Skip to main content

2020 ParentMap Seattle Baby

Page 1

2020

SEATTLE Baby From bump to bundle and beyond, the ultimate local resources guide for Seattle parents Hundreds of parent-tested, baby-approved resources for new families!

Plus: Brain-Building Games to Play With Baby Sick Kiddo? Know When to Go to a Pro Sweet Tooth: Optimizing Baby’s Oral Health Surefire Solutions for Sounder Summer Sleep Bringing Home Baby: The Essentials List Troubleshooting Tummy Trouble Fostering a Reading Culture at Home Preschool Shopping 101


INSIDE

FROM THE PUBLISHER

CATEGORIES

W

Adoption + Fostering ..........................................3 Baby Services ..........................................................4 Child Care ..............................................................12 Child Health + Wellness .................................19 Childbirth Services ............................................26 Community Services ........................................33 Family Health + Wellness ..............................36 Hospitals + Birthing Centers ........................45 Learning + Play ...................................................49 Parent Education + Support ........................52 Retailers + E-tailers ...........................................58 Special Needs ......................................................61 A–Z Advertiser Index .......................................63

ARTICLES Optimizing Oral Health of Babies .............10 Preschool Shopping 101.................................16 Solving Summer Sleep Woes ........................24 Bringing Home Baby: The Essentials List .30 Caring for Common Baby Maladies .........38 Troubleshooting Tummy Trouble ..............46 How to Foster a Reading Culture at Home ..................................................................50 Brain-Building Games to Play With Baby .............................................................54 2020 PARENTMAP BABY PUBLISHER Alayne Sulkin MANAGING EDITOR Patty Lindley SENIOR DESIGNER Amy Chinn ADVERTISING + PARTNERSHIPS Ida Wicklund, Jen Dine ADVERTISING CLIENT SERVICES MANAGER Jessica Collet ADVERTISING INFORMATION

206-709-9026 or advertising@parentmap.com DISTRIBUTION distribution@parentmap.com ParentMap is published monthly PMB #190, 7683 S.E. 27th St. Mercer Island, WA 98040 ADMINISTRATION 206-709-9026, parentmap.com

All rights reserved; reproduction in whole or part without permission prohibited © ParentMap 2020 • Printed in Oregon

Illustrations by Alli Arnold/alliarnold.com

hile humans worldwide are confronted daily by the challenges and disruptions of COVID-19, thankfully, not even a dastardly pandemic can stop the birth of breathtaking, precious babies. The perpetual and unpredictable pendulum swing of joy, love, frustration and exhaustion overflows our parenting emo-buckets daily. Since time immemorial, it’s been said that there is no greater role in life that can call upon our strength, wisdom, tenacity, empathy, love and humor more than being a parent. But a worldwide pandemic does complicate things. Young parents are coping with a lack of child care and family support — some are also saddled with the necessity of providing distance learning for their grade-schoolers — all while logging more family time than anyone could ever imagine. Parents with little ones are required to tap into something superhuman. Yet there are some magical silver linings to be enjoyed with life slowed down, calendars remaining empty and endless family meals that truly counteract our broken work-life balance. The hopeful potential outcomes of the pandemic were all captured magnificently in the viral (literally and figuratively) bedtime story “The Great Realisation,” created by filmmaker and poet Tomos Roberts (aka Probably Tomfoolery; probablytomfoolery.com). The blossoming of your babies is the prime time to investigate every aspect of early parenthood. However, I urge you to remember yourself and who you are as a friend, daughter or son, professional and community member. As the airplane adage goes, put your oxygen mask on first. Find time for friendships, moments of self-compassion or date nights. Our kids are miraculous sponges from day one. Remember that you are their first and most important teacher: They feel your love and energy and hear the tone of your words as they attach and grow.

Special thanks to our sponsor, Swedish Medical Center (swedish.org) Resource listings are not comprehensive due to space limitations. 2


ADOPTION + FOSTERING Adoption Therapy Associates of West Seattle — Laura Stone, MA Licensed mental health counselor certified in adoption and foster care therapy and in attachment-trauma-focused therapy Seattle, West Seattle; 206-498-9895 laurastone.org Adoptive Friends & Families of Greater Seattle Nonprofit support and educational group that includes both families touched by adoption and families waiting to adopt Greater Seattle area; 425-243-7725 affgs.org AdoptUSKids National project that supports child welfare systems and connects children in foster care with families Nationwide; adoptuskids.org Agape Adoptions Highly personalized, professional international adoption placement services for children from China, Hong Kong, Romania, Bulgaria, Uganda and the Dominican Republic Nationwide; 253-987-5804 agapeadoptions.org Amara Not-for-profit organization serving children in foster care and the families who care for them Offices in King and Pierce Counties; 206-260-1700 amaraputskidsfirst.org Casey Family Programs National operating foundation headquartered in Seattle providing services to children in foster care (birth–18) and their families Multiple national field offices; Seattle office: 206-322-6711 (toll free: 1-800-496-2230) Children’s Home Society of Washington Nonprofit organization providing residential and group care for troubled children as well as a range of family support, therapeutic, adoption and advocacy services Regional offices statewide; 206-695-3200 (toll-free: 1-800-456-3339) childrenshomesociety.org A Child’s Dream Licensed nonprofit adoption agency located in Poulsbo serving birth mothers and birth parents throughout the state with child placement services Statewide; 1-800-247-8280 achildsdream.org/washington-state

Foster Parents Association of Washington State Resources, programs and advocacy for foster, kinship and adoptive families to enrich the quality of life for Washington state’s children in out-of-home or adoptive care Statewide; 1-800-391-2273 fpaws.org Holt International Christian organization committed to keeping families in crisis together, caring for homeless kids and finding adoptive families; support for domestic and international adoptions 1-888-355-HOLT (4658); holtinternational.org Kinship Caregivers Support Program Washington State Department of Social and Health Services’ searchable database of kinship caregiver resources, support groups and Tribal kinship navigation dshs.wa.gov/altsa/kinship-care-support-services Northwest Adoption Exchange Championing youth foster care and making important connections with potential adoptive families Serving Pacific Northwest youth; 1-800-927-9411 nwae.org Olive Crest Outreach and services for at-risk children, including child abuse prevention, fostering and adoption placement, life skills training and mentoring, counseling and more Bellevue (425-462-1612), Tacoma (253-572-7888), Silverdale (360-328-1650) olivecrest.org Open Adoption & Family Services Open adoption agency supporting pregnant women and couples in making decisions about their options — pregnancy, abortion, adoption — in an atmosphere of dignity and respect Greater Seattle area; 206-782-0442 openadopt.org P.E.E.R.S. Play Individualized services to support healthy child development through engagement, emotional regulation and social play; support for families created through adoption Seattle; peersplay.com Treehouse Nonprofit with a mission to give foster kids a childhood and a future; providing academic and other essential support for more than 8,000 youth in foster care across Washington state each year Offices in Seattle, statewide impact; 206-767-7000 treehouseforkids.org 3


BABY SERVICES Breastfeeding Support Health:Latch Niche health-care practice dedicated to releasing tongue and lip tethers to create more suction for newborns during nursing Bellevue; 425-310-8430 healthlatch.com La Leche League of Washington Accredited leaders providing mother-to-mother breastfeeding support through helplines and group meetings Statewide; 425-610-6119; national toll-free helpline: 1-877-452-5324 lllwa.org Northwest Mother’s Milk Bank Not-for-profit milk bank providing health screening, pasteurization and prescription distribution of donor milk Portland; 503-469-0955 donatemilk.org Nurturing Expressions Providing breastfeeding, lactation and pumping education; help navigating breast pump insurance benefit Offices in West Seattle (206-763-2733), Tukwila (206-763-2733), Poulsbo (206-763-2733), Tacoma (253-948-0784) nurturingexpressions.com Our Perfect Baby Supplier of top breast pumps and verification of insurance eligibility; free shipping in Washington Online; 1-800-403-3895 ourperfectbaby.com PMSI ......................................................................................5 Insurance-eligible breast pumps; local and woman-owned since 1973; shipping or curbside pickup available Bellevue; 425-462-0577 pacificmsi.com Sound Beginnings Trusted lactation and parenting support in the Greater Seattle area and online for new parents anywhere 206-973-0337; support@soundbeginningsfamily.com soundbeginningsfamily.com

Diaper Services Andy Pandy by Hansen Kids, LLC ...........................6 Award-winning and eco-friendly baby products, including premium bamboo disposable diapers, that are good for your baby and the planet Shipping within the Unite States only; andypandykids.com 4

Baby Diaper Service .....................................................7 Service offering freshly laundered cloth diaper delivery; supporting Puget Sound families from birth to potty training since 1946 Puget Sound service area; 206-634-2229 babydiaperservice.net Bootyland Kids Center for hip kids and modern parents, promoting baby wearing, cloth diapering, breastfeeding, quality over quantity, sustainability Seattle; 206-328-0636 bootylandkids.com Diaper Stork .....................................................................8 Diaper service and baby boutique providing healthy and eco-conscious alternative to disposable diapers; free classes offered Greater Seattle area; 206-928-6982 diaperstork.com

Photographers Alicen Lum Photography Specializing in professional baby and newborn photography Federal Way studio serving Greater Seattle and Eastside; 206-484-7677 alicenlumphotography.com Anela Deisler Photography Specializing in lifestyle, maternity, newborn and family photography Greater Seattle and Eastside; hello@aneladeisler.com aneladeisler.com Hardie Photography Onsite birth and family photographer Greater Seattle and Eastside; whitneyhardie@gmail.com hardiephotography.com Hey Baby Ultrasound 2-D, 3-D and 4-D ultrasound imaging services, including heartbeat, gender determination and reveal parties Kirkland; 1-844-777-2229 heybabyultrasound.com Jennifer Loomis Photography .................................9 Boutique studio specializing in maternity and family photography since 2001 Serving the Puget Sound area; 206-329-4772 jenniferloomis.com Kiley Riffell Photography Award-winning family, maternity and portrait photography Greater Seattle and Eastside; kileyriffell@gmail.com kileyriffellphotography.shootproof.com


BABY SERVICES

Insurance-Eligible Breast Pumps, Support, and Supplies Specializing in breast pumps, home medical equipment, and compression stockings since 1973! PMSI is a local, woman-owned company with a strong focus on helping new moms find the right breast pump to fit their needs. Success starts with support. Our lactation specialists are ready and waiting to help with any questions or concerns. Follow-up care is always included. Preferred provider. PMSI is in-network with most major insurance companies and has a team of trained staff who will submit claims on your behalf and handle the logistics of billing. Shipping or curbside pickup available.

pacificmsi.com • 425-462-0577 info@pacificmsi.com

Maple Hollow Photography Specializing in on-call birth story photography with unlimited coverage of your labor and delivery; “bump to baby” and family documentary sessions Greater Seattle and Eastside; 206-669-8778 maplehollowphotography.com

Pediatric Sleep Consulting — Seattle Sleep Doula Birth and postpartum doula specializing in sleep coaching and consultation Greater Seattle and Eastside; 206-999-6362 pediatricsleepconsulting.com

Sleep Consultants

Rebecca Michi — Children’s Sleep Consultant Realistic, gentle sleep support and training for newborns and toddlers Greater Seattle and Eastside; rebecca@rebeccamichi.com childrenssleepconsultant.com

Belly to Bean Sleep Co. Certified sleep consultation that helps families with babies and toddlers get more sleep Greater Seattle and Eastside; 206-859-7094 bellytobean.com Desiree Baird, Pediatric Sleep Coach ............... 12 Helping families resolve sleep troubles so everyone can get the sleep they need and deserve. Rated five stars on Google! Greater Seattle and Eastside; 425-275-2070 pediatricsleepcoach.com/parentmap Nested Sleep Personalized holistic family sleep consulting for parents of babies and children ages 0–18 Seattle; 206-588-6304 nestedsleep.com

Sarah Oliver — Baby Sleep Consultancy Internationally certified infant and child sleep consultant dedicated to giving babies, parents and the whole family the good night’s sleep they deserve Greater Seattle and Eastside; 206-747-1710 saraholiverconsultancy.com Seattle Sleep Trainer In-home and virtual sleep training programs customized to your baby and family Seattle; tiffany@seattlesleeptrainer.com seattlesleeptrainer.com

5


BABY SERVICES

3 Reasons Why Eco-Conscious Parents Love Bamboo Diapers Traditional disposable diapers are wasteful and bad for the environment. Cloth diapers just aren’t for everyone. This is why many parents are turning to eco-friendly alternatives such as bamboo diapers. Better for the planet Bamboo is fast-growing, sustainably grown and biodegradable. Bamboo diapers are more than 85% biodegradable, which decreases their impact on the environment. Absorbs twice as much as cotton Bamboo is highly absorbent and absorbs 60% more than cotton. This makes bamboo diapers perfect for sensitive skin and for preventing diaper rash. Naturally hypoallergenic and antibacterial With bamboo diapers, you can be sure your little one will not have an allergic reaction. They are also antibacterial, so they help keep your baby clean and healthy. “I cannot recommend Andy Pandy diapers enough to new parents and families seeking a better option than traditional diapers.” — Dr. Emily Copeland, pediatrician

Choose Andy Pandy today, because your baby deserves a better tomorrow!

andypandykids.com support@andypandykids.com 6


BABY SERVICES

Freshly laundered cloth diapers, delivered to your home each week! Locally owned Baby Diaper Service makes it simple and enjoyable for families to choose cloth diapers. We deliver freshly laundered natural cotton diapers, pH-balanced for baby’s delicate skin, right to your front door. No rinsing, no soaking, no dumping anything out — just toss the soiled diaper into the pail that we provide and let us do the dirty work! Healthy, simple, convenient, affordable, adorable. Cloth is the healthiest option for your baby and the safest option for our environment. We have an exclusive wash formula and wash process that result in the safest diaper for your baby. Our BDS team of cloth diaper experts provides the highest level of customer service as we support you through your diapering journey — from birth to potty training. 74 Years of Delivering Cloth Diapers to Puget Sound Families! Free BDS 101 Cloth Diaper Classes offered each month!

Supporting Puget Sound families with resources and community throughout their diapering journey, from birth to potty training.

babydiaperservice.net • 206-634-2229 Servicing from Bellingham to Olympia and North Bend to Poulsbo info@babydiaperservice.net 7


BABY SERVICES

We make cloth diapering easy! Less waste less guilt Whether you’re looking for a local full-service provider or need quality cloth diapers at home, Diaper Stork has a solution. Save time by choosing our weekly pickup and delivery service; save $$ by renting or purchasing a cloth diapering bundle for home washing. Babies go through 6,000 diapers, making disposable diapers the third largest single consumer item in landfills. We’re here to help make your sustainable choices more convenient and worth the extra effort. How service works: 1. You’ll receive 100% cotton diapers, a diaper bin, cute covers and cloth wipes. 2. Toss the dirty diapers in the bin. No rinsing! 3. Each week, dirties go in our reusable bags and our driver swaps them out for a clean set. Boost your diaper IQ! Join our free virtual Cloth Diaper 101, Infant Potty Training and Toddler Potty Training classes. Add us to your registry!

Diaper Stork is a mom-owned cloth diaper service and boutique enabling parents to make conscientious choices for their babies and their communities.

diaperstork.com • 206-928-6982 Serving the Greater Seattle Area service@diaperstork.com 8


BABY SERVICES

Do you want great maternity and family photography and a great experience? “Jennifer Loomis’ artistry is transformational. Working with her on my maternity photography was definitely one of the highlights of my pregnancy.” — Charlotte, a Seattle mother The Commissioned Portrait Experience Each session is custom-designed for you, with you and your interests, décor and comfort in mind. 1. Jennifer’s Discovery Session via Zoom or video chat (30 minutes–1 hour) 2. Your Photography Session (2–3 hours) 3. Your Image Reveal and Order Session — learn about the light, moment and composition that Jennifer has carefully worked into your images 4. Delivery of framed prints The pioneer of maternity photography, Jennifer has photographed over 4,000 women and their families. Schedule a call or video chat to see the studio, meet Jennifer and learn more. Whether outside or in our gorgeous naturally lit studio in a historical Seattle building, COVID-19 protocols are strictly followed.

