Issuu on Google+


Titelfoto (Nr. 9001) BADEN, MARKGRAFSCHAFT (BIS 1803), KURFÜRSTENTUM (1803-1806) UND GROSSHERZOGTUM (1806-1918) Großherzoglicher Hausorden der Treue. Juweliers-Anfertigung des Bruststerns von Biennais in Paris. 86,3 x 87,4 mm, 49,2 g, Silber.


AUKTION 215 Orden und Ehrenzeichen

ZEIT

Freitag, 22. Juni 2012 14.00 Uhr - 18.00 Uhr: Nr. 9001 - Nr. 9761

ORT

Steigenberger Hotel Remarque Osnabrück, Natruper-Tor-Wall 1

AUKTIONS-TELEFON

+49 (0)541 60 96 633

AUKTIONS-FAX

+49 (0)541 60 96 634

Auktionen 210-215, Juni 2012 18. JUNI 2012 18./19. JUNI 2012 19. JUNI 2012

Auktion 210 The Sultan Collection, Part 2 Auktion 211 Münzen und Medaillen aus Mittelalter und Neuzeit Auktion 212 Die Haussammlung der Fürsten zu Solms-Hohensolms-Lich

20./21. JUNI 2012

Auktion 213 Sammlung Vogel, Hamburg, Teil 2

21./22. JUNI 2012

Auktion 214 Geprägtes Gold aus Mittelalter und Neuzeit Russische Münzen und Medaillen

22. JUNI 2012

Auktion 215 Orden und Ehrenzeichen


Zeitplan/Timetable Auktion 210 The Sultan Collection Münzen des Ottomanischen Reiches, Teil 2

Montag, 18. Juni 2012 10.00 Uhr - 13.00 Uhr Nr. 909 bis Nr. 1582 Sulaymân II. ibn Ibrâhîm - Selîm III. 14.00 Uhr - 15.30 Uhr Nr. 1583 bis Nr. 1970 Mustafâ IV. - Mahmûd II.

Auktion 211 Münzen und Medaillen aus Mittelalter und Neuzeit

15.30 Uhr - 18.30 Uhr Nr. 2001 bis Nr. 2587

Europa, Übersee Dienstag, 19. Juni 2012 10.00 Uhr - 13.00 Uhr Nr. 2588 bis Nr. 3197 Habsburg, Deutschland: Anhalt - Jülich-Kleve-Berg 14.00 Uhr - 16.30 Uhr Nr. 3198 bis Nr. 3656 Deutschland: Kempten - Würzburg, Spezialsammlungen, Medaillen, Papiergeld, Münzenlots, Literatur

Auktion 212 Die Haussammlung der Fürsten zu Solms-Hohensolms-Lich

Auktion 213 Sammlung Vogel, Hamburg, Teil 2 Die Goldmünzen der deutschen Staaten ab 1800

16.30 Uhr - 18.30 Uhr Nr. 4001 bis Nr. 4328

Mittwoch, 20. Juni 2012 10.00 Uhr - 13.00 Uhr Nr. 4501 bis Nr. 4931 Deutsche Staaten: Anhalt - Hannover 14.00 Uhr - 17.30 Uhr Nr. 4932 bis Nr. 5357 Deutsche Staaten: Hessen - Wuppertal

Sammlung Vogel, Hamburg, Teil 2 Deutsche Münzen ab 1871 - mit einer kompletten Typensammlung Kaiserreich in Gold und Silber

Donnerstag, 21. Juni 2012 10.00 Uhr - 13.00 Uhr Nr. 5358 bis Nr. 6077 Deutsche Münzen ab 1871: Reichsgoldmünzen, Reichskleinmünzen, Reichssilbermünzen: Anhalt - Sachsen 14.00 Uhr - 15.00 Uhr Nr. 6078 bis Nr. 6359 Reichssilbermünzen: Sachsen-Altenburg - Württemberg, Weltkrieg und Inflation, Weimarer Republik, Drittes Reich, BRD, DDR, Kolonien, Notmünzen, Danzig, Litzmannstadt, Proben, Lots

Auktion 214 Geprägtes Gold aus Mittelalter und Neuzeit Russische Münzen und Medaillen

15.00 Uhr - 18.30 Uhr Nr. 7001 bis Nr. 7764

Freitag, 22. Juni 2012 10.00 Uhr - 13.00 Uhr Nr. 8001 bis Nr. 8368

Auktion 215 Orden und Ehrenzeichen 2

14.00 Uhr - 18.00 Uhr Nr. 9001 bis Nr. 9761


Sehr geehrte Münzfreunde/Dear Coin Collectors, Ich wünsche Ihnen viel Freude mit unseren neuen Auktionskatalogen und hoffe, Sie finden einige schöne Stücke für Ihre Sammlung. Als Europas führendes Auktionshaus für Münzen, Medaillen und Orden hat sich unser Dienstleistungsspektrum für Sie als unsere Kunden stetig verbessert und erweitert. Einen kleinen Überblick über unsere Angebote finden Sie hier. I wish you a lot of pleasure with our new auction catalogues and I hope you will find a few additonal items for your collection. As Europe´s leading auction company for coins, medals and decorations our range of services for our customers has been steadily improving and expanding. Following is a short overview of our offers. Mit herzlichen Grüßen/With warm regards

Friti z Ru Frit Fr Rudo dolflff K do Kün ünke ün ker ke ker

AUKTIONEN/AUCTIONS Besuchen Sie unsere international bedeutenden Auktionen, die Ihnen viermal jährlich zahlreiche Raritäten bieten. Profitieren Sie als Bieter oder Einlieferer von unserer Erfahrung und Kompetenz. Visit our internationally recognized auctions which take place four times a year and offer many rarities. Benefit from our experience and competence while being a bidder or consigner. GOLDHANDEL/GOLD COIN TRADING Wir bieten Ihnen ein ständiges Angebot sowie den Ankauf von Anlagemünzen aus Deutschland, Europa und aller Welt zu fairen tagesaktuellen Preisen. We are constantly offering as well as purchasing a vast range of German, European and World bullion coins. We buy and sell gold assets at a fair, daily updated market price. ONLINE-SHOP Wir bieten Ihnen in unserem Online-Shop auf www.kuenker.de ein täglich aktualisiertes Münz-Angebot von der Antike bis zur Neuzeit. Kaufen Sie hier unkompliziert zum Festpreis und ohne Risiko. We offer you an exclusive daily updated selection of coins from ancient to modern times. You can order at www.kuenker.com without hassle or risk. eLIVE AUCTION Mit unseren eLive Auctions können Sie über das Internet an regelmäßigen Auktionen mit einem virtuellen Auktionator teilnehmen. Sie können Vorgebote bequem online abgeben und abschließend die Auktion live am Bildschirm für sich entscheiden. With our eLive Auctions, we offer you an opportunity to participate in regular auctions live over the Internet. You can submit preliminary bids online, and up to the last moment of the sale you can win auctions live on your computer screen. ORDEN UND EHRENZEICHEN/ORDERS AND DECORATIONS Einmal im Jahr findet unsere besondere Ordensauktion statt, die sich ganz den dekorativen Ehrenzeichen widmet. Profitieren Sie als Bieter oder Einlieferer von unserer Erfahrung und Kompetenz im Bereich Phaleristik. Once a year there is a special auction dedicated to medals and decorations. Benefit from our experience in the field of phaleristik becoming our bidder or consigner.

TEL +49 (0)541 96 20 20, FAX +49 (0)541 96 20 222, SERVICE@KUENKER.DE, WWW.KUENKER.DE

3


Besichtigung/On View Die Besichtigung des Auktionsgutes kann nach vorheriger telefonischer Absprache erfolgen. Auction lots may be viewed by appointment only.

Online-Katalog/Online Catalogue

KUENKER.DE

Betrachten Sie unsere Auktionskataloge im Internet! Unter www.kuenker.de und www.sixbid.com haben Sie die Möglichkeit, Abbildungen zu vergrößern, Ihre Gebote direkt abzugeben und die Ergebnisse der Auktionen abzurufen. Please browse our auction catalogues at www.kuenker.com or at www.sixbid.com! You will have the possibility to zoom all images, to place your bids and to view all auction results online.

Künker-Service Wir sind mittlerweile mit neun eigenen Standorten in Deutschland und Europa vertreten. So können wir Ihnen unseren beliebten Künker-Service auch in Ihrer Nähe anbieten. Unsere Leistungen vor Ort: • Persönliche Beratung und Betreuung in Ihrer Nähe. • Sie können Ihre Münzen direkt einliefern oder verkaufen, ersteigerte Münzen abholen und sich nach Vereinbarung Einlieferungen auszahlen lassen. • Sie können sich von unserem Kooperationspartner auf den Künker-Auktionen vertreten lassen. We are now represented with nine locations in Germany and Europe so that we can also provide you the best service in your vicinity. Our local services: • You always have a point of contact nearby. • You can directly consign or sell your coins, collect purchases and receive by appointment payment for consignments. • You can have our cooperation partner represent you at our auctions. OSNABRÜCK Fritz Rudolf Künker GmbH & Co. KG Gutenbergstraße 23, 49076 Osnabrück Tel. +49 (0)541 96 20 20, E-Mail: service@kuenker.de USt-IdNr./VAT-No: DE256270181 Haupptstsititz Ha ititz in in Osn s abbrüückk

4

TEL +49 (0)541 96 20 20, FAX +49 (0)541 96 20 222, SERVICE@KUENKER.DE, WWW.KUENKER.DE


Standorte/Locations

Drrr. H D Huube bert rt R Ruß uß

Fraannk Ri Fr Rich chharrds dsen en en

MÜNCHEN Künker Numismatik AG Löwengrube 12, 80333 München Dr. Hubert Ruß Tel. +49 (0)89 242 198 38, service@kuenker-numismatik.de Fritz Rudolf Künker GmbH & Co. KG Maximiliansplatz 12a, 80333 München Frank Richardsen Tel. +49 (0)89 242 16 990, frank.richardsen@kuenker.de BERLIN Fritz Rudolf Künker GmbH & Co. KG Poststraße 22, 10178 Berlin-Mitte Wollankstraße 117, 13187 Berlin-Pankow Michael Otto Tel. +49 (0)30 247 248 91, michael.otto@kuenker.de

M ch Mi chae aell Ot Otto tttoo

Rolaand nd Trraam mppe

HAMBURG Künker Hamburg, c/o Roland Trampe Roland Trampe Tel. +49 (0)541 96 20 20, roland.trampe@kuenker.de KONSTANZ Künker Konstanz, c/o Michael Autengruber Schulthaißstraße 10, 78462 Konstanz Michael Autengruber Tel. +49 (0)7531 28 44 69, michael.autengruber@kuenker.de

Michaeel Autengruubeer

Petr Kov Pe ovaljo jov

ZNOJMO Künker Znojmo, c/o Petr Kovaljov 17. Listopadu 18, 66902 Znojmo, Tschechische Republik Petr Kovaljov Tel. +42 (0)603 81 10 31, petr.kovaljov@kuenker.de ZÜRICH Künker Zürich, c/o Hess-Divo AG Löwenstraße 55, 8001 Zürich, Schweiz Ulf Künker Tel. +41 (0)44 225 40 90, zuerich@kuenker.de

Alleekksesey On Oncchhuk ukoovv ukov

MOSKAU Künker Moskau, c/o Russian Coin Co. Ltd. Lyalin pereulok dom 9, str. 1, of. 3, 105062 Moskau, Russland Aleksey Onchukov Tel. +7 (495) 589 56 10, aleksey.onchukov@kuenker.de

TEL +49 (0)541 96 20 20, FAX +49 (0)541 96 20 222, SERVICE@KUENKER.DE, WWW.KUENKER.DE

5


Was ist für Ihre schriftliche Auktionsteilnahme besonders wichtig?

DEUTSCH

• Bitte senden Sie uns Ihre Aufträge möglichst frühzeitig zu. Wenn uns Ihr Auftrag erst kurz vor der Auktion erreicht, können sich bei der Bearbeitung Fehler einschleichen. Das beiliegende Formular erleichtert Ihnen die Abgabe eines schriftlichen Gebots. Gerne nehmen wir Ihre Gebote per Post, Fax oder Email entgegen. • Wenn Sie noch nicht bei uns gekauft haben, bitten wir Sie, uns als Referenz eine Münzhandlung anzugeben, mit der Sie bereits in Geschäftsverbindung stehen. • Wir gewährleisten die Echtheit aller verkauften Objekte auch über die gesetzliche Frist hinaus.

Sie möchten telefonisch an der Auktion teilnehmen? Die telefonische Teilnahme an der Auktion ist bei uns selbstverständlich möglich. Wir rufen Sie während der Auktion gerne an und helfen Ihnen, die gewünschten Stücke zu ersteigern. Aus organisatorischen Gründen bitten wir Sie, die folgenden Punkte zu beachten:

Ulrich Künker Leiter Kundenbetreuung

• Telefonisches Bieten ist nur bei Losen mit einer Taxe von mind. € 500,– möglich. • Bitte teilen Sie uns mindestens 48 Stunden vor der Auktion mit, zu welchen Stücken Sie angerufen werden möchten. • Bitte achten Sie darauf, dass Sie erreichbar sind, wenn Ihre Stücke versteigert werden. Der Zeitplan in diesem Katalog hilft Ihnen dabei, den Zeitpunkt der Versteigerung abzuschätzen. • Wir empfehlen, zusätzlich zu Ihrem Anrufwunsch auch ein Gebotslimit abzugeben, damit wir für Sie auch dann bieten können, falls die Verbindung nicht zustande kommt. • Bitte beachten Sie, dass telefonisches Bieten eine unsichere Variante der Auktionsteilnahme sein kann. Wir können keine Garantie für das Zustandekommen der telefonischen Verbindung übernehmen. Wenn Sie sicher gehen wollen, besuchen Sie bitte unsere Auktion persönlich oder geben Sie uns ein schriftliches Gebot.

Was passiert nach der Auktion? Barbara Westmeyer deutschsprachige Kundenbetreuung

Telefon: +49 (0)541 96 20 20 Fax: +49 (0)541 96 20 222 Gebührenfrei: 0800 58 36 537 E-Mail: service@kuenker.de Internet: www.kuenker.de Montag – Donnerstag 8.30 – 17.00 Uhr Freitag 8.00 – 15.30 Uhr

6

• Der Versand der Auktionsware startet sofort nach Beendigung der Auktion und dauert in der Regel 8 Tage. • Alle Kunden, die an unserer Auktion schriftlich teilgenommen haben, erhalten innerhalb von 2 Wochen nach der Auktion unsere Ergebnisliste gratis. • Alle Ergebnisse sind spätestens einen Tag nach Auktionsende auf unserer Internetseite verfügbar.

Sie möchten Ihre Münzen in unsere Auktion einliefern? Sollten Sie sich zum Verkauf Ihrer Münzen entschlossen haben, kommen Sie zu uns. Seit 1985 beweisen wir mit derzeit 4 Auktionsterminen und ca. 15 Katalogen pro Jahr unsere Kompetenz und Zuverlässigkeit. Wichtige Informationen für Sie im Überblick: • Ihre Münzen werden von unseren Experten nach neuestem numismatischem Standard bestimmt und in hochwertigen Farbkatalogen präsentiert. • Wir verfügen mit mehr als 10.000 Kunden über eine der besten Kundendateien weltweit. Im Durchschnitt verkaufen wir mehr als 95 % der Stücke einer Auktion, nicht selten erzielen wir dabei Rekordzuschläge. Für nicht verkaufte Objekte werden keine Gebühren erhoben. • Ab der Übergabe an uns sind Ihre Münzen mit dem doppelten Schätzwert versichert. Unsere Kundenbetreuung bespricht gerne mit Ihnen wie Ihre Stücke sicher zu uns gelangen können. • Ihre Einlieferung wird Ihnen sofort nach der Übernahme quittiert. Spätestens 5 Wochen vor der Auktion erhalten Sie eine Auflistung Ihrer Stücke inkl. Katalognummern und Schätzpreisen. • Unmittelbar nach der Auktion erhalten Sie die Ergebnisliste und können dann alle erzielten Preise feststellen. Den Auktionserlös erhalten Sie innerhalb von 45 Tagen nach der Auktion.

TEL +49 (0)541 96 20 20, FAX +49 (0)541 96 20 222, SERVICE@KUENKER.DE, WWW.KUENKER.DE


Important facts for a written participation in the auction • Please send us your instructions as early as possible. The likelihood of errors occurring increases if we receive your instructions only shortly before the auction. The enclosed form should make it simple for you to submit a written bid, you may send your bids by mail, fax or e-mail. • If you are a new customer who has not yet purchased from us, we do request references. Please name a coin dealer with whom you have already done business. • The genuineness of all objects sold is warranted beyond the statutory length of time.

ENGLISH

Do you wish to participate by telephone? You are welcome to participate in our auction by telephone. We are glad to call you during the auction and to assist you in bidding for your items. Please take notice of the following conditions: • Telephone bidding is accepted exclusively on lot numbers with estimates at 500 Euro or above. • Please inform us at least 48 hours in advance if you wish to register for telephone bidding, even for single lots. We do need 48 hours to schedule all incoming requests. • Please be available, when your lots will be sold. The time schedule in the catalogue will help you to estimate the approximate time when your items are going to be sold. • When you register for telephone bidding, we recommend to leave a written bid in addition. This bid will only be executed, should the telephone bidding be interrupted or not be achieved. • Please be aware that telephone bidding is a risky way of participation in our auction. We do not assume liability should the telephone line be interrupted or not be achieved. We advise you to attend the auction in person or to send written bids.

Nadine Zuber English, Deutsch

What occurs after the auction? • The shipment of all auction goods starts immediately after the completion of the entire auction week and it usually takes 8 days to be completed. • All auction results are available on our website one day after the end of the auction week. • All clients who submitted bids for the auction will automatically receive the list of auction results free of charge within two weeks after the end of auction.

Do you wish to consign your coins to our auction? Should you decide to sell your coins, we are ready to assist you. Since 1985 we have earned our bona fides in conducting over 4 auctions and in publishing 15 catalogues per year. In the following you will find the most important information on consigning: • We guarantee the professional handling of your consignment following the latest numismatic level of expertise including its presentation in colour catalogues of outstanding quality. • We possess one of the best customer lists worldwide. On average we sell more than 95 % of all items in our auction, and it is not unusual for us to achieve record hammer prices for lots submitted. Unsold items incur no fees. • Once the coins are consigned they are covered by our insurance at double the estimate. Upon consultation with our customer service we try to advise you on the safest way of shipping for your coins. • Your delivery will be confirmed in writing immediately on receipt. At least five weeks before the auction, you will receive an exact list of your objects with the relevant catalogue numbers and descriptions. • Within a week of the end of auction, you will receive a list of auction results in order to see what prices were reached for each individual lot. As a consignor, you will receive the auction proceeds within 45 days after the end of auction.

Marion Künker English, Deutsch

Phone: +49 (0)541 96 20 20 Fax: +49 (0)541 96 20 222 E-Mail: service@kuenker.de Website: www.kuenker.com Monday –Thursday 8.30 AM – 5 PM Friday 8 AM – 3.30 PM

TEL +49 (0)541 96 20 20, FAX +49 (0)541 96 20 222, SERVICE@KUENKER.DE, WWW.KUENKER.DE

7


Votre participation par écrit – Les points essentiels

FRANCAIS

• Veuillez nous faire parvenir vos ordres le plus tôt possible. Si vos ordres nous parviennent juste avant la vente aux enchères, des erreurs risquent d’être commises lors de leur traitement. Le formulaire ci-joint vous aidera à rédiger facilement votre offre. Vous pouvez nous envoyer vos ordres par la poste, par fax ou par e-mail. • Si vous n’avez encore fait aucune acquisition chez nous, nous vous prions de nous indiquer une ou deux références d’autres maisons numismatiques où vous avez déjà acheté. • L’authenticité des pièces vendues est garantie même au-delà des délais légaux.

