Page 1


Titelfoto (Nr. L 4) Monnoies en argent, Haupt- und Supplementband, Wien, 1756 – 1770 Monnoies en or, Haupt- und Supplementband, Wien, 1759 – 1769 Lipsius S. 265 (2)


eLive Auction Numismatische Literatur – Aus den Bibliotheken Egon Beckenbauer, Hauck & Auf häuser Privatbankiers, München, u. a. Teil 1 Losnummer L 1 – L 892

Bibliophile Werke, Monographien: Allgemeine Numismatik, Antike allgemein, Griechen, Römer, Kelten, Byzanz, Völkerwanderung, Frühmittelalter, Neuzeit allgemein, Balkan, Griechenland, Malta, Belgien, Niederlande, Luxemburg, Deutschland

7. November 2012, Start: 1300 Uhr Teil 2 Losnummer L 893 – L 1637

Monographien: Frankreich, Monaco, Großbritannien, Irland, Habsburgische Erblande, Ungarn, Böhmen, Italien, Polen, Russland, Baltikum, Portugal, Spanien, Schweiz, Liechtenstein, Skandinavien, Orient, Islam, Übersee, Medaillen, Plaketten, Orden und Ehrenzeichen, Papiergeld, Geschichte allgemein, Gemmen und Kameen

Festschriften, Zeitschriften und Reihen, Auktionskataloge 8. November 2012, Start: 1300 Uhr

Sehr geehrte Münzfreunde/Dear Coin Collectors Ich freue mich sehr, Ihnen den Sonderkatalog »Numismatische Literatur« zu unserer eLive Auction im November zu präsentieren. Die eLive Auctions sind regelmäßig stattfindende Auktionen, die nur im Internet abgehalten werden. Wir haben uns entschlossen, für die Versteigerung der Literatur einen gedruckten Spezialkatalog für Sie zu produzieren. Ich wünsche Ihnen viel Freude beim Studium und hoffe, dass Sie viele schöne Monographien, Zeitschriften oder Kataloge finden werden.

F iittz Ru Fr Rudo d lff Küünnke do ker

We are very happy to introduce the special catalogue »Numismatic Literature« for our November eLive Auction to you. With our eLive Auctions, we offer you a direct and easy opportunity to participate in regular auctions live over the internet. We decided to produce this printed catalogue for this literature sale. I wish you a lot of pleasure studying our special catalogue and hope you will find interesting books and catalogues for your numismatic library. Mit herzlichen Grüßen/With warm regards


Besichtigung/On View Das Auktionsgut kann nach Vereinbarung in Osnabrück besichtigt werden. Auction lots may be viewed in Osnabrück by appointment only.

Registrierung/Registration Um an der eLive Auction teilzunehmen, benötigen Sie einen aktiven myKünker-Account. Falls Sie noch keinen Account besitzen, können Sie sich auf unserer Website registrieren oder Sie wenden sich direkt an unsere Kundenbetreuung. Bitte beachten Sie, dass jede Registrierung manuell bearbeitet wird und nur während der Geschäftszeiten möglich ist. Wir empfehlen, sich möglichst frühzeitig zu registrieren, da jede Registrierung ca. einen Werktag dauert. In order to participate in the eLive Auction, all you need is an Internet connection along with an active myKünker account to log in. In case you do not yet have access to myKünker, you can register on our website or get in touch directly with our customer service department. Please note: New registrations are only possible during our business hours!

Künker-Service Wir sind mittlerweile mit neun eigenen Standorten in Deutschland und Europa vertreten. So können wir Ihnen unseren beliebten Künker-Service auch in Ihrer Nähe anbieten. Unsere Leistungen vor Ort: • Persönliche Beratung und Betreuung in Ihrer Nähe. • Sie können Ihre Münzen direkt einliefern oder verkaufen, ersteigerte Münzen abholen und sich nach Vereinbarung Einlieferungen auszahlen lassen. • Sie können sich von unserem Kooperationspartner auf den Künker-Auktionen vertreten lassen. We are now represented with nine locations in Germany and Europe so that we can also provide you the best service in your vicinity. Our local services: • You always have a point of contact nearby. • You can directly consign or sell your coins, collect purchases and receive by appointment payment for consignments. • You can have our cooperation partner represent you at our auctions.

Haupptstsititz Ha ititz in in Osn s abbrüückk

2

OSNABRÜCK Fritz Rudolf Künker GmbH & Co. KG Gutenbergstraße 23, 49076 Osnabrück Tel. +49 (0)541 96 20 20, E-Mail: service@kuenker.de

TEL +49 (0)541 96 20 20, FAX +49 (0)541 96 20 222, SERVICE@KUENKER.DE, WWW.KUENKER.DE


Standorte/Locations

Drrr. H D Huube bert rt R Ruß uß

Fraannk Ri Fr Rich chharrds dsen en en

MÜNCHEN Künker Numismatik AG Löwengrube 12, 80333 München Dr. Hubert Ruß Tel. +49 (0)89 242 198 38, service@kuenker-numismatik.de Fritz Rudolf Künker GmbH & Co. KG Maximiliansplatz 12a, 80333 München Frank Richardsen Tel. +49 (0)89 242 16 990, frank.richardsen@kuenker.de BERLIN Fritz Rudolf Künker GmbH & Co. KG Poststraße 22, 10178 Berlin-Mitte Wollankstraße 117, 13187 Berlin-Pankow Michael Otto Tel. +49 (0)30 247 248 91, michael.otto@kuenker.de

Miichae M chhae aell Ot Otto

Rola lannndd Tra ram mppe

HAMBURG Künker Hamburg, c/o Roland Trampe Roland Trampe Tel. +49 (0)541 96 20 20, roland.trampe@kuenker.de KONSTANZ Künker Konstanz, c/o Michael Autengruber Schulthaißstraße 10, 78462 Konstanz Michael Autengruber Tel. +49 (0)7531 28 44 69, michael.autengruber@kuenker.de

Michaeel Autengruubeer

P tr Kov Pe ovaljov jov jo

ZNOJMO Künker Znojmo, c/o Petr Kovaljov 17. Listopadu 18, 66902 Znojmo, Tschechische Republik Petr Kovaljov Tel. +42 (0)603 81 10 31, petr.kovaljov@kuenker.de ZÜRICH Künker Zürich, c/o Hess-Divo AG Löwenstraße 55, 8001 Zürich, Schweiz Ulf Künker Tel. +41 (0)44 225 40 90, zuerich@kuenker.de

Alleekksesey On Oncchhuk ukoovv ukov

MOSKAU Künker Moskau, c/o Russian Coin Co. Ltd. Lyalin pereulok dom 9, str. 1, of. 3, 105062 Moskau, Russland Aleksey Onchukov Tel. +7 (495) 589 56 10, aleksey.onchukov@kuenker.de

TEL +49 (0)541 96 20 20, FAX +49 (0)541 96 20 222, SERVICE@KUENKER.DE, WWW.KUENKER.DE

3


Fritz Rudolf Künker GmbH & Co. KG Als Europas führendes Auktionshaus für Münzen, Medaillen und Orden verbessert sich unser Dienstleistungsspektrum für Sie als unsere Kunden weiterhin stetig. Einen kleinen Überblick über unsere Angebote finden Sie hier. As Europe’s leading auction company for coins, medals and decorations our range of services for our customers has been steadily improving and expanding. Following is a short overview of our offers. AUKTIONEN/AUCTIONS Besuchen Sie unsere international bedeutenden Auktionen, die Ihnen viermal jährlich zahlreiche Raritäten bieten. Profitieren Sie als Bieter oder Einlieferer von unserer Erfahrung und Kompetenz. Visit our internationally recognized auctions which take place four times a year and offer many rarities. Benefit from our experience and competence while being a bidder or consigner. GOLDHANDEL/GOLD COIN TRADING Wir bieten Ihnen ein ständiges Angebot sowie den Ankauf von Anlagemünzen aus Deutschland, Europa und aller Welt zu fairen tagesaktuellen Preisen. We are constantly offering as well as purchasing a vast range of German, European and World bullion coins. We buy and sell gold assets at a fair, daily updated market price. ONLINE-SHOP Wir bieten Ihnen in unserem Online-Shop auf www.kuenker.de ein täglich aktualisiertes Münzangebot von der Antike bis zur Neuzeit. Kaufen Sie hier unkompliziert zum Festpreis und ohne Risiko. We offer you an exclusive daily updated selection of coins from ancient to modern times. You can order at www.kuenker.com without hassle or risk. eLIVE AUCTION Mit unserer eLive Auction können Sie über das Internet an regelmäßigen Auktionen mit einem virtuellen Auktionator teilnehmen. Sie können Vorgebote bequem online abgeben und abschließend die Auktion live am Bildschirm für sich entscheiden. With our eLive Auction, we offer you an opportunity to participate in regular auctions live over the Internet. You can submit preliminary bids online, and up to the last moment of the sale you can win auctions live on your computer screen. ORDEN UND EHRENZEICHEN/ORDERS AND DECORATIONS Einmal im Jahr findet unsere besondere Ordensauktion statt, die sich ganz den dekorativen Ehrenzeichen widmet. Profitieren Sie als Bieter oder Einlieferer von unserer Erfahrung und Kompetenz im Bereich Phaleristik. Once a year there is a special auction dedicated to orders and decorations. Benefit from our experience in the field of phaleristik becoming our bidder or consigner.

4

TEL +49 (0)541 96 20 20, FAX +49 (0)541 96 20 222, SERVICE@KUENKER.DE, WWW.KUENKER.DE


Ihr schneller Einstieg in die Künker eLive Auction

DEUTSCH

Mit der eLive Auction bieten wir Ihnen die Möglichkeit, direkt und unkompliziert über das Internet an regelmäßigen Auktionen live teilzunehmen. Bequem von zu Hause oder unterwegs können Sie Vorgebote abgeben und abschließend – ganz wie in einer echten SaalAuktion im Bieterwettstreit mit anderen – den Ausgang der Auktionen für sich entscheiden.

Was benötige ich, um teilzunehmen? Um an der eLive Auction teilzunehmen, benötigen Sie eine Internetverbindung sowie einen aktiven myKünker-Account, um sich anzumelden. Falls Sie noch keinen Account besitzen, können Sie sich auf unserer Website registrieren oder Sie wenden sich direkt per E-Mail an unsere Kundenbetreuung. Wir helfen Ihnen gerne weiter.

Wie verläuft eine Künker eLive Auction? Ganz wie in einer Saal-Auktion werden Sie auch hier auf viel Vertrautes treffen. Zunächst werden alle Stücke der Auktion auf der Internetseite www.eLive-Auction.de präsentiert und können im Detail besichtigt werden. Während dieses Zeitraums bis zum Ausruf des jeweiligen Stücks können Sie in der gewünschten Höhe Vorgebote abgeben, die bei der Versteigerung für Sie berücksichtigt werden. Nach der Besichtigungs- und Vorgebotsphase wird jedes Stück einzeln und nacheinander entsprechend seiner Losnummer ausgerufen und versteigert. Jetzt haben Sie die Möglichkeit, im virtuellen Auktionssaal live im Wettstreit mit anderen um jedes Stück zu bieten. Nach dem Ausruf können Sie schrittweise Ihre Gebote erhöhen und den Zuschlag für sich entscheiden, indem Sie auf den zentralen Button »Jetzt bieten« klicken.

Weitere Informationen und eine ausführliche Beschreibung aller Funktionen der eLive Auction finden Sie unter www.eLive-Auction.de/hilfe

Wie kann ich schriftlich bieten? Bei dieser speziellen eLive Auction können Sie auch schriftlich bieten – genauso wie Sie es bei unseren Saalauktionen gewohnt sind. Bitte senden Sie uns Ihre Aufträge möglichst frühzeitig zu. Wenn uns Ihr Auftrag erst kurz vor dem Start der eLive Auction erreicht, können wir nicht für eine fristgerechte Bearbeitung garantieren. Das beiliegende Formular erleichtert Ihnen die Abgabe eines schriftlichen Gebots. Gerne nehmen wir Ihre Gebote per Post, Fax oder E-Mail entgegen. Wenn Sie noch nicht bei uns gekauft haben, bitten wir Sie, uns als Referenz eine Münzhandlung anzugeben, mit der bereits eine Geschäftsbeziehung besteht.

Was kostet die Teilnahme an der eLive Auction? Die Teilnahme an der eLive Auction ist kostenlos. Sie benötigen lediglich einen myKünkerAccount, der für Sie als unseren Kunden ebenfalls kostenlos ist. Wenn Sie in einer Auktion erfolgreich geboten haben, sind bei anfallenden Kosten für Ihre Münze folgende Dinge zu berücksichtigen: Auf den Zuschlagspreis entfällt ein Aufgeld in Höhe von 10 % des Zuschlagspreises. Ferner sind alle Preise grundsätzlich Nettopreise. Das bedeutet, dass auf den Gesamtpreis (inkl. Aufgeld) die gesetzliche Mehrwertsteuer zu entrichten ist. Bitte beachten Sie: Die im Katalog angegebenen Preise sind Startpreise, die nicht unterschritten werden können.

Kundenservice: Telefon: +49 (0)541 96 20 20 Fax: +49 (0)541 96 20 222 Gebührenfrei: 0800 58 36 537 E-Mail: service@kuenker.de Internet: www.kuenker.de Geschäftszeiten: Montag – Donnerstag 8.30 – 17.00 Uhr Freitag 8.00 – 15.30 Uhr

Der größte Teil der Versandkosten wird durch uns übernommen. Ihren Beitrag zu diesen Kosten berechnen wir nach folgendem Schema: • Versand innerhalb der BRD: € 5,90 pro Paket, ab € 1.000,– Bestellwert versandkostenfrei • Versand innerhalb der EU (inkl. Schweiz und Norwegen): € 9,90 pro Paket, ab € 2.500,– Bestellwert versandkostenfrei • Versand nach Übersee: € 14,90 pro Paket, ab € 5.000,– Bestellwert versandkostenfrei

Worauf kann ich mich bei Künker verlassen? Wir gewährleisten die Echtheit aller verkauften Objekte auch über die gesetzliche Frist hinaus. Sollte uns ein Fehler bei der Beschreibung oder der Erhaltungsbewertung unterlaufen sein, können Sie auf unsere Kulanz zählen.

TEL +49 (0)541 96 20 20, FAX +49 (0)541 96 20 222, SERVICE@KUENKER.DE, WWW.KUENKER.DE

5


ENGLISH

Your Fast Introduction to the Künker eLive Auction With our eLive Auction we offer you a direct and easy opportunity to participate in regular auctions live over the Internet. From the convenience of your own home or when you are travelling, you can submit preliminary bids, and up to the last moment – as in a real floor auction in bidding competition with others – decide the outcome of the auctions in your favor.

What do I need to participate? In order to participate in the eLive Auction, all you need is an Internet connection along with an active myKünker account to log in. In case you do not yet have access to myKünker, you can register on our web site or get in touch directly with our customer service department. We are delighted to assist you. Please visit our website for further information and a detailed description of every eLive Auction feature: www.eLive-Auction.com/hilfe

How does a Künker eLive Auction work? Just as in a hall auction, you will find many features here that will be familiar to you. Initially all the pieces of the auction are presented for two weeks on the auction site and can be previewed in detail. During this time period, until each item is called up for auction, you can submit preliminary bids in a desired amount to be considered for you at the auction. After the preview and preliminary bid phase, each piece is called up and auctioned individually, in sequential order, according to its lot number. Now you have the opportunity to join others in live bidding for each piece in the virtual auction hall. When the bidding starts, you can have your bids increase incrementally or submit new bids and win the auction by clicking on the central button »Bid now«.

How do I have to do for a written participation in the eLive Auction? In this special eLive Auction you can send us your instructions as usual in a normal auction. Please send us your bids as early as possible. If we receive your instructions only shortly before the eLive auction, we are not able to ensure the processing in due time. The enclosed form should make it simple for you to submit a written bid. You may send your bids by mail, fax or e-mail. If you are a new customer who has not yet purchased from us, we do request references. Please name a coin dealer with whom you have already done business. Customer Service: Phone: +49 (0)541 96 20 20 Fax: +49 (0)541 96 20 222 E-Mail: service@kuenker.de Website: www.kuenker.com Opening Hours: Monday –Thursday 8.30 AM – 5 PM Friday 8 AM – 3.30 PM

What is the cost to attend the eLive Auction? Participation in the eLive Auction is free of charge. All you need is a free myKünker account. If you have bought items in an auction, please remember that your coin is subject to the following costs: On top of the hammer price there is a buyer’s premium in the amount of 10 % of the hammer price. In addition, all prices are always net prices. This means that the total price (including the buyer’s premium) is subject to applicable value-added tax. In shipping the merchandise, we assume a majority of the packing and shipping costs. We calculate your contribution to these costs according to the following schedule: • Shipping within Germany: € 5.90 per parcel, free shipping for order value above € 1,000.– • Shipping within the EU (incl. Switzerland and Norway): € 9.90 per parcel, free shipping for order value above € 2,500.– • Shipping overseas: € 14.90 per parcel, free shipping for order value above € 5,000.–

A trademark of reliability you can count on at Künker: The genuineness of all objects sold is warranted beyond the statutory length of time. Should we still make a mistake in the catalogue description or concerning a condition, you can always count on our goodwill.

6

TEL +49 (0)541 96 20 20, FAX +49 (0)541 96 20 222, SERVICE@KUENKER.DE, WWW.KUENKER.DE


INHALT AUKTION eLive Numismatische Literatur Nr./No. NUMISMATISCHE LITERATUR - AUS DEN BIBLIOTHEKEN EGON BECKENBAUER UND HAUCK & AUFHÄUSER PRIVATBANKIERS, MÜNCHEN u. a. Bibliophile Werke Monographien Allgemeine Numismatik Antike - Allgemein Griechen Römer Kelten Byzanz, Völkerwanderung, Frühmittelalter Neuzeit - Allgemein Balkan, Griechenland, Malta Belgien, Niederlande, Luxemburg Deutschland Frankreich, Monaco Großbritannien, Irland Habsburgische Erlande, Ungarn, Böhmen Italien Polen, Russland, Baltikum Portugal, Spanien Schweiz, Liechtenstein Skandinavien Orient, Islam, Übersee Medaillen, Plaketten Orden und Ehrenzeichen Papiergeld Geschichte - Allgemein, Gemmen und Kameen Festschriften Zeitschriften und Reihen Auktionskataloge

Seite / Page

1

-

1637

9

-

125

1 80 80 99 116 398 543 576 620 639 645 660 893 913 924 959 978 991 998 1012 1021 1061 1154 1167 1169 1207 1236 1278

-

79 1206 98 115 397 542 575 619 638 644 659 892 912 923 958 977 990 997 1011 1020 1060 1153 1166 1168 1206 1235 1277 1637

9 24 24 25 26 42 49 51 54 55 56 57 74

-

Autorenregister Index of authors Tableau des auteurs

126 -

135 Stichwortregister General index Tableau générale

Sammlungsregister Index of collections Tableau des collections

136 -

139 Abkürzungsverzeichnis Index of abbreviations Tableau des abréviations

83 84 86 94

-

96 99 101 104

-

24 98 25 26 42 49 51 54 55 56 57 74 77 77 80 81 82 82 81 84 86 94 96 96 98 100 103 125

140 -

143

77 80 81

144

VERSANDKOSTEN - SHIPPING FEES - EXPÉDITION - SPESE DI SPEDIZIONE Für alle Büchersendungen werden die Versandkosten nach Aufwand in Rechnung gestellt. Shipping fees for all books will be invoiced at cost. Les frais d'expédition des livres seront facturés d'après le prix réel de transport. Le spese di spedizione per i libri saranno applicate in base alle spese d'invio da noi sostenute. 7


4

4

8


BIBLIOPHILE WERKE

07/+5/#6+5%*'.+6'4#674 #75&'0$+$.+16*'-'0')10$'%-'0$#7'470& *#7%-#7(*75'424+8#6$#0-+'45/ª0%*'0WC $+$.+12*+.'9'4-' .

.

.

#/2#%* %. XQP /ÒP\GP WPF /GFCKNNGP5COONWPI  #DVJGKNWPI 2TGWUUGP WPF 5CEJUGP    0CWODWTI5'KPDCPFFGT<GKV4ÒEMGPHGJNVCDGTHGUVIGDWPFGP&GEMGNDGUEJ·FKIV-) 4KVVGT XQP 5%*7.6*'554'%*$'4) 6JCNGT-CDKPGVV $GUEJTGKDWPI CNNGT DGMCPPV IGYQTFGPGP   6JCNGTFGT2·RUVGWPF'T\DKUEJÌHG9KGP$NN5+P1TKIKPCN8GTNCIUDTQUEJWTPQEJWPCWH IGUEJPKVVGP  



#010;/ %JWT WPF (ÒTUVNKEJGT 5·EJUKUEJGT *GNFGP5CCN 1FGT MWT\G  LGFQEJ CWUHÒJTNKEJG $G   UEJTGKDWPIGP FGT #PMWPHHV  #WHPCJOG  (QTVRHNCP\WPI WPF XQTPGJOUVGT )GUEJKEJVGP &KGUGU   *QEJNÌDNKEJGP*CWUGUUCOVFGUUGP)GPGCNQIKG9CRRGPWPF-WRHHGTDKNFPKUUGP#WHNCIG0ÒTP DGTI ,QJCPP *QHOCPP  (TQPVKURK\ 5FCXQPGKPKIGVGKNUMQNQTKGTVG6HP#PJCPI4GIKUVGT u <GKVIGPÌUUKUEJGT )CP\RGTICOGPVGKPDCPF )CP\TQVUEJPKVV (TQPVKURK\ OKPKOCN DGUEJ·FKIV $WEJ   DNQEMNGKEJVIGNQEMGTV



#WUGTNGUGPG5COONWPIXQPCNNGTJCPFCNVGPWPFTCTGP5RGEKGU6JCNGTPOGJTGPVJGKNU)GF·EJVPKU/ÒP\GP WPF 5EJCW2HGPPKIGP *CODWTI   5  6HP u 2CRRDCPF FGT <GKV 'VYCU DGUVQ­GP GKPG   5GKVGTGUVCWTKGTV/KVMNGKPGO9CUUGTTCPF#



4

.

/QPPQKGUGPCTIGPVSWKEQORQUGPVWPGFGUFKHHGTGPVGURCTVKGUFW%CDKPGV+ORGTKCNFGRWKUNGURNWUITCP FGU RKGEGU  LWUSWyCW HNQTKP KPENWUKXGOGPV 0QWXGNNG 'FKVKQP EQTTTKI¾G GV EQPUKFGTCDNGOGPV CWIOGPV¾G   *CWRV WPF 5WRRNGOGPVDCPF 9KGP ,GCP 6JQOCU 6TCVVPGT  (TQPVKURK\  6HP 5WRRNG   OGPV6HP'KPIGNGIVGUJCPFUEJTKHVNKEJGU4GIKUVGTDNCVV)TQ­HQNKQ2TCEJVXQNNGT)CP\NGFGTGKPDCPFOKV $ÒPFGPOKV)QNFXGT\KGTWPIGPWPF6GKNIQNFUEJPKVVGVYCUDGUVQ­GP/QPPQKGUGPQTSWKEQORQUGPV WPG FGU FKHHGTGPVGU RCTVKGU FW ECDKPGV FG 5/ Ny'ORGTGWT FGRWKU NGU RNWU ITCPFGU RKGEGU LWUSWy CWZ   RNWU RGVKVGU *CWRV WPF 5WRRNGOGPVDCPF 9KGP ,GCP 6JQOCU 6TCVVPGT   6HP  6HP   )TQ­HQNKQ/QFGTPGT)CP\NGFGTGKPDCPFOKVCWHIGMNGDVGO4ÒEMGPUEJKNF6CFGNNQUGTJCNVGP.KRUKWU5   2TCEJVXQNNG9GTMGXQPFGPGPPWT'ZGORNCTGIGFTWEMVWPFFCXQPXGTUEJGPMVYWTFGP

 9


BIBLIOPHILE WERKE

.

'TÌHPGVGU )GJGKOPWU FGT RTCEVKUEJGP /ÒP\9KUUGPUEJCHV UCOV DG[IGHÒIVGT 6CTKHHC ÒDGT )QNF WPF   5KNDGT0ÒTPDGTI#FCO,QPCVJCP(GN­GEMGTU'TDGP5FCXQP(CNVVCDGNNG(CNVVHP #010;/6CTKHHCÒDGTFGPHGKPGP)GJCNVFGU)QNFGUWPF5KNDGTUPCEJ-CTCVWPF)T·PFCPP.QVJWPF )T·P1JPG1TV<CJNTGKEJG6CDGNNGPu<GKVIGPÌUUKUEJGU)CP\RGTICOGPVMNGKPG0QVK\RTCEJV XQNNG'TJCNVWPI



&KG6CHGNP\GKIGP-WRHGTUVKEJG\WT/ÒP\JGTUVGNNWPI

.

)GUEJKEJVO·­KIG $GUEJTGKDWPI FGT .CPFIT·HNKEJ*G­KUEJGP )CP\GP WPF *CNDGP 6JCNGT YKG CWEJ   GKPKIGT&GPEM/ÒP\GP4GIGPUDWTI5OKV#DD2CRRDCPF9GPKIG$NGKUVKHVCPUVTGKEJWP IGPUQPUVVCFGNNQUGTJCNVGP



7

.

.

.

#22'. , ,QUGRJ #RRGNU /ÒP\WPF /GFCKNNGP 5COONWPI XQP KJO UGNDUV PCEJ UGKPGO GKIGPGP   PGWGP5[UVGOGIGQTFPGVWPFDGUEJTKGDGP$CPF#DVJGKNWPI9KGP:++55 556HP(TQPVKURK\*CNDNGFGTOKVIQNFGPGT4ÒEMGPXGT\KGTWPIGVYCUUVQEMHNGEMKI



#RRGNyU4GRGTVQTKWO\WT/ÒP\MWPFGFGU/KVVGNCNVGTUWPFFGTPGWGTGP<GKV$CPFKP$·PFGPMQO RNGVV2GUVJ9KGP::8+56HP/ÒP\GPOGUUGT8+++56HP 5  /ÒP\GPOGUUGT  6HP  5 +8 5   6HP 8+++  5  6HP :++ 5     6HP +P $CPF  ++ #DVJGKNWPI6HPNQUG$CPF ++ + ++ + ++KP GKPJGKVNKEJGO*CNDNGFGTIGDWPFGP$CPF+2CRRDCPFDGUVQ­GP)QNFRT·IWPIUVKOOVPKEJVOKV+PJCNV ÒDGTGKPUVCVVFGUUGPPCEJVT·INKEJGTKEJVKIGJCPFUEJTKHVNKEJG0WOOGTKGTWPI



#RRGNyU4GRGTVQTKWO\WT/ÒP\MWPFGFGU/KVVGNCNVGTUWPFFGTPGWGTGP<GKV$CPFKP$·PFGPMQO RNGVV2GUVJ9KGP::8+56HP/ÒP\GPOGUUGT8+++56HP 5  /ÒP\GPOGUUGT  6HP  5 +8 5   6HP 8+++  5  6HP :++ 5   6HP$CPF ++ + ++ + ++4GUVCWTKGTVKP)CP\NGFGTIGDWPFGPOKV&GEMGN UEJNKG­G FGHGMV $CPF+KO1TKI)CP\NGFGT4ÒEMGPNQUGDGUVQ­GP&WTEJUEJQUUGPG'ZGORNCTGOKV XKGNGPJCPFUEJTKHVNKEJGP#POGTMWPIGP



*QEJKPVGTGUUCPVGU&QMWOGPV$GUKV\GTUVGORGNKO8QTUCV\

10


BIBLIOPHILE WERKE

10

.

.

.

$#7'4 ) )GQTIG $CWGTU #WUGTNGUGPG WPF PÒV\NKEJG 0GWKIMGKVGP HÒT CNNG /ÒP\NKGDJCDGT /KV -WR   HGTP WPF GKPGO *CWRVTGIKUVGT ÒDGT CNNG \YCP\KI 5VÒEMG 0ÒTPDGTI ,QJCPP 'DGTJCTF <GJ    555OKVGKPKIGP6GZVCDDWPF6HPu+P$·PFGPKP)CP\NGFGTOKV$ÒP FGPIGDWPFGP)CP\TQVUEJPKVV'KPD·PFGOKV)GDTCWEJUURWTGPGKPKIG5GKVGPUVQEMHNGEMKI.KRUKWU5

 



$'06+0%-%5FG%CVCNQIWGF WPGEQNNGEVKQPFGOGFCKNNGUCPVKSWGU(CKVGRCTNC%QOVGUUGFQWCKTFG $GPVKPEMP¾GEQOKVGUUG& #NFGPDWTI&COGFG8CTGN-PKGRJCWUGPGV&QQTYGTVJ$CPF#OUVGTFCO 5u<GKVIGPÌUUKUEJGT)CP\NGFGTGKPDCPFKP$ÒPFGP)CP\IQNFUEJPKVVGVYCUDGUVQ ­GPWPFOKVYGPKIGP)GDTCWEJUURWTGPCPUQPUVGPUGJTIWVGTJCNVGP



$'4)#0GY/ÒPV\DWGEJFCTKPPGPCNNGTNG[ITQ­WPPFMNGKPG5KNDGTPGWPF)WNFGPG5QTVGP0GW FTWEM0GWYKGFFGT#WUICDGXQP$NNFQRRGNUGKVKIG6HPOKV\CJNTGKEJGP8KIPGVVGPKO 6GZV#PJCPI$NN-N(QNKQ-CTVQPGKPDCPFOKV.GKPGPRT·IWPI

 11


BIBLIOPHILE WERKE

13

.

$+4#)+(/+ORGTCVQTWO4QOCPQTWO0WOKUOCVCC2QORGLQ/CIPQCF*GTCENKWO/CKNCPF 'KPKIG $NN  ITQ­HQTOCVKIGT -WRHGTUVKEJ  5 +PFGZ  5 OKV \CJNTGKEJGP #DD (QNKQ /QFGTPGT   2GTICOGPV FGT <GKV 6KVGNUGKVGP WPF GKPKIG 5GKVGP KO 6GZV GVYCU DGUEJOWV\V CPUQPUVGP KP VCFGNNQUGO   <WUVCPF#



14

.

$+<162  *KUVQKTGOGVCNNKSWGFGNC4GRWDNKSWGFG*QNNCPFG2CTKU&CPKGN*QTVJGOGNU  6KVGNMWRHGT :++   5 OKV \CJNTGKEJGP #DD WPF 6HP (QNKQ <GKVIGPÌUUKUEJGT )CP\NGFGTGKP   DCPFOKV$ÒPFGPWPFIQNFGPGT&GEMGNRT·IWPIGVYCUDGUVQ­GP4ÒEMGPNGKEJVDGUEJ·FKIV&GMGUGN$ //#) /KV'ZNKDTKU%9)80KO8QTUCV\

12




BIBLIOPHILE WERKE .

*KUVQKTG/GVCNNKSWGFGNC4GRWDNKSWGFG*QNNCPFG$·PFG0QWXGNNG'FKVKQPWPF5WRRNGOGPV#OUVGT FCO 2KGTTG /QTVKGT  (TQPVKURK\ 8+++   5 \CJNTGKEJG /ÒP\CDD WPF -WRHGTVHP KO   6GZV(TQPVKURK\ +8  5 5 5 OKV\CJNTGKEJGP/ÒP\CDDWPF-WRHGTVHPu'KPJGKVNK EJGT)CP\NGFGTGKPDCPFFGT<GKVOKV$ÒPFGPIQNFGPG4ÒEMGPXGT\KGTWPI<YKUEJGPHCN\GPGVYCUGKPIG TKUUGP  



16

.

$4'00'4'  6JGUCWTWUPWOOQTWO5WGQ)QVJKEQTWOUVWFKQKPFGHGUUQ'NKCG$TGPPGTK . CPPQTWO URCVKQ EQNNGEVWU  CEEGUUKV GLWUFGO CWEVQTKU .KDGNNWU FG PWOOQRJ[NCEKKU 5WGEKCG &G   UETKRVQTKDWU TGK PWOOCTKCG 5WGVJKECG 5VQEMJQNO  (TQPVKURK\ -WRHGTUVKEJ  $N  5    6HPWPF\CJNTGKEJG#DDKO6GZV)CP\NGFGTOKVIQNFGPGT4ÒEMGPXGT\KGTWPI



2TCEJVXQNNGTWPFUGJTUGNVGPGT$CPFOKV\CJNTGKEJGP#DDKNFWPIGPXQPUEJYGFKUEJGP/ÒP\GPWPF/GFCKNNGP

.

$4ª))'/#00 *TUI &GPMOÒP\GP\WT)GUEJKEJVGUGKPGT/CLGUV·VFGU-ÌPKIUXQP2TGWUUGP(TKGF TKEJ9KNJGNO+++$GTNKP8+++56HPu*CNDNGFGTDGUVQ­GP4ÒEMGPGKPIGTKUUGP5VQEM HNGEMKI#



.

%#8'&10+%4CIIWCINKQUVQTKEQCTEJGQNQIKEQF¾RTGEKRWKTKRQUVKINK#PVKEJKFGOGFCINKGEQPUQNCTKG FKHCOKINKGTQOCPGF CTIGPVQ/QFGPC5*CNDNGKPGP4ÒEMGPNGKEJVDGUEJ·FKIV



.

&#4+'4*6CDNGCWFW6KVTG2QKFUGV8CNGWTFGUFKHH¾TGPVGU/QPPCKGUFyQTGVFyCTIGPVSWKEKTEW NGPVFCPUNG%QOGTG#XGE'ORTGKPVGU)GPH6KVGNMWRHGT56HPu<GKVIGPÌUUKUEJGT *CNDNGFGTGKPDCPF9CUUGTTCPFCWHFGP6CHGNPDGUVQ­GP<YKUEJGPHCN\GPWPF4ÒEMGPDGUEJ·FKIV



&1'&'4.+0 ,# %QOOGPVCVKQ *KUVQTKEC FG 0WOKU )GTOCPKCG /GFKCG SWQU XWNIQ DTCEVGCVQU GV   ECXQU0ÒTPDGTI,WN#TPQNF'PIGNDTGEJV9/'PFVGTK(KNKCU5(CNVVHPu$TQUEJKGTV XGTDNCUUVGT)CP\TQVUEJPKVV5GKVGPKPVCFGNNQUGO<WUVCPF#



'%-*'.,-WT\IGHC­VG7OHCPIUITÒPFG\WTCNVGP0WOKUOCVKM9KGP$NN56HCNU -QRKGDGKNKGIGPF)Tu0GWDTQUEJKGTV5GKVGPT·PFGTOKVUVCTMGP)GDTCWEJUURWTGP'KPDCPFCWUIGDNK EJGP5WHCNUEJPWOOGTKGTV



.

.

13


BIBLIOPHILE WERKE

22

.

'NGOGPVC 4GK 0WOCTKCG 8GVGTWO 5KXG ,QUGRJK 'EMJGNKK 2TQNGIQOGPC &QEVTKPCG 0WOQTWO 9GKIGN   56HP%)(4#%%+##PVKEJG/QPGVG5KEKNKCPGKPGFKVGQRGT3WCNUKGUK2CTVKEQNCTKVC¯ 0WQXGFGN4GCN/WUGQFK2CNGTOQ1156&B#00'%+0QVKEGUWTWPG/¾FCKNNGFG2JKN KRRG/CTKG8KUEQPVKFWEFG/KNCP2CTKU56HP'38+5%106+.GVVGTCUW&BWP#PVKEQ 2KQODQ 8GNKVGTPQ UETKVVC #NNB'OKPGPVKUUKOQ G 4GXGTGPFKUUKOQ 2TKPEKRGOKN 5KIPQT %CTFKPCNG 5VGHCPQ   $QTIKC4QO5#(7.)10+.GVVGTCUWFWG/QPWOGPVKPGB3WCNKGB/GOQTKC&B#PVQPKC #WIWUVC 4QO Q,  5  #DD ( +/*11($.7/'4 /QPPCKGU )TGESWGU +VCNKG GV 5KEKNG #O   UVGTFCO56HP))4+%%+1.G/QPGVGFGNNG#PVKEJGHCOKINKGFK4QOCHKPQCNNQ+ORG TCVQTG #WIWUVQ  #WHNCIG 0CRQNK   5  5 /4 4#17.41%*'66' 5WRRN¾OGPV ± NC   0QVKEGUWT3WGNSWGU/¾FCKNNGU)TGESWGUKP¾FKVGUFG4QKUFGNC$CEVTKCPGGVFG.BKPFG11 56HP1*0'#76145WRRN¾OGPV±NC5WKVGFGU/¾FCKNNGUFGU4QKUFGNC$CEVTKCPG5V2¾VGTU DQWTI56H+PGKPGO$CPFIGDWPFGP*CNDNGKPGP$KPFWPIGVYCUNQEMGTWPFGKPKIG5GKVGP GVYCUDGUEJ·FKIVWPFUVQEMHNGEMKI/CPEJG5GKVGPNQUG/KV#POGTMWPIGPKO6GZV



('4%*'.(/$GUEJTGKDWPIXQPUGEJUJWPFGTVCPVKMGPTÌOKUEJGP/ÒP\GPYGNEJGUGKV,CJTGPKP $C[GTP IGHWPFGP YWTFGP /KV #PICDG FGT (WPFQTVG /ÒPEJGP   5 $TQUEJKGTV 'EMGP WOIG   MPKEMV(NGEMGPCWHFGP5



/KVJCPFUEJTKHVNKEJGP$GUKV\GTXGTOGTM)5EJOKFV

.

/KV$GUKV\GTUVGORGNXQO*KUVQT8GTGKPXQPWPFHÒT1DGTDC[GTP

24

.

(+0#7'422$CLGTKUEJG/ÒP\DGNWUVKIWPI'TUVGU(CEJ=CNNGGTUEJKGPGPGP?/ÒPEJGP/GJTGTG $NN56HPu*CNDRGTICOGPVGVYCUDGUVQ­GPWPFUVQEMHNGEMKI#



.

(.'0&'4,*&KURWVCVKQKPCWIWTCNKULWTKFKECFGTGOQPGVCTKCSWCO5WD%CGNGUVK2TCGUKFKQ'Z/C IPKHKEC#ORNK­KOG(CEWNVCVKU,WTKFKEC&GETGVQ+P+NNWUVTK*CUUQ)KGUUGPC7PKXGTUKVCVG)KG­GP*GP PKPI/ÒNNGT5&GMGUGN(.KRUKWU5,-+6<'.++6TCEVCVWURQUVJWOWUFGKWTG/Q PGVCTWOEWO0QVKU#PVKPKK(TGWPFGDGTI/CTDWTI%CURCT%JGONKP54GIKUVGT.KRUKWU5  )# (4'70&'$'4) &GUETKRVKU OQTCVQTKKU UGW KPFWEKKU /CTDWTI %CURCT %JGONKP    GKPKIGWPRCIKPKGTVG5GKVGP54GIKUVGT&C\WYGKVGTG#WHU·V\Gu+PGKPGO$CPFKP\GKVIGPÌUUK UEJGO )CP\RGTICOGPV IGDWPFGP JCPFUEJTKHVNKEJGU +PJCNVUXGT\GKEJPKU KO 8QTUCV\ 'KPDCPF NGKEJV DG   UEJ·FKIV



14


BIBLIOPHILE WERKE

26

.

=)1&100'5%*'0?/GFCKNNGUFW4½IPGFG.QWKU:82CTKUQ,(TQPVKURK\6KVGNMWRHGT6HP u *CNDNGFGTGKPDCPF FGT <GKV OKV  $ÒPFGP )CP\TQVUEJPKVV OKPKOCN DGUVQ­GP WPF DGTKGDGP 4ÒEMGP   QDGPIGTKPIHÒIKIDGUEJ·FKIVGKPKIG6CHGNPNGKEJVIGDT·WPV.KRUKWU5



+PFKGUGO9GTMUKPFCNNG/GFCKNNGP\W'JTGP.WFYKIU:8DKU\WO,CJTKPHGKPGP-WRHGTUVKEJGPCDIGDKNFGV

.

)¤6<%,&GT$G[VT·IG\WO)TQUEJGP%CDKPGV6GKN&TGUFGP555 6HP#PUVTGKEJWPIGPWPF#POGTMWPIGPKO6GZV2CRRDCPFDGUVQ­GP  



/KVJCPFUEJTKHNKEJGO$GUKV\GTXGTOGTM

.

.

)4#'8+75,).#PPGCWU(NQTWU4GEGPUKVWUKNNWUVTCVWU7VTGEJV#RWF,QJCPPGO4KDDKWO  $NN  5 OKV ICP\UGKVKIGO 6GZVMWRHGTP &WTEJ $KPFGHGJNGT HGJNGP  5GKVGP FCHÒT  5 FQRRGNV   #PKOCFXGTUKQPGUKP.#PPCGK(NQTK5$NNWPF5+PFGZ(CNVVH)CP\NGFGTGKPDCPFFGT<GKV KP$ÒPFGP'EMGPDGUVQ­GPCPUQPUVGPUGJTUCWDGTGUWPFUGNVGPGU'ZGORNCT



)ª66*'4%*5CN\DWTIGT'OKITCPVGP9QEJGPVNKEJG-ÌPKIUGTIKUEJG(TCIGWPF#P\GKIWPIU0CEJ TKEJVGP 0Q  XQO  /CLK  OKV GKPGT $GUEJTGKDWPI FGT /GFCKNNGP WPF /ÒP\GP UQ CWH FGP   #WUICPIFGT2TQVGUVCPVGPCWU5CN\DWTIIGRT·IGVYQTFGPWPFCWHJKGUKIGT*QEJIT·HNKEJXQP9CN NGPTQFVUEJGP$KDNKQVJGMDGHKPFNKEJUKPF5KGDGPUGKVKIGT$GTKEJV$TQUEJWTFGT<GKV



30

.

*#)'0 ,)( XQP %QPXGPVKQPU/ÒP\ECDKPGV QFGT $GUEJTGKDWPI FGT 6JCNGT )WNFGP WPF MNGKPGTP   5KNDGTOÒP\GP YGNEJG PCEJ FGO  GTTKEJVGVGP %QPXGPVKQPUOÒP\HW­ DKUJGTQ IGRT·IV YQTFGP 0ÒTP   DGTI/GJTGTG$NN5(CNVVHP/CPEJOCNGVYCUHNGEMKI*CNDRGTICOGPV-CPVGPWPF'EMGP DGUVQ­GP

 15


BIBLIOPHILE WERKE

31

.

*'..'4 , 5EJCTPCIGNyU /ÒP\UCOONWPI KP $CODGTI YGNEJG FCUGNDUV XQO  DKU5GRVF,U XGTUVGKIGTV YKTF $CODGTI  :+8  5 2CRRDCPF &WTEJUEJQUUGPGU 'ZGORNCT 'KPG 5GKVG OKV   $NGKUVKHVPQVK\GP



5GJTUGNVGP

32

.

*+45%* ,% &GU 6GWVUEJGP 4GKEJU /ÒP\#TEJKX $GUVGJGPF KP GKPGT 5COONWPI -C[UGTN WPF   4GKEJU/ÒP\)GUGV\G1TFPWPIGP 2TKXKNGIKGP ÒDGT FCU /ÒP\4GEJV -C[UGTN 4GUETKRVGP   $·PFG   0ÒTPDGTI5(CNVVCDGNNGPOGJTGTG6GZV8KIP *QN\UVKEJG <GKVIGPÌUUKUEJG.GFGT GKPD·PFGOKVIQNFGPGT4ÒEMGPDGUEJTKHVWPIWPFXGT\KGTWPIUQYKG$ÒPFGP4QVUEJPKVV'KPD·PFGGVYCU DGUVQ­GP-QORNGVVGT5CV\KPVCFGNNQUGT'TJCNVWPI  *KTUEJyU &GU 6GWVUEJGP 4GKEJU /ÒP\#TEJKX DKNFGV FKG WOHCUUGPFUVG WPF YKEJVKIUVG \GKVIGPÌUUKUEJG <WUCOOGP   UVGNNWPICNNGT4GKEJUWPF6GTTKVQTKCNIGUGV\GFCU)GNFWPF/ÒP\YGUGPDGVTGHHGPF&CDGKHCPFGPUQYQJNFCUÌUVGT TGKEJKUEJG CNU CWEJ FCU UEJYGK\GTKUEJG /ÒP\YGUGP CWUHÒJTNKEJG $GCEJVWPI 9KT UKPF UVQN\ FKGUGU KP UGKPGT 8QNN   UV·PFKIMGKV KPMN4GIKUVGTDCPF+: WPF3WCNKV·VPWTUGJTUGNVGPCPIGDQVGPG9GTMQHHGTKGTGP\WMÌPPGP  

/KV'ZNKDTK(:#FG5VWDGPTCWEJWPFJCPFUEJTKHVNKEJGP$GUKV\GTXGTOGTM

.

16

,1#%*+/ ,(   0GWGTÌHHPGVGU )TQUEJGP%CDKPGV (CEJ  .GKR\KI )TQ­    (CEJKPFTGK$·PFGPKP*CNDNGFGTIGDWPFGP4ÒEMGPGVYCUDGUEJ·FKIV6KVGNDNCVVXQP$CPF GVYCU GKPIGTKUUGP GKPKIG 0QVK\GP WPF KP $CPF  JCPFUEJTKHVNKEJGU 4GIKUVGT (CEJ  WPF  KP FTGK   $·PFGP 6GZV Z WPF6CHGNP Z KP)CP\NGKPGPIGDWPFGP 




BIBLIOPHILE WERKE

34

.

7PVGTTKEJVXQPFGO/ÒP\YGUGPYQTKPPGPUQYQNFGT<WUVCPFWPF$GUEJCHHGPJGKVFGT/ÒP\GP$GKFGP ,ÒFGP)TKGEJGPWPF4ÌOGTPCNUCWEJFKG'KPTKEJVWPIFGU/ÒP\YGUGPUKPFGPXQTPGJOGPGWTQR·KUEJGP .·PFGTPXQTIGUVGNNVYKTF*CNNG5*CNDRGTICOGPVOKPKOCNDGUVQ­GP#



/KVOGJTGTGP$GUKV\GTUVGORGNPWPFJCPFUEJTKHVNKEJGP$GUKV\GTXGTOGTMGP\$$G[UEJNCIKUEJG$KDNKQVJGM

.

.

.

&CU PGW GTÌHPGVG /ÒP\ECDKPGV FCTKPPGP OGTMYÒTFKIG WPF XKGNG DKUJGTQ PQEJ PKTIGPFU OKVIGVJGKNVG   )QNF WPF 5KNDGTOÒP\GP \W HKPFGP FKG TKEJVKI KP -WRHGT CDIGDKNFGV DGUEJTKGDGP WPFGTN·WVGTVYGTFGP XQP&,QJCPP(TKGFTKEJ,QCEJKO$F0ÒTPDGTI)GQTI$CWGT(TQPVKURK\56HP$F 0ÒTPDGTI)GQTI$CWGT(TQPVKURK\56HP$F0ÒTPDGTI,QJCPP'DGTJCTF<GJ (TQPVKURK\55VCOOVH6HP$F,24'+0*#4&  0ÒTPDGTI,QJCPP 'DGTJCTF<GJ56HPFCXQP(CNVVH4GIKUVGT5u+P\YGK$·PFGPKPTGUVCWTKGT VGO)CP\NGFGTIGDWPFGP)CP\TQVUEJPKVV4ÒEMGPOKV)QNFXGT\KGTWPIGPGVYCUUVQEMHNGEMKI.KRUKWU5   



=-.'+05%*/+&6%.?5COONWPIHÒTUVNKEJJGUUKUEJGT.CPFGU1TFPWPIGPWPF#WUUEJTGKDGPPGDUV FCJKP IGJÌTKIGP 'TN·WVGTWPIUWPF CPFGTGP 4GUETKRVGP 4GUQNWVKQPGP #DUEJKGFGP IGOGKPGP $GUEJGK   FGPWPFFGTINGKEJGP6GKNXQP<GKVGPFGT4GIKGTWPI*GTTP.CPFITCHGP*GPTKEJU++DKUCPFCU'PFG FGT4GIKGTWPI*GTTP.CPFITCHGP/QTKV\GPUXQO,CJTDKUKPFCU,CJT-CUUGN,QJCPP0KEQNCWU 5GKDGTVQ,(TQPVKURK\OGJTGTG$NN54GIKUVGT5u/QFGTPGT)CP\NGFGTGKPDCPF)CP\ TQVUEJPKVV 9CUUGTUEJCFGP DGUQPFGTU CWH FGP GTUVGP WPF NGV\VGP 5GKVGP VGKNU TGUVCWTKGTV (TQPVKURK\ PGW   GKPIGMNGDV



-¤*.'4 ,&   *KUVQTKUEJG /ÒP\$GNWUVKIWPIGP 6GKN  WPF 4GIKUVGT 6GKN  WPF    0ÒTPDGTI %JTKUVQRJ 9GKIGN 9KVVYG WPF 'TDGP   u 'KPJGKVNKEJ KP  UEJÌPGP   )CP\RGTICOGPVGKPD·PFGP FGT <GKV OKV IQNFGPGT &GEMGNRT·IWPI WPF IQNFGPGT 4ÒEMGPDGUEJTKHVWPI   )CP\DNCWUEJPKVV$CPFOKV9CUUGTUEJCFGPWPFGPVHGTPVGT&GEMGNRT·IWPI$CPFOKVNGKEJVGO9CU UGTTCPFCWHFGPNGV\VGP5GKVGPCPUQPUVGPJGTXQTTCIGPFG'TJCNVWPI.KRUKWU5    8QNNUV·PFKIG#WUICDGFKGUGUJGTXQTTCIGPFGTJCNVGPGPWPFUGNVGPGP9GTMGU

.

*KUVQTKUEJG /ÒP\$GNWUVKIWPI &CTKPPGP CNNGTJCPF OGTMYÒTFKIG WPF TCTG 6JCNGT &WECVGP 5EJCWUVÒE   MGP WPF CPFGTG UQPFGTDCTG )QNF WPF 5KNDGT /ÒP\GP XQP OCPEJGTNG[ #NVGT \WUCOOGP .:+ 5VÒEMG   #EEWTCV KP -WRHGT IGUVQEJGP DGUEJTKGDGP WPF CWU FGT *KUVQTKG WOUV·PFNKEJ GTMN·TGV YGTFGP $CPF +   :+++ :8::++  4GIKUVGT 0ÒTPDGTI  7PVGTUEJKGFNKEJ IGDWPFGP VGKNYGKUG GVYCU DGUVQ­GP   WPF YGPKIG 'ZGORNCTG OKV MNGKPGO 9CUUGTTCPF XGTUEJKGFGPG 'Z NKDTK WPF $GUKV\GTUVGORGN $CPF    GVYCUYCUUGTHNGEMKI$CPFWPFUQYKG$CPFWPFKPGKPGO$WPFIGDWPFGP+PJCNVVCFGNNQUWPF VTQV\FGUHGJNGPFGP$CPFGUKPFKGUGT8QNNUV·PFKIMGKVIGUWEJV   

.

*KUVQTKUEJG/ÒP\$GNWUVKIWPIGP6GKN0ÒTPDGTI%JTKUVQRJ9GKIGN9KVVYGWPF'TDGP (TQPVKURK\5OKVGKPKIGP6GZVCDD:::++5OKVGKPKIGP#DD5OKVGKPKIGP#DD:. 5LGYGKNUOKV4GIKUVGT'KPJGKVNKEJKP)CP\RGTICOGPVFGT<GKVIGDWPFGPWPF6GKNKPGKPGP $CPFKP)CP\NGFGTFGT<GKVIGDWPFGP:::++54GIKUVGTOKVGKPKIGP#DD8+++54GIK UVGTOKVGKPKIGP#DD$WEJFGEMGNNQUGDGUVQ­GP  



/KVJCPFUEJTKHVNKEJGO$GUKV\GTXGTOGTM

17


BIBLIOPHILE WERKE

.

.

.

8QNNUV·PFKIGU &WECVGP%CDKPGV *CPPQXGT 'TDGP FGU 0KEQN (ÌTUVGT WPF 5QJP  <CJNTGKEJG   $NN5$NN54GIKUVGT-Nu2CRRD·PFGGVYCUDGUVQ­GP+PJCNVVCFGNNQU&C\W ,% XQP 5116*' #WUGTNGUGPGU WPF JÌEJUV CPUGJPNKEJGU &WECVGPECDKPGV 0GWFTWEM $QPP  FGT   #WUICDG*CODWTI:+5=/KV$GUKV\GTUVGORGN&T(:9GK\KPIGT%Q?*CNDNGKPGPNGKEJV DGUVQ­GP  



-70&/#00 ,% 0WOOK 5KPIWNCTGUQFGT5QPFGTDCTG6JCNGTWPF/ÒPV\GP$TG­NCW.GKR\KI DG[ /KEJCGN *WDGTV  5  $NN  -WRHGTVHP 2CRRDCPF FGT <GKV $WEJFGEMGN WPF 5GKVGP NQUG   DGUVQ­GP.KRUKWU5



-70<%5GEQPFQ%CVCNQIQFK1IIGVVKFK0WOKUOCVKECXGPFKDKNK2TGUUQ/QPGVG$K\CPVKPGOQPGVGFK RTKPEKRKQEEKFGPVCNKKP1TKGPVGGE8GPG\KC56HP#51'6$''4$GKVT·IG\WT)GUEJKEJVG FGU )GNF WPF /ÒP\YGUGPU KP &GWVUEJNCPF  WPF  #DUEJPKVV 11 WPF Q, 5  %.   )416'('0&&KG/ÒP\GPFGTITKGEJKUEJGPRCTVJKUEJGPWPFKPFQUM[VJKUEJGP-ÌPKIGXQP$CMVTKGPWPF FGP.·PFGTPCO+PFWU*CPPQXGT56HP7*1'2.+.KDTCKTKG#PEKGPPG%CVCNQIWG0 /KNCP5OKV0TP=/KV$GUKV\GTUVGORGN#$WEJJQN\?+PGKPGO$CPFKP*CNDNGKPGP IGDWPFGPOKPKOCNDGUVQ­GP



43

.

.'55'4 (% $GUQPFGTG /ÒP\GP YGNEJG UQYQJN CWH IGNGJTVG )GUGNNUEJCHVGP CNU CWEJ CWH IGNGJTVG   .GWVG UQPFGTNKEJ CWH & /CTVKP .WVJGTP PCEJ ,WPMGTU JGTCWUIGIGDGPGO 'JTGP)GF·EJVPKU FGUUGNDGP   IGRT·IV YQTFGP (TCPMHWTV.GKR\KI /KEJCGN $NQEJDGTIGT   5  5  -WRHGTVHP -N u   2CRRDCPFFGT<GKV4ÒEMGPHGJNVDGUVQ­GP+PJCNVVCFGNNQU#



.+'$'%5&KCVTKDGFGRUGWFQP[OKC,Q%CNXKP+PCSWCKKUSWCG2GVTWU$CGNKWU$CKNNGVWU#OUVGTFCO  CRWF 9GVUVGPKQU  $N  5 2TQFTQOK TGHQTOCVKQPKU RKC OGOQTKC TGEQNGPFCG UKXG 0WOOK   .WFQXKEK:++TGIKUICNNQTWO.GKR\KICRWF,Q%JTKUV/CTVKPK$NN5%CTOKPC,WXGPKNKC FKXGTUKUVGORQTKDWUGNCDQTCVCGVEQNNGEVCC%5..GKR\KIWO5+PGKPGO$CPFKP)CP\NGFGT FGT <GKV IGDWPFGP OKPKOCN DGUVQ­GP 5GKVGP NGKEJV IGDT·WPV CPUQPUVGP UGJT IWV GTJCNVGPGU 'ZGORNCT   FKGUGUUGNVGPGP9GTMGU



.+25+75 ,) $KDNKQVJGEC PWOCTKC UKXG %CVCNQIWU CWEVQTWO SWK WUSWG CF HKPGO UGEWNK :8+++ FG TG   OQPGVCTKCCWVPWOKUUETKRUGTWPV6QOWU+ ++5::5$GKIGDWPFGP,.GKV\OCPP$KDNKQ VJGECPWOCTKC8GT\GKEJPKUUU·OOVNKEJGTKPFGO<GKVTCWOGDKUGTUEJKGPGPGP5EJTKHVGPÒDGT /ÒP\MWPFG9GKUUGPUGG+85$GKIGNGIVUGKVKIGJCPFUEJTKHVNKEJG#WHNKUVWPI\WPWOKUOCVK UEJGP<GKVUEJTKHVGP+PGKPGP$CPFKP*CNDNGKPGPIGDWPFGP



/KVGZNKDTKUKO8QTUCV\

.

.

/KV$GUKV\GTUVGORGN6JGQF9KNOGTUFQGTHHGTKO8QTUCV\

18


BIBLIOPHILE WERKE

46

.

.1%*0'4,*  5COONWPIOGTMYÒTFKIGT/GFCKNNGP'TUVGUDKUCEJVGU,CJT+PYGNEJGT YÌEJGPVNKEJGKPEWTKÌUGU)GRT·IOGKUVGPUXQPOQFGTPGP/GFCKNNGPCWUIGUWEJGVWPFPKEJVPWTHNGKUKI KP -WRHGT XQTIGUVGNNGV UQPFGTP CWEJ FWTEJ GKPG JKUVQTKUEJG 'TN·WVGTWPIJKPN·PINKEJGTMN·TGVPWPCDGT UQ YQN OKV XQNNUV·PFKIGP 4GIKUVGTP CP FCU .KEJV IGIGDGP YQTFGP 0ÒTPDGTI 2GVGT %QPTCF /QPCVJ   =?(TQPVKURK\$NN5#DD4GIKUVGT $NN <YG[VGU,CJT(TQPVKURK\$NN 5#DD4GIKUVGT $NN (CNVVH&TKVVGU,CJT(TQPVKURK\$NN5#DD 4GIKUVGT $NN 8KGTVGU,CJT(TQPVKURK\$NN5#DD4GIKUVGT $NN (ÒPHVGU ,CJT(TQPVKURK\$NN5#DD4GIKUVGT $NN 5GEJUVGU,CJT(TQPVKURK\ $NN  5  #DD 4GIKUVGT  $NN  5KGDGPFGU ,CJT  (TQPVKURK\  $NN  5  #DD   4GIKUVGT  $NN  #EJVGU ,CJT  (TQPVKURK\  $NN  5  #DD 4GIKUVGT  $NN  &C\W   2GTUQPGP5CEJWPF5RTWEJ4GIKUVGT\WU·OVNKEJGPCEJV$·PFGPFGT5COONWPIOGTMYÒTFKIGT/GFCKN NGP$GCTDGKVGVXQP(,CGEMGN&TGUFGP5u&KXGTUG5GKVGPUKPFTGUVCWTKGTVYQTFGP#NNGUKP GKPJGKVNKEJGO *CNDNGFGT OKV IQNFGPGT 4ÒEMGPDGUEJTKHVWPI IGDWPFGP 6CFGNNQUGU 'ZGORNCT +P FKGUGT   3WCNKV·VUGNVGPCPIGDQVGP.KRUKWU5    /KV$GUKV\GTUVGORGNCWHFGO6KVGNDNCVV

47

.

.110 ) XCP   $GUEJT[XKPI FGT 0GFGTNCPFUEJG *KUVQTKGRGPPKPIGP 1H DGMPQRV 8GTJCCN   XCP V IGPG HGFGTV FG 1XGTFTCEJV FGT *GTTUEJCRR[G XCP -G[\GT -CTGN FGP 8[HFGP QR -QPKPI 2JKNKRU   <[PGP <QQP 6QV JGV HNW[GVGP XCP FGP 7[VTGEJVUEJGP 8TGGFG  $·PFG )TCXGPJCCIG %JTKUVKCP XCP   .QO +UCCE 8CKNNCPV 2KGVGT )QUUG WY  'Z NKDTKU 6KVGNMWRHGT  5 4GIKUVGT  5   54GIKUVGT554GIKUVGT554GIKUVGT5LGYGKNUOKV\CJNTGKEJGPYWP FGTUEJÌPGP -WRHGTCDD (QNKQ +P GKPJGKVNKEJGO DÒPFKIGO )CP\NGFGT OKV &GEMGNR·IWPI IGDWPFGP   $CPFOKV$NGKUVKHVPQVK\KO&GEMGN$CPFWPFNGKEJVDGUVQ­GP<YKUEJGPHCN\DGK$CPFDGUEJ·FKIV CPUQPUVGP·W­GTUVRTCEJVXQNNGT5CV\FKGUGUUGNVGPGPWPFYKEJVKIGP9GTMGU.KRUKWU5    /KV$GUKV\GTUVGORGNP

19


BIBLIOPHILE WERKE

48

.

.14+,)XQP   *I 5COONWPIFGUDCKGTKUEJGP/ÒP\TGEJVU$CPF$NN5 $CPF$NN5$CPF$NN5+P$CPFCWHFGPGTUVGP5GKVGP OKVMNGKPGP9CUUGTTCPF*CNDNGFGTDGUVQ­GPGVYCUUVQEMHNGEMKI    5GJTUGNVGP'ZNKDTKU95EJTCV\KP$CPFWPF'ZNKDTKU#5VGTPKP$CPF

.

.

.

/#&#+ &5 8QNNUV·PFKIGU 6JCNGT%CDKPGV $CPF  WPF  /KV CPUGJPNKEJGT 8GTOGJTWPI KP \YG[GP   6JGKNGPJGTCWUIGIGDGPWPFOKVPÌVJKIGP4GIKUVGTPXGTUGJGP$CPF+PEJTQPQNQIKUEJGTWPFIGPGCNQIK UEJGT 1TFPWPI PGDUV PÌVJKIGP 4GIKUVGTP $CPF  &GU XQNNUV·PFKIGP 6JCNGT%CDKPGVU GTUVG \YGKVG WPF   FTKVVG (QTVUGV\WPI -ÌPKIUDGTI <GKUG WPF *CTVWPI  (TQPVKURK\ $NN5(TQPVKURK\ $NN5$NN54GIKUVGT $NN $NN5$NN5$NN5u#WH FKXGTUGP 5GKVGP PQTOCNG MNGKPG (NGEMGP WPF MNGKPG 9CUUGTHNGEMGP 'KPJGKVNKEJ IGDWPFGPGU VCFGNNQUGU   'ZGORNCT*CNDNGFGT.KRUKWU5  



8GT\GKEJPKU FGT CWUGTNGUGPGP WPF JÌEJUVCPUGJPNKEJGP 6JCNGTUCOONWPI FGU \W *CNNG IGUVQTDGPGP *Q   HTCVJU &CXKF 5COWGN XQP /CFCK *CODWTI  6KVGNDNCVV OKV /ÒP\MWRHGT  5  $N 1TKI$TQ   UEJWT\CJNTGKEJGJCPFUEJTKHVNKEJDGKIGUEJTKGDGPG<WUEJNCIURTGKUG



/'4.'XQP$GUEJTGKDWPIFGTMÌNPKUEJGP/ÒP\UCOONWPIFGU&QOJGTTPWPFMWTHÒTUVNKEJYGNVNKEJGP *QHIGTKEJVU2T·UKFGPVGPXQP/GTNG-ÌNP.CPIGPUEJG$WEJJCPFNWPI/GJTGTG$NN52CRR DCPF



52

.

/'0'564+'4%(  &GT$GTÒJOVGP-ÌPKINKEJGP#ECFGOKUVGP\W2CTKU%WTKÌUG5EJCW /ÒPV\GP 8QTUVGNNGPF FKG XQTPGJOUVGP 6JCVGP .WFYKI FGU )TQUUGP =? /GFCKNNGU UWT NGU RTKPEKRCWZ   GXGPGOGPVUFWTGIPGFG.QWKUNG)TCPF=?$CFGP,QJCPP.WFYKI$CNFKPIGT5OKV\CJN TGKEJGP -WRHGTCDD  $NN 4GIKUVGT  u )CP\NGFGT OKV IQNFGPGT 4ÒEMGPXGT\KGTWPI 'VYCU DGUVQ­GP   $NGKUVKHVITCHHKVKKO8QTURCPP+PJCNVKOVCFGNNQUGP<WUVCPF//#) +PFKGUGO$CPFUKPFUQYQJNFKGHTCP\ÌUKUEJGP1TKIKPCNVGZVGCNUCWEJFGTGPFGWVUEJGªDGTUGV\WPIGPVJCNVGP

20




BIBLIOPHILE WERKE .

/+'4+5 ( XCP *KUVQTK FGT 0GFGTNCPUEJG 8QTUVGP  OGV OGGT FCP FWK\GPF *KUVQTKRGPPKPIGP )TC   XGPJCCIG$NN5$NN$NN5$NN$NN5$NN(QNKQ*CND NGFGTFGT<GKV4ÒEMGPDGUVQ­GPWPFVGKNYGKUGTGRCTKGTVGKP&GEMGNNQUGUGNVGPCPIGDQVGPGU'ZGORNCT .KRUKWU5   

.

/104#&+20WOK#PVKSWKGV$[\CPVKPKEK8GTUVGKIGTWPIUGKPGT5COONWPI\W*CODWTI 51TKIIGJGHVGV



.

0'.-'0$4'%*'4 ,% 0QXGCW /CPWGN FGU /QPPCKGU  VTCFWKV RCT ,GCP/CTKG &GUEJCORU    #WHNCIG2CTKU5/CTOQTKGTVGT2CRRDCPFFGT<GKV



(TCP\ÌUKUEJGªDGTUGV\WPIFGUDGTÒJOVGPFV6CUEJGPDWEJGUFGT/ÒP\/C­WPF)GYKEJVUMWPFGHÒT$CPMKGTUWPF -CWHNGWVGOKV\CJNTGKEJGP7OTGEJPWPIUVCDGNNGPWUY 2TCEJVXQNNG'TJCNVWPI

57

56

.

1%%1#  +ORGTCVQTWO4QOCPQTWO0WOKUOCVCC2QORGKQ/CIPQCF*GTCENKWO/CK NCPF)TQ­(QNKQ5OKV/ÒP\CDD(TQPVKURK\)CP\NGFGTGKPDCPFGVYCUDGUVQ­GP



.

2#6+0 %   6JGUCWTWU 0WOKUOCVWO #OUVGTFCO   $NN  5 OKV IGUVQEJGPGP   8KIPGVVGP WPF \CJNTGKEJGP /ÒP\MWRHGTUVKEJGP *CNDRGTICOGPV 'KPDCPF NÌUV UKEJ DGUVQ­GP 5GKVGP KP   VCFGNNQUGO<WUVCPF



'ZNKDTKU#WUFGT$ÒEJGTGKXQP%-ÌJNGT

58

.

6JGUCWTWU0WOKUOCVWO#PVKSWQTWO4GEGPVKQTWOGZ#WTQ#TIGPVQ#GTG#DKNNWUVTK&2GVTQ /CWTQEGPQ5GPCVQTG8GPGVQ#WHNCIG8GPGFKI+Q(TCPEKUEK8CNWCUGPUKU(TQPVKURK\5 OKV#DDu)CP\NGFGTGKPDCPFFGT<GKV$ÒPFGMNGKPGT9CUUGTTCPFCWHGKPKIGP5GKVGP8QTUCV\DNCVV IGNQEMGTV'KPDCPFOKVO·­KIGP)GDTCWEJUURWTGP4ÒEMGPDGUEJ·FKIV&GMGUGN2.KRUKWU5

 21


BIBLIOPHILE WERKE

59

.

.

24#70#5)TÒPFNKEJG0CEJTKEJVXQPFGO/ÒP\YGUGPKPUIGOGKPKPUDGUQPFGTGCDGTXQPFGOVGWV UEJGP/ÒP\YGUGP·NVGTGTWPFPGWGTGT<GKVGPWPFFCPPCWEJXQPFGO(TCP\ÌUKUEJGP5RCPKUEJGP0KG FGTN·PFUEJGP 'PINKUEJGP WPF &·PKUEJGP /ÒP\YGUGP 8GTOGJTV WO FCU 5EJYGFKUEJG 4WUUKUEJG WPF   2QNPKUEJG/ÒP\YGUGP*GNOUV·FV9G[ICPF1TKIKPCNCWUICDGCWUFGO,CJTG::::8+ 5 u 5GJT UEJÌPGT )CP\NGFGTGKPDCPF FGT <GKV OKV  $ÒPFGP WPF IQNFGPGT 4ÒEMGPXGT\KGTWPI GVYCU   DGTKGDGP#



5%*/+'&'4 %% *CPFYÌTVGTDWEJ FGT IGUCOOVGP /ÒP\MWPFG HÒT /ÒP\NKGDJCDGT WPF )GUEJ·HVU   NGWVG0CEJVTCI*CNNG$GTNKP8+++5+85u/KVJCPFUEJTKHVNKEJGP#POGTMWP IGP+PGKPGO$CPFIGDWPFGP)CP\TQVUEJPKVV2CRRDCPFDGUVQ­GP



/KVJCPFUEJTKHVNKEJGP$GUKV\GTXGTOGTMKO8QTUCV\WPF$GUKV\GTUVGORGNCWHFGO6KVGNDNCVV

.

.

*CPFYÌTVGTDWEJFGTIGUCOOVGP/ÒP\MWPFGHÒT/ÒP\NKGDJCDGTWPF)GUEJ·HVUNGWVG*CNNG$GTNKP 8+++  5 0CEJVTCI \W FGO *CPFYÌTVGTDWEJ FGT IGUCOOVGP /ÒP\MWPFG HÒT /ÒP\NKGDJCDGT WPF   )GUEJ·HVUNGWVG *CNNG$GTNKP  +8  5 +P GKPGO $CPF KP *CNDNGKPGP IGDWPFGP YGPKIG $NGK   UVKHVPQVK\GPUGJTIWVG'TJCNVWPI#



5%*7$'46 6( XQP /QPPC[GU 4WUUGU FGU FGTPKGTU VTQKU 5K½ENGU FGRWKU NG %\CT,QCP9CUKNKGYKE\ )TQ\P[K LWUSW ¯ .yGORGTGWT #NGZCPFTG ++  6GZV WPF #VNCUDCPF .GKR\KI  :+8    5 6HP ++:::8++ FC\W  6H OKV $GUEJTGKDWPI FGT 4CPFUEJTKHVGP /QFGTPGU *CNDNGFGT -QNQTKGTVG   #DDVGKNYGKUGGVYCUCDIGTKGDGP6GZVDCPFVGKNYGKUGUVQEMHNGEMKI7PVGTUEJKGFNKEJIGDWPFGP  



5GJTUGNVGP/KV$GUKV\GTUVGORGN&T(:9GK\KPIGT%QKO6GZVDCPF

.

.

.

.

5%*7.6*'554'%*$'4) - ) 6JCNGT%CDKPGV $GUEJTGKDWPI CNNGT DGMCPPV IGYQTFGPGP 6JC   NGT$CPF9KGP$CPF-CKUGTWPF-ÌPKIG(TQPVKURK\:++ 5$CPFWPF #DVGKNWPI)GKUVNKEJMGKV$NN5WPF$NN5$CPFWPF#DVGKNWPI9GNVNKEJG *GTTGP #PJCNV*GPPGDGTI  $NN  5 :8++   5  #DVGKNWPIGP GKPJGKVNKEJ KP  $·PFGP KP   *CNDNGFGTIGDWPFGP-CPVGPOKPKOCNDGUVQ­GP6CFGNNQUGU'ZGORNCT//#)  



52#0*'+/'&KUUGTVCVKQFGRTCGUVCPKCGVWUWPWOKUOCVWOCPVKSWQTWO4QO$NN5 +PFGZ )CP\RGTICOGPV FGT <GKV NGKEJV DGUVQ­GP 2CRRDCPF WPF 4ÒEMGP NQEMGT 9CUUGTTCPF CWH FGP   GTUVGPHÒPH5GKVGPUGNVGPG'TUVCWHNCIG



6+'21.1.6*'721.75(/WUGK6JGWRQNK#PVKSWC0WOKUOCVC1NKOEQNNGEVCC,QCPPG&QOK PKEQ6JGWRQNQCWEVCGVGFKVCC.CWTGPVKQGV(TGFGTKEQHTCVTKDWU6JGWRQNKU8GPGVKKU+: (CNVVHP5554GIKUVGT5'TTCVCu2GTICOGPVFGT<GKVKP$·PFGPIGDWPFGP OKV&GEMGNRT·IWPIVCFGNNQUGTJCNVGP  



61'.-'0 '* 'TMN·TGPFGU 8GT\GKEJPK­ FGT CPVKMGP XGTVKGHV IGUEJPKVVGPGP 5VGKPG FGT -ÌPKINKEJGP   2TGW­KUEJGP)GOOGPUCOONWPI$GTNKP.:8+++5*CNDNGFGT'EMGPOKPKOCNDGUVQ­GP



/KV$GUKV\GTGVKMGVV

.

6140$'4)%,0WOK%WHKEK4GIKK0WOQRJ[NCEKK*QNOKGPUKUSWQUQOPGUKPVGTTC5WGEKCGTGRGTVQU 7RRUCNC.:::8+++56HPu1TKI$TQUEJWTWPCWHIGUEJPKVVGP4ÒEMGPNGKEJVGKPIG TKUUGP//#) 5GJTUGNVGP

22




BIBLIOPHILE WERKE .

.

64+'4 &,9 'KPNGKVWPI \W FGT 9CRGP-WPUV 0GWG #WHNCIG .GKR\KI%CTN.WFYKI,CEQDK (TQPVKURK\5OKV#DD6HP(CNVVHP4GIKUVGT-Nu<GKVIGPÌUUKUEJGT)CP\NGFGTGKPDCPF OKV$ÒPFGPIQNFGPG4ÒEMGPXGT\KGTWPI4ÒEMGPNGKEJVDGUEJ·FKIVXQTFGTG(CN\OKPKOCNGKPIGTKUUGP



8#6'4&,55[PEJTQPKUVKUEJG6CHGNPFGT-KTEJGPIGUEJKEJVGXQO7TURTWPIGFGU%JTKUVGPVJWOUDKU CWHFKGIGIGPY·TVKIG<GKV*CNNG5'KP\GNPG$NN-NGKPGT9CUUGTTCPFCWHFGPGTUVGP5GK VGP+PPGPGKPDCPFVGKNYGKUGCDIGNÌUV*CNDNGFGTDGUVQ­GP



8GTOGTM\WO6QFFGU#WVQTUKO8QTUCV\

.

9#)'05'+. %, 8GTUWEJ GKPGT )GUEJKEJVG FGT 5VCFV #WIUDWTI 'KP .GUGDWEJ HÒT CNNG 5V·PFG   #WIUDWTI:52CRRDCPFDGUVQ­GP9CUUGTHNGEMGPCWHFGP5WPF



.

9'+./';4 (: #NNIGOGKPGU 0WOKUOCVKUEJGU .GZKEQP QFGT /ÒP\9ÌTVGTDWEJ \WO PÒV\NKEJGP   )GDTCWEJGWPF7PVGTTKEJVLGFGP5VCPFGUWPF)GYGTDGU6JGKN5CN\DWTI5-WRHGTVHP &KG6CHGNUKPFNQUG2CRRDCPFOKPKOCNDGUVQ­GP



9'+5' #% 8QNNUV·PFKIGU )WNFGP%CDKPGV KP FGT 1TFPWPI FGU OCFCKUEJGP 6JCNGT%CDKPGVU $CPF     0ÒTPDGTI /CTVKP ,CEQD $CWGT   5  5 4GIKUVGT u 2CRRD·PFG OKPKOCN   DGUVQ­GP.KRUKWU5



.

/KV$GUKV\GTUVGORGNCWHFGO6KVGNDNCVVWPFCWHFGTNGV\VGP5GKVG

73

.

8QNNUV·PFKIGU )WNFGP%CDKPGV KP FGT 1TFPWPI FGU OCFCKUEJGP 6JCNGT%CDKPGVU $CPF  0ÒTPDGTI   /CTVKP,CEQD$CWGT5u2CRRDCPFOKPKOCNDGUVQ­GP#.KRUKWU5



.

9'.<. 810 9'..'0*'+/ . 8GT\GKEJPKU FGT /ÒP\ WPF /GFCKNNGP5COONWPI -CVCNQI FGT   ÌHHGPVNKEJGP 8GTUVGKIGTWPI 9KGP  $CPF  ++  5 OKV  0TP *CNDNGKPGP 'KPDCPF   GVYCUDGUVQ­GPNGKEJVUVQEMHNGEMKI4ÒEMGPFGHGMV&WTEJUEJQUUGPGU'ZGORNCT0KEJVXQNNUV·PFKI



8GT\GKEJPKUFGT/ÒP\WPF/GFCKNNGP5COONWPI-CVCNQIFGTÌHHGPVNKEJGP8GTUVGKIGTWPIXQOWPF 9KGP$CPF5OKV0TP$CPF++5OKVFGP0TPWPF 8GT\GKEJPKU GKPGT 5COONWPIXQP1TKIKPCN5KGIGNUV·ORGNP9KGP5OKV0TP+PGKPGO $CPFKP*CNDNGKPGPIGDWPFGPVGKNYGKUGUVQEMHNGEMKI#



.

/KV$GUKV\GTXGTOGTM--*QHDWEJJCPFNWPI9KNJGNO(TKEM

.

8GT\GKEJPKU FGT /ÒP\ WPF /GFCKNNGP5COONWPI-CVCNQIFGTÌHHGPVNKEJGP8GTUVGKIGTWPI9KGP  $CPF     5 OKV  0TP WPF 8GT\GKEJPKU GKPGT 5COONWPI XQP 1TKIKPCN5KGIGNUVGO   RGNP  5 OKV  0TP $CPF  +    5 OKV  0TP )TÌ­GPVCDGNNG 4GIKUVGT WPF 8GT   \GKEJPKUPWOKUOCVKUEJGT$ÒEJGT5OKV0TP$CPF++5OKV0TP4GIKUVGT$CPF )CP\NGKPGP4ÒEMGPNQUGGVYCUDGUVQ­GPWPFVGKNYGKUGNGKEJVUVQEMHNGEMKI=/KV'ZNKDTKU1VVQ5EJW NGPDWTI? $CPF  + ++ KP  $·PFGP GKPJGKVNKEJ KP *CNDNGFGT OKV CWHIGMNGDVGP CNVGP 4ÒEMGP IGDWPFGP   /CPEJOCNNGKEJVUVQEMHNGEMKI=/KV'ZNKDTKU1VVQ5EJWNGPDWTI?&C\W*CPFUEJTKHVNKEJGT#WU\WICWUFGT 5COONWPI9GN\NXQP9GNNGPJGKO54GIKUVGT*CNDNGFGTOKPKOCNDGUVQ­GP//#)  

 23


ALLGEMEINE NUMISMATIK .

9+&/'4/,XQP&QOWU9KVVGNUDCEJGPUKUPWOKUOCVKEC1FGT5COONWPICNNGTGZKUVKGTGPFGP/ÒP \GPWPF/GFCKNNGPFGUFWTEJNCWEJVKIUVGPYKVVGNUDCEJKUEJGP5VCOOJCWUGUFGTNWFQXK\KPKUEJGPWPFTWFQN RJKPKUEJGP.KPKGCNUXQP1VVQFGO)TÌ­GTGPDKU\WTIGIGPY·TVKIINQTYÒTFKIUVGP4GIKGTWPI-CTN6JGQ FQTU$CPF *GHV /ÒPEJGP+PIQNUVCFV(TQPVKURK\5OKV#DD6HP5COONWPI CNNGT DGMCPPVGP &GPM 5EJCW WPF CPFGTGT /ÒP\GP FGU &WTEJNGWEJVKIUVGP 2HCN\DCKGTKUEJGP *CWUGU CWU   FGOWTCNVGP9KVVGNUDCEJKUEJGP)GUEJNGEJVG8QPFGT.WFYKIKUEJGPQFGT$CKGTKUEJGP.KPKGKPUDGUQPFGTG 'TUVGU5VÒEM55VCOOVH6HPXQPFGT4WFQNRJKPKUEJGPQFGTRHCN\IT·HKUEJGP.KPKG KPUDGUQPFGTG'TUVGU5VÒEM/ÒPEJGP55VCOOVH6HP<YG[VGUDGUQPFGTGU2H·N\K UEJGU 5VWEM =/ÒPEJGP ? 5  6HP   5VCOOVH  +P\YGK$·PFGPIGDWPFGP2CRR DCPF'KPDCPFDGUEJ·FKIVWPF$KPFWPINQEMGT+P$CPFCWHFGPGTUVGP5MNGKPGT9CUUGTUEJCFGP /KVGKPKIGP#POGTMWPIGP6GKNYGKUGMQNQTKGTVG-WRHGTVHP+PJCNVGVYCUUVQEMHNGEMKIUQPUVVCFGNNQU  



&QOWU 9KVVGNUDCEJGPUKU PWOKUOCVKEC 1FGT 5COONWPI CNNGT GZKUVKGTGPFGP /ÒP\GP WPF /GFCKNNGP FGU   FWTEJNCWEJVKIUVGPYKVVGNUDCEJKUEJGP5VCOOJCWUGUFGTNWFQXK\KPKUEJGPWPFTWFQNRJKPKUEJGP.KPKGCNUXQP 1VVQ FGO )TÌ­GTGP DKU \WTIGIGPY·TVKIINQTYÒTFKIUVGP4GIKGTWPI-CTN6JGQFQTU$CPF *GHV  /ÒPEJGP+PIQNUVCFV(TQPVKURK\5OKV#DD6HP6HHGJNVXQPFGT4WFQNRJKPKUEJGP QFGTRHCN\IT·HKUEJGP.KPKGKPUDGUQPFGTG'TUVGU5VÒEM/ÒPEJGP55VCOOVH6HP <YG[VGUDGUQPFGTGU2H·N\KUEJGU5VWEM=/ÒPEJGP?56HP5VCOOVH+P\YGK $·PFGPIGDWPFGP2CRRDCPFOKPKOCNDGUVQ­GP/KVYGPKIGP#POGTMWPIGP+PJCNVGVYCUUVQEMHNGEMKI UQPUVVCFGNNQU  



&QOWU 9KVVGNUDCEJGPUKU PWOKUOCVKEC 1FGT 5COONWPI CNNGT GZKUVKGTGPFGP /ÒP\GP WPF /GFCKNNGP FGU   FWTEJNCWEJVKIUVGP YKVVGNUDCEJKUEJGP 5VCOOJCWUGU XQP FGT 4WFQNRJKPKUEJGP QFGT RHCN\IT·HKUEJGP .KPKG   KPU DGUQPFGTG 'TUVGU 5VÒEM /ÒPEJGP   5  5VCOOVH 5   6HP 6KVGNDNCVV FGU    5VÒEMGU WPF 8GTDGUUGTWPIGP FGU  5VÒEMGU HCNUEJ GKPIGDWPFGP  5COONWPI CNNGT DGMCPPVGP &GPM   5EJCW WPF CPFGTGT /ÒP\GP FGU &WTEJNGWEJVKIUVGP 2HCN\DCKGTKUEJGP *CWUGU CWU FGO WTCNVGP 9KVVGNU   DCEJKUEJGP)GUEJNGEJVG8QPFGT.WFYKIKUEJGPQFGT$CKGTKUEJGP.KPKGKPUDGUQPFGTG'TUVGU5VÒEM  5  5VCOOVH  6HP +P GKPGO $CPF KP )CP\NGFGT IGDWPFGP 'KPDCPF DGUEJ·FKIV WPF $KPFWPI   NQEMGT



'ZNKDTKU,).QTK*CPFUEJTKHVNKEJG$GUKV\GTXGTOGTMGWCKP$CPF$GUKV\GTXGTOGTMXQP$GKGTNGKP

.

/KV$GUKV\GTUVGORGNXQP&T(:9GK\KPIGT%Q

.

/101)4#2*+'0 #..)'/'+0'07/+5/#6+-'+0(ª*470)'0.':+-#24'+5$ª%*'4 .

%.#+056'(#0'..+'5GNGEV0WOKUOCVKE$KDNKQITCRJ[0GY;QTM:5OKV0TP )CP\NGKPGP



.

)#/$'4+0+&+5%#4(–#%5VWFKQUWNNÌYGPVJCNGTGFKNOG\\QNÌYGPVJCNGTFGNNG2TQXKPEG7PKVG F 1NCPFCGUWNNGNQTQKOKVC\KQPKGEQPVTCHHC\KQPKKVCNKCPGGUVTCPKGTG$TGUEKC5OKV#DD1TKI $TQUEJWT0WOOGTKGTVGU'ZGORNCT



*#.. '6/'6%#.( &/ /GVJQFU QH %JGOKECN CPF /GVCNNWTIKECN +PXGUVKICVKQP QH #PEKGPV   %QKPCIG#U[ORQUKWOJGNFD[VJG4Q[CN0WOKUOCVKE5QEKGV[CV$WTNKPIVQP*QWUG4055RGEKCN2WDNK ECVKQP.QPFQP8+++56HP)CP\NGKPGP



,'0-+05)--ª6*'/#00*576*'4.#0&%*8WC&KG9GNVFGT/ÒP\GP/ÒP\GP FGT )TKGEJGP /ÒP\GP FGT 4ÌOGT /ÒP\GP XQP $[\CP\ /ÒP\GP FGU /KVVGNCNVGTU /QFGTPG /ÒP\GP   /ÒP\GPFGT0GW\GKV/ÒPEJGP(TKDQWTI)CP\NGKPGP  



-10)4'55$'4+%*6',$#$'.10,.#(#74+' *TUI %QPIT½U+PVGTPCVKQPCNFG0WOKUOCVK SWG2CTKU,WKNNGV6GKNGKPGKPGP$CPFIGDWPFGP2CTKU::+5+:5 OKV6GZVCDD)CP\NGKPGP//#)



.

'$1'*4+0)'4 *TUI 9KUUGPUEJCHVNKEJG#DJCPFNWPIGPFGUFGWVUEJGP0WOKUOCVKMGTVCIGUKP)ÌV VKPIGP)ÌVVKPIGPWC56HP.GKPGPOKV5EJWV\WOUEJNCI



.

*#%#*0).'4+&'4 *TUI #EVGUFW½OG%QPIT½U+PVGTPCVKQPCNFG0WOKUOCVKSWG0GY;QTM 9CUJKPIVQP#+02$·PFG2CTKU$CUGN:+856HP.GKPGP%#.(#41% /#4%152 16'41 *TUI  :+++ %QPITGUQ +PVGTPCEKQPCN FK 0WOKUO±VKEC  $·PFG /CFTKF     5 OKV XKGNGP #DD 5  OKV XKGNGP 6HP )CP\NGKPGP FC\W # 5748'; 1(   07/+5/#6+%4'5'#4%*1TKI$TQUEJWT  



) &'2';4166 *#%-'05) /17%*#46' *TUI  4[VJOGU FG NC 2TQFWEVKQP /QP¾VCKTG FG   N #PVKSWKV¾ ¯ PQU ,QWTU #EVGU FW %QNNQSWG +PVGTPCVKQPCN 1TICPKU¾ ¯ 2CTKU FW  CW  ,CPXKGT    .QWXCKPG.C0GWXG:8+56HP)CP\NGKPGP



6 *#%-'05) /17%*#46' *TUI  0WOKUOCVKSWG GV JKUVQKTG ¾EQPQOKSWG RJ¾PKEKGPPGU GV RW   PKSWGU #EVGU FW %QNNQSWG VGPW ¯ .QWXCKPNC0GWXG  /CK  0WOKUOCVKEC .QXCPKGPUKC    .QWXCKPNC0GWXG:+++56HP.GKPGP//#)



%'-+0)&)9+)) *TUI %QKP(KPFUCPF%QKP7UGKPVJG4QOCP9QTNF6JGVJKTVGGPVJ1ZHQTF 5[ORQUKWO QP %QKPCIG CPF /QPGVCT[ *KUVQT[  5VWFKGP \WT (WPFOÒP\G FGT #PVKMG   

 5OKV6HPWPF#DD$TQUEJKGTV



.

.

.

.

.

.

24


ANTIKE ALLGEMEIN .

.

.

, 01..—$ 18'4$'%-2 9'+55 *TUI  +PVGTPCVKQPCNGU -QNNQSWKWO \WT MCKUGT\GKVNKEJGP /ÒP\   RT·IWPI -NGKPCUKGPU  #RTKN  KP FGT 5VCCVNKEJGP /ÒP\UCOONWPI /ÒPEJGP 0QOKUOCVC    /KNCPQ5FCXQP6HP-CTVQPKGTV



-70&/#00 , % 0WOOK 5KPIWNCTGU 1FGT UQPFGTDCTG 6JCNGT WPF /ÒPV\GP UQ QHHV YGIGP GKPGT   MNGKPGP/CTSWGQFGTVJGKNEQWTKGWUGP*KUVQTKGVJGKNUHCDGNJCHHVGP/·JTEJGPXQPFGPGP/ÒPV\.KGDJC DGTPJQEJIGUEJ·V\GV$TGUNCWWPF.GKR\KI58GT\GKEJPKU6HP*CNDRGTICOGPV'EMGPWPF -CPVGPDGUVQ­GP



.110)XCP%QPVGORQTCT[0WOKUOCVKEU$GKPICVTGCVKUGCDQWV6JG1TKIKPQH/QPG[VJGFGXGNQR OGPV CPF FKUVKPIWKUJKPI HGCVWTGU QH EQOOGOQTCVKXG OGFCNU 6JG PCVWTG QH CPF OGVJQFU QH TGEMQPKPI   YKVJ,GVVQPU*QYVJGCPEKGPVUFKFVJGKTECNEWNCVKQPU6JGQTKIKPQH0WOGTCNU/CIKE%QKPUCPF'OGT IGPE[ /QPG[ 0CEJFTWEM .GKFGP FGT #WUICDG &GP *CCI  :  5  5 $KDNKQITCRJKG WPF   +PFGZ)CP\NGKPGPPGWYGTVKI



0TFKGUGT#WHNCIGOKV'ZGORNCTGP

.

/#08+..'*'41$'465106,$TKVKUJ0WOKUOCVKE#WEVKQP%CVCNQIWGU'PE[ENQ RCGFKCQH$TKVKUJ0WOKUOCVKEU8QNWOG/CPWUMTKRVFTWEM1ZHQTF5)CP\GKPGP

.

5'+&'.-&&KGFGWVUEJG)GNFIGUGV\IGDWPIUGKV/ÒPEJGP:::8+5)CP\NGKPGP

.

9+.$'4)/4GIGPVGP6CDGNNGP(TCPMHWTVCPFGT1FGT8++5*CNDNGKPGP/KV#POGT MWPIGPKO6GZV



.

-1081.76 -QPXQNWV XQP /QPQITCRJKGPWPF#WMVKQPUMCVCNQIGP\WXGTUEJKGFGPGP6JGOGPFGT0W OKUOCVKM WC )¤$.0WOKUOCVKM/#;'4'NNYCPIGP5'..+'4(TGKUKPI DTQUEJKGTV 41*4'4

*TUI  5CN\DWTIGT /ÒP\TGEJV 0+)). &KTKIGPVGP *'55 .W\GTP MCVCNQI XQO  -4'55   #WMVKQP  )QRRGN2NWO*QNNGT 516*'$; <ÒTKEJ /GVTQRQNKVCP /WUGWO #PEKGPV %QKPU 2CTV   + ++7PVGTUEJKGFNKEJIGDWPFGP  



.

/QPQITCRJKGP\WTCNNIGOGKPGPWPFFGWVUEJGP0WOKUOCVKM6)T·HKP-.'0#7&GWVUEJGU/ÒP\RTGKU ,CJTDWEJ  UQYKG    * -475; )GIGPUVGORGN CWH /ÒP\GP FGU 5R·VOKVVGNCNVGTU *   -7*0 )GRT·IVG (QTO )QGVJGU /QTRJQNQIKG WPF FKG /ÒP\MWPUV , 2146'175 /ÒP\GP )G   UEJKEJVGWPF$GFGWVWPIKP9KTVUEJCHV2QNKVKMWPF-WNVWT)241$5<69GUGPWPF9CPFGNFGT/ÒP \GP # 4+'%*/#00 9CTWO WPF YKG UCOOGNV OCP /ÒP\GP WPF /GFCKNNGP 20 5%*7.6'0   &GWVUEJG/ÒP\GPCWUFGT<GKV-CTNU8%5%*9#.$#%*&KGPGWGUVGPFGWVUEJGP6JCNGT&QRRGNV JCNGT WPF &QRRGNIWNFGP 21 5+).'4 5[EGG 5KNXGT 00/   29 56ª4/'4 8GT\GKEJPKU WPF   )GRT·IGFGTITQDGPWPFMNGKPGP/ÒP\UQTVGP45;'1/#0#ECVCNQIQHOQFGTPYQTNFEQKPU   &C\W FKG <GKVUEJTKHV &GT /ÒP\GPUCOONGT 8GTUEJKGFGPG #WUICDGP CWU FGP ,CJTGP     *GHVG



.

<CJNTGKEJG /QPQITCRJKGP WPF -NGKPUEJTKHVGP \WT CNNIGOGKPGP 0WOKUOCVKM WC * $7%*'0#7   )TWPFTK­FGT/ÒP\MWPFG.GKR\KIWPF$GTNKP#9'0<'.#WHNÌUWPIGPNCVGKPKUEJGT.GIGPFGP CWH/ÒP\GPWPF/GFCKNNGP$TCWPUEJYGKI'%.#+056'(#0'..+5GNGEV0WOKUOCVKE$KDNKQ ITCRJ[ 0GY ;QTM  * )416' 5VCOOVCHGNP /KV #PJCPI %CNGPFCTKWO OGFKK CGXK .GKR\KI    9 4GPV\OCPP 0WOKUOCVKUEJGU 9CRRGP.GZKEQP $GTNKP  +PFGZ WPF #VNCUDCPF 9   *1.6<#DMÒT\WPIGPCWH/ÒP\GP$TCWPUEJYGKI7PVGTUEJKGFNKEJIGDWPFGP  



 

#06+-'#..)'/'+0 .

$#$'.10,.GRQTVTCKVFCPUN CPVKSWKV¾F CRT½UNGUOQPPCKGU2CTKU56HPOKV /ÒP\CDD)CP\NGKPGPOKVOQPVKGTVGP6KVGNDNCVVFGT$TQUEJWTGKPKIG#PUVTGKEJWPIGP



.

$+5*12 ,&*1..19#; 44 9JGCVQP %QNNGIG %QNNGEVKQP QH )TGGM CPF 4QOCP %QKPU   #%0#%0GY;QTM56HP)CP\NGKPGP#



.

%#/2'..9)TGGMCP4QOCPRNCVGVEQKPU0GY;QTM #05 5FCXQP\CJNTGKEJG#D DKNFWPIUVHPUQYKG6CHGNCPJCPI2CTV++2NCVGU/ÒP\CDDUQYKG9GKVGTHÒJTWPIFGT#DDDKU6H $TQUEJKGTV



%*4+56 - #PVKMG /ÒP\HWPFG 5ÒFYGUVFGWVUEJNCPFU /ÒP\HWPFG )GNFYKTVUEJCHV WPF )GUEJKEJVG KO   4CWOG $CFGP9ÒTVVGODGTIU XQP MGNVKUEJGT DKU KP CNNCOCPPKUEJG <GKV$CPF+*GKFGNDGTI 5OKV#DD(CNVVHP)CP\NGKPGP&GEMGNOKV)QNFRT·IWPIGPVCFGNNQUGUW­GTGU



.

)+'5'%-'9#PVKMGU)GNFYGUGP.GKR\KI(TQPVKURK\+856HP)GDWPFGP



.

/+..'4/&KG/ÒP\GPFGU#NVGTVWOU$GTNKP8+++5OKV6HP*CNDNGFGT



.

4#.(¤.&+/#PVKMG0WOKUOCVKM$·PFG/CKP\:.856HP-CTVGP::: 56HP-CTVQPKGTV  



.

4').+0)-&KGCPVKMG/ÒP\GCNU-WPUVYGTM$GTNKP56HP*CNDNGKPGP



.

5#%-'0'XQP-'00'4(&KG5COONWPIGPFGUMM/ÒP\WPF#PVKMGP%CDKPGVGU9KGP 5OKV6H5R·VGTGT*CNDNGFGTGKPDCPFOKV$ÒPFGPWPFCNVGO/CTOQTRCRKGTFGT<GKVWPF)QNF

CO4ÒEMGP UQYKG$NKPFUVGORGNXGT\KGTWPI CWHFGO&GEMGN KO5VKNFGT<GKV

.

 25


ANTIKE - GRIECHEN .

.

.

.

.

.

.

.

5#..'6#X2+%-$WC$GUEJTGKDWPIFGT#PVKMGP/ÒP\GP=KPFGPMÌPKINKEJGP/WUGGP\W$GT NKP? $CPF  6CWTKUEJG %JGTUQPGUWU 5CTOCVKGP 2CPPQPKGP /QGUKGP 6JTCEKGP 6JTCEKUEJG -ÌPKIG   $GTNKP5OKV6GZVCDD6HPOKV<KPMFTWEMGP)CP\NGKPGP·W­GTUVUGNVGP



5%*/+&6 4) 8GT\GKEJPKU FGT 1DGTUVNKGWVGPCPV (9 5EJOKFV UEJGP CPVKMGP /ÒP\UCOONWPI FGU   9KNJGNO'TPUV)[OPCUKWOUJGTCWUIGIGDGPXQP1-PQVV9GKOCT5OKV0TP*CND NGKPGPDGUVQ­GP



<1)4#2* #0 #PEKGPV %QKPCIG 2CTV  6JG )GPGTCN 2TQDNGOU QH #PEKGPV 0WOKUOCVKEU 2CTV    6JG#PEKGPV%QKPUQHVJG0QTVJGTP$NCEM5GC.KVVQTCN$#45WRRNGOGPVCT[5GTKGU1ZHQTF 556HP1TKI$TQUEJWTGVYCUDGUEJ·FKIV//#)  



-1081.76/QPQITCRJKGP5QPFGTFTWEMGWPF#WHU·V\G\WTITKGEJKUEJGPWPFTÌOKUEJGP0WOKUOCVKM WCXQP)#5-'9-$+55+0)'4)$47%--&+664+%*#(.14#0%'24(4#0-' 9 (4'*0'4 4 )¤$.   # *'55   / *+4/'4   - -'4'0;+ ./   .#0%-14105-+ ' -0+66'45%*'+& * -ª*0'42.#$#7/'./.#0%-14105-+

  - .#0)' / /+..'4 - 2(+56'4 #8 5#..'6   ,8 5%*.155'4 9   5%*9#$#%*'4 . 5%*9#$' & 5%*9#4< . /+.&'0$'4) *# 5'#$; ,   -1<1.7$5-+  %5'.6/#0    



/QPQITCRJKGP\WTCPVKMGP0WOKUOCVKM/XQP$#*4('.&6&KG/ÒP\UCOONWPIFGU4QGOGT/WUG WOU \W *KNFGUJGKO #. $'..+0)'4 0WOKUOCVKE PQVGU CPF OQPQITCRJU / $'40*#46 *CCT   VTCEJVGPTÌOKUEJGT-CKUGTKPPGPCWH/ÒP\GP*#%#*0)TKGEJKUEJG/ÒP\GP-&+664+%*#PVKMG /ÒP\GPCWU1NDKCWPF2CPVKMCRCWO-¤0+).+%*'/75''0<7$'4.+0$GUEJTGKDWPIFGTCPVKMGP /ÒP\GP4/ª056'4$'4)&KG$GCOVGPPCOGPCWHFGPITKGEJKUEJGP/ÒP\GP$2+%-&KG2GTUQ PGPWPF)ÌVVGTPCOGPCWH-CKUGTOÒP\GPXQP$[\CPVKQP5&CWUFGT9KGPGTPWOKUOCVKUEJGP<GKVUEJTKHV  $CPF / 2+0&'4 &KG CPVKMGP /ÒP\GP 4 2156'. -CVCNQI FGT CPVKMGP /ÒP\GP KP FGT *CO   DWTIGT -WPUVJCNNG  $·PFG 52#4-#55' 4')'05$74) 4ÌOKUEJGT 5EJCV\HWPF ( 56'(#0   /ÒP\MWPFG FGU #NVGTVWOU ) 9')'/#00 &KG /ÒP\GP FGT -TGW\HCJTGTUVCCVGP #%' XQP   9'4.*1(*CPFDWEJFGT)TKGEJKUEJGP0WOKUOCVKM  



-QPXQNWVCWU$ÒEJGTP$#$'.10,&CWGTPFGTCNU'T\&19.'#(+002%QKPUHQTRNGC UWTGCPFKPXGUVOGPV-1%*5*)GRT·IVGU)QNF.#0)'-/ÒP\DKNFPKUUGCWU\YGK,CJTVCWUGPFGP /#&5#%-'/ÒP\GPCWUGKPGTPQTFFGWVUEJGP2TKXCVUCOONWPI2146'175,/ÒP\GP'TNGUGPG .KGDJCDGTGKGP  241$5<6 ) )QNFOÒP\GP 5%*('4 ' 0GWGUVG /ÒP\MWPFG 9+'.#0&6 (   /ÒP\GP WPF $CWVGP 64'+%*.+0)'4 9/ &CU )GNF  5GKPG )GUEJKEJVG KP )GUEJKEJVGP   9#)'0(ª*4*&GTIQNFGPG-QORCUU&KG)GNFIGUEJ·HVGITQUUGT*GTTGP  



&KXGTUG /QPQITCRJKGP ÒDGT CPVKMG0WOKUOCVKMFCTWPVGT/4#.(¤.&+/GVJQFGPFGTCPVKMGP0W OKUOCVKM &CTOUVCFV  - -4#(6 )GUCOOGNVG #WHU·V\G\WTCPVKMGP)GNFIGUEJKEJVGWPF0WOKU OCVKM+WPF++&CTOUVCFVW$·PFG,(4+'&.#'0&'44GRGTVQTKWO\WTCPVKMGP0W OKUOCVKM $GTNKP  $8 *'#& *KUVQTKC 0WOQTWO # OCPWCN QH )TGGM PWOKUOCVKEU 1ZHQTF    .:::8+++  5 OKV XKGNGP 6GZVCDD  6HP 1TKI )CP\NGKPGP DGUVQ­GP # XQP 5#..'6   -ÌPKINKEJG /WUGGP \W $GTNKP $GUEJTGKDWPI FGT CPVKMGP /ÒP\GP  $·PFG $GTNKP  .GKPGP   7PVGTUEJKGFNKEJIGDWPFGP  



-QPXQNWV XQP /QPQITCRJKGP 5QPFGTFTWEMGP WPF #WHU·V\GP \WT CPVKMGP 0WOKUOCVKM +PVGTGUUCPVGU   -QPXQNWVOKVXKGNGP5VCPFCTFYGTMGP8GTUEJKGFGPG'KPD·PFG  



)4+'%*'0 .