Jennifer Loomis Photography is a boutique studio specializing in maternity/family photography and heirloom silver prints since 2001.

jenniferloomis.com • 206-329-4772 Serving the Puget Sound area info@jenniferloomis.com 9


BABY SERVICES

Super Smiles

Optimizing oral health for babies and toddlers By Malia Jacobson

E

very time you test the temperature of your baby’s bottle with your mouth, or share food, a straw or a utensil with your toddler, you’re also sharing bacteria that cause tooth decay. That’s right, cavity-causing dental decay is an infectious, transmissible disease that parents can unknowingly pass to their children, according to the National Institutes of Health (NIH; nih.gov). After decades of decline, the rates of cavities in children under 5 are on the rise; experts blame a diet higher in sugary foods and drinks. The National Institute of Dental and Craniofacial Research, part of the NIH, reports that from one-third to one-half of children under age 5 develop cavities in baby teeth. Yet, like many infectious diseases, dental decay is preventable. Here’s how to protect your child’s oral health, even if those pearly whites are still months away from appearing. When to visit a dentist In the National Poll on Children’s Health, researchers at C.S. Mott Children’s Hospital found that most parents weren’t sure when their child should first visit the dentist. Out of this majority, over 16 percent believed kids didn’t need to visit a dentist until after age 4, reflecting a common belief that cleaning baby teeth isn’t all that important — they’ll just fall out anyway, right? Wrong. Decay in baby teeth can harm oral health in the short term and for years to come. The bacteria that cause tooth decay in baby teeth can break down the enamel of permanent teeth as they begin to come in, making these teeth more vulnerable to developing cavities. And because baby teeth serve as placeholders that help guide permanent teeth into position, losing baby teeth too early as a result of tooth decay can create a crooked, crowded smile later on. Scheduling a dental visit by age 1, or six months after the first tooth pops up, helps safeguard oral health in a few important ways, according to experts at C.S. Mott Children’s 10

Hospital. First, establishing a relationship with a dentist early helps pave the way for smoother, less stressful visits in the future, when your child begins “real” dental cleanings or needs a filling. Visiting the dentist by 12 months of age also helps the dentist spot any early signs of trouble and then advise you on the best way to care for your child’s oral health. Little cavities, big deal What’s the dentist looking for at these early visits? Before tooth decay causes a cavity, it may cause white spots on tooth enamel, which signal that the enamel is breaking down. From there, a cavity may look like a small, light brown spot on your child’s tooth. If the cavity isn’t treated, the spot becomes larger and may turn darker brown or black. More advanced tooth decay may cause a toothache, sensitivity to hot or cold, bad breath and swelling. According to the American Dental Association (ada.org), tooth decay in baby teeth can affect a child’s overall well-being; kids with painful teeth are less likely to eat enough, and therefore

Young toddlers need just a dab of toothpaste — about the size of a grain of rice — while preschoolers can use a peasize amount.


BABY SERVICES

won’t get the nutrition they need to thrive. What happens if my baby has a cavity? After giving your child a complete dental exam, the dentist may suggest X-rays to help diagnose tooth decay. In many cases, small cavities can be filled in a single dentist visit; the dentist removes the decayed enamel and uses tooth-colored material to fill the hole. Though the process may not delight your child, they’ll usually be able to eat or drink soon afterward and shouldn’t experience pain. Dead or seriously decayed teeth may need to be completely removed. This process may take two or more visits, and also may require sedation. If removing decayed baby teeth will affect the placement of permanent teeth, your child’s dentist may recommend a composite bridge (similar to a partial denture) that replaces the missing teeth and holds the remaining teeth in place until permanent teeth come in. Caring for gums and baby teeth Before your baby’s teeth appear, use a clean, soft cloth or small piece of gauze to gently wipe the gums after feedings. This helps prevent sugary

milk or food residue from remaining on your baby’s gums; such residue provides an environment in which the bacteria that cause tooth decay can grow. Start brushing your child’s teeth as soon as the first one appears, advises Stanford Children’s Health (stanfordchildrens.org). Young toddlers need just a dab of toothpaste — about the size of a grain of rice — while preschoolers can use a pea-size amount. After age 2, add daily flossing to your child’s routine. Does your toddler need an electric toothbrush? Most dentists say no — any child-size, extra-soft toothbrush will work. However, electric toothbrushes can coax reluctant brushers and help establish healthy habits, especially when kids choose the toothbrush (or at least the color) themselves. Pair the chosen toothbrush with a kid-friendly brushing app to create a fun routine that makes brushing tiny teeth a bit less burdensome. We’ll say “Ahhhh” to that! (Find other nifty tricks and tips for getting kids to brush their teeth at parentmap.com/teeth.)

■

Malia Jacobson is a health and family journalist. 11


BABY SERVICES

Better Sleep Starts Here! Did you know sleep deprivation is a leading cause of maternal depression? This is a startling fact, and I am here to help. Hi there, my name is Desiree Baird. I work with families all over the world to improve their little one’s sleep. My goal is to exceed your sleep goals while educating you along the way. Many parents do not contact me until they are at their breaking point. Let’s work together before you’re frustrated and exhausted. Visit pediatricsleepcoach.com/parentmap to learn more and get a FREE pediatric sleep resource magnet. Follow me @the_sleepcoach for free tips.

pediatricsleepcoach.com/parentmap • 425-275-2070 pediatricsleepcoach@gmail.com

CHILD CARE Nanny Services Annie’s Nannies, Inc. ................................................ 13 Full-service nanny placement providing comprehensive consultation to Seattle and Eastside families since 1984 Greater Seattle and Eastside; 206-784-8462 aniseattle.com AuPairCare Award-winning agency matches PNW families with international live-in au pairs 1-800-428-7247; customercare@aupaircare.com aupaircare.com CareWorks Nanny Referral Service .................. 13 Expert, personalized nanny placements since 1993 Greater Seattle and Eastside; 206-325-9985 careworksnw.com College Nannies + Sitters + Tutors Dedicated to helping parents build stronger families by creating smarter, happier kids Multiple Puget Sound area locations; collegenanniesandtutors.com 12

The Nanny Consultant Placement services for nannies, household managers, doulas, night nannies and newborn care specialists Greater Seattle, Eastside, Tacoma; 425-512-3123 thenannyconsultant.com The Nanny League College-educated nannies and more Greater Seattle and Eastside; 206-349-1622 thenannyleague.com Nanny Parent Connection Subscription-based platform where families and verified child-care providers can connect Puget Sound; 425-243-7032 nannyparentconnection.com On Call Nanny Full-service nanny agency offering a comprehensive suite of services, unparalleled customer support and a streamlined nanny referral process Greater Seattle area; 206-890-8898 oncallnanny.com


CHILD CARE

Because you want the best care possible for your child CareWorks has been voted “Seattle’s Best Nanny Service” and is one of the oldest and most respected agencies in the area, serving Seattle and Eastside families and nannies for over two decades. By listening carefully to our clients, and by providing unmatched personal support along the way, we create meaningful, lasting relationships that satisfy everyone’s needs. Whether you’re a family looking for just the right care arrangement, or a nanny, household manager or family assistant looking for the perfect family, CareWorks will be with you the entire way.

careworksnw.com • 206-325-9985 careworks.seattle@gmail.com

Your Family, Our Priority Since 1984

“The most important family we work with is yours” Bring baby home with expert support from Annie’s Nannies, Inc (ANI). Providing comprehensive consultation and placement to Seattle and Eastside families since 1984. Our team will be there for you every step of the way as you select the perfect person for your family. ANI supports the whole family with: • Nanny and Household Support placement (long-term, short-term, full-time, part-time) • Night Nannies, Newborn Care Specialists, Doula and Family Assistant placement • Convenient app for On-Call childcare, household support and party help • Hotel/Visitor childcare

aniseattle.com • 206-784–8462 info@aniseattle.com 13


CHILD CARE

Where Brighter Futures Take Root Goodwin connects families to educational opportunities that build financial stability and create generational change. When families are accepted into the Family Connections Program, they become eligible for childcare or preschool tuition assistance. Support for childcare and preschool expenses enables parents to attend college full-time, focus on their studies, graduate in a timely manner and ultimately embark on a career that pays a living wage. At the same time, their children receive a quality early-learning opportunity — giving them a great start on their own educational journey.

goodwinconnections.org • 206-526-7944 program@goodwinconnections.org Nanny Services continued

The Seattle Nanny Network Long- and short-term nanny placement, plus sitters, tutors and specialists Greater Seattle and Eastside; 425-803-9511 seattlenanny.com West Coast Nannies Full-service nanny agency offering simple and affordable fee structure and one-on-one consultation Serving the Seattle area; 253-245-8538 wcnannies.com

Preschools + Day Care Centers Bright Horizons Child-care programs designed with working parents in mind, offering convenient locations and flexible hours that fit your busy schedule Multiple locations in the Greater Seattle area; 1-877-624-4532 brighthorizons.com Child Care Aware of Washington Family Center Helping families find quality child care in Washington • Child Care Aware Family Center: 1-800-446-1114; childcareawarewa.org • Kaleidoscope Play & Learn playgroups: 206-329-1011; childcare.org • CCR Homeless Program: 206-329-5842; childcare.org 14

Goodwin Connections .............................................. 14 Connecting families to educational opportunities that build financial stability and create generational change Serving King, Pierce, Snohomish County families; 206-526-7944 goodwinconnections.org Kaleidoscope School Preschool program for children ages 2–6; summer camps; after-school program offered for K–grade three students attending Blaine K–8 and Magnolia Elementary School Magnolia neighborhood of Seattle; kscopeschool@gmail.com kaleidoscope-school.com Kid’s Country Early Learning Centers Infant program providing a safe, loving environment that encourages little ones to love, laugh, learn and grow Multiple Greater Seattle locations; 360-668-5145 kidscountry.net Kids Klub Child Development Centers ............. 15 Offering infant and toddler day care; evening and weekend program available; flexible hours Bellevue; 425-502-8837 kidsklubcdc.com


CHILD CARE

Where Every Day Leads to New Discovery Kids Klub Bellevue’s infant program provides the highest level of quality care and supervision. The first floor is a dedicated environment where we have gone to great lengths to create a safe, clean, stimulating experience with low student-teacher ratios, which allows a hands-on approach to caring for your baby. Our teachers are skilled and prepared to make each day at Kids Klub a fun and loving experience, leading age-appropriate activities within our spacious indoors and unique outdoor play area. This stepping stone to preschool provides the building blocks necessary to promote your baby’s physical, social, emotional and cognitive development.

KidsKlubCDC.com • 425-502-8837 FrontOfficeBEL@kidsklub.us

Adults and Children Learning Together Are you … looking for support on your parenting journey? … seeking community? … interested in a low-cost preschool option with a high adult-to-child ratio? The Seattle Colleges Cooperative Preschool programs provide safe and nurturing environments for your child to learn and grow. Our neighborhood-based schools are located throughout Seattle and serve children from birth–6 years. Skilled teachers implement a play-based curriculum, and our educators support parents to be directly involved in the education of their children. Co-op classes and family support will continue to be available via Zoom in the event of a stay-at-home order.

northseattlecoops.org • 206-934-7796 beth.goss@seattlecolleges.edu 15


CHILD CARE

Preschool Shopping 101

Top tips for finding the right fit for your child and family By Sarina Behar Natkin, LICSW

T

he process of choosing a preschool can stir up plenty of anxiety for parents, because this is often the first decision they make about their child’s education. It’s easy to put a lot of pressure on ourselves, and to feel like we have to get this right and not make any mistakes. What’s important to keep in mind is that preschool is a wonderfully positive opportunity for your child to experience time with peers, learn how to separate from a caregiver, and build their social and emotional skills. Ultimately, the “right” decision is about choosing a preschool that works for your family, addresses your child’s individual needs and reflects the type of early education community that you want to be a part of.

Understanding different preschool learning philosophies There’s a variety of different early learning philosophies that we hear about from schools and other parents, and I think it’s helpful for parents to have a general idea of what the key differences are. Montessori programs focus on individual learning. These programs take a very self-paced and self-directed approach, with not a lot of group work. Teachers act as guides to help children progress to other activities that might be right for them. Reggio Emilia programs have four main principles. One of these principles is collaboration, with children working in both small and large groups. Another is project-based learning, giving kids the opportunity to study one subject in depth. Representational learning is also emphasized, presenting a subject through various forms, so that kids with diverse learning styles and needs are able to engage with the material. Reggio Emilia teachers also follow an emergent curriculum, meaning they create and adapt the curriculum to what the children are interested in at the time. Waldorf schools prioritize a focus on engaging and opening the child’s mind, spirit and soul to a love of group-based learning within the natural environment. These programs favor lots of time 16

outdoors; also, classrooms tend not to include technology, plastics or synthetic items. Cooperative preschools rely on a lot of parent involvement in the running of the classroom. Such schools are often run by the parents themselves and include a board, with the board being responsible for hiring teachers. Academics-based preschools are teacher-driven classroom settings that emphasize rigorous preparation for elementary school, and there is not as much emphasis on what the children are motivated by or interested in learning and exploring. I can’t recommend this model, as it moves kids away from the way they learn best: by playing. Play is the work of children, and it allows them to focus on developmentally appropriate tasks, which act as building blocks to naturally move the child forward to their next stages and discoveries. How do I find the right fit? When thinking about the right preschool for your child, start with your child. Think about who your child is and what activities they enjoy. Focus on their unique attributes and preferences for activities — and make sure that those qualities and options are supported by and reflected in the school. Next, think about yourself and your family. Although you’re choosing education for your child, it’s important to think about what kind of community you, as a parent, want to be involved in. Thinking about your own child and your own values helps you tune in to a preschool that will be the right fit for everyone involved. Play is the thing When supporting your child’s early education and development, it’s really important for parents to keep in mind that learning happens best through play with other young children. During play, kids learn how to share, solve problems, delay gratification, regulate their emotions and practice flexibility. In addition, play gives children ample


CHILD CARE time and occasion to develop empathy. This is a life skill that is critical for solving problems and dealing with conflict. More and more findings from research confirm that social and emotional skills are the critical building blocks for future academic success, which means we need to prioritize play in order for our children to be ready to learn when they enter elementary school. Sometimes our drive to ensure that our children are prepared for success later in life can create unrealistic expectations for what we want them to know coming out of preschool. For example, having an expectation that our kids should be able to read and write in preschool would not be a developmentally appropriate objective or outcome, because focusing on those skills might come at the expense of tasks and experiences that would be more developmentally appropriate and essential for that age. Of course, if your child is interested in reading and writing, a teacher supporting and providing opportunities for your child to further develop those skills is great. Realistic expectations about what your child will learn from preschool include having ample time to practice skills without fear of making mistakes; developing social and emotional skills through learning how to interact with their peers; developing confidence in their abilities; and discovering that school and learning are fun. How do I make this decision? The first step in the preschool decision-making process is to identify your priorities. This includes taking child-care needs into account — do you need part-time or full-time child care? Carefully consider the location of the preschool. There might be a terrific preschool across town, but are you willing to drive there on non-school days to support your children’s developing friendships? Consider what curricular activities you would like your child to experience. Is a second language important? Is music or the arts important? Is it important that the program or school philosophy is affiliated with a cultural or religious practice? After identifying your priorities, you need to do your research. This involves talking to other parents, attending preschool fairs and evaluating available programs online.

After doing your research, it is imperative to visit schools and ask a lot of questions. Submit your top choices to the kid test: Bring your child with you and notice how the teachers and staff interact with them. Also pay attention to the environment. Is it bright and well lit? Is it clean? Are there any safety red flags that you notice? When you have a chance to ask questions of teachers and administrators, it’s important to inquire about their discipline philosophy and strategies. Keep reflecting on the values you identified

as priorities for a preschool fit for your kid and evaluate whether those seem to be a part of the curriculum and environment. Lastly, trust your instincts. You know your child best, and you will be able to find the right fit for them. And if, for some reason, it doesn’t feel like the right fit after your child has started, know that children are incredibly resilient, and if you need to switch schools, you’ll be able to do so. My biggest piece of advice is to try not to let the preschool hype overwhelm you. When you shift your focus to the bigger picture, the decision becomes less about the “perfect” preschool and more about the best fit for your child and family.

■

Sarina Behar Natkin, LICSW, is a parent coach, speaker and author in the Seattle area. 17


CHILD CARE

King’s Preschool Is a Great Beginning! King’s Preschool offers high-quality care and exceptional education to young children by providing a stimulating, supportive, challenging and integrated learning experience that sets a strong foundation for the elementary years and beyond. A dynamic curriculum is implemented daily by our dedicated and knowledgeable teachers and staff who are committed to lifelong learning, professionalism, observation and purposeful teaching. All classrooms are designed with each child in mind, allowing every student the opportunity to actively engage in learning through creative play, discovery and exploration. In addition, teachers and staff at King’s Preschool build relationships and work together with families to ensure that each child achieves individual success and growth. A safe, consistent and purposeful program is provided by our strong community of teachers and staff.