Vous voulez participer par téléphone? La participation par téléphone est bien sûr possible. Nous vous appelons volontiers pour vous aider à acquérir les pièces voulues. Pour des raisons d´organisation veuillez noter les points suivants:

Alexandra Elflein, M. A. Français, Deutsch, English, Italiano

• La participation par téléphone est possible seulement pour les lots estimé à plus de 500 Euros chacun. • Veuillez nous informer au moins 48 heures avant la vente de la liste des pièces pour lesquelles vous voudriez être appelé. • Veuillez prendre soin d´être joignable quand vos pièces seront mises en vente. L’ordre de vente dans ce catalogue vous aidera à estimer l´heure de la vente. • Vue les risques de la participation téléphonique, nous vous recommandons néanmoins d’indiquer une limite maximale pour chaque lot, pour que nous puissions enchérir pour vous, même si la communication téléphonique serait interrompue ou ne pourrait pas être établie. • La participation par téléphone présente des risques, et nous déclinons toute responsabilité dans le cas où la communication téléphonique serait interrompue, ou bien ne pourrait être établie.

Ce qui se passe après la vente Kmar Chachoua Français, Deutsch, English, Arabic

Tél. +49 (0)541 96 20 20 Facs. +49 (0)541 96 20 222 E-Mail: service@kuenker.de Site: www.kuenker.de Lundi à Jeudi de 8h30 à 17h00 Vendredi de 8h00 à 15h30

• L´expédition des biens va commencer immédiatement après la fin de la vente complète, et prend généralement 8 jours. • Tous les clients qui ont participé à l’une de nos ventes aux enchères recevront gratuitement une liste de résultats dans les deux semaines qui suivent. • Les résultats seront disponibles sur notre site internet, au plus tard un jour après la fin de la vente.

Vous voulez confier vos monnaies pour nos ventes aux enchères? Contactez nous si vous envisagez de vendre vos pièces. Notre compétence et fiabilité est prouvée depuis 1985 par actuellement 4 ventes aux enchères et environ 15 catalogues par an. Le plus important pour vous est que: • Vos pièces seront décrites par notre équipe d’experts selon les standards numismatiques les plus récents, et elles seront présentées dans des catalogues de haute qualité en couleurs. • Nous avons un des meilleurs fichiers-clientèle du monde avec plus de 10.000 clients. Nous vendons en moyenne plus de 95% de la vente aux enchères, et obtenons souvent des prix records. Les monnaies invendues n’encourent aucun frais. • Notre service clientèle est disponible pour vous conseiller pour l’envoi de vos pièces, et dès leur réception vos pièces seront assurées pour le double de la valeur d´estimation. • Vous recevrez une liste détaillée des pièces fournies au moment de la prise en charge puis, au plus tard cinq semaines avant la vente aux enchères, vous recevrez leur liste exacte avec les numéros de catalogue correspondants. • Immédiatement après la vente aux enchères, vous recevrez la liste des résultats et pourrez prendre connaissance des prix obtenus. Vous recevrez le produit de la vente dans les 45 jours après les enchères.

8

TEL +49 (0)541 96 20 20, FAX +49 (0)541 96 20 222, SERVICE@KUENKER.DE, WWW.KUENKER.DE


I punti piú importanti per la Sua partecipazione per iscritto • La preghiamo di farci pervenire i Suoi ordini al piú presto possibile. Se i Suoi ordini ci arrivano poco prima dell´inizio dell´asta possono verificarsi errori. Il formulario allegato Le faciliterá l´invio dei Suoi ordini per iscritto. Ci puó far pervenire i Suoi ordini per posta, per fax o per email. • Se non ha mai acquistato presso di noi, La preghiamo di volerci indicare a titolo di referenza il nome di uno o due commercianti numismatici presso i quali è giá cliente. • L’autenticità di tutti gli oggetti venduti viene garantita anche oltre i termini previsti dalla legge.

ITALIANO

Desidera partecipare telefonicamente alla nostra asta? La partecipazione telefonica è naturalmente da noi possibile. La chiameremo durante l´asta e La assisteremo volentieri per ottenere l´aggiudicazione dei pezzi desiderati. Per motivi di organizzazione La preghiamo di voler tenere conto dei seguenti punti: • La partecipazione telefonica è possibile solo per lotti stimati con almeno 500,– € l´uno. • La preghiamo di volerci comunicare almeno 48 ore prima dell´inizio dell´asta per quali pezzi desidera essere chiamato. • La preghiamo di aver cura di essere raggiungibile telefonicamente al momento in cui vengono messi all´asta i pezzi che Le interessano. Lo schema orario in catalogo La aiuterá a stimare a che ora verranno messi all´asta i pezzi che Le interessano. • Consigliamo di indicare sempre assieme alla richiesta di partecipazione telefonica anche un´ importo massimo, per permetterci di fare per Lei l´offerta anche nel caso in cui la telefonata non fosse possibile. • La partecipazione telefonica è un modo incerto di partecipare alle aste. Non assumiamo nessuna responsabilità se per esempio la linea telefonica è occupata o interrotta o se Lei non sará raggiungibile per altri motivi.

Sonia Russo, M. A. Italiano, Deutsch, English, Español

Cosa succede dopo l´asta? • La spedizione del materiale d´asta comincia subito dopo la fine dell´intera asta e termina normalmente entro 8 giorni. • Tutti i clienti che hanno partecipato all´asta ricevono entro 2 settimane dopo l´asta la lista dei prezzi di realizzo. • I prezzi di realizzo sono visionabili sul nostro sito internet al piú tardi un giorno dopo la fine dell´intera asta.

Vuole consegnarci le Sue monete per una nostra asta? Ci contatti se ha deciso di vendere le Sue monete. Dal 1985 la nostra competenza ed affidabilità è dimostrata da attualmente 4 aste e circa 15 cataloghi all´anno. Quali sono i punti di maggior importanza per Lei:

Cristina Welzel Italiano, Deutsch, English, Français

Tel.: +49 (0)541 96 20 20 Fax: +49 (0)541 96 20 222 E-Mail: service@kuenker.de Internet: www.kuenker.de Lunedì a giovedì dalle 8.30 alle 17.00 Venerdì dalle 8.00 alle 15.30

• Le Sue monete vengono valutate dal nostro staff di esperti secondo i piú attuali standard numismatici e vengono presentati in cataloghi di alto valore a colori. • Con piú di 10.000 clienti disponiamo di una delle migliori banca dati clienti del mondo. In media vendiamo oltre il 95% del materiale d´asta realizzando spesso prezzi da record. Per i pezzi invenduti non ci sono nessune spese da pagare. • Dal momento della consegna le Sue monete sono assicurate per il doppio del valore di stima. Il nostro servizio clientela Le consiglierá volentieri come farci avere le Sue monete nel modo piú sicuro. • La Sua consegna Le verrá immediatamente quietanzata al momento della resa dei pezzi. Al piú tardi 5 settimane prima dell´asta riceverá una lista dettagliata dei Suoi pezzi con i numeri di catalogo ed i prezzi di stima. • Subito dopo l´asta riceverá la lista con i risultati d´asta dalla quale potrá subito controllare i prezzi realizzati. Riceverá l´importo di realizzo entro 45 giorni dopo la fine dell´asta.

TEL +49 (0)541 96 20 20, FAX +49 (0)541 96 20 222, SERVICE@KUENKER.DE, WWW.KUENKER.DE

9


Что особенно важно при заочном участии на аукционе?

RUSSKIJ

• Тщательно изучите наш каталог и запишите те лоты, которые Вас заинтересовали. Заполните приложенный формуляр и отправьте нам его заранее по почте, факсу или электронной почте. Мы обращаем внимание на то, что если Ваши ставки придут перед самым началом аукциона либо во время аукциона, то существует вероятность допуска ошибки в процессе обработки заказа. • Если Вы впервые принимаете участие в нашем аукционе, то мы рекомендуем Вам указать Ваш референц – аукционные дома, с которыми Вы уже сотрудничали. Или свяжитесь с нами по телефону +49(0)541 9620268. • Подлинность купленных на нашем аукционе лотов гарантируется нами на протяжении неограниченного времени.

Вы хотели бы принять участие на аукционе по телефону? У нас, конечно, есть возможность организовать Ваше телефонное участие на торгах, но мы бы хотели обратить внимание на следующие пункты: Anastasija Koepsell Russkij, Deutsch

Dzmitry Nikulin Russkij, Deutsch, English

Телефон: +49 (0)541 96 20 20 Факс: +49 (0)541 96 20 222 E-Mail: service@kuenker.de интернет: www.kuenker.de понедельник – четверг 8.30 – 17.00 пятница 8 – 15.30

• Участие в телефонных торгах возможно только для лотов со стартовой ценой свыше 500 евро. • Для участия в торгах по телефону просим Вас связаться с нами не позднее 48 часов до начала аукциона. • Мы хотим подчеркнуть, что телефонное участие на аукционе – не самый безопасный способ: в случае плохой связи, недоступности клиента во время торгов либо других технических проблем мы не несем ответственности. • Мы рекомендуем Вам при участии в торгах по телефону  дополнительно сообщить нам о Вашем лимите на интересующие лоты в случае, если телефонная связь будет невозможна или по техническим причинам прервана.

Что происходит после окончания аукциона? • Результаты аукционов доступны на нашем сайте на следующий день после окончания торгов. • Вы можете лично забрать приобретенные лоты. По окончании торгов мы готовим все необходимые документы на вывоз из Евросоюза. • Почтовые отправки в Россию ( Беларусь, Украину ) осуществляются по предварительной договоренности. Для связи с нами звоните по телефону +49 (0)541 9620268.

Вы хотели бы выставить Ваши предметы на аукцион? Более 160-ти успешно проведенных аукционов, тысячи участников, 4 аукциона в год - эти и другие преимущества, которые говорят в пользу выставления Ваших коллекций на аукцион Кюнкер: • Ваши монеты будут оценены нашими экспертами по самым новым нумизматическим стандартам и представлены в высококачественном цветном каталоге. • Более 10000 клиентов со всего мира оказывают нам свое доверие. В среднем мы продаем более 95% всех выставляемых предметов, при этом зачастую достигая рекордных сумм. • Все Ваши предметы, после передачи их нам, хранятся у нас до начала аукциона застрахованными. Не позднее 5-ти недель до начала аукциона Вы получите по почте подробное описание Ваших лотов с указаннами номерами в каталоге, а также их оценочной стоимостью. • Результаты аукционов также будут высланы Вам по почте после окончания торгов. В течение 45 дней после аукциона Вам будет выплачено Ваше вознаграждение.

10

TEL +49 (0)541 96 20 20, FAX +49 (0)541 96 20 222, SERVICE@KUENKER.DE, WWW.KUENKER.DE


Vortrag von Michael Autengruber anlässlich unserer Sommer-Auktionen 210 – 215

Das Mysterium um die Beute von Waterloo – Die verschlungenen Pfade der Orden Napoléons von Belle-Alliance bis Paris Napoléon I., Kaiser der Franzosen (1769 – 1821), war Inhaber der höchsten Orden der meisten europäischen Staaten seiner Zeit. Am Abend der Schlacht von Belle-Alliance/Waterloo, am 18. Juni 1815, fiel preußischen Soldaten die gesamte Equipage des Korsen in die Hände, und mit ihr unzählige Juwelen, Gold- und Silbermünzen, silberne Tafelservice, Kleider und Gebrauchsgegenstände, darunter auch seine persönlichen Ordensinsignien. Teile davon gelangten durch Feldmarschall Gebhard Leberecht Fürst Blücher in die Königlichen Kunstsammlungen in Berlin und schließlich ins Zeughaus, aus dessen Beständen sie zu Ende des Zweiten Weltkrieges verschwanden und erst wieder in den 1990er Jahren im Historischen Museum in Moskau wieder auftauchten. Derzeit sind sie (bis zum 8. Juli 2012) als Leihgabe der Russischen Föderation im Museum der Ehrenlegion und der Ritterorden in Paris zusammen mit weiteren Ordensinsignien und Preziosen aus der »Waterloo-Beute« zu sehen. Der Vortragende beabsichtigt, anhand von zahlreichen Bildern, zeitgenössischen Berichten und Darstellungen die verschlungenen und spannenden Pfade der »Waterloo-Beute« wie auch dieser wohl einzigartigen »Sammlung« von Ordensinsignien nachzuzeichnen.

Donnerstag, 21. Juni 2012 um 19:00 Uhr, Steigenberger Hotel Remarque, Osnabrück


INHALT AUKTION 215 Nr. ORDEN UND EHRENZEICHEN

9001

-

9761

17

-

184

Deutsche Staaten Baden Bayern Braunschweig Hannover Hessen Schaumburg-Lippe Mecklenburg-Strelitz Oldenburg Preußen Sachsen, sächsische Herzogtümer Württemberg

9001

-

17

-

9002 9012

-

18

-

9016 9023

-

21

-

9026 9039 9077 9092

-

9094 9001 9011 9014 9015 9022 9024 9025 9038 9076 9091 9094

24 25 32

-

36 17 20 20 21 23 23 23 25 32 36 36

9095

36

Deutsches Reich 1871-1918

9096

-

9097

37

Weimarer Republik 1919-1933

9098

-

9104

37

Drittes Reich 1933-1945

9105

-

9118

Deutsche Demokratische Republik (1949-1990)

9119

-

9120

Bundesrepublik Deutschland (seit 1949) Ordensschnallen Miniaturenschnallen und -kettchen Allgemeine Konvolute

9121 9123 9136 9145

-

9152 9135 9144 9152

41 42 45 46

-

47 44 46 47

Ordensschnallen - International

9153

-

9155

47

-

48

Heiliges Römisches Reich Deutscher Nation (bis 1806)

38

-

40 40

Miniaturenschnallen und -kettchen International

9156

-

9168

49

-

52

Konvolute-International

9169

-

9181

52

-

54

Belgien

9182

-

9193

54

-

57

Bulgarien

9194

-

9195

Dänemark

9196

-

9203

Estland

9204

-

9206

Finnland

9207

-

9220

59

-

61

Frankreich Königreich (Restauration - 1814/1815-1830) Zweites Kaiserreich (1852-1870) Dritte Republik (1870-1940) Fünfte Republik (seit 1958) Koloniale Auszeichnungen Inoffizielle Auszeichnungen

9221

-

9248

62

-

67

9221

-

62

-

9231

-

64

-

9242 9245

-

9229 9230 9240 9241 9244 9248

63 63 66 66 66 67

Griechenland Zweites Königreich (1863-1924)

12

Seite

57 57

-

58 59

9249 9249

67 67

Vereinigtes Königreich von Großbritannien und Nordirland

9250

-

9270

Island

9271

-

9274

74

Italien Königreich (1861-1946) Republik (seit 1946)

9275 9275

-

9280 9279 9280

75 75 75

68

-

74


Lettland Erste Republik (1918-1940)

9281 9281

-

9288 9288

76 76

-

77 77

Liechtenstein

9289

77

Luxemburg

9290

77

Monaco

9291

78

Niederlande

9292

-

9294

79

Norwegen Königreich, Personalunion mit Schweden (bis 1905) Königreich (seit 1905)

9295

-

9300

80

-

82

9295 9297

-

9296 9300

80

-

80 82

Österreich Kaiserreich (1804-1918) Hoher deutscher Ritterorden

9301 9301 9315

-

9317 9314 9317

82 82 84

-

85 84 85

Polen Erste Republik (1918-1939)

9318 9318

85 85

Portugal Königreich (bis 1910)

9319 9319

-

9321 9321

85 85

-

86 86

Rumänien Königreich (1881-1947) Volksrepublik (1948-1965) Sozialistische Republik (1965-1989) Dritte Republik (seit 1989)

9322 9322 9387 9389

-

9398 9386 9388 9397 9398

86 86

-

99 97 97 98 99

Russland Zarentum (bis 1917) Union der sozialistischen Sowjetrepubliken (Sowjetunion) Russische Föderation, tschetschenische Republik Itschkeria (seit 1991)

9399 9399

-

9433 9431

99 99

-

109 109

San Marino

9432

109

9433

109

9434

110

Schweden

9435

-

9512

Serbien und Jugoslawien Fürstentum und Königreich Serbien (1817/1867-1918) Königreich der Serben, Kroaten und Slowenen bzw. Königreich Jugoslawien (1918-1941/1945)

9513

-

9516

110

-

124 125

9513

-

9515

125

9516

125 125 125

Slowakei Erste Republik (1939-1945)

9517 9517

-

9518 9518

Spanien Drittes Königreich, Restauration (1813-1868) Drittes Königreich, Regierung Isabellas II. (1833/1843-1868) Provisorische Regierung/Regentschaft (1868-1870)

9519

-

9556

126

-

137

9519

-

9523

126

-

127

9524

-

9535

128

-

131

9536

-

9556

131

-

137

9557 9557

-

9558 9558

138 138

-

9559 9559 9594

139 139 146

Tschechoslowakei und tschechische Republik Erste Republik (1918-1939/1946) Ungarn Volksrepublik (1949-1989) Kirchenstaat, Heiliger Stuhl und Vatikan

9560

139

-

13


Ägypten

9595

146 147

Äthiopien

9596

-

9597

Afghanistan

9598

-

9599

Brasilien

-

149 150

China

9601

-

9605

150

-

152

Elfenbeinküste

9606

-

9607

152

-

153

Georgien

9608

153

Guinea

9609

153

Haiti

9610

154

9615 9616

154 155

Kanada

9617

155

Komoren

9618

156 156

Japan Jordanien

9611

-

Korea

9619

-

9620

Laos

9621

-

9625

156

-

157

Manchukuo

9626

157

Marokko

9627

157 157

Mongolei

9628

-

9629

Persien / Iran

9630

-

9632

Philippinen Thailand Tunesien

9634

-

9679

-

9682

-

Annam-Vietnam Miniaturenschnallen und -Kettchen International Urkunden, Dokumente & Statuten Deutsche Staaten

-

9677

159

-

9680

168

9681

169

9685

169

-

9761 9717

170 170

9687 -

167 167

9686

9688 9688

159 159

9678

Venezuela Vereinigte Staaten von Amerika (U. S. A.)