#%37#41 ' /QPGVG 2WPKEJG PGNNG EQNNG\KQPK KVCNKCPG $QNNGVKPQ FK 0WOKUOCVKEC /QPQITCHKC    4QO5OKV\CJNTGKEJGP#DDWPF6HP)CP\NGKPGP



.

#-#4%##.GUOQPPCKGUITGESWGUFG/[NCUC$KDNKQVJ½SWG#TEJ¾QNQIKSWGGV*KUVQTKSWGFGN +PUVKVWV (TCP¼CKU F #TEJ¾QNQIKG F +UVCPDWN 2CTKU   5  6HP 1TKI$TQUEJWT WPCWHIGUEJPKVVGP   //#)



.

#/#0&4;/4'/;$.GUOQPPCKGUFGNyCVGNKGTFG5GDCUVQRQNKUFWRQPV2CTKU5 6HP1TKI$TQUEJWT



.

#01-*+08#6JG%QKPCIGQH%JGTUQPGUWU+8%GPVWT[$%:++%GPVWT[#&$#4+PVGTPCVKQ PCN5GTKGU1ZHQTF56HP1TKI$TQUEJWTOKPKOCNDGUVQ­GP



.

#010;/)TKGEJKUEJG/ÒP\GP(CU\KPCVKQPWPF)GUEJKEJVG#WH\GKEJPWPIGPGKPGU5COONGTU1UPC DTÒEM5OKVHCTDKIGP#DD-CTVQPKGTV



5COONWPIUDGUEJTGKDWPIOKVXKGNGP-QOOGPVCTGPFGU5COONGTUWPF#DDKNFWPIGPKPHCPVCUVKUEJGT3WCNKV·V

.

. 26

#06+-' /ª0<'0 014&)4+'%*'0.#0&5 $ 2+%- &KG CPVKMGP /ÒP\GP XQP &CEKGP WPF   /QGUKP &KG CPVKMGP /ÒP\GP 0QTF)TKGEJGPNCPFU +  *CNDD·PFG $GTNKP  /QGUKC 5WRGTKQT   8KOKPCEKWO 5  FC\W 1TKIKPCNVCHGNCWUUEJPKVV FGT 6H  OKV FGP #DDXQP8KOKPQEKWO&CEKGP WPF/QGUKGP/CTMKCPQRQNKU56HWPF1TKI6CHGNCWUUEJPKVVFGT6HOKV#DDXQP /CTMKCPQRQNKU+P$·PFGPKPGKPJGKVNKEJGO*CNDNGKPGPIGDWPFGP  



#401.&$+7%%*+ % 6JG 4CPFC\\Q *QCTF  CPF 5KEKNKCP %JTQPQNQI[ KPVJG'CTN[(KHVJ%GP VWT[$%050GY;QTM(TQPVKURK\56HP)CP\NGKPGP//#)




ANTIKE - GRIECHEN .

#45.#0 '# /QPGVC\KQPG CWTGC GF CTIGPVGC FGK $TGVVKK )NCWZ  /KNCPQ   5  6HP   -CTVQPKGTV//#)



.

#45.#0/.+)*6(116%)TGGMEQKPJQCTFUKPVWTMG[#PMCTC56HP)CP\NGK PGPOKV5EJWV\WOUEJNCI



.

#6.#057PVGTUWEJWPIGPÃ&#x2019;DGTFKGUKFGVKUEJGP/Ã&#x2019;P\GPFGUWPF,CJTJWPFGTVUX%JT7PVGTUW EJWPIGPKPFGT)GIGPFXQP#PVCN[C#PMCTC::+56HP*CNDNGFGT//#)



6Ã&#x2019;TMKUEJGTWPFFGWVUEJGT6GZV/KV9KFOWPIFGT8GTHCUUGTKP

.

#66+#0'5' 2 -TQVQP .G OQPGVG FK DTQP\Q 5QXGTKC /CPPGNNK   5 OKV \CJNTGKEJGP 6GZ   VCDD)CP\NGKPGPOKV5EJWV\WOUEJNCI



.

#7.1%-*XQP&KG/Ã&#x2019;P\RT·IWPIFGU)QTFKCP+++WPFFGT6TCPSWKNNKPCKP.[MKGP+UVCPDWNGT/KV VGKNWPIGP$GKJGHVG6Ã&#x2019;DKPIGP5DGKNKGIGPFG6HPDGKIGNGIVG-CTVG1TKI$TQUEJWT OKV5EJWV\WOUEJNCI#



.

/Ã&#x2019;P\GPWPF5V·FVG.[MCQPKGPU+UVCPDWNGT/KVVGKNWPIGP$GKJGHV6Ã&#x2019;DKPIGP56HP (CNVMCTVG1TKI$TQUEJWT#



.

/Ã&#x2019;P\GPWPF5V·FVG2KUKFKGPU+UVCPDWNGT/KVVGKNWPIGP$GKJGHVWPF6GKNG6Ã&#x2019;DKPIGP 56HP56HP-CTVG$GKFGKP1TKI$TQUEJWT#  



.

/Ã&#x2019;P\GP WPF 5V·FVG 2JT[IKGPU +UVCPDWNGT /KVVGKNWPIGP $GKJGHV  WPF   6GKNG 6Ã&#x2019;DKPIGP    56HP56HP1TKI$TQUEJWT//#)  



.

$#$'.10'%CVCNQIWGFGUOQPPCKGUITGESWGUFGNC$KDNKQVJ½SWG0CVKQPCNG.GU2GTUGU#EJ¾O¾PK FGUNGUUCVTCRGUGVNGUF[PCUVGUVTKDWVCKTGUFGNGWTGORKTG%[RTG2J¾PKEKG2CTKU%:%+8OKV YGPKIGP#DD56HP2TCEJVXQNNGT*CNDNGFGTGKPDCPFOKV-QRHIQNFUEJPKVV//#)



+O8QTUCV\DGHKPFGVUKEJUQYQJNGKP'ZNKDTKUCNUCWEJGKP$GUKV\GTUVGORGNXQP'F(9GDGT

132

.

%CVCNQIWG FGU OQPPCKGU ITGESWGU FG NC $KDNKQVJ½SWG 0CVKQPCNG .GU TQKU FG 5[TKG F #TOGPKG GV FG   %QOOCI½PG2CTKU%%::++56HP(CNVVH2TCEJVXQNNGT*CNDNGFGTGKPDCPFOKV-QRH IQNFUEJPKVV//#)



+O8QTUCV\DGHKPFGVUKEJUQYQJNGKP'ZNKDTKUCNUCWEJGKP$GUKV\GTUVGORGNXQP'F(9GDGT

.

$#.&9+0 $4'66 # /WUGWO QH (KPG #TVU $QUVQP %CVCNQIWG QH )TGGM %QKPU 7PXGT·PFGTVGT   0CEJFTWEM 0GY ;QTMFGT#WUICDG$QUVQP(TQPVKURK\:8+56HP)CP\NGKPGP //#)  &C\W  /WUGWO QH (KPG #TVU $QUVQP )TGGM %QKPU $QUVQP   5  6HP   )CP\NGKPGP  



.

$#.&9+0#5[ODQNKUOQP)TGGM%QKPU5&CWU#OGTKECP,QWTPCNQH0WOKUOCVKEU 0CEJ FTWEM0GY;QTM5OKV6GZVCDD6HP-WPUVNGFGT



.

6JG'NGEVTWOCPFUKNXGTEQKPUQH%JKQU0CEJFTWEM%JKECIQFGT'TUVCWUICDG0GY;QTM 5OKVGKPKIGP6GZVCDD&QRRGNVHP)CP\NGKPGP#

 27


ANTIKE - GRIECHEN .

$#4#/-+ &% 6JG %QKP %QNNGEVKQP QH VJG #OGTKECP 7PKXGTUKV[ QH $GKTWV /WUGWO 2CNGUVKPG CPF   2JQGPKEKC$GKTWV:+5FCXQP6HP.GKPGPOKPKOCNDGUVQ­GP//#)



.

$#4410,26JG5KNXGT%QKPUQH5COQU.QPFQP:++56HP)CP\NGKPGP//#) 



.

$#75.#7)*4#5KNXGT%QKPCIGYKVJVJG6[RGUQH#GUKNNCUVJG3WCGUVQT050GY;QTM 56HP)CP\NGKPGPOKPKOCNDGUVQ­GP



.

$'40#4& 2 (QWKNNGU F #Å -JCPQWO $CPF  .GU OQPPCKGU JQTU VT¾UQTU 3WGUVKQPU F JKUVQKTG   )T¾EQ$CEVTKGPPG/¾OQKTGUFGNC&¾N¾ICVKQP#TEJ¾QNQIKSWG(TCP¼CKUGGP#HIJCPKUVCP2CTKU :+:56HP1TKI$TQUEJWT//#)



$'40*#4&1&GT#FNGTCWHITKGEJKUEJGPWPFTÌOKUEJGP/ÒP\GP5&CWU504  5 OKV#DDKO6GZV6HP*CNDNGFGT



.

5GJTUGNVGP

.

)TKGEJKUEJG WPF TÌOKUEJG /ÒP\DKNFGT KP KJTGP $G\KGJWPIGP \WT )GUEJKEJVG FGT /GFK\KP 8GTÌHHGPVNK   EJWPIGP FGT 5EJYGK\GTKUEJGP )GUGNNUEJCHV HÒT )GUEJKEJVG FGT /GFK\KP WPF FGT 0CVWTYKUUGPUEJCHVGP    <ÒTKEJWC56HP*CNDNGFGT



.

$1&'056'&6(2JQM·KUEJGU'NGMVTQP)GNFXQPX%JT5VWFKGP\WT$GFGWVWPIWPF\WFGP 9CPFNWPIGPGKPGTCPVKMGP)QNFY·JTWPI/CKP\56HP.GKPGP



.

2JQM·KUEJGU 'NGMVTQP)GNF XQP  X %JT 5VWFKGP \WT $GFGWVWPI WPF \W FGP 9CPFNWPIGP GKPGT   CPVKMGP)QNFY·JTWPI/CKP\56HP)CP\NGKPGPVCFGNNQUGT<WUVCPF



.

&KG'NGMVTQPOÒP\GPXQP2JQMCKCWPF/[VKNGPG6ÒDKPIGP:56HPFCXQPKP(CTDG )CP\NGKPGP6CFGNNQUGT<WUVCPF//#)



.

$1'*4+0)'4'&KG/ÒP\GPXQP5[TCMWU$GTNKP8+++56HP+PGKPGO$CPFKP )CP\NGFGTIGDWPFGP4ÒEMGPOKV)QNFXGT\KGTWPIGPRTCEJVXQNNG'TJCNVWPI



.

$12'#4#%*%*+ 14#*/#0 # 74 2TG-WUJCPC %QKPU KP 2CMKUVCP -CTCEJK   5   /ÒP\GPCWH(CTDVHPCDIGDKNFGV-WPUVNGFGT'KPDCPFHNGEMKI//#)



.

$15%*%&KGMNGKPCUKCVKUEJGP/ÒP\GPFGTTÌOKUEJGP-CKUGT\GKV6GKN'KP\GNWPVGTUWEJWPIGP$CPF $KVJ[PKGP=OGJTPKEJVGTUEJKGPGP?5VWVVICTV:++5*CNDNGKPGP//#)



/KVJCPFUEJTKHVNKEJGO$GUKV\GTXGTOGTMXQP'$GEMGPDCWGTCWHFGO6KVGNDNCVV

.

$176+0 5 %CVCNQIWG FG OQPPCKGU ITGESWGU CPVKSWGU FG NʼnCPEKGPPG EQNNGEVKQP 2Q\\K /QPPCKGU   HTCRR¾GUGP'WTQRG$·PFG/CCUVTKEJV:++56HP6HP1TKI$TQUEJWT  



.

$4+%#7.6.5[NNQIG0WOOQTWO4GNKIKQPKU+UKCECGGV5CTCRKCECG 504+5 2CTKU5OKV #DD-CTVGP1TKI$TQUEJWTOKPKOCNDGUVQ­GP



.

$4+6+5*/75'7/%#6#.1)7'#%CVCNQIWGQHVJG)TGGM%QKPUKPVJG$TKVKUJ/WUGWO6JGU UCN[VQ#GVQNKC$CPF.QPFQP.8+++56HP)CP\NGKPGPIGTKPIHÒIKIDGUVQ­GP



.

#%CVCNQIWGQHVJG)TGGM%QKPUKPVJG$TKVKUJ/WUGWO2GNQRQPPGUWU$CPF.QPFQP.:+8 56HP)CP\NGKPGPIGTKPIHÒIKIDGUVQ­GP



.

# %CVCNQIWG QH VJG )TGGM %QKPU KP VJG $TKVKUJ /WUGWO #VVKEC /GICTKU #GIKPC $CPF  .QPFQP   .:+:56HP)CP\NGKPGPGKPKIG6CHGNPNQUG



.

# %CVCNQIWG QH VJG )TGGM %QKPU KP VJG $TKVKUJ /WUGWO %QTKPVJ %QNQPKGU QH %QTKPVJ GVE $CPF    .QPFQP.:8+++56HP)CP\NGKPGPIGTKPIHÒIKIDGUVQ­GP



.

#%CVCNQIWGQHVJG)TGGM%QKPUKPVJG$TKVKUJ/WUGWO)TGGMEQKPUQH+QPKC$CPF.QPFQP .8++56HP(CNVMCTVG)CP\NGKPGPOKPKOCNDGUVQ­GP$KPFWPIOKPKOCNIGNQEMGTV



.

#%CVCNQIWGQHVJG)TGGM%QKPUKPVJG$TKVKUJ/WUGWO)TGGMEQKPUQH6TQCU#GQNKUCPF.GUDQU$CPF .QPFQP.:::+++56HP(CNVMCTVG)CP\NGKPGPOKPKOCNDGUVQ­GP



.

$740'66##/#0&4;/4+21..–522 4QOCP2TQXKPEKCN%QKPCIG8QNWOG+(TQOVJG &GCVJQH%CGUCTVQVJG&GCVJQH8KVGNNKWU $%#& 6GKNG.QPFQP2CTKU:8++5 -CTVGP56HP1TKI)CP\NGKPGPKO5EJWDGT  



%#*0 *# &KG /ÒP\GP FGT UK\KNKUEJGP 5VCFV 0CZQU 'KP $GKVTCI \WT -WPUVIGUEJKEJVG FGU ITKGEJK   UEJGP9GUVGPU$CUNGT5VWFKGP\WT-WPUVIGUEJKEJVG$CUGN56HP)CP\NGKPGP//#) 



&KG /ÒP\GP FGT UK\KNKUEJGP 5VCFV 0CZQU 'KP $GKVTCI \WT -WPUVIGUEJKEJVG FGU ITKGEJKUEJGP 9GUVGPU   $CUNGT 5VWFKGP \WT -WPUVIGUEJKEJVG  $CUGN   5  6HP *CNDNGFGT VCFGNNQUG 'TJCNVWPI   //#)



.

.

28


ANTIKE - GRIECHEN .

&KG /ÒP\GP FGT UK\KNKUEJGP 5VCFV 0CZQU 'KP $GKVTCI \WT -WPUVIGUEJKEJVG FGU ITKGEJKUEJGP 9GUVGPU   $CUNGT 5VWFKGP \WT -WPUVIGUEJKEJVG  $CUGN   5  6HP )CP\NGFGT VCFGNNQUG 'TJCNVWPI   //#)



.

-PKFQU&KG/ÒP\GPFGUUGEJUVGPWPFFGUHÒPHVGP,CJTJWPFGTVUX%JT#/7)5$GTNKP:+++ 56HP)CP\NGKPGP6HPNGKEJVIGNDNKEJCPUQPUVGPVCFGNNQUGT<WUVCPF//#)



.

-PKFQU&KG/ÒP\GPFGUUGEJUVGPWPFHÒPHVGP,CJTJWPFGTVUX%JT#/7)5$GTNKP:+++ 5OKV#DD6HP)CP\NGKPGP//#)



'KPIGMNGDVG4G\GPUKQPXQP-CTN5EJGHQNF\WFKGUGO9GTMGTUEJKGPGPKP0GWG$ÒEJGT<GKVWPI

.

.

%#*0 *#*746'4 5/+.&'0$'4) .564#755 2 )TKGEJKUEJG /ÒP\GP #WU FGT   5COONWPIGKPGU-WPUVHTGWPFGU 5NI)KNNGVG.CWUCPPG 5OKV0TPOKV#DDCNNGT/ÒP\GP DGKO 6GZV WPF CWUHÒJTNKEJGP $GUEJTGKDWPIGP UQYKG \CJNT 8GTITÌ­GTWPIGP CWH 6HP #WMVKQPUMCVCNQI   FGT(C$CPM.GW#)<ÒTKEJWPF/ÒP\GPWPF/GFCKNNGP#)$CUGNXQO 5.WPF'.NKGIGP DGK)CP\NGKPGPPGWYGTVKI



%#*0 *# /+.&'0$'4) .47551 481')6.+ * 5COONWPI .WFYKI )TKGEJKUEJG   /ÒP\GPCWU)TQ­ITKGEJGPNCPFWPF5K\KNKGP$CUGN5OKVXKGNGP#DD6HP$TQUEJKGTV



/KV$GUKV\GTUVGORGN'Z$KDNKQVJGEC,GNNKUUGPCWHFGO8QTUCV\

.

%#.%+#6+4#*QCTFQH&KQP[UKWU&TCEJOUHTQO)GNC556HP1TKI$TQUEJWT



.

%*4;55#06*#-+0#).' - . JKUVQKTG OQPGVCKTG FyCDFGTG GP 6JTCEG #VJGP   5    6HP1TKI$TQUEJWT



.

%+%%+1)FG)NKCWTGK5KTCEQUCPKFK%KOQPGGFK'XGPGVQ8GT·PFGTVGWPFGTYGKVGTVG0GWCWHNCIG %QNNCPCFGK5VWFK0WOKUOCVKEK+84QO56HP)CP\NGFGT(QVQFGT1TKIKPCNVHGKPIGMNGDV -QRHIQNFUEJPKVVUQYKG)QNFRT·IWPIGP//#)



.

%1.+0 *, &KG /ÒP\GP XQP 2GTIG KP 2CORJ[NKGP CWU JGNNGPKUVKUEJGT <GKV -ÌNP   5    6HP-CTVQPKGTV//#)



.

%74+'.4(755/#0).GVT¾UQTOQP¾VCKTGFG3WPFW\/¾OQKTGUFGNC&¾N¾ICVKQP#TEJ¾QNQIK SWG(TCP¼CKUGGP#HIJCPKUVCP2CTKU56HP1TKI$TQUEJWT//#)



.

%746+5,9/+.0',)6GVTCFTCEJOUQH4QOCP'I[RV.GCFGP'I[RVQ4QOCP6QMGP%QKPCIG 6JG%WTTGPE[QH'I[RVKPVJG(KHVJ%GPVWT[0CEJFTWEM0GY;QTMFGT#WUICDGP 5OKVGKPKIGP#DDWPF6HP-WPUVNGFGT//#)



&'/14)#0,6TCKV¾FGUOQPPCKGUITGSWGUGVTQOCKPGURCT'TPGUV$CDGNQP+++/QPPCKGUQTKGPVC NGU0WOKUOCVKSWGFGNC2GTUGCPVKSWG(CUEKEWNG2GTUKFG'N[OCKFG%JCTCE½PG2CTKU6GZV DCPF56CHGNDCPF6HP 6HP *CNDNGFGTOKVOCTOQTKGTVGP&GEMGNP  



6TCKV¾FGUOQPPCKGUITGSWGUGVTQOCKPGURCT'TPGUV$CDGNQP+++/QPPCKGUQTKGPVCNGU0WOKUOCVKSWGFG NC 2GTUG CPVKSWG  (CUEKEWNG &[PCUVKG 5CUUCPKFG 2CTKU  6GZVDCPF 5  6CHGNDCPF    6HP 6HP *CNDNGFGTOKVOCTOQTKGTVGP&GEMGNP  



6TCKV¾FGUOQPPCKGUITGSWGUGVTQOCKPGURCT'TPGUV$CDGNQP+++/QPPCKGUQTKGPVCNGU0WOKUOCVKSWGFG NC 2GTUG CPVKSWG  (CUEKEWNG #TUCEKFGU 2CTKU 6CHGNDCPF  6HP 6HP   6GZVDCPF HGJNV   *CNDNGFGTOKVOCTOQTKGTVGP&GEMGNP



.

&'50'7: , .GU V¾VTCFTCEJOGU F #MCPVJQU 5& CWU 4$0     5  6HP $TQUEJKGTV   //#)



.

&+664+%*-#PVKMG/ÒP\GPCWU1NDKCWPF2CPVKMCR·WO5NI,/KEJGTC2TCI5FCXQP 6HP)CP\NGKPGP



.

&4#)#018&6JG%QKPCIGQH%CD[NG5QRJKC56HP1TKI$TQUEJWT



.

&4'55'. * (ÒPH )QNFOGFCKNNQPU CWU FGO (WPFG XQP #DWMKT #WU FGP #DJCPFNWPIGP FGT MÌPKIN   RTGWUU#MCFGOKGFGT9KUUGPUEJCHVGPXQO,CJTG$GTNKP56HP-CTVQPKGTV//#) 



&417+0''UUCKFG&¾EJKHHTGOGPVFGU/QPPCKGUC.¾IGPFGU#TCO¾GPPGUFGNC%JCTCE½PG5&CWU FGT 40 2CTKU   5 6HP   %JTQPQNQIKG GV0WOKUOCVKSWGFGU4QKU+PFQ5E[VJGU5&CWU FGT402CTKU56HP+PGKPGO$CPFIGDWPFGPGKPKIG5GKVGPHNGEMKI-CTVQPKGTV



.

.

.

.

$GUKV\GTUVGORGN2TQH&T'WIGP9KNJGNO,GPCWPFGKP9KFOWPIUXGTOGTM

.

&7210651//'4 #41$'46 . .C F¾GUUG FG *K¾TCRQNKU %CUVCDCNC %KNKEKG  $KDNKQVJ½SWG   #TEJ¾QNQIKSWGGV*KUVQTKSWGFGN +PUVKVWV(TCP¼CKUF #TEJ¾QNQIKGF +UVCPDWN2CTKU5 6HP1TKI$TQUEJWT6GKNYGKUGWPCWHIGUEJPKVVGP//#)



.

'.#;+,'.#;+#).G/QPPC[CIGFGNCEKV¾2J¾PKEKGPPGFG5KFQP¯Ny¾RQSWGRGTUG5WRRN¾OGPV Pu¯6TCPUGWRJTCV½PG2CTKU$·PFG556HP1TKI$TQUEJWT  



.

(+5%*'4$155'4696JG#VJGPKCP&GECFTCEJO0WOKUOCVKE0QVGUCPF/QPQITCRJU0GY ;QTM:56HP.GKPGP

 29


ANTIKE - GRIECHEN

181

.

(144'4.6JG9GDGT%QNNGEVKQP)TGGM%QKPU8QNWOG+.QPFQP(TQPVKURK\:8+5 6HP&C\W8QNWOG+.QPFQP(TQPVKURK\:8+5QJPG6HP8QNWOG++.QPFQP 5QJPG6HP$·PFGKPWPVGTUEJKGFNKEJGO)CP\NGKPGPIGDWPFGP  



(4#0-'24&KGCPVKMGP/ÒP\GPXQP'RKTWU$CPF2QNGKU5V·OOGWPFGRKTQVKUEJGT$WPFDKU X%JT-CVCNQIWPF(QTUEJWPIGP9KGUDCFGP:85(CNVVCDGNNG-CTVG6HP1TKI )CP\NGKPGPICP\NGKPGPGT1TKI(CNVMCTVQP//#)  



&KGCPVKMGP/ÒP\GPXQP'RKTWU$CPF2QNGKU5V·OOGWPFGRKTQVKUEJGT$WPFDKUX%JT-CVCNQI WPF(QTUEJWPIGP9KGUDCFGP:85-CTVG6HPKO5EJWDGT)CP\NGKPGPOKVIQNFGPGT &GEMGNRT·IWPI  



.

(4#0-'24*+4/'4/&KGITKGEJKUEJG/ÒP\G/ÒPEJGP5GKPIGMNGDVG/ÒP\ HQVQITCHKGP/ÒP\CDD)CP\NGKPGP



.

(4''/#0 '# )GUEJKEJVG 5KEKNKGPU WPVGT FGP 2JÌPKMKGTP )TKGEJGP WPF 4ÌOGTP #WU FGO 'PINK   UEJGP ÒDGTUGV\V OKV GKPGT FKG $GUEJTGKDWPI FGT /ÒP\GP GPVJCNVGPFGP $GKICDG XQP ,QU 4QJTOQUGT   .GKR\KI:8+5OKV#DD(CNVMCTVG*CNDNGFGTOKPKOCNDGUVQ­GP



/KV'ZNKDTKU*QYCTF%.GXKUKP8QNWOG+FGTFKG6CHGNPDGKPJCNVGV

.

.

.

(4+6<' * XQP)#'$.'4 * 01/+5/# 7PVGTUWEJWPIGP CWH FGO )GDKGVG FGT CPVKMGP /ÒP\   MWPFG$CPF$GTNKP,GYGKNUOKV\WIGJÌTKIGP6HP$CPFHGJNV*CNDNGFGTGKPDCPF   &GT HGJNGPFG $CPF  * XQP (TKV\G 'NGMVTQPRT·IWPI XQP -[\KMQU 5KGJG - 4GINKPI  5NI 9CTTGP *CPU XQP   (TKV\GJCVFQTVFKG'NGMVTQP/ÒP\GPXQP-[\KMQUDGUEJTKGDGP



.

01/+5/#7PVGTUWEJWPIGPCWHFGO)GDKGVGFGTCPVKMGP/ÒP\MWPFG$CPF5GUVQU6GTKPC$GTQKC $GTNKP56HP)CP\NGKPGP



.

(4¤*.+%* % /QPPCKGU KPFQUE[VJGU GV KPFQRCTVJGU FW F¾RCTVGOGPV FGU /QPPCKGU /¾FCKNNGU GV   #PVKSWGU%CVCNQIWGTCKUQPP¾56HP1TKI$TQUEJWT#810(#4-#5&KG+MQPQITC RJKG FGT 2CTVJGTMÌPKIG #PJCPI 7PGFKGTVG ITKGEJKUEJG /ÒP\GP #KWF   5  6HP 1TI$TQ   UEJWT/KVJCPFUEJTKHVNKEJGT9KFOWPIWPFJCPFUEJTKHVNKEJGP$GUKV\GTXGTOGTM  



.

(41.18#0#6JG%QKPCIGQHVJG-KPIFQOQH$QURQTWU#&$#4+PVGTPCVKQPCN5GTKGU 1ZHQTF56HP1TKI$TQUEJWTGVYCUDGUEJ·FKIV//#)



.

6JG%QKPCIGQHVJG-KPIFQOQH$QURQTWU(TQOVJGHKTUVEGPVWT[$%VQVJGOKFFNGQHVJGHKTUVEGPVWT[ #&$#4+PVGTPCVKQPCN5GTKGU1ZHQTF56HP1TKI$TQUEJWT



.

&KGHTÒJG/ÒP\RT·IWPIXQO-KOOGTKUEJGP$QURQTQU&KG/ÒP\GPFGT5V·FVG2CPVKMCRCKQP6JGQFQUKC 0[ORJCKQPWPF2JCPCIQTKCUQYKGFGT5KPFGT$GTNKP56HP.GKPGP



.

(74690).'4#'/QPPCKGUITGSWGUGP)CWNG.GVT¾UQTF #WTKQNGVNGOQPPC[CIGFG/CUUCNKC CX,%6[RQU+++(TKDQWTI56HP.GKPGP



.

)ˆ$4+%+'.COQPGVC\KQPGFGNDTQP\QPGNNC5KEKNKCCPVKEC0&$QNQIPCFGT#WUICDG2CNGTOQ 8+56HP$TQUEJKGTV



.

)'+55'0#-CVCNQI#NGZCPFTKPKUEJGT-CKUGTOÒP\GPFGT5COONWPIFGU+PUVKVWVUHÒT#NVGTVWOUMWPFG FGT7PKXGTUKV·V\W-ÌNP2CR[TQNQIKEC%QNQPKGPUKC$CPFWPF1RNCFGP5OKV #DD5OKV#DD51TKI)CP\NGKPGP//#)  



&GT$CPFYWTFGXQP99'+5'4XGTHCUUV

30


ANTIKE - GRIECHEN

195

.

)+'5'%-' 9 5KEKNKC 0WOKUOCVKEC &KG )TWPFNCIGP FGU ITKGEJKUEJGP /ÒP\YGUGPU CWH 5KEKNKGP   .GKR\KI856HP1TKI*CNDNGKPGPDGUVQ­GP4ÒEMGPDGUEJ·FKIV//#)



.

5KEKNKC0WOKUOCVKEC&KG)TWPFNCIGPFGUITKGEJKUEJGP/ÒP\YGUGPUCWH5KEKNKGP.GKR\KI8 56HP)CP\NGFGTRTCEJVXQNNGT-QRHIQNFUEJPKVV//#)



.

+VCNKC 0WOKUOCVKEC 'KPG )GUEJKEJVG FGT KVCNKUEJGP )GNFU[UVGOG DKU \WT -CKUGT\GKV .GKR\KI  8+   56HP)CP\NGKPGPIQNFUEJYCT\G&GEMGNRT·IWPI



.

)+6.'4 *6#. 1 6JG %QKPCIG QH 2JKNKUVKC QH VJG HKHVJ CPF HQWTVJ EGPVWTKGU $% # UVWF[ QH VJG   GCTNKGUVEQKPUQH2CNGUVKPG%QNNG\KQPK0WOKUOCVKEJG/CKNCPF5OKVXKGNGP#DD.GKPGP



.

)¤$.4&QPWO$WTPU&KG-WUCPOÒP\GPKO/ÒP\MCDKPGVV$GTPWPFFKG%JTQPQNQIKG9KGP 56HP-CTVQPKGTV



.

)1.'0-1-8/ÒP\GPFGU,JCWU2QPVQUOKVTF/ÒP\CDDCWH6HP+P0WOKUOCVKMCK 'RKITCHKMC$CPF/QUMCW5OKV6GZVCDDWPF6HPKPTWUUKUEJGT5RTCEJG)CP\NGKPGP



.

)4#0&,'#0 % .GU /GUU¾PKGPU FG  CW GT UK½ENG FG PQVTG ½TG /QPPC[CIGU GV JKUVQKTG   #VJGP:8+++56HP1TKI$TQUEJWT



.

)4''09'.. 9 6JG GNGEVTWO EQKPCIG QH %[\KEWU .QPFQP  +8  5  6HP .GKPGP   //#)



.

)415'59%CVCNQIWGQHVJG/E.GCP%QNNGEVKQPQH)TGGM%QKPU$·PFG0CEJFTWEM%JKECIQ FGT#WUICDG%CODTKFIG:56HP56HP8+56HP .GKPGPOKPKOCNDGUVQ­GP  



.

)470#7'4810 *1'45%*'./#00 5 &KG /ÒP\RT·IWPI FGT .CMGFCKOQPKGT #/7)5    $GTNKP::++56HP.GKPGP//#)



.

)76/#00 (5%*9#$#%*'4 9 &KG 6GVTCFTCEJOGP WPF &KFTCEJOGPRT·IWPI XQP *KOGTC  

X%JT 5QPFGTCDFTWEMCWU/$0)  56HP1TKI$TQUEJWT



.

*##((2#XCPyV%CVCNQIWGQH'N[OCGCP%QKPCIG%C$%#&.QPFQPWPF2GPPU[NXC PKC8+5OKVXKGNGP#DD.GKPGP



.

*#*0 7 &KG (TCWGP FGU TÌOKUEJGP -CKUGTJCWUGU WPF KJTG 'JTWPIGP KO ITKGEJKUEJGP 1UVGPCPJCPF GRKITCRJKUEJGTWPFPWOKUOCVKUEJGT<GWIPKUUGXQP.KXKCDKU5CDKPC5CCTDTÒEMGT5VWFKGP\WT#TEJ·QNQ IKGWPF#NVGP)GUEJKEJVG5CCTDTÒEMGP51TKI$TQUEJWT//#)



.

*'#&$81PVJG%JTQPQNQIKECN5GSWGPEGQHVJG%QKPUQH'RJGUWU5&CWU0%.QPFQP2CTKU 8+56HP1TKIKPCN.GKPGPOKPKOCNDGUVQ­GP



.

*KUVQTKC0WOQTWO#OCPWCNQH)TGGMPWOKUOCVKEU#WHNCIG1ZHQTF.:::8+++5OKV XKGNGP6GZVCDD6HPKP*CNDNGFGTD·PFGPIGDWPFGPVCFGNNQUG'TJCNVWPI$8*'#&#IWKFGVQ VJGRTKPEKRCNEQKPUQHVJG)TGGMUHTQOEKTE$%VQ#&.QPFQP56HP1TKI )CP\NGKPGP  



*'4$'46 - 6JG ,QJP /CZ 9WNHKPI %QNNGEVKQP KP 9CUJKPIVQP 7PKXGTUKV[ #%0#% 0GY ;QTM   56HP)CP\NGKPGP//#)



.

31


ANTIKE - GRIECHEN .

*'4<('.&'4*.GUOQPPCKGUF CTIGPVFG4JGIKQPHTCRR¾GUGPVTGGVNGOKNKGWFW+8GUK¾ENGCX ,%2CTKU56HP)CP\NGFGTOKV-QRHIQNFUEJPKVVRTCEJVXQNNG'TJCNVWPI//#)



.

.GU OQPPCKGU F CTIGPV FG 4JGIKQP HTCRR¾GU GPVTG  GV NG OKNKGW FW +8G UK¾ENGCX,%2CTKU 56HP)CP\NGFGT//#)



.

*+..)(%QKPUQH#PEKGPV5KEKN[9GUVOKPUVGT(TQPVKURK\:85-CTVG6HP)CP\ NGFGT-QRHIQNFUEJPKVV//#)



.

*17)*610#%QKPUHTQOVJG5GNGWEKF'ORKTGHTQOVJG%QNNGEVKQPQH#TVJWT*QWIJVQP#%0#% 0GY;QTM:+856HP(CNVVHP)CP\NGKPGP//#)&C\W1&*118'4 %QKPU QH VJG 5GNGWEKF 'ORKTG HTQO VJG %QNNGEVKQP QH #TVJWT *QWIJVQP #%0#%  0GY ;QTM    :+++56HP)CP\NGKPGP  



.

%QKPUHTQOVJG5GNGWEKF'ORKTGHTQOVJG%QNNGEVKQPQH#TVJWT*QWIJVQP#%0#%0GY;QTM :+8(CNVVHP56HP)CP\NGKPGPOKPKOCNDGUVQ­GP//#)



.

+%#4&5&KEVKQPCT[QH)TGGMEQKPKPUETKRVKQPU0CEJFTWEM%JKECIQ PWOOGTKGTVG#WUICDG  FGT#WUICDG2CTKUQ,=?::+856HP)CP\NGKPGP



.

+/*11($.7/'4()TKGEJKUEJG/ÒP\GPKPFGOMÌPKINKEJGP/ÒP\MCDKPGVKO*CCIWPFKPCPFGTGP 5COONWPIGP$GTNKP56HP&KG2T·IQTVGFGT#DDCKVGT'RKMVGVGT)TKOGPQVJ[TKVGPWPF 6GOGPQVJ[TKVGP 5   &KG /ÒP\GP FGT -KNKDKCPGT KP .[FKGP  5  6H 5GKVGP NQUG    /CNNQU /¾ICTUQU #PVKQEJG FW 2[TCOQU 0CEJFTWEM %JKECIQ  FGT#WUICDG2CTKU5 6HP 2 )#4&0'4 #PEKGPV EQKPU KNNWUVTCVKPI NQUV OCUVGTRKGEGU QH ITGGM CTV %JKECIQ    .::8+++56HP7PVGTUEJKGFNKEJIGDWPFGP  



.

%JQKZFGOQPPCKGUITGESWGUFGNCEQNNGEVKQPFG(+OJQQH$NWOGT#WHNCIG2CTKU6HP)TQ­ HQNKQ-CTVQPKGTVDGUVQ­GP1DGTGTGEJVG'EMGIGMPKEMV$WEJDNQEMIGNÌUV//#)



219

.

2QTVT·VMÌRHGCWHCPVKMGP/ÒP\GPJGNNGPKUEJGTWPFJGNNGPKUKGTVGT8ÌNMGTOKV<GKVVCHGNPFGT&[PCUVKGPFGU #NVGTVWOUPCEJKJTGP/ÒP\GP.GKR\KI+856HP-CTVQPKGTV\YGK6HPNQUG



6CFGNNQUG'TJCNVWPI'ZNKDTKU&T*)4QGFGTUVGKPKO8QTUCV\

.

<WT ITKGEJKUEJGP WPF TÌOKUEJGP /ÒP\MWPFG +P4GXWG5WKUUGFG0WOKUOCVKSWG)GP¾XG$CPF:+8 56HP +PUIGUCOV56HP )CP\NGKPGP



.

#PVKMGITKGEJKUEJG/ÒP\GP+P4GXWG5WKUUGFG0WOKUOCVKSWG)GP¾XG$CPF:+:5 6HP +PUIGUCOV56HP )CP\NGKPGP



.

+056+6761+6#.+#01&+07/+5/#6+%# *TUI #VVKFGNEQPXGIPQFGNEGPVTQKPVGTPC\KQPCNGFK UVWFKPWOKUOCVKEK+  .C%KTEQNC\KQPGFGNNCOQPGVC#VGPKGUGKP5KEKNKCGKPOCIPC)TGEKC4QO ++  .COQPGVC\KQPGCTECKECFK*KOGTCHKPQCN#%4QO+++  .COQPGVC \KQPG FK DTQP\Q FK 2QUGKFQPKC  2CGUVWO 4QO  +8   .G GOKUUKQPK FGK EGPVTK UKEWNK HKPQ   #NNy'RQEC FK 6KOQNGQPVG G K .QTQ 4CRRQTVK EQP NC /QPGVC\KQPG FGNNG %QNQPKG )TGEJG FK 5KEKNKC 4QO   8  %QPVTKDWVK+PVTQFWVVKXKCNNQ5VWFKQFGNNC/QPGVC\KQPG'VTWUEC4QO8+  .G 1TKIKPKFGNNC/QPGVC\KQPGFK$TQP\QKP5KEKNKCGKPOCIPC)TGEKC4QO.C/QPGVCPGK%QPVGUVK #TEJGQNQIKEK GUGORK FCINK UECXK FK 4QOC #VVK &GNNy+PEQPVTQ FK 5VWFKQ 4QO  1TKI$TQUEJWT   OKPKOCNDGUVQ­GP  



+PFKGUGT8QNNUV·PFKIMGKVUGNVGPCPIGDQVGP

32


ANTIKE - GRIECHEN .

.G QTKIKPK FGNNC /QPGVC\KQPG FK $TQP\Q KP 5KEKNKC G KP /CIPC )TGEKC #VVK FGN XK EQPXGIPQ FGN EGPVTQ   KPVGTPC\KQPCNG FK UVWFK PWOKUOCVKEK  0CRQNK  #RTKNG  4QO5(CNVVHP#DD 1TKIKPCNDTQUEJWTOKPKOCNXGTH·TDV



/KV$GUKV\GTUVGORGN

.

+5+- ' (TÒJG 5KNDGTRT·IWPI KP 5V·FVGP 9GUVMNGKPCUKGPU 5EJTKHVGP \WT #TEJ·QNQIKUEJGP 0WOKUOCVKM   $CPF5CCTDTÒEMGP56HP1TKI$TQUEJWT&C\W'NGMVTQPUVCVGTGCWU-NC\QOGPCK 5CCTDTÒEMGT5VWFKGP\WT#TEJ·QNQIKGWPFCNVGP)GUEJKEJVG$CPF&GT5EJCV\HWPFXQP5CCTDTÒE MGP56HP1TKI$TQUEJWT  



,#/'510 4 %1..'%6+10 6QOG  /QPPCKGU )TGESWGU #PVKSWGU 6CHGNDCPF 2CTKU     6HP )TKGEJGP  (CNVOCRRG KP 1TKI *CNDNGKPGP 'KPDCPF GVYCU N·FKGTV 6QOG  5WKVG FGU /QPPCKGU   )TGESWGU CPVKSWGU GV KOR¾TKCNGU 4QOCKPGU 2CTKU  +:  5 6HP  4ÌOGT    

)TKGEJGP 1TKI$TQUEJWTWPCWHIGUEJPKVVGP6QOG5WKVGFGUOQPPCKGU)TGESWGUCPVKSWGUGVKOR¾ TKCNGU4QOCKPGU2CTKU56HP 4ÌOGT  )TKGEJGP 1TKI$TQUEJWTWPCWH IGUEJPKVVGP GKPKIG 6HP WPF FKG 'KPDCPFTÒEMUGKVG DGUEJ·FKIV WPF GVYCU UEJOWV\KI 9CUUGTUEJCFGP   7OUEJNCINQUGWPFDGUEJ·FKIV#  



.

,'0-+05 )-.'9+5 4$ %CTVJCIKPKCP )QNF CPF 'NGEVTWO %QKPU 405 5RGEKCN 2WDNKECVKQP    .QPFQP(TQPVKURK\56HP1TKI)CP\NGKPGPOKV7OUEJNCI#



.

,10)-''5 ,* 6JG -KOQPKCP &GMCFTCEJOU # %QPVTKDWVKQP VQ 5KEKNKCP 0WOKUOCVKEU 0CEJFTWEM   #OUVGTFCOFGT#WUICDG7VTGEJV56HP)CP\NGKPGP//#)



.

6JG-KOQPKCP&GMCFTCEJOU#%QPVTKDWVKQPVQ5KEKNKCP0WOKUOCVKEU0CEJFTWEM#OUVGTFCOFGT #WUICDG7VTGEJV5OKV#DD6HP)CP\NGKPGP4ÒEMGPWPFJKPVGTGT&GEMGNVGKNYGKUGCWU IGDNKEJGP//#)



.

-#&/#0 . 6JG %QKPU QH VJG ,GYKUJ 9CT QH  %' %QTRWU 0WOOQTWO 2CNCGUVKPGPUKWO PF   UGTKGU8QN,GTWUCNGO5-CTVGP6HP.GKPGP



.

6JGEQKPUQH#MMQ2VQNGOCKU%02+8,GTWUCNGO5OKV#DD6HP)CP\NGKPGP



.

-#4#;1618+6JG%QKPCIGQH/GUCODTKC8QN5KNXGTCPF)QNF%QKPUQH/GUCODTKC5Q\QRQN +85-CTVG6HP-WPUVNGFGT//#)



.

-'74'0(XCP6JG%QKPCIGQH*GTCENGC.WECPKCG#TEJCGQNQIKEC4QO56HP 1TKI$TQUEJWT//#)



.

5GJTUGNVGP

.

-+0&.'4 # %QKPU QH VJG NCPF QH +UTCGN %QNNGEVKQP QH VJG DCPM QH +UTCGN # ECVCNQIWG ,GTWUCNGO   +++5OKV\CJNTGKEJGP#DD.GKPGP&C\W.-#&/#06JG%QKPUQHVJG,GYKUJ9CTQH %'%QTRWU0WOOQTWO2CNCGUVKPGPUKWOPFUGTKGU8QN,GTWUCNGO5-CTVGP 6HP*CNDNGKPGP#4'+('0$'4)#PEKGPV,GYKUJ%QKPU#WHNCIG,GTWUCNGO56HP -WPUVNGKPGP  



.

-.'+0&5COONWPIXQPITKGEJKUEJGP-NGKPUKNDGTOÒP\GPWPF$TQP\GP0QOKUOCVC/CKNCPF 56HP-CTVQPKGTV//#)



.

-.'+0'4(501'526JG'CTN[%KUVQRJQTKE%QKPCIG050GY;QTM56HP )CP\NGKPGP//#)



.

-1%**#JQCTFQHEQKPUHTQOGCUVGTP2CTVJKC00/0GY;QTM/CNKDW+:5 6HP-CTVG1TKI)CP\NGKPGP



.

-4'/;&+5+%+.+#01756JG%QKPCIGQHVJG4QOCP%QNQP[QH&KQP$KDNKQVGECQHVJG*GNNGPKE 0WOKUOCVKE5QEKGV[#VJGP:8+++56HP.GKPGPOKV5EJWV\WOUEJNCI//#)



+PITKGEJKUEJGT5RTCEJG

.

.

-4+66 $ 5GNGWEKF %QKPU QH $CEVTKC %NCUUKECN 0WOKUOCVKE 5VWFKGU  .CPECUVGT2GPPU[NXCPKC    :5OKVGKPKIGP#DDWPF6HP1TKI)CP\NGKPGP&C\W&[PCUVKE6TCPUKVKQPUKPVJG%QKPCIG QH $CEVTKC #PVKQEJWU&KQFQVWU'WVJ[FGOWU %NCUUKECN 0WOKUOCVKE 5VWFKGU  .CPECUVGT2GPPU[NXCPKC   :85OKVGKPKIGP#DDWPF6HP1TKI)CP\NGKPGP  



.#%41+:..GUTGRTQFWEVKQPUFGUVCVWGUUWTNGUOQPPCKGU)TGESWGU.CUVCVWCKTGCTEJCÅSWGGVENCU UKSWG$KDNKQVJ½SWGFGNC(CEWNV¾FG2JKNQUQRJKGGV.GVVTGUFGN 7PKXGTUKV¾FG.K½IG0&FGT#WU ICDG.K½IG::++56HP51TKI$TQUEJWT//#)



5GJTUGNVGPGU9GTM

.

.

.' 4+&'4 ) &GWZ VT¾UQTU FG OQPPCKG ITGESWGU FG NC RTQRQPVKFG +8G UK½ENG CXCPV ,%  $KDNKQ   VJ½SWG#TEJ¾QNQIKSWGGV*KUVQTKSWGFGN +PUVKVWV(TCP¼CKUF #TEJ¾QNQIKGF +UVCPDWN2CTKU5 6HP)CP\NGKPGP



/QPPC[CIGGVHKPCPEGUFG2JKNKRRG++WP¾VCVFGNC3WGUVKQP/GNGVKOCVC#VJGP5-CTVG 6HP1TKI$TQUEJWT

 33


ANTIKE - GRIECHEN .

.

#PVKQEJGFG5[TKGUQWUNGU5¾NGWEKFGU%QTRWUFGUOQPPCKGUF QTGVF CTIGPV$CPF&G5¾NGWEQU+¯ #PVKQEJQU8E/¾OQKTGUFGN #ECF¾OKGFGU+PUETKRVKQPUGV$GNNGU.GVVTGUPQWXGNNGU¾TKG 2CTKU56HP1TKI$TQUEJWT//#)



.'0);'. . %JGHU& 1'WXTG FGU /QPPCKGU )TGESWGU /QPVTQWIG5GKPG   5  6HP    -CTVG0WOGTKGTVG#WUICDGKP(QNKQHQTOCV6GZVWPF6HPNQUGKP-CUUGVVG



#WHNCIGOKV'ZGORNCTGP

.

.'4/#009#VJGPCV[RGPCWHITKGEJKUEJGP/ÒP\GP/ÒPEJGP56HP*CNDNGFGT

.

.+$'41/#0)+'4+)8GNKCGNCUWCOQPGVC\KQPG.WICPQ56HP.GKPGP//#) &C\W8GNKCCPFKVUEQKPCIGªDGTUGV\WPIFGU6GZVGU(W­PQVGP 5 WPFFGU-CVCNQIGU  5 $TQUEJKGTV  



.+%*6'0$'4)'4#-WNVGWPF-WNVWTFGT&GMCRQNKU7PVGTUWEJWPIGP\WPWOKUOCVKUEJGPCTEJ·Q NQIKUEJGP WPF GRKITCRJKUEJGP <GWIPKUUGP #DJCPFNWPIGP FGU &GWVUEJGP 2CN·UVKPC8GTGKPU  9KGUDC   FGP:+56HPNQUG-CTVG)CP\NGKPGP



.

.14$'4%%#ORJKRQNKU6JG%KXKE%QKPCIGKP5KNXGTCPF)QNF.QU#PIGNGU(TQPVKURK\+8 -CTVG56HP.GKPGP//#)



.

/#%&10#.& &, %QKPU HTQO #RJTQFKUKCU $#4 5WRRNGOGPVCT[ 5GTKGU  1ZHQTF   5    6HP1TKI$TQUEJWT//#)



.

#P +PVTQFWEVKQP VQ VJG *KUVQT[ CPF %QKPCIG QH VJG -KPIFQO QH VJG $QURQTWU %NCUUKECN 0WOKUOCVKE   5VWFKGU0Q.CPECUVGT2GPPU[NXCPKC8++5OKVGKPKIGP#DDWPF-CTVGP)CP\NGKPGP



.

/#;,/(6JG%QKPCIGQH#DFGTC $% 4055RGEKCN2WDNKECVKQP.QPFQP:+ 56HP.GKPGP//#)



.



/KV'ZNKDTKU24(TCPMGKO8QTUCV\

.

/#;4#&KGCPVKMGP/ÒP\GPFGT+PUGNP/CNVC)Q\QWPF2CPVGNNGTKC/ÒPEJGP56H FC\W#8105#..'6'KPKIGWPGFKTVGQFGTOGTMYÒTFKIGWPVGTKVCNKUEJGWPFUKEKNKUEJG/ÒP\GP5 OKVYGPKIGP#DD5GRCTCVCDFTWEM'KP)QNFUVCVGTFGTVCWTKUEJGP%JGTUQPGUWU56H &KG·NVGUVGP6GVTCFTCEJOGPFGT#TUCEKFGP52GTVKPCZ%CGUCT56H&KG CPIGDNKEJGP/ÒP\GPXQP5QNNKWO#ECTPCPKCG56H-COPCUMKTGUWPFUGKPG&[PCUVKG5 &KG/ÒP\GPFGT-ÌPKIGXQP%JCTCEGPG5$&'-1'*0'.GVVTG±/QPUKGWT ,;QPIG#MGTOCP5V2GVGTUDWTI56H#010;/6JG%QKP%JCTV/CPWCN0WT /ÒP\WPF$CPMPQVGPCDD/,5#$#6+'4/QPPCKGU4QOCKPGUFG$TQP\G56H%CVC NQIWG QH VJG %CDKPGV QH XCNWCDNG CPF TCTG ITGGMEQKPU5QVJGD[9KNMKPUQP*QFIG5%QN NGEVKQP FG / 2TQURGT &WRT¾ 2CTKU  8+++  5  6HP +P GKPGO $CPF IGDWPFGP *CNDNGKPGP   $WEJDNQEMNQUG4ÒEMGPNGKEJVGKPIGTKUUGP



.

/'5*14'4;#PEKGPV,GYKUJ%QKPCIG$·PFG0GY;QTM56HP56HP )CP\NGKPGP\CJNTGKEJG#PUVTGKEJWPIGP#POGTMWPIGPKO6GZVWPFCWHFGP6HP  



.

/'5*14'4;3'&#456JG%QKPCIGQH5COCTKPCKPVJG(QWTVJ%GPVWT[$%',GTWUCNGO  5 OKV XKGNGP #DD  6HP .GKPGP  5COCTKCP %QKPCIG 0WOKUOCVKE UVWFKGU CPF TGUGCTEJGU    ,GTWUCNGO5OKVGKPKIGP#DD6HP.GKPGP  



/'50+.&7$7+55104FW6GUU½TGUGVOQPPCKGUFG2CNO[TG+PXGPVCKTGFGUEQNNGEVKQPUFW%CDK PGVFGU/¾FCKNNGUFGNC$KDNKQVJ½SWG0CVKQPCNG6GZVDCPF2CTKU5#DD)CP\NGKPGP 6GUU½TGU GV OQPPCKGU FG 2CNO[TG FG NC $KDNKQVJ½SWG 0CVKQPCNG  2CTKU %CDKPGV FGU /¾FCKNNGU GV #PVK   SWGU6CHGNDCPF2CTKUNQUG6HPKP*CNDNGKPGP/CRRG  



/+.&'0$'4) .*746'4 5 6JG #TVJWT 5 &GYKPI %QNNGEVKQP QH )TGGM %QKPU #%0#%     $·PFG0GY;QTM(TQPVKURK\:++56HP+P$·PFGPKP1TKI)CP\NGKPGPKOICP\NGK PGPGP5EJWDGT//#)  



.

/+.0',)-QNQRJQPCPFKVUEQKPCIG#UVWF[00/0GY;QTM56HP)CP\NGK PGPOKV-QRHIQNFUEJPKVV



.

/+100'66'&GUETKRVKQPFGO¾FCKNNGUCPVKSWGUITGESWGUGVTQOCKPGUCXGENGWTFGIT¾FGTCTGV¾GV NGWT GUVKOCVKQP  $·PFG  5WRRNGOGPVD·PFG  6CHGNDCPF WPXGT·PFGTVGT 0CEJFTWEM )TC\    FGT 1TKIKPCNCWUICDGP 2CTKU  +P GKPJGKVNKEJGO )CP\NGKPGP KP  $·PFGP IGDWPFGP //#)    &C\W # $176-195-+).+0-# 2GVKV /KQPPGV FG 2QEJG QW 4¾RGTVQKTG 2TCVKSWG $GTNKP   5*CNDNGFGTOKPKOCNDGUVQ­GP  



.

.

/KQPPGV JCV UKEJ KP FKGUGO UGJT UGNVGPGP 9GTM CWH FKG$GUV·PFGFGT$KDNKQVJ½SWG0CVKQPCNGIGUVÒV\V+OOGTPQEJ YKEJVKIHÒTFKG$GUVKOOWPIXQPITKGEJKUEJGP$TQP\GPFGTTÌOKUEJGP-CKUGT\GKV

.

34

/+6%*+0'4/+PFQ)TGGMCPF+PFQ5E[VJKCP%QKPCIG$·PFG.QPFQP%.:::+8 5\CJNTGKEJG6GZVCDD-QORNGVVKP1TKI$TQUEJWT//#)  




ANTIKE - GRIECHEN .

6JGGCTN[%QKPCIGQH%GPVTCN#UKC%QPVGORQTCTKGUQHVJG+PFQ)TGGMU4$9*+6'*'#&%CVCNQIWG QHEQKPUKPVJGRCPLCDOWUGWO.CJQTG#%700+0)*#/%QKPUQH/GFKCGXCN+PFKC%QKPUQH#NGZ CPFGT UUWEEGUUQTU  



.

/15%**%XQP$KNFGT\WO4WJOG#VJGPU#URGMVGFGU5V·FVGNQDUKPFGTMCKUGT\GKVNKEJGP/Ã&#x2019;P\ RT·IWPI#VJGPU0QOKUOCVC/CKNCPF5FCXQP6HP-CTVQPKGTV#



.

/17%*/180##PVKEPVGOQPGVKPC$CNMCPUMKLCRQNWQUVTQXKOQPGVKVGPCDWNICTUEMKVGECTG(QVQ MQRKGFGT#WUICDG5QHKC::56HP)CP\NGKPGP



.

/1756#-##-WNVGWPF/[VJGPCWHVJGUUCNKUEJGP/Ã&#x2019;P\GP$GKVT·IG\WT#TEJ·QNQIKG9Ã&#x2019;T\DWTI 56HP1TKI$TQUEJWT//#)



.

/ª..'4.0WOKUOCVKSWGF #NGZCPFTGNGITCPF5WKXKGF WPCRRGPFKEGEQPVGPCPV.GUOQPPCKGUFG 2JKNKRRG ++ GV +++ 0& $CUGN5VWVVICTV  7PXGT·PFGTVGT 0CEJFTWEM FGT  KP -QRGPJCIGP DGK   $KCPEQ.WPQGTUEJKGPGPGP#WUICDG5OKV#DD)CP\NGFGT4Ã&#x2019;EMGPIGTKPIHÃ&#x2019;IKICWUIGDNKEJGP



/ª056'4$'4) 4 &KG $GCOVGPPCOGP CWH FGP ITKGEJKUEJGP /Ã&#x2019;P\GP )GQITCRJKUEJ WPF CNRJCDG   VKUEJ IGQTFPGV  6GKNG WPF 0CEJVTCI KP GKPGO $CPF 5WDUKFKC 'RKITCRJKEC  *KNFGUJGKO0GY ;QTM   5555*CNDNGKPGP#



.

/7041*#; 5% %QKPCIG QH #TCDKC (GNKZ 6JG RTGKUNCOKE EQKPCIGQHVJG;GOGP0QOKUOCVC /CKNCPF56HP-CTVQPKGTV#



.

/¦4-*1./1'CTN[*GNNGPKUVKE%QKPCIGHTQOVJG#EEGUUKQPQH#NGZCPFGTVQVJG2GCEGQH#RCOGC

$% %CODTKFIG::++56HP-CTVGP.GKPGP./ª..'40WOKUOCVK SWGF #NGZCPFTGNG)TCPFUWKXKGF WPCRRGPFKEGEQPVGPCPVNGUOQPPCKGUFG2JKNKRRG++GV+++0CEJFTWEM $CUGN5VWVVICTV  FGT #WUICDG -QRGPJCIGP   6HP .GKPGP ) -.'+0'4 #NGZCPFGTU   4GKEJUOÃ&#x2019;P\GP #DJCPFNWPIGP FGT FGWVUEJGP #MCFGOKG FGT 9KUUGPUEJCHVGP \W $GTNKP ,CJTICPI    0T$GTNKP56H$TQUEJKGTVDGUVQ­GP'60GYGNN520QG6JG#NGZCPFGT%QKPCIG QH5KE[QP0WOKUOCVKEUVWFKGU0Q0GY;QTM56HP)CP\NGKPGPCWHFGTGTUVGP5GKVG 9CUUGTUEJCFGP  



.

5VWFKGUKPVJG%QKPCIGQH#PVKQEJWU+8QH5[TKC&GV-QPIGNKIG&CPUMG8KFGPUMCDGTPGU5GNUMCD*KUVQ TKUMHKNQUQHKUMG/GFFGNGNUGT-QRGPJCIGP56HP.GKPGP//#)



.

/¦4-*1./1<#*.',6JG%QKPCIGQH-WRTNNK#0WOKUOCVKECPF#TEJCGQNQIKECN5VWF[+P #EVC #TEJCGQNQIKEC    5  1TKI$TQUEJWT OKPKOCN DGUVQ­GP -PKEMURWT CWH FGO 'KP   DCPF



.

6JG %QKPCIGU QH VJG .[EKCP &[PCUVU -JGTKIC -JGT¿K CPF 'TDDKPC # 0WOKUOCVKE CPF #TEJCGQNQIKECN   5VWF[5&CWU#EVC#TEJCGQNQIKEC  5OKV6HP$TQUEJKGTV



.

0#8+..'..GU/QPPCKGUF QTFGNC%[T¾PCÃ&#x2026;SWGFG¯CXCPV,%%QPVTKDWVKQPCN ¾VWFGFGU OQPPCKGU)TGESWGUCPVKSWGU)GP½XG(TQPVKURK\5OKV#DD6HP)CP\NGFGT-QRHIQNF UEJPKVVVCFGNNQUGT<WUVCPF//#)



0'9'..'60WOKUOCVKEPQVGUCPFOQPQITCRJU00/0GY;QTM $CPFKP*CNDNGFGT$CPFKP$TQUEJWT  



.

.

$CPFYWTFGXQP4$5'#)'4XGTHCUUV

.

6JG %QKPCIGU QH &GOGVTKWU 2QNKQTEGVGU .QPFQP  +:  5  6HP $NCWGT )CP\NGFGTGKPDCPF   -QRHIQNFUEJPKVV4Ã&#x2019;EMGPCWUIGDNKEJGPCPUQPUVGPJGTXQTTCIGPFG'TJCNVWPI//#)



.

6JG %QKPCIG QH VJG 'CUVGTP 5GNGWEKF /KPVU HTQO 5GNGWEWU + VQ #PVKQEJWU +++ 05  0CEJFTWEM 0GY   ;QTMFGT#WUICDG0GY;QTM+:56HP-CTVG-CTVQPKGTV6JG%QKPCIGQH VJG 9GUVGTP 5GNGWEKF /KPVU HTQO 5GNGWEWU + VQ #PVKQEJWU +++ 05  0CEJFTWEM 0GY ;QTM  FGT   #WUICDG0GY;QTM+:56HP-CTVG-CTVQPKGTV  



.

6JG%QKPCIGQHVJG9GUVGTP5GNGWEKF/KPVUHTQO5GNGWEWU+VQ#PVKQEJWU+++050GY;QTM 0CEJFTWEMFGU1TKIKPCNUXQP+:56HP-CTVG)CP\NGKPGP#



.

6JG %QKPCIG QH VJG 'CUVGTP 5GNGWEKF /KPVU HTQO 5GNGWEWU + VQ #PVKQEJWU +++ 05  0CEJFTWEM 0GY   ;QTMFGT#WUICDG0GY;QTM+:56HP-CTVG-CTVQPKGTV6JG%QKPCIGQH VJG 9GUVGTP 5GNGWEKF /KPVU HTQO 5GNGWEWU + VQ #PVKQEJWU +++ 05  0CEJFTWEM 0GY ;QTM  FGT   #WUICDG0GY;QTM+:56HP-CTVG-CTVQPKGTV6JG5GNGWEKF/KPVQH#PVKQEJ 0CEJFTWEM%JKECIQFGT#WUICDG0GY;QTM5OKVGKPKIGP#DD6HP)CP\MWPUVNG FGTOKPKOCNDGUVQ­GP#  



.

6JG%QKPCIGQHVJG'CUVGTP5GNGWEKF/KPVUHTQO5GNGWEWU+VQ#PVKQEJWU+++050GY;QTM 0CEJFTWEMFGU1TKIKPCNUXQP+:56HP-CTVG)CP\NGKPGP#



.

0'9'..'601'2/ª..'4.0GYGNN  4Q[CNITGGMRQTVTCKVEQKPU6JGUGNGWEKFEQKPC IGUQH6[TG6JGRGTICOGPGOKPVWPFGT2JKNGVCGTWU0QG  6JG#NGZCPFGTEQKPCIGQH5KE[QP/Ã&#x2019;NNGT

 0WOKUOCVKSWGF #NGZCPFTGNGITCPF  

 35


ANTIKE - GRIECHEN .

01'526JG/GPFG -CNKCPFTC *QCTF00/0GY;QTM56HP1TKI$TQUEJWT DGUVQ­GP4ÒEMGPGKPIGTKUUGP//#)



.

6JGEQKPCIGQH/GVTCRQPVWO$CPF 0GY;QTM56HP(TQPVKURK\56HP +PGKPJGKVNKEJGO*CNDNGFGTKP$·PFGPIGDWPFGP  



.

6JG %QKPCIG QH %CWNQPKC 05  0GY ;QTM   5  6HP 4QVGT)CP\NGFGTGKPDCPF-QRHIQNF UEJPKVV4ÒEMGPOKPKOCNCWUIGDNKEJGP//#)



.

6JG%QKPCIGQH%CWNQPKC050GY;QTM56HP)CP\NGFGT-QRHIQNFUEJPKVV4ÒEMGP CWUIGDNKEJGP//#)



.

01'52,1*05610#6JGEQKPCIGQH/GVCRQPVWO00/WPF6GKNGFCXQP6GKN WPFCNU0CEJFTWEM0GY;QTMFGT#WUICDGP0GY;QTM6GKN0GY;QTM+: 5OKV#DD6HP+:56HP1TKI)CP\NGKPGP#  



01'5-' *% &KG /ÒP\GP FGT 2VQNGO·GT *KUVQTKUEJGU /WUGWO (TCPMHWTV CO /CKP (TCPMHWTV   5OKVXKGNGP#DD1TKI$TQUEJWTOKPKOCNDGUVQ­GP



.

8GTITKHHGP

.

1.%#;05';4+)*.GVT¾UQTFG/GMVGRKPKGP2JT[IKG6T¾UQTUOQP¾VCKTGU5¾NGWEKFGU2CTKU 5OKV6GZVCDD6HP1TKI$TQUEJWT6GKNYGKUGWPCWHIGUEJPKVVGP//#)



.

2#2#)'14)+#&17$#0+5%6JG%QKPCIGQH-GC/GNGVKOCVC#VJGP8+++5 6HP1TKI$TQUEJWT//#)



.

2'6419+%< # 4KVVGT XQP 5COONWPI 2GVTQYKE\ #TUCEKFGP/ÒP\GP9KGP8+5 6HP4QVGT*CNDNGFGTGKPDCPFOKVOCTOQTKGTVGP2CRKGTWPF6KVGNKP)QNFRT·IWPI



5GJTUEJÌPGU'ZGORNCTFGT1TKIKPCNCWUICDG0WT'ZGORNCTGFKGUGT#WHNCIG

.

5COONWPI 2GVTQYKE\ #TUCEKFGP/ÒP\GP0CEJFTWEM)TC\FGT#WUICDG9KGP8+5 6HP.GKPGP



.

21665&66JG2TG+UNCOKE%QKPCIGQH'CUVGTP#TCDKC%QRGPJCIGP5OKV6GZVCDD )GDWPFGP



.

24+%'/6JG%QKPCIGKPVJG0COGQH#NGZCPFGTVJG)TGCVCPF2JKNKR#TTJKFCGWU#$TKVKUJ/WUGWO %CVCNQIWG$·PFG<ÒTKEJ.QPFQP556HP)CP\NGKPGPVCFGNNQUGT<WUVCPF //#)  



.

24+%'/9#))10'40#TEJCKE)TGGM%QKPCIG6JG#U[WV*QCTF.QPFQP5 6HP(CNVMCTVG-CTVQPKGTV//#)



.

241-1218+&KG5KNDGTRT·IWPIFGT+PUGN6JCUQUWPFFKG6GVTCFTCEJOGPFGUVJCUKUEJGP6[RUXQO ,CJTJWPFGTVX%JT$GTNKP5-CTVG6HP)CP\NGKPGP



.

251/# 5 1N[PVJG GV NGU %JCNEKFKGPU FG 6JTCEG 'VWFGU FG 0WOKUOCVKSWG GV &yJKUVQKTG 5VWVVICTV   56HP-CTVG



.

4#8'.1'6JG%QNVUQH#ODTCEKC00/0GY;QTM56HP)CP\NGKPGPOKV -QRHIQNFUEJPKVV//#)



.

6JG%QNVUQH#ODTCEKC00/0GY;QTM56HP1TKI$TQUEJWTOKPKOCNDGUVQ ­GP//#)



.

0WOKUOCVKSWG )TGESWG (CNUKHKECVKQPU OQ[GPU RQWT NGU TGEQPPCKVTG  #WHNCIG .QPFQP  FGU 5&   CWU FGT 40   5  6HP *CNDNGKPGP NGKEJV DGUVQ­GP 6CHGNVGKN NÌUV UKEJ CWU FGT $KPFWPI   //#)



.

&GUETKRVKXG %CVCNQIWG QH 6JG %QNNGEVKQP QH 6CTGPVKPG %QKPU HQTOGF D[ /2 8NCUVQ .QPFQP    (TQPVKURK\:+56HP)CP\NGFGT-QRHIQNFUEJPKVVUGJTUEJÌPGU'ZGORNCT//#)



.

.GU RQWNCKPU FG %QTKPVJG /QPQITCRJKG FGU UVCV½TGU %QTKPVJKGPU $CPF  &G  C  CX ,%   .QPFQP   5 6HP  )TÒPGT )CP\NGFGTGKPDCPF 4ÒEMGP NGKEJV CWUIGDNKEJGP CPUQPVGP   CWUIG\GKEJPGVGTJCNVGP//#)



.

.GU RQWNCKPU FG %QTKPVJG /QPQITCRJKG FGU UVCV½TGU %QTKPVJKGPU $CPF  &G  C  CX ,%   .QPFQP56HP)CP\NGKPGP2CRKGTNGKEJVIGDT·WPV



.

.GU2QWNCKPUFG%QTKPVJG/QPQITCRJKGFGU5VCV½TGU%QTKPVJKGPU$CPFWPF0CEJFTWEM%JKECIQ FGT#WUICDG$CUGNWPF.QPFQP56HP+PGKPGO$CPFKP.GKPGPIGDWP FGP



4').+0) - 6GTKPC  2TQITCOO \WO 9KPEMGNOCPPUHGUVG FGT #TEJCGQNQIKUEJGP )GUGNNUEJCHV \W   $GTNKP$GTNKP56HP*CNDGKPGPOKPKOCNDUGVQ­GP/KV#PUVTGKEJWPIGPKO6GZVWPFCWH FGP6CHGNP



.

36


ANTIKE - GRIECHEN .

&KG ITKGEJKUEJGP /ÒP\GP FGT 5COONWPI 9CTTGP 6GZV WPF 6CHGNDCPF $GTNKP  8+++  5 6HP<YGKPGWGTG*CNDNGFGTD·PFGOKV4ÒEMGPXGTIQNFWPIKO5VKNFGT<GKV  



/KV \CJNTGKEJGP /ÒP\GP CWU 'NGMVTQP \$ XQP %[\KEWU DGUEJTKGDGP XQP *CPU XQP (TKV\G  5VÒEMG CNNG OKV   #DDKO6CHGNDCPF 

.

4'+0#%* #, .C DCUG CWZ VTQRJ¾GU FG &¾NQU GV NGU OQPPCKGU FG 2JKNKRRG #PFTKUMQU 5& CWU   ,QWTPCN KPVGTPCVKQPCN F CTEJ¾QNQIKG PWOKUOCVKSWG #VJ½PGU 5GKVGP  OKV 6GZVCDD WPF    6HPOKV/ÒP\CDD*CNDNGFGTOKV/CTOQTRCRKGT



.

41$'46.8KNNGUF #UKGOKPGWTG'VWFGUFGI¾QITCRJKGCPEKGPPG#WHN2CTKU5 6HP.GKPGP//#)



.

/QPPCKGUCPVKSWGUGP6TQCFG)GP½XG2CTKU56HP/QPPCKGUITGESWGU6[RGUN¾IGP FGU OCIKUVTCVU OQP¾VCKTGU GV I¾QITCRJKG )GP½XG2CTKU   5  6HP &QEWOGPVU FG N #UKG   OKPGWTGOGTKFKQPCNG+PUETKRVKQPUOQPPCKGUGVI¾QITCRJKG)GP½XG2CTKU56HP1TKI $TQUEJWT//#)  



# VTCXGTU N #UKG OKPGWTG 2Q½VGU GV RTQUCVGWTU OQPPCKGU ITGESWGU XQ[CIGWTU GV I¾QITCRJKG $KDNKQ   VJ½SWGFGU¾EQNGU(TCP¼CKUGUF #VJGPGUGVFG4QOG2CTKU8+++5OKV#DD1TKI$TQ UEJWTWPCWHIGUEJPKVVGP//#)



.

&QEWOGPVUFyCUKGOKPGWTG$KDNKQVJ½SWGFGU¾EQNGU(TCP¼CKUGUF #VJGPGUGVFG4QOG(CU\KMGNDKU 2CTKU8+++5OKV#DD1TKI$TQUEJWTVGKNYGKUGWPCWHIGUEJPKVVGP



.

41$'46.WPF,(QWKNNGUF #O[\QPGP%CTKG$CPF'ZRNQTCVKQP*KUVQKTG/QPPCKGUGV+PUETKR VKQPU2CTKU8+++5OKV#DD1TKI$TQUEJWTVGKNYGKUGWPCWHIGUEJPKVVGP



.

41$'46594*'#&$86JGCPEKGPV$QGQVKCPUCPFVJGEQKPCIGQH$QGQVKC0CEJFTWEM%JKECIQ FGT#WUICDGP%CODTKFIGWPF.QPFQP:556HP.GKPGP



.

41$+0510&/#*QCTFQH5KNXGT%QKPUHTQO%CT[UVWU00/0GY;QTM56HP 1TKI$TQUEJWT



.

41$+0510 '5)%#5641 *+2¡.+61 / # %CVCNQIWG QH VJG %CNQWUVG )WNDGPMKCP%QNNGEVKQP QH)TGGM%QKPU$·PFG.KUDQC56HPKO5EJWDGT56HPKO5EJW DGT.GKPGP//#)  



.

4155*1..19#;46JG6JKTVGGP/QPVJU%QKPCIGQH*KGTQP[OQUQH5[TCEWUG#/7)5$GTNKP ::+++56HPKP$GKNCIG.GKPGP//#)



.

4155 *1..19#; 4,'0-+05 )- 'Z CPVKSWKVCVG PWOOK 6GTKPC $GNNKP\QPC   5   FCXQP6HP)CP\NGKPGP//#)



.

415619<'9/6GUUGTCTWOWTDKU4QOCGGVUWDWTDKRNWODGCTWO5[NNQIG0CEJFTWEM.GKR\KI FGT#WUICDG5V2GVGTUDWTI6GZVDCPF+:5OKV#DD5WRRNGOGPV+856HP 6CHGNDCPFKO(QNKQHQTOCV6HP/QFGTPGU)CP\NGKPGP



.

4766'4 0- %CORCPKCP %QKPCIGU  $% 'FKPDWTIJ  8+++  5  6HP .GKPGP   //#)



.

54564¤//#5VWF[KPVJG%QKPCIGQHVJG/COGTVKPGU$CUGN.WPF:856HP .GKPGP//#)



.

5#..'6#8&KG0CEJHQNIGT#NGZCPFGTUFGU)TQUUGP+P$CMVTKGPWPF+PFKGP$GTNKP+8 56HP*CNDNGKPGPMNGKPGT9CUUGTTCPFCPFGPWPVGTGP5GKVGPT·PFGTP



.

5#7.%;(FG0WOKUOCVKSWGFGNC6GTTG5CKPVG&GUETKRVKQPFGUOQPPCKGUCWVQPQOGUGVKOR¾TKCNGU FGNC2CNGUVKPGGVFGN #TCDKGR¾VT¾2CTKU:856HP*CNDNGFGT



.

5%*.155'4,XQP$GUEJTGKDWPIFGTCNVITKGEJKUEJGP/ÒP\GP$CPF6JGUUCNKGP+NN[TKGP&CNOC VKGPWPFFKG+PUGNPFGUCFTKCVKUEJGP/GGTGU'RGKTQU=OGJTPKEJVGTUEJKGPGP?9KGP:+5 6HP.GKPGP//#)



$GUEJTGKDWPI FGT CNVITKGEJKUEJGP /ÒP\GP $CPF  6JGUUCNKGP +NN[TKGP &CNOCVKGP WPF FKG +PUGNP FGU   CFTKCVKUEJGP/GGTGU'RGKTQU=OGJTPKEJVGTUEJKGPGP?9KGP:+56HP-CTVQPKGTVVGKN YGKUGWPCWHIGUEJPKVVGP#WHFGPGTUVGP\YGK5GKVGPUVQEMHNGEMKI//#)



5%*¤0'46)'+55')TKGEJKUEJGU/ÒP\YGTM&KG/ÒP\RT·IWPIXQP$[\CPVKQP6GKN#WVQPQOG <GKV5EJTKHVGP\WT)GUEJKEJVGWPF-WNVWTFGT#PVKMG6GZVWPF6CHGNDCPF$GTNKP#OUVGTFCO 856HPKP(CNVOCRRG1TKI$TQUEJWT Z *CNDNGKPGP Z   



)TKGEJKUEJGU/ÒP\YGTM&KG/ÒP\RT·IWPIXQP$[\CPVKQP6GKN-CKUGT\GKV5EJTKHVGP\WT)GUEJKEJVG WPF-WNVWTFGT#PVKMG6GZVWPF6CHGNDCPF$GTNKP#OUVGTFCO56HPKP(CNVOCRRG 1TKI$TQUEJWT Z *CNDNGKPGP Z   



)TKGEJKUEJGU /ÒP\YGTM &KG /ÒP\RT·IWPI XQP /CTQPGKC 5EJTKHVGP \WT )GUEJKEJVG WPF -WNVWT FGT   #PVKMG6GZVWPF6CHGNDCPF$GTNKP5OKV-CTVGP6HPKP(CNVOCRRG*CNDNGKPGP

 



.

.

/KV$GUKV\GTUVGORGN&T(:9GK\KPIGT%QCWHFGO6KVGNDNCVV

.

.

.

37


ANTIKE - GRIECHEN .

5%*9#$#%*'49&KG6GVTCFTCEJOGPRT·IWPIXQP5GNKPWPV5&CWU/$0)  5 6HP6CHGNPNKGIGPFQRRGNVXQT*CNDNGKPGP



/KVJCPFUEJTKHVNKEJGT9KFOWPIFGU8GTHCUUGTU

.

5'..911&&#P+PVTQFWEVKQPVQVJG%QKPCIGQH2CTVJKC.QPFQP5OKVGKPKIGP#DD 6HP1TKI)CP\NGKPGP#P+PVTQFWEVKQPVQVJG%QKPCIGQH2CTVJKC#WHNCIG.QPFQP5 6HP1TKI)CP\NGKPGP  



.

5'0+144%+PFQ5E[VJKCP%QKPUCPF*KUVQT[.CPECUVGT 8QNWOG)CP\NGKPGP  



.

5+/10'66#$6JG%QKPUQHVJG%CRRCFQEKCP-KPIU6[RQU(TKDQWTI56HP)CP\ NGKPGP//#)



.

56#4%-; ,%#3716 # 4GEWGKN FGU VGUU½TGU FG 2CNO[TG +PUVKVWV (TCP¼CKU F #TEJ¾QNQIKG FG   $G[TQWVJ$KDNKQVJ½SWG#TEJ¾QNQIKSWGGV*KUVQTKSWG2CTKU:56HP1TKI$TQUEJWT 7PCWHIGUEJPKVVGP//#)



.

56#44%)#VJGPKCP%QKPCIG$%1ZHQTF8+++56HP)CP\NGKPGP//#) 



.

58141015,0.GUOQPPCKGUF #VJ½PGU6GTOKP¾CRT½UNCOQTVFGN CWVGWTRCT$2+%-/ÒPEJGP :+:56HP)TQ­HQNKQ*CNDNGFGT5GKVGPYWTFGPGKPJGKVNKEJPGWGKPIGDWPFGP//#) 



2TCEJVXQNNGU'ZGORNCTFKGUGUUGNVGPGP9GTMGU

.

5;..1)' 07//147/ )4#'%147/ $'.)+'0 .C %QNNGEVKQP FG $TQP\GU )TGEU FG /CTE   $CT$TÒUUGN5OKVXKGNGP#DD)CP\NGKPGP



.

5;..1)' 07//147/ )4#'%147/ $7.)#4+'0 $QDQMQX $TQU %QNNGEVKQP 6JTCEG    /QGUKC+PHGTKQT$CPF&GWNVWO4WUG5FCXQP6HP-CTVQPKGTVOKPKOCNDGUVQ­GP



.

5;..1)'07//147/)4#'%147/&0'/#4-$·PFG*GHVG#GVQNKGP-QTKPVJ -QRGPJCIGP*GHVG2JNKCUKC$KVJ[PKC-QRGPJCIGP*CNDNGKPGP  



.

$·PFG#GQNKU.GUDQU6TQCU'I[RV6JG2VQNGOKGU%QRGPJCIGP(QNKQ1TKI$TQUEJWT

 



.

6JG4Q[CN%QNNGEVKQPQH%QKPUCPF/GFCNU&CPKUJ0CVKQPCN/WUGWO8QNU+VCN[CPF5KEKN[XQNU 6JTCEGCPF/GCEGFQPKCXQNU)TGGEG6JGUUCN[VQ#GIGCP+UNCPFUXQNU$QURQTWU VQ.GUDQUXQNU+QPKC%CTKCCPF.[FKCXQNU2JT[IKGVQ%KEKNKCXQNU%[RTWUVQ +PFKC XQNU  'I[RV 6JG 2VQNGOKGU #NGZCPFTKC%[RTGPCKEC 0QTVJ #HTKEC5[TVKEC/CWTGVCPKC   5RCKP)CWN8QNU9GUV/KNHQTF8QNU0CEJFTWEM9GUV/KNHQTFFGT-QRGPJCIG PGT1TKIKPCNCWUICDG(QNKQ+P$·PFGPKPGKPJGKVNKEJGO)CP\NGKPGPIGDWPFGPVCFGNNQUGT<WUVCPF  



.

$CPF  6JG *CTV %QNNGEVKQP $NCEMDWTP /WUGWO 1ZHQTF   6HP -CTVQPKGTV QDGTG 'EMG FGU   &GEMGNUKUVOKVYGK­GT(CTDGDGUEJOWV\VCPUQPUVGPVCFGNNQUGT<WUVCPF



.

5;..1)'07//147/)4#'%147/&'765%*.#0&5VCCVNKEJG/ÒP\UCOONWPI/ÒPEJGP $CPF$GTNKP+PGKPGO$CPFKP*CNDNGFGTIGDWPFGPVCFGNQUGU'ZGORNCT



.

5VCCVNKEJG /ÒP\UCOONWPI /ÒPEJGP *GHV          *KURCPKC )CNNKC 0CTDQPGPUKU   'VTWTKC7ODTKC2KEGPWO.CVKWO5COPKWO(TGPVCPK%CORCPKC#RWNKC-CNCDTKGP.WMCPKGP$TWV VKWO0T-CTVJCIGTKP+VCNKGP0T5KMGNKC0T6TQCU.GUDQU0T +QPKGP0T2JT[IKGP0T$GTNKP/ÒPEJGP(QNKQ1TKI$TQUEJWT  



.

5NIXQP#WNQEM*GHV-CTKGP.[FKGP.[MKGP2CORJ[NKGP2KUKFKGP.[MCQPKGP+UCW TKGP$GTNKP(QNKQ1TKI$TQUEJWT  



.

/ÒP\UCOONWPI FGT 7PKXGTUKV·V 6ÒDKPIGP  $·PFG $GTNKP D\Y /ÒPEJGP  0T  :   56HP6HP6HP6HP6HP6HP)TQ­HQNKQ1TKI$TQ UEJWT  



.

/ÒP\UCOONWPIFGT7PKXGTUKV·V6ÒDKPIGP*GHV6CWTKUEJG%JGTUQPGU-QTM[TC0T #MCTPCPKGP  $KVJ[PKGP 0T  /[UKGP+QPKGP 0T  $GTNKP/ÒPEJGP    (QNKQ1TKI$TQUEJWT  



.

2H·N\GT 2TKXCVUCOONWPIGP $CPF  WPF  2CORJ[NKGP 0T  2KUKFKGP WPF .[MCQPKGP 0T    /ÒPEJGP$GKFG$·PFGUKPFGKPJGKVNKEJKP)CP\NGKPGPIGDWPFGP  



.

9 .'5%**140 *GT\QI #PVQP 7NTKEJ/WUGWO $TCWPUEJYGKI -CVCNQI FGT ITKGEJKUEJGP /ÒP\GP   $TCWPUEJYGKI5OKVXKGNGP#DD)CP\NGKPGP



.

5;..1)' 07//147/ )4#'%147/ )4+'%*'0.#0& %QNNGEVKQP 4¾PC * 'XGNRKFKU   #VJ½PGU  $·PFG .QWXCKPGU   6HP )TQ­HQNKQ -CTVQPKGTV $CPF  OKV -NGDGHQNKGPÒDGT   \WI  



%QNNGEVKQP4¾PC*'XGNRKFKU#VJ½PGU*GHVG.QWXCKP*GHV+VCNKG5KEKNG6JTCEG*GHV /CE¾FQPKG6JGUUCNKG+NN[TKG—RKTG%QTE[TG(QNKQ*CNDNGKPGP#  



.

$GK$CPFJCPFGNVGUUKEJWO'ZGORNCT0T$GK$CPFWO'ZGORNCT0T

38


ANTIKE - GRIECHEN .

5;..1)'07//147/)4#'%147/)4155$4+6#00+'0$CPF6GKN6JG%QNNGEVKQP QH%CRV')5RGPEGT%JWTEJKNN/%QH0QTVJYKEM2CTM6JG5CNVKPI%QNNGEVKQPQHVJG8KEVQTKCCPF #NDGTV/WUGWO.QPFQP6HP-CTVQPKGTVUVCTMDGUVQ­GP



.

$CPF6JG.QEMGVV%QNNGEVKQP.QPFQP6HP(QNKQ*CNDNGKPGPOKPKOCNDGUVQ­GP



.

$CPF  (KV\YKNNKCO /WUGWO .GCMG CPF )GPGTCN %QNNGEVKQPU  $·PFG *GHVG  5RCPKGP6JTCMKGP   0CEJFTWEM .QPFQP  FGT #WUICDG .QPFQP  *GHVG  2QPVWU0CDCVJCGC .QPFQP    *CNDNGKPGP  



$CPF#UJOQNGCP/WUGWO1ZHQTF6GKNG # .QPFQP0GY;QTM6GKN #  +VCN[ 'VTWTKC.WECPKC 6JWTKWO  6GKN  +VCN[ 5KEKN[ %CVJCIG 6GKN  /CEGFQPKC 6GKN  2CGQPKC    6JGUUCN[ 6GKN  $QURQTWU#GQNKU(QNKQ-CTVQPKGTV Z *CNDNGKPGP Z )CP\NGKPGP Z 6GKNG DGUVQ­GP  



.

.

$CPF6JG$TKVKUJ/WUGWO6GKN5RCKP.QPFQP5FCXQP6HP)CP\NGKPGP

.

$CPF  6JG *WPVGTKCP /WUGWO 7PKXGTUKV[ QH )NCUIQY 0GY ;QTM  6GKN  4QOCP 2TQXKPEKCN   %QKPU5RCKP-KPIFQOUQH#UKC/KPQT6HP6GKN4QOCP2TQXKPEKCN%QKPU%[RTWU'I[RV6HP )CP\NGKPGP  



5;..1)' 07//147/ )4#'%147/ +6#.+'0 /KNCPQ %KXKEJG 4CEEQNVG 0WOKUOCVKEJG   6GKN/KNCPQ5FCXQP6HP5FCXQP6HP5FCXQP6HP 5FCXQP6HP-CTVQPKGTV6GKNWCO4Ã&#x2019;EMGPGVYCUDGUEJ·FKIV  



5;..1)' 07//147/ )4#'%147/ ¤56'44'+%* 5COONWPI &TGGT-NCIGPHWTV KO .CP   FGUOWUGWO -·TPVGP $CPF  WPF  -NCIGPHWTV  6GKN  +VCNKGP 5K\KNKGP 6GKN  5RCPKGP   )CNNKGP-GNVGPN·PFGT(QNKQ*CNDNGKPGP4Ã&#x2019;EMGPXQP6GKNGVYCUN·FKGTV6GKNOKVDGKIGNGIVGT-QP MQTFCP\NKUVG#  



5COONWPI &TGGT-NCIGPHWTV KO .CPFGUOWUGWO -·TPVGP  $·PFG -NCIGPHWTV   5    6HP6HP6HP)TQ­HQNKQ1TKI$TQUEJWTOKPKOCNDGUVQ­GP*KPVGTGT&GEMGNDGK$CPFNGKEJV GKPIGTKUUGP  



5;..1)'07//147/)4#'%147/5%*9'&'0$CPF6JG%QNNGEVKQPQH*KU.CVG/CLG UV[ -KPI )WUVCH 8+ #FQNH 6JG (TGF (QTDCV %QNNGEVKQP 5VQEMJQNO   5 FCXQP  6HP (QNKQ   1TKI$TQUEJWT  $CPF  6JG %QNNGEVKQP QH VJG 4Q[CN %QKP %CDKPGV 0CVKQPCN /WUGWO QH /QPGVCT[   *KUVQT[ 5VQEMJQNO 6GKN  )CNNKC  5KEKN[ 5VQEMJQNO   5 FCXQP  6HP (QNKQ 1TKI$TQ   UEJWT6GKN6JG)&.QTKEJUEQNNGEVKQP5VQEMJQNO6HP(QNKQ)CP\NGKPGP  



$CPF6JG%QNNGEVKQPQH*KU.CVG/CLGUV[-KPI)WUVCH8+#FQNH6JG(TGF(QTDCV%QNNGEVKQP5VQEM JQNO5FCXQP6HP(QNKQ1TKI$TQUEJWT$CPF6JG%QNNGEVKQPQHVJG4Q[CN%QKP %CDKPGV0CVKQPCN/WUGWOQH/QPGVCT[*KUVQT[5VQEMJQNO6GKN)CNNKC5KEKN[5VQEMJQNO 5FCXQP6HP(QNKQ1TKI$TQUEJWT6GKN6JTCEG'WDQKC5VQEMJQNO5OKVFGP6HP (QNKQ1TKIMCTVQPKGTVOKPKOCNDGUVQ­GP#  



5;..1)'07//147/)4#'%147/5%*9'+<$CPF5WRRNGOGPV.GXCPVG%KEKNKC<Ã&#x2019;TKEJ :8+++56HP$CPF/Ã&#x2019;P\GPFGT#PVKMG-CVCNQIFGT5NI,GCP2KGTTG4KIJGVVKKO$GTPK UEJGP *KUVQTKUEJGP /WUGWO $CN±\U -CRQUU[ $GTP 5VWVVICTV 9KGP  'KPKIG 5  6HP +P    $·PFGPKP)CP\NGKPGPIGDWPFGP  



.

.

.

.

.

.



357

.

5YKV\GTNCPF+.GXCPVG%KEKNKC$GTP5FCXQP-CTVG6HP)CP\NGKPGP

 39


ANTIKE - GRIECHEN .

5;..1)'07//147/)4#'%147/6ª4-'+6WTMG[#PCOWT/WUGWO$CPF4QOCP 2TQXKPEKCN%QKPU+UVCPDWN:+++5FCXQP6HP6WTMG[%CPCMMCNG/WUGWO$CPF 4QOCP2TQXKPEKCN%QKPUQH/[UKC6TQCUGVE+UVCPDWN6HP)CP\NGKPGP  



.

5;..1)' 07//147/ )4#'%147/ 70)#40 $WFCRGUV /CI[CT 0GO\GVK /Ð\GWO $CPF   *KURCPKC5KEKNKC6GKN/KNCPQ5FCXQP6HP-CTVQPKGTV



.

5;..1)'07//147/)4#'%147/75#6JG$WTVQP;$GTT[%QNNGEVKQP$CPF/CEGFQ PKCVQ#VVKEC0GY;QTM6HP*CNDNGKPGP



.

6#.+'4%+1 /'05+6+'4+ / .C OQPGVC\KQPG FK 8CNGPVKC %GPVTQ +PVGTPC\KQPCNG FK 5VWFK 0WOKU   OCVKEK$KDNKQVJGEC4QO56HP1TKI$TQUEJWT//#)



.

6*1/2510 / 6JG #ITKPKQP *QCTF 00/  0GY ;QTM  8  5  6HP 1TKI$TQ   UEJWT//#)



.

#NGZCPFGT U&TCEJO/KPVU+5CTFGUCPF/KNGVWU050GY;QTM56HP#NGZCP FGT U&TCEJO/KPVU++.CORUCEWUCPF#D[FWU050GY;QTM56HP1TKI)CP\ NGKPGP  



.

6*1/2510//¦4-*1./1-4##;%/ *TUI #P+PXGPVQT[QH)TGGM%QKP*QCTFU 0GY;QTM:8+++5(CNVMCTVGP1TKI$TQUEJWT//#)



.

612#.1856JG1TF[UKCP-KPIFQOHTQOVJGNCVGHKHVJVQVJGOKFHQWTVJ%$%%QPVTKDWVKQPUVQVJG UVWF[ QH KVU EQKPCIG CPF JKUVQT[ 5QHKC  56HP/GUUCODTKC2QPVKEC%QPVTKDWVKQPVQVJG UVWF[VJGEQKPOKPVKPIQHVJGEKV[HKHVJHKTUVE$%56HP1TKI$TQUEJWT  



64'514 &' 07/+5/#6+37' '6 &' ).;26+37' 0WOKUOCVKSWG FGU 4QKU )TGEU 2CTKU Q,   5 $GUEJTGKDWPIDKU6H 6HP*CNDNGFGTGVYCUDGUVQ­GP6GKNYGKUGUVQEMHNGEMKI8QTUCV\ DNCVVHGJNV



.

0WOKUOCVKSWGFGU4QKU)TGEU2CTKUQ,5 $GUEJTGKDWPIDKU6H 6HP*CNDNGFGTOKPKOCN DGUVQ­GP8QTUCV\DNCVVHGJNV(NGEMGPCWHFGP6HPWPF



.

64—514&'07/+5/#6+37''6&').;26+37'0WOKUOCVKSWGFGU4QKU)TGEU2CTKU 56HP*CNDNGFGTOKV)CP\IQNFUEJPKVVGVYCUUVQEMHNGEMKI



.

5GNVGPGU9GTMOKVUEJÌPGP+NNWUVTCVKQPGP

.

641:'.. *# 6JG 0QTOCP &CXKU %QNNGEVKQP #%0#% 0GY ;QTM   5  6HP 1TKI   $TQUEJWT-*'4$'466JG,QJP/CZ9WNHKPI%QNNGEVKQPKP9CUJKPIVQP7PKXGTUKV[#%0#%0GY ;QTM56HP.GKPGPOKPKOCNDGUVQ­GP  



.

6JG%QKPCIGQHVJG.[EKCP.GCIWG00/0GY;QTM:8++56HP-CTVG)CP\ NGKPGP//#)



.

5VWFKGU KP VJG /CEGFQPKCP %QKPCIG QH #NGZCPFGT VJG ITGCV 05  0GY ;QTM   5  6HP   )CP\NGKPGP



.

65#0)#4+ &+ %QTRWU FGU /QPPCKGU FyQT  FyCTIGPV GV FG $TQP\G FG NC %QPH¾F¾TCVKQP ¾VQNKGPPG   #VJGP5FCXQP6CDGNNGP6HPWPF-CTVG1TKI$TQUEJWTOKPKOCNDGUVQ­GP



.

67&''4 .16 &KG 6GFTCFTCEJOGPRT·IWPI XQP 5[TCMWU KP FGT 2GTKQFG QFGT FGT UKIPKGTGPFGP   -ÒPUVNGT5&CWU<H0$GTNKP56HP)CP\NGFGT-QRHIQNFUEJPKVV//#)



.

&KG 6GVTCFTCEJOGPRT·IWPI XQP 5[TCMWU 0CEJFTWEM $QNQIPC  FGT 1TKIKPCNCWUICDG $GTNKP    56HP)CP\NGKPGP



.

&KG 6GFTCFTCEJOGPRT·IWPI XQP 5[TCMWU KP FGT 2GTKQFG FGT UKIPKGTGPFGP -ÒPUVNGT 5& CWU <H0    $GTNKP56HP)TÒPGT)CP\NGFGTGKPDCPF-QRHIQNFUEJPKVV//#)



.

8+..#410)# .6JG#GU%QKPCIGQH'ORQTKQP$#45[RRNGOGPVCT[5GTKGU1ZHQTF 56HP1TKI$TQUEJWT



.

8+5/#4#0/QPGVC\KQPGCTECKECFGNNC.[EKC++NFKPCUVC9GMJUUGTG+)NCWZ/KNCPQ 5 OKV \CJNTGKEJGP #DD 1TKI$TQUEJWT  /QPGVC\KQPG CTECKEC FGNNC .[EKC ++ .C EQNNG\KQPG 9KPUG   OCPP (CNIJGTC )NCWZ  /KNCPQ   5  6HP 1TKI$TQUEJWT DGUVQ­GP  /QPGVC\KQPG   CTECKECFGNNC.[EKC+++.GRTKOGGOKUUKQPKFGN9GFTK)NCWZ/KNCPQ::+85OKV\CJN TGKEJGP#DD-CTVQPKGTV  



.

81')6.+*$KNFGTFGT*GNFGPGRGPKPFGTMCKUGT\GKVNKEJGPITKGEJKUEJGP/ÒP\RT·IWPI#GUEJ :856HPDGKIGNGIV1TKI$TQUEJWTDGUVQ­GP//#)



.

81)6 , &KG CNGZCPFTKPKUEJGP /ÒP\GP )TWPFNGIWPI GKPGT CNGZCPFTKPKUEJGP -CKUGTIGUEJKEJVG    $·PFG 5VWVVICTV  :  5  6HP +8  5 +P \YGK $·PFGP KP TQVGO )CP\NGFGT IGDWPFGP   4ÒEMGPNGKEJVCWUIGDNKEJGP//#)  



40


ANTIKE - GRIECHEN .

&KGCNGZCPFTKPKUEJGP/ÒP\GP)TWPFNGIWPIGKPGTCNGZCPFTKPKUEJGP-CKUGTIGUEJKEJVG$·PFG5VWVVICTV  'Z NKDTKU :  5  6HP +8  5 +P GKPGO $CPF KP *CNDNGFGT IGDWPFGP GKPIGJGHVGVGT   #WU\WI CWU FGO )PQOQP  5  GKPKIG 0QVK\GP XGTOGJTV CWH FGP GTUVGP 5GKVGP //#)   



9#&&+0)6109*$#$'.10'4'+0#%*64GEWGKNI¾P¾TCNFGUOQPPCKGU)TGESWGUF # UKG/KPGWTG$CPF2CTKU56HP1TKI$TQUEJWT4ÒEMGPNQUGWPFDGUEJ·FKIVGDGPUQ 'KPDCPFFGU6CHGNDCPFGU+PJCNVVCFGNNQU



.

9#..#%'926JG'WDQKCP.GCIWGCPFKVU%QKPCIG00/0GY;QTM:+5 6HP-CTVG(CNVVCDGNNG1TKI$TQUEJWT//#)



.

6JG 'WDQKCP .GCIWG CPF KVU %QKPCIG 00/  0GY ;QTM  :+  5  6HP )CP\NGKPGP   -QRHIQNFUEJPKVV4ÒEMGPNGKEJVCWUIGDNKEJGP//#)



.

9#44'0 ,#9 6JG $TQP\G %QKPCIG QH VJG #EJCKCP -QKPQP 6JG %WTTGPE[ QH C (GFGTCN +FGCN   .QPFQP:8+56HP)CP\NGKPGP



.

9'+. 4 &KG -ÒPUVNGTKPUEJTKHVGP FGT UKEKNKUEJGP /ÒP\GP $GTNKP  5OKV#DDUQYKG6HP WPFIGIGPÒDGTLGYGKNUFKG$GUEJTGKDWPIFGTKPUIGU/ÒP\GP5EJÌPGT.GFGTGKPDCPF



.

9'56#$)QNFEQKPUHTQOVJG6JTCEKCPEQCUV00/0GY;QTM5OKV#DD6HP )CP\NGKPGP-QRHIQNFUEJPKVVWPFIQNFGPGP&GEMGNRT·IWPIGPNGKEJVCWUIGDNKEJGPGT4ÒEMGP



.

9'56'4/#4- 7,'0-+05 - 6JG %QKPCIG QH -COCTKPC 405 5RGEKCN 2WDNKECVKQP  .QPFQP   5FCXQP(CNVMCTVG6HP.GKPGP



.

9*+6'*'#& 4$ %CVCNQIWG QH %QKPU KP VJG 2CPLCD /WUGWO .CJQTG 8QN  +PFQ)TGGM %QKPU   1ZHQTF:++56HP.GKPGPOKPKOCNDGUVQ­GP-QRHIQNFUEJPKVVVGKNYGKUGWPCWHIGUEJPKV VGP//#)



.

9+..+#/5 46 6JG %QPHGFGTCVG %QKPCIG QH VJG #TECFKCPU KP VJG (KHVJ %GPVWT[ $% 00/    0GY;QTM:+:56HP1TKI$TQUEJWT//#)



.

6JG 5KNXGT %QKPCIG QH VJG 2JQMKCPU 405 5RGEKCN 2WDNKECVKQP  .QPFQP  +:  5  6HP   )CP\NGKPGP



.

914-'6JG'CTNKGT5VCVGTUQH*GTCENKC.WECPKCG00/0GY;QTM56HP//#) &C\W(KHVJCPFHQWTVJEGPVWT[IQNFEQKPUHTQOVJG6JTCEKCP%QCUV00/0GY;QTM  5  6HP $GKFG $ÒEJGT UKPF KP )CP\NGKPGP IGDWPFGP WPF YGTFGP FWTEJ GKPGP -QRHIQNFUEJPKVV   IGUEJOÒEMV  



947%-9&KGU[TKUEJG2TQXKP\KCNRT·IWPIXQP#WIWUVWUDKU6TCKCP5VWVVICTV8+++5OKV #DD6HP)CP\NGFGT4ÒEMGPOKPKOCNCWUIGDNKEJGP//#)



.