King’s Preschool is a faith-based preschool and extended care program for children ages 18 months to 5 years.

kingsschools.org/preschool • 206-289-7783 schristensen@kingsschools.org 18


CHILD CARE Preschools + Day Care Centers continued

King’s School ................................................................. 18 Challenging preschool–grade 12 students to grow intellectually in a close-knit, interdenominational Christian learning community Shoreline; 206-289-7783 kingsschools.org/preschool LegUp Service matching busy parents with available child-care seats at licensed, high-quality centers Greater Seattle and Eastside; team@legup.care legup.care North Seattle Cooperative Preschools ............ 15 Cooperative preschools with parent education and support Multiple neighborhood-based schools throughout Seattle; 206-934-7796 northseattlecoops.org

Seattle Department of Education & Early Learning Child Care Assistance Program (CCAP) helps those who are eligible and living within the Seattle city limits to pay for child-care services for children up to age 13 Seattle; 206-386-1050 seattle.gov/education SJCC Early Childhood School Reggio-Emilia-inspired program offering full-day and part-day options for infants to pre-K Greater Seattle and Eastside; 206-388-0825 sjcc.org/programs/early-childhood-school Weekdays Service matching parents with care providers in safe, joyful in-home child care; micro-school options for parents going back to work after COVID-19 Online; 206-208–2852 joinweekdays.com

CHILD HEALTH + WELLNESS Dentists Natural Dentistry Group ......................................... 20 Natural dentistry, custom-made orthodontics, TMJ and sleep appliances for comfort, and the best growth and development in children Mercer Island; 206-257-4921 naturaldentist.com The Tooth Ferry ........................................................... 21 Family-owned and -operated pediatric dental practice conveniently located north of Ballard Seattle; 206-486-7260 toothferrydentistry.com Washington State Dental Association — Special Needs Directory Online directory of oral health-care providers who specialize in treating patients with developmental or acquired special needs Statewide; wsda.org/special-needs-directory

Pediatricians Ballard Pediatric Clinic Private, physician-owned practice of nine primary-care, board-certified pediatricians who enjoy providing high-quality, family-centered care to children from birth to age 18 Seattle; 206-783-9300 ballardpeds.com

Kaiser Permanente — Pediatrics Offering high-quality pediatric primary and specialty care services, as well as easy, convenient access to care that busy parents need Multiple Seattle-area and Eastside locations; kp.org/wa/getcare North Seattle Pediatrics Outstanding, evidence-based pediatric care, physician-owned and -operated for more than 50 years North Seattle; 206-368-6080 northseattlepediatrics.com Odessa Brown Children’s Clinic (OBCC) Community clinic of Seattle Children’s Hospital located in Seattle’s Central District serving children from birth through 21 Central District; 206-987-7210 seattlechildrens.org/contact/odessa-brown The Polyclinic Providing general and high-risk pediatric care, cross-cultural medicine, newborn care, preventive health care, developmental pediatric care and therapeutic care for childhood diseases Multiple Seattle-area clinics; 206-329-1760 (toll-free: 1-800-648-8837) polyclinic.com

19


CHILD HEALTH + WELLNESS

Natural Dentistry for Your Whole Family Natural Dentistry means using the least invasive procedures and least toxic materials available. That means NO mercury, fluoride, nickel, latex or fragrances! Our holistic approach to oral health includes natural methods to remineralize tooth enamel. We work with young children over several appointments if necessary to help them learn what to expect and what is expected of them, and we proceed at a pace appropriate for each child. We welcome parents to stay with their kids, and to hold babies and toddlers on their lap. Most babies can have dental exams and gentle treatments without sedation or general anesthesia, and without “shots,� too. We use a gentle touch for a relaxed, fun and stress-free dental visit! We use comfortable orthodontic expansion appliances to correct crowding, midlines, tongue space, airway and jaw joint alignment. This is followed by kids, teens and adults clear aligners or Invisalign, to finish straightening if needed.

Natural Dentistry is the dental complement to natural medicine. NO mercury, fluoride, nickel, latex or fragrances in our office.

naturaldentist.com • 206-257-4921 appointments@naturaldentist.com 20


CHILD HEALTH + WELLNESS

A Dentist Just for Kids! Children should have their first dental visit by age 1, or six months after you see their first tooth. Choosing your child’s pediatric dentist is as important as choosing their pediatrician. Megan Posthuma, DDS, is board-certified in pediatric dentistry, and every aspect of her office is specifically designed with the unique interests of children in mind. Recognizing that children’s dental visits are not “onesize-fits-all,” The Tooth Ferry team takes the time needed to go at your child’s pace, so that visiting the dentist becomes a fun and empowering experience. Children who visit the dentist regularly and from an early age are primed to develop a love for dental visits. Start your child off on the right foot: Come visit us at The Tooth Ferry and experience the difference a quality pediatric dental visit can make!

We specialize in creating positive associations with dental care that last a lifetime!

toothferrydentistry.com • 206-486-7260 kidsonly@toothferrydentistry.com 21


CHILD HEALTH + WELLNESS Pediatricians

continued Seattle Children’s ....................................................... 48 Offering 60+ pediatric specialty clinics and services, including a Level IV NICU, emergency and urgent care Serving Seattle and the Eastside; 206-987-2000 seattlechildrens.org Swedish Medical Center — Pediatrics ............. 23 Comprehensive, coordinated care, including multiple pediatric specialty departments, for your child from birth through adolescence Serving Seattle and the Eastside; 1-800-SWEDISH (1-800-793-3474) swedish.org/services/pediatric-specialty-care/ our-services UW Medicine — Pediatrics Offering the latest therapies for premature infants in our Level IV and III neonatal intensive care units at UW Medical Center and Valley Medical Center; specialized pediatric gynecology, neurosurgery and trauma services; operating a Level I pediatric trauma center at Harborview Medical Center Greater Seattle area; uwmedicine.org/about/contact-us Virginia Mason — Pediatrics Delivering world-class pediatric care at five locations around the Puget Sound Greater Seattle and the Eastside; 1-866-832-6633 virginiamason.org/pediatrics

National Sexual Assault Hotline (Rape, Abuse & Incest National Network) RAINN’s 24-hour confidential hotline connects callers to a counselor and information on local community resources 1-800-656-HOPE (4673); rainn.org NHTSA — Car Seats and Booster Seats Step-by-step guide to choosing the right seat, installing it correctly and keeping your child safe nhtsa.gov Washington Poison Center 24-hour hotline providing immediate treatment advice and assistance 1-800-222-1222; wapc.org

Required Reading: Baby Care 411 New moms rave about the “Moms on Call” reference book series, coauthored by pediatric nurse practitioners Laura Hunter and Jennifer Walker — great, they say, for parents who want to establish a consistent sleep, eat, play — repeat! — routine. Armin A. Brott’s research-based “The New Father: A Dad’s Guide to the First Year” is a must-have for any new dad, offering practical advice on caring for his child and supporting the new mama.

Safety Center for Childhood Safety Information about car seat safety, guidelines and programs that offer free or low-cost car seats; car seat inspections, bike helmets and life jacket fittings Serving Pierce and South King Counties; Car Seat Helpline: 253-403-1417 multicare.org/childhoodsafety Child Protective Services and Elder Abuse Hotline Washington state’s 24-hour hotline for reporting suspected abuse or neglect of a child or vulnerable adult 1-866-ENDHARM (1-866-363-4276); call 9-1-1 if a child or adult is in an emergency Children’s Advocacy Centers of Washington Coordinating comprehensive services for victims of child abuse Statewide; 1-866-235-4716 cacwa.org

22

Dawn Dais’ “The Sh!t No One Tells You” books are hilariously frank reads, keeping it real with honest anecdotes and wisdom from moms and dads who aren’t at all afraid to tell it like it is.


CHILD HEALTH + WELLNESS

Swedish cares for kids. At Swedish Pediatric Specialty Care, your child will have access to board-certified pediatric physicians and integrated care teams. Comprehensive, personalized care for children and families is our top priority, and we care for children from birth through adolescence. Specialties include: · Pediatric Aerodigestive Diseases · Pediatric Bowel/Bladder Care · Pediatric Gastroenterology · Pediatric General Surgery · Pediatric Growth and Integrated Nutrition Service · Pediatric Infectious Disease · Pediatric Nephrology · Pediatric Neurology and Epilepsy · Pediatric Nutrition · Pediatric Orthopedics · Pediatric Pulmonology · Pediatric Sports Medicine · Pediatric Therapy Services · Pediatric Urology We offer convenient scheduling at both our Seattle and Issaquah locations. Every year, more than 20,000 families turn to Swedish and discover one of the finest and most complete pediatric programs in the region.

Multiple pediatric specialty departments, convenient scheduling, Seattle and Eastside locations, and comprehensive care for the entire family within one system.

swedish.org/services/pediatric-specialty-care/our-services Serving Seattle and the Eastside 23


CHILD HEALTH + WELLNESS

Solving Summer Sleep Woes

Why your baby isn’t sleeping right now, and how to help them catch their z’s By Malia Jacobson

F

irst, the good news: Thanks to social distancing and travel restrictions, fewer children are experiencing ear infections, colds and other minor illnesses this year, says Maida Chen, M.D., director of the Pediatric Sleep Disorders Center at Seattle Children’s Hospital. Because these illnesses routinely disrupt slumber for babies, toddlers and young children, fewer parents are calling about illness-related sleep complaints. However, that doesn’t mean everyone is sleeping soundly in 2020. In fact, more parents are reporting sleep regressions: Babies and toddlers are skipping or dropping naps, suddenly waking at night or taking ages to fall asleep at bedtime. With COVID-19 disrupting family life for the past few months, daily routines, including sleep schedules, may be shifting, says Chen. Here’s how to cope. Redefining regression The term “sleep regression” describes a temporary but troubling return of an undesirable sleep behavior that a parent or caregiver assumed the child had outgrown; for example, sudden night awakenings months after a child had begun sleeping through the night. While sleep regressions can happen at any time, they’re common around 4, 9, 12, 18 and 24 months of age and can coincide with developmental milestones. One 2015 study found that learning to crawl temporarily disrupts nighttime sleep for babies between 5 and 11 months of age. Another study found that transitions in napping patterns in 24

toddlerhood can shift melatonin production and delay bedtime. Sleep regressions can stretch anywhere from a few days to a few weeks or longer, often involving fussy behavior in overtired babies during the day and long stretches of light sleep or crying at night for irritable infants. It’s no wonder that parents want to rush through these regressions and get sleep back on track, stat. Although sleep regressions are real, whether or not they’re a problem may be a matter of perception, says Chen. In about half of the cases, a sleep regression is developmentally appropriate; it’s normal for babies to wake more often after they’ve acquired a new skill, such as learning to roll over or stand. “A sleep regression is really just a change in sleep that’s perceived as undesirable by a caregiver,” says Chen. “It’s simply a misalignment with our expectations of how a baby should be sleeping compared to what’s happening with their sleep.” Why regressions are worse this year It’s true that childhood sleep disruptions seem to be worse this year, despite fewer illness-related sleep complaints from parents, says Chen. But the changes may have more to do with parental stress than actual sleep problems. “The issue is more highlighted now because we’re spending more time at home and traveling less, and parents have zero time away from their kids,” she says. “When you rely on your toddler’s nap or bedtime so that you can work or have a break, you’re going to be more upset


CHILD HEALTH + WELLNESS when those regressions happen.” Yet it’s also true that there may be genuine triggers for disruptions in sleep patterns, such as fewer naps or later bedtimes. For example, spending more time at home might mean that a baby is sleeping later in the morning or taking a longer afternoon nap, two factors that can cause a later bedtime or nighttime awakenings. “Without school or day care for many children, there’s a major lack of structure and daytime cues,” says Chen. These cues help organize sleep patterns for babies, toddlers and children; without them, schedules drift and sleep routines slide. Families are also battling the normal, seasonal early sunrises and late sunsets (at about 10 p.m. by midyear) that disrupt melatonin production and delay bedtimes. This year, summer’s extended daylight combined with a decrease in physical activity and hours of extra screen time can negatively affect sleep, says Chen. How to help First, take inventory of your child’s supposed sleep problems, recommends Chen. “Parents should really do a gut check about what their child is experiencing in terms of sleep, and how big of a problem it really is for the child and the family. Is your child really being affected adversely from a developmental standpoint, or is it really just the stress of upholding what life is supposed to look like?” Determine your family’s sleep priorities. If you’re operating in survival mode and just need to nab enough shut-eye to get through the next day, don’t waste a moment worrying about bringing your toddler into bed with you if it will help everyone get more sleep, says Chen. Only bring your baby into your bed to feed or comfort them, and then place your baby back in his or her own sleep space when you are ready to go to sleep. On the other hand, if keeping your child’s daily routine running smoothly helps keep stress at bay, don’t feel guilty about prioritizing a consistent sleep schedule. “If the family thrives on routine, and survival is not the main concern, then this can be a good time to teach the baby or toddler self-soothing skills.” That could mean allowing

your baby some extra time to fall asleep unaided or encouraging your toddler to play alone if they wake too early or aren’t taking a nap. During periods of sleep slipups, such as skipped naps, early-morning awakenings and later-than-you’d-like bedtimes, gently reinforcing the idea of a “read and rest” period with books and quiet toys can reduce stress for everyone. Whether your family is staying at home most of the time or not, build in regular movement, especially in the morning, when light exposure helps regulate sleep patterns and paves the way for a smoother bedtime. Aim for 10 minutes of outdoor time within the first hour of waking up; try an a.m. walk around the block or a game of hopscotch in the driveway. Investing in inexpensive blackout blinds from a big-box store can also help keep sleep routines intact during the bright spring and summer months, says Chen. Limit screen time, especially in the final hour or two before bed. “This can be a time to establish family routines that support rest, like taking time at night to unplug as a family and relax,” she notes. “Parents can model healthy habits like taking a break from phones and screens at night.” It’s normal to feel stressed when things seem to be falling apart, including your child’s sleep routine, says Chen. But like everything else in babyhood, the change is temporary; children with healthy sleep patterns will nearly always get back on track after a developmental milestone, life change or seasonal disruption passes. If you’re worried about your child’s sleep issues, don’t hesitate to contact their health-care provider with any questions or concerns. “Right now, what parents need most is to give themselves grace,” says Chen.

■

Malia Jacobson is a health and family journalist. Sponsored by

25


CHILDBIRTH SERVICES

Personalized, Private, Family-Centered Maternity Care Have you ever wished that the care provider you get to know during pregnancy will be at your birth? This is possible! Can you imagine staying home after your baby is born and having your care provider come check on you and your baby’s health and well-being? This is possible! Licensed midwives in Washington state are licensed by the Department of Health, able to accept insurance as a form of payment, carry malpractice insurance and administer emergency medicine if needed. Midwives provide evidence-based care that focuses on empowering parents and respecting families’ needs and preferences.

communitymaternityservices.com • 206-353-0540 communitymaternityservices@gmail.com Birth + Postpartum Services Belly to Babies Providing a wide spectrum of doula services to help new mothers through pregnancy, labor and the postpartum period Greater Seattle (206-390-4377), Eastside (425-894-3475) bellytobabies.com Birth Matters Northwest Labor doulas, postpartum doulas, massage, placenta encapsulation, belly binding King and Snohomish Counties; 425-835-3872 birthmattersnw.com Community Maternity Services .......................... 26 Licensed midwife offering complete prenatal care, labor and birth services, postpartum and newborn care Seattle area; 206-353-0540 communitymaternityservices.com Doulas Northwest Compassionate and unbiased expertise and support for today’s families; overnight support from postpartum doulas Greater Seattle and Eastside; 360-602-1564 doulasnorthwest.com 26

Doulas of North America (DONA) — Doula Locator Call or go online to locate a birth or postpartum doula in your area Nationwide online service; 1-888-788-3662 dona.org Eastside Doula Circle Collaborative of professionally trained birth and postpartum doulas Based on the Eastside and serving King, Pierce and Snohomish Counties eastsidedoulacircle.com Exhale Birth Services Midwifery and doula services, childbirth education Greater Seattle area; 727-667-8039 exhalebirthservices.com MultiCare Midwifery Offering a complete range of health-care services specifically for women at clinics conveniently located in neighborhoods throughout the area Multiple Puget Sound locations; 1-800-342-9919 multicare.org


CHILDBIRTH SERVICES

Access the power of your body-mind connection for better births! Nancy is a clinical hypnotherapist and counselor, serving the Seattle area since 1993. She provides private childbirth preparation hypnosis sessions, teaching skills to promote a more relaxed and confident birth. As a longtime birth doula, Nancy’s experience provides a solid foundation for her empowering approach. The Hypnosis for Birth sessions complement, and build on, other childbirth classes and methods. Regardless of your birth plan, having skills and tools, to focus and deeply relax during your birth can make a big difference. Childbirth Preparation | Birth Doula | Counseling | Free Monthly Information Sessions