158

9633

Türkei

171 171 171

-

184 175

Heiliges römisches Reich deutscher Nation (bis 1806)

9718

176

Deutschland - Allgemeine Konvolute

9719

176

Bulgarien

9720

176

Frankreich

9721

-

9725

176

-

Griechenland

9726

-

9727

Österreich

9728

-

9735

177

-

178

Russland

9736

-

9747

178

-

181

Serbien und Jugoslawien

9748

-

9749

Spanien

9750

-

Kirchenstaat, Heiliger Stuhl und Vatikan China

9755

-

Thailand Türkei

9758

-

177 177

181

9753

182

9754

182

9756

182

-

183

9757

183

9761

184

Ein Stichwortverzeichnis finden Sie am Ende des Auktionskataloges 214. 14

148

9600


5GJTIGGJTVG5COONGTXGTGJTVG-WPFGP +EJHTGWGOKEJ+JPGPOKVFKGUGO-CVCNQIPWPUEJQPFGPUKGDVGP5RG\KCNMCVCNQIOKV1TFGPWPUGTGU*CWUGUXQTNGIGP\WMÌPPGP #WH  5GKVGP DKGVGP YKT +JPGP 1TFGP 'JTGP WPF #D\GKEJGP /KPKCVWTGP 1TFGP WPF /KPKCVWTGPUEJPCNNGP UQYKG 8GTNGKJWPIUWTMWPFGP KP ÒDGT  #WMVKQPUNQUGP CP &KG 5VÒEMG UVCOOGP W C CWU 5COONWPIGP 4WO·PKGP 5EJYGFGP 5RCPKGP*GKNKIGT5VWJND\Y8CVKMCP5KCOD\Y6JCKNCPFCWUGKPGT/KPKCVWTGP5COONWPIWPFGKPGT7TMWPFGP5COONWPI UQYKGCWUXGTUEJKGFGPGP0CEJN·UUGP <WP·EJUVIGNCPIGPKP.QUGP1TFGP'JTGPWPF#D\GKEJGPFGTFGWVUEJGP$WPFGUUVCCVGPDKUWCCWU$CFGP$C[GTP FGP DGKFGP *GUUGP 1NFGPDWTI 2TGW­GP 5CEJUGP WPF FGP VJÒTKPIKUEJGP *GT\QIVÒOGTP FGT 9GKOCTGT 4GRWDNKM WPF FGU &GWVUEJGP 4GKEJGU XQP  DKU  UQYKG GKPG 4GKJG XQP ITQ­GP 1TFGPUUEJPCNNGP /KPKCVWTGPUEJPCNNGP WPF MGVVEJGP (GNFUEJPCNNGP\WO#WHTWH &GT GWTQR·KUEJG 6GKN OKV KPUIGUCOV PCJG\W  .QUGP DGKPJCNVGV PGDGP FGP UEJQP XQTJGT IGPCPPVGP 5COONWPIGP W C FKG YGKVGTGP 5EJYGTRWPMVG $GNIKGP &·PGOCTM 'UVNCPF (KPPNCPF (TCPMTGKEJ )TQ­DTKVCPPKGP +UNCPF +VCNKGP .GVVNCPF 0QTYGIGP ¤UVGTTGKEJ WPF 4WUUKUEJGU 4GKEJ +O ÒDGTUGGKUEJGP $GTGKEJ OKV ÒDGT  .QUGP NKGIGP FKG 5EJYGTRWPMVG PGDGP 5KCO6JCKNCPF DGK #HIJCPKUVCP %JKPC .CQU WPF 2GTUKGP <WO #DUEJNW­ IGNCPIGP PQEJ ÒDGT  .QUG 8GTNGKJWPIUWTMWPFG UQPUVKIG&QMWOGPVGWPF1TFGPUUVCVWVGP\WO#WHTWH #O8QTCDGPFFGT#WMVKQPYKTFFGT-CVCNQICWVQTKPGKPGOHCTDGPRT·EJVKIGP$KNF8QTVTCIOKVFGO6KVGNō&CU/[UVGTKWOWO FKG $GWVG XQP 9CVGTNQQ ņ &KG XGTUEJNWPIGPGP 2HCFG FGT 1TFGP 0CRQN¾QPU XQP $GNNG#NNKCPEG DKU 2CTKUŋ ÒDGT FGTGP 5EJKEMUCNDGTKEJVGP#PJCPFXQP\CJNTGKEJGP$KNFGTP\GKVIGPÌUUKUEJGP$GTKEJVGPWPF&CTUVGNNWPIGPUQNNXGTUWEJVYGTFGPFKG URCPPGPFG)GUEJKEJVGFGTō9CVGTNQQ$GWVGŋWPFFKGUGTYQJNGKP\KICTVKIGPō5COONWPIŋXQP1TFGPUKPUKIPKGPPCEJ\W\GKEJPGP 9KT YÒPUEJGP +JPGP UGJT IGGJTVGT 5COONGT WPF -WPFG XKGN (TGWFG DGKO 5VWFKWO FKGUGU -CVCNQIGU WPF YÒTFGP WPU UGJT HTGWGPYGPPGKPKIGFGTJKGTCPIGDQVGPGP1DLGMVGCWEJ+JT+PVGTGUUGHKPFGPYÒTFGP /KEJCGN#WVGPITWDGT

15


'TJCNVWPIUWPF5GNVGPJGKVUITCFG 1TFGP WPF 'JTGP\GKEJGP /GFCKNNGP WPF /KPKCVWTGP 7TMWPFGP &QMWOGPVGWPF UQPUVKIGJKUVQTKUEJG5COONWPIUIGIGPUV·PFG UKPF 1DLGMVG FKG \WO 6TCIGP D\Y \WO V·INKEJGP )GDTCWEJ DGUVKOOV YCTGP WPF UQOKV GKPGT PCVWTIGO·­GP #DPWV\WPI WPVGTNKGIGP$GUQPFGTUDGKHTÒJGP'ZGORNCTGPDGTÒEMUKEJVKIVFKG'TJCNVWPIUGKPUVWHWPIFCU#NVGT/·PIGNQFGT$GUEJ·FKIWPIGP FKG ÒDGT FCU ÒDNKEJG /C­ JKPCWUIGJGP YGTFGP KP FGT $GUEJTGKDWPI CWUFTÒEMNKEJ GTY·JPV 9KT YGKUGP KP FKGUGO <WUCOOGPJCPICWUFTÒEMNKEJFCTCWHJKPFC­FGT-WPFGUKG/ÌINKEJMGKV\WT8QTDGUKEJVKIWPIXQTFGT8GTUVGKIGTWPIJCV 'TJCNVWPIUCPICDGP CNU 'TIGDPKU UWDLGMVKXGT $GVTCEJVWPI UKPF MGKP $GUVCPFVGKN FGT $GUEJTGKDWPI &GT LGYGKNKIG 'TJCNVWPIU\WUVCPFKUVPCEJFGT$GUEJTGKDWPIYKGHQNIVCPIGIGDGP + ++ +++ +8

   

2TCEJVGZGORNCTPGWYGTVKIQFGTPGW XQT\ÒINKEJGTJCNVGPOKVMNGKPGP)GDTCWEJUURWTGP IWVGTJCNVGPOKV)GDTCWEJUURWTGP OKVUGJTFGWVNKEJGP)GDTCWEJUURWTGP

#WEJ 5GNVGPJGKVUITCFG CNU 'TIGDPKU UWDLGMVKXGT NCPIL·JTKIGT /CTMVDGQDCEJVWPI UKPF MGKP $GUVCPFVGKN FGT $GUEJTGKDWPI &GT LGYGKNKIG5GNVGPJGKVUITCFKUVPCEJFGT$GUEJTGKDWPIYKGHQNIVCPIGIGDGP 4  44  444 4444

UGNVGP UGJTUGNVGP XQPCNNGTITÌ­VGT5GNVGPJGKV GZVTGOUGNVGP

 

+PFKECVKQPQH%QPFKVKQPCPF4CTKV[ 1TFGTUCPFFGEQTCVKQPUOGFCNUCPFOKPKCVWTGUFQEWOGPVUCPFQVJGTJKUVQTKECNEQNNGEVKDNGUCTGQDLGEVUQTKIKPCNN[KPVGPFGFHQT YGCTKPITGURWUGCPFVJGTGHQTGVJG[CTGUWDLGEVVQCEGTVCKPYGCTCPFVGCT'URGEKCNN[HQTGCTN[RKGEGUVJGITCFGQHEQPFKVKQPKU EQPUKFGTKPIKVUCIG+ORQTVCPVFGHGEVUQTFCOCIGUCTGOGPVKQPGFKPVJGFGUETKRVKQP6JGENKGPVJGTGYKVJKUKPHQTOGFVJCVJGJCU VJGRQUUKDKNKV[DGHQTGVJGCWEVKQPHQTCRGTUQPCNXKGYCPFEQPVTQNQHVJGQDLGEVUJGOKIJVDGKPVGTGUVGFKP 6JG FGITGGU QH EQPFKVKQP CU C TGUWNV QH UWDLGEVKXG EQPUKFGTCVKQP CTG PQV RCTV QH VJG FGUETKRVKQP 6JG TGNCVKXG EQPFKVKQP KU KPFKECVGFCHVGTVJGFGUETKRVKQPCUHQNNQYU + ++ +++ +8

   

GZVTGOGN[HKPGEQPFKVKQP IQQFXGT[HKPGEQPFKVKQP KPHKPGEQPFKVKQP KPDCFEQPFKVKQP

#NUQVJGKPFKECVKQPQHTCTKV[CUCTGUWNVQHCUWDLGEVKXGQDUGTXCVKQPQHVJGOCTMGVCTGPQVRCTVQHVJGFGUETKRVKQP6JGTGNCVKXG TCTKV[KUKPFKECVGFCHVGTVJGFGUETKRVKQPCUHQNNQYU 4  44  444 4444 

16

TCTG XGT[TCTG QHJKIJGUVTCTKV[ GZVTGOGN[TCTG


DEUTSCHE STAATEN

14&'070&'*4'0<'+%*'0 #DDKNFWPIGPUQHGTPPKEJVCPFGTUCPIGIGDGP CWHXGTMNGKPGTV

9001 (1:1)

&'765%*'56##6'0 $#&'0/#4-)4#(5%*#(6 $+5 -74(ª456'067/    70&)4155*'4<1)67/   

)TQ­JGT\QINKEJGT*CWUQTFGPFGT6TGWG,WYGNKGTU#PHGTVKIWPIFGU$TWUVUVGTPUXQP/CTVKP)WNNCWOG $KGPPCKUKP2CTKUZOOI5KNDGT#WHNCIGP)QNFITCXKGTVGOCKNNKGTV'OCKNNGOCNGTGK MNGKPG $N·UEJGP#DRNCV\WPIGP KP FGT YGK­GP 'OCKNNG FGT $WEJUVCDGP FGU /GFCKNNQPU QJPG UKEJVDCTG    2WP\KGTWPIGP CWH FGT 4ÒEMUGKVG ITÒPGU .GFGTGVKMGVV OKV IQNFHCTDGPGT #WHUEJTKHV $+'00#+ 5 14(     —84'A&'. '/2 '4'74 '641+# 2#4 +5OKVGKUGTPGO$TQUEJKGTWPIUU[UVGOFKG0CFGNHGJNV 4444++  5GJT HGKPG WPF UGNVGPG #PHGTVKIWPI FGU YQJN DGFGWVGPFUVGP *QHLWYGNKGTU -CKUGT 0CRQN¾QPU + CWU FGO <GKVTCWO   \YKUEJGPWPFKPGKPGTHÒTKJT#NVGTJGTXQTTCIGPFGP'TJCNVWPI7PUGTGU9KUUGPUJCPFGNVGUUKEJJKGTDGK \WUCOOGPOKVGKPGOYGKVGTGPPCJG\WKFGPVKUEJGP'ZGORNCT UW WOFKG·NVGUVGDGMCPPVG/GVCNNCWUHÒJTWPIGKPGU $TWUVUVGTPUFGUDCFKUEJGP*CWUQTFGPUFGT6TGWG5VCVWVGPIGO·­MCOGP\WLGPGT<GKVCWUUEJNKG­NKEJIGUVKEMVG$TWUV UVGTPG \WO #PP·JGP  \WUCOOGP OKV FGO -NGKPQF CO 5EJWNVGTDCPF \WT 8GTNGKJWPI &KGUG GTYKGUGP UKEJ LGFQEJ   DGUQPFGTU HÒT &KRNQOCVGP WPF JQJG 5VCCVUDGCOVG CNU WPRTCMVKUEJ FC GU CWU RTQVQMQNNCTKUEJGP )TÒPFGP PQVYGPFKI   YCT FKG 1TFGPUUVGTPG CPNC­IGO·­ \W YGEJUGNP &GUJCND JCDGP GKPKIG XQP KJPGP DGK ,WYGNKGTGP #WUHÒJTWPIGP KP   /GVCNN OKV TÒEMUGKVKI CPIGDTCEJVGP $TQUEJKGTWPIUU[UVGOGP CPHGTVKIGP NCUUGP FKG DGFGWVGPF NGKEJVGT \W YGEJUGNP   YCTGP0CRQN¾QP+UGNDUVOQEJVGIGUVKEMVG5VGTPÒDGTJCWRVPKEJVWPFNKG­UKEJHÒTCNNGKJOXGTNKGJGPGP1TFGPXQP UGKPGO *QHLWYGNKGT /CTVKP)WKNNCWOOG $KGPPCKU   #WUHÒJTWPIGP KP /GVCNN CPHGTVKIGP 5GKPGO$GKURKGN HQNIVGP XKGNG 9ÒTFGPVT·IGT YKG CWU FGTGP 1TFGPUPCEJN·UUGP FGWVNKEJ \W GTUGJGP KUV 'KP YGKVGTGU PCJG\W KFGPVK   UEJGU 'ZGORNCTFKGUGUJKGTCPIGDQVGPGP$TWUVUVGTPUCWUFGO$GUKV\-CKUGT0CRQN¾QPU+ GDGPHCNNUOKVIGUKEJGTVGT 2TQXGPKGP\ DGHKPFGVUKEJFGT\GKVKPFGT5QPFGTCWUUVGNNWPI.C$GTNKPGFG0CRQN¾QPņ.GO[UV½TGFWDWVKPFG9C VGTNQQ KO /WUGWO FGT 'JTGPNGIKQP WPF FGT 4KVVGTQTFGP KP 2CTKU WPF KUV KO INGKEJPCOKIGP WPF  GTUEJKGPGP   #WUUVGNNWPIUMCVCNQI *I,GCP6WNNCTF CWH5GKVGCDIGDKNFGV  2TQXGPKGP\ 'OOGTKEJ ,QUGRJ &WE FG &CNDGTI   FGUUGP GKP\KIG 6QEJVGT /CTKG .QWKUG 2GNNKPG XGTJ   .CF[ #EVQP   FGTGP 5QJP ,QJP 'OGTKEJ 'FYCTF &CNDGTI#EVQP UV$CTQP#EVQP  FGUUGP 5QJP 4KEJCTF /CZKOKNKCP .[QP&CNDGTI#EVQP PF $CTQP #EVQP ņ  FGUUGP 'TDGP WPF 0CEJGTDGP   #WMVKQP1TFGTU&GEQTCVKQPU/GFCNUCPF/KNKVCTKCDGK&KZ0QQPCP9GDDKP.QPFQPCO,WNK -CV0T   \WUCOOGP OKV YGKVGTGP 1TFGPUKPUKIPKGP CWU FGO $GUKV\ FGT (COKNKG #EVQP 5KGJG CWEJ -CVCNQI 0T      &GT*CWUQTFGPFGT6TGWGYWTFGCO0QXGODGTXQP)TQ­JGT\QI%CTN(TKGFTKEJ  CP'OOGTKEJ ,QUGRJ(TGKJGTTPXQP&CNDGTIHÒTUGKPGITQ­GP8GTFKGPUVGWOFCU)TQ­JGT\QIVWO$CFGPCNUFGUUGP)GJGKOGT4CV CW­GTQTFGPVNKEJGT )GUCPFVGT WPF DGXQNNO·EJVKIVGT /KPKUVGT DGK FGT 4GRWDNKM (TCPMTGKEJ WPF FGO (TCP\ÌUKUEJGP   -CKUGTTGKEJXGTNKGJGP'OOGTKEJ,QUGRJ(TGKJGTTX&CNDGTI /CKP\*GTTPUJGKO YCTFGT 5QJP XQP 9QNHICPI *GTKDGTV (TGKJGTTP X &CNDGTI  ņ   WPF FGUUGP 'JGHTCW /CTKC 'NKUCDGVJ (TGKKP X   7NNPGTXQP&KGRWTIWPF0GHHGFGU·NVGTGP$TWFGTUUGKPGU8CVGTU-CTN6JGQFQT(TGKJGTTPX&CNDGTI   -WTHÒTUV'T\DKUEJQH XQP /CKP\ WPF 4GIGPUDWTI 4GKEJUGT\MCP\NGT (ÒTUVDKUEJQH XQP -QPUVCP\ WPF9QTOU(ÒTUV 2TKOCUFGU4JGKPDWPFGUWPF)TQ­JGT\QIXQP(TCPMHWTVYWTFGGT9KTMNKEJGT4CVDGKFGT(KPCP\CDVGKNWPIFGU )GPGTCN.CPFMQOOKUUCTKCVU KO )TQ­JGT\QIVWO$CFGPDCFKUEJGT)GJGKOGT4CVCW­GTQTFGPVNKEJGT)GUCPFVGT WPFDGXQNNO·EJVKIVGT/KPKUVGTDGKFGT4GRWDNKM(TCPMTGKEJ9KTMNKEJGT)GJGKOGT4CVOKV5KV\WPF5VKOOGKO DCFKUEJGP4CVUMQNNGIKWO.GKVGTFGTCWUY·TVKIGP#PIGNGIGPJGKVGPKO)TQ­JGT\QIVWO$CFGPDGTKGHKJP -CKUGT 0CRQN¾QP + KP HTCP\ÌUKUEJG &KGPUVG #PPCJOG FGT HTCP\ÌUKUEJGP 5VCCVUDÒTIGTUEJCHV   YWTFG GT \WO   &WE=*GT\QI?FG&CNDGTIGTJQDGPWPF\WOMCKUGTNKEJ5VCCVUTCVGTPCPPVYWTFGGT/KVINKGFFGTRTQXKUQTKUEJGP HTCP\ÌUKUEJGP 4GIKGTWPI 6CNNG[TCPF  DGXQNNO·EJVKIVGT /KPKUVGT (TCPMTGKEJU DGKO 9KGPGT -QPITG­     2TGOKGTOKPKUVGTWPF2CKTXQP(TCPMTGKEJWPF DKU )GUCPFVGTKO-ÌPKITGKEJ2KGOQPV5CTFKPKGP'TYCT XGTJGKTCVGV OKV /CTKG 2GNNGITKPG $TKIPQNG 5CNG   GKPGT 2CNCUVFCOG FGT HTCP\ÌUKUEJGP -CKUGTKP /CTKG  .QWKUGUKGJCVVGPGKPG6QEJVGT/CTKG.QWKUG2GNNKPG UQ &CNDGTIYWTFGCW­GTFGOD\YXQP-ÌPKI .WFYKI :8+++ FCU )TQ­MQTFQP D\Y )TQ­MTGW\ FGU -ÌPKINKEJGP 1TFGPU FGT 'JTGPNGIKQP XGTNKGJGP PCEJFGO GT   UEJQP  /KVINKGF FGT 'JTGPNGIKQP IGYQTFGP YCT  JCV KJO .WFYKI :8+++ FGP 1TFGP XQO *N )GKUV   XGTNKGJGP&GU9GKVGTGPJCVGTFCU)TQ­MTGW\FGU1TFGPUFGUJN(GTFKPCPFWPFHÒT8GTFKGPUVFGU-ÌPKITGKEJU $GKFGT5K\KNKGPGTJCNVGP  &GTGKPMNCUUKIG*CWUQTFGPYWTFGCO,WPKFWTEJ/CTMITCH-CTN+++9KNJGNOXQP$CFGP&WTNCEJIGUVKHVGV  YWTFG FGT 1TFGPUUVGTP IGUEJCHHGP  YWTFG FGT 1TFGP XQO -WTHÒTUVGPVWO ÒDGTPQOOGP \WP·EJUV   \YGKMNCUUKI )TQ­MTGW\ WPF -QOOCPFGWT   XQO )TQ­JGT\QIVWO ÒDGTPQOOGP CD  HQTOCN FTGKMNCUUKI  

4KVVGTMTGW\ FCU PKG CWUIGIGDGP YWTFG  CD  YKGFGT GKPMNCUUKI  YWTFG FCU 2TKP\GUUKPGPMTGW\ IGUVKHVGV   5GKVFGO'PFGFGU)TQ­JGT\QIVWOUGZKUVKGTVGTCNU*CWUQTFGPYGKVGT

17


DEUTSCHE STAATEN

9002 (1:1)