.

393

.

&KGU[TKUEJG2TQXKP\KCNRT·IWPIXQP#WIWUVWUDKU6TCKCP5VWVVICTV8+++56HP*CNDNGFGT //#)



'ZNKDTKU&T*-KFGT[

.

&KG U[TKUEJG 2TQXKP\KCNRT·IWPI XQP #WIWUVWU DKU 6TCKCP 5VWVVICTV  8+++  5  6HP $TQ   UEJKGTV//#)

 41


ANTIKE - RÖMER .

<+').'4 4 /ÒP\GP -KNKMKGPU CWU MNGKPGTGP FGWVUEJGP 5COONWPIGP 8GUVKIKC  /ÒPEJGP    8+++5-CTVG56HP)CP\NGKPGP//#)



.

<1081.76 )4+'%*+5%*' 07/+5/#6+-  -QPXQNWV XQP /QPQITCRJKGP WPF 5QPFGTFTWEMGP   \WTITKGEJKUEJGP0WOKUOCVKMWCXQP#9+0<'4#PVKMG2QVTCKVOÒP\GPFGT2GTUGTWPF)TKGEJGPCWU XQTJGNNGPKUVKUEJT <GKV 5VWVVICTV  * -1%* # JQCTF QH EQKPU HTQO GCUVGTP 2CTVJKC 00/    0GY ;QTM  &1# -.15' 8QP #NGZCPFGT \W -NGQRCVTC *GTTUEJGTRQTVT·VU FGT )TKGEJGP WPF   $CTDCTGP/ÒPEJGP42.#06)TGGMEQKPV[RGUCPFVJGKTKFGPVKHKECVKQP.QPFQP%5GNV OCP )TGGM EQKPU .QPFQP   /QPQITCRJKGP WPF  5QPFGTFTWEMG 7PVGTUEJKGFNKEJ IGDWPFGP  

 



-1081.76 07/+5/#6+% 016'5 #0& /101)4#2*5  0T    (KHVJ CPF HQWTVJ   %GPVWT[)QNFEQKPUHTQOVJG6JTCEKCP%QCUV0QVGUQPVJG#PEKGPV%QKPCIGQH*KURCPKC%KVGTKQT .CVG5GNGWEKF/KPVUKP#MG2VQNGOCKUCPF&COCUEWU%JG OKECN %QORQUKVKQP QH 2CTVJKCP %QKPU 0GY ;QTM           1TKI$TQUEJWTOKPKOCNDGUVQ­GP  



.

4¤/'4 .

#.(¤.&+ # &KG -QPVQTPKCVGP 'KP XGTMCPPVGU 2TQRCICPFCOKVVGN FGT 5VCFVTÌOKUEJGP JGKFPKUEJGP   #TKUVQMTCVKGKPKJTGO-CORHGIGIGPFCUEJTKUVNKEJG-CKUGTVWO$WFCRGUV56HP.GKPGP



.

#.(¤.&+##.(¤.&+'&KG-QPVQTPKCV/GFCKNNQPU#/7)5$FG$GTNKP0GY;QTM  :8+  5  (CNVVHP  6HP KO 5EJWDGT ::+++  5 6HP  .GKPGP //#)     



.

#.4#//&KG/ÒP\RT·IWPIFGU-CKUGTU/CZKOKPWU+6JTCZ  /+49KGP 56HP1TKI$TQUEJWT//#)



.

#/#0&4;/'56+165)#76+'4).GOQPPC[CIGFGN CVGNKGTFG.[QP CX,% CRT,% 5WRRN¾OGPV++0WOKUOCVKSWG4QOCKPG9GVVGTGP56HP.GKPGP//#) 



.

#/#0&4; /4'/; $ %QOCPC FW 2QPV UQWU Ny'ORKTG TQOCKP 'VWFG JKUVQTKSWG GV EQTRWU   OQP¾VCKTG)NCWZ/CKNCPF5-CTVGP6HP-CTVQPKGTV



.

#45.#0/6JGEQKPUQH)CNCVKCP-KPIFQOCPF4QOCP%QKPCIGQH#PE[TCKP)CNCVKC#PMCTC 56HPVGKNYGKUGCWEJHCTDKIG6HP-CTVQPKGTV



.

#5-'9)6JG%QKPCIGQH4QOCP$TKVCKP.QPFQP(TQPVKURK\5OKVXKGNGP#DD)CP\NGK PGP#



.

#51.#6+/+NVGUQTQFKHCNGTKKPQXK0WQXKEQPVTKDWVKUWNNCOQPGVC\KQPGKVCNKECKPDTQP\QFGINKCPPK FK4KEKOGTQ F% 0WOKUOCVKEC2CVCXKPC  56HP1TKI$TQUEJWT



.

$#$'.10'&GUETKRVKQPJKUVQTKSWGGVEJTQPQNQIKSWGFGUOQPPCKGUFGNC4¾RWDNKESWG4QOCKPGXWN ICKTGOGPV CRRGN¾GU OQPPCKGU EQPUWNCKTGU  $·PFG 2CTKU  :++ .8+  5  5 OKV   \CJNTGKEJGP#DDKO6GZV*CNDNGFGTUVCTMDGUVQ­GP//#)  



407

.

$#*4('.&6 / XQP 0CEJVT·IG WPF $GTKEJVKIWPIGP \WT /ÒP\MWPFG FGT 4ÌOKUEJGP 4GRWDNKM KO   #PUEJNWUUCP$CDGNQPU8GT\GKEJPKUFGT%QPUWNCT/ÒP\GP9KGP+:56HP*CNDNGFGT DGUVQ­GP8QP$CJTHGNFVPWOOGTKGTVGU 0T WPFWPVGTUEJTKGDGPGU'ZGORNCT6CHGNVGKNFWTEJUEJQUUGP WPFOKV0QVK\GP//#) 5GJTUGNVGPGU9GTM

42




ANTIKE - RÖMER .

.

&KG4ÌOKUEJG)QNFOÒP\GPRT·IWPIY·JTGPFFGT4GRWDNKMWPFWPVGT#WIWUVWU'KPGEJTQPQNQIKUEJGWPF OGVTQNQIKUEJG5VWFKG*CNNGCPFGT5CCNG:8+5OKV#DD6HP)CP\NGFGTOKV)QNFXGT \KGTWPIGP//#)



&KG4ÌOKUEJG)QNFOÒP\GPRT·IWPIY·JTGPFFGT4GRWDNKMWPFWPVGT#WIWUVWU'KPGEJTQPQNQIKUEJGWPF OGVTQNQIKUEJG5VWFKG*CNNGCPFGT5CCNG:8+56HP*CNDNGKPGP//#)



*CPFUEJTKHVNKEJGT$GUKV\GTXGTOGTM'$GEMGPDCWGTCWHFGO6KVGNDNCVV

.

$#06+#+)TCPFK$TQP\K+ORGTKCNK$CPF(KTGP\G'KPJGKVNKEJKPDNCWGO-WPUV NGFGTIGDWPFGPVGKNYGKUGOKPKOCNDGUVQ­GP  



.

$#06+#5+/10'66+.%QTRWU0WOOQTWO4QOCPQTWO$·PFG(KTGP\G'KP JGKVNKEJ KP ITÒPGO )CP\NGKPGP IGDWPFGP CWHYGPFKI IGUVCNVGVG &GEMGN WPF 4ÒEMGP OKV )QNFXGT\KGTWP   IGP4ÒEMGPXQP$CPFUVCTMCDIGTKGDGPCPUQPUVGPJGTXQTTCIGPFGT<WUVCPF  



.

%QTRWU0WOOQTWO4QOCPQTWO$·PFG(KTGP\G)CP\NGKPGP  



.

$#56+'0 2 .G OQPPC[CIG FG N CVGNKGT FG .[QP &KQENGVKGP GV UGU EQT¾IGPVU CXCPV NC T¾HQTOG   OQP¾VCKTG   0WOKUOCVKSWG TQOCKPG  9GVVGTGP   5  6HP )CP\NGKPGP //#)   



.

.G OQPPC[CIG FG N CVGNKGT FG .[QP FG NC T¾QWXGTVWTG FG N CVGNKGT RCT #WT¾NKGP¯NCOQTVFG%CTKP HKP OK 0WOKUOCVKSWG4QOCKPG9GVVGTGP56HP1TKI)CP\NGKPGP



.

.GOQPPC[CIGFGN CVGNKGTFG.[QP&GNCT¾HQTOGOQP¾VCKTGFG&KQENGVKGP¯NCHGTOGVWTGVGORQTCKTGFG N CVGNKGTGP  0WOKUOCVKSWG4QOCKPG9GVVGTGP56HP1TKI$TQUEJWT OKPKOCNDGUVQ­GP//#)



.

.GOQPPC[CIGFGN CVGNKGTFG.[QPFGNCT¾QWXGTVWTGFGN CVGNKGTGP¯NCOQTVFG%QPUVCPVKP   0WOKUOCVKSWG4QOCKPG9GVVGTGP56HP.GKPGP#



.

.GOQPPC[CIGFG/CIPGPEG  #WHNCIG0WOKUOCVKSWG4QOCKPG9GVVGTGP5 6HP.GKPGP//#)



.

.GOQPPC[CIGFGN CVGNKGTFG.[QPFGNCOQTVFG%QPUVCPVKP¯NCOQTVFG,WNKGP  0WOKUOCVK SWG4QOCKPG9GVVGTGP56HP.GKPGP//#)



.

.G OQPPC[CIG FG N CVGNKGT FG .[QP FW T½IPG FG ,QXKGP ¯ NC OQTV FG ,QXKP   0WOKUOCVKSWG   4QOCKPG9GVVGTGP56HP)CP\NGKPGP//#)



.

$#56+'0 2#/#0&4; /)#76+'4 ) .G OQPPC[CIG FG N CVGNKGT FG .[QP     5WRRN¾OGPV 2 $#56+'0 .G O¾FCKNNQP FG RNQOD FG .[QP 0WOKUOCVKSWG 4QOCKPG  9GVVGTGP   56HP56HP.GKPGP//#)



.

$#56+'0 2%16*'0'6 # 6T¾UQTU /QP¾VCKTGUFWEJGT0WOKUOCVKSWG4QOCKPG8+++9GVVGTGP 5OKV#DD6CDGNNGPKO6GZV6HP$TQUEJKGTV



.

$#56+'0 2*78'.+0 * 6TQWXCKNNG FG (QNNGU FG NC 2¾TKQFG %QPUVCPVKPKGPPG   0WOKU   OCVKSWG4QOCKPG9GVVGTGP56HP1TKI$TQUEJWT//#)



.

$'..+0)'4#46JG5[TKCP6GVTCFTCEJOUQH%CTCECNNCCPF/CETKPWU050GY;QTM 56HP)CP\NGKPGP#



.

$'40*#46 / *CPFDWEJ \WT /ÒP\MWPFG FGT TÌOKUEJGP -CKUGT\GKV  $·PFG *CNNG CP FGT 5CCNG   556HP)CP\NGKPGPOKPKOCNDGUVQ­GP//#)  



.

*CPFDWEJ\WT/ÒP\MWPFGFGTTÌOKUEJGP-CKUGT\GKV$·PFG*CNNGCPFGT5CCNG55  6HP 1TKI)CP\NGKPGP -QRHTQVUEJPKVV WPVGTG 4ÒEMGP NGKEJV DGTKGDGP CPUQPUVGP UGJT IWV GTJCNVGP   //#)  



*CPFDWEJ\WT/ÒP\MWPFGFGTTÌOKUEJGP-CKUGT\GKV$·PFG*CNNGCPFGT5CCNG55  6HP +P DNCWGP )CP\NGKPGP IGDWPFGP -QRHTQVUEJPKVV 'KPDCPF OKV NGKEJVGO 9CUUGTUEJCFGP FGT   +PJCNVKUVFCXQPPKEJVDGVTQHHGP//#)  



.

$'51/$'52#/QPPCKGUFGNy'ORKTGTQOCKP+86TCLCP CRT½U,% 2CTKU5VTCUDQWTI 56HP)CP\NGKPGP



.

$.#0&46JG%JCNHQPV*QCTFCPFQVJGT4QOCP%QKP*QCTFU%QKP*QCTFUHTQO4QOCP$TKVCKP .QPFQP56HP)CP\NGKPGP



.

$.1'5%* * 'TKPPGTWPIGP CP #KIGCK 8GTÌHHGPVNKEJWPI FGU /ÒP\MCDKPGVVU 9KPVGTVJWT 9KPVGTVJWT   56HP1TKI$TQUEJWT



.

$47%- ) &KG UR·VTÌOKUEJG -WRHGTRT·IWPI 'KP $GUVKOOWPIUDWEJ HÒT UEJNGEJV GTJCNVGPG /ÒP\GP   )TC\::+:5OKV\CJNTGKEJGP#DD<GKVVH CWUIGTKUUGP -CTVG)CP\NGKPGP



.

43


ANTIKE - RÖMER .

$744'4(/ÒP\RT·IWPIWPF)GUEJKEJVGFGU6JGUUCNKUEJGP$WPFGUKPFGT4ÌOKUEJGP-CKUGT\GKVDKU CWH*CFTKCP X%JTP%JT 5CCTDTÒEMGT5VWFKGP\WT#TEJ·QNQIKGWPF#NVGP)GUEJKEJVG 5CCTDTÒEMGP::85&KCITCOOG6HP1TKI$TQUEJWT//#)



.

$7664';LT686JG6TKWOXKTCN2QVTCKV)QNFQHVJG3WCVVWQXKTK/QPGVCNGUQH$%00/ 0GY;QTM:56HP1TKI$TQUEJWT#



.

%#/2#0# # .C OQPGVC\KQPG FGINK KPUQTVK +VCNKEK FWTCPVG NC )WGTTC 5QEKCNG  C%  /QFGPC   :856HP1TKI$TQUEJWTOKV5EJWV\WOUEJNCI//#)



/KV$GUKV\GTUVGORGN'Z$KDNKQVJGEC,GNNKUUGPKO8QTUCV\

.

%#45104#)28*+..,2%-'06.CVG4QOCP$TQP\G%QKPCIG#&.QPFQP 56HP)CP\NGKPGP



.

%+</'.+<.GOQPPC[CIGFG0¾QE¾UCT¾GGVFWMQKPQPFW2QPV)NCWZ/CKNCPF5 -CTVGP6HP-CTVQPKGTV



436

.

%1*'0 * &GUETKRVKQP JKUVQTKSWG FGU OQPPCKGU HTCRR¾GU UQWU N 'ORKTG 4QOCKP EQOOWPGOGPV CR   RGN¾GUO¾FCKNNGUKOR¾TKCNGU#WHNCIG2CTKU.QPFQP$CPF::8++5:8+ 555556H55LGYGKNUOKV\CJNTGKEJGP#DD+PGKPJGKVNKEJ DTCWPGP*CNDNGFGTGKPD·PFGPOKV$ÒPFGPIGDWPFGP&GEMGNXQP$CPFWPFNQUGXGTUEJKGFGPUVCTM DGUVQ­GPWPFDGTKGDGP+PJCNVVCFGNNQU#  



.

%1/2#4'66'6.#GUUKIPCVWO%JKECIQ56HP.GKPGP//#)



.

%4#9(14& /* 4QOCP 4GRWDNKECP%QKP*QCTFU4055RGEKCN2WDNKECVKQP.QPFQP8+ 5OKV6CDGNNGP6HP)CP\NGKPGP//#)



.

4QOCP4GRWDNKECP%QKPCIG$·PFG%CODTKFIGWC:+85:+56HP )CP\NGKPGPVCFGNNQUGT<WUVCPF#  



.

&'2';416).GU¾OKUUKQPUOQP¾VCKTGUF #TNGU 3WCVTK½OGEKPSWK½OGUK½ENGU %QNNGEVKQP/QPGVC 9GVVGTGP56HP1TKI$TQUEJWT



.

'./'4 ) 'ZMWTU ÒDGT FKG TÌO )QNFDCTTGP CWU 5KTOKWO 0CKUUWU W 6JGUUCNQPKEG W KJTG &CVKG   TWPI +P0WOK\OCVKECTXQO/CK5OKVGKPKIGP#DD9GKVGTG#WHU·V\GWC-2+0-&KG 'ZCIKCUQNKFK 5 )'./'4<YGK5EJCWOÒP\GPFGU)CNNWUW8QNWUKCPWUCWU8KOKPCEKWOKPFGT 5COONWPI9GKHGTV 5 1TKI$TQUEJWTDGUVQ­GP+PFGT/KVVGIGMPKEMV



.

'4%1.#0+ %1%%*+ ' %CVCNQIQ FGNNC EQNNG\KQPG PWOKUOCVKEC FK %CTNQ 2KCPECUVGNNK /QPGVC\KQPG   4QOCPC+ORGTKCNGF%(QTNK56HP-CTVQPKGTVOKPKOCNDGUVQ­GP



.

(+6<,&GT)GNFWONCWHFGTTÌOKUEJGP2TQXKP\GPKO&QPCWIGDKGV/KVVGFGU,CJTJWPFGTVU$·PFG $WFCRGUV$QPP5FCXQP6HP)CP\NGKPGP//#)  



.

&GT )GNFWONCWH FGT TÌOKUEJGP 2TQXKP\GP KO &QPCWIGDKGV /KVVG FGU  ,CJTJWPFGTVU  $·PFG $WFC   RGUV$QPP5FCXQP6HP)CP\NGKPGP//#)  



44

/KV$GUKV\GTUVGORGNXQP,CESWGU5EJWNOCP$8


ANTIKE - RÖMER .

.

(4+'&.#'0&'4,ªDGTGKPKIGTÌOKUEJG/GFCKNNQPU#WUFGP#DJCPFNWPIGPFGTMÌPKIN#MCFGOKG FGT 9KUUGPUEJCHVGP \W $GTNKP  $GTNKP  5   6H -CTVQPKGTV UVQEMHNGEMKI  VGKNYGKUG   WPCWHIGUEJPKVVGP



(41'*0'49.GUO¾FCKNNQPUFGN GORKTGTQOCKPFGRWKUNGT½IPGF #WIWUVGLWUSW C2TKUEWU#VVCNG 2CTKU:85OKV#DDKO6GZV*CNDNGFGTVGKNYGKUGUVQEMHNGEMKI#



/KV$GUKV\GTUVGORGNXQP,QUGH6JGQFQT/CNNOCPPKO8QTUCV\

.

(7%*5)CWUFGO0CEJNCUUJTUIXQP,$.'+%-'0/(7*4/#00#TEJKVGMVWTFCTUVGNNWPIGP CWHTÌOKUEJGP/ÒP\GPFGT4GRWDNKMWPFFGTHTÒJGP-CKUGT\GKV#/7)5$GTNKP::85 OKV#DD6HPKPFGT$GKNCIG)CP\NGKPGP//#)



.

)'$*#46*-4#(6-&KG(WPFOÒP\GPFGTTÌOKUEJGP<GKVKP&GWVUEJNCPF#DVGKNWPI++$CFGP 9ÒTVVGODGTI$CPF5ÒFYÒTVVGODGTI*QJGP\QNNGTP$GTNKP5(CNVVH)CP\NGKPGP



.

)+#4&,$.GOQPPC[CIGFGN CVGNKGTFG.[QPFGUQTKIKPGUCWT½IPGFG%CNKIWNC CXCPV,% CRT½U,% 0WOKUOCVKSWG4QOCKPG9GVVGTGP56HP)CP\NGKPGP//#)



.

.GOQPPC[CIGFGN CVGNKGTFG.[QPFG%NCWFG+GT¯8GURCUKGP CRT½U,% GVCWVGORUFG%NQFKWU #NDKPWU  CRT½U ,%  0WOKUOCVKSWG 4QOCKPG  9GVVGTGP   5  6HP .GKPGP   //#)



/QPPCKGUFGN 'ORKTGTQOCKP$CPF#WIWUVG#WHNCIG2CTKU:8+56HP-WPUVNG FGT OKV5EJWV\WOUEJNCI%CVCNQIWGFGUOQPPCKGUFGN GORKTGTQOCKP$CPF&G6KD½TG¯0¾TQP 2CTKU56HP-WPUVNGFGT/QPPCKGUFGN 'ORKTGTQOCKP$CPF&WUQWN½XGOGPVFG CRT½U,%¯0GTXC%CVCNQIWG2CTKU+:56HP(CTDVHP-WPUVNGFGT//#)   



.

)+'5'%-' 9 &CU ·NVGTGTÌOKUEJG2HWPF$GTNKP5&CWU$GTNKPGT/ÒP\DN·VVGT0( 5)CP\NGKPGPOKVOQPVKGTVGO6KVGNFGT$TQUEJWT0GWYGTVKI



.

)+..,#/ ** #PVQPKPKCPK WPF #WTGK FGU 7NRKWU %QTPGNKWU .CGNKCPWU )GIGPMCKUGT FGU 2QUVWOWU   -ÌNP5FCXQP6HP-CTVQPKGTV



.

'ZGORNCT0TXQP

.

.

.

.

)+6.'4*2106+0)/6JGUKNXGT%QKPCIGQH5GRVKOWU5GXGTWUCPFJKUHCOKN[ #& # UVWF[QHVJG%JGOKECN%QORQUKVKQPQHVJG4QOCPCPF'CUVGTP+UUWGU)NCWZ/CKNCPF5 6HP-CTVQPKGTV



)/;4'-%4ÌOKUEJG-CKUGTWPFITKGEJKUEJG)ÌVVKP&KGTGNKIKÌURQNKVKUEJG(WPMVKQPFGT#VJGPC /KPGTXCKPFGT5GNDUVWPF4GKEJUFCTUVGNNWPIFGTTÌOKUEJGP-CKUGT0QOKUOCVC/KNCPQ5 #DDCWH6HP-CTVQPKGTV//#)



)4+'45102/#;5/%CVCNQIWGQH.CVG4QOCP%QKPUKPVJG&WODCTVQP1CMU%QNNGEVKQPCPFKP VJG 9JKVVGOQTG %QNNGEVKQP (TQO #TECFKWU CPF *QPQTKWU VQ VJG #EEGUUKQP QH #PCUVCUKWU 9CUJKPIVQP   &%:+85FCXQP6HP1TKI)CP\NGKPGP//#)



)47'$'4 *# %QKPU QH VJG4QOCP4GRWDNKEKPVJG$TKVKUJ/WUGWO$·PFG0CEJFTWEM1ZHQTF FGT#WUICDG.QPFQP%::85OKVGKPKIGP#DD5OKVGKPKIGP#DD5 6HP'KPJGKVNKEJTQVGU1TKI)CP\NGKPGP'KPDCPFXQP$CPFOKPKOCNDGUEJOWV\V//#)  



/KV$GUKV\GTUVGORGN'ZDKDNKQVJGEC,GNNKUUGP

.

*#'$'4.+0',#GUITCXG&CU5EJYGTIGNF4QOUWPF/KVVGNKVCNKGPUGKPUEJNKG­NKEJFGTKJOXQTCWU IGJGPFGP 4QJDTQP\GY·JTWPI (TCPMHWTV C/  'TUVGT $CPF GPVJCNVGPF FKG /ÒP\XGT\GKEJPKUUG   ::8+++56H)TQ­HQNKQ*CNDNGKPGP



/KV$GUKV\GTUVGORGN&T(:9GK\KPIGT%Q

.

#GUITCXG&CU5EJYGTIGNF4QOUWPF/KVVGNKVCNKGPUGKPUEJNKG­NKEJFGTKJOXQTCWUIGJGPFGP4QJDTQP\G Y·JTWPI$·PFG(TCPMHWTVCO/CKP::8+++56H6HP)TQ­HQNKQ*CNDNGFGTOKV -QRHIQNFUEJPKVV 'KPD·PFG GVYCU DGTKGDGP &GEMGN FGU 6GZVDCPFGU OKPKOCN DGUEJ·FKIV YGPKIG $NGK   UVKHVPQVK\GPGTUVG5GKVGPFGU6CHGNDCPFGUOKV-PKEM//#)   

.

*+..286JG&CVKPICPF#TTCPIGOGPVQHVJG7PFCVGF%QKPUQH4QOG#&.QPFQP 5FCXQP6HP.GKPGP//#)



.

+/*11($.7/'4(2QTVT·VMÌRHGCWHTÌOKUEJGP/ÒP\GPFGT4GRWDNKMWPFFGT-CKUGT\GKVHÒTFGP 5EJWNIGDTCWEJ .GKR\KI   5  6HP *CNDNGKPGP GVYCU DGUVQ­GP (NGEMG CWH FGP NGV\VGP 6HP   *GTTUEJGTPCOGPCWHFGP4ÒEMUGKVGPFGT6CHGNP



,'.1%0+- # 0CLFDC CTIGPVGWUQX \IQFPLG 6GVTCTJKLG X 5KUMW 6JG 5KUCM *QCTF QH #TIGPVGK QH VJG   'CTN[6GVTCTEJ[5KVWNC.LWDNLCPC56HP*CNDNGKPGP//#)



.

/KVJCPFUEJTKHVNKEJGO$GUKV\GTXGTOGTM$GEMGPDCWGTCWHFGO6KVGNDNCVV

.

%GPVWTUMC\CMNCFPCPCLFDCHQNKUQXOCMUGPEKLCKPVGVTCTJKLG6JG%GPVWT*QCTF(QNNGUQH/CZGPVKWUCPF QHVJG6GVTCTEJ[5KVWNC.LWDNLCPC56HP1TKI$TQUEJWT

 45


ANTIKE - RÖMER .

,1*05610#)TGGM+ORGTKCN&GPQOKPCVKQPUEC#UVWF[QHVJG4QOCP2TQXKPEKCN$TQP\G %QKPCIGU QH #UKC /KPQT 405 5RGEKCN RWDNKECVKQP 0Q .QPFQP   5  6HP  -CTVGP   )CP\NGKPGP



.

,15+(185-+ 2 4QOCP /KPV QH 5VQDK 0CVKQPCN $CPM QH VJG 4GRWDNKE QH /CEGFQPKC 5MQRLG    56HP.GKPGP



.

,747-18# , )TKGEJKUEJGU /ÒP\YGTM &KG /ÒP\RT·IWPI XQP &GWNVWO 5EJTKHVGP \WT )GUEJKEJVG   WPF-WNVWTFGT#PVKMG$·PFG$GTNKP85-CTVG6HPDGKIGNGIV*CNDNGKPGPOKPK OCNDGUVQ­GP  



.

-#&/#0.%02++6JGEQKPUQH%CGUCTGC/CTKVKOC,GTWUCNGO5OKV\CJNTGKEJGP#DD 6HP)CP\NGKPGP



.

-#'0'. */ XQP /ÒP\RT·IWPI WPF /ÒP\DKNFPKU FGU %NCWFKWU #/7)5  $GTNKP  :+++   56HP.GKPGP//#)



/KV$GUKV\GTUVGORGN'Z$KDNKQVJGEC,GNNKUUGP

.

-'+/,-.7/$#%**&GTTÌOKUEJG5EJCV\HWPFXQP5VTCWDKPI/ÒPEJGP8(CTDMCTVG 5OKV#DD6HP)CP\NGKPGP



.

-'00'4 ( &KG /ÒP\UCOONWPI FGU 5VKHVGU 5V (NQTKCP KP 1DGT¤UVGTTGKEJ KP GKPGT #WUYCJN KJTGT   YKEJVKIUVGP5VÒEMG9KGP:::++56HP*CNDNGKPGP6CHGNPNGKEJVUVQEMHNGEMKIOKPKOCN DGUVQ­GPCPUQPUVGPJGTXQTTCIGPFGTJCNVGP//#)



'Z.KDTKUFGT0WOKUOCVKUEJGP$KDNKQVJGM5KGIOWPF9GTMPGT+PPUDTWEM

.

-'06,2%18'4$'%-$56;.19#7&KGTÌOKUEJG/ÒP\G/ÒPEJGP5 6HP(CTDVHP1TKI)CP\NGKPGPVCFGNNQUG'TJCNVWPI//#)



.

-+'0#56 & 4ÌOKUEJG -CKUGTVCDGNNG )TWPF\ÒIG GKPGT TÌOKUEJGP -CKUGTEJTQPQNQIKG &CTOUVCFV   ::8+5)CP\NGKPGP



.

-1/0+%-*&KG/ÒP\RT·IWPIXQP0KEQRQNKUCF/GUVWO$GTNKP8+++56HP)CP\NGK PGP



.

-15 2 0CLFDC #PVQPKPKLCPQX 6TGVLGIC 5VQNGVLC # *QCTF QH VJKTF %GPVWT[ #PVQPKPKCPK 5KVWNC    .LWDNLCPC56HP.GKPGP



.

-15 2 5'/418 # 4KOUMK 0QXEK KP -QPVTCOCTMG K\  5VQNGVLC 4QOCP +ORGTKCN %QKPU CPF   %QWPVGTOCTMU QH VJGHKTUVEGPVWT[ #WIWUVWU6TCKCPWU 5KVWNC0CTQFPKOW\GL5FCXQP 6HP-CTVQPKGTV



.

-4##;%/6JG#GU%QKPCIGQH)CNDC00/0GY;QTM:5(CNVFKCITCOOG 6HP)CP\NGKPGPOKV-QRHIQNFUEJPKVV4ÒEMGPNGKEJVCWUIGDNKEJGP//#)



.

6JG #GU %QKPCIG QH )CNDC 00/  0GY ;QTM  :  5  6HP  (CNVVCDGNNGP 1TKI   $TQUEJWT//#)



.

.#%#/).CHKPFGN 'ORKTG4QOCKPGVNGOQPPC[CIGQTGP+VCNKG$·PFG.W\GTP (CTDKIGU (TQPVKURK\  5 FCXQP  6HP (TQPVKURK\ 5  FCXQP 6HP   6HP   LGYGKNUOKVXKGNGP#DD(QNKQ1TKI)CP\NGKPGP//#)  



.#*75'0 ) &KG $KNFPKUOÒP\GP FGT TÌOKUEJGP 4GRWDNKM /ÒPEJGP   5  6HP    (CTDVHP.GKPGP



.

/KV$GUKV\GTUVGORGN'Z$KDNKQVJGEC,GNNKUUGP

.

.#0).1+5 8 0WOKUOCVKSWG FGU PQOGU F ¾I[RVG UQWU N CFOKPKUVTCVKQP TQOCKPG 2CTKU  'Z   NKDTKU (CNVMCTVG  5  6HP +P )CP\NGKPGP IGDWPFGP DGUVQ­GP GKPIGMNGDVG #TVKMGN WPF WP\·JNKIG   #POGTMWPIGPWPF0QVK\GPGKPKIGYGPKIG5VQEMHNGEMGP



.

.''&5'6#*QCTFQH4QOCP(QNNGUHTQO&KQENGVKCP U4GHQTO #& VQ%QPUVCPVKPG%CGUCT (QWPFCV([HKGNF$GTMU1ZHQTF56HP1TKI$TQUEJWTOKPKOCNDGUVQ­GP//#)



.

.7-#0%+&KQENGVKCPXUFGTTÌOKUEJG-CKUGTCWU&CNOCVKGP9GVVGTGP5OKV\CJNTGKEJGP #DDKO6GZV)CP\NGKPGPVCFGNNQUGU'ZGORNCT//#)



.

/#46+0+4/QPGVC\KQPGDTQP\GCTQOCPCVCTFQTGRWDDNKECPC+&KXQU+WNKWUFK1EVCXKCPWUCUUKFK 5GZVWU2QORGKWUGOKUUKQPKFKGRTGHGVVKFK#PVQPKWU)NCWZ/KNCPQ5OKVOGJTGTGP6HP



.

/#66+0).; * %QKPU QH VJG 4QOCP 'ORKTG KP VJG $TKVKUJ /WUGWO  $·PFG KP  6GKNGP 0CEJ   FTWEMG.QPFQPFGT#WUICDG.QPFQP.GKPGP  



.

/#66+0).;*5;&'0*#/'WC *TUI 6JG4QOCP+ORGTKCN%QKPCIG8QNWOG+:8CNGP VKPKCP+VQ6JGQFQUKWU+0CEJFTWEM.QPFQP:.+856HP)CP\NGKPGPPGWYGTVKI



46


ANTIKE - RÖMER .

6JG4QOCP+ORGTKCN%QKPCIG8QNWOG8+(TQO&KQENGVKCP UTGHQTO #& VQVJGFGCVJQH/CZK OKPWU #&   0& .QPFQP  FGT #WUICDG .QPFQP  ::+  5  6HP )CP\NGKPGP   (NGEMCWHFGT5EJPKVVUGKVG



.

6JG4QOCP+ORGTKCN%QKPCIG8QNWOG:6JGFKXKFGFGORKTGCPFVJGHCNNQHVJGYGUVGTPRCTVU#& 0&.QPFQP%.:::++56HP)CP\NGKPGPPGWYGTVKI



.

/#74+%',0WOKUOCVKSWG%QPUVCPVKPKGPPG+EQPQITCRJKGGVEJTQPQNQIKG&GUETKRVKQPJKUVQTKSWGFGU ¾OKUUKQPU OQP¾VCKTGU  $·PFG (QTPK 0CEJFTWEMFGT#WUICDG2CTKU%.::+:5 6HP%:::8+56HP:.8+++56HPLGYGKNUOKVGKPKIGP(CNVVCDGNNGP)CP\NGKPGP //#)  



/#<<+0+)/QPGVGKORGTKCNKTQOCPG$·PFG/KNCPQ:+:56HP+: 56HP+:56HP:+++56HP+:56HP)CP\NGKPGPOKV-QRH IQNFUEJPKVV//#)  



.

8QPITQ­GT5GNVGPJGKV'ZGORNCTG0TCWUGKPGTCWH'ZGORNCTGNKOKVKGTVGP#WHNCIG

.

/'6%#.( 9' 6JG %KUVQRJQTK QH *CFTKCP 05 0GY;QTM56HP)CP\NGKPGP //#)



.

/+55'4' ) (106#0# (/ .C %QNNG\KQPG /KUUGTG FK /QPGVG 4QOCPG 2TQXKPEKCNK /QFGPC   ::+++56HP1TKI$TQUEJWT



.

/+66#)2(#NVG-ÌRHGKPPGWGP*·PFGP7TJGDGTWPF(WPMVKQPFGT-QPVQTPKCVGP#PVKSWKVCU $QPP:+56HP.GKPGP



.

/1//5'0 6 )GUEJKEJVG FGU TÌOKUEJGP /ÒP\YGUGPU 0CEJFTWEM )TC\  FGT #WUICDG $GTNKP    :::++  5 GKPG GTI·P\GPFG (CNVVCDGNNG )CP\NGKPGP $NGKDUVKHVPQVK\ CWH FGT NGV\VGP 5GKVG #   



.

/156'%-;*/ÒP\GP\YKUEJGP4QOWPF$[\CP\5VWFKGP\WTUR·VCPVKMGP0WOKUOCVKM0WOKUOC VKEC.QXCPKGPUKC.QWXCKPNC0GWXG+856HP.GKPGP



.

/17%*/180#.GUOQPPCKGUGVNGUCVGNKGTUOQP¾VCKTGUFG5GTFKEC5QHKC8+++5 6HP#WHFGTGTUVGP5GKVGMNGKPGT9CUUGTHNGEM)CP\NGKPGP



.

/ª..'4 ' %·UCTGP2QTVT·VU +++ 6GKN $GKVT·IG \WT 2J[UKQIPQOKMWPF2CVJQITCRJKGFGTTÌOKUEJGP -CKUGTJ·WUGTPCEJKJTGP/ÒP\GPWPFCPFGTPCPVKMGP&GPMO·NGTP$GTNKP5OKV\CJNTGKEJGP /ÒP\CDDCWHWPRCI6HPKO6GZVUQYKGYGKVGTGP6HPOKV$ÒUVGP5VCVWGPWPF(QVQU$TQUEJKGTV WPCWHIGUEJPKVVGP



0'9'..'600/$CPF6YQ4QOCP*QCTFUHTQO&WTC'WTQRQU6JGHKHVJ&WTC *QCTF6YQ*QCTFUHTQO/KPVWTPQ6JGUKZVJUGXGPVJCPFVGPVJ&WTC*QCTFU0GY;QTM -NGKPu*CNDNGKPGP



.

$CPFWPFYWTFGPXQP#4$'..+0)'4XGTHCUUV

.

2#1.7%%+4<7$#.COQPGVC\KQPGFK#SWKNGKCTQOCPC6JG4QOCP+ORGTKCNEQKPCIGQH#SWK NGKC2CFWC5OKV\CJNTGKEJGP#DD1TKI)CP\NGKPGP#



.

2'6'4 / 'KPG 9GTMUV·VVG \WT *GTUVGNNWPI XQP UWDCGTCVGP &GPCTGP KP #WIWUVC 4CWTKEC 5(/#    $GTNKP5OKV#DD6CDGNNGP6HP$TQUEJKGTV



.

2+0--6JG6TKWOXKTKOQPGVCNGUCPFVJGUVTWEVWTGQHVJGEQKPCIGQHVJGTQOCPTGRWDNKE050GY ;QTM   5 /QFGTPGU )CP\NGKPGP &C\W  &GT #WHDCW FGT TÌOKUEJGP /ÒP\RT·IWPI KP FGT   -CKUGT\GKV5.QUG.CIGP  



.

4#.(¤.&+ / &KG %QPUVCPVKPKUEJG )QNFRT·IWPI 7PVGTUWEJWPIGP \W KJTGT $GFGWVWPI HÒT -CKUGT   RQNKVKMWPF*QHMWPUV/CKP\:+56HP1TKI)CP\NGKPGP//#)



.

&KG %QPUVCPVKPKUEJG )QNFRT·IWPI 7PVGTUWEJWPIGP \WKJTGT$GFGWVWPIHÒT-CKUGTRQNKVKMWPF*QHMWPUV /CKP\:+56HP1TKI)CP\NGKPGP6KVGNGVYCUDGUEJOWV\V//#)



.

4').+0)-&GT&QTVOWPFGT(WPFTÌOKUEJGT)QNFOÒP\GP&QTVOWPF56HP)CP\NGK PGP



.

4'75%* 9 &GT -ÌNPGT /ÒP\UEJCV\HWPF XQO ,CJTG  <WINGKEJ GKP $GKVTCI\WT)GUEJKEJVGFGU TÌOKUEJGP-ÌNP.GKR\KI56HP-CTVQPKGTVOKPKOCNDGUVQ­GP



.

41$'46510 #5 4QOCP +ORGTKCN %QKPU KP VJG *WPVGT %QKP %CDKPGV 7PKXGTUKV[ QH )NCUIQY    $·PFG1ZHQTFWC%.::+56HP%.:8+++56HP%:+85 6HP%%:8+56HP:.8+++56HP)CP\NGKPGP#$GK$CPF$WEJ TÒEMGPNGKEJVIGNÌUV   

.

415619<'9 / 4ÌOKUEJG $NGKVGUUGTCG 'KP $GKVTCI \WT 5Q\KCN WPF 9KTVUEJCHVUIGUEJKEJVG FGT   TÌOKUEJGP-CKUGT\GKV.GKR\KI+:56HP*CNDNGFGT

 47


ANTIKE - RÖMER .

47<+%-#.&KG/ÒP\GPXQP5GTFKEC5&CWUFGT0WOKUOCVKUEJGP<GKVUEJTKHV :.8+++$CPF  9KGP56HP/KVYGPKIGP#POGTMWPIGPKO6GZV)CP\NGKPGP



/KV$GUKV\GTUVGORGN0WOKUOCVKUEJGT.GJTCRRCTCVFGT7PKXGTUKV·V9KGPCWHOGJTGTGP5GKVGP

.

&KG /ÒP\GP XQP 2CWVCNKC 5& CWU $WNNGVKP FG N +PUVKVWV CTEJ¾QNQIKSWG DWNICTG    5    5QHKC56HP/QFGTPGT)CP\NGFGTGKPDCPF//#)



5GJTUGNVGPGU9GTM

.

5#06+0+ # 5CIIKQ FK ECVCNQIQ IGPGTCNG FGNNG OQPGVG EQPUQNCTK CPQPKOG EQP UKODQNK /KNCPQ    5(CNVVHP1TKI$TQUEJWTUVCTMDGUVQ­GP'KPTKUUKO4ÒEMGP6GKNYGKUGWPDGUEJPKVVGP//#) 



.

5#6*;#/746*;6%CVCNQIWGQHTQOCPIQNFEQKPU&GRCTVOGPVQH#TEJCGQNQI[-GTCNC6JKTWXC PCPVJCRWTCO56HP1TKI$TQUEJWTDGUVQ­GP



.

5%*##(( 7 /ÒP\GP FGT TÌOKUEJGP -CKUGT\GKV OKV 5EJKHHUFCTUVGNNWPIGP KO 4ÌOKUEJ)GTOCPKUEJGP   <GPVTCNOWUGWO4)</-CVCNQIGXQTWPFHTÒJIGUEJKEJVNKEJGT#NVGTVÒOGT/CKP\8++5 (CTDVHP6HP.GKPGPOKV5EJWV\WOUEJNCI//#)



.

5%*7.6' $ &KG )QNFRT·IWPI FGT ICNNKUEJGP -CKUGT XQP 2QUVWOWU DKU 6GVTKEWU 6[RQU /QPQITC   RJKGP\WTCPVKMGP0WOKUOCVKM#CTCWWC56HP)CP\NGKPGP//#)



.

5%*7.6<5&KG/ÒP\RT·IWPIXQP/CIPGUKCCO/·CPFGTKPFGTTÌOKUEJGP-CKUGT\GKV*KNFGUJGKO 56HP-CTVQPKGTV//#)



.

5*+'. 0 6JG 'RKUQFG QH %CTCWUKWU CPF #NNGEVWU $#41ZHQTF+++56HP$TQ UEJWT4ÒEMGPIGNÌUV//#)



.

52#07/-GTCOQUFK%CTKC5VQTKCG/QPWOGPVK5VWFKC#TEJCGQNQIKEC4QO5OKV \CJNTGKEJGP#DD6HP)CP\NGKPGP



.

561..46KGTGCWHTÌOKUEJGP/ÒP\GP6TKGT+:5OKV#DD(TCWGPCWHTÌOKUEJGP /ÒP\GP6TKGT5OKV#DD#TEJKVGMVWTCWHTÌOKUEJGP/ÒP\GP6TKGT5OKV #DD&KG/ÒP\GPFGTTÌOKUEJGP-CKUGTXQP6TKGT6TKGT5OKV#DD*GTCMNGUCWH TÌOKUEJGP/ÒP\GP6TKGT5OKV#DD-CTVQPKGTV  



564#%- 2. 7PVGTUWEJWPIGP \WT TÌOKUEJGP 4GKEJURT·IWPI FGU \YGKVGP ,CJTJWPFGTVU 6GKN    5VWVVICTV:+56HP8+++56HP:56HP*CNDNGKPGP//#)   



.

/KVJCPFUEJTKHVNKEJGO$GUKV\GTXGTOGTM$GEMGPDCWGT

.

7PVGTUWEJWPIGP\WTTÌOKUEJGP4GKEJURT·IWPIFGU\YGKVGP,CJTJWPFGTVU6GKN5VWVVICTV :+5FCXQP(CNVVCDGNNGP6HP8+++5(CNVVCDGNNGP6HP:56HP 'KPJGKVNKEJKP)CP\NGFGTIGDWPFGP*GTXQTTCIGPFG'TJCNVWPI//#)  



.

576*'4.#0&%*86JG%KUVQRJQTKQH#WIWUVWU4055RGEKCN2WDNKECVKQP.QPFQP:++ 56HP.GKPGP//#)



.

576*'4.#0& %*8%#4510 4# 6JG 4QOCP +ORGTKCN %QKPCIG $CPF  .QPFQP    )CP\NGKPGP$CPFKUVWPVGTVGKNKP\YGK$·PFG  



.

576*'4.#0&%*8-4##;%/%CVCNQIWGQH%QKPUQHVJG4QOCP'ORKTGKPVJG#UJOQNGCP /WUGWO 2CTV  #WIWUVWU E  $%  #&   1ZHQTF  :8 5  6HP OKV LG GKPGT 5GKVG   $GUEJTGKDWPI5(QNKQ*CNDNGKPGP//#)



.

5;&'0*#/ '# 6JG %QKPCIG QH VJG 4QOCP 4GRWDNKE .QPFQP  .:+:  5 8+  6HP   )CP\NGKPGP//#)



.

6JG%QKPCIGQHVJG4QOCP4GRWDNKE.QPFQP.:+:56HP)CP\NGFGTKP$ÒPFGPOKV -QRHIQNFUEJPKVVVCFGNNQUG'TJCNVWPI//#)



.

5<#+8'46 9 &KG /ÒP\RT·IWPI FGT -CKUGT 6KDGTKWU WPF %CKWU %CNKIWNC   /+4  WPF    9KGP56HP$TQUEJWT//#)



.

61;0$'' ,/% 4QOCP *KUVQTKECN 2QTVTCKVU .QPFQP   5 OKV  #DD .GKPGP OKV   5EJWV\WOUEJNCI



.

64+../+%*9(COKNKGPRTQRCICPFCFGT-CKUGT%CNKIWNCWPF%NCWFKWU#ITKRRKPC/CKQTWPF#PVQ PKC#WIWUVCCWH/ÒP\GP#/7)5$GTNKP:856HP6CDGNNGP.GKPGP//#) 



674%#0 4 0KITC /QPGVC 5EGCWZ ,GVQPU 6GUUGTGU #OWNGVVGU 2NQODU OQP¾VCKTGU QW OQP¾VKHQT   OGU 1DLGVU FKXGTU GP RNQOD QW GP GVCKP F ¾RQSWG 4QOCKPG EQPUGTX¾U CW /WU¾G FGU $GCWZ#TVU FG   .[QP#XGEWPCRRGPFKEGUWTN GORTGKPVGGPRNQODF WPEQKPFGO¾FCKNNQP+OR¾TKCN.[QP5 6HP)CP\NGKPGPPGWYGTVKI



.

48


ANTIKE - KELTEN .

8#)+&.%QKPCIGCPF*KUVQT[QHVJG4QOCP'ORKTG$·PFG5KFPG[:+:5:+8 5OKV\CJNTGKEJGP#DDKO6GZV.GKPGPOKV5EJWV\WOUEJNCI//#)  



.

81'66'41%QNNGEVKQP'TPUV2TKP\\W9KPFKUEJ)T·V\8+$CPF+/ÒP\GPFGTTÌOKUEJGP4GRW DNKM++/ÒP\GPFGTTÌOKUEJGP-CKUGT9KGP56H)CP\NGKPGP



.

&KG -WRHGTRT·IWPI FGT &KQENGVKCPKUEJGP 6GVTCTEJKG 5& 9KGP   5  6HP FCXQP  (CNVVHP   )CP\NGKPGP#



$GUKV\GTUVGORGNYWTFGGPVHGTPV

.

&KG /ÒP\GP FGT TÌOKUEJGP -CKUGT -CKUGTKPPGP WPF %CGUCTGP XQP &KQENGVKCPWU DKU 4QOWNWU -CVCNQI   FGTJKPVGTNCUUGPGP5COONWPIWPF#WH\GKEJPWPIGPFGU*GTTP2CWN)GTKP9KGP5$TQUEJKGTV //#)



.

9'+..'44&GT5EJCV\HWPFXQO6KVGNDGTI  #PVQPKPKCPGXQP%CTCECNNCDKU#WTGNKCP5VWFKGP \WT(WPFOÒP\GPFGT#PVKMG  5OKV6HPWPF\WO6GKNHCTDKIGP#DD$TQUEJKGTV



.

9'+5'4 9 -CVCNQI FGT $KVJ[PKUEJGP /ÒP\GP FGT 5COONWPI FGU +PUVKVWVU HÒT #NVGTVWOUMWPFG FGT   7PKXGTUKV·V-ÌNP$CPF0KMCKC/KVGKPGT7PVGTUWEJWPIFGT2T·IGU[UVGOGWPF)GIGPUVGORGN2CR[ TQNQIKEC%QNQPKGPUKC1RNCFGP::8+56HP1TKI$TQUEJWT6%1456'0$CPF -ÌPKIG%QOOWPG$KVJ[PKCG5V·FVG CW­GT0KMCKC 2CR[TQNQIKEC%QNQPKGPUKC1RNCFGP:++ 5OKV\CJNTGKEJGP#DD1TKI$TQUEJWT  



.

9+'4%+05-#,%CVCNQIWGQH#PEKGPV%QKPUKPVJG0CVKQPCN/WUGWOKP9CTUCY%QKPUQHVJGTQOCP TGRWDNKE9CTUEJCW56HP-CTVQPKGTV



.

91;6'- $ #TOC GV 0WOOK (QTUEJWPIGP \WT TÌOKUEJGP (KPCP\IGUEJKEJVG WPF /ÒP\RT·IWPI FGT   ,CJTGDKUX%JT8GTÌHHGPVNKEJWPIGPFGTPWOKUOCVKUEJGP-QOOKUKQP$CPF9KGP:+++ 56HP-CTVQPKGTV



947%-9&KGU[TKUEJG2TQXKP\KCNRT·IWPIXQP#WIWUVWUDKU6TCLCP5VWVVICTV8+++5 6HP*CNDNGFGTDGUVQ­GP



.

/KVJCPFUEJTKHVNKEJGT9KFOWPI

.

;#5*+0%(TQO#UECNQPVQ4CRJKC%KV[%QKPUQHVJG5QWVJGTP2CNGUVKPKCP%QCUV,GTWUCNGO 56HP-CTVQPKGTV



.

<'*0#%-'4*/QPGVC4GEJGTEJGUUWTN QTICPKUCVKQPGVN CTVFGU¾OKUUKQPUOQP¾VCKTGUFGNC4¾RW DNKSWG4QOCKPG CX,% $'(#4$·PFG4QO::+856HP1TKI )CP\NGKPGP//#)  



<+').'44&GT5EJCV\HWPFXQP$TCWYGKNGT7PVGTUWEJWPIGP\WT/ÒP\RT·IWPIWPF\WO)GNFWONCWH KOICNNKUEJGP5QPFGTTGKEJ$GKJGHVGFGT$QPPGT,CJTDÒEJGT$QPP5(CNVMCTVG6HP )CP\NGKPGP



.

5V·FVKUEJGU2TGUVKIGWPFMCKUGTNKEJG2QNKVKM5VWFKGP\WO(GUVYGUGPKP1UVMKNKMKGPKOWPF,CJTJWP FGTVP%JT-WNVWTWPF'TMGPPVPKU&ÒUUGNFQTH56HP-CTVG-WPUVNGKPGP



.

-1081.76 -QPXQNWV XQP /QPQITCRJKGP #WUUVGNNWPIUMCVCNQIGP WPF 5QPFGTFTWEMGP \WT TÌOKUEJGP   0WOKUOCVKMWC)(¤45%*0'4&KG/ÒP\GPFGTTÌOKUEJGP-CKUGTKP#NGZCPFTKGP(TCPMHWTVCO /CKP  24 (4#0-'+ 2##4 &KG CPVKMGP /ÒP\G FGT 5COONWPI *G[PGP -ÌNP  24   (4#0-' -NGKPCUKGP \WT 4ÌOGT\GKV /ÒPEJGP  4 )¤$. 'KPHÒTWPI KP FKG /ÒP\MWPFG FGT   TÌOKUEJGP -CKUGT\GKV 9KGP  7 -#/2/#006 )#05%*19 &KG /ÒP\GP FGT TÌOKUEJGP   /ÒP\UV·VVG#NGZCPFTKC4GIGPUVCWH*,$'4-4QOCP)QNF%QKPUQHVJG/GFKGXCN9QTNF  #& +NNKPQKU  &# 5'#4 4QOCP %QKPU CPF VJGKT 8CNWGU  #WHNCIG  # 5#8+1   -CVCNQI FGT CNGZCPFTKPKUEJGP /ÒP\GP FGT 5COONWPI &T %JTKUVKCP (TKGFTKEJ #WIWUV 5EJNGFGJCWU KO   -WNVWTIGUEJKEJVNKEJGP /WUGWO 1UPCDTÒEM $TCOUEJG  5QPFGTFTWEMG   /QPQITCRJKGP     7PVGTUEJKGFNKEJIGDWPFGP  



0WOKUOCVKE0QVGUCPF/QPQITCRJU(QWT/GFCKNNQPUHTQOVJG#TTCU*QCTF$CTDCTKCPUQP 4QOCP +ORGTKCN %QKPU CPF 5EWNRVWTG   (GUVCN CPF &CVGF %QKPU QH VJG 4QOCP 'ORKTG (QWT   2CRGTU0GY;QTM  



.

.

-'.6'0 .

#..'0&(6JG%QKPUHTQOVJG1RRKFWOQH#NVGPDWTICPFVJG$WUJGN5GTKGU5&CWU)GTOCPKC /CKP\56HP-CTVGP-CTVQPKGTV4ÒEMGPNÌUVUKEJNGKEJV



.

$17&'64&'2';416)/QPPCKGU)CWNQKUGU¯NC%TQKZ%QNNGEVKQP/QPGVC9GVVGTGP 5OKV#DD6HP1TKI$TQUEJWT



.

$4'016%5%*''455%CVCNQIWGFGU/QPPCKGU/CUUCNK½VGUGV/QPPCKGU%GNVKSWGUFW/WU½GFGU $GCWZ#TVUFG.[QP.GWXGP:8+++55.GKPGPOKV5EJWV\WOUEJNCI

 49


ANTIKE - KELTEN .

%1.$'46&'$'#7.+'7,$%CVCNQIWGFGUEQNNGEVKQPUCTEJ¾QNQIKSWGUFG$GUCP¼QP.GUOQP PCKGU )CWNQKUGU #PPCNGU NKVV¾TCKTGU FG Ny7PKXGTUKV¾ FG $GUCP¼QP   #WHNCIG 2CTKU   5    6HP1TKI$TQUEJWT/&#;'6%CVCNQIWGFGUOQPPCKGUICWNQKUGUFW,WTC#PPCNGUNKVV¾TCKTGUFG Ny7PKXGTUKV¾FG$GUCP¼QP2CTKU56HP1TKI$TQUEJWT#



&'.'564''.26#%*'/0QWXGN#VNCUFGU/QPPCKGU)CWNQKUGU$CPF5CKPV)GTOCKPGP .C[G$CPF&GNC5GKPGCW4JKP5(CTDVHP$CPF&GNC5GKPG¯NC.QKTG OQ[GPPG5(CTDVHP$CPF5(CTDVHP5WRRN¾OGPVCWZVQOGU++++++5 (CTDVHP-CTVQPKGTV$CPFWPFKO5EJWDGT$CPFYWTFGXGTMGJTVJGTWOIGDWPFGP  



&'/$5-+)-WPUVJKUVQTKUEJGU/WUGWO9KGP/ÒP\MCDKPGVV-CVCNQIFGTCPVKMGP/ÒP\GP#)TKG EJGP+*KURCPKGPWPFFKGTÌOKUEJGP2TQXKP\GP)CNNKGPU9KGP856HP-CTVG-CTVQ PKGTV//#)



&'41%#.GUOQPPCKGU)CWNQKUGUF CTIGPVFGNCXCNN¾GFW4JÊPG'VWFGUFGPWOKUOCVKSWG%GNVKSWG 2CTKU:+56HP1TKI$TQUEJWTNGKEJVGT-PKEMKPFGTTGEJVGPQDGTGP'EMG//#) 



.

&'55'9((; / $CTD±T 2¾P\GK $WFCRGUV  56HP*CNDNGFGTOKVYGPKIGP7PVGTUVTGK EJWPIGPKO6GZV//#)



.

&7%*#.#+5#&GUETKRVKQPFGUO¾FCKNNGU)CWNQKUGUHCKUCPVRCTVKGFGUEQNNGEVKQPUFGNC$KDNKQVJ½SWG 4Q[CNG2CTKU:56HP*CNDNGFGTDGUVQ­GP5VQEMHNGEMKI4ÒEMGPOKV-NGDGDCPFHKZKGTV //#)



.

.

.

/KV$GUKV\GTUVGORGN$KDNKQVJGM-CTN-KTEJOCKT

.

(144'44-GNVKUEJG0WOKUOCVKMFGT4JGKPWPF&QPCWNCPFG5VTC­DWTI:+5OKV\CJN TGKEJGP#DDKO6GZV6HPFCXQPHCTDKIG(CNVVHP*CNDNGKPGP'KPDCPFDGTKGDGP//#)



.

)7/#00#2QVKPOÒP\GPFGT-GNVGP'KPGU[UVGOCVKUEJG<WUCOOGPUVGNNWPIFGTDGMCPPVGP6[RGP OKV4GHGTGP\CPICDGP8KGTVGÒDGTCTDGKVGVG#WHNCIG$GTP:+5OKV\CJNTGKEJGP#DD5RKTCN DKPFWPI



.

)¤$. 4 1UVMGNVKUEJGT 6[RGPCVNCU /KV OGVJQFKUEJGO -QOOGPVCT $TCWPUEJYGKI   5    6HP)CP\NGKPGPVCFGNNQUGU'ZGORNCT//#)



.

)142*' , .G 6T½UQT FG 6C[CE 2CTKU   5 OKV \CJNTGKEJGP #DD WPF  -CTVG1TKI$TQ UEJWT



.

)47'. -/14+0 ' .GU OQPPCKGU %GNVGU FW /WU¾G FG $TGVCIPG 2CTKU   5 FCXQP    (CTDVHP-CTVQPKGTV//#)



.

*'+55#&GUETKRVKQPI¾P¾TCNGFGUOQPPCKGUCPVKSWGUFGN 'URCIPG2CTKU56HP)TQ­ HQNKQ*CNDNGFGTOKPKOCNDGUVQ­GP//#)



.

*1$$5 4 $TKVKUJ +TQP #IG %QKPU KP VJG $TKVKUJ /WUGWO .QPFQP   5  6HP .GKPGP   //#)



.

-152-GNVUMK0QXEK5NQXGPKLG-GNVKUEJG/ÒP\GP5NQYGPKGPU5KVWNC.LWDNLCPC5 6HP 1TKI $TQUEJWT &C\W ' -1.0+-18Š -GNVUM¾ /KPEG PC 5NQXGPUMW $TCVKUNCXC   5   .GKPGPOKV5EJWV\WOUEJNCI  



.'0);'..&CUIGJGKOG9KUUGPFGT-GNVGPGPVT·VUGNVCWUFTWKFKUEJMGNVKUEJGT/[VJKMWPF5[ODQ NKM(TGKDWTIKP$T5OKVTF#DDXQP/ÒP\GPWPF$GK\GKEJGPCWHFGP/ÒP\GP(C FGPIGJGHVGVGT-WPUVNGFGTGKPDCPF



.14+%*5 )& FG 4GEJGTEJGU PWOKUOCVKSWGU EQPEGTPCPV RTKPEKRCNGOGPV NGU O¾FCKNNGU EGNVKD¾TKGP   PGU$CPF2CTKU5*CNDNGFGT8QTDNCVVWPFNGV\VG6CHGNTGRCTKGTV9CUUGTUEJCFGPWPFNGKEJV UVQEMHNGEMKI#



/';'4 * $GUEJTGKDWPI FGT KP FGT 5EJYGK\ CWHIGHWPFGPGP )CNNKUEJGP /ÒP\GP <ÒTKEJ 8+++ 56HP*CNDNGKPGP#WHFGP5GKVGPKUVQDGPGKPNGKEJVGT-PKEMWPFCWHFGTNGV\VGP5GKVGTGEJVU WPVGP



.

.

.

*CPFUEJTKHVNKEJGT$GUKV\GTXGTOGTM$GEMGPDCWGT'

.

0#5* & 5GVVNGOGPV  %QKPCIG KP %GPVTCN )CWN E    $% $#4 5WRRNGOGPVCT[ 5GTKGU     $·PFG1ZHQTF8++56HP+PFGZ1TKI$TQUEJWT//#)  



.

10&417%*8-GNVUM¾/KPEG6[RW$KCVGE\$TCVKUNCX[2QMNCFXGNyMÓEJUVTKGDQTPÓEJOKPEÃ\TQMW  #TEJCGQNQIKEC GV *KUVQTKEC $TCVKUNCXKGPUKC /QPQITCRJKCG  $TCVKUNCXC   5  6HP    (CNVMCTVGP)CP\NGKPGP



2#7.5'0 4 &KG /ÒP\RT·IWPIGP FGT $QKGT OKV $GTÒEMUKEJVKIWPI FGT XQTDQKUEJGP 2T·IWPIGP    $·PFG .GKR\KI9KGP  8+++  5  6HP (CNVMCTVG  6HP 'KPJGKVNKEJ KP TQVGO )CP\NGFGT   IGDWPFGPXGTGKP\GNVG5VQEMHNGEMGP//#)  



.

50


BYZANZ - VÖLKERWANDERUNG .

2#76#551#.GOQPGVGRTGTQOCPGFGNN +VCNKCUGVVGPVTKQPCNG8CTGUG56HP)CP\ NGKPGP'ZGORNCT0T//#)



.

2+0- - 'KPHÒJTWPI KP FKG -GNVKUEJG /ÒP\MWPFG #TEJCGQNQIKC #WUVTKCEC $GKVT·IG \WT 2CN·CPVJTQ   RQNQIKG7TWPF(TÒJIGUEJKEJVG¤UVGTTGKEJU9KGP56HPWPFGKPGT(WPFMCTVG*CNDNGK PGP&C\W'KPHÒJTWPIKPFKGMGNVKUEJG/ÒP\MWPFGOKVDGUQPFGTGT$GTÒEMUKEJVKIWPIFGUÌUVGTTGKEJK UEJGP4CWOGU#WHNCIG9KGP56HP-CTVG1TKI$TQUEJWT  



/KVJCPFUEJTKHVNKEJGP$GUKV\GTXGTOGTM$GEMGPDCWGT'

568

.

&KG/ÒP\RT·IWPIFGT1UVMGNVGPWPFKJTGT0CEJDCTPGTI·P\VGWPFXGTDGUUGTVG#WHNCIGJGTCWUIGIGDGP XQP4)¤$.$TCWPUEJYGKI1TKIKPCNCWUICDGGTUEJKGPKPFGT4GKJG&KUUGTVCVKQPGU2CPPQPK ECG:++56HPHCTDKIG(CNVMCTVG)CP\NGKPGP



21.'0< * /ÒP\GP KP NCV½PG\GKVNKEJGP )T·DGTP/KVVGNGWTQRCUCWUFGT<GKV\YKUEJGPWPFX %JT )GDWTV 5& CWU $C[GTKUEJG 8QTIGUEJKEJVUDN·VVGT    5   6HP /KV \CJNTGKEJGP   #DD*CNDNGFGT



.

5%*''455/QPPCKGU)CWNQKUGUFG5GKPG/CTKVKOG4QWGP56HPKP$GKNCIG1TKI $TQUEJWT//#)



.

6174 * FG NC #VNCU FG OQPPCKGU )CWNQKUGU 2CTKU   5  6HP *CNDNGKPGP &C\W 5   5%*''457PEQORNGOGPVCN CVNCUFGOQPPCKGU)CWNQKUGUFG*GPTKFGNC6QWT2CTKU/CCUVTKEJV 51TKI$TQUEJWT  



.

8#0#45&'..4&%GNVKE%QKPCIGQH$TKVCKP.QPFQP:8+56GZVCDD6HP)CP\ NGKPGP



.

8#0 &'4 9+'.'0 ;)'+5'4 #-ę0+) ('%#/2#)01.1 / /QPPC[CIGU #NNQDTQ   IGU %CJKGTU TQOCPFU FG PWOKUOCVKSWG  .CWUCPPG   5 FCTWPVGT \CJNTGKEJG #DD WPF 6HP   1TKI$TQUEJWT//#)



.

8+..#410)#)#44+)#..GUOQPGFCUFG#TUG5CIWPVWO$CTEGNQPC(TQPVKURK\5 6HP1TKI$TQUEJWT



.

-1081.76 -QPXQNWV XQP /QPQITCRJKGP WPF 5QPFGTFTWEMGP \WT MGNVKUEJGP 0WOKUOCVKM WC '   $17&'#7 /QPPCKGU )CWNQKUGU /CCUVTKEJV  # $74-*#4&6 3WCPVKVCVKXG /GVJQFGP \WT   MGNVKUEJGP 0WOKUOCVKM $GTP  * &#00*'+/'4 *TUI  &GT /ÒP\HWPF XQP 5QPVJGKO /ÒP   EJGP  / '))'4 &CU GTUVG )GNF KP $C[GTP5&CWU$C[GTNCPF7PVGTUEJKGFNKEJIGDWP FGP  



.

5GJTUGNVGPGU9GTM/KVJCPFUEJTKHVNKEJGP$GUKV\GTXGTOGTM$GEMGPDCWGT'

$;<#0<8¤.-'49#0&'470)(4ª*/+66'.#.6'4 .

.

$#44#.+#.6'6:.CEKTEWNCVKQPFGUOQPPCKGU5W½XGUGV8KUKIQVKSWGU%QPVTKDWVKQP¯N JKUVQKTG ¾EQPQOKSWG FW TQ[CWOG XKUKIQV $GKJGHVG FGT (TCPEKC  /ÒPEJGP   5  6HP )CP\NGKPGP   //#)



$'0&#..5#2TKXCVG%QNNGEVKQPQH2CNCGQNQICP%QKPU9QNXGTJCORVQP5FCXQP5 6HP)GDWPFGPVCFGNNQUGT<WUVCPF



$[\CPVKPGYGKIJVU#PKPVTQFWEVKQP.QPFQP5OKV#DDWPFGKPGT6HOKV/QPQITCOOGP CWH)NCUIGYKEJVGP*CNDNGFGT



0TXQP'ZGORNCTGP

.

51


BYZANZ - VÖLKERWANDERUNG

579

.

$'4)*#752&KGOGTQYKPIKUEJGP6TKGPVGPXQP#NVGPYCNFG5&CWU&KG-WPFG  5 6HP-CTVGP*CNDNGKPGP=OKV9KFOWPIFGU8GTHCUUGTU?



'ZNKDTKU2GVGT$GTIJCWU

.

&'/1 < 1UVTQIQVJKE %QKPCIG HTQO %QNNGEVKQPU KP %TQCVKC 5NQXGPKC CPF $QUPKC  *GT\GIQXKPC   5KVWNC.LWDNLCPC:85OKV6HPGKPGT-CTVGWPF#DD-CTVQPKGTV



.

&ª44 0 %CVCNQIWG FGU RQKFU $[\CPVKPU %CVCNQIWG FG NC EQNNGEVKQP .WEKGP 0CXKNNG CW %CDKPGV FG   0WOKUOCVKSWGFW/WU¾GF #TVGVF *KUVQKTGFG)GP½XG5&CWU)GPCXC$CPF:++5FCXQP 6HPOKV\CJNTGKEJGP#DD5EJÌPGT*CNDNGFGTGKPDCPFOKV/CTOQTRCRKGTPGWYGTVKI



(4+'&.#'0&'4 , &KG /ÒP\GP FGT 1UVIQVJGP $GTNKP   5  6HP  &KG /ÒP\GP FGT   8CPFCNGP0CEJVT·IG\WFGP/ÒP\GPFGT1UVIQVJGP.GKR\KI56HP+PGKPGO$CPFIGDWP FGP-CTVQPKGTVDGUVQ­GP



.

.

)#4%+# #%'5%7&'41 (//106'1.+8# ,8 /QPGFCU 8KUKIQFCU %CV±NQIQ FGN )CDK   PGVGFG#PVKIÒGFCFGU/CFTKF5OKV\CJNTGKEJGPHCTDKIGP#DD.GKPGPOKV5EJWV\WOUEJNCI



.

)11&#%4' * # *CPFDQQM QH VJG %QKPCIG QH VJG $[\CPVKPG 'ORKTG .QPFQP  :+  5   \CJNTGKEJG6GZVCDD.GKPGP//#)



.

)4+'45102%CVCNQIWGQHVJG$[\CPVKPG%QKPUKPVJG&WODCTVQP1CMU%QNNGEVKQPCPFKPVJG9JKV VGOQTG %QNNGEVKQP 8QNWOG  #PCUVCUKWU + VQ /CWTKEG  ::8+  5  6HP 8QNWOG    2JQECU VQ 6JGQFQUKWU +++  2CTV + 2QEJCU CPF *GTCENKWU    5  6HP 2CTV ++   *GTCENKWU%QPUVCPVKPGVQ6JGQFQUKWU+++  56HP8QNWOG.GQ+++VQ0KEG RJQTWU+++2CTV+.GQ+++VQ/KEJCGN+++  +:56HP2CTV++$CUKN+VQ 0KEGRJQTWU+++  9CUJKPIVQP&%'KPJGKVNKEJGU)CP\NGKPGP  



*#*09/QPGVC+ORGTKK$[\CPVKPK4GMQPUVTWMVKQPFGU2T·IGCWHDCWGUCWHU[PQRVKUEJVCDGNNCTKUEJGT )TWPFNCIG $CPF  8QP #PCUVCUKWU + DKU ,WUVKPKCPWU +   GKPUEJNKG­NKEJ FGT QUVIQVKUEJGP WPF   XCPFCNKUEJGP 2T·IWPIGP ¤#&9 2JKNJKUV -N &GPMUEJTKHVGP  9KGP   5  6HP    2T·IGVCDGNNGP $CPF  8QP ,WUVKPWU ++ DKU 2JQECU   GKPUEJNKG­NKEJ FGT 2T·IWPIGP FGT *GT   CENKWU4GXQNVGWPFOKV0CEJVT·IGP\WO$CPF¤#&92JKNJKUV-N&GPMUEJTKHVGP9KGP 56HP2T·IGVCDGNNGP$CPF8QP*GTCENKWUDKU.GQ+++#NNGKPTGIKGTWPI  /KV 0CEJVT·IGP \WO  WPF  $CPF  ¤#&9 2JKNJKUV -N &GPMUEJTKHVGP  9KGP   5    6HP2T·IGVCDGNNGP1TKI)CP\NGKPGP//#)  



&KG 1UVRT·IWPI FGU 4ÌOKUEJGP 4GKEJGU KO  ,CJTJWPFGTV   ¤#&9 2JKNJKUV -N &GPM   UEJTKHVGP  9KGP   5  6HP  2T·IGVCDGNNGP .GKPGP //#)   <WT /ÒP\RT·   IWPI FGU HTÒJD[\CPVKPKUEJGP 4GKEJGU #PCUVCUKWU + DKU 2JQECU WPF *GTCENKWU4GXQNVG  9KGP   5OKV\CJNTGKEJGP#DD-CTVQPKGTV  



.

*#*09/'6%#.(9'5VWFKGUKPGCTN[$[\CPVKPGIQNFEQKPCIG050GY;QTM 56HP)CP\NGKPGP#



.

*#*09/'6.+%*/#/QPG[QHVJG+PEKRKGPV$[\CPVKPG'ORKTG #PCUVCUVKWU+,WUVKPKCP+   8+0  9KGP  +8  5  6HP  (CNVVCDGNNGP )CP\NGKPGP VCFGNNQUGT <WUVCPF   #



.

.

52


BYZANZ - VÖLKERWANDERUNG .

*'+55#&GUETKRVKQPI¾P¾TCNGFGUOQPPCKGUFGUTQKU9KUKIQVJUF 'URCIPG2CTKU+++5 6HP*CNDNGFGTDGUVQ­GP9CUUGTHNGEMCWHFGPNGV\VGP6CHGNP//#)



.

/QPGFCU*KURCPQ%TKUVKCPCU&GUFGNCKPXCUKQPFGNQUŠTCDGU$CPF0CEJFTWEM/CFTKFFGT 1TKIKPCNCWUICDGP /CFTKF   5  6HP OKV 2TGKUNKUVG #TCIQP  5 6HP  0C   XCTTC56HP'KPJGKVNKEJKPITÒPGO)CP\NGFGTIGDWPFGPVCFGNNQU



-#5#/#018# .0 (WPF XQP $CTVKO $[\CPVKPKUEJG 5KNDGTOÒP\GP FGU  ,CJTJWPFGTVU +P 0<   6GKN*IXQP&$5EJGNQX/QUMCW56HP)CP\NGKPGP



.

&KGUGT<GKVUEJTKHVGPDCPFGPVJ·NV#WHU·V\GKPTWUUKUEJGT5RTCEJG

.

-4#75((&KG/ÒP\GP1FQXCECTUWPFFGU1UVIQVGPTGKEJGUKP+VCNKGP/ÒP\UVWFKGP*CNNGCPFGT 5CCNG  (TQPVKURK\ :8  5  6HP *CNDNGKPGP OKPKOCN DGUVQ­GP $KPFWPI GVYCU NQEMGT   //#)



.

&KG /ÒP\GP 1FQXCECTU WPF FGU 1UVIQVGPTGKEJGU KP +VCNKGP /ÒP\UVWFKGP  *CNNG CP FGT 5CCNG    (TQPVKURK\:856HP*CNDNGKPGP//#)



.

.#74'06 8 .GU UEGCWZ $[\CPVKPU FW /¾FCKNNKGT 8CVKECP %KVV¯ FGN 8CVKECPQ  ::+++  5   UQYKG6HP$TQUEJKGTVPQEJWPCWHIGUEJPKVVGP



.

.10)7'6*+PVTQFWEVKQP¯NC0WOKUOCVKSWG$[\CPVKPG.QPFQP+:56HP)CP\NGK PGP  # 2TQRQU FW /QPPC[CIG /¾TQXKPIKGP  5& Q1 Q, 5  )GJGHVGV WPCWHIGUEJPKVVGP   =*QOOCIGFGNyCWVGWT?.GU6TKGPU/¾TQXKPIKGPUCW$WUVGFG(CEG5&2CTKUCWU40 5   6H 1TKIIGJGHVGVWPCWHIGUEJPKVVGP=/KV9KFOWPIFGU#WVQTU?7PG6TQWXCKNNGFG /QPPCKGU FGU 2CN¾QNQIWGU 5& $TÒUUGN  CWU 4$0    5  6HP  1TKI   $TQUEJWT=/KV9KFOWPIFGU#WVQTUCWHFGO'KPDCPF?&KGWPGFKVKGTVGPD[\CPVKPKUEJGP/ÒP\GPFGU 9KGPGT -CDKPGVVU Z  5& CWU 0<    5  6HP  .QUGT $WEJDNQEM KP/CRRG=/KV 9KFOWPI FGU #WVQTU? - -4'56'8 $GYGTVWPIUVCDGNNG \WO -CVCNQI 4CVVQ $[\CPVKPKUEJG /ÒP\GP   -ÌNP51TKI$TQUEJWT#  



.

/'6%#.(&/%NCUUKHKECVKQPQH$[\CPVKPG5VCOGPCKPVJGNKIJVQHCJQCTFHQWPFKP5QWVJGTP5GTDKC 5KVWNC.LWDNLCPC56HP1TKI$TQUEJWTOKPKOCNDGUVQ­GP



.

/+.'5 )% 6JG %QKPCIG QH VJG 8KUKIQVJU QH 5RCKP .GQXKIKNF VQ #EJKNC ++ *KURCPKE 0WOKUOCVKE   5GTKGU/QPQITCRJ0GY;QTM:856HP)CP\NGKPGP//#)



.

/144+510-()4706*#.*%CTQNKPIKCP%QKPCIG00/0GY;QTM:++5 6HP(CNVMCTVGP1TKI$TQUEJWT//#)



.

/144+5510 % %CVCNQIWG FGU OQPPCKGU $[\CPVKPGU FG NC $KDNKQVJ½SWG 0CVKQPCNG 6QOG  & #   PCUVCUG+GTC,WUVKPKGP++  2CTKU56HP6QOG&G2JKNKRRKEWUC#NGZKU+++

 2CTKU56HP.GKPGP//#)  



.

12 &'0 8'.&' 9-.##55'0 %,( 5EGCVVCU CPF /GTQXKPIKCP &GPKGTU HTQO &QODWTI CPF   9GUVGPUEJQWYGP/KFFGNDWTI:++5OKV6HP-CTVQPKGTV



.

2417 / %CVCNQIWG FGU /QPPCKGU (TCP¼CKUGU FG NC $KDNKQVJ½SWG 0CVKQPCNG .GU /QPPCKGU %CTQNKP   IKGPPGU 2CTKU  .:::+:  5 OKV #DD  6HP *CNDNGFGT PCEJ HTCP\ÌUKUEJGT $KPFWPIUCTV   2CRKGTGVYCUDT·WPNKEJ//#)



4#0+'4+'.COQPGVC\KQPGFK4CXGPPCCPVKECFCN8CNNy8+++UGEQNQ+ORGTQ4QOCPQG$K\CPVKPQ 4GIPQ 1UVTQIQVQ G .QPIQDCTFQ $QNQIPC  :8+++  5 OKV \CJNTGKEJGP #DD -CTVQPKGTV   #



4#5+.' / .G /QPGVG FK %CRWC FGN RGTKQFQ CPVKEQ G OGFKQGXCNG +VTK   5 OKV XKGNGP #DD   1TKI$TQUEJWTOKV*GHVMNCOOGTCDFTWEM



.

.

/KV9KFOWPIUUVGORGNCWHFGO6KVGNDNCVV

.

4#6614/QPPCKGUD[\CPVKPGU0CEJFTWEM#OUVGTFCOFGT#WMVKQP.WICPQ5 6HP'.)CP\NGKPGP



.

/QPPCKGU $[\CPVKPGU GV F CWVTGU RC[U EQPVGORQTCKPGU C N ¾RQSWG $[\CPVKPG .C RNWU TKEJG GV NC RNWU   XCUVGEQNNGEVKQPRTKX¾G0CEJFTWEM#OUVGTFCOFGT#WUICDG.WICPQ5OKV0TP  6HP 'TIGDPKUNKUVG .GKPGP /KV $NGKUVKHVPQVK\GP - -4'56'8 $GYGTVWPIUVCDGNNG \WO -CVCNQI   4CVVQ/QPPCKGU$[\CPVKPGU/ÒPEJGP56HP.GKPGP  



.

4'+0*#46 9 &KG /ÒP\GP FGU 5YGDGPTGKEJGU .CU OQPGFCU 8KUKIQFCU FGN /WUGQ #TSWGQNQIKEQ   5&CWU/$0)56HP*CNDNGFGT



.

&KG /ÒP\GP FGU YGUVIQVKUEJGP 4GKEJGU XQP 6QNGFQ 5& CWU &GWVUEJGU ,CJTGUDWEJ HÒT 0WOKUOCVKM   ,CJTICPIWPF/ÒPEJGP56HP$TQUEJKGTV



.

4'6195-+1&KG/ÒP\GPFGT-QOPGPGPXQP6TCRG\WPV/QUMCW56HP*CNDNGKPGP FGT<GKVUGJTUGNVGPGU'ZGORNCT

 53


NEUZEIT - ALLGEMEIN .

4+%166+24+0#&.COQPGVC\KQPGCWTGCFGNNG\GEEJGOKPQTK$K\CPVKPGFCN8+CN+:UGEWNQ4QO 56HP.GKPGP//#)



.

5#$#6+'4 , &GUETKRVKQP I¾PGTCNG FGU OQPPCKGU $[\CPVKPGU  $·PFG 0& )TC\  FGT #WUICDG   2CTKU  8++  5  5 +P GKPGO $CPF KP .GKPGP IGDWPFGP :+++  6HP .GKPGP &C\W    YGKVGTG5EJTKHVGP\WTD[\CPVKPKUEJGP0WOKUOCVKM  



&GUETKRVKQP I¾P¾TCNG FGU OQPPCKGU $[\CPVKPGU HTCRR¾GU UQWU NGU GORGTGWTU F 1TKGPV FGRWKU #TECFKWU   LWUSW C NC RTKUG FG %QPUVCPVKPQRNG RCT /CJQOGV ++   $·PFG 0CEJFTWEM .GKR\KI  FGT #WUICDG   2CTKU.QPFQP8++5OKV6GZVCDD6HP56HP)CP\NGKPGP2CTV+NNWUVT¾G )TC\:+++6HP)CP\NGKPGP  



5#/$10)4GRGTVQTKQIGPGTCNGFGNNGOQPGVGEQPKCVGKP+VCNKCGFC+VCNKCPKCNN GUVGTQFCNUGEQNQ8uCN ::u 6GKN  2GTKQFQ FCN  =OGJT PKEJV GTUEJKGPGP? 2CTKIK  (TQPVKURK\ :+  5    6HP$TQUEJWT//#)



5'+$69&KGD[\CPVKPKUEJGP$NGKUKGIGNKP¤UVGTTGKEJ$CPF-CKUGTJQH¤#&98GTÌHHGPVNKEJWPIGP FGT-QOOKUUKQPHÒT$[\CPVKPKUVKM9KGP56HP.GKPGPOKV5EJWV\WOUEJNCI//#) 



61.561+,/QPPCKGU$[\CPVKPGU0&$QNQIPCQ,FGT#WUICDG5V2GVGTUDWTI: 56HP+P\YGK$·PFGPIGDWPFGP.GKPGP  



.

.

.

.

+PTWUUKUEJGT5RTCEJG

.

.

.

.

61/#5+0+ 9, 6JG $CTDCTKE 6TGOKUUKU KP 5RCKP CPF 5QWVJGTP (TCPEG #PCUVCUKWU VQ .GQXKIKNF   00/  0GY ;QTM  ::8  5   6HP 1TKI $TQUEJWT //#)   ,&   $4'%-'04+&)' 6JG 0WOKUOCVKE +EQPQTCRJ[ QH,WUVKPKCP++ #& 00/ 0GY;QTM:56HP1TKI$TQUEJWT  



8¤.%-'45 ** -CTQNKPIKUEJG /ÒP\HWPFG FGT (TÒJ\GKV   2KRRKP -CTNOCPP -CTN FGT   )TQ­G + WPF ++ /ÒP\RGTKQFG  #DJCPFNWPIGP FGT #MCFGOKG FGT 9KUUGPUEJCHVGP KP)ÌVVKPIGP2JKN JKUV-N)ÌVVKPIGP56HP)CP\NGKPGPVCFGNNQUGT<WUVCPF#



9416*99GUVGTPCPFRTQXKPEKCN$[\CPVKPG%QKPUQHVJG8CPFCNU1UVTQIQVJU.QODCTFUCPFQHVJG 'ORKTGU QH 6JGUUCNQPKEC 0KECGC CPF 6TGDK\QPF KP VJG $TKVKUJ /WUGWO 0CEJFTWEM %JKECIQ  FGT   1TKIKPCNCWUICDG .QPFQP  :%+8  5  6HP )CP\NGKPGP ( 56'(#0 &KG /ÒP\UV·VVG 5KT   OKWO WPVGT FGP 1UVIQVGP WPF )GRKFGP 'KP $GKVTCI \WT )GUEJKEJVG FGU IGTOCPKUEJGP /ÒP\YGUGPU KP   FGT<GKVFGT8ÌNMGTYCPFGTWPI*CNNGCPFGT5CCNG56H=/KV$GUKV\GTUVGORGN2GVGT,CGE MGN?1TKI$TQUEJWT  



+ORGTKCN $[\CPVKPG %QKPU KP VJG $TKVKUJ /WUGWO  $·PFG 0& %JKECIQ  FGT #WUICDG .QPFQP   %:++56HP+PGKPGO$CPFIGDWPFGP.GKPGP



0'7<'+6#..)'/'+0 .

$4#75'/#05('.&#(GNF0QVJWPF$GNCIGTWPIUOÒP\GPXQP&GWVUEJNCPF¤UVGTTGKEJ7PICTP 5KGDGPDÒTIGP/QNFCW&·PGOCTM5EJYGFGP0QTYGIGP4WUUNCPF2QNGPWUY$·PFG$GTNKP :+56HP8+++56HP(QNKQ+PGKPGO$CPFKP*CNDNGKPGPIGDWPFGP6C FGNNQUG'TJCNVWPI//#)



$GUKV\GTUVGORGN&T(:9GK\KPIGT%Q

.

&#8'02146,5'WTQRGCP%TQYPU(TCPMHWTV)CNGUDWTI #WHNCIG)CNGUWTICD#WHNCIG.QPFQP  



.

&+'7&100'#/CPWGNFGURQKFUOQP¾VCKTGU2CTKU(TQPVKURK\8++56HP*CNDNGK PGP'TUVG5GKVGGKPIGTKUUGP



.

(.+'55$#%*(/ÒP\UCOONWPIGPVJCNVGPFFKGYKEJVKIUVGPUGKVFGO9GUVRJ·NKUEJGP(TKGFGPDKU\WO ,CJTGIGRT·IVGP)QNFWPF5KNDGT/ÒP\GP#WHNCIG.GKR\KI(CTDVHPOKV'TN·WVGTWP IGPXQP5RTQ6H+P\YGK$·PFGP6GZVWPF6CHGNVGKNIGDWPFGP*CNDNGFGTOKPKOCNDGUVQ­GP

 



(4+'&'05$74)(/ÒP\MWPFGWPF)GNFIGUEJKEJVGFGT'KP\GNUVCCVGPFGU/KVVGNCNVGTUWPFFGT0GWG TGP <GKV *CPFDWEJ FGT OKVVGNCNVGTNKEJGP WPF PGWGTGP )GUEJKEJVG #DVGKNWPI  /ÒPEJGP$GTNKP    8+++56HP.GKPGP#.75%*+0810'$'0)4'76*#NNIGOGKPG/ÒP\MWPFGWPF)GNF IGUEJKEJVG FGU /KVVGNCNVGTU WPF FGT PGWGTGP <GKV *CPFDWEJ FGT OKVVGNCNVGTNKEJGP WPF PGWGTGP )G   UEJKEJVG #DV  *KNHUYKUUGPUEJCHVGP WPF #NVGTVÒOGT  #WHNCIG /ÒPEJGP$GTNKP :+:5 OKV#DD.GKPGP  



-+5%*$5ECNGUCPF9GKIJVU#*KUVQTKECN1WVNKPG;CNG5VWFKGUKPVJG*KUVQT[QH5EKGPEGCPF/GFK EKPG0GY*CXGP.QPFQP::5OKV#DD.GKPGPOKV5EJWV\WOUEJNCI'EMGPOKPKOCN DGUVQ­GP



.

.

54


BALKAN, GRIECHENLAND, MALTA .

-.7)' $  0WOKUOCVKM FGU /KVVGNCNVGTU *CPFDWEJ WPF 6JGUCWTWU 0WOOQTWO /GFKK #GXK   $GTNKP9KGP5OKV6HP)CP\NGKPGP



.

-4#75'%./+5*.'4%5VCPFCTF%CVCNQIQH9QTNF%QKPU&GNWZG#0#%GPVGPPKCN'FKVKQP $·PFG+QNC5OKV\CJNTGKEJGP#DD-WPUVNGFGTKO5EJWDGT'KPKIG5GKVGPIGMPKEMV//#)   



.75%*+0 8 '$'0)4'76* # #NNIGOGKPG /ÒP\MWPFG WPF )GNFIGUEJKEJVG FGU /KVVGNCNVGTU WPF   FGT0GW\GKV#WHNCIG/ÒPEJGP$GTNKP:+:5OKV\CJNTGKEJGP#DD)CP\NGKPGPOKVCWH IGMNGDVGP2CRKGTVKVGN



.

/-'.'4*4GKEJUOÒP\YGUGPKOUR·VGP/KVVGNCNVGT6GKN&CU,CJTJWPFGTV5VWVVICTV 56HP-CTVQPKGTV



.

241-+5%* $ )TWPFFCVGP \WT GWTQR·KUEJGP /ÒP\RT·IWPI FGT 0GW\GKVEC/ÒP\UV·PFG 2T·IGDGTGEJVKIVG2T·IG\GKVGP/ÒP\UV·VVGP-WT\DKDNKQITCRJKG8GTUWEJGKPGT#DHQNIGQTFPWPI8+0 9KGP::8+++5-CTVQPKGTVOKPKOCNDGUVQ­GP//#)



4'+//#00(/ÒP\GPWPF/GFCKNNGPECDKPGVFGU,WUVK\TCVJU4GKOOCPPKP*CPPQXGT#WMVKQP #*GUU(TCPMHWTVC/6GKNGTGXKFKGTVG#WHNCIG(TQPVKURK\8+++5OKV 0TP6HP+85OKVFGP0TP6HP+85OKVFGP0TP6HP *CNDNGFGT OKPKOCN DGUVQ­GP $GKIGNGIV 'TIGDPKUNKUVGP FGT #WMVKQPGP # *GUU (TCPMHWTV C/    WPF#  



5%*.+%-';5'0 (9#2#../#00 4&41;5'0 * 'TMNCGTWPI FGT #DMWGT\WPIGP CWH   /WGP\GPFGTPGWGTGP<GKVFGU/KVVGNCNVGTUWPFFGU#NVGTVJWOUUQYKGCWH&GPMOWGP\GPWPFOWGP\CTVK IGP <GKEJGP  #WHNCIG $GTNKP  8+  5 6HP)CP\NGKPGPOKV&GEMGNRT·IWPI&GEMGNOKV MNGKPGO(NGEMNGKEJVDGUVQ­GP



.

5%*.7/$'4)'4*)QNFOÒP\GP'WTQRCUXQPDKUJGWVG#WHNCIG/ÒPEJGP5 OKV\CJNTGKEJGP#DD$TQUEJKGTV//#)



.

5*'22#4&6/75*#/,(/QPG[5ECNGUCPF9GKIJVU4GRTKPVGFHTQOVJG0WOKUOCVKE%KTEW NCT  .QPFQP   5 OKV  #DD &C\W  -CVCNQIG FGT (KTOC 0WOKUOCVKEC 9KGP   0T  WPF0T  UQYKGGKPMNGKPGU$WEJ'YKIG9CCIGXQP7*·WUUGTOCPP-ÌNP 5OKVXKGNGP#DD.GKPGP Z -CTVQPKGTV Z $TQUEJWT Z 



.

.

.

.

6*1/5'0%,%CVCNQIWGFGNC%QNNGEVKQPFGOQPPCKGUFGHGW%JTKUVKCP,ÒTIGPUGP6JQOUGP6GKN .GUOQPPCKGUFWOQ[GPCIG$CPF-QRGPJCIGP50TP)CP\NGKPGPFGT<GKV



.

-1081.76-QXQNWVXQP/QPQITCRJKGP5QPFGTFTWEMGPWPF#WHU·V\GP\WTPGW\GKVNKEJGP0WOKUOC VKM+PVGTGUUCPVGU-QPXQNWVOKVXKGNGP5VCPFCTFYGTMGP8GTUEJKGFGPG'KPD·PFG  



.

8GTUEJKGFGPG /QPQITCRJKGP FCTWPVGT , .'+6</#00 9GIYGKUGT CWH FGO )GDKGVG FGT FGWVUEJGP   /ÒP\MWPFG KPEN 1GUVGTTGKEJ 5EJYGK\ .WZGODWTI WPF 'NUCUU  QFGT IGUEJKEJVNKEJG 0CEJTKEJVGP ÒDGT   FCU /ÒP\YGUGP &GWVUEJNCPFU 9GK­GPUGG  4 (4+'&$'4) )QNF %QKPU QH VJG 9QTNF HQO #P   EKGPV 6KOGU VQ VJG 2TGUGPV %NKHVQP  ,5 &#8'02146 .CTIG 5K\G 5KNXGT %QKPU QH VJG 9QTNF   )CNGUDWTI +..  ( (4+'&'05$74) /ÒP\MWPFG WPF )GNFIGUEJKEJVG FGT 'KP\GNUVCCVGP FGU   /KVVGNCNVGTUWPFFGTPGWGTGP<GKV/ÒPEJGP$GTNKP((.+'55$#%*/ÒP\UCOONWPIGPVJCNVGPF FKGYKEJVKIUVGPUGKVFGO9GUVRJ·NKUEJGP(TKGFGPDKU\WO,CJTGIGRT·IVGP)QNFWPF5KNDGT/ÒP\GP U·OOVNKEJGT.·PFGTWPF5V·FVG.GKR\KI7PVGTUEJKGFNKEJIGDWPFGP  



-NGKPGU -QPXQNWV \W XGTUEJKGFGPGP 6JGOGP FGT PGW\GKVNKEJGP 0WOKUOCVKM WC XQP )#.'4+' &'5   /100#+'5 5# *& )+$$5 -,)'4   *& -#*. 4 /'6< /ª0<'0 70&   /'&#+..'0#)$#5'.  '0#792#6#.#5  #2+%-*2+.#46<#567*.'

   



.

$#.-#0)4+'%*'0.#0&/#.6# .

$7<&7)#0 ).7%*+#0 1124'%7 %% /QPGFG XK DCPEPQVG 4QO³PGXVK $WMCTGUV   :.5OKV\CJNTGKEJGP#DDWPF(CTDVHP.GKPGPOKV5EJWV\WOUEJNCI//#)&C\W ) 241$5<6 0WOKUOCVKUEJG .KVGTCVWT 1UVGWTQRCU WPF FGU $CNMCPU *GHV  )TC\   5 OKV   #DD1TKI$TQUEJWTOKPKOCNDGUVQ­GP  



.

(745' '* /¾OQKTGU PWOKUOCVKSWGU FG N QTFTG UQWXGTCKP FG 5CKPV ,GCP FG ,¾TWUCNGO 0CEJFTWEM   $QNQIPCFGT#WUICDG4QO5OKV\CJNTGKEJGP#DD$TQUEJKGTV



.

.,7$+%#51RKU,WIQUNCXGPUMKJPQXCEC<CITGD::8++56HP*CNDNGKPGPOKPKOCN DGUVQ­GP6GKNYGKUGUVQEMHNGEMKIWPFGVYCUYCUUGTTCPFKI//#)



.

241-+5%* $ WC 4GRGTVQTKWO \WT PGW\GKVNKEJGP /ÒP\RT·IWPI 'WTQRCU $CPF  5ÒFQUVGWTQRC   8GTÌHHGPVNKEJWPIGPFGU+PUVKVWVUHÒT0WOKUOCVKM9KGP9KGP.+++5OKV\CJNTGKEJGP#DD (QNKQ)CP\NGKPGP//#)

 55


BELGIEN, NIEDERLANDE, LUXEMBURG .

4'0),'1+%QTRWUFGTOKVVGNCNVGTNKEJGP/Ã&#x2019;P\GPXQP-TQCVKGP5NCXQPKGP&CNOCVKGPWPF$QUPKGP )TC\++56HP(CNVMCTVG)CP\NGKPGP0COGCWH6KVGNPQVKGTV#



.

5%*'/$4+%*%%QKPUCPF/GFCNUQHVJG-PKIJVUQH/CNVC0CEJFTWEM.QPFQPFGT#WUICDG .QPFQP:++5OKV6HP)CP\NGKPGP#



$'.)+'00+'&'4.#0&'.7:'/$74) .

&'./106' # .G $¾P¾NWZ F QT #OUVGTFCO   .G $¾P¾NWZ F CTIGPV #OUVGTFCO     5WRRNGOGPVCW$¾P¾NWZF CTIGPV#OUVGTFCO$GKFG*CWRVD·PFGUKPFKP)CP\NGKPGPIGDWPFGPWPF KP VCFGNNQUGO <WUVCPF GDGPUQ FCU <WUCV\JGHV   , /'8+75 , FG /'; *4 -+'<'$4+0-   7+6)'8'4+,<100'0$.1'/#/56'4&#/  



.

.7%#5 2 /QPPCKGU UGKIPGWTKCNGU /QUCPGU 9CNEQWTV  <CJNTGKEJG WPGKPJGKVNKEJ PWOOGTKGTVG   5GKVGPOKVXKGNGP#DD1TKI$TQUEJWT//#)



.

/#)#+02.GUOQPPCKGUFG,GCP6J¾QFQTGFG$CXK½TG2TKPEGÂ&#x2014;X½SWGFG.K½IG%GTENG F ¾VWFGU 0WOKUOCVKSWGU 6TCXCWZ  $TWZGNNGU  (TQPVKURK\  5  6HP1TKI$TQUEJWTDGUVQ ­GP//#)



.

/14+0(/QPPCKGUFG$GNIKSWGFGC%CVCNQIWGFGUETKRVKHF¾VCKNN¾CXGE2NCPEJGUFG )TCXWTGUFGVQWVGUNGU/QPPCKGUC[CPVPQTOCNGOGPVEKTEWN¾$QQO56HP*CNDNGKPGP



.

0#*7;5/6*KUVQKTG0WOKUOCVKSWGFW4Q[CWOGFG*QNNCPFGUQWUNG4½IPGFG5/.QWKU0CRQ NGQP 4QK FG *QNNCPFG #OUVGTFCO  (TQPVKURK\ :8+  5  VGKNYGKUG MQNQTKGTVG 6HP .QUG   .CIGPVGKNYGKUGWPCWHIGUEJPKVVGP#



650

.

14&'0)XCP*CPFNGKFKPIXQQT8GT\COGNCCTUXCP0GFGTNCPFUEJG*KUVQTKGRGPPKPIGP6GKNG.G[ FGP55)Tu+PGKPGO$CPFKP*CNDNGFGTIGDWPFGP/KPKOCNDGUVQ­GP



/KVOGJTGTGP$GUKV\GTUVGORGNP5VCCVUCTEJKX&Ã&#x2019;UUGNFQTH&GRQV98KGNJCDGT$KDNKQVJGM

.

41$'46%0WOKUOCVKSWGFG%CODTCK2CTKU++56HP)CP\NGKPGPPGWGT'KPDCPF OKV1TKI5GKVGP6HPVGKNYGKUGNGKEJVUVQEMHNGEMKICPUQPUVGPVCFGNNQUG'TJCNVWPI



.

5%*1.6'0%6JG%QKPUQHVJG&WVEJ1XGTUGCU6GTTKVQTKGU#OUVGTFCO5 6HP 1TKI$TQUEJWT , 5%*7./#0 *CPFDQGM XCP FG PGFGTNCPFUG OWPVGP   #WHNCIG   #OUVGTFCO5OKV\CJNTGKEJGP#DD.GKPGP//#)  



.

.

. 56

5%*7./#00,*CPFDQGMXCPFG0GFGTNCPFUG/WPVGPXCPVQV#OUVGTFCO5 OKV#DD*CPFDQGMXCPFG0GFGTNCPFUG/WPVGPXCP#OUVGTFCO5OKV#DD



61740'74 8 .GU TQKU FG (TCPEG FG 2JKNKRRG#WIWUVG ¯ 2JKNKRRGNG$GN GVNCOQPPCKGFG(NCPFTG $GKVTCIKP4$0  $TÃ&#x2019;UUGN5OKVXKGNGP#DD1TKI$TQUEJWT$NGKUVKHVCPOGTMWPIGP #



8#0 )'.&'4 *' &G PGFGTNCPFUG PQQFOWPVGPXCPFGVCEJVKILCTKIGQQTNQI)TCXGPJCIG 56HP1TKI$TQUEJWTOKPKOCNDGUVQ­GP




DEUTSCHLAND .

8#0 )'.&'4 *'*1% / .GU OQPPCKGU FGU 2C[U$CU DQWTIWKIPQPU GV GURCIPQNU    #OUVGTFCO56HP)CP\NGKPGP5WRRNGOGPVKP-QRKGNKGIVDGK//#)



.

8'4-#&' 2 /WPVDQGM DGXCVVGPFG FG PCOGP GP CHDGGNFKPIGP XCP OWPVGP IGUNCIGP KP FG \GXGP   XQQTOCNKIXGTGGPKIFGPGFGTNCPFUEJGRTQXKPEKGPUGFGTVFGPXTGFGXCP)GPVVQVQRQP\GPVKLF0CEJFTWEM FGT#WUICDG5EJKGFCO8+56HP+PGKPGO$CPFKP)CP\NGKPGPIGDWPFGP#



.

9'+..'44.GUOQPPC[CIGU¾VTCPIGTUFGURTKPEGU.WZGODQWTIGQKU.WZGODQWTI5OKV \CJNTGKEJGP#DDKO6GZV



.

-1081.76 $'.)+'00+'&'4.#0&'.7:'/$74) -QPXQNWVÒDGTDGNIKUEJGPKGFGTN·PFK UEJGWPFNWZGODWTIKUEJG/ÒP\IGUEJKEJVGFCTWPVGT,6#'./#0/WPVGPGP2GPPKPIGPKP$QWTIQP FKUEJ8NCCPFGTGP5VCF$TWIIG,4FG/';0WOKUOCVKE2QEMGVWPF$TÒUUGN , /GXKWU 5RGEKCNG ECVCNQIWU XCP FG PGFGTNCPFUG OWPVGP XCP  VQV JGFGP #OUVGTFCO  WPF   5RGEKCNGECVCNQIWUXCPFGOWPVGPXCPJGVMQPKPMTKLMFGTPGFGTNCPFGP#OUVGTFCO,&' /';.GUOQPPCKGU$GNIQ.WZGODQWTIQKUGUFG%JCTNGU+++¯)WKNNCWOG+GT  7PVGTUEJKGF NKEJIGDWPFGP  



&'765%*.#0& .

.

.

.

.

