LatinX SA Combined

P. 6

P. 10

Table of Contents

LatinX SA

Miguel Maltos Gonzales

Chicano Artist

The Road to Redemption

Fernando Mora Story

P. 14

Model of the Month

Bethany Contreras

Masterminds Talent LLC

P. 18

Fashion Designer

Felix Tambora

P. 22

Latino Comedian

Jerry Garcia

P. 27

Actor Andrew Cortez

P. 29 ‘D

Art and Dominica herrera

Hart

Passion 4 Photography

Filmmaking-Fashion

LatinX SA Medical

P. 35 Gourmet Gainz Monthly meal prep Joe Montague

P. 38 Dr. Jeffrey martinez (English) espada vascular

P. 42 Dr. Jeffrey martinez (spanish) espada vascular

P. 46 The Importance of hydration and detoxification Dr. pinkston

P. 50 Diabetes in the latin community

P. 52 Understanding glaucoma the silent thief of sight

P. 58 The Transforming Power of Exercise for Diabetics

P. 62 Benefits of regular Chiropractic Care

P. 66 Giovanni cabrera El cabron” Fighters First

” ”

P. 70 DMP Desi Martinez Promotions by Fernando Maxx” Mora

P. 74 Valero Texas Open Player Commitments

VTO Press Release

P. 79 2Ten Sports Fights Scene bio’s Fernando 2 the Maxx” Mora MMa-is-life John Noriega

P. 80 Is Canelo Alvarez Afraid of Monsters by Fernand Maxx Mora

” ”

P. 81 Maxx’s Pound for Pound Best Boxers.....Top 10 Fernando Maxx Mora

P. 82 Max and Alex Montiel a Tale of Perseverance Family Submitted

P. 86 Lil Animal Jacob Silva MMA-is-Life Series by John Noriega

LATINX SA Magazine

“It’s Not My Weekend”

The Road to FernandoMora’sStory of theMonth

Redemption

MastermindsTalentLLC

FashionDesigner

Felix Tambora Model

Jerry Garcia

HBO Latino

Comedian

Miguel Maltos Gonzales

ChicanoArtist

MiguelMaltosGonzalesisaphotographerborninSanAntonio,TX.Manypeoplecall hisworkmixedmedia,butit’sbetteridentifiedasavisualrepresentationofhis lifestyle.identifiedasavisualrepresentationofhisbiculturalChicano

According to Miguel, his film photography captures the beauty of the land, and the world we share. He then scans the film to illustrate people of color into the photograph. These illustrated people are drawn like a memory of a person. Almost incomplete, but yielding enough detail to be a resemblance of someone By combining film photography with digital illustration, Miguel is combining the two mediums to represent living among two cultures. Balancing the existence between two languages, social norms, and at times a Miguel’s photography journey began in the 1980s by learning from his father. His father was a street photographer, portrait artist and collaborated with painters to create Chicano art. As Miguel would accompany his father to photoshoots on the west side of San Antonio and watch his father develop print in a small darkroom in the back of a garage, they would experiment with different techniques. “The camera is a same principle as an enlarger All you need is time and light ” , stated Miguel By concentrating on darkroom skills for two years, Miguel was able to grasp the concept of exposing film quickly He started to experiment with his father’s old formulas in the garage darkroom He started to show and sell his artwork in the early 90s to eventually have his own community darkroom and gallery by the late 90s. Miguel then pursued editorial and branding photography for small businesses. When Miguel moved to Spokane, Washington he was immersed in community of art and culture inequities. Miguel learned about the people and stepped up to be a voice for artists of color. In doing so, Miguel was ale to bring his Chicano art, Mexican artists, and diversity to local galleries that didn’t typically show these styles of art. Activism and building creative economy in eastern Washington was a challenge however, Miguel made allies that supported a similar vision. He became an art commissioner for the city of Spokane, a board member with Art Administrators of Color, joined the board of Spokane Ensemble Theater, and eventually President of the Hispanic Business Professional Association. Pandemic put a hold to art as the world quarantined in early 2020. Fueled by his passion, Miguel created LTNX artes as an online gallery to continue to show and sell art Not just for himself but free to other creative in need of working full time as artists. LTNX artes housed galleries for various visual artists across the US and Mexico. As pandemic settled and galleries began to open again, Miguel joined the oldest art gallery in Spokane, WA

After serving the creative community of Washington state and connecting with other artists of color across the country, Miguel has returned to San Antonio, TX He currently sells his artwork exclusively with the Guadalupe Cultural Art Center Bookstore, and works as a branding photographer for local small businesses in the San Antonio and hill country area.

Thunderbird:CollaborationbetweenMiguelGonzalesandhisfatherRamondGonzales.

Mommadidn’traisenomensa:PortraitofDrNancyGonzaleswithherchildrengraduating fromcollege.

Alacran:PortraitofamanImetatBarAmericainthelate90s.

ComoUnaVirgen:IllustrationoftheVirgenMary.

ElProgresso:Ilustrationofamanplayingaccordionandhsbrotherdancingbehindhimas theystrollbesideEProgressobuildingonGuadalupeStreet

Miguel Maltos Gonzales Branding Photographer & ChicanoArtist

210-872-3668

210-362-1753

Your healing is our priority!

Don’t give up hope!

We have customized, innovative

treatment plans that may work for you!

ConditionsWeTreatInclude:

Diabetic Foot Ulcer

ChronicVenousInsufficiency*

ChronicVenousStasisUlcer

PeripheralArterialDisease(PAD)*

FootandAnkleDisorders

Bunions

HammerToes

ChronicLymphedema*

ChronicEpisodesofCellulitis*

AutonomicNerveTesting/Foot

Non-healingFractureofFoot

FootInjuries

ChronicFootPain

NeuropathicBurningFeet

SurgicalFootEvaluations

DiabeticFootEvaluations

PlantarFasciitis/HeelPain

Nuestra prioridad es curarte! No pierdas la esperanza!

Tenemos tratamientos nuevos y personalizados para ti!

Condicionesquetratamos:

Ulcera Diabetica

insuficiencia venosa crónica estasis venosa crónica

enfermedad arterial periférica condiciones del pie y tobillo

Juanetes Dedos de martillo

Linfedema y piernas hinchadas celulitis crónica prueba del nervio autónomo del pie fracturas del pie lesiones del pie dolor del pie pies ardientes neuropáticos

evaluación para cirugía del pie evaluación del pie diabético

fascitis plantar/ dolor de talón

TheRoadtoRedemption

TheWord|Summer2023|

ByCallumRiley,BA’13

ArticleProvidedbytheUniversityofIncarnateWord

In 2004,FernandoMoralookedoutofhiscellintheBexar CountyJailandknewthathislifeneededtochange.Facing thejudgeforthesecondtimeintwoyearsforrepeat offenses,hewasatriskofspendingasignificantamountof timebehindbars.

Atthispoint,Fernando didnotrealizehewastakingthefirststeponhisroadto redemption.Hewasalsounawarehewasabouttoreceiveahelpinghandfroma surprisingplace.

ItwasMay2004intheveryfirsthoursofanewMondaymorning.AllofSanAntonio waswideawake, watchingtheNBAplayoffsandcheeringontheSpursastheytook ontheLosAngelesLakersinCalifornia.Mora’sfocuswasn’tonthegame –itwason hisupcoming8a.m.courtroomappearance.

“Iwassettoseethejudgeat8am.onMondaytofindoutmy fate,”heremembered. “Whyisthatimportant?BecauseofthetimedifferenceinCalifornia!Thegamewas crazyandtherewasadelay,soeveryonewasupuntil2a.m cheeringonthe Spurs includingthejudge”

Moraarrivedforhisappearance,onlytobemetbythebailiffwhosaidtohim,“It’syour luckyday Thejudgeisgivingyouanotherchance”

“Iguessmorepaperworkwasinvolvedinsentencingmetojail,andhewastiredfrom watchingthegame,soheletmeoffthehook,”Morasaidofthejudgewho alteredthe courseofhislife“Icouldn’tbelieveit!”

Itwasthissecondchancethatultimatelychangedhislifetrajectory

BornandraisedonSanAntonio’sSouthside,MoragrewupnexttoanareacalledThe Circle,nestledbetweenSouthcrossandZarzamoraSt.,justoffI-35–anareawitha notoriousreputationinthecityfordrugsandcrime.

Hismotherandfathercamefrombigfamilieswhogrewupinthisneighborhood Many ofhisunclesspenttimeinandoutofprison.Morasawfamilymembersstruggl ewith addictionandjailsentencessooftenthathegrewupthinkingitwasnormal.Thatwas justlife.

“Of my eight uncles, five spent time in and out of prison,” he shared, “My grandfather died from cirrhosis of the liver, and my father died at 57 from alcoholism. Everyone I knew would drink and take drugs each week. If you didn’t do it, you were the odd one out. So even after the judge let me off, I was still up to no good, until one night … "

The night was October 18, 2005 Fernando was at home watching a Spurs game alone. His table was littered with beer cans, cigarettes and drugs A feeling struck him – the realization that he’d been squandering the second chance he’d been gifted more than a year before. It was a moment that changed his life forever.

“As I’m sitting watching the game, I just started crying,” he revealed. “Not just a tear, but floods of tears I didn’t know why I was crying the Spurs were winning! But I quickly realized it was my inner soul that was crying out for help.”

“Right then I took all my stuff off the table –the beer, cigarettes and drugs, and flushed it all down the toilet. I knelt and prayed. I said ‘God, you’ve got to help me out of this I’m tired. I don’t want to live like this anymore.’ I haven’t touched alcohol, drugs or cigarettes since that day.”

Two months later, Mora had another epiphany. He felt a calling to go back to school. It was at the University of the Incarnate Word that Mora found the program and support he needed to completely alter the course of his path a nd begin living his life in the service of others.

Beginning his higher education journey at 35 years old, Fernando set a goal to earn his bachelor’s degree before age 40. He enrolled in classes each spring, summer and fall while working full -time at an orthopedic surgery center

“It’s been an amazing ride so far. I’m so excited to see where this journey takes us next. "

InMay2010,FernandograduatedwithhisBBAfromUIWatage39,fulfillinghisgoal. Atthispoint,hewasn'tsureifhewantedtocontinue.Buthecreditshisacademic advisoratUIW,OlgaBarton,forprovidinghimwiththeadvicehecontinuestoshare withpeopletoday.