$#;'40-74(ª456'067/ $+5 70&-¤0+)4'+%*   

8GTFKGPUVQTFGP FGT $C[GTKUEJGP -TQPG $TWUVUVGTP \WO -QOVWTMTGW\ D\Y )TQ­MQOVWTMTGW\ UGKV    &WTEJOGUUGTOO5KNDGTDTKNNCPVKGTVWPFTGRGTEKGTVCWHFGT4ÒEMUGKVGXGTIQNFGV#WHNCIGP )QNFVGKNYGKUGDTKNNCPVKGTVVGKNYGKUGHGKPUVITCXKGTVGOCKNNKGTVCWHFGT4ÒEMUGKVG*GTUVGNNGTDG\GKEJPWPI FGT*QHMWPUVCPUVCNV,CEQD.GUGTKP5VTCWDKPICP0CFGN5KNDGTXGTIQNFGVCWHFGT+PPGPUGKVG5KNDGTRWP\G $9-1'- +p++  -NGPCW KP)-.5 IKDVHÒTFGP<GKVTCWOXQPDKU,WPKPWT8GTNGKJWPIGPCP)GUVKHVGVXQP-ÌPKI /CZKOKNKCP + ,QUGRJ OKV )GUGV\ XQO  /CK  CNU %KXKN8GTFKGPUV1TFGP FGT $C[GTKUEJGP -TQPG KP FTGK   -NCUUGP&KGDGTGKVUDGUVGJGPFG%KXKN8GTFKGPUVOGFCKNNGKP)QNFWPF5KNDGTYKTFFGO1TFGPCHHKNKKGTVYKTFFKG -NCUUGFGT)TQ­MQOVWTGGKPIGHÒJTV/KVUGKPGT8GTNGKJWPIYCTFGTRGTUÌPNKEJG#FGNOKVFGT$G\GKEJPWPI4KVVGTXQP XGTDWPFGP/KVFGT#DFCPMWPI-ÌPKI.WFYKIU+++KO0QXGODGTYWTFGPFKG8GTNGKJWPIGPGKPIGUVGNNV

9003 (1:1) 9004

9004



8GTFKGPUVQTFGP XQO JGKNKIGP /KEJCGN  /QFGNN   /KPKCVWT FGU 4KVVGTMTGW\GU D\Y  

 4KVVGTMTGW\GU-NCUUG)QNFGOCKNNKGTVI +p++





8GTFKGPUVQTFGP XQO JGKNKIGP /KEJCGN  /QFGNN   -TGW\  -NCUUG 5KNDGT XGTIQNFGV     WPFGOCKNNKGTVOKVUEJÌPGT2CVKPCCOPGWGP$CPF$9-1'- +p++



1DGUUKEJJKGTDGKWOGKP\GKVIGPÌUUKUEJQFGTUR·VGTXGTIQNFGVGU'ZGORNCTJCPFGNVMCPPNGKFGTPKEJVOKV5KEJGTJGKV HGUVIGUVGNNV YGTFGP &GT WTURTÒPINKEJ  XQP ,QUGRJ %NGOGPU XQP $C[GTP -WTHÒTUV WPF 'T\DKUEJQH XQP -ÌNP   IGUVKHVGVG /KEJCGNU1TFGP YWTFG  WPFUEJNKG­NKEJPCEJWPFPCEJKPFGPFTGKMNCUUKIGP )TQ­MTGW\ 4KVVGT'JTGPTKVVGT 4KVVGT*CWU1TFGPXQOJGKNKIGP/KEJCGNWOIGHQTOV&KGUGPYCPFGNVGUEJNKG­NKEJ-ÌPKI.WFYKI+ CO  ,CPWCT  KP FGP FTGKMNCUUKIGP )TQ­MTGW\ -QOVWT 4KVVGT  8GTFKGPUVQTFGP XQO JN /KEJCGN WO    YWTFGPCNUPGWG-NCUUGFKG)TQ­MQOVWTGGKPIGHÒJTVYWTFGFGT1TFGPPGWQTICPKUKGTVWPFWOHC­VGPWPOGJT )TQ­MTGW\-NCUUGOKVWPFQJPG5VGTP-NCUUG OKV-TQPG 8GTFKGPUVMTGW\WPF5KNDGTPG8GTFKGPUVOG FCKNNG  MCOGP FKG $TQP\GPG 8GTFKGPUVOGFCKNNG WPF  FKG  -NCUUG QJPG -TQPG  WPF FCU 8GTFKGPUVMTGW\   OKV-TQPGJKP\W/KVFGT#DFCPMWPI-ÌPKI.WFYKIU+++KO0QXGODGTYWTFGPFKG8GTNGKJWPIGPGKPIGUVGNNV

8IN CWEJ 6TQUV .WFYKI &KG )GUEJKEJVG FGU 5V /KEJCGNU1TFGPU KP$C[GTPWPFFGT5V/KEJCGNU$TWFGTUEJCHV UGKVFGO,CJTGDKUCWHFKG)GIGPYCTV/ÒPEJGPWPF.GKR\KI 

18


DEUTSCHE STAATEN

9007

9005 9006 (1:1)



'T\DTWFGTUEJCHV FGU JN /KEJCGN \W $GTI CO .CKO KP /ÒPEJGP 5KNDGTPG $TWFGTUEJCHVUOGFCKNNG   5KNDGTQJPG$CPF +++





/KNKV·T8GTFKGPUVQTFGP /KNKV·T8GTFKGPUVMTGW\ QJPG 5EJYGTVGT  FGU /KNKV·T8GTFKGPUVQTFGPU    /QFGNN GKPUVWHKI OKV GOCKNNKGTVGP #TOGP    5KNDGT /GFCKNNQPU )QNF GOCKNNKGTV PCJG\W   WPUKEJVDCTGT %JKR CO 4CPF FGT 4ÒEMUGKVG FGU QDGTGP -TGW\CTOGUCOCNVGP&TGKGEMUDCPF$9- 1'- +p++



&GT \WP·EJUV HÒPHMNCUUKIG 1TFGP OKV CHHKNKKGTVGO /KNKV·T8GTFKGPUVMTGW\ YWTFG XQP -ÌPKI .WFYKI ++ CO  ,WNK   IGUVKHVGV'TGTHWJTKO.CWHGUGKPGU$GUVGJGPUOGJTGTG8GT·PFGTWPIGPWPF'TYGKVGTWPIGP     WPF   #D  DGUVCPF GT CWU  -NCUUGP FKG OGKUV KP OGJTGTG )TCFG WPVGTVGKNV YCTGP  

)TQ­MTGW\-NCUUG-NCUUGOKVWPFQJPG5VGTP1HHK\KGTUMTGW\4KVVGTWPF-NCUUGOKVWPFQJPG-TQPG  WPF FGO CHHKNKKGTVGP FTGKMNCUUKIGP /KNKV·T8GTFKGPUVMTGW\ OKV WPF QJPG -TQPG #D  MQPPVGP CNNG -NCUUGP OKV   5EJYGTVGTPWPFCDCWEJFKG-NCUUGWPFFCU)TQ­MTGW\CNU*ÌJGTUVWHWPIOKVFGT-TQPGXGTNKGJGPYGT FGP/KVFGO6JTQPXGT\KEJV-ÌPKI.WFYKIU+++KO0QXGODGTGTNQUEJCWEJFGT1TFGP



5V 'NKUCDGVJ1TFGP 5KNDGTPG 'TKPPGTWPIU/GFCKNNG CWH FCU L·JTKIG $GUVGJGP FGU 1TFGPU    PKEJVVTCIDCT5KNDGTOKV5VGORGNUEJPGKFGTUKIPCVWT#$ę45%*)$* 44+p



.CWV)GDJCTFV KP)$*5 YWTFGPXQPFKGUGT/GFCKNNGKO1MVQDGTPWT/GFCKNNGPIGRT·IVFKGCPFKG 1TFGPUFCOGPCWUIGIGDGPYWTFGP

9008 (1:1)



9009 (1:1)

/KNKV·T8GTFKGPUVOGFCKNNG D\Y CD /·T\   6CRHGTMGKVUOGFCKNNG  /QFGNN OKV 2QTVTCKV XQP   -ÌPKI/CZ+,QUGRJCD #WUHÒJTWPI ITÌ­GTGT-QRHOKV5VGORGNUEJPGKFGTUKIPCVWT,4+'5 EC  )QNFGPG /GFCKNNG 5KNDGT XGTIQNFGV &WTEJOGUUGT  OO &KEMG  OO   )GYKEJV  I OKV VTQRHGPHÌTOKIGT ¤UG KO 4CPF RWP\KGTV  WPF *CNDOQPF PCEJ NKPMU   8GTIQNFWPIUVCTMDGTKGDGPOGJTGTG4CPFFGNNGPQJPG$CPF$9-1'- +++



8QP *GUUGPVJCN WPF 5EJTGKDGT IGDGP KP *5 5  CP FC­ XQP FGT 5KNDGT XGTIQNFGVGP #WUHÒJTWPI KPUIGUCOV    'ZGORNCTGIGRT·IVYQTFGPUKPF



/KNKV·T8GTFKGPUVOGFCKNNG D\Y CD /·T\   6CRHGTMGKVUOGFCKNNG  /QFGNN OKV 2QTVTCKV XQP   -ÌPKI/CZ+,QUGRJCD #WUHÒJTWPI MNGKPGTGT-QRHQJPG5VGORGNUEJPGKFGTUKIPCVWT EC  5KNDGTPG /GFCKNNG &WTEJOGUUGT  OO 5KNDGT  I CWH FGT 8QTFGTUGKVG GKPKIG   4CPF(GJNRT·IGUVGNNGPCWHFGT4ÒEMUGKVGHGJNVGKP6GKNFGU5EJYCP\GUWPVGTJCNDFGUNKPMGP*KPVGTNCWHGU OKVFÒPPGT(NCEJFTCJVÌUGQJPG$CPFTKPIWPFQJPG$CPF$9-*5++0+1'- ++



8GTNKGJGPGU 'ZGORNCT CWU FGO &GWVUEJ(TCP\ÌUKUEJGP -TKGI  5R·VG 2T·IWPI WO  FC GKP 6GKN FGU   5EJYCP\GU WPVGT FGO NKPMGP *KPVGTNCWH HGJNV 0KOOGTIWV UEJTGKDV KP 0+ 5   FC­ GU HÒT FKGUG #WUHÒJTWPI   QHHGPUKEJVNKEJ\YGKXGTUEJKGFGPG4ÒEMUGKVGPUVGORGNIKDVFKGUKEJIGTKPIHÒIKIWPVGTUEJGKFGP WCFWTEJFKGIGTKPI HÒIKI WPVGTUEJKGFNKEJG 5EJYCP\UEJNCWHG FGU .ÌYGP  .CWV *GUUGPVJCNWPF5EJTGKDGT KP*55 UKPFXQPFKGUGT #WUHÒJTWPIXQPDKUPWT'ZGORNCTGIGRT·IVYQTFGP

19


DEUTSCHE STAATEN

9010 9012 (1:1)

9012 (1:1)



/KNKV·T&KGPUVCWU\GKEJPWPI &KGPUVCWU\GKEJPWPIUMTGW\  -NCUUG HÒT ::+8 &KGPUVLCJTG CO MWT\GP   $CPFUVÒEM$9-1'- ++





-QPXQNWV XQP  #WU\GKEJPWPIGP WPF #D\GKEJGP FGU -ÌPKITGKEJGU WPF FGU (TGKUVCCVGU $C[GTP   &CTWPVGTOGJTGTG(GWGTYGJT'JTGP\GKEJGP/GFCKNNGPHÒTNCPIL·JTKIG6TGWG/KVCTDGKVFGU-WTCVQTKWOU FGT$C[GTKUEJGP#TDGKVIGDGTUEJCHVHÒTWPF,CJTG LGYGKNUOKV/KPKCVWTWPF4GXGTUUEJNGKHEJGP KP 'VWKU  )QNFGPGU 5KNDGTPGU WPF $TQP\GPGU .GKUVWPIUCD\GKEJGP FGU 1DGTRH·N\GT 5EJÒV\GPDWPFGU KP   5EJYCPFQTHCP0CFGNP8GTUEJKGFGPG/GFCKNNGPVGKNUXGTIQNFGVVGKNUXGTUKNDGTVVGKNUCP$·PFGTPVGKNU CP0CFGNPKPQTFGPVNKEJGP'TJCNVWPIGP&C\W\YGKGOCKNNKGTVG5EJÒV\GP-NGKPCD\GKEJGPCP0CFGNP  5VÒEM++



$4#705%*9'+)*'4<1)67/ $+5  

*GT\QINKEJ$TCWPUEJYGKIKUEJGT1TFGP*GKPTKEJFGU.ÌYGP4KVVGTMTGW\-NCUUG  5KNDGT GOCKNNKGTVIHGKPUVG'OCKNNGOCNGTGK#WUHÒJTWPIOKVCDIGUEJPKVVGPGO2HGTFGUEJYCP\PCEJWPVGP COPKEJVICP\MQTTGMVGPUEJOCNGP$CPF$9-1'- ++



-NGPCWHÒJTVKPUGKPGT6[RQNQIKG KP)-.5++ FKGUGP/GFCKNNQPV[RWUPKEJVCWH#WEJCWHITWPFXQP&GVCKNWP VGTUEJKGFGP KP FGT )GUVCNVWPI XQP -TQPG WPF .ÌYG FÒTHVG GU UKEJ JKGTDGK WO GKPGP DKUJGT PKEJV KFGPVKHK\KGTVGP   *GTUVGNNGTJCPFGNP

9013



9014

*GT\QINKEJ$TCWPUEJYGKIKUEJGT1TFGP*GKPTKEJFGU.ÌYGP4KVVGTMTGW\-NCUUG  5KNDGT GOCKNNKGTV 'OCKNNGOCNGTGK FTGK #TOG FGU #XGTUGU TGUVCWTKGTV =VJTGG CTOU QH VJG HTQPV UKFG TGUVQTGF?   #DRNCV\WPIGP KP FGT TQVGP 'OCKNNG FGT -TQPG =UQOG GPCOGN FCOCIGU? CO UR·VGTGP $CPF $9-    1'- +++



'ZGORNCTFGT#WMVKQP(TKV\4WFQNH-ÒPMGT1UPCDTÒEM0T

 20

*GT\QINKEJ$TCWPUEJYGKIKUEJGT1TFGP*GKPTKEJFGU.ÌYGP'JTGP\GKEJGP-NCUUGKP5KNDGT   5KNDGTCOPGWGP$CPF$9-1'- ++




DEUTSCHE STAATEN

9015 (1:1)

*#0018'4-74(ª456'067/ $+5 70&-¤0+)4'+%*   

9CVGTNQQ/GFCKNNG #WUHÒJTWPI QJPG 5VGORGNUEJPGKFGTPCOGP   5KNDGT OKV 4CPFKPUEJTKHV   *75#4 #0& 5%*9#4< 24+0< 4')'06*75#4'0 OKV QTKIKPCNGO $CPFTKPI CO CNVGP   $CPF$9-1'- 44++



+PFKGUGT#WUHÒJTWPIXQPCNNGTITÌ­VGT5GNVGPJGKV&CU5VÒEMGPVURTKEJVKPCNNGP&GVCKNU CW­GTFGT4CPFKPUEJTKHV FGO DGK0KOOGTIWV KP0+5 DGUEJTKGDGPGPWPFCDIGDKNFGVGP'ZGORNCT0T&CU*QHWPF5VCCVU*CPFDWEJ HÒT FCU -ÌPKITGKEJ *CPPQXGT CWHFCU,CJT *CPPQXGTQJPG,CJTGUCPICDG  59CVGTNQQ/GFCKNNG  HÒJTV FC\W CWU +P FGT <GKV XQP  YWTFGP 0CEJHGTVKIWPIGP HÒT XGTNQTGPIGICPIGPG 'ZGORNCTG XQO *QH   $TQP\GHCDTKMCPVGP%$GTPUVQTHH'KEJYGFGKP*CPPQXGTJGTIGUVGNNV#WHVTCIIGDGTYCTFKG*CPPQXGTUEJG)GPGTCN #FLWVCPVWT.CWV6JKGUWPF*CRMG KP6*0T YWTFGPPWT5VÒEMGCWUIGIGDGP

9016 (1:1)

*'55'0 &#4/56#&6  70& $'+ 4*'+0 .#0&)4#(5%*#(6 $+5     70&)4155*'4<1)67/   

)TQ­JGT\QINKEJ *GUUKUEJGT 8GTFKGPUV1TFGP 2JKNKRRU FGU )TQ­OÒVJKIGP D\Y )TQ­JGT\QINKEJ   *GUUKUEJGT 2JKNKRRU1TFGP  /QFGNN   OKV FGT $ÒUVG FGU .CPFITCHGP 2JKNKRR  -QOVWT   MTGW\)QNFGOCKNNKGTVI OKV*CNUDCPF FGTTÒEMUGKVKIG.ÌYGKPVCMVCO*CNUDCPFKOQTKIKPCNGP QMCIQPCNGPIQNFHCTDGPDGFTWEMVGP8GTNGKJWPIUGVWKOKVPKEJVICP\RCUUGPFGTLGFQEJQTKIKPCNGT'KPNCIG $9-1'- +p++  8GTNKGJGPCPFGP-CRKV·P\WT5GG,QJCPP%JTKUVKCP9KNJGNO$GTVTCOUR·VGT-QPVTGCFOKTCNOKNKV·TKUEJGU/KVINKGF FGU 4GKEJUOKNKV·TIGTKEJVU 7TMWPFGP0CEJNC­ UKGJG -CV 0T   )GUVKHVGV CO  /CK  XQP )TQ­JGT\QI    .WFYKI++CNUXKGTMNCUUKIGT8GTFKGPUVQTFGP )TQ­MTGW\-QOVWTGWPF-NCUUG4KVVGT YWTFGFGT1TFGP ITWPFNGIGPF KP UGKPGT )GUVCNVWPI XGT·PFGTV WPF KP FGP ,CJTGP    WPF  GTHQNIVGP YGKVGTG   8GT·PFGTWPIGP  XGTHÒIVG FGT 1TFGP ÒDGT KPUIGUCOV UGEJU -NCUUGP )TQ­MTGW\ -QOVWT  WPF  -NCUUG   'JTGPMTGW\ 4KVVGT  WPF  -NCUUG  WPF GKPGO CHHKNKKGTVGP 5KNDGTPGP -TGW\ FKG CNNG CW­GT FGO 'JTGPMTGW\ CNU   *ÌJGTUVWHWPI OKV -TQPG XGTNKGJGP YGTFGP MQPPVGP 5·OVNKEJG -NCUUGP MQPPVGP CWEJ OKV 5EJYGTVGTP XGTNKGJGP   YGTFGP/KVFGO7PVGTICPIFGT/QPCTEJKGKO0QXGODGTGTNQUEJCWEJFGT1TFGP

21


DEUTSCHE STAATEN

9018

9017 (1:1)

9019 (1:1)



)TQ­JGT\QINKEJ *GUUKUEJGT 8GTFKGPUV1TFGP 2JKNKRRU FGU )TQ­OÒVJKIGP D\Y )TQ­JGT\QINKEJ   *GUUKUEJGT2JKNKRRU1TFGP/QFGNN OKVFGT$ÒUVGFGU.CPFITCHGP2JKNKRR 4KVVGTMTGW\ D\Y CD 4KVVGTMTGW\-NCUUGOKV5EJYGTVGTP CD )QNFGOCKNNKGTVIPCJG\WWPUKEJV DCTG'OCKNNGMTCV\GTEJGPFKG5EJYGTVGTMNKPIGPIGRT·IVWPFIGUVGEMVFKG5EJYGTVGTITKHHGCNVGTI·P\VF JGKP\GNPITCXKGTV  WPFCWHIGNÌVGVTÒEMUGKVKIGT.ÌYGKPVCMVCOPGWGP$CPFCDUEJPKVV 44++ 