#&'45 )*7.5*1(( #. WC &KG )GUEJKEJVG FGT )TCHGP WPF *GTTGP XQP .KODWTI WPF .KO   DWTI5V[TWOWPFKJTGT$GUKV\WPIGP6GKN++$F#UUGPWPF/ÒPUVGT9GUVH56HP #DD)CP\NGKPGP



#.$4'%*6 , /ÒP\IGUEJKEJVG FGU *CWUGU *QJGPNQJG XQO FTGK\GJPVGP DKU \WO PGWP\GJPVGP ,CJT   JWPFGTV 5& CWU #TEJKX HÒT JQJGPNQJKUEJG )GUEJKEJVG  1GJTKPIGP  1GJTKPIGP   5   0CEJVT·IG56HP5EJCT\GU*CNDNGFGTOKVIQNF4ÒEMGPVKVGNOKV5VCJNUVTKEJXQP5EJKNNKPIU HÒTUV



#401.& 237'../#.< 9 5·EJUKUEJVJÒTKPIKUEJG $GTIDCWIGRT·IG )GYKPPWPI WPF 8GTJÒV   VWPI XQP )QNF 5KNDGT WPF -WRHGT KO 5RKGIGN FGT /ÒP\GP WPF /GFCKNNGP .GKR\KI   5 OKV   \CJNTGKEJGP#DD)CP\NGKPGP//#)



$#*4('.&6 ' &CU /ÒP\YGUGP FGT /CTM $TCPFGPDWTI XQP FGP ·NVGUVGP <GKVGP DKU \WO #PHCPIG   FGT 4GIKGTWPI FGT *QJGP\QNNGTP $GTNKP  +:  5 -CTVG  6HP  -CTVG *CDNGKPGP GVYCU   DGUVQ­GP//#)#



&KG/ÒP\GPWPF/GFCKNNGP5COONWPIKPFGT/CTKGPDWTI$·PFGKP\YGK$·PFGPIGDWPFGP6GZV WPF6CHGNDCPF&CP\KI85OKV6GZVCDD5OKV6GZVCDD5OKV6GZVCDD 6HP*CNDNGKPGP  



$GUKV\GTUVGORGNXQP#NHTGF(TCUGWPF$GUKV\GTGVKMGVV#4KGEJOCPP%QCWHFGO6KVGNDNCVV

.

.

.

.

&KG /ÒP\GP WPF /GFCKNNGP5COONWPI KP FGT /CTKGPDWTI $·PFG  &CP\KI  8  5   OKV 6GZVCDD  6HP  5 OKV 6GZVCDD 6HP   5 OKV 6GZVCDD 6HP  6GKNYGKUG   NQUG.CIGP1TKI$TQUEJWT  



$#*4('.&6 / XQP 0KGFGTU·EJUKUEJGU /ÒP\CTEJKX 8GTJCPFNWPIGP CWH FGP -TGKU WPF 2TQDCVK   QPUVCIGP FGU 0KGFGTU·EJUKUEJGP -TGKUGU  8GTÌHHGPVNKEJWPIGP FGT *KUVQTKUEJGP -QOOKUUKQP   HÒT*CPPQXGT1NFGPDWTI$TCWPUEJYGKI5EJCWODWTI.KRRGWPF$TGOGP$CPF$CPF   $CPF   $CPF   *CNNG CP FGT 5CCNG  8+  5    6HP+856HP8+++56HP8++56HP+PGKPJGKVNKEJGO)CP\NGFGTIGDWP FGPVCFGNNQUGTJCNVGP//#)  



0KGFGTU·EJUKUEJGU /ÒP\CTEJKX 8GTJCPFNWPIGP CWH FGP -TGKU WPF 2TQDCVKQPUVCIGP FGU 0KGFGTU·EJUK   UEJGP -TGKUGU  8GTÌHHGPVNKEJWPIGP FGT *KUVQTKUEJGP -QOOKUUKQP HÒT *CPPQXGT 1NFGPDWTI   $TCWPUEJYGKI 5EJCWODWTI.KRRG WPF $TGOGP  $CPF   $CPF   $CPF    *CNNGCPFGT5CCNG8+56HP+856HP8++56HP $CPFKPGKPJGKVNKEJGO.GKPGPIGDWPFGP$CPF-WPUVNGKPGP$CPFWPF'KPDCPFHNGEMKI//#)   



0KGFGTU·EJUKUEJGU /ÒP\CTEJKX 8GTJCPFNWPIGP CWH FGP -TGKU WPF 2TQDCVKQPUVCIGP FGU 0KGFGTU·EJUK   UEJGP -TGKUGU  8GTÌHHGPVNKEJWPIGP FGT *KUVQTKUEJGP -QOOKUUKQP HÒT *CPPQXGT 1NFGPDWTI   $TCWPUEJYGKI 5EJCWODWTI.KRRG WPF $TGOGP  $CPF   $CPF   $CPF    $CPF*CNNGCPFGT5CCNG8+56HP+856HP 8+++  5  6HP 8++  5  6HP $CPF  KP GKPJGKVNKEJGO )CP\NGKPGP IGDWPFGP $CPF    )CP\NGKPGP$CPFDTQUEJKGTV$CPFOKV-QRHTQVUEJPKVVVCFGNNQUG'TJCNVWPI//#)  



.

&KG/ÒP\GPFGT5VCFV5VCFG9KGP8+56HP*CNDNGKPGPUVQEMHNGEMKI#



.

$GKVT·IG \WT /ÒP\IGUEJKEJVG FGT .ÒPGDWTIKUEJGP .CPFG KO GTUVGP &TKVVGN FGU  ,CJTJWPFGTVU 9KGP   :85#DDKO6GZV)CP\NGKPGP



$GUKV\GTUVGORGNXQP&T(:9GK\KPIGT%QCWHFGO6KVGNDNCVV

57


DEUTSCHLAND .

.

$GKVT·IG \WT /ÒP\IGUEJKEJVG FGT .ÒPGDWTIKUEJGP .CPFG KO GTUVGP &TKVVGN FGU  ,CJTJWPFGTVU 9KGP   'ZNKDTKU:8OKV-CTVGWPF6H5OKVGKPKIGP#DD)CP\NGKPGPURQTCFKUEJG#POGTMWPIGP IGDT·WPVG 5GKVGP WPF CWUIGDNKEJGPGT 4ÒEMGP CPUQPUVGP IWV GTJCNVGPGU 'ZGORNCT # &C\W    5QPFGTFTWEMG&KGDKUEJÌHNKEJ*KNFGUJGKOGT#WUDGWVGVCNGTCWUFGP,CJTGP9KGPGTPWOKUOC VKUEJG<GKVUEJTKHV$CPF  



ªDGT FKG ·NVGTGP *CODWTIGT 2QTVWICNÌUGT KP <GKVUEJTKHV FGU 8GTGKPU HÒT *CODWTIKUEJG )GUEJKEJVG   $CPF*CODWTI5(CNVVH*CNDNGKPGP



673

.

.

.

.

674

$#..;1$GUEJTGKDWPIXQP/ÒP\GPWPF/GFCKNNGPFGU(ÒTUVGPJCWUGUWPF.CPFGU$CFGPKPEJTQPQ NQIKUEJGT(QNIGCWUFGT5COONWPIFGUITQUUJGT\QINKEJDCFKUEJGP-QOOGT\KGPTCVJU1VVQ$CNN[KP5·EM KPIGP6GKN#CTCW::+:5RTCEJVXQNNMQNQTKGTVG9CRRGPVHP5VCOOWPF/ÒP\VHP )TQ­HQNKQ )GRT·IVGT WPF IGH·TDVGT )CP\NGKPGPGKPDCPF OKV )CP\TQVUEJPKVV WPF IQNFGPGT 4ÒEMGPDG   UEJTKHVWPIDGUVQ­GPXGTGKP\GNVG5VQEMHNGEMGPCOQDGTGPWPFWPVGTGP5GKVGPTCPF#



$GUEJTGKDWPI XQP /ÒP\GP WPF /GFCKNNGP FGU (ÒTUVGPJCWUGU WPF .CPFGU $CFGP  6GKN /ÒP\GP WPF   /GFCKNNGP FGU <·JTKPIGP$CFKUEJGP (ÒTUVGPJCWUGU #CTCW  ::+: 9CRRGPVH  5VCOOVHP    6HP1TKI$TQUEJWT)CP\IQNFUEJPKVV



$'%-'0$#7'4'&KG/ÒP\GPFGT4GKEJUUVCFV4GIGPUDWTI$C[GTKUEJG/ÒP\MCVCNQIG)TÒPYCNF   5 OKV \CJNTGKEJGP #DD -WPUVNGFGT'KPDCPFNGKEJVXGTUEJOWV\V'TI·P\WPIGP$GTKEJVK IWPIGP5VGNNWPIPCJOGP2T·IGVCDGNNGP)TÒPYCNF5OKV\CJNTGKEJGP#DD)GJGHVGV//#) *5%*¤22.'44GIGPUDWTIGT/ÒP\GPFGUFGWVUEJGP/KVVGNCNVGTU5)GJGHVGV  



&KG /ÒP\GP FGT 4GKEJUUVCFV 4GIGPUDWTI $C[GTKUEJG /ÒP\MCVCNQIG  )TÒPYCNF   5 OKV   \CJNTGKEJGP#DD-WPUVNGFGT



677

.

$'+'4.'+0,2&KGDC[GTKUEJGP/ÒP\GPFGU*CWUGU9KVVGNUDCEJXQPFGO'PFGFGU\YÌNHVGPDKU\WT /KVVG FGU UGEJ\GJPVGP ,CJTJWPFGTVU   /ÒPEJGP   5  6HP *CNDNGKPGP 6HP KP   HCNUEJGT4GKJGPHQNIG  GKPIGDWPFGP)WVGTJCNVGPGU'ZGORNCT//#) /KV'ZNKDTKU1-Q\KPQYUMKKO8QTUCV\

58




DEUTSCHLAND .

$'4)'4 ( &KG OKVVGNCNVGTNKEJGP $TCMVGCVGP KO -GUVPGT/WUGWO *CPPQXGT 5COONWPIUMCVCNQI    *CPPQXGT5FCXQP\CJNTGKEJG6HP-CTVQPKGTV#$ª660'4&$ª660'4&KGOKV VGNCNVGTNKEJGP$TCMVGCVGPKO-GUVPGT/WUGWO*CPPQXGT6GKN5COONWPIUMCVCNQI*CPPQXGT 5FCXQP\CJNTGKEJG6HP1TKI$TQUEJWT#  



.

$'4)*#75 2/-'.'4 * &GWVUEJG /ÒP\GP FGT 9KMKPIGT\GKV UQYKG FGU JQJGP WPF UR·VGP   /KVVGNCNVGTU*0KNNUUQP *TUI 7RRUCNC8+++5OKV6HP)CP\NGKPGP



.

$'40*#46 / &KG /ÒP\GP FGT 4GKEJUUVCFV -CWHDGWTGP /ÒPEJGP   5  6HP 5& CWU   /$0)*CNDNGKPGP5VGORGNCWHFGO6KVGN



.

&KG/ÒP\GPFGT4GKEJUUVCFV-GORVGP5&CWU/$0)  56HP)CP\NGKPGP//#) 



.

&KG /ÒP\GP FGT 4GKEJUUVCFV -GORVGP 5& CWU /$0)     5  6HP *CNDNGFGT 4ÒEMGP   DGUEJ·FKIV//#)



.

&KG/ÒP\GPFGT4GKEJUUVCFV-GORVGP5&CWU/$0)  56HP*CNDNGKPGP//#) 



684

.

686

$'456'66 # (TGKJGTT XQP /ÒP\IGUEJKEJVG FGU <·JTKPIGP$CFKUEJGP (ÒTUVGPJCWUGU WPF FGT OKV   UGKPGO5EGRVGTXGTGKPKIVGP5V·FVGWPF.CPFUEJCHVGP(TGKDWTIKO$TGKUICW8+++56HP -NCRRMCTVG6HPGVYCUUVQEMHNGEMKIUQPUVVCFGNNQUGU'ZGORNCT-CTVQPKGTV4ÒEMGPGVYCUDGUEJ·FKIV //#)



$';5%*.#)&'8GTUWEJGKPGT/ÒP\IGUEJKEJVG#WIUDWTIUKPFGO/KVVGNCNVGTPGDUV$G[VT·IGP\WT /ÒP\IGUEJKEJVGFGTÒDTKIGP#NGOCPPKUEJ5WGXKUEJGP.CPFGKPFGOP·ONKEJGP<GKVTCWOG5VWVVICTVWPF 6ÒDKPIGP:56HP,2)TQUUJCWUGT8GT\GKEJPKUFGTKPFGT/ÒP\UCOONWPIFGUJKUVQTK UEJGP8GTGKPUXQP5EJYCDGPWPF0GWDWTIDGHKPFNKEJGP/ÒP\GPWPF/GFCKNNGPFGT5VCFV#WIUDWTI 5FWTEJUEJQUUGPGU'ZGORNCTOKVXKGNGP0QVK\GP+PGKPGP$CPFIGDWPFGP4ÒEMGPNQUG*CNDNGKPGP



8GTUWEJ GKPGT /ÒP\IGUEJKEJVG #WIUDWTIU KP FGO /KVVGNCNVGT PGDUV $G[VT·IGP \WT /ÒP\IGUEJKEJVG FGT   ÒDTKIGP#NGOCPPKUEJ5WGXKUEJGP.CPFGKPFGOP·ONKEJGP<GKVTCWOG5VWVVICTVWPF6ÒDKPIGP: 56HP*CNDNGFGT



$+0&'4 %'$0'4 , 9ÒTVVGODGTIKUEJG /ÒP\ WPF /GFCKNNGPMWPFG $CPF  *GHV WPF$CPF *GHV  0CEJFTWEM 5VWVVICTV  FGT #WUICDG 5VWVVICTV  +85&QRRGNVHP 5&QRRGNVHP)CP\NGKPGPGKPKIG$NGKUVKHVPQVK\GPKO6GZV//#)



.

9ÒTVVGODGTIKUEJG/ÒP\WPF/GFCKNNGPMWPFG$CPF5VWVVICTV+85&QRRGNVHP*CND RGTICOGPV



.

$1&' 9,. &CU ·NVGTG /ÒP\YGUGP FGT 5VCCVGP WPF 5V·FVG 0KGFGTUCEJUGPU $TCWPUEJYGKI    :8+56HP-CTVQPKGTVOKVCWHIGMNGDVGP.GFGTTGUVGPFGU1TKIKPCNVKVGNUCWHFGO4ÒEMGPUVQEM HNGEMKI6HPOKV9CUUGTUEJCFGP#



$1.<'06*#. * &GPMOÒP\GP \WT )GUEJKEJVG UGKPGT /CLGUV·V FGU -ÌPKIU XQP 2TGWUUGP (TKGFTKEJ   9KNJGNO+++$GTNKP+856HP$TCWPGT*CNDNGFGTGKPDCPFDGUVQ­GPWPFUVQEMHNGEMKI



.

.

.

.

59


DEUTSCHLAND .

$7%*'0#7 *2+%- $ &GT $TCMVGCVGPHWPF XQP )QVJC   /ÒPEJGP  8+++  5 OKV   #DD6HP+P*CNDNGKPGPIGDWPFGPWPFKPUGJTIWVGO<WUVCPF//#)



.

$7%-*&CU)GNFWPF/ÒP\YGUGPFGT5V·FVGKPFGP.CPFGP*CPPQXGTWPF$TCWPUEJYGKI(TCPMHWTV CO /CKP   5 $TQUEJKGTV * $7%-1 /'+'4 &KG /ÒP\GP FGT 5VCFV *CPPQXGT *CPPQXGT    5CWDGTG -QRKG KP )CP\NGKPGP $ &14(/#00/ÒP\GPWPF/GFCKNNGPFGT*GT\ÌIGXQP5CEJ UGP.CWGPDWTI 4CV\GDWTI   5  6HP $TQUEJKGTV $ '0)'.-' /ÒP\IGUEJKEJVG FGT 5VCFV   *CPPQXGT *CPPQXGT   5  6HP )CP\NGKPGP ) &78' &KEMVCNGT2T·IWPIGP    (TCPMHWTVCO/CKP5OKV\CJNTGKEJGP#DD)CP\NGKPGP  



.

&CU)GNFWPF/ÒP\YGUGPFGT5V·FVGKPFGP.CPFGP*CPPQXGTWPF$TCWPUEJYGKI(TCPMHWTVCO/CKP 51TKI$TQUEJWT



.

&KG/ÒP\GPFGT5VCFV'KPDGEM*KNFGUJGKOWPF.GKR\KI8++56HP1TKI$TQUEJWT5GKVGP WPCWHIGUEJPKVVGP//#)



.

$7%-*$#*4('.&6/XQP&KG/ÒP\GPFGT5VCFV*KNFGUJGKO*KNFGUJGKOWPF.GKR\KI :+5OKV#DD6HP-N(QNKQ)CP\NGKPGPVCFGNNQUGU'ZGORNCT//#)



.

&KG /ÒP\GP FGT 5VCFV *KNFGUJGKO *KNFGUJGKO WPF .GKR\KI  :+  5 OKV #DD  6HP -N   (QNKQ1TKI$TQUEJWTVCFGNNQUGU'ZGORNCT//#)



.

%#*0 '$ &KG /ÒP\GP FGU *QEJUVKHVU 'KEJUV·VV $C[GTKUEJG /ÒP\MCVCNQIG  )TÒPYCNF     5(CNVMCTVG)CP\MWPUVNGFGT#



.

%#*0 , /ÒP\ WPF )GNFIGUEJKEJVG XQP -QPUVCP\ WPF FGU $QFGPUGGIGDKGVGU KO /KVVGNCNVGT DKU \WO   4GKEJUOÒP\IGUGV\XQP/ÒP\WPF)GNFIGUEJKEJVGFGTKO)TQ­JGT\QIVWO$CFGPXGTGKPKIVGP)G DKGVG+6GKN*GKFGNDGTI:56HP(CNVMCTVG2TCEJVXQNNGT)CP\NGFGTGKPDCPFOKV-QRH IQNFUEJPKVV \CJNTGKEJGP JCPFUEJTKHVNKEJGP 0QVK\GP GKPKIGJKP\WIGHÒIVG/ÒP\CDDKNFWPIGPOKV$GUEJTGK DWPIGP//#)



%#22' *2 &KG /ÒP\GP FGT FGWVUEJGP -CKUGT WPF -ÌPKIG FGU /KVVGNCNVGTU  6GKNG KP GKPGP $CPF   &TGUFGP8+++:+88+++56HP*CNDNGFGTVCFGNNQUG'TJCNVWPI #



&KG/ÒP\GPFGT*GT\ÌIGXQP$CKGTPFGT$WTIITCHGPXQP4GIGPUDWTIWPFFGT$KUEJÌHGXQP#WIUDWTI CWUFGO\GJPVGPWPFGNHVGP,CJTJWPFGTVG&TGUFGP56HPOKPKOCNUVQEMHNGEMKI*CNDNGK PGP#



$GUEJTGKDWPI FGT /ÒP\GP FGU XQTOCNKIGP -CKUGTNKEJGP HTGKGP YGNVNKEJGP 5VKHVU 3WGFNKPDWTI &TGUFGP   +85-WRHGTVHP)CP\NGKPGPUVQEMHNGEMKI//#)



.

.

.

W­GTUVUGNVGP#WUFGT$KDNKQVJGM(ÒTUVGPDGTI&QPCWGUEJKPIGP

.

&KG /ÒP\GP FGT 5VCFV WPF FGU $KUVJWOU *KNFGUJGKO &TGUFGP :  5  -WRHGTVHP .GKPGP   'KPTKG­CO4ÒEMGPOKPKOCNDGUVQ­GP//#)



.

%#22' 9 7TMÒPFNKEJG /ÒP\)GUEJKEJVG FGT 5VCFV %QGUHGNF \WINGKEJ $GKVTCI \WT )GUEJKEJVG FGT   ÒDTKIGPOÒPUVGTN·PFKUEJGP5V·FVG%QGUHGNF51TKI$TQUEJWT



.

&#00'0$'4) * &KG FGWVUEJGP /ÒP\GP FGT U·EJUKUEJGP WPF HT·PMKUEJGP -CKUGT\GKV  $·PFG KP   FTGKIGDWPFGP$GTNKP:+:56HP-CTVG856HP(CNV MCTVG 8+ 5  OKV 6GZVCDD 6HP  8+ 5  6HP  $CPF  WPF  KP   *CNDNGFGTIGDWPFGP$CPFKP*CNDNGKPGPOKPKOCNDGUVQ­GP6CFGNNQUGU'ZGORNCT//#)  



+PFKGUGT3WCNKV·VUGNVGPCPIGDQVGP

.

&KGFGWVUEJGP/ÒP\GPFGTU·EJUKUEJGPWPFHT·PMKUEJGP-CKUGT\GKV$·PFGWPF0CEJVT·IG0CEJFTWEM #CNGPFGT#WUICDG$GTNKP:+:88+8+56HP-CTVGP5 6HP)CP\NGKPGP#  



&#8'02146 ,5 )GTOCP 6CNGTU  .QPFQP  )GTOCP EJWTEJ CPF EKV[ 6CNGTU     +NNKPQKU  )GTOCPEJWTEJCPFEKV[6CNGTU8QN+NNKPQKU)GTOCP5GEWNCT 6CNGTU(TCPMHWTVC/  



.

)GTOCP 6CNGTU  (TCPMHWTV C/   5 OKV \CJNTGKEJGP #DD -WPUVNGFGT //#)   



.

.CTIG5K\G5KNXGT%QKPUQHVJG9QTNFVJVQVJ%GPVWTKGU#WHNCIG+QNC5OKV\CJNTGK EJGP#DD-WPUVNGFGT



.

5KNXGT )WNFGP   #WHNCIG 0GWYKGF  FGT #WUICDG (TCPMHWTV C/   5 OKV   \CJNTGKEJGP#DD-WPUVNGFGT//#)



.

&'6*.'(5 )56')79'+6 9 *TUI  )GNF-WPUV -WPUV)GNF &GWVUEJG )GFGPMOÒP\GP UGKV   )GUVCNVWPIWPF)GUVCNVGT1UPCDTÒEM5OKV#DD-CTVQPKGTV



.

8GTITKHHGP

60


DEUTSCHLAND .

&'765%*'$70&'5$#0- *I $TCMVGCVGPFGT5VCWHGT\GKV(TCPMHWTVCO/CKPQ, 5#DDOKV$GUEJTGKDWPIGPGKPG-CTVG&GWVUEJG6CNGT8QPFGP#PH·PIGPFGT6CNGTRT·IWPIDKU \WO&TGK­KIL·JTKIGP-TKGI(TCPMHWTVCO/CKPQ,5OKV#DD6HP(CNVMCTVG&GWVUEJG6CNGT 8QO&TGK­KIL·JTKIGP-TKGIDKU\WO'PFGFGT6CNGTRT·IWPI(TCPMHWTVCO/CKPQ,5OKV#DD -CTVGP  6CNGTCDD (CNVMCTVG #NNG FTGK 9GTMG UKPF KP XGTUEJKGFGP ITCWHCTDGPGP )CP\NGKPGP OKV   UKNDGTPGT&GEMGNRT·IWPIIGDWPFGPUGJTIWVGT<WUVCPF  



.

&1..+0)'4(&KG(ÒTUVGPDGTIKUEJGP/ÒP\GPWPF/GFCKNNGP&QPCWGUEJKPIGP56HP )CP\NGKPGP//#)



.

&7&+-$&GUJQJGPFGWVUEJGP4KVVGTQTFGPU/ÒP\UCOONWPIKP9KGP9KGP:++ 5 6HP'VYCUUVQEMHNGEMKI*CNDNGFGT



.

&ª0+0)#ªDGTUKEJVÒDGTFKG/ÒP\IGUEJKEJVGFGUMCKUGTNKEJGPHTGKGPYGNVNKEJGP5VKHVU3WGFNKPDWTI 3WGFNKPDWTI56HP1TKI$TQUEJWTUVCTMCWUIGDNKEJGPWPFGVYCUDGUEJOWV\V



.

&78')*KUVQT[QHVJG4GFGGOCDNG/WNVKRNGCPF/KPKPI6CNGTUQH$TWPUYKEM.WPGDWTI,QJCPPGU DWTI   5 OKV \CJNTGKEJGP #DD -WPUVNGKPGP //#)  ,5 &#8'02146 1XGTUK\G   /WNVKRNG 6CNGTU QH VJG $TWPUYKEM FWEJKGU CPF 5CZG.CWGPDWTI 8+  5 OKV XKGNGP 6GZVCDD    5VCOOVCHGN-WPUVNGKPGP  



716

.

'*'$'4) -6 ªDGT FCU ·NVGTG FGWVUEJG /ÒP\YGUGP WPF FKG *CWUIGPQUUGPUEJCHVGP DGUQPFGTU KP   XQNMUYKTVJUEJCHVNKEJGT$G\KGJWPI.GKR\KI8+++5*CNDNGKPGP



.

'+5'4/#00'&KG/ÒP\GKP#NVRTGW­GP8QTVTCIIGJCNVGPKPFGT*CWRVXGTUCOONWPIFGU)GUCOV XGTGKPUFGTFGWVUEJGP)GUEJKEJVUWPF#NVGTVWOUXGTGKPGCO#WIWUV*CNNGCPFGT5CCNG 56HP1TKI$TQUEJWT



'.<'6&KG/ÒP\GP$GTPJCTFU)TCHGPXQP#PJCNV*GT\QIUXQP5CEJUGP*GHVG$GTNKP 56HP56HP+PGKPGO$CPFKP*CNDNGFGTIGDWPFGP//#)



.

/KV$GUKV\GTUVGORGNXQP&T(:9GK\KPIGT%QCWHFGO6KVGNDNCVV

.

.

.

.

'//'4+)*&GT4GIGPUDWTIGT2HGPPKI&KG/ÒP\RT·IWPIKP4GIGPUDWTIXQO,CJTJWPFGTVDKU  $GTNKPGT 0WOKUOCVKUEJG (QTUEJWPIGP 0GWG (QNIG  $GTNKP   5  -CTVGP  6HP   -CTVQPKGTV//#)



'//'4+) *-1<+0195-+ 1 &KG /ÒP\GP WPF/GFCKNNGPFGT4GIGPUDWTIGT$KUEJÌHGWPFFGU &QOMCRKVGNU UGKV FGO  ,CJTJWPFGTV /ÒP\IGUEJKEJVG WPF 8CTKCPVGPMCVCNQI 5ÒFFGWVUEJG /ÒP\MCVC   NQIG5VWVVICTV5OKV\CJNTGKEJGP#DD-CTVQPKGTV//#)



'4$56'+0 , W # &KG 4KVVGT XQP 5EJWNVJGUU4GEJDGTI UEJG /ÒP\ WPF /GFCKNNGP5COONWPI    6GKNG&TGUFGP:8+5OKV0TP5'.:+++55'. *CNDNGFGT/KV#POGTMWPIGPKO6GZV//#)



'4$56'+0,4WPF*#&KG/ÒP\WPF/GFCKNNGP5COONWPIFGUXGTUVQTDGPGP*GTTP&TLWT% -PQNN KP 0ÒTPDGTI $GJWHU ÌHHGPVNKEJGT \W 0ÒTPDGTI UVCVVHKPFGPFGT 8GTUVGKIGTWPI IGQTFPGV WPF DG   UEJTKGDGP 0ÒTPDGTI  8++  5 OKV  0TP *CNDGKPGP 9GPKIG #POGTMWPIGP KO 6GZV   //#)



$GUKV\GTXGTOGTM/WUGWOFGT5VCFV4GIGPUDWTI

61


DEUTSCHLAND

723

.

'4$56'+0 , W # &GU -ÌPKINKEJGP /ÒP\%CDKPGVU \W &TGUFGP &QWDNGVVGP CP /ÒP\GP/GFCKNNGP WPF$ÒEJGTP&TGUFGP8+++56H'KPKIG0QVK\GPKO6GZVVGKN)CP\NGKPGP

.

'TÌTVGTWPIGP CWH FGO )GDKGV FGT U·EJUKUEJGP /ÒP\ WPF /GFCKNNGP 5COONWPI $CPF  &TGUFGP     5  6HP +P GKPGO $CPF KP )CP\NGKPGP IGDWPFGP 5  UQYKG 6H ++ +++ NKGIGP CNU   -QRKG XQT &C\W 9 *#726 6CDGNNGP \WT U·EJUKUEJGP /ÒP\MWPFG #TDGKVU WPF (QTUEJWPIUDGTKEJVG   \WTU·EJUKUEJGP$QFGPFGPMOCNRHNGIG&TGUFGP5FCXQP6HP*CNDNGKPGP6CDGNNG\WT U·EJUKUEJGP/ÒP\MWPFG'KPG*CPFTGKEJWPIHÒT5COONGTU·EJUKUEJGT/ÒP\GP&TGUFGP5  





.

'4.#0)'4 *, &KG 4GKEJUOÒP\UV·VVG KP 0ÒTPDGTI 0ÒTPDGTIGT (QTUEJWPIGP  0ÒTPDGTI    85OKV-CTVGP6HP)CP\NGKPGP//#)



.

':6'4(2H·N\KUEJG/ÒP\GPWPF/GFCKNNGP(CMUKOKNG/ÒPEJGP+:55VCOOVCHGNP .GKPGPOKV5EJWV\WOUEJNCI



727

.

62

(+#.#'/ÒP\GPWPF/GFCKNNGPFGT9GNHKUEJGP.CPFG6GKN2T·IWPIGPFGT<GKVFGT.KWFQNHKPIGT $TWPQPGP 1VVQPGP  $KNNKPIGT 5WRRNKPIGPDWTIGT GVE .GKR\KI9KGP   5  6HP 6GKN  &KG   9GNHGPKPFGP5CEJUGPNCPFGP&CUCNVG*CWU.ÒPGDWTI2T·IWPIGPFGT$WTIWPFKGTFGT9GNHGPKP$C[ GTP+VCNKGPGVE.GKR\KI9KGP5OKV6GZVCDD6HP6GKN&CUCNVG*CWU$TCWPUEJYGKI .KPKG \W )TWDGPJCIGP /KVVGNDTCWPUEJYGKI/KVVGNNÒPGDWTI .GKR\KI9KGP   5 OKV 6GZ   VCDD6HP6GKN&CUOKVVNGTG*CWU$TCWPUEJYGKI.KPKG\W9QNHGPDÒVVGN.GKR\KI9KGP 5OKV#DD6HP6GKN&CUOKVVNGTG*CWU$TCWPUEJYGKI.KPKG\W%CNGPDGTI.GKR\KI9KGP  5 OKV #DD  6HP 6GKN  &CU PGWG *CWU $TCWPUEJYGKI \W 9QNHGPDÒVVGN .GKR\KI9KGP     5 OKV #DD  6HP 6GKN  &CU PGWG *CWU $TCWPUEJYGKI \W 9QNHGPDÒVVGN ++  

$GXGTP  .GKR\KI9KGP  5  OKV #DD 6HP 6GKN  KP GKPGO $CPF IGDWPFGP   *CNDNGFGTNGKEJVDGUVQ­GPCPUQPUVGPVCFGNNQUGTJCNVGP8KGNGDGKIGNGIVG<GVVGNOKVKPVGTGUUCPVGP0QK\GP //#)   


DEUTSCHLAND .

/ÒP\GP WPF /GFCKNNGPFGT9GNHKUEJGP.CPFG6GKN2T·IWPIGPFGT<GKVFGT.KWFQNHKPIGT$TWPQPGP

1VVQPGP $KNNKPIGT5WRRNKPIGPDWTIGTGVE2TCI56HP6GKN&KG9GNHGPKPFGP5CEJ UGPNCPFGP&CUCNVG*CWU.ÒPGDWTI2T·IWPIGPFGT$WTIWPFKGTFGT9GNHGPKP$C[GTP+VCNKGPGVE2TCI 56HP6GKN&CUCNVG*CWU$TCWPUEJYGKI.KPKG\W)TWDGPJCIGP/KVVGNDTCWPUEJYGKI /KVVGNNÒPGDWTI 2TCI   5  6HP 6GKN  &CU OKVVNGTG *CWU $TCWPUEJYGKI .KPKG \W   9QNHGPDÒVVGN2TCI56HP6GKN&CUOKVVNGTG*CWU$TCWPUEJYGKI.KPKG\W%CNGPDGTI 2TCI56HP6GKN&CUPGWG*CWU$TCWPUEJYGKI\W9QNHGPDÒVVGN2TCI 56HP6GKN&CUPGWG*CWU$TCWPUEJYGKI\W9QNHGPDÒVVGN++ $GXGTP 2TCI5 6HP6GKN&CUPGWG*CWU.ÒPGDWTI %GNNG \W*CPPQXGT+2TCI56HP6GKN&CU PGWG *CWU .ÒPGDWTI %GNNG  \W *CPPQXGT++2TCI56HP6GKN&CUPGWG*CWU\W *CPPQXGT +++ 2TCI   5  6HP 6GKN  &CU PGWG *CWU .ÒPGDWTI \W 'PINCPF )TQ­DTKVCP  PKGP 2TCI56HP+P$·PFGPGKPJGKVNKEJIGDWPFGP6CFGNNQUGTJCNVGP//#)   /KV $GUKV\GTUVGORGN XQP &T ( : 9GK\KPIGT%Q KP $CPF     WPF  $GUKV\GTUVGORGN XQP # 4KGEJ   OCPP%QKP$CPF

.

.

.

.

.



(+5%*'4'&KG/ÒP\GPFGU*CWUGU5EJYCT\DWTI'KP$GKVTCI\WT.CPFGUIGUEJKEJVGFGT(ÒTUVGPVÒ OGT5EJYCT\DWTI5QPFGTUJCWUGPWPF5EJYCT\DWTI4WFQNUVCFV*GKFGNDGTI.:+856HP *CNDNGKPGPVCFGNNQUGU'ZGORNCT//#)



(¤45%*0'4 ) &GWVUEJG /ÒP\GP #CEJGP DKU #WIUDWTI  /KVVGNCNVGT DKU 0GW\GKV $GUVCPF FGU   *KUVQTKUEJGP/WUGWOU(TCPMHWTVCO/CKP5OKV$GUEJTGKDWPIWPF#DDXQPGVYC/ÒP\GP -CTVG-WPUVNGFGTPGWYGTVKI



(1456'4#5%*/+&4&KG/ÒP\GPFGTHTGKGP4GKEJUUVCFV#WIUDWTIXQPGTNCPIVGO/ÒP\TGEJV

 CPDKU\WO8GTNWUVGFGT4GKEJUHTGKJGKV  #WIUDWTI5&QRRGNVHP-WPUVNGKPGP (NGEMKI//#)



(4+'&'05$74)(5EJNGUKGPU/ÒP\IGUEJKEJVGKO/KVVGNCNVGT6GKNGWPF'TI·P\WPIUDCPF$TGUNCW   5  6HP 8+++  5  5  6HP 5  MNGKPGT 'KPTK­ KO 6GZV //#)   5EJNGUKGPUPGWGTG/ÒP\IGUEJKEJVG$TGUNCW8+++5#NNGXKGT6GKNGKPGKPGP$CPFKP *CNDNGFGTIGDWPFGP/KPKOCNDGUVQ­GP



(4+'&'05$74)(5')'4*5EJNGUKGPU/ÒP\GPWPF/GFCKNNGPFGTPGWGTGP<GKV$TGUNCW 8++56HP(QNKQ*CNDNGKPGP6KPVGPHNGEM$KPFWPINÌUVUKEJNGKEJV//#)



734

.

.

.

(4+'&'4+%* -&KG/ÒP\GPWPF/GFCKNNGPFGU*CWUGU5VQNDGTIWPFFKG)GUEJKEJVGUGKPGU/ÒP\ YGUGPU &TGUFGP   5 OKV GKPKIGP #DD  6HP 2TCEJVXQNNGT )CP\NGFGTGKPDCPF OKV HCTDKI   IGRT·IVGO5VQNDGTIGT9CRRGPKP5EJYCT\4QV)QNFOKV5EJYCT\)QNF5EJYCT\UEJPKVV//#)



)#'&'%*'05 1% *CODWTIKUEJG /ÒP\GP WPF /GFCKNNGP  $·PFG 0CEJFTWEM .GKR\KI  FGT   #WUICDG*CODWTI8+++5+855LGYGKNUOKVXKGNGP#DD+PGKPJGKVNKEJ QTCPIGPGP)CP\NGKPGPIGDWPFGP//#)  



)#'66'05 4 &KG /ÒP\GP FGT )TCHUEJCHV .ÒEJQY <WINGKEJ GKP $GKVTCI \WT /ÒP\IGUEJKEJVG FGT   /CTMITCHUEJCHV $TCPFGPDWTI FGU 'T\DKUVWOU /CIFGDWTI WPF FGT $TCWPUEJYGKI.ÒPGDWTIGT .CPFG   *CNNGCPFGT5CCNG8++56HP-NCRRMCTVGP*CNDNGKPGP

 63


DEUTSCHLAND .

+PHNCVKQPGP&CU&TCOCFGT)GNFGPVYGTVWPIGPXQO#NVGTVWODKUKPFKG)GIGPYCTV/ÒPEJGP 5OKV6GZVCDDWPF6HP)CP\NGKPGPPGWYGTVKI



.

&CU)GNFWPF/ÒP\YGUGPFGT#DVGK(WNFCKO*QEJOKVVGNCNVGTWPVGT#WUYGTVWPIFGT/ÒP\GPCNU3WGN NGP FGT )GUEJKEJVG WPF -WPUVIGUEJKEJVG FGT 9KTVUEJCHVUIGUEJKEJVG WPF FGU 5VCCVUTGEJVU (WNFC    56HP-NCRRMCTVGP.GKPGP//#)



)#'66'054'46'.*'KP$GKVTCI\WT/ÒP\IGUEJKEJVGFGT)TCHGPXQP/CPUHGNF$GUEJTGKDWPI FGT5COONWPI*CWRVOCPP$TCWUG*CNNG$NN56HPOKV'TIGDPKUNKUVGFGT#WMVKQPCNU (QVQMQRKG5&CWUFGO#WMVKQPUMCVCNQI#4KGEJOCPP*CNNG1TKI$TQUEJWT



.

/KV9KFOWPI'TIGDGPUVÒDGTTGKEJVXQPFGP8GTHCUUGTP

.

.

)'$'46 %( &KG $TCPFGPDWTI(T·PMKUEJGP -KRRGTOÒP\UV·VVGP   /KV =? GKPGO #P   JCPI&GT#WUICD6JGKNFGUEWNODCEJGT5EJNGIUEJCV\DWEJGU0ÒTPDGTI5OKVGKPKIGP#DD 1TKI $TQUEJWT GKPKIG 5GKVGP WPCWHIGUEJPKVVGP URQTCFKUEJG $NGKUVKHVPQVK\GP $TQUEJWT GVYCU XGTH·TDV   WPFNGKEJVDGUEJ·FKIV//#)



)'$*#46*&KG/ÒP\GPWPF/GFCKNNGPFGT5VCFV&QPCWYÌTVJ/ÒP\UVWFKGP*CNNGCPFGT5CCNG 56HP)CP\NGKPGPVCFGNNQUGU'ZGORNCT//#)



742

.

&KG /ÒP\GP WPF /GFCKNNGP FGT 5VCFV &QPCWYÌTVJ *CNNG   5  6HP$KDNKQRJKNCNU2CRRDCPF IGDWPFGPGU'ZGORNCTOKVOKVIGDWPF1TKIKPCNWOUEJNCIWPFQDGPUQYKGWPVGPNGFGTXGTUV·TMVGO4ÒEMGP XQO$WEJDKPFGTUKIPKGTV



'ZNKDTKUKO8QTUCV\

.

&GT/ÒP\HWPF*GTUDTWEM5&CWU/$0)5OKV#PUVTGKEJWPIGPKO6GZV6HP$TQUEJKGTV GVYCUIGYGNNV



.

)+'5'0 - &KG /ÒP\GP FGT )TCHGP XQP *Q[C )GNF WPF /ÒP\IGUEJKEJVG )GRT·IGMCVCNQI 1UPC   DTÒEM5OKV\CJNTGKEJGP#DD)CP\NGKPGP&KG/ÒP\GPXQP&KGRJQN\)GNFWPF/ÒP\IG UEJKEJVG)GRT·IGMCVCNQI1UPCDTÒEM5OKVXKGNGP#DD)CP\NGKPGP//#)  



.

)¤6<' 4 .CPFCW 0QVOÒP\GP FKG Y·JTGPF FGT $GNCIGTWPI  WPF  IGUEJNCIGP YWTFGP   0ÒTPDGTI5#DDKO6GZV-NGKPHQTOCV$TQUEJKGTV



.

)4#55'4 9 /ÒP\ WPF )GNFIGUEJKEJVG XQP %QDWTI  (TCPMHWTV C/   5 OKV   \CJNTGKEJGP#DD1TKI)CP\NGKPGP//#)



.

)4+//'/ÒP\GPWPF/GFCKNNGPFGT5VCFV9KUOCT$GTNKP5*CNDNGKPGP//#)



.

)416'* *TUI /ÒP\UVWFKGP$·PFG0CEJFTWEM)TC\FGT#WUICDG.GKR\KI+P GKPJGKVNKEJGOITÒPGP)CP\NGKPGPIGDWPFGP//#)  



.

/ÒP\UVWFKGP$·PFG0CEJFTWEM)TC\FGT#WUICDG.GKR\KI+PGKPJGKVNKEJGOITÒPGP )CP\NGKPGPIGDWPFGP//#)/KV0QVK\GP  



.

*$'4.'#7NOGT/ÒP\WPF)GNFIGUEJKEJVGFGU/KVVGNCNVGTU7NOGT5EJTKHVGP\WT-WPUVIGUEJKEJVG 7NO56HP7NOGT/ÒP\WPF)GNFIGUEJKEJVGFGU:8+:+:,CJTJWPFGTVU7NOGT 5EJTKHVGP\WT-WPUVIGUEJKEJVG7NO56HP1TKI$TQUEJWTPGWYGTVKIG'ZGORNCTG

 



64


DEUTSCHLAND .

7NOGT /ÒP\ WPF )GNFIGUEJKEJVG FGU /KVVGNCNVGTU 7NOGT 5EJTKHVGP \WT -WPUVIGUEJKEJVG  7NO   56HP7NOGT/ÒP\WPF)GNFIGUEJKEJVGFGU:8+:+:,CJTJWPFGTVU7NOGT5EJTKH VGP\WT-WPUVIGUEJKEJVG7NO56HP1TKI$TQUEJWTVGKNYGKUGNQUG.CIGP  



7NOGT /ÒP\ WPF )GNFIGUEJKEJVG FGU /KVVGNCNVGTU 7NOGT 5EJTKHVGP \WT -WPUVIGUEJKEJVG  7NO   56HP7NOGT/ÒP\WPF)GNFIGUEJKEJVGFGU:8+:+:,CJTJWPFGTVU7NOGT5EJTKH VGP\WT-WPUVIGUEJKEJVG7NO56HP)CP\NGKPGPOKVIQNF4ÒEMGPVKVGN  



*8'40+%-9&GT-ÌNPGT2HGPPKIKOWPF,CJTJWPFGTV2GTKQFGFGTVGTTKVQTKCNGP2HGPPKI OÒP\G8KGTVGNLCJTUEJTKHVHÒT5Q\KCNWPF9KTVUEJCHVUIGUEJKEJVG$GKJGHV5VWVVICTV8++5 FCXQP-CTVG(CNVMCTVG1TKI$TQUEJWT//#)



&KG OKVVGNCNVGTNKEJGP /ÒP\HWPFG KP 6JÒTKPIGP 8GTÌHHGPVNKEJWPIGP FGT 6JÒTKPIKUEJGP *KUVQTKUEJGP   -QOOKUUKQP  6GZV WPF 6CHGNDCPF ,GPC   5  6CDGNNGP 1TKI$TQUEJWT WPCWHIGUEJPKVVGP   (CNVOCRRGOKV6HP//#)  



.

*#*0 941 6[RGPMCVCNQI FGT /ÒP\GP FGT DC[GTKUEJGP *GT\ÌIG WPF -WTHÒTUVGP    $TCWPUEJYGKI56HP)CP\NGKPGPGKPKIG0QVK\GPKO6GZV//#)



.

/QPGVC4CFCURQPGPUKU$C[GTPU/ÒP\RT·IWPIKOWPF,CJTJWPFGTV$TCWPUEJYGKI 5OKVGKPKIGP6GZVCDD6HP)CP\NGKPGP//#)



.

*#//'4+%* * &KG FGWVUEJGP 4GKEJUOÒP\GP 'KP *CPFDWEJ CNNGT XQP  UVCVVIGJCDVGP   #WURT·IWPIGP OKV GKPGO #PJCPI ÒDGT FKG CWH FGWVUEJGP /ÒP\UV·VVGP HÒT 4GEJPWPI HTGOFGT 5VCCVGP   JGTIGUVGNNVGP /ÒP\UQTVGP UQYKG FGT GKPUEJN·IKIGP )GUGV\G 8GTQTFPWPIGP RR $GTNKP   5   .GKPGP5NQUG0CEJVTCI+GPVJCNVGPFFKG2T·IWPIGPWPF)GUGV\GGVEFGT,CJTGWPF  UQYKG 'TI·P\WPIGP $GTKEJVKIWPIGP $GUEJTGKDWPI FGT 2TQDGOÒP\GP GVE $GTNKP   5   .QUG  



*#456'4 9 8GTUWEJ GKPGT 5RGKGTGT /ÒP\IGUEJKEJVG /KVVJGKNWPIGP FGU *KUVQTKUEJGP 8GTGKPU FGT   2HCN\5RG[GT+856HP*CNDNGKPGP//#)



.

.

.

.

/KV$GUKV\GTUVGORGNXQP&T(:9GK\KPIGT%QCWHFGO6KVGNDNCVV

.

*#6<)&KG#PH·PIGFGU/ÒP\YGUGPUKP*QNUVGKP&KG2T·IWPIGPFGT)TCHGPXQP5EJCWGPDWTIDKU  05V  *CODWTI  :8+++  5  -CTVGP  6HP  -CTVGP 1TKI $TQUEJWT $KPFWPI   WPF6CHGNVGKNNQUG//#)



.

*#72695·EJUKUEJG/ÒP\MWPFG#TDGKVUWPF(QTUEJWPIUDGTKEJVG\WTU·EJUKUEJGP$QFGPFGPMOCN RHNGIG$GKJGHV$·PFG$GTNKP56HP)CP\NGKPGP  



.

*'..'4 , &KG DCODGTIKUEJGP /ÒP\GP EJTQPQNQIKUEJ IGQTFPGV WPF DGUEJTKGDGP $CODGTI    :8+++5)CP\NGKPGPVCFGNNQUGT<WUVCPF



0WOGTKGTVGU'ZGORNCTFGTWPXGT·PFGTVGP#WHNCIGKP'ZGORNCTGP

.

*'./4'+%*6&CU)GNFYGUGPKPFGPFGWVUEJGP5EJWV\IGDKGVGP(ÒTVJ6GKNGKPGKPGP $CPFIGDWPFGP5OKV6GZVCDD5OKV6GZVCDD5)CP\NGKPGP



/KV$GUKV\GTUVGORGNXQP&T(:9GK\KPIGT%QCWHFGP6KVGNDN·VVGTP

.

*'./5%*4166-W49ÒT\DWTIGT/ÒP\GPWPF/GFCKNNGPXQP-NGKPTKPFGTHGNF  5 OKV  \CJNTGKEJGP #DDKNFWPIGP WPF DGKIGHÒIVGT $GYGTVWPIUNKUVG )CP\NGKPGP # 4   9#)0'4&KG/ÒP\GPFGT9ÒT\DWTIGT$KUEJÌHGCD9ÒT\DWTI5)CP\NGKPGP  



.

9ÒT\DWTIGT/ÒP\GPWPF/GFCKNNGPXQP-NGKPTKPFGTHGNF5OKV\CJNTGKEJGP#D DKNFWPIGPWPFDGKIGHÒIVGT$GYGTVWPIUNKUVG)CP\NGKPGP#



.

*';0'1&GT-WTHÒTUVGPVCI\W4GIGPUDWTIXQP$GTNKP+:5*CNDNGKPGPOKPKOCN DGUVQ­GP6GKNYGKUGUVQEMHNGEMKI



.

*+.&+5%* , &KG /ÒP\GP FGT RQOOGTUEJGP *GT\ÌIG XQP  DKU \WO 'TNÌUEJGP FGU )TGKHGPIG   UEJNGEJVGU8GTÌHHGPVNKEJWPIGPFGT*KUVQTKUEJGP-QOOKUUKQPHÒT2QOOGTP-ÌNP9KGP:+++ 5OKV\CJNTGKEJGP#DD(CNVVH)CP\NGKPGP//#)



+.+5%* 25%*9'&' # &CU /ÒP\YGUGP KO 5VKHV %QTXG[  5VWFKGP WPF 3WGNNGP \WT   YGUVH·NKUEJGP)GUEJKEJVG$CPF8GTÌHHGPVNKEJWPIGPFGT*KUVQTKUEJGP-QOOKUUKQPHÒT9GUVHCNGP:+ #TDGKVGP\WT)GNFWPF/ÒP\IGUEJKEJVG9GUVHCNGPU$CPF2CFGTDQTP:8+5OKV\CJNTGK EJGP#DD-CTVQPKGTVVCFGNNQUGT<WUVCPF#



+00 70& -0;2*#75'0 - )TCH /ÒP\ WPF /GFCKNNGP-CDKPGV FGU )TCHGP -CTN \W +PP WPF   -P[RJCWUGP *CPPQXGT  :  5  6HP 'TUVGT 0CEJVTCI \WO /ÒP\ WPF /GFCKNNGP-CDKPGV   FGU)TCHGP\W+PPWPF-P[RJCWUGP*CPPQXGT8++56HP*CNDNGFGTGVYCUDGUVQ­GPWPF DGTKGDGP GTUVG 5GKVG FGU *CWRVDCPFGU PGW GKPIGMNGDV GKPKIG$NGKUVKHVPQVK\GP$GUKV\GTUVGORGN//#)   



.

.

65


DEUTSCHLAND .

,#')'4-&KG/ÒP\RT·IWPIGPFGTFGWVUEJGP5VCCVGPXQT'KPHÒJTWPIFGT4GKEJUY·JTWPI$·PFG $CUGN  -CTVQPKGTV ITÌ­VGPVGKNU OKV DGKIGNGIVGT $GYGTVWPIUVCDGNNG YGPKIG $NGKUVKHVPQVK\GP   &C\W  ·NVGTG #WHNCIGP FGT /ÒP\RT·IWPI FGT FGWVUEJGP 5VCCVGP  UQYKG  XGTUEJ #WHNCIGP FGT   &KGFGWVUEJGP/ÒP\GPUGKV  



.

,'55' 9 &GT 9GPFKUEJG /ÒP\XGTGKP .ÒDGEM  8+  5  6HP $TQUEJKGTV GKPKIG 6HP   NQUG



.

&GT 9GPFKUEJG /ÒP\XGTGKP 0CEJFTWEM OKV 0CEJVT·IGP WPF 8GTDGUUGTWPIGP $TCWPUEJYGKI  FGT   #WUICDG.ÒDGEM8+++56HP)CP\NGKPGP#



.

/ÒP\ WPF )GNFIGUEJKEJVG 0KGFGTUCEJUGPU 9GTMUVÒEMG CWU /WUGWO#TEJKXWPF$KDNKQVJGMFGT5VCFV $TCWPUEJYGKI$TCWPUEJYGKI(TQPVKURK\56HPDGKNKGIGPF(CNVMCTVG*CNDNGKPGP //#)



&KG /ÒP\GP FGT 5VCFV $TCWPUEJYGKI XQP  DKU  $TCWPUEJYGKI   5 OKV \CJNTGKEJGP   #DD 1TKI$TQUEJWT  /ÒP\ WPF )GNFIGUEJKEJVG 0KGFGTUCEJUGPU $TCWPUEJYGKI   5    6HP*CNDNGKPGP  



,15'2*2)QNFOÒP\GPFGU:+8WPF:8,CJTJWPFGTVU &KUKDQFGPDGTIGT(WPF PGDUVWTMWPFNKEJGP $GKVT·IGP \WT /ÒP\IGUEJKEJVG FGT 4JGKPNCPFG DGUQPFGTU (TCPMHWTVU 5& CWU #TEJKX FGU 8GTGKPU HÒT   )GUEJKEJVGWPF#NVGTVWOUMWPFGKP(TCPMHWTVCO/CKP0GWG(QNIG(TCPMHWTVC/5 6HP*CNDNGKPGP//#)



.

.

$GKFGOXQTNKGIGPFGO'ZGORNCTJCPFGNVGUUKEJWOFCUXQPIGFTWEMVGP'ZGORNCTGP

.

&KG/ÒP\GPFGUIT·HNKEJGPWPFHÒTUVNKEJGP*CWUGU.GKPKPIGP0CEJFTWEM$KGNGHGNFFGT#WHNCIG 9KGP56HP)CP\NGKPGP



.

&KG *CNDDTCMVGCVGPHWPFG XQP 9QTOU WPF #DGPJGKO (TCPMHWTV C /   5 OKV #DD  6HP   )CP\NGKPGPOKVOQPVKGTVGO6KVGNDNCVVFGT$TQUEJWTPGWYGTVKI



.

&KG/ÒP\GPWPF/GFCKNNGPFGUHÒTUVNKEJGPWPFIT·HNKEJGP*CWUGU5QNOU0CEJFTWEM$KGNGHGNFFGT #WUICDG(TCPMHWTVC/5WPFWPRCIKPKGTVG5GKVGP6HP)CP\NGKPGP#



.

&KG/GFCKNNGPWPF/ÒP\GPFGT9KNFWPF4JGKPITCHGP(ÒTUVGP\W5CNO0CEJFTWEM$KGNGHGNFFGT #WHNCIG(TCPMHWTVC/5OKV6GZVCDD6HP)CP\NGKPGP#



.

,70)- * &KG DTGOKUEJGP /ÒP\GP /ÒP\GP WPF /GFCKNNGP FGU 'T\DKUVWOU WPF FGT 5VCFV $TGOGP   $TGOGP:56HP$TCWPGU*CNDNGFGTOKVIQNF4ÒEMGPVKVGN



.

-#.8'.#)'*5%*41%-7')/ÒP\GPFGT5VCFV*COGNP*COGNP5)CP\NGKPGP ,CJTG5RCTMCUUGFGT5VCFV*COGNP*COGNP5OKV\CJNTGKEJGP#DD)CP\ NGKPGP  



.

-#.8'.#)' *64+22.'4 * &KG /ÒP\GP FGT )TCHGP *GT\ÌIG WPF )TQ­JGT\ÌIG XQP 1NFGP   DWTI1UPCDTÒEM5OKV\CJNTGKEJGP#DD)CP\NGKPGP



.

-#6517415(/ÒP\GPFGU*GT\QIU(TKGFTKEJXQP%GNNGWPFUGKPGU0CEJHQNIGTU*GT\QI%JTKUVKCP .WFYKI$QOCPP/WUGWO%GNNG/ÒP\GPUCOONWPI$CPF+%GNNG5OKV#DD)CP\NGKPGP



.

-'..0'4 ' WPF *, &KG /ÒP\GP FGT 4GKEJUUVCFV 0ÒTPDGTI 5ÒFFGWVUEJG /ÒP\MCVCNQIG     #WHNCIG5VWVVICTV5OKV\CJNTGKEJGP#DD-CTVQPKGTV#



.

-'..0'4 *, &KG /ÒP\GP FGT PKGFGTDC[GTKUEJGP/ÒP\UV·VVGP$C[GTKUEJG/ÒP\MCVCNQIG$CPF )TÒPYCNF5OKV#DD)CP\NGKPGP



9KFOWPIFGU*I*)GKIGTKO8QTUCV\

.

&KG/ÒP\GPFGTPKGFGTDC[GTKUEJGP/ÒP\UV·VVGP$C[GTKUEJG/ÒP\MCVCNQIG$CPF)TÒPYCNF 5OKV#DD-WPUVNGFGT



$GKIGNGIV0CEJVT·IGWPF$GYGTVWPIUNKUVG

.

-'00'21*.-&KG/ÒP\GPXQP1UPCDTÒEM/ÒPEJGP:856HP$TCWPGU)CP\ NGKPGPOKVIQNF4ÒEMGPVKVGN



.

&KG /ÒP\GP XQP 1UPCDTÒEM &KG 2T·IWPIGP FGU $KUVWOU WPF FGU &QOMCRKVGNU 1UPCDTÒEM FGT 5VCFV   1UPCDTÒEMUQYKGFGU-QNNGIKCVUVKHVUWPFFGT5VCFV9KGFGPDTÒEM8GTÌHHGPVNKEJWPIGPFGU/WUGWOUFGT 5VCFV1UPCDTÒEM0CEJFTWEM/ÒPUVGTFGT#WUICDG/ÒPEJGP:856HP)CP\ NGKPGP



66


DEUTSCHLAND

788

797

.

-+4%**'+/'4 ( &KG $GTIDCW)GRT·IG CWU $CFGP9ÒTVVGODGTI (TGKDWTI KO $TGKUICW    (TQPVKURK\5OKV#DDWPF-CTVGP)CP\NGKPGP#



.

-.'$'.5$'4) ( )TCH XQP %CVCNQI FGT CWUGTNGUGPGP /ÒP\GP WPF /GFCKNNGP5COONWPI FGTGP   8GTUVGKIGTWPIFWTEJ*GTTP)GQTI-TCWUUVCVVHKPFGPYKTF9KGP8+56HP#PIGDWPFGP ,,49*#+6'5%CVCNQIFGTTGKEJJCNVKIGP5COONWPIXQP/ÒP\GP/GFCKNNGPWPF0QVJOÒP\GPUQYKG FGT PWOKUOCVKUEJGP $KDNKQVJGM PGDUV FGT 5COONWPI CPVKMGT /ÒP\GP FGU *GTTP 6JGQFQT 4QJFG FGTGP   8GTUVGKIGTWPI FWTEJ *GTTP ,QUGRJ $CGT WPVGT #UUKUVGP\ FGU 'ZRGTVGP .GQRQNF *CODWTIGT UVCVVHKPFGP   YKTF(TCPMHWTV:851TKI*CNDNGFGTGKPDCPFFGT<GKV



-.'+074#((#&KG9ÒTVVGODGTIKUEJGP/GFCKNNGP5ÒFFGWVUEJG/ÒP\MCVCNQIG$CPF WPF 5VWVVICTV   5 OKV #DD  5OKV#DD5OKV#DD5(CTDVHP :8+5(CTDVHPLGYGKNUOKV\CJNTGKEJGP#DD-CTVQPKGTV  



&KG /ÒP\GP WPF /GFCKNNGP XQP 'UUNKPIGP 5ÒFFGWVUEJG /ÒP\MCVCNQIG  5VWVVICTV   5 OKV   \CJNTGKEJGP#DDWPF6HP//#)



.

.

#WH  6HP UKPF KP FKGUGO $CPF GTUVOCNU U·OVNKEJG DGMCPPVGP YKMKPIGT\GKVNKEJGP /ÒP\GP GKPGT 2T·IGUV·VVG FGU   4GKEJUIGDKGVGUCDIGDKNFGVWPFFGTGP5VGORGNXGTDKPFWPIGPPQVKGTVYQTFGP

.

-.'0#7 6 &GWVUEJGU /ÒP\RTGKULCJTDWEJ      /ÒPEJGP    -CTVQPKGTV  



.

-.ª55'0&14( 0 5VWFKGP \W 9·JTWPI WPF 9KTVUEJCHV CO 0KGFGTTJGKP XQO #WUICPI FGT 2GTKQFG   FGUTGIKQPCNGP2HGPPKIUDKU\WO/ÒP\XGTVTCIXQP$QPP5(CNVMCTVG*CNDNGKPGP



.

-0+))' 9 /ÒP\ W /GFCKNNGP-CDKPGV FGU (TGKJGTTP 9KNJ -PKIIG *CPPQXGT  8  5   )CP\NGKPGP'KPDCPFGVYCUDGTKGDGP#PUVTGKEJWPIGPKO6GZV//#)



.

-1<+0195-+11661,4755*&KG/ÒP\GPFGU(ÒTUVGPWPF*GT\QIVWOU%QDWTIXQP DKU&KG2T·IWPIGPFGTKP%QDWTITGIKGTGPFGPU·EJUKUEJGP*GT\ÌIG$·PFG/ÒPEJGP: 5OKV\CJNTGKEJGP#DD-CTVQPKGTVVCFGNNQUGT<WUVCPF  



.

-7..,8&KG/ÒP\GPFGUIT·HNKEJGPWPFHÒTUVNKEJGP*CWUGU(WIIGT5&CWU/$0)/ÒPEJGP 56HP*CNDNGFGTOKV$ÒPFGPUGJTUGNVGPGU'ZGORNCT//#)



.

-7//'4 # &KG FGWVUEJGP 4GKEJUOÒP\GP XQO ,CJTG  DKU OKV  WPF DG\ÒINKEJG )GUGV\G   WUY&TGUFGP+856HP1TKI)CP\NGKPGPIGRT·IVG&GEMGNXGT\KGTWPI#



.

-70<'. /&KG/ÒP\GPFGT*CPUGUVCFV9KUOCTDKU/ÒP\IGUEJKEJVGWPF)GRT·IGMCVC NQI 9KUOCTGT 5VWFKGP \WT #TEJ·QNQIKG WPF )GUEJKEJVG  $GTNKPGT PWOKUOCVKUEJG (QTUEJWPIGP0GWG (QNIG9KUOCT$GTNKP5OKV#DD6HP-CTVQPKGTVVCFGNNQUG'TJCNVWPI



&KG/ÒP\GPFGT*CPUGUVCFV4QUVQEMECDKU/ÒP\IGUEJKEJVGWPF)GRT·IGMCVCNQI$GTNKPGT PWOKUOCVKUEJG(QTUEJWPIGP0GWG(QNIG$GTNKP5OKVGKPKIGP#DD6HP-CTVQPKGTV VCFGNNQUGTJCNVGP



.#0< 1 /ÒP\ WPF )GNFIGUEJKEJVGXQP+UP[5&CWU9ÒTVVGODGTIKUEJG8KGTVGNLCJTUJGHVGHÒT.CP FGUIGUEJKEJVG0GWG(QNIG5VWVVICTV56HP*CNDNGFGTPGWYGTVKI//#)



.

.

67


DEUTSCHLAND .

.'$'- 9 &KG /ÒP\GP FGT 5VCFV .KPFCW 5& CWU &GWVUEJGU ,CJTDWEJ HÒT 0WOKUOCVKM ,CJTICPI    WPF  56HP*CNDNGFGTVCFGNNQUGT<WUVCPF//#)



.

&KG/ÒP\GPFGT5VCFV.KPFCW5&CWU&GWVUEJGU,CJTDWEJHÒT0WOKUOCVKM,CJTICPIWPF   56HP1TKI$TQUEJWTVCFGNNQUGT<WUVCPF//#)



.

.'+6</#00,9GIYGKUGTCWHFGO)GDKGVFGT/ÒP\MWPFGFGU-ÌPKITGKEJU2TGW­GPQFGTIGUEJKEJV NKEJG 0CEJTKEJVGP ÒDGT FCU /ÒP\YGUGP 2TGW­GPU 9GIYGKUGT CWH FGO )GDKGVG FGT FGWVUEJGP /ÒP\   MWPFG QFGT IGUEJKEJVNKEJG 0CEJTKEJVGP ÒDGT FCU /ÒP\YGUGP &GWVUEJNCPFU 9GK­GPUGG   5   *CNDNGFGT#



/KVJCPFUEJTKHVNKEJGP$GUKV\GTXGTOGTM

.

.'5%**140 9 $TCWPUEJYGKIKUEJG /ÒP\GP WPF /GFCKNNGP $TCWPUEJYGKI   5OKV\CJN TGKEJGPHCTDKIGP#DD)CP\NGKPGP



.

.¤(('.*1.< 810 -1.$'4) 9 (TGKJGTT 1GVVKPICPC 0GWGT $GKVTCI \WT ÌVVKPIKUEJGP )G   UEJKEJVG KPUDGUQPFGTG \WT )GUEJKEJVG FGU ÌVVKPIKUEJGP /ÒP\YGUGPU #NU /CPWUETKRV IGFTWEMV 11   Q,=0ÌTFNKPIGP?55VCOODCWO4GIKUVGT0CEJVT·IG/ÒP\VH9CRRGPVHP*CNDNGFGTOKV IGRT·IVGO4ÒEMVGPVKVGN



.

.ª%-)'4*,&KG/ÒP\GPXQP-ÌNP0CEJVT·IGWPF$GTKEJVKIWPIGP\W$CPFFGU-ÌNPGT/ÒP\ YGTMU/ÒPEJGP56HP.GKPGP



.

/#00 , #PJCNVKUEJG /ÒP\GP WPF /GFCKNNGP XQO 'PFG FGU :8 ,CJTJWPFGTVU DKU  *CPPQXGT   5*CNDNGFGT6J'N\GªDGTUKEJVFGT/ÒP\GPWPF/GFCKNNGPFGU*CWUGU#PJCNVKPFGTPGWG TGP<GKV  9KGP+85)CP\NGKPGP  



/#46+0%-#*.*&%#*0'$&GT5EJCV\HWPFXQP%QTEGNNGURT½U2C[GTPG8GTITCDGPWO  Y·JTGPF FGT #WUGKPCPFGTUGV\WPIGP WO FKG DWTIWPFKUEJG 0CEJHQNIG .G VT¾UQT FG %QTEGNNGURT½U   2C[GTPG'PHQKXGTU¾RQSWGFGUEQPHNKVURQWTNCUWEEGUUKQPFG$QWTIQIPG504  $GTP 5OKV6GZVCDD6HP(CNVMCTVG1TKI$TQUEJWTVCFGNNQUGU'ZGORNCT//#)



.

/'*. / &KG /ÒP\GP FGT )TCHGP XQP $CTD[ WPF /ÒJNKPIGP *CODWTI   5 OKV GKPKIGP   ITÌ­VGPVGKNUHCTDKIGP#DD6HP-CTVQPKGTV



.

&KG /ÒP\GP FGU $KUVWOU *KNFGUJGKO 6GKN  &GT 2T·IG\GKVTCWO  DKU  3WGNNGP WPF &QMW   OGPVCVKQPGP \WT 5VCFVIGUEJKEJVG *KNFGUJGKOU   $·PFG *CODWTI  :  5 8+++  5   -CTVQPKGTV  



.

&KG/ÒP\GPFGU5VKHVGU3WGFNKPDWTI*CODWTI5OKV\CJNTGKEJGP#DD-CTVQPKGTV



.

/ÒP\WPF)GNFIGUEJKEJVGFGU'T\DKUVWOU/CIFGDWTIKO/KVVGNCNVGT$CPF6GZVVGKNWPF/ÒP\VCHGNP $CPF-CVCNQI*CODWTI5OKV#DD6HP-CTVQPKGTV



.

/'+'41#WUFGTLWPIGP4GUKFGP\+P*CPPQXGTUEJG)GUEJKEJVUDN·VVGT*GHV*CPPQXGT5 OKVGKPKIGP#DD$TQUEJKGTV0QVK\CWHFGO&GEMGN



.

&GT$TCMVGCVGPHWPFXQP$QMGNDGK$GXGTP-TGKU$TGOGTXÌTFG'KP$GKVTCI\WT'THQTUEJWPIFGTOKVVGN CNVGTNKEJGP DGUQPFGTU FGT PKGFGTU·EJUKUEJGP /ÒP\FGPMOCNG CWU FGT <GKV XQP GVYC  DKU  KP   *CPPQXGTUEJG)GUEJKEJVUDN·VVGT0GWG(QNIG  *CPPQXGT8+5OKV\CJNTGKEJGP#DD 1TKI$TQUEJWT



/'+0*#4&6 ) &KG /ÒP\ WPF )GNFIGUEJKEJVG FGU *GT\QIVWOU 2TGW­GP  5VWFKGP \WT   )GUEJKEJVG 2TGW­GPU $CPF  *GKFGNDGTI   5  6HP *CNDNGFGT 4ÒEMGP NGKEJV CWUIGDNKEJGP   //#)



/'0<'. 2 &GWVUEJG 0QVOÒP\GP WPF UQPUVKIG )GNFGTUCV\OCTMGP  6KVGN XQP $CPF    &GWVUEJURTCEJKIG0QVOÒP\GPWPF)GNFGTUCV\OCTMGPKO#WUNCPF6KVGNXQP$CPF0QVOÒP \GP WPF )GNFGTUCV\OCTMGP XQP $C[GTP    $·PFG )ÒVGTUNQJ   5  5    5  5 $·PFG  OKV \CJNTGKEJGP #DD -CTVQPKGTV &C\W  CMVWCNKUKGTVG DKU   #WHNCIG   )ÒVGTUNQJFGT$·PFGWPF  



/'4.'XQP$GUEJTGKDWPIFGT-ÌNNPKUEJGP/ÒP\UCONWPIFGU&QOJGTTPWPF-WTHÒTUVNKEJ9GNVNKEJGP *QHIGTKEJVURTCGUKFGPVGPXQP/GTNG-ÌNP::8+ 55&TWEMHGJNGT/GUUVH*CNDNG FGT'KPDCPFGVYCUDGUVQUUGPWPFCDIGPWV\V



.

.

.

.

$GUKV\GTXGTOGTM&T9GKPDGTI

.

.

/'46'05 ' /ÒP\ WPF )GNFIGUEJKEJVG FGT 5VCFV 0QTVJGKO /ÒP\UVWFKGP  *CNNG CP FGT 5CCNG   #PUKEJVFGT5VCFV0QTVJGKOPCEJ<GKNNGT/GTKCPU6QRQITCRJKG5OKV#DD6HP $GKNCIGP*CNDNGKPGP//#)



&GT $TCMVGCVGPHWPF XQP 0QTFJCWUGP /ÒP\UVWFKGP  *CNNG CP FGT 5CCNG   5 (CNVMCTVG    6HP*CNDNGFGT



'ZNKDTKU1-Q\KPQYUMK

68


DEUTSCHLAND .

/'4<&14(,(.61NFGPDWTIU/ÒP\GPWPF/GFCKNNGPCWH)TWPFFGT/ÒP\UCOONWPI5TMÌPKIN *QJGKV FGU )TQ­JGT\QIU XQP 1NFGPDWTI JKUVQTKUEJMTKVKUEJ DGUEJTKGDGP 1NFGPDWTI  8+  5   //#)   &KG /ÒP\GP WPF /GFCKNNGP ,GXGTNCPFyU CWH )TWPF XGTUEJKGFGPGT /ÒP\UCOONWPIGP   PCOGPVNKEJ FGT 5T MÌPKIN *QJGKV FGU )TQ­JGT\QIU XQP 1NFGPDWTI JKUVQTKUEJMTKVKUEJDGUEJTKGDGP1N FGPDWTI8+++5+PGKPGP$CPFIGDWPFGP*CNDNGFGTOGJTGTG$NGKUVKHVCPUVTGKEJWPIGP



.

/ª..'41(&KG/ÒP\GPFGT(COKNKG$CEJQXGPXQP'EJV5&CWUFGO::+$CPFFGT0WOKUOCVK UEJGP<GKVUEJTKHV9KGP5.KEJVFTWEMVCHGNP1TKI$TQUEJWTNQUG



.

/ª..'4,#*0%-' 9&81.< (' &KG /ÒP\GP WPF /GFCKNNGP FGT IT·HNKEJGP*·WUGT5C[P =? PGDUV GKPGO #PJCPI &KG /ÒP\GP WPF /GFCKNNGP FGU IT·HNKEJGP *CWUGU *CV\HGNF (TCPMHWTV CO   /CKP56HP)CP\NGKPGP//#)



.

&KG /ÒP\GP WPF /GFCKNNGP FGT IT·HNKEJGP *·WUGT 5C[P 0GDUV GKPGO #PJCPI &KG /ÒP\GP WPF /G   FCKNNGPFGUIT·HNKEJGP*CWUGU*CV\HGNFV(TCPMHWTVCO/CKP56HP)CP\NGKPGP



.

/ª.8'456'&6)#XQP&KG0QTFJ·WUGT/ÒP\GPCWUFGOPGWGTGP<GKVCNVGT   +P (GUVUEJTKHV \WT FTKVVGP QTFGPVNKEJGP *CWRVXGTUCOONWPI FGU *CT\8GTGKPUHÒT)GUEJKEJVGWPF#NVGT VWOUMWPFG\W0QTFJCWUGPCOWPF,WPK9GTPKIGTQFG5*CNDNGKPGP #W­GTFGO KP FGT (GUVUEJTKHV GPVJCNVGP <WUCOOGPUVGNNWPI FGT $TCMVGCVGP FGT PQTOCNKIGP HTGKGP 4GKEJUUVCFV 0QTF  



JCWUGP

.

/ª5'.'4-$GTIDCWIGRT·IG&CTIGUVGNNVCWH)TWPFFGT5COONWPIFGT2TGWUUCI#MVKGPIGUGNNUEJCHV $·PFG*CPPQXGT<CJNTGKEJGWPGKPJGKVNKEJPWOOGTKGTVG5GKVGPOKVXKGNGP#DD1TKI)CP\NGK PGPKO2CRRUEJWDGTOKV$GUKV\GTUVGORGN//#)  



.

0#7'&KG/ÒP\GPWPF/GFCKNNGPFGTQDGTUEJY·DKUEJGP5V·FVG(TGKDWTIKO$TGKUICW5 6HP*CNDNGKPGPVCFGNNQUGU'ZGORNCT//#)



.

0'7 * &KG /ÒP\GP WPF /GFCKNNGP FGU *GT\QIVWOU WPF FGU JGT\QINKEJGP *CWUGU #TGPDGTI $QPP   56HP)CP\NGKPGP#



.

0155#&KG/ÒP\GPFGT'T\DKUEJÌHGXQP%ÌNP&KG/ÒP\GPWPF/GFCKNNGPXQP%ÌNP -ÌNP:8+++56HP1TKI)CP\NGKPGPOKVIGRT·IVGO'KPDCPF//#)



/KV$GUKV\GTUVGORGNXQP&T(:9GK\KPIGT%Q

.

&KG/ÒP\GPXQP6TKGT6GKN$GUEJTGKDWPIFGT/ÒP\GP2WDNKMCVKQPGPFGT)GUGNNUEJCHV HÒT4JGKPKUEJG)GUEJKEJVUMWPFG$QPP:::56HP*CNDNGKPGP



$GUKV\GTUVGORGNXQP&T(:9GK\KPIGT%QWPFJCPFUEJTKHVNKEJGT$GUKV\GTXGTOGTMXQP$GEMGPDCWGTKO8QTUCV\

.

&KG/ÒP\GPFGT'T\DKUEJÌHGXQP-ÌNP&KG/ÒP\GPWPF/GFCKNNGPXQP-ÌNP-ÌNP :856HP1TKI)CP\NGKPGPOKVIGRT·IVGO'KPDCPF'KPDCPFGVYCUIGDQIGP



.

&KG/ÒP\GPFGT5V·FVG-ÌNPWPF0GWUU&KG/ÒP\GPWPF/GFCKNNGPXQP-ÌNP-ÌNP :+++56HP1TKI)CP\NGKPGPOKVIGRT·IVGO'KPDCPF#



.

&KG/ÒP\GPWPF/GFCKNNGPXQP-ÌNP$·PFG0CEJFTWEM*KNFGUJGKO0GY;QTMFGT#WUICDGP -ÌNP  $CPF  9 *8'40+%- &KG /ÒP\GP XQP -ÌNP 8QO $GIKPP FGT 2T·IWPI DKU   :+:56HP-CTVGP$CPF&KG/ÒP\GPFGT'T\DKUEJÌHGXQP-ÌNP8+++ 56HP$CPF&KG/ÒP\GPFGT'T\DKUEJÌHGXQP-ÌNP:856HP$CPF &KG/ÒP\GPFGT5V·FVG-ÌNPWPF0GWUU:+++556HPLGYGKNUOKVXKGNGP $GKNCIGP'KPJGKVNKEJKP$·PFGPKPDNCWGO)CP\NGKPGPIGDWPFGP#  



.

&KG/ÒP\GPXQP,ÒNKEJ/ÌTUWPF#NRGP/ÒPEJGP:+856HP-CTVG*CNDNGKPGP //#)



.

&KG /ÒP\GP FGT )TCHGP WPF *GT\ÌIG XQP -NGXG /ÒPEJGP  :8  5  6HP *CNDNGKPGP   VCFGNNQUG'TJCNVWPI//#)



.

1$'4/#;4 , ' *KUVQTKUEJG 0CEJTKEJV XQP $C[GTKUEJGP /ÒP\GP QFGT OWVJOC­NKEJG 'TMN·TWPI   FGTGT\W4GKEJGPJCNNCWUIGITCDGPGPWPFKPFGO:+WPF:++,CJTJWPFGTVIGUEJNCIGPGP/ÒP\GP(TCPM HWTV WPF .GKR\KI  :.8+++  5  -WRHGTUVKEJVHP 'VYCU UVQEMHNGEMKI 2CRRDCPF DGUVQ­GP   +PJCNVWPF6CHGNPKPVCFGNNQUGT'TJCNVWPI



1%* ( /ÒP\GP DC[GTKUEJGT -NÌUVGT -KTEJGP 9CNNHCJTVUQTVG WPF CPFGTGT IGKUVNKEJGT +PUVKVWVG 5&   CWU 1DGTDC[GT #TEJKX  /ÒPEJGP   5  6HP +P GKPGO $CPF KP *CNDNGKPGP IGDWPFGP   VCFGNNQUGT<WUVCPF#



.

18'4$'%- $ $KDNKQITCRJKG FGT DC[GTKUEJGP /ÒP\ WPF )GNFIGUEJKEJVG  9KGUDCFGP   :8+++5)CP\NGKPGP//#)



.

2'75 $ &CU )GNF WPF /ÒP\YGUGP FGT 5VCFV /ÒPUVGT K9 5& CWU 3WGNNGP WPF (QTUEJWPIGP \WT   )GUEJKEJVG FGT 5VCFV /ÒPUVGT 8GTÌHHGPVNKEJWPIGP FGT *KUVQTKUEJGP-QOOKUUKQPFGU2TQXKP\KCNKPUVKVWVU HÒT 9GUVH·NKUEJG .CPFGU WPF 8QNMUMWPFG  /ÒPUVGT KP 9GUVHCNGP   5  6HP )CP\NGKPGP   YGPKIG#PUVTGKEJWPIGPKO6GZV



.

/KV9KFOWPIFGU8GTHCUUGTUXQOCP.(QTTGT

69


DEUTSCHLAND .

.

215'40-.'66%(XQP/ÒP\UV·VVGPWPF/ÒP\GPFGT5V·FVGWPFIGKUVNKEJGP5VKHVGT5CEJUGPUKO /KVVGNCNVGT 5CEJUGPU /ÒP\GP KO /KVVGNCNVGT  .GKR\KI  :  5  6HP *CNDNGFGT 4ÒEMGP   NGKEJVDGUEJ·FKIVCPUQPUVGPUGJTIWVGTJCNVGP//#)



4'+//#00(/ÒP\GPWPF/GFCKNNGPECDKPGVFGU,WUVK\TCVJU4GKOOCPPKP*CPPQXGT'TUVG#DVGK NWPI*CPPQXGT56HP*CNDNGFGTGKPDCPFGVYCUDGUVQ­GPWPFOKV)GDTCWEJUURWTGP



&KG6CHGNP\GKIGP#DTKGDGXQP/ÒP\GPKP)QNFWPF5KNDGT

.

#WMVKQPGP   WPF  # *GUU 5COONWPI FGU ,WUVK\TCVJU 4GKOCPP *CPPQXGT  /ÒP\GP WPF /G   FCKNNGP%CDKPGV  TGXKFKGTVG #WHNCIG  $·PFG (TCPMHWTV CO /CKP    5OKV0TP6HP5OKV0T6HP5OKV0T6HP )GDWPFGPKP*CNDNGFGTFGT<GKV'.GKPIGDWPFGP



.

4+66/#00 * &GWVUEJG )GNFIGUEJKEJVG  /ÒPEJGP   5 -CTVQPKGTV //#)   



.

47&1.2*'<WUCOOGPUVGNNWPIFGT6CNGTKO:+8UQYKGKO:::6CNGTHWUUGKPFGT<GKVXQP UQYKGFGTPCEJFKGUGT<GKVGTUEJKGPGPGP)GFGPMVCNGT&TGUFGP56HP)CP\NGKPGP &KG)QNFOÒP\GP&GWVUEJNCPFUUGKVFGT#WHNÌUWPIFGUJGKNKIGPTÌOKUEJGP4GKEJGUDKU\WT9KGFGT CWHTKEJVWPIFGUFGWVUEJGP4GKEJGU5&CWU,CJTDWEJFGUPWOKUO8GTGKPU\W&TGUFGP5  6HP GKPKIG #PUVTGKEJWPIGP *CNDNGKPGP  &KG 5KNDGT W-WRHGTOÒP\GPFGWVUEJGT5VCCVGPCWUFGT <GKV+0CEJVTCI&TGUFGP:++55*CNDNGKPGP  



.

5#./1 * &GWVUEJG /ÒP\GP KP XQTIGUEJKEJVNKEJGP (WPFGP (KPPNCPFU 5WQOGP /WKPCKUOWKUVQ[JFK   UV[MUGP#KMCMCWUMKTLC*GNUKPMK:+56HP)CP\NGKPGP//#)



.

5#74/#,'.65%**XQP *I 5EJNGUKUEJG/ÒP\GPWPF/GFCKNNGP$TGUNCW56HP 8QTUCV\OKV5VQEMHNGEMGP+PJCNVVCFGNNQU*CNDNGFGTOKPKOCNDGUVQ­GP



.

5%*##(4&KG2TQDGPFGTFGWVUEJGP/ÒP\GPUGKV8GTUWEJGKPGT-CVCNQIKUKGTWPI$CUGN 5OKV\CJNTGKEJGP#DD)CP\NGKPGP



$GUKV\GTUKIPCVWT$GPFKI

.

.

.

5%*.')'. # &KG MWTOCKP\KUEJG /ÒP\UV·VVG *ÌEJUV  DKU  'KP $GKVTCI \WT *GKOCV   MWPFG (TCPMHWTV C/   5 OKV \CJNTGKEJGP #DD 1TKI )CP\NGKPGP VCFGNNQUG 'TJCNVWPI   //#)



&KGMWTOCKP\KUEJG/ÒP\UV·VVG*ÌEJUVDKU'KP$GKVTCI\WT*GKOCVMWPFG(TCPMHWTVC/   5 OKV \CJNTGKEJGP #DD )CP\NGKPGP 5VGORGN CWH -QRHUEJPKVV UQPUV VCFGNNQUG 'TJCNVWPI   //#)



5%*/+&6$-0#$%'4$56'+0,4GWUUKUEJG/ÒP\IGUEJKEJVG&TGUFGP+85 6HP*CNDNGFGT//#)



850

.

70

5%*/+&6 / &KG /ÒP\GP WPF /GFCKNNGP FGT *GT\ÌIG XQP 5CEJUGP.CWGPDWTI PGDUV GKPNGKVGPFGP   /KVVGKNWPIGP ÒDGT FCU /ÒP\YGUGP WPF FCU 9CRRGP FGU *GT\QIVWOU 4CV\GDWTI  (CTDKIGU (TQP   VKURK\ +8  5  6HP 5VCOOVH *CNDNGFGT 4ÒEMGP DGUEJ·FKIV GTUVGP 5GKVGP NQUGWPFNGKEJVUVQEM HNGEMKI//#)




DEUTSCHLAND .

5%*0'' ) 5·EJUKUEJG 6CNGT  WPF #DUEJN·IG XQP 6CNGTUVGORGNP KP )QNF WPF 5KNDGT  

&WMCVGP/GJTHCEJ6CNGT*CNDVCNGT (TCPMHWTVC/5OKV\CJNTGKEJGP#DD)CP\NGKPGP



.

5%*0'+&'4-&CU/ÒP\YGUGPKPFGP)TCHUEJCHVGP9KGF0GWYKGFWPF9KGF4WPMGN(TCPMHWTVC /5OKVGKPKIGP#DD6HP)CP\NGKPGPVCFGNNQUGT<WUVCPF#



.

5%*¤0'/#00 %2% <WT XCVGTN·PFKUEJGP /ÒP\MWPFGXQO\YÌNHVGPDKUHÒPH\GJPVGP,CJTJWPFGTV QFGT )TWPF\ÒIG FGT $TCEVGCVGPMWPFG WPF $GUEJTGKDWPI XQP DGKPCJG HÒPHJWPFGTV CNVGP $TCWPUEJYGKIK   UEJGP *GNOUVGFV UEJGP *CNDGTUV·FVKUEJGP 4GKPUVGKPKUEJGP )QUNCTKUEJGP #PJCNVKUEJGP WPF CPFGTGP   *QJNRHGPPKIGPYKGCWEJ9GUVH·NKUEJGPWPF*GUUKUEJGP\YGKUGKVKIGP2HGPPKIGP9QNHGPDÒVVGN 56HP*CNDNGKPGP'KPDCPFGVYCUN·FKGTV//#)



5%*4¤66'4((TGKJGTTXQP&CURTGW­KUEJG/ÒP\YGUGPKO,CJTJWPFGTV$GUEJTGKDGPFGT6GKN *GHV&KG/ÒP\GPCWUFGT<GKVFGT-ÌPKIG(TKGFTKEJ+WPF(TKGFTKEJ9KNJGNO+$GTNKP8+++ 56HP*GHV&KG/ÒP\GPCWUFGT<GKVFGU-ÌPKIU(TKGFTKEJ++FGU)TQ­GP$GTNKP: 56HP*GHV&KG/ÒP\GPCWUFGT<GKVFGT-ÌPKIG(TKGFTKEJ9KNJGNO++WPF(TKGFTKEJ9KN JGNO +++ DKU \WO ,CJTG  $GTNKP   5  6HP $CPF  WPF  1TKI )CP\NGKPGP $CPF    *CNDNGKPGP$CPFGVYCUUVQEMHNGEMKI#  



&KG/ÒP\UV·VVG\W5VGVVKPWPVGTFGP-ÌPKIGP-CTN:+WPF-CTN:++XQP5EJYGFGP5&CWU FGT<GKVUEJTKHVHÒT0WOKUOCVKM$CPF$GTNKP56HP*CNDNGKPGP



.

.

856

.

&KG /ÒP\GP (TKGFTKEJ 9KNJGNOU FGU )TQ­GP -WTHÒTUVGP WPF (TKGFTKEJU +++ XQP $TCPFGPDWTI CWH   )TWPFNCIGFGT5COONWPIFGUMIN/ÒP\MCDKPGVVU$GTNKP:++56HP1TKI)CP\NGKPGP NGKEJVDGUVQ­GP



'ZNKDTKU#NDGTV6GTDGTIGT

.

&CURTGW­KUEJG/ÒP\YGUGPDKU$GUEJTGKDGPFGT6GKN$GTNKP56HP)CP\NGK PGP//#)



.

$TCPFGPDWTI(T·PMKUEJGU /ÒP\YGUGP /ÒP\UVWFKGP  WPF   6GKNG *CNNG CP FGT 5CCNG    :+++5:56HP+PGKPGO$CPFKP*CNDNGFGTIGDWPFGP$CPFOKVMNGKPGTGO9CUUGT UEJCFGP



.

5%*7.6'020&KG/ÒP\GPFGT)TCHGPXQP*QJPUVGKPXQPFGPGTUVGP#PH·PIGPKO/KVVGNCNVGTDKU \WO#WUUVGTDGPFGUIT·HNKEJGP*CWUGU1UPCDTÒEM51TKI$TQUEJWT



.

5%*7.<' + WPF 9) &KG HÒTUVDKUEJÌHNKEJOÒPUVGTUEJGP /ÒP\GP FGT 0GW\GKV /ÒPUVGT 9GUVH    56HP)CP\NGKPGP#



.

5%*9#.$#%*%&KGPGWGTGPFGWVUEJGP6CNGT&QRRGNVCNGTWPF&QRRGNIWNFGPXQT'KPHÒJTWPIFGT 4GKEJUY·JTWPI#WHNCIG/ÒPEJGP56HP)CP\NGKPGP&KGPGWGUVGPFGWVUEJGP6JC NGT&QRRGNVJCNGTWPF&QRRGNIWNFGP#WHNCIG.GKR\KI56HPOKV0QVK\GP&KGPGWG UVGPFGWVUEJGP/ÒP\GPWPVGT6JCNGTITÌ­GXQT'KPHÒJTWPIFGU4GKEJUIGNFGU#WHNCIG.GKR\KI 56HP+PGKPGP$CPFKP*CNDNGFGTIGDWPFGP&KGPGWGUVGPFGWVUEJGP/ÒP\GPWPVGT6JCNGT ITÌ­G XQT 'KPHÒJTWPI FGU 4GKEJUIGNFGU  #WHNCIG .GKR\KI   5  6HP  &KG PGWGUVGP   FGWVUEJGP 6JCNGT &QRRGNVJCNGT WPF &QRRGNIWNFGP  #WHNCIG .GKR\KI   5  6HP +P GKPGP   $CPFKP*CNDNGFGTIGDWPFGPDGUVQ­GP  

 71


DEUTSCHLAND .

5%*9+0-195-+ 9 /ÒP\ WPF )GNFIGUEJKEJVG FGT /CTM /GK­GP WPF /ÒP\GP FGT YGNVNKEJGP   *GTTGP PCEJ OGK­PKUEJGT #TV $TCMVGCVGP  XQT FGT )TQUEJGPRT·IWPI 6GKN  #DDKNFWPIUVCHGNP =OGJT   PKEJVGTUEJKGPGP?(TCPMHWTVC/56HP)CP\NGKPGP//#)



'ZNKDTKUCWH8QTUCV\

.

.

.

5''.0&'4 0 #WIWUVKUUKOCG CE 5GTGPKUUKOCG )GPVKU $TWPUXKEQ .WPGDWTIGPUKU 0WOKUOCVC CE   /QPGVC CGVCVKU 4GEGPVKQTKU /CZKOCO 2CTVGO KP #GU +PEKUCG 0CEJFTWEM FGT #WUICDG *CPPQXGT    56HP(QNKQ)CP\NGKPGPVCFGNNQUGT<WUVCPF#



5'..+'44&KG/ÒP\GPWPF/GFCKNNGPFGU*QEJUVKHVU(TGKUKPI$C[GTKUEJG/ÒP\MCVCNQIG)TÒP YCNF  (TQPVKURK\  5 OKV \CJNTGKEJGP #DD )CP\NGKPGP //#)  $GKNKGIGPF $GYGT   VWPIUNKUVG\W$CPF*QEJUVKHV(TGKUKPI



5'7$'46 8GT\GKEJPKU FGT KP FGT 5COONWPI FGU /CPPJGKOGT #NVGTVWOUXGTGKPU DGHKPFNKEJGP RH·N\K   UEJGPWPFDCFKUEJGP/ÒP\GPWPF/GFCKNNGP/CPPJGKO56HP*CNDNGKPGP//#)



.

5/+6*46JG%QKPCIGQHVJG#PINQ*CPPQXGTKCP2GTUQPCN7PKQP1UPCDTÒEM 5OKV#DD-CTVQPKGTV



.

52476* ( &KG 1DGTJCT\GT#WUDGWVGVCNGTXQP$TCWPUEJYGKI.ÒPGDWTI'KP$GKVTCI\WT+PFWUVTKGCT EJ·QNQIKG 8GTÌHHGPVNKEJWPIGP CWU FGO &GWVUEJGP $GTIDCW/WUGWO $QEJWO$QEJWO(TQP VKURK\  5 OKV \CJNTGKEJGP #DD (CNVMCTVG 1TKI )CP\NGKPGP //#)   &KG $GTIDCWRT·   IWPIGPFGT6GTTKVQTKGPCP'FGT.CJPWPF5KGI'KP$GKVTCI\WT+PFWUVTKGCTEJ·QNQIKG8GTÌHHGPVNKEJWP IGP CWU FGO $GTIDCW/WUGWO  $QEJWO  (TQPVKURK\  5 OKV \CJNTGKEJGP #DD (CNVMCTVG   1TKI)CP\NGKPGP//#)  



&KG 1DGTJCT\GT#WUDGWVGVCNGTXQP$TCWPUEJYGKI.ÒPGDWTI'KP$GKVTCI\WT+PFWUVTKGCTEJ·QNQIKG8GT ÌHHGPVNKEJWPIGPCWUFGO&GWVUEJGP$GTIDCW/WUGWO$QEJWO$QEJWO(TQPVKURK\5OKV \CJNTGKEJGP #DD (CNVMCTVG 1TKI )CP\NGKPGP //#)   &KG $GTIDCWRT·IWPIGP FGT 6GTTKVQ   TKGP CP 'FGT .CJP WPF 5KGI 'KP $GKVTCI \WT +PFWUVTKGCTEJ·QNQIKG 8GTÌHHGPVNKEJWPIGP CWU FGO$GTI DCW/WUGWO  $QEJWO  (TQPVKURK\  5 OKV \CJNTGKEJGP #DD (CNVMCTVG 1TKI )CP\NGKPGP   //#)   &KG $GTIDCWRT·IWPIGP FGT TJGKPRH·N\KUEJGP 5KNDGTITWDGP $QEJWO   5 OKV   #DD $TQUEJKGTV &KG *KNFGUJGKOGT $GTIDCWVCNGTFGU$KUEJQHU,QDUV'FOWPFX$TCDGEMFGT)TWDG5V #PVQPKWU 'TGOKVC KP *CJPGPMNGG $QEJWO   5 OKV #DD  (CNVMCTVG $TQUEJKGTV 2   #401.&937'../#.<5·EJUKUEJVJÒTKPIKUEJG$GTIDCWIGRT·IG)GYKPPWPIWPF8GTJÒVVWPIXQP )QNF5KNDGTWPF-WRHGTKO5RKGIGNFGT/ÒP\GPWPF/GFCKNNGP.GKR\KI5OKV#DD  



56#0)' ' )GNF WPF /ÒP\IGUEJKEJVG FGU $KUVWOU /KPFGP 8GTÌHHGPVNKEJWPIGP FGT JKUVQTKUEJGP   -QOKUUKQP HÒT 9GUVHCNGP /ÒPUVGT 9GUVH    5 OKV XKGNGP #DD  (CNVVH )CP\NGKPGP OKV   OQPVKGTVGO&GEMGNFGT1TKI$TQUEJWTVCFGNNQUGT<WUVCPF#



)GNFWPF/ÒP\IGUEJKEJVGFGT)TCHUEJCHV4CXGPUDGTI8GTÌHHGPVNKEJWPIGPFGT*KUVQTKUEJGP-QOOKUUKQP FGU2TQXKP\KCNKPUVKVWVUHÒTYGUVH·NKUEJG.CPFGUWPF8QNMUMWPFG/ÒPUVGT 9GUVH 8+++5 OKVGKPKIGP#DD6H1TKI$TQUEJWT2CRKGTIGDT·WPV//#)



.

.

.

#WHFGO&GEMGNWPFFGUUGP4ÒEMUGKVGDGHKPFGPUKEJ$GUKV\GTXGTOGTMGXQP$CPMJCWU,/$KEMGNOCPP%QWPF /ÒP\JCPFNWPI&T$WUUQ2GWU

.

.

.

. 72

564'$'4(8GTUWEJGKPGT)GUEJKEJVGFGUMÌPKINKEJGP/ÒP\MCDKPGVVUKP/ÒPEJGP6GKNG/ÒPEJGP   WPF  #WU &GPMUEJTKHVGP FGT MÌPKINKEJGP #MCFGOKG FGT 9KUUGPUEJCHVGP \W /ÒPEJGP     56HP7GDGTGKPGIQNFGPG/GFCKNNG*GT\QIU#NDTGEJV8+KP$CKGTP5(CNVVC HGN #EJ·WU -ÌPKI XQP .[FKGP CWH GKPGT ÒDGTCWU UGNVGPGP )QNFOÒP\G KP FGT MÌPKINKEJGP /ÒP\   UCOONWPIKP/ÒPEJGP56H7GDGTGKPGUGJTUGNVGPG/ÒP\GXQP/[VKNGPGCWH.GUDQUYGN EJGUKEJKPFGTMÌP5COONWPI\W/ÒPEJGPDGHKPFGV56H&KG·NVGUVGPXQPFGP9KVVGNUDC EJGTP KP FGT 1DGTRHCN\ IGUEJNCIGPGP /ÒP\GP 'TUVG #DVGKNWPI &KG /ÒP\GPFGTRHCN\IT·HNKEJGP.KPKG #DUEJPKVV/ÒPEJGP56H56HWPF56HP#NNGUKPGKPGP$CPFIG DWPFGP 2CRRDCPF OKPKOCN DGUVQ­GP VGKNYGKUG NGKEJV UVQEMHNGEMKI &C\W  ªDGT GKPKIG UGNVGPG WPF   WPDGMCPPVG5EJCWOÒP\GP*GT\QIU#NDGTV8CWU$CKGTP/ÒPEJGPQ,5OKV-WRHGTVHP'VYCU UVQEMHNGEMKI.QUG7GDGTGKPGUGJTUGNVGPG/ÒP\GXQP/[VKNGPGCWH.GUDQUYGNEJGUKEJKPFGTMÌP 5COONWPI\W/ÒPEJGPDGHKPFGV5QJPG6H.QUG  



&KG·NVGUVGP/ÒP\GPFGT)TCHGPXQP9GTVJGKO5&/ÒPEJGPCWUFGP#DJCPFNWPIGPFGT2JKNQUQ RJKUEJRJKNQNQIKUEJGP%NCUUGFGT-ÌPKINKEJ$C[GTKUEJGP#MCFGOKGFGT9KUUGPUEJCHVGP56H 1TKI$TQUEJWTWPCWHIGUEJPKVVGP6HGVYCUUVQEMHNGEMKI#



57%*+'4 4 &KG /ÒP\GP FGT )TCHGP XQP *CPCW <WO FTGKJWPFGTVL·JTKIGP ,WDKN·WO FGT 0GWUVCFV   *CPCW *CPCW   5  6HP *CNDNGFGTDCPF OKV/CTOQTRCRKGTCWHFGO&GEMGNUGJTUGNVGPGU 'ZGORNCT//#)



6*14/#00 * &KG CPJCNVKUEJGP /ÒP\GP FGU /KVVGNCNVGTU /ÒPUVGT   5 \CJNTGKEJG -QP   MQTFCP\VCDGNNGP6HP.GKPGP




DEUTSCHLAND .

.

.

6140#7 1 /ÒP\YGUGP WPF /ÒP\GP FGT )TCHUEJCHV /CPUHGNF XQP FGT /KVVG FGU HÒPH\GJPVGP ,CJT   JWPFGTVUDKU\WO'TNÌUEJGPFGUIT·HNKEJGPWPFHÒTUVNKEJGP*CWUGU2TCI56HP*CNDNGFGT OKV-QRHIQNFUEJPKVV4ÒEMGPXQP$KPFWPIIGNÌUV//#)&C\W'KPJCPFUEJTKHVNKEJGT#WMVKQPU MCVCNQIFGT5NI-WP\'KIGPVWO$-WP\5GKVGPPKEJVPWOGTKGTV*CNDNGKPGP



&KG $TCMVGCVGP FGT )TCHGP XQP /CPUHGNF FGT 'FNGP *GTTGP XQP (TKGFGDWTI WPF FGT *GTTGP XQP   5EJTCRNCW )TÒPDGTI KP 5EJNGUKGP  8+++  5  6HP *CNDNGKPGP &C\W , W # '4$56'+0   /CPUHGNF3WGTHWTV * )4¤55.'4 /CPUHGNF 6 56'0<'. /CPUHGNF *CNDNGKPGP Z  1TKI$TQ   UEJWT Z   



64+22'#&KG/ÒP\GPXQP/GFGDCEJ$TCWPUEJYGKI5FCXQP6HP)CP\NGKPGP//#) 



878

.

9'+&*#5 ,( &KG $TCPFGPDWTIGT &GPCTG XQP *GKPTKEJ -ÌPKI FGT 9GPFGP  DKU CWH (TKGFTKEJ +   -WTHÒTUV CWU FGO *CWUG *QJGP\QNNGTP  WPF XQP FGOUGNDGP FKG $TCPFGPDWTIGT )TQUEJGP WPF MNGKPGP   /ÒP\GPDKUCWH(TKGFTKEJ9KNJGNO+8-ÌPKIXQP2TGWUUGP$GTNKP8+++56HP*CNDNG FGTOKPKOCNDGUVQ­GPGVYCUUVQEMHNGEMKI#



/KV'ZNKDTKUOGJTGTGP$GUKV\GTXGTOGTMGPWPF$GUKV\GTGVKMGVVXQP&T/GT\DCEJGT/ÒPEJGP

.

9'+0)460'4 , $GUEJTGKDWPI FGT -WRHGT/ÒP\GP 9GUVHCNGPU PGDUV JKUVQTKUEJGP 0CEJTKEJVGP   *GHV2CFGTDQTP56HP*CNDNGKPGP



.

$GUEJTGKDWPIFGT-WRHGT/ÒP\GP9GUVHCNGPU2CFGTDQTP*GHVWPF0CEJVTCI8+++ 56HP*CNDNGFGT



.

