvest Time and Packing n the Northern hemisphere the typical time of the year to harvest and pack fresh tomatoes usually starts in July and continues through September. Usually when we think RISDFNLQJWRPDWRHVZHWHQGWRĂ&#x20AC;UVWWKLQNRI California or Italy, as their tomato products are the most common here in the US, although there are many locations throughout the world that grow and pack fresh tomatoes. Here on the East Coast there are many tomato growing farms and canneries as well as in the Midwest. There are also many other European countries that produce and pack tomatoes such as Spain and Turkey. In Asia, countries like China, India and Egypt are also big producers. In fact, China is the largest tomato producing country in the world. 17


Tomato packing facilities start production in July or as soon as the tomatoes start to ripen and during the peak of harvest, the larger packing plants normally run 24 hours a day/ 7 days a week. Depending on the weather conditions and location of the crop, some of these factories will sometimes continue their production into October. During the height of the production season, the sight outside of a packing facility is an extensive line of trailers that are loaded with fresh harvested tomatoes, waiting to be off loaded. These specially made trailers were loaded out on the WRPDWRÀHOGVGLUHFW from a “Tomato Harvester”. This is a vehicular harvesting machine that drives through each row and extracts the entire tomato plant and effectively separates the fruit from the plant and then, by conveyer, loads the tomatoes into the trailers without damaging the fruit. This harvest process happens at a rapid pace; therefore the tomatoes reach the packing facility within an hour of processing. This is important as the tomatoes need to be processed soon after they are harvested. When the trucks arrive at the packing plant to be off loaded, the process of transferring the fruit into the factory is done in such a way to avoid damaging the fruit. The tomatoes are never dumped; rather water is pumped into the trailer at the top of the tomato load

and the fruit is forced by water pressure through a hatch on the lower part of the trailer transferring them from the trailer into a washing pool to commence production. The tomatoes are then washed and then transferred into the plant by a conveyer system. At this point they are steamed, peeled and then by belt, travel to many sorting lines for manual sorting. Some facilities have improved auto-technology to kick out any non-ripe or undesirable fruit before they get mixed into the sorting lines. The tomatoes are then processed for their intended variety (whole peeled, ground, etc.) and then packed in metal tins or glass for foodservice or retail. One important step that does take place prior to the tomato production is the lab work. Every hour on the hour, samples of fruit are pulled from each load of fresh tomatoes and are sent to an onsite lab for testing. A variety of quality assurance tests are then performed that include PH, acid and solids. The test result of each sample is then coded for traceability. If the fruit does not meet the requirements of the packer, then the load is rejected. Touring a tomato packing facility is a fascinating experience. The tour would XVXDOO\VWDUWRQWKHIDUPDQGWKHQÀQLVK at the facility. As with any plant tour, it breeds a new appreciation for the ÀQLVKHGSURGXFW

PROCUREMENT Procurement of Tomatoes started back in the 1960’s. My father Louis G. Piancone, the founder of Roma Food, decided to create a tomato brand that would have an identity that would be V\QRQ\PRXVZLWKTXDOLW\2QHRIWKHÀUVW Piancone Branded products that he released was Italian Whole Peeled Plum Tomatoes packed in Juice with Basil Leaf. This became very popular with our customers. As the company grew so did the demand for this item and many other tomato items. Through the 1970’s and 80’s, California tomato packers were making headway into foodservice, producing a variety of quality tomato products such as Pizza Sauce , All Purpose Ground Tomatoes, Whole Peeled tomatoes (Italian Style) and many

18


others. These items also became very popular with restaurants and pizzerias. Therefore the time was right to release similar Roma branded quality tomato products that would be produced and packed in California. These products became just as popular as the Italian Tomatoes and at present time the demand has consistently grown.

all agriculture, climate and soil are the contributing factors to the quality of a Ă&#x20AC;QDOSURGXFW,WDO\¡VWRPDWRHVDUHXQLTXH although they have fewer solids than Californiaâ&#x20AC;&#x2122;s. This limits Italy from achieving high quality standards in other tomato products such as Ground Tomatoes, Pizza Sauce and other Puree and Paste style products.

Since the inception of these products, the annual procurement of Italian and California Tomatoes has been an ongoing project to assure consistent quality; starting with the selection of the seed, WKHĂ&#x20AC;HOGORFDWLRQDQGWKHFRQGLWLRQRI the soil. Of course proper irrigation and a few prayers for cooperative weather conditions are thrown in as well. The fruit is harvested at its peak of ripeness and processed with accuracy. By the way, it helps to have a good relationship with the tomato packer. He understands your needs and will always pack a consistent product.

THE APPLICATIONS

CLIMATE SOIL Makes a Difference

The most common tomato variety for processing is the pear-shape or sometimes called plum. This variety naturally contains higher solids and is more Ă DYRUIXO7KHOHYHORIVROLGVDQGDFLGLW\ varies from each growing region. Californiaâ&#x20AC;&#x2122;s San Joaquin Valley is a vast tomato growing region. This valley is part of the enormous Central Valley which produces the majority of more than 12% of the United Statesâ&#x20AC;&#x2122; agricultural production. This Valley is known for its long and dry growing season. This climate allows the fruit to naturally create very high solids (sugars) and in turn gives opportunity to tomato producers to pack a variety of high quality products. Italy is a very large producer of tomatoes. Their ever so popular Whole Peeled Plum Tomatoes packed in Juice with Basil Leaf is widely used in restaurant and pizzeria kitchens in many parts of the world. This tomato is known for its XQLTXHĂ DYRUWKDWLVYHU\YHUVDWLOHDV it is the base for many dishes. As with

Italian Tomatoes are great when making marinara sauce, especially when used ZLWKĂ&#x20AC;VKDQGVKHOOĂ&#x20AC;VK7KHDFLGLW\RI these tomatoes marries well with shell Ă&#x20AC;VK5HPHPEHUWKHFRRNLQJWLPHLV minimal with these tomatoes because of their lack of solids. They can be used with other tomato/pasta applications but if you want more sweetness, then you may need to incorporate some high sugar veggies such as carrots and onions. If youâ&#x20AC;&#x2122;re making a sweeter sauce or a sauce used with meats then my suggestion is to use a California Tomato which has more solids and can endure longer cooking time. To achieve a simple and delicious pizza, simply hand crush Italian or California Whole Tomatoes and then add the right seasoning of fresh garlic, oregano, black pepper and fresh basil leaves. Then top off with a good Pecorino Romano and a little fresh mozzarella. A more common pizza sauce recipe using Italian Tomatoes is to grind them through a food mill and then adding them to California Pizza Sauce and/or California All Purpose Ground Tomatoes. This blending makes for a Ă DYRUIXOSL]]DVDXFH7KHLGHDKHUHLVWR make a pizza sauce with the sweetness of the California fruit and the unique Ă DYRUDQGDFLGLW\RIWKH,WDOLDQWRPDWRHV There is no rule of thumb to this. The idea here is to take what Mother Nature produces, understand the differences and use the right tomatoes for the right application.

â&#x20AC;&#x153;With over 55 years of tomato procurement, I would like to share some tomato information that could help with your menu preparations.â&#x20AC;? Because Italy and California are the most popular Tomato growing regions, I will explain by comparing the two. Tomatoes from Italy and California are unique in their own way: â&#x20AC;˘ Italian Tomatoes contain fewer solids than California, thus they contain less sugar which means less structure and minimal cook time (Important factoids: Tomatoes are made up of pulp, seeds, skin and solids. Solids are a natural component of the tomato that determines its structure and how it could be used. These Solids are made up of three components-Sugar, Acids and Salt, - sugar being the major component. â&#x20AC;˘ Italian Tomatoes contain more natural acidity than California Tomatoes which pairs well with certain foods. The higher acidity will, as with  PRVWIRRGVOHDYHDORQJHUĂ&#x20AC;QLVKRQ your palate. â&#x20AC;˘ Due to the rich soil and ideal climate in Italy, the PH of Italian Tomatoes is usually within a normal range, therefore there is minimal or no need for citric  DFLGZKLFKFDQPDVNWKHQDWXUDOĂ DYRU of the tomato. However, the California soil is more alkaline, therefore acid levels in fruit can be lower than in Italy. When acid levels are below range, PH levels tend to run high. This could lead to potential spoilage; therefore some California producers wonâ&#x20AC;&#x2122;t take that risk and add citric acid to their product. In addition, the California soil and climate will drive sugar levels higher in fruit than in Italy. Because they are sweeter, the California Tomato is considered by chefs to be very versatile for creating many dishes. â&#x20AC;˘ As you can see, Solids (sugar), Acid and PH are the most important points to know about this fruit. Both Italy and California do produce unique quality Tomatoes. Due to the fact that they have their own natural characteristics, their kitchen applications can be used accordingly.

19


History OF PIZZA SAUCE

THEN... Historically pizza shops have been the majority of Romaâ&#x20AC;&#x2122;s customers and which still holds true today. Looking back 30 to 40 years ago the pizzeria menu was typically made up of a variety of pizzas with an assortment of toppings to choose from, but the menu also included hot and cold sub sandwiches, calzones and some basic pasta dishes. Today the menu has expanded into an array of fast food items and some menus are more sophisticated than others. But pizzas have always been the center of the plate or letâ&#x20AC;&#x2122;s just say-- itâ&#x20AC;&#x2122;s the main item on the menu. The shop owner needs to make his/her preparations one day in advance. Making and SURRĂ&#x20AC;QJGRXJKVKUHGGLQJFKHHVHURDVWLQJWKH sausage and meatballs, slicing the pepperoni and so on. The ownerâ&#x20AC;&#x2122;s choice of products and style of preparation was always very special and personalized. The method of prepping in a pizzeria was very basic but each shop owner did something a little different from his/her competitor up the street. There could be two or three pizza shops within a two mile radius, the owners may have come from the same town in Italy, they could even be related but they all did something a little different to create their own identity. This specialized restaurant group was proud of the food they served. When it came to sauce preparation they were very particular. The pizza sauce, where PXFKRIWKHĂ DYRURISL]]DFRPHVIURPKDG WRKDYHDVSHFLĂ&#x20AC;FSURĂ&#x20AC;OHWKDWZDVGHVLJQHG by the shop owner. Some used only canned Italian whole tomatoes or â&#x20AC;&#x153;all purposeâ&#x20AC;? ground tomatoes or mixed them with their own personal seasoning. Here in the Northeast in the 1960s and 70s, the growth of independent pizza businesses were on the rise. Shops were opening in every major town, as well as in shopping centers and malls. Therefore with any new IRRGVHJPHQWWKDWLVĂ RXULVKLQJWKHUHZHUH many product manufacturers and distributors that became available to service this growing industry. Although back then, nobody thought that â&#x20AC;&#x153;Pizzaâ&#x20AC;? would become an industry. Many new products became available. Some were re-invented for convenience and some were additions to menus.