WhenMoraaskedBartonhowlongitwouldtaketocompletehismaster’sdegree,she washonest–abouttwoyears.Havingjustcompletedfourchallengingyearsofschool, hewasabithesitanttoimmediatelyjumpbackin.

“Fernando,lookatitthisway,”herecalledherguidinghim.“Twoyearsaregoingto comeandgowhetheryoudosomething,oryoudon’t.Don’tbethatpersontwoyears fromnowthinking,‘ifI’dstartedbackthen,I’dbedonenow’.”

It was exactly what he neededto hear.

FernandocrossedthestagetocollecthisMBAfromUIW’sH -E-BSchoolofBusiness andAdministrationinDecember2011;justoneshortmonthafterhis40th birthday.

Notsatisfiedwithsimplyusinghiseducationtobetterhisownlife,Moragottowork applyinghisnewfoundknowledgeandskillstoimprovethelivesofothers In2013,he foundedanon-profitorganizationcalledMora-VationMinistry Forthelastnineyears, hisnon-profithasorganizedanannualChristmaseventtogifttoysandbicyclesto childrenontheSouthsideofSanAntonio.

"It’saplayonwordswithmyname,”hebeamedaboutthenameofhisorganization. “YousayitprettyfastanditsoundslikeMotivation.Thisyearwillmarkour 10thanniversaryandsofar,we’vegifted10,000toysand1,000brand-newbicyclesto lessfortunatechildrenfromthesamestreetsontheSouthsideofSanAntonioIgrew upon”

Moradidn’tstopthere.Heexpandedhisnon-profitthisyeartogivebacktoanother groupinneedinhishomecommunity.Thenewdivisionofthenon-profitiscalled Milagritos–Spanishforlittlemiracles.

“We helped the children, and now I want to help the senior citizens in the Southside too,” he explained about the purpose of the Milagritos branch. “I’ve been in medical sales for over 30 years and noticed that many senior citizens in our area go without medical braces; for their back, knee, wrist and ankle.”

Mora pointed to two reasons for this unfortunate reality. One, the medical braces are too expensive. Two, many of the senior citizens in need in the areadon’t have medical insurance. So, Mora got to work.

“I reached out to some business contacts in the medical industry, told them about my plan, and asked if they could help,” he said “I thought they might send a few hundred braces at most they sent 7,000! It’s been an amazing ride so far I’m so excited to see where this journey takes us next.”

Today, Mora has been clean and sober for nearly 18 years. A proud two -time graduate of the University of the Incarnate Word, he ha s gone on to use his BBA and MBA to help improve the quality of life of others. In addition to his non -profit organization, Mora founded two small businesses in the medical sales industry. He looks back on that fateful night when the Spurs played the Laker s nearly 20 years ago with gratitude.

“Everyone has their stories,” he reflected. “But for me, it’s how you react to your story. I want my story to show perseverance Because no matter where you’re from, no matter your past, if you think about what you gen uinely want and go after it with your heart, you can do anything.”

March 2024

Felix Tambora is a Washington D C Native! He grew up loving to draw and loved clothes from the start! He'll never forget asking his mom inthe 5th grade for a powder blue Fadora hat to match his powder blue suit for his class pictures! His mom granted that wish! You have tosee the smile inthat picture! Felix progressed over the years in art as well as fashion! He attended a Scholarship Course at the Smithsonian Institute for Sculpturing, several art awards as well !

Unfortunately as time went on the influences on the D.C. streets to a holdon him. Drug charges, gun charges, 1st degree aggravated assault and even attempted murder charges followed! Being locked up and even shot on twoseparate occasions didn't change his behavior It took him having kids to actually change his life!

The love he had for his son and daughter prompted him to make wiser decisions! He moved to SanAntonioTexas 19 years ago! Best decision ever hestated! He's now happily married with both children finishing up their college degrees while he's been perfecting his craft for art as well as fashion! He alsochanneled his aggressive behavior into something more positive! Felix is now a gym owner who teaches boxing and fitness! His lovefor helping others was there from the start! FelixTambora is now doing his own fashion and art shows as well! You haven't seethe best of Felix Tambora yet! His motto is, ChangingYour Mindset Can ChangeYour Life! Don't miss his next fashion and art show April 14th in Washington D C He's taking it back home with a totally new mindset! His goal is to influence others to make positivechanges!

"Jerry Garcia: Breaking Barriers in Latino Comedy"

In the vibrant world of Latino comedy, Jerry Garcia stands as a testament to passion, perseverance, and the pursuit of laughter. Coming off of his HBO special, we delve into his journey, starting with a candid interview that sheds light on the roots of his comedic career.

Garcia's comedic odyssey began in 2009, a pivotal year when he, at the age of 29, decided to confront an early midlife crisis by embracing his lifelong humor-infused identity. His comedic prowess was evident even in his high school years, where he earned the coveted title of "funniest" in the yearbook. However, it wasn't until his late twenties that the stage became his calling.

The North Hollywood Ha Ha Comedy Club served as the backdrop for Garcia's comedic debut, a five-minute stint that he vividly recalls as both awkward and uncomfortable

The $5 entry fee granted him a mere five minutes on stage, and while his performance may have been far from flawless, Garcia discovered a sense of belonging that fueled his determination to pursue comedy further.

What sets Garcia apart is his natural presence on stage, treating the audience as if they were his closest friends or even his parents. Despite the initial awkwardness and discomfort, he felt a sense of belonging that transcended the momentary challenges of his debut

As our conversation delves into the influence of Latino comedians, Garcia openly acknowledges the impact of George Lopez. Lopez's success served as a motivating force, proving that comedians from the Hispanic community could thrive on the big stage. Seeing someone relatable, with brown skin, dark hair, and an unfiltered, sweaty authenticity, inspired Garcia to believe that he, too, could make his mark in the world of comedy

However, Garcia reflects on the broader landscape of Latino comedians, noting that while many perform in small clubs across different towns, the leap to mainstream success is often a daunting challenge. The prevalence of talent in local scenes contrasts with the scarcity of individuals who manage to break into the mainstream comedy industry

Garcia emphasizes the importance of encouragement and support for aspiring comedians within the Hispanic community. He acknowledges the difficulties many face in pursuing their dreams, particularly when doors don't readily open. The comedian has become a beacon of inspiration, not only through his performances but also by actively providing advice and support to those who reach out to him.

In various towns, including San Antonio, Garcia has taken it upon himself to encourage emerging comedians to embrace their unique voices. His commitment to being a positive force in the Hispanic comedy scene is evident as he travels to different spots, offering advice and support to those who share his passion for making people laugh.

As Jerry Garcia continues to make strides in his career, he stands as a symbol of resilience and representation within the Latino comedy landscape. Through his journey, he not only entertains but also opens doors for others, proving that laughter knows no boundaries when fueled by authenticity and shared experiences

Jerry Garcia, not to be confused with the late Grateful Dead guitarist, is a rising star in the world of comedy. Hailing from a background rich in Latino culture, Garcia shares his unique brand of humor that resonates with audiences across diverse landscapes. Recently, he shared insights into his journey, ambitions, and the joy of bringing laughter to people worldwide.

Reflecting on his own comedic evolution, Garcia acknowledged the familiar presence of a funny individual at family gatherings and events. He drew parallels to his own realization at the age of 29, recognizing his comedic inclination and deciding to pursue it wholeheartedly

Garcia has already made waves with a Latino HBO special and appearances on platforms like Netflix As he delves into new projects, including Lopez versus Lopez on Peacock NBC, he expressed a desire to venture into acting, commercials, and independent films. This shift aims to deepen the understanding of Garcia's persona beyond the stage.

The discussion touched on the difference between performing live and acting for the camera. Garcia finds comfort in the spontaneity of live performances, where he can be himself. However, he is exploring the world of acting, appreciating the creative process that comes with scripts and on-camera work.

Addressing his aspirations for the next five years, Garcia shared plans to be more active in acting while continuing to deliver laughter on stage. He emphasized the importance of being genuine and relatable, traits that have endeared him to his audience.

When asked about dream venues, Garcia expressed a love for theaters and stadiums, citing the unparalleled experience of connecting with large audiences While he acknowledged the practicality of performing wherever the job takes him, his comfort zone lies in the southern and western parts of the U.S., particularly Texas, the Midwest, and California.

Garcia's passion for performing in areas with a strong Latino presence is evident, but he also spoke about the thrill of performing in unexpected places. From the snowy landscape of Edmonton, Canada, to his humor resonating with a diverse audience, Garcia embraces the challenge of bringing laughter to all corners of the globe.

As the interview concluded, Garcia expressed gratitude for the support he receives and looked forward to continued growth, particularly in top markets His journey is one of cultural connection, laughter, and a commitment to authenticity, making Jerry Garcia a rising star to watch in the world of comedy.

Acting:

Ialwayshadapassionforacting

AndrewSCortez,bornandraisedinSanAntonio,Tx GraduatedfromCentralCatholicHighSchool(1981)Playedfootballandbasketball .

StudiedPsychologyandDramaatSanAntonioCollege.(1981-82) Startedafamily

1985JoinedSanAntonioFireDept.TransferredtoEMSDivisionin 2000,EarnedParamedicCertificationfromUTHSC-SA Retiredin2019 .

MyfirstrolewasinKindergartenIplayedPapaBear(probablybecauseIwasalargechild)in GoldilocksandTheThreeBears.

WhileinHighSchoolplayedBarabasin“PassionPlay”thatwastouringthruSanAntonio .

1995-1999WasActing/Modeling.IhadtochoosebetweenActingandTheFireDeptwhenI wasaskedtomovetoLasVegasforafulltimeproject.Ididnotwanttorelocatemyfamily .

Ireconnectedwithactingafterretiring,howeveritwasnotmyplan.

DidabriefstintasaBassplayerinaHeavyMetalband .

InFeb2020IwasinGranadaformybirthday.IwasstayingataHotelonthegroundsofthe Alhambra.Iwaswalkingthegrounds,predawn.IwassittinginsolitudedrinkingaCortado,and watchedtheSunrise.Irealizeditwasn’tthe20819thsunrisebutthefirstsunriseofmynewlife. Idecidedtoleavemypastbehindandtrytofindmyself .

MyfirstFilm“EyesofARoman”-TriGoodwynProductions . InMarch2021,IrespondedtoapostlookingforextrasforaBattlescenebetweenRomans& Barbarians ThatexperiencerekindledmypassionforactingIwentbacktofilmotherscenesin MarchandApril.ItwastherethatImetBrianD Anderson(actor)whoencouragedmeand supportedmeinmypursuitofacting .