&KG5KNDGT/ÒP\GPXQP%ÌNPKUEJ*GT\QIVJWO9GUVHCNGPWPF)TCHUEJCHVQFGT8GUV4GEMNKPIJCWUGPPGDUV JKUVQTKUEJGP0CEJTKEJVGP/ÒPUVGT56HP*CNDNGFGT4ÒEMGPNQUGGKPKIGJCPFUEJTKHVNKEJG 5GKVGP



9'.6'4)&KG/ÒP\GPFGT9GNHGPUGKV*GKPTKEJFGO.ÌYGP$·PFG$TCWPUEJYGKI :+  5 +:  5  6HP 8++  5 OKV XKGNGP #DD )CP\MWPUVNGFGT $KPFWPI XQP $CPF    GVYCUIGNQEMGTV$GKIGNGIV*GHVOKV0CEJVT·IGP#  



9';.#&KG2CWN*GPEMGN UEJG5COONWPI$TCPFGPDWTI2TGWUUKUEJGT/ÒP\GPWPF/GFCKNNGP$GTNKP 6GKNOKV0CEJVTCI56HP0CEJVTCI$GTNKP5+P\YGK$·PFGPKP )CP\NGFGTFGT<GKVIGDWPFGPOKPKOCNDGUVQ­GP



.

.

+O0CEJVTCIKUVGKPCWUHÒJTNKEJGU4GIKUVGTUQYKGFKGFGVCKNNKGTVG'.UCOVFGTPCOGPVNKEJGP-·WHGTPCOGPCWHIGHÒJTV

.

9+$'. ( /ÒP\IGUEJKEJVGFGT)TCHGPXQP9GTVJGKOWPFFGU)GUCOVJCWUGU.QGYGPUVGKP9GTVJGKO 0CEJFTWEM$KGNGHGNFFGT#WUICDG*CODWTI:++55VCOOHVP6HP)CP\NGKPGP



.

9+'.#0&6($CFKUEJG/ÒP\WPF)GNFIGUEJKEJVG8GTÌHHGPVNKEJWPIGPFGU$CFKUEJGP.CPFGUOWUG WOU#WHNCIG-CTNUTWJGFGT'TUVCWHNCIGXQP:+56HP)CP\NGKPGP



.

&GT$TGKUICWGT2HGPPKIWPFUGKPG/ÒP\UV·VVGP'KP$GKVTCI\WT/ÒP\WPF)GNFIGUEJKEJVGFGU#NGOCP PGPNCPFGU KO /KVVGNCNVGT  PGWDGCTDGKVGVG #WHNCIG -CTNUTWJG   5 (CNVMCTVG  6HP 1TKI   $TQUEJWT#/ÒP\GPWPF)GNFKP2HQT\JGKO-CTNUTWJG5OKV\CJNTGKEJGP#DD KP(CTDG)CP\NGKPGPOKVUKNDGTPGT&GEMGNRT·IWPI  

 73


FRANKREICH, MONACO .

9ª466'/$'4)+5%*'5 .#0&'5/75'7/ 56766)#46 &KG <GKV FGT 5VCWHGT $CPF    5VWVVICTV&CTKP'0#7/ÒP\GPWPF)GNFKPFGT5VCWHGT\GKV$TQUEJKGTV  



.

-1081.76 #..) 07/+5/#6+- 70& 9+465%*#(65)'5%*+%*6'  -QPXQNWV XQP /Q   PQITCRJKGP#WHU·V\GP.GZKMC\WTCNNIGOGKPGPPGW\GKVNKEJGPWPFCWUN·PFKUEJGP0WOKUOCVKMWCXQP ,2&+815EJYGK\.KEJVGPUVGKP4(4+'&$'4))QNF%QKPUQHVJG9QTNF8)#&174;(TCPM TGKEJ 2 )4+'4510 $KDNKQITCRJKG 0WOKUOCVKSWG * *'&' &·PGOCTM 0QTYGIGP9 *1.6<   #DMÒT\WPIGP CWH /ÒP\GP . -4#75'% /+5*.'4 9QTNF %QKPU   9QTNF %QKPU  6   -41*# .GZKMQP FGT 0WOKUOCVKM - .#0)' /KVVGNCNVGT *4 /'&+0) &KG *GTUVGNNWPI XQP   /ÒP\GP*4+66/#00&GWVUEJGU/ÒP\UCOONGTNGZKMQP(9#5%*.+%-';5'042#../#00 'TMN·TWPI FGT #DMÒT\WPIGP CWH /ÒP\GP * 5%*.7/$'4)'4 )QNFOÒP\GP 5'#$; 'PINCPF   8GTGKPVGU-ÌPKITGKEJ#9'0<'.#WHNÌUWPINCVGKPKUEJGT.GIGPFGPCWH/ÒP\GPWPF/GFCKNNGP

 



-1081.76 &'765%*' 07/+5/#6+- 70& )'.&)'5%*+%*6'  &KXGTUG /QPQITCRJKGP   OGKUVGPU \WT FGWVUEJGP 0WOKUOCVKM WPF )GNFIGUEJKEJVG WC % , )¤6< &GWVUEJNCPFU -C[   UGTOÒP\GP FGU /KVVGN#NVGTU 0CEJFTWEM .GKR\KI  FGT 1TKIKPCNCWUICDG &TGUFGP    &'765%*' $70&'5$#0- *TUI  &GWVUEJG 6CNGT XQP FGP #PH·PIGP FGT 6CNGTRT·IWPI DKU \WO   &TGK­KIL·JTKIGP -TKGI CWU FGT 5COONWPI FGT &GWVUEJGP $WPFGUDCPM (TCPMHWTV CO /CKP Q, =/KV   $GUKV\GTUVGORGN?&GWVUEJG6CNGTXQO&TGK­KIL·JTKIGP-TKGIDKU\WO'PFGFGT6CNGTRT·IWPICWUFGT 5COONWPIFGT&GWVUEJGP$WPFGUDCPM(TCPMHWTVCO/CKPQ,=/KV$GUKV\GTUVGORGN?*,-'..0'4 &KG /ÒP\GP FGT (TGKGP 4GKEJUUVCFV 0ÒTPDGTI $C[GTKUEJG /ÒP\MCVCNQIG $CPF  )TÒPYCNF  '   0'7/#00 &KG /ÒP\GP FGU &GWVUEJGP 1TFGPU KP 2TGW­GP FGU *GT\QIVWO 2TGW­GP 9GUVRTGW­GP   UQYKG FKG )GRT·IG FGU &GWVUEJGP 1TFGPU KP /GTIGPVJGKO  -ÌNP  - /#46+0 &KG   RTGW­KUEJGP/ÒP\RT·IWPIGPXQP$CPFFGT5EJTKHVGPTGKJG&KG/ÒP\G$GTNKP, WPF#'4$56'+0&GU-ÌPKINKEJGP/ÒP\%CDKPGVU\W&TGUFGP&QWDNGVVGPCP/ÒP\GP/GFCKNNGPWPF $ÒEJGTP&TGUFGP9GUVHCNKC0WOKUOCVKEC/ÒPUVGT7PVGTUEJKGFNKEJG$KPFWPIGP  



/QPQITCRJKGP WPF #WHU·V\G \W 6JGOGP FGT FGWVUEJGP 0WOKUOCVKM W C XQP ) &78' $TCWP   UEJYGKI.ÒPGDWTIKUEJG&KEMVCNGT*'*4'0&5RG[GTGT/ÒP\IGUEJKEJVG4*##5/CPPJGKO9 *#00'/##0 /GEMNGPDWTI5VTGNKV\  4QUVQEM 9 *#726 5CEJUGP # -'..'4 2CRKGTIGNF   FGWVUEJGT -QNQPKGP - /#46+0 2TGW­GP  # 2+%- 2CRKGTIGNF * 4+66/#00 &GWV   UEJG)GNFIGUEJKEJVG)5%*¤0#NVFGWVUEJNCPF95%*7.6'0&GWVUEJG/ÒP\GPCWUFGT<GKV-CTN 806*70&QRRGNIWNFGP&QRRGNVCNGTWXO  



-1081.76 016/ª0<'0 /#4-'0 214<'..#0)'.&  &KXGTUG /QPQITCRJKGP 5QPFGT   FTWEMGWPF-NGKPUEJTKHVGPFCTWPVGT1*140&KG/ÒP\GPWPF/GFCKNNGPCWUFGTUVCCVNKEJGP/CPW HCEVWT \W /GKUUGP .GKR\KI  # -'..'4 &CU FGWVUEJG 0QVIGNF   6GKN -NGKPIGNF   UEJGKPG  #WHNCIG $GTNKP   &CU FGWVUEJG 0QVIGNF   6GKN -NGKPIGNFUEJGKPG    #WHNCIG(TCPMHWTVC/&CUFGWVUEJG0QVIGNF6GKN#WHNCIG$GTNKP +P GKPGP $CPF IGDWPFGP OKV $ 4¤66+0)'4 &CU FGWVUEJG )GHCPIGPGPNCIGTIGNF UQYKG )TWDGP WPF   <GEJGPIGNF  (TCPMHWTV C /  =/KV $GUKV\GTUVGORGN? 9 *#55'./#00 &KG %QP   UWOXGTGKP9GTVJOCTMG /ÒPUVGT  4 # .#/$ %CVCNQIWG QH )GTOCP 9CT 6QMGPU #TK\QPC   2/GP\GN&GWVUEJG0QVOÒP\GPWPFUQPUVKIG)GNFGTUCV\OCTMGPDKU$GTNKP- 5%*'7%*/GFCKNNGPCWU2QT\GNNCP$CPF#WUICDGQTVG#<1DGT'UEJDCEJ-TWODCEJD)KGUUGP 7PVGTUEJKGFNKEJG$KPFWPIGP  



-1081.76 +PVGTGUUCPVGU -QPXQNWV XQP JQEJYGTVKIGP 0CEJFTWEMGP XQP YKEJVKIGT 5VCPFCTFNKVGTCVWT   \WT FGWVUEJGP 0WOKUOCVKM WC XQP , #.$4'%*6 *QJGPNQJG * $'*4'05 .ÒDGEM *2   %#22' )QUNCT -* &#55&14( 5·EJUKUEJG )GUEJKEJVG $&7&+- &GWVUEJGT 1TFGP , W #   '4$56'+0 5COONWPI 'PIGNJCTFV  5EJWNVJGUU4GEJDGTI UEJ ( (4+'&'05$74)* 5'')'4   5EJNGUKGP - (4+'&'4+%* *CWU 5VQNFDGTI  -QPVGTOCTMGPYGUGP . )41$' *GT\QIVWO 5CEJ   UGP/GKPKPIGP , *'..'4 $CODGTI #X *'55 /CKP\  *GUUGP , +5'0$'%- 0CUUCW 2   ,15'2*' ('..0'4 (TCPMHWTV CO /CKP * ,70)- $TGOGP )TCH - \W +0070&   -0;2*#75'0 /ÒP\ WPF /GFCKNNGP-CDKPGV 9 -0+))' /ÒP\ WPF /GFCKNNGP-CDKPGV 2X   .'*/#00 /CTKC XQP ,GXGT , .'+6</#00 'THWTV ' .','70' $WTI (TKGFDGTI 9 (TJT   .ÌHHGNJQN\ X -1.$'4) 1GVVKPICPC , /#00 #PJCNV 1 /'45'$74)'4 5CEJUGP '   /'46'05 &GWVUEJG $TCMVGCVGP # /';'4 /ÒP\GP WPF /GFCKNNGP FGT *GTTGP XQP 4CPV\CW 4   2+.16; 9ÒT\DWTI # 4+'%*/#00 /KVVGNCNVGTNKEJG /ÒP\GP * (TJT X 5#74/#,'.65%*   &GWVUEJNCPF 5EJYGK\ 2QNGP-5%*4#%-$C[GTP4GIGPUDWTI((TJTX5%*4¤66'4(TKGF TKEJ9KNJGNOFGUITQ­GP-WTHÒTUVGPWPF(TKGFTKEJ+++XQP$TCPFGPDWTI(TKGFTKEJ+WPF(TKGFTKEJ 9KNJGNO +  2TGW­GP 4 57%*+'4 *CPCW 9' 6'06<'. 5CEJUGP - 81)'.5#0) #WU   DGWVGOÒP\GP (# 8155$'4) &CP\KI # 9';. $TCPFGPDWTI2TGW­GP  9+.*'/5&¤4(('4   $TCPFGPDWTIKP(TCPMGP  



.

.

.

.

(4#0-4'+%*/10#%1 .

%#410'/QPPCKGUH¾QFCNGUHTCP¼CKUGU2CTKU::+856HP*CNDNGFGTHTCP\ÌUKUEJG $KPFWPIDKUCWHYGPKIGGVYCUUVQEMHNGEMKIG6HPKPVCFGNNQUGT'TJCNVWPI//#)



.

/QPPCKGUH¾QFCNGUHTCP¼CKUGU2CTKU::+856HP*CNDNGFGT#  



74


FRANKREICH, MONACO .

%*#6+..10 . ,GVQPU EQPUWNCKTGU FG NC XKNNG FG .[QP #FFKVKQP CWZ TGEJGTEJGU FW &T 2QPEGV   .[QP2CTKU56H*CNDNGFGT8IN#

.

%+#0+ . .GU OQPPCKGU TQ[CNGU HTCP¼CKUGU FG *WIWGU %CRGV C .QWKU :8+ CXGE KPFKECVKQP FG NGWT   XCNGWTCEVWGNNG0CEJFTWEM$CTEGNQPCFGT#WUICDG2CTKU5OKVXKGNGP#DD*CNDNGKPGP

.

%1..+0$.yCVGNKGTOQP¾VCKTGTQ[CNFG/QPVRGNNKGTGVNCEKTEWNCVKQPOQP¾VCKTGGPNCPIWGFQEFG.QWKU :+++CNCT¾XQNWVKQP  0Ã&#x201E;OGU5FCXQPGKPKIG6HP1TKI$TQUEJWT#



 

0TXQP'ZGORNCTGP

.

'0)'.#5'4474'46TCKV¾FGPWOKUOCVKSWGFWOQ[GPCIG$·PFG0CEJFTWEM$QNQIPC FGT#WUICDG2CTKU.::8++5OKV6GZVCDD$TQUEJKGTV  



899

.

)#4+'. ' .GU OQPPCKGU TQ[CNGU FG (TCPEG UQWU NC TCEG %CTQNKPIKGPPG  6GKNG 5VTCUDQWTI      5  6HP  5  6HP +P FTGK $·PFGP KP *CNDNGFGT IGDWPFGP DGUVQ­GP +P $CPF    YWTFGFCU4GIKUVGTJCPFUEJTKHVNKEJGTI·P\V//#)  



*CPFUEJTKHVNKEJG9KFOWPIKP$CPF

900

.

*1((/#00 * .GU OQPPCKGU TQ[CNGU FG (TCPEG FGRWKU *WIWGU %CRGV LWUSWyC .QWKU :8+ 2CTKU   :856HP2TCEJVXQNNGT)CP\NGFGTDCPFOKVIQNF&GEMGNWPF4Ã&#x2019;EMGPXGT\KGTWPI  75


FRANKREICH, MONACO

901

.

.GUOQPPCKGUTQ[CNGUFG(TCPEGFGRWKU*WIWGU%CRGVLWUSW ¯.QWKU:8+2CTKU:85 6HP)CP\NGFGTKPHTCP\ÌUKUEJGT$KPFWPI&GEMGNRT·IWPIGPGKPG'EMGFGT4ÒEMUGKVGKUVDGUEJ·FKIVWPF 4·PFGTUKPFNGKEJVDGTKGDGP



.#(#74+',.GUOQPPCKGUFGUTQKUFG(TCPEG*WIWGU%CRGVC.QWKU:++2CTKU$CUGN::+ 56HP224+'74.GUOQPPCKGUFGUTQKUFG(TCPEG(TCP¼QKU+GTC*GPTK+82CTKU$CUGN  :8++  5 6HP  $GKFG $ÒEJGT KP *CNDNGFGT IGDWPFGP UGJT IWV GTJCNVGP URQTCFKUEJG   $NGKUVKHVPQVK\GP//#)  



.

/#<#4& , *KUVQKTG OQP¾VCKTG GV PWOKUOCVKSWG EQPVGORQTCKPG   $·PFG 2CTKU$CUGN   55.GKPGP  



.

/14+0 * 0WOKUOCVKSWG H¾QFCNG FW &CWRJKP¾ 2CTKU  8+++  5  6HP *CNDNGFGT OKV   -QRHIQNFUEJPKVVUVQEMHNGEMKI//#)



.

21';& #8#06(/QPPCKGUH¾QFCNGUFG(TCPEG$·PFG0CEJFTWEM)TC\FGT1TKIKPCNCWU ICDG2CTKU:++56HP56HP56HP1TKI)CP\NGK PGP'KPDCPFOKV)GDTCWEJUURWTGP#  



41$'46 2% /QPPCKGU ,GVQPU GV /¾FCKNNGU FGU 'X½SWGU FG /GV\ /¾OQKTG RWDNK¾ GV VGTOKP¾   F CRT½UNGUPQVGUFGN CWVGWTRCT45'4474'0CEJFTWEM.WZGODWTIFGU5&/CEQPCWU #PPWCKTG FG NC 5QEK¾V¾ (TCP¼CKUG FG 0WOKUOCVKSWG5OKV\CJNTGKEJGP#DD-WPUVNGFGT(FG 5#7.%; .GU /QPPCKGU FG NC %KV¾ FG /GV\NGU/QPPCKGUFGU'X½SWGUFG/GV\0CEJFTWEM.WZGO DWTIFGT#WUICDG/GV\\CJNTGKEJGWPRCIKPKGTVG5-NCRRVHP4GEJGTEJGUUWTNGU/QP PCKGUFGU'X½SWGUFG/GV\0CEJFTWEM.WZGODWTIFGT#WUICDG=/GV\?\CJNTGKEJGWPRCIK PKGTVG5-NCRRVHP5WRRN¾OGPVCWZ4GEJGTEJGUUWTNGU/QPPCKGUFGU'X½SWGUFG/GV\0CEJFTWEM .WZGODWTIFGT#WUICDG=/GV\?\CJNTGKEJGWPRCIKPKGTVG56HP+PGKPGO$CPFKP-WPUV NGFGTIGDWPFGP  



41..+0('7#4&'06%CVCNQIWGFGUOQPPCKGUTQ[CNGUGVUGKIPGWTKCNGUFG(TCPEGFGRWKUNGU/¾TQ XKPIKGPULWUSW CPQULQWTU%QPVGPCPVPWO¾TQUCXGENGWTURTKZFGXGPVG2CTKU.QPFQP 52NCPEJGU2CTKU56HP2CRRGKPDCPFOKVCWHIGMNGDVGT6KVGNUGKVG//#)  



5#7.%;(FG*KUVQKTGPWOKUOCVKSWGFGT½IPGFG(TCP¼QKU+GTTQKFG(TCPEG2CTKU85 OKVGKPKIGP#DD*CNDNGFGTHTCP\ÌUKUEJG$KPFWPIJGTXQTTCIGPFG'TJCNVWPI//#)



.

.

.

.

$GUKV\GTUVGORGNXQP(/KIPQV2TCFKGT#WZGTTGWPF5VGORGN0WOKUOCVKSWGHTCPECKUGKO8QTUCV\WPFCWHFGO 6KVGNDNCVV

.

.

64'514 &' 07/+5/#6+37' '6 &' ).;26+37' *KUVQKTG RCT NGU /QPWOGPVU FG .BCTV   /QP¾VCKTG EJG\ NGU /QFGTPGU 2CTKU   5  6HP *CNDNGFGT OKPKOCN DGUVQ­GP 6GKNYGKUG   UVQEMHNGEMKI)CP\IQNFUEJPKVV



9'0&.+0)'%QTRWU0WOOQTWO.QVJCTKPIKCG/QUGNNCPCG6GZVWPF6CHGNDCPF/GV\ 56HP$TQUEJWT#  



#NNG6GZVGUQYQJNKPHTCP\ÌUKUEJGTCNUCWEJKPFGWVUEJGT5RTCEJG

76


HABSBURG, UNGARN, BÖHMEN .

<#;'*KUVQKTGOQP¾VCKTGFGUEQNQPKGUHTCP¼CKUGUFyCRTGUNGUFQEWOGPVUQHHKEKGNU2CTKU5 OKV6GZVCDD*CNDNGFGTGKPDCPF-QRHIQNFUEJPKVV



0WTUGNVGPKPFGT1TKIKPCNCWUICDG\WGTUVGJGP

.

-1081.76 8GTUEJKGFGPG 5EJTKHVGP\WTHTCP\ÌUKUEJGP0WOKUOCVKMFCTWPVGT'$17&'#7%CVC NQIWG)¾P¾TCNKNNWUVT¾/QPPCKGU(TCP¼CKUGU 2TQXKPEKCNGU 0CEJFTWEMXCPFGT&WUUGP/CCUVTKEJV FGT#WHNCIG=2CTKU?Q,8)#7&14;/QPPCKGU(TCP¼CKUGU#WHNCIG/QPVG%CTNQ  , FG /';$ 21+0&'55#7.6 4¾RGTVQKTG FGU /QPPCKGU 0CRQN¾QPKFGU 4¾RGTVQKTG FG NC 0W   OKUOCVKSWG(TCP¼CKUG%QPVGORQTCKPG$TÒUUGN2CTKU$'4056.GUOQPPCKGUHTCP¼CKUGU  $TCWPUEJYGKI   .GU OQPPCKGU HTCP¼CKUGU FGRWKU  $TCWPUEJYGKI  ) 51$+0   ,T6JGUKNXGTETQYPUQH(TCPEG0GY,GCTU[7PVGTUEJKGFNKEJIGDWPFGP  



)4155$4+6#00+'0+4.#0& .

$411-' )% 'PINKUJ %QKPU HTQO VJG 5GXGPVJ %GPVWT[ VQ VJG 2TGUGPV &C[  #WHNCIG .QPFQP   :++56HP.GKPGPOKPKOCNDGUVQ­GPWPFUVQEMHNGEMKI



.

%*#..+5%' *TUI #PGYJKUVQT[QHVJG4Q[CN/KPV%CODTKFIG::+5OKV#DD .GKPGPOKV5EJWV\WOUEJNCI



.

'.+#5'4&6JG#PINQ)CNNKE%QKPU.GU/QPPCKGU#PINQ(TCP¼CKUGU2CTKU.QPFQP+: 5OKVXKGNGP#DD-CTVQPKGTV#



.

(1.-'5/6CDNGUQH'PINKUJ5KNXGTCPF)QNF%QKPU0CEJFTWEM)TC\FGT#WUICDG.QP FQP+8556HP)CP\NGKPGP



.

)#.56'4)5[NNQIGQH%QKPUQHVJG$TKVKUJ+UNGU4Q[CN%QNNGEVKQPQH%QKPUCPF/GFCNU0CVKQPCN /WUGWO%QRGPJCIGP2CTV+#PEKGPV$TKVKUJCPF#PINQ5CZQP%QKPUDGHQTG#GVJGNTGF++.QPFQP  5  6HP 2CTV ++ #PINQ5CZQP %QKPU #GVJGNTGF ++ .QPFQP :8+56HP$GKFG $·PFGKPGKPJGKVNKEJGO)CP\NGKPGPIGDWPFGP  



)47'$'4*#-'#4;%(#%CVCNQIWGQH'PINKUEJ%QKPUKPVJG$TKVKUJ/WUGWO#PINQ5CZQP 5GTKGU$·PFG0&.QPFQPFGT#WUICDG.QPFQP:%+856HP%::8+ 56HP(CNVMCTVG-CTVQPKGTV&C\W#541$'465105[NNQIGQH%QKPUQHVJG$TKVKUJ+UNGU $CPF*WPVGTKCPCPF%QCVU%QNNGEVKQPU7PKXGTUKV[QH)NCUIQY6GKN#PINQ5CZQP%QKPU.QPFQP :8+++5OKV6HP-CTVQPKGTV))#.56'45[NNQIGQH%QKPUQHVJG$TKVKUJ+UNGU4Q[CN %QNNGEVKQP QH %QKPU CPF /GFCNU 0CVKQPCN /WUGWO %QRGPJCIGP 6GKN  #PINQ 5CZQP %QKPU .QPFQP   :+85OKV6HP-CTVQPKGTV  



.

/#;*'9 0, 'FYCTFKCP /QPGVCT[ #HHCKTU   # 5[ORQUKWO JGNF KP 1ZHQTF #WIWUV   $#41ZHQTF51TKI$TQUEJWTOKPKOCNDGUVQ­GP



.

0146*,,24'5610/14.';2,5[NNQIGQHEQKPUQHVJG$TKVKUJ+UNGU6JG,QJP)$TQQ MGTEQNNGEVKQP%QKPUQH%JCTNGU+  .QPFQP.:+:6HP)CP\NGKPGP#



.

5;..1)'1(%1+051(6*'$4+6+5*+5.'5$CPF*5EJPGKFGT%QNNGEVKQP2CTV+'PINKUJ )QNF%QKPUCPFVJGKT+OKVCVKQPU.QPFQP:+++5OKV6HP)CP\NGKPGP



.

9+..+#/510 )% *TUI  6TCFG VQMGPU KUUWGF KP VJG UGXGPVGGPVJ EGPVWT[  $·PFG 0CEJFTWEM   .QPFQPFGT#TDGKV9+..+#/$1;0'5:.+5FCXQPGKPKIGOKV#DDWPFCNU 6HP1TKI)CP\NGKPGP#  



-1081.76 )4155$4+6#00+'0+4.#0& &KXGTUG/QPQITCRJKGP\WTDTKVKUEJGPWPFKTKUEJGP 0WOKUOCVKMFCTWPVGT25'#$;5GCD[yUUVCPFCTFECVCNQIWG%QKPUCPFVQMGPUQH+TGNCPF.QPFQP ,&$#6'510%QKPCIGKP5EQVNCPF.QPFQP*#5'#$;6JG$TKVKUJ+ORGTKCN5KNXGT %QKPCIG QT 6JG 'PINKUJ 5KNXGT %QKPCIG HTQO  .QPFQP  4 .1$'. WC %QKPETCHV U    5VCPFCTF%CVCNQIWGQH'PINKUJ7-%QKPUVQ&CVG.QPFQP,-'06[GCTUQH$TKVKUJ %QKPUCPF/GFCNU.QPFQP)$'44;/GFKGXCN'PINKUJ,GVQPU=.QPFQP?7PVGTUEJKGFNKEJ IGDWPFGP  



.

.

*#$5$74)+5%*''4$.#0&'70)#40$¤*/'0 .

$'4)7(TGKJGTTXQP&KG/ÒP\GPWPF/GFCKNNGP5COONWPI9GKNCPFFGU#TVWT)TCHGPX'P\GP DGTI/ÒP\GPWPF/GFCKNNGPFGTIGHÒTUVGVGP)TCHUEJCHV6KTQNFGTÌUVGTTGKEJKUEJGP8QTNCPFGFGT*QEJ UVKHVG6TKGPVW$TKZGPWPFXGTYCPFVGT)GDKGVG.CPFGUHÒTUVNKEJG2T·IWPIGPCWUFGT<GKVXQP $F++/ÒPEJGP(TQPVKURK\56HP*CNDNGKPGP



.

%#56'.+0-%GUMC&TQDPC/KPEG&QD[2TGFJWUKVUMGC*WUKVUMG2TCI5OKV #DD*CNDNGKPGPOKPKOCNDGUVQ­GP



.

%'4/#--5-4$'-$/KPEG-TCNQXUVXK%GUMGJQ$·PFG8+++555VCOO VCHGN6HP*CNDNGFGTOKPKOCNDGUVQ­GP  



.

%7$#5%**&KG/ÒP\GPWPVGTFGT4GIKGTWPIUGKPGTMCKUWMÌPCRQUVQNKUEJGP/CLGUV·VFGU-CK UGTU(TCP\,QUGRJ+DKU\WT'KPHÒJTWPIFGT-TQPGPY·JTWPI9KGP8+++56HP.GKPGPOKV )GDTCWEJUURWTGP

 77


HABSBURG, UNGARN, BÖHMEN .

.

.

&+'6+-'4 *# $ÌJOGP -CVCNQI FGT *CDUDWTIGT /ÒP\GP  DKU  /ÒPEJGP   5   OKV #DD )CP\NGKPGP  -NGKPG DÌJOKUEJG /ÒP\IGUEJKEJVG <QNNKMGTDGTI Q,  5 OKV #DD $TQ   UEJWT,%',0'-¤UVGTTGKEJKUEJGWPICTKUEJGDÌJOKUEJGWPFUEJNGUKUEJG/ÒP\RT·IWPIGPXQP 9KGPQ,:85$TQUEJWT¤UVGTTGKEJKUEJG/ÒP\RT·IWPIGPXQP9KGP 5$TQUEJWT  



'0<'0$'4)9#)TCHXQP5COONWPI#TVJWT)TCH'P\GPDGTI#WMVKQP)KNJQHGT4CPUEJDWTI 9KGP XQO   0TP  6HP DGKIGUEJTKGDGPG 2TGKUG #WMVKQP # *GUU #) .W\GTP   0TP6HP+PGKPGO$CPFKP*CNDNGKPGPIGDWPFGP a



(+#.#'$GUEJTGKDWPIDÌJOKUEJGT/ÒP\GPWPF/GFCKNNGP$CPF7T\GKV -GNVGP DKU\WT'KPHÒJ TWPIFGT$TCMVGCVGPRT·IWPI2TCI8++56HP*CNDNGKPGPOKVOQPVKGTVGO6KVGNDNCVVFGT $TQUEJWT



/KV8GTHCUUGTYKFOWPICP&T'TDUVGKP

.

%QNNGEVKQP'TPUV2TKP\\W9KPFKUEJ)T·V\+ ++$CPF2TCI556HP+P GKPGO$CPFKP.GKPGPIGDWPFGP$GUVQ­GP



932

.

%GUMG&GPCT[2TCI6GZVDCPFOKV56CHGNDCPFOKV6HP$KDNKQRJKNGRTCEJVXQNNGDTCWPG )CP\NGFGTD·PFGOKVIQNF2T·IGFTWEMCWH&GEMGNWPF4ÒEMGP)CP\IQNFUEJPKVV  



#WUFGT$KDNKQVJGMFGUMÌPKINKEJGP*CWUGU*CPPQXGT

.

.

.

);¤0);¤55; /9+06'4 * /ÒP\GP WPF /GFCKNNGP FGU WPICTKUEJGP /KVVGNCNVGTU    5COONWPIUMCVCNQIGFGUMWPUVJKUVQTKUEJGP/WUGWOU9KGP5OKVGKPKIGP#DD6HPWPF -CTVG-CTVQPKGTV# *#.#%-#+/KPEG<GOÃ-QTWP[%GUM¾$·PFG-TQOGTÃ\55 5DGKIGNGIVG(CNVMCTVGLGYGKNUOKV\CJNTGKEJGP#DD1TKI)CP\NGKPGP#  





*'4+0'- . ¤UVGTTGKEJKUEJG /ÒP\RT·IWPIGP $CPF  WPF  9KGP   5  5 LG   YGKNU OKV \CJNTGKEJGP #DD )CP\NGKPGP DGKFG 8QTUCV\DN·VVGT OKV MNGKPGO #WUUEJPKVV $GKIGNGIV .   *'4+0'-'TI·P\WPIGP\W¤UVGTTGKEJKUEJG/ÒP\RT·IWPIGPXQP9KGP&C\W,5 &#8'02146 6JG 6CNGTU QH VJG #WUVTKCP 0QDNG *QWUGU 6 ';2'.6#7'4 %QTRWU 0WOOQTWO   4GIPK/CTKCG6JGTGUKCG*,70)9+46*%QTRWU0WOOQTWO#WUVTKCEQTWO %0# 8.GQRQNF+ -CTN 8+   ( .';21.& &GT /CTKC6JGTGUKGP6JCNGT  ) 241$5<6 ¤UVGTTGKEJK   UEJG/ÒP\WPF)GNFIGUEJKEJVG8QPFGP#PH·PIGPDKU481).*7$'46CNGTWPF5EJCWVCNGT FGU'T\JCWUGU*CDUDWTI  



.

*1.</#+4'/ÒP\IGUEJKEJVGFGTÌUVGTTGKEJKUEJGP0GWHÒTUVGPOKV$GUEJTGKDWPIKJTGT/ÒP\RT·IWP IGPUGKV.GQRQNF+5&CWU0<  56HP*CNDNGFGTOKV/CTOQTRCRKGTPGWYGTVKI



.

,70)9+46* * %QTRWU 0WOOQTWO #WUVTKCEQTWO %0#  $CPF  .GQRQNF +  -CTN 8+     9KGP8+++56HP)CP\NGKPGP//#)



.

-.'/'5%**&KGXQTFGTÌUVGTTGKEJKUEJG/ÒP\UV·VVG'PUKUJGKO-CUUGN5OKV\WO6GKN HCTDKIGP#DD-CTVQPKGTV



78


HABSBURG, UNGARN, BÖHMEN .

.#,15 * 5\GPV +UVX±P 2¾P\GK $WFCRGUV   5 OKV #DD 1TKI$TQUEJWT DGUVQ­GP 4GEJVG   WPVGTG'EMGCDIGTKUUGPWPFIGMPKEMV



.

)GQTIUOÒP\GP$WFCRGUV5OKV#DD6HP1TKI$TQUEJWTNGKEJVCWUIGDNKEJGP



.

.75%*+0810'$'0)4'76*#(TKGUCEJGT2HGPPKIG$GKVT·IG\WKJTGT/ÒP\IGUEJKEJVGWPF\WT -GPPVPKUKJTGT)GRT·IG5&CWU9KGPGT0WOKUOCVKUEJG<GKVUEJTKHV  5WPF   56HP9GKVGTG6CHGNPDGKIGNGIV.GKPGPDGUVQ­GP4ÒEMGPGKPIGTKUUGP&KG9KGPGT 2HGPPKPIG (WPFXGT\GKEJPKUUG WPF MTKVKUEJG 5VWFKGP 9KGP   5  6HP *CNDNGKPGP DGUVQ­GP   9CUUGTHNGEMCWHFGP6CHGNP  



/#4-. / &KG /ÒP\GP /GFCKNNGP WPF 2T·IWPIGP OKV 0COGP WPF 6KVGN (GTFKPCPF + 6GZVDCPF   0CEJFTWEM $KGNGHGNF  FGT #WUICDG 2TCI  6CHGNDCPF 0CEJFTWEM $KGNGHGNF  FGT #WUICDG   2TCI8+56HP)CP\NGKPGP//#)  



/';'4 # #NDTGEJV XQP 9CNNGPUVGKP 9CNFUVGKP  *GT\QI XQP (TKGFNCPF WPF UGKPG /ÒP\GP 9KGP   (TQPVKURK\56HP*CNDNGFGTDGUVQ­GP//#)



.

.

/KV$GUKV\GTXGTOGTM'WIGP.CPIGT

.

&KG/ÒP\GPFGT(COKNKG'IIGPDGTI9KGP56HP*CNDNGFGTDCPFOKV/CTOQTRCRKGT WPF$NKPFUVGORGNXGT\KGTWPICWHFGP&GEMGNP



.

/+..'4 <7 #+%**1.< 8 ¤UVGTTGKEJKUEJG /ÒP\RT·IWPIGP   #WHNCIG 9KGP    (TQPVKURK\ :::++  5 3WGTHQNKQ *CNDNGKPGP DGUVQ­GP 'TUVG 5GKVG GKPIGTKUUGP $KPFWPI NQEMGT   /CPEJG5GKVGPUKPFIGMPKEMV



&GT6CHGNDCPFYWTFGGTUV\WT\YGKVGP#WHNCIGGTUVGNNV*CPFUEJTKHVNKEJGT$GUKV\GTXGTOGTM'$GEMGPDCWGT

.

/+..'4<7#+%**1.<8.1'*4#*1.</#+4'¤UVGTTGKEJKUEJG/ÒP\RT·IWPIGP   $·PFG  #WHN 9KGP  :.  5  5  6HP *CNDNGKPGP )GNGPMG GVYCU NQEMGT   -CPVGPNGKEJVDGUVQ­GP#  



/15'4*6745-;*&KG/ÒP\UV·VVG*CNNKP6KTQN+PPUDTWEM5OKV VGKNUHCTDKIGP#DD&KG/ÒP\UV·VVG*CNNKP6KTQN+PPUDTWEM5OKV#DD )CP\NGKPGP//#)  



.

/7((#6 -# 7GDGT FCU )GYKEJV WPF FGP )GJCNVFGTQGUVGTTGKEJKUEJGP2HGPPKPIG/ÒPEJGP 5-CTVQPKGTV



.

01*',.18Š24Š618Š'&CU/ÒP\YGUGP#NDTGEJVUXQP9CNNGPUVGKP)TC\56HP )CP\NGKPGP 4XQP .+%*0195-;' XQP /#;'4 &GUHÒTUVNKEJGP*QEJUVKHVGU1NOÒV\/ÒP\GPWPF /GFCKNNGP0CEJFTWEM)TC\FGT#WUICDG9KGP5)CP\NGKPGP#/';'4&KG/ÒP \GP WPF /GFCKNNGP FGT (COKNKG 'IIGPDGTI 0CEJFTWEM 5CCTDTÒEMGP  FGT #WUICDG 9KGP     56HP$TQUEJWT  



241$5<6 ) ¤UVGTTGKEJKUEJG /ÒP\ WPF )GNFIGUEJKEJVG XQP FGP #PH·PIGP DKU  )TC\    )CP\NGKPGP&C\W,%',0'-¤UVGTTGKEJKUEJGWPICTKUEJGDÌJOKUEJGWPFUEJNGUKUEJG/ÒP\RT·IWPIGP X9KGPQ,#X).1$1%0+-)GUEJKEJVNKEJGªDGTUKEJVFGU¤UVGTTGKEJKUEJGP)GNFWPF /ÒP\YGUGPU9KGP2#46*¨4'XU\±OP¾NMÒNKOCI[CTFGP±TQM¾UQDWNWUQM$WFC RGUV)*8'4##6ÌTÌMGNNGPGU*±DQTÐM'ON¾M¾TOGK$WFCRGUV&C\WYGKVGTG5EJTKH VGP7PVGTUEJKGFNKEJIGDWPFGP  



.

&KG/ÒP\GP5CN\DWTIUGTI·P\VG#WHNCIG$CUGN)TC\FGT'TUVCWHNCIGXQP56HP )CP\NGKPGP



.

4+<<1..+ * &KG 6KTQNGT /ÒP\RT·IWPIGP KP /GTCP $Q\GP   5 CWH FGP 5GKVGP  FKG   #DDCNNGTDGUEJTKGDGPGP/ÒP\GP$KDNKQVJGMU5VGORGN-CTVQPKGTV



.

5%*¤08+50'45%CVCNQIWUPWOQTWO*WPICTKCGCE6TCPUKNXCPKCG6GKNG2GUV8+5 55#RRGPFKZ2GUV:8++56HP+P$·PFGPKP*CNDNGKPGPIGDWPFGP 4ÒEMGPVGKNYGKUGNQUG+P$CPFKUVCWHGKPGT5GKVGGKPMNGKPGT'KPTKUU  



.

.

5GJTUGNVGPGU9GTM'ZNKDTKU&T9QNHICPIX9WT\DCEJWPFJCPFUEJTKHVNKEJGT$GUKV\GTXGTOGTM

.

6#00+%* - &KG /ÒP\GP WPF /GFCKNNGP FGT (ÒTUVGP \W 5EJYCT\GPDGTI 5& CWU 5EJYCT\GPDGTIK   UEJGU,CJTDWEJ $WFYGKU 56HPOKV#DD)CP\NGKPGP//#)



#WHNCIGOKV'ZGORNCTGP

.

81).*7$'4 4 6CNGT WPF 5EJCWVCNGT FGU 'T\JCWUGU *CDUDWTI XQP 'T\JGT\QI 5KIKUOWPF X 6KTQN   DKU-CKUGT(TCP\,QUGH+(TCPMHWTVC/56HP)CP\NGKPGP



.

9+'0 - - *#726/ª0<#/6 -CVCNQI FGT /ÒP\GP WPF /GFCKNNGP5VGORGN5COONWPI FGU -   -*CWRVOÒP\COVGUKP9KGP$CPF9KGP8+++ +8 +8 8 5 5 6HP)CP\NGKPGP+O$CPFUKPFFKG6HPWPFFKG$GTKEJVKIWPIGPWPF0CEJVT·IG\WFGPGTUVGP FTGK$·PFGP6CHGNVGKNVGKNYGKUGUVQEMHNGEMKI  

 79


ITALIEN .

.

-CVCNQIFGT/Ã&#x2019;P\GPWPF/GFCKNNGP5VGORGN5COONWPIFGU--*CWRVOÃ&#x2019;P\COVGUKP9KGP$CPF 9KGP8+++ +8 +8 8 5 56HP)CP\NGFGT+O$CPFUKPFFKG $GTKEJVKIWPIGPWPF0CEJVT·IG\WFGPGTUVGPFTGK$·PFGP  



<¤66.*5CN\DWTI/Ã&#x2019;P\GPWPF/GFCKNNGP$CPFWPF5CN\DWTI5 OKVHCTDKIGP6HPWPF#DD-CTVQPKGTV  



5KGIGTFGU#+20$WEJRTGKUGU

+6#.+'0 .

$#.$+&'%#415 *TUI +)QP\CIG/QPGVG#TVG5VQTKC/KNCPQ5OKV\CJNTGK EJGPXKGNHCEJHCTDKIGP#DD1TKI$TQUEJWT//#)



.

$'40#4&+)+NFWQEGPVQC6TKGUVG.GOQPGVG6TKGUVG5OKV\CJNTGKEJGP#DD.GKPGP OKV5EJWV\WOUEJNCI7OUEJNCINGKEJVDGUEJ·FKIV0TXQP'ZGORNCTGP//#)



.

$'401%%*+/.GOQPGVGFGNNC4GRWDDNKEC(KQTGPVKPC 6GKN(NQTGP\:::8+++ 56HP(TQPVKURK\5EC6HP.GKPGPOKV5EJWV\WOUEJNCI  



.

$+)0166+..C<GEECFK/CPVQCFCNNG1TKIKPK EKTEC CNNC%JKWUWTC  G%CUCNG/QPHGT TCVQ 2GT KN 2GTKQFQ FGNNC 5KIPQTKC )QP\CIJGUEC   /CPVQXC   5 OKV \CJNTGKEJGP   #DD)CP\NGKPGPVCFGNNQUGT<WUVCPF#



.

$470'66+ . 1RWU OQPGVCNG%KIQK11:::8++56HP.GKPGPOKPKOCNDGUVQ ­GP6CHGNDN·VVGTVGKNYGKUGNQUG//#)



.

%+(('4+4.C/QPGVC\KQPGFGK6CTÃ&#x201A;F QTQFGINK5XGXKF +VCNKC+P%QNNCPCFK5VWFK0WOKUOCVKEK 84QO5OKVGKPKIGP#DD$NCWGU)CP\NGFGTOKV-QRHIQNFUEJPKVVUQYKGIQNFGPGP&GEMGN XGT\KGTWPIGP4Ã&#x2019;EMGPCWUIGDNKEJGP



%+8+%*'4#%%1.6'07/+5/#6+%*'.C/QPGVC\KQPGFK.WFQXKEQ+N/QTQ.C/QPGVC\KQPG FK%CTNQ8.C/QPGVC\KQPGFK.WFQXKEQ:++(TCPEGUEQ++5HQT\C.C/QPGVC\KQPGFK(KNKRRQ8GFK %CTNQ+++%CTNQ8+.C/QPGVC\KQPG&B'RQEC#WUVTKCECFK/KNCPQ.C/QPGVC\KQPGFGK6TKXWN\KQ+2GUK /QPGVCTKFK/QPGVG/KNCPGUK.C/QPGVC\KQPG)KCRRQPGUG<GEEJG/KPQTKFGNNC.QODCTFKC2CTVG+.C /QPGVC\KQPGFGNNC6QUECPC++.C/QPGVC\KQPGFGNNC6QUECPC.G/QPGVGFGNNC<GEECFK8GPG\KC2CTVG  /KNCPQ  1TKI$TQUEJWT VGKNYGKUG OKPKOCN DGUVQ­GP 'KP $CPF JCV GKPGP -PKEM KP FGT   /KVVG  



%1427507//147/+6#.+%147/$CPF(QTPK0CEJFTWEM$QNQIPCFGT#WU ICDG4QO*CNDNGFGT'&166+6CTKHHCFKOQPGVGOGFKQGXCNKGOQFGTPG+VCNKCPGUGEQPFQ N QTFKPGUGIWKVQFCN%QTRWU0WOOQTWO+VCNKEQTWO$·PFG0&$QNQIPCFGT#WUICDG/KNCPQ +PGKPGO$CPFKP*CNDNGFGTIGDWPFGP6CTKHHCFKOQPGVGOGFKQGXCNKGOQFGTPG+VCNKCPG UGEQPFQ N QTFKPG UGIWKVQ FCN %QTRWU 0WOOQTWO +VCNKEQTWO 8QN   KP (QVQMQRKG 5GKVGP OKV   NGKEJVGTRKPMHCTDGPGT8GTH·TDWPI  



.

)#.'166+#.GOQPGVGFGNITCPFWECVQFK6QUECPC0&$QNQIPCFGT#WUICDG.KXQTPQ 5OKV\CJNTGKEJGP#DD.GKPGP



.

,'5747/#%TQPKUVQTKCFGNNG1UGNNGFK8GPG\KC%QPUKFGTC\KQPKUWNXCNQTGCVVWCNGFGNNG1UGNNG8GPG \KCPGFK)$GTPCTFK#WHNCIG6TKGUV5OKV\CJNTGKEJGP#DD-CTVQPKGTV5EJWV\WOUEJNCI HNGEMKIWPFGKPIGTKUUGP



/70610+(.GOQPGVGFGKRCRKGFGINK5VCVK2QPVKHKEK$·PFG4QO:.8+++  56HP 56HP6HP 56HP 56HP6HP 1TKI-WPUVNGFGT//#)  



.

.

.

&KG)GUCOVCWHNCIGWOHCUUVG'ZGORNCTG

.

.

.

80

1.+8+'4+#/QPGVGGOGFCINKGFGINK5RKPQNCFK6CUUCTQNQ4QPEQ4QEECHQTVG#TSWCVCG8GTICIPK EJGUGTDCPUKPGNNC47PKXGTUKV¯GFKPCNVTGEQNNG\KQPKFK)GPQXC)GPQXC-CTVG+:5 6HP/QPGVGOGFCINKGGUKIKNNKFGKRTKPEKRK&QTKCEJGUGTDCPUKPGNNCDKDNKQVGECFGNNC4GIKC7PKXGT UKV¯GFKPCNVTGEQNNG\KQPKFK)GPQXC)GPQXC8++56HP/QPGVGGUKIKNNKFGKRTKPEKRK %GPVWTKQPK5EQVVK EJG UGTDCPUK PGNNC 4GIKC 7PKXGTUKV¯ GF KP #NVTG %QNNG\KQPK FK )GPQXC )GPQXC    +8  5  6H +P GKPGO $CPF KP *CNDNGKPGP IGDWPFGP /KPKOCN DGUVQ­GP VGKNYGKUG UVQEMHNGEMKI   //#)



2#)#0+ # /QPGVG KVCNKCPG FCNN KPXCUKQPG 0CRQNGQPKEC CK IKQTPK PQUVTK   /KNCPQ    8+++  5 OKV \CJNTGKEJGP #DD .GKPGP  2TQXG G RTQIGVVK FK OQPGVG KVCNKCPG Q DCVVWVG KP +VCNKC   FCNN KPXCUKQPG HTCPEGUG CK IKQTPK PQUVTK   /KNCPQ  8+++  5 OKV \CJNTGKEJGP #DD   1TKI$TQUEJWTDGUVQ­GP&C\WYGKVGTG/QPQITCRJKGPWPF2TGKUDÃ&#x2019;EJGT\WTKVCNKGPKUEJGP0WOKUOC VKM  



2#2#&121.+ 0 .G OQPGVG FK 8GPG\KC  6GZV WPF  6CHGNDCPF (QTPK 0CEJFTWEM $QNQIPC    FGT 1TKIKPCNCWUICDG 8GPGFKI/CKNCPF  :  5  5 (TQPVKURK\  5  6HP   )CP\NGKPGP#  




POLEN, RUSSLAND, BALTIKUM .

4+0#.&+ 1 .G OQPGVG EQPKCVG KP +VCNKC FCNNC 4KXQNW\KQPG (TCPEGUG CK PQUVTK IKQTPK $CPF   Q1   :+++5OKV#DD)CP\NGKPGP



.

41..# / (CUEKQ PWOKUOCVKEQ =? UWNNG OQPGVG +VCNKCPG 6QTKPQ Q,  5 *CNDNGKPGP //#)   



$GUKV\GTUVGORGNFGU#WVQTU

.

.

5+/10'66+./QPGVGKVCNKCPGOGFKQGXCNKGOQFGTPG$CPF%CUC5CXQKC6GKNG(KTGP\G 555LGYGKNUOKV\CJNTGKEJGPVGKNUHCTDKIGP#DD)CP\MWPUVNGFGTKO2CRRUEJW DGT//#)&C\W4$#4<#02TG\\CTKQIGPGTCNGFGNNGOQPGVGFKECUC5CXQKC(KTGP\G 7PFFTGKYGKVGTG2TGKUDÃ&#x2019;EJGT#  



5.'218# 6+ -QNNGMEKLC OCPVWCPUMKEJ OQPGV X 'TOKVC\G .C EQNNG\KQPG FK OQPGVG /CPVQXCPG   FGNNÅ&#x2030;'TOKVCIG/KNCPQ5$TQUEJKGTV



6GZVKP4WUUKUEJWPF+VCNKGPKUEJ

.

6*'/'55. , /Ã&#x2019;P\GP W /Ã&#x2019;P\YGUGP FGU 2CVTKCTEJGPUVCCVGU #SWKNGLC 9KGP   5  6HP   *CNDNGKPGP//#)



21.'04755.#0&$#.6+-7/ .

$4'--'$(#WMVKQP9QTNF9KFG%QKPUQH%CNKHQTPKC5COONWPI$TGMMG6GKN++8 0T   6HP 2GVGT +  'NKUCDGVJ  0T  6HP 2GVGT +++  2CWN +   0T6HP#NGZCPFGT+0KMQNCWU++0TPDTQUEJKGTVG$·PFG LGYGKNUOKV'.  



.

%*#7&1+4$CTQP5FG#RGT¼WUWTNGUOQPPCKGUTWUUGUGVUWTNGUOQPPCKGU¾VTCPI½TGUSWKQPVGW EQWTU GP 4WUUKG FGRWKU NGU VGORU RNWU TGEWN¾U LWUSW  ¯ PQU LQWTU  $·PFG WPF 6CHGNDCPF 5V 2GVGTU   DWTI2CTKU  8++  5 :++  5  5  6CDGNNGP  6HP 'KPJGKVNKEJ UEJYCT\G   *CNDNGKPGPGKPD·PFG GKPG \WU·V\NKEJG #DD OKVGKPIGMNGDV GKPKIG $NGKUVKHVPQVK\GP NGKEJV UVQEMHNGEMKI   6CDGNNGPWPFHGJNGP//#)   

.

#RGT¼W UWT NGU OQPPCKGU TWUUGU GV UWT NGU OQPPCKGU ¾VTCPI½TGU SWK QPV GW EQWTU GP 4WUUKG FGRWKU NGU   VGORURNWUTGEWN¾ULWUSW ¯PQULQWTU6GZVWPF6CHGNDCPF0&)TC\FGT#WUICDG5V2GVGTUDWTI  8++  5 :++  5  5   6HP .GKPGP OKV 5EJWV\WOUEJNCI 7OUEJNCI OKV   )GDTCWEJUURWTGP  



(7%*5#WMVKQPGP5QVJGD[ U .QPFQPU 5COONWPI(WEJU6GKN+2GVGTFGT)TQ­GDKU -CVJCTKPC FKG )TQ­G  6GKN ++ 2CWN + DKU 0KMQNCWU ++  6GKN +++ ,GHKOMK   6GKNHÃ&#x2019;TUVGPVÃ&#x2019;OGT.QVU0QXQFGNU0TP6HPDTQUEJKGTVG-CVCNQIGOKV'.  



.

982

.

)7/195-+/*CPFDWEJFGTRQNPKUEJGP0WOKUOCVKM)TC\(TQPVKURK\:+5OKVGKPK IGP#DD6HP-CTVG)CP\NGKPGP#2KGPKCF\)FCPUMK&CP\KI 5GKPUEJN6HPOKV&CP\KIGT0QVIGNFWPF/Ã&#x2019;P\GP1TKI$TQUEJWT  

 81


POLEN, RUSSLAND, BALTIKUM .

.

-#+/4&KGCNVTWUUKUEJG/ÒP\IGUEJKEJVGWPFFKG2T·IWPIGPXQP$·PFG*CIGP 5OKVXKGNGP#DD5OKVXKGNGP6GZVCDD1TKI)CP\NGKPGP4WUUKUEJG0WOKUOCVKM $TCWPUEJYGKI:+56HP1TKI)CP\NGKPGP4WUUNCPF5GTKG5RG\KCN$CPF#WPF *CIGP'KPJGKVNKEJDTQUEJKGTV#WUIGPQOOGP$CPF#UKPFCNNG'ZGORNCTGFKGUGT $ÒEJGTUVCTMGP#WHNCIGXQO#WVQTJCPFUKIPKGTVWPFOKVFGTLGYGKNKIGP'ZGORNCTPWOOGTXGTUGJGP  



/+*#+.'5%7$œ4.+$#8 *TUI 6JGITGCVOGFKGXCNEQKPJQCTFQH+CUK*KUVQTKECNUKIPKHKECPEGQH VJGITGCVOGFKGXCNEQKPJQCTFQH+CUK+PUVKVWVGQH#TEJCGQNQI[QH+CUK+CUK56HP -WPUVNGKPGP



/KVJCPFUEJTKHVNKEJGT9KFOWPI

.

5#%*55'0&#*.,5KGIGNWPF/ÒP\GPFGTYGNVNKEJGPWPFIGKUVNKEJGP)GDKGVKIGTÒDGT.KX'UVWPF %WTNCPFDKU\WO,CJTGPGDUV5KGIGNPGKPJGKOKUEJGT)GUEJNGEJVGT'UVWPF.KXN·PFKUEJG$TKGHNCFG  4GXCN  :::++  5 QJPG 6HP *CNDNGFGT UVCTM DGUVQ­GP 9CUUGTUEJCFGP CWH FGP NGV\VGP   5GKVGP$KPFWPIGVYCUNQEMGT



.

5#,#75-#55-#7$4;5&.KGVÏXQU&KF\KQUKQU-WPKICKMUV[UVGU0WOK\OCVKMC8KNPKWU 5OKV#DD$TQUEJKGTV&C\WYGKVGTG/QPQITCRJKGP  



.

52#55-; +) 6CNGTK X TWUUMQO FGPGIJOGO GDTCUJGPKK  UXQFPKL MCVCNQI GHKOMQX .GPKP   ITCF56HP)CP\NGKPGP&C\W4-#+/4WUUKUEJG/ÒP\UV·VVGP/ÒP\\GKEJGP/ÒP\ OGKUVGT\GKEJGP4WUUKUEJG0WOKUOCVKM'KP*CPFDWEJWPF6[RGPMCVCNQIXQP2GVGTFGO)TQ­GPDKU \WT)GIGPYCTV*/5'8'4+06JG5KNXGT%QKPCIGQH+ORGTKCN4WUUKC)QNFCPF2NCVK PWOEQKPCIGQH+ORGTKCN4WUUKCHTQO  



.

6JG 4WUUKCP /QPGVCT[ 5[UVGO#*KUVQTKEQ0WOKUOCVKE5WTXG[ªDGTCTDGKVGVGWPFGTYGKVGTVG#WHNCIG #OUVGTFCO5OKV\CJNTGKEJGP#DD.GKPGP



.

-1081.76 21.'0  -NGKPGU -QPXQNWV XQP /QPQITCRJKGP \WT RQNPKUEJGP 0WOKUOCVKM WPF /G   FCKNNGPMWPUV FCTWPVGT % -#/+ 05-N +NWUVTQYCP[ -CVCNQI /QPGV 2QNUMKEJ  9CTU\CYC    , &76-195-+ 2TGKUG RQNPKUEJGT )QNFOÒP\GP WPF )QNFOÒP\GP CWU OKV 2QNGP XGTDWPFGPGP   )GDKGVGP CWH #WMVKQPGP  )FCPUM  2 /4#55, 5#-9'4&# ,WVVC1UVGP5MWNRVWT /GFCKNNGP)TCRJKM9TQENCY4CVKPIGP*ÌUGN7PVGTUEJKGFNKEJIGDWPFGP  



-1081.76 4755.#0&  /QPQITCRJKGP \WT TWUUKUEJGP 0WOKUOCVKM WPF /GFCKNNGPMWPFG WC   887<&'0+-184WUUKCP%QKPU/QUMCW,+8'45'0/GFCKNNGPCWHFKG6JCVGP 2GVGT FGU )TQUUGP .QPFQP Q, 0CEJFTWEM  8+ 2'6418 %CVCNQIWG FGU /QPPCKGU 4WUUGU )TC\    0CEJFTWEM  4 -#+/ 4WUUKUEJG /ÒP\UV·VVGP /ÒP\\GKEJGP /ÒP\OGKUVGT\GKEJGP $TCWP   UEJYGKI  */ 5'8'4+0 )QNF CPF 2NCVKPWO %QKPCIG QH +ORGTKCN 4WUUKC HTQO  VQ    0GY;QTM7PVGTUEJKGFNKEJIGDWPFGP  



.

21467)#.52#0+'0 .

$#&+#+6144'5#%CV¯NGIFGNU%TQCVUFG$CTEGNQPC$CTEGNQPC56HP .GKPGP0TXQP'ZGORNCTGP//#)



.

$74<+1 *( &KEEKQPCTKQ FG NC OQPGFC *KURCPQCOGTKECPC  $·PFG 5CPVKCIQ FG %JKNG    :+:556HP1TKI$TQUEJWTUVCTMDGUVQ­GP7PCWHIGUEJPKVVGP//#)  



.

'-.70&1201'52*CEKGPFC6QMGPUQH/GZKEQ00/0GY;QTM56HP 1TKI$TQUEJWT#



.

*'+55 # &GUETKREKQP IGPGTCN FG NCU OQPGFCU *KURCPQ%TKUVKCPCU FGUFG NC KPXCUKQP FG NQU #TCDGU   6CHGNDCPF/CFTKF56HP*CNDNGFGT6CHGNPUCWDGTCWH(CN\GPOQPVKGTVGKPKIG6CHGNTÒEM UGKVGPOKV$NGKUVKHVPQVK\GPXGTUGJGPGVYCUUVQEMHNGEMKI#



#NU1TKIKPCNCWUICDG·W­GTUVUGNVGP

.

&GUETKREKQPIGPGTCNFGNCUOQPGFCU*KURCPQ%TKUVKCPCUFGUFGNCKPXCUKQPFGNQU#TCDGU$·PFG0CEJ FTWEM5CTCIQUUCFGT#WUICDG/CFTKF56HP56HP5 6HP*CNDMWPUVNGKPGP+P$CPFYWTFGP5GKVGPTGRCTKGTV  



*CPFUEJTKHVNKEJGT$GUKV\GTXGTOGTM'$GEMGPDCWGT

.

.

82

0'5/+6*4+6JG%QKPCIGQHVJG(KTUV/KPVQHVJG#OGTKECUCV/GZKEQ%KV[00/ 0GY ;QTM   5 OKV XKGNGP #DD  PWOOGTKGTVG WPF GKPKIG WPPWOOGTKGTVG 6HP 1TKI$TQ   UEJWT



-1081.76 -QPXQNWV XQP /QPQITCRJKGP WPF #WHU·V\GP XQP , ;4+#6' &' 1.+8#. .12'<   %*#8'<5#0%*'<%CVCNQIQFGNQUTGCNGUFGCQEJQ'URCÇQNGU/CFTKF..12'<%*#8'< 5#0%*'<,;4+#6';1.+8#%CVCNQIQFGNFQDNQPFGCFQUGUEWFQU/CFTKF,2'..+%'4 + $4¨ 'N /GFKQ &WTQ 'URCÇC 2TQXKPEKCU FG #O¾TKEC G +ORGTKQ $CTEGNQPC   ( WPF :   %#.+%1, 64+)1 /QPGFCU GURCÇQNCU FGUFG (GNKRG +++ C +UCDGN ++ #ÇQU  C   #WHNCIG   $CTEGNQPC  ,4 %#;10% %#56#0 /QPGFCU GURCÇQNCU FGUFG NQU 8KUKIQFQU JCUVC GN SWKPVQ   EGPVGPCTKQFGNFGUEWODTKOKGPVQFG#OGTKEC/CFTKF&C\WYGKVGTGMNGKPG5EJTKHVGP1TKI$TQ UEJWT Z .GKPGP Z -CTVQPKGTV Z -WPUVNGFGT Z   




SKANDINAVIEN 5%*9'+<.+'%*6'056'+0 .

&'..# %#5# / .C OQPGVC\KQPG ECPVQPCNG 6KEKPGUG  5EJYGK\GTKUEJG /ÒP\MCVCNQIG    .WICPQ/W\\CPQ5OKV\CJNTGKEJGPVGKNUHCTDKIGP#DD.GKPGPOKV5EJWV\WOUEJNCI//#) 



&'/1.''9#84'9*KUVQKTGOQP¾VCKTGFG0GWEJ³VGN2WDNKECVKQPUFGNC5QEK¾V¾F *KUVQKTGGV F #TEJ¾QNQIKG FW %CPVQP FG 0GWEJCVGN 0GWG (QNIG  0GWEJCVGN  (TQPVKURK\  5  6HP   1TKI$TQUEJWTDGUVQ­GP//#)



. *'05'.'4 # 'UUCK UWT NGU OQPPCKGU F QT GV F CTIGPV FG (TKDQWTI (TKDQWTI   5  6HP   )CP\NGKPGPOKPKOCNUVQEMHNGEMKI5UKPFNQUG-NGKPGT'KPTKUUCWHFGO6KVGNDNCVV//#)



.

'KPGUXQP'ZGORNCTGP/KV5KIPCVWTFGU8GTHCUUGTU

. *ª4.+/#00 * <ÒTEJGT /ÒP\IGUEJKEJVG <ÒTKEJ   5 FCXQP \CJNTGKEJG 6HP .GKPGP   //#)



. /+5510) # &KG /ÒP\GP FGU (ÒTUVGPJCWUGU .KGEJVGPUVGKP 0CEJFTWEM 8CFW\  FGT #WUICDG   9KGP:.8++56HP*CNDNGFGT



. 61$.'4'<·EJ$0755$#7/5&KG/ÒP\RT·IWPIFGT5VCFV5V)CNNGP5EJYGK\GT 5VWFKGP \WT 0WOKUOCVKM $CPF  5V)CNNGP   5 OKV \CJNTGKEJGP #DD .GKPGP OKV 5EJWV\WO   UEJNCI



. 9+'.#0&6 ( 5EJCHHJCWUGT /ÒP\ WPF )GNFIGUEJKEJVG 5EJCHHJCWUGP Q, =?  5  6HP   *CNDNGKPGP//#)



. 5EJCHHJCWUGT/ÒP\WPF)GNFIGUEJKEJVG5EJCHHJCWUGPQ,=?56HP*CNDNGKPGP//#) 



/KV9KFOWPIFGU8GTHCUUGTU

. /ÒP\WPF)GNFIGUEJKEJVGFGU5VCPFGU5EJY[\5EJY[\1JPG(TQPVKURK\56HP*CND MWPUVNGFGT//#)



. /ÒP\ WPF )GNFIGUEJKEJVG FGU 5VCPFGU <WI <WI  (CTDKIGU (TQPVKURK\  5  /ÒP\VHP WPF   \CJNTGKEJG$KNFGTVHP*CNDNGKPGP//#)



. /ÒP\WPF)GNFIGUEJKEJVGFGU5VCPFGU.W\GTP.W\GTP(TQPVKURK\56HP*CNDNGKPGP



. 9+06'456'+0 % )QNFIWNFGP XQP $CUGN $CUGN   5 OKV \CJNTGKEJGP VGKNU HCTDKIGP #DD   )CP\NGKPGPOKV5EJWV\WOUEJNCI#



. &KG -NKRRGP FGT 5EJYGK\ 'KP PWOKUOCVKUEJGU 5RG\KCNIGDKGV $CUGN5OKV\CJNTGKEJGP#DD -CTVQPKGTV



. -1081.76 -QPXQNWV XQP /QPQITCRJKGP WPF #WHU·V\GP WC XQP 4 810 #4: &KG /ÒP\IG   UEJKEJVGFGU.CPFGU)NCTWU*KNVGTHKPIGP'$%#*0&GT/ÒP\HWPFXQP/QQUUGGFQTH 5&CWU FGO,CJTDWEJFGU$GTPKUEJGP*KUVQTKEJGP/WUGWOU %.1*0'4&KG/ÒP\GPFGT4GRW DNKM$GTP<ÒTKEJQ, 0CEJFTWEM 5EJYGK\GT/ÒP\MCVCNQIGWPF#)'+);*CNFGPUVGKPWPF 5EJCWGPUVGKP4GKEJGPCWKPFKJTG/ÒP\RT·IWPI$CUGN 5&CWU5048+++ 7PVGTUEJKGFNKEJIGDWP FGP*4+66/#005EJYGK\GT/ÒP\GPWPF$CPMPQVGP  



$GUKV\GTUVGORGN)KVVC-CUVPGTWPFJCPFUEJTKHVNKEJGT$GUKV\GTXGTOGTM'$GEMGPDCWGT

5-#0&+0#8+'0 . )4#; ,%( 6TCPSWGDCT # )WKFG VQ VJG%QKPUQH&CPKUJ+PFKCEKTECVQ/CUUCEJWUGVVU 5OKVXKGNGP#DD.GKPGPOKV5EJWV\WOUEJNCI



. *#7$'4)2/[PVHQTJQNFQI7VO[PVPKPIGTK&CPOCTMKPFVKN&-IN&CPUMG8KFGPUM5GNUM 5MT  4ºMMG JKUVQTKUM QI HKNQUQHKUM #HF 8 -QRGPJCIGP   5  6HP *CNDNGFGT OKV    $ÒPFGP )CP\TQVUEJPKVV YGPKIG 6HP OKPKOCN UVQEMHNGEMKI CPUQPUVGP VCFGNNQU =/KV $GUKV\GTGVKMGVV WPF   6TQEMGPUVGORGNKO8QTUCV\?//#)#VNCUQXGT&CPOCTMU/ÎPVGTEC-QRGPJCIGP 6HP1TKI$TQUEJWT4ÒEMGPNGKEJVDGUEJ·FKIV$NGKUVKHVPQVK\CWHFGO6KVGN  



. *'&'*&CPOCTMUQI0QTIGU/ÎPVGT-QRGPJCIGP:+85.GKPGP



. 5NI *GFG  6GKN  #WMVKQPGP $ 4CUOWUUGP -QRGPJCIGP $ #JNUVTÌO 5VQEMJQNO    $TQUEJKGTV  



. /#./'4 $ 1NQH 5MÌVMQPWPIU O[PV QEJ CPFTC 'VJGNTGFKOKVCVKQPGT #PVKMXCTKUMV CTMKX  .WPF   56HP1TKI$TQUEJWTOKV5EJWV\WOUEJNCIOKPKOCNDGUVQ­GP7PCWHIGUEJPKVVGP



. &GPUGPOGFGNVKFCRGPPKPIGPK5XGTKIG.CVGOGFKGXCNRGPPKGUKP5YGFGP-WPINKIC8KVVGTJGVU*KUVQTKG QEJ#PVKMXKVGVU#MCFGOKGPU*CPFNKPICT#PVKMXCTKUMC5GTKGP5VQEMJQNO:8+++5FCXQP 6HP1TKI$TQUEJWTWPCWHIGUEJPKVVGP//#)

 83


ORIENT, ISLAM, ÜBERSEE . /#./'4$WC *TUI %QTRWU0WOOQTWO5CGEWNQTWO+::+SWKKP5WGEKCTGRGTVKUWPV%CVCNQ IWGQH%QKPUHTQOVJG8KMKPI#IGHQWPFKP5YGFGP$CPF)QVNCPF6GKN #MGD·EM#VNKPIDQ .WPF ::8+++56HP1TKI$TQUEJWTOKV5EJWV\WOUEJNCI&C\W9*G­$GOGTMWPIGP\WO KPPGTFGWVUEJGP)GNFWONCWHKOWPF,CJTJWPFGTV5&CWU5KIVWPC2CRGTU5 -CTVGP)GMNCOOGTV+PFGT/KVVGIGMPKEMV  



. /'0<+05-; * 'P 5VWFKG CX -CTN +:U /[PVJKUVQTKC $CPF  -CRKVGN    -KXKM   5OKV\CJNTGKEJGP#DD5OKV#DD5OKV#DD-CTVQPKGTV&GEMGNXQP$CPF NGKEJVDGUEJOWV\V



. 4#5/75510 0..#)'438+56.1%QOOGPVCVKQPGUFGPWOOKUUCGEWNQTWO+::+KP5WGEKC TGRGTVKU-WPINKIC8KVVGTJGVU*KUVQTKGQEJ#PVKMXKVGVU#MCFGOKGPU*CPFNKPICT#PVKMXCTKUMC5GTKGP  $·PFG 5VQEMJQNO WC  8+++  5  6HP  56HP1TKI$TQUEJWTDGUVQ­GP //#)  



14+'06+5.#/ª$'45'' . #.4#/ /);5'.'0 4 5[NNQIG 0WOOQTWO 5CUCPKFCTWO 2CTKU  $GTNKP  9KGP $CPF  #T   FCUJKT+5JCRWT+¤#&9&GPMUEJTKHVGPRJKNJKUV-N9KGP5FCXQP6HP-CT VQPKGTV



. #467-+&GPK\DCEKFGHKPGUK6ÒTM6CTKJ-WTWOW;C[KPNCTKPFCP#PMCTC:+85 6HP1TKI$TQUEJWTOKPKOCNDGUVQ­GP//#)



. -CPWPÄ5WNVCP5ÒNG[OCPCFKPCDCUKNCPUKMMGNGT6ÒTM6CTKJ-WTWOW;C[KPNCTKPFCP#PMCTC :8+56HP1TKI$TQUEJWTOKPKOCNDGUVQ­GP//#)



. #467-+WPF%+UVCPDWNCTMGQNQLKOÒ\GNGTKVGUXJKTFGMKKUN³OÄUKMMGNGTMCVCNQIW$·PFG+UVCPDWN  .8+  5  6HP +8 8++  5 6HP  1TKI$TQUEJWT 7OUEJNCI DG   UEJOWV\VWPFDGUVQ­GP//#)  



. $#.1)26JG%QKPCIGQHVJG#[[CPF#DKFU4055RGEKCN2WDNKECVKQP.QPFQP:+++ 56HP-WPUVNGFGT//#)



. $'&17-+#02<%QKPCIGQH%KNKEKCP#TOGPKC00/0GY;QTM:::+56HP .GKPGP//#)



. %#56+).+10+%1&GNNyWUQEWKGTCPQFGUVKPCVKKXGVTKEQP'RKITCHK%WHKEJGGFGNNCQTKIKPGGUVGP UKQPGGFWTCVCFKGUUQ/KNCPQ56HP-WPUVJCNDNGKPGPOKPKOCNDGUVQ­GP5VQEMHNGEMKIWPF GKPKIG#PUVTGKEJWPIGPKO6GZV



. %11.'#$%QKPUKP%JKPCyUJKUVQT[6KGPVUKP8+5OKV#DD3WGTHQTOCV1TKI)CP\ NGKPGP



. '&*'/ * /WU¾GU +OR¾TKCWZ 1VVQOCPU %CVCNQIWG FGU /QPPCKGU /WUWNOCPGU 6GKN  /QPPCKGU   1VVQOCPGU$CPF5WNVCP1UOCP+5WNVCP/QWTCF+++%QPUVCPVKPQRNG56HP/QFGT PGU)CP\NGKPGP//#)



. (#4#*$#-*5* * +TCPKCP *COOGTGF %QKPCIG  #&  #* 9GUV $GTNKP    5OKV\CJNTGKEJGP#DD1TKI$TQUEJWTOKPOCNDGUVQ­GP#WHFGTGTUVGP5GKVGKUVGKPMNGKPGT'KP TKUU//#)



. )*#.+$ '&*'/ + 6CSWKOK /WUMWMCHK 5CNLWSK[C =/ÒP\GP FGT 4WO5GNFUEJWMGP? -QPUVCPVKPQRGN    #*    5  6HP 5EJÌPGT*CNDNGFGTDCPFOKV/CTOQTRCRKGTWPF)QNFRT·IWPICWHFGO &GEMGN5'.%7-.75+--'.'4+//#)



. /WU¾G+OR¾TKCN1VVQOCP5GEVKQPFGU/QPPCKGU/WUWNOCPGU%CVCNQIWGFGUOQPPCKGUVWTEQOCPGU$GPK 1TVQM $GPK<GPIWK(TQW #VCDGS[¾JGV/GNKMU'[QWDKVGUFG/GK[CHCTKMKP(QTPK0CEJFTWEM$QNQIPC Q, 'ZGORNCTG FGT#WUICDG%QPUVCPVKPQRNG:8++56HP-CTVQPKGTV



. )¤$. 4 5CUCPKFKUEJG 0WOKUOCVKM *CPFDÒEJGT FGT /KVVGNCUKCVKUEJGP 0WOKUOCVKM $CPF  $TCWP   UEJYGKI8++5(CNVMCTVG6CDGNNGP6HP)CP\NGKPGP



. )¤$. 4 WC 0WOKUOCVKSWG 5WUKGPPG /QPPCKGU VTQWX¾GU C 5WUG FG  C  /¾OQKTGU FG NC   OKUUKQPCTEJ¾QNQIKSWGGP+TCP2CTKU56HP*CNDNGKPGP//#)



. *##5 , 5KCOGUG %QKPCIG 5JCPIJCK   5 OKV #DD )GJGHVGV OKV *CNDNGKPGPOCRRG 4ÒEMGP   UVCTMCWUIGDNKEJGP



. *'+&'/#0050'$'50 *TUI 5[NNQIGFGT/ÒP\GPFGU-CWMCUWUWPF1UVGWTQRCUKO1TKGPVC NKUEJGP/ÒP\MCDKPGVV,GPC$GCTDGKVGVXQP6QDKCU/C[GT/KV$GKVT·IGPXQP5VGHCP*GKFGOCPPWPF)GTV 4KURNKPI9KGUDCFGP::++5OKV6HP$TQUEJKGTV



. .#0'211.' 5 %CVCNQIWG QH VJG %QNNGEVKQP QH 1TKGPVCN %QKPU (CUEKEWNWU + %QKPU QH VJG #OCYK   -JCNKHGJU*GTVHQTF8+++56HP-CTVQPKGTV



W­GTUVUGNVGP6GZVKPCTCDKUEJGT5RTCEJG

6GZVKPCTCDKUEJGT5EJTKHV

*CPFUEJTKHVNKEJGT$GUKV\GTXGTOGTM'$GEMGPDCWGT

/KVJCPFUEJTKHVNKEJGP$GUKV\GTXGTOGTM'$GEMGPDCWGT

84


ORIENT, ISLAM, ÜBERSEE . .#0'211.' 5211.' 45 %CVCNQIWG QH 1TKGPVCN %QKPU KP VJG $TKVKUJ /WUGWO  $·PFG   0CEJFTWEM$QNQIPCFGT#WUICDG.QPFQP/GJTCNU56HP.GKPGP//#)   



. /#0&'.',%CUV%QKPCIGQH-QTGC9KUEQPUKP5OKV\CJNTGKEJGP#DD-CTVQPKGTVOKV 5EJWV\WOUEJNCI



. /+6%*+0'4 / 1TKGPVCN %QKPU CPF VJGKT 8CNWGU 6JG 9QTNF QH +UNCO .QPFQP   5 OKV   \CJNTGKEJGP#DD)CP\NGKPGP



. 1TKGPVCN%QKPUCPF6JGKT8CNWGU6JG#PEKGPV%NCUUKECN9QTNU$%#&.QPFQP  5 OKV \CJNTGKEJGP #DD )CP\NGKPGP 'Z NKDTKU KO 8QTUCV\  1TKGPVCN %QKPU CPF 6JGKT 8CNWGU   0QP+UNCOKE 5VCVGU  9GUVGTP %QNQPKGU #&  .QPFQP   5 OKV \CJNTGKEJGP #DD   )CP\NGKPGP  



. /1%*+4+/+'VWFGUFGPWOKUOCVKSWG+TCPKGPPGUQWUNGU5CUUCPKFGU$CPF6GJGTCP5 OKV\CJNTGKEJGP#DD)CP\NGKPGP



. /155/#002./QPG[QHVJG#OGTKECP%QNQPKGUCPF%QPHGFGTCVKQP0WOKUOCVKE5VWFKGU0GY ;QTM5OKV#DD)CP\NGKPGP



. 0'9/#0 '2$4'55'66 -' 6JG HCPVCUVKE  &QNNCT 9KUEQPUKP   5 OKV #DD   -WPUVNGFGT



/KVJCPFUEJTKHVNKEJGT9KFOWPI

. 0+%1. 0& # EQTRWU QH (CVKOKF EQKPU 6TKGUV  :.8+  5   6HP -CTVQPKGTV   #



. 0ª6<'. * /ÒP\GP FGT 4CUWNKFGP PGDUV GKPGO #DTKUUFGT)GUEJKEJVGFKGUGTLGOGPKUEJGP&[PCUVKG +PCWIWTCN&KUUGTVCVKQP \WT 'TNCPIWPI FGT RJKNQUQRJKUEJGP&QEVQTYÒTFGCPFGT7PKXGTUKV·V,GPC$GTNKP 5OKV#DD-CTVQPKGTV//#)



5GJTUGNVGP/KVJCPFUEJTKHVNKEJGP$GUKV\GTXGTOGTM'$GEMGPDCWGT

. -ÌPKINKEJG /WUGGP \W $GTNKP -CVCNQI FGT QTKGPVCNKUEJGP /ÒP\GP  $·PFG /CPWUMTKRVFTWEM $GTNKP   :8+++56HP:+++56HP-CTVQPKGTV//#)    +PVCFGNNQUGT'TJCNVWPIWPFUGJTUGNVGP/KVJCPFUEJTKHVNKEJGP$GUKV\GTXGTOGTM'$GEMGPDCWGTWPF$GUKV\GTUVGORGN &T(:9GK\KPIGT%Q

. 2#47%- (&, 5CUCPKCP %QKPU 0GY &GNJK  ::  5  6HP WPF YGKVGTG  6HP FGT   $CTVJQNQOCGK%QNNGEVKQP $GUEJTGKDWPICWHFGP5GKVGP *CNDNGKPGP



. 211.'45%CVCNQIWGQH+PFKCP%QKPUKPVJG$TKVKUJ/WUGWO6JG/QIJWN'ORGTQTU.QPFQP %.++  5  6HP  (CNVMCTVG 1TKI)CP\NGKPGP 'KPDCPF DGUVQ­GP VGKNYGKUG WPCWHIGUEJPKVVGP   8QTUCV\DNCVVGVYCUGKPIGTKUUGP



&KG1TKIKPCNCWUICDGKUVUGNVGP/KVJCPFUEJTKHVNKEJGP$GUKV\GTXGTOGTM

. 37+))+0#*#5WTXG[QH2TKOKVKXG/QPG[6JG$GIKPPKPIUQH%WTTGPE[0&0GY;QTMFGT #WUICDG.QPFQP(TQPVKURK\::++56HP(CNVMCTVGP.GKPGP//#)



. 4#;/10&96JGIQNFEQKPUQH0QTVJCPF5QWVJ#OGTKEC0GY;QTM6JGUKNXGTFQNNCTUQH 0QTVJCPF5QWVJ#OGTKEC#WHNCIG9KUEQPUKP%1(('',/#VYQQFyUECVCNQIWGQH7PKVGF 5VCVGUCPF%CPCFKCP6TCPURQTVCVKQP6QMGPU#WHNCIG/CUUCEJWUGVVU&C\WMNGKPGTG5EJTKHVGP \WTCOGTKMCPKUEJGP0WOKUOCVKM  



. 415'1%JKPGUKUEJG/ÒP\GP9GTFGICPIFGUEJKPGUKUEJGP/ÒP\YGUGPUXQORTKOKVKXUVGP7TURTWPI DKU\WT)GIGPYCTV6UKPIVCW5OKV#DD+PPGWGTGT<GKVHCFGPIGJGHVGVWPVGT8GTYGPFWPI FGU1TKIKPCN'KPDCPFGUPCEJIGDWPFGP$GUKV\GTUVGORGNCWH6KVGNUGKVG



. 5%*+0&'. 0 5[NNQIG 0WOOQTWO 5CUCPKFCTWO 2CTKU  $GTNKP  9KGP $CPF  5JCRWT ++    -CYCNF+4GIKGTWPI¤#&9&GPMUEJTKHVGPRJKNJKUV-N9KGP5OKV#DD5 FCXQP6HP-CTVQPKGTV  



. 5%166-%QWPVGTHGKVKPIKP%QNQPKCN%QPPGEVKEWV00/0GY;QTM+:56HP '2 0'9/#0 6JG 5GETGV QH VJG )QQF 5COCTKVCP 5JKNNKPI 5WRRNGOGPVGF YKVJ 0QVGU QP 1VJGT )G   PWKPGCPF%QWPVGTHGKV/CUUCEJWUGVVU5KNXGT%QKPU00/0GY;QTM:+56HP1TKI $TQUEJWT  



. 8#.'06+0' 9* /QFGTP %QRRGT %QKPU QH VJG /WJCOOGFCP 5VCVGU QH 6WTMG[ 2GTUKC 'I[RV   #HIJCPKUVCP /QTQEEQ 6TKRQNK 6WPKU GVE /CPWUMTKRVFTWEM .QPFQP  (CTDMCTVG  5 FCXQP   \CJNTGKEJG6HP)CP\NGKPGP



. 9#.-'4,#%CVCNQIWGQHVJG/WJCOOCFCP%QKPUKPVJG$TKVKUJ/WUGWO=6GKN?#%CVCNQIWGQH VJG #TCD5CUUCPKCP %QKPU 7OCK[CF )QXGTPQTU KP VJG 'CUV #TCD'RJVCNKVGU #DDCUKF )QXGTPQTU KP   6CDCTKUVCP CPF $WMJCTC  0CEJFTWEM 1ZHQTF  FGT #WUICDG .QPFQP  %.:+  5  6HP   .GKPGPOKV5EJWV\WOUEJNCI7OUEJNCIKUVUVCTMDGUVQ­GP//#)

 85


MEDAILLEN, PLAKETTEN . 9#.5*'*8'4/#626JG%QKPCIGQH0GRCN&GNJK8CTCPCUK::++56HP.GK PGP &C\W - )#$4+5%* )GNF CWU 6KDGV 5COONWPI &T -CTN )CDTKUEJ  5 FCXQP  6HP   1TKI$TQUEJWT  



. 9#0);ª%* ª#0'CTN[%JKPGUG%QKPCIG00/0GY;QTM8+++5OKV-CTVGP  6HP *CNDNGKPGP //#)  &C\W  YGKVGTG /QPQITCRJKGP WPF MNGKPG *GHVG \WT EJKPGUKUEJGP   0WOKUOCVKM  



. 9';.#&KG,WNGU(QPTQDGTV UEJG5COONWPIÒDGTUGGKUEJGT/ÒP\GPWPF/GFCKNNGP'KP$GKVTCI\WT /ÒP\IGUEJKEJVGCWUUGTGWTQR·KUEJGT.·PFGT#OGTKMC6GKNG$GTNKPQ,=?8+5OKV 0TP5OKV0TP5OKV0TPLGYGKNUOKV\CJNTGKEJGP #DD'.DGK6GKNWPFOKVGKPIGDWPFGP*CNDNGKPGP2CRKGTYKGÒDNKEJGVYCUIGDT·WPVGKPKIG5GKVGP TGUVCWTKGTV 5  HGJNGP =/KV JCPFUEJTKHVNKEJGP $GUKV\GTXGTOGTM?  8GT\GKEJPKUU XQP /ÒP\GP   WPF&GPMOÒP\GPFGT'TFVJGKNG#WUVTCNKGP#UKGP#HTKMCWPFXGTUEJKGFGPGTOQJCOOGFCPKUEJGT&[PC UVKGPFGT,WNGU(QPTQDGTV UEJGP5COONWPIYGNEJGCO,CPWCTJKGTUGNDUVWPVGTOGKPGT.GKVWPI \WT ÌHHGPVNKEJGP 8GTUVGKIGTWPI IGNCPIGP $GTNKP  +8  5 OKV  0TP  6HP *CNDNGKPGP   DGKIGUEJTKGDGPG2TGKUG=/KVJCPFUEJTKHVNKEJGP$GUKV\GTXGTOGTMGPWC'$GEMGPDCWGT?//#)

 



. <#/$#74'XQP&KG/ÒP\RT·IWPIGPFGU+UNCOU<GKVNKEJWPFÌTVNKEJIGQTFPGV$CPF&GT9G UVGP WPF 1UVGP DKU \WO +PFWU OKV U[PQRVKUEJGP 6CDGNNGP =OGJT PKEJV GTUEJKGPGP? 9KGUDCFGP    (TQPVKURK\5-NCRRVCDGNNGP.GKPGP//#)



/'&#+..'02.#-'66'0 . #.8#4'<15514+1(%CV±NQIQFGNCUOGFCNNCUFGNQUUKINQU:8[:8+/CFTKF:+++ 5OKV\CJNTGKEJGP6HP1TKI$TQUEJWTDGUVQ­GP



. #0&4'95##WUVTCNCUKCPVQMGPUEQKPU0CEJFTWEM5[FPG[FGT#WUICDG5[FPG[ 56HP1TKI)CP\NGKPGP4ÒEMGPCWUIGDNKEJGP#



1063

. #40'6* , %CVCNQI FGT MCKUGTNKEJMÌPKINKEJGP /GFCKNNGP5V·ORGN5COONWPI 9KGP   5   *CNDNGFGT//#)



$GUKV\GTUVGORGN(ÒTUVNKEJ5VCTJGODGTIBUEJG(COKNKGP$KDNKQVJGM5EJNQUU'HGTFKPI

. $#$'.10,.CO¾FCKNNGGVNGUO¾FCKNNGWTU%QNNGEVKQPN CTVGVNGIQÑV2CTKU56HP *CNDNGFGTOKV-QRHTQVUEJPKVVOKPKOCNUVQEMHNGEMKI



. $#461.166+ ( .C OGFCINKC CPPWCNG FGK 4QOCPK 2QPVGHKEK FC 2CQNQ 8 C 2CQNQ 8+    4KOKPK::++5OKV\CJNTGKEJGP#DD.GKPGP//#)



5GJTUGNVGPGU9GTM

. .G OGFCINKG RQPVKHKEKG FK OCUUKOQ OQFWNQ FC 2KQ +: C 2KQ :+ 4KOKPK   5 OKV \CJNTGKEJGP   #DD.GKPGP//#)



. $'.. 4% 6TCFGUOGPBU 6KEMGVU CPF 2TKXCVG 6QMGPU  0GYECUVNG  :++  5 OKV   \CJNTGKEJGP#DD-WPUVNGFGTOKPKOCNDGUVQ­GP



86


MEDAILLEN, PLAKETTEN . $'4)/#00,/GFCKNNGPCWHDGTÒJOVGWPFCWUIG\GKEJPGVG/·PPGTFGUÌUVGTTGKEJKUEJGP-CKUGTUVCC VGUXQO:8+DKU\WO:+:,CJTJWPFGTV$·PFG9KGP:58+++56HP+PGK PGO$CPFIGDWPFGP.GKPGPOKV2T·IGFTWEM6GKNYGKUGUVQEMHNGEMKI//#)



. $'40*#46 / &KG $KNFPKUOGFCKNNGP -CTNU FGU (ÒPHVGP /ÒPEJGP   5  6HP /QFGTPGU   )CP\NGKPGP6CFGNNQUG'TJCNVWPIFKGUGUUGJTUGNVGPGP9GTMGU//#)



$GUKV\GTUVGORGN&T(:9GK\KPIGT%Q

. &KG 2NCMGVVGPUCOONWPI #NHTGF 9CNEJGT 4KVVGT XQP /QNVJGKO 9KGP +VCNKGPKUEJG URCPKUEJG FGWVUEJG   PKGFGTN·PFKUEJG HTCP\ÌUKUEJG #TDGKVGP FGU  ,CJTJ 8GTUVGKIGTWPI KP FGT )CNGTKG *WIQ *GNDKPI   /ÒPEJGP   5 OKV  0TP  6HP .GKPGP $GKIGUEJTKGDGPG 2TGKUG WPF 0QVK\GP   //#)



. #WIUDWTIU /GFCKNNGWTG WPF $KNFPKUUG #WIUDWTIGT -WPUVJCPFYGTMGT CWH 5EJCWOÒP\GP FGU  ,J 5&   CWU/$0)5OKV#DD6HP*CNDNGFGTPGWYGTVKI



. $1.<'06*#.*5MK\\GP\WT-WPUVIGUEJKEJVGFGTOQFGTPGP/GFCKNNGP#TDGKV  $GTNKP  +8  5  6HP :+ *CNDRGTICOGPV OKPKOCN DGUVQ­GP 6GKNYGKUG UVQEMHNGEMKI //#)   



. $4#/5'0 . /¾FCKNNKGT 0CRQN¾QP NG )TCPF QW FGUETKRVKQP FGU O¾FCKNNGU ENKEJ¾U TGRQWUU¾U GV   O¾FCKNNGUF¾EQTCVKQPU TGNCVKXGU CWZ CHHCKTGU FG NC (TCPEG RGPFCPV NG EQPUWNCV GV N GORKTG  6GKNG 2C   TKU-QRGPJCIGP::::5+8::8+++5::+:5+PGKPGO$CPF KP)CP\NGKPGPIGDWPFGPUGJTIWVG'TJCNVWPI//#)



. $4#70 '9 &KG FGWVUEJGP 4GPCKUUCPEGRNCMGVVGP FGT 5COONWPI #NHTGF 4KVVGT XQP /QNVJGKO KP   9KGP9KGP5OKV\CJNTGKEJGP6GZVCDD1TKI$TQUEJWT6HPKP(CNVOCRRG  



. $4190.$TKVKUJ*KUVQTKECN/GFCNU$·PFG.QPFQP::8+5::+8 5:::+5LGYGKNUOKV\CJNTGKEJGP#DD.GKPGPOKV5EJWV\WOUEJNCI//#)  



1076

. %1%*4#02#64+%-49%CVCNQIWGQHOGFCNUQH5EQVNCPFHTQOVJGGCTNKGUVRGTKQFVQVJGRTGUGPV VKOG 'FKPDWTIJ  8+++  5  6HP DÒPFKIGT *CNDNGFGTGKPDCPF -QRHIQNFUEJPKVV VCFGNNQUG   'TJCNVWPI#



5GJTUGNVGPGU9GTMXQPFGOPWT'ZGORNCTGIGFTWEMVYWTFGP$GKFGOXQTNKGIGPFGP'ZGORNCTJCPFGNVGUUKEJ WO0T

. %1..+)010 ,2 .C OGFCKNNG HTCP¼CKUG CW :+:G UKGENG GV NyJKUVQKTG 2TGHCEG FG 2#64+%'   %#*#46 11   5  6HP 1TKI -CTVQP 4ÒEMGP OKV -NGDGD·PFGT DGHGUVKIV 'ZGORNCT   0T  XQP  ( 2#)'&+81,2 &+81 /GFCKNNGU FG 0CRQNGQP +++ <ÒTKEJ   5 OKV   XKGNGP#DD-CTVQPKGTV.WPF,<GKV\0CRQNGQPU/GFCKNNGP2GVGTUDGTI5OKV\CJNTGKEJGP ITÌ­VGPVGKNUHCTDKIGP#DDWPF(CTDVHP-CTVQPKGTV  



. &'765%*')'5'..5%*#(6(ª4/'&#+..'0-7056$CPF&KG-WPUVOGFCKNNGKP &GWVUEJNCPF $GTNKP  $CPF + ++ -NCW­ , &KG /GFCKNNGPUCOONWPI )QGVJGU $GTNKP   $CPF&KG/GFCKNNGWPF)GFGPMOÒP\GFGU,CJTJWPFGTVUKP&GWVUEJNCPF$GTNKP$CPF &GVJNGHU)5VGIWYGKV9)GNF-WPUV-WPUV)GNF&GWVUEJG)GFGPMOÒP\GPUGKV)GUVCNVWPI WPF )GUVCNVGT $GTNKP  &C\W GKPKIG -CVCNQIG WPF #WHU·V\G \WT /GFCKNNGPMWPFG 7PVGTUEJKGFNKEJ   IGDWPFGP  

 87


MEDAILLEN, PLAKETTEN

1079

. &+81,2(2#)'&+81,2&+81/GFCKNNGUFG0CRQNGQP+++<ÒTKEJ5OKVXKGNGP VGKNU HCTDKIGP #DD -CTVQPKGTV VCFGNNQUGT <WUVCPF =/KV 9KFOWPI (ÒT (TKV\ $GPFKI KP 'TKPPGTWPI CP   =FKG?IWVGPCNVGPNWUVKIGP6CIG<ÒTKEJ9GKJPCEJVGPXQP,2CWN&KXQ?



. &1/#0+) - 2QTVT·VOGFCKNNGP FGU 'T\JCWUGU ¤UVGTTGKEJ XQP-CKUGT(TKGFTKEJ+++DKU-CKUGT(TCP\ ++CWUFGT/GFCKNNGPUCOONWPIFGUCNNGTJÌEJUVGP-CKUGTJCWUGU9KGP8++56HP(QNKQ *CNDNGKPGPOKPKOCNDGUVQ­GP//#)



. &KG FGWVUEJG /GFCKNNG KP MWPUV WPF MWNVWTJKUVQTKUEJGT *KPUKEJV PCEJ FGO $GUVCPFG FGT /GFCKNNGP   UCOONWPIFGUCNNGTJÌEJUVGP-CKUGTJCWUGU9KGP88+++56HP*CNDNGFGTOKV4ÒEMGP XGTIQNFWPI-QRHIQNFUEJPKVVMNGKPG9CUUGTHNGEMGPWPVGPCWHFGO'KPDCPF4ÒEMGPNGKEJVCWUIGDNKEJGP 6GZVWPF6CHGNVGKNVCFGNNQU$KDNKQVJGMUUVGORGN +PFGO$CPFYGTFGP/ÒP\GPWPF/GFCKNNGPCWUHÒJTNKEJUVDGUEJTKGDGPCPIGHCPIGPXQPFGPGTUVGP)WNFGPITQ



UEJGP DKU \WO 'PFG FGU  ,CJTJWPFGTVU OKV UGJT FGVCKNNKGTVGO4GIKUVGTPCEJ2GTUQPGP1TVGP+PJCNVGPWPFFGP /GFCKNNGWTGP

1082

. '+&.+6<4,/GFCNUCPF/GFCNNKQPU4GNCVKPIVQ#TEJKVGEVU0GY;QTM:::85 6HP (QNKQ )CP\NGKPGP OKV )QNFRT·IWPI -QRHIQNFUEJPKVV VCFGNNQUGT <WUVCPF FKGUGU UGJT UGNVGPGP   9GTMU//#)



. ('7#4&'06(,GVQPUGVO¾TGCWZFGRWKU.QWKU+:LWUSW CNCHKPFW%QPUWNCVFG$QPCRCTVG$·PFG 2CTKU.QPFQP:8+5555::++6HP$TQUEJKGTV//#)  



88


MEDAILLEN, PLAKETTEN

1084

. (144'4.$KQITCRJKECN&KEVKQPCT[QH/GFCNNKUVU$·PFG0CEJFTWEM9GVVGTGPQ,FGT#WUICDG .QPFQP(TQPVKURK\:.8+++5(TQPVKURK\8+5(TQPVKURK\5(TQPVKURK\ 5(TQPVKURK\5(TQPVKURK\8+++555CNNGOKV#DD'KPJGKVNKEJGU)CP\ NGKPGP#  



7PXGT\KEJVDCTGT9GTVHÒTFKGPWOKUOCVKUEJG$GCTDGKVWPIXQP/GFCKNNGP

. (4'&'.&CUMNCUUKUEJG9GKOCTKP/GFCKNNGP9GKOCTGT$GKVT·IG\WT-WPUV9GKOCT 56HP)CP\NGKPGPOKVIGRT·IVGT&GEMGNXGT\KGTWPI5EJWV\WOUEJNCI#



. (4+'&.#'0&'4 , &KG KVCNKGPKUEJGP 5EJCWOÒP\GP FGU HÒPH\GJPVGP ,CJTJWPFGTVU  'KP   $GKVTCI\WT-WPUVIGUEJKEJVG$GTNKP56HP*CNDNGFGTVGKNYGKUGUVQEMHNGEMKI



. )'$*#4&6-#NQKU$ÌTUEJ-ÌPKINKEJDC[GTKUEJGT/ÒP\WPF*QHOGFCKNNGWT/ÒPEJGP :8+5OKV\CJNTGKEJGP#DD-CTVQPKGTV



. )416'/';'4 2 (ÒJTGT FWTEJ FKG UVCCVNKEJG /ÒP\UCOONWPI KP /ÒPEJGP /GFCKNNGP /ÒPEJGP   56HP*CNDNGFGTPGWYGTVKI



. (TCP\#PFTGC5EJGIC/ÒP\UVGORGNUEJPGKFGTWPF/GFCKNNGWTCPFGTMWTHÒTUVNKEJGP/ÒP\G\W /ÒPEJGP/ÒPEJGP56HP-WPUVNGFGT&C\WDTQUEJ5&OKV6HPCWUFGO,0) WPFXQP'$GEMGPDCWGT\W(#5EJGIC 0CEJVT·IG9CEJUCTDGKVGP #



. *#$+%* ) &KG FGWVUEJGP /GFCKNNGWTG FGU :8+ ,CJTJWPFGTVU *CNNG CP FGT 5CCNG  6GZVDCPF   ::5OKV#DD6CHGNDCPF6HP<YGK)CP\NGKPGPD·PFG//#)



. &KGFGWVUEJGP/GFCKNNGWTGFGU:8+,CJTJWPFGTVU*CNNGCPFGT5CCNG::56HP)CP\ NGKPGP//#)



. &KG/GFCKNNGPFGTKVCNKGPKUEJGP4GPCKUUCPEG5VWVVICTV$GTNKP:++56HP(QNKQ)TÒPGU )CP\NGFGT OKV -QRHIQNFUEJPKVV WPF IQNFGPGP &GEMGNXGT\KGTWPIGP CWUIGDNKEJGPGT 4ÒEMGP CPUQPUVGP   CWUIG\GKEJPGVGTJCNVGP//#)



. *#)'0 7 &KG 9CNNHCJTVUOGFCKNNGP FGU 4JGKPNCPFGU KP )GUEJKEJVG WPF 8QNMUNGDGP 9GTMGP WPF   9QJPGP-ÌNP56HP)CP\NGKPGP//#)



. *#*0 ' ,CMQD 5VCORHGT )QNFUEJOKGF /GFCKNNGWT WPF 5VGORGNUEJPGKFGT XQP <ÒTKEJ    /KVVGKNWPIGPFGT#PVKSWCTKUEJGP)GUGNNUEJCHVKP<ÒTKEJ  (TQPVKURK\5OKV#DD 6HP(CNVUVCOOVH1TKI$TQUEJWT$KPFWPINÌUVUKEJ//#)



. *#46/#00(4#0<'05*7.& '' XQP &GWVUEJG 2GTUQPGP/GFCKNNGP FGU :8+ ,CJTJWPFGTVU   PCOGPVNKEJ GKPKIGT 9KGPGT )GUEJNGEJVGT #WU\WI CWU #TEJKX HÒT ÌUVGTTGKEJKUEJG )GUEJKEJVG   

 9KGP56HP)CP\NGKPGP6CHGNPWPFYGPKIG5GKVGPHNGEMKI#

 89


MEDAILLEN, PLAKETTEN . *#75'4,&KG/ÒP\GPWPF/GFCKNNGPFGTKO,CJTGIGITÒPFGVGP UGKV *CWRVWPF4GUK FGP\UVCFV/ÒPEJGPOKV'KPTGKJWPILGPGT5VÒEMGYGNEJGJKGTCWH$G\WIJCDGP/ÒPEJGP:::++  5  6HP *CNDNGFGT FGT <GKV OKV )CP\TQVUEJPKVV XGTGKP\GNPF $NGKUVKHVOCTMKGTWPIGP KO 6GZV   //#)



. *'+55#.GUO¾FCKNNGWTUFGNCTGPCKUUCPEG6GKN+++ 82CTKU 56HP5 6HP1TKI$TQUEJWT6GKNYGKUGUVQEMHNGEMKIWPFWPCWHIGUEJPKVVGP  



. *'00+0 / *KUVQKTG PWOKUOCVKSWG FG NC 4¾XQNWVKQP (TCP¼CKUG QW FGUETKRVKQP TCKUQPP¾G FGU   O¾FCKNNGU OQPPCKGU GV CWVTGU OQPWOGPU PWOKUOCVKSWGU TGNCVKHU CWZ CHHCKTGU FG NC (TCPEG FGRWKU   NyQWXGTVWTG FGU 'VCVU)¾P¾TCWZ LWUSW C N ¾VCDNKUUGOGPV FW )QWXGTPGOGPV %QPUWNCKTG 0CEJFTWEM Q,   /CCUVTKEJVFGT#WUICDG2CTKU::56HP+P\YGK$·PFGPKP)CP\MWPUVNGFGTIGDWPFGP #  



. *+..)(21..#4&)4GPCKUUCPEG/GFCNUHTQOVJG5COWGN*-TGUU%QNNGEVKQPCVVJG0CVKQPCN )CNNGT[QH#TV.QPFQP:5\CJNTGKEJG6HP)CP\NGKPGP



. 4GPCKUUCPEG/GFCNUHTQOVJG5COWGN*-TGUU%QNNGEVKQPCVVJG0CVKQPCN)CNNGT[QH#TV.QPFQP :5OKV\CJNTGKEJG6HP)CP\NGKPGPOKV5EJWV\WOUEJNCI//#)&C\WGKPKIGMNGKPG/Q PQITCRJKGP XQP $#&+5%*'5 .#0&/75'7/   (#$4+%<; .8 )1.&5%*0'+&'4 .  