PRODUCT LINEUP... $OO3XUSRVH$OOLQ2QH *URXQG7RPDWRHVLQ3XUHH Luigi 

,WDOLDQ:KROH3HHOHG 7RPDWRHVLQ+HDY\-XLFH with Basil 3LDQFRQH 

([WUD+HDY\7RPDWR6DXFH with Basil 5RPD  20


/RX3LDQFRQH

Import Specialist Performance Foodservice - Metro NY 908-436-4964

NOW... The one item that California tomato packers designed was the Extra Heavy Pizza Sauce. This is produced very similar to a highly concentrated heavy puree or almost like a light paste with some light seasoning (salt and dried basil). The pizza sauce was made up of the solids of the tomatoes to achieve a heavy consistency. The natural tomato “solids” are made up of mainly sugar along with natural salts and acid. California grown tomatoes achieve higher solids than tomatoes grown in other parts of the world due to the California climate and soil (Terrior). These high solids allow the tomato packer to create a pizza sauce that is highly FRQFHQWUDWHGDORQJZLWKVZHHWÁDYRU7KHUHDVRQ for all this tomato logic is to allow the end-user (the Pizza Man) to add water to this heavy prepared sauce. The higher solids of the sauce allow the water to absorb, thus increasing the total volume ZLWKRXWGLOXWLQJWKHÁDYRU

CALIFORNIA GROWN TOMATOES ACHIEVE HIGHER SOLIDS THAN TOMATOES GROWN IN OTHER PARTS OF THE WORLD RESULTING IN A CONCENTRATED SWEET FLAVOR. This product became very popular with pizza shops ZKLOHWKH\VWLOOFRXOGFUHDWHDSHUVRQDOL]HGÁDYRU SURÀOHIRUWKHSL]]DWKDWWKH\SUHSDUHG7KLVLWHP could be used right out of the can but with a water addition. The sauce would be way too thick to use without diluting. Therefore we came up with a simple recipe by using a few Roma Branded tomato products blended together with the addition of water. 21


FOR A DELICIOUS AND FRESH TASTING PIZZA SAUCE START BY USING USING A LARGE CLEAN PLASTIC OR STAINLESS STEEL CONTAINER THAT CAN HOLD 6 OR 7 GALLONS OF LIQUID.

COMBINE A

2- #10 CANS OF LUIGI ALL-PURPOSE GROUND TOMATOES FROM CALIFORNIA â&#x20AC;&#x201D; ITEM 247437

B

2- #10 CANS OF ROMA EXTRA HEAVY PIZZA SAUCE -- ITEM 233006 (Roma X Hvy Pizza Sauce Is Designed To Add One Can Of Water To One #10 Can Of Sauce)

C

2- CANS OF WATER

D

1- #10 CAN OF PIANCONE ITALIAN PEELED TOMATOES â&#x20AC;&#x201D; ITEM 243310

(Using The Emptied Pizza Sauce Cansâ&#x20AC;Ś.As There Will Be Residual Sauce Clinging To The Can That Need To Be Collected. Using These Cans To Add The Water Is A Good Method)

(Add These In By Using A Food Mill To Grind Them In)

â&#x20AC;˘The idea of adding Italian tomatoes is that they have more QDWXUDODFLGLW\WKDWZLOOKHOSEDODQFHWKHĂ DYRURIWKLVVDXFH Â&#x2021;$WWKLVSRLQWDGGLWLRQVRIVHDVRQLQJDUHQHHGHG7KLVLVZKHUH WKHSHUVRQDOL]DWLRQWDNHVSODFH6XJJHVWLRQVDUH6DOW3HSSHU *DUOLF3RZGHUHWFÂŤ5HPHPEHUWKHSL]]DVDXFHFRPHVDOUHDG\ VHDVRQHGZLWKGU\EDVLO Â&#x2021;$IWHUWKHGHVLUHGWDVWHSURĂ&#x20AC;OHLVDFKLHYHGthe sauce will need WRVLWLQDUHIULJHUDWRURYHUQLJKW7KHZDWHUDGGLWLRQZLOOWDNH WRKRXUVWRDEVRUELQWRWKHVROLGV6RRQDIWHUWKHVDXFHZLOO appear with a heavy consistency, but will be workable to make SL]]D 7KHFRPELQHGWRWDOYROXPHZLOOEHMXVWOHVVWKDQĂ XLGRXQFHV7\SLFDOO\RXQFHVRI VDXFHLVXVHGRQDODUJHLQFKSL]]D7KHUHIRUHWKLVSUHSDUDWLRQFDQPDNHDSSUR[LPDWHO\ ODUJHSL]]DSLHV7KLVFDQYDU\EDVHGRQWKHVL]HRIWKHSL]]D3URYLGLQJWKDWWKHUHLV HQRXJKVDOWLQWKHPL[WXUHWKHVDXFHFDQVLWUHIULJHUDWHGIRUDWOHDVWWRGD\V$OVRQRWH WKDWWKHZDWHUDGGLWLRQZLOOFXWWKHFRVWRIWKHSL]]DVDXFHLQKDOI7KLVLVDVLPSOHPHWKRGRI preparing a delicious and fresh tasting pizza sauce that is consistent and will allow the end XVHUWRFUHDWHDVSHFLĂ&#x20AC;FĂ DYRUSURĂ&#x20AC;OH

22


For 80 years Roland Foods has provided customers with exceptional gourmet food. Our dedication to providing quality and consistency has made us a leader amongst specialty food importers and suppliers.

Kalamata Olive Wedges 901461.....2/6.5 lb

Pitted Country Greek Olive Mix 910998.....2/6.5 lb

Sliced Ripe Olives 150122.....6/#10

Pitted French Nicoise Olives 262824.....2/7.71 lb

Pimento-Stuffed Queen Olives 48570.....4/80 oz

Country Greek Olive Mix 173960.....6/6.93 lb

Pitted Manzanilla Olives 325481.....2/32 oz 23

Classic Greek Salad with

Country Olive Mix


Chef Robert Conti, Corporate Executive Performance Foodservice - Metro NY 908-436-3887 • rconti@pfgc.com

Chefie’sAwesome

ALMOST No Cook Tomato Basil Sauce

FEATURES & BENEFITS Great Flavor

=

Customer Satisfaction

Easy to Make No Need to Cool

= =

Labor saving, higher yield due to no cooking loss +LJKHUTXDOLW\SURGXFWZLWKORQJHUVKHOÁLIH

RECIPE

METRO #

Piancone California Plum Tomatoes Luigi All in One Ground Tomatoes Piancone Extra Virgin Olive Oil

1 #10 can 1 #10 can 2 cups

232026 234437 233302

Peeled Garlic Cloves, sliced lengthwise West Creek Fresh Basil, chopped Kosher Salt Peppercorns, fresh ground

1½ cups 4 oz. 5 tsp 1½ tsp

 855569 987731 242875

1/ Coarsely crush plum tomatoes.

2/Add ground tomatoes to crushed plum tomatoes. 3/ Poach garlic in olive oil until light golden in color.

4/Add chopped basil to garlic and cook for 30 seconds.

Add garlic basil olive oil mixture to tomatoes,

5 / season with salt and pepper and mix until combined. Done!

Great for Pizza, Pasta & Soups 24


Tomatoes The choice is yours

WHOLE TOMATOES

IItalian It tal aliiaan W Wh Whole hol ole Pe PPeeled eeelleedd TTomatoes in Heavy Juice with Basil Piancone 243310.....6/#10

Italian Whole Peeled Tomatoes in Heavy Juice with Basil Piancone 105582 12/28 oz..... 6/#10

California Pear Tomatoes Whole Peeled in Juice with Basil Piancone 232026.....6/#10

SAUCES

Extra xtra Heavy Tomato Sauc Sauce with Basil Roma 233006.....6/#10

Pizza Sauce Super Heavy Traditional Marinara Sauce with Basil Roma Assoluti 240392.....6/#10 231754.....6/#10

Pasta Sauce with Olive Oil & Spices Roma 237768.....6/#10

DICED & CUT

Tomato Strips in Heavy Juice (Pomodori Quattro Tagli) Piancone 233038..... 6/#10

Pear Tomato Cuts in Puree Roma 240394..... 6/#10

Diced Tomatoes in Juice Assoluti 244196.....6/#10

Petite Diced Tomatoes in Juice Assoluti 78741.....6/#10

GROUND

Ground Unpeeled Tomatoes in Puree Assoluti 78777..... 6/#10

Tomato Puree Extra Heavy 1.07 Roma 78769..... 6/#10 25

All Purpose, All in One Ground Tomatoes in Puree Luigi 234437..... 6/#10


West Creek branded pork products are available in an assortment of grinds, cuts, and sizes designed to appeal to chefs at any restaurant, country club, or diner. West Creek ground and diced pork products are ideal for use in casseroles, stews, pasta sauces, kabobs, or homemade sausage. The chops and tenderloins serve well as main course menu items such as apple or herb stuffed pork chops, or grilled pork tenderloin and wild rice. West Creek products deliver outstanding quality and value to foodservice professionals! DESCRIPTION Bone-in Pork Butts Boneless, Pork Butts Rib Pork, 3 piece bag/3 bags per box, frozen Rib Pork, Light Spare, Skin-On, 2.5 - 4 LB, 3 piece bag/6 bags per box, frozen Pork Spare Rib, fresh Pork Spare Rib, St. Louis Style, 2.75 lb up, frozen Pork Tenderloin, fresh Whole Pork Loin, bone-in, fresh Pork Loin, boneless, center cut, strap on

26

METRO # 464469 464407 471467 472789 464484 475433 464780 464468 464778

PACK/SIZE 8/8.5 lb 8/8.5 lb 9/5.2 lb 18/2.89 lb 9/5.2 lb 12/3.6 lb 12/1.25 lb 4/19 lb 6/9 lb


Gluten Free Our customers come first at David’s Cookies, so we’re happy to announce our latest certified Gluten Free product line!