HypnosisForBirth.com • 425-827-9498 hello@hypnosisforbirth.com Northwest Association for Postpartum Support (NAPS) Local organization dedicated to supporting, educating and certifying postpartum doulas in the Greater Seattle area; free customized referrals 206-956-1955; referrals@napsdoulas.com napsdoulas.com Open Arms Perinatal Services Leading nonprofit providing community-based doula services specifically for pregnant and parenting families in Washington state that are facing poverty Puget Sound region; 206-723-6868; Spanish-language line: 206-317-1842 openarmsps.org Pacific Association for Labor Support Doulas (PALS) Provides personalized assistance in finding a doula King, Snohomish, Pierce and Kitsap Counties; 206-329-7257 palsdoulas.org

Rainier Valley Midwives Equitable midwifery-led care is all-inclusive and provides mothers with lactation support, a doula, access to physician care, and mental health and well-being check-ins Rainier Valley, Seattle; 206-712-7352 rv-cc.org Seattle Doulas Birth and postpartum doulas, placenta encapsulation, virtual childbirth education classes, pregnancy and postpartum support groups, prenatal yoga Greater Puget Sound area; 206-717-4400 seattledoulas.com Thresholds ..................................................................... 29 Retreat-style childbirth classes and specialty workshops Puget Sound area; 206-819-1383 thresholds.info Tranquility Postpartum Support Childbirth educator, postpartum doula, infant sleep consultant, AHA CPR instructor and parenting educator offers postpartum doula services, childbirth and postpartum classes Serving north King County and south Snohomish County; 206-595-3240 fourthtrimester.com 27


CHILDBIRTH SERVICES Birth + Postpartum Services continued

What to Expect Independent, medically reviewed pregnancy and parenting site providing expert, authoritative, evidence-based health information for every step of the pregnancy and parenting journey Online resources; whattoexpect.com

Postpartum Depression Support Moms’ Mental Health Matters Action plan and resources to address depression and anxiety during pregnancy and after birth Online; nichd.nih.gov Parent Support of Puget Sound Nonprofit, volunteer-run organization supporting people who have lost a baby through miscarriage, stillbirth or infant loss; peer support groups, events, resources, referrals, more Puget Sound; 425-686-9451 psofpugetsound.org Perinatal Support Washington Nonprofit provider of resources, new parent support groups and a “Warm Line” to assist parents recovering from pregnancy and postpartum mood disorders in connecting with peers and licensed therapists Statewide; 1-888-404-7763 perinatalsupport.org Postpartum Men Helping men beat the baby blues with information, resources, self-assessment for postpartum depression, community forum Online; postpartummen.com Postpartum Support International (PSI) Services dedicated to helping families suffering from postpartum depression, anxiety and distress Helpline: 1-800-944-4773 postpartum.net Swedish Center for Perinatal Bonding and Support Specialized care to prevent and treat perinatal mood and anxiety disorders, and strengthen attachment Greater Seattle area; 206-320-7288 swedish.org/locations/ center-for-perinatal-bonding-and-support

Maternity Health Care 3W Medical for Women Empowering women through evidence-based services and education to make the best medical decisions Greater Seattle area; 206-588-0311 3wmedical.org 28

Hypnosis for Birth ...................................................... 27 Offering private birth preparation, counseling, clinical hypnotherapy and birth doula services since 1993 Greater Seattle area; 425-827-9498 hypnosisforbirth.com Kaiser Permanente — Women’s Health Centers Obstetrics and gynecology, pregnancy services and other women’s health services; serving patients at multiple locations across Washington state 1-888-874-1620; wa.kaiserpermanente.org Northwest Women’s Healthcare Providing expert consultation, preventative and therapeutic health care, and both medical and surgical services for women of all ages First Hill Swedish campus, Seattle; 206-386-3400 nwwomenshealth.com The Polyclinic — Obstetrics & Gynecology All-female provider group of board-certified physicians and nurse practitioners dedicated to women’s health at each stage of life Northgate Plaza, Madison Center locations in Seattle; 206-860-4541 polyclinic.com Swedish Medical Center — OB/GYN Specialists Complete range of obstetrical and gynecologic services for women from adolescence through menopause; state-of-the-art outpatient procedures Multiple locations; 1-800-SWEDISH (793-3474) swedish.org UW Medicine ................................................................. 32 Providing complete care for women through all stages of life, with obstetrics, gynecology, midwifery, fertility/infertility, prenatal/neonatal and pediatrics services Multiple Greater Seattle locations; 206-520-6055 uwmedicine.org/specialties/ center-for-women-and-children Virginia Mason Medical Center —Gynecology Gynecology specialists focus on ensuring the gynecologic health and well-being of patients Seattle (206-223-6191), Edmonds (425-775-9474), Bellevue (206-223-6191), Federal Way (253-838-2400) virginiamason.org Washington State Health Care Authority (HCA) Find eligibility requirements for Washington Apple Health for pregnant individuals to apply for or renew coverage Statewide; 1-800-562-3022 hca.wa.gov


CHILDBIRTH SERVICES

Relationship-Based Workshops for Expecting Families Congratulations, you have entered the wonderful and wild world of pregnancy. We want to help you cross the parenting threshold with confidence! At Thresholds, we believe that childbirth preparation should also be parenting preparation. Hands-on practice, realistic expectations and unconditional support are what we provide. Our classes are interactive and thought-provoking. You and your partner will have time to relax, love and learn as you explore how you will cope with the unknown and intense nature of birth. We offer in-person and virtual workshops evenings and weekends. Thresholds strives to create a healthy and productive environment for all families, regardless of who you love or your race, religion, body size, ability to pay or family configuration. When you strengthen emotional connection and gather practical information YOU WILL THRIVE. Photos by Alec Mills, alecmillsphotography.com

Now offering: Birthing From Within, Bringing Baby Home, Nourishing Newborns, Get That Baby OUT!, Birth Story Healing and private sessions.

thresholds.info • 206-819-1383 amity@thresholds.info 29


CHILDBIRTH SERVICES

Bringing Home Baby

12 Essentials You Actually Need By Kali Sakai

B

efore you go wandering glassy-eyed through the aisles frantically filling your shopping cart in impending parenthood panic mode, check out our list of must-haves — curated from hard-earned wisdom and on-the-job experience in the child-rearing trenches. 1. Car seat: Car seats are mandatory by federal law, and the hospital won’t allow you to take baby home without one. Nonprofit Safe Kids Worldwide (safekids.org) is a tremendously valuable resource for tips on buying and installing a proper car seat for your child at every age and stage.

This goes without saying, but there is a lot of spit-up in your future. Keep at least 15-20 burp cloths on hand that are washed and ready for duty.

for frame strollers, which are exactly what they sound like: a frame with wheels that you can snap your infant car seat into — done and done. 4. Diaper bag: The best diaper bags feature waterproof/microfiber surfaces, offer plenty of pockets for storage, can be slung cross-body or sport backpack straps, and come in designs that all caregivers will want to be seen using. 5. Nursing essentials: If you’re breastfeeding, a trusty nursing pillow is a must for keeping baby in the optimal position, and mom should have at least two good nursing bras or tank tops in rotation, plus nursing pads so she doesn’t leak through her shirts. 6. Bottles and formula: Recommendations vary on when to introduce a bottle, but you may need one sooner than you think. Options include glass or BPA-free plastic bottles, breast-mimicking or classic-style nipples, gas-reducing venting technology and more. If you’re supplementing or planning to formula-feed, you can choose between organic, soy and reflux-reducing formulas in addition to the conventional brands. 7. “Burp” cloths: This goes without saying, but there is a lot of spit-up in your future. Keep at least 15–20 burp cloths on hand that are washed and ready for duty.

2. Soft carrier: When you can’t put your newborn down but want to move around with your hands free, soft carriers are lifesavers. Styles range from sling to wrap to front-to-back convertible, so talk to a friend, try a few out (keep your receipts)!

8. Co-sleeper or bassinet: Most newborns start out sleeping somewhere near mom. Co-sleepers attach securely to the parental bed and have a padded drop-side for easy transfer of baby back to his own sleep space after feeding. A bassinet can be a convenient and portable solution for the first few months.

3. Stroller: If you’ve already chosen your primary stroller, see if it has an adapter available for your baby car seat model. Otherwise, look

9. Sleep soothers: Here are my three top recommendations for helping your newborn — and you! — get some rest: Stream the “Happiest

30


CHILDBIRTH SERVICES

Baby on the Block” video (or read the book) to learn invaluable baby-calming skills; have several pacifiers on hand; and invest in at least two swaddlers to keep baby wrapped up snugly. 10. Diapering essentials: Choosing a diapering strategy can be a daunting proposition. Cloth diapers work beautifully for some families. For disposable options, Diaper Dabbler (diaperdabbler.com) is an easy way to try several brands and see what works without buying a whole package. Diaper cream will literally save your baby’s butt — look for a brand with 12–40 percent zinc oxide. 11. Reference book: If there were ever an instruction manual that should come with ba-

bies, “Baby 411” (now in its ninth edition) gets my vote. Authors Denise and Alan Fields team up with pediatricians and other specialists to regularly update this comprehensive, straighttalking, easy-to-navigate reference about caring for babies ages 0–12 months. 12. Tdap and flu shots: Everyone who comes in contact with your baby must be vaccinated at least two weeks before the new bundle arrives. Don’t forget to breathe — welcome to parenthood! Kali Sakai is a Seattle-based freelance writer and blogger; read her work at evidentlyblog.com. 31


CHILDBIRTH SERVICES

UW Medicine provides expert women’s health care for all stages of life. UW Medicine provides complete care for women through all stages of life. From expert advice on birth control to preparing for pregnancy, we’ll help you achieve your health goals. Our UW Medicine doctors now offer safe and secure video-based appointments to address your health needs without leaving home. During virtual visits, you’ll receive the same personal and attentive care from our doctors as you would in person at our clinics. We also offer pregnancy care, complete with equipment so you can take your own blood pressure and find your baby’s heartbeat using a doppler machine.

uwmedicine.org/maternity 206-520-6055 uwmarketing@uw.edu

32


COMMUNITY SERVICES

Everyone Is Welcome For 70-plus years, the Stroum Jewish Community Center of Greater Seattle has been a place where friendships form, traditions thrive and community strengthens — a place everyone is welcome. We remain as committed to this as ever as we navigate 2020 and beyond. Our Reggio Emilia-inspired Early Childhood School prepares children from infants to pre-k for kindergarten and beyond. As your family grows, we offer opportunities to attend camp, join after school classes, play with friends, learn to swim and volunteer together as you forge lifelong friendships with other families. There is something for everyone in the family at the J.

sjcc.org • 206-232-7115 info@sjcc.org Community Centers

Family + Social Services

Boys & Girls Clubs of King County 34 clubs serving more than 25,000 young people with hundreds of programs Multiple Greater Seattle locations; 206-436-1800 positiveplace.org

Atlantic Street Center Wrap-around services including education, family support and behavioral health counseling to the low-income minority populations of King and Pierce Counties 206-329-2050; atlanticstreetcenter.org

Seattle Parks & Recreation Community Centers Find the community center nearest you seattle.gov/parks/find/centers/ community-centers-a-z Stroum Jewish Community Center .....................33 For more than 70 years, the JCC of Greater Seattle has been a place where friendships form, traditions thrive and community strengthens Greater Seattle and Eastside; 206-232-7115 sjcc.org YMCA of Greater Seattle Offering child care for kids ages 0–12; youth and family programs and social services; camps, classes and fitness 13 Seattle-area and Eastside locations; seattleymca.org

FamilyWorks Seattle Connecting neighbors and families to nourishing food, essential resources and a supportive community; two food bank locations; playgroups, parenting classes, advocacy, referrals, more Wallingford, Greenwood; 206-694-6727 familyworksseattle.org Jewish Federation of Seattle .................................35 From books mailed to your home to interactive song and story times, every Jewish family has a home with Federation! Greater Seattle area; 206-774-2259 jewishinseattle.org/youngfamilies North Helpline Provider of basic resources to families in need, including two food banks, client services, financial assistance and health-care screenings and services North Seattle; 206-367-3477 northhelpline.org 33


COMMUNITY SERVICES Family + Social Services continued

ParentHelp123 — Service of WithinReach Providing simple, integrated, family-focused information about state-benefit programs and local resources for families, including applying for health insurance, food assistance programs and much more Statewide; 1-800-322-2588 parenthelp123.org Public Health — Seattle & King County Health-care services and resources for the entire family King County; 206-296-4600 kingcounty.gov Renton Area Youth & Family Services (RAYS) Provider of high-quality, integrated behavioral health care and prevention services to children, youths and families, to restore hope for a healthier future Renton (425-271-5600), Seattle (206-772-2050) rays.org Washington State Department of Children, Youth & Families Services for families and youth, including child care and early learning, foster parenting, adoption and adoption support, Child Protective Services (CPS) and access to programs benefiting Washington state families in need Statewide; dcyf.wa.gov Washington State Division of Child Support Information about receiving or paying child support and how to apply Statewide; 1-800-442-KIDS (5437) dshs.wa.gov/esa/division-child-support Women, Infants and Children Nutrition Program (WIC) Program serving eligible pregnant, postpartum and breastfeeding women and children up to 5 years old with monthly checks for food, nutrition education, breastfeeding support, and health screenings and referrals Over 200 clinics statewide; Help Me Grow WA Hotline: 1-800-322-2588 doh.wa.gov/YouandYourFamily/WIC

Immigrant + Refugee Services Center for MultiCultural Health Promoting health and well-being in diverse communities; Refugee Health Advocacy Project offers case management and English-language training for immigrant and refugee families Seattle; 206-461-6910 cschc.org 34

CISC Early childhood education, youth development, family support, cultural navigation, senior and disabled adult services, and health-care access programs for immigrants and their families King County; 206-624-5633 cisc-seattle.org East African Community Services Providing education and citizenship programs and case management services for the East African community King County; 206-721-1119 eastafricancs.org El Centro de la Raza Comprehensive programs and services for the Latino community Seattle; 206-957-4607 elcentrodelaraza.org Jewish Family Service Culturally diverse and caring staff helps refugees and immigrants make a successful transition to self-sufficiency Seattle (206-461-3240), South King County (253-850-4065), Eastside (425-643-2221) jfsseattle.org Lutheran Community Services Northwest (LCSNW) Provider of services for behavioral health issues, family and community support, refugee and immigrant resettlement, child welfare, crime victims, and assisting seniors and people with disabilities remain independent Multiple Washington state offices; 206-901-1685 lcsnw.org Mother Africa Programs designed to help African refugee and immigrant women and their families reach their fullest potential Kent; 253-277-7625 motherafrica.org Neighborhood House Individual and family assistance centers offer a range of employment, housing, adult education and case management support as well as connections to community, early education and health resources Multiple Seattle-area locations; central office: 206-461-8430 nhwa.org/contactus


COMMUNITY SERVICES

Federation’s Jewish experiences designed just for you and your family! Jewish Federation is here to help your family figure out how Jewish works for YOU — whether you’re looking for an easy way to bring Jewish songs and stories into your life or a supportive cohort learning experience with other parents (child care included)! Every Jewish family has a home with Federation. Get involved today! • PJ Library® Books — free to your mailbox every month jewishinseattle.org/pjlibrary • Bim Bam Baby! — Shabbat song and story time jewishinseattle.org/bbb • Jewish Parenting Together — support for parenting the oys and joys with child care included jewishinseattle.org/jpt There is something for everyone, from Bainbridge Island to Sammamish and beyond, to create a supportive Jewish experience for you and your family, designed with you in mind.