*I )416'/';'42241$5<6).WFYKI0GWHCJTGT  



. *+.. )(4+%%+ 5 FG 6JG )WUVCX &TG[HWU%QNNGEVKQP4GPCKUUCPEG/GFCNU+PUIGUCOV/G FCKNNGP CWUHÒJTNKEJ DGUEJTKGDGP WPF CDIGDKNFGV 4GKEJG 5GTKGP KVCNKGPKUEJGT WPF FGWVUEJGT 4GPCKUUCPEG   /GFCKNNGP1ZHQTF:++56HP(QNKQ)CP\NGKPGP  'KPG FGT DGTÒJOVGUVGP /GFCKNNGP5COONWPIGP CNNGT <GKVGP JGWVG KP FGT 0CVKQPCN )CNNGT[ QH #TV WUUGTUV UGNVGP   CPIGDQVGP

1102

1106

. *1.</#+4$-CVCNQIFGT5COONWPI&T,QUGH$TGVVCWGT/GFKEKPCKP0WOOKU9KGP(TQP VKURK\:8+56HP1TKI$TQUEJWT//#)



. -CVCNQIFGT5COONWPI&T,QUGH$TGVVCWGT/GFKEKPCKP0WOOKU9KGP(TQPVKURK\:8+5 6HP*CNDNGKPGP//#)



*CPFUEJTKHVNKEJGT$GUKV\GTXGTOGTM'$GEMGPDCWGT

. -#6<8&KGGT\IGDKTIKUEJG2T·IGOGFCKNNGFGU:8+,CJTJWPFGTVU0&)ÒVGTUNQJFGT#WUICDG 2TCI5OKVXKGNGP#DD6HP)CP\NGKPGP



+O8QTUCV\DGHKPFGVUKEJGKPGZNKDTKUXQP4QDGTV5EJQPYCNVGT

. -'00'4(.GQPG.GQPKBU/GFCKNNGPHÒTFGPMCKUGTNKEJGP*QH5GRCTCVCCWU,CJTDWEJFGT-WPUVJK UVQTKUEJGP5COONWPIGPFGU#NNGTJÌEJUVGP-CKUGTJCWUGU$F9KGP56HPWPF #DDKO6GZV-CTVQPKGTV'TUVG5GKVGTGUVCWTKGTV



. -+'0#56)96JG/GFCNUQH-CTN)QGV\%NGXGNCPF5OKV\CJNTGKEJGP#DD)CP\NGKPGP OKV)QNFRT·IWPI



. -1'0+) #56#.<'4 ( 4GEJGPRHGPPKIG $CPF  0ÒTPDGTI 5KIPKGTVG WPF \WYGKUDCTG )GRT·IG    .KGHGTWPI &KG (COKNKGP5EJWNVGU-QEJWPF-TCWYKPEMGN-CVCNQIGFGT5VCCVNKEJGP/ÒP\UCOONWPI /ÒPEJGP/ÒPEJGP8+++56HP1TKI$TQUEJWTPGWYGTVKI//#)



. -¤0+).+%*' /75''0 <7 $'4.+0 5EJCWOÒP\GP FGU *CWUGU *QJGP\QNNGTP $GTNKP  :     5 OKV #DD  6HP VGKNYGKUG HCTDKI (QNKQ 1TKIKPCNICP\NGKPGP 'KPDCPFUEJOWV\KI&GEMGNOKV /GFCKNNQPRT·IWPIGVYCUDGUVQ­GPWPF4ÒEMGPFGHGMV



90


MEDAILLEN, PLAKETTEN

1109

. .#/#5#/GFCNJCURQTVWIWGUCUGGUVTCPIGKTCUC2QTVWICN6GKN/GFCNJCU%QOGOQTCVKXCU.KUDQC .:::8+56HP2TCEJVXQNNGTUEJYCT\GT*CNDNGFGTDCPF$ÒPFGPWPFIQNF4ÒEMGPVKVGN . .#00#(TGKJGTT#XQP#WMVKQP4.GRMG5COONWPIFGU(TGKJGTTP#FCNDGTVXQP.CPPC2TCI 6GKN$GTNKP5OKV0TP6HP(QNKQ-CTVQPKGTV'KPDCPFOKPKOCNDGUEJ·FKIV 6GKNWOHC­VFKGDGTÒJOVG5COONWPIXQP/GFCKNNGPWPF/ÒP\GP





. #WMVKQP4.GRMG5COONWPIFGU(TGKJGTTP#FCNDGTVXQP.CPPC2TCI6GKN$GTNKP 5OKV0TP6HP(QNKQ/KV'TIGDPKUNKUVG-CTVQPKGTVDGUVQ­GP



. .¤$$'%-'##WMVKQP,*KTUEJ0T5COONWPI#TVJWT.ÌDDGEMG$TCWPUEJYGKI-WPUVOGFCKN NGPWPF2NCMGVVGPFGU:8DKU:8++,CJTJWPFGTVU/ÒPEJGP5OKV0TP6HP *CNDNGFGTVCFGNNQUGTJCNVGP-QRHIQNFUEJPKVV//#)



5GJTUGNVGP'ZNKDTKU.CYTGPEG#NDGTV$TQYP

. .17$#6,(6JG/GFCNNKE*KUVQT[QHVJG7PKVGF5VCVGUQH#OGTKEC6GZVWPF6CHGNDCPF 0GY ;QTM  .:+:  5  5 4G\GPUKQPGP :8+  6HP (QNKQ *CNDNGKPGP Z  )CP\NGKPGP  

Z  -QRHIQNFUEJPKVVG 'KPD·PF OKV PWT YGPKIGP )GDTCWEJUURWTGP +PJCNV ITÌ­VGPVGKNU VCFGNNQU   #  



. /#46+0+4%CVCNQIQFGNNGOGFCINKGFGNNG%KXKEJG4CEEQNVG0WOKUOCVKEJG8+5GEQNQ::$CPF 4GIPQ &B+VCNKC 8KVVQTKQ 'OCPWGNG +++   /KNCPQ  ::+++  5  6HP -CTVQPKGTV   OKPKOCNDGUVQ­GP



. /#7'*5GDCUVKCP&CFNGT/GFCKNNGPKO&TGK­KIL·JTKIGP-TKGI0ÒTPDGTI5 OKV#DD)CP\NGKPGP



. /';'4974/$#%* ' -ÌNPGT <GKEJGP WPF 2HGPPKIG \W 'JTGP FGT *GKNKIGP &TGK -ÌPKIG #WU   GKPGT<GKVUEJTKHV-ÌNP56HP)CP\NGKPGP



. /ª056'4'4 *1 #OWNGVVMTGW\G WPF -TGW\COWNGVVG 5VWFKGP \WT TGNKIKÌUGP 8QNMUMWPFG 4GIGPU   DWTI5OKV#DDWPF6HPCWHFGP5GKVGP-CTVQPKGTV)GRT·IVGU'ZNKDTKUCWH8QT UCV\



. 1.&+0)/&KG/GFCKNNGPCWH(TKGFTKEJFGP)TQ­GPXQP2TGW­GPDKU4GIGPUVCWH 2QTVTCKVVH5OKV#DD)CP\NGKPGP



. 155$#*4 %# /[PV QEJ OGFCNLGT UNCIPC HÌT HT·OOCPFG OCMVGT K CPNGFPKPI CX MTKI OQV 5XGTKIG   6KNN·II VKNN $' *KNFGDTCPFU 5XGTKIGU QEJ 5XGPUMC MQPWPICJWUGVU OKPPGURGPPKPICT RTCMVO[PV QEJ   DGNÌPKPIUOGFCNLGT 7RRUCNC56HP)TÒPGU*CNDNGFGTKP$ÒPFGPYGPKIG5GKVGPNQUG //#)



. 2#%*+0)'4 #/ 9CNNHCJTVU $TWFGTUEJCHVU WPF )PCFGPOGFCKNNGP FGU *GT\QIVWOU 5CN\DWTI   0CEJFTWEM9KGPFGT#WUICDG9KGPCWH-WPUVFTWEMRCRKGTOKVIWVGP#DD:+++56HP *CNDNGFGT//#)



. 2#%*+0)'4 #/(4+'5'0'))'4 ,/ #DJCPFNWPIGP ÒDGT 9CNNHCJTVUOGFCKNNGP WPF 7NTKEJU   MTGW\G5&CWU/$0)0&56HP*CNDNGKPGPPGWYGTVKI

 91


MEDAILLEN, PLAKETTEN

1123

1124

. 2'75$5EJNGUKUEJG9CNNHCJTVUOGFCKNNGPXQT#WUGKPGT<GKVUEJTKHVQJPG1TVWPFQJPG,CJTWO 56HP)CP\NGKPGP#WMVKQPXQO5NI2GWU9CNNHCJTVUOG FCKNNGPFGUFGWVUEJGP5RTCEJIGDKGVGU0TP6HP'.*CNDNGKPGP  



. 2.10'$GPXGPWVQ%GNNKPK1TH¾XTG/GFCKNNGWTGV5EWNRVGWT2CTKU56HP2TCEJVXQNNGT *CNDNGFGTDCPFOKVIQNF4ÒEMGPRT·IWPI



. .GQPG.GQPKGV2QORGQ.GQPK2CTKU+856HP2TCEJVXQNNGTUEJYCT\GT*CNDNGFGTDCPF OKVGKPIGNGIVGO/GFCKNNQP$ÒPFGPWPFIQNF4ÒEMGPVKVGN



. 210%'6 ' 4GEJGTEJGU UWT NGU LGVQPU EQUWNCKTGU FG NC XKNNG FG .[QP 0WOKUOCVKSWG .[QPPCKUG   .[QP2CTKU  :++  5  6HP *CNDNGFGTGKPDCPF OKV  $ÒPFGP VCFGNNQUG 'TJCNVWPI$GKIGDWP FGP.%*#6+..10,GVQPUEQPUWNCKTGUFGNCXKNNGFG.[QP#FFKVKQPCWZTGEJGTEJGUFW&T2QPEGV .[QP2CTKU   5  6H FKG 6H KUV \WU·V\NKEJ CNU IGFTWEMVG (QVQITCHKG OKVGKPIGDWPFGP   #



. 241$5<61*5614(( ) &KG -·TPVPGT /GFCKNNGP #D\GKEJGP WPF 'JTGP\GKEJGP $WEJTGKJG FGU   .CPFGUOWUGWOUHÒT-·TPVGP-NCIGPHWTV56HP.GKPGPOKV5EJWV\WOUEJNCI//#) 



. 241-+5%* $ &KG 4CKVRHGPPKIRT·IWPI KP FGP ÌUVGTTGKEJKUEJGP 'TDN·PFGTP 8GTÌHHGPVNKEJWPIGP FGU   +PUVKVWVGU HÒT 0WOKUOCVKM WPF )GNFIGUEJKEJVG $CPF  9KGP   6GKNG  5 OKV \CJNTGKEJGP   #DD5VGORGNITCRJGP.GKPGP$GKDCPFIGJGHVGV  



. 4#%<;05-+')CDKPGV/GFCNÉY2QNUMKEJ1TC\6[EJ-VÉTG5KG&\KGLÉY2QNUMK6[E\C2QE\CYU\[QF 0CLFCYPK¾LU\[EJC\FQ-QPEC2CPQYCPKC,CPC+++  6GKN+ ++$GTNKP.:8++5 OKV \CJNTGKEJGP -WRHGTUVKEJVHP  5 OKV \CJNTGKEJGP -WRHGTUVKEJVHP 2CRRD·PFG OKPKOCN DGUVQ­GP   'VYCUUVQEMHNGEMKI  



. 4+%*6'4 # &KG PWOKUOCVKUEJGP &GPM\GKEJGP CWH FKG 4GIKGTWPIULWDKN·GP -CKUGT (TCP\ ,QUGRJ +   9KGP8+56HP/QFGTPGU*CNDNGFGT



/KV9KFOWPIFGU8GTHCUUGTU

. 4+%*6'4 , &KG 5EJÒV\GPVCNGT WPF 5EJÒV\GPOGFCKNNGP FGT 5EJYGK\ 4GIGPUVCWH   5 OKV   \CJNTGKEJGPHCTDKIGP#DD-CTVQPKGTV&KG5EJÒV\GPLGVQPUFGT5EJYGK\4GIGPUVCWH5OKV \CJNTGKEJGPHCTDKIGP6GZVCDD-CTVQPKGTV  



. 417;'4,*7%*'4'*KUVQKTGFWLGVQPCWOQ[GPCIG$CPF=CNNGGTUEJKGPGPGP?2CTKU 56HP*CNDNGFGT#



. 5#..'6#XQP&KG/GFCKNNGP#NDTGEJV&ÒTGTU$GTNKPQ,5&CWUFGT<GKVUEJTKHV<H0++5 6HP  7PVGTUWEJWPIGP ÒDGT #NDTGEJV &ÒTGT $GTNKP   5 OKV \YGK *QN\UEJPKVVGP   =$GUKV\GTXGTOGTM#4KGEJOCPP%Q?+PGKPGO$CPFKP*CNDNGKPGPIGDWPFGP



. 5#7.%; .(,% FG 5QWXGPKTU PWOKUOCVKSWGU FG NC 4GXQNWVKQP FG  4GEWGKN EQORNGV FGU   O¾FCKNNGUOQPPCKGUGVLGVQPUSWKQPVRCTWGP(TCPEGFGRWKUNG(¾XTKGTLWUSW CW&¾EGODTG 2CTKU56HP)CP\NGKPGPRTCEJVXQNNGTHTCP\ÌUKUEJGT'KPDCPFOKVIQNFGPGT&GEMGNRT·IWPI WPF )CP\IQNFUEJPKVV 4ÒEMGP OKV NGKEJVGP )GDTCWEJUURWTGP YGPKIG 0QVK\GP CWH FGP GTUVGP 5GKVGP   #



5GNVGPG1TKIKPCNCWUICDG+O8QTUCV\DGHKPFGVUKEJGKP$GUKV\GTGVVKMGVV

92


MEDAILLEN, PLAKETTEN . 5%*'45-6JG%WTTGPE[QH(COG2QTVTCKV/GFCNUQHVJG4GPCKUUCPEG0GY;QTM(TQPVKURK\ 5OKV\CJNTGKEJGPXKGNHCEJHCTDKIGP#DDWPF6HP)CP\NGKPGP//#)



. 5'4(#5**CDUDWTIU7PKXGTUKV·VGP*QEJUEJWNGPWPF#MCFGOKGPWPFFGTGP0CEJHQNIGTCWH/ÒP\GP WPF/GFCKNNGP=9KGP?5OKV\CJNTGKEJGP#DD(CNVMCTVG-CTVQPKGTV



. 5/1.&'4'0..C/¾FCKNNGGP$GNIKSWGFGUQTKIKPGU¯PQULQWTU9GVVGTGP5FCTWPVGT \CJNTGKEJG6HP.GKPGPOKV5EJWV\WOUEJNCI



. 64'514 &' 07/+5/#6+37' '6 &' ).;26+37' 5EGCWZ FGU TQKU GV TGKPGU FG (TCPEG 2CTKU   56HP(QNKQ*CNDNGFGTUVQEMHNGEMKINGKEJVDGUVQ­GP-NGKPGT9CUUGTTCPF#



5GNVGPGU9GTMOKVUEJÌPGP+NNWUVTCVKQPGP

. /¾FCKNNGU EQWN¾GU GV EKUGN¾GU GP +VCNKG CWZ :8G GV :8+G UK½ENG 2CTKU 56HP5 6HP(QNKQ*CNDNGFGTVGKNYGKUGUVQEMHNGEMKINGKEJVDGUVQ­GP



5GNVGPGU9GTMOKVUEJÌPGP+NNWUVTCVKQPGP/KV$GUKV\GTUVGORGN

. $CUTGNKGHUFGNCHTKUGFW2CTVJ¾PQPGVFWVGORNGFG2JKICNKG2CTKU56HP(QNKQ*CNDNG FGTUVQEMHNGEMKIGVYCUDGUVQ­GP#



5GNVGPGU9GTMOKVUEJÌPGP+NNWUVTCVKQPGP

. /¾FCKNNGU FG NC T¾XQNWVKQP HTCPECKUG FGRWKU N QWXGTVWTG FGU 'VCVU)¾P¾TCWZ  OCK   LWUSW ¯ NC   2TQENCOCVKQP FG N 'ORKTG  OCK   2CTKU   5  6HP *CNDNGFGT URQTCFKUEJG 5VQEM   HNGEMGPDGUVQ­GP6GKNYGKUG9CUUGTTCPFWPF9CUUGTHNGEMGP//#)



5GNVGPGU9GTMOKVUEJÌPGP+NNWUVTCVKQPGP

. 4GEWGKN I¾P¾TCN FG DCUTGNKGHU GV FyQTPGOGPU QW O¾NCPIGU V[RQIN[RVKSWGU 2CTKU   5  6HP   (QNKQ*CNDNGFGTUVQEMHNGEMKIOKPKOCNDGUVQ­GP



5GNVGPGU9GTMOKVUEJÌPGP+NNWUVTCVKQPGP

. 5EGCWZ FGU ITCPFU HGWFCVCKTGUFGNCEQWTQPPGFG(TCPEG2CTKU56HP(QNKQ*CNDNGFGT OKPKOCNDGUVQ­GP6GZVVGKNUVQEMHNGEMKI6CHGNVGKNOKPKOCNUVQEMHNGEMKI#



5GNVGPGU9GTMOKVUEJÌPGP+NNWUVTCVKQPGP

. 5EGCWZFGUITCPFUHGWFCVCKTGUFGNCEQWTQPPGFG(TCPEG2CTKU56HP(QNKQ.QUG.CIGP FGT1TKIKPCNNKGHGTWPI5VQEMHNGEMKI#



5GNVGPGU9GTMOKVUEJÌPGP+NNWUVTCVKQPGP

. 5EGCWZ FGU TQKU GV TGKPGU Fy#PINGVGTTG 2CTKU   5   6HP (QNKQ *CNDNGFGT NGKEJV UVQEM   HNGEMKIIGTKPIHÒIKIDGUVQ­GP(NGEMCWH6H



5GNVGPGU9GTMOKVUEJÌPGP+NNWUVTCVKQPGP

1145

. 6;5<-+'9+%< ' 5COONWPI XQP /GFCKNNGP YGNEJG UKEJCWHFKG)GUEJKEJVGFGT.·PFGTWPF5V·FVG FGTGJGOCNKIGP4GRWDNKM2QNGPDG\KGJGPWPFXQPKJTGTGTUVGP6GKNWPIDKU\WO6QFGFGU-CKUGTU0KMQ NCWU+IGRT·IVUKPF4KIC:56HP$TCWPGU*CNDNGFGTOKV$ÒPFGPWPFIQNF 4ÒEMGPVKVGN



5GJTUGNVGPGU9GTM

93


ORDEN UND EHRENZEICHEN . 8#00'.(61&'4+).COGFCINKCDCTQEECKP6QUECPC(KTGP\G56HP.GKPGP OKV5EJWV\WOUEJNCI//#)



. 8'4'+0 (ª4 07/+5/#6+- <7 24#) *TUI  $GUEJTGKDWPI FGT DKUJGT DGMCPPVGP DÌJOKUEJGP   2TKXCVOÒP\GP WPF /GFCKNNGP 2TCI  8+  5  6HP /CTOQTKGTVGT -CTVQPGKPDCPF DGUVQ­GP   4ÒEMGPGKPIGTKUUGP//#)



. 9'+.'4 * -ÌNPGT &QO/GFCKNNGP  $·PFG  6GKN  DKU  ,J 4QOCPVKM )QVKM 4GPCKU   UCPEG   6GKN  WPF  ,J $CTQEM\GKV   6GKN  WPF  ,J &QOYGKVGTDCW WPF OQFGTPG   <GKV  -TGHGNF*ÒNU  'KPJGKVNKEJ KP IGNDGO )CP\NGKPGP IGDWPFGP %NGOGPU#WIWUV*GT \QIXQP$C[GTP-WTHÒTUVXQP-ÌNP&KG/GFCKNNGP5EJCWWPF)GFGPMVCNGTWUY)CP\NGKPGP  



. -ÌNPKUEJG /GFCKNNGP 2NCMGVVGP 5EJCWVCNGT ,GVQPU <GKEJGP WPF /CTMGP 6GKN  WPF  -TGHGNF*ÒNU     5  5 OKV LGYGKNU \CJNTGKEJGP #DD )CP\NGKPGP  -ÌNPGT &QO/GFCKNNGP   6GKNG-TGHGNF*ÒNU555LGYGKNUOKV\CJNTGKEJGP6GZVCDD)CP\NGKPGP %NGOGPU#WIWUV*GT\QIXQP$C[GTP-WTHÒTUVXQP-ÌNP&KG/GFCKNNGP5EJCWWPF)GFGPMVCNGTWUY

-ÌNPKUEJG/GFCKNNGP -TGHGNF*ÒNU5OKV6HP)CP\NGKPGP$QPPGT$GNCIGTWPIGPKO 5RKGIGNFGT/GFCKNNGP-GORGP*ÒNU5OKVXKGNGP#DD)CP\NGKPGP//#)  



. 9+'%'- # 5GDCUVKCP &CFNGT /GFCNKGT IFCPUMK :8++ YKGMW &CP\KI   5  6HP 1TKI   $TQUEJWTVCFGNNQUGT<WUVCPF//#)



. 5GDCUVKCP &CFNGT /GFCNKGT IFCPUMK :8++ YKGMW &CP\KI   5  6HP 1TKI$TQUEJWT UVCTM   DGUVQ­GP//#)



. 9+'.#0&6(<'+6<,&KG/GFCKNNGPFGU*CWUGU$CFGP&GPMOÒP\GP\WT)GUEJKEJVGFGU\·JTKP IGPDCFKUEJGP (ÒTUVGPJCWUGU CWU FGT <GKV XQP  DKU  -CTNUTWJG   5 OKV \CJNTGKEJGP   #DD)CP\NGKPGP#



. 974<$#%*6#00'0$'4) 94 XQP -CVCNQI OGKPGT 5COONWPI XQP /GFCKNNGP 2NCMGVVGP WPF   ,GVQPU6GKNGWPXGT·PFGTVGT0CEJFTWEM*CODWTIFGT'TUVCWHNCIG<ÒTKEJWC(TQPVKURK\ :8556HP)CP\NGKPGP#  



1154

14&'070&'*4'0<'+%*'0 . $10#00+ 2 1TFKPWO 'SWGUVTKWO GV /KNKVCTKWO %CVCNQIWU KP +OCIKPKDWU GZRQUKVWU  EWO DTGXK   PCTTCVKQPG =-CVCNQI FGT 4KVVGT WPF /KNKV·T1TFGP FCTIGUVGNNV KP $KNFGTP WPF OKV MWT\GT 'TN·WVGTWPI?   'TUVG#WUICDG4QO(QTOCVZEOKPNCVGKPKUEJGTWPFKVCNKGPKUEJGT5RTCEJGOKV6KVGNMWR HGT  5 OKV  -WRHGTUVKEJVHP FCXQP  OKV #DD XQP 1TFGPUVTCEJVGP WPF  OKV #DD XQP   1TFGPUKPUKIPKGP+P5EJYGKPUNGFGTIGDWPFGP  5GNVGPG'TUVCWUICDGOKVCNNGP-WRHGTUVKEJVCHGNPGKPGUFGTDGFGWVGPFUVGPQTFGPUMWPFNKEJGP6KVGNFGU,CJTJWPFGTVU FCUUR·VGTKPYGKVGTGP#WHNCIGPWPFCWEJHTGOFURTCEJKIGP#WUICDGP WCKPFGWVUEJ GTUEJKGPGPKUV7OHCPITGKEJ DGDKNFGTVGU9GTMFGU,GUWKVGP$QPCPPKÒDGTFKGUGKPGT\GKVDGMCPPVGPDGUVGJGPFGPGTNQUEJGPGPYKGCWEJUCIGPJCHVGP IGKUVNKEJGPWPFYGNVNKEJGP4KVVGTQTFGPOKV&CTUVGNNWPIKJTGT6TCEJVGPWPF+PUKIPKGP(ÒTFCUJQJG#NVGTIWVGTJCNVGP

94


ORDEN UND EHRENZEICHEN

1155

1159

. %+$4#4+1.&GUETK\KQPG5VQTKECFGINK1TFKPK%CXCNNGTGUEJK$CPFWPF0GCRGN#WH NCIG(TQPVKURK\55$GKFG$·PFGPGPVJCNVGPHCTDKIG6HPFKGLGFQEJHCNUEJPWOGTKGTVUKPF *CNDNGFGTGKPDCPFUGJTUGNVGPGU9GTMKPJGTXQTTCIGPFGO<WUVCPF  



. (#..17 . .GU ECEJGVU OKNKVCKTGU HTCP¼CKUGU FG NyCPEKGP T¾IKOGCPQULQWTU.C)KDGTPG2CTKU 5OKV\CJNTGKEJGP6HP(TCP\ÌUKUEJG$KPFWPIOKV$ÒPFGP#



5GJT UGNVGPGU 9GTM OKV 5KIPCVWT FGU #WVQTU KO 8QTUCV\ 0T  XQP  CWH2CRKGT +OR¾TKCN FW ,CRQP  IGFTWEMVGP   'ZGORNCTGP

. *';&'0 * XQP 'JTGP<GKEJGP WPF #D\GKEJGP KP(TCPMTGKEJWPF$GNIKGP(TCPMHWTV5 -CTVQPKGTVDGUVQ­GP



/KV$GUKV\GTUVGORGN&T(:9GK\KPIGT%Q

. 0+//'4)76,&GWVUEJG1TFGPWPF'JTGP\GKEJGPDKU$·PFGWPF0CEJVTCI/ÒPEJGP (TQPVKURK\::5(CTDVHP(TQPVKURK\:8+5(CTDVHP(TQPVKURK\:8+ 5(CTDVHP(TQPVKURK\:8+5(CTDVHP(TQPVKURK\:8+5LGYGKNU OKV\CJNTGKEJGP#DD#NNGKP1TKI)CP\NGKPGPIGDWPFGP-QRHTQVUEJPKVV#  



-QORNGVVG#WHNCIGDGKO8GTNCIDGTGKVUXGTITKHHGP

. 14&+0'&+5)'00#41+PUVKVW\KQPGG5VCVWVKFGN4GCN1TFKPGFK5)GPPCTQ0GCRGN 56HP)TQ­HQNKQ+OOQFGTPGP*CNDNGFGTIGDWPFGP6KPVGPHNGEMCWHFGTGTUVGP5GKVG



. 14&+0' /+.+6#4' &+ 5#81,# 4GIKG 2CVGPVK RGT NC %TGC\KQPG FGNN QTFKPG /KNKVCTG FK5CXQLCKP FCVC FGK  #IQUVQ  6WTKP 57PDGUEJPKVVGPG1TKIKPCNDN·VVGTFKGNGV\VGP5GKVGPGVYCU HNGEMKI



. 14&+0'/+.+6#4'&+5)+14)+1&'..#4+70+10'.GIIG+UVKVWVKXCFGN4GCNG1TFKPG/K NKVCTGFK5)KQTIKQFGNNC4KWPKQPGG&GETGVQEJG#DQUEGN 1TKFKPGFGNNGFWG5KEKNKG0GCRGN 5(CNVMCTVG1TKI$TQUEJWTNGKEJVUVQEMHNGEMKI



. 64156 ., &KG 4KVVGT WPF 8GTFKGPUV 1TFGP 'JTGP\GKEJGP WPF /GFCKNNGP CNNGT 5QWXGT·PG WPF   5VCCVGPUGKV$GIKPPFGU:+:,CTJWPFGTVU:++56HP'KPKIG6HPNQUG)CP\NGKPGPDGUVQ­GP



. 81..'*$CFGPU1TFGP'JTGP\GKEJGP2T·OKGPOGFCKNNGP/CPWUMTKRVFTWEM(TGKDWTI5 (CTDVH  6HP )CP\NGKPGP //#)  &C\W -.'0#7 # )TQ­GT FGWVUEJGT 1TFGPUMCVCNQI DKU   /ÒPEJGP5OKV\CJNTGKEJGP#DD)CP\NGKPGP4ÒEMGPGVYCUCWUIGDNKEJGP



. 9#*.'0#&CU$WEJFGT4KVVGTQTFGPWPF'JTGP\GKEJGP.GKR\KIHQTVIGUEJTKGDGPG#WHNCIG +PFGWVUEJGT5RTCEJG5OKVJCPFMQNQTKGTVGP1TFGPUVCHGNPPGWKP*CNDNGFGTIGDWPFGP

 95


GESCHICHTE, GEMMEN, KAMEEN

1165

. 9'$'4 &#401.& 2-'+. 2 &KG 1TFGP FGU -ÌPKITGKEJU 5CEJUGP 2JCNGTKUVKUEJG /QPQITC   RJKGP1HHGPDCEJQ,5OKV\CJNTGKEJGPHCTDKIGP#DD-CTVQPKGTV#



. -1081.76 -QPXQNWV XQP /QPQITCRJKGP \WT FGWVUEJGP WPF GWTQR·KUEJGP 1TFGPUMWPFG WC /   )4+6<0'4 *CPFDWEJ FGT 4KVVGT WPF 8GTFKGPUVQTFGP CNNGT -WNVWTUVCCVGP FGT 9GNV KPPGTJCND FGU    ,CJTJWPFGTVU 0& )TC\  FGT #WUICDG .GKR\KI  , XQP (#.-'056+'0 +ORGTKCN #WUVTKCP   /GFCNUCPF&GEQTCVKQPU#WHNCIG*[TWO9$+)15<'95-#2QNUMKG1TFGT[K1F\PCE\GPKC 9CTUEJCW  8 /'4+%-# 1TFGP WPF #WU\GKEJPWPIGP  #WHNCIG 2TCI  -)   -.+'6/#00 &GWVUEJG #WU\GKEJPWPIGP $GTNKP  Q 8GTH &KG 1TFGP WPF 'JTGP\GKEJGP FGT   FGWVUEJGP5VCCVGP.GKR\KIQ,=/GJTGTG$GUKV\GTUVGORGN&T(:9GK\KPIGT%Q?&C\WHTCP\ÌUKUEJG WPFGPINKUEJG#WMVKQPUMCVCNQIG7PVGTUEJKGFNKEJIGDWPFGP  



2#2+'4)'.& . &'765%*' $70&'5$#0- (TÒJ\GKV FGU 2CRKGTIGNFGU $GKURKGNG CWU FGT )GNFUEJGKPUCOONWPI FGT   &GWVUEJGP $WPFGUDCPM (TCPMHWTV C/ Q, ::+ \CJNTGKEJG #DD OKV CWUHÒJTNKEJGT $GUEJTGKDWPI    &GWVUEJGU2CRKGTIGNF(TCPMHWTVC/Q,:\CJNTGKEJG#DD&CU2CRKGTIGNFKO&GWV UEJGP4GKEJ(TCPMHWTVC/Q,5OKV\CJNTGKEJGP6GZVCDD&KG0QVGPFGT&GWV UEJGP $WPFGUDCPM #NNG KP )CP\NGKPGP IGDWPFGP (TCPMHWTV C/ Q,  5 OKV \CJNTGKEJGP #DD   &C\W/QPQITCRJKGPWPFMNGKPG#WHU·V\G\WO6JGOC2CRKGTIGNFWC#2+%-&CU2CRKGTIGNF$C[ GTPU4GIGPUVCWH2CRKGTIGNF'KP*CPFDWEJHÒT5COONGTWPF.KGDJCDGT$TCWPUEJYGKI # 2+%-,7 4+:'0 2CRKGTIGNF5RG\KCNMCVCNQI &GWVUEJNCPF  DKU JGWVG  #WHNCIG /ÒPEJGP   7PVGTUEJKGFNKEJIGDWPFGP6GKNYGKUGUVQEMHNGEMKI  



. 0#%*64)'<7/*#0&$7%*&'4$#0-016'070&/ª0<'0'7412#5#WU\ÒIGCWU FGT  WPF  #DVGKNWPI FGT 'TMGPPWPIU\GKEJGP $CPF  KP  6GKNGP #. 08  9KGP    *WPFGTVG0CEJVTCIUDN·VVGTOKVXKGNGP#DD1TKI)CP\NGKPGPIGRHNGIV$CPFOKV(NGEMGPCWHFGO XQTFGTGP'KPDCPF#  



/GJTGTG$GUKV\GTUVGORGNCWHFGO6KVGNDNCVVXQP$CPF

)'5%*+%*6'#..)'/'+0)'//'070&-#/''0 . #-74)#. ' &KG -WPUV FGT *GVJKVGT /ÒPEJGP   5  6HP VGKNU HCTDKI .GKPGP VGKN   YGKUGHNGEMKI



. #06+-')'//'0+0&'765%*'05#//.70)'05VCCVNKEJG/ÒP\UCOONWPI/ÒPEJGP$CPF +  5 OKV  6HP /ÒPEJGP  +  5 OKV 6HP /ÒPEJGP+5OKV 6HP  /ÒPEJGP  5VCCVNKEJG /WUGGP 2TGW­KUEJGT -WNVWTDGUKV\ #PVKMGPCDVGKNWPI $GTNKP   $CPF ++5OKV6HPWPF#DD/ÒPEJGP$TCWPUEJYGKI)ÌVVKPIGP-CUUGN$CPF+++ 6GZV 6HP8+++56HP9KGUDCFGP*CPPQXGTWPF*CODWTI$CPF+86GZV 6HP 8+++56HP9KGUDCFGP.GKPGP  



. $'4)'4 . 4ÌOKUEJG )N·UGT CWU 8KPFQPKUUC 8GTÌHHGPVNKEJWPIGP FGT )GUGNNUEJCHV RTQ 8KPFQPKUUC   $CPF+8$CUGN56HP1TKI$TQUEJWTOKPKOCNDGUVQ­GP



. $1#4&/#0 ,5%#4+5$4+%- & 6JG 4CNRJ *CTCTK %QNNGEVKQP QH (KPIGT 4KPIU .QPFQP     5 OKV  #DD .GKPGP &C\W ,* -1.$##6 0'/'6* )QNFUEJOKGFGCTDGKVGP $WFCRGUV     5  #DD .GKPGP * $#66-' )GUEJKEJVG FGU 4KPIGU +P $GUEJTGKDWPI WPF $KNFGTP   $CFGP$CFGP   5  6HP .GKPGP $ %*#&1745#/2510 #PVKMG (KPIGTTKPIG &KG   5COONWPI#NCKP1NNKXKGT/ÒPEJGP5OKV\CJNTGKEJGPOGKUVGPUHCTDKIGP#DD.GKPGP&C\W YGKVGTGMNGKPGTG5EJTKHVGP7PVGTUEJKGFNKEJIGDWPFGP  



96


GESCHICHTE, GEMMEN, KAMEEN . $4+0%-/'+'4 ' 2TCMVKUEJGU *CPFDWEJ FGT JKUVQTKUEJGP %JTQPQNQIKG CNNGT <GKVGP WPF 8ÌNMGT DG   UQPFGTUFGU/KVVGNCNVGTU0&)TC\FGT#WUICDG$GTNKP::+85.GKPGP



. '+5'.'+0 , ,QJCPP 9KPEMGNOCPPU UCGOVNKEJG 9GTMG 6GKNG  &QPCWGUEJKPIGP +P GKPJGKVNKEJGP -CTVQPGKPD·PFGP FGT <GKV IGDWPFGP VGKNYGKUG UVQEMHNGEMKI 'KPD·PFG GVYCU DGUVQ­GP   $CPFOKVMNGKPGO9CUUGTTCPF#  



. )'$*#46 * )GOOGP WPF -COGGP $KDNKQVJGM HÒT -WPUV WPF #PVKSWKV·VGP  5COONGT $CPF    $GTNKP8+++5OKV#DD.GKPGP&C\WYGKVGTG$ÒEJGT\WO6JGOC.GKPGP Z $TQ UEJWT Z   



. )4''0/,5OCNN%WNV1DLGEVUHTQOVJG/KNKVCT[#TGCUQH4QOCP$TKVCKP$#41ZHQTF 5OKV\CJNTGKEJGP#DD1TKI$TQUEJWTOKPKOCNDGUVQ­GP



. *'-.'4#&KG$KNFPKUMWPUVFGT)TKGEJGPWPF4ÌOGT5VWVVICTV:.8+++56HPOKV #DD-CTVQPKGTVDGUVQ­GP$KPFWPINQEMGT



. *'0+) / # %QTRWU QH 4QOCP 'PITCXGF )GOUVQPGU HTQO$TKVKUJ5KVGU$#41ZHQTF 56HP1TKI$TQUEJWTOKPKOCNDGUVQ­GP4ÒEMGPGVYCUDGUEJ·FKIV



. *'00'#/4*;014KVVGT UIGQITCRJKUEJUVCVKUVKUEJGU.GZKMQPÒDGTFKG'TFVJGKNG.·PFGT/GGTG $WEJVGP*·HGP5GGP(NÒUUG+PUGNP)GDKTIG5VCCVGP5V·FVG(NGEMGP&ÌTHGT9GKNGT$·FGT$GTI YGTMG -CP·NG OKV #PICDG U·OVNKEJGT 2QUV 'KUGPDCJPGP WPF 6GNGITCRJGP5VCVKQPGP FGT YKEJVKIUVGP   .·PFGTHÒT2QUV$WTGCWZ%QORVQKTU-CWHNGWVG(CDTKMCPVGP<GKVWPIUNGUGT4GKUGPFG4GCN+PFWUVTKG WPF *CPFGNUUEJWNGP 0CEJFTWEM 'UUGP  FGT  #WHNCIG .GKR\KI  8+  5 -WPUVNGFGT   //#)



. *1%*7.+);5'. # -NGKPCUKCVKUEJG )NCUKGTVG 4GNKGHMGTCOKM  X %JT DKU  P %JT  WPF KJTG   1DGTKVCNKUEJGP0CEJCJOWPIGP#EVC$GTPGPUKC8++$GTP56HP.GKPGPVGKNYGKUGHNGE MKI



. *140 *)4ª)'4 %$ *TUI  &KG 0WOKFGT 4GKVGT WPF -ÌPKIG PÌTFNKEJ FGT 5CJCTC $QPP   56HP\WO6GKNHCTDKI-CTVGP-CTVQPKGTV



. +22'. # &GT $TQP\GHWPF XQP )CNLÑD /QFGNNG GKPGU JGNNGPKUVKUEJGP )QNFUEJOKGFU  2GNK\CGWU/W   UGWO\W*KNFGUJGKO9KUUGPUEJCHVNKEJG8GTÌHHGPVNKEJWPIGP$GTNKP5WPF6HP-CTVQ PKGTVOKPKOCNDGUVQ­GP



. -+66'.'5KGIGN$TCWPUEJYGKI85OKV\CJNTGKEJGP#DD)CP\NGKPGP



. -¤0+) 6 *KUVQTKUEJIGQITCRJKUEJGT *CPF#VNCU \WT NVGTP /KVVNGTP WPF 0GWGTP )GUEJKEJVG 9QN   HGPDÒVVGN-CTVGP*CNDNGFGTUVCTMDGUVQ­GP5VQEMHNGEMKI9CUUGTHNGEMGP



. .#*75'0)(14/+).+'4ÌOKUEJG$KNFPKUUGCWU$TQP\G-WPUVWPF6GEJPKM/ÒPEJGP 5OKV\CJNTGKEJGPVGKNUHCTDKIGP#DD)CP\NGKPGP#



. .+221.& ) *TUI  )GOOGP WPF -COGGP FGU #NVGTVWOU WPF FGT 0GW\GKV :++  5  6HP   -CTVQPKGTV



. .7..+'54)TKGEJKUEJG2NCUVKM8QPFGP#PH·PIGPDKU\WO#WUICPIFGU*GNNGPKUOWU#WHNCIG /ÒPEJGP  FGT #WUICDG /ÒPEJGP   5  6HP  (CTDVHP 1TKI )CP\NGKPGP   #



. /#46+0+9&KGGVTWUMKUEJG4KPIUVGKPIN[RVKM*GKFGNDGTI56HP1TKI$TQUEJWT



. /')1994-COGGPXQP#WIWUVWUDKU#NGZCPFGT5GXGTWU#/7)5$GTNKP:8+ 56HP.GKPGP



. /'0<'.*#PVKMG.CORGPKO4ÌOKUEJ)GTOCPKUEJGP<GPVTCNOWUGWO\W/CKP\4ÌOKUEJ)GTOC PKUEJGU<GPVTCNOWUGWO\W/CKP\-CVCNQI/CKP\8+++5OKV#DD*CNDNGKPGP



. 0'66.'(1.&(,6JG%QNNGEVKQPQH$TQP\GUCPF%CUVKPIUKP$TCUUCPF1TOQNWHQTOGFD[/T(, 0GVVNGHQNF.QPFQP(TQPVKURK\5OKV6HP.GKPGPOKPKOCNDGUVQ­GP



. 146*/#00 9 &KG -GTCOKM FGT HTÒJGP $TQP\G\GKV CWU +PPGTCPCVQNKGP $GTNKP   5    6HP*CNDNGKPGP



. 156'0**XQPFGT#PEKGPV1TKGPVCN5GCNUKPVJG%QNNGEVKQPQH/T'FYCTF60GYGNN6JG7PKXGT UKV[QH%JKECIQ1TKGPVCN+PUVKVWVG2WDNKECVKQPU8QNWOG::++%JKECIQ:+++56HP.GK PGP



. #NVQTKGPVCNKUEJG5KGIGNUVGKPGFGT5COONWPI*CPU5KNXKWUXQP#WNQEM5VWFKC'VJPQITCRJKEC7RUCNKGPUKC :+++7RRUCNC56HP.GKPGP



. 2'5%*.19$+0&1-#6 #2'5%*.19 7 &KG 5COONWPI 6WTCP $GNGT KP -WODCDC DGK 5KNG   #PVKMG WPF D[\CPVKPKUEJG &GPMO·NGT XQP FGT DKVJ[PKUEJGP 5EJYCT\OGGTMÒUVG 5& CWU +UVCPDWNGT /KV   VGKNWPIGP$CPF6ÒDKPIGPQ,56HP1TKI$TQUEJWT

 97


GESCHICHTE, GEMMEN, KAMEEN

1196

1201

. 4+%*6'4)/#%CVCNQIWGQH'PITCXGF)GOU)TGGM'VTWUECPCPF4QOCP4QO:.++ 56HP.GKPGPVGKNYGKUGUVQEMHNGEMKI



. 5%*'(1.&-/GKUVGTYGTMGITKGEJKUEJGT-WPUV$CUGN5VWVVICTV(CTDKIGU(TQPVKURK\:++ 5OKV#DD.GKPGP&C\W5#7'4.#0&6/)TKGEJKUEJG$KNFYGTMG&ÒUUGNFQTH.GKR\KI :85OKV#DD:51TKI$TQUEJWT#WUUVGNNWPIUMCVCNQI1N[ORKCKPFGT#PVKMG'UUGP 56HP1TKI$TQUEJWT$WEJDNQEMIGNÌUV  



. 5%*7.6'0#.yCHTKSWG4QOCKPG5&2CTKUCWU.C4GXWG6WPKUKGPPG56HP2CRR DCPF



/KV9KFOWPIFGUªDGTUGV\GTU&T(NQTCPEGCPOQPUKGWT(GWCTFGPV

. 5+'8'-+0), *TUI &KG$TQP\GPFGT5COONWPI.QGD/ÒPEJGP56HP-CTVQPKGTV



. &KG6GTTCMQVVGPFGT5COONWPI.QGD/ÒPEJGP$·PFG:8+56HP:8++:8+++ 56HP*CNDNGFGTDGUVQ­GP-QRHIQNFUEJPKVV  



. $TQP\GP 6GTTCMQVVGP 8CUGP CWU FGT 5COONWPI .QGD /ÒPEJGP   5  6HP .GKPGP -QRH   IQNFUEJPKVV



. 81+6..GUGDWEJFGT#PVKMG$CPF555LGYGKNUOKV#DD.GKPGP  



. 81..'09'+&'4/.&KG2QTVT·VIGOOGPFGTTÌOKUEJGP4GRWDNKM$·PFG/CKP\:+++ 5856HP)CP\NGKPGP  



. 9'$'4 +5 )GUEJPKVVGPG 5VGKPG FGU  DKU  ,J 8GTIGUUGPG -QUVDCTMGKVGP KP FGT 5VCCVNKEJGP   /ÒP\UCOONWPI /ÒPEJGP /ÒPEJGP   5 OKV \CJNTGKEJGP #DD )CP\NGKPGP  )GUEJPKVVGPG   5VGKPG CWU CNVDC[GTKUEJGO $GUKV\ -COGGP WPF +PVCINKGP FGU  DKU UR·VGP  ,J KP FGT 5VCCVNKEJGP   /ÒP\UCOONWPI/ÒPEJGP/ÒPEJGP$GTNKP5OKV\CJNTGKEJGP#DD)CP\NGKPGP  



. 9'$'4 1 #NVQTKGPVCNKUEJG 5KGIGNDKNFGT  $·PFG .GKR\KI   5 8+++  6HP +P GKPGO   $CPF KP *CNDNGKPGP IGDWPFGP =/KV JCPFUEJTKHVNKEJGP $GUKV\GTXGTOGTM ' $GEMGPDCWGT? &C\W &CU   4QNNUKGIGN KP 5[TKGP <WT 5VGKPUEJPGKFGMWPUV KP 5[TKGP \YKUEJGP  WPF  XQT %JTKUVWU #WUUVGN   NWPIUMCVCNQI6ÒDKPIGP5OKV\CJNTGKEJGP#DD1TKI$TQUEJWT  



. <9+'4.'+0&+'*.'&KGCPVKMGP)GOOGPFGU-WPUVJKUVQTKUEJGP/WUGWOUKP9KGP$CPF+&KG )GOOGP XQP FGT OKPQKUEJGP <GKV DKU\WTHTÒJGPTÌOKUEJGP-CKUGT\GKV/ÒPEJGP5OKV 6HP $CPF ++ &KG )NCUIGOOGP &KG )NCUMCOGGP 0CEJVT·IG \W $CPF + &KG )GOOGP FGT UR·VGTGP   TÌOKUEJGP-CKUGT\GKV6GKN+)ÌVVGT/ÒPEJGP5OKV6HP.GKPGPOKV5EJWV\WOUEJNCI

 



98


FESTSCHRIFTEN

('565%*4+(6'0 . #/'4+%#007/+5/#6+%51%+'6;*+0)*1.6 *TUI %GPVGPPKCN2WDNKECVKQPQHVJG#OG TKECP0WOKUOCVKE5QEKGV[0GY;QTM:++56HP.GKPGP//#)



. #45.#0 '# 4 /#46+0+0 8+5/#4# *TUI  'TOCPPQ # #TUNCP 5VWFKC &KECVC  $·PFG   /KNCPQ5FCXQP6HP#DD-CTVQPKGTV//#)  



. $#-*17/ 5 & )'4+0# )'+55'0/ #/#0&4; *TUI  #GI[RVKCEC UGTVC KP 5QJGKT $CM   JQWO OGOQTKCO /¾NCPIGUFGPWOKUOCVKSWGFyKEQPQITCRJKGGVFyJKUVQKTG/KNCPQ5OKV 6HP-CTVQPKGTVOKPKOCNDGUVQ­GP



. $'4)*#75 2 6 (+5%*'42 +.+5%* *TUI  .CIQO (GUVUEJTKHV HÒT 2GVGT $GTIJCWU \WO    )GDWTVUVCICO0QXGODGT/ÒPUVGT(TQPVKURK\:+85OKV\CJNTGKEJGP#DDWPF 6HP)CP\NGKPGP



. $.1'5%* * *2 +5.'4) 5'+6'4.' *TUI  <WT ITKGEJKUEJGP -WPUV *CPULÌTI $NQGUEJ \WO   UGEJ\KIUVGP)GDWTVUVCICO,WNK$GTP56HP-CTVQPKGTV



. $15%*%'#6.#05$#;&740 16'-+0#'41. *TUI #PEKGPV*KUVQT[0WOKUOC VKEUCPF'RKITCRJ[KPVJG/GFKVGTTCPGCP9QTNF5VWFKGUKPOGOQT[QH%NGOGPU'$QGUEJCPF5CDCJCV #VNCPCPFKPJQPQWTQH0G\CJCV$C[FWT+UVCPDWN::+5OKVXKGNGP6HP-CTVQPKGTV'EMGP DGUVQ­GP



. $7%*'0#7 * *GKPTKEJ $WEJGPCW CO  #RTKN   ,CJTG CNV )GYKFOGV XQP (TGWPFGP WPF   -QNNGIGP/ÒPEJGP$TGOGP51TKI$TQUEJWT//#)



. %.#+056'(#0'..+ '' +VCNKCO HCVQ RTQHWIK *GURGTKPCSWG XGPGTWPV NKVQTC 0WOKUOCVKE 5VWFKGU   &GFKECVGFVQ8NCFKOKTCPF'NXKTC'NK\C%NCKP5VGHCPGNNK0WOKUOCVKEC.QXCPKGPUKC.QWXCKPNC0GWXG ::+++5OKV\CJNTGKEJGP#DDWPF6HP.GKPGP//#)



. %1.$'46&'$'#7.+'7,$%$'/106WC *TUI /¾NCPIGUQHHGTVUCWFQEVGWT,$%QNDGTV FG$GCWNKGW6QWNQWUG(TQPVKURK\:::5OKV\CJNTGKEJGP#DDWPF6HP1TKI)CP\NGKPGP //#)



'ZGORNCT0T

. &'$14&22$470 *TUI 5ETKRVC#PCVQNKEC*QOOCIGU¯2KGTTG&GDQTF#WUQPKWU¾FKVKQPU $QTFGCWZ5OKV#DDWPF6HP-CTVQPKGTVOKPKOCNDGUVQ­GP



. (4#0-(746'4 07/+5/#6+5%*' )'5'..5%*#(6  ,CJTG (TCPMHWTVGT 0WOKUOCVKUEJG   )GUGNNUEJCHV/GNUWPIGP5OKVXKGNGP#DD)CP\NGKPGP#



. )4#06 / /2 )#4%+#$'..+&1# /156#.#%# ,+/'0'< *TUI  &GN +ORGTKWO FG   2QORG[QCNC#WEVQTKVCUFG#WIWUVQ*QOGPCLGC/KEJCGN)TCPV#PGLQUFG#TEJKXQ'URCPQNFG#TSW GQNQIÃC:.8++/CFTKF5OKVXKGNGP#DDWPF6HP1TKI$TQUEJWT



. )4+'4510 2 %0. $411-' WC *TUI   5VWFKGU KP 0WOKUOCVKE /GVJQF RTGUGPVGF VQ 2JKNKR   )TKGTUQP%CODTKFIGWC(TQPVKURK\:::5FCXQP6HP)CP\NGKPGP#



. *#$'4.+0',/XQP$#*4('.&6 *TUI 'TPUV,WUVWU*CGDGTNKP5GKP9KTMGPKP9KUUGPUEJCHV WPF.GDGP/ÒPEJGP(TQPVKURK\56HP1TKI$TQUEJWT



. *#%-'056/17%*#46')WC *TUI .KDGT#OKEQTWO6QP[*CEMGPU0WOKUOCVKEC.QXC PKGPUKC.QWXCKPNC0GWXG:8+5OKV\CJNTGKEJGP6HP1TKI)CP\NGKPGP



. +#204/#4)1.+5*81')6.+0WOKUOCVKEU9KVPGUUVQJKUVQT[+#202WDNKECVKQP9GVVGTGP :856HP.GKPGP//#)



. ,'.1%0+- # 2 -15&'/1 *TUI  5VWFKC PWOKUOCVKEC .CDCEGPUKC #NGZCPFTQ ,GNQEPKM QDNCVC   5KVWNC.LWDNLCPC(TQPVKURK\5OKV\CJNTGKEJGP#DDWPF6HP-CTVQPKGTVOKPKOCNDGUVQ ­GP//#)



. -41..,*2)XCP#.('0 *TUI #IQTCPQOKC5VWFKGUKP/QPG[CPF'ZEJCPIG2TGUGPVGFVQ ,QJP*-TQNN0GY;QTM:++56HP.GKPGPOKV5EJWV\WOUEJNCI



. .#(#74+' , 2 $#56+'0 WC *TUI  /¾NCPIGU FG PWOKUOCVKSWG F CTEJ¾QNQIKG GV F JKUVQKTG   QHHGTVU ¯ ,GCP .CHCWTKG 2CTKU  (TQPVKURK\  5  6HP 1TKI$TQUEJWT OKPKOCN DGUVQ­GP   //#)

 99


FESTSCHRIFTEN

1226

. /1//5'0 6 */ XQP -#'0'./ 4#.(¤.&+7 2'6'4* -1//+%- )GNFIGUEJKEJVG   XU 0WOKUOCVKM 6JGQFQT /QOOUGP WPF FKG CPVKMG /ÒP\G $GTNKP  2QTVTCKVVH :+8  5    6HP-CTVQPKGTV



. 0#56'4255%*''45 *TUI 5VWFKC2CWNQ0CUVGTQDNCVC$CPF0WOKUOCVKECCPVKSWC1TKGP VCNKC.QXCPKGPUKC#PCNGEVC.GWXGP:::+++5FCXQP6HP.GKPGP//#)



. 1+-101/+&'5 / :#2#-6*2 #RJKGTÊOC UV½ /CPVQ 1KMQPQOKFQW #VJGP   5 OKV   XKGNGP6HP1TKI$TQUEJWT



. 24+%' /, #2 6<#/#.+5 *TUI  /CTVKP , 2TKEG 6GZVU KP )TGGM  'PINKUJ $KDNKQVJGMG VGU   GNNGPKMGUPQOKUOCVKMGUGVCKRGKCU#VJGP(CTDKIGU(TQPVKURK\5OKVXKGNGP#DDWPF6HP FCXQPKP(CTDG1TKI$TQUEJWT)GDTCWEJUURWTGPCO'KPDCPF//#)



. 5%*''45 5 , XCP *''5%*+ *''4'0 *TUI  %QKPCIG KP VJG +TQP #IG 'UUC[U KP JQPQWT QH   5KOQPG5EJGGTU.QPFQP::++5OKV\CJNTGKEJGP#DD.GKPGPOKV5EJWV\WOUEJNCI



. 5%*¤0'46)'+55 ' 7 2'6'4 *TUI  5VGRJCPQU PQOKUOCVKMQU 'FKVJ 5EJÌPGTV)GKUU \WO    )GDWTVUVCI$GTNKP:8+++5OKV\CJNTGKEJGP#DDWPF6HP-CTVQPKGTV//#)



. 51%+'6'(4#0•#+5'&'07/+5/#6+37'%GPVGPCKTGFGNC5QEK¾V¾HTCPECKUGFG0WOKUOCVKSWG 2CTKU5OKV\CJNTGKEJGP6HP1TKI$TQUEJWTDGUVQ­GP



. 576*'4.#0& * 4#) %#4510%/ -4##; *TUI  5ETKRVC 0WOOCTKC 4QOCPC 'UUC[U   RTGUGPVGF VQ *WORJTG[ 5WVJGTNCPF .QPFQP  (TQPVKURK\ :+++  5  6HP .GKPGP //#)   



. 8'4'+0&'4/ª0<'0(4'70&'+0*#/$74)G8 (GUVUEJTKHV\WOL·JTKIGP$GUVGJGPFGU 8GTGKPU FGT /ÒP\HTGWPFG KP *CODWTI G8 0QTFFGWVUEJGU ,CJTDWEJ HÒT /ÒP\MWPFG WPF XGTYCPFVG   )GDKGVG  *CODWTI   5 OKV XKGNGP #DD -CTVQPKGTV ='U JCPFGNV UKEJ WO FCU  XQP    'ZGORNCTGPFKGUGU9GTMGU?(GUVUEJTKHV\WO)GDWTVUVCIFGU*GTTP&TLWT)GGTV5GGNKICO 0QXGODGT0QTFFGWVUEJGU,CJTDWEJHÒT/ÒP\MWPFGWPFXGTYCPFVG)GDKGVG*CODWTI 5OKVXKGNGP#DDWPF6HP.GKPGP='UJCPFGNVUKEJWOFCUXQP'ZGORNCTGPFKGUGU9GTMGU?



. 9ª466'/$'4)+5%*'48'4'+0(ª4/ª0<-70&'G8 *TUI $GKVT·IG\WT5ÒFFGWVUEJGP /ÒP\IGUEJKEJVG(GUVUEJTKHV\WOL·JTKIGP$GUVGJGPFGU9ÒTVGODGTIKUEJGP8GTGKPUHÒT/ÒP\ MWPFGG85VWVVICTV5OKV#DD-CTVQPKGTV



100


ZEITSCHRIFTEN UND REIHEN

<'+65%*4+(6'070&4'+*'0 . #007#+4'&'.#51%+'6'(4#0•#+5'&'07/+5/#6+3''6& #4%*'1.1)+'$CPF   'KPJGKVNKEJKPTQVGO*CNDNGFGTOKV)QNFUEJPKVVIGDWPFGP  



. #4%*+8 (ª4 /'&#+..'0 70& 2.#-'66'0-70&' 4GFCMVKQP 2TQH &T ) *CDKEJ WPF   &T/$GTPJCTV,CJTICPI*GHVG MQORNGVVG4GKJG *CNNG1TKI$TQUEJWT  



. #4—6*75'4GXWGVTKOGUVTKGNNG*TUIXQP,$#$'.102& '52'%'.$CPF   'KPJGKVNKEJKP$·PFGPKP*CNDNGFGTIGDWPFGP4ÒEMGPVGKNYGKUGOKVMNGKPGP-TCV\GTP//#)   +PFKGUGT8QNNUV·PFKIMGKVWPF'TJCNVWPIUGJTUGNVGP



. $'4+%*6'*I**-TKEJGNFQTH&GT/ÒP\GPWPF/GFCKNNGPUCOONGT$GTKEJVG#WUCNNGP)GDKG VGP FGT )GNF /ÒP\GP WPF /GFCKNNGPMWPFG (TGKDWTI   WPF  DTQUEJKGTV FKG   CPFGTGP*GHVGUKPFKPFTGK$·PFGPKP)CP\NGKPGPIGDWPFGP'UHGJNV*GHV0T



. $'4.+0'4/ª0<$.66'40GWG(QNIG$CPFWPF*GHVG   $CPFWPFKP*CNDNGKPGPIGDWPFGP$CPFWPFKPGKPJGKVNKEJGO *CNDNGKPGP IGDWPFGP 4GIKUVGT FGT ,CJTI·PIG  UQYKG FKG *GHVG  WPF  KP (QVQMQRKG   &C\WGKPKIGNQUG*GHVG



. $'4.+0'4 07/+5/#6+5%*' (145%*70)'0 *TUIXQP*(GPINGT$-NWIGWPF5VCCVNK EJG/WUGGP\W$GTNKP$CPF  1TKI$TQUEJWT#  



. $'4.+0'407/+5/#6+5%*'<'+65%*4+(6$CPF*GHVG6HP*GHVG   .QUG*GHVG



. $.66'4 (ª4 /ª0<(4'70&' *TUI XQP * )TQVG HQTVIGHÒJTV XQP,WPF#'TDUVGKP* $WEJGPCW'/GTVGPUWPF4)CGVVGPU$CPF  +PGKPGO$CPFIGDWPFGP2CRRDCPF DGUVQ­GP



. $CPF    +P  $·PFGP IGDWPFGP *CNDNGKPGP 7PVGTUEJKGFNKEJG $KPFWPIGP Z 4ÒEMGP   FGHGMV  



6TQV\FGT.ÒEMGPKPVGTGUUCPVG4GKJGFKGUGT<GKVEJTKHV

/KV'ZNKDTKU#NQKU5VGTP$GPGFKMVDGWGTP

. $CPF  .QUG*GHVG



. 0GWG(QNIG,CJTICPI  $CPF ,I KP*CNDNGKPGPIGDWPFGPWPF,IKP )CP\NGKPGPIGDWPFGPUQPUVNQUG*GHVG'UHGJNGPPWT*GHVWPF6H



. 0GWG(QNIG$CPFWPF  .QUG*GHVG . -QPXQNWVXQP\CJNTGKEJGPNQUGP*GHVGP

 

. $.66'4 (ª4 /ª0<-70&' *I * )TQVG $CPF   6KVGNDNCVVCWHIGMNGDVGKPKIG6CHGNP NQEMGT WPF TGUVCWTKGTV 5VQEMHNGEMKI 'KPTKUU CWH FGP 5 #WH FGP 5HGJNVGKP6GKNFGT 5GKVGP/KVYGPKIGP$NGKUVKHVCPOGTMWPIGP*CNDNGFGTDGUVQ­GP



. %1/6'54'0&75 &' .# 51%+'6' (4#0%#+5' &' 07/+5/#6+37' '6 & #4%*'1   .1)+'$CPF  'KPJGKVNKEJKPDTCWPGO)CP\NGFGTIGDWPFGP&C\W5GTKG6QOG+ 2TGOKGT 2CTVKG    5GTKG 6QOG+5GEQPFG2CTVKG  5GTKG6QOG+6TGUKGOG2CTVKG

 $TQUEJKGTV Z     W­GTUVUGNVGPCPIGDQVGPG<GKVUEJTKHV

. &'765%*' /ª0<$.66'4 0GWG (QNIG $CPF  ,WNK5GRVGODGT   *CNDNGKPGP   WPVGTUEJKGFNKEJIGDWPFGP6KVGNWPF4GIKUVGTXQP$FHGJNGP//#)  



. &'765%*'5 ,#*4$7%* (ª4 07/+5/#6+- *TUI XQP / $GTPJCTV ( &YQTUEJCM *   )GDJCTVWPF#5WJNG$CPF  $TQUEJKGTV  



8QNNUV·PFKIG5GTKGFGT<GKVUEJTKHV

1253

. (4#0-(746'4 /ª0<$.66'4 UGKV  (4#0-(746'4 /ª0<<'+670) $CPF   

 +PGKPGO$CPFKP*CNDNGKPGPIGDWPFGP'KPKIG#PUVTGKEJWPIGPKO6GZVWPFCWHFGP6HP 'ZNKDTKUWPF$GUKV\GTUVGORGN)*.QEMPGT9ÒT\DWTIWPF$GUKV\GTUVGORGN*KUVQTKUEJGT8GTGKP#NV9GTVJGKO

 101


ZEITSCHRIFTEN UND REIHEN . (4#0-(746'4 /ª0<<'+670) *TUI XQP 2 ,QUGRJ WPF FGT (TCPMHWTVGT 0WOKUOCVKUEJGP   )GUGNNUEJCHV,CJTICPI  0GWG(QNIG,CJTICPI  QJPG 6KVGNWPF4GIKUVGT&C\WNQUG*GHVG*CNDNGKPGP Z DTQUEJKGTV



. 0GWG(QNIG,CJTICPI  +P\YGK$·PFGPKP*CNDNGKPGPIGDWPFGP6HNQUG



. *#/$74)'4 $'+64)' <74 07/+5/#6+- *TUI XQP 9 *·XGTPKEM WPF ) *CV\ CD   $CPF *GHV  $TQUEJKGTV  



*GHVOKVJCPFUEJTKHVNKEJGP$GUKV\GTXGTOGTM

. ,#*4$7%*&'507/+5/#6+5%*'08'4'+05<7&4'5&'0,CJTICPI  1TKI$TQ UEJWT4ÒEMGPIGTKPIHÒIKIGKPIGTKUUGP*CNDDCPFOKVMNGKPGO9CUUGTTCPF  



. ,#*4$7%* (ª4 07/+5/#6+- 70& )'.&)'5%*+%*6' *TUI XQP FGT $C[GTKUEJGP 0W   OKUOCVKUEJGP)GUGNNUEJCHV,0)$CPF WPF  /ÒPEJGP  1TKI$TQUEJWT $CPF  WPF   WPF  UQYKG  WPF  LGYGKNU KP   GKPGO$CPFIGDWPFGP  



. ,1740#. +06'40#6+10#. & #4%*—1.1)+' 07/+5/#6+37' *TUI XQP , 0   58141015$CPF  'KPJGKVNKEJKPOQFGTPGP)CP\NGKPGPIGDWPFGP&C\W5&CWU #VJGPU#PPCNUQH#TEJCGQNQI[$TQUEJKGTV  



. $CPF    &C\W GKPKIG 'KP\GNJGHVG XGTUEJKGFGPGT PWOKUOCVKUEJGT <GKVUEJTKHVGP \W 6JGOGP FGT   CPVKMGP 0WOKUOCVKM WC ,0)    *$0    /$0)      

              #NNGU 0CEJFTWEMG 00#  00$   FKXGTUG'KP\GNJGHVGWPFGKPKIG2TGKUNKUVGP  



1261

. /+66'+.70)'0&'4$#;'4+5%*'007/+5/#6+5%*'0)'5'..5%*#(6,CJTICPI *CWRVTGIKUVGT   *CNDNGFGT Z Z 4ÒEMGP FGHGMV  *CNDNGKPGP Z $TQUEJKGTV Z 6GKN YGKUGWPCWHIGUEJPKVVGP  



8QNNUV·PFKIG5GTKGFKGUGTYKEJVKIGP<GKVUEJTKHVCNU1TKIKPCNCWUICDG

. /+66'+.70)'0 (ª4 /ª0<5#//.'4 *TUI XQP ' -0+66'45%*'+& WPF , *#/   $74)'4,CJTICPI  +PGKPGP$CPFKP)CP\NGKPGPIGDWPFGP//#)



8QNNUV·PFKIG5GTKGFKGUGT<GKVUEJTKHV

. /10#65$.#66&'407/+5/#6+5%*'0)'5'..5%*#(6+09+'0$CPF   )CP\NGKPGP



. 01/+5/#6+-#:410+-#*TUIXQPFGT)TKGEJKUEJGP0WOKUOCVKUEJGP)GUGNNUEJCHV$CPF

 1TKI$TQUEJWT  



. 07/+5/#6+% %*410+%.' *TUI XQP FGT 4Q[CN 0WOKUOCVKE 5QEKGV[ .QPFQP ,CJTICPI    WPF#NNGKPGKPJGKVNKEJGPTQVGO)CP\NGKPGPIGDWPFGP  



102


ZEITSCHRIFTEN UND REIHEN . 07/+5/#6+%%+4%7.#4*TUIXQP5RKPM5QP.QPFQP$CPF.QPFQP 'KPJGKVNKEJKP)CP\NGKPGPIGDWPFGP  



. 07/+5/#6+%-« %#512+5 %'5-15.18'05-« $CPF  WPF    +O $CPF 8+++   24+$+.$8GT\GKEJPKUFGT9GKJGOÒP\GPMCVJQNKUEJGP/GFCKNNGPWPF,GVQPGKPFGT6UEJGEJUNQYCMGK +PGKPGO$CPFKP)CP\NGKPGPIGDWPFGP



. 07/+5/#6+5%*' /+66'+.70)'0 0ª40$'4) *TUI XQP %( )GDGTV 7PIG\·JNVG /KVVGK   NWPIUDN·VVGTDGIKPPGPFOKVFGT0T  DKU\WT0T  



. 07/+</#6+%#4 *TUI 5GTDKCP 0WOKUOCVKE 5QEKGV[ 5CQRKU \C CPVKEMK + UVCTK LWPIQUNQXGPUMK PQ   XCE$GQITCF/CK5OKV\CJNTGKEJGP#DD$TQUEJKGTV



/GKUV FGWVUEJURTCEJKIG $GKVTCIG WC XQP ( &YQTUEJCM  *CDUDWTIKUEJG 5KGIGN WPF /ÒP\GP  - 2KPM  'ZCIKC   UQNKFK )'NOGT 4ÌOKUEJGT)QNFDCTTGPCWU5KTOKWO0CKUUWUWPF6JGUUCNQPKEC 

. $CPF$GNITCF$TQUEJKGTV  



. 37#&'40+6+%+0'5+0WOKUOCVKECGCPVKEJKV¯ENCUUKEJG$CPFWPF  1TKI $TQUEJWTOKPKOCNDGUVQ­GP  



1272

1273

. 4'87' $'.)' &' 07/+5/#6+37' '6 &' 5+)+..1)4#2*+' *TUI XQP FGT 5QEK¾V¾   4Q[CNGFG0WOKUOCVKSWGFG$GNIKSWG$CPF  4GIKUVGTDCPF$KUCWHFKG $·PFG FKGUGDTQUEJKGTV CNNGKPHCUVGKPJGKVNKEJGOTQVGP*CNDNGFGTIGDWPFGP DKU OKV)QNFUEJPKVV     6CFGNNQUG'TJCNVWPIOKVFGPUGNVGPGPHTÒJGP$·PFGPFKGUGTYKEJVKIGPPWOKUOCVKUEJGP<GKVUEJTKHV·W­GTUVUGNVGPUQ XQNNUV·PFKICPIGDQVGP

. 4'87'07/+5/#6+37'$GITÒPFGVCNU4'87'&'.#07/+5/#6+37'(4#0•1+5'XQP '%#46+'4.&'.#5#755#;'5GTKG  4GIKUVGTDCPFWPF $KU CWH FKG ,CJTI·PIG  FKGUG DTQUEJKGTV  CNNG KP HCUV GKPJGKVNKEJGO YGK­GP )CP\NGFGTGKPDCPF   IGDWPFGP    6CFGNNQUGWPFXQNNUV·PFKIG4GKJGFKGUGTUGNVGPGPWPFYKEJVKIGP<GKVUEJTKHVFKGGTUVGP,CJTI·PIGUKPF·W­GTUVUGNVGP

. 5GTKG  $CPF    5GTKG   GU HGJNV $CPF    5GTKG      $CPF  5GTKGWPFKPGKPJGKVNKEJGO)CP\NGKPGP Z $CPFKP1TKI $TQUEJWT Z     . 5%*9'+<'4+5%*' 07/+5/#6+5%*' 470&5%*#7 $GTP *TUI XQP FGT 5EJYGK\GTKUEJGP   0WOKUOCVKUEJGP )GUGNNUEJCHV $CPF  &GT 5EJCV\HWPF XQP %QTEGNNGURT½U2C[GTPG         WPF         #NNG KP 1TKI   $TQUEJWT4ÒEMGPWPF'KPD·PFGVGKNYGKUGDGUEJTKHVGVWPFGVYCUUEJOWV\KI2CRKGTDGK$CPFIGYGNNV

 



'PJ·NVCWEJFGP#WHUCV\XQP,GPMKPUÒDGTFKG5KEKNQ2WPKUEJGP6GVTCFTCEJOGP

. 9+'0'407/+5/#6+5%*'/10#65*'(6'$CPF  +P\YGK$·PFGPKP*CNDNGK PGPIGDWPFGP7PVGTUEJKGFNKEJG$KPFWPIGP6GKNYGKUGUVQEMHNGEMKI$KPFWPIGVYCUNQEMGT9GPKIG6HP NQUG  



. -1081.76 -QPXQNWV XQP 'KP\GND·PFGP QFGT MNGKPGP 5GTKGP XQP \WOGKUV GWTQR·KUEJGP PWOKUOCVK   UEJGP<GKVUEJTKHVGPFCTKPGPVJCNVGPXKGNGKPVGTGUUCPVGWPFYKEJVKIG#WHU·V\GXGTUEJKGFGPG*GTCWUIG DGT)CP\NGKPGP Z *CNDNGKPGP Z $TQUEJWT

 103


AUKTIONSKATALOGE

#7-6+105-#6#.1)' . $#.. 4 $GTNKP #WMVKQP  XQO  *CNDNGKPGP OKV $NGKUVKHVPQVK\GP #WMVKQP  XQO   1TKI$TQUEJWT#WMVKQPXQO1TKI$TQUEJWT#WMVKQPXQOOKV 5EJ·V\NKUVG1TKI$TQUEJWT#WMVKQPXQOOKV5EJ·V\NKUVG1TKI$TQUEJWT#WMVKQPXQO  OKV 5EJ·V\NKUVG *CNDNGFGTDGKIGUEJTKGDGPG2TGKUG#WMVKQPXQOOKV5EJ·V\NK UVG  



. #WMVKQPXQO5NI-PQDNCWEJ/KVVGNCNVGT0GW\GKV5NI5VTWRR5CEJUGP'TPGUVKPGTDGU -NCRROÒV\GPVCNGT  0TP  6HP  #WMVKQPXQO0GW\GKV0TP6HP #WMVKQP  XQO  7PKXGTUCN DGU (WNFC  0TP  6HP 5.  #WMVKQP  XQO    5NI *GKNDTWPP  5CEJUGP )QNFOÒP\GP 4CTKV·VGP  0TP  6HP 5.  #WMVKQP    XQO#PVKMG/ÒP\GP0TP6HP#WMVKQPXQO&WDNGVVGPFGUUVCCVNK EJGP/ÒP\MCDKPGVVU$GTNKPWC7PKXGTUCNDGU/KVVGNCNVGT(WPFXQP+UVTWU/ÒP\GP$TGOGP)GIGP UVGORGN  0TP  6HP 5.  #WMVKQP  XQO 7PKXGTUCNDGU$TCPFGPDWTI2TGW­GP $TCWPUEJYGKI /CPUHGNF  0TP  6HP 5. OKV DGKIGUEJTKGDGPGP 2TGKUGP  #WMVKQP  XQO   =5NI2TKP\.GQRQNFXQP2TGW­GP?1TFGP.ÌUGT0TP6HP5.+PFTGK$·PFGPKP )CP\NGKPGPVCFGNNQUIGDWPFGP  



. 8GTMCWHUMCVCNQIXQP$GUQPFGTU$TCPFGPDWTIWPF#PVKMG +P FTGK $·PFGP KP )CP\NGKPGP VCFGNNQU IGDWPFGP FC\W \CJNTGKEJG 8GTMCWHUNKUVGP FGT ,CJTG    $TQUEJKGTV  



*QEJKPVGTGUUCPVGU-QPXQNWV

. $#4#0195-+ / /KNCPQ #WMVKQP XQO  5NI %W\\K  2CTVG 2TKOC /QPGVG 4QOCPG   0TP6HP1TKI$TQUEJWT#WMVKQPXQO5NI%W\\K2CTVG5GEQPFC/QPGVGFK <GEEJG+VCNKCPG0TP6HP1TKI$TQUEJWT  



. #WMVKQP XQO  5NI %CXCNNCTQ  2CTVG 2TKOC /QPGVG +VCNKCPG  0TP  6HP 1TKI$TQ   UEJWTIWVG'TJCNVWPI&C\W(GUVRTGKUNKUVGPXQPWPF  



. #WMVKQP XQO  5NI %CXCNNCTQ  2CTVG 2TKOC /QPGVG +VCNKCPG  0TP  6HP 1TKI$TQ   UEJWTIWVG'TJCNVWPI



. #WMVKQPXQO5NI6TCXGTUQWPF5NI/CTVKPK/QPGVG)TGEJGG4QOCPG0TP 6HP1TKI$TQUEJWT$KPFWPIIGDTQEJGPNGV\VG6H\GTTKUUGP



. #WMVKQP  XQO  %QNNG\KQPG FK CPVKEC G PQDKNG (COKINKC FGNN +VCNKC UGVVGPVTKQPCNG G FK CNVTK   #OCVQTK /QPGVG FK <GEEJG +VCNKCPG 2CTVG + G ++  0TP  6HP 1TKI$TQUEJWT 4ÒEMGP IGDTQ   EJGP



. #WMVKQP  XQO  5NI 6TCXGTUQ  /QPGVG FK <GEEJG +VCNKCPG  0TP  6HP 1TKI$TQ   UEJWT4ÒEMGPIGDTQEJGP



. $'./106' , LWP  *CODWTI #WMVKQP XQO  5NI )WVJGKN   0TP WPF  0TP   .KVGTCVWT'.DGKIGUEJTKGDGPG2TGKUG#WMVKQPXQO5NI5EJWNV\G5V·FVGOÒP\GP0TP '. DGKIGUEJTKGDGPG 2TGKUG 9';. # $GTNKP #WMVKQP XQO  5NI (KGYGIGT  5CV[TKUEJG   /ÒP\GP WPF /GFCKNNGP  0TP #WMVKQP  XQO  &WDNGVVGP FGU /ÒP\MCDKPGVVU )QVJC   )TKGEJGP 4ÌOGT  0TP #WMVKQP  XQO  &WDNGVVGP FGU /ÒP\MCDKPGVVU $GTNKP  6GKN    7PKXGTUCN  0TP '. DGKIGUEJTKGDGPG 2TGKUG #WMVKQP XQO  &WDNGVVGP FGU /ÒP\MCDK   PGVVU$GTNKP6GKN$GU#PVKMG0TP'.DGKIGUEJTKGDGPG2TGKUG+PGKPGO$CPFKP*CNDNGKPGP IGDWPFGP



. $'4/#00,9KGP#WMVKQPXQO8GT\GKEJPKUGKPUGJTITQUUGPWPFUGJTIGY·JNVGPRQNPK UEJGP /ÒP\ W /GFCKNNGP5COONWPI FCPP GKPGT 5COONWPI XQP/ÒP\GPWPF/GFCKNNGPCNNGT.·PFGT 8GTHCUUVXQP.GQP/KMQEMK0TP6HP*CNDNGKPGP



. #WMVKQPXQO5NIFG6TCWZ7PKXGTUCN0TP*CNDNGKPGP//#)



. $+0&'4 ) *CODWTI 8GTMCWHUMCVCNQI *CODWTIGT /ÒP\XGTMGJT FKXGTUG .KUVGP CWU FGP ,CJTGP    FC\W )#48' , *CODWTI 8GTMCWHUMCVCNQI  *CODWTIKUEJG /ÒP\GP *'4+0)   '*CODWTI8GTMCWHUMCVCNQI    /ª0&*'+//0CEJH*CODWTI8GTMCWHUMCVC NQIG  122'.(*CODWTI8GTMCWHUMCVCNQI$TQUEJKGTV EC 



. $174)'; ' 2CTKU #WMVKQP XQO  5NI 4QWUUGV  #PVKMG )QNFOÒP\GP  0TP    6HP1TKI$TQUEJWT#PUVTGKEJWPICWHFGO&GEMGN



. $76610 ' (TCPMHWTVGT /ÒP\GPJCPFNWPI #WMVKQPGP   WPF  CWU FGP ,CJTGP    1TKI$TQUEJWT Z )CP\NGKPGP Z 1TKIIGJGHVGV Z -CTVQPKGTV Z   



. %#*0#'(TCPMHWTVC/ #WMVKQPXQO5COONWPIGKPGU5VWVVICTVGT/ÒP\HTGPFGU /ÒP\GPFGUWPF,CJTJWPFGTVU0TP/CPEJOCNOKVDGKIGUEJTKGDGPGP2TGKUGP#WMVKQP XQO5NI.CKDNG0GW\GKV0TP#WMVKQPXQO5NI)TÒPGTV$TCWUEJYGKI 5QYKGGKPG5COONWPIXQP/ÒP\GPWPF/GFCKNNGPCWHFKG4GHQTOCVKQP0TP'.+PGKPGO$CPFKP )CP\NGKPGPVCFGNNQUIGDWPFGP



104


AUKTIONSKATALOGE . #WMVKQP  XQO  5NI XQP *G[FGP 1TFGP XQP &GWVUEJNCPF ¤UVGTTGKEJ 7PICTP 'PINCPF   7NTKEJUMTGW\G0TP6HP1TKI$TQUEJWTDGUVQ­GP//#)



. #WMVKQPXQO5NI)TQVGWPF$CTFV/KVVGNCNVGT(F)TÒPUVCFV 2HCN\ 5NI)TGGPG5KG IGNUVGORGN0TP#WMVKQPXQO5NI.QVJQN\0GW\GKVDGU0ÒTPDGTI4GHQTOC VKQP5NI)TQVG6GKN/KVVGNCNVGT$T#PUDCEJ0TP6HP'.+PGKPGO$CPFKP)CP\NGKPGP VCFGNNQUIGDWPFGP



. 5NIXQP/QNVJGKP'TI·P\WPIUWPF*CPFMCVCNQI\WT8GTUVGKIGTWPICO5)CP\NGKPGP



. #WMVKQP  XQO   5COONWPIXQP/ÒP\GPWPF/GFCKNNGPXQP(TCPMHWTVC/CWUCNVGO $GUKV\0TP)CP\NGKPGP



. #WMVKQPXQO5NI*G[FGPWPF$WJNGTU1TFGPXQP(TCPMTGKEJ$GNIKGPWPF&GWVUEJNCPF 0TP)CP\NGKPGP#



. #WMVKQP  XQO  5NI 4WHH  5V·FVGOÒP\GP WPF /GFCKNNGP $TCWPUEJYGKI )QNFOÒP\GP   0TP)CP\NGKPGP//#)



. #WMVKQPGPXQO5NI/CTVKPK#PVKMG/ÒP\GP0TP6H)CP\NGKPGP



. #WMVKQPXQO#WIUDWTI5EJYGK\5NI2CN¾\KGWZ/ÒP\GPFGU$KUVWOU5KVVGP0TP  6H  #WMVKQP  XQO  5NI 5=EJNKGHHGP?  0GW\GKV  0TP  6HP +P GKPGO $CPF KP   *CNDNGKPGPIGDWPFGP



. #WMVKQP  XQO  5NI 0CVJWUKWU WPF 9CNEJGT  6CNGT /ÒP\GP WPF /GFCKNNGP FGT 5VCFV   5EJY·DKUEJ*CNN0TP6HP'.*CNDNGKPGP



. #WMVKQPXQO5NI$WEJGPCWWPF*G[G/KVVGNCNVGT0KGFGTUCEJUGP0TP6HP )CP\NGKPGPVCFGNNQUGTJCNVGP



. #WMVKQPXQO5NI$WEJGPCWWPF*G[G/KVVGNCNVGT0KGFGTUCEJUGP0TP6HP $TQUEJKGTV&GEMGNDGUEJ·FKIVWPF4ÒEMGPIGMNGDV+PJCNVVCFGNNQU



. #WMVKQP 5NI5EJNGUKPIGT  5NI-KTUEJ  5NI4KVVGTXQP*ÌHMGP*CVVKPIUJGKO   5NI$GEM  5NI$QYKG  5NI<=QDGN?  =5NI5VTCWUU? 

5NIXQP*=ÒVVGPDCEJ?5NI5KOQP5NI0KGU  5NI(ÒTUVGPDGTI  5NI(ÒTUVGPDGTI 

5NI5CWNE[WPF(ÒTUVGPDGTI  5NI2KGRGTWPF5VGIGT /CPEJOCNOKV5.&KG-CVCNQIG DTQUEJKGTVFKGÒDTKIGPKP$·PFGPKPOQFGTPGP)CP\NGKPGPIGDWPFGP  



. #WMVKQPGPXQO5NI5EJTCFGT9ÒTVVGODGTI0QVOÒP\GP0TP6H#WMVKQP XQO&GWVUEJG6CNGT+VCNKGP$TCMVGCVGP0TP6H#WMVKQPXQO 5NIXQP*G[FGP'JTGP\GKEJGPXQP+VCNKGP5EJYGK\4WUUNCPF2QNGPGVE0TP+PGKPGO$CPFKP )CP\NGKPGPVCFGNNQUIGDWPFGP



. #WMVKQPXQO5NIXQP*G[FGP'JTGP\GKEJGPXQP+VCNKGP5EJYGK\4WUUNCPF2QNGPGVE 0TP$TQUEJKGTV4ÒEMGPDGUEJ·FKIV



. #WMVKQP  XQO  5NI XQP $CNFKPIGT  #PVKMG 9ÒTVVGODGTI0TP6HP)CP\NGKPGP #



. #WMVKQPXQO5NI-KTUEJ7PKXGTUCN0TP6HP1TKI$TQUEJWT2CRKGTNGKEJV IGDT·WPV



. #WMVKQP5NI1GTVGN#PVKMG5NI5VGIGT/ÒP\GPFGTTÌOKUEJGP-CKUGT6KVGNDNCVVHGJNV 5NI &T ( 4ÌOKUEJG -CKUGTOÒP\GP  5NI (ÒTUV \W 9KPFKUEJ)T·V\ 5COONWPI TÌOKUEJGT /ÒP\GP     5COONWPI GKPGU TJGKPKUEJGP )GNGJTVGP 5GTKG DCTDCTKUEJGT /ÒP\GP $TCMVGCVGP  5COONWPI   GKPGU0WOKUOCVKMGTUKP-NGKPCUKGP#PVKMG/ÒP\GP5NI*CJP#PVKMG#PVKMG6GKN++FGU JGT\QINKEJCPJCNVKUEJGP/ÒP\MCDKPGVVU5NI'XCPU.CYTGPEGXQP-QDNKV\5VGIGT6GKNYGKUGDGKIG UEJTKGDGPG2TGKUGWPF5EJ·V\NKUVGP-CVCNQIGKP$·PFGPKP)CP\NGKPGPIGDWPFGP  



. #WMVKQPXQO-WPUVOGFCKNNGPFGU:8:8++,CJTJWPFGTVU5CEJUGP7PKXGTUCN0TP 6HP)CP\NGKPGP#WMVKQPXQO5NI*GKPTKEK/GFCKNNGPWPF2NCMGVVGPFGT4GPCKU UCPEG0TP6HP)CP\NGKPGP  



. #WMVKQPXQO&WDNGVVGPFGU(ÒTUVNKEJ(ÒTUVGPDGTIKUEJGP/ÒP\MCDKPGVVU0TP6HP  #WMVKQPGPCWUFGP,CJTGP&CU(ÒTUVNKEJ(ÒTUVGPDGTIKUEJG/ÒP\MCDK PGVV\W&QPCWGUEJKPIGP6GKN   0CEJVTCI    0TP   0CEJVTCI   6HP5.GKPIGDWPFGP/CPEJOCNOKVDGKIG UEJTKGDGPGP2TGKUGP+PFTGK$·PFGPKP)CP\NGKPGPVCFGNNQUIGDWPFGP  



. #WMVKQPXQO5NI(TKGFGPUDWTI/ÒP\GPFGUFGWVUEJGP/KVVGNCNVGTU0TP6HP $GKIGUEJTKGDGPG2TGKUG2CRKGTGVYCUIGDT·WPV*CNDNGKPGP



. #WMVKQP  XQO  5NI /WGNNGT.GDCPQP  -WPUVOGFCKNNGP FGT 4GPCKUUCPEG\GKV DGU FGWVUEJG   0TP6HP2CRRDCPFCWHFGPGTUVGP5GKVGPMNGKPGT'KPTKUU



/KV$GUKV\GTUVGORGN/ÒP\GPJCPFNWPI,WNKWU,GPMG

*QEJKPVGTGUUCPVGU-QPXQNWV\WTPGW\GKVNKEJGP0WOKUOCVKMOKVYKEJVKIGP5COONWPIGP

#WMVKQPUMCVCNQIG\WTCPVKMGP0WOKUOCVKM

105


AUKTIONSKATALOGE . #WMVKQPXQO5NIGKPGU0WOKUOCVKMGTUKP-NGKPCUKGP/ÒP\GPFGT#PVKMG$[\CP\$CTDC TGPWPF8ÌNMGTYCPFGTWPIU\GKV0T6HP)CP\NGKPGPGKPKIG0QVK\GP



. #WMVKQPXQO5NI5KOQP4ÌOGTWPF)TKGEJGP0TP6HP5.$GKIGUEJTKG DGPG2TGKUG)CP\NGKPGP



. #WMVKQP  XQO  5NI .ÌHHNGT  5EJNGUKGP  0TP  6HP JCPFIGEJTKGDGPG '. 1TKI   $TQUEJWT4ÒEMGPNGKEJVDGUEJ·FKIV



. #WMVKQPXQO0QTFFGWVUEJG5COONWPI=.CIGTFGT(KTOC4KGEJOCPP*CNNG?0GW\GKVNKEJG /ÒP\GPWPF/GFCKNNGP6GKN*CDUDWTIKUEJG'TDNCPFG)GKUVNKEJMGKV#NVHÒTUVGP0TP6HP 5. DGKIGUEJTKGDGPG 2TGKUG  #WMVKQP  XQO  0QTFFGWVUEJG 5COONWPI =.CIGT FGT (KTOC   4KGEJOCPP *CNNG? 0GW\GKVNKEJG /ÒP\GP WPF /GFCKNNGP  6GKN 5GTKGP FGT 0GWHÒTUVGP WPF 5V·FVG   +VCNKGP5EJYGK\0KGFGTNCPFGWPF2GTUQPGPOGFCKNNGP0TP6HP5.DGKIGUEJTKGDGPG2TGKUG +PGKPGO$CPFKP)CP\NGKPGPVCFGNNQUIGDWPFGP



. #WMVKQPXQO5NI(FG5CWNE[&CUHÒTUVNKEJHÒTUVGPDGTIKUEJG/ÒP\MCDKPGVV\W&QPCW GUEJKPIGP 6GKN 8++ &KG /ÒP\GP XQP .QVJTKPIGP FGT HTCP\ÌUKUEJGP (GQFCNGP FGT /GTQYKPIGT WPF   -CTQNKPIGTUQYKGFGTHTCP\ÌUKUEJGP-ÌPKIGDKUKPEN(TCP\+0TP6HP*CNDNGKPGP



. #WMVKQP IGOGKPUCOOKV*GUU0CEJH XQO5NI*CGDGTNKP&KG)QNFWPF5KNDGTOÒP \GPFGTTÌOKUEJGP4GRWDNKM0TP6HP//#))CP\NGKPGP



. 8GTMCWHUMCVCNQIGCWUFGP,CJTGPDKU.KUVGPDTQUEJKGTV*CNDWPF)CP\NGKPGPVGKNYGKUG DGUEJ·FKIV EC 



. #WMVKQPGPXQO        WPF XQO    1TKI$TQUEJWTVGKNYGKUGOKV5.  



. %#0'55# % WPF ' 0GCRGN #WMVKQP XQO  5NI %QNQPPC  2TGOK½T 2CTVKG /QPPCKGU   +VCNKGPPGU0TP6HP1TKI$TQUEJWT6CHGNVGKNNQUG



. %*4+56+' /#0510 CPF 911&5 .6& .QPFQP 4QO 0GY ;QTM #WMVKQP XQO    5NI  1 $[TPG  6GKN 8+ 5CEJUGP  0TP  6HP 1TKI$TQUEJWT 4ÒEMGP NGKEJV DGUEJ·FKIV OKV   $KDNKQVJGMUUVGORGN



. %+#0+.2CTKU#WMVKQPXQO5NIFG)TCPFRTG[#PVKMG(TCPMTGKEJ/GFCKNNGP 0TP  6HP DGKIGUEJTKGDGPG 2TGKUG VGKNYGKUG DGKIGUEJTKGDGPG -·WHGT 1TKI$TQUEJWT 4ÒEMGP DG   UEJ·FKIV . #WMVKQPXQO5NI(NQTCPIG.QVJTKPIGP0TP6HP)CP\NGKPGP# . #WMVKQPXQO5NI(NQTCPIG.QVJTKPIGP0TP6HP1TKI$TQUEJWT#

  

. %.'4+%+%WPF%/KNCPQ#WMVKQPXQO5NI%CRTQVVK6GKN)TKGEJKUEJGWPFTÌOK UEJG/ÒP\GP0TP6HP*CNDNGKPGP



. &1416*'7/ 9KGP #WMVKQPGP XQO    5NI <GPQ  6GKN  )TKG   EJGPWPF4ÌOGT0TP6HP6HP6HP'.-CVCNQIGKPFTGK$·PFGPIGDWPFGP$TQ UEJWT//#)  



. &724+'< % $TÒUUGN #WMVKQPGP XQO  Z    Z     .KUVGPWPF,CP(/7..'4#OUVGTFCO#WMVKQPGPXQO

Z  Z  Z $TQUEJKGTV  



9GPKIDGMCPPVGITQ­G5COONWPIOKVCWUIGURTQEJGPGP5CEJUGP4CTKV·VGP

1331

. '))'4 $4ª&'4 9KGP #WMVKQP XQO5NI/KPWU6CNGTWPF/GFCKNNGP5NI2TGKUU $CNVKMWO0TP6HP$GKIGUEJTKGDGPG2TGKUG*CNDNGKPGPDGUVQ­GP//#) /KV$GUKV\GTUVGORGN%()GDGTV

106




AUKTIONSKATALOGE . #WMVKQP  XQO  /ÒP\GP WPF /GFCKNNGP 5COONWPI CNNGT .·PFGT FGU *GTTP )TCHGP <   0TP6HP'.*CNDNGKPGP



1333

. #WMVKQP XQO  5NI 7PIGT  #PVKMG /ÒP\GP WPF /GFCKNNGP FGT ÌUVGTTTGKEJKUEJWPICTKUEJGP   /QPCTEJKG0TP6HP*CNDNGKPGP



. #WMVKQPXQO5NI.CVQWTXQP6JWTODWTI6GKN#PVKMG*CDUDWTI'WTQRC 0TPQJPG6HP#WMVKQPXQO5NI.CVQWTXQP6JWTODWTI6GKN)GKUVNKEJMGKVYGNVNK EJG*GTTGP5V·FVGGVE0TP6HP#WMVKQPXQO#PVKMG0TP6HP #WMVKQPXQO5NI%\KMCPP*CDUDWTI&GWVUEJNCPF0TP6HP#WMVKQPXQO 7PKXGTUCN0TP6HP+ONGV\VGP-CVCNQIDGKIGUEJTKGDGPG2TGKUG-CVCNQIGKPGKPGO $CPFIGDWPFGP)CP\NGKPGP



. #WMVKQP  XQO  5NI 6TCW 7PKXGTUCNDGU9KGPGT/GFCKNNGP-WPUVOGFCKNNGP2NCMGVVGP 0TP6HP*CNDNGKPGPNGKEJVDGUVQ­GP//#)



. #WMVKQP  XQO  5NI 6TCW 7PKXGTUCNDGU9KGPGT/GFCKNNGP-WPUVOGFCKNNGP2NCMGVVGP 0TP6HP*CNDNGKPGP//#)



. #WMVKQPXQO5NI2TQYG#PVKMG0TP6HPDGKIGUEJTKGDGPG2TGKUG#WMVKQP XQO)TKGEJGPDGU5K\KNKGP0TP6HP+PGKPGO$CPFKP)CP\NGKPGPIGDWPFGP



. #WMVKQP  XQO  5NI )TCH $GTEJVQNF  *CDUDWTI 7PICTP 5KGDGPDÒTIGP &GWVUEJNCPF    0TP  6HP /KV DGKIGUEJTKGDGPGP 2TGKUGP WPF 6GZVCWUUEJPKVVGP  #WMVKQPXQO )QNFOÒP\GP WPF /GFCKNNGP  0TP  6HP 'KPG 5GKVG NGKEJV DGUEJ·FKIV  #WMVKQP  XQO    5NI /KNNGT \W #KEJJQN\  &GWVUEJNCPF 'WTQRC  0TP  6HP  #WMVKQP XQO   4WUUKUEJG/ÒP\GP0TP$GKIGUEJTKGDGPG2TGKUG+P\YGK$·PFGPKP)CP\NGKPGPIGDWP FGP&C\W#WMVKQPXQO5NI-TCHV7PKXGTUCNDGU*CDUDWTI&GWVUEJNCPF5EJYGK\ 'KUGPDCJPOGFCKNNGP0TP6HP*CNDNGKPGP#WMVKQPXQO¤UVGTTGKEJ9GUV HCNGP#WUDGWVG'NUCUU0TP6HP Z $TQUEJKGTVDGUVQ­GPWPFDGUEJ·FKIV  



. #WMVKQP  XQO  5NI .GUVTCPIGU  )TKGEJKUEJG /ÒP\GP  0TP  6HP #WMVKQP    XQO)TKGEJKUEJGWPFTÌOKUEJG/ÒP\GP&WDNGVVGPFGT/ÒP\UCOONWPIGPFGUCNNGTJÌEJUVGP -CKUGTJCWUGU0TP6HP#WMVKQPOKVDGKIGUEJTKGDGPGP2TGKUGP-CVCNQIGKPGKPGO$CPF IGDWPFGP)CP\NGKPGP9CUUGTUEJCFGPCOQDGTGP4CPFHNGEMKI



. #WMVKQPXQO5NI2TQYG)TKGEJKUEJG/ÒP\GP0TP6HP/KVDGKIGUEJTKGDGPGP 2TGKUGP WPF MNGKPGP 0QVK\GP  #WMVKQP  XQO  5NI %J=TKUVKVEJ?  XQTOCNU 5NI $G[   #PVKMG0TP6HP+PGKPGO$CPFKP)CP\NGKPGPIGDWPFGP



#WMVKQPOKV$GUKV\GTUVGORGN&T(:9GK\KPIGT%Q

. #WMVKQPXQO¤UVGTTGKEJ9GUVHCNGP#WUDGWVG'NUCUU0TP6HP)CP\ NGKPGP6CHGNOKV6GUCTGRCTKGTV



. #WMVKQPXQO5NI%J=TKUVKVEJ?XQTOCNU$G[)TKGEJGP4ÌOGT$[\CP\0TP 6HP1TKI$TQUEJWT4ÒEMGPGKPIGTKUUGP#WUUEJPKVVCWH6H

 107


AUKTIONSKATALOGE . #WMVKQPXQO)TKGEJKUEJGWPFTÌOKUEJG/ÒP\GP0TPQJPG6HP$GKIGUEJTKGDGPG 2TGKUG#WMVKQPXQO5NI2TQYG)TKGEJKUEJG/ÒP\GP0TP6HP/CPEJ OCN OKV DGKIGUEJTKGDGPGP 2TGKUGP +P GKPGO $CPF KP )CP\NGKPGP IGDWPFGP &C\W  #WMVKQPXQO 4ÌOGT$TCPFGPDWTI(TCPMGP5CN\DWTI5V)GQTIUOÒP\GP0TPQJPG6HP$GUKV\GT UVGORGN*KUVQTKUEJGT8GTGKPHÒT1DGTRHCN\WPF4GIGPUDWTI$TQUEJKGTV



. 8GTMCWHUNKUVGPKPGKPGO$CPFKP)CP\NGKPGPIGDWPFGP&C\W8GTMCWHUNKUVGP

Z   Z    Z        $TQUEJKGTV DGUEJ·FKIV UVQEMHNGEMKI   VGKNYGKUGNQUG  



. ('7#4&'06(4–4'52CTKU#WMVKQPXQO=5NI/CVVG[?)TKGEJGP0TP6HP DGKIGUEJTKGDGPG2TGKUG1TKI$TQUEJWTGKPKIG#PUVTGKEJWPIGPKO6GZV



. #WMVKQPXQO5NI&WPF))TKGEJKUEJGTÌOKUEJGWPFHTCP\ÌUKUEJG/ÒP\GP0TP 6HP1TKI$TQUEJWT4ÒEMGPIGTKPIHÒIKIDGUEJ·FKIV



. #WMVKQPGPXQOWPFXQO5NI$QTFGCWZ6GKN(TCPMTGKEJ 0TP  6HP '. XQP 6GKN  GKPIGMNGDV /KV DGKIGUEJTKGDGPGP 2TGKUGP WPF XKGNGP -·WHGTPCOGP +P   GKPGO$CPFKP*CNDNGFGTIGDWPFGPYGPKIG#PUVTGKEJWPIGP//#)



. (+5%*'4'9KGP8GTMCWHUMCVCNQIGWPF  +PGKPGO$CPFKP*CND NGKPGPIGDWPFGP&C\WFKG.KUVGPCNUDTQUEJKGTVG'ZGORNCTG



. (.14#0)' , WPF %+#0+ . 2CTKU #WMVKQP XQO  5NI (GTTCTK NC 4GPQVK½TG   2CRUVOÒP\GPWPF5CXQ[GP0TP6HP1TKI$TQUEJWT7OUEJNCINQUG



. #WMVKQPXQO5NI)CNNGV)TKGEJKUEJGWPFTÌOKUEJG/ÒP\GP-WPUVOGFCKNNGP0TP 6HP$TQUEJKGTVOKV)GDTCWEJUURWTGP#



. #WMVKQP XQO  5NI $CTTCEJKP  #PVKSWKV·VGPITKGEJKUEJGTÌOKUEJGWPFHTCP\ÌUKUEJG/ÒP \GP0TP6HP'.OKVGKPIGDWPFGPDGKIGUEJTKGDGPG2TGKUG*CNDNGFGT'.OKV6GUCTGRCTKGTV



. #WMVKQPGPXQOWPF5NI#NNQVVGFGNC(W[G6GKNWPF)TKGEJKUEJGTÌOKUEJG WPFD[\CPVKPKUEJG/ÒP\GP0TP6HP0TP6HP)CP\NGKPGP//#)



. #WMVKQPXQO(TCPMTGKEJ0TP6HP*CNDNGKPGP



. #WMVKQPGP XQO   WPF XQO 6GKNG(TCPMTGKEJ0TP6HP '.DGKIGDWPFGP*CNDNGFGTRTCEJVXQNNGTJCNVGP



'ZNKDTKU$GTPJCTF5EJWNVG

. (4'; * 2 4 (TGKDWTI KO $TGKUICW UR·VGT $.#5'4(4'; #WMVKQPGP  CWU FGP ,CJTGP   6GKNYGKUGOKV'.QFGTDGKIGUEJTKGDGPGP2TGKUGP1TKI$TQUEJWT Z )CP\NGKPGP Z   



. )#'66'054.ÒDGEM#WMVKQPGPCWUFGP,CJTGPOKVDG UQPFGTGT5GTKG-CTQNKPIGTWPFU·EJUKUEJHT·PMKUEJG-CKUGT\GKV6GKNYGKUGOKV'.1TKI$TQUEJWT  



. )'$'46 %( 0ÒTPDGTI #WMVKQPUNKUVGP WPF /ÒP\8GTMGJT 0ÒTPDGTI             $   &CDGK YGPKIG &WDNGVVGP 2CRKGT VGKNYGKUG IGDT·WPV DTQ   UEJKGTVIGJGHVGVQFGTNQUG$N·VVGT



+PVGTGUUCPVGU-QPXQNWV

1358

. )+.*1('44#05%*$74)9KGPWPF*'55#.W\GTP#WMVKQPXQO5NI6TCW /ÒP\GPFGTTÌOKUEJGP-CKUGT0TP6HP5.$TQUEJKGTV 108




AUKTIONSKATALOGE . ).'0&+0+0)  %1 WPF 5'#$; $ # .QPFQP #WMVKQP  XQO  )TKGEJKUEJG WPF   TÌOKUEJG/ÒP\GP0TP6HP1TKI$TQUEJWT7OUEJNCIDGUEJ·FKIV



. )4#$19 . 4QUVQEM UR·VGT $GTNKP WPF /'755 * *CODWTI #WMVKQPGP XQO      WPF XQO 5NI 4QGRGT   6GKNG 0QTFFGWVUEJNCPF (TQPVKURK\    0TP6HP5.#NU6GZVWPF6CHGNDCPFIGDWPFGP)CP\NGKPGPVCFGNNQUG'TJCNVWPI



#NNG5.OKV$GUKV\GTUVGORGN&T96JGKNG4GEJVUCPYCNV.GKR\KI6CHGNOK$GUKV\GTUVGORGN-NCWU-NCFGP

. )4#$19.4QUVQEMUR·VGT$GTNKP#WMVKQPGPXQO  ZGKPOCNQJPG6CHGNP 1TKI$TQUEJWTVGKNYGKUGOKV 5.  