Chocolate Chip Cookie

Chocolate Chip Brownie

gluten free, individually wrapped, frozen, trans fat free 459864.....24/3 oz

gluten free, individually wrapped, frozen, trans fat free 459448.....48/3.5 oz

Reese’s® Peanut Butter Chunk Cookie Dough

Hershey’s® Triple Chocolate Cookie Dough

trans fat free 925567.......80/4.5 oz

trans fat free 956688.......80/4.5 oz 27


Sail Brand, our signature brand shirmp, is grown and processed only under strict HACCP controls to ensure the highest product quality and consistency standards. DESCRIPTION

METRO #

PACK/SIZE

Breaded ButterďŹ&#x201A;y Shrimp 16/20, tail on

281694

4/3 lb

Breaded ButterďŹ&#x201A;y Shrimp 21/25, tail on

281695

4/3 lb

Tiger Shrimp, 6/8, shell on, frozen

450918

6/4 lb

U-10 White Shrimp, shell on, headless, frozen

326778

10/5 lb

U-10 White Shrimp, shell on, headless, frozen

468162

10/5 lb

U-12 White Shrimp, shell on, headless, frozen

326779

10/5 lb

U-12 White Shrimp, raw, peeled & deveined, tail on, frozen

421821

10/2 lb

U-15 White Shrimp, shell on, headless, frozen

337195

4/5 lb

White Shrimp 16/20, raw, headless, shell on White Shrimp 16/20, raw, peeled & deveined, tail on, frozen

467887 335601

10/5 lb 5/2 lb

White Shrimp 21/25, raw, peeled, deveined, tail-off, frozen

389755

10/2 lb

White Shrimp 21/25, raw, peeled & deveined, tail on, frozen

281699

5/2 lb

White Shrimp 26/30, headless, shell on, frozen

424428

10/4 lb

White Shrimp 31/40, raw, peeled & deveined, tail off, frozen

348095

5/2 lb

White Shrimp 41/50, peeled & deveined, tail off , fully cooked, frozen

281665

5/2 lb

White Shrimp 71/90, raw, peeled & deveined, tail off, frozen

348110

10/2 lb

28


Director of Sales, Strategic Accounts

Sam Roselli Performance Foodservice - Metro NY 908-436-9952 Sam.Roselli@pfgc.com

The Perfect Order. It sounds easy, right? You order Now let us examine the role of the customer in achieving a perfect order. 50 cases, the truck backs in and everything is there just like you ordered. There is actually quite Do you have systems to help place and receive the perfect order? Are there Par Levels set up so you have an accurate idea a bit more to it than that and do not doubt me of what is needed day in and day out and are they adjusted as when I tell you that it is a two-sided process, needed? Do you have staff order with yields in mind and how AP (as purchased) weights translate into EP (edible portion) us and you!

weights? Do you keep a Log or Journal recording daily events internal and external that affect business including but not Letâ&#x20AC;&#x2122;s begin with Performance Foodservice. limited to weather, local events such as graduations, parades, 8SRQUHFHLSWRIDQRUGHUIURPDFXVWRPHUWKHRUGHUPXVWĂ&#x20AC;UVW street closures and so on. It is important for you to know why be studied for everything from out of stocks to large quantities there was a very busy night. Was it a one-time event that drove WKDWGHPDQGYHULĂ&#x20AC;FDWLRQWRPDNLQJVXUHWKHGHOLYHU\GDWHLV business in a typically slow night? Trying to accurately determine correct plus a host of other things the Customer Service Team your needs in compiling an order is a complex process. The scans orders for. Next, the order is routed for delivery, selectsame way a short on your delivery negates a perfect order, so ed, staged and loaded onto a straight truck or trailer. Invoices does an item returned at delivery because between the time it are printed, drivers are dispatched and deliveries commence. was ordered and the delivery it was decided the product really Drivers and the Transportation Department interact to manage was not needed. Are you ordering for delivery on a regularly each route from Stop 1 to completion, no small job in itself. scheduled delivery day? Do you make the cutoff times for next There are systems involved in every step of all of these proday delivery? Both of these questions are often overlooked cesses that help maintain standards in all departments that but when orders are received after the cutoff times or are are checked and adjusted as needed and any error is analyzed being shipped on an â&#x20AC;&#x153;Off Dayâ&#x20AC;? it puts a lot of pressure on and studied to drive results. There is a Purchasing Department many departments and lessens the chance of a perfect order. where we must make sure we buy the right quantity at the Everyone gets the best outcome when deliveries are kept to right price and coordinate those purchases with Operations, regularly scheduled delivery days and orders are in the system Logistics and hundreds of manufacturers and carriers. We by the cutoff times. also have to manage all of the inventory, not the least of which There is a lot more that can be discussed but my hope is to is counting it and making sure it is stored at the correct temshed light on what makes a perfect order possible. Running a perature and rotated properly. There are hundreds of people Foodservice establishment is a tough job. It is why we strive to every day that work to make sure orders are perfect on the make every order the â&#x20AC;&#x153;Perfect Orderâ&#x20AC;?. distributor side and it is an ongoing process! 29


GGEnUInE EnUInE BarbEqUE BarbEqUE ROoTED ROoTED In In CrafT. CrafT.

PEcANwoOD sMOKEd St. LOUIS RIbs

SmoKy. saVORy. GEnUInEly diStINCTIvE. Our pecanwood smoked barbeque items are prepared the way you would do it back of house â&#x20AC;&#x201C; if you had the time, the equipment, and an experienced pitmaster ensuring every batch was consistently perfect â&#x20AC;&#x201C; with no short cuts.

These ribs feature an enticing mahogany color, visible rub and a distinctive exterior bark achieved only when slow-smoked to perfection â&#x20AC;&#x201D; plus a deep, smoky taste and ďŹ rm yet tender pull-from-the-bone texture.

â&#x20AC;˘ Genuine barbeque inspired by simple ingredients and classic slow-smoke preparation. â&#x20AC;˘ Competition-quality taste & texture created by select spices and 100% pecanwood smoking. â&#x20AC;˘ Add a signature sauce, or a unique rub â&#x20AC;&#x201C; or serve these items â&#x20AC;&#x153;as is.â&#x20AC;?

PEcANwoOD sMOKEd POrk SHOulDER

â&#x20AC;˘ Take your barbeque where you want it to go: classic, urban, upscale, down-home.

Whether you pull it or shred it, this pork shoulder is skillfully crafted, allowing the smoke to penetrate deeply for a more intense smoke profile. This technique is complemented by a savory barbeque rub that further enhances its balanced flavor.

â&#x20AC;˘ Create distinctive appetizers, sandwiches, soups and center-of-the-plate items.

NEW ITEM #

BBQ Pecanwood Smoked St. Louis Style Ribs fully cooked, frozen, trans fat free 461197.....12/1.69 lb

NEW PACK SIZE

BBQ Pecanwood Smoked  SF  OE DYJ Pork Shoulder frozen, trans fat free 461222.....2/5 lb

&RQWDFW 0DUF 'L)DELR DW  RU PDGLIDELR#KRUPHOFRP

Š2015 Hormel Foods, LLC

30


G e n U i n E

B A r B E q u E

E S t a B L I S H e d

1 9 9 8

CoMpeTITION-QUAliTy BaRbEQuE ThAT gIVes yOu AN uNFAIR AdVanTaGe. Get real, genuine, slow-smoked barbeque – in just minutes. New AUSTIN BLUES® St. Louis RibsBOEPork Shoulder. Each prepared with a savory barbeque rub and slow-smoked over 100% pecanwood.

31


Products ITEM#

DESCRIPTION

PACK

347428

PORK CHOP C/C B/I, FRESH

20 7 oz

296026

PORK CHOP C/C B/I, FRESH

20 8 oz

299920

PORK CHOP C/C B/I, FRESH

16 10 oz

296025

PORK CHOP C/C B/I, FRESH

10 16 oz

296267

PORK CHOP C/C FRNCHD, FRESH

27 6 oz

299110

PORK CHOP C/C FRNCHD, FRESH

20 7 oz

296024

PORK CHOP C/C FRNCHD, FRESH

20 8 oz

296007

PORK CHOP C/C FRNCHD, FRESH

16 10 oz

296006

PORK CHOP C/C FRNCHD, FRESH

14 12 oz

296005

PORK CHOP C/C FRNCHD, FRESH

12 14 oz

420470

PORK CHOP C/C FRNCHD, 2 BONE, FRESH

10 16 oz

334729

PORK CHOP C/C FRNCHD, FRESH

10 16 oz

464518

PORK 5 RIB RACK 10 BONE C/C, FRESH

4 5 lb

464513

PORK LOIN BNLS C/C STRAP ON, FRESH

6 8 lb

471043

PORK RIB BACK PLD, FROZEN

10 2.75 lb avg

464540

PORK RIB ST LOUIS, FRESH

12 3.5-3.6

471465

PORK RIB ST LOUIS, FROZEN

12 3.75 lb

464541

PORK TNDRLN FRESH

12 .1.25 lb

332676

PORK CHOP C/C 2 BONE, FRESH

10 20 oz

472523

PORK LOIN B/I 12 RIB CHINE BONE, FRESH

4 13 lb

296027

PORK LOIN C/C 8 BONE, FRESH

4 9 lb

305867

PORK PORTERHOUSE, FRESH

27 6 oz

458780

PORK PORTERHOUSE, FRESH

24 7 oz

296795

PORK CHOP E/E B/I, FRESH

27 6 oz

296796

PORK CHOP E/E B/I, FRESH

20 8 oz

348700

PORK CHOP E/E B/I, FRESH

10 16 oz

32

SIZE

Special Order

Special Order


ALLEGIANCE FRESH PORK

Unsurpassed Taste and Tenderness

A Pledge of Superiority AllegianceÂŽ Premium Pork is the highest level of pork available in the United States. The Allegiance name makes a bold statement that all involved in the brand have a pledge to be in alignment to deliver the most consistent and exquisite tasting pork in the foodservice industry. Allegiance comes from the top 20 of hogs available in the U.S. and enjoys the KLJKHVWVSHFLĂ&#x20AC;FDWLRQVLQWKHLQGXVWU\$OOHJLDQFHLVIURPDVLQJOHVRXUFH0LGZHVWIDPLO\ IDUPDQGDVLQJOHVRXUFHSDFNHU7KLVFRXSOHGZLWKRXU3DWK3URYHQÂŽSURJUDPHQVXUHV WKHKLJKHVWTXDOLW\JUHDWPDUEOLQJDQGIRUNWHQGHUGHOLFLRXVWDVWH²DOOPDNLQJIRUDQ incredible eating experience.