We can’t wait to see you!

jewishinseattle.org/youngfamilies • 206-774-2259 lisar@jewishinseattle.org

35


COMMUNITY SERVICES Immigrant + Refugee Services continued

Refugee Women’s Alliance (ReWA) Nonprofit providing holistic services to help refugee and immigrant women and families quickly and effectively stabilize, acculturate, increase language proficiency and improve employability Rainier Valley; 206-721-0243 rewa.org Southeast Youth & Family Services Licensed mental health center providing comprehensive early learning and mental health services; African and Asian immigrant and refugee support and community outreach Seattle; 206-721-5542 seyfs.org

Southwest Youth & Family Services (SWYFS) Leading resource for education, counseling, youth and family development services and programs for low-income families in Southwest King County 206-937-7680; swyfs.org Ukrainian Community Center of Washington Offering immigration services, behavioral health and social services; by appointment only; languages spoken: Russian, Ukrainian and Polish Statewide; 425-430-8229 uccwa.org

FAMILY HEALTH + WELLNESS Complementary + Alternative Medicine Body Motion Physical Therapy Helping women through pregnancy and beyond so they can live active, confident and healthy lives to prevent surgery and the need for medications Edmonds; 425-582-0727 bodymotionpt.com Catalyst Health Studio Gentle and holistic chiropractic care for preconception, pregnancy, postpartum, pediatrics and performance Queen Anne; 206-483-7207 catalysthealthstudio.com Elizabeth Rogers Pilates & Physical Therapy Comprehensive orthopedic, pelvic health and Pilates expertise to manage common pregnancyrelated concerns, such as pelvic and lower back pain, pelvic organ prolapse, urinary incontinence, diastasis recti, c-section scars, painful intercourse, bowel dysfunction Mount Baker, Ravenna; 206-535-7356 elizabethrogerspt.com Emerald Physical Therapy & Pilates Pilates-based holistic rehabilitation for treating pre-, peri- and postpartum patients Ballard; 206-708-6766 emeraldptpilates.com Esva Healing Acupuncture to guide the body toward overall health and provide a safe environment focused on healing Greater Seattle area; esvahealing@gmail.com esvahealing.com 36

Hooyman Family Chiropractic Chiropractic adjustments, treatment of headaches and migraines, prenatal chircopractic care Greenwood; 206-486-6451 hooymanfamilychiropractic.com Inner Rhythm Wellness Integrative physical therapy, women’s health, nutrition and lifestyle coaching, medical yoga and Pilates instruction Seattle area; tara@innerrhythmwell.com innerrhythmwell.com Meghan Devonport, LMP, Therapeutic Massage Licensed esthetician and massage practitioner with certifications in perinatal massage, structural integration, CranioSacral Therapy (CST), reflexology, sports massage, neuromuscular and Reiki Ballard, Queen Anne; 561-843-5935 meghandevonport.com Seed of Life Chiropractic + Wellness Promoting the health of the community by providing state-of-the-art complementary and alternative health care to people of all ages, with a focus on prenatal and pediatric care Serving Fremont, Wallingford and the Greater Seattle area; 206-519-6634 seedoflifechiro.com Solfuel Wellness Functional Manual Therapy (FMT) for conception, pregnancy, delivery preparation and postpartum recovery Columbia City; 425-448-2567 solfuelwellness.com


FAMILY HEALTH + WELLNESS Therapydia Women’s health physical therapy services to treat pelvic pain, pelvic floor dysfunction Ballard; 206-735-4414 therapydia.com Tree of Life Chiropractic Providing prenatal, postnatal and pediatric chiropractic care to families in the Seattle area Wallingford; 206-652-4807 treeoflifeseattle.com Vital Chiropractic & Wellness Center Chiropractic care for fertility and pregnancy issues, athletes, injury and rehabilitation, infant/pediatric issues, plus licensed massage therapy Mount Vernon; 360-848-6755 vitalchiro.com Vital Flow Massage & Bodywork Compassionate, individualized massage therapy for your pregnancy journey; labor prep massage, cesarean scar massage, and pelvic and back pain relief Everett; 425-224-5538 vitalflowmb.com

Coronavirus (COVID-19) Resources City of Seattle COVID-19 Community Resources Information and links for City of Seattle programs and services to aid residents significantly impacted by the COVID-19 pandemic City of Seattle; 206-684-4000 seattle.gov/mayor/covid-19 Downtown Public Health Center Offering free COVID-19 testing for people with symptoms Seattle; 206-477-8300 kingcounty.gov/covid United Way of King County United Way is working to coordinate free meals for youths during school closures and additional resources for families King County; 206-461-3700 uwkc.org/covid-19-updates Washington State Coronavirus Response (COVID-19) Website providing information to help families, workers and employers navigate the COVID-19 crisis, including details of Gov. Inslee’s “Safe Start” guidance for reopening Statewide; coronavirus.wa.gov Washington State Department of Children, Youth & Families Resource guide to help families with children navigate the stressors brought about by the COVID-19 outbreak Statewide; dcyf.wa.gov/coronavirus-covid-19

Washington State Department of Health Coronavirus (COVID-19) Information Website provides current information about the coronavirus (COVID-19) outbreak, including symptoms, testing, resources and latest health advisories Statewide; 1-800-525-0127 doh.wa.gov/emergencies/coronavirus

Family Medicine HealthPoint Complete, convenient care, including whole family medicine and dentistry, pediatrics, obstetrics, naturopathic medicine, WIC, pharmacy and more Multiple King County locations healthpointchc.org Immunity Community — a WithinReach Program ........................................................................... 41 A vaccine promotion program of WithinReach that also helps families connect with health and food resources Statewide; 1-800-322-2588 immunitycommunitywa.org Kaiser Permanente — Primary Care: Family Medicine and Pediatrics Full-service medical centers offer primary care, various specialties, a pharmacy and (at most locations) radiology and lab services Multiple locations statewide; 1-888-874-1620 wa.kaiserpermanente.org One Sky Family Medicine ....................................... 42 Naturopathic primary care clinic specializing in women’s health, pediatrics, lactation services, fertility, postpartum care Located in the Ravenna neighborhood of Seattle; 206-363-5555 oneskyfamilymedicine.com Pacific Medical Centers — Primary Care Multispecialty network of board-certified physicians providing excellent family medicine, internal medicine, pediatrics care services Multiple Seattle-area locations; 1-888-4PACMED (1-888-472-2633) pacificmedicalcenters.org The Polyclinic — Family Medicine Practice encompassing all areas of primary care for all ages, newborns to seniors, including preventative care, management of chronic conditions, pediatrics, women’s health, men’s health, sexual health Multiple Seattle locations; polyclinic.com/family-medicine

37


FAMILY HEALTH + WELLNESS

When to Go to a Pro

Expert advice on when you should take your sick baby to the doctor By Malia Jacobson

I

f it seems like your baby is always coming down with something, there’s an explanation. Because babies are still building critical immune-supporting antibodies, they lack protection against viruses and bacterial illnesses that circulate during cold and flu season. According to the American Academy of Pediatrics (aap.org), babies catch as many as 10 colds per year, more if they have older siblings or attend day care. Since each illness may result in from two to three weeks of symptoms, your baby may be sick as many as 140 days out of the year. But not every sniffle or sneeze warrants a visit to the doctor — and going in for unnecessary office visits may expose your baby to more germs or spread them to others. When you’re considering a doctor visit for your baby, here’s how to know when to go.

VIRAL ILLNESSES Although viral illnesses like influenza (aka the flu) are more common during the winter and spring months, they can happen at any time. “For viral infections, we treat symptoms, but because the illness is viral and not bacterial, antibiotics are not needed,” says Frida Pena, M.D., a family medicine physician at Overlake Medical Center in Bellevue. RSV and bronchiolitis Respiratory syncytial virus, or RSV, is a common respiratory illness that can progress to a lung infection called bronchiolitis. RSV usually begins like a regular cold, with a stuffy or runny nose, a mild cough, fever (temperature higher than 100.4 degrees F/38 degrees C) and decreased appetite. As the illness progresses, the afflicted child may breathe rapidly or have trouble breathing, wheeze or make a whistling sound when breathing, or have a severe cough. When to go: Many children with RSV or bronchiolitis do not need to see a doctor. But parents 38

should watch for some important symptoms, says Pena. Call your health-care provider if: • You can see indentations between or below your baby’s ribs when they breathe. • Your baby’s nostrils flare (get bigger) when they breathe. • Your baby is younger than 3 months and has a fever (temperature greater than 100.4 degrees F/38 degrees C). • Your baby is older than 3 months and has a fever (temperature greater than 100.4 degrees F/38 degrees C) for more than three days. • Your baby has fewer wet diapers than normal. Erythema infectiosum (better known as fifth disease) Erythema infectiosum, or fifth disease, is a common contagious illness with mild symptoms that include fever, headache, sore throat, cough, diarrhea, vomiting and muscle aches that last from two to five days. After these symptoms fade, children may develop a lacy, bright pink “slapped cheek” rash across the face, arms and upper back, along with joint pain. When to go: Most children feel better within a week and don’t require a doctor visit. See your pediatrician or health-care provider in the following situations: • If your baby has an immune or blood disorder and has symptoms of fifth disease. • If your baby has symptoms for longer than a month. • If you develop fifth disease during pregnancy. In rare cases, fifth disease can be dangerous for an unborn baby. Hand, foot and mouth disease Hand, foot and mouth disease (HFMD) is a common babyhood illness that causes painful sores to form in the mouth and on the hands, feet, buttocks and, sometimes, the genitals. The condition is un-


FAMILY HEALTH + WELLNESS comfortable but usually short-lived — symptoms fade within a week or so. When to go: It’s best to keep kids with HFMD at home to avoid spreading this highly contagious illness, says Pena. Call your pediatrician if: • Your baby is drinking less than usual and hasn’t had a wet diaper for about four to six hours. • The condition isn’t improving after several days or symptoms seem to be getting worse. Croup Croup is a term for a group of infections that affect the trachea (the main airway through which we breathe), causing a distinctive cough that sounds like a seal barking. Croup infections are most com-

Call your baby’s pediatrician if: • Your baby’s cough won’t go away. • Your baby starts to drool or can’t swallow. • Your baby makes a noisy, high-pitched sound when breathing, even while just sitting or resting. • You see indentations between or under your baby’s ribs when breathing. • Your baby is younger than 3 months and has a fever (temperature greater than 100.4 degrees F/38 degrees C). “All these diseases can be prevented by washing your hands and your baby’s hands often with soap and water, or using alcohol-based hand sanitizers for older children; staying away from adults and children who are sick; and making sure your baby gets all the recommended vaccines, including the flu shot,” says Pena. While you’re at it, get a flu shot for yourself.

BACTERIAL INFECTIONS

mon between 6 months and 3 years of age, and are less common after age 6. When to go: In most children, croup goes away on its own. However, in some cases, croup warrants a doctor visit or may even require immediate medical attention in an emergency department. Call 911 if your baby: • Starts to turn blue or pale. • Is breathing with extreme difficulty. • Can’t speak or cry because they can’t get enough air. • Is very upset, very sleepy or doesn’t seem to respond to you.

Many common babyhood illnesses, from strep throat to whooping cough, are caused by bacteria. “For bacterial infections, recommendations in terms of how to prevent them are the same as for viral infections,” says Pena. The main differences between these illnesses and viral infections: Bacterial illnesses require either oral or topical treatment, and an office visit is usually required. Strep throat About 3 in 10 sore throats are caused by streptococcal bacteria, resulting in strep throat. Strep throat causes severe throat pain, fever and swollen glands in the neck. Strep throat is less common in babies than in older children; babies with strep throat may be especially fussy or disinterested in eating. u 39


FAMILY HEALTH + WELLNESS

When to Go to a Pro continued from page 39

When to go: If you suspect strep throat, contact your baby’s health-care provider, since this bacterial infection requires treatment. Additionally, contact your baby’s doctor if the baby: • Has a fever of at least 101 degrees F or 38.3 degrees C. • Doesn’t want to eat or drink anything. Call 911 if your baby has trouble breathing or swallowing, is drooling much more than usual, or has a stiff or swollen neck. Scarlet fever The same bacteria that cause strep throat can also cause scarlet fever, a condition that includes a red rash. Children with scarlet fever usually have a sore throat along with a spotty, red, sandpaper-like rash on the head and neck that spreads to the body, arms and legs. Your baby’s tongue may appear bright red with white spots. When to go: Scarlet fever is treated with antibiotics, so it’s important to call your baby’s health-care provider if the baby has a sore throat accompanied by a rash. As with strep throat, seek medical attention if your baby: • Has a fever of at least 101 degrees F/38.3 degrees C. • Doesn’t want to eat or drink anything.

pect impetigo; the condition requires treatment with antibiotics to avoid spreading the illness to others. Also, be sure to call your baby’s doctor if the sores: • Continue to spread after beginning antibiotic treatment. • Don’t begin to improve 24 hours after starting treatment. Whooping cough Also called pertussis, whooping cough is an infection that causes a severe cough that can last for weeks or months. The distinctive “whoop” sound occurs when someone tries to breathe after a coughing attack, but not everyone with whooping cough will make the sound, says Pena. Symptoms include sneezing, a runny nose, and a cough that lingers and gets worse after other symptoms resolve. This illness is preventable through vaccination; children should get five doses of the whooping cough vaccine by age 6.

Call 911 if your baby has trouble breathing or swallowing, is drooling much more than usual, or has a stiff or swollen neck.

When to go: Whooping cough requires treatment with antibiotics for the person with the illness as well as family members, even if they’re not sick. After your baby begins antibiotic treatment, watch for the following signs that may require another doctor visit. Your baby: • Develops a fever. • Vomits repeatedly from coughing. • Loses interest in eating or drinking. • Appears dehydrated, with fewer than four to six wet diapers in 24 hours.

Impetigo When bacteria get into cuts and scrapes, a skin infection called impetigo can cause red, painful bumps on the skin, usually on the face, arms or legs. These bumps go on to form blisters before scabbing over; scabs are often yellow, gold or brown.

If you still have questions about when to take your baby to the doctor, pick up the phone. Caregivers should always call their baby’s health-care provider anytime they have questions or concerns about their baby’s health, says Pena. Here’s to a healthier first year with fewer sick days!

When to go: Call your baby’s doctor if you sus-

Malia Jacobson is a health and family journalist.

40

■


FAMILY HEALTH + WELLNESS

Stay Safe, Stay Healthy, Stay Vaccinated! It is more important than ever for babies and children to stay up-to-date on their routine vaccinations. Clinics have changed to make it safe for your child to get needed vaccines, so that they can be protected from 14 serious diseases. Talk with your doctor or clinic today about the immunizations your child needs to stay healthy, and to see what safety measures they have put in place to protect your family during COVID-19. Vaccinating children on time is the best way to protect them from vaccine-preventable diseases, such as measles and pertussis.

immunitycommunitywa.org • 1-800-322-2588 ic@withinreachwa.org Family Medicine continued

Swedish Family Medicine Family physicians integrate the biological, clinical and behavioral sciences to provide continuing and comprehensive health care for all ages, sexes, each organ system and every disease entity Multiple Seattle-area and Eastside campuses; 1-800-SWEDISH swedish.org UW Medicine — Primary Care Active patient-provider relationships, seamless coordination across care teams, full-spectrum care for all through all stages of life, urgent care clinics for walk-ins 7 days a week Multiple Seattle-area locations; uwmedicine.org Virginia Mason — Family Medicine Care Physicians serve as primary care providers and work closely with teams of specialists, hospitalists and nurses to coordinate and personalize care for your unique family Greater Seattle and the Eastside; 1-866-832-6633 virginiamason.org/family-medicine

Fertility + Reproductive Health Abundant Spring Specialized acupuncture and Traditional Chinese Medicine treatments for women and men experiencing infertility Bellevue; 425-644-5375 abundantspring.com ORM Fertility Expert care and a state-of-the-art embryology lab to help achieve the highest success rates Bellevue; ormfertility.com/bellevue Planned Parenthood Nonprofit provider of high-quality, affordable health care and the nation’s largest provider of sex education Multiple Puget Sound-area health centers; 1-800-230-PLAN (7526) plannedparenthood.org RESOLVE: The National Infertility Association National patient advocacy organization providing free support groups in more than 200 communities; patient advocacy; and resources for anyone challenged in their family building Nationwide; 703-556-7172 resolve.org 41


FAMILY HEALTH + WELLNESS

Integrative Naturopathic Primary Care in Seattle One Sky Family Medicine offers a holistic approach to primary care, specializing in pediatrics and women’s health. Utilizing the best of both naturopathic and conventional medicine, we use a variety of tools in the care we provide, including standard and alternative lab testing, diet and lifestyle counseling, hydrotherapy, prescription medications, herbal medicine and nutrient therapy. We offer full-spectrum primary care, including newborn exams, well-child visits, preventive medicine, fertility and preconception care, lactation services and postpartum care. Though the physicians at One Sky Family Medicine are no longer attending births, several are retired midwives and have a deep love of caring for newborns and their families.

oneskyfamilymedicine.com • 206-363-5555 info@oneskyfamilymedicine.com Fertility + Reproductive Health continued

The Vasectomy Center Advanced no-needle, no-scalpel vasectomy technique, performed by board-certified doctors with decades of experience Swedish Medical Center – Issaquah; 425-394-0773 vasectomyclinic.com

Mental Health Childhaven Early learning, early intervention and family counseling programs to prevent childhood trauma and create safe, stable and nurturing relationships and environments Puget Sound service area; 206-624-6477 childhaven.org Children’s Home Society of Washington Nonprofit organization providing residential and group care for troubled children as well as a range of family support, therapeutic, adoption and advocacy services Regional offices statewide; 206-695-3200 (toll-free: 1-800-456-3339) childrenshomesociety.org

42

Coleman Family Services Private, community-based agency utilizing a counseling model that understands behavioral problems within the context of family relationships and the social environment Renton; 425-235-9386 colemansfamilyservices.org Consejo Counseling and Referral Service Award-winning agency providing behavioral health services to the Latino community in the state of Washington 11 locations around Washington; main office: 206-461-4880 consejocounseling.org Cooper House Treating the social, emotional and behavioral challenges of infancy and early childhood, with signature programs Fussy Baby Network® and Smooth Way Home Serving Seattle/King County from two Capitol Hill locations; 206-402-3168; Spanish-language line: 206-402-3972 cooperhouse.org