)TQ­JGT\QINKEJ *GUUKUEJGT 8GTFKGPUV1TFGP 2JKNKRRU FGU )TQ­OÒVJKIGP D\Y )TQ­JGT\QINKEJ   *GUUKUEJGT 2JKNKRRU1TFGP CD    /QFGNN   NGGTGU 'VWK \WO 4KVVGTMTGW\ + -NCUUG   TGEJVGEMKIG#WUHÒJTWPICWUFGT4GIKGTWPIU\GKVXQP)TQ­JGT\QI'TPUV.WFYKI TGIXQPDKU  UEJYCT\OKVIQNFHCTDGPGO9CRRGPCWHFTWEM ++



'ZGORNCTFGT#WMVKQP(TKV\4WFQNH-ÒPMGT1UPCDTÒEM0T



'TKPPGTWPIU\GKEJGP HÒT $GFKGPUVGVG FGT 5VCCVUDCJPGP 4GFWMVKQP UQIGP *CNDOKPKCVWT  FGU   #D\GKEJGPUHÒT,CJTGZOO5KNDGTVGKNYGKUGXGTIQNFGVCP0CFGN ++



9020 (1:1)

*'55'0 -#55'.  .#0&)4#(5%*#(6 $+5  70&  $+5   70&    -74(ª456'067/   

*CWU1TFGPXQO)QNFGPGP.ÌYGP/QFGNN OGJTMNCUUKI 4KVVGTMTGW\)QNFGOCKNNKGTV CWHFGT4ÒEMUGKVGKO/QPQITCOOOGJTGTGMNGKPG NGKEJVTGUVCWTKGTDCTG 'OCKNNGCWUDTÒEJGQJPG$CPF KOQTKIKPCNGP8GTNGKJWPIUGVWK$9-1'- ++  'ZGORNCT FGT #WMVKQP (TKV\ 4WFQNH -ÒPMGT  1UPCDTÒEM  0T  &GT 7PVGTUEJKGF \YKUEJGP FGP XQNN   MQOOGP INGKEJ CWUUGJGPF GTUEJGKPGPFGP 4KVVGTMTGW\GP FGU *CWU1TFGPU XQO )QNFGPGP.ÌYGPXQPDKU WPFFGU9KNJGNO1TFGPUXQPDKUNKGIVKO2TKP\KRKPFGT&CTUVGNNWPIFGU.ÌYGPKO8QTFGTUGKVGP/GFCKN NQP$GKOGTUVGTGPKUVFGT.ÌYGJGTCNFKUEJUVGKIGPFFCTIGUVGNNVFJFKGGKPG*KPVGTRHQVGKUVJÌJGTFCTIGUVGNNVCNUFKG CPFGTG*KPVGTRHQVGDGKOCPFGTGPGTUEJGKPVFGT.ÌYGJGTCNFKUEJUEJTGKVGPFFJDGKFG2HQVGPUKPFKPINGKEJGT*ÌJG FCTIGUVGNNV #NNGTFKPIU MQPPVG KP\YKUEJGP PCEJIGYKGUGP YGTFGP FC­ CWEJ 4KVVGTMTGW\G FKG WTURTÒPINKEJ HÒT FGP   *CWU1TFGP8GTYGPFWPIHCPFGPUR·VGTCNU4KVVGTMTGW\GFGU9KNJGNO1TFGPUXGTNKGJGPYQTFGPUKPF8QPDKU UKPFKPUIGUCOVPWT4KVVGTMTGW\GXGTNKGJGPYQTFGPYQXQPCDGTFKGCNNGTOGKUVGPPCEJFGO6QFFGT$GNKG JGPGP\WTÒEMIGIGDGPYQTFGPUGKPFÒTHVGP

22


DEUTSCHE STAATEN

9021

9022

9023



&KGPUVCWU\GKEJPWPIHÒT/KNKV·TRGTUQPGPXQO(GNFYGDGNCDY·TVU/QFGNN  &KGPUVCWU \GKEJPWPIUMTGW\HÒT&KGPUVLCJTG$TQP\GQJPG$CPF$9-1'- 44++





&KGPUVCWU\GKEJPWPIHÒT/KNKV·TRGTUQPGPXQO(GNFYGDGNCDY·TVU/QFGNN  &KGPUVCWU \GKEJPWPIUMTGW\HÒT&KGPUVLCJTG$TQP\GQJPG$CPFTKPIWPFQJPG$CPF$9-1'- 44++



5%*#7/$74).+22'(ª456'067/ $+5  

-TGW\ HÒT VTGWG &KGPUVG #WUICDG  #NVG <YGKVCPHGTVKIWPI FGU 5VGEMMTGW\GU $TQP\G XGTIQNFGV   NGKEJVIGYÌNDVCWHFGT4ÒEMUGKVGCNVG$TQUEJKGTWPIOKVFÒPPGTTWPFGT0CFGN ++

.CWV0KOOGTIWV KP0+50T KUVFKGUGU-TGW\PWTOCNCP/KVINKGFGTFGUHÒTUVNKEJGP*CWUGUXGTNKG JGPYQTFGP



9024



/GFCKNNG \WO L·JTKIGP ,WDKN·WO FGU  9GUVH·NKUEJGP +PHCPVGTKG4GIKOGPVU 0T  $TQP\G   OGJTGTG4CPFFGNNGPWPFMGTDGPQJPG$CPF 44++p+++



9025

9025 9025

/'%-.'0$74)564'.+6<*'4<1)67/ $+5 70&  )4155*'4<1)67/   

-TGW\HÒT#WU\GKEJPWPIKO-TKGIGHÒT(TCWGP5KNDGTCPFGTQTKIKPCNGP&COGPUEJNGKHGKOQTKIKPC NGP8GTNGKJWPIUGVWKFGT(KTOC,)QFGVW5QJPKP$GTNKPOKV/QPQITCOO#($9-1'- 44++

.CWV1JO*KGTQP[OWUUGP KP/565 YWTFGP\YKUEJGPWPFXQPFGT(KTOC)QFGVPWT'ZGO RNCTGKP5KNDGTJGTIGUVGNNV



23


DEUTSCHE STAATEN

ex 9027 9028

ex 9029

9026 (1:1)

1.&'0$74)*'4<1)67/ $+5 70&)4155*'4<1)67/   

)TQ­JGT\QINKEJ 1NFGPDWTIGT *CWU WPF 8GTFKGPUVQTFGP FGU *GT\QIU 2GVGT (TKGFTKEJ .WFYKI   1HHK\KGTUMTGW\ZOO5KNDGT8QTFGTUGKVGXGTIQNFGVGOCKNNKGTVICP0CFGNFKGUGCWH FGT +PPGPUGKVG OKV *GTUVGNNGTDG\GKEJPWPI FGT (KTOC $ -PCWGT KO QTKIKPCNGP 8GTNGKJWPIUGVWK $9-   1'- ++  .CWV$G[TGK­ KP$;15 YWTFGP1HHK\KGTUMTGW\GXGTNKGJGP





)TQ­JGT\QINKEJ 1NFGPDWTIGT *CWU WPF 8GTFKGPUVQTFGP FGU *GT\QIU 2GVGT (TKGFTKEJ .WFYKI   'JTGPMTGW\  -NCUUG  #WUHÒJTWPI 5KNDGT UGRCTCV IGRT·IVG /GFCKNNQPU CO $CPF \WUCOOGP OKV   ªDGTUGPFWPIUUEJTGKDGPFGU-TGW\GUHÒTFGP9GTMOGKUVGT*GPLGUCWU1NFGPDWTIFCVKGTV1NFGPDWTICO ,CPWCT\WUCOOGPOKVFGO8GTUCPFEQWXGTVFGT1TFGPUMCP\NGKOKV.CEMUKGIGNWPF<GKVWPIUCWU UEJPKVVÒDGTFKG8GTNGKJWPI 5VÒEM++



)TQ­JGT\QINKEJ 1NFGPDWTIGT *CWU WPF 8GTFKGPUVQTFGP FGU *GT\QIU 2GVGT (TKGFTKEJ .WFYKI   'JTGPMTGW\  -NCUUG OKV 5EJYGTVGTP  #WUHÒJTWPI )W­GKUGP IGUEJY·T\V  I OKV 4KPI  CO   QTKIKPCNGPCNVGP$CPF$9-1'- ++



<YGKHGNUHTGKGU1TKIKPCNGZGORNCTFGTGTUVGP#WUHÒJTWPIKP'KUGPIW­.CWV$G[TGK­ KP$;15 YWTFGPKPUIGUCOV 5VÒEMXGTNKGJGPFCXQPKO&GWVUEJGP-TKGIXQPXKGTWPFKO&GWVUEJ(TCP\ÌUKUEJGP-TKGI +O'TUVGP9GNVMTKGIGTHQNIVGPMGKPG8GTNGKJWPIGP



24

4QVG-TGW\/GFCKNNG  5KNDGTXGTIQNFGVVGKNYGKUGGOCKNNKGTVCWHFGT4ÒEMUGKVGRWP\KGTVCO NCPIGP$CPF\WUCOOGPOKV\WIGJÌTKIGT/KPKCVWTXGTIQNFGVWPFVGKNYGKUGGOCKNNKGTVCP$·PFEJGPKO 5EJ·EJVGNEJGPFGT(KTOC$GTPJ-PCWGTKP1NFGPDWTI\WUCOOGPOKVFGOªDGTUGPFWPIUUEJTGKDGP QFGT 8GTNGKJWPIUWTMWPFG! HÒT5EJYGUVGT/CTVC(KUUNGTKP+FCTFCVKGTVCO/CKOKV1TKIKPCNWPVGT UEJTKHVXQP1DGTUVWPF(NÒIGNCFLWVCPVX,QTFCP$9-1'- 5VÒEM++




DEUTSCHE STAATEN

9030

9031 ex 9034 9032



(TKGFTKEJ#WIWUV-TGW\-TGW\-NCUUG$TQP\GIGUEJY·T\VCP0CFGN$9-1'- ++





(TKGFTKEJ #WIWUV-TGW\ -TGW\  -NCUUG KP TGFW\KGTVGT #WUHÒJTWPI UQIGP 2TKP\GPITÌ­G   ZOO$TQP\GIGUEJY·T\V0CFGNDQEMOKV0CFGNCDIGDTQEJGP 4++





(TKGFTKEJ #WIWUV-TGW\ -TGW\  -NCUUG 'KUGP IGUEJY·T\V CO $CPF OKV $CPFURCPIG 814 &'/   ('+0&'KPFGTQTKIKPCNGP8GTNGKJWPIUVÒVGFGT(KTOC$GTPJ-PCWGT\WUCOOGPOKVFGT/KPKCVWTCO $·PFEJGPOKVFGT/KPKCVWT$CPFURCPIG814&'/('+0&'$9-1'- ++



(TKGFTKEJ#WIWUV-TGW\-TGW\-NCUUG'KUGPIGUEJY·T\V\WUCOOGPOKVJCPFIGUEJTKGDGPGT8GTNGK JWPIUWTMWPFGHÒT,QJCPP/CTKGPJQHHCWU<GVGN\WUCOOGPOKVFGO'JTGPMTGW\FGU9GNVMTKGIGU OKV8GTNGKJWPIUWTMWPFGCPFKGINGKEJG2GTUQP$9-1'- ++



(TKGFTKEJ#WIWUV-TGW\-TGW\-NCUUG'KUGPIGUEJY·T\VCPTQVDNCWGT&COGPUEJNGKHG\WUCOOGP OKV2JQVQMQRKGFGT8GTNGKJWPIUWTMWPFGHÒT)GTVTWF5EJ[OCPUMKCWU4ÒUVTKPIGPWPFFGUªDGTUGPFWPIU UEJTGKDGPFGU)TQ­JGT\QINKEJ1NFGPDWTIKUEJGP#OVUKP4ÒUVTKPIGPFC\WFKG/KPKCVWTUEJNGKHGOKVFGO /KPKCVWTMTGW\KO1TKIKPCNUEJ·EJVGNEJGPFGT(KTOC-PCWGT$9-1'- 5VÒEM++



(TKGFTKEJ#WIWUV-TGW\-TGW\-NCUUG'ZGORNCTG 'KUGPIGUEJY·T\VOKVWPDGPWV\VGO1TKIK PCNDCPF HÒT -·ORHGT KP FGT QTKIKPCNGP 8GTNGKJWPIUVÒVG XQP -PCWGT   'KUGP IGUEJY·T\V CP 'KPGT   $CPFURCPIGOKV$CPFHÒT-·ORHGT -TKGIUOGVCNNIGUEJY·T\VCOUR·VGTGP$CPF 'KUGPIGUEJY·T\V CO TQVDNCWGP $CPF HÒT 0KEJVM·ORHGT FC\W \YGK /KPKCVWTGP CO DNCWTQVGP WPF CO TQVDNCWGP $·PF   EJGP$9-1'- 5VÒEM++









9039 (1:1) 9036

9037

9038



-TKGIUXGTFKGPUVOGFCKNNG #P &COGPUEJNGKHG \WUCOOGP OKV 8GTNGKJWPIUWTMWPFG HÒT 6JGQFQTC $CTVJ   FCVKGTVCO,WPKWPF/KPKCVWTOGFCKNNGOKV$CPFUEJNGKHEJGP$9-1'- ++





5KNDGTPG/GFCKNNGFGU)TQ­JGT\QIRCCTGU\WT)QNFGPGP*QEJ\GKV0KEJVVTCIDCT&WTEJOGUUGTOO 5KNDGT CWH FGT 4ÒEMUGKVG &CVWOUITCXWT #WIWUV KO 1TKIKPCNGVWK FGT (KTOC $GTPJ  -PCWGTKP1NFGPDWTI ++





(CJPGPOGFCKNNGFGU1NFGPDWTIGT.CPFGUMTKGIGTXGTDCPFGU(ÒT/KVINKGFUXGTGKPGFKGKJTL·JTKIGU $GUVGJGPHGKGTP$TQP\GXGTIQNFGVCWHFGT4ÒEMUGKVG*GTUVGNNGTDG\GKEJPWPIFGT(KTOC1/CNNGTUVGFGKP 1NFGPDWTICPFGTQTKIKPCNGP$CPFUEJNGKHG 4++



24'755'0-¤0+)4'+%*   

4QVGT #FNGT1TFGP  /QFGNN OKV NKNCTQVGO #FNGT    /KPKCVWT FGU -TGW\GU  -NCUUG   )QNFGOCKNNKGTVIHGKPUVG'OCKNNGOCNGTGK +p++

 25


DEUTSCHE STAATEN

9040 (1:1)



4QVGT#FNGT1TFGP/QFGNN OKV\KGIGNTQVGO#FNGT -NGKPQF\WO)TQ­MTGW\Z  OO )QNF VGKNYGKUG HGKPUV IWKNNQEJKGTV ITCXKGTV WPF \KUGNKGTV GOCKNNKGTV  I OKV 4KPI  CWH   FGO 4CPF FGU TGEJVGP -TGW\CTOGU QDGTHN·EJNKEJG 2TÒHURWTGP CWH FGO 4CPF FGU WPVGTGP -TGW\CTOGU   4KV\OCTMG9FGU*GTUVGNNGTU9CIPGTKP$GTNKPOKVFGOQTKIKPCNGP\GKVIGPÌUUKUEJGPMQPHGMVKQPKGTVGP 5EJWNVGTDCPF$9-1'- +p  7TURTÒPINKEJ  XQP 'TDRTKP\ )GQTI 9KNJGNO XQP $TCPFGPDWTI$C[TGWVJ CNU GKPMNCUUKIGT 1TFGPFGNC5KPEGTKV¾ IGUVKHVGVYWTFGGTPCEJªDGTPCJOGFGT/CTMITCHUEJCHVFWTEJ2TGW­GPÒDGTPQOOGPWPFKO(QNIGPFGPUWM\GU UKXG FWTEJ \CJNTGKEJG PFGTWPIGP 'TI·P\WPIGP WPF 'TYGKVGTWPIGP GTJGDNKEJ CWUIGDCWV 'T XGTHÒIVG CO 5EJNW­   ÒDGT UGEJU -NCUUGP -GVVG )TQ­MTGW\  DKU  -NCUUG  XQP FGPGP FKG \YGKVG KP \YGK 5VWHGP WPVGTVGKNV YCT  OKV   GKPGT CHHKNKKGTVGP /GFCKNNG XQP FGPGP FKG +PUKIPKGP OKV \CJNTGKEJGP $GK\GKEJGP 5EJYGTVGT 5EJYGTVGT CO 4KPI   $TKNNCPVGP -TQPG 'KEJGPNCWD ,WDKN·WOU\CJN ,QJCPPKVGTMTGW\ 5EJYGTV WPF <GRVGT 'OCKNNGDCPF FGU -TQPGPQT   FGPU  -QODKPCVKQPGP OÌINKEJ  XGTNKGJGP YGTFGP MQPPVGP YCU \W GKPGT IGTCFG\W WPÒDGTUKEJVNKEJGP #TVGPXKGNHCNV   HÒJTVG/KVFGO'PFGFGT/QPCTEJKGKUVCWEJFGT1TFGPWPVGTIGICPIGP

9041 (1:1)



26

4QVGT #FNGT1TFGP  /QFGNN OKV \KGIGNTQVGO #FNGT    $TWUVUVGTP \WO )TQ­MTGW\ OKV   DNCWGOCKNNKGTVGT5EJTKHVHN·EJG &WTEJOGUUGTOOI5KNDGTXGTIQNFGV#WHNCIGP5KNDGTXGTIQN FGV/GFCKNNQP5EJTKHVDCPF)QNFGOCKNNKGTVHGKPUVG'OCKNNGOCNGTGKVGKNYGKUG)QNFUVCWDOCNGTGKCWHFGT 4ÒEMUGKVGWPVGTJCNDFGU0CFGNJCMGPU4KV\OCTMG9FGT(KTOC9CIPGTKP$GTNKPCP0CFGN$9- 1'- +p++ 


DEUTSCHE STAATEN

9042 (1:1)

9044 (1:1)

9045 (1:1)



4QVGT#FNGT1TFGP/QFGNN OKV\KGIGNTQVGO#FNGT /KPKCVWTFGU-TGW\GU-NCUUG ZOO  )QNFGOCKNNKGTVHGKPUVG'OCKNNGOCNGTGKQJPG$·PFEJGP +p++



4QVGT#FNGT1TFGP/QFGNN  NGGTGUTQVGU'VWK\WO-TGW\-NCUUG



4QVGT#FNGT1TFGP/QFGNN OKV\KGIGNTQVGO#FNGT /KPKCVWTFGU-TGW\GU-NCUUG )QNF GOCKNNKGTV HGKPUVG 'OCKNNGOCNGTGK <WUCOOGP CP <YGKGTUEJPCNNG OKV &·PGOCTM  &CPPGDTQI   1TFGP  /QFGNN#WUICDG OKV/QPQITCOO-ÌPKI%JTKUVKCP+: 4KVVGTMTGW\)QNF GOCKNNKGTVQJPG0CFGN 5VÒEM++



-ÌPKINKEJGT -TQPGP1TFGP  /QFGNN OKV TWPFGT UQIGP JGTCNFKUEJGT -TQPG  EC    /KPKCVWTFGU-TGW\GU-NCUUGZOO  5KNDGTXGTIQNFGVWPFGOCKNNKGTVQJPG$·PFEJGP ++





++

 

8QP-ÌPKI9KNJGNO+CWU#PNC­UGKPGT-TÌPWPIIGUVKHVGV'TXGTHÒIVGÒDGTXKGT-NCUUGPXQPFGPGPFKG \YGKVGKP\YGK5VWHGPWPVGTVGKNVYCTOKVGKPGTCHHKNKKGTVGP8GTFKGPUVOGFCKNNG&KG+PUKIPKGPMQPPVGPOKV\CJNTGKEJGP $GK\GKEJGP 5EJYGTVGT5EJYGTVGTCO4KPI$TKNNCPVGP,WDKN·WOU\CJN)GPHGT-TGW\'OCKNNGDCPFFGU4QVGP#FNGT 1TFGPU  -QODKPCVKQPGP OÌINKEJ  XGTNKGJGP YGTFGP YCU ·JPNKEJ YKG DGKO 4QVGP #FNGT1TFGP \W GKPGT ITQ­GP   #TVGPXKGNHCNVHÒJTVG/KVFGO'PFGFGT/QPCTEJKGKUVCWEJFKGUGT1TFGPWPVGTIGICPIGP