Additional important Allegiance attributes â&#x20AC;˘ 'XURFEDVHGJHQHWLFVSURGXFHKLJKO\PDUEOHGWHQGHUSRUN â&#x20AC;˘ 3URGXFWLVKDQGVHOHFWHGEDVHGRQGHPDQGLQJFRORUDQGPDUEOLQJFKDUDFWHULVWLFV â&#x20AC;˘ 6WULFWVSHFLĂ&#x20AC;FDWLRQVJRYHUQLQJDQLPDOIHHGDQGPHGLFLQHVHQVXUHTXDOLW\9DULRXV â&#x20AC;&#x153;negativeâ&#x20AC;? feed ingredients and medicines are prohibited. â&#x20AC;˘ Allegiance is the most consistent pork available on the market. â&#x20AC;˘ 6SHFLĂ&#x20AC;FDWLRQVIURPWKHIDUPWRWKHSURFHVVRUVDUHHVWDEOLVKHGE\3)* â&#x20AC;˘ 3URGXFHUVDQGSURFHVVRUVDUHWKLUGSDUW\DXGLWHGWRHQVXUHFRPSOLDQFHZLWK3)* VSHFLĂ&#x20AC;FDWLRQV â&#x20AC;˘ 'HGLFDWHGIDPLO\IDUPDQGVLQJOHVRXUFHIRUWKHSURFHVVRUHQVXUHVWKDWWKHJHQHWLFV IHHGSURGXFWLRQV\VWHPVDQGSURFHVVLQJWHFKQLTXHVQHYHUYDU\ â&#x20AC;˘ $OOHJLDQFHLVRZQHGE\3)*DQGQRERG\FDQHYHUFKDQJHDQ\WKLQJDERXWWKH SURGXFWZLWKRXWWKHDSSURYDORI 3)* â&#x20AC;˘ Allegiance is dedicated to sustainability.

33


34


DESCRIPTION Oven Roasted Browned Turkey Breast, skin on Oven Roasted Natural Turkey Breast, boneless, skinless Oven Roasted Smoked Turkey Breast, skin on Roast & Serve Turkey Breast, skin-on, pan style, fully cooked

BRAND Ridgecrest Ridgecrest Ridgecrest Ridgecrest

METRO # 891757 891769 891766 87377

PACK SIZE 2/9 lb 2/9 lb 2/9 lb 2/9 lb

Turkey Breast, ready to cook, in foil, frozen Oven Roasted Turkey Breast, skinless Oven Prepared Turkey Breast, skinless Oven Roasted Smoked Turkey Breast, skinless Oven Roasted Turkey Breast, browned, in oil, skinless Turkey Breast, browned, skinless Turkey Ham

Ridgecrest Silver Source West Creek West Creek West Creek West Creek West Creek

891756 891746 891752 891751 891753 296664 296661

2/10 lb 2/9 lb 2/9 lb 2/9 lb 2/9 lb 2/9 lb 2/8 lb


Campbell’s® Reserve Ready-to-Eat Frozen Pouch 4/4 lb. Pouch Yields Approximately 256 fl. oz. Broadway Basil & Tomato Bisque

Roasted Red Pepper & Smoked Gouda Bisque

PFS No. 426069

PFS No. 888199

MFG No. 21081

This satiny bisque is made with a puree of vine-ripened red tomatoes blended with heavy cream and onions simmered in real chicken stock, then finished with sweet basil.

MFG No. 16835

A rich, velvety bisque of purÏed roasted red bell peppers paired with smoked Gouda, sweet basil leaves, crushed garlic and fresh cream.

Kickin' Crab & Sweet Corn Chowder

Roasted Poblano & White Cheddar Soup With Tomatillos

PFS No. 424982

PFS No. 426097

MFG No. 21082

 

MFG No. 21115

Fire-roasted poblanos, green chilies and tangy tomatillos complement the rich blend of sharp white Cheddar and sweet cream, finished with a refreshing squeeze of lime.

A creamy chowder made with tender crab, sweet corn and green bell peppers, finished with brandy and a dash of TABASCO® Pepper Sauce.

Chicken With Egg Noodle Soup

Jambalaya With Chicken, Sausage & Ham

PFS No. 426094

PFS No. 426074

MFG No. 21085

MFG No. 21083

A hearty Creole-style classic featuring long grain rice, chicken, smoky sausage, ham, onions and green bell peppers simmered in a tomato-infused chicken stock.

The original comfort soup features tender egg noodles, white meat chicken, chunky carrots and celery simmered in a rich chicken stock seasoned with garlic, thyme and a dash of black pepper.

Wicked Thai Style Chicken & Rice Soup PFS No. 424584

Soup Statistics

An exotic blend of chicken, rice, peppers and aromatic spices enhanced with the flavor of lemongrass, cabbage, shiitake mushrooms, sliced chives and rice.

Entrée

9% Side Dish

MFG No. 20805

Appetizer

15%

10% Side Dish

17%

Appetizer

23% Entrée

26%

58%

of consumers order soup at lunch

42%

of consumers order soup at dinner

Served at Lunch Served at Dinner

Wicked Thai Style Chicken Soup

Technomic, Inc. 2014, The Left Side of the Menu: Soup & Salad Consumer Trend Report

36


Campbellâ&#x20AC;&#x2122;sÂŽ Signature Ready-to-Eat Frozen Pouch

Italian Style Wedding Soup PFS No. 477957

4/4 lb. Pouch Yields Approximately 256 fl. oz.

MFG No. 22963

A savory classic made with acini di pepe pasta, classic Italian meatballs and spinach in a rich chicken stock.

Southwestern Vegetarian Chili

Hearty Beef Chili With Beans

PFS No. 426599

PFS No. 353693

MFG No. 20602

A satisfying bean chili loaded with tomatoes, corn, carrots, peppers and four types of beans in a spicy broth seasoned with chili powder and smoked paprika.

MFG No. 20300

Boasting a complex blend of spices and a specially crafted blend of chili powders, this flavorful seasoned beef chili would make Southern chili cook-off judges proud.

Harvest Butternut Squash

Vegan Vegetable Soup

PFS No. 396166

PFS No. 374880

MFG No. 20597

Rich butternut squash simmered with cream and a blend of warm spices including ginger, cinnamon and nutmeg.

MFG No. 20600

Made with carrots, tomatoes, Great Northern beans and red lentils, this hearty home-style soup is slow-simmered with aromatic herbs and a dash of balsamic vinegar for a sweet, savory flavor.

Italian Style Wedding Soup

For further information, samples or product demonstrations, please contact: Anthony Palermo | (732) 567-1197 | apalermo@acosta.com Jose Alfaro | (708) 426-8526 | jalfaro@acosta.com Joe Youngs | (201) 446-3553 | jyoungs@acosta.com

www.acostafoodservice.com

37


DANISH Mini Filled Danish, variety pack; Chocolate-Orange, Black Currant-Apricot, Custard Cream Dèlifrance®.....450662.....120/1.23 oz

CROISSANTS

BRAND

METRO #

NEW! Mini Butter Chocolate Croissant, ready to bake

White Toque

451052

PACK/SIZE 120/.88 oz

NEW! Multigrain Butter Croissant, ready to bake

White Toque

279178

55/2.82 oz

NEW! Mini Multigrain Butter Croissant, ready to bake

Dèlifrance®

450624

100/1.06 oz

Mini Plain Croissant Dough

White Toque

395207

200/.88 oz

Croissant Dough, buttered

White Toque

381857

72/2.82 oz

Butter Croissant, ready to bake Dèlifrance®........../.4 oz

Feuille de brick Pastry Dough White Toque 370583.....50/10 ct

Variety Assortment Filled Churros caramel & chocolate

La Toca Blanca 450950.....2/4 lb

Originating in Morocco, this thin, crispy dough is malleable for unique presentations. Use in sweet or savory applications. Can be baked, deep-fried or pan fried. 38

Chopped Spinach frozen

White Toque 451053.....12/3 lb


Difficulty: Easy

Ingredients 1 box Kosher salt (3 lb) 1 cup Roland Sriracha Chili Sauce Metro NY # 229380......12/28 oz

recipe

Sriracha Salt

Directions 1. Combine salt and Sriracha Chili Sauce in a bowl. Mix thoroughly 2. Spread mixture evenly onto a parchment lined sheet pan. 3. Allow to dry for 7-10 days. Break up any clumps daily to allow for even drying.  )RUDĂ&#x20AC;QHUĂ&#x20AC;QLVKHGSURGXFWFKRSLQIRRGSURFHVVRU

Also try! DESCRIPTION Fleur de Sel Sea Salt Fleur de Sel Sea Salt Course Sea Salt Fine Sea Salt Fine Sea Salt

METRO # 330942 865206 972724 972726 982418 39

PACK/SIZE 1/8.8 oz 6/8.8 oz 12/26.5 oz 12/26.5 oz 1/12.5 kg


40


Our Lobster

Harvested from pristine Maine coastal waters,

only the most succulent lobster are processed at the peak of sweetness. With a fresh-from-the-sea taste, our lobster products are ready to eat, with absolutely no preservatives.

Lobster Meat claw, knuckle, dry packed, Maine USA 409845.....6/2 lb

Lobster Meat claw, knuckle, leg, dry packed, Maine USA 409846.....6/2 lb

41


AVOCADO

A L L T R A N S FAT F R E E Avocado Halves Guacamole Hot N Spicy 998089.....4/3 lb

59652.....12/1 lb

Chunky Avocado Pulp Guacamole Western Stylee 45257.....12/1 lb

46113.....12/1 lb

42


Import S p e c i a lt y f o o d

Stuffed Grape Leaves with Rice 354971.....6/70 oz

Cocktail Onions 994257.....12/32 oz 857851.....1/1 qt

Queen Green Olive Stuffed

Saffron

354758.....1/1 oz

51947.....4/1 gal

ambrosia

metro #

Pack/size

ambrosia

metro #

Pack/size

Manzanilla Olive, Pitted, Cocktail trans fat free Manzanilla Olive, pitted, cocktail, split

862528 861860

12/1 qt 1/1 qt

Sliced Water Chestnuts, trans fat free

337488

6/#10

Queen Green Olive Pitted, 100-110 ct., trans fat free 861205

4/1 gal

Green Olives Stuffed with Pimento

417804

4/1 gal

Manzanilla Olive, stuffed, trans fat free

862529

4/1 gal

Pack/size

862527

4/1 gal

Colmans

metro #

Salad Olives Cocktail Onions, split

857851

1/1 qt

Dry Mustard, English Original

71863

12/16 oz

Sliced Water Chestnuts, trans fat free

337488

6/#10

6XSHUĂ&#x20AC;QH0XVWDUGWUDQVIDWIUHH

54177

1/1 lb

Green Olives Stuffed with Pimento

417804

4/1 gal


FROM DELI MEATS TO BACON TO GROUND TURKEY, WE MAKE IT EASY TO EAT WELL.