SincethenIhaveworked25otherFilm&Televisionprojects,notincludingCommercialsand musicvideos IhaveworkedinEngland,Germany,AustriaandSpain

LaterImetBrandyLopez(actress)whohasalsobeenverysupportive.Wehaveworkedona musicvideotogetherandhaveotherprojectscomingwithBertLopez .

IhavehadthepleasureofmeetingmanyverytalentedindividualsfromSanAntoniointhefilm industry

ProudtobefromSanAntonioandhopebringaspotlighttothetalenthere.Alsotohavemore projectsfilmedhere,startingwithaHorrorWesternbyJasonWrightfromSilent-StudiosUKin late2023

LATINX SA Medical Magazine

FeaturedNurse Monicamartinez-bazan MMB

Latinasand BreastCancer

TheImportanceofHydration andDetoxification: MealPrep BeefandBroccoli

DR.JeffreyMartinez VascularSurgerySpeciallist

MEAL PREP of the MONTH

Hi, My name is Joe Montague. A former gym trainer and current nutrition chef. For years I struggled with my weight. I jumped from one fad diet to another trying to find something that worked! When I say I tried it all, I mean I tried it ALL.No carbs, all carbs, paleo, keto, fasting, you name it. What I found was that these diets were far too restrictive, for someone like me who enjoyed food.

That is why I started Gourmet Gainz, a meal prep company based in San Antonio Texas.

Gourmet Gainz is based on the fact that you can still enjoy the foods you love, by just making healthier, more calorie conscious substitutions to the recipes. No “diet” is going to work for you, if you do not enjoy what you are eating. I take meals that would normally be considered a “cheat meal” and turn them into recipes you can enjoy on a daily basis. Recipes like this month’s recipe of the month:

Beef and Broccoli:

What you’ll need:

1lb flank steak

3 tablespoons liquid aminos

1 tablespoon minced ginger

½ cup low sodium beef broth

1 ½ tablespoons arrowroot powder

3 tablespoons coconut sugar

1 tablespoon olive oil

¼ cup water

1 ½ tablespoons minced garlic

4 cups broccoli florets

Instructions:

1. Slice the steak into quarter inch thick pieces about 2 inches long

2. Mix arrowroot with water, whisk well. Then combine with the liquid aminos, ginger, beef broth and sugar. Whisk well and set aside

3. Set a large non-stick skillet on medium heat. Toss in olive oil. Once oil is warm, add garlic and cook 1-2 minutes, stirring frequently to not burn.

4. Increase heat to medium-high, add pieces of steak. Cook 3-4 minutes until outside edges of the steak are seared.

5. Reduce heat back to medium, pour in your sauce mixture. Stir immediately and then add broccoli

6. Cook for about 2 minutes. Sauce will thicken. Remove from heat and let sit for 3-4 minutes

7. Stir and serve with cooked white rice or cauliflower rice

Makes 5 servings l Prep: 5 minutes l Cook: 15 minutes

Serving size ⅕ of recipe: Calories 263, Protein: 21g, Carbs: 15g, Fat:14g, Fiber:2g, Sugar:8g, Sodium:435g

Dairy free, Gluten free

Find me on facebook and Instagram @GourmetGainz_SA

Email: GourmetGainzsa@gmail.com

MEETDR.MARTINEZ

IntheheartofSanAntonio,wheretheMartinezfamily'srootsrundeep,Dr Jeffrey Martinezhasnotonlycontinuedafamiliallegacybuthasbecomeapioneerinthefield ofvascularsurgery,leavinganindeliblemarkonthecommunity.

Bornintoalineagethatsettledintheregionin1715,Dr Martinez'sconnectiontoSouth Texasgoesbeyondhisprofessionallife.Hisfamilyhasplayedapivotalroleinthe developmentofthearea,witnessingitstransformationfromundiscoveredterritorytoa thrivingcommunityonthesouthsideofSanAntonio.Itwasthisrichheritagethat inspiredhimtocontributetothewell-beingofthepeopleinhishometown.

AfterpursuinghisundergraduateeducationatTexasA&MUniversity,Dr Martinez embarkedonhismedicaljourneyattheUniversityofTexasHealthScienceCenteratSan Antonio.Hiscommitmenttoexcellenceledhimtocompletehisresidencytrainingin generalsurgeryatthesameinstitution,followedbyavascularfellowshipatthe UniversityofTennesseeMedicalCenterinMemphis.

Dr.Martinez'sdedicationtoserviceextendedtotheU.S.Navy,wherehespenteight yearsonactiveduty.FromtheUSSTrenton(LPD17)totheUSSEnterprise(CVN65),and finallyastheChiefofVascularSurgeryatNavalHospital,Portsmouth,Virginia,hehoned hisskillsandgainedauniqueperspectiveonhealthcare.Hismilitaryservicenotonly instilleddisciplinebutalsofueledhispassionforprovidinghigh-qualitymedicalcareto thoseinneed.

ReturningtoSanAntonioin2001,Dr.MartinezsetouttomakeadifferenceintheLatin communityonthesouthside.Foryears,hewasdedicatedtocaringforsomeofSouth Texas’mostneedy Allthewhile,hegainedperspectiveandexperienceonthe community’schallengestocare.Recognizingtheunderservedmedicalneedsandthe prevalenceofvasculardiseaseswithintheLatinCommunityonthesouthsideofthecity, hefoundedEspadaVascular,offeringstate-of-the-artvascularcareofthelower extremity.Dr.MartineztreatspatientsandofferseducationonPAD(peripheralartery disease)andothervasculardiseasesthatoftenaffecttheLatinCommunity.Hisfour convenientlylocatedoffices,anOutpatientBasedprocedurefacility(OBL),exemplifyhis commitmenttoaccessiblehealthcare,sparingpatientstheinconvenienceoffrequent hospitalvisits.

Withateamofhighlydedicatedstaff,state-of-the-arttechnology,andunparalleled commitmenttohispatients’wellbeing,EspadaVascularisnotjusttreatingconditions,it istransforminglives.Itsmissionistorevolutionizethewayvasculardiseasesare diagnosed,treatedandmanaged.Thegoalistocreateanindividualizedapproachto vascularhealththatharmonizeswithone’soveralllifestyle.

Beyondthewallsofhispractice,Dr Martinezextendshishealingtouchtocommunity centersandretirementhomes Withafocusoneducation,heraisesawarenessabout thesignsandsymptomsofvasculardiseases,empoweringindividualstotakechargeof theirhealth.Amanofdiverseinterests,Dr.Martinezdedicateshisdowntimetoalocal podcast,PuroPedoTalkShow,andactivecommunityinvolvement.Hismultifaceted approachtolifereflectshisbeliefinGod,thewell-beingofindividuals,emphasizingthe importanceofcommunityconnections,andhealtheducation

Inhispursuitofexcellence,Dr.Martinezhasnotonlyembracedcutting-edge technologiesbuthasalsobeenaleadinvestigatorfornumerousclinicaltrialsinvolving peripheralarterialdisease.Hiscontinualquestforknowledgeanddedicationto evaluatingnewtreatmentoptionsshowcaseshiscommitmenttoprovidingthebestcare forhispatients.

TheSouthsidecommunityisdisproportionatelyaffectedbythetriadofdiabetes, peripheralarterialdisease(PAD),andamputation,leadingtoahigherprevalenceof amputations

DiabetesisasignificantriskfactorforPAD Highbloodsugarlevelscandamageblood vessels,leadingtothedevelopmentofPAD.

PADaffectsapproximately8.5meanpeopleintheUnitedStatesanditsprevalence increaseswithage. Newerevidencesuggeststhatcloserto20-24millionpeople(about thepopulationofTexas)intheUnitedStatesareaffected.

HispanicshaveahigherprevalenceofPADcomparedtootherethnicgroups Thisis linkedtohigherratesofdiabetesandmetabolicsyndromeinthispopulation.

PADoftengoesundiagnosedbecauseitssymptoms,suchaslegpainornumbness,are frequentlyattributedtoagingorotherconditions

PADisoneoftheleadingcausesoflimbamputations Itisestimatedthatevery30 secondssomeoneintheworldlosesalimbduetocomplicationsfromPAD. Inthe UnitedStatesadiabeticlosestheirlimbevery3to4minutesduetoPAD. Diabetescanleadtonumerouscomplicationssuchasheartdisease,kidneydamage,eye damage,nervedamage,whichsignificantlyimpactaperson'squalityoflife.

Peoplewithdiabetesareatamuchhigherriskoflowerlimbamputations. Diabeticfoot ulcers,commoncomplicationofdiabetes,proceed85%ofdiabetesrelatedamputations. Amputationsignificantlyimpactsaperson'slife,includingtheirmobility,independence, andmentalhealth. Itoftenleadstohigherhealthcarecostsandreducedlife expectancy

Regularphysicalactivity,healthydiet,smokingcessation,andproperfootcarecan significantlyreducetheriskofdiabetesandPAD,andsubsequently,theriskof amputation

Regularmedicalcheckupscanhelpinearlydetectionandmanagementofdiabetesand PADandotherriskfactors. Thiscanpreventordelaycomplicationsandimprovethe overallqualityoflifeforthoselivingwiththeseconditions.

AtaEspadaVascular,Dr.MartinezistryingtocombatPADbypromotingawarenessand understandingaboutdiseases. Hisclinicsincreasetheaccesstodetection,treatment, andreducingtheriskofamputation.

Let'sacttogethertoprotectourcommunityfromthedevastatingeffectsofdiabetes, PAD,andamputation.InthelegacyoftheMartinezfamily,Dr.JeffreyMartinezstandsas abeaconofhealinginSanAntonio.Hisjourneyfromnavalservicetopioneering vascularcareisnotjustastoryofpersonalsuccessbutatestamenttotheenduring impactoneindividualcanhaveonthehealthandwell-beingofanentirecommunity

CONOCERDR.MARTINEZ

EnelcentrodelcorazóndeSanAntonio,dondelasraícesdelafamiliaMartinezcorren profundamente,elDr.JeffreyM.Martineznosolocontinuandoellegadofamiliar,perovino aconvertirseenunpioneroelcampodelacirugíavascular,dejandounahuellaimborrable enlacomunidad.