FAMILY HEALTH + WELLNESS Familywise Northwest Fourteen-week, evidence-based, therapist-led programs offered for parents and their children to address behavioral challenges Greater Seattle and Eastside; 425-295-1705 familywisenw.com Mindful Therapy Group Like-minded collaborative of over 100 mental health-care specialists serving with compassion, experience Greater Seattle and Eastside; 425-640-7009 mindfultherapygroup.com Navos Nonprofit organization dedicated to transforming the quality of life for people vulnerable to mental illness and substance use disorders; infant/family mental health programs offered Locations in Seattle and Burien; 206-248-8226 navos.org P.E.E.R.S. Play Individualized services to support healthy child development through engagement, emotional regulation and social play; support for families created through adoption Seattle; peersplay.com Samaritan Center of Puget Sound Spiritually integrated counseling and education for individuals and families of all faiths and lifestyles 13 Puget Sound locations; 206-527-2266 samaritanps.org Sound Emotional and behavioral health services for children and families, including mental health and addiction assessments, individual and family therapy, parenting support, care coordination, more Offices in Seattle Metro area, King County; 206-302-2300 sound.health THIRA Health Solutions as unique as every patient, with an emphasis on sustainable journeys, whole-person treatment and dialectical behavior therapy Bellevue; 425-454-1199 thirahealth.com Valley Cities Behavioral Health Care Offering mental health, chemical dependency and domestic violence counseling as well as psychiatric assessment, medication management, vocational training, family support services, and homelessness and housing services 10 King County locations; 253-833-7444 (after-hours crisis line: 206-461-3222) valleycities.org

Help Lines If you or someone you care about is suicidal or in emotional crisis, caring professionals are ready to listen and assist you in finding the help you need. 2-1-1 Statewide 2-1-1 connects callers, at no cost, to critical health and human services in their community; Monday–Friday, 8 a.m.–6 p.m. 2-1-1 or 1-877-211-9274; win211.org King County 24-Hour Crisis Line (Crisis Connections) Designated mental health crisis hotline for King County; calls answered 24/7/365 1-866-4-CRISIS (1-866-427-4747); crisisconnections.org National Suicide Prevention Lifeline 24-hour hotline for anyone in suicidal crisis or emotional distress 1-800-273-TALK (8255); suicidepreventionlifeline.org Perinatal Support Washington’s “Warm Line” Helpline connecting parents recovering from pregnancy and postpartum mood disorders with peers and licensed therapists 1-888-404-7763; perinatalsupport.org Teen Link Confidential teen-answered helpline and text-line available evenings 6–10 p.m. 1-866-833-6546; 866teenlink.org WA Recovery Help Line 24-hour crisis intervention and referral line for those struggling with issues related to mental health, substance abuse and problem gambling 1-866-789-1511; warecoveryhelpline.org

43


FAMILY HEALTH + WELLNESS

Orthopedics and Pelvic Rehab Flow Rehabilitation specializes in pelvic health for the whole family. Pelvic floor conditions, including bowel (constipation), bladder (incontinence, urgency), pelvic organ prolapse and sexual health (pain with intercourse), are all issues we treat every day. Sacroiliac joint pain, tailbone pain and other conditions are commonly improved with skilled physical therapy. We love helping families stay active. Do you have questions about diastasis recti, how to return to vigorous sports safely, or simply how to feel more comfortable carrying your child? With expert care, Flow Rehab provides the tools and knowledge you need to keep enjoying all the activities you love — so you can keep up with your kids!

flowrehab.com • 206-858-2914 frontoffice@flowrehab.com Mental Health continued

Wellspring Family Services Nonprofit organization providing a range of therapeutic services, including parent-child counseling, parenting consultation, and classes and workshops Multiple King County locations; 206-524-9055 wellspringfs.org

Physical Therapy Flow Rehab ..................................................................... 44 Specializing in the care of patients who have pelvic dysfunction, orthopedic issues or chronic pain Seattle; 206-858-2914 flowrehab.com

Public Health + Human Services King County Early Support for Infants and Toddlers Offering a range of “birth-to-three” services and early learning and development programs to meet the needs of children and their caregivers King County; 206-204-3536 (toll free: 1-800-322-2588) kingcounty.gov

44

Sea Mar Community Health Centers Community-based organization committed to providing comprehensive health, human, housing, educational and cultural services to diverse communities, specializing in service to Latinos in Washington state Statewide; seamar.org Seattle and King County Public Health Centers Adult and child health-care clinics, maternity support and infant case management; immigrant clients are encouraged to access services without fear Multiple Puget Sound locations; 206-296-4600 kingcounty.gov/depts/health Washington State Department of Social & Health Services (DSHS) Transforming lives through food, medical, housing, child support, mental health, disability and employment assistance services and programs Statewide; dshs.wa.gov/dshs-contact-us

Wellness + Fitness Aditi Yoga | Wellness Nourish your body and your baby in a supportive community; pre- and post-natal yoga offered by certified practitioners Wallingford; 206-428-6004 aditistudio.com


FAMILY HEALTH + WELLNESS Aham Yoga Yoga classes, prenatal yoga, teacher training, workshops and retreats Greater Seattle and Eastside; 425-202-5071 ahamyoga.com Aligned Yoga With Jenny Rhodes Find your zen again with public and private yoga classes, workshops and retreats for healthy pregnancy and postpartum healing North Seattle; alignedyoga.net FIT4MOM Fitness and support for every stage of motherhood Multiple Puget Sound-area locations; fit4mom.com Longevita Pilates & Yoga Studio Pilates, yoga, strength and conditioning for lifelong fitness; prenatal and Mommy + Baby postnatal yoga classes Auburn and online; 253-249-7456 longevitapilates.com

We Yoga Co. Grassroots yoga studio offering Vinyasa, Yin, Hot Hatha, Hot Vinyasa, Baby and Me, and prenatal yoga; child care provided for some classes Roosevelt neighborhood of Seattle; weyogaco-op.com

Yoga the Animal Way! Introduce your little yogi to fun movement and mindfulness practices with “Yoga Animals” by Paige Towler. Rhyming text and animal-inspired stretches and photos provide a “wild” introduction to learning kid-friendly yoga poses.

HOSPITALS + BIRTHING CENTERS + CLINICS Birthing Centers The Birthing Inn Premier freestanding birth center where babies are delivered into warm, cozy and peaceful surroundings; since 1999 Tacoma-based facility serving the Puget Sound area; 253-761-8939 thebirthinginn.com Center for Birth Accredited freestanding community birth center extending privileges to qualified midwives in Seattle to provide the most personalized experience possible South Lake Union; 206-407-3397 centerforbirth.com Puget Sound Midwives & Birth Center Personalized attention from experienced, licensed midwives; luxurious private birth suites or in the comfort of your own home; prenatal, childbirth and postpartum care Renton (425-207-8769), Kirkland (425-823-1919) birthcenter.com

Hospitals + Clinics Country Doctor Community Health Center (CDCHC) Nonprofit organization providing comprehensive care, combining outpatient and in-patient family practice primary care with community health care and preventive health education 3 Seattle clinics; countrydoctor.org

HealthPoint Complete, convenient care, including whole family medicine and dentistry, pediatrics, obstetrics, naturopathic medicine, WIC, pharmacy and more Multiple King County locations; healthpointchc.org Immediate Clinic Neighborhood urgent care open 7 days a week Multiple Puget Sound locations; immediateclinic.com International Community Health Services (ICHS) Providing high-quality health care to improve the wellness of King County’s diverse people and communities Multiple Puget Sound locations; 425-373-3000 ichs.com Seattle Children’s .......................................................48 Offering 60+ pediatric specialty clinics and services, including a Level IV NICU, emergency and urgent care Serving Seattle and the Eastside; 206-987-2000 seattlechildrens.org Seattle Indian Health Board Community health center providing health and human services to its patients, while specializing in the care of Native people King County; 206-324-9360 sihb.org 45


HOSPITALS + BIRTHING CENTERS + CLINICS

Tiny Tummy Trouble

The scoop on poop and other first-year digestive drama By Malia Jacobson

B

in the poop or problems with the baby’s growth.

What are the top digestive issues you see in babies? Most babies who come to see me are brought in for fussiness or excessive crying. The vast majority of the time, the baby is otherwise fine. The top issues I see and treat in babies are feeding problems, difficulty gaining weight, vomiting, changes in bowel movements, like diarrhea or constipation, and reflux. Conditions like digestive tract birth defects or bowel obstructions are much less common.

Does a breastfeeding parent’s diet create gassiness in their baby? While by-products of some foods that make a mother gassier can also occasionally cause gassiness in her infant, this type of gas typically shouldn’t cause severe pain. The gas produced within a mother’s own digestive tract after she eats certain foods doesn’t get passed through her breast milk to her baby. I tell mothers that it’s wise not to eat too much of any one food, but to eat a varied and healthful diet while breastfeeding. Broccoli, beans and yes, even chocolate, are often okay in moderate portions!

abies, especially newborns, spend most of their waking hours feeding and pooping. So, it’s understandable that digestive issues are a top concern for new parents, says Uma K. Pisharody, M.D., a specialist in pediatric gastroenterology with Swedish Medical Center. “New babies mostly eat, poop and sleep, so anything that makes them fussier than normal often leads to an assumption that there’s a problem with the baby’s digestion.” Happily, most babies have healthy, functional digestive systems, she notes — even those who experience an occasional bout of gas, diarrhea or tummy pain. But because common digestive issues such as spitting up, reflux, diarrhea, gas, constipation and changes in bowel movements top the list of concerns for new parents, they’re well worth clearing up. From the first poop to the first birthday, Dr. Pisharody answers your questions about first-year digestive dramas.

What’s the first step you take when a new patient comes in? I ask the parent or caregiver a lot of questions around feeding: What’s going on in the home during feeds? When do feeds occur? And how do feeds relate to fussiness or other symptoms? I then look for specific red flags that tell us that there could be a digestive problem. Those red flags could be extremely forceful vomiting — which is noticeably more forceful than normal spit-up — particularly vomit that has a fluorescent yellow/green color or blood, any blood 46

When it comes to spitting up, what’s normal? How much is too much? There is actually no “normal” or “abnormal” amount of baby spit-up, as each and every baby is different, and it’s best not to compare babies to each other. What I look for first and foremost is whether or not there is any forceful vomiting. Second, does the spit-up contain bile or blood? And third, is the baby gaining weight? If a baby spits up dozens of times per day but the spit-up isn’t forceful, doesn’t contain blood or bile, and the baby is happy and growing well, I don’t consider that a problem. On the other hand, a baby could spit up hardly a few times each day, but if those issues are present, there could be something going on.

A newborn’s poop is already so watery — how can a parent tell if their baby has diarrhea? When I examine diarrhea in newborns, I am looking specifically for a significant change in frequency of bowel movements more than a change in consistency. If a baby who was having about six watery bowel movements each day suddenly begins having 10 to 15, that’s probably diarrhea and worth a call to your pediatrician. But with constipation, we look for changes


HOSPITALS + BIRTHING CENTERS + CLINICS not only in frequency, but also in consistency. A baby should pass the first black, sticky stool, called meconium, within 24 hours of birth. From there, a baby’s bowel movements will vary in frequency from many per day (for example, after each feeding) to as long as one every two weeks for breastfed infants; the latter is not typical, but certainly can be normal. So we look for changes in each individual baby’s routine: If a baby is having three to four stools each day and then starts going a few days between stools, or if the stools suddenly become more firm, that’s something to bring to your health-care provider’s attention. Until solids are introduced to a baby’s diet, we want bowel movements to be fairly runny, not hard or firm. What’s a common myth about baby tummy trouble? One big misunderstanding is that all babies with reflux are experiencing acid reflux in the same way adults do. Reflux in babies is different from the acid reflux experienced by adults. When infant reflux is treated with medication to reduce acid, the medication may end up harming a baby’s digestive process in the long run, instead of helping, since natural digestive acid is essential for normal, healthy digestion. Another myth is that mucous in the stool is always a sign of a problem. In fact, mucous in stools can be normal for babies, particularly those who are breastfed. The amount of mucous depends on the baby’s specific microbiome, or types of bacteria present in the digestive tract. What is colic and how common is it? Colic is inconsolable crying that starts around 1 to 4 weeks of age. Around one in four babies have it. It’s thought to result from immaturity of the nervous system, rather than digestive problems or gas, as many parents assume. What are signs that a baby is experiencing gas and how can caregivers help? Any adult can tell you that gas can certainly be uncomfortable. One way to tell that your baby’s discomfort is from gas is that the pain seems to be relieved by burping or passing gas. I haven’t found OTC [over-the-counter] gas drops to be particularly helpful, but I don’t have a problem with them, if parents want to use them

or find them helpful. For babies, gas in the digestive tract is usually caused by swallowed air. Along with regular burping after feeds, I recommend working with a lactation consultant to improve a baby’s latch during breastfeeding to reduce air swallowed during feeding. Gentle abdominal massage can help a baby who is experiencing gas pains. For a new baby, you can place the baby tummy down on your lap, with the infant’s knees tucked in towards the chest, and gently massage the abdomen with your hands. This has the added benefit of lifting the baby’s bottom up, so gas rises upward and can more easily pass. This can help the baby pass a gas bubble. For older babies, laying them on their back and gently bicycling the legs can help. When should a caregiver seek help for a digestive problem? What are signs that something is wrong? Feeding aversion — when an infant seems disinterested or actively opposed to feeding — is a red flag that needs medical attention. When a baby is not gaining weight or growing, that’s something to bring to your health-care provider’s attention right away. Prolonged jaundice — or jaundice lasting longer than two weeks — is a reason to see your pediatrician. We also worry about stools that lose their normal brown or yellowish color and become white or creamy, since that might signal a problem with the baby’s liver and bile ducts. Belly distension, extreme or sudden fussiness, forceful and/or bilious or bloody vomiting, or bloody stools are other reasons to contact your health-care provider. When in doubt, contact your provider with questions about your baby’s digestion. If you do head online to search for answers, Dr. Pisharody recommends the GIKids website (gikids.org). Here’s to happier tummies and fewer troubles, starting today!

■

Malia Jacobson is a health and family journalist. Sponsored by

47


HOSPITALS + BIRTHING CENTERS + CLINICS

World-Class Care, Close to Home For more than 25 years, Seattle Children’s has been consistently recognized as one of the nation’s best children’s hospitals by U.S. News & World Report. Kids aren’t just part of what we do: They are our whole reason for being. With board-certified pediatric experts in nearly 60 subspecialties, we provide inpatient, outpatient, diagnostic, surgical, rehabilitative, behavioral and emergency services. Children require care designed specifically for them. Our pediatric experts understand how treatments today affect growing bodies in the future. Whether we’re treating a 1-pound preemie in our Level IV Neonatal Intensive Care Unit or a high school football player in our Sports Gym, the entire team has experience caring for children of every age and developmental stage. And because kids don’t just need care during office hours, we offer Urgent Care evenings, weekends and holidays for minor illnesses or injuries.

We provide hope, care and cures to help every child live the healthiest and most fulfilling life possible.

seattlechildrens.org • 206-987-2000 4800 Sand Point Way N.E., Seattle, WA 98105 48


HOSPITALS + BIRTHING CENTERS + CLINICS Hospitals + Clinics continued

Swedish Medical Center .............................23 Since 1910, Swedish has been the Seattle area’s hallmark for excellence in hospitals and health care, with its No. 1 priority: quality care and patient safety 7 campuses in Seattle and the Eastside; 1-800-SWEDISH swedish.org UW Medicine Neighborhood Clinics Network of community-based clinics offering a wide spectrum of primary care services, as well as secondary care, from pediatrics to geriatrics Multiple Puget Sound locations; uwmedicine.org/locations

Latch Onto This!

Additional resources for new mothers • From first latch to solid foods, find support and information for feeding baby from PEPS (peps.org; search “feeding”). • For help finding a lactation consultant, attend a La Leche League (llli.org) meeting. • For general breastfeeding support, visit the Office on Women’s Health website (womenshealth.gov/breastfeeding; or call the helpline at 1-800-994-9662) or the Breastfeeding Coalition of Washington website (withinreachwa.org). • New moms swear by the plethora of evidencebased information on breastfeeding and parenting found on KellyMom (kellymom.com).