. #WMVKQPGP#CWUFGP,CJTGP/GKUVGPUOKV5.VGKNYGKUGOKV DGKIGUEJTKGDGPGP 2TGKUGP -CVCNQI  # DTQUEJKGTV FKG CPFGTGP -CVCNQIG KP  $·PFGP KP )CP\NGKPGP   IGDWPFGP  



1363

. *#/$74)'4,(TCPMHWTVC/#WMVKQPGPCWUFGP,CJTGP5NI4KVVGTXQP9KN OGTUFÌTHHGT6GKN/KVVGNCNVGTWPF0GW\GKVDGU-WPUVOGFCKNNGPWPF&GWVUEJNCPF0TP\WU 6HP'.GKPIGDWPFGPCW­GTKP6GKN$GKIGUEJTKGDGPG2TGKUGKP6GKN +P6GKNHGJNGPFKG5GK VGP-CVCNQIGKP\YGK$·PFGPIGDWPFGP#NNG-CVCNQIGUKPF&GFKECVKQPUGZGORNCTG*CNDNGKPGP //#)  



. #WMVKQPGP  XQO   WPF  5NI 4KVVGT XQP 9KNOGTUFÌTHHGT  6GKN    /KVVGNCNVGTWPF0GW\GKVDGU-WPUVOGFCKNNGPFGT4GPCKUUCPEGWPF&GWVUEJNCPF0TP6HP 6HP6HP'.\W6GKN6GKNOKVDGKIGUEJTKGDGPGP2TGKUGP+PGKPGO$CPFKP)CP\NGKPGPIGDWP FGP



$GKFGP#WMVKQPUMCVCNQIGPWPFJCPFGNVGUUKEJWO&GFKECVKQPUGZGORNCTG

. #WMVKQPXQO5NI5WEJKGTWPF4KVVGTXQP9KNOGTUFÌTHHGT#PVKMG0TP6HP'. #WMVKQPXQO5NI5WEJKGT*CPCW*GUUGP5EJNGUKGP0TP'.-CVCNQIKUVGKP &GFKECVKQPUGZGORNCT+PGKPGO$CPFKP)CP\NGKPGPIGDWPFGP



. *#/$74)'4.(TCPMHWTVC/#WMVKQPXQO5NI$WTUKQ0GW\GKV5NI5VGEMK6GKN  2QNGP 5NI 8QIGNUVGKP  /KVVGNCNVGT WPF #PVKMG 5NI <GKUDGTI  5GNVGPG 6CNGT WPF 2QTVT·VOGFCKNNGP   0TP6H*#/$74)'4..(TCPMHWTVCO/CKP#WMVKQPXQO5NI.ÌJT /KVVGNCNVGTWPF0GW\GKV5NI5VGEMK6GKN2QNGP5NI4¾IPCWNV+VCNKGPDGU-KTEJUVCCV,QJCPPKVGT 2TQDGP  0TP  6H /KV #PUVTGKEJWPIGP .GV\VG 5GKVG TGRCTKGTV +P \YGK $·PFGP KP )CP\NGKPGP   IGDWPFGP  



. #WMVKQPXQO5NI$WTUKQ0GW\GKV5NI5VGEMK6GKN2QNGP5NI8QIGNUVGKP/KVVGNCNVGT WPF#PVKMG5NI<GKUDGTI5GNVGPG6CNGTWPF2QTVT·VOGFCKNNGP0TP6H*CNDNGKPGP



'ZNKDTKU1VVQ5EJWNGPDWTI

. *#/$74)'4..(TCPMHWTVC/#WMVKQPXQO*GUUKUEJG&WDNGVVGPWPFCWUIG UEJKGFGPG 5VÒEMG FGU )TQUUJGT\QINKEJ *GUUKUEJGP /ÒP\MCDKPGVVU KP &CTOUVCFV 5NI 5WJO  $CFGP   5EJYGK\'NUC­5NI5GNVOCP#PVKMG/ÒP\HWPFCWU0CRNWU0TP6H)CP\NGKPGP

 109


AUKTIONSKATALOGE . #WMVKQP XQO  5NI 5 WPF ) /ÒP\GP WPF /GFCKNNGPFGU/KVVGNCNVGTUWPFFGT0GW\GKV 0TP6H'.)CP\NGKPGP



. #WMVKQP  XQO  =5NI 9WPFGTN[?  6GKN  #PVKMG &GWVUEJNCPF +VCNKGP 5RCPKGP GVE    0TP6HP'.#WMVKQPXQO=5NI9WPFGTN[?6GKN*CDUDWTI4W­NCPF-CUVKNKGP 'PINCPF (TCPMTGKEJ GVE  0TP  6HP DGKIGUEJTKGDGPG 2TGKUG #WMVKQP  XQO  =5NI   9WPFGTN[?  6GKN  $CUGN WPF )GPH  0TP  6HP DGKIGUEJTKGDGPG 2TGKUG #WMVKQP  XQO   =5NI9WPFGTN[?6GKN-WPUVOGFCKNNGP0TP6HPDGKIGUEJTKGDGPG2TGKUG#WMVKQP XQO=5NI9WPFGTN[?6GKN(TGKDWTI 5EJYGK\ 5EJCHHJCWUGP5QNVJWTPGVE0TP 6HP'.#WMVKQPXQO=5NI9WPFGTN[?6GKN$GTP7TK5EJY[\7PVGTYCNFGP<WI  0TP  6HP #WMVKQP  XQO  =5NI 9WPFGTN[?  6GKN  .W\GTP 5EJY[\ )NCTWU   #RRGP\GNN )TCWDÒPFGP #CTICW 6JWTICW 6GUUKP 9CCTFV 9CNNKU 0GWEJ³VGN 5WN\ 5V $NCUKGP    0TP6HP6GKNKPGKPGO$CPFKP)CP\NGKPGPIGDWPFGP6GKN DTQUEJKGTV  



. #WMVKQPXQO-WPUVOGFCKNNGP0TP6HP$GKIGUEJTKGDGPG2TGKUG#WMVKQPXQO 5NI2PKQYGT5EJNGUKGP5NI2GVVKPCVK7PKXGTUCN0TP6HP'.+PGKPGO$CPF KP)CP\NGKPGPIGDWPFGP



. #WMVKQPXQO5NI5CWTOC,GNVUEJ$GIKPPFGT)TQUEJGPRGTKQFGDKU\WT-KRRGT\GKV 0TP  6HP '. GKPIGDWPFGP DGKIGUEJTKGDGPG 2TGKUG *CNDNGFGT GVYCU UVQEMHNGEMKI 4ÒEMGP NQUG   //#)



. #WMVKQPXQO&WDNGVVGPWPF0KEJVUEJNGUKUEJG/ÒP\GPWPF/GFCKNNGPFGU/WUGWO5EJNG UKUEJGT#NVGTVJÒOGT9ÒTVVGODGTI1GNU9CNNGPUVGKP(TGKOCWTGT6JGWGTWPIUOGFCKNNGP0TP 6HP '. OKV 6CHGNCWUEJPKVV CWH FGT GTUVGP 6H #WMVKQP XQO  5NI 5CVVNGT 7PKXGTUCNDG UQPFGTU 5EJYGK\ $KDNKQVJGM FGU 2TKP\GP #NGZCPFGT XQP *GUUGP WPF DGK 4JGKP   0TP OKV DGKIG   UEJTKGDGPGP2TGKUGP#WMVKQPXQO=5NI*G[OCPP?-ÌNP(TCPMHWTV0TPOKVDGKIG UEJTKGDGPG2TGKUG#WMVKQPXQO7PKXGTUCN0TP6HP#WMVKQPXQO 5NI 4WNCPF  (TCPMHWTV  0TP  6HP '. #WMVKQP XQO  #PVKMG $KDNKQVJGM    0TP6H+PGKPGO$CPFKP)CP\NGKPGPIGDWPFGP



. #WMVKQPXQO5NI5VTQGJNKP5GNVGPJGKVGP0TP6HPDGKIGUEJTKGDGPG2TGKUG #WMVKQPXQO5NI)WKFKWPF)WVGMWPUV7PKXGTUCN0TP6H#WMVKQPXQO  5CN\DWTI (TCPMHWTV  0TP  6HP DGKIGUEJTKGDGPG 2TGKUG  #WMVKQP  XQO    5NI &T $CGUGEMG  7PKXGTUCN 0QVOÒP\GP *CDUDWTI  0TP  6HP '. +P GKPGO   -CVCNQIKP)CP\NGKPGPIGDWPFGP



. #WMVKQPGP   CWUFGP,CJTGP5NI)PGEEJK6GKN+VCNKGPKUEJG/ÒP\GPWPF $KDNKQVJGM    0TP  6HP /GKUVGPU OKV DGKIGUEJTKGDGPGP 2TGKUGP  -CVCNQIG KP GKPGO   $CPFKP)CP\GNGKPGPVCFGNNQUIGDWPFGP//#)



. #WMVKQPGP  WPF  XQO  WPF  5NI 2QIIG  6GKN  WPF  2QOOGTP 4WUUNCPF   2QNGP&·PGOCTM5EJYGFGPWPF/GEMNGPDWTI0TP0TP6HP6HP'.+PGKPGO $CPFKP*CNDNGFGTIGDWPFGPOKPKOCNDGUVQ­GP//#)  



. #WMVKQPXQO5NI*GPPGDGTI7PKXGTUCN0TP6HP'.)CP\NGKPGP



. #WMVKQPGP XQO           6GZV WPF 6CHGNDCPF   1TKI $TQUEJWT Z  *CNDNGKPGP Z  2CRRDCPF Z   

 



. #WMVKQP  XQO  =5NI )GUUPGT?  6GKN  5EJYGK\  0TP #WMVKQP  XQO    =5NI)GUUPGT?6GKN5EJYGK\0TP6HP'KPG5GKVGNQUG#WMVKQPXQO 5NI +MN¾  5EJYGK\GT )QNFOÒP\GP  0TP  6HP #WMVKQP  XQO  5NI (QTF WPF   ,QUGRJ5EJYGK\0TP6HP#WMVKQPXQO5EJYGK\0TP6HP#WMVKQ PGP   XQO   6GKN + ++ =5NI $CEJQHGP$WTEMJCTFV $CUGN?  5EJYGK\GT   /ÒP\GPWPF/GFCKNNGPXC<ÒTKEJ$GTP.W\GTP5QNQVJWTP#WMVKQPXQO5NI)TQUU OCPP  5EJYGK\  0TP  6HP#WMVKQPXQO5NI+MN¾5EJYGK\GT/ÒP\GP 0TP6HP#WMVKQPXQO=5NI5VWT\GPGIIGT?5EJYGK\GTKUEJG/ÒP\GPWPF /GFCKNNGP0TP6HP5.#WMVKQP DTQUEJKGTV&KGCPFGTGP-CVCNQIGUKPFKP $·PFGPKP)CP\NGKPGPIGDWPFGP  



. #WMVKQP  XQO  =5NI )GUUPGT?  6GKN  5EJYGK\  0TP #WMVKQP  XQO    =5NI)GUUPGT?6GKN5EJYGK\0TP6HPDGKFGOKVDGKIGNGIVGT'.+PGKPGO$CPFKP )CP\NGKPGPIGDWPFGP//#)



'ZNKDTKU5RKPM5QP0WOKUOCVKEU.VF

. #WMVKQPXQO5NI+MN¾5EJYGK\GT)QNFOÒP\GP0TP6HP'.DGKIGUEJTKGDGPG 2TGKUG)CP\NGKPGP7OUEJNCIGVYCUDGUEJOWV\V



. #WMVKQPGP  WPF  XQO  WPF  5NI ,QUGRJ  6GKN  WPF  &GWVUEJNCPF DGU   4JGKPNCPF/KVVGNTJGKP*GUUGP.WZGODWTIHTCP\ÌUKUEJG/GFCKNNGP0TP6HPDGKIGUEJTKG DGPG2TGKUG-CVCNQIGKPGKPGO$CPFKP)CP\NGKPGPIGDWPFGP



110


AUKTIONSKATALOGE . #WMVKQPXQO5NI7JTOCEJGT/KVVGNCNVGT0GW\GKVDGU$TCWPUEJYGKIWPF-ÌNP0TP  MQORNGVV 6HP)CP\NGKPGP# . #WMVKQPXQO5NI'DPGT9ÒTVVGODGTI0TP6HP)CP\NGKPGP2CRKGTIGDT·WPV

 

. #WMVKQPXQO5NI5EJ=PGKFGT?'NUC­0TP6HP$TQUEJKGTVDGUVQ­GP4ÒEMGP DGUEJ·FKIV//#)



. #WMVKQPXQO5NIXQP45EJNGUKGP5NIXQP%NCGT/GFCKNNGP(TKGFTKEJUFGU)TQ­GP &GT$TCMVGCVGPHWPFXQP.KEJVGPDGTI0TP6HP)CP\NGKPGP#



. #WMVKQPXQO5NI=5RÌVVN?5CN\DWTI0TP6HP)CP\NGKPGP



. #WMVKQPXQO#NVG5COONWPIR·RUVNKEJGT/ÒP\GP0TP6HP$TQUEJKGTVDGUVQ ­GP



. #WMVKQPGP     XQO         5NI 8QIGN  6GKNG ++8++ +PUIGUCOV  0TP  6HP /KV DGKIG   UEJTKGDGPGP2TGKUGP+P\YGK$·PFGPKP*CNDNGKPGPIGDWPFGP   . #WMVKQPXQO8KGTVGNVCNGT0TP6HP)CP\NGKPGP

 

1391

. #WMVKQPXQO5NI8QIGN6GKN-WPUVOGFCKNNGP0TP6HP(QNKQ)CP\NGKPGP 6KVGNUGKVGTGRCTKGTV-NGKPG9CUUGTHNGEMGP . #WMVKQPXQO5NI*CWGT/GEMNGPDWTI0TP6HP1TKI$TQUEJWT . #WMVKQPXQO 5NI%WTVKWU XQOXQO 5NI9QNHH XQO XQO OKVDGKIGUEJTKGDGPGP2TGKUGP XQO OKVDGKIGUEJTKGDG PGP2TGKUGP XQO OKVDGKIGUEJTKGDGPGP2TGKUGP XQOXQO

VGKNYGKUG OKV DGKIGUEJTKGDGPGP 2TGKUGP   XQOXQO5NI2TKP\2JKNKRRXQP 5CEJUGP%QDWTI)QVJCXQO&C\WGKPKIG.CIGTMCVCNQIG&KGGTUVGPOKV'.-C VCNQIGKP$·PFGPKP)CP\NGKPGPVCFGNNQUIGDWPFGP  

 



*QEJKPVGTGUUCPVGU-QPXQNWVOKVGKPKIGP5COONWPIGP

. #WMVKQP  XQO  5NI2TKP\2JKNKRRXQP5CEJUGP%QDWTI)QVJC7PKXGTUCN0TP 6HP1TKI$TQUEJWTGTUVGPXKGT5GKVGPTGRCTKGTV$NGKUVKHVPQVK\GP#



. #WMVKQPXQO5NIXQP-CWHOCPP#PVKMG/ÒP\GP0TP6HP#WMVKQPXQO 5NI7PIGT&WDNGVVGPFGU$GTNKPGT/ÒP\MCDKPGVVU#PVKMG$CTDCTGP9ÒTVVGODGTI1NFGP DWTI -WPUVOGFCKNNGP  0TP  6HP #WMVKQP  XQO  #PVKMG DGU <GPVTCNITKGEJGP   NCPF #UKGP #HTKMC  0TP 6HP5.#WMVKQPXQO)TKGEJKUEJGWPFTÌOKUEJG /ÒP\GP  0TP  6HP 5. #WMVKQP  XQO  )TKGEJKUEJG /ÒP\GP DGU 5K\KNKGP    0TP6HP5.-CVCNQIGKP$·PFGPKP)CP\NGKPGPIGDWPFGP  



. #WMVKQP  XQO  2QNPKUEJG /ÒP\GP 0TP6HP5.#WMVKQPXQO 4ÌOKUEJG 4GRWDNKM )QNFOÒP\GP $TCMVGCVGP  0TP  6HP 5. +P GKPGO $CPF KP )CP\NGKPGP   IGDWPFGP

 111


AUKTIONSKATALOGE . *'$'4.' ,/ * .GORGTV\  5ÌJPG  -ÌNP #WMVKQPGP XQO  5NI *WIQ )CTVJG  

6GKNYGKUG DGKIGUEJTKGDGPG 2TGKUG WPF 0QVK\GP   5NI $NCUU (WEJU /CLGTWU  -ÌNP    5NI 5EJCNNGPDGTI   5NI 0CVJCP  -ÌNP  5NI 5CEJUG     5NI$TCOOWPF8CECPQ5NI5RGKGT/#6*.'/2'46<y$7%**#0&.70)70& #06+37#4+#6#WMVKQPXQO5NI$KPIGP 6CHGNPMPCRRDGUEJPKVVGP /CPEJOCN2CRKGT IGDT·WPV+PFTGK$·PFGPKP)CP\NGKPGPIGDWPFGP  



. *'.$+0) * /ÒPEJGP #WMVKQP XQO   5NI #TVCTKC  7PKXGTUCN  0TP  6HP #WMVKQP   XQO5COONWPIITKGEJKUEJGTWTÌOKUEJGT/ÒP\GPCWUFGO0CEJNCUUFGUKP9ÒT\DWTIXGT UVQTDGPGP*GTTP2TQHGUUQTU2/0TP/KV#PUVTGKEJWPIGP+PGKPGO$CPFKP)CP\NGKPGPIGDWP FGP



. *'.$+0) 1 /ÒPEJGP #WMVKQP  XQO  5NI =)TGKP?  #WMVKQP  XQO  5NI   /GGUG 5NI 1EJ  5CN\DWTI 9GKJGOÒP\GP 5NI 5EJTCV\  9GKJGOÒP\GP '. #WMVKQP  XQO   '.#WMVKQPXQO5NI9GTVJGKOGT6KTQN#WMVKQPXQO5NIXQP (CNMGPJCWUGP#WMVKQPXQO5NI4=GKEJGPYCNNPGT?5CN\DWTI5NI9CNVGT#WMVKQP XQO'.#WMVKQPXQO5NI.KPFPGT5CN\DWTI*CDUDWTIGVE'.#WMVKQP XQO5NI(WTIGT5EJYGK\1JPG6HP'.#WMVKQPXQO5NI*CTVOCPP WPF .QEJPGT  '. #WMVKQP  XQO  5NI /CWTGT WPF -GNNGTOC[T  #WMVKQP  XQO    5NI 5EJTQVV  '.  #WMVKQP  XQO  5NI $GTIGT #WMVKQPXQO 5NI*ÌTWPF5NI$TG[OC[GT'.#WMVKQPXQO5NI)GDJCTFVWPF5NI)WDGWPF5NI %WTVKWU  #WMVKQP  XQO  5NI (KUEJGT  6GKNYGKUG 2CRKGT IGDT·WPV 6GKNYGKUG OKV DGKIG   UEJTKGDGPGP2TGKUGP/CPEJG5GKVGPTGRCTKGTV+P$·PFGPKP)CP\NGKPGPIGDWPFGP  



. #WMVKQPGP  CWU FGP ,CJTGP  'PVJCNVGP UKPF FKG 5COONWPIGP 5NI .KPFPGT  5CN\DWTI   *CDUDWTI5NI)GDTÒFGT(WTIGT5EJYGK\5NI*CTVOCPPWPF5NI.QEJPGT/KVVGNCNVGTWPF0GW\GKV 5NI/CWTGTWPF5NI-GNNGTOC[T/KVVGNCNVGTWPF0GW\GKV$ÌJOGP'IIGPDGTI5EJNKEM9CNNGPUVGKP 5NI5EJTQVV7PKXGTUCN=5NI4CKPGT?6GKNG7PKXGTUCN#NNGOKV'.+P$·PFGPKP)CP\NGKPGP IGDWPFGP  



'ZNKDTKU'F/GTVGPU*CPPQXGTKO8QTUCV\

. #WMVKQPGP  CWU FGP ,CJTGP  WPF  5NI =4CKPGT?  6GKN  7PKXGTUCN  0TP    6HP'.GKPIGDWPFGP$GKIGUEJTKGDGPG2TGKUG-CVCNQIGKPGKPGO$CPFIGDWPFGP*CNDNGFGTDGTKG DGPWPFDGUVQ­GP//#)



. #WMVKQPXQO5NI(TCPM9ÒT\DWTI(FXQP'NNOGPFKPIGP5NI9GKUU$CFGP 0TP6HP'.#WMVKQPXQO2QNGP&CP\KI6JQTP0TP6HP'.9G PKIG6CHGNPNGKEJVTGRCTKGTV-CVCNQIGKPGKPGO$CPFIGDWPFGP)CP\NGKPGP



. *'.$+0)0#%*(1/ÒPEJGP#WMVKQPGPCWUFGP,CJTGP$GUV·PFGFGTCWHIG NÌUVGP(KTOC<5%*+'5%*'-¤&'4.GKR\KI6GKN 0TP 6HP$GKIG UEJTKGDGPG2TGKUG-CVCNQIGKPFTGK$·PFGPIGDWPFGP'KPJGKVNKEJGT)CP\NGKPGP$·PFGVCFGNNQUGTJCN VGP//#)  



. #WMVKQPGP   5NI =5QGEMGN?5NI-CJNGTVWPF-T·OGT5NI9CNVGT5NI(TGKJGTT\W 4JGKP5NIFGN5VTQVJGT5NI*KPVGTUVQKUUGT5NI5GKH    &CDGKGKPKIG&WDNGVVGP  UQYKG8GTMCWHUNKUVGP  6GKNYGKUGDGKIGUEJTKGDGPG2TGKUG1TKI$TQUEJWT

Z )CP\NGKPGP Z *CNDNGKPGP Z   



*QEJKPVGTGUUCPVGU-QPXQNWVOKVDGFGWVGPFGP5COONWPIGPWPFKP\WOGKUVVCFGNNQUGP)CP\NGKPGPGKPD·PFGP

. #WMVKQPXQO5NI0CIGN(TGKOCWTGTOGFCKNNGP5NI.QTGP\5EJYCNDCEJ0TP 6HP)CP\NGKPGP//#)



. #WMVKQPXQO5NIXQP9CUUGTUEJNGDGP2QOOGTP1UVRTGW­GP0TP6HP$GKIG UEJTKGDGPG2TGKUGWPFOCPEJOCN-·WHGT)CP\NGKPGP



. #WMVKQPXQO5NI$WEJGPCW/ÒP\GPFGU/KVVGNCNVGTUWC0TP6HP)CP\NGK PGP



. #WMVKQPGPCWUFGP,CJTGP&CU(ÒTUVNKEJ(ÒTUVGPDGTIKUEJG/ÒP\MCDKPGVV\W &QPCWGUEJKPIGP0TP 6HP 6GKNYGKUG 5. GKPIGDWPFGP OGKUV OKV DGKIGUEJTKGDGPGP 2TGKUGP  -CVCNQIG KP FTGK $·PFGP KP   )CP\NGKPGPIGDWPFGP//#)  



. #WMVKQPGP Z CWUFGP ,CJTGPªDGTYKGIGPF1TKI$TQUEJWTYGPKIGKP*CNDNGKPGPIGDWPFGPVGKNYGKUGOKV5.WPF '.  



. *'55#(TCPMHWTVC/#WMVKQPXQO5NI4WFQNRJXQP9KNFGPUVGKP<QNNGTWPF5VÌNVKPI 6GKN7PKXGTUCN#PVKMG(TCPMHWTVFGWVUEJG5V·FVGOÒP\GP0TP6H'.#WMVKQPXQO 5NI5VÌNVKPI6GKNWPF%NGHH7PKXGTUCN0TP6H'.*CNDNGFGTWPF*CNDNGKPGP 2CRKGTIGDT·WPVWPFYGPKIG5GKVGPGKPIGTKUUGP  



112


AUKTIONSKATALOGE . #WMVKQP  XQO5NI$=KGDGT?2QTVWIKGUKUEJG/ÒP\GP0TP6H#WMVKQPXQO  5NI 5EJWNV\G  )GKUVNKEJMGKV  0TP $GKIGUEJTKGDGPG 2TGKUG #WMVKQP XQO    5NI4QJFG$[\CP\0TP2CRKGTIGDT·WPV/CPEJG5GKVGPGKPIGTKUUGP+PGKPGO$CPFKP)CP\NGK PGPIGDWPFGP



. #WMVKQP  XQO  5NI 5GFIYKEM$GTGPF  &GWVUEJNCPF +VCNKGP 5EJYGK\ /GFCKNNGP    0TP6HP#WMVKQPXQO5NI+V\KPIGT-WPUVOGFCKNNGP0TP6HP'.#WM VKQPXQO=5NI-QHNGT?*CDUDWTI-WPUVOGFCKNNGP0TP6HP*'550#%*( # (TCPMHWTV CO /CKP #WMVKQP  XQO  5NI (TKGFGTKEJ  -WPUVOGFCKNNGP /GFCKNNGP FGU   #PVQP5EJCTHH0TP6HP#WMVKQPXQO5NI9JKVEQODG)TGGPG-WPUVOGFCKNNGP 0TP6HP#WMVKQPXQO5NI9JKVEQODG)TGGPG-WPUVOGFCKNNGP$TCPFGPDWTI  0TP  6HP #WMVKQP  XQO  5NI 9JKVEQODG )TGGPG  -WPUVOGFCKNNGP TÌOKUEJG   )QNFOÒP\GP0TP6HP'.6GKNYGKUGDGKIGUEJTKGDGPG2TGKUG'KPKIG5GKVGPNQUGQFGTGKPIGTKU UGP-CVCNQIGKPGKPGO$CPFKP*CNDNGKPGPIGDWPFGP2CRKGTNGKEJVIGDT·WPVWPFGVYCUDGUVQ­GP



. #WMVKQPXQO5NI/QTGN(CVKQ/KVVGNCNVGT0GW\GKV5NI)GDGTV'KEJUV·VV0TP 6HP)CP\NGKPGP2CRKGTNGKEJVIGDT·WPV//#)



. #WMVKQP  XQO  WPF #WMVKQP  XQO 5NI &QPGDCWGT  6GKN  WPF  $ÌJOGP   0TP6GKNYGKUGDGKIGUEJTKGDGPG2TGKUG-CVCNQIGKPGKPGO$CPFIGDWPFGP)CP\NGKPGP2CRKGT NGKEJVIGDT·WPV



. #WMVKQP  XQO  5NI 5GEMGT  6CNGT  0TP $GKIGUEJTKGDGPG 2TGKUG 2CRKGT NGKEJV IG   DT·WPV&KGGTUVGPFTGK5GKVGPGKPIGTKUUGP



*QEJKPVGTGUUCPVGT5COOGNDCPFOKV-CVCNQIGPÒDGT-WPUVOGFCKNNGP

$GUKV\GTUVGORGN#FQNRJ*GUU0CEJH

. #WMVKQP  XQO  5NI &GNDGEMG  )TKGEJKUEJG /ÒP\GP =5NI XQP 4QVJ?  -WPUVOGFCKNNGP   2QTVT·VOGFCKNNGP=5NI+XGTUGP?7PKXGTUCN0TP6HP)CP\NGKPGP#WHFGPGTUVGP\YGK5GKVGP HGJNVFKGTGEJVGWPVGTG'EMG//#)



. #WMVKQPXQO/KVVGNCNVGTDGU&GWVUEJNCPF'PINCPFWPF5MCPFKPCXKGP5OKV#DD 0TP6H)CP\NGKPGP



. #WMVKQP  XQO  5NI (CTKPC  4JGKPKUEJG .·PFGT $TCPFGPDWTI2TGW­GP 9GUVHCNGP    0TP6HP)CP\NGKPGPVCFGNNQUGTJCNVGPGU'ZGORNCTFKGUGTDGFGWVGPFGP5COONWPI



. #WMVKQP  XQO  5NI (CTKPC  4JGKPKUEJG .·PFGT $TCPFGPDWTI2TGW­GP 9GUVHCNGP    0TP6HP'.#WMVKQPXQO5NI+UGPDGEM7PKXGTUCN$CODGTI9ÒT\DWTI/CI FGDWTIGVE0TP'.&C\W*#/$74)'4..(TCPMHWTVC/#WMVKQPXQO 5NI5CWTOC,GNVUEJ$GIKPPFGT)TQUEJGPRGTKQFGDKU\WT-KRRGT\GKV0TP6HP'.-CVC NQIGKPGKPGO$CPFKP*CNDNGKPGPIGDWPFGP4ÒEMGPNQUG



. #WMVKQP  XQO  5NI FGU #TVU  *CODWTI  0TP '. $GKIGDWPFGP 8GTMCWHUNKUVG XQP   8GTMCWHUNKUVGXQP6JCNGTWPF/GFCKNNGP5COONWPI  



/KVOGJTGTGP$GUKV\GTUVGORGNP

. *'550#%*(#(TCPMHWTVC/#WMVKQPXQO5NI9GUGPGT7PKXGTUCN0TP #WMVKQP  XQO  5NI 2PKQYGT  $TCPFGPDWTI2TGW­GP  0TP  6HP '. +P GKPGO   $CPFKP)CP\NGKPGPIGDWPFGP2CRKGTIGDT·WPV



. #WMVKQP  XQO  5NI /G[GT)GFCPGPUKU  6GKN  /ÒP\GP WPF /GFCKNNGP FGT -CKUGT WPF   -ÌPKIGFGT)GKUVNKEJMGKVWPFFGT#NVHÒTUVNKEJGP*·WUGT0TP6HP#WMVKQPXQO 5NI/G[GT)GFCPGPUKU6GKN0GWHÒTUVGP+VCNKGP5EJYGK\0KGFGTNCPFGGVE0TP6HP $GKFG OKV '.6HPOKPKOCNCPIGUEJPKVVGP+PGKPGO$CPFKP*CNDNGFGTIGDWPFGPDGUVQ­GP//#) 



. #WMVKQP  XQO  5NI (GNKZ  -WPUVOGFCKNNGP JCWRVU·EJNKEJ CWU FGT 2GTKQFG FGT FGWVUEJGP   4GPCKUUCPEG5OKV0TP6HP/KVDGKIGUEJTKGDGPGP2TGKUGPWPF'.)CP\NGKPGP



. #WMVKQP  XQO  =5NI $=KGDGT?  7PKXGTUCN  0TP  6HP '. 2CRKGT NGKEJV IGDT·WPV   )CP\NGKPGP



. #WMVKQPXQO5NI5EJWNV\G/ÒP\GPWPF/GFCKNNGP)WUVCX#FQNRJU-ÌPKIXQP5EJYGFGP 0TP6HP6HPGYCUCPIGUEJPKVVGP)CP\NGKPGP



. #WMVKQPXQO5NIXQPFGT*G[FGP$TCPFGPDWTI2TGW­GP0TP6HP#WMVKQP XQO5NIXQPFGT*G[FGP$TCPFGPDWTI2TGW­GP4GHQTOCVKQP(TGKOCWTGT0TP 6HP $GKIGUEJTKGDGPG 2TGKUG WPF GKPKIG 0QVK\GP 6HP GVYCU CPIGUEJPKVVGP  -CVCNQIG KP GKPGO $CPF   IGDWPFGP



. #WMVKQP  XQO  5NI 4QGFGT  9ÒT\DWTI  0TP  6H OKV DGKIGUEJTKGDGPG 2TGKUG   0QVK\GPCWHFGP6HP)CP\NGKPGP

 113


AUKTIONSKATALOGE . #WMVKQP  XQO  5NI XQP $ÒNQY  /GEMNGPDWTI 5NI /ÌNNGT  7PKXGTUCN 5NI *QVJQTP   6KTQN4JGKPNCPF0TP#WMVKQPXQO=5NI*GKNDTQPPGT?7PKXGTUCN=5NI5EJÌP DGTI6JCOOGPJCKP?4GHQTOCVKQPUOÒP\GPWPF/GFCKNNGP=5NI2TKP\)GQTIXQP2TGW­GP?7PKXGTUCN 0TP'.2CRKGTIGDT·WPV+PGKPGO$CPFKP)CP\NGKPGPIGDWPFGP



. #WMVKQPGP Z 5NI)GUUPGT5NI*QN\OCPP5NI8QIGNXQO         #WM   VKQPGP    &WDNGVVGP FGU MÌPKINKEJGP /ÒP\MCDKPGVVU \W $GTNKP 6GKNYGKUG DGKIGUEJTKGDGPG   2TGKUG-CVCNQIGKP$·PFGPKP)CP\NGKPGPIGDWPFGP



. #WMVKQP  XQO  &WDNGVVGP FGU MÌPKINKEJGP /ÒP\MCDKPGVVU \W $GTNKP /KVVGNCNVGT    0TP '. #WMVKQP  XQO  &WDNGVVGP FGU MÌPKINKEJGP /ÒP\MCDKPGVVU \W $GTNKP 0GW\GKV   0TP6HP2CRKGTIGDT·WPV6GKNYGKUGDGKIGUEJTKGDGPG2TGKUG+PGKPGO$CPFKP)CP\NGKPGP IGDWPFGP



. #WMVKQPXQO5NI/GTVGPU/QFGTPG-WPUVOGFCKNNGP2NCMGVVGP/GFCKNNGPCWH2TKXCVRGT UQPGP0TP6HP$GKIGUEJTKGDGPG2TGKUG2CRKGTIGDT·WPV)CP\NGKPGP



. #WMVKQPXQO5NI/GTVGPU/QFGTPG-WPUVOGFCKNNGP2NCMGVVGP/GFCKNNGPCWH2TKXCVRGT UQPGP0TP6HP2CRKGTIGDT·WPV$TQUEJKGTV$TQUEJWTDGUEJ·FKIV



. #WMVKQP  XQO  5NI -KNNKUEJ XQP *QTP  $TCPFGPDWTI2TGWUUGP 0TP6HP'. *CNDNGKPGPCWUIGDNKEJGPGT4ÒEMGP



. #WMVKQPXQO5NIXQP-WDKEMK2QNGP0TP6HP'.GKPIGDWPFGP6HPGVYCU CPIGUEJPKVVGP2CRKGTIGDT·WPV)CP\NGKPGP



. #WMVKQP  XQO  5NI 7NGZ  0QTF <GPVTCN WPF 5ÒFCOGTKMC  0TP  6HP $GKIG   UEJTKGDGPG2TGKUG2CRKGTIGDT·WPV)CP\NGKPGP



. #WMVKQP       CWU FGP ,CJTGP 5NI 'TDUVGKP  6GKN  MQORNGVV  'WTQR·KUEJG/ÒP\GPFGU/KVVGNCNVGTUWPFFGT0GW\GKV<WU0TP6HP$KUCWH6GKNOKV'. 6GKNYGKUG DGKIGUEJTKGDGPG 2TGKUG 9GPKIG 6HP GVYCU CPIGUEJPKVVGP 9GPKIG 5GKVGP TGRCTKGTV #NNG    -CVCNQIGKP$·PFGPKP*CNDNGKPGPIGDWPFGPOKPKOCNDGUVQ­GP  



#NUMQORNGVVG5GTKGUGNVGPCPIGDQVGP

. #WMVKQP  XQO  5NI 0QNVG  $TCPFGPDWTI2TGW­GP *QJGP\QNNGTP $TCPFGPDWTI(TCPMGP   5EJNGUKGP/GFCKNNGPCWHDGTÒJOVG2GTUQPGP0TP6HP'.)CP\NGKPGP



. #WMVKQP  XQO  =5NI 4WORH?  4GHQTOCVKQP WPF 2TQVGUVCPVKUOWU  0TP  6HP '.   )CP\NGKPGP



. #WMVKQP  XQO  5NI # (TG[DQWTI /ÒP\GP WPF /GFCKNNGP XQP 2QOOGTP WPF 5EJYGFGP    0TP  6HP '. #WMVKQP XQO  6CNGT $TCPFGPDWTI2TGWUUGP 7PICTP 5KGDGPDÒT   IGP0TP6H)CP\NGKPGP



. #WMVKQPXQO&WDNGVVGPFGUMCKUGTNKEJGP/ÒP\MCDKPGVVUFGT'TGOKVCIGKP5V2GVGTUDWTI 7PKXGTUCN  0TP6HP2CRKGTIGDT·WPV)CP\NGKPGP#WMVKQPXQO5NI)TCH 6QNUVQK4WUUKUEJG/ÒP\GPFGU,CJTJWPFGTVU0TPQJPG6HPOKVDGKIGUEJTKGDGPGP2TGKUGP 1TKI$TQUEJWTDGUVQ­GP&C\W0CEJFTWEMFGT#WMVKQPXQO5NI-NKPIGTV4WUUKUEJG /ÒP\GP0TP6HP'.$TQUEJKGTV  



. #WMVKQPXQO=5NI6KEJ[?/ÒP\GPWPF/GFCKNNGPFGU-ÌPKITGKEJU$ÌJOGP0TP 6HP2CRKGTIGDT·WPV)CP\NGKPGP



. #WMVKQP  XQO  5NI $TCVTKPI 2QOOGTP 5EJYGFGP WPF $TCPFGPDWTI2TGW­GP    0TP6HP)CP\NGKPGP



. #WMVKQPXQO=5NI2TQYG?)TKGEJGP4ÌOGT0TP6HP//#)$GK IGDWPFGP#4+'%*/#00#WMVKQPXQO5NIGKPGU(CDTKMFKTGMVQTU)KP)4ÌOGT 0TP6HP)CP\NGKPGPDGKIGDWPFGPGT0WOOGTPVGKNIGDT·WPV



. #WMVKQPXQO5NI5EJG[GT4ÌOKUEJG/ÒP\GP0TP6HP)CP\NGKPGP



*CPFUEJTKHVNKEJGT$GUKV\GTXGTOGTM

. #WMVKQPXQO5NI(TKGFGTKEJ5VQNDGTIWPF*QJPUVGKP0TP6HP1TKI $TQUEJWT



. 0CEJFTWEM FGT #WMVKQP  XQO  5NI $TWWP  6GKN  5EJYGFGP  0TP  6HP    6HP'.6GZVWPF6CHGNVGKN(CNVOCRRGDGUEJ·FKIV$TQUEJKGTV  



114


AUKTIONSKATALOGE

1447

. #WMVKQPWPFXQOWPF5NI$TWWP5EJYGFKUEJG/ÒP\GP6GKN WPF0TP6HP0T6HP6GKNOKVDGKIGUEJTKGDGPGP'TIGDPKUUGP6GKN YWTFGYGIGPFGU9GNVMTKGIUCWUDTWEJUPKEJVXGTUVGKIGTV*CNDNGFGTOKVPWTYGPKIGP)GDTCWEJUURWTGP 'ZNKDTKU+%*CWHFGT&GEMGNKPPGPUGKVG







#WHYGKVGTGP5GKVGPUKPFXGTUEJKGFGPG'TKPPGTWPIUUVÒEMGCPFGP5COONGT$TWWPGKPIGMNGDVWCGKP#WVQITCOO FGU5COONGTUGKP(QVQXQP$TWWPKPLÒPIGTGP,CJTGPDGKFGP6CHGNPGKP$TKGH$TWWPUXQOIGUEJTKGDGP OKV UGKPGT #FTGUUG .KPFGICCTFGP #PPGVVGXGL %JCTNQVVGPNWPF CP &T , 9KNCMG UQYKG CWH FGP NGV\VGP 5GKVGP   XGTUEJKGFGPGUEJYGFKUEJG<GKVWPIUCTVKMGNOKVFGT0CEJTKEJVUGKPGU6QFGUKP/QPVG%CTNQKPUGKPGT8KNNC'NGCPQT

. #WMVKQP  XQO  5NI *QTUM[  #PVKMG /ÒP\GP  0TP  6HP )CP\NGKPGP //#)   



. #WMVKQPXQO5NI*QTUM[#PVKMG/ÒP\GP0TP6HP1TKI$TQUEJWTDGUVQ ­GP6HNQUG//#)



. #WMVKQPXQO=5NI8KGTQTFV?)TKGEJKUEJG/ÒP\GP0TP6HP$GKIGUEJTKGDGPG 2TGKUGWPF0QVK\GP)CP\NGKPGP//#)



$GUKV\GTUVGORGN&T(:9GK\KPIGT%Q

. #WMVKQPXQO \WUCOOGPOKV4-7$'$GTNKP 5NI$CJTHGNFV/ÒP\GPFGU&GWVUEJGP /KVVGNCNVGTU0TP6HP9CUUGTUEJCFGPCWHFGPNGV\VGP5GKVGPCOWPVGTGP4CPF2CRKGTYKG KOOGTNGKEJVIGDT·WPV)CP\NGKPGP//#)



. #WMVKQP  XQO  =5NI 8GTYQTP?  8ÌNMGTYCPFGTWPI  0TP  6HP 1TKI$TQUEJWT   4ÒEMGPDGUEJ·FKIV2CRKGTIGDT·WPV//#)



. #WMVKQP  XQO  5NI .ÌDDGEMG )TKGEJKUEJG WPF TÌOKUEJG /ÒP\GP  0TP  6HP   )CP\NGKPGP



. #WMVKQP  XQO  5NI 8QIGN  6GKN  ¤UVGTTGKEJ 7PICTP 4WUUNCPF 2QNGP $CNVKMWO   &·PGOCTM  0TP  6HP #WMVKQP  XQO  5NI 8QIGN  6GKN  5ÒFFGWVUEJNCPF   'NUCUU(TCPMTGKEJ5RCPKGP0KGFGTNCPFG0TP6HP$GKIGUEJTKGDGPG2TGKUG-CVCNQIG KPGKPGO$CPFKP)CP\NGKPGPIGDWPFGP



. #WMVKQPXQO5NI9GYGNGT9GUVHCNGPWPF0CEJDCTIGDKGVG0TP6HP//#)  &KG GTUVGP 5GKVGP NGKEJV GKPIGTKUUGP 1TKI$TQUEJWT DGUEJ·FKIV &C\W #WMVKQP  XQO   0TPQJPG6HP&WTUEJUEJQUUGPGU'ZGORNCTOKV2TGKUGP)CP\NGKPGP  



. #WMVKQPXQO5NI2GP\KI5CEJUGP0TP6HP5.)CP\NGKPGP



. -QPXQNWV\CJNTGKEJGT#WMVKQPUMCVCNQIGFGT(KTOC*GUU#WMVKQPGP5NI9GKPI·TVPGT 5NI 5WEJUNCPF         5NI -WNN           Z   Z  5NI6TCW5NI)TCH'P\GPDGTI.KUVGP      &C\W GKPKIG 8GTMCWHUNKUVGP CWU FGP ,CJTGP  )CP\NGKPGP Z    $TQUEJKGTV Z *CNDNGFGT Z *CNDNGKPGP Z     *QEJKPVGTGUUCPVGU-QPXQNWVOKVDGFGWVGPFGP5COONWPIGPWPFKP\WOGKUVVCFGNNQUGP)CP\NGKPGPGKPD·PFGP

. #WMVKQP WPFCWUFGP,CJTGP1TKI$TQUEJWTVGKNYGKUGOKV5.  

 115


AUKTIONSKATALOGE . *'55#)#.W\GTP#WMVKQPGPXQO5NI'T\JGT\QI 5KIKUOWPFXQP¤UVGTTGKEJ'WTQRC*CDUDWTI&GWVUEJNCPF   0TP    6HP5.KP-CVCNQI6GKNFQRRGNVXQTJCPFGP-CVCNQIGKP\YGK$·PFGPIGDWPFGP *CNDNGKPGPOKPKOCNDGUVQ­GPWPF)CP\NGKPGP  



. *+45%* , /ÒPEJGP #WMVKQP  XQO  5NI )TCH $=GTEJGO?  $C[GTP 2HCN\ 9CNNHCJTV   2GUVCOWNGVVG0TP6HP'.VGKNYGKUGDGKIGUEJTKGDGPG2TGKUG*CNDNGKPGP



. #WMVKQP  XQO  #PVKMG  0TP  6HP '. DGKIGUEJTKGDGPG 2TGKUG 6H  TGRCTKGTV   *CNDNGKPGP



. #WMVKQP  XQO  )TKGEJKUEJG WPF TÌOKUEJG /ÒP\GP  0TP  6HP $GKIGUEJTKGDGPG   2TGKUG*CNDNGKPGP



. #WMVKQPXQO)TKGEJGP4ÌOGT&GWVUEJNCPF5NI5=VWV\?/GFCKNNGPWPF2NCMGVVGP#PVQP 5EJCTHH U0TP6HP'.$GKIGUEJTKGDGPG2TGKUG*CNDNGKPGP



. #WMVKQP  XQO  )QNFOÒP\GP XQP 7PICTP WPF 5KGDGPDÒTIGP  0TP  6HP $GKIG   UEJTKGDGPG2TGKUG*CNDNGKPGP



. #WMVKQP  XQO  5NI -  )TKGEJKUEJG WPF TÌOKUEJG /ÒP\GP  0TP  6HP $GKIG   UEJTKGDGPG2TGKUGWPFGKPKIG0QVK\GP*CNDNGKPGP



. #WMVKQPXQO5NI/)TKGEJKUEJGWPFTÌOKUEJG/ÒP\GP0TP6HP'..GKEJV UVQEMHNGEMKI*CNDNGKPGP



. #WMVKQPXQO=5NI4JQWUQRQWNQU?)TKGEJKUEJG/ÒP\GP0TP6HP'.&GFK ECVKQPUGZGORNCT*CNDNGKPGP



. #WMVKQPXQO5NI/GTMGPU)TKGEJKUEJG/ÒP\GPDGU)TQ­ITKGEJGPNCPFWPF5K\KNKGP 4ÌOKUEJG/ÒP\GP0TP6HP$GKIGUEJTKGDGPG2TGKUGWPF-·WHGT*CNDNGKPGP



. #WMVKQPXQO=5NI2JKNKRUGP?)TKGEJGPDGU*KURCPKC)CNNKC+VCNKC5K\KNKC%CTVJCIQ 5NI.ÌDDGEMG4ÌOKUEJG)QNFOÒP\GP.KVGTCVWT0TP6HP6GKNYGKUGDGKIGUEJTKGDGPG2TGKUG WPF-·WHGT1TKI$TQUEJWTUVCTMDGUEJ·FKIV.GV\VGU$NCVVNQUG



. #WMVKQPXQO)TKGEJKUEJG/ÒP\GPDGU+VCNKC5KEKNKC6JGUUCNKC'NKUWC0TP 6HP'.*CNDNGKPGPDGUVQ­GP



. #WMVKQP  XQO  5NI +OJQQH$NWOGT  4ÌOKUEJG WPF D[\CPVKPKUEJG /ÒP\GP )TKGEJKUEJG   /ÒP\GP  0TP  6HP 6GKNYGKUG OKV '. WPF JCPFUEJTKHVNKEJGP '. VGKNYGKUG DGKIGUEJTKGDGPG   2TGKUG*CNDNGKPGP//#)



. #WMVKQP  XQO  5NI +OJQQH$NWOGT  4ÌOKUEJG WPF D[\CPVKPKUEJG /ÒP\GP )TKGEJKUEJG   /ÒP\GP0TP6HP*CNDNGKPGPVGKNYGKUGDGKIGUEJTKGDGPG2TGKUGUGJTIWVG'TJCNVWPI//#) 



. #WMVKQPXQO=5NI8KT\K?)TKGEJKUEJG/ÒP\GPDGU5K\KNKGP0TP6HP$GKIG UEJTKGDGPG2TGKUG'.*CNDNGKPGP



. #WMVKQP  XQO  5NI *QUMKGT  )TKGEJKUEJG WPF TÌOKUEJG /ÒP\GP  0TP  6HP   $GKIGUEJTKGDGPG2TGKUG'.*CNDNGKPGP



1475

. #WMVKQP  XQO  5NI 9GDGT  6GKN  )TKGEJKUEJG /ÒP\GP  0TP    6HP '.   #WMVKQPXQO5NI9GDGT6GKN4ÌOKUEJGWPFD[\CPVKPKUEJG/ÒP\GP0TP 6HP 6GZV WPF 6CHGNDCPF $GK FGT #WMVKQP  HGJNGP 6HP +P \YGK $·PFGP KP *CNDNGFGT IGDWPFGP   OKPKOCNDGUVQ­GP   'ZNKDTKU/CZKOKNKCP-TCW­

116




AUKTIONSKATALOGE . #WMVKQP  XQO  5NI 9GDGT  6GKN  )TKGEJKUEJG /ÒP\GP  0TP  6HP $GKIG   UEJTKGDGPG2TGKUGWPF-·WHGT*CNDNGKPGP



. #WMVKQP  XQO  =5NI 5EJGPPKU?  4ÌOKUEJG /ÒP\GP (F )QNFOÒP\GP %QPUVCPVKPU FGU   )TQ­GPWPFUGKPGT(COKNKG0TP6HP'.$GKIGUEJTKGDGPG2TGKUGWPF-·WHGT*CNDNGKPGP



. #WMVKQPXQO5NI2JKNKRUGP#PVKMGDGU)TKGEJGPNCPF#UKGPWPF#HTKMC0TP 6HP/GKUVGPUDGKIGUEJTKGDGPG2TGKUGWPF-·WHGT*CNDNGKPGP



. #WMVKQPXQO5NI2JKNKRUGP#PVKMGDGU)TKGEJGPNCPF#UKGPWPF#HTKMCUVCVV 0TPUVCVV6HP+P\YGK$·PFGPKP*CNDNGFGTIGDWPFGPOKPKOCNDGUVQ­GP  



'ZNKDTKU/CZKOKNKCP-TCW­

. #WMVKQPXQO5NI.CODTQU)TKGEJGP=5NI*GT\HGNFGT?4ÌOKUEJG/ÒP\GP.KVGTCVWT 0TPQJPG6HP9GPKIGDGKIGUEJTKGDGPG2TGKUG1TKI$TQUEJWT



. #WMVKQP  XQO  5NI $CTTQP WPF =5NI 'XCPU?  )TKGEJKUEJG WPF TÌOKUEJG /ÒP\GP    0TP6HP$GKIGUEJTKGDGPG2TGKUGWPFVGKNYGKUG-·WHGT*CNDNGKPGP



. #WMVKQPXQO5NI)WVGMWPUV0KGUUWPF5NI$CTTQP)TKGEJKUEJGTÌOKUEJGWPFD[\CPVKPK UEJG/ÒP\GP0TP6HP+P\YGK$·PFGPKP*CNDNGFGTIGDWPFGPOKPKOCNDGUVQ­GP6GZVWPF 6CHGNVGKN  



'ZNKDTKU/CZKOKNKCP-TCW­

. #WMVKQPXQO5NIXQP5EJGPPKUWPF5NI-=ÌTPGT?)TKGEJKUEJGTÌOKUEJGWPFD[\CPVK PKUEJG/ÒP\GP0TP6HP*CNDNGFGTVCFGNNQUGT<WUVCPF//#)



. #WMVKQPXQO5NI)WVGMWPUV)TKGEJKUEJG4ÌOKUEJGWPF$[\CPVKPKUEJG/ÒP\GP/GFCKN NGP WPF 2NCMGVVGP FGT 4GPCKUUCPEG /ÒP\GP WPF /GFCKNNGP XQP 9ÒTVVGODGTI GVE XQT\WIUYGKUG CWU   FGO0CEJNCUUGGKPGUDGMCPPVGPFGWVUEJGP-WPUVUCOONGTU0TP6HP*CNDNGFGTDGKIGUEJTKG DGPG'TIGDPKUUG



'ZNKDTKU,/CNVGT75#GZ$KDNKQVJGM,5EJWNOCP#OUVGTFCO

. 8GTMCWHUMCVCNQIXQP7PKXGTUCN0TP*CNDNGKPGP//#)



. 8GTMCWHUMCVCNQIXQP7PKXGTUCN0TP6KVGNDNCVVTGRCTKGTV*CNDNGKPGP



. 8GTMCWHUMCVCNQIXQP1MVQDGT#PVKMG0TP*CNDNGKPGP



. 8GTMCWHUNKUVGCWUFGO(GDTWCT)TKGEJGP0TPOKV#DD*CNDNGKPGP



. *14070) 5 /¦06#7-6+10'4 -QRGPJCIGP #WMVKQPGP       &C\W   *+45%*/;06*#0&'.#$5VQEMJQNO#WMVKQP5NI5XGPUUQP+++#4#5/755'0-QRGPJC IGP#WMVKQP5NI'TPUV+#WMVKQP5NI2TQUEJQYUM[$TQUEJKGTV  



. -10+0) , #OUVGTFCO #WMVKQP XQO  5NI 2KGTTG XCP &COOG   0TP /QFGTPGU   *CNDNGKPGP



. -4#75 ( ( $TCWPUEJYGKI #WMVKQP  XQO  $TCWPUEJYGKI WPF 0KGFGTUCEJUGP    0TP6HP#WMVKQPXQO0KGFGTUCEJUGPWPF9GUVHCNGP0TP6HP#WMVKQP XQO  5NI 2CWNK  )QNFOÒP\GP .ÌUGT #WUDGWVGOÒP\GP 5CEJUGP 5NI /KEJCKNQXKVUEJ   ,GHKOKMK0TP6HPGKPJGKVNKEJG1TKI$TQUEJWT4ÒEMGPGVYCUCWUIGDNKEJGP//#)  



. #WMVKQP  XQO  $TCWPUEJYGKI WPF 0KGFGTUCEJUGP  0TP  6HP #WMVKQP  XQO   0KGFGTUCEJUGPWPF9GUVHCNGP0TP6HP#WMVKQPXQO5NI2CWNK )QNFOÒP\GP .ÌUGT #WUDGWVGOÒP\GP 5CEJUGP 5NI /KEJCKNQYKVUEJ  ,GHKOKMK  0TP  6HP   $GKIGUEJTKGDGPG2TGKUG+PGKPGO$CPFKP)CP\NGKPGPIGDWPFGP#WMVKQPOKV5.&C\WFKXGTUG8GT MCWHUMCVCNQIG$TCWPUEJYGKIGT/ÒP\XGTMGJTCWUFGP,CJTGPDKU1TKI$TQUEJWT



. #WMVKQPXQO#WMVKQPXQO'/'4<$#%*'40#%*(4/ÒPEJGP #WMVKQP  XQO   #WMVKQP  XQO  * /'755 *CODWTI #WMVKQP  XQO     #WMVKQP  XQO   #WMVKQP  XQO   #WMVKQP  XQO   #WMVKQPXQO#WMVKQPXQO1TKI$TQUEJWT Z *CND NGKPGP Z VGKNYGKUGOKV5.WPFPQVKGTVGP'TIGDPKUUGP  



. #WMVKQPXQO5NI2CWNK)QNFOÒP\GP.ÌUGT#WUDGWVGOÒP\GP5CEJUGP(GTPGTGKPKIG 5GNVGPJGKVGP WPF GKPG 5RG\KCNUCOONWPI XQP 6CNGTP OKV TWUUKUEJGP -QPVGTOCTMGP 5NI /KEJCKNQYKVUEJ   ,GHKOKMK0TP6HP5.1TKI$TQUEJWTDGUVQ­GP



. -4'55 - /ÒPEJGP #WMVKQPGP  CWU FGP ,CJTGP  &CTWPVGT #WMVKQP  XQO    5NI )QRRGN 2NWO WPF *QNNGT  ,QCEJKOUVJCNGT /GFCKNNGP 4GHQTOCVKQP .KGDG WPF 'JG   -TKGIWPF(TKGFGP$CFGP9GPKIGDGKIGUEJTKGDGPG2TGKUG/GKUVGPUOKV'.+PGKPJGKVNKEJGP)CP\NGK PGPD·PFGPIGDWPFGP#WMVKQPKP1TKI.GKPGP  



. -7$' 4 $GTNKP #WMVKQP  XQO  5NI -QTP  2TGW­GP 5EJNGUKGP -CKUGT WPF -ÌPKIG   0TP6HP$GKIGUEJTKGDGPG2TGKUG*CNDNGKPGP//#)

 117


AUKTIONSKATALOGE . #WMVKQPXQO5NI2GN\GT/GEMNGPDWTI7PKXGTUCN0TP)CP\NGKPGP



. #WMVKQP  XQO  5NI =$TCVTKPI? WPF *GTOCPP  5VTCNUWPF 7PKXGTUCN&QRRGNVCNGTWPFIWN FGP0CRQNGQP/GFCKNNGP0TP6HP)CP\NGKPGP



. #WMVKQP  XQO  4WUUKEJG /GFCKNNGP .ÒDGEM 4QUVQEM 9KUOCT 4GHQTOCVKQP 7PKXGTUCN   0TP)CP\NGKPGP



. #WMVKQP  XQO  5NI *CWUYCNFV  /CIFGDWTI )QNFIWNFGPHWPF &QWDNGVVGP $GTNKPGT   /ÒP\MCDKPGVV4WUUKUEJ)TWUKUEJG/ÒP\GP)TQUEJGPHWPF4ÌOGT0TP6HP1TKI$TQUEJWT $KPFWPIIGNÌUV



. #WMVKQPXQO5NI5EJWNV\/GFCKNNGP5NI/GV\4GKEJUOÒP\GP/KVVGNCNVGT0TP 6HP)CP\NGKPGP&C\WGKPKIG8GTMCWHUNKUVGPCWUFGP,CJTGP



. .#0<*)TC\#WMVKQPGP CWUFGP,CJTGP/GKUVGPUOKV'.WPF5.1TKI $TQUEJWT  



. .'*/#00 * WPF (.14#0)' , 2CTKU #WMVKQP XQO  5NI 'PIGN)TQU  &GWVUEJG   WPF UEJYGK\GTKUEJG 4GPCKUUCPEG/GFCKNNGP  0TP  6HP DGKIGUEJTKGDGPG 2TGKUG *CNDNGKPGP   //#)



. .'/2'46</-ÌNP#WMVKQPXQO5NI&TCGIGTWPF(CJTDCEJ7PKXGTUCN6CNGT 0TP 0CEJVTCI#WMVKQPXQO5NI&QTOCIGP7PKXGTUCN0TP#WMVKQP XQO5NI&GKEJOCPP7PKXGTUCN0TP#WMVKQPXQO5NI-GUUNGT 4ÌOKUEJG/ÒP\GP0TP.CIGTMCVCNQICWUFGO,CJTG+PGKPGO$CPFKP)CP\NGKPGPIGDWP FGP2CRKGTVGKNYGKUGIGDT·WPV



. #WMVKQPXQO5NIXCP8NGWVGP6GKN)TKGEJGP4ÌOGT$[\CPVKPGTUVCVV 0TP6HP)CP\NGKPGP



. #WMVKQP  XQO  5NI XCP 8NGWVGP  6GKN  )TKGEJGP 4ÌOGT $[\CPVKPGT  0TP    6HP1TKI$TQUEJWT$NGKUVKHVCPUVTGKEJWPIGP'KPDCPFGVYCUUEJOWV\KI//#)



. #WMVKQP  XQO  5NI XCP 8NGWVGP  6GKN  )TKGEJGP 4ÌOGT $[\CPVKPGT  0TP    6HP1TKI$TQUEJWTDGUVQ­GP4ÒEMGPIGMNGDV//#)



. #WMVKQPGP  XQO   XQO  WPF  XQO  5NI 2KGRGT  6GKN    4JGKPNCPFWPF9GUVHCNGPWPKXGTUCN0TP6HP#WMVKQPXQO5NI8QIGNUCPI'KPG #NNIGOGKPUCOONWPIOGKUV6CNGT0TP6H+PGKPGO$CPFIGDWPFGP.GKPGP//#)



. .'7 #) <ÒTKEJ WPF *'55 # .W\GTP #WMVKQP XQO  WPF  /ÒP\GP FGT *Q   JGPUVCWHGP\GKV5COONWPIGKPGU)GNGJTVGP=4)CGVVGPUUGP?6GKNG0TP6HP5.+PGKPGO $CPFKP)CP\NGKPGPIGDWPFGP



. /'4<$#%*'4 ' /ÒPEJGP -QPXQNWV XQP  #WMVKQPUMCVCNQIGP FCTWPVGT    *CPFGZGORNCTG   FGU #WMVKQPCVQTU  #WMVKQP XQO  5+I $CWGT  5EJÒV\GP 8GPGFKI 4GIGPUDWTI  0TP   (CNVDNCVV HÒT FKG 5EJÒV\GPOGFCKNNGP QJPG 6HP GTUEJKGPGP \\IN 5GRCTCVC FGU 4GIGPUDWTI6GKNU DTQ   UEJKGTV  #WMVKQP XQO  5+I 5G[HHGT  )TKGEJGP 4ÌOGT  0TP  6HP #WMVKQP XQO    5+I 2CWGT  7PKXGTUCN )GKUVNKEJMGKV  0TP 1JPG 6HP GTUEJKGPGP *CPFGZGORNCT FGU   #WMVKQPCVQTU #WMVKQP XQO  *GTXQTTCIGPFG )QNFOÒP\GP5COONWPI  0TP QJPG 6HP   *CPFGZGORNCT FGU #WMVKQPCVQTU #WMVKQP XQO  5+I 4QVGPJCP  $C[GTP 2HCN\  0TP   QJPG6HPGTUEJKGPGP#WMVKQPXQO5+I<CPMN2QNGP&CP\KI'NDKPI6JQTP0TP &QRRGNVHP'.OKV2TGKUGPWPF-·WHGTP#WMVKQPXQO5+I9GNUEJ$TWO7PKXGTUCN 0TP QJPG 6HP GTUEJKGPGP '. #WMVKQP XQO  5+I 5EJOKFV  2QNGP 3WGFNKPDWTI )QNF   HWPF XQP 7UKPIGP  0TP  &QRRGNVHP #WMVKQP XQO  5+I 4GKEJCTFV  4GIGPUDWTI   9GUVH·NKUEJGT)QNFHWPF0TP&QRRGNVHP#WMVKQPXQO5NI(CNMGPJCWUGP7PKXGT UCN OKV 9CRRGPFCTUVGNNWPIGP  0TP QJPG 6HP &WTEJIGJGPFG 2TGKUPQVKGTWPIGP #WMVKQP XQO    #NV W 0GWHÒTUVGP4&4)GKUVNKEJMGKV0TP6HP'.*CPFGZGORNCTFGU#WMVKQ PCVQTU #WMVKQP XQO  5+I -QNNOCPP  7PKXGTUCN )GIGPUVGORGN  0TP  6HP *CP   FGZGORNCT FGU #WMVKQPCVQTU #WMVKQP XQO  5+I 'RUVGKP .QPFQP  /WUKMGT 5EJYGK\ #NV   FGWVUEJNCPF  0TP  6HP '. #WMVKQP XQO  5+I 4QJFG  *QJGPNQJG #NVFGWVUEJNCPF   0CRQNGQP +  0TP  6HP *CPFGZGORNCT FGU #WMVKQPCVQTU #WMVKQP XQO  5+I , .GX[   -ÌNP  $CFGP 2HCN\ -ÌNP  0TP  6HP *CPFGZGORNCT FGU #WMVKQPCVQTU #WMVKQP XQO   5+IGKPGUKVCNKGP#OCVGWTU)TKGEJGP4ÌOGT0TP6HP#WMVKQPXQO 5+I (TJ XQP 5  7PKXGTUCN  0TP  6HP *CPFGZGORNCT FGU #WMVKQPCVQTU #WMVKQP XQO    5+I GKPGU HT\ #OCVGWTU XCP /W[FGP  )TKGEJGP 4ÌOGT  0TP  6HP #WMVKQP   XQO  5+I (TJ X 5GKPUJGKO  4&4 #NV W 0GWHÒTUVGP  0TP  6HP *CPFGZGORNCT   FGU #WMVKQPCVQTU #WMVKQP XQO  5+I GKPGU GNU·UUKUEJGP #OCVGWTU  4&4 $C[GTP 2HCN\   )QNFOÒP\GP  0TP  6HP WPF 0CEJVTCI #WMVKQP XQO  5+I )GQTIGU )CNNGV   5EJYGK\0TP6HP#WMVKQPXQO5+I(KEMGT+PPUDTWEM4&4,WFCKEC$C[GTP #WIUDWTI0TP6HP'. -QRKG #WMVKQPXQO5+IGKPGUUÒFFGWVUEJGP#TKUVQMTC VGP4GPCKUUCPEGWPF-WPUVOGFCKNNGP0TP6HP)TQUU(QNKQ#WMVKQPXQO7PKXGT UCN)QNF4GPCKUUCPEGOGFCKNNGP0TP6HP&C\W.CIGTMCVQNCIG.KGHGTWPI   WPF.KGHGTWPI  WPF0TP*CNDNGFGT Z\WO6GKNOKV4ÒEMGP XGTIQNFWPI )CP\NGKPGP Z *CNDNGKPGP Z DTQUEJKGTV Z     /KV#WMVKQPUMCVCNQIGPKUVFCUJKGTCPIGDQVGPG-QPXQNWVFCUDKUNCPIWOHCPITGKEJUVGFGT(KTOC&T/GT\DCEJGT D\Y /GT\DCEJGT 0CEJH FCTWPVGT DGHKPFGP UKEJ CEJV *CPFGZGORNCTG FGU#WMVKQPCVQTUWPF'ZNKDTKXQP*GKPTKEJ -QJN&QOGPKEQ4QUUK2WTKEGNNK

118


AUKTIONSKATALOGE . #WMVKQP  XQO  5NI 2CWGT  /QFGTPG /ÒP\GP WPF /GFCKNNGP  0TP 6GKNYGKUG DGKIG   UEJTKGDGPG2TGKUG2CRKGTIGDT·WPV)CP\NGKPGP



. #WMVKQPXQO)QNFOÒP\GP0TP6HPFCXQP&QRRGNVHP)CP\NGKPGP5GKVGPVGKN YGKUGTGRCTKGTV2CRKGTIGDT·WPV



. #WMVKQPXQO5NI(TJTXQP4QVGPJCP$C[GTP2HCN\0TP$GKIGUEJTKGDGPG2TGKUG 2CRKGTIGDT·WPV)CP\NGKPGP



. #WMVKQPXQO5NI5EJOKFV0GW\GKVDGU(TCPMHWTVUVCVV0TP6HP)CP\ NGKPGP



. #WMVKQPXQO5NI(TJTXQP(CNMGPJCWUGP7PKXGTUCN0TP6GKNYGKUGDGKIGUEJTKG DGPG2TGKUG)CP\NGKPGP



. #WMVKQPXQO5NIXQP1NU\QYUMK2QNGP5NI-CRU/GFCKNNGP0CRQNGQP+0TP )CP\NGKPGP



. #WMVKQPGPXQOXQO Z XQOXQOXQO   XQO   XQO   XQO   XQO   XQO    WPF  XQO  6GKNYGKUG DGKIGUEJTKGDGPG 2TGKUG &C\W GKPKIG DTQUEJKGTVG FQRRGNVG   -CVCNQIGUQYKG.CIGTNKUVGP)CP\NGKPGPWPF1TKI$TQUEJWT



+PVGTGUUCPVGU-QPXQNWV

. #WMVKQP  XQO  =5NI *GT\HGNFGT? WC 4ÌOKUEJG WPF ITKGEJKUEJG /ÒP\GP  0TP    6HP$GKIGUEJTKGDGPG2TGKUGWPFOGKUVGPUCWEJ-·WHGT8QTUCV\WPFFKGGTUVGP5GKVGPTGUVCWTKGTV)CP\ NGKPGP



. #WMVKQPXQO0GW\GKV0TP6HP$TQUEJKGTV



. #WMVKQPXQO-WPUVOGFCKNNGP0TP6HP(QNKQ-WPUVNGFGT6KVGNDNCVVHGJNVFKGNGV\VG 6CHGNTGUVCWTKGTV



/KV$GUKV\GTUVGORGN

. /'755 * *CODWTI #WMVKQP  XQO  5NI /ÒNNGT#NKPGPJQH 6GKN ++  0TP    6HP#WMVKQPXQO5NI&CP\KIGT$TGOGP$TGOGP8GTFGP5VCFG0TP6HP #WMVKQPXQO5NI/ÒNNGT#NKPGPJQH6GKN+80TP6HP#WMVKQPXQO 5NI/ÒNNGT#NKPGPJQH6GKN80TP6H#WMVKQPXQO7PKXGT UCN  0TP  6HP #WMVKQP  XQO  7PKXGTUCN  0TP  6HP5.#WMVKQP XQO7PKXGTUCN0TP6H#WMVKQPXQO0GW\GKV0TP#WMVKQ PGP  WPF  FQRRGNV XQTJCPFGP 6GKNYGKUG DGKIGUEJTKGDGPG 2TGKUG &C\W .CIGTNKUVGP CWU FGP ,CJTGP   )CP\NGKPGP Z 1TKI$TQUEJWT Z   



. /ª0<'0 70& /'&#+..'0 #) $CUGN WPF $#0- .'7  %1 <ÒTKEJ #WMVKQPGP XQO      WPF XQO  5NI 0KIIGNGT  6GKNG  )TKGEJGP 4ÌOGT   5EJYGK\ +VCNKGP0TP6HP0TP6HP+P$·PFGPKP$TQUEJWTIGDWPFGP CNNGOKV'.$CPFWPFOKV5.VGKNYGKUGCWUIGDNKEJGP#  



. /ª0<*#0&.70)$#5'.$CUGN-CVCNQIWPF$CUGN6GKNYGKUGOKV5. 'KPJGKVNKEJKP$·PFGPKP)CP\NGFGTIGDWPFGPGKPKIG$NGKUVKHVPQVK\GP  



. #WMVKQP  XQO  4ÌOKUEJG$TQP\GOÒP\GP0TP6HP$GKIGDWPFGP'))'4#WM VKQPXQO5NI/QTQUKPK6KTQN0TP6HP*CNDNGKPGP#WMVKQPXQO 4ÌOGT0TP6HP$TQUEJKGTV#WMVKQPXQO5NI5V=GIGT?9=CNFGEM?#NGZCPFTK PGT 4ÌOGT $[\CP\  0TP  6HP $TQUEJKGTV #WMVKQP  XQO5NI9CNFGEM)TKG EJGP4ÌOGT$[\CP\0TP6HP)CP\NGKPGP  



. /74+5'6)+%16 % )GPH #WMVKQP XQO  IGOGKPUCO OKV . (144'4 .QPFQP  5NI   5VTQGJNKP6GKN5EJYGK\0TP6HP-QRKGTVG'..GKPGP



. 0#8+..'  %Q )GPH #TU %NCUUKEC  #WMVKQP  XQO  5NI 2Q\\K  )TKGEJKUEJG /ÒP\GP   0TP6HP'.*CNDNGKPGP5GKVGPNGKEJVIGDT·WPV



. #WMVKQPXQO5NI8CWVKGTWPF%QNNKIPQP4ÌOKUEJG-CKUGT\GKV0TP6HP$GKIG UEJTKGDGPG2TGKUG)CP\NGKPGP//#)



. #WMVKQP  XQO  5NI 8CWVKGT WPF %QNNKIPQP  4ÌOKUEJG -CKUGT\GKV  0TP  6HP   //#)#WMVKQP5NI'XCPU4ÌOGTWPF$[\CP\0TP6HP+PGKPGO$CPFKP)CP\ NGKPGPIGDWPFGP



'ZNKDTKUXQP/2GVGTUGP

. #WMVKQP  XQO  5NI /KEJCKNQXKVUEJ 'XCPU WC  )TKGEJKUEJG /ÒP\GP  0TP  6HP   )CP\NGKPGP

 119


AUKTIONSKATALOGE . #WMVKQPXQO&WDNGVVGPFGU$TKVKUJ/WUGWOCWUFGT5NI$GTVKGTFGNC)CTFGWC)TKGEJK UEJG/ÒP\GP0TP6HP$GKIGUEJTKGDGPG2TGKUG)CP\NGKPGP



. #WMVKQP  XQO  5NI $GOGPV  6GKN  )TKGEJKUEJG /ÒP\GP DGU #VVKSWG WPF /CWTGVCPKG   0TP6HP6HP#WMVKQPXQO5NI$GOGPV/QPPCKGU4QOCKPGU#PVK SWGU  0TP  6HP $GKIGUEJTKGDGPG 2TGKUG +P GKPGO $CPF KP )CP\NGKPGP IGDWPFGP#FTGUUGP XGTOGTMGWPF$GUKV\GTCWHMNGDGT



. #WMVKQPXQO5NI2GVTQYKE\4QIGTUWC)TKGEJKUEJGWPFTÌOKUEJG/ÒP\GP0TP 6HP6HP1TKI$TQUEJWT7OUEJNCIGVYCUDGUEJ·FKIVWPFCWUIGDNKEJGP//#)



. #WMVKQPXQO5NI.GXKU4ÌOKUEJG/ÒP\GP0TP6HP$GKIGUEJTKGDGPG2TGKUG )CP\NGKPGP//#)



. #WMVKQPXQO5NI#NNCVKPK%JWTEJKNN$NQEJWPF8GKVJ4ÌOGTWPF)TKGEJGP0TP 6HP*CNDNGKPGPTGUVCWTKGTVGU6KVGNDNCVV\CJNTGKEJG$NGKUVKHVPQVK\GP



8GTUEJKGFGPG$GUKV\GTUVGORGNCWHFGO6KVGNDNCVV

. #WMVKQPXQO5NI#NNCVKPK%JWTEJKNN$NQEJWPF8GKVJ4ÌOGTWPF)TKGEJGP0TP 6HP#WMVKQPXQO5NI%JWTEJKNN6GKN)TKGEJKUEJG/ÒP\GP0TP6HP+P GKPGO$CPFKP)CP\NGKPGPIGDWPFGP5GKVGPNGKEJVIGDT·WPV



. #WMVKQPXQO5NI%JWTEJKNN6GKN)TKGEJKUEJG/ÒP\GP0TP6HP*CNDNGKPGP 6KVGNDNCVVTGRCTKGTV#



$GUKV\GTGVKMGVV5$QWVKPCWHFGO'KPDCPF

. #WMVKQPXQO5NI9QQFYCTFWC#PVKMG/ÒP\GP0TP6HP)CP\NGKPGPURQTC FKUEJG$NGKUVKHVPQVK\GP



. #WMVKQPXQO5NI$WTTCIGWC)TKGEJKUEJGWPFTÌOKUEJG/ÒP\GP5NI'XCPU4ÌOK UEJG /ÒP\GP  0TP  6HP DGKIGUEJTKGDGPG 2TGKUG *CNDNGKPGP OKPKOCN DGUVQ­GP GTUVG 5GKVG   NQUG#



$GUKV\GTGVKMGVV5$QWVKPCWHFGO'KPDCPF

. #WMVKQP  XQO  =5NI 5CTVKIGU?  4ÌOKUEJG /ÒP\GP  0TP  6HP '. 1TKI$TQ   UEJWTNGKEJVDGUVQ­GPYGPKIG$NGKUVKHVPQVK\GP



. 07/+5/#6+% (+0' #465 $GXGTN[ *KNNU #WMVKQP       &C\W  -CVCNQIG   /CKN$KF5CNGU,QWTPCNQH0(#$#0-.'7#)6JG)CTTGVV%QNNGEVKQP2CTV++++$TQ UEJKGTV  



. 07/+5/#6+%#9KGP#WMVKQPXQPDKU6GKNYGKUGOKV'.&C\W.CIGTNKUVG XQP1TKI$TQUEJWT  



. 0755$#7/*<ÒTKEJ#WMVKQPXQP8GPVG0QOKUOC5RG\KCNUCOONWPIXQP/ÒP\GPFGT UÒFNKEJGP0KGFGTNCPFGWPFXQPJKUVQTKUEJGPPKGFGTN·PFKUEJGP/GFCKNNGPUQYKGUQNEJGPFGU*CWUGU*CDU DWTI0TP6HP)CP\NGKPGP//#)



. 2#)'#2CTKU#WMVKQPXQO#PVKMG/ÒP\GP0TP6HPDGKIGUEJTKGDGPG2TGKUG 1TKI$TQUEJWT



. #WMVKQPXQO5NI/FG%)QNFOÒP\GP0TP6HP1TKI$TQUEJWT



. 2'6')*'/ % XCP 2CTKU #WMVKQP XQO  5NI /CKNNKGV  $GNIKGP ,GVQPU /GFCKNNGP   .KVGTCVWT0TP0TP0TP*CNDNGFGTOKVGKPIGDWPFGPGP$NCPMQUGKVGP



. 2'750#%*(&4$7551(TCPMHWTVCO/CKP#WMVKQPXQO1MVQDGTWPF#WMVKQP XQO1MVQDGT 5NI-QEJ6GKN+WPF6GKN++  0TP 6HP)CP\NGKPGPVGKN YGKUGDGKIGUEJTKGDGPG2TGKUG  



. #WMVKQP  XQO  5NI $QPJQHH /KVVGNCNVGT  0TP OKV #DD  #WMVKQP  XQO   XQO5NI#!+ 6GKNWPF/KVVGNCNVGT(QVQMQRKGTVG'.$TQUEJKGTV  



. 2.#66%2CTKU2TGKUNKUVGQ,2CRUVVWO0TP6HP1TKI$TQUEJWT4ÒEMGPNGKEJVCWHIG TKUUGP



. 4#22#2146 ' $GTNKP #WMVKQPGP        XQO  *CNDGTUVCFV      5NI %QJP      (F XQP /CNEJKP   5NI $KTMGPTWVJ    9GKOCTGT &KEJVGTHÒTUVGP WPF KJTG <GKV      5NI$GVJG5CEJUGP +PFTGK$·PFGPIGDWPFGP)CP\NGK PGP&C\W\CJNTGKEJG8GTMCWHUNKUVGPCWUFGP,CJTGP



. 0WOKUOCVKUEJGU 1HHGTVGPDNCVV 0T            

   1TKI$TQUEJWT  4'&&'4.GKR\KI8GTMCWHUNKUVG  5CEJ UGP0TP51TKI$TQUEJWT



120


AUKTIONSKATALOGE . 4#661 / /CKNCPF #WMVKQP XQO  5NI )KQTIK  4ÌOKUEJG WPF D[\CPVKPKUEJG /ÒP\GP    0TP  6HP '. 1TKI$TQUEJWT OGKUV DGKIGUEJTKGDGPG 2TGKUG WPF JCPFUEJTKHVNKEJG 0QVK\GP   //#)



. #WMVKQPGP XQO   WPF  5NI %WTCVQNQ  6GKN  +VCNKGPKUEJG /ÒP\GP   0TP6HPOKV5.'KPJGKVNKEJDTQUEJKGTV&C\WYGKVGTG-CVCNQIGCWUFGP,CJTGP

 



. 4#661 4 .WICPQ #WMVKQP XQO  &WRNKECVK FK WP OWUGQ UVTCPKGTQ 6GKN  0TP    6HP1TKI$TQUEJWT



. #WMVKQPXQO5NI%ÊVG/ÒP\GPXQP6CTGPV0TP6HPDGKIGDWPFGPG'.)CP\ NGKPGP//#)



. 4'&&'4 ( .GKR\KI 8GTMCWHUNKUVGPWPFCWUFGP,CJTGP&C\WGKPKIG &WDNGVVGP*CNDNGKPGPWPFDTQUEJKGTV Z   



. 4+'%*/#00#*CNNGCPFGT5CCNG#WMVKQPGP WC5NI$TCWUG*CNNG  Z  Z 

5NI -GUUNGT   5NI5EJOWNC-TCRRKV\  5NI(TKGFTKEJ#WIWUVXQP1N FGPDWTI    5NI 8QIGNUCPI   5NI 5VTKGDQNN   CWU FGP ,CJTGP  )CP\NGKPGP  

Z  *CNDNGKPGP Z    &C\W .CIGTNKUVGP CWU FGP ,CJTGP  VGKNYGKUG OGJTHCEJ XQTJCP   FGP



*QEJKPVGTGUUCPVGU-QPXQNWVOKVXKGNGPYKEJVKIGP5COONWPIGP

. #WMVKQP  XQO   #WMVKQP  XQO  OKV '.  #WMVKQPXQO #WMVKQPXQO#WMVKQPXQO#WMVKQPXQO#WMVKQP XQO   #WMVKQP  XQO   #WMVKQP  XQO   #WMVKQP  XQO     #WMVKQP  XQO   #WMVKQP  XQO  1TKI $TQUEJWT Z    *CNDNGKPGP Z   &C\W.KUVGPXGTM·WHNKEJGT/ÒP\GP0TQJPG0T



. #WMVKQPWPFXQOWPF5NI-C[UGT6GKNGWPF9CNFGEM4JGKPNCPF9GUV HCNGP+PGKPGO$CPFKP)CP\NGKPGPIGDWPFGP



. #WMVKQP  XQO  5NI .QGYG  -WPUVOGFCKNNGP WPF 2NCMGVVGP &WDNGVVGP FGU /ÒP\MCDKPGVVU   /ÒPEJGP0TP6HP$GKIGUEJTKGDGPG2TGKUGKO6GZVWPFCWHFGP6HP)CP\NGKPGP



. #WMVKQPXQO=5NI*CTOGPKPI?-WPUVOGFCKNNGPFGUDKU,CJTJWPFGTVU0TP 6HP$GKIGUEJTKGDGPG2TGKUG$WEJDNQEMVGKNYGKUGNQUG1TKI*CNDNGKPGPOKPKOCNDGUVQ­GP



. #WMVKQPXQO4ÌOKUEJG/ÒP\GP0TP6HP)CP\NGKPGP



. #WMVKQP  XQO  5NI -TCC\   &GWVUEJG -KRRGTOÒP\GP 0CEJFTWEM $KGNGHGNF  FGT   'TUVCWHNCIG*CNNGCPFGT5CCNG0TP6HP)CP\NGKPGP



. #WMVKQP  XQO  5RG\KCNUCOONWPI U·EJUKUEJGT /ÒP\GP WPF /GFCKNNGP 0TP6HP &KGNGV\VGP6HPGVYCUHNGEMKI)CP\NGKPGP



. #WMVKQP  XQO  &WDNGVVGP FGU /ÒP\MCDKPGVVU $GTNKP WC  )TKGEJGP  0TP  6HP   /CPEJOCNNGKEJVUVQEMHNGEMKI)CP\NGKPGP



. #WMVKQPXQO&WDNGVVGPFGU/ÒP\MCDKPGVVU$GTNKPWC)TKGEJKUEJG/ÒP\GP0TP  6HP DGKIGUEJTKGDGPG 2TGKUG $TQUEJKGTV NGKEJV UVQEMHNGEMKI CWH FGP NGV\VGP DGKFGP 6HP //#)   



. #WMVKQP  XQO  5NI .ÌDDGEMG -WPUVOGFCKNNGP WPF 2NCMGVVGP FGU  DKU  ,CJTJWPFGTVU   0TP6HP-NGKP(QNKQ1TKI$TQUEJWT



. #WMVKQPXQO5NI.ÌDDGEMG&GWVUEJG$TCMVGCVGP0TP6HP1TKI$TQUEJWT DGUVQ­GPJKPVGTGT'KPDCPFHGJNV'TUVG5GKVGTGRCTKGTV



. #WMVKQPXQO$TCPFGPDWTI2TGW­GP0TP6HP)CP\NGKPGP



. #WMVKQP  XQO  /GFCKNNGP WPF /ÒP\GP FGU  DKU  ,CJTJWPFGTVU  0TP  6HP   )CP\NGKPGP



. #WMVKQP  XQO  /KVVGNCNVGT $TCMVGCVGPHWPF XQP 0QTFJCWUGP   0TP6HP)CP\NGK PGP



. #WMVKQP  XQO  (WPF XQP .WFYKU\E\G  /KVVGNCNVGT  0TP  6HP 1TKI$TQUEJWT   DGUVQ­GP4ÒEMGPGKPIGTKUUGP



. 41..+0  ('7#4&'06 2CTKU #WMVKQP XQO  5NI /QPPKGT  .QVJTKPIGP  0TP   DGKIGUEJTKGDGPG2TGKUG*CNDNGKPGP



. #WMVKQP XQO  5NI 4QDGTV  (TCPMTGKEJ  0TP  6HP #DD KO 6GZV *CNDNGKPGP   DGKIGUEJTKGDGPG2TGKUGWPFGKPKIG#POGTMWPIGP



W­GTUVYKEJVKIGTWPFUGNVGPGT-CVCNQI

121


AUKTIONSKATALOGE . #WMVKQP XQO  5NI 2QPVQP F #O¾EQWTV  4ÌOKUEJG WPF D[\CPVKPKUEJG )QNFOÒP\GP    0TP6HP(QTPK0&



. 41..+0  ('7#4&'06 2CTKU WPF #*1.<*#75'0 9KGP #WMVKQP  XQO  5NI   9CNEJGTFG/QNVJGKP)TKGEJGP-CVCNQIDGCTDGKVGVXQP8FG4'00'42CTKU9KGP(TQPVKURK\ 8++5OKV0TP6HP2TGKUNKUVG*CNDNGFGTNGKEJVUVQEMHNGEMKICWHFGPGTUVGP5GKVGP



. 415'0$'4)*5*CPPQXGT#WMVKQPGPCWUFGP,CJTGP&CTWPVGTXKGNG5COONWP IGPWC5NI-PKIIG.GJOCPP/CPP&ÒPKPI$QJNOCPP0GWDCWGT'PIGNGT$ÒUEJJQHH&C\WGKPKIG 8GTMCWHUNKUVGP+PGKPJGKVNKEJGO)CP\NGKPGPZ1TKI$TQUEJWT  



+PFKGUGT8QNNUV·PFKIMGKVWPF'TJCNVWPIUGNVGPCPIGDQVGP

. #WMVKQP XQO  5NI -QGPKI WPF 5EJNÒVGT  $TCPFGPDWTI2TGW­GP $TCWPUEJYGKI.ÒPGDWTI   0TP6HPOKVGKPIGDWPFGPG'.*CNDNGKPGP



. #WMVKQP XQO  5IN *GUGOCPP   5IN .GJOCPP   5IN $QFG    5IN$CGUGEMG5IN'PIGNGT5IN4QUGPDGTI  



. #WMVKQP  XQO  =5NI &GGEMG?  $TCWPUEJYGKI.ÒPGDWTI  0TP  6HP 1TKI$TQ   UEJWTYGPKIG$NGKUVKHVPQVK\GP//#)



. #WMVKQPGP WPFXQOWPF5NI-PKIIG6GKNWPF$TCWPUEJYGKI.ÒPG DWTI0TP6HPYGPKIGDGKIGUEJTKGDGPG2TGKUG+P\YGK$·PFGPIGDWPFGP$CPFDTQUEJKGTV $CPF*CNDNGFGTFWTEJUEJQUUGP//#)  



. #WMVKQPGP  WPF  CWU FGP ,CJTGP  WPF  5 415'0$'4) (TCPMHWTV #WMVKQPGP                    WPF  CWU FGP ,CJTGP    1TKI$TQUEJWTVGKNYGKUGOKV5.WPF'.(5%*.'55+0)'4$GTNKP#WMVKQPGPWPF CWU FGP ,CJTGP  1TKI $TQUEJWT VGKNYGKUG OKV 5. WPF PQVKGTVGP 'TIGDPKUUGP *   5'.+)/#00*CPPQXGT#WMVKQPGPWPFCWUFGP,CJTGP1TKI$TQUEJWT OKV 5. WPF VGKNYGKUG OKV PQVKGTVGP 'TIGDPKUUGP %) 6*+'/' &TGUFGP 0WOKUOCVKUEJGT 8GTMGJT   8GT\GKEJPKU XGTM·WHNKEJGT /ÒP\GP GVE 0T     0TP  5  6HP    HGJNV 1TKI$TQUEJWT#WMVKQPXQO5NI%WTV5R·VG1TKI$TQUEJWTIWVG'TJCNVWPI <5%*+'5%*-'  -¤&'4 .GKR\KI 8GT\GKEJPKU XGTM·WHNKEJGT /ÒP\GP 0T  XQO     0TP51TKI$TQUEJWTGKPKIG/CTMKGTWPIGPKO6GZV



. 415'0$'4) 5 (TCPMHWTV CO /CKP #WMVKQPGP      CWU FGP ,CJTGP    &CTWPVGTXKGNG5COONWPIGPWC5NI*GNNYGI9CNVGT$WEJGPCW$CGT4QVJOCPP2JKNKRR.GX[1VVQ #JTGPU&KGN+P$·PFGPIGDWPFGP)CP\NGKPGP Z *CNDNGKPGP    



+PVGTGUUCPVGU-QPXQNWVOKVXKGNGPYKEJVKIGP5COONWPIGP

. #WMVKQPGP    WC /QGTU KP 0WOOKU 5NI 5EJYCNDCEJ 5KEM 5RG[GT 2HCN\  *GT\  

0CUUCW 5EJÒUUNGT *GUUGP-CUUGN 5EJYCDG *GUUGP =5CEJU? 2HCN\9ÒT\DWTI$C[GTP *GGTFV6GKN &C\W8GTMCWHUNKUVGPCWUFGP,CJTGP)CP\NGKPGP Z 1TKI$TQUEJWT Z   



*QEJKPVGTGUUCPVGU-QPXQNWVOKVXKGNGPYKEJVKIGP5COONWPIGP6CFGNNQUKP)CP\NGKPGPIGDWPFGP

. #WMVKQPGPWPFXQPDKU IGOGKPUCOOKV55%*1669#..'456'+0(TCPMHWTV CO/CKP 5NI$GNNK6GKN7PKXGTUCNDGUQPFGTU4GHQTOCVKQP(TCPMHWTVWPF-WPUVOGFCKNNGP 0TP  6HP  &QRRGNVHP '. +P GKPGO $CPF IGDWPFGP )CP\NGKPGP OKPKOCN DGUVQ­GP 4ÒEMGP   GKPIGTKUUGP//#)



. #WMVKQPXQO5NI,QJP2JKNKRR&CP\KIWC0TP6HP)CP\NGKPGP$WEJDNQEM GVYCUIGDTQEJGP*CPFGZGORNCTFGU#WMVKQPCVQTUOKV8QTIGDQVGP\68QTMQOOGP2TGKUGPWPF-·W HGTP



. #WMVKQPXQO5NI#JTGPU0GWTHÒTUVNKEJGIT·HNKEJGWPFHTGKJGTTNKEJG*·WUGT0TP 6HP2CRKGTNGKEJVIGDT·WPV)CP\NGKPGP



. #WMVKQP  XQO  5NI *GNHGTKEJ  #PVKMG /ÒP\GP 5V·FVGVCNGT /GFKEKPC KP PWOOKU    0TP6HP$TQUEJKGTV4ÒEMGPDGUEJ·FKIV



. #WMVKQPWPFXQOWPF5NI(KQTKPQ+WPF++*GUUGPWPF0CEJDCTIGDKGVG 0TP6HP0T6HP$TQUEJKGTV6GKN+FWTEJIGJGPF6GKN++DKU0TPQVKGTVG 2TGKUG  



. #WMVKQPXQO=5NI8KGNJCDGT?/QGTUKPPWOOKU/QGTU0CUUCW1TCPKGP$TCPFGPDWTI 2TGW­GP,ÒNKEJ%NGXG$GTI2HCN\0TP6HP)CP\NGKPGP2CRKGTNGKEJVIGDT·WPV



. 5#/$10)/CKNCPF4QO(NQTGP\#WMVKQPXQO/WUGQ$CTVQNQOGQ$QTIJGUK6GKN 0GW\GKV0TP6HP*CNDNGKPGPOKVDGKIGUEJTKGDGPGP2TGKUGP



. 5#/$10#%#0'55#%WPF'2CTKU#WMVKQPXQO)TQ­ITKGEJGPNCPFWPF5K\K NKGP0TP6HP*CNDNGKPGP5GKVGPIGDT·WPV#



122


AUKTIONSKATALOGE . 5#/$10#2CTKU%#0'55#%WPF'4QO#WMVKQPXQO5NI5VTQ\\K)TKGEJK UEJGWPFTÌOKUEJG/ÒP\GP#GUITCXG0TPOKV#DD6HP*CNDNGKPGP//#)



. 5#06#/#4+# 2 WPF 2 4QO #WMVKQP XQO  5NI /CTVKPQTK  +VCNKGP 0TP 6HP)CP\NGKPGP5TGUVCWTKGTV8QTUCV\DN·VVGT+PFGZWPFFKGGTUVGP\YGK-CVCNQIUGKVGPCNU-QRKG UQPUVXQNNUV·PFKIWPFVCFGNNQUGTJCNVGP//#)



. #WMVKQPXQO1UGNNGPXQP8GPGFKIWPF/WTCPQ0TP6HPGKPIGDWPFGPG5.)CP\ NGKPGP&C\W)#22#476+4QO#WMVKQPXQO8GPG\KCPKUEJGWPFOWTCPKUEJG1UGNNGP

 



. #WMVKQP XQO  5NI )=CTCXCINKC?  -KTEJGPUVCCV  0TP  6HP '. #WMVKQP XQO   5NI)-KTEJGPUVCCV0TP6HP5.#WMVKQPXQO5NI5KIPQTGNNK6GKN -KTEJGPUVCCV-TGW\HCJTGT,QJCPPKVGTQTFGP0TP6HP5.VGKNYGKUGDGKIGUEJTKGDGPG2TGKUG CWHFGP6CHGNP#WMVKQPXQO5NI$5CXQ[GPWPF+VCNKGP0TP6HP5.WPF'. &C\W52+0-510.VF.QPFQP0CEJFTWEM.QPFQPFGU8GTMCWHUMCVCNQIUXQP/GFCKN NGPCWH2·RUVG#NNGKP1TKI$TQUEJWT$KPFWPIDGK#WMVKQPNQUG



. #WMVKQPXQO5NI/CIPCIWVK'ZPWOOKUJKUVQTKC6GKN$[\CPVKPKUEJG/ÒP\GPKVCNKGPK UEJGU/KVVGNCNVGT8GPGFKI0TP6HP)CP\NGKPGP



. #WMVKQPXQO+VCNKGPKUEJG/ÒP\GP0TP6HP5.WPF'.1TKI$TQUEJWT



. 5#66.'4#$CUGN8GTMCWHUNKUVGP  KPGKPGO$CPFKP)CP\NGKPGPIGDWPFGP



. 5%*.'55+0)'4($GTNKP#WMVKQPXQO IGOGKPUCOOKV*5'.+)/#00*CPPQ XGT  =5NI (GNFJGKO?  $TCWPUEJYGKIKUEJG /ÒP\GP WPF /GFCKNNGP  0TP  6HP )CP\NGKPGP   //#)



. #WMVKQP  XQO  IGOGKPUCO OKV * 5'.+)/#00 *CPPQXGT  =5NI (GNFJGKO?  $TCWP   UEJYGKIKUEJG/ÒP\GPWPF/GFCKNNGP0TP6HP1TKI$TQUEJWT//#)



. #WMVKQPXQO5EJYGK\CPVKMG)QNFOÒP\GP0TP6HP)CP\NGKPGP



. #WMVKQPGP  XQO  WPF  XQO  =5NI 0QTFJGKO?  6GKN  WPF  /KVVGNCNVGT WPF   0GW\GKV DGU 2QNGP  0TP 6HP FCXQPGKPG6HOKV#WUUEJPKVV #WMVKQPXQO =5NI 0QTFJGKO?  6GKN  +VCNKGP 5RCPKGP 4WUUNCPF *CODWTI /KVVGNCNVGT 0TP  WPF    0TP.KVGTCVWT6HP,GYGKNUOKV5.+PGKPGO$CPFKP)CP\NGKPGPIGDWPFGP



. #WMVKQP  XQO  IGOGKPUCO OKV . *#/$74)'4 (TCPMHWTV CO /CKP  5NI (TCPMKGYKE\   2QNGP0TP6HP5.)CP\NGKPGP



. #WMVKQPXQO5EJYGK\0TP6HP5.)CP\NGKPGP



. #WMVKQPXQO5NICWUCWUN·PFKUEJGO/WUGWOUDGUKV\=&WDNGVVGP 'TGOKVCIG? 6GKN  &GWVUEJNCPF 4W­NCPF (TCPMTGKEJ 'PINCPF 5MCPFKPCXKGP +VCNKGP 5EJYGK\   0KGFGTNCPFG#PVKMG8GTUEJKGFGPG.·PFGT0TP6HP5.6GKNYGKUG DGKIGUEJTKGDGPG2TGKUG+PGKPGO$CPFKP)CP\NGKPGPIGDWPFGP



. #WMVKQPXQO5NICWUCWUN·PFKUEJGO/WUGWOUDGUKV\=&WDNGVVGP'TGOKVCIG?)TKGEJKUEJG /ÒP\GP0TP6HP-CTVGP5.$TQUEJKGTV//#)



. #WMVKQPXQO5NICWUCWUN·PFKUEJGO/WUGWOUDGUKV\=&WDNGVVGP'TGOKVCIG?)TKGEJKUEJG /ÒP\GP0TP6HP-CTVGP5.9GPKIGDGKIGUEJTKGDGPG2TGKUG//#)



. 5%*1669#..'456'+0 5 (TCPMHWTV C/ #WMVKQPGP  XQO  5NI -GGVOCPP  0GW   \GKV0TP6HP#WMVKQPXQO5NI5EJGGN9GKGTWPF0KORVUEJ6CNGT0TP 6HP#WMVKQPXQO0GW\GKV0TP6HP#WMVKQPXQO5NI2GVT[ 7PKXGTUCN0TP6HP#WMVKQPXQO&QWDNGVVGPFGUMÌPKINKEJGP/ÒP\MCDKPGVVU\W %CUUGN *GUUGP-CUUGN 9GUVHCNGP (WNFC *CPCW WC  0TP  6HP #WMVKQP  XQO    0GW\GKV  0TP  6HP #WMVKQP  XQO  *GUUGP (WNFC *CPCW .CIGTMCVCNQI    *CNDNGKPGP Z 1TKI$TQUEJWT Z   



. 5%*7./#0*/(0GY;QTM#WMVKQPGPXQOWPF5NI $TCPF.KEJVGPHGNU  #WMVKQP XQO  5NI 7ODGTVQ  #WMVKQPGP XQO  WPF    5NI/CDDQVV)TKGEJKUEJG/ÒP\GPZDTQUEJKGTV5NI/CDDQVVKP*CNDNGKPGPIGDWPFGP  



. 5%*7./#0 ,  #OUVGTFCO -QPXQNWV XQP  -CVCNQIGP FGT ,CJTG  OKV XKGNGP KPVGTGU   UCPVGPWPFDGMCPPVGP5COONWPIGPUQYKGFKG-CVCNQIGWPFFGT,CJTG $TQUEJKGTVVGKNYGKUG1TKI$TQUEJWT  



. #WMVKQP  XQO  =5NI /GKGTJQH?  $TCWPUEJYGKIGT .ÌUGT  0TP  6HP 1TKI$TQ   UEJWT//#)