9046 (1:1)

9046 (1:1) 9047 (1:1)



-ÌPKINKEJGT -TQPGP1TFGP  /QFGNN OKV ITQ­GT RTGW­KUEJGT -TQPG  EC   -TGW\    -NCUUG )QNF GOCKNNKGTV QJPG $CPFTKPI  I KO /GFCKNNQPHGNF FGT 4ÒEMUGKVG OKP 'KPFGNNWPI   CWH FGO <[NKPFGT *GTUVGNNGTRWP\G 59 FGT (KTOC 5[ WPF 9CIPGT KP $GTNKP QJPG 5EJWNVGTDCPF   $9-1'- +p++  8GTNKGJGPCO&G\GODGTCP4KEJCTF/CZKOKNKCP&CNDGTI#EVQPPF$CTQP#EVQP  MIN$TKVK UEJGTFKGPUVVWGPFGT-COOGTJGTT'Z#WMVKQP1TFGTU&GEQTCVKQPU/GFCNUCPF/KNKVCTKCDGK&KZ0QQPCP9GDDKP .QPFQPCO,WNK -CV0T \WUCOOGPOKVYGKVGTGP1TFGPUKPUKIPKGPCWUFGO$GUKV\FGT(COKNKG#EVQP 5KGJG CWEJ -CVCNQI 0T      &T 2GVGT 5CWGTYCNF -CCTUV UGK HÒT FKG $GUV·VKIWPI FGT   8GTNGKJWPITGEJVJGT\NKEJIGFCPMV 



-ÌPKINKEJGT -TQPGP1TFGP  /QFGNN OKV ITQ­GT RTGW­KUEJGT -TQPG  EC   -TGW\    -NCUUG )QNF GOCKNNKGTV  I OKV $CPF  CWH FGO 4CPF FGU WPVGTGP -TGW\CTOU 4KV\OCTMG 9   FGT (KTOC 9CIPGT KP $GTNKP CO*CNUDCPFKOQTKIKPCNGPUEJYCT\GP8GTNGKJWPIUGVWKOKV/QPQITCOO -ÌPKI9KNJGNOU++$9-1'- +p++



8GTNKGJGPCO,CPWCTCPFGP-CRKV·P\WT5GGWPFUR·VGTGP-QPVGTCFOKTCN,QJCPP%JTKUVKCP9KNJGNO$GT VTCOOKNKV·TKUEJGU/KVINKGFFGU4GKEJUOKNKV·TIGTKEJVU 7TMWPFGP0CEJNC­UKGJG-CV0T 



-ÌPKINKEJGT -TQPGP1TFGP  /QFGNN OKV ITQ­GT RTGW­KUEJGT -TQPG  EC   NGGTGU   UEJYCT\GU'VWK=GORV[ECUG?\WO-TGW\-NCUUGFWPMGNDTCWPOKVDNCWGT5COVGKPNCIGOKVIQNFHCTDG PGO/QPQITCOO-ÌPKI9KNJGNOU++ ++

 27


DEUTSCHE STAATEN

9049 (1:1)



-ÌPKINKEJGT-TQPGP1TFGP/QFGNN OKVITQ­GTRTGW­KUEJGT-TQPGEC /KPKCVWTFGU -TGW\GU-NCUUGZOO)QNFGOCKNNKGTVIQJPG$·PFEJGP +p++



9050 (1:1)



-ÌPKINKEJGT -TQPGP1TFGP  /QFGNN OKV ITQ­GT RTGW­KUEJGT -TQPG  EC   -TGW\   -NCUUGOKVFGO)GPHGT-TGW\)QNFGOCKNNKGTVIWPVGTGT-TGW\CTONGKEJVPCEJJKPVGPIGDQIGP CWH FGUUGP 8QTFGTUGKVG PCJG\W WPUKEJVDCTG 'OCKNNGTGRCTCVWT CWH FGO 5EJTKHVTKPI FGU TÒEMUGKVKIGP   /GFCKNNQPTKPIGDGPHCNNUPCJG\WWPUKEJVDCTG'OCKNNGTGRCTCVWTQJPG$CPF$9-1'- ++  <YGKHGNUHTGKGU \GKVIGPÌUUKUEJ IGHGTVKIVGU QTKIKPCNGU 'ZGORNCT FGUUGP ITQ­G 5GNVGPJGKV CWEJ PKEJV FWTEJ FKG GTJCN   VWPIUO·­KIGP 'KPUEJT·PMWPIGP PKEJV YGUGPVNKEJ DGGKPVT·EJVKIV YKTF 8GTNKGJGP CP /CZKOKNKCP )TCH XQP WPF \W   #TEQ8CNNG[  MIN$C[GTKUEJG-·OOGTGT)TQ­MCP\NGTFGU-ÌPKINKEJ$C[GTKUEJGP/KNKV·TKUEJGP*CWU TKVVGTQTFGPUXQOJGKNKIGP)GQTI5EJYKGIGTXCVGTXQP,QJP'OGTKEJ'FYCTF&CNDGTI#EVQPUV$CTQP#EVQP   'Z#WMVKQP1TFGTU&GEQTCVKQPU/GFCNUCPF/KNKVCTKCDGK&KZ0QQPCP9GDDKP.QPFQPCO,WNK

FQTVCPIGDQVGPCNUCP&QTQVJ[.[QP&CNDGTI#EVQP.CF[#EVQP  XGTNKGJGP  -CV0T \WUCOOGP OKVYGKVGTGP1TFGPUKPUKIPKGPCWUFGO$GUKV\FGT(COKNKG#EVQP5KGJGCWEJ-CVCNQI0T  &T2GVGT5CWGTYCNF-CCTUVUGKHÒTFKG$GUV·VKIWPIFGT8GTNGKJWPITGEJVJGT\NKEJIGFCPMV <WT)GUEJKEJVG FKGUGT #WU\GKEJPWPI XIN -NKGVOCP -WTV) &GT -ÌPKINKEJG -TQPGP1TFGP &TKVVGT WPF 8KGTVGT -NCUUG OKV FGO   4QVGP-TGW\+P+0(10T  57PF)GKNG9KNNK+O)GKUVGFGU*GPT[&WPCPV0+0(10T

 5

9052 9053 9051







-ÌPKINKEJGT -TQPGP1TFGP  /QFGNN OKV ITQ­GT JGTCNFKUEJGT RTGW­KUEJGT -TQPG  EC     -TGW\-NCUUG$TQP\GXGTIQNFGV/GFCKNNQPU)QNFVGKNYGKUGGOCKNNKGTVCWHFGOWPVGTGP4CPF4KV\ OCTMG(4FGT(KTOC(TKGFN·PFGTKP$GTNKPCO$CPF$9-1'- ++



-ÌPKINKEJGT *CWUQTFGP XQP *QJGP\QNNGTP 0CEJHGTVKIWPI =VC[NQT U EQR[? FGU 4KVVGTMTGW\GU OKV   5EJYGTVGTP\YKUEJGPWPF5KNDGT5EJYGTVGT$TQP\GXGTIQNFGVWPFGOCKNNKGTVHGKPUVG'OCKN NGOCNGTGKCWHFGO4CPFFGUWPVGTGP-TGW\CTOU5KNDGTUVGORGNQJPG$CPF ++



-ÌPKINKEJGT*CWUQTFGPXQP*QJGP\QNNGTP#FNGTFGT+PJCDGT#WUHÒJTWPIOKVDTGKVGTMWIGNHÌTOKIGT ¤UG  5KNDGTVGKNYGKUGGOCKNNKGTVCOCNVGPQTKIKPCNGP$CPF$9-1'- ++



<YGKHGNUHTGKGU1TKIKPCNGZGORNCT

 28

1TFGPRQWTNGO¾TKVG$CPF\WO*CNUMTGW\#PHGTVKIWPIPCEJLGFQEJPKEJVPGWOODTGKVEC OONCPIWPMQPHGMVKQPKGTV ++




DEUTSCHE STAATEN

9055 (1:1)



#FNKIGU (T·WNGKPUVKHV 5V /CTKGP \W .KRRUVCFV 2TQXKP\ 9GUVHCNGP  $TWUVUVGTP FGT -CPQPKUUGP   IGUVKEMVG #WUHÒJTWPI  Z  OO )QNF WPF 5KNDGTNCCP5VKEMGTGK 2CKNNGVVGP FKG 5VTCJNGP FGU   5VGTPUCWU5KNDGTDNGEJTÒEMUGKVKI2CRKGTCDFGEMWPI*2 44++ 

&CU5VKHV5V/CTKGP\W.KRRUVCFVKUVPKEJV\WXGTYGEJUGNPOKVFGOKP%CRRGNJGWVGGKPGO5VCFVVGKNXQP.KRRUVCFV CPIGUKGFGNVGP WPF DKU  DGUVGJGPFGP &COGPUVKHVU %CRRGN &CU 5VKHV 5V /CTKGP \WP·EJUV CW­GTJCND FGT 5VCFV   .KRRUVCFV IGNGIGP YWTFG  XQP )TCH $GTPJCTF ++ \WT .KRRG WO   CNU #WIWUVKPGT%JQTHTCWGPUVKHV   IGITÒPFGV)TCH$GTPJCTF+8\WT.KRRG  XGTNGIVGFCU-NQUVGTKPFKG5VCFV0CEJFGT4GHQTOCVKQP YWTFGFCU-NQUVGTKPGKPYGNVCFGNKIGU(T·WNGKPUVKHV HTGKLÒPHGTNKEJGU5COOVUVKHV OKVGKPGO2TQRUVWPF2T·DGPFGP WOIGYCPFGNV&KG5VCFVYWTFGKP(QNIGFGU8GTVTCIGUXQP-NGXGXQP\WGKPGO-QPFQOKPKWOFGU-WTHÒTUVGP VWOU $TCPFGPDWTI WPF FGT )TCHUEJCHV .KRRG DKU UKG KP (QNIG GKPGU 5VCCVUXGTVTCIGU XQO  /CKXQNNUV·PFKI RTGW­KUEJYWTFG-ÌPKI(TKGFTKEJ++XQP2TGW­GP  UVKHVGVGCO(GDTWCTFCU1TFGPU\GKEJGPWPF FGP $TWUVUVGTP NGV\VGTGP KP IGUVKEMVGT #WUHÒJTWPI CWU FGT KO  ,J GKP /GVCNNUVGTP IGYQTFGP KUV +O  ,J   YWTFG FCU 5VKHV XQP FGT 9GUVRJ·NKUEJGP 4GIKGTWPI \WP·EJUV CWHIGNÌUV FCPP LGFQEJ YKGFGT PGW OKV  2T·DGPFGP   IGUVKHVGV FKG CDYGEJUGNPF XQO -ÌPKI XQP 2TGW­GP WPF XQO (ÒTUVGP \WT .KRRG DGUGV\V YWTFGP*GWVGDGUVGJVFCU 5VKHVPKEJVOGJT<WT)GUEJKEJVGFGU&COGPUVKHVGUUKGJGCWEJ1JPG#WVQTCPICDG&CUIGOGKPUEJCHVNKEJ-ÌPKINKEJ 2TGW­KUEJGWPF(ÒTUVNKEJ.KRRKUEJG(T·WNGKPUVKHV\W.KRRUVCFV1JPG1TV7PF)TKV\PGT/CZKOKNKCP*CPF DWEJ FGT KO &GWVUEJGP 4GKEJG KP ¤UVGTTGKEJ7PICTP &·PGOCTM 5EJYGFGP WPF FGP 4WUUKUEJGP 1UVUGGRTQXKP\GP   DGUVGJGPFGP&COGPUVKHVGTWPFKO4CPIGINGKEJUVGJGPFGT9QJNV·VKIMGKVUCPUVCNVGPPGDUVFGP1TFGPU\GKEJGPFGT'TUVG TGP(TCPMHWTVCO/CKP5

9057 (1:1) 9056 (1:1)





9056 (1:1)

(T·WNGKPUVKHV /CTKGPHNKUU KP 2QOOGTP 1TFGPU\GKEJGP FGT /KPQTGPPGP  6[R  Z  OO   5KNDGT XGTIQNFGV WPF GOCKNNKGTV 'OCKNNGUEJ·FGP KO #XGTU WPF 4GXGTUOGFCKNNQP QJPG $CPFUEJNGKHG   *2 4+++



/KNKV·T'JTGP\GKEJGP /KPKCVWT FGU /KNKV·T'JTGP\GKEJGPU  -NCUUG  Z  OO 5KNDGT QJPG   $·PFEJGP ++



'ZGORNCTFGT#WMVKQP(TKV\4WFQNH-ÒPMGT1UPCDTÒEM0T

29


DEUTSCHE STAATEN

9058

9059 (1:1)



9059 (1:1)

'KUGTPGU-TGW\#WUICDG5R·VGTG0CEJHGTVKIWPI=VC[NQT UEQR[?FGU'KUGTPGP-TGW\+-NCUUG #WUICDG  Z  OO  I IGUVWHVGT'KUGPMGTPUEJYCT\NCEMKGTV5KNDGTTCJOGPCWHFGT4ÒEM UGKVGRWP\KGTVHÒTNÌVJKIGU5KNDGTWPF6TGOQNKGTUVTKEJCPTWPFGT0CFGN ++



'UFÒTHVGUKEJJKGTDGKWOGKPG,WYGNKGTUCPHGTVKIWPICWUFGO&TKVVGNFGU,CJTJWPFGTVUCNUQFGWVNKEJPCEJFGT 8GTNGKJWPIU\GKVJCPFGNP



'KUGTPGU -TGW\ #WUICDG  'KUGTPGU -TGW\ ++ -NCUUG  Z  OO  I UVWHKIGT   IGUEJY·T\VGT'KUGPMGTP5KNDGT\CTIG$CPFTKPIQHHGPCOPGWGP$CPF$9-1'- ++ 





ex 9062

9061

9060

'KUGTPGU -TGW\ #WUICDG  'KUGTPGU -TGW\  -NCUUG HNCEJG #WUHÒJTWPI 5KNDGT 'KUGPMGTP   IGUEJY·T\V CWH FGT 4ÒEMUGKVG *GTUVGNNGTRWP\G -1 FGU -ÌPKINKEJGP /ÒP\COVU KP $GTNKP WPF ITCXKGTVG   9KFOWPI.GWVPCPV9QNHH2KQPKGT4IV$GN(TCP0CFGN$9-1'- ++



'KUGTPGU -TGW\ #WUICDG  'KUGTPGU -TGW\  -NCUUG HNCEJG #WUHÒJTWPI 5KNDGT 'KUGPMGTP   IGUEJY·T\VCP0CFGNFKGUGOKV*GTUVGNNGTRWP\G59FGT(KTOC5[9CIPGTKP$GTNKP$9- 1'- ++



'TKPPGTWPIUMTGW\  -QPXQNWV XQP XKGT XGTUEJKGFGPGP 'ZGORNCTGP   -ÌPKIIT·V\   &GT /CKP   #TOGG   6TGWGP -TKGIGTP   (ÒT 2HNKEJVVTGWG KO -TKGIG $TQP\G KP QTFGPVNKEJGP 'TJCNVWPIGP CP   $·PFGTP 5VÒEM++



#PHGTVKIWPIFGUDGFGWVGPFGP$GTNKPGT*QHNKGHGTCPVGPXQO$GIKPPFGU'TUVGP9GNVMTKGIU



9063

9064



2CVTK\G OKV FGO 2QTVTCKV -CKUGT 9KNJGNO + \WO 2T·IGUVGORGN FGT <GPVGPCTOGFCKNNG 'KUGP   ITCXKGTV ++





8GTFKGPUVMTGW\HÒT-TKGIUJKNHG#WUHÒJTWPIKP5KNDGTKO<[NKPFGTRWP\KGTVQJPG$CPF1'-  ++



30


DEUTSCHE STAATEN

9067

9065 9068

9066



-COOGTJGTTGPUEJNÒUUGN #WUHÒJTWPI WPVGT FGP -ÌPKIGP (TKGFTKEJ 9KNJGNO ++ WPF +++     $TQP\GXGTIQNFGVZOOIQJPG$CPFTQUGVVG&9'5 ++





)GUEJGPMMTGW\#WIWUVC8KMVQTKCU-ÌPKIKPXQP2TGW­GP WPF&GWVUEJG-CKUGTKP ZOO )QNFFQWDNGGJQJNIGHGTVKIVOKV6TCIGTKPIHÒTGKP-GVVEJGPKOQTKIKPCNGP8GTNGKJWPIUGVWKFGT(KTOC, 9CIPGT5QJPKP$GTNKPOKV/QPQITCOO#WIWUVG8KMVQTKCU 4++





+PQHHK\KGNNGU)GFGPMMTGW\UQIGP$GTNKPGT'KUGPZOO'KUGPFWTEJDTQEJGPIGCTDGKVGV /GFCKNNQP )QNF OKV FGP 2QTVTCKVU XQP -ÌPKI (TKGFTKEJ 9KNJGNO +++ WPF XQP (GNFOCTUEJCNN $NÒEJGT   QJPG-GVVEJGPQFGT$CPF ++



+PQHHK\KGNNGU)GFGPMMTGW\UQIGP$GTNKPGT'KUGPCWHFGP5KGIÒDGTFKG(TCP\QUGPKPFGTUQIGP 8ÌNMGTUEJNCEJVDGK.GKR\KICO1MVQDGTZOO'KUGPIGUEJY·T\V#RRNKMCVKQPGP 5KNDGT#XGTUKPUEJTKHV8+%614+#$.4GXGTUKPUEJTKHV1%6COQTKIKPCNGP'KUGPMGVVEJGP OKV5KNDGT#RRNKMCVKQPGP ++





9069

9071

9070



+PQHHK\KGNNGU)GFGPMMTGW\UQIGP$GTNKPGT'KUGPCWHFKGUQIGP8ÌNMGTUEJNCEJVDGK.GKR\KIXQO  DKU  1MVQDGT   Z  OO 'KUGP IGUEJY·T\V #RRNKMCVKQPGP 5KNDGT #XGTUKPUEJTKHV   *'+. &'0  47  1'  24  5% 4GXGTUKPUEJTKHV         1%6 QJPG   -GVVEJGPQFGT$CPF ++





+PQHHK\KGNNGU)GFGPMMTGW\UQIGP$GTNKPGT'KUGPCWHFGP5KGIÒDGTFKG(TCP\QUGPKPFGT5EJNCEJV DGK 9CVGTNQQ$GNNG #NNKCPEG CO  ,WPK   Z  OO 'KUGP IGUEJY·T\V #RRNKMCVKQPGP   5KNDGT#XGTUKPUEJTKHV.#$'..'#..+#0%'4GXGTUKPUEJTKHV+70+QJPG-GVVEJGPQFGT $CPF ++



8KXCV/GFCKNNG CWH *GKPTKEJ -CTN 'TFOCPP (ÒTUV \W %CTQNCVJ$GWVJGP   'KUGPIW­   &WTEJOGUUGTOOFCVKGTV0QXGODGTIGJGPMGNVQJPG$CPF ++