Turkey Canadian Ham sliced, frozen 28619.....8/3.12 lb

Turkey Canadian Ham .5 oz, frozen 126872.....12/1 lb

Turkey Ham 25% water added, extra lean, frozen 57814.....2/8 lb

Turkey Breast oven roasted, reduced sodium, fully cooked, frozen 324509.....4/9.6 lb

Smoked Turkey Franks 8/1, reduced sodium 435732.....2/5 lb

Turkey Bacon 50 ct, fully cooked, sliced 391236.....6/9.33 oz Turkey Bacon extra lean, fully cooked 2701.....10/1 lb

44

ALSO TRY... Turkey Pepperoni sliced, seasoned, frozen 263614.....6/2 lb


The latest thing in burgers is in our burgers.

DESCRIPTION

VENDOR CODE

METRO #

PACK/SIZE

Beef Patty,frozen, stuffed portobello & white mushrooms, diced onions, white wine sauce and Swiss cheese Beef Patty, frozen, stuffed diced jalapenos and nacho cheese

74525

461720

20/8 oz

74535

461722

20/8 oz

$ OPERATOR

PROMO

EARN $7 PER CASE UP TO $100 ON STUFFED BURGERS! Get $7.00 off each case ordered, up to $100 total per operator on qualified items. *Paid in USD. This offer is valid until December 31st, 2015. Only foodservice operators purchasing this product through foodservice distributors are eligble for this offer. See back for details.

45


EARN $7 PER CASE UP TO $100 ON STUFFED BURGERS! Stuffed Burger Product Line Product Description

Code

Portion

Count

Case Weight

Stuffed Nacho Jalapeño

74535

8 oz. / 227g

20

10.00 lbs. / 4.5kg

Stuffed Philly-Style

74515

8 oz. / 227g

20

10.00 lbs. / 4.5kg

Stuffed Mushroom

74525

8 oz. / 227g

20

10.00 lbs. / 4.5kg

Diced Jalapeños and Nacho Cheese

Soft & Creamy White American Cheese with Green Peppers and Onions

Portobello & White Mushrooms, Diced Onions, White Wine Sauce and Swiss Cheese

Get $7.00 off each case ordered, up to $100 total per operator on qualified items. *Paid in USD. This offer is valid until December 31st, 2015. Only foodservice operators purchasing this product through foodservice distributors are eligble for this offer. See above for qualifying products. To receive rebate, fill out the coupon below. Attach your distributor invoice (or distributor reports) as proof of purchase and mail to: AdvancePierre Foods • Coupon Rebates • P.O. Box 5498 • Enid, OK 73702 Coupon must be postmarked by January 31, 2016. Please allow at least 6 weeks for return payment by check, made payable only to end user. No consolidated payments to distributor allowed. Offer valid to individual foodservice establishments, one request per location only. Invoices submitted with this rebate not valid with any other offer. Offer does not apply to bid, military or contract accounts. For additional rebate information please call 1.888.723.8237. Rebate offer per foodservice operator customer only.

Establishment:______________________________ Type of Establishment:__________________________________ Food Purchaser:_____________________________ Title:__________________________________________________ Phone No.:_________________________________ Fax No.:_______________________________________________ Mailing Address:____________________________ City, State and Zip Code:_________________________________ Email Address:_____________________________________________________________________________________ Total Cases Ordered:_____________________ x $7.00 = Total Rebate Amount: $___________________________ (Maximum $100.00 Per Operator.) PRG #: 196956

9987 Carver Rd. Suite 500 Blue Ash, OH 45242 www.advancepierre.com 1.800.317.2333 091615CG1 © 2015 AdvancePierre Foods

46


Mac Pearce Greatly Missed Honored Posthumously by IFDA for Industry Leadership /:8LXPU^$:5GV?^/\UV:J^V?:^ 2K@Y:PU@V\^L<^/MXV?^5PLF@K5^ /8?LLF^L<^#LV:G^.:UV5XP5KV^5K9^0LXPAUJ^*5K5>:J:KV^ 5K9^V?:^L5P9^L<^V?:^#5RY:UV^$LN:^!LL9^5KE^@K^ "P::KY@GF:^/ ^ :K@U:^$LFG5K9^V?:^;LL9^75KEU^ ,^9:U8PA7:9^*P ^ -:5P8:^5U^5^85P@K>^<P@:K9^VL^V?:^N:LNF:^?:^EK:Z^7XV^5GUL^ 5U^5^N:PULK^ZAV?^5^9::N^8LJJAVJ:KV^VL^V?:^;A>?V^5>5@KUV^ ?XK>:P 0?5V^8LJJAVJ:KV^VLX8?:9^V?:^GAY:U^L<^J5K\?:^ 9@9K V^EKLZ ^#LGF5K9^U5@9^V?5V^V?:U:^Z:P:^U::9U^NF5KV:9^ 7\^?AU^;5J@G\^Z?L^?5Y:^UXNNLPW:9^$5PY:UV^#LN:^<LP^J5K\^ \:5PU ^ JLK>^?AU^J5K\^8LKVPA7XVALKU^#LGF5K9^U5A9^V?5V^+P ^ 3@FGA5J^*8!5GG^-:5P8:^EKLZK^5U^+58^7\^;P@:K9U^5K9^ 8LFG:5>X:U^V?PLX>?LXV^V?:^@K9XUVP\^Z5U^NLUV?XJLXUF\^

-:5P8:^7PLX>?V^?AU^FA;:GLK>^<LL9^AK9XUVP\^UE@FGU^VL^V?:^;LL9^ 75KE ^*58^Z5U^5^NAGF5P^L;^G:59:PU?@N^U?5PAK>^7:UV^ NP58VA8:U^Z@V?^#5PY:UV^$LN:^VL^?:FN^J::V^LXP^9@UVPA7XV@LK^

?LKLP:9^LK^(5KX5P\^^9XP@K>^V?:^NP:U:KV5VALK^L;^V?:^ ^%!^LPK:PUVLK:^Z5P9 ^+P ^ -:5P8:^Z5U^NP:U@9:KV^

?59^K::9:9^:OXANJ:KV^UX8?^5U^<LPE^GA;WU^N5GF:V^C58EU^5K9^

9:J5K9U^ $LGF5K9^U5@9 ^#:^U5Z^VL^AV^V?5V^$5PY:UV^#LN:^ ;GLLP^U8PX77:PU^@K^599@V@LK^VL^5^>P:5VF\^ZAU?:9^<LP^VP58VLP^

L<^-:R;LPJ5K8:^!LL9U:RY@8:^5V^V?:^VAJ:^L;^?@U^9:5V?^AK^ /:NV:J7:P^ ^#AU^ZA;:^/@9K:\^95X>?V:P^/5P5^ GF@U^5K9^

VP5AG:P^5K9^5KLV?:P^UJ5GF:P^VPX8E ^$:^Z5U^5FUL^V?:P:^Z@V?^ >@<WU^L;^JX8?^K::9:9^<LL9^5K9^;XK9U^ %K^9@U8XUU@K>^*P ^-:5P8:U^Y5FX57G:^8LKVP@7XV@LKU^

ULK^+8!5GG^5U^Z:GF^5U^LV?:P^<5JAF\^J:J7:PU^5VW:K9:9^V?:^ NP:U:KV5VALK^?:G9^5V^V?:^%!^-5PWK:PU^ [:8XV@Y:^!LPXJ ^

V?PLX>?^%!^GG:K^P:J:J7:P:9^?AJ^5U^5^UVPLK>^ 59YL85V:^;LP^V?:^<LL9U:PY@8:^9AUVP@7XV@LK^@K9XUVP\^5K9^<LP^

+58^Z5U^5^>P:5V^;P@:K9^VL^LXP^@K9XUVP\^5^Y5FX:9^ J:J7:P^L;^V?:^&!^L5P9^L;^@P:8VLPU^5K9^Z:^Z5KV^VL^ N5\^VP@7XV:^VL^?AU^J:JLP\^5K9^P:8L>KA]:^?AU^J5K\^

?@U^8LJN5K\^Z?:K^?:^85J:^VL^35U?AK>VLK^ ^

8LKVP@7XV@LKU^ U5@9^%!^?5APJ5K^0LJ^45VAK5^@K^LN:K@K>^ P:J5PEU^5V^V?:^75KOX:V ^ 1?:^'!^LPK:PUVLK:^Z5P9^Z5U^:UV57F@U?:9^JLP:^

+58^:KDL\:9^E::N@K>^57P:5UV^L<^Z?5V^Z5U^?5NN:KAK>^ @K^35U?AK>VLK^5K9^V?:^NLF@V@8U^L<^AV^ U5@9^FH:K ^#:^Z5U^ LK^VLN^L<^5K\^G:>AUG5VBLK^LP^P:>XF5VALKU^V?5V^8LXG9^?5Y:^5K^

V?5K^5^9:859:^5>L^VL^P:8L>K@]:^VPXF\^:[8:NVALK5G^AK9XUVP\^ G:59:PU^ 5K9^*58^Z5U^UXP:F\^L;^V?5V^P5KE^ U5@9^*5PE^

@JN58V^LK^V?:^7XU@K:UU^

^ 5K9^VLLE^V?:^V@J:^VL^9:Y:GLN^ P:F5VALKU?@NU^Z@V?^?AU^F5ZJ5E:PU 1?5V^85K^;::H^F@E:^5K^

GF:K^%!U^NP:U@9:KV^5K9^ ,^Z?L^NP:U:KV:9^V?:^ 5Z5P9 ^ *58^Z5U^5K^:[8:NVALK5G^G:59:P^AK^?@U^8LJJXK@V\^

XN?@FG^75VVF:^5V^VAJ:U^7XV^+58^Z5U^5FZ5\U^V?:P:^LK^V?:^ ;PLKV^F@K:^J5E@K>^UXP:^V?:^8LK8:PKU^L<^?AU^8LJN5K\^Z:P:^ 7:@K>^?:5P9^