Nacidoenunlinajequeseestablecióenlaregiónen1715,laconexiónqueelDr.Martinez tienealsurdeTexasvamasalládesuvidaprofesional Sufamiliahasidoparte fundamentalypresenciandoeneldesarrollodelazona,siendotestigodesu transformacióndeunterritoriodesconocidoaunacomunidadprosperaenelladosurFue estaricaherencialaqueloinspiroacontribuiralbienestardelagentedesuciudadnatal. DespuésdecontinuarsueducaciónuniversitariaenTexasA&MUniversity ,elDrMartinez iniciosutrayectoriamedicaenlauniversidad.Sucompromisoconlaexcelencialollevoa completarsuresidenciaenlacirugíageneralenlamismainstitución,seguidadeunabeca vascularenlaUniversityofTennesseeMedicalCenterenMemphis.

LadedicaciónalservicioseextendióalaMarinadelosEE.UU.,dondepasoochoañosen servicioactivo DesdeelUSSTrenton(LPD17)hastaelUSSEnterprise(CVN65),y finalmentecomoJefedeCirugíaVascularenelhospitalNaval,Portsmouth,Virginia, perfeccionosushabilidadesyobtuvounaperspectivaúnicasobrelaatenciónmédica.Su serviciomilitarnosololeinculcodisciplina,sinoquetambiénalimentosupasiónpor brindaratenciónmedicadealtacalidadalosnecesitados

RegresandoaSanAntonioen2001,Dr.Martinezsepropusomarcarladiferenciaenla comunidadlatinadelladosur.Duranteañossededicóalcuidaralgunosdelosmas necesitadosdelsurdeTexas.Almismotiempo,adquirióperspectivayexperienciasobre losdesafíosdelacomunidadenlamateriadeatención.Reconociendolasnecesidades médicasmenosatendidasylaprevalenciadeenfermedadesvascularesdentrodela comunidadlatinaenelladosurdelaciudad,formoEspadaVascular,ofreciendoatención devanguardiaparalasextremidadesinferiores.ElDr.Martineztratalospacientesyofrece educaciónsobreEAP(enfermedadarterialperiférica)yotrasenfermedadesvascularesque afectanlacomunidadLatina.Suscuatrooficinasconvenientementeubicadasyincentro deprocedimientoambulatoriosejemplificansucompromisoconunaatenciónmedica accesible,evitandoalospacienteslamolestiadevisitasfrecuentesalhospital. Conunequipodepersonas,altamentededicados,tecnologíadepuntayuncompromiso incomparableconelbienestardesuspacientes,EspadaVascularnosolotrataafecciones, sinoquetransformavidas.Sumisiónesrevolucionarlaformadediagnosticar,tratary gestionarlasenfermedadesvasculares.Elobjetivoescrearunenfoqueindividualizado parasaludgeneralquearmoniceconelestilodevidageneral.

Masalládelosmurosdesupráctica,elDrMartinezextiendesutoquecurativoalos centrosdecomunidadyhogaresderehabilitación.Conenfoqueyeducación,crea concienciasobrelossignosysíntomasdelasenfermedadesvascularescapacitandoalas personasparaquesehagancargodesusalud.UnhombreconinteresescontrariosElDr Martinezdedicasutiempolibreaunpodcastlocal,PuroPedoTalkShow,ylaparticipación delacomunicad.SuenfoquemultifacéticodelavidareflejasucreenciaenDios,yel bienestardelaspersonas,enfatizandolaimportanciadelasaludylaeducación.

Ensubúsquedadelaexcelencia,elDr . Martineznosolohaadoptadotecnologíasde vanguardia,sinoquetambiénhasidoelinvestigadorprincipaldenumerososensayos clínicosrelacionadosconlaenfermedadarterialperiférica.Subúsquedacontinuede conocimientosydedicaciónparaevaluarnuevasopcionesdetratamientodemuestrasu compromisodebrindarlamejoratenciónasuspacientes.

LaComunidaddelSurseveafectadadesproporcionadamenteporlatriadadediabetes enfermedadarterialperiférica(EAP),yamputacionesloquellevaaunamayorprevalencia deamputaciones.

DiabetesesunfactorderiesgoparaEAP.Altosnivelesaltosdeazúcarpuedendañarlos vasossanguíneos,loquellevaaldesarrollodeEAP

EAPafectaaproximadamente8.5millonesdegenteinlosEE.UU.ysuprevalenciasube conlaedad.Nuevaevidenciasugierequemascercasde20-24millóndegente(casila populacióndeTexas)inlosEE.UU.sonafectados.

Hispanosdieronunamayorprevalenciaa EAPcomparadoaotrosgruposétnicos.Estoes porloscasosmasaltosdediabetesysindromametabólicoenestapopulación

EAPnosediagnosticadebidoaquesussíntomas,comodoloroentumecimientode piernas,seatribuyenconfrecuenciaalenvejecimientoyotrasenfermedades

LaEAPesunadelasprincipalescausasdeamputacionesdeextremidades;seestimaque cada30segundosalguienenelmundopierdeunaextremidaddebidoacomplicacionesde laEAPEnlosEstadoUnidosundiabéticopierdesuextremidadcada3-4minutos Diabetespuedeprovocarnumerosascomplicacionescomoenfermedadescardiacas, dañosrenales,dañosoculares,ydañosdelosnervios,queafectansignificativamentela calidaddelavidadeunapersona.

Personascondiabetestienenmasaltoriesgodeamputacionesdemiembroinferior. Ulcerasdiabéticasdelospies,complicacionescomunesdediabetes,proceden85%de amputacionesrelacionadasaladiabetes.

Amputaciónafectasignificadamentelavidadeunapersona,incluyendosumovilidad, independencia,ysaludmental. Ytambiénconducencostosmayoresmédicosyreducela esperanzadevida.

Actividadesfísicasregularmented,unadietasaludable,cesacióndefumar,ycuidado adecuadodelospiespuedesignificadamentereducirelriesgodediabetesyEAP, subsecuenteelriesgodeamputación

Chequeosmédicosregularespuedendetectarymanejareldiabetes,EAP,otrosriesgosy factores Estoprevienecomplicacionesymejorasobretodolacalidaddevidapara aquellosconestascondiciones.

EnEspadaVascular,elDrMartinezestátratandodecombatirEAPpromoviendola sensibilizaciónyelentendimientodelasenfermedades.Susclínicasaumentanla detección,tratamientoyreduciendoelriesgodeamputación

Vamosjuntosactuarparaprotegernuestracomunidaddelosafectosdevastadores efectosdeladiabetes,EAP,yamputaciónEnlegadodelafamiliaMartinez,DrJeffreyM. MartinezsiendounfarodesanaciónenSanAntonio.SuviajedeservicioNavalhasta pionerodesaludovascularnoessolamenteunahistoriadeéxitopersonalperoun testamentodeimpactoduraderoqueunindividualpuedetenerenlasaludybienestarde unacomunidadentera.

The Importance of Hydration and Detoxification:

Unlocking the Secrets to a Healthy Spring and Summer

In our quest for health and wellness, we are subject to buzzwords, phrases, and a constant bombardment of information and advertising. With easy internet access toinformation, how do you know what is true and what isn’t? How do you know which products and services are good for you and which are sales pitches?

Concentrating on the fact we are about to enter the summer months and the heat has been newsworthy, two things that are highly relevant and searched are hydration and detoxification. Realizing one cannot be without the other, these basic principles have existed sincethe dawn of civilization yet are the focus of a billion dollar industry

You do not have to look very farto feed your body the basics of what it needs to cleanse itself and prevent dehydration. Why is dehydration so essentialto avoid? What does good hydration mean, and can hydration be over-achieved?

Hydration allows your body to maintain its levels of minerals and electrolytes. Each cell needs sodium, potassium, magnesium, and other basic minerals to perform all the electrical tasks of speaking between themselves These internal electricalmessages allow our heart to beat and the nerves tokeep our brain functioning and muscle movements. Hydration allows our body to rid itself of toxic exposures, so even thesunscreen, mosquitosprays, grass fertilizers on the field, etc , can be cleared from the tissues and liver by improved circulation, regular bowel movements, sweating, and urination and good hydration allows all of these functions to occur naturally and regularly. Hydration allows vitamins and nutrients to build our muscles and tissues and feed thei r tasks .

Theadvertisingandmarketingindustry depends onyourlack ofknowledgeanddesperationfor informationonthelatest andgreatesttobuy theirproducts.Hydrationissimple. Mineral water from goodsources inglassandstainless steelcanisters,locallygrownproduceinseasonand organic ornon - GMOandrainbowof colors, regularexercise, anddaylightwithout direct sun, avoiding10am to2pm, andstressreductionaretheways toimproveyourbodies functionand needs without ahighpricetagorcomplicatingyourefforts. Ilikeglutathione, magnesium glycinate, andsimplewateradditivessuchaselectrolytebalancingpackets without additives, andpleaseavoidsugar - loadedelectrolytedrinks. Eventhelowsugaror“nocarb”drinks have artificialsweeteners, andwearenot abletodifferentiateartificial sweeteners from puresugaror highfructosecornsyrup. IVhydrationbars andclinics areexcellentforhangovers orafter intenseworkouts, butyoushouldavoidbothpractices becauseneitherisgoodforyou.

Headaches, legcramps, disorientation, nausea, andevensignsofthirst aresignsyouhave pushedyourbody toofarandaredehydrated Dehydrationhappens quickly

Dehydrationinterrupts allof theseessentialfeatures, andyes,youcanoverdohydration. If too muchwateris without balancelikeagallonplus of pureordistilledwaterallat onceorany rehydrationtooquickly, dependingontheseverity of dehydration, itcancausesodium and potassium levels todroprapidly andis deadly, sostay hydratedandprevent dehydrationas a precaution .

Theoldruleof 8-10glasses aday is toovague, sotheCDCstatesthat womenneed2.7liters a day andmen3liters aday.I say this isthebareminimum especially inthis summerheat orif youareworkingoutsideandexercising.Acupof 6-8Ozevery 10-20minhelps tostay hydrated, but rememberif youfeel thirsty,youarealready dehydratedintheearly stages

Stayinghydratedimprovesyoursweating, urinating, andbowel movements, whichis howwe removetoxins,anddrinkingplenty of waterkeepsthebloodwashingthroughyourorgans and musclestoflushthosetoxins. Cheapandeasy detoxification!