. 5'.+)/#00 # *CPPQXGT #WMVKQPGP                1TKI$TQUEJWT  



8QNNUV·PFKIG5GTKGFGT#WMVKQPUMCVCNQIGFGT(KTOC

123


AUKTIONSKATALOGE . #WMVKQPGPWPFXQOWPF5NI-P[RJCWUGP6GKN  $TCWPUEJYGKI.ÒPGDWTI 0KGFGTUCEJUGP  0TPWPF6HPDGKIGDWPFGPG5.+P 6GKNDGKIGUEJTKGDGPG2TGKUG+PGKPGO$CPFIGDWPFGP)CP\GKPGP



. #WMVKQPGP  +PXKGT$·PFGPKP)CP\ NGKPGPIGDWPFGP&C\WGKPKIG8GTMCWHUNKUVGPCWUFGP,CJTGP



. 516*'$; 9+.-+0510  *1&)' .QPFQP #WMVKQPUMCVCNQIG FGT ,CJTG  FCDGK 5NI   %NCTM%CTN[QP$TKVVQP9CNVGTU$WTUVCN&TWOOQPF9CMNG[+PFGTYKEM1y*CICP$WEMNG[/WTFQEJ WPF%JQNONG[OKVDGFGWVGPFGP5COONWPIGP'PINCPFWPF#PIGNUCEJUGP$TQUEJKGTVDGKGKPKIGP-CVCNQ IGPNQUG.CIGP  



. 516*'$;%1.QPFQP#WMVKQPXQO5NI(CTQWM7PKXGTUCNDGUQPFGTU)QNFOÒP\GP WPF2TQDGP0TP6HP 6HUKPF&QRRGNVHP 1TKI$TQUEJWTOKOKOCNDGUVQ­GP//#) 



. #WMVKQP XQO  5NI (CTQWM  7PKXGTUCN DGUQPFGTU )QNFOÒP\GP WPF 2TQDGP  0TP    6HP 6H  UKPF &QRRGNVHP  $GKIGUEJTKGDGPG 2TGKUG 1TKI$TQUEJWT OKOKOCN DGUVQ­GP //#)   



. #WMVKQPUMCVCNQIGFGT,CJTGWPFOKV5COONWPIGP\WT DTKVKUEJGPWPFGWTQR·KUEJGP0WOKUOCVKM1TKI$TQUEJWT Z 2CRRDCPF Z   



. #WMVKQPUMCVCNQIG FGT ,CJTG   OKV 5COONWPIGP XQP 1TFGP WPF 'JTGP\GKEJGP WC 5NI   .QXGNN 2CWN QH ;WIQUNCXKC 1CMNG[ /E-GCP4CD[ ,COGU (NQTG[ $Q[F WPF .COD  1TKI$TQUEJWT  

 



. #WMVKQPUMCVCNQIGFGT,CJTGOKV5COONWPIGPKUNCOKUEJGT/ÒP\GP1TKI$TQUEJWT  



. #WMVKQPUMCVCNQIGFGT,CJTGWPFOKV5COONWPIGP CPVKMGT/ÒP\GP5NI*GEMGVV9QQFDTKFIG9CTF&QJGP[&WMGQH0QTVJWODGTNCPF6JG/GVTQRQNKVCP /WUGWOQH#TV1TKI$TQUEJWT Z 2CRRGKPDCPF Z )CP\NGKPGP Z   



. 516*'$;.QPFQP0GY;QTM<ÒTKEJ#WMVKQPGP5NI$TCPF6GKN6GKNYGKUG '.QFGTDGKIGUEJTKGDGPG2TGKUG1TKI$TQUEJWT  



. #WMVKQPGP XQO     6JG 0GNUQP $WPMGT *WPV %QNNGEVKQP   )TKGEJKUEJGWPFTÌOKUEJG/ÒP\GP6GKN#WMVKQPXQO+UNCOKUEJG/ÒP\GP6GKNYGKUG'. -CTVQPKGTVOKV5EJWV\WOUEJNCI Z 1TKI$TQUEJWT Z   



. 56'40$'4)(<ÒTKEJ#WMVKQPGPXQPDKUOGKUV OKV'.1TKI$TQUEJWTWPF*CNDNGKPGP  



. 6*+'/' %) .GKR\KI&TGUFGP -QPXQNWV XQP \CJNTGKEJGP 8GTMCWHUNKUVGP 0WOKUOCVKUEJGT 8GT   MGJTCWUFGP,CJTGPKPFTGK$·PFGPKP2CRRGKPDCPFIGDWPFGPKPGKPGO$CPFKP *CNDNGKPGPIGDWPFGP DTQUEJKGTVG*GHVG   



1626

. 9'+)'. %1 .GKR\KI #WMVKQP XQO  =5NI %CRRG?  7PKXGTUCN DGUQPFGTU /KVVGNCNVGT    0TP *CPFIGUEJTKGDGPGU 4GIKUVGT CWH  PCEJVT·INKEJ GKPIGDWPFGPGP 5GKVGP *CNDNGKPGP OKPKOCN   DGUVQ­GP0QVK\GPKO6GZV//#) *CPFUEJTKHVNKEJGT$GUKV\GTXGTOGTM'#9QNH

124




AUKTIONSKATALOGE . 9'5'0'4 (, /ÒPEJGP #WMVKQP XQO  5NI /QTDKQ  4ÌOKUEJG /ÒP\GP +VCNKGP   $TQP\GOGFCKNNGP0TP6HP'.*CNDNGKPGP//#)



. #WMVKQPXQO5NI/QTDKQ4ÌOKUEJG/ÒP\GP+VCNKGP$TQP\GOGFCKNNGP0TP 6HP6GKNYGKUGNQUG.CIGPDTQUEJKGTV//#)



. 9';.#$GTNKP#WMVKQPGPCWUFGP,CJTGP&C\W GKPKIG 8GTMCWHUNKUVGP FGT ,CJTG  $TQUEJKGTV 2CRKGT VGKNYGKUG IGDT·WPV WPF DGUEJ·FKIV FGP   PQEJKPVGTGUUCPVGU-QPXQNWVOKVUGNVGPGP5GTKGP



. 9+0-'./#)0755'0-QRGPJCIGP#WMVKQPXQ5NI)NÒEMUVCFV7PKXGTUCNDGU &·PGOCTMWPF5EJNGUYKI*QNUVGKP0TPOKV#DD1TKI$TQUEJWTUVCTMDGUVQ­GP#



. 947%-9$GTNKP#WMVKQPUMCVCNQIGXQPDKUOKV DGFGWVGPFGP 5COONWPIGP \W $TCPFGPDWTI2TGW­GP &QTVOWPF 9GUVHCNGP 5CEJUGP WPF /CPUHGNF   $GTNKPGT/ÒP\XGTMGJTXQP1TKI$TQUEJWT  



$GUKV\GTUVGORGNKO8QTUCV\

1632

. <5%*+'5%*'-¤&'4.GKR\KI8GTMCWHUMCVCNQIGCWUFGP,CJTGP<WOGKUVKP*CNDNGK PGP\WUCOOGPIGDWPFGP $·PFG FC\WGKPKIG&WDNGVVGPDTQUEJKGTVWPF*CNDNGKPGPD·PFG  



. -1081.76 )TQ­GU -QPXQNWV OKV #WMVKQPUMCVCNQIGP \WOGKUV FGWVUEJGT (KTOGP PCEJ FGO  9GNV   MTKGI FCDGK WC FKG (KTOGP #.$4'%*6  *1((/#00 $#&'09ª466'/$'4)+5%*'   $#0- $'4.+0'4 /ª0<%#$+0'6 &14#7 (4+'&4+%*5 )#.'4+' &'5 /100#+'5   )140; )4'+5'4 *+45%* -¤.0'4 /ª0<-#$+0'66 -15.195-+ -742(.<+5%*'   /ª0<*#0&.70) -4'55 .#0< .'7 /ª0<)#.'4+' /ª0%*'0 /ª0<-10614   (4#-(746 07/+5/#6+%# 9+'0 2#46+0 $#0- 2'75 4#7%* 5%*4#//   5%*7./#006+'6,'0%19+06'4947%-



. )TQ­GU -QPXQNWV OKV #WMVKQPUMCVCNQIGP \WOGKUV CWU FGT <GKV PCEJ FGO <YGKVGP 9GNVMTKGI WC XQP   #7%6+10'5 #) &4'5&0'4 /ª0<#7-6+10 ).'0&+/+0) #&1.2* *'55 *'55.'7   *+45%* -#560'4 -4+%*'.&14( .'7 /ª0<'0 70& /'&#+..'0 #) /ª0<   <'0647/ -¤.0 2'75 4+)¤ 5%*7.6'0  %1 516*'$; 5 52+0- <ÒTKEJ    9#.&'/#4 947%- %C  .KUVGP WPF -CVCNQIG &C\W /ª0<'0 70& /'&#+..'0 #)   $CUGN.KUVGP  <WOGKUVDTQUEJKGTV



. )TQ­GU -QPXQNWV XQP -CVCNQIGP \W CPVKMGP /ÒP\GP WC XQP %#*0 #WMVKQP      '))'4  5NI2TQYG6HPCNU-QRKG).'0&'0+0)-CVCNQIGCWUFGP,CJTGP  *'.$+0) 5& \WT #WMVKQP  4ÌOKUEJG /ÒP\GP $CTDCTKUEJG 2T·IWPIGP   *'.$+0) #WMVKQP XQO  5NI *GTOCPP  *'.$+0) #WMVKQP  XQO    *'55.'7#WMVKQPXQO#WMVKQPXQO*'55#WMVKQPXQO5NI 5[FGPJCO WC  516*'$; 5 #WMVKQP XQO  516*'$; 5 #WMVKQP XQO  5NI   &QJGP[516*'$;9+.-+0510*1&)'#WMVKQPXQO<WOGKUVDTQUEJKGTV  



. -QPXQNWVXQPXKGNGP8GTMCWHUNKUVGPFGT(KTOGP'OKN0GWUV·VVGT(GNKZ5EJNGUUKPIGT/CZ-KGJP.WF YKI.QGUGT9KNF%QORWPF1VVQ*CMGCWUFGP,CJTGP



. -QPXQNWV XQP 8GTUVGKIGTWPIUMCVCNQIGP GWTQR·KUEJGT #WMVKQPUJ·WUGT FGT 8QT WPF 0CEJMTKGIU\GKV OKV   DGFGWVGPFGP5COONWPIGPWPF5GTKGP7PVGTUEJKGFNKEJDTQUEJKGTVWPFIGDWPFGP  

 125


AUTORENINDEX A

#ESWCTQ' #FGTU)*WNUJQHH#NWC #MCTEC# #MWTICN' #NDTGEJV, #NHGP2)XCP #NHÌNFK##NHÌNFK' #NNGP&( #NTCO/ #NTCO/)[UGNGP4 #NXCTG\1UUQTKQ( #OCPFT[/'UVKQV5)CWVKGT) #OCPFT[/4GO[$ #OGTKECP0WOKUOCVKE5QEKGV[ #ORCEJ%NXQP #PFTGYU# #PPWCKTGFGNC5QEKGVG(TCP¼CKUGFG0WOKUOCVKSGGV F CTEJGQNQIKG #PQMJKP8# #PQP[O #PVKMG)GOOGPKPFGWVUEJGP5COONWPIGP #PVKMG/ÒP\GP0QTF)TKGEJGPNCPFU #RRCTWVK)4QO #RRGN,5GR #TEJKXHÒT/GFCKNNGPWPF2NCMGVVGPMWPFG #T¾VJWUG4GXWG6TKOGUVTKGNNG #TPGVJ, #TPQNF23WGNNOCN\9 #TPQNF$KWEEJK% #TUNCP'# #TUNCP/.KIJVHQQV% #TVJÐT2 #TVWM+ #TVWM+WPF% #TZ4XQP #UMGY) #UQNCVK/ #VNCP5 #VVKCPGUG2 #WNQEM*XQP

B

$CDGNQP' $CDGNQP,.CHCWTKG, $CFKCK6QTTGU# $CJTHGNFV' $CJTHGNFV/XQP $CMJQWO5 $CNDK&G%CTQ5 $CNFYKP$TGVV# $CNFYKP# $CNN4$GTNKP $CNN[1 $CNQI2 $CPVK#5KOQPGVVK. $CTCOMK&% $CTCPQYUMK//KNCPQ $CTTCN+#NVGV: $CTTQP,2 $CTVQNQVVK( 126

$CT\CP4 $CUVKGP2 $CUVKGP2#OCPFT[/)CWVKGT) $CUVKGP2%QVJGPGV# $CUVKGP2*WXGNKP* $CVGUQP,& $CVVMG* $CWGT) $CWUNCWIJ4# $GEMGPDCWGT' $GFQWMKCP2< $GKGTNGKP,2 $GNN4% $GNNKPIGT#N $GNNKPIGT#4 $GNOQPVG, LWP *CODWTI $GOQPV% $GPFCNN5 $GPVKPEM%5FG $GTI# $GTI7(TGKJGTTXQP $GTIGT( $GTIGT. $GTIJCWU2 $GTIJCWU2/·MGNGT* $GTIOCPP, $GTKEJVG*TUI**-TKEJGNFQTH $GTM*, $GTNKPGT/ÒP\DN·VVGT0GWG(QNIG $GTNKPGT0WOKUOCVKUEJG(QTUEJWPIGP $GTNKPGT0WOKUOCVKUEJG<GKVUEJTKHV $GTOCPP,9KGP $GTPCTF2 $GTPCTFK) $GTPJCTF1 $GTPJCTV/ $GTPQEEJK/ $GTT[) $GTUVGVV#(TGKJGTTXQP $GUQODGU2# $G[UEJNCI&' $KIPQVVK. $KIQU\GYUMC9 $KPFGT%'DPGT, $KPFGT)*CODWTI $KTCIK(/ $KUJQR,&*QNNQYC[44 $K\QV2# $N·VVGTHÒT/ÒP\HTGWPFG*TUIXQP*)TQVGHQTVIGHÒJTV XQP,WPF#'TDUVGKP*$WEJGPCW'/GTVGPUWPF4 )CGVVGPU $N·VVGT(ÒT/ÒP\MWPFG*I*)TQVG $NCPF4 $NQGUEJ* $QCTFOCP,5ECTKUDTKEM& $QFG9,. $QFGPUVGFV( $QGJTKPIGT' $QN\GPVJCN* $QPCPPK2 $QRGCTCEJEJK14CJOCP#7T


$QUEJ% $QUEJ%'#VNCP5$C[FWT0 $QWFGCW' $QWFGV4&GRG[TQV) $QWTIG['2CTKU $QWVKP5 $QWVMQYUMK)NKPMC# $TCOUGP. $TCWP'9 $TCWUG/CPUHGNF# $TGEMGPTKFIG,& $TGMMG$( $TGPPGT' $TGPQV%5EJGGTU5 $TKECWNV. $TKPEMOGKGT' $TKVKUJ/WUGWO%CVCNQIWG $TQQMG%0N $TQQMG)% $TQYP. $TWEM) $TÃ&#x2019;IIGOCPP $TWP2 $TWPGVVK. $WEJGPCW* $WEJGPCW*2KEM$ $WEM* $WEM*$CJTHGNFV/XQP $WEM*/GKGT1 $Ã&#x2019;VVPGT#$Ã&#x2019;VVPGT& $WTMJCTFV# $WTPGVV##OCPFT[/4KRQNN½U22 $WTTGT( $WT\KQ*( $WVVQP'(TCPMHWTVGT/Ã&#x2019;P\GPJCPFNWPI $WVVTG[,T68 $W\FWICP)NWEJKCP11RTGEW%%

C

%CJP#G(TCPMHWTVC/ %CJP'$ %CJP*#/KNFGPDGTI.4WUUQ48QGIVNK*  %CJP*#*WTVGT5/KNFGPDGTI.5VTCWUU2 %CJP*#.G4KFGT) %CJP, %CNEKCVK4 %CNKEKQ(WPF:6TKIQ %CORCPC# %CORGNN9 %CPGUUC%WPF'0GCRGN %CRRG*2 %CRRG9 %CTQP' %CTUQP4#)28*KNN,2%-GPV %CUVGNKP- %CUVKINKQPK%1 %CXGFQPK% %GLPGM, %GTOCM-5MTDGM$ %JCFQWT5CORUQP$ %JCNNKU%' %JCVKNNQP.

%JCWFQKT$CTQP5FG %JTKUV- %JTKUVKG/CPUQPCPF9QQFU.VF.QPFQP4QO0GY ;QTM %JT[UUCPVJCMK0CING- %KCPK. %KCPK.2CTKU %KDTCTKQ. %KEEKQ)FG %KHHGTK4 %KXKEJG4CEEQNVG0WOKUOCVKEJG %K\OGNK< %NCKP5VGHCPGNNK' %NGTKEK%WPF%/KNCPQ %QEJTCP2CVTKEM49 %QHHGG,/ %QJGP* %QNDGTVFG$GCWNKGW,D %QNKP*, %QNNKIPQP,2 %QNNKP$ %QORCTGVVG6N %QOVGU4GPFWUFGNC5QEKGVG(TCPECKUGFG0WOKUOCVKSWGGV F CTEJGQNQIKG %QQNG#$ %QTRWU0WOOQTWO+VCNKEQTWO %QTUVGP6 %TCYHQTF/* %WDCUEJ* %WPPKPIJCO# %WTKGN4(WUUOCP) %WTVKU,9/KNPG,)

D

&B#PPGEK6 &CPPGPDGTI* &CPPJGKOGT* &CTKGT* &CXGPRQTV,5 &C[GV/ &G/QTICP, &GDQTF2 &GNGUVTGG.26CEJG/ &GNNC%CUC/ &GNOQPVG# &GODUMK) &GOQ< &GOQNG'9CXTG9 &GRGT[TQV)*CEMGPU6/QWEJCTVG) &GRG[TQV) &GTQE# &GUPGWZ, &GUUGYHH[/ &GVJNGHU)5VGIWYGKV9 &GWVUEJG$WPFGUDCPM &GWVUEJG)GUGNNUEJCHVHÃ&#x2019;T/GFCKNNGPMWPUV &GWVUEJG/Ã&#x2019;P\DN·VVGT0GWG(QNIG &GWVUEJGU,CJTDWEJHÃ&#x2019;T0WOKUOCVKM &KGVKMGT*# &KGWFQPPG# &KVVTKEJ- &KXQ,2 &QGFGTNKP,# 127


&QNNKPIGT( &QOCPKI- &QTHOCPP$ &QTQVJGWO9KGP &QVVK' &TCICPQX& &TGUUGN* &TQWKP' &WEJCNCKU# &WFKM$ &ÒPKPI# &ÒTT0 &WRQPV5QOOGT#4QDGTV. &WRTKG\%$TÒUUGN &WVMQYUMK, &WXG)

E

'EMJGN, 'FJGO* 'IIGT$TÒFGT9KGP 'IIGT/ 'JGDGTI-6 'KFNKV\4, 'KUGNGKP, 'KUGTOCPP' 'MNWPF120QG52 'NC[K,'NC[K#) 'NKCU'4& 'NOGT) 'N\G6 'OOGTKI* 'OOGTKI*-Q\KPQYUMK1 'PIGN#5GTTWTG4 'PIGNMG$ 'P\GPDGTI9#)TCHXQP 'TDUVGKP,W# 'TEQNCPK%QEEJK' 'TNCPIGT*, 'TPUV$ 'TQN# 'ZVGT( '[RGNVCWGT6

F

(CNMGPUVKGP,XQP (CNNQW. (CTCJDCMJUJ* (CTMCU#XQP (GTEJGN(/ (GWCTFGPV( (GWCTFGPV(T½TGU2CTKU (KCNC' (KPCWGT22 (KUEJGT'9KGP (KUEJGT6 (KUEJGT$QUUGTV9 (KV\, (NGPFGT,* (NKGUUDCEJ( (NQTCPIG,WPF%KCPK.2CTKU (ÌTUEJPGT) (QNMGU/ 128

(QTTGT. (QTTGT4 (QTUVGT#5EJOKF4 (TCEEKC%) (TCPMG24 (TCPMG24*KTOGT/ (TCPMG242CCT. (TCPMHWTVGT/ÒP\DN·VVGT5GKV(TCPMHWTVGT /ÒP\\GKVWPI (TCPMHWTVGT0WOKUOCVKUEJG)GUGNNUEJCHV (TGFG. (TGGOCP'# (TGWPFGDGTI)# (TG[*24(TGKDWTIKO$TGKUICW5R·VGT$NCUGT(TG[  (TKGFDGTI4 (TKGFGPUDWTI( (TKGFGPUDWTI(5GIGT* (TKGFGTKEJ- (TKGFNCGPFGT, (TKV\G*XQP)CGDNGT* (TÌJNKEJ% (TQGJPGT9 (TQNQXC0# (WEJU) (WNIQPK# (WTUG'* (WTVY·PINGT#G

G

)¯DTKEK' )CGFGEJGPU1% )CGVVGPU4 )CGVVGPU4.ÒDGEM )CGVVGPU4'TVGN* )·WOCPP# )CNGQVVK# )CNUVGT) )CODGTKPKFK5ECTH½C% )CTEKC#%'UEWFGTQ(//QPVGQNKXC,8 )CTEKC$GNKFQ/2 )CTKGN' )CTXG, )CWFQT[8 )GDGTV%(0ÒTPDGTI )GDJCTFV- )GDJCTV* )GDJCTV*-TCHV- )GKI[# )GKUUGP# )GTKP& )JCNKD'FJGO+ )KCTF,$ )KGUGEMG9 )KGUGP- )KNJQHGT4CPUEJDWTI9KGP )KNJQHGT4CPUEJDWTI9KGPWPF*GUU#.W\GTP  )KNNLCO** )KVNGT*2QPVKPI/ )KVNGT*6CN1 )NGPFGPKPI )NGPFKPKPI%QWPF5GCD[$#.QPFQP


)NQDQEPKM#8 )O[TGM% )QFQPPGUEJG0 )ÌDN( )ÌDN4WC )ÌV\%L )ÌV\G4 )QNGPMQ-8 )QQFCETG* )QTRJG, )TCDQY.4QUVQEMUR·VGT$GTNKP )TCGXKWU,) )TCPFLGCP% )TCPV/ )TCUUGT9 )TC[,%( )TGGP/, )TGGPYGNN9 )TKGTUQP2/C[U/ )TKOO' )TKV\PGT/ )TÌUUNGT* )TQUG59 )TQVG* *TUI  )TQVGHGPF%. )TQVGOG[GT2 )TWGDGT*# )TWGDGT*#-GCT[%( )TWGN-/QTKP' )TWPCWGTXQP*QGTUEJGNOCPP5 )ÒVVJGT%* )WOQYUMK/ )WVOCPP(5EJYCDCEJGT9 )[ÌPI[ÌUU[/9KPVGT*

H

*CCHH2#XCP *CCU, *CDGTNKP', *CDKEJ) *CEMGPU6/QWEJCTVG) *·DGTNG# *CGDGTNKP', *·XGTPKEM9 *CIGP,)(XQP *CIGP7 *CJP' *CJP7 *CJP9/GVECNH9' *CJP9/GVNKEJ/# *CJP9TQ *CNCEMC+ *CNN'6/GVECNH&/ *CODWTIGT$GKVT·IG\WT0WOKUOCVKM *CODWTIGT,(TCPMHWTVC/ *CODWTIGT..(TCPMHWTVC/  *CODWTIGT.(TCPMHWTVC/ *COOGTKEJ* *CTUVGT9 *CTVOCPP(TCP\GPUJWNF''XQP *CV\) *CWDGTI2

*CWRV9 *CWUGT, *GCF$X *GDGTNG,/ *.GORGTV\ 5ÌJPG -ÌNP *GFG* *GGTGP+ *GGUEJ,XCP *GKFGOCPP50GDGU0 *GKUU# *GMNGT# *GNDKPI *GNDKPI0CEJH1/ÒPEJGP *GNDKPI*/ÒPEJGP *GNDKPI1/ÒPEJGP *GNNGT, *GNOTGKEJ6 *GNOUEJTQVV-W4 *GPKI/ *GPPGCO4J[P1 *GPPKP/ *GPUGNGT# *GTDGTV- *GTKPGM. *GTKPI' *GT\HGNFGT* *GUU#).W\GTP *GUU0CEJH#(TCPMHWTVC/ *GUU#(TCPMHWTVC/ *G[FGP*XQP *G[PG1 *KNFKUEJ, *KNN)( *KNN)(2QNNCTF) *KNN)(4KEEK5FG *KNN28 *KTUEJ,/ÒPEJGP *KTUEJ,% *QDDU4 *QEJWNK)[UGN# *QGRNK7 *QHHOCPP* *QNV\9 *QN\OCKT$ *QN\OCKT' *QQXGT1& *QTP*)4ÒIGT%$ *QTPWPI U/ÎPVCWMVKQPGT-QRGPJCIGP *QWIJVQP# *ÒTNKOCPP*

I

+#20 +ECTF5 +NKUEJ2 +NKUEJ25EJYGFG# +OJQQH$NWOGT( +OJQQH$NWOGT()CTFPGT2 +PIJQNV* +PPWPF-P[RJCWUGP-)TCH +PUVKVWVQ+VCNKCPQFK0WOKUOCVKEC +RRGN# +UKM' +UNGT*2 129


+XGTUGP,

J

,CGIGT- ,CJTDWEJFGU0WOKUOCVKUEJGP8GTGKPU\W&TGUFGP ,CJTDWEJHÒT0WOKUOCVKMWPF)GNFIGUEJKEJVG ,COGUQP4%QNNGEVKQP ,GNQEPKM# ,GPMKPU)--ÒVJGOCPP*5WVJGTNCPF%*8WC ,GPMKPU)-.GYKU4$ ,GUUG9 ,GUWTWO# ,KOGPG\# ,QCEJKO,( ,QJPUVQP# ,QPIMGGU,J ,QUGRJ2 ,QUKHQXUMK2 ,QWTPCN+PVGTPCVKQPCNF CTEJ¾QNQIKG0WOKUOCVKSWG  ,WPIM* ,WPIYKTVJ* ,WTWMQXC,

K

-CFOCP. -CGPGN*/XQP -CKO4 -CNXGNCIG*5EJTQEM7') -CNXGNCIG*6TKRRNGT* -COKPUMK% -COROCPP7)CPUEJQY6 -CTC[QVQX. -CUCOCPQXC.0 -CVUQWTQU( -CV\8 -GKO,-NWODCEJ* -GNNPGT'WPF*, -GNNPGT*, -GPPGRQJN- -GPPGT( -GPV, -GPV,2%1XGTDGEM$5V[NQY#7 -GWTGP(XCP -KGPCUV& -KGPCUV)9 -KG\GDTKPM*4 -KPFNGT# -KPI%'9KII) -KTEJJGKOGT( -KUEJ$ -KVVGN' -KV\GNKK, -NCW­, -NGDGNUDGTI()TCHXQP -NGKP& -NGKP74CHH# -NGKPGT(50QG52 -NGKPGT) -NGKPUEJOKFV%. -NGOGUEJ* -NGPCW# -NGPCW6 -NKGVOCPP-) 130

-NQUG&1# -NÒUUGPFQTH0 -NWIG$ -PKIIG9 -QEJ* -QEJU* -ÌJNGT,F -QGJPG$FG -QGPKI#5VCN\GT( -ÌPKI6 -ÌPKINKEJG/WUGGP\W$GTNKP -QNDC,*0¾OGVJ#6 -QNPÃMQX±' -QOPKEM* -QPITGUUDGTKEJVG -QPKPI,#OUVGTFCO -QU2 -Q\KPQYUMK11VVQ,4WUU* -TCC[%/ -TCHV- -TCWU(($TCWPUEJYGKI -TCWUG%./KUJNGT% -TGO[FK5KEKNKCPQW5 -TGUU-/ÒPEJGP -TGUVGX- -TKVV$ -TQNN,* -TWU[* -WDG4$GTNKP -WJP* -WNN,X -WOOGT# -WPFOCPP,% -WP\% -WP\GN/

L

.CECO) .CETQKZ. .CHCWTKG, .CJWUGP) .CJWUGP)(QTOKINK' .CLQU* .COCU# .CPG2QQNG52QQNG45 .CPIG- .CPINQKU8 .CPPC(TGKJGTT#XQP .CP\*)TC\ .CP\1 .CWTGPV8 .G4KFGT) .GDGM9 .GGFU'6 .GJOCPP*WPF(NQTCPIG,2CTKU .GKV\OCPP, .GORGTV\/-ÌNP .GPI[GN. .GTOCPP9 .GUEJJQTP9 .GUUGT(% .GW#)<ÒTKEJWPF*GUU#.W\GTP .G[RQNF(


.KDGTQ/CPIKGTK) .KEJPQYUM[4XQP .KEJVGPDGTIGT# .KGDG%5 .KRRQNF) .KRUKWU,) .LWDKEC5 .QDGN4 .QEJPGT,* .ÌDDGEMG# .ÌHHGNJQN\XQP-QNDGTI9(TGKJGTT .QJPGT% .QPFQP .QPIWGV* .QQP)XCP .QTDGT%E .QTK,IXQP .QTKEJU)&FG .QWDCV,( .WECU2 .ÒEMIGT*, .WMCPE. .WNNKGU4 .WUEJKPXQP'DGPITGWVJ#

M

/CEFQPCNF&, /CFCK&5 /CFUCEM' /·MGNGT* /CICKP2 /CNOGT$WC /CPFGN', /CPP, /CPXKNNG*'4QDGTVUQP6, /CTIQNKU4 /CTMN/ /CTVKP%-CJN*&%CJP'$ /CTVKPK4 /CTVKPK9 /CVVKPIN[* /CVVKPIN[*5[FGPJCO'WC /CWG* /CWTKEG, /C[,/( /C[GT% /C[GT'XQP /C[JGY0, /C[T# /C\CTF, /C\\KPK) /GIQY94 /GJN/ /GKGT1 /GKPJCTFV) /GPGUVTKGT%( /GP\GN* /GP\GN2 /GP\KPUM[* /GTKEMC8 /GTNGXQP /GTVGPU' /GT\DCEJGT'/ÒPEJGP

/GT\FQTH,(.6 /GUJQTGT;3GFCT5 /GUPKNFW$WKUUQP4 /GVECNH&/ /GVECNH9' /GWUU**CODWTI /GXKWU, /G[,FG /G[,FG2QKPFGUUCWNV$ /G[GT# /G[GT* /G[GT9WTODCEJ' /KGTKU(XCP /KJCKNGUEW$ÄTNKDC8 /KMQEMK. /KNFGPDGTI.*WTVGT5 /KNGU)% /KNNGT\W#KEJJQN\8 /KNNGT\W#KEJJQN\8.QGJT#*QN\OCKT' /KNNGT/ /KNPG,) /KQPPGV6' /KUUGTG)(QPVCPC(/ /KUUQPI# /KVEJKPGT/ /KVVCI2( /KVVGKNWPIGPFGT$C[GTKUEJGP0WOKUOCVKUEJGP)GUGNNUEJCHV  /KVVGKNWPIGPHÒT/ÒP\UCOONGT /QEJKTK/+ /QOOUGP6 /QPCVUDNCVVFGT0WOKUOCVKUEJGP)GUGNNUEJCHVKP9KGP  /QPTCF+2 /QTKP( /QTKP* /QTTKUQP-()TWPVJCN* /QTTKUUQP% /QUEJ*%XQP /QUGT*6WTUM[* /QUUOCPP2. /QUVCNCE# /QUVGEM[* /QWEJCTVG /QWEJOQX0# /QWUVCMC# /TCUU25CMYGTFC, /ÒNNGT' /ÒNNGT. /ÒNNGT1( /ÒNNGT,CJPEMG9&8QN\(' /ÒNXGTUVGFV)#XQP /ÒPFJGKO/ /ÒPUVGTDGTI4 /ÒPUVGTGT*1 /ÒP\GPWPF/GFCKNNGP#)$CUGN$CPM.GW%Q <ÒTKEJ /ÒP\JCPFNWPI$CUGN$CUGN /ÒUGNGT- /WHHCV-# /WNNGT( /WPTQ*C[5% /WPVQPK( 131


/WTKUGV)KEQV%)GPH /ÎTMJQNO1 /ÎTMJQNO1<CJNG,

N

0CJW[U/6 0CUJ& 0CUVGT2 0CW' 0CXKNNG%Q)GPH #TU%NCUUKEC  0CXKNNG. 0GNMGPDTGEJGT,% 0GUOKVJ4+ 0GVVNGHQNF(, 0GW* 0GYGNN'60QG2/ÒNNGT. 0GYGNN'60QG5R 0GYOCP'2$TGUUGVV-' 0KEQN0& 0KIIN2 0KOOGTIWV, 0QG52,QJPUVQP# 0QGUMG*% 0QJGLNQX±2T±VQX±' 0QNN¾,1XGTDGEM$9GKUU2 0QOKUOC 0QOKUOCVKMC:TQPKMC 0QTVJ,,2TGUVQP/QTNG[2, 0QUU# 0ÒV\GN* 0WOKUOCVKE%JTQPKENG 0WOKUOCVKE%KTEWNCT 0WOKUOCVKE(KPG#TVU$GXGTN[*KNNU 0WOKUOCVKEC9KGP 0WOKUOCVKEMÓ%CUQRKU%GUMQUNQXGPUMÓ 0WOKUOCVKUEJG/KVVGKNWPIGP0ÒTPDGTI 0WOK\OCVKECT 0WUUDCWO*<ÒTKEJ

O

1DGTOC[T,' 1EEQ# 1EJ( 1KMQPQOKFGU/ 1NEC[05G[TKI* 1NFKPI/ 1NKXCEC[QP,4%CUVCP% 1NKXKGTK# 1PFTQWEJ8 1RFGP8GNFG9-NCCUUGP%,( 1RRGN( 1TFGP)XCP 1TFKPGFK5)GPPCTQ 1TFKPG/KNKVCTGFK5)KQTIKQ&GNNC4KWPKQPG 1TFKPG/KNKVCTGFK5CXQLC 1TVJOCPP9 1UUDCJT%# 1UVGP**XQPFGT 1XGTDGEM$

P

2CEJKPIGT#/ 2CEJKPIGT#/(TKGUGPGIIGT,/ 132

2CICPK# 2CIG#2CTKU 2CIG&KXQ(&KXQ,2 2CQNWEEK4<WD# 2CRCFQRQNK0 2CRCIGQTIKCFQW$CPKU% 2CTWEM(&, 2CVKP% 2CWNUGP4 2CWVCUUQ# 2GUEJNQY$KPFQMCV#2GUEJNQY7 2GVGIJGO%XCP2CTKU 2GVGT/ 2GVGT7 2GVTQX8+ 2GVTQYKE\#4KVVGTXQP 2GWU0CEJH&T$WUUQ(TCPMHWTV#O/CKP 2GWU$ 2KEM# 2KEM#4KZGP,7 2KEM$ 2KPM- 2NCPV4 2NCVV%2CTKU 2NQP' 2QG[F #XCPV( 2QNGP\* 2QPEGV' 2QQNG45 2QTVGQWU, 2QUGTP-NGVV%(XQP 2QVVU&6 2TCWP#5 2TKDKN$ 2TKEG/9CIIQPGT0 2TKEG/, 2TKGWT2 2TQDU\V) 2TQDU\V1JUVQTHH) 2TQMKUEJ$ 2TQMKUEJ$WC 2TQMQRQX+ 2TQW/ 2UQOC5

Q

3WCFGTPK6KEKPGUK 3WGNNOCN\9 3WKIIKP#*

R

4#NHÌNFK/ 4CE\[PUMK' 4CPKGTK' 4CRRCRQTV'$GTNKP 4CUKNG/ 4CUOWUUGP# 4CUOWUUQP0..CIGTSXKUV.1 4CVVQ//CKNCPF 4CVVQ4 4CVVQ4.WICPQ 4CXGN1' 4C[OQPF9


4GFFGT(.GKR\KI 4GFFGT9 4GINKPI- 4GKHGPDGTI# 4GKOOCPP( 4GKPCEJ#, 4GKPJCTF,2   4GKPJCTV9 4GPILGQ+ 4GPPGT8FG 4GVQYUMK1 4GWUEJ9 4GXWG$GNIGFG0WOKUOCVKSWGGVFG5KIKNNQITCRJKG 4GXWG0WOKUOCVKSWG 4KEEKQ)) 4KEJVGT# 4KEJVGT)/# 4KEJVGT, 4KEQVVK2TKPC& 4KGEJOCPP# 4KGEJOCPP#*CNNGCPFGT5CCNG 4KPCNFK1 4KVVOCPP* 4K\\QNNK* 4QDGTV% 4QDGTV. 4QDGTV.WPF, 4QDGTV2% 4QDGTVU94*GCF$8 4QDGTVUQP#5 4QDKPUQP&/ 4QDKPUQP'5)%CUVTQ*KRÉNKVQ/ 4QJTGT) 4QNNC/ 4QNNKP(GWCTFGPV2CTKUWPF#*QN\JCWUGP9KGP 4QNNKP(GWCTFGPV2CTKU 4QUG1 4QUGPDGTI*5*CPPQXGT 4QUGPDGTI5(TCPMHWTV#O/CKP 4QUU*QNNQYC[4 4QUU*QNNQYC[4,GPMKPU)- 4QUVQY\GY/ 4QW[GT,*WEJGT' 4WFQNRJ' 4WVVGT0- 4W\KEMC.

S

5CDCVKGT, 5CDCVKGT/, 5CEJUUGPFCJN, 5CEMGP'XQP-GPPGT( 5·TUVTÌO/ 5CLCWUMCU5-CWDT[U& 5CNNGV#XQP 5CNNGV#XQP2KEM$WC 5CNOQ* 5CODQP#%CPGUUC%WPF'2CTKUWPF4QO  5CODQP) 5CODQP)/CKNCPF4QO(NQTGP\ 5CPVCOCTKC2WPF24QO 5CPVKPK#

5CVJ[COWTVJ[6 5CVVNGT#$CUGN 5CWGTNCPFV/ 5CWNE[(FG 5CWNE[.(,%FG 5CWTOC,GNVUEJ*XQP 5EJCCH4 5EJCCHH7 5EJ·HGT' 5EJGGTU5 5EJGHQNF- 5EJGODTK%*% 5EJGT5- 5EJKPFGN0 5EJNGIGN# 5EJNGUUKPIGT($GTNKP 5EJNKEMG[UGP(9#2CNNOCPP4&TQ[UGP* 5EJNQUUGT,XQP 5EJNWODGTIGT* 5EJOKFV$-PCD%'TDUVGKP, 5EJOKFV/ 5EJOKFV4) 5EJOKGFGT%% 5EJPGG) 5EJPGKFGT- 5EJÌPGOCPP%2% 5EJÌPGTV)GKUU' 5EJÌPXKUPGT5 5EJÌRRNGT* 5EJQNVGP% 5EJQVV9CNNGTUVGKP5(TCPMHWTVC/ 5EJTÌVVGT((TGKJGTTXQP 5EJWDGTV6(XQP 5EJWNOCP*/(0GY;QTM 5EJWNOCP, 5EJWNOCP,#OUVGTFCO 5EJWNVG$ 5EJWNVGP# 5EJWNVGP20 5EJWNVJGUU4GEJDGTI-) 5EJWNV\5 5EJWN\G+WPF9) 5EJYCDCEJGT9 5EJYCNDCEJ% 5EJYGK\GTKUEJG0WOKUOCVKUEJG4WPFUEJCW 5EJYKPMQYUMK9 5EQVV- 5GCD[*# 5GGN·PFGT0 5GKDV9 5GKFGN-& 5GKVGTNG) 5GNKIOCPP#*CPPQXGT 5GNKIOCPP* 5GNNKGT4 5GNNYQQF& 5GNVOCP% 5GOTQX# 5GPKQT4% 5GTHCU* 5GWDGTV 5GXGTKP*/ 5JGRRCTF6/WUJCO,(H 133


5JKGN0 5KGXGMKPI, 5KOQPGVVC$ 5KOQPGVVK. 5NGRQXC6+ 5OKVJ4 5OQNFGTGP. 5QEKGVG(TCP¼CKUGFG0WOKUOCVKSWG 5QGVDGGT# 5QVJGD[%Q.QPFQP 5QVJGD[ U 5QVJGD[.QPFQP0GY;QTM<ÒTKEJ 5QVJGD[9KNMKPUQP*QFIG.QPFQP 5RCPJGKO' 5RCPW/ 5RCUUM[+) 5RKPM5QP 5RTWVJ( 5VCPIG' 5VCTEM[,%CSWQV# 5VCTT%) 5VGHCP( 5VGP\GN6 5VGTPDGTI(<ÒTKEJ 5VQNN4 5VTCEM2. 5VTGDGT( 5WEJKGT4 5WVJGTNCPF%*8-TCC[%/ 5WVJGTNCPF* 5XQTQPQU,0 5[FGPJCO'# 5[NNQIG0WOOQTWO)TCGEQTWO$GNIKGP 5[NNQIG0WOOQTWO)TCGEQTWO$WNICTKGP 5[NNQIG0WOOQTWO)TCGEQTWO&·PGOCTM 5[NNQIG0WOOQTWO)TCGEQTWO&GWVUEJNCPF 5[NNQIG0WOOQTWO)TCGEQTWO)TKGEJGPNCPF 5[NNQIG0WOOQTWO)TCGEQTWO)TQUUDTKVCPPKGP 5[NNQIG0WOOQTWO)TCGEQTWO+VCNKGP 5[NNQIG0WOOQTWO)TCGEQTWO¤UVGTTGKEJ 5[NNQIG0WOOQTWO)TCGEQTWO5EJYGFGP 5[NNQIG0WOOQTWO)TCGEQTWO5EJYGK\ 5[NNQIG0WOOQTWO)TCGEQTWO6ÒTMGK 5[NNQIG0WOOQTWO)TCGEQTWO7PICTP 5[NNQIG0WOOQTWO)TCGEQTWO75# 5[NNQIGQH%QKPUQHVJG$TKVKUJ+UNGU 5\CKXGTV9

T

6CGNOCP, 6CNKGTEKQ/GPUKVKGTK/ 6CPPKEJ- 6GMKP1 6JGOGUUN, 6JKGOG%).GKR\KI&TGUFGP 6JQORUQP/ 6JQORUQP//ÎTMJQNO1-TCC[%/O 6JQOUGP%, 6JQTOCPP* 6KGRQNQ.6JGWRQNWU( 6QDNGT'<·EJ$0WUUDCWO5 6QGNMGP'* 6QNUVQK, 134

6QOCUKPK9, 6QRCNQX5 6QTPCW1 6QTPDGTI%, 6QWT*FGNC 6QWTPGWT8 6Q[PDGG,/% 6TGUQTFG0WOKUOCVKSWGGVFG)N[RVKSWG  6TKGT&,9 6TKNNOKEJ9 6TKRRG# 6TQUV., 6TQZGNN*# 6UCPICTK&+ 6WFGGT.16 6WTECP4 6[U\MKGYKE\' 6\COCNKU#2

U

7\FGPKMQX88

V

8CIK&. 8CNGPVKPG9* 8CP#TUFGNN4& 8CP&GT9KGNGP;)GKUGT#-ĚPKI('%CORCIPQNQ / 8CP)GNFGT*' 8CP)GNFGT*'*QE/ 8CPPGN(6QFGTK) 8CVGT&,5 8GTC)* 8GTGKPFGT/ÒP\GPHTGWPFGKP*CODWTI 8GTGKPHÒT0WOKUOCVKM\W2TCI 8GTMCFG2 8KNNCTQPIC)CTTKIC. 8KNNCTQPIC. 8KUEQPVK'3 8KUOCTC0 8QGIVNK* 8ÌNEMGTU** 8QGVVGT1 8QINJWDGT4 8QIV, 8QKV. 8QNNG* 8QNNGPYGKFGT/.

W

9CFFKPIVQP9*$CDGNQP'4GKPCEJ6 9CIGPUGKN%, 9CIPGT4 9CJNGP# 9CNMGT, 9CNNCEG92 9CNUJ'*8GTOC62 9CPI;ÒEJ ÒCP 9CTTGP,#9 9GDGT&#TPQNF2-GKN2 9GDGT+5 9GDGT1


9GKFJCU,( 9GKIGN%1.GKR\KI 9GKN4 9GKNGT* 9GKNNGT4 9GKNOG[T(: 9GKPI·TVPGT, 9GKUG#% 9GKUGT9 9GNVGT) 9GN\N8QP9GNNGPJGKO. 9GPFNKPI' 9GP\GN# 9GUGPGT(,/ÒPEJGP 9GUV#$ 9GUVGTOCTM7,GPMKPU- 9G[N# 9G[N#$GTNKP 9JCKVGU,,4 9JKVGJGCF4$ 9KDGN( 9KFOGT/,8QP 9KGEGM# 9KGNCPFV( 9KGNCPFV(<GKV\, 9KGP--*CWRVOÒP\COV 9KGPGT0WOKUOCVKUEJG/QPCVUJGHVG 9KGTEKPUMC, 9KNDGTI/ 9KNNKCOU46 9KNNKCOUQP)% 9KPMGN/CIPWUUGP-QRGPJCIGP 9KPVGTUVGKP% 9KP\GT# 9QTM' 9Q[VGM$ 9TQVJ9 9TWEM9 9TWEM9$GTNKP 9ÒTVVGODGTIKUEJGT8GTGKP(ÒT/ÒP\MWPFG 9ÒTVVGODGTIKUEJGU.CPFGUOWUGWO5VWVVICTV 9WT\DCEJ6CPPGPDGTI94XQP

Y

;CUJKP% ;TKCVGFG1NKXC,.QRG\%JCXG\5CPEJG\.

Z

<CODCWT'XQP <C[' <GJPCEMGT* <GKV\.WPF, <KGINGT4 <ÌVVN* <QITCRJ#0 <UEJKGUEJG-ÌFGT.GKR\KI <YKGTNGKP&KGJN'

135


SAMMLUNGSINDEX A

#JTGPU#' #NKPGPJQH*/ #NNCVKPK%JWTEJKNN')5 #NNQVVGFGNC(W[G #OGTKECP7PKXGTUKV[QH$GKTWV/WUGWO #TVCTKC# #TVU*FGU #WNQEM*5XQP

B

$CEJQHGPXQP'EJV $CEJQHGP$WTEMJCTFV,,9 $CGT% $CGUGEMG* $CJTHGNFV' $CNFKPIGTXQP $CT/ $CTFV( $CTTCEJKP $CTTQP2 $CTTQP69 $CTVJQNQOCGK $CWGT, $GEM, $GNGT6 $GNNK. $GOGPV%5 $GTEJGO $GTEJVQNF $GTIGT5 $GTNKP/ÒP\MCDKPGVV $GTT[$; $GTVKGTFGNC)CTFG#. $GVJGXQP $G[( $KGDGT $KPIGP* $KTMGPTWVJ# $NCUU' $NQEJ8GKVJ $QDQMQX$TQU $QFG $QJNOCPP4 $QPJQHH $QTFGCWZ $Q[F/ $TCPF8/ $TCPFV.KEJVGPHGNU $TCVTKPI*GTOCPP $TCVTKPI2 $TCWUG*CNNG $TGMMG$( $TGVVCWGT, $TG[OC[GT( $TWWP.' $WEJGPCW* $WEMNG[ $ÒNQYXQP $WJNGTU $WPMGT*WPV0 136

$WTTCIG4 $WTUKQ)$ $WTUVCN'-

C

%CRRG %CRTQVVK %CTN[QP$TKVVQP %CXCNNCTQ%) %JTKUVKVEJ %JWTEJKNN')5 %NCGT'XQP %NCTM% %NGHH4 %QJP. %QNNKIPQP/ %QNQPPC %ÊVG% %WTCVQNQ %WTVKWU %W\\K# %\KMCPP,.

D

&COOG2XCP &CP\KIGT &CXKU0 &GGEMG &GKEJOCPP%6 &GNDGEMG# &GYKPI#5 &KGN &QJGP[2# &QPGDCWGT/ &QTOCIGP &TCGIGT) &TGGT( &TGUFGP-ÌPKIN/ÒP\%CDKPGV &TG[HWU) &ÒPKPI# &WMGQH0QTVJWODGTNCPF &WODGTVQP1CMU

E

'DPGT, 'PIGN)TQU 'PIGNGT1 'P\GPDGTI# 'P\GPDGTI#)TCHXQP 'P\GPDGTI9#)TCHXQP 'TDUVGKP4, 'TKOKVCIG 'TPUV 'T\JGT\QI5KIKUOWPFXQP¤UVGTTGKEJ 'XCPU#, 'XCPU, 'XGNRKFKU4*

F

(CJTDCEJ. (CNMGPJCWUGP#XQP


(CTKPC% (CTQWM (GNFJGKO (GNKZ' (GTTCTKNC4GPQVK½TG (KGYGIGT (KQTKPQ (KUEJGT' (NQTCPIG, (NQTG[4 (QPTQDGTV, (QTF,4 (TCPM% (TCPMKGYKE\/ (TG[DQWTI# (TKGFGPUDWTI (TKGFGTKEJ& (TKGFTKEJ#WIWUVXQP1NFGPDWTI (WEJU9 (ÒTUVGPDGTIKUEJGU/ÒP\MCDKPGVV\W&QPCWGUEJKPIGP  (WTIGT

G

)CGVVGPU )CNNGV )CTCXCINKC )CTTGVV )CTVJG* )GDGTV%( )GUUPGT )GUUPGT' )KNNGVG )KQTIK )NÒEMUVCFV )PGEEJK' )QRRGN/. )QVJG/ÒP\MCDKPGVV )TCPFRG[FG )TGGPG )TGKP )TQUUOCPP6 )TQVG* )TÒPGTV%( )WKFK )WNDGPMKCP% )WVGMWPUV*) )WVJGKN

H

*CGDGTNKP', *CJP- *CTOGPKPI *CTVOCPP *CWGT *CWUYCNFV *GEMGVV)5 *GFG* *GGTFV( *GKNDTQPPGT *GKNDTWPP$ *GKPTKEK) *GNHGTKEJ

*GNNYGI# *GPEMGN2 *GPPGDGTI# *GTOCPP *GT\* *GT\HGNFGT *GUGOCPP *G[FGP#XQPFGT *G[FGP*XQP *G[G' *G[OCPP *KPVGTUVQKUUGT, *ÌHMGP*CVVKPIUJGKO *ÌT% *QNNGT *QN\OCPP/ *QTUM[ *QUMKGT*% *QVJQTP *QWIJVQP#

I

+MN¾# +OJQQH$NWOGT( +PPWPF-P[RJCWUGP-\W +UGPDGEM, +V\KPIGT9 +XGTUGP

J

,COGU*. ,COGUQP4 ,QUGRJ2

K

-CRU9' -CWHOCPPXQP -C[UGT -GGVOCPP# -GNNGTOG[GT -GUUNGT% -GUUNGT- -KNNKUEJXQP*QTP -KTUEJ -NKPIGTV) -PKIIG9 -PQDNCWEJ, -PQNN% -P[RJCWUGP- -QDNKV\*XQP -QEJ -QGPKI -ÌTPGT -QHNGT -QNNOCPP' -QTP -TCC\ -T·OGT' -TCHV9 -TCWU) -TGUU5* -WDKEMK1XQP -WNN,8 137


-WPUVHTGWPF -WP\

/WUGWOQH(KPG#TVU$QUVQP

L

0CIGN5 0CVJCP& 0CVJWUKWU 0GWDCWGT4 0GYGNN'6 0KGUU# 0KIIGNGT9 0QNVG, 0QTFJGKO

.CKDNG .COD,' .CODTQU,2 .CPPC#XQP .CVQWTXQP6JWTODWTI- .CYTGPEG.# .GJOCPP .GJOCPP2XQP .GUVTCPIGU .GXKU*% .GX[, .KPFPGT .QEJPGT) .QEMGVV4% .ÌDDGEMG# .ÌHHNGT( .ÌJTXQP .QGYG* .QTGP\9 .QVJQN\ .QXGNN% .WFYKI

M

/CDDQVV61 /CFCK&5 /CIPCIWVK /CKNKGV /CLGTWU /CPP, /CTKGPDWTI /CTVKPK# /CTVKPQTK' /CVVG[ /CWTGT /E-GCP4CD[% /E.GCP /GGUG, /GKGTJQH /GTMGPU( /GTNGXQP /GTVGPU' /GVTQRQNKVCP/WUGWOQH#TV /GV\* /G[GT)GFCPGPUKU# /KEJCKNQXKVUEJ# /KEJGTC, /KNNGT\W#KEJJQN\8 /KPWU) /ÌNNGT /QNVJGKO#94KVVGTXQP /QPPKGT /QPTCF+2 /QTDKQ% /QTGN(CVKQ# /QTQUKPK /WGNNGT.GDCPQP* /ÒP\MCDKPGVV /WTFQEJ,) 138

N

O

1 $[TPG 1CMNG[*,2 1EJ( 1GTVGN# 1NU\QYUMK.XQP

P

2CN¾\KGWZFG 2CWGT, 2CWNK( 2GN\GT# 2GP\KI 2GVTQYKE\# 2GVT[* 2GVVKPCVK 2JKNKRR, 2JKNKRUGP) 2KGRGT9 2NWO 2PKQYGT) 2QIIG%( 2QPVQPF #O¾EQWTV 2Q\\K5 2TGKUU2 2TKP\#NGZCPFGTXQP*GUUGPWPFDGK4JGKP 2TKP\)GQTIXQP2TGW­GP 2TKP\.GQRQNFXQP2TGW­GP 2TKP\2JKNKRRXQP5CEJUGP%QDWTI)QVJC 2TQYG6

R

4CKPGT 4¾IPCWNV* 4GKOOCPP( 4JQFG6 4JQWUQRQWNQU 4KGEJOCPP 4QDGTV 4QGFGT% 4QGRGT 4QIGTU' 4QJFG6 4QUGPDGTI*5 4QVGPJCP*XQP 4QVJXQP 4QWUUGV 4WFQNRJ 4WHH* 4WNCPF%


4WORH

S

5CEJUG4 5CEJUGP%QDWTI)QVJC2XQP 5CTVKIGU 5CVVNGT# 5CWNE[( 5CWTOC,GNVUEJ*XQP 5EJCNNGPDGTI, 5EJCTPCIGN 5EJGGN9GKJGTWPF0KORVUEJ4(XQP 5EJGPPKU$CTQP(XQP 5EJG[GT, 5EJNGUKPIGT9 5EJNKGHHGP 5EJNÒVGT 5EJOKFV(9 5EJOKFV) 5EJOWNC-TCRRKV\& 5EJPGKFGT' 5EJPGKFGT* 5EJÌPDGTI6JCOOGPJCKP 5EJTCFGT, 5EJTCV\9 5EJTQVV 5EJÒUUNGT9 5EJWNVJGUU4GEJDGTI4KVVGTXQP 5EJWNV\1 5EJWNV\G. 5EJYCDG, 5EJYCNDCEJ% 5GEMGT 5GFIYKEM$GTGPF9$ 5GKH( 5GNVOCPP', 5G[HHGT 5KEM% 5KIPQTGNNK 5KOQP/ 5QGEMGN-CJNGTV# 5RGKGT. 5RGPEGGT%JWTEJKNN') 5RÌVVN 5V2GVGTUDWTI'TGOKVCIG 5VGEMK* 5VGIGT* 5VKHV5V(NQTKCP 5VÌNVKPI 5VTQGJNKP2% 5VTQVJGT#FGN 5VTQ\\K 5VTWRR. 5VWT\GPGIIGT 5VWV\ 5WEJKGT4 5WEJUNCPF' 5WJO), 5XGPUUQP 5[FGPJCO

T

6JQOUGP%, 6KEJ[ 6QNUVQK,, 6TCW( 6TCWZFG 6TCXGTUQ8

U

7JTOCEJGT, 7NGZ)( 7ODGTVQ 7PIGT6

V

8CWVKGT 8GKVJ 8GTYQTP 8KGNJCDGT 8KGTQTFV 8KT\K 8NGWVGP(XCP 8QIGN* 8QIGNUCPI- 8QIGNUVGKPXQP

W

9CMNG[6 9CNEJGT 9CNFGEM 9CNVGT- 9CNVGT4 9CNVGTU(# 9CTF, 9CTTGP'2 9CUUGTUEJNGDGP'XQP 9GDGT'( 9GDGT* 9GKPI·TVPGT, 9GKUU, 9GN\NXQP9GNNGPJGKO. 9GUGPGT(, 9GYGNGT 9JGCVQP%QNNGIG 9JKVEQODG)TGGPG6 9KNFGPUVGKP4XQP 9KNOGTUFÌTHHGT/XQP 9KPFKUEJ)T·V\'2TKP\\W 9KPUGOCPP(CNIJGTC 9QNHH& 9QQFYCTF9* 9WNHKPI,/ 9WPFGTN[XQP/WTCNV*

Z

<CPMN1 <GKUDGTI <GPQ <QNNGT' <UEJKGUEJG-ÌFGT

139


STICHWORTINDEX A

#DFGTC #GIKPC #GQNKU #MCPVJQU #NGZCPFTKPGT #NNIGOGKPG0WOKUOCVKM #NRGP #ORJKRQNKU #PJCNV #PVKMG#NNIGOGKP #RJTQFKUKCU #SWKNGKC #TEJKVGMVWT #TGPDGTI #TMCFKC #TNGU #TOGPKGP #VVKEC #VVKMC #WIUDWTI #WMVKQPUMCVCNQIG #WUDGWVG #WUVTCNKGP #[[WDKFGP

B

$CFGP $CMVTKGP $CNMCP)TKGEJGPNCPF/CNVC $CNVKMWO $CODGTI $CTD[ $CUGN $C[GTP  $GNCIGTWPI $GNIKGP $GNIKGP0KGFGTNCPFG.WZGODWTI $QDNKQRJKNG9GTMG,CP $ÌJOGP $QGQVKGP $QURQTQU $TCPFGDWTI $TCPFGPDWTI(TCPMGP $TCPFGPDWTI2TGWUUGP   $TCWPUEJYGKI.ÒPGDWTI     $TGKUICW $TGOGP $[\CPVKQP $[\CP\  $[\CP\8ÌNGTYCPFGTWPI(TÒJOKVVGNCNVGT

140

C

%CODTCK %JKPC %JKQU %KIKQ %QDWTI %QGUHGNF %QTXG[

D

&·PGOCTM &CMKGP &CNOCVKGP &CP\KI &GMCRQNKU &GWNVWO &GWVUEJGT1TFGP &GWVUEJNCPF &KGRJQN\ &KQP &QPCWYÌTVJ

E

'FGT 'IIGPDGTI 'KEJUV·VV 'KPDGEM 'NUCUU 'N[O·GT 'ORQTKQP 'PUKUJGKO 'RGKTWU 'RJGUWU 'RKTWU 'T\IGDKTIG 'UUNKPIGP 'WDQGC

F

(CVKOKFGP (F#DGPJGKO (F#DWMKT (F#ITKPKQP (F#U[WV (F#WTKQN (F$C[GTP (F$QMGN (F$TCWYGKNGT (F%CT[UVWU (F%GPVWT (F%JCNHQPV (F%QTEGNNGURT½U2C[GTPG (F&KUKDQFGPDGTIGT (F&QTVOWPF (F&WTC (F'NNOGPFKPIGP (F)CNLÑD (F)QVJC (F)TÒPUVCFV (F*GTUDTWEM (F+CUK (F+UVTWU


(F-ÌNP (F.KEJVGPDGTI (F.WFYKU\E\G (F/GPFG -CNCPFTC  (F/KPVWTQ (F0QTFJCWUGP (F3WPFW\ (F4CPFC\\Q (F5KUCM (F5VTCWDKPI (F6C[CE (F6KVGNDGTI (F9QTOU (GUVUEJTKHVGP (NCPFGTP (NQTGP\ (TCPMHWTV (TCPMTGKEJ  (TCPMTGKEJ/QPCEQ (TGKOCWTGT (TGKUKPI (TKDQWTI (ÒTUVGPDGTI (WIIGT (WNFC

G

)CNCVKC )GNC )GOOGP  )GPGCNQIKG )GUEJKEJVG#NNIGOGKP)GOOGPWPF-COGGP  )GYKEJVG )TKGEJGP )TQ­DTKVCPPKGP )TQ­DTKVCPPKGP+TNCPF

H

*CDUDWTI  *CDUDWTIKUEJG'TNCPFG7PICTP$ÌJOGP *CNDGTUVCFV *CODWTI *COGNP *CPCW *CPPQXGT *CWUIGPQUUGP *GTCNFKM *GUUGP *KNFGUJGKO *KOGTC *ÌEJUV *QJGPNQJG *QJGP\QNNGTP *QJPUVGKP *QNUVGKP *Q[C *WUUKVGP

I

+NN[TKGP +PFKGP +PFQ5E[VJGP +QPKGP +TCP +UP[ +VCNKGP 

J

,GXGT ,ÒNKEJ

K

-CD[NG -COCTKPC -COGGP -CORCPKGP -CRRCFQMKGP -CTKGP -CTQNKPIGT -CTVJCIQ -CWHDGWTGP -CWNQPKC -GC -GNVGP -GORVGP -KNKMKGP -KTEJGPUVCCV -NGKPCUKGP -NGXG -PKFQU -ÌNP  -QNQRJQP -QOOCIGPG -QPUVCP\ -QPVQTPKCVGP -QTGC -QTKPVJ -TQVQP -WRTNNK -WUJCP -[\KMQU

L

.CJP .CMGFCKOQPKGP .CORUCMQU .CPFCW .CPIQDCTFGP .CWGPDWTI .GKPKPIGP .GUDQU .KGEJVGPUVGKP .K½IG .KODWTI .KPFCW .QVJTKPIGP .QVJTKPIGT .WECPKC .ÒDGEM .ÒEJQY

141


.WMCPKC .WZGODWTI .W\GTP .[MCQPKGP .[MKGP .[QP

M

/CIFGDWTI /CIPGUKC /CKP\ /CMGFQPKGP /CNVC /COGTVKOG /CPUHGNF /CPVWC /CTQPGKC /GEMNGPDWTI /GFCKNNGP    /GFCKNNGP2NCMGVVGP /GFCKNNGWTG$ÌTUEJ# /GFCKNNGWTG%GNNKPK$ /GFCKNNGWTG&CFNGT5 /GFCKNNGWTG&ÒTGT# /GFCKNNGWTG)QGV\- /GFCKNNGWTG.GQPK. /GFCKNNGWTG.GQPK2 /GFCKNNGWTG5EJGIC(# /GFCKNNGWTG5VCORHGT, /GFGDCEJ /GFKEKPCKP0WOOKU /GICTKU /GK­GP /GTQYKPIGT /GUCODTKC /GUUCODTKC /GVCRQPV /GZKMQ /KPFGP /KVVGNCNVGT     /QGTU /QGUKGP /QPVRGNNKGT /ÒJNKPIGP /ÒPEJGP /ÒPUVGT /[NCUC /[VKNGPG

N

0CUUCW 0CZQU 0GRCN 0GWGPDWTI 0GWUU 0GW\GKV#NNIGOGKP 142

0KGFGTNCPFG  0KGFGTUCEJUGP  0KMQRQNKU 0QTFJCWUGP 0QTVJGKO 0QVOÒP\GP 0ÒTPDGTI 0[ORJCKQP

O

¤VVKPIGP 1NDKC 1NFGPDWTI 1TFGP 1TFGPWPF'JTGP\GKEJGP 1TKGPV+UNCOªDGTUGG 1UOCPGP 1UPCDTÒEM 1UVIQVGP 1UVTQIQVGP

P

2CN·UVKPC 2CNO[TC 2CPVKMCR·WO 2CRKGTIGNF 2CTVJGT 2CWVCNKC 2GNGRQPPGU 2GTIG 2GTUKGP 2HCN\ 2JCPCIQTKC 2JÌPK\KGP 2JQMCKC 2JT[IKGP 2KUKFKGP 2QNGP  2QNGP4WUUNCPF$CNVKMWO 2QOOGTP 2QTVWICN 2QTVWICN5RCPKGP 2TGWUUGP 2TKOKVKXIGNF 2VQNGO·GT

Q

3WGFNKPDWTI

R

4CUWNKFGP 4CXGPUDGTI 4GEJGPRHGPPKI 4GHQTOCVKQP  4GIGPUDWTI 4GKEJUOÒP\GP 4GPCKUUCPEG 


  4GWUU 4JGIKQP 4JGKPNCPF 4ÌOGT 4QUVQEM 4WUUNCPF 

S

5CEJUGP  5CNO 5CN\DWTI 5COCTKPC 5COQU 5CTFKU 5CUUCPKFGP 5CXQKC 5C[P 5EJCHHJCWUGP 5EJNGUKGP  5EJQVVNCPF 5EJÒV\GP 5EJY·DKUEJ*CNN 5EJYCT\DWTI 5EJYCT\GPDGTI 5EJYGFGP  5EJYGK\   5EJYGK\.KGEJVGPUVGKP 5EJY[\ 5GDCUVQRQN 5GNFUEJWMGP 5GNGWMKFGP 5GNKPWPV 5GTFKEC 5KCO 5KFG 5KGDGPDÒTIGP 5KGI 5KIKNNQITCRJKG  5KPFGT 5K\KNKGP  5MCPFKPCXKGP 5QNOU 5RCPKGP 5RG[GT 5V)CNNGP 5VCFG 5VGVVKP 5VQDK 5VQNDGTI 5VTCNUWPF 5[TCMWU 5[TKGP

T

6CTGPV 6GTKPC 6GUUKP 6JCUQU 6JGQFQUKC 6JGUUCNKGP 6JTCMKGP 6JÒTKPIGP 6QUMCPC 6TCRG\WPV 6TKGT 6TKGUV 6TQCU

U

7NO 75#

V

8GNKC 8GPGFKI

W

9CCIGP 9CNFGEM 9CNNGPUVGKP 9CNNHCJTV 9CPFCNGP 9GPFKUEJG/ÒP\XGTGKP 9GTVJGKO 9GUVHCNGP   9GUVIQVGP 9KGF 9KUKIQVJGP 9KUOCT 9ÒTVVGODGTI 9ÒT\DWTI

Z

<GKVUEJTKHVGPWPF4GKJGP <ÒTKEJ <WI <[RGTP

143


ABKÜRZUNGEN #DD #%0#% #+02 #,0 #/7)5 #06+37+6#5 $#4 DGCTD DGIT $NN $0, '. (/4& JTUI *TUI /$0) //#) /+4 0% 00’ 00/ 0TP 05 05V 0< Q, Q1 ¤#&9 1TKI 2JKNJKUV-N 4$0 40 405 5 5%$+ 5& 5. 5NI 504 5R 6H 6HP 8QN <H0

144

#DDKNFWPIGP #PEKGPV%QKPUKP0QTVJ#OGTKECP%QNNGEVKQPU#OGTKECP0WOKUOCVKE5QEKGV[0GY;QTM #UUQEKCVKQP+PVGTPCVKQPCNGFGU0WOKUOCVGU2TQHGUUKQPPGNU #OGTKECP,QWTPCNQH0WOKUOCVKEU #PVKMG/ÒP\GPWPFIGUEJPKVVGPG5VGKPG&GWVUEJGU#TEJ·QNQIKUEJGU+PUVKVWV$GTNKP #DJCPFNWPIGP\WT8QTWPF(TÒJIGUEJKEJVG\WTMNCUUKUEJGPWPFRTQXKP\KCNTÌOKUEJGP #TEJ·QNQIKGWPF\WT)GUEJKEJVGFGU#NVGTVWOU $TKVKUJ#TEJCGQNQIKECN4GRQTVU1ZHQTF DGCTDGKVGV DGITÒPFGV $N·VVGT 6JG$TKVKUEJ0WOKUOCVKE,QWTPCN 'TIGDPKUNKUVG (WPFOÒP\GPFGTTÌOKUEJGP<GKVKP&GWVUEJNCPF JGTCWUIGIGDGP *GTCWUIGDGT /KVVGKNWPIGPFGT$C[GTKUEJGP0WOKUOCVKUEJGP)GUGNNUEJCHV /ÒP\GPWPF/GFCKNNGP#)$CUGN /QPGVC+ORGTKK4QOCPK¤UVGTTGKEJKUEJG#MCFGOKGFGT9KUUGPUEJCHVGP9KGP 0WOKUOCVKE%JTQPKENG 0QTFKUM0WOKUOCVKUM’TUUMTKHV 0WOKUOCVKE0QVGUCPF/QPQITCRJU #05 0WOOGTP 0WOKUOCVKE5VWFKGU #05 0WOKUOCVKUEJG5VWFKGP/WUGWOHÒT*CODWTIKUEJG)GUEJKEJVG#DV/ÒP\MCDKPGVV 0WOKUOCVKUEJG<GKVUEJTKHV QJPG,CJT QJPG1TV ¤UVGTTGKEJKUEJG#MCFGOKGFGT9KUUGPUEJCHVGP 1TKIKPCN 2JKNQUQRJKUEJJKUVQTKUEJG-NCUUG 4GXWG$GNIGFG0WOKUOCVKSWGGVFG5KIKNNQITCRJKG 4GXWG0WOKUOCVKSWG 4Q[CN0WOKUOCVKE5QEKGV[.QPFQP 5GKVGP 5[NNQIGQH%QKPUQHVJG$TKVKUJ+UNGU 5QPFGTFTWEM 5EJ·V\NKUVG 5COONWPI 5EJYGK\GTKUEJG0WOKUOCVKUEJG4WPFUEJCW 5RCNVG 6CHGN 6CHGNP 8QNWOG <GKVUEJTKHVHÒT0WOKUOCVKM


BIBLIOGRAPHISCHE ANGABEN BIBLIOGRAPHIC TERMS EXPRESSIONS BIBLIOGRAPHIQUES &'765%* #DIGUEJPKVVGP #DURCPP #PUVTGKEJWPIGP #WUIGDNKEJGP #WUUEJPKVV $GTKGDGP $GUEJ·FKIV $GUEJOWV\V $GUEJPKVVGP $GUVQ­GP $NGKUVKHVPQVK\ $TQUEJWT $ÒPFGP &GEMGN &GEMGNRT·IWPI 'EMGP 'KPDCPF 'KPIGDWPFGP 'KPIGTKUUGP 'KPJGKVNKEJ 'KPTKUU 'PIG$KPFWPI 'TJCNVWPI 'VYCU (CNVMCTVG (CN\ (CNVOCRRG (NGEMKI (TQPVKURK\ )CP\IQNFUEJPKVV )CP\ITÒPUEJPKVV )CP\NGFGT )CP\NGKPGP )CP\RGTICOGPV )CP\TQVUEJPKVV IGDTCWEJV )GDT·WPV )GDWPFGP )GJGHGV )GNQEMGTV )GYGNNV )QNFXGT\KGTWPI *CNDNGFGT *CNDNGKPGP *CNDRGTICOGPV *GTXQTTCIGPF +PGKPGO$CPFIGDWPFGP +PJCNV -CTVQPGKPDCPF -CTVQPKGTV -NGDGUVTGKHGP -WPUVNGFGT -WRHGTVCHGNP .CIGP .GKEJV .ÌEJGT .QUG /KPKOCN

'0).+5* EWV NCUVRCIGU OCTMUCPFPQVGU DNGCEJGF EWV YQTP FCOCIGF FKTV[ VTKOOGF YQTP RGPEKNPQVGU RCRGTDCEM DQWPF EQXGT EQXGTGODQUUOGPV GFIGU DKPFKPI DQWPF VQTP WPKHQTO VGCT VKIJVDKPFKPI RTGUGTXCVKQP UNKIJVN[ HQNFKPIOCR HQNF HQNFGT UVCKPGF HTQPVKURKGEG IKNVGFIG ITGGPGFIG NGCVJGTDQWPF ENQVJDQWPF XGNNWO TGFGFIG UGEQPFJCPF DTQYPGF DQWPF UGYP NQQUG EQTTWICVGF IKNVFGEQTCVKQP JCNHNGCVJGT JCNHENQVJ JCNHXGNNWO URNGPFKF DQWPFKPCUKPINGXQNWOG EQPVGPV U ECTFEQXGT RCRGTDCEM CFJGUKXGUVTKR U[PVJGVKENGCVJGT EQRRGTRNCVGU UK\GHQTOCV UNKIJVN[ RGTHQTCVKQP NQQUG OKPKOCN

(4#0%#+5 F¾EQWR¾ FGTPK½TGURCIGU OCTSWGUGVCPPQVCVKQPU DNCPEJK F¾EQWR¾ WU¾ CDKO¾ UCNG F¾EQWR¾ WU¾ PQVGUCWETC[QP DTQEJ¾ TGNK¾ EQWXGTVWTG RNCVUQTP¾U VTCPEJGU TGNKWTG TGNK¾ F¾EJKT¾ WPKHQTOG F¾EJKTWTG TGNKWTG¾VTQKVG EQPUGTXCVKQP N¾I½TGOGPV ECTVGF¾RNKCPVG RNKWTG GODQÄVCIG VCEJ¾ HTQPVKURKEG VTCPEJGFQT¾G VTCPEJGXGTVG TGNK¾EWKT TGNK¾VQKNG X¾NKPRCTEJGOKP VTCPEJGTQWIG F QEECUKQP TQWUUGWTU TGNK¾ EQWUW F¾HCKV QPFWN¾IQPFQN¾ FQTWTG FGOKEWKT FGOKVQKNG FGOKX¾NKP GZEGRVKQPPGN TGNK¾GPWPXQNWOG EQPVGPW ECTVQPP¾ ECTVQPP¾ CFJ¾UKH UKOKNKEWKT ITCXWTGUUWTEWKXTG HQTOCV N¾I½TGOGPV RGTHQTCVKQP F¾VCEJ¾ KPHKOG 145


/QFGTP /QPVKGTV 0CEJFTWEM 1TKI 2CRKGTGVYCUIGDT¡WPV 2CRKGTGVYCUYGNNKI 2CRRDCPF 2GTICOGPV 2TCEJVXQNNG 4GRCTKGTV 4GUVCWTKGTV 4Ă&#x2019;EMGP 5GKVGP 5QPFGTFTWEM 5& 5RQTCFKUEJ 5VQEMHNGEMKI 6CFGNNQU 6CHGNP 6GKNYGKUG 6GZV 6KVGNDNCVV 7OUEJNCI 7PCWHIGUEJPKVVGP 7PVGTUEJKGFNKEJ 8QTUCV\ 8QTURCPP 9CUUGTTCPF 9CUUGTUEJCFGP 9WTOHTC­ <WUVCPF

OQFGTP OQWPVGF TGRTKPV QTKIKPCN RCRGTUNKIJVN[DTQYPGF RCRGTUNKIJVN[ETGCUGF RCRGTDCEM XGNNWO UWRGTD TGRCKTGF TGUVQTGF URKPG RCIGU QHHRTKPVTGRTKPV URQTCFKE URQVVGF HNCYNGUU RNCVGU RCTVN[ VGZV VKVNGRCIG LCEMGV WPEWV FKHHGTGPV JGCFGT HKTUVRCIGU YCVGTURQVVKPI YCVGTFCOCIG YQTOJQNGU EQPFKVKQP

OQFGTPG OQPVž TžKORTGUUKQP žFKVKQPQTKIKPCNG RCRKGTNžI½TGOGPVTQWUUK RCRKGTNžI½TGOGPVRNKž DTQEJž XžNKP UWRGTDG TžRCTž TGUVCWTž FQU RCIGU TžKORTGUUKQP SWGNSWGU TQWUUGWTU GPRCTHCKVžVCV RNCPEJGU RCTVKGNNGOGPV VGZVG RCIGFGVKVTG EQWXGTVWTG PQPFžEQWRž FKHHžTGPV GPV¿VG RTGOK½TGURCIGU OQWKNNWTGU CžVžOQWKNNž VTQWUFGXGTU žVCV

BUCHGRĂ&#x2013;SSEN GroĂ&#x;folio Folio 4° (Quart) Gr. 8° (GroĂ&#x;oktav) 8° (Oktav) Kl. 8° (Kleinoktav) 16° (Sedez)

(Buchrßckenlänge) >45 cm 35-45 cm 25-35 cm 22,5-25 cm 18,5-22,5 cm 15-18,5 cm 10-15 cm

REFERENZWERKE A169 Dekesel Dekesel Leitzmann Lipsius

MMAG

146

KĂźnker, F.R., OsnabrĂźck, Auktion 169 vom 21.6.2010. Numismatische Bibliotheken Hanfried Bendig, Bremen und Bernard Poindesault, Paris Dekesel, C.E.: Bibliotheca Nummaria. Bibliography of 16th Century Numismatic Books. London 1997. Dekesel, C.E.: Bibliotheca Nummaria. Bibliography of 17th Century Numismatic Books. 3 Bände London 2003. Vgl. Lipsius. Lipsius J.G.: A Bibliography of Numismatic Books printed before 1800 with Supplement to 1866 by J. Leitzmann. Colchester 1977, unveränderter Nachdruck der Originalausgabe Leipzig 1801 und WeiĂ&#x;ensee 1867 KĂźnker, F.R., OsnabrĂźck, Auktion 102 vom 23.6.2005. Die Numismatische Bibliothek der MĂźnzen und Medaillen AG Basel.


Bernd Kluge Die Münzen König Friedrichs II. von Preußen (1740 –1786) Auf Grundlage der Werke Friedrich Freiherr von Schrötters neu bearbeitet. Unter Mitarbeit von Elke Bannicke und Renate Vogel

Berliner Numismatische Forschungen. Neue Folge Band 10 Gebr. Mann Verlag · Berlin 2012 Gebunden, 21 × 29,7 cm, 416 Seiten, € 49,00 ISBN 978-3-7861-2667-6

Das Buch verbindet den Bestandskatalog des Berliner Münzkabinetts (3.597 Münzen) mit einer Gesamtkatalogisierung der Münzen Friedrichs des Großen und einer Darstellung der Münzgeschichte. Im Katalog sind alle Typen, Varianten und Jahrgänge beschrieben und über 1.500 Münzen abgebildet. Münzkommentare bieten Hintergründe und Prägezahlen zu den einzelnen Emissionen, in Tabellen sind Münzsorten, Münzfüße und Prägemengen zusammengefasst. Die münzgeschichtliche Darstellung zeichnet auf der Grundlage der Werke des verdienten Erforschers der preußischen Münzgeschichte Friedrich Freiherr von Schrötter (1862–1944) die wesentlichen Entwicklungen nach und bietet eine Neubewertung der Münzpolitik Friedrichs des Großen. Ein Dokumentenanhang fasst die dafür wichtigsten archivalischen Quellen zusammen. Als Separatum liegt dem Buch eine aktuelle Bewertungsliste der Münzen Friedrichs des Großen auf der Grundlage der Preisentwicklung der letzten fünfzig Jahre bei. Bestellungen an Fritz Rudolf Künker GmbH & Co. KG, Gutenbergstrasse 23, D-49076 Osnabrück Tel 0541 / 96 20 20 service@kuenker.de

Fax 0541 / 96 20 222


Versteigerungsbedingungen der eLive Auction § 1 Geltungsbereich Unsere nachfolgenden Allgemeinen Geschäftsbedingungen für die eLive Auctions gelten für sämtliche Rechtsgeschäfte zwischen der Fritz Rudolf Künker GmbH & Co. KG (Auktionator) und dem Kunden im Rahmen der Teilnahme an den eLive Auctions. Evtl. von unseren Geschäftsbedingungen abweichenden Einkaufsbedingungen des Bestellers wird hiermit ausdrücklich widersprochen; dieser Widerspruch gilt auch für den Fall, dass der Besteller für den Widerspruch eine besondere Form vorgeschrieben hat. Ist ein Widerspruch ausgeschlossen, so treten anstelle widersprechender Bedingungen die gesetzlichen Bestimmungen. Eine Anerkennung abweichender Einkaufsbedingungen tritt nur dann ein, wenn ihre Anwendung von uns schriftlich bestätigt worden ist. § 2 Vertragsschluss Bei den eLive Auctions (Versteigerung) handelt es sich um öffentliche Versteigerungen der Auktionatoren Fritz Rudolf Künker, Oliver Köpp, Arne Kirsch und Dr. Andreas Kaiser der Fritz Rudolf Künker GmbH & Co. KG i. S. d. § 156 BGB. Die Versteigerung erfolgt im Auftrag und für Rechnung der Eigentümer unter Einhaltung der sich aus der Versteigerungsordnung (BGBl I 1976, 1346) ergebenden und für Kommissionäre geltenden gesetzlichen Bestimmungen des BGB und HGB gegen Zahlung des Kaufpreises in Euro-Währung. Durch Abgabe eines Gebotes werden die Versteigerungsbedingungen anerkannt, dies gilt auch für die schriftlichen Gebote. Jedes Gebot des Kunden im Rahmen der eLive Auctions stellt ein verbindliches Angebot zum Abschluss eines Kaufvertrages dar. Dieses ist solange wirksam bis ein höheres Gebot (Übergebot) abgegeben oder die eLive Auction ohne Erteilung eines Zuschlages geschlossen wird. Ein Vertrag kommt erst durch Zuschlag des Auktionators zustande. Der Zuschlag erfolgt nach dreimaliger Hervorhebung des höchsten Gebotes und verpflichtet zur Abnahme und Zahlung. Der Versteigerer ist berechtigt, Nummern zu vereinigen oder zu trennen. Eine Vorausnahme von Nummern erfolgt nicht. Die Teilnahme an der Versteigerung ist nur Kunden gestattet, die sich zuvor bei den eLive Auctions registriert haben. Sowohl mit der Registrierung für unsere eLive Auctions als auch mit Abgabe des Gebotes akzeptieren Sie unsere Allgemeinen Bedingungen für die eLive Auctions. § 3 Gebotsschritte Die Mindeststeigerungsstufen für das Bietungsverfahren betragen: Höhe der Gebote bis zu € 50,– bis zu € 200,– bis zu € 500,– bis zu € 1.000,– bis zu € 2.000,– bis zu € 5.000,– bis zu € 10.000,– bis zu € 20.000,– bis zu € 50.000,– ab € 50.000,–

Mindeststeigerungsstufe € 2,– € 5,– € 10,– € 25,– € 50,– € 100,– € 250,– € 500,– € 1.000,– € 2.500,–

Bei mehreren gleichhohen Geboten erhält das zuerst eingegangene den Zuschlag. § 4 Katalog, Besichtigung Die Beschreibung im Katalog ist gewissenhaft durchgeführt. Sie begründet jedoch keine Rechts- oder Sachmängelhaftung gemäß §§ 434, 459 ff BGB. Die Angabe der Erhaltung ist streng nach den im deutschen Münzhandel

üblichen Erhaltungseinstufungen vorgenommen und gilt als persönliche Beurteilung. Der Auktionskatalog kann als PDF-Datei heruntergeladen werden. Gegen Kostenerstattung i. H. v. 10,– € versenden wir auch einen Ausdruck des Kataloges. § 5 Versandkosten Nach Zuschlagserteilung und Erteilung der Rechnung ist die Zahlung innerhalb von 14 Tagen auf eines unserer nachstehenden Konten zu leisten. Wir tragen einen Großteil der Kosten für die sorgfältige Verpackung und die zuverlässige Zustellung der Ware. Die Versandkosten werden Ihnen gem. nachfolgender Aufstellung in Rechnung gestellt: Versand innerhalb der BRD: € 5,90 pro Paket, ab € 1.000,– Bestellwert versandkostenfrei Versand innerhalb der EU (inkl. Schweiz und Norwegen): € 9,90 pro Paket, ab € 2.500,– Bestellwert versandkostenfrei Versand nach Übersee: € 14,90 pro Paket, ab € 5.000,– Bestellwert versandkostenfrei § 6 Zahlung Alle Gebote und Zuschläge verstehen sich in Euro exklusive der geltenden Mehrwertsteuer und dem Aufgeld. Neben dem Zuschlagsbetrag hat der Kunde ein Aufgeld in Höhe von 10 % des Zuschlaggebotes an den Auktionator zu zahlen. Ferner hat der Kunde die derzeit gültige Mehrwertsteuer auf das Zuschlagsgebot und auf das Aufgeld zu zahlen. Etwaig weitere anfallende Steuern sowie Einfuhr- und Ausfuhrsteuern sind von dem Kunden zu zahlen. Ggf. hat sich der Kunde hierüber zuvor selbst zu informieren oder mit uns Kontakt aufzunehmen. Ausländischen Münzhändlern aus Ländern der europäischen Gemeinschaft wird bei Nachweis der Umsatzsteuer-Identifi kationsnummer (§ 27a UStG) und der sonstigen Voraussetzungen gemäß § 4 Nr. 1b UStG in Verbindung mit § 6a UStG die Lieferung ohne Umsatzsteuer berechnet. Anderen ausländischen Käufern (aus Drittländern) wird, sofern die Münzen durch uns exportiert werden, ein Aufgeld von 10 % netto auf den Zuschlagpreis berechnet; sie erhalten die Lieferung nur gegen Zahlung des Kaufpreises in Euro-Währung, bankspesenfrei. Nach Zuschlagerteilung und Zustandekommens des Vertrages ist die Zahlung innerhalb von 14 Tagen auf eines unserer nachstehenden Konten zu leisten. Wir akzeptieren Kreditkartenzahlungen mit VISA und MasterCard und informieren Sie gerne über die entsprechenden Servicegebühren. Hinsichtlich der Zahlung mit diesen Kreditkarten möchten wir Sie bitten, zuvor Kontakt mit uns aufzunehmen. § 7 Lieferung, Lieferfrist Die Lieferung bei den eLive Auctions erfolgt nur gegen Vorauskasse. Ihnen wird nach Erteilung des Zuschlages eine Rechnung übersandt, die Sie innerhalb von 14 Tagen an uns zu zahlen haben. Nach Zahlungseingang werden wir die Ware innerhalb von 14 Tagen an Sie übersenden. Ist der Kunde Unternehmer, so geht die Gefahr des zufälligen Untergangs sowie der zufälligen Verschlechterung der Ware mit der Übergabe, beim Versendungskauf mit der Auslieferung der Sache an den Spediteur, den Frachtführer oder die sonst zur Ausführung der Versendung bestimmte Person oder Anstalt auf den Kunden über. Ist der Käufer Verbraucher, so geht die Gefahr des zufälligen Untergangs und der zufälligen Verschlechterung der verkauften Sache beim Versendungskauf erst mit der Übergabe der Sache auf den Käufer über. Der Übergabe steht es gleich, wenn der Verbraucher in Verzug mit der Annahme der verkauften Sache ist. Die von uns zu tragende Versandgefahr ist durch den Abschluss ausreichender Versicherungen abgedeckt.

TEL +49 (0)541 96 20 20, FAX +49 (0)541 96 20 222, SERVICE@KUENKER.DE, WWW.KUENKER.DE


§ 8 Mängelhaftung Da durch Vorbesichtigung Gelegenheit gegeben ist, sich vom Erhaltungszustand des Versteigerungsgutes zu überzeugen, können nach erfolgtem Zuschlag Reklamationen nur bei irrtümlich übersehener Henkel- oder Fassungsspur oder gestopftem Loch berücksichtigt werden. Bei Losen mit mehreren Stücken sind die Stückzahlen nur Circa-Angaben, irrtümliche Zuschreibungen sind im Einzelfall nicht ausgeschlossen. Diese Lose sind nach erfolgtem Zuschlag von jeder Reklamation ausgeschlossen. Der Versteigerer kann bei eventuellen Meinungsverschiedenheiten bzw. Beanstandungen einen vereidigten Sachverständigen seiner Wahl (die Kosten trägt der unterliegende Teil) beauftragen. Eventuelle Beanstandungen können nur innerhalb von 8 Tagen nach der Auktion bzw. nach Erhalt der ersteigerten Stücke berücksichtigt werden. Die Echtheit der Stücke wird bis zur Höhe des Kaufpreises garantiert. Die beigedruckten Preise sind Schätzpreise, die unter- oder überschritten werden können. Sollten gelieferte Artikel offensichtliche Mängel aufweisen, wozu auch Transportschäden zählen, so ist der Kunde verpflichtet, solche Mängel unverzüglich zu reklamieren. Das Versäumnis dieser Rüge hat allerdings für die gesetzlichen Ansprüche von Verbrauchern keine Konsequenzen. Der Kundendienst ist schriftlich sowie telefonisch und per E-Mail zu den üblichen Geschäftszeiten zu erreichen. § 9 Datenschutz Alle personenbezogenen Daten werden grundsätzlich vertraulich behandelt und nicht an Dritte weitergegeben. § 10 Haftungsbeschränkung In allen Fällen, in denen aufgrund vertraglicher oder gesetzlicher Anspruchsgrundlagen der Auktionator und/oder der Einlieferer zum Scha-

dens- oder Aufwendungsersatz verpflichtet ist, haften diese nur, soweit ihnen Vorsatz, grobe Fahrlässigkeit oder eine Verletzung von Leben, Körper oder Gesundheit zur Last fällt. Unberührt bleibt die verschuldensunabhängige Haftung nach dem Produkthaftungsgesetz. Unberührt bleibt auch die Haftung für die schuldhafte Verletzung wesentlicher Vertragspflichten; die Haftung ist insoweit jedoch außer in den Fällen der Sätze 1 und 2 auf den vorhersehbaren, vertragstypischen Schaden beschränkt. Eine Änderung der Beweislast zum Nachteil des Kunden ist mit den vorstehenden Regelungen nicht verbunden. § 11 Anzuwendendes Recht, Gerichtsstand Erfüllungsort ist Osnabrück. Es gilt Deutsches Recht unter Ausschluss des UN-Kaufrechtes. Ist der Kunde Kaufmann, juristische Person des öffentlichen Rechts oder öffentlichen-rechtlichen Sondervermögens, ist ausschließlicher Gerichtsstand für alle Streitigkeiten aus diesem Vertrag der Geschäftssitz der Fritz Rudolf Künker GmbH & Co. KG, Osnabrück. Dasselbe gilt, wenn der Kunde keinen allgemeinen Gerichtsstand in der Bundesrepublik Deutschland hat oder der Wohnsitz oder gewöhnliche Aufenthalt im Zeitpunkt der Klageerhebung nicht bekannt ist. Sollten einzelne Bestimmungen des Vertrages mit dem Kunden einschließlich dieser AGB ganz oder teilweise unwirksam sein oder werden, so wird hierdurch die Wirksamkeit der übrigen Bestimmungen nicht berührt. Die ganz oder teilweise unwirksame Regelung soll durch eine Regelung ersetzt werden, deren wirtschaftlicher Erfolg dem der unwirksamen Regelung möglichst nahe kommt. Im Falle einer Regelungslücke werden die Parteien eine Regelung treffen, die dem nach dem gesamten Vertragsinhalt erkennbaren Parteiwillen zur Durchsetzung verhilft.

Terms and Conditions of eLive Auction § 1 Scope Our below eLive Auctions General Terms and Conditions apply to all legal transactions between Fritz Rudolf Künker GmbH & Co. KG (auctioneer) and the customer in the course of participation in the eLive Auction. We expressly do not recognize any purchasing conditions that deviate from our General Terms and Conditions; this non-recognition also applies to cases where the buyer has stipulated a particular formality for non-recognition. If non-recognition is excluded, legal regulations shall take the place of deviating conditions. Deviating purchasing conditions shall only be recognized if we confirm in writing that they are to be applied.

An auction sale occurs when the highest bid has been called out three times and obliges the bidder to take over and pay for the merchandise. The auctioneer is entitled to combine or separate lot numbers. Lot numbers will not be called up out of sequence. Participation in the auction is only permitted to customers who have previously registered at eLive Auctions. Both registration for our eLive Auction and submission of a bid constitute acceptance of our General Terms and Conditions for the eLive Auction.

§ 2 Conclusion of Contract eLive Auction (auction) involves public auctions staged by auctioneers Fritz Rudolf Künker, Oliver Köpp, Arne Kirsch and Dr. Andreas Kaiser of Fritz Rudolf Künker GmbH & Co. KG as defined in § 156 German Civil Code (BGB). The auction is conducted on the basis of payment of the purchase price in Euro currency and is staged on behalf of and on the account of the proprietors, in compliance with prevailing legal provisions arising from the German Auction Act (Federal Law Gazette (BGBl) Vol. I, 1976, 1346) and legal provisions of the German Civil Code (BGB) and Commercial Code (HGB) applicable to commercial agents. By submitting a bid, you agree to the auction terms and conditions; this also applies to written bids. Each bid by the customer as part of the eLive Auctions constitutes a legallybinding offer to conclude a purchasing contract. This is in force until a higher bid (overbid) is submitted or the eLive Auction is concluded with the item left unsold. A contract is concluded only when the auctioneer accepts the winning bid.

Amount of the bids

Minimum increment

up to

€ 50.–

€ 2.–

up to

€ 200.–

€ 5.–

up to

€ 500.–

€ 10.–

up to

€ 1,000.–

€ 25.–

up to

€ 2,000.–

€ 50.–

up to

€ 5,000.–

€ 100.–

up to

€ 10,000.–

€ 250.–

up to

€ 20,000.–

€ 500.–

up to

€ 50,000.–

€ 1,000.–

from

€ 50,000.–

€ 2,500.–

§ 3 Bid Increments The minimum bid increments for the bidding procedure are:

When several identical bids are received, the bid received first is the winning bid.

TEL +49 (0)541 96 20 20, FAX +49 (0)541 96 20 222, SERVICE@KUENKER.DE, WWW.KUENKER.DE


§ 4 Catalogue, Preview The description of items in the catalogue is diligently prepared. However, it does not meet the threshold of legal liability or liability for material defects pursuant to §§ 434, 459 pp. of the German Civil Code (BGB). The stated condition of preservation is determined strictly according to the categories of preservation customary in German coin trading and is considered a personal evaluation. The auction catalogue can be downloaded as a pdf file. For a fee of € 10.– to defray expenses, we will gladly send out a print-out of the catalogue. § 5 Cost of Shipping Upon acceptance of the winning bid and issuance of an invoice, payment is to be made to one of our below bank accounts within 14 days. We assume a majority of the costs involved in carefully packing and reliably dispatching the merchandise. We charge you for shipping costs according to the following schedule: Shipping within Germany: € 5.90 per parcel, free shipping for order value above € 1,000.– Shipping within the EU (incl. Switzerland and Norway): € 9.90 per parcel, free shipping for order value above € 2,500.– Overseas shipping: € 14.90 per parcel, free shipping for order value above € 5,000.– § 6 Payment All bids and hammer prices are in Euros, subject to prevailing value-added tax and buyer’s premium. On top of the hammer price, the customer is to pay the auctioneer a buyer’s premium in the amount of 10 % of the hammer price. In addition, the customer is to pay the prevailing rate of value-added tax on the amount of the hammer price and on the buyer’s premium. Any other taxes, along with import and export taxes, are to be paid by the customer. Wherever applicable, the customer is to inquire about this beforehand or contact us. For buyers from countries within the European Union who are able to produce proof of a VAT identification number (§ 27a Value-Added Tax Act (UStG)) and other prerequisites according to § 4 1b Value-Added Tax Act (UStG) in connection with § 6 a of the UStG, goods will be shipped without VAT being charged. Other foreign buyers (from non-EU countries), assuming we are the exporter of the coins, are subject to a 10 % buyer’s premium charged on top of the hammer price; they only receive shipments after paying the purchase price in Euro currency, where bank charges are paid by the customer. Upon acceptance of the winning bid and the formation of the contract, payment is to be made to one of our below bank accounts within 14 days. We accept payment with credit cards such as VISA and MasterCard and will gladly inform you of any service fees involved. With regard to payment with these credit cards, we kindly ask that you contact us beforehand. § 7 Terms of Delivery and Delivery Period For eLive Auctions delivery is only made upon payment in advance. After your bid has been accepted, we will send you an invoice to be paid within 14 days. Upon receipt of payment, we will ship the merchandise to you within 14 days. If the customer is a business entity, the risk of incidental demise as well as incidental deterioration of the merchandise is transferred at the time the merchandise is handed over, in the case of shipped items, when the merchandise is handed over to the shipping agent, carrier or person or institution charged with expediting the shipment. If the buyer is a consumer, for a mail-order purchase the risk of incidental demise or deterioration of the purchased item is only transferred when the merchandise is handed over to the buyer. The merchandise shall be consid-

ered handed over if the consumer is in default of accepting the purchased merchandise. The transport risk we assume is covered by sufficient insurance policies. § 8 Liability for Defects Because the preview provides an opportunity to be assured of the auction merchandise’s condition of preservation, once merchandise has been sold at the auction, claims can only be considered in cases where traces of hooks and mountings or a plugged hole were overlooked in error. In lots with several pieces, the number of pieces stated only represent approximations, and erroneous attributions cannot be ruled out in individual cases. After the sale has been made, these lots are excluded from any claim. In case of possible differences of opinion or complaints, the auctioneer may appoint an expert of his choice (the costs shall be borne by the party losing the dispute). Any disputes can only be considered within 8 days after the auction or after receipt of the auctioned items. The authenticity of the pieces is guaranteed up to the amount of the purchase price. The stated prices are estimated prices which may turn out to be lower or higher. Should the articles delivered prove to have obvious defects, whereby this also includes shipping damage, the customer is obliged to file a claim for such defects without delay. If you are a consumer, the failure to give notice of defect, however, shall not have any consequences on your legal rights. You can reach our Customer Service Department by mail, telephone, and e-mail during normal business hours. § 9 Data Protection All personal data will be kept strictly confidential and will not be made available to third parties. § 10 Liability Disclaimer In all cases where the auctioneer and/or the consignor are obliged on the basis of contractual or legal grounds to pay for damages or reimbursements, these parties are only liable to the extent that they have been proven to have acted willfully and with gross negligence or to have caused injury to life, limb, or health. This shall not affect liability regardless of negligence or fault according to the Product Liability Act. Nor shall it affect liability for gross breach of contract; to this degree, liability is limited to damages that are foreseeable and typical for this type of contract, except for the cases referred to in the first two sentences. The aforementioned provisions are not coupled with a change in the burden of proof to the disadvantage of the customer. § 11 Applicable Law, Venue The place of fulfillment is Osnabrück. German law shall apply at the exclusion of the United Nations Convention on Contracts for the International Sale of Goods. If the customer is an entrepreneur, a legal entity under public law or a special fund under public law, the exclusive venue for all disputes arising from this contract shall be the place of business of Fritz Rudolf Künker GmbH & Co. KG, Osnabrück. The same applies if the customer has no general legal venue in the Federal Republic of Germany or his domicile or normal place of abode is not known at the time a lawsuit is filed. Should any of the provisions of this contract with the customer, including these General Terms and Conditions, be determined unlawful in part or whole, this shall not invalidate the remaining provisions. The provision found to be unlawful in part or whole shall be replaced with a provision that most closely achieves the economic purpose of the unlawful provision. In case there is an unforeseen eventuality, the parties shall agree upon provisions that, on the basis of the entire body of the contract, shall help execute the contract according to the apparent will of both parties.

TEL +49 (0)541 96 20 20, FAX +49 (0)541 96 20 222, SERVICE@KUENKER.DE, WWW.KUENKER.DE


Impressum Numismatische Bearbeitung

Conrad-Agilolf Blaschke, Marie-Luise Kalker, Michael Lang

Fotos

Fritz Rudolf Künker GmbH & Co. KG

Layout

danner pc gesteuerte systeme, Waiblingen

Druck

Meister Print & Media GmbH, Kassel Jeglicher Nachdruck, auch auszugsweise, bedarf der Genehmigung des Auktionshauses

Zahlungen aus dem Inland Kontoinhaber

Fritz Rudolf Künker GmbH & Co. KG USt.-Id.-Nr. DE 256 270 181

Deutsche Bank Osnabrück

BLZ 265 700 90, Konto-Nummer 0 177 006

Commerzbank Osnabrück

BLZ 265 800 70, Konto-Nummer 780 520 200

Sparkasse Osnabrück

BLZ 265 501 05, Konto-Nummer 247 320

Volksbank eG Bad Laer-Borgloh-Hilter-Melle

BLZ 265 624 90, Konto-Nummer 1 200 222 400

Bankhaus Lampe KG, Bielefeld

BLZ 480 201 51, Konto-Nummer 174 076

Postbank Hannover

BLZ 250 100 30, Konto-Nummer 290 060 308

HypoVereinsbank München

BLZ 700 202 70, Konto-Nummer 2 417 952

WestLB Dortmund

BLZ 440 500 00, Konto-Nummer 1 128 842

PayPal

paypal@kuenker.de, Servicegebühr: 3,5 %

Zahlungen aus dem Ausland/Foreign Payments Account

Fritz Rudolf Künker GmbH & Co. KG USt.-Id.-Nr. DE 256 270 181

Deutsche Bank Osnabrück

IBAN: DE11 2657 0090 0017 7006 00 Swift-Code: DEUTDE3B265

Sparkasse Osnabrück

IBAN: DE50 2655 0105 0000 2473 20 Swift-Code: NOLADE22XXX

Postbank Hannover

IBAN: DE73 2501 0030 0290 0603 08 Swift-Code: PBNKDEFF

Credit Suisse Commerzbank Hong Kong Credit Cards PayPal

IBAN: CH43 0483 5177 3509 0200 0 Swift-Code: CRESCHZZ80A IBAN: 146102290400 HKD Swift-Code: COBAHKHXXXX We do accept VISA and MasterCard, service charge: 4,5 % paypal@kuenker.de, service charge: 3,5 %

Zahlungen innerhalb Russlands/Payments within Russia Deutsche Bank Moskau ООО «Дойче Банк»

ИНН 7728717332, КПП 772801001 Получатель: ЗАО «Кюнкер» Счет №: 40702810500000000825, БИК: 044525101 Корсчет №: 30101810100000000101

eLive Auction 12 by Künker  

Numismatische Literatur aus den Bibliotheken Egon Beckenbauer und Hauck & Aufhäuser Privatbankiers, München, u.a.