-WTKQUG/GFCKNNG



5EJKG­RTGKUOGFCKNNGFGU9GUVH·NKUEJGP+PHCPVGTKG4GIKOGPVU)TCH$CTHW­0T5KNDGTOKV 6T·IGTITCXWT /WUM9QNH CP ¤UG QJPG $CPF &C\W 5EJKG­RTGKU/GFCKNNG  /QFGNN OKV 2QTVTCKV   -ÌPKI9KNJGNOU+ #WUHÒJTWPI OKV5VGORGNUEJPGKFGTUKIPCVWT'9'+)#0&('%  /GFCKNNG\W/CTM&WTEJOGUUGTOO5KNDGTCP¤UGQJPG$CPF 5VÒEM++p++

 31


DEUTSCHE STAATEN

9074

9073

ex 9076

9077

9075



#D\GKEJGPFGU#TVKNNGTKG8GTGKPU5QNKPIGP/GUUKPIDNGEJXGTUKNDGTVOKV$NGKCWUIGIQUUGPTÒEM UGKVKI*GTUVGNNGTDG\GKEJPWPIFGT(KTOC&GUEJNGT5QJPKP/ÒPEJGPCP0CFGN ++





7PDGMCPPVG5RCPIG<WT'TKPPGTWPICF(GNF\ÒIGXZCWHFGT4ÒEMUGKVG&WTEJ \WIUURCPIG ++





5VGEMCD\GKEJGP FGU +8 )CTFG4GIKOGPVU \W (W­ #WHNCIGP VGKNYGKUG XGTIQNFGV VGKNYGKUG XGTUKNDGTV   WPFVGKNYGKUGNCEMKGTV OKV#DRNCV\WPIGP CP0CFGN ++p





-QPXQNWVXQPRTGW­KUEJGP#WU\GKEJPWPIGP&CDGK-TQPGP/GFCKNNG#NNIGOGKPGU'JTGP\GKEJGP -NCUUG &QRRGN-TGW\  /KNKV·T&KGPUVCWU\GKEJPWPIGP HÒT +: :++ WPF :8 ,CJTG 8GTUEJKGFGPG   /GVCNNG\YGKKP5KNDGTVGKNUXGTIQNFGVVGKNUXGTUKNDGTVVGKNUXGTMWRHGTVFTGKVGKNYGKUGGOCKNNKGTVITÌ­ VGPVGKNUCP$·PFGTP\YGKCP0CFGNPFTGKCPGKPGT1TFGPUUEJPCNNGOKVINCVVGP$·PFGTPKPQTFGPVNKEJGP 'TJCNVWPIGP 5VÒEM++++p+++



5#%*5'0-74(ª456'067/ $+5 70&-¤0+)4'+%*   

-ÌPKINKEJ 5·EJUKUEJGT /KNKV·T5V *GKPTKEJU1TFGP 5KNDGTPG /KNKV·T5V *GKPTKEJU/GFCKNNG 5KNDGT   KO*CNUCDUEJPKVV5VGORGNUEJPGKFGTUKIPCVWT(7COQTKIKPCNGPCNVGP&TGKGEMUDCPF$9-1'-  ++



9078 (1:1)



-ÌPKINKEJ 5·EJUKUEJGT <KXKN8GTFKGPUVQTFGP   D\Y -ÌPKINKEJ 5·EJUKUEJGT 8GTFKGPUV   1TFGP  /QFGNN OKVIGOCNVGP/GFCKNNQPU XQPDKU#DVGKNWPIHÒT +PN·PFGT4KVVGTMTGW\CD4KVVGTMTGW\-NCUUG#PHGTVKIWPICWUFGO3WCTVCNFGU,CJTJWP FGTVUOKV-TQPGOKVUEJOCNGO-TQPTGKH)QNFJQJNIGHGTVKIVGOCKNNKGTVIHGKPUVG'OCKNNGOCNGTGK MCWO UKEJVDCTGT *CCTTK­ KO /GFCKNNQPHGNF FGT 4ÒEMUGKVG CO QTKIKPCNGP CNVGP $CPF $9- H   1'- +p++  &GT1TFGPYWTFGCO,WPKXQP-ÌPKI(TKGFTKEJ#WIWUV+CNUFTGKMNCUUKIGT1TFGPOKVCHHKNKKGTVGT/GFCKNNG IGUVKHVGVYWTFGHÒT#WUN·PFGTGKPG#WUHÒJTWPIOKVCPFGTGT+PUEJTKHVGKPIGHÒJTV'KPWPVGTJCNDFGU4KVVGTMTGW \GUCPIGUKGFGNVGUUQIGPCPPVGU-NGKPMTGW\YWTFGIGUVKHVGVFCUKP'JTGPMTGW\WODGPCPPVYWTFG YWTFG FGT1TFGPKP8GTFKGPUVQTFGPWODGPCPPVWPFGUGTHQNIVGFKG#WHVGKNWPIFGT-QOVWTGKPWPF-NCUUG #WU#PNC­FGU-TKGIGUXQPYWTFGPHÒTCNNG-NCUUGPFGU#WUHÒJTWPIHÒT+PN·PFGTFKG5EJYGTVGTHÒT8GTFKGPUV KO-TKGIWPFFKG5EJYGTVGTCO4KPIGKPIGHÒJTVMCOFKGDGUQPFGTG#WUHÒJTWPIHÒT#WUN·PFGTKP(QTV HCNNGTHQNIVGPYGKVGTG8GT·PFGTWPIGP&KG4KVVGTMNCUUGYKTFKP4KVVGTWPF-NCUUGCWHIGVGKNVFCU'JTGP MTGW\ WPF FKG )QNFGPG WPF 5KNDGTPG 8GTFKGPUVOGFCKNNG YGTFGP CWHIGJQDGP WPF UVCVV FGUUGP FCU 8GTFKGPUVMTGW\   IGUVKHVGVGTHQNIVGFGTUQIGPCPPVG/QFGNNYGEJUGNFKGDKUJGTIGOCNVGP9CRRGPYGTFGPKPCWU/GVCNNIGRT·IVG WPF CWH FCU /GFCKNNQP CWHIGUGV\VG XGT·PFGTV YQDGK LGFQEJ XQP GKP\GNPGP *GTUVGNNGTP 4KVVGTMTGW\  -NCUUG OKV   IGOCNVGO/GFCKNNQPUDKUJGTIGUVGNNVYGTFGP&GU9GKVGTGPGTJKGNVGPFKG)TQ­WPF-QOVWTMTGW\GGKPG-TQPG CNUªDGTJÌJWPIWPFFGTDKUJGTKIG$TWUVUVGTPGTJKGNVUVCVVDKUJGTUGEJUPWPOGJTCEJV5VTCJNGP /QFGNN#WUHÒJ TWPIņOKVUGRCTCVIGRT·IVGO/GFCKNNQPTKPIWPFIGRT·IVGP9CRRGP #DGTHQNIVGFKG(GTVKIWPIFGT+PUKIPKGP KP5KNDGTXGTIQNFGVYWTFGFKG#WUHÒJTWPIFGT+PUKIPKGPXGTGKPHCEJVKPFGODGKCNNGP+PUKIPKGP/GFCKNNQPTKPI WPFņHGNFCWUGKPGO5VÒEMCPIGHGTVKIVYWTFGP /QFGNN#WUHÒJTWPI /KVFGO6JTQPXGT\KEJV-ÌPKI(TKGFTKEJ #WIWUVU+++  CO0QXGODGTGTNQUEJCWEJFGT1TFGP

32


DEUTSCHE STAATEN

9079



-ÌPKINKEJ 5·EJUKUEJGT <KXKNXGTFKGPUVQTFGP D\Y -ÌPKINKEJ 5·EJUKUEJGT 8GTFKGPUVQTFGP  /QFGNN  

 4KVVGTMTGW\-NCUUGOKV5EJYGTVGTP#WUHÒJTWPI OKVIGOCNVGO9CRRGPņ   5KNDGT VGKNYGKUG XGTIQNFGV GOCKNNKGTV 'OCKNNGOCNGTGK CWH FGO 4CPF FGU WPVGTGP -TGW\CTOU   RWP\KGTV,FKG5EJYGTVGTGKPUGKVKIIGRT·IVWPFGKPIGUGV\VCOQTKIKPCNGPCNVGP&TGKGEMUDCPF)'$ 1'- ++ 'ZGORNCTFGT#WMVKQP(TKV\4WFQNH-ÒPMGT1UPCDTÒEM0T.CWV&KGVGT9GDGT&TGUFGP FGTYQJN DGFGWVGPFUVG -GPPGT U·EJUKUEJGT 1TFGP  JCPFGNV GU UKEJ DGK FKGUGO 'ZGORNCT CWHITWPF FGT GKPFGWVKI ITÌDGTGP   'OCKNNGOCNGTGKFGU9CRRGPUPKEJVWOGKPG#WUHÒJTWPIFGUGTUVGP/QFGNNU DKU UQPFGTPWOGKPG#PHGT VKIWPIFGT(KTOC#NHTGF4QGUPGT<W#PHCPIGTHQNIVGGKPG$GUVGNNWPIFGT1TFGPUMCP\NGKXQP4KVVGTMTGW\GP -NCUUGOKV5EJYGTVGTPCPFKG(KTOC#NHTGF4QGUPGT1DYQJNDGTGKVUGKPG8GTHÒIWPIGTNCUUGPYQTFGPYCT PCEJ FGT FCU 9CRRGP MÒPHVKI IGRT·IV UGKP UQNN JCDGP UKEJ YGFGT )NCUGT  5QJP PQEJ 4QGUPGT CP FKGUG *GTUVGN   NWPIUXQTUEJTKHV IGJCNVGP WPF DKU  UEJ·V\WPIUYGKUG  DKU  )NCUGT WPF 5QJP  UQYKG EC  4QGUPGT    4KVVGTMTGW\G OKV 5EJYGTVGTP KP FGT #WUHÒJTWPI OKV IGOCNVGO 9CRRGP IGNKGHGTV +PUQHGTP YWTFGP Y·JTGPF FGU   'TUVGP 9GNVMTKGIGU 4KVVGTMTGW\G OKV 5EJYGTVGTP KP FGT #WUHÒJTWPI OKV IGRT·IVGP 9CRRGP EC \YGK &TKVVGN FGT   )GUCOV\CJN  YKG CWEJ KP FGT #WUHÒJTWPI OKV IGOCNVGO 9CRRGP ECGKP&TKVVGNFGT)GUCOV\CJN XGTNKGJGP&KGUG 'TMGPPVPKUUGUKPFKPFGTDKUJGTKIGPRJCNGTKUVKUEJGP.KVGTCVWTWPDGTÒEMUKEJVKIVIGDNKGDGP$GKFGT,2WP\GJCPFGNV GUUKEJOÌINKEJGTYGKUGWOGKPUEJNGEJVRWP\KGTVGU4FGT(KTOC4QGUPGT&KG(KTOGP,WPEMGTKP$GTNKPWPF,ÒT IGPU KP $TCWPUEJYGKI CNU GKP\KIG FGWVUEJG 1TFGPULWYGNKGTG FGTGP 0COG OKV , DGIKPPV  MÌPPGP CNU *GTUVGNNGT   PKEJV KP $GVTCEJV IG\QIGP YGTFGP FC )GUWEJG CW­GTU·EJUKUEJGT *GTUVGNNGT WO #WHVT·IG UVGVU CDIGNGJPV YQTFGP   UKPF *GTTP&9GDGTUGKCPFKGUGT5VGNNGHÒTUGKPGYGKVGTHÒJTGPFGP#WUHÒJTWPIGPJGT\NKEJUVIGFCPMV 



9080 (1:1)



-ÌPKINKEJ5·EJUKUEJGT#NDTGEJVUQTFGP/QFGNN OKVFGO2QTVTCKVXQP-WTHÒTUV,QJCPP FGU $GUV·PFKIGP OKV FGT UQIGP $·EMGTOÒV\G  $TWUVUVGTP \WO )TQ­MTGW\  #WUHÒJTWPI     5KNDGTDNGEJ 5KNDGTFTCJV /GFCKNNQP )QNF GOCKNNKGTV )QNFFTCJV FGT WONCWHGPFG 5KNDGTFTCJV CP XKGT   5VGNNGPGVYCUIGNÌUVCWHFGO4GXGTU#DFGEMNGKPGP1'- ++p+++  'ZGZORNCTFGT5COONWPI6COOCPP#WMVKQP7$5$CUGN0TWPFFGT#WMVKQP(TKV\4WFQNH-ÒPMGT 1UPCDTÒEM0T$GFGWVGPFGT$TWUVUVGTPCWUFGT5VKHVWPIU\GKVFGU1TFGPUCNUFKGUGPQEJHGUVCWH FGO4QEMCPIGDTCEJVYCTGPXQPITÌ­VGT5GNVGPJGKVWPFKP#PDGVTCEJVFGU#NVGTUKPDGUVGT'TJCNVWPI.CWV9GDGT #TPQNFWPF2HGKN KP9$5 YWTFGFKGUGGTUVGFÒPPIGRT·IVG#WUHÒJTWPIXQO,WYGNKGT)#5EJCTHHGP DGTI KP &TGUFGP JGTIGUVGNNV &GP INGKEJGP #WVQTGP \WHQNIG KP 9$ 5   KUV FKGUG -NCUUG XQP  DKU    KPUIGUCOVOCNXGTNKGJGPYQTFGP'KPKFGPVKUEJG'ZGORNCTLGFQEJKPGVYCUDGUUGTGT'TJCNVWPIFKGPVCNU6KVGN UVÒEM FGT XQP &T )GTV 5EJCTHGPDGTI DGCTDGKVGVGP  #WHNCIG FGU 1'- 0KOOGTIWV ,ÌTI &GWVUEJG 1TFGP WPF   'JTGP\GKEJGP    4GIGPUVCWH  #WHNCIG   )GUVKHVGV CO  &G\GODGT  XQP -ÌPKI (TKGFTKEJ   #WIWUV ++ CNU \WP·EJUV HÒPHMNCUUKIGT CNNIGOGKPGT 8GTFKGPUVQTFGP   5VKHVWPI FGT 5EJYGTVGT  WPF    GTHQNIVGP8GT·PFGTWPIGPWPF'TYGKVGTWPIGPYWTFGOKVFGO'TNC­PGWGT1TFGPUUVCVWVGPFCU2QTVTCKVCWHFGO 8QTFGTUGKVGPOGFCKNNQPIG·PFGTV9GKVGTG'TYGKVGTWPIGPGTHQNIVGPWPF/KVFGO6JTQPXGT \KEJV-ÌPKI(TKGFTKEJ#WIWUVU+++KO0QXGODGTGTNQUEJCWEJFGT1TFGP

33


DEUTSCHE STAATEN

9082 (1:1)

9081 (1:1)



9081 (1:1)

-ÌPKINKEJ5·EJUKUEJGT#NDTGEJVUQTFGP/QFGNN OKVFGO2QTVTCKVXQP*GT\QI#NDTGEJV+++ FGO $GJGT\VGP   #WUHÒJTWPI   #WUHÒJTWPI KP GEJV )QNF  -NGKPQF \WO )TQ­MTGW\   #PHGTVKIWPI OKVGEMKIGP-TGW\CTOT·PFGTP9CRRGPWPF-TQPGFGU4GXGTUOGFCKNNQPUUGRCTCVIGRT·IV  )QNFVGKNYGKUGHGKPUV\KUGNKGTVGOCKNNKGTVICOPGWGP5EJWNVGTDCPF ++  .CWV9GDGT#TPQNFWPF-GKN KP9$5 YWTFGPXQPDKUPWT)TQ­MTGW\GKP)QNFXGTNKGJGP



/KNKV·TXGTFKGPUVOGFCKNNG  CD/GFCKNNGFGU-ÌPKINKEJ5·EJUKUEJGP/KNKV·T5V*GKP TKEJU1TFGPU  #WUHÒJTWPI QJPG 5EJNGKHG KO *CCT    )QNFGPG /GFCKNNG &WTEJOGUUGT    OO )QNF  I OKV 5VGORGNUEJPGKFGTUKIPCVWT *1'%-0'4( CO QTKIKPCNGP *GPMGN OKP   4CPFFGNNGP OKV NQUGO GVYCU UR·VGTGP $CPFUVÒEM 1'-  6'5   9$  JKGT   LGFQEJXGTUGJGPVNKEJKPFGT$KNFDG\GKEJPWPICNU/QFGNNDG\GKEJPGV   +PJGTXQTTCIGPFGT'TJCNVWPIWPFXQPCW­GTQTFGPVNKEJGT5GNVGPJGKV++  'ZGORNCTFGT5COONWPI)GTJCTV4QVJGT#WMVKQP(TKV\4WFQNH-ÒPMGT1UPCDTÒEM0T  7PVGTUWEJWPIGP KO /ÒP\MCDKPGVV &TGUFGP FWTEJ 2TQH &T 2CWN #TPQNF WPF &KGVGT 9GDGT DGKFGU CWUIGYKGUGPG   'ZRGTVGP KP FGT U·EJUKUEJGP 1TFGPU WPF 'JTGP\GKEJGPMWPFG FWTEJ FKG 8GTINGKEJG OKV FGO FQTV DGHKPFNKEJGP   \YGKHGNUHTGKGP CWU FGT 5COONWPI $CWOICTVGP UVCOOGPFGP 1TKIKPCNGZGORNCT WPF FGP 2T·IGUVGORGNP JCDGP    GKPFGWVKIGTIGDGPFC­GUUKEJDGKWPUGTGO5VÒEM\YGKHGNUHTGKWOGKP1TKIKPCNGZGORNCTJCPFGNV  #WUDKUJGTPKEJVXGTÌHHGPVNKEJVGP)TÒPFGPYWTFGGKPPGWGT8QTFGTUGKVGPUVGORGNHÒTFKG/GFCKNNGIGUEJPKVVGP DGK FGO FKG (TKUWT FGU -ÌPKIU NGKEJV XGT·PFGTV WPF KPUDGUQPFGTG FKG *CCTUEJNGKHG HQTVIGHCNNGP YCT 8QP FKGUGT   /GFCKNNG UKPF NCWV FGP #WVQTGP XQP 6'5 CWH 5GKVG   \YKUEJGP  WPF  KPUIGUCOV PWT  )QNFGPG   /GFCKNNGP XGTNKGJGP YQTFGP #WHITWPF FGT KP LGPGT <GKV OKV CNNGTITÌ­VGO 0CEJFTWEM XGTHQNIVGP UVTGPIGP   4ÒEMICDGRHNKEJV PCEJ #DNGDGP FGU $GNKGJGPGP FÒTHVGP FKG CNNGTOGKUVGP 5VÒEMG YKGFGT CP FKG 1TFGPUMCP\NGK   \WTÒEMIGIGDGP YQTFGP UGKP YQ UKG FGT 'KPUEJOGN\WPI \WIGHÒJTV YWTFGP 5QOKV FÒTHVGP UKEJ PWT UGJT YGPKIG   'ZGORNCTGJÌEJUVGPUFTGKQFGTXKGTDKUKPWPUGTG6CIGGTJCNVGPJCDGP$GKFGP#WVQTGP$CWOICTVGP $CWOICTVGP ,)*KUVQTKUEJIGPGCNQIKUEJEJTQPQNQIKUEJGUMTKVKUEJGU8GT\GKEJPKUCNNGTDGMCPPVGPFWMCVGPHÌTOKIGP)QNFOÒP\GP FGTCNDGTVKPKUEJGP*CWRVNKPKGFGUWTCNVGPU·EJUKUEJGP*CWUGU&TGUFGPWPF)TWPF )TWPF4CKPGT&KG-ÒPUVNGT HCOKNKG *QGEMPGT +P ,CJTDWEJ FGT UVCCVNKEJGP -WPUVUCOONWPIGP &TGUFGP    5     YWTFGP WPVGT   UEJKGFNKEJG&CTUVGNNWPIGPFGT\GKVNKEJGP#DHQNIGFGTWPF#WUHÒJTWPIXGTÌHHGPVNKEJV9GDGT#TPQNFWPF-GKN HÒJTGP JKGT\W CWU KP 9$ 5   &CU /ÒP\MCDKPGVV &TGUFGP DGUKV\V GKP 'ZGORNCT FKGUGT /GFCKNNG KP )QNF KO   HCEJGP &WMCVGPIGYKEJV CWU FGT 5COONWPI $CWOICTVGP FGT &WTEJOGUUGT DGVT·IV  OO WPF FCU )GYKEJV    I &KGUG /GFCKNNG KUV KFGPVKUEJ OKV $CWOICTVGP  5KG KUVPCEJ$CWOICTVGPU(GUVUVGNNWPIJCWRVTCT'T DGUEJTGKDVFKG(TKUWTFGU-ÌPKIUOKVGKIGPGOKO0CEMGPIGDWPFGP*CCTWPFGTY·JPVFCDGKMGKPG*CCTUEJNGKHGYKG DGKO  WPF  /QFGNN 'KP 8GTINGKEJ OKV FGT (TKUWT CWH FGT  IGRT·IVGP /GFCKNNG FGU <KXKNXGTFKGPUVQTFGPU   DGYGKUV\WFGOFKG4KEJVKIMGKVFGT\GKVNKEJGP#DHQNIGXQPWPF/QFGNN)TWPFQTFPGVFCIGIGPDGKFG/GFCKNNGP WOIGMGJTV CP QJPG CNNGTFKPIU CWH FKG \GKVNKEJG #DHQNIG GKP\WIGJGP &KG <WQTFPWPI XQP $CWOICTVGP  \WO   /QFGNNKUVCDGTDGK)TWPF+8HCNUEJXKGNOGJTUKPF$CWOICTVGPWPF)TWPF8KFGPVKUEJYCU\WFGO CWEJFCU)GYKEJVXQPI&WMCVGP &WMCVGP¯I GKPFGWVKIDGUV·VKIVYKTF  &KG2T·IGUVGORGNHÒTFKG85WPFFKG45UKPFKO5VGORGNCTEJKXFGU/ÒP\MCDKPGVVU&TGUFGPXQTJCPFGP8QP DKU  UKPF PCEJ FGP $TCMVGCVGPDÒEJGTP MGKPG FKGUGT 1TFGPUOGFCKNNGP KP FGT MIN /ÒP\UV·VVG &TGUFGP IGRT·IV   YQTFGP &KGUGU  /QFGNN FGT 8QTFGTUGKVG YCT X *G[FGP #PO F 8GTH KP *&  WPF CWEJ X *GUUGPVJCN WPF   5EJTGKDGT #PO F 8GTH KP *5  WPDGMCPPV #WEJ -NGPCW HÒJTV FKGUGU /QFGNN KP -. PKEJV CWH GDGPUQYGPKI   0KOOGTIWVKO1'-KPFGP#WUICDGPDKUGKPUEJNKG­NKEJ+P0+HÒJTVGTUKGUEJNKG­NKEJWPVGTFGT0T CWHWPFCWEJKO1'-KUVUKGUGKVFGT#WUICDGWPVGTFGT-CV0T\WHKPFGP