LEARNING + PLAY Camps + Classes Gymboree Play & Music Themed parties and dynamic classes for kids ages 0–5 to support social, physical and intellectual development Bellevue (425-452-1400), Seattle (206-783-3741) gymboreeclasses.com Hop to Signaroo American Sign Language classes and materials for hearing parents to help you to effectively communicate with your baby or toddler before speech is possible Seattle area; 206-789-SIGN (7446) hoptosignaroo.com Joyful Music Seattle .................................................. 51 Singing, dancing and instrument play enable parents to interact musically with their children Seattle; 312-774-6482 joyousnoisestudio.com The Little Gym Gymnastics, parties, camps, karate, dance, sports skills 11 Puget Sound locations; thelittlegym.com Nurturing Pathways Offering creative dance classes for families, parent education workshops, educators’ workshops, training and certification for instructors Phinney Ridge; 425-280-3805 nurturingpathways.com

Sponge Instruction in Spanish, Mandarin and more; ages 0–10 Seattle, Kirkland, Issaquah, online; 206-227-7138 spongeschool.com Sunshine Music Together ....................................... 51 Award-winning early childhood music program for children ages birth to 5 years and the grown-ups who love them Multiple Seattle-area locations; 206-281-1111 sunshinemusictogether.com Waterbabies Aquatic Program Safety-focused swim instruction, babies to adults Multiple Puget Sound-area locations; 425-643-3533 waterbabiesusa.com

Out + About Children’s Museum of Tacoma Imaginative playscapes, parties, preschool, camps, more Tacoma; 253-627-6031 playtacoma.org Hands On Children’s Museum Stimulating curiosity, creativity and learning through fun, interactive exhibits and programs for children, families and school groups Olympia; 360-956-0818 hocm.org

49


LEARNING + PLAY

Tips for Creating a Reading Culture in Your Home By Sanya Pelini, Ph.D.

M

any experts agree that the earlier in life children are exposed to books and to broad vocabulary, the more successful they are in learning new words and the more they benefit from everyday experiences. There are multiple advantages in reading to kids, and there is plenty of research to back that up. • Reading to your kids awakens their curiosity, imagination and critical thinking skills. • Children who hear stories are more likely to fall in love with books. • Reading provides a bonding experience with your child and can be comforting. • Children who are read to from their earliest moments express themselves better and therefore become better communicators. • Reading promotes two-way communication. • Reading opens up kids’ worlds. It introduces them to new things and new places. • The earlier children learn a word, the better they master it, even in adulthood. • Reading takes kids away from screens. • And — my personal favorite — reading keeps kids quiet! A recent study compared the vocabulary in picture books to adults’ spoken vocabulary and found that, whereas adults frequently used the same words, a more extensive vocabulary was most likely to be found in picture books. Books therefore increase vocabulary and are effective in helping build kids’ language and literacy skills. Here are six simple steps to help you create a reading culture in your home:

Establish a reading tradition. Choose a comfortable reading space and a regular reading schedule and try to stick to it. Start with short reading sessions and vary your reading material. 50

If they stop paying attention, it means it’s time to stop. Don’t insist.

Be a model. Kids learn from example. Children whose parents read and seem to enjoy reading are more likely to become readers themselves. Talk about what you’re reading with your partner and kids.

Get into it. Sometimes parents are so obsessed with “the idea of reading” that they fail to explore how reading helps kids. Getting into it means being aware of what you’re reading and of what your kids understand. It means encouraging their comments on the stories or illustrations in the books: What do they understand? What do they see? How do they feel? What do they think?

Don’t forget the power of making up stories. While it might be difficult at first, making up stories is a great way to teach your kids about creativity. It’s important to involve kids in this process, as doing so develops a multitude of skills: creativity, critical thinking, imagination and others. If you have trouble starting, try using creative story cards.

Check out books for your kids. Head to your public library with your kids and check out books, magazines and comic books, and keep them visible and readily accessible. Keep in mind that it’s the quality rather than quantity that matters. Not sure what is the appropriate reading level for them? Ask a librarian — they are always happy to make recommendations!

Follow your rhythm. It’s not always easy to find the time to read with your kids. Don’t get into the trap of thinking there’s just one way to do things. Work around your schedule, talk to your kids or make up stories in the car or over dinner.

■

Sanya Pelini is a parent who holds a Ph.D. in educational research.


LEARNING + PLAY

Shake it up, baby! Learn, play and get inspired. Joyful Music’s Musikgarten classes offer instruction tailored for each age level — from your baby who benefits greatly from being part of a live music environment, right up through school-age children who delight in piano classes. The Musikgarten curriculum is a holistic program, in that it develops the whole child — physically, emotionally, socially, cognitively, and, of course, musically! We nurture music aptitude by engaging children and their families in singing and movement activities that help attune the ear, refine the voice and develop a rhythmic body through which music can be expressed. Multiple classes are offered each week, including a baby drop-in class! Online options are also available.

joyfulmusicseattle.com • 312-774-6482 clarice@joyfulmusicseattle.com

We Need Music Now More Than Ever Sunshine Music Together is an eight-time Golden Teddy Award winner for Best Music Program in Seattle! Registration is now open for summer online classes! Locations in Queen Anne, Capitol Hill. West Seattle, Redmond and Green Lake and Online. Music Together is a researched and evidence-based internationally recognized Early Childhood Music Development Program for children birth to five years and their parents or caregivers. The classes include songs, rhythmic rhymes, movement, and instrument play - forty-five minutes of pure fun with your child every week!

sunshinemusictogether.com • 206-281-1111 info@sunshinemusictogether.com 51


LEARNING + PLAY Out + About continued

Imagine Children’s Museum Interactive exhibits and activities encourage children ages 1–12 and their families to role-play, experiment, splash, think, wander and create together Everett; 425-258-1006 imaginecm.org Kids Discovery Museum (KiDiMu) Sparking children’s curiosity through play and experiential learning; summer camps, virtual art room and activities Bainbridge Island; 206-855-4650 kidimu.org KidsQuest Children’s Museum Art, science and engineering camps; learning and play for kids ages 3–grade 3 Bellevue; 425-637-8100 kidsquestmuseum.org Northwest Trek Wildlife Park 720-acre wildlife park with native Northwest animals, forest, tours and more Eatonville; 360-832-6117 nwtrek.org Pacific Science Center New discoveries for all ages, every day; camps and programs for curious minds Seattle; 206-443-2001 pacsci.org

Point Defiance Zoo & Aquarium Zoo, aquarium and botanical garden with over 500 animal and plant species; camps and programs; conservation programs Tacoma; 253-404-3800 pdza.org Seattle Aquarium Premier resource for hands-on marine experiences and conservation education Puget Sound; 206-382-6133 seattleaquarium.org Seattle Children’s Museum 18,000 square feet of play space designed for kids ages birth–8 Seattle Center; 206-441-1768 thechildrensmuseum.org Seattle Children’s PlayGarden All-abilities park and playground Seattle; 206-325-5576 childrensplaygarden.org Seattle Public Library — Kids and Families Free programs, events and services to support parents, caregivers and teachers in their work with kids; story times in multiple languages for babies, toddlers and preschoolers 27 locations in neighborhoods throughout Seattle; Central Library: 206-386-4636 spl.org Woodland Park Zoo Connecting kids to animals and nature Seattle; 206-548-2424 zoo.org

PARENT EDUCATION + SUPPORT Parenting Resources Down Syndrome Community of Puget Sound . 53 Nonprofit organization serving and advocating for individuals with Down syndrome and their families Puget Sound area; 206-257-7191 dscpugetsound.org Parenting Counts Research-based resource site developed to support parents and caregivers in raising socially and emotionally healthy children Online resources; parentingcounts.org Parent Trust for Washington Children Respected source of education and support for parents, caregivers and the professional community; resources database, Great Starts™ parenting classes, professional trainings, developmental screenings, more Statewide; Family Help Line: 1-800-932-HOPE (4673) parenttrust.org 52

Pawsitive Transformation Family-focused dog training specializing in preparing the family dog for baby’s arrival Serving North Seattle, Edmonds, Everett; 425-202-5963 pawsitivetransformation.com Priceless Parenting Online parenting classes with certificate of completion, parenting presentations, parent coaching, free charts for kids Online, coaching sessions by phone; 425-770-1629 pricelessparenting.com Puget Sound Adlerian Society Positive Discipline parenting courses; calendar of parenting education classes, lectures, workshops, conferences, support groups; resources for parent coaches, mentors and facilitators Puget Sound; 206-527-2566 psasadler.org


PARENT EDUCATION + SUPPORT

Building a Caring, Understanding, Supportive Community The Down Syndrome Community of Puget Sound’s (DSC) unwavering mission is to empower people with Down syndrome and their families through life-long learning and experiences, while building an accepting and inclusive society. Our First Call program assists parents who have just received a Down syndrome diagnosis with information, support and resources, as well as facilitates connections with other parents. For over 25 years, the DSC has proudly provided individuals with Down syndrome and their families with programs, events, and resources. Our passion is to share and nurture a climate where every human being is recognized, their strengths are appreciated, and their accomplishments are respected and valued.

dscpugetsound.org • 206-257-7191 contact@dscpugetsound.org Sproutable Supporting adults growing remarkable kids; source for research-based Positive Discipline tools for young children, birth–6 Online; sproutable.teachable.com WithinReach No-cost information referral and helpline connecting parents with the support and resources they need to encourage their child’s healthy growth Statewide; 1-800-322-2588 withinreachwa.org Zero to Three Nonprofit that trains parents and professionals to support the connections that are critical to the early development, learning and well-being of babies and toddlers Nationwide; 1-800-899-4301 zerotothree.org

Support Groups Babywearing International of Seattle Supporting families to adopt the tool of babywearing through membership meetings, education resources and baby-centric activities Greater Seattle/King County area; info@seattlebabywearers.com seattlebabywearers.com

Community of Mindful Parenting Connecting parents and caregivers in pursuit of mindful living through signature programs, Listening Mothers and Finding Calm, that are designed to help focus compassion, reduce stress and enhance secure attachment Classes held all over the Puget Sound area and virtually; 206-829-2660 communityofmindfulparenting.com Early Days Facilitator-led drop-in groups where honest, judgement-free discussions about the realities of new parenthood are had West Seattle; 425-243-2355 theearlydays.net Families of Color Seattle (FOCS) Nonprofit dedicated to building a strong community by supporting families of color through parent groups, community resources and events, and racial equity consulting Greater Seattle and Eastside; 206-317-4642 focseattle.org India Association of Western Washington Promoting and providing social, educational and cultural programs that enable children of Indian heritage to understand Indian traditions Greater Seattle and Eastside; 253-234-9989 iaww.org

53


PARENT EDUCATION + SUPPORT

Brain-Building Games to Play With Baby By Malia Jacobson

F

or babies, getting smarter is child’s play. According to researchers and child development experts, simple, everyday games can boost your baby’s brain development, encouraging growth in language, science, math and organizational skills (called executive functions), along with social and emotional learning. Babies at play are learning about themselves, others and their world, says Sarah R. Lytle, Ph.D., director of outreach and education for the Institute for Learning & Brain Sciences (I-LABS; ilabs.washington.edu) at the University of Washington. “Babies are these natural scientists. They’re always playing games that are actually experiments. Every time a baby drops their spoon off their high chair, they’re figuring out their world and how it works.” Here’s how to assist your little scientist by introducing games that benefit cognitive development from birth through age 1. Back and forth Quality interactions with loving caregivers are vital to cognitive development in general — things such as responding to babies’ coos and cries, gazing into their eyes and making silly faces. “In a high-quality interaction, you want to see a true back-and-forth exchange between a parent and a baby. When the baby babbles, the parent responds like they’re having a conversation,” says Lytle. Where’s the cup? By 4–7 months of age, babies begin developing object permanence, or the knowledge that something still exists even when it’s not visible. Simple games such as moving a cup just out of sight and asking your baby, “Where’s the cup?” help your baby attain this memory milestone. Baby gym No, you don’t need to take your baby to spin class. But physical activity — think tummy time, crawling, scooting, walking practice or par54

ent-child swimming — can boost brain growth. Canadian researchers found that physical activity benefits cognitive development, especially executive functions and language skills, in children from birth through age 5. Why, thank you! When your baby hands you a toy and looks at you expectantly, they’re initiating a game that develops social and emotional intelligence, says Lytle. Play along by responding with delight (“Thank you so much!”), waiting a beat, then handing the toy back. Keep the back-and-forth going for as long as your baby stays interested. Bust a move Exposing babies to music introduces the concept of rhythm, which benefits mathematical skills, says Lytle. Encourage this learning with mini dance sessions as early as the newborn stage (holding your baby, of course), spending 5–10 minutes bouncing and swaying to the beat of songs you know and love. Rhyme time Reading books filled with rhyming words, such as “The Cat in the Hat,” helps your baby develop phonological awareness, an important component of language and literacy, says Lytle. “Books work well for this because, as parents, we don’t normally speak in rhymes. And we tend to get into verbal ruts and use the same words over and over again. Books expose babies to words and rhymes you might not normally use.” Face it Gazing at faces seems to support babies’ visual development and cognitive growth. Just hours after birth, babies show a preference for gazing at faces. Stanford researchers found that by 4 months of age, babies have facial recognition skills that are on par with those of adults, and those skills are more highly developed than other cognitive abilities. A simple game such as


PARENT EDUCATION + SUPPORT

placing your face 10–12 inches from your baby’s face, then switching with another person or even a stuffed animal and waiting for your baby to respond can help babies hone this important skill. Building skills That shape-sorting toy you may have received at your baby shower is great for developing spatial awareness and mathematical ability, says Lytle. Once babies get a bit older, building blocks can help continue that development. “With blocks, babies are testing their environment and really getting into some complex concepts related to math, such as volume, distance and how structures work,” she says. Baby comedian “Parents sometimes think that in order to build language skills they need to ‘fill their baby’s bucket’ with a lot of words,” says Lytle. “But the back-and-forth interaction is what really benefits cognitive growth.” Try responding to your baby’s early coos and first words with a hearty laugh, a squeal or a surprised face. The sillier the better,

since babies are often delighted by these responses and more interested in keeping the interaction going. I get it Playing together provides opportunities to boost social and emotional skills by helping your baby understand and process emotions, says Lytle. “When your child becomes frustrated, talking about the emotions they’re feeling is important. When parents say, ‘I understand why that made you upset,’ they’re scaffolding [or supporting] important social and emotional concepts.” Focused, attentive interactions with loving caregivers are the best brain builders, says Lytle. When caregivers play with babies, they can make the experience even more beneficial by focusing on their baby and tuning out their phone and other distractions. “To create a high-quality interaction, it’s important to be fully present and really focus your attention on your child.”

■

Malia Jacobson is a health and family journalist. 55


PARENT EDUCATION + SUPPORT

Find support, resources and connection for your family! For nearly 40 years, PEPS has been connecting and supporting new families, helping to build parent confidence in the early weeks and months of becoming a new parent. PEPS Groups are fun and social, with a focus on babies’ development. Trained facilitators host weekly discussions, helping parents cope with the challenges of adjusting to their new roles, and offering a community of support. Daytime and evening virtual groups are available, with more than 340 groups a year offered to families living in Bellevue, Kirkland, Snoqualmie and everywhere in between, with new areas added each year. Flexible pricing options are offered on all groups, with additional financial assistance available. PEPS makes it easy to connect with other new parents with babies close in age to yours. Register for a group today!

Support. Resources. Connection.

peps.org • 206-547-8570 All around King and Snohomish Counties peps@peps.org 56


PARENT EDUCATION + SUPPORT Support Groups continued

International Cesarean Awareness Network (ICAN) of Seattle Cesarean recovery, peer-to-peer support, VBAC support, cesarean information Greater Seattle area; 1-800-686-ICAN (4226) ican-online.org Journey Program (Grief and Loss) at Seattle Children’s Providing support to families coping with the death of a child; support groups, sibling grief support, counseling services, bereavement education Greater Seattle area; 206-987-2062 seattlechildrens.org/clinics/grief-and-loss Mommy Matters Offering parent coaching, workshops and online courses that blend Love & Logic Parenting, positive discipline and Gottman principles Greater Seattle and Eastside; 206-226-6707 melissabenaroya.com Northwest Infant Safety & SIDS Alliance (NISSA) Nonprofit organization supporting families that have been affected by the death of a child and educating the community about sudden infant death syndrome Statewide; nwsids.org Om Mama Co. Membership-based community featuring monthly meetups, workshops and special offers from top photography and wellness businesses serving Seattle-area mamas Greater Seattle area; ommamaco.com Parent Support of Puget Sound Nonprofit, volunteer-run organization supporting people who have lost a baby through miscarriage, stillbirth or infant loss; peer support groups, events, resources, referrals, more Puget Sound; 425-686-9451 psofpugetsound.org PEPS – Program for Early Parent Support ....... 56 Parent peer support groups led by trained group leaders facilitating weekly for 12 weeks Greater Seattle area; 206-547-8570 peps.org Puget Sound Dads Group Meetup group for dads featuring outings with the kids, parenting workshops, “Dad’s Night Out” events and other opportunities to socialize with and support each other meetup.com/PugetSoundDadsGroup

Sarina Behar Natkin, LICSW Supporting a community of parents committed to growing and learning through individual consultation, Bringing Baby Home and Positive Discipline Courses, and other resources Greater Seattle and Eastside; sarina@sarinanatkin.com sarinanatkin.com Seattle Families of Multiples (SFOM) Nonprofit organization formed to offer support to local parents and expectant parents of multiples with programming, events, resources and community connection Greater Seattle area; info@seattlemultiples.org seattlemultiples.org Seattle Parents of Preemies Peer-led support group for parents of preemies and infants who experienced a prolonged NICU stay; in-person and online meetings, support and education on topics relating to prematurely born and medically fragile children Greater Seattle area and beyond; seattlepreemies.com

Let's Sleep on It Sleep concerns vie only with feeding frets to top the new parent worrywart list. Here are two recommended resources to help: Taking Cara Babies • takingcarababies.com A neonatal nurse and mom of four, Cara offers popular online and live sleep classes, ebooks and by-appointment phone consults for parents of sleep-challenged kiddos ages newborn to 2 years. “Ready, Set, Sleep” • parentmap.com/parentmap-books Sleep journalist Malia Jacobson’s ebook offers science-based strategies and solutions for sleep success that are also compassionate, practical and doable.