! HaveagreatSpringandbepreparedforthehotsummertocome,andstaywell!

Understanding the Challenges and

Diabetes in the Latin Community: Promoting Health

Diabetes is a growing health concern worldwide, and its impact is particularly significant in the Latin community The Latin population faces unique challenges related to diabetes, including cultural factors, genetic predispositions, and access to healthcare. This article aims to shed light on the prevalence, risk factors, and specific challenges that individuals of Latin descent may encounter in managing diabetes.

The Latin community has witnessed a surge in diabetes cases over the years, with a higher prevalence compared to other ethnic groups. According to the Centers for Disease Control and Prevention (CDC), the risk of developing diabetes is almost double for Hispanics/Latinos compared to non-Hispanic whites. This increased prevalence can be attributed to a combination of genetic factors, lifestyle choices, and socioeconomic disparities.

Cultural influences play a significant role in how diabetes is perceived and managed within the Latin community. Traditional Latin diets, rich in carbohydrates and sugars, may contribute to an increased risk of developing type 2 diabetes. Additionally, cultural celebrations often involve food and drinks that can be high in calories and contribute to poor blood sugar control.

Limited English proficiency can be a barrier to accessing crucial diabetes information and healthcare services. Understanding diabetes management instructions, dietary guidelines, and medication regimens can be challenging for individuals who primarily speak Spanish. Healthcare providers need to bridge this gap by offering culturally sensitive and language-appropriate resources to ensure effective communication and understanding

Some studies suggest a genetic predisposition to diabetes in individuals of Latin descent. Genetic factors can contribute to an increased risk of developing diabetes, making it essential for healthcare providers to consider familial history when assessing an individual's risk profile.

Members of the Latin community often face socioeconomic challenges that impact their ability to manage diabetes effectively. Limited access to healthcare, financial constraints, and a lack of health insurance can hinder regular check-ups, preventive care, and timely management of diabetesrelated complications.

To address the challenges posed by diabetes in the Latin community, community support and education play a vital role. Culturally tailored educational programs, support groups, and outreach initiatives can empower individuals to make healthier lifestyle choices, manage their diabetes effectively, and reduce the overall burden of the disease.

Diabetes is a significant health concern in the Latin community, with a higher prevalence and unique challenges that require targeted interventions. By recognizing the cultural, linguistic, and socioeconomic factors that contribute to diabetes disparities, healthcare providers, community organizations, and policymakers can work collaboratively to develop strategies that promote diabetes prevention, early detection, and effective management within the Latin population. Empowering individuals with knowledge and support is crucial in creating a healthier future for the Latin community in the face of this chronic condition.

Understanding Glaucoma: The Silent Thief of Sight

Glaucoma, often referred to as the "silent thief of sight," is a group of eye conditions that gradually damage the optic nerve, leading to irreversible vision loss. This condition typically progresses slowly and painlessly, and in its early stages, individuals may not experience noticeable symptoms. As a result, glaucoma can go undetected until significant vision impairment occurs This article aims to shed light on glaucoma, its causes, risk factors, symptoms, and available treatments

What is Glaucoma?

Glaucoma is a group of eye disorders characterized by increased intraocular pressure (IOP), the pressure within the eye. The increased pressure can damage the optic nerve, which is crucial for transmitting visual information from the eye to the brain. If left untreated, glaucoma can lead to permanent vision loss and blindness

Causes and Risk Factors:

The primary cause of glaucoma is an imbalance between the production and drainage of the fluid (aqueous humor) inside the eye. When the fluid does not drain properly, it results in an increase in intraocular pressure. While elevated intraocular pressure is a key risk factor, it is not the sole determinant of glaucoma, and individuals with normal pressure can also develop the condition.

Several risk factors contribute to the development of glaucoma, including:

1 Age: The risk of glaucoma increases with age, particularly after the age of 40

2 Family history: Individuals with a family history of glaucoma are at a higher risk.

3. Race: Certain ethnicities, such as African Americans, Asians, and Hispanics, are more prone to developing glaucoma.

4. Medical conditions: Conditions like diabetes, hypertension, and heart disease may increase the risk of glaucoma.

5. Eye injuries or surgeries: Trauma to the eyes or previous eye surgeries can elevate the risk of glaucoma

Types of Glaucoma:

There are several types of glaucoma, but the two main categories are open-angle glaucoma and angle closure glaucoma

1 Open-angle glaucoma: This is the most common form, characterized by a gradual increase in intraocular pressure. The drainage angle between the cornea and iris remains open, but the fluid does not flow out as it should.

2. Angle-closure glaucoma: In this type, the drainage angle between the cornea and iris becomes blocked or closes, causing a sudden increase in intraocular pressure. This type often presents with more noticeable symptoms and requires immediate medical attenti

Symptoms:

As mentioned earlier, glaucoma is often asymptomatic in its early stages. However, as the condition progresses, individuals may experience symptoms such as:

1 Blurred vision

2 Severe eye pain

3. Headaches

4. Halos around lights

5. Nausea and vomiting (in the case of acute angle-closure glaucoma)

Regular eye check-ups are crucial for detecting glaucoma in its early stages, especially for those at higher risk.

Diagnosis and Treatment:

Diagnosing glaucoma typically involves a comprehensive eye examination, including measurements of intraocular pressure, visual field testing, and examination of the optic nerve. Early detection is key to managing glaucoma effectively

Treatment options for glaucoma aim to reduce intraocular pressure and prevent further damage to the optic nerve. Common treatments include:

1. Prescription eye drops: These help to lower intraocular pressure by either increasing fluid drainage or reducing fluid production.

2. Oral medications: In some cases, oral medications may be prescribed to lower intraocular pressure

3 Laser therapy: Laser procedures can improve the drainage of fluid from the eye or decrease its production.

4. Surgical intervention: In advanced cases, surgery may be recommended to create a new drainage channel or reduce fluid production.

Glaucoma remains a significant global health concern, affecting millions of people worldwide. The importance of regular eye check-ups, especially for those at higher risk, cannot be overstated. Increased awareness, early detection, and effective management are crucial in preventing the progression of glaucoma and preserving vision. By understanding the risk factors and symptoms associated with glaucoma, individuals can take proactive measures to protect their eyesight and ensure a brighter future for their visual health.

The Transformative Power of Exercise for Diabetics:

A Path to Better Health

Living with diabetes can be a challenging journey, but integrating regular exercise into your routine can be a game-changer. Exercise is a potent tool that offers a myriad of benefits for individuals with diabetes, helping manage blood sugar levels, improving cardiovascular health, and enhancing overall well-being. In this article, we will explore the numerous advantages of exercise for diabetics, shedding light on how physical activity can be a crucial component of diabetes management.

One of the primary benefits of exercise for diabetics is its ability to regulate blood sugar levels. Physical activity increases insulin sensitivity, allowing cells to use glucose more effectively. This means that, with regular exercise, the body becomes better equipped to absorb and utilize blood sugar, leading to improved glycemic control. Consistent physical activity can also reduce the need for diabetes medications in some cases.

Maintaining a healthy weight is crucial for managing diabetes, as excess body weight is often associated with insulin resistance Exercise plays a pivotal role in weight management by burning calories, increasing metabolism, and promoting the development of lean muscle mass. Combined with a balanced diet, regular physical activity can contribute to achieving and maintaining a healthy weight, reducing the risk of complications associated with diabetes.

Diabetes is a significant risk factor for cardiovascular diseases. Regular exercise is a powerful ally in promoting heart health, as it helps lower blood pressure, improve cholesterol levels, and enhance overall cardiovascular function. Aerobic exercises such as walking, cycling, and swimming are particularly

effective in strengthening the heart and reducing the risk of heart-related complications in individuals with diabetes.

Exercise enhances insulin sensitivity, allowing cells to respond more efficiently to insulin. This means that the body requires less insulin to transport glucose into cells, ultimately reducing the strain on the pancreas. Improved insulin sensitivity not only helps manage blood sugar levels but also lowers the risk of developing type 2 diabetes in those at risk.

Living with diabetes can be stressful, and stress itself can adversely affect blood sugar levels. Exercise is a natural stress reliever, triggering the release of endorphins, which are the body's feel-good hormones. Engaging in physical activity can help reduce stress and anxiety levels, promoting mental well-being and contributing to better diabetes management.

Regular exercise has been linked to improved mood and better sleep quality. For individuals with diabetes, maintaining emotional well-being is essential, as stress and mood swings can impact blood sugar levels. Incorporating exercise into your routine can help stabilize mood, reduce depression and anxiety, and contribute to more restful sleep.

Incorporating regular exercise into the lives of individuals with diabetes is a key strategy for managing the condition effectively. From blood sugar control and weight management to cardiovascular health and enhanced overall wellbeing, the benefits of exercise are vast. It is crucial for individuals with diabetes to work with healthcare professionals to develop a personalized exercise plan that aligns with their health status and goals. With commitment and consistency, exercise can become a transformativetool in the journey towards better health for those living with diabetes.

The Surprising Benefits of Regular Chiropractic Care

In the pursuit of optimal health and well-being, many individuals are turning to alternative and holistic approaches to complement traditional medical care. One such avenue gaining popularity is regular visits to a chiropractor. While chiropractic care is often associated with alleviating back pain, its benefits extend far beyond just spinal health. In this article, we will explore the surprising advantages of seeing a chiropractor regularly and how it can contribute to overall wellness.

Pain Relief and Improved Mobility:

One of the primary reasons individuals seek chiropractic care is to address musculoskeletal pain, particularly in the back and neck.

Chiropractors use manual adjustments to realign the spine, reducing tension in the muscles and promoting better joint function. This can lead to significant pain relief and improved mobility, allowing individuals to engage in daily activities with greater ease.

Enhanced Nervous System Function:

The spine plays a crucial role in housing and protecting the nervous system. Regular chiropractic adjustments help maintain proper alignment, ensuring optimal communication between the brain and the rest of the body This can result in improved nerve function, potentially addressing issues such as headaches, sciatica, and even digestive problems.

Boosted Immune System:

Research suggests a link between chiropractic care and a strengthened immune system. When the nervous system functions at its best, the body is better equipped to fend off infections and illnesses. Regular adjustments may contribute to an overall improvement in immune system function, helping individuals stay healthier and recover more efficiently

Stress Reduction:

The physical and mental toll of stress on the body is undeniable. Chiropractic adjustments can have a positive impact on stress levels by 62

Stress Reduction:

The physical and mental toll of stress on the body is undeniable. Chiropractic adjustments can have a positive impact on stress levels by

promoting relaxation, reducing muscle tension, and releasing endorphins. As a result, individuals often report feeling more relaxed and better equipped to handle the challenges of everyday life.