5K9^@K^?AU^PLG:^5U^NP:UA9:KV^L<^-:R=LPJ5K8:^!LL9U:PYA8:^ 5K9^Z5U^?:F9^AK^Y:P\^?@>?^:UV::J^7\^J:J7:PU^L;^V?:^

%K^9@U8XUU@K>^-:5P8:U^F:59:PU?@N^GI:K^U?5P:9^5^ J:JLR\^L;^V?:^%!^L5P9^ZLPE@K>^LK^5^8?5FG:K>AK>^

%!^L5P9^L;^@P:8VLPU ^!LP^J:^N:PULK5GG\^  *68^Z5U^ 5FZ5\U^AK8P:9A7G\^?:FN;XF^5K9^>:K:PLXU^Z@V?^?@U^8LXKU:G^

@K9XUVT^@UUX:^LY:P^5^KXJ7:P^L;^JLKV?U ^+58^NPLYA9:9^5^ UV:59\^>X@9AK>^?5K9^5U^Z:^ZLPE:9^VL^<LPJXF5V:^LXP^ NLU@V@LK^5K9^NF5K^L<^58VALK ^%K^5^>:KVF:^7XV^<@PJ^J5KK:P^ *58^Z5U^5^G:59:P^AK^9P@Y@K>^V?:^5UUL8@5V@LK^VL^8LKU:KUXU^

5K9^VAJ:^ .:8LGF:8V@LKU^L<^5^KXJ7:P^L<^8LGF:5>X:U^Z:Q:^U?5P:9^ 9XPAK>^V?:^NP:U:KV5V@LK ^":LP>:^#LHJ^ ,^L<^ -:P<LPJ5K8:^!LL9^"PLXN^Z5U^P:UNLKU@7F:^;LP^7PAK>@K>^

5K9^9A9^AV^@K^5^Y:P\^XK5UUXJAK>^Z5\^ U5@9^FG:K ^$:^

*P ^-:5P8:^@KVL^?@U^PLG:^5V^V?:^8LJN5K\^5K9^9:U8P@7:9^ ?AJ^5U^5K^:[VP5LP9AK5P\^J5K^Z?L^Z5U^5U^8LJ;LS57G:^AK^ V?:^7L5P9PLLJ^5U^?:^Z5U^ZAV?^>X\U^ZAV?^Z?LJ^?:^U?5P:9^

7PLX>?V^5^GLV^L;^8LJJLK^U:KU:^5K9^?@UVLPA85G^N:PUN:8VAY:^ VL^V?LU:^9@U8XUU@LKU^5K9^Z:^Z:P:^7:VV:P^L<=^5U^5^P:UXFV^L;^ ?@U^G:59:PU?AN^LK^V?5V^AUUX:^

V@J:^P@9@K>^JLVLP8\8F:U ^#:^Z5U^5^F:59:P^Z@V?@K^V?:^ :[:8XVAY:^V:5J^7XV^Z5U^5GUL^57G:^VL^:5U@G\^8LKK:8V^Z@V?^

XK9:PUVLL9^V?5V^?:^Z5U^5^VPX:^>:KVF:J5K ^%^UN:5E^;LP^

V?:^P5KE^5K9^;@F:^5V^V?:^9AUVPA7XVALK^8:KV:P ^

J5K\^Z?:K^%^U5\^Z:^Z:P:^V?5KE;XH^VL^?5Y:^EKLZK^?@J^

%K^8LK8GX9@K>^FG:K^U5A9^K\LK:^Z?L^EK:Z^*58^

5K9^V?5KE<XF^V?5V^?@U^<5JAG\^5K9^UL^J5K\^L<^?@U^7XU@K:UU^ 8LHG:5>X:U^5K9^;PA:K9U^8LXG9^7:^?:P:^VL^?LKLP^?@J ^+58^AU^

3@V?@K^?AU^8LJJXK@V\^+P ^-:5P8:^U:RY:9^LK^V?:^L5P9^ L;^@P:8VLPU^L;^V?:^2P75K^):5>X:^L;^V?:^2NUV5V:0 ?:^LK^

JAUU:9^

Virginia

47


6ZHHWDQGVDOW\ùDYRUSOXV$/$RPHJDIURPFKLD PDNHXSRQHGHOLFLRXVO\QXWULWLRXVFKHZ\JUDQRODEDU \ \J Chocolate Almond mond & Sea Salt with h Chia chewy granola bars ars 460012.....72/1.23 23 oz

:KROHJUDLQVGDUNFKRFRORDWHWDUWUHGFKHUULHVDQG URDVWHGQXWVPDNHIRUDEDUZLWKUHDO\XPP\JRRGQHVV Cherry Dark Chocolate chewy granola bars 869013.....72/1.23 oz

48


You don’t get a second chance to impress your guests Superb service and fabulous flavor will appeal to new customers and keep regulars coming back for more.

Grades do count! Reduce your risk of offering a slightly tough or tougher steak.

Certified Angus Beef ® Brand

1 in 50

USDA Choice

1 in 13

USDA Select

1 in 6

Source: Oklahoma State University, 2004 Journal of Animal Science

The Certified Angus Beef ® brand reduces the odds of a tough steak by nearly 300% over USDA Choice.

That’s flavor and quality you can take to the bank.


Flavorful Dressings. Uncomplicated Ingredients. Proudly presenting PURE KRAFT Dressings—five delicious refrigerated ed dressings specifically created with noo artificial preservatives, colors or flavors ors for authentic chef-made flavor. Pure Mayonnaise no corn syrup, no artificial flavors, colors, preservatives 461223.....4/1 gal

Pure Aged Asiago Caesar pourable, no corn syrup, no artificial 437403.....4/1 gal

Pure Farmhouse Ranch pourable, no corn syrup, no artificial 437402.....4/1 gal

Pure Country Creamy Aged Balsamic Vinegar & EVOO Dressing pourable, no corn syrup, no artificial flavors, colors, preservatives 437406.....4/1 gal

50


Versatile Pasta For Endless Possibilities 速

Penne

Campanelle

gluten free Metro # 401766 12/12 oz

Metro # 382712 12/16 oz

Cellentani Cavatappi

Orecchiette Metro # 466453 9/35 oz

Metro # 282076 2/10 lb

Conchiglie Rigate

Pipette Metro # 865405 2/10 lb

trans fat free Metro # 31317 2/10 lb

THE CHOICE OF ITALY速 51


Harvest Ranch 461163.....64 ct/1.375 oz

Smokehouse BBQ 230074.....64 ct/1.375 ozz

Meyer Lemon & Rosemary 461157....64 ct/1.375 oz For marketing assistance and samples please contact Karen Coigne / Karen.Coigne@pepsico.com (215) 292-1219

Jalapeno 230092.....64 ct/1.375 oz Sea Salt & Vinegar Original Recipe Sea Salt 230091.....64 ct/1.375 oz 230072.....64 ct/1.375 oz

Also Try!

Variety Pack: Sea Salt & Vinegar, Jalapeno, Smokehouse BBQ and Original Seasalt 885514.....60 ct/1.37 oz


Turkey Burger Patties, ready to cook, frozen ..................................... Perdue ........... 119890 ...... 30/5.3 oz Woodfire Grill Turkey Burger, ready to cook, frozen ........................... Perdue ........... 285478 ...... 40/4 oz Mediterranean Turkey Patties, ready to cook, frozen ......................... Perdue ........... 887394 ...... 30/5.3 oz Wood Fire Grill Homestyle Turkey Patties, ready to cook, frozen ...... Perdue ........... 909249 ...... 30/5.33 oz Turkey Burger Patties, white meat, ready to cook, frozen.................. Perdue ........... 916298 ...... 40/4 oz Turkey Patties, white meat, ready to cook, frozen ............................. Perdue ........... 989701 ...... 30/5.3 oz Turkey Franks 8-1, frozen ................................................................... Perdue ........... 77349 ........ 2/5 lb Turkey Sausage Patties, frozen .......................................................... Perdue ........... 979958 ...... 107/1.5 oz Turkey Sausage Links Raw 1 oz......................................................... Perdue ........... 985418 ...... 1/10 lb

TURKEYSatisfy With Less Fat

Italian Turkey Meatballs .5 oz ............................................................. Perdue ........... 907654 ...... 2/5 lb Turkey Breast, skinless, oven roasted ................................................ Perdue ........... 415105 ...... 2/9-11 lb Turkey Patty, trans fat free, ready to cook, frozen .............................. Shenandoah .. 329245 ...... 40/4 oz Sausage Turkey Link, mild, fully cooked, frozen ................................ Shenandoah .. 979959 ...... 160/1 oz Ground Turkey 80/20, frozen .............................................................. Shenandoah .. 992428 ...... 2/10 lb

Also Available... Jumbo Chicken Wing, 3 oz, fully cooked, individually quick frozen .......... Perdue ....... 438260 .......... 2/4.5 lb Jumbo Chicken Wings, steamed, frozen ................................................... Perdue ....... 870348 .......... 2/5 lb Chicken Breast Chunks, boneless, fully cooked, frozen ............................ Perdue ....... 275876 .......... 2/5 lb Breaded Chicken Nugget, fully cooked, frozen, dinosaur shape ............... Perdue ....... 939032 .......... 2/5 lb Whole Cornish Hen, without giblets ........................................................... Perdue ....... 997025 .......... 24/20 oz 53


IN THE DRIVER’S SEAT Performance ce F Foodservice-Metro oodservice-Metro N NY YH Honors onors Drivers with 5-10-15 year Accident-free Record It was only 10 years ago that Hamid Sarmadi introduced a driver safety rewards program to recognize Performance Foodservice-Metro NY drivers who maintained an accident-free driving record for each year. In 2005, 18 drivers out of about 50 had no accidents at all. Today, 85 drivers out of 135 can say the same. he story these numbers tell is that we have improved our safety record from 36 percent of our drivers having a perfect driving record in 2005 to 63 percent in 2015,” says Hamid Sarmadi, Safety Claims Manager at Performance Foodservice-Metro NY. “We are very proud of our drivers’ accomplishments and are excited to honor 15 of them this year for having a 5-10-15 year accident-free record.” Washington Avellaneda, Director of Transportation and Hamid Sarmadi, Safety Claims Manager

Michael Acevedo, Lloyd Adams, Hugo Almada, Mario Biondi, Fausto Brito, Patrick Cordial, Anthony Delchop, Kirk Faines, Alfonso Farmer, William Biondi, Otis Jennings, Jacek Szeszol, Allen Rice, Wesley Martins, Jeffrey Young have been awarded a special plaque and jacket, along with a cash reward at a special ceremony with Chuck Cuomo, CEO Region President; Michael Irwin, Metro NY President; Joe Monteleone, VP of Operations; Washington Avellaneda, Director of Transportation and Hamid Sarmadi. The Accident-Free Recognition Program is only one of many elements that constitute the driver safety program at Performance Foodservice-Metro NY.