57


RETAILERS + E-TAILERS

Pamper your baby with our Cushie Collection Decent Exposures® has been putting customer comfort first since 1986. We are a small clothing company based in Seattle, dedicated to using organic fabrics and earth-friendly practices. Our cushie collection for babies includes organic cotton burp cloths, blankets, diapers and more. Available in over 20 colors, these incredibly soft, latex-free items feel comfortable against even the most sensitive skin. For new mothers and mothers-to-be, we offer nursing bras in over 200 sizes and 20 colors, as well as washable organic cotton nursing pads. Give yourself and your baby the comfort you both deserve!

decentexposures.com • 1-800-524-4949 info@decentexposures.com Clothing + Furniture + Gear Bootyland Kids Center for hip kids and modern parents, promoting baby wearing, cloth diapering, breastfeeding, quality over quantity, sustainability Seattle; 206-328-0636 bootylandkids.com buybuy BABY Baby registry service and retailer offering a comprehensive selection of merchandise for infants, kids and their parents Tukwila; 800-462-3966 stores.buybuybaby.com Decent Exposures, Inc. ............................................. 58 Woman-owned custom clothing company dedicated to using organic fabrics and Earthfriendly practices since 1986 Seattle and online; 1-800-524-4949 decentexposures.com Little Bipsy Offering a hip and modern assortment of apparel for stylish babies and toddlers Shop online or at Edmonds store; 425-778-7600 littlebipsy.com

58

My Traveling Baby Product reviews and gear-buying guides for expectant and new parents (product purchasing through Amazon) Online; mytravelingbaby.solutions WestSide Baby Providing essential items to local children in need by collecting and distributing diapers, clothing and equipment Western King County; 206-767-1662 westsidebaby.org

Consignment Stores Childish Things Resale boutique offering new and gently used children’s clothing and gear, books, toys, accessories, maternity and nursing products, more Greenwood and online; 206-789-1498 childishresale.com Hopskotch Kids Consignment Quality children’s and maternity consignment Lynnwood; 425-778-6200 hopskotchkids.com


RETAILERS + E-TAILERS

Healthy, Safe Sleep Soaring Heart Natural Beds has been building all-natural and organic mattresses and bedding for over 35 years. As a certified-organic manufacturer, we can guarantee that there are no flame retardants, fumigants, perfumes or petroleum products used anywhere in our products. We handcraft every one of our products and stand behind every stitch we make. Now cautiously reopening following strict COVID guidelines to protect both our health and yours! Call for an in-store appointment or visit us online.

soaringheart.com • 206-282-1717 soaringheart@soaringheart.com Jack & Jill Consignment Events Consigning opportunity and kids’ clothing and gear sales Lynnwood; info@thejackandjillsale.com thejackandjillsale.com Just Between Friends — Everett/Monroe Kids’ and maternity consignment; shop or sell Sept. 16–19, 2020 at the Evergreen State Fairgrounds Everett/Monroe; everett.jbfsale.com Kym’s Kiddy Corner Huge selection of new and used kid’s clothing, shoes, furniture, baby gear, safety products, toys and more North Seattle; 206-361-5974 kymskiddycorner.com

Maternity Wear + Products BellyMoms Maternity and Nursing Wear Shop collections of maternity and breastfeeding clothing, ranging from tops, dresses and nursing bras to swimwear and labor gowns Online; support@bellymoms.com bellymoms.com

Cake Maternity Offering fashion-forward, high-quality maternity clothing, lingerie, swimwear, nursing bras and pads, more Shop online; support@cakelingerie.com cakematernity.com Village Maternity Stylish maternity, nursing and baby wear; hospital-grade breast pump and baby scale rentals; childbirth and child-care classes Seattle; 206-523-5167 villagematernity.com

Specialty Services + Products Organized by Heart Professional organizer offering home decluttering services, virtual consultations and group workshops Seattle; 206-619-4143 organizedbyheart.com Pursuit Concierge Membership-based lifestyle management service powered by a team of on-demand personal assistants ready to take on your most time-consuming, energy-sucking tasks Greater Seattle area; 206-552-9211 pursuitofseattle.com 59


RETAILERS + E-TAILERS

Party Planning, Design, Décor, Sparkly Tutus and So Much More! • Parties for any event, any way you can dream it • Tutus in all sizes and any color • Capes to empower all abilities and superheros • Glittery, shiny shirts for all occasions Every child is special! Our creations and events are customized to be as unique to the individual being celebrated. We have planned, designed and coordinated birthday parties for all ages, bridal showers, baby showers, anniversaries, graduations and more.

turtlesoccasions.com • 425-502-5301 turtlesoccasions@gmail.com Specialty Services + Products

continued Soaring Heart Natural Beds .................................. 59 All-natural bedding, mattresses, pillows, blankets and comforters Greater Seattle area; 206-713-4490 soaringheart.com ThriveBerry Healthy home consultants teach families how to get rid of toxic products in their home and replace them with healthy alternatives Greater Seattle and Eastside; 206-280-5130 thriveberry.com Turtle’s Occasions ...................................................... 60 Offering party planning, design and décor services, tutus and more Greater Seattle and Eastside; 425-502-5301 turtlesoccasions.com

Toy Stores Clover Toys “Seattle’s most charming toy store” offers beautiful toys and clothing for the children in your life Ballard or shop online; 206-782-0715 clovertoys.com

60

Curious Kidstuff Non-violent and imaginative toys, books, music, art supplies and other fun stuff for infants to tweens West Seattle; 206-937-8788 calicotoyshoppe.com Kid’s Club and Salon Games, art supplies, baby toys, puzzles, a kid’s hair salon, books, puzzles, STEM toys, science kits and more University Village; 206-524-2553 shopkidsclub.com Lakeshore Providing innovative education products “that spark young imaginations, instill a sense of wonder and foster a lifelong love of learning” Bellevue and online; 425-462-8076 lakeshorelearning.com Magic Mouse Toys 6,000 square feet of toys, stuffies, games, books, puzzles and more Pioneer Square; 206-682-8097 magicmousetoys.com Red Wagon Offering a full range of toys from Lego, Playmobil and Calico Critters to an extensive selection of books, games and puzzles for all ages Madison Park; 206-453-5306 redwagonmadisonpark.com


RETAILERS + E-TAILERS Snapdoodle Toys Educational toys, art classes, camps and parties Kenmore (425-408-0021), Redmond (425-869-9713), Issaquah (425-651-2838), Seattle (206-782-0098) snapdoodletoys.com

Wishes Carefully chosen, high-quality toys that help your child unplug, imagine, discover and play Alderwood Mall (425-412-2990), Bellis Fair Mall (360-738-4575), Everett Mall (425-265-7005) wishestoysbooksgames.com

SPECIAL NEEDS Adaptive Equipment + Assistive Technology eSpecial Needs Provider of adaptive equipment and therapy products, including strollers, toys, clothing, furniture and learning tools Shop online; 1-877-664-4565 especialneeds.com Firefly Range of adaptive equipment products inspired by a mission to support “special needs family participation” for kids ages 1–16 years Shop online; hello@fireflyfriends.com fireflyfriends.com Washington Assistive Technology Act Program (WATAP) Resources, demonstrations and evaluations to help you find assistive technology that will work best for your child Statewide; 1-800-214-8731 watap.org

Autism Spectrum Disorder A.P.P.L.E. Consulting Providing Applied Behavior Analysis (ABA) services to individuals ages 0–21 with autism and their families Bothell, serving King, Snohomish and Kitsap Counties; 206-437-5412 apple-asd.com Aspiring Youth Program Social skills groups, summer camps, tutoring and other services geared for students ages 8 and older with autism, Asperger syndrome, ADHD, learning disabilities or other similar traits Seattle, Bellevue, Redmond, West Seattle, South Seattle; 206-517-0241 aspiringyouth.net The Autism Exchange (AEX) Custom software and interactive tools for securely accessing, organizing and interlinking information for and by autism caregivers Online resource; theautismexchange.com

Autism Parent Support Groups Comprehensive list of local support groups, meetup groups and online groups for parents and caregivers around the region Greater Puget Sound area; theautismblog.seattlechildrens.org/ autism-and-parent-support-groups Autism Society of Washington Information and referral services for individuals with autism spectrum disorders and their families Statewide; 1-888-279-4968 autismsocietyofwa.org Autism Speaks National organization dedicated to increasing autism awareness Nationwide; 1-888-288-4762 autismspeaks.org Northwest Autism Center Information, awareness, education and training to build our community’s capacity and competency in providing services and access for individuals with autism spectrum disorder (ASD) Spokane, statewide; 509-328-1582; info@nwautism.org nwautism.org Pediatric Physical and Occupational Therapy Services Specializing in working with children presenting with challenges associated with disorders of relating and communicating such as autism spectrum disorder, Asperger syndrome, sensory processing disorders, regulatory disorders, dyspraxia, learning, behavioral and neurological disorders Greater Seattle area; 206-367-5853 rosemarywhitepediatricservices.com Profectum Education, training and research in autism and other developmental and mental health challenges; free online toolbox resource for parents to learn strategies to help engage their child Online; 973-348-9462 profectum.org 61


SPECIAL NEEDS Autism Spectrum Disorder continued

Seattle Children’s Autism Center Providing assessment, diagnostic evaluation, therapies, treatments and support for autism spectrum disorders King County; 206-987-8080 seattlechildrens.org Sesame Street Autism Resources for Parents Information, research and tools for parents and caregivers of children with autism, including videos, interactives for kids, storybooks and more autism.sesamestreet.org UW Autism Center Caring for individuals and families affected by autism spectrum disorders through exceptional clinical services, innovative scientific research and high-quality training 206-221-6806 or 1-877-408-UWAC (8922) depts.washington.edu/uwautism Washington Autism Alliance & Advocacy (WAAA) Registration-based site offering support resources, information and advocacy for children and adults with ASD, including information on accessing ABA therapy Statewide; 425-894-7231 washingtonautismadvocacy.org

Learning + Developmental Differences The Arc of King County Advocacy for quality services and necessary funding to meet the needs of people with intellectual and developmental disabilities and their families Seattle; 206-364-6337 arcofkingcounty.org Boyer Children’s Clinic Providing Puget Sound-area children with neuromuscular disorders with early intervention services designed to help them reach their maximum potential and improve their quality of life Two clinics serving the Greater Seattle area; 206-325-8477 boyercc.org Child Mind Institute Leading online resource for children’s mental health information, gold-standard treatment for children, adolescents and communities, and research for new tools and treatments Online; childmind.org

62

Children’s Therapy Center Highly trained pediatric therapy staff creates a supportive environment to meet every child’s needs Burien, Kent, Tacoma, Maple Valley; 253-854-5660 ctckids.org Disability Rights Washington Free advocacy and legal services to protect the rights of people with disabilities Statewide; 206-324-1521 or 1-800-562-2702 disabilityrightswa.org Hearing, Speech & Deaf Center Comprehensive array of programs that foster effective communication for individuals and families affected by hearing or speech differences Seattle (206-323-5770), Tacoma (253-475-0782), Bellingham (360-647-0910) hsdc.org Home Care Association of Washington Unifying in-home services providers through public outreach, education, legislative advocacy and supporting practice standards; searchable database of home-care providers by county Statewide; hcaw.org HopeCentral Pediatric and behavioral health clinic in South Seattle offering specialized services including ADHD/executive function evaluation, autism evaluation and education South Seattle; 206-455-9845 hopecentralhealth.org Kindering Inclusive preschool, early intervention, physical therapy, speech therapy, occupational therapy, autism resources, developmental evaluations, family support Bellevue (425-747-4004), Bothell (425-747-4004), Redmond (425-747-4004), Renton (425-747-4004) kindering.org/referrals Learning Disabilities Association of Washington Promoting and providing service and support to improve the quality of life for individuals and families affected by learning and attentional disabilities Statewide resources directory; 425-882-0820 ldawa.org Listen and Talk Nonprofit early development program delivering life-changing programs, therapy and services for families with children who are deaf or hard of hearing Seattle area; 206-985-6646 listentalk.org


SPECIAL NEEDS Open Doors for Multicultural Families Providing quality, culturally responsive services for diverse families of loved ones with developmental and intellectual disabilities and special health-care needs Seattle, Kent, Redmond; main office number: 253-216-4479 multiculturalfamilies.org Pediatric Speech and Language Therapy Communication assessment and early intervention for children Seattle, West Seattle; 206-547-2500 pediatricspeechtherapy.org South King County CHADD Support and information for families and individuals living with ADHD South King County; 253-237-4793 chadd.net/chapter/149 Washington Partnerships for Action, Voices for Empowerment (PAVE) Parent-directed organization working with families, individuals, professionals and community members in all walks of life with all types of disabilities Tacoma; 253-565-2266 wapave.org Washington Sensory Disabilities Services Information and referral services for children with sensory (hearing or vision) disabilities from birth to age 21 Statewide; 360-947-3297 wsdsonline.org Washington State Dental Association — Special Needs Directory Online directory of oral health-care providers who specialize in treating patients with developmental or acquired special needs Statewide; wsda.org/special-needs-directory Washington State Fathers Network (Kindering Center — Bothell) Information, advocacy and resources to support fathers in caring for children with special needs Statewide; 425-653-4286 fathersnetwork.org Wonderland Child & Family Services Nonprofit early-intervention development center serving children ages 0–3 with special needs and their families North King and south Snohomish Counties; 206-364-3777 wonderlandkids.org

ADVERTISER INDEX

Andy Pandy Diapers ................................................. 6 Annie’s Nannies, Inc. ...............................................13 Baby Diaper Service .................................................. 7 CareWorks Nanny Referral Service .....................13 Community Maternity Services ............................26 Decent Exposures, Inc. ...........................................58 Desiree Baird, Pediatric Sleep Coach ..................12 Diaper Stork ............................................................... 8 Down Syndrome Community of Puget Sound .53 Flow Rehab ...............................................................44 Goodwin Connections ............................................14 Hypnosis for Birth ...................................................27 Immunity Community — a WithinReach Program .........................................41 Jennifer Loomis Photography ................................. 9 Jewish Federation of Seattle .................................35 Joyful Music ..............................................................51 Kids Klub Child Development Centers ................15 King’s Schools ...........................................................18 Natural Dentistry Group ........................................20 North Seattle Cooperative Preschools ...............15 One Sky Family Medicine .. .....................................42 PEPS ...........................................................................56 PMSI ............................................................................. 5 Seattle Children’s .....................................................48 Soaring Heart ...........................................................59 Stroum Jewish Community Center ......................33 Sunshine Music Together ......................................51 Swedish Medical Group .........................................23 Thresholds ................................................................29 The Tooth Ferry .......................................................21 Turtle’s Occasions ...................................................60 UW Medicine ............................................................32

63


At Swedish Pediatrics, we offer numerous

highly trained pediatricians to choose from, more than 20 locations for your convenience, flexible hours for busy parents, and easy access to your medical records and provider office through MyChart. Stay connected through your pregnancy and afterward with our free pregnancy & parenting app providing a development tracker, checklists and tips for raising healthy kids! Within the Swedish system, your child’s pediatrician can connect easily with Swedish Pediatric Specialty Care doctors should your child need evaluation or treatment for health conditions beyond general pediatric care. We offer one of the most comprehensive pediatric programs in the region, and prioritize care for the whole child and their family starting the moment they are born.

swedish.org

SWEDISHCARES FORKIDS


Turn static files into dynamic content formats.

Create a flipbook
2020 ParentMap Seattle Baby by ParentMap - Issuu