Improved Posture:

Modern lifestyles, characterized by prolonged periods of sitting and screen time, contribute to poor posture Chiropractors can address postural issues through adjustments, exercises, and education. Improved posture not only enhances physical appearance but also reduces the risk of developing musculoskeletal problems over time.

Better Sleep Quality:

Chronic pain and discomfort can disrupt sleep patterns, leading to fatigue and decreased overall well-being Chiropractic care aims to alleviate such issues by addressing the root causes of pain. Many individuals report improved sleep quality and duration after regular chiropractic sessions.

Incorporating regular chiropractic care into a wellness routine can offer a multitude of benefits beyond merely addressing back pain. From enhanced immune system function to stress reduction and improved posture, the positive effects of chiropractic adjustments ripple throughout the body. It's essential to consult with a qualified chiropractor to develop a personalized treatment plan tailored to individual needs. As the field of holistic health gains recognition, the role of chiropractic care in promoting overall well-being continues to be a compelling and valuable option for many seeking a holistic approach to health.

2TEN SPORTS Magazine

Giovanni

Giovanni Cabrera

EL CABRON” ”

Giovanni“ElCabron”Cabrera Bio

Stylish southpaw Giovanni Cabrera plans to put his elevated skills to the test against the best the 135 division has to offer.

Cabrera, age 28, is a Seale nave now living and training in Hollywood at the famed Wild Card Gym with Hall of Fame trainer Freddie Roach. Since relocang on his birthday on July 19, 2021, Cabrera stepped up his game on the first day, being pressed into service as a sparring partner for eight division champion Manny Pacquiao, who was looking for new talent to test himself for an ancipated fight against Errol Spence Jr.

The fight never took place, but Cabrera seized his opportunity to make an impression in front of an inmidang crowd of onlookers including the Pacquiao family, NBA stars, and members of the Black-Eyed Peas, along with the ever-present cameras in the famed gym’s pressure cooker.

“I had changed my team, my managers, my trainers, and my first test was trial by fire with Manny Pacquiao,” recalls Cabrera.

"It was one of the first mes I truly prayed to God. I thought, 'You know what, man? It's crazy! How is this possible? All right, man, you asked for it and here's your chance.'

"I fought my bu off and managed to just hang in there. Freddie said I could stay. He said, 'I knew one of two things are going to happen – you're going to be what they say you are, or you're going to get knocked out.' I was like, 'Really? That's sweet,” said Cabrera.

Cabrera and Roach Partnership Paying Off

Since then, Cabrera has five fights working with Roach, amassing a 21-1 record with seven knockouts. Recent victories include decisions over René Téllez Girón, who recently scored an upset win over George Acosta on February 8; and dealt highly regarded prospect Gabriel Flores Jr. a loss in July 2022 dominant scorecards of 98-89. He’s been a sparring partner for champions Gary Russell Jr. and Jose Zepeda.

Cabrera stepped up to a big stage on July 29, 2023, when he fought Isaac “Pitbull” Cruz to a narrow split decision loss in the co-main event supporng Spence vs. Crawford, baling from the B-side and coping with mulple headbus. Scores were 114-113 for Cabrera and 115-112, 114-113 for Cruz.

Cabrera Combines The Best of Two Boxing Cultures

Cabrera began boxing at age 16, inspired by watching Manny Pacquiao fight Miguel Coo in 2019. He found success as an amateur, winning the Chicago Golden Glove in 2013 before moving to Mexico, his father’s nave country. He earned a bronze medal at the Mexican Naonal Amateur Championships in 2015, and narrowly missed qualifying for the 2016 Mexican Olympic Boxing Team for the Rio Olympics.

Cabrera returned to the U.S. to begin his professional career in April 2016. Cabrera notes since then, he’s defeated more undefeated fighters than most but remains hungry and eager to take on the big names in the compeve lightweight division.

Student of the Old School Style

Cabrera describes himself as a pressure fighter who can box and bang when needed. He can switch stances from southpaw to orthodox. His strengths including fluid movement in the ring, coming at his opponents from awkward angles which he makes work to his advantage.

Cabrera considers himself a student of the fight game. I've been studying guys like Willie Pep, Sugar Ray Robinson, Jake LaMoa, Roberto Duran – all the great old fighters,” praising the “old school” style as a good fit.

“I know that more than anything, people want genuine, real boxing. They like to see real fights. I have no illusions about what I do and who I am, and I want to prove it by beang good fighters.,” said Cabrera.

As for his nickname, Cabrera says it embodies the Mexican boxing culture he proudly represents. “Outside the ring, I’m a gentleman. Inside the ring, I’m ‘El Cabron.’ Somemes I let the beast become a lile too dormant, and I need to bring him out.”

Giovanni “El Cabron” Cabrera

Age: 28 (DOB July 19, 1994)

Residence: Hollywood, California

Birthplace: Seale, Washington

Record: 21-0, 7 KOs

Height: 5’9” / Reach: 71”

Stance: Le-handed – will switch stances

Manager: Jolene Mizzone, Fighters First

Trainer: Freddie Roach

Okay,firstofall,whoisDesiMartinez?So,DesiMartinez,Igrewupallovertheworld.AndIalways say,andit'sarunningjoke,eitherIgrewupinpovertyorIgrewupinEurope.Mystepdadcame alongandsavedus.Hewasasoldier.MyrealdadwasaVietnamvet.ThefamilysplitupwhenIwas young,soIwasraisedbymymom.So,mymom,stepdadretiredhere.Imovedbackaftermoving aroundforalongtime,openedupalawfirm.AndsowhatdoIdo?I'matrialattorney,principalto Martinez&Associates.Itwasimportantformetostartalawfirmonthesouthsideandbringagood producttowheretheunderservedare.Andforthelastthreeyears,we'vebeen,youknow,thebest lawfirminthecity.I'vethankfullybeenabletogetrecognizedverdictsforthepast10,15years. We'reveryproudoftheproductweputon,butwe'reacommunity-basedtriallawfirmthat specializesinpersonalinjury.Andwe'rehereonthesouthside.Okay.So,whatisadayinthelifeof DesiMartinezfromwhenyougetupinthemorning?So,it,ofcourse,startsoffwithgettingupearly becausetheboys,Ihavetwoboysthatgotoschool.Andforsomereason,everybodystartsschool beforethesuncomesup.So,Igetupwiththem,Igoworkout,Isaymyrosary,Idomymeditations onprayer,andthenIgettowork.Andlet'ssay,forinstance,todayIhaveatrialonMonday.So,Iget totheofficeandmakesureeverything'srunningthewayitshouldbe.Everybody'sreadyforwhat they'vegottodofortheday.Ihaveseveralconversationsthroughouttheday.Igettowork individuallyonthethingsthatIhavetodo,thetrialsIhavetogoto.Icommunicatewithallofthe supervisors.AndthenIalsonowhavethisaswellasafewotherbusinessinterestsandcommunity activities.Forinstance,rosarytonight.Ihavetobethere.Ihadagoodfriend,adeacon,whose motherdied.So,Iwillbetheretonight.AndthenIwillstartupagainwithmeetingsinthemorning.So, adayinmylifeofisverystructured,veryunstructured,verybusy,butyoumaketimeforthethings thatareimportanttoyou.So,what'simportanttome,myfaith,myfamily,andthenthiscomesnext.

DMP,DesiMartinezPromotions,turningathoughtintoarealityl I'veknownitcanbearealityfora decade.Ijust,I'mthemosthesitantpromoteryou'veevermet.Thetimingwasn'tright.Icouldsee whatwasgoingonwiththesport.Showboxsteppingout,HBOafternighttimeorwhateveritwas called,steppingout.Iseewhat'sgoingon.IactuallypredicteditwhenIfirststartedtalkingwith people.Nottopatmyselfontheback,it'sjustitwasanunsustainablebusinessmodelforhowmuch theywerepayingforthoseshows.So,Iknewtherewouldcomeatimewhentherewouldbechaos. Andthere'salwaysopportunityinchaos,right?So,thatdidn'tmeanitwastimetostepin.Whatit meantwasIopenedmyeyesandsaw,man,there'saspace,rightnow.Alotoffightersthey needathome.Andultimately,myrelationshipwithAdrian,myrelationshipwithJolene,I'veknown themforyears,Itrustedthem.Andthen,honestly,it's,youknowhowGodworks.He'snevergoing tocomeoutandtellyou,hey,writethisdown,Ineedyoutodothis,right?He'snevergoingtosay that.Itwouldmakethingsaloteasier.Butthere'salwayssignalgraces.Andbelieveitor not,theteamthatstartedcomingtogetheronceIsaidIwasinterestediswhatIwaswaitingfor.And thatwasconfirmation,okay,thislookslikesomethingthatI'msupposedtobedoing.Itfeelsright.It looksright.So,again,DesiMartinezPromotionsisnotjustmyself,it'sagroupofgentlemenwhoIhavea lotofadmirationfor,DarrylGoodlow,BobbyMendez,partnershipswithAdrianClark,JoleneMizzone, overthereatFightersFirst.And,again,Iseewho'sinthespace,andtherearelocalsthatarehelping aswell.They'relike,look,youknow,thesejustcan'tbeoutsiderscomingin,man.Weneedtoput somefightsupforalotofourlocalfolks.AndIsaid,hey,man,I'mlookingtomakethisaseriesof fights,notjustonefight.Absolutely,Ineedthoserelationships.Andwhenallthosethingslookedlike theywereright,thenIjumped.It'stimetojumpnow,withFightersFirst.

I'veknownAdrianforyears,andforme,it'salwaysabouttrustfirst.It'snot lookatbusinessopportunitiesandgo,I'mgoingtojumponthat.Ilookatwho'sinvolved.

IchoseAdrianandFightersFirstbecauseofthetrustIhaveinthem.KnowingAdrianforyearsand understandingtheimportanceofrelationshipsinthisventure,itfeltrighttocollaboratewithateamI couldrelyon.Businessopportunitiescomesecond;it'saboutthepeopleinvolved. IfIcantrustyou,thenIcantrustwhatyou'retellingme.IcantrustAdrian. IcantrustJolene.I'veknownthemlongenough.Andthatmeansthatwhenthey'retellingme something,Icantrustit,Icanstartputtingit intoplace.Sothat'swhythenI'veknownthem forlongenoughtoadmirewhatthey'redoing,toseewhatthey'redoingfromafar,andthengo, okay,thenthislooksliketherightorganizationthatIwanttobeteamedupwith.