34


DEUTSCHE STAATEN

ex 9083 9084 (1:1)



(TKGFTKEJ#WIWUV/GFCKNNG5KNDGTPG/GFCKNNG5KNDGTCO(TKGFGPUDCPFOKV$CPFURCPIG9'.6-4+') 5KNDGTOKVHNCEJGPUGKVNKEJURKV\GP5RNKPVGP&C\WGKPYGKVGTGU'ZGORNCT5KNDGTKP5VGORGN INCP\'TJCNVWPICO-TKGIUDCPF1'- 5VÒEM+++



5#%*5'0 9'+/#4'+5'0#%*  $+5   *'4<1)67/ $+5   70&   )4155*'4<1)67/   

)TQ­JGT\QINKEJ5·EJUKUEJGT*CWUQTFGPFGT9CEJUCOMGKVQFGTXQO9GK­GP(CNMGP$TWUVUVGTP\WO )TQ­MTGW\ HÒT CNNIGOGKPG 8GTFKGPUVG QJPG -TGW\CTOCWHNCIGP    &WTEJOGUUGT  OO   5KNDGT#WHNCIGP)QNFVGKNYGKUGGOCKNNKGTVICWHFGT4ÒEMUGKVG*GTUVGNNGTDG\GKEJPWPIFGU*QHLW YGNKGTU6J/ÒNNGTKP9GKOCTCP0CFGN$9-1'- +p++  )GUVKHVGV CO  #WIWUV  FWTEJ *GT\QI 'TPUV #WIWUV XQP 5CEJUGP9GKOCT YWTFG GTCO1MVQDGTCNU FTGKMNCUUKIGTCNNIGOGKPGT8GTFKGPUVQTFGPGTPGWGTVWPFGTHQNIVGP'TYGKVGTWPIGPYWTFGFCU )TQ­MTGW\CWHIGVGKNVKP+PUKIPKGPHÒT8GTFKGPUVGWOFCUITQ­JGT\QINKEJG*CWUWPFUQNEJGHÒTCNNIGOGKPG8GTFKGPUVG 9GKVGTG8GT·PFGTWPIGPGTHQNIVGPWPF



9KNJGNO'TPUV-TKGIUMTGW\.GGTGU'VWK=GORV[ECUG?OKVTQVGT5COV'KPNCIG&GEMGNGVYCUDGUEJ· FKIV WPF WPUCEJIGO·­ TGUVCWTKGTV FGUUGP +PPGPUGKVG OKV *GTUVGNNGTDG\GKEJPWPI FGU *QHLWYGNKGTU 6J   /ÒNNGTKP9GKOCTFCU'VWKGVYCUDGTKGDGP 4+++



5%*5+5%*'*'4<1)6ª/'4)'/'+05#/ 

*GT\QINKEJ 5CEJUGP'TPGUVKPKUEJGP *CWUQTFGPU .GGTGU 'VWK =GORV[ ECUG? \WO 4KVVGTMTGW\  QFGT   -NCUUGFGU*QH,WYGNKGTU9KNNK)CPUUGPKP%QDWTIOKVITÒPGT5COVGKPNCIGQJPG#WHUEJTKHV ++



9087

5#%*5'0#.6'0$74)*'4<1)67/   

8GTFKGPUVOGFCKNNG FGU *GT\QINKEJ 5CEJUGP'TPGUVKPKUEJGP *CWUQTFGPU/QFGNN OKVFGO2QTVTCKV *GT\QI'TPUVU+ #WUHÒJTWPI OKVGKPUGKVKIUKEJVDCTGP$CEMGPDCTVFGU*GT\QIU   5KNDGTPG /GFCKNNG 5KNDGT OKV 5VGORGNUEJPGKFGTUKIPCVWT *'.(4+%*6 ( CWH FGO 4CPF   RWP\KGTV5+.$'4WPFQJPG$CPF$9-1'- 4+



.GDGPUTGVVWPIUOGFCKNNG .GGTGU 'VWK QJPG FKG /GFCKNNG  =GORV[ ECUG? OWVOC­NKEJ \WT /GFCKNNG FGU    /QFGNNU   &WTEJOGUUGT FGT 'KPNCIG#WUURCTWPI  OO OKV QTKIKPCNGO $CPFUVÒEM <W   $9-\W1'-WPF 44++



+PFKGUGTCDUQNWVGP6QR'TJCNVWPIUGNVGP\WHKPFGP



8QP CNNGTITÌ­VGT 5GNVGPJGKV .CWV $G[TGK­ KP $;. 5  WPF   YWTFGP XQP FGT /GFCKNNG FGU  /QFGNNU   \YKUEJGP  WPF  KPUIGUCOV  'ZGORNCTG XGTNKGJGP XQP FGT /GFCKNNG FGU/QFGNNU\YKUEJGPWPF KPUIGUCOV

35


DEUTSCHE STAATEN

9089

9090

9091

5#%*5'0%1$74)70&)16*#*'4<1)67/   

*GT\QINKEJ 5CEJUGP'TPGUVKPKUEJGT *CWUQTFGP 5KNDGTPG 8GTFKGPUVOGFCKNNG  /QFGNN OKV 2QTVTCKV   XQP*GT\QI#NHTGF 5KNDGTQJPG$CPF$9-1'- ++



5%*#7/$74).+22'

<YGK1DLGMVGFGU(ÒTUVGPVWOU5EJCWODWTI.KRRGHKPFGP5KGWPVGTFGP0TPWPF

5%*.'59+)*1.56'+0*'4<1)6ª/'4 $+5  

'TKPPGTWPIUOGFCKNNG CP FKG 2TQMNCOCVKQP (TKGFTKEJU 8+++ \WO *GT\QI $TQP\G CO PGWGP LGFQEJ   MQTTGMVGP$CPF1'- 44++



&KG/GFCKNNGYWTFGCO&G\GODGTXQP*GT\QI(TKGFTKEJ\W5EJNGUYKI*QNUVGKP5QPFGTDWTI#WIWUVGPDWTI CWU#PNC­FGTINGKEJV·IKIGP$GUV·VKIWPIUGKPGT2TQMNCOCVKQP XQO0QXGODGT \WO4GIKGTWPIUCPVTKVVCNUTGIKG TGPFGT*GT\QIXQP5EJNGUYKI*QNUVGKPWPVGTFGO0COGP(TKGFTKEJ8+++IGUVKHVGV



'TKPPGTWPIUMTGW\ CP FKG UEJNGUYKIJQNUVGKPKUEJG #TOGG #WUHÒJTWPI OKV ,CJTGU\CJNGP 'KUGP   IGUEJY·T\VCOCNVGPXGTH·TDVGPWPF\GTUEJNKUUGPGO$·PFEJGP1'- ++

9092 (1:1)



9093 (1:1)

9ª466'/$'4) *'4<1)67/ $+5   -74(ª456'067/     70&-¤0+)4'+%*  



1TFGPFGT-ÌPKINKEJGP9ÒTVVGODGTIKUEJGP-TQPG/KPKCVWTFGU-TGW\GUFGU'JTGPTKVVGT/QFGNN

 D\YFGU4KVVGTMTGW\GUOKVFGP.ÌYGP)QNFGOCKNNKGTVI +p++





-ÌPKINKEJ9ÒTVVGODGTIKUEJGT (TKGFTKEJU1TFGP  /QFGNN OGJTMNCUUKI    /KPKCVWTFGU 4KVVGTMTGW\GUD\Y CD FGU4KVVGTMTGW\GU-NCUUG)QNFGOCKNNKGTVI +p++





1TFGPFGT-ÌPKINKEJGP9ÒTVVGODGTIKUEJGP-TQPG1TFGPUUVCVWVGPKPFGT(CUUWPIXQP5GKVGP IGMPKEMV ++



9095 (1:1)

*'+.+)'54¤/+5%*'54'+%*&'765%*'40#6+10 $+5  

#FNKIG )CPGTDUEJCHV #NVGP.KORWTI \W (TCPMHWTV CO /CKP &GMQTCVKQP FGT /KVINKGFGT  /QFGNN  

OKV TWFQNRJKPKUEJGT -CKUGTMTQPG CD    Z  OO )QNF GOCKNNKGTV OKP #DRNCV\WPIGP KO   XQTFGTWPFTÒEMUGKVKIGP/GFCKNNQPTKPICP$CPFUEJNGKHGOKV6TCIGMPQRH/- 4++  'ZGORNCTFGT#WMVKQP(TKV\4WFQNH-ÒPMGT1UPCDTÒEM0T&KG&GMQTCVKQPFKGUGT)GUEJNGEJVGTIG UGNNUEJCHVKUVXQPCNNGTITÌ­VGT5GNVGPJGKV5KGYWTFGNCWV2TQEJ±\MC KP2)#5H CO/·T\XQP(TCP\++ -CKUGT FGU *GKNKIGP 4ÌOKUEJGP 4GKEJGU &GWVUEJGT 0CVKQP IGUVKHVGV &KGNGV\VGP5VCVWVGPFGT)GUGNNUEJCHVUVCOOGP XQP

36


WEIMARER REPUBLIK

9097 9098 (1:1)

9096

&'765%*'54'+%*



7$QQV-TKGIUCD\GKEJGP/CUUKXG#WUHÒJTWPI$TQP\GXGTIQNFGVIQJPG*GTUVGNNGTDG\GKEJ PWPICPUKNDGTHCTDGPGTDCWEJKIGT0CFGN0/1'- ++





+PQHHK\KGNNG'TKPPGTWPIUDTQUEJG\WT5KNDGTPGP*QEJ\GKV-CKUGT9KNJGNOU++WPF-CKUGTKP#WIWUVG 8KMVQTKCU5KNDGTCP0CFGNKO1TKIKPCNGVWK 4++



&'765%*'54'+%* 51)'09'+/#4'44'27$.+-  

'TKPPGTWPIUCD\GKEJGPHÒT*GGTGUNWHVUEJKHHG8GTUKNDGTVCP0CFGNFKGUGVTCIGDGFKPIVGVYCUXGTDQIGP 0/D1'- ++



9100 9099

9101

9104 9102



9103

5EJNGUKUEJGU$GY·JTWPIUCD\GKEJGPUQIGP5EJNGUKUEJGT#FNGT'JTGP\GKEJGP5VWHG$TQP\GXGTUKN DGTVGOCKNNKGTVFKG#WHNCIGPOKVVGNU*QJNPKGVGPDGHGUVKIV0CFGN'KUGPNGKEJVG-QTTQUKQPUURWTGP0/ F1'- ++p





$CNVGPMTGW\FGU$CNVKUEJGP0CVKQPCN#WUUEJWUUGU5VGEMMTGW\IGYÌNDVG#WUHÒJTWPI'KUGPIGUEJY·T\V #WHNCIGXGTIQNFGVOKV\YGK-NCOOGPDGHGUVKIVCP0CFGN0/1'- ++





#PPCDGTIMTGW\FGU(TGKMQTRU1DGTNCPF5VGEMMTGW\CNVGIGIQUUGPG#WUHÒJTWPI=QNFECUVOCPWHCEVW TKPI?XGTUKNDGTVWPFGOCKNNKGTVTÒEMUGKVKIGU<GPVTWOU#DFGEMM·RREJGPOKV3WGTPCFGN0/D 1'- ++



'JTGPMTGW\ OKV 5EJYGTVGTP FGU 'JTGPDWPFGU 5·EJUKUEJGT 9GNVMTKGIUVGKNPGJOGT G 8 8GTIQNFGV   COCNVGP1TKIKPCNDCPF ++





(GWGTYGJT'TKPPGTWPIUCD\GKEJGP )QNFDTQP\G CWH FGT 4ÒEMUGKVG +PUEJTKHV 14+)+0#.)'5    )'5%*ª6<6CP0CFGNKOQTKIKPCNGP8GTNGKJWPIUGVWKOKVDGUEJ·FKIVGO&GEMGN ++





8GTFKGPUVMTGW\ FGU .CPFGUHGWGTYGJTXGTDCPFGU 9ÒTVVGODGTI 8GTFKGPUVMTGW\ HÒT  &KGPUVLCJTG   5KNDGTVGKNYGKUGXGTIQNFGVCO$CPFOKVCWHIGNGIVGO#D\GKEJGP'HD ++

'ZGORNCTFGT#WMVKQP(TKV\4WFQNH-ÒPMGT1UPCDTÒEM0T&CFCU#PPCDGTIMTGW\MGKPGUVCCVNKEJG #WU\GKEJPWPIYCTICDGUOGJTGTG*GTUVGNNGTFKGGUCWHWPVGTUEJKGFNKEJG9GKUGWPF3WCNKV·VJGTIGUVGNNVJCDGP



'ZGORNCTFGT#WMVKQP(TKV\4WFQNH-ÒPMGT1UPCDTÒEM0T

 37


DRITTES REICH

&'765%*'54'+%* 51)'0&4+66'54'+%*  5QNCPIG UKEJ -WPFG WPF 8GTM·WHGT PKEJV IGIGPVGKNKI ·W­GTP XGTUKEJGTP UKG FC­ UKG )GIGPUV·PFG   WPF $Ã&#x2019;EJGT CWU FGT <GKV FGU &GWVUEJGP 4GKEJGU XQP  DKU  PWT \W <YGEMGP FGT   UVCCVUDÃ&#x2019;TIGTNKEJGP#WHMN·TWPIFGT#DYGJTXGTHCUUWPIUYKFTKIGT$GUVTGDWPIGPFGT-WPUVQFGTFGT 9KUUGPUEJCHV FGT (QTUEJWPI QFGT FGT .GJTG FGT $GTKEJVGTUVCVVWPI Ã&#x2019;DGT 8QTI·PIG FGU <GKV   IGUEJGJGPUQFGTFGT)GUEJKEJVGQFGT·JPNKEJGP<YGEMGPGTYGTDGP&KGUG)GIGPUV·PFGWPF$Ã&#x2019;EJGT YGTFGPITWPFU·V\NKEJPWTWPVGTFKGUGP8QTCWUUGV\WPIGPCPIGDQVGPWPFCDIGIGDGP5QOKVUVGNNVFGT 'TYGTD XQP )GIGPUV·PFGP WPF $Ã&#x2019;EJGTP CWU FKGUGT <GKV WPVGT FGP QDGP CWHIGHÃ&#x2019;JTVGP 8QTCWU   UGV\WPIGPIGO·­FGThhC#DUD\Y#DU5V)$MGKPGP5VTCHVCVDGUVCPFKO5KPPGFGUhC #DU  5V)$ FCT 7PVGT FKGUGP 7OUV·PFGP KUV GU CNUQ ITWPFU·V\NKEJ GTNCWDV 1TFGP WPF 'JTGP   \GKEJGPFKGKPh#DU)GUGV\Ã&#x2019;DGT6KVGN1TFGPWPF'JTGP\GKEJGPPKEJVCWHIGHÃ&#x2019;JTVUKPFUQYKG #D\GKEJGPOKVPCVKQPCNUQ\KCNKUVKUEJGP'ODNGOGP\WXGTMCWHGPWPF\WGTYGTDGPWPFFKGUGPVIGIGP FGP $GUVKOOWPIGP FGU h  #DU  )GUGV\ Ã&#x2019;DGT 6KVGN 1TFGP WPF 'JTGP\GKEJGP &GUJCND JCV FGT   $WPFGUOKPKUVGTFGT,WUVK\OKV5EJTGKDGP++XQOFGOUGKPGT\GKVKIGP 8QTUKV\GPFGP FGU $WPFGU FGWVUEJGT 1TFGPUUCOONGT G 8 CWUFTÃ&#x2019;EMNKEJ GTMN·TV FC­ FGT 'TYGTD   XQP1TFGPWPF'JTGP\GKEJGPCWUFGT<GKVFGUUQIGPCPPVGP&TKVVGP4GKEJGUFWTEJGTPUVJCHVGWPF QTICPKUKGTVG5COONGTOKVFGO<KGNFKGUGP)GIGPUVCPFKPGKPG5COONWPIGKP\WHÃ&#x2019;IGPMGKPGP5VTCH VCVDGUVCPFKO5KPPGFGU)GUGV\GUFCTUVGNNV  1TFGPUUEJPCNNGP OKV #WU\GKEJPWPIGP FGU &GWVUEJGP 4GKEJGU XQP  DKU  UKGJG &'765%*   .#0&14&'055%*0#..'0 

1TFGP XQO &GWVUEJGP #FNGT  /QFGNN OKV UVKNKUKGTVGT #MCPVJWU#ITCHHG WPVGTJCND FGT ¤UG   5GV FGU 8GTFKGPUVMTGW\GU OKV 5VGTP CD   -NCUUG  DGUVGJGPF CWU 8GTFKGPUVMTGW\ 5KNDGT   XGTIQNFGVWPFGOCKNNKGTVKPFGT¤UG5KNDGTRWP\GCOQTKIKPCNGPWPIGVTCIGP*