Anthony Delchop 54

Kirk Faines


In addition to participating in quarterly driver safety meetings, drivers are required to complete a Pure Safety Program on a monthly basis. This online educational program covers various safety-related topics and requires that all drivers complete the interactive course modules. This past year we installed cameras in all of our entire vehicles. A program called Drive Cam monitors day all events that occur in a vehicle 24 hours a day. Each event is recorded and reviewed by a trained specialist to analyze and advise if an unsafe act has occurred. This event is then sent to transportation to review and coach the driver on improving his driving behavior, thus creating a safer delivery driver.

Michael Acevedo

Mario Biondi

Alfonso Farmer

Otis Jennings

Some of the topics covered include defensive driving techniques for large vehicles, extreme driving conditions, safe backing and turning, Department of Transportation compliance, and much more. Drivers are also encouraged to share their own experiences with their peers to discuss valuable lessons learned from real-life situations. “Another critical component of our safety program is our new Hire Safety Orientation Program,” says Hamid who is responsible for developing and implementing environmental and occupational health and safety programs for the company. “Our number one concern is the safety of our associates and the communities where we work.”

Lloyd Adams

Jacek Szeszol

Hugo Almada

Allen Rice

Fausto Brito

55

Patrick Cordial

Westley Marins

William Biondi

Jeffrey Young


PAM® Grilling Spray PA PA Grilling No-Stick Cooking Spray is a water/canola blend (emulsion) with no PAM added soy lecithin, specially formulated to perform at high temperatures. PAM ad Grilling offers trusted non-stick performance that helps address the allergen and Gr health concerns of today's patrons. Special tip: make cleanup easier by spraying PAM he Grilling on your grilling utensils! Allergen Free and contains no Soy! Gr Item #: 470394 Ite

Pack Size: 6/17 oz. cans

Application Ideas A PAM will help you serve food that looks and tastes great! PA

Grilling

Sautéing

Griddles

Steaks

Omelettes

Waffles

PAM PAM, the #1 cooking spray and the most widely used, is specially formulated to deliver the consistent performance needed in professional kitchens!¹ No matter what your cooking application, there’s a PAM spray that is right for you. PAM sprays are also perfect for healthier cooking with no calories, no fat, no cholesterol and 0g trans fat per serving. You can be confident that PAM covers all of your back-of-house needs. 1Source: Proprietary Pan Sprays Dynamics Study, Datassentials, Sept 2012

For further information, samples or product demonstrations, please contact: Anthony Palermo | (732) 567-1197 | apalermo@acosta.com Joe Youngs | (201) 446-3553 | jyoungs@acosta.com 56

www.acostafoodservice.com


- Raised without the use of antibiotics - Vegetarian grain fed - Certified by the American Humane Association - 100% all natural, no artificial ingredients - No added hormones - Raised on local Pennsylvania family farms - Grain fed from local Pennsylvania family mills - Harvested in Pennsylvania Dutch Country - Uncured (No Nitrates/Nitrites Added) - Gluten free, no MSG - Premium meat block and seasonings used

Meets the American Human Association standards forfarm animals which requires that animals be raised in ways which reduce stress, with adequate shelter, comfortable resting areas, sucient space, proper facilities and the ability to express normal behavior DESCRIPTION

BRAND

METRO #

PACK/SIZE

Pork Osso Bucco, hind shank, skinless, frozen

Leidys

354714

24/1.13 lb

Pork Scrapple, trans fat free

Leidys

294136

2/5 lb

Mild Pork Roll, fully cooked, trans fat free

Alderfer

244283

2/6 lb

57


A land known for beauty… A product known for quality… A name known for reliability…

From the pristine fields of Australia to your Kitchen … FRESH 100% Grass-Fed Premium Lamb and Beef

Your customers are a selective bunch and they are always looking for one thing…A great product, but at a fair price. Why not serve them a product that delivers both. Now at Performance Foodservice - Metro NY you can order Fresh Never Frozen, premium 100% Grass Fed beef and lamb direct from down under…where they have been doing it this way for decades. So experience the natural difference with Aussie Premium lamb and beef.Contact your Performance Foodservice - Metro NY Rep for details.

• 100% Grass-Fed • Fresh – Never frozen

DESCRIPTION

BRAND

METRO #

PACK/SIZE

Beef Flank Steak, halal

Aussie Premium

423756

16/3 lb

Beef Outside Skirt, boneless, peeled

Aussie Premium

427155

18/1.75 lb

• HALAL Certified

Beef Ribeye, boneless, lip on, halal

Aussie Premium

423750

3/10 lb

Beef Strip Loin, boneless, halal

Aussie Premium

423751

4/8-12 lb

Beef Tenderloin PSMO, boneless, halal

Aussie Premium

423758

6/5 lb

Frenched Rack of Lamb, 26-28 oz, frozen

Aussie Premium

422986

12/1.5 lb

Frenched Rack of Lamb, 12-14 oz, frozen

37655

12/2 ct

Frenched Rack of Lamb, 14-16 oz, frozen

28953

10/2 ct

Frenched Rack of Lamb, 16-18 oz, frozen

915968

8/2 ct

Frenched Rack of Lamb, 18-20 oz, frozen

945183

1/25 lb

Frenched Rack of Lamb, 20-22 oz, frozen

283945

1/22 lb

Beef Top Sirloin, culotte, boneless, fat on

354427

1/35 lb

• Raised without hormones or antibiotics • Free Range • All Natural • Excellent Plate Cost


Perfect flavor and a creamy-smooth texture with every single batch

DESCRIPTION Real® Au Gratin, instant

METRO #

PACK/SIZE

439578

12/20.35 oz

Real Mashed Potatoes, instant Real® Scalloped Potatoes, instant

439576

12/26 oz

439579

12/20.35 oz

®

59


Sweetended Dried Cranberries with elderberry juice concentrate

244263.....1/10 lb Sweetended Dried Cranberries with elderberry juice concentrate

288008.....1/25 lb

60


House Cuts速 Lattice Chips

Potato Products For Anytime!

Traditional House Cut Fries

Straight Cut Fries

DESCRIPTION Traditional House Cut Fries, 5/16" Straight Cut Fries, frozen, fancy, black pepper, sea salt and garlic House Cuts速 Lattice Chips

61

BRAND Lambs Natural

METRO # 336072

PACK/SIZE 6/5 lb

Lambs Seasoned Lamb Weston

426649 469952

6/5 lb 5/5 lb


Fabulous flavor is easy. With a little help from West Creek Toppings and Syrups, your desserts will take a delicious turn for the best.

62

DISCRIPTION Toppings Sliced Strawberries Caramel

METRO #

PACK/SIZE

417360 417352

6/#5

Crushed Pineapples Chocolate Syrups & Fudges Fountain Supreme Chocolate Syrup Rich N’ Creamy Chocolate Hot Fudge

417359

6/#5 6/#5

417325

12/24 oz

417326

12/24 oz


STurkey Breast Half Skinless, fully cooked7KLVH[WUHPHO\YHUVDWLOHSURGXFWLVRYHQURDVWHGDQGOLJKWO\VHDVRQHG

Each single lobe breast is skin-on, clean label, whole muscle, and hand-crafted for a great taste that is unforgettable. Carolinaâ&#x20AC;Ś..439311â&#x20AC;Ś..6/3.5 lb.

Turkey Patty with White Meat, frozen

Ground Turkey

Savory White Turkey Burger, made from 100% white meat WXUNH\ZLWKDULFKĂ DYRUWKDWZLOOPDNHDJUHDWDGGLWLRQWRDQ\ burger menu. Use your imagination on burger builds or visit our culinary center for a variety of concepts and recipes. Butterballâ&#x20AC;Ś..459436â&#x20AC;Ś..30/5.33 oz.

Add variety with this classic ground turkey, a low-fat, high protein alternative in comparison to our red meat counterparts. Carolinaâ&#x20AC;Ś..970769â&#x20AC;Ś..2/10 lb.

Sausage Turkey Patty, ready-to-cook

Save time and add variety with this fully cooked lightly seasoned meatball. Made of top grade, dark meat as well as imported Pecorino and Romano cheeses. A low-fat, high protein alternative to our red meat counterparts. Carolinaâ&#x20AC;Ś..317711â&#x20AC;Ś..2/5 lb.

Turkey Meatball .5 oz., fully cooked

Save time and add variety with this low-fat, high protein breakfast sausage patty. Lightly seasoned with a traditional VDJHĂ DYRUWKHVHSDWWLHVVDUHH[FHOOHQWDGGLWLRQVWRDQ\PHQX Butterballâ&#x20AC;Ś..279638â&#x20AC;Ś..128/1.5 oz.

ALSO TRY... Turkey Breast browned in oil Butterball 949577.....2/8 lb avg

63


64


ĹŽ

+  \ , )  High quality ingredients to create delicious beverages: 100% pure, expertly roasted coffee extracts, 100% real skim milk, and rich, premium chocolate mix.

DESCRIPTION Milano Expresso Roast Premium Cocoa Powdered Mix Powdered Skim Milk

65

METRO # 449575 416818 378847

PACK/SIZE 4/8.82 oz 4/1.75 lb 4/500 gm


Beer Battered Cod

EMPIREâ&#x20AC;&#x2122;S TREASURE Beer Battered Haddock

Beer Battered Pollock

3 oz, par frozen, fried, oven ready, 4-5 oz, par frozen, fried, oven ready, 3 oz, par frozen, fried, oven ready, natural shape natural shape natural shape 463795.....1/10 lb .....1/10 lb .....1/10 lb 3HUIHFWIRUVDQGZLFKHVEDVNHWVVHDIRRGFRPELQDWLRQLWHPVĂ&#x20AC;VKWDFRVRUFHQWHURIWKHSODWHHQWUHHVWKHVHRSWLRQVUHDOO\ UDLVHWKHEDUZKHQLWFRPHVWREHHUEDWWHUHGĂ&#x20AC;VK

Also Try...