WhatisgoingtodifferentiateDMPfromother tobeabletoattendalotoffights.Youknow,Icanseefromaspectator'sperspective,which iswhatItrytodoinmylawpractice

Asaspectator,I'msittingtherewatching

inwithmyticketuptothesuite.It

feelslikewhenIgetthere,nobodyknowsthatI'mthere,thatmyguests spending30minutesinbetweeneveryfight.There'snoentertainmentor to.

localpromoters?I'vebeengiventheopportunity aswell.Ialwayshavetoputmyselfinmyclient'sposition. thebigfightsintown.I'llgetasuiteanditfeelslike I'mabothertotheparkingattendantwhenIdrivein.ItfeelslikeI'mabothertoeverybodyasI'mwalking wantsomethingtoeat.I'm orthey'retryingtogivemeentertainment,andit'snotanythingIidentifywithorlisten Thentheydon'tdoanythingwiththe pay-per-viewvisual.SoI'mjustan amIherefor?SoI'mlookingatwhatsgoingon,asas watchafightlikethis.And

WhenChavezusedtofight,everybody whenJohnnyTapiawouldfight,he'd hisstomach.Andeverybodywas yourelate.And,again,notthatI'm Iknewwhohewas.Anditmademe fromthegoldenera,right?Theolddays,thefourkings,allthatstuff.Youhadonethatyoupickedout. you’vegottoaskyourself ishalfMexican.

lightsinthebigfights.Why?Becauseit'sgoingtomessupthe afterthought.Mymoneydoesn'tmeananything.Sowhatthehell pectator.Oh,man,Ididn'tdropthiskindofmoneyto thenithitme.Idon'tidentifywiththesefighterseither,man. waswarmingupliketheyweregoingtofight,right?Oh,yeah.

rideinwithasombreroandhe'dhavethetattoooftheVirginon like,man,thatlookslikemyprimo.Iknewwhathisstorywas, anythinglikeMikeTyson,butIidentifiedwithhisstrugglesonce wanttowatchhimmore,right?Soyouthinkaboutallthosefighters

why.Becauseyouidentifiedwithhim.There'ssomethingabouthim. thingswhereIwas Iwasn'thavingagoodtime.

inthespaceandIdidn'tlikewhatIwasseeing.

Irealizedit'sbecauseIalsodon'tidentifywithalotofthese

RobertoDuran That'smyguy,right?Soattheendoftheday,it'sjustoneofthose Ididn'tenjoywhatIwasseeing. fightersnowadays.

Wewanttobringbackthepersonalconnectionandidentificationwithfighters,andhopeyouappreciate DMP'sapproachtonotonlypromotingfightsbutalsoeducatingandsupportingthefightersin variousaspectsoftheirlives.ThisfocusonfairnessandopportunitiesiswhatwehopewillsetDMP apartfromotherpromoters

Thatleftspaceopen.Thatmeansifthere'sawaytobuildthatidentification,ifthere'sawayto bringtheentertainmentbacktoit,I'mgoingtogiveitatry,becauseIthinktherightteamisthere.

Theexpectationsarethere'llbeashowwithinashow,andIguaranteeyouthere'sgoingtobe eventsleadinguptothefightandonfightnightyouwillfeelthatyoucanidentifywiththepeople thatareputtingtheirbodiesonthelineforus,right?Right.Andyoucanunderstandwhy. Becausethewhyisimportant.We'rejustnothearingthewhyanymore.

IsDMPintheprocessofnegotiatingtosigntheirownfighters?No,I'mtryingtostay outofthatspacerightnow.Onestepatatime,atleastforme,thewayIthinkaboutit,for r instance,whenIwasanattorney,Iliterallydidn'tfeelthatiftherewasacasethatwassobigthat itwasoutofmywheelhouse,IwouldhavetobemoreproficientatwhatIdobeforeIstepinto thatspacealone,right?Samethinghere.IwanttoknoweverythingaboutwhatI'mdoinginthe promotionalspacebeforeIdecidetobranchout.Masteronethingfirstbeforeyoumoveon. Crawlbeforeyouwalk.So,atthemoment,I'mnotlookingtopromote

anybodyindividuallyortostepintothatspace.Again,I'mjusttryingtoputonthebestshowswe canputon.WearesearchingforlocaltalentasSanAntonioisfertileground. LookatHouston.LookatCorpus. andthat'swhatIwastalkingaboutatthepressconference. Thisisfertilesoilforthefighters,man,forthetalent.Sowe'reabsolutely andagain,it'sjustamatterofbuildingthoserelationshipswiththepeoplethatareinthespace. Iknowthatfightershavebeenburnedbyotherpromoters.I'mnottryingtodothat. Lookatthisway,asIsaythisintrialalot.Peoplejustdon'twakeuponemorningandbecomeliars. Thereisapatternofbehaviorthatyoucanpointtotosay,oh,thatpersonisaliar.They'vedone ittheirwholelives.Samethingasanattorney.Samethingasapromoter.Asofrightnow,again, there'snothingyoucanpointtoandnothing,hopefully,thatyoucaneverpointtothatI'mnota manofmyword,right?Andhopefullythetrainers,theotherlocalpromoterswillseethatand theywillsay,youknowwhat,man,Icantrustmyfightersonthiscard.He'snotgoingtotrytodo somethingtous,orhe'snotgoingtotrytoburnus.

LookatLaredo.LookattheValley.There'ssomanyfighters, lookingtofillthecardswithlocals,

In5yearsDMPplanstostillbehereSotheplanisaseriesoffightsalready,right? Idon'twanttogetaheadofmyselfandstartthinkingaboutthefuture becausethenIwon'tbeabletofocusonthenow,we'replanning,by theendoftheyear,aseriesoffights.Techportwasverygoodtousandsaid,look,ifyou're planningaseries,thenwe'llworkwithyou.That'sawesomebecauseIdon'twantthistobea one-timeshow.Thisisdramaaswell,right?Dramaisastory.Thatstoryhastobebuiltover time.Soattheendoftheday,we'relookingatourgoalsasatleastthreeor fourshowsthisyear,right?Andthenwithinthenextfiveyears,aseriesofshowsbuiltaround fightersthatyoucanidentifywith,bringinginalotofthelocaltalent,nowwehaveastage. Noweverybodysees,hey,guesswhat?There'ssomewheretheycancompetewithVegas. Wedon'talwayshavetobeinVegas.Wedon'talwayshavetobeintheEastCoastorWestCost. There'sgoodshowsbeingthrowninSouthTexas.Let'sgocheckitout,right?Let'sgocheckout thatvenue.Theygotalotofstufftheretoo.So,again,it'shopefullyshowcasingthecityenough sothatsomeofthenationalpromoterslookandsay,well,youknowwhat,maybeit'stimeto haveoneofthemajorfightsdownhere.Again,notcountingonit,notsittingtherelookingat thatasthespecificgoal,butit'skindoflikeifyoubuildit,theywillcome,right?Youjustgotto builditright.Theringofdreams,Right.

McIlroy, Homa and Morikawa Headline

Early Valero Texas Open Player Commitments

Two-timeChampionCoreyConnersSettoDefendTitle

SAN ANTONIO, TX — The 102nd edition of the Valero Texas Open returns to San Antonio this spring and today tournament officials announced an attractive collection of early player commitments for the 144-man field scheduled to compete. The historical PGA TOUR stop returns to TPC San Antonio’s The Oaks course for the 14th year, April 17, a week preceding the Masters Tournament.

World No. 2 Rory McIlroy is scheduled to make his third start in the TPC San Antonio era of the tournament with his best finish coming in 2013 when he finished runner-up. Since his last Valero Texas Open start in 2022, the 24-time PGA TOUR winner has won six times worldwide, including the 2022 TOUR Championship and his third FedExCup title. His most-recent win came this past Sunday at the Hero Dubai Desert Classic on the DP World Tour.

Max Homa will be making his first start in San Antonio since 2019. He’s gone on to win six times since then en route to becoming the 7th ranked player in the world. Homa is defending his most recent PGA TOUR title this week at Torrey Pines in San Diego, California.

Collin Morikawa, ranked 12th in the world, will be playing here for the first time in his career. The two-time major champion has won six PGA TOUR titles since turning pro in 2019.

2019 and 2023 champion, Corey Conners is the 10th multiple winner of the Valero Texas Open and the first since Zach Johnson (2008 & 2009). The Canadian also became the fourteenth player in history to record his first two TOUR victories at the same event. After opening with an 8-under 64 last year, the 32-year-old became the first player to carry the first-round lead/co-lead on to victory since the Valero Texas Open moved to TPC San Antonio in 2010.

Joining Conners on the past champions list include J.J. Spaun (2022), Charley Hoffman (2016), Jimmy Walker (2015) and Martin Laird (2013).

Lucas Glover, two-time TOUR winner in 2023 and world number 31, will be making his fifth consecutive Valero Texas Open start and is among the Masters Invitees that will be competing in this year’s tournament. In addition to Glover, recent winners including New Zealand’s Ryan Fox, who won the BMW PGA Championship on the DP World Tour in September and is currently ranked 32nd in the world, Sony Open in Hawaii winner and world number 50 Grayson Murray and, World Wide Technology Championship winner Erik Van Rooyen, have all committed to compete in the Valero Texas Open prior to playing in the year’s first major championship.

PGA TOUR players have until Friday, March 29 at 4:00 p.m. Central Time to commit and can withdraw at any time.

IS HIRING!

Wearelookingfordynamicprofessionalstojoinourteam!

WeoffergenerousPTO,benefits,apositiveculture,andmore!

OpenpositionsincludeAccountant,DirectorofAnalytics, ChildDevelopmentTeachersandmore.

Mora Fernando

“

Hellosportsfans,pleaseallowmetointroducemyself.MynameisFernando 2TheMaxx”Mora.Iwillbeoneofyoursportsinsiderswhenitcomestobringing breakingnewstoyou,thefan.Myfocusinthismagazinewillbeonbringingyou thelatestmoves,trades,signings onourveryownSanAntonioSpurs.Inaddition, Iwillbebringingyouthelatestinprofessionalboxing(localandglobal).Please beawarethatIwillbringtoyoumanyfactualstatementsalongwithmyveryown PERSONALOPINION.Youmaydisagreewith afewthingsIsay,butthatis perfectlyfine,itjustmakesforbetterconversation.