Flounder Fillet

SILVER SOURCE Flounder Fillet

Flounder Fillet

3 oz, individually quick frozen 4 oz, individually quick frozen 5 oz, individually quick frozen 451822.....1/10 lb 451823.....1/10 lb 451824.....1/10 lb :KHWKHUEUHDGHGDQGEDNHGEDWWHUHGRUIULHGRUVLPSO\VHDVRQHGRXU6LOYHU6RXUFHĂ RXQGHUZRUNVDFURVV\RXUPHQX 66


BIG SAVINGS

WITH FLOUNDER

OPERATOR REBATE • NOW UNTIL DECEMBER 31, 2015

$2.50 OFF

RECEIVE PER CASE ON OUR NEW SILVER SOURCE IQF

FLOUNDER FILLETS

Silver Source is adding a new member to the family. Our new line of IQF Flounder Fillets deliver consistent quality at an affordable price point. For a limited time, we’re offering up to $250 in savings on case purchases of any of our four new Flounder options. Light and flaky with a delicate bite and a slightly sweet flavor, flounder is the perfect option for your menu. Whether breaded and baked, battered or fried, or simply seasoned, our Silver Source flounder works across your menu. PFS ITEM #

3$&. 6,=(

DESCRIPTION

451822

OE

3 oz. IQF Flounder Fillet

$2.50

451823

OE

4 oz. IQF Flounder Fillet

$2.50

451824

OE

5 oz. IQF Flounder Fillet

$2.50

# CASES PURCHASED

CASE REBATE AMOUNT

TOTAL REBATE VALUE

TOTAL

Operator Name:

To claim rebate, operators must complete and mail this coupon together with distributor invoice, clearly indicating your eligible purchases of products to:

Title: Company:

FLOUNDER, c/o Village Press Inc., P.O. Box 552 Traverse City, MI 49685-0552

Operator Signature: Address: City:

If redeeming your rebate online, visit www.rapidrebate.net. Complete the short form to activate your registration and upload the rebate. Your account can be acccessed through the website or mobile app. Your online account will also allow you to check the status of your rebate once it is received.

State:

Zip:

Phone (daytime): Email: PFS/ROMA Distributor: Select Your Segment: Restaurant / Healthcare / Military / College & Universities / Business & Industry / Catering / Lodging / Other:

RULES: • • • • • •

Offer valid now to December 31, 2015. Valid for PFS/ROMA operator account customers only with proof of purchase. Multi-Unit chain accounts submit one entry per location. Maximum rebate value per operator is $250. Please allow 8-10 weeks for processing the redemption. Not valid in conjunction with any other High Liner Foods’ offer, bid, contract price, promotion or rebate. • Proof of purchase in the form of PFS/ROMA invoice only must accompany request. Computer generated proof of purchase reports will be accepted if they contain customer information and purchase details.

… Yes, I would like to receive email communication and information from High Liner Foods

67

6/2015


RAISE THE BAR

WITH BEER BATTERED SEAFOOD

OPERATOR REBATE • NOW UNTIL DECEMBER 31, 2015

RECEIVE

$5 OFF PER CASE ON OUR NEW DOCK 19 BEER BATTERED SEAFOOD Summer is here and the time is right to add our new crispy, golden beer battered cod, haddock and pollock to your menu. For a limited time, you will receive big savings on every case of our new Dock 19 seafood items up to a maximum of $500. Your customers will enjoy the high quality beer battered options in cod, haddock or pollock, while you enjoy the savings. Perfect for sandwiches, baskets, seafood combination items, fish tacos, or center of the plate entrees, our new options really raise the bar when it comes to beer battered fish.

PFS ITEM #

3$&. 6,=(

DESCRIPTION

# CASES PURCHASED

CASE REBATE AMOUNT

463795

OE

3 oz. Dock 19 Beer Battered Cod Fillet

$5.00

463803

OE

4-5 oz. Dock 19 Beer Battered Haddock Fillet

$5.00

463802

OE

3 oz. Dock 19 Beer Battered Pollock Fillet

$5.00

TOTAL REBATE VALUE

TOTAL

Operator Name:

To claim rebate, operators must complete and mail this coupon together with distributor invoice, clearly indicating your eligible purchases of products to:

Title: Company:

Dock 19, c/o Village Press Inc., P.O. Box 552 Traverse City, MI 49685-0552

Operator Signature: Address: City:

If redeeming your rebate online, visit www.rapidrebate.net. Complete the short form to activate your registration and upload the rebate. Your account can be acccessed through the website or mobile app. Your online account will also allow you to check the status of your rebate once it is received.

State:

Zip:

Phone (daytime): Email: PFS/ROMA Distributor: Select Your Segment: Restaurant / Healthcare / Military / College & Universities / Business & Industry / Catering / Lodging / Other:

RULES: • • • • • •

Offer valid now to December 31, 2015. Valid for PFS/ROMA operator account customers only with proof of purchase. Multi-Unit chain accounts submit one entry per location. Maximum rebate value per operator is $500. Please allow 8-10 weeks for processing the redemption. Not valid in conjunction with any other High Liner Foods’ offer, bid, contract price, promotion or rebate. • Proof of purchase in the form of PFS/ROMA invoice only must accompany request. Computer generated proof of purchase reports will be accepted if they contain customer information and purchase details.

… Yes, I would like to receive email communication and information from High Liner Foods

68

6/2015


F R E S H

C H I C K E N

B R E A S T

Premium Quality Foodservice Products.

Performance Foodservice is pleased to offer a premium cut chicken breast under its Ridgecrest brand. The Ridgecrest chicken breast is custom trimmed to offer the most useable product with the least amount of waste. <RX will realize less preparation time and enjoy an expanse of menu options with this premium cut product. Performance Foodservice brands consistently deliver quality products at affordable prices.

)HDWXUHVDQG%HQHĂ&#x20AC;WV â&#x20AC;˘ â&#x20AC;˘ â&#x20AC;˘ â&#x20AC;˘ â&#x20AC;˘

Hand trimmed to 99% fat free More usable meat in each case The industryâ&#x20AC;&#x2122;s highest yielding breast meat Reduced waste of packaging and trim as well as increased safety of not trimming meat Full pieces only in each bag

Products ITEM NUMBER

460072

PRODUCT DESCRIPTION

CHICKEN BR($67),//(7&+()5($'<

+$1'T5,00(' TO 99%)$7)5((

Serving Suggestions Ridgecrest 99% Fat-Free Chicken Breasts are Chef Ready and provide the ideal protein base for virtually any operator wanting to use a lean white meat protein. Recipe options abound, as these products are ideal for baking, VWLUIU\LQJJULOOLQJVWXIĂ&#x20AC;QJRUVHUYLQJ on a salad.

69

PACK

SIZE

4

10LB


Delicious Treats to Create with

Fruit Fillings

Cherry Ch PPretzel t l SSquare Cook time: 10 mins, Serves: 12

Blueberry Bliss-Filled Lemon Layers Cook time: 20 mins, Serves: 9

Ingredients • 3 cups pretzels, chopped • ¾ cup brown sugar • ½ cup butter, melted • 18 ounce package cream cheese, softened • 1 cup powdered sugar • 18 ounce container frozen whipped dessert topping, thawed • 2-#10 cans West Creek Cherry Pie Filling # 228616

Ingredients

Instructions Preheat oven to 350°F. In a medium bowl, combine crushed pretzels, brown sugar and butter. Spread half of this pretzel mixture in bottom of 9x13-inch baking pan. Bake 10 minutes. Cool. While the pretzel mixture is baking, combine the cream cheese and powdered sugar in large mixing bowl. Fold in whipped topping. Spread half of this cream cheese mixture on top of the cooled baked pretzel crust. Spread 2 cans of West Creek Cherry Pie Filling over the cream cheese layer, then spread the remaining half of the cream cheese mixture over the pie filling. Sprinkle with the remaining pretzel mixture. Refrigerate at least 4 hours.

2 cups all-purpose flour 1 cup pecans, chopped 1 cup melted butter 1 3.5-ounce package lemon instant pudding mix 2 cups milk 1 teaspoon lemon peel,finely shredded 1 Tablespoon lemon juice 1 8-ounce package cream cheese, softened 2 cups powdered sugar 1 8-ounce container frozen whipped dessert topping, thawed 1 #10 can West Creek Blueberry Pie Filling # 228614

Instructions Preheat oven to 350°F. In a medium bowl combine flour, pecans, and melted butter; spread evenly in a 3-quart rectangular baking pan. Bake 20 minutes; cool on wire rack 10 minutes. Break apart with a fork, reserving about ½ cup.

DESCRIPTION METRO # Cherry Pie Filling, trans fat free 228616 Apple Pie Filling, trans fat free 228609 Blueberry Pie Filling, cultivated, trans fat free 228614 ALSO AVAILABLE! NEW! Applesauce, sweetened 228600 NEW! Unsweetened Applesauce, trans fat free 228606 NEW! Applesauce, chunky 228595

PACK/SIZE 6/#10 6/#10 6/#10

Meanwhile in a medium mixing bowl, combine pudding mix and milk. Whisk 2 minutes to blend.Stir in lemon peel and lemon juice.Set aside.

6/#10 6/#10 6/#10

In a 3-quart trifle dish, layer the pudding, crumb mixture, about ½ can of West Creek Blueberry Pie Filling, cream cheese mixture and remaining pie filling.Sprinkle with remaining crumb mixture.Chill until ready to serve.

NEW! Fancy Sliced Apples in Water, 6.5 lb

6/#10

228588

70

In a large mixing bowl beat cream cheese with an electric mixer on medium speed until smooth. Gradually beat in powdered sugar.Fold in dessert topping.


Marbling is the key to flavor “Great taste is the primary reason consumers make beef their food of choice for a pleasurable dining experience. When marbling scores of Modest or greater are attained, the incidence of undesirable flavor ratings is greatly diminished.” Dr. Daryl Tatum, Colorado State University meat scientist

85% of the USDA Choice grade has only Small amounts of marbling.* The Certified Angus Beef ® brand requires Modest or higher marbling, ensuring premium flavor. The brand’s standards are so strict, less than 8% of all beef makes the grade. * After modest or moderate branded beef programs have been sorted Photos courtesy of the National Cattlemen’s Beef Association, and the U.S. Department of Agriculture, ©NCBA

Modest Marbling

Small Marbling

Minimum marbling requirment for the Certified Angus Beef ® brand

Minimum marbling requirement for USDA Choice

Flavor is the key to success “If beef tastes great, people are not only more likely to buy it, but also more willing to pay more for it. Delivering a desirable eating experience time after time is fundamentally important to sustained growth.” — Tatum

In the face of your competition, quality is everything.


When we set out to create the world’s first premium brand of beef, we started by choosing Angus cattle, known for producing beef of superior taste and tenderness. But that alone wasn’t going to satisfy us. So we put into place 10 exacting standards that every cut of the Certified Angus Beef ® brand has to meet. The result is an Angus beef of unrivaled flavor, juiciness and tenderness.

Certified Angus Beef ® brand. From our family ranchers to your family table.

Culinary Edge vol 62 digital  

Performance Foodservice Metro NY

Read more
Read more
Similar to
Popular now
Just for you