2TEN SPORTS Fight Scene...........With “2TheMaxx” MMA

IS LIFE

John Noriega

Alittleaboutmyself,Iama52yearoldmarriedLatinowithabeautifulwife,3 grownchildrenandaveryintelligentsoontobe2yearoldgrandbaby.Iearned mybachelor’sinbusiness Admin.(BBA) ’ 11and master’sinbusiness Admin (MBA)‘12bothfromUIW.Iown2smallbusinesses aswellasacharitable nonprofitorganization.I’vealwayshadaloveforboxing,igrewupwatching fightswithmylatefatherformanyyears.Ihavebeena10yearseasonticket membertoSanAntonioSpurs.Irecentlyfelt asif somethingwasmissinginmy life.Nowbybeingpartof2TenSportsMagazine,Ifeelasifthevoidhas beenfilled.IlookforwardtobringingyouSpursandboxingcontentthatwill keepyouinformed,educateyou,andmostimportantlyentertainyou.

HellomynameisJohnNoriegawriterforTwotenSportsfightersside.Ispecializeinthemixed martialartssideofthismagazine.For21yearsmmahasbeenmylife.Findinginspirationand beautyinasportthat'sknownforitsknockoutsandviolence B eyondthathowever Behind those4ozthinglovesandintentionsofbeatingyouropponentintosubmissionorseparating themfromconsciousness.Aremenandwomenfromvariousupbringing.Backgroundsand nationalities.Withdreamsofbeingthebestmovingontothebiggestpromotioninthesportof. UFC.Wheredreamscometrueandthebigbucksawait.Iconcentrateonthetierbeforethis. TheTexasmmaregionalscene.WhereTommarowsstarscompeteasalmostknowns.Each monthmymissionistobringyouthereaders.Theemostinspirational,sometimescontroversial alwaysin-depthninjatalesintheLoneStarState.SobuckleupandgetreadyasIpainta pictureoftheseninjas.Onewriteupfeaturingthegrownfolks.Theotherbeingthekiddosthat trainjustashardanddreamjustasbig.ThekiddosIaffectionatelydubbedtheminininjas.One storybasedonaAmmeturorprofessionalside

Is CaneloAlvarez afraid of Monsters?

So, what is going on with Canelo Alvarez? He wants to be considered one of thebest Mexican boxers of all me, which he was well on his way to do so. For the last couple of years seems to me like he's avoiding certain fighters in his weight class. Especially the one named David “The Mexican Monster” Benavidez. Canelo Alvarez even moved up to light heavyweight to face a 175 lbs Bivol and lost I believe he is ducking Benavides due to the fear of him possibly losing another fight. Benavides has been the #1 contender for the last two years, yet Canelo chooses to fight other people with a lesser threat to him. The reason I think Canelo will lose to Benavidez is prety much the size differen ce. Even though they have a fighng weight is 168 lbs. Benavidez is approximately 4 to 5 inches taller. I think canelo feels that with that reach advantage plus the power that Benavidez possess; he would be in trouble in this fight. Just last year Canelo told the world that he does not want to fight another Mexican fighter. He says that Mexican fighters should push each other to be the best there is and not beat each other and bring each other down. Yes, I think he has a point there that they should bring each other up but if you're going to say comment like that, don't turn around and schedule a fight with another Mexican fighter because you feel that you can beat them. Canelos is now scheduled to fight Jaime Mungia on this year’s Cinco Mayo weekend. A “Mexican” fighter canelo vowed that he would never fight. If you ask me, I think he just said that in order to stay away from David Benavidez. Again, for the last two years Benavidez has been the #1 contender AT 168lbs but now Canelo is talking about fighng big Charlo, Edward Berlanga, or even David Morrell. All which he feels he can beat Not once has he menoned fighng Benavidez Benavidez promoter even went as far as to offer him $60 million to fight and guess what? Canelo refused that as well. I used to be a huge fan of Canelo when he first started. He was very talented and prideful fighter back in his country of Mexico and while coming to the states. He never feared anyone, fighng whoever they put in front of him. But once he became very popular he became a drama queen, he would pick and choose the fights he wanted. whereas in the past he would fight whoever was mandatory. Is he one of the best Mexican fighters of all me? Yes! He is right now but, in my opinion, if keeps doing this stuff he loses credibility. Not once did you ever see Julio Cesar Chavez back down from a fight or much less turned down a fight from a #1 contender. He fought whoever black, white, Mexican, whoever they put in front of him. So, what's in the future for Canelo? I think he's going to fight Mungia this Cinco De Mayo weekend. To make things worse he wants to fight Crawford which is 3 weight classes below his. If and when he fights Crawford in my opinion, I think he's in a no win situaon. If he beats Crawford, he beat up a litle guy. If he loses to Crawford? He lost to a litle guy. No win at all for him. I just hope that before Canelo reres, he steps up and fights David Benavidez I am a big fan of David Benavidez as you can tell. I would love to see this fight just like any boxing fan out there. This is the fight they everybody wants to see. Give the fans what they want! Again, this is just my opinion.

1. Terrence Crawford 40-0 (31 KO’s)

2. Naoya Inoue 26-0 (23 KO’s)

3. Oleksander Usyk 21-0 (14 KO’s)

4. Dmitry Bivol 2 2-0 (11KO’s)

5. Canelo Alvarez 60-2-2 (39 KO’s)

6. Devin Haney 31-0 15 (KO’s)

7. Errol Spence 28-1 (22 KO’s)

8. Tyson Fury 34-0-1 (24 KO’s)

9. Artur Beterbiev 20-0 (20KO’s)

10. David Benavidez 28-0 (24 KO’s)

EarlyBeginningsinSanAntonio

MaxandAlexMontiel:

ATaleofPerseverance

FromNovicestoChampions

MaxandAlexMontiel,bornandraisedinSanAntonio,Texas,comefromaproud Mexicanfamily Raisedbytheirsinglemotherfromthetimeshewaspregnant, theyhavefacedtheirfairshareofchallengesandlimitations.However,throughit all,theirmotherhasprovidedunwaveringsupport,ensuringtheirgrowthand success.

AJourneyinSports

Attheyoungageof4,theMontieltwinsbegantheirforayintosportsbyplaying soccer.TheirloveforthegameledthemtojoinalocalsoccerclubinSanAntonio, wheretheyhonedtheirskills.Littledidtheyknowthatanewdestinyawaited them.

ATwistofFate

Sometimes,destinyhasitsownplans.Attheageof8,MaxandAlexstumbled upontheAlamoCityBoxingClub.Whatstartedasasearchforanothersporttofill theirfreedaysquicklymorphedintosomethingextraordinary.Itbecameevident thatthetwinspossessedanincredibletalentforboxing,atalentthatcouldn'tbe ignored.

Undertheguidanceoftheircoach,theMontieltwinsembarkedonajourney towardscompetition.TheyregisteredwithUSABoxing,andtheirpathtogreatness began Inthesummerof2021,theyparticipatedintheirfirstnationalcompetition inLubbock,Tex as.

Toeveryone'samazement,bothMaxandAlexadvancedtothesemifinals, solidifyingtheirplaceamongthenation'stop10pee -weeboxersinthe50lbs& 55lbscategories.Theirimpressiveperformancegarneredrecognitionandrespect fromtheirpeers.

A Brothers' Showdown

In March of 2023, in Detroit, Michigan, Max and Alex found themselves in an unexpected situation. Both boys competed in the same weight class, Bantam male 60lbs. What unfolded was a heartwarming yet intense battle for the championship. The brothers were set to fight each other.

Many wondered why they would face off against one another, but like any fierce competitors, Max and Alex yearned to earn their place in the ring. Ultimately, it was a close split-decision, with Alex emerging as the winner, securing the gold medal. Max proudly took home the silver medal. Despite the intense competition, their bond as brothers remained unbreakable, and both medals found a special place in their home.

A Memorable Chapter

This national competition became a cherished memory for the entire Montiel family. The journey of Max and Alex Montiel is a testament to their perseverance, dedication, and the unwavering support of their single mother. Their story serves as an inspiration to all, proving that through hardships and adversities, dreams can be realized, and greatness can be achieved.

FollowourJourney

Youcanfollowusthroughoursocialmediaaccountsandfollowalongaswe continuethisdream.-MontielTwins

Instagram:@thetwins maxalex

TikTok:@thetwins_maxalex

Facebook:AlexMaxMontiel

MMA IS LIFE

LilAnimal Jacob Silva continues adding to his Legacy

For somebody who never had dreams of lacing up the 4 oz gloves. Nor hear that cage door lock behind him 35 year old Jacob Silva will forever be remembered as aTx MMAstaple.

Started with Silverback Fight Club where his coach at the time "CoachTony" approached a 22-23 year old Jacob about fighting. With Silva declining due to him not seeing himself as a fighter.

Once a second opportunity arose a young Silva was in.This wouldn't be jus any debut.This debut had a bit more at stake.

This scrap would be a main event and with a championship at stake.

Fight night came and saw Silva drop a razor close split decision.That however was 2011. Fast forward to 2023 and LilAnimal has been in animal like fights.

The next 12 years flew by with the ninja now fighting out of Metro MMA. He Has made his opponents shed tons of blood while he himself spilled over pints of his.

This back n forth slugfest with flying knees and ultimately a submission win for Silva

In the 3rd.Tough fight as both OG's were really in need of a win. Each planning on turning things around at each others expense.

Take it back some to March 6th 2021.Acard stacked filled with many FuryFC big names. Names that deserve to be inducted into a HOF of there own.(To bad FFC doesn't have one. Which they should)

Especially with fights like Jacob Silva vs C.J Vergara Fury 44.The fight started with an intense face off and no glove touch.

LilAnimal exploded from the first second with a flying knee and a good left hook that sits C.J.Tide would keep turning back n forth making a good fight into a fotn before our eyes.Then like every great scrap it transforms into a real classic fight.

Since then Silva has gone 3-4 and has found himself investing in outside ventures for when that day indeed comes. However it won't be today as that championship just sits there vacant with no owner. The lilAnimal knows what he has to do.

Credit to Hosanna Rull for the awesome pictures I used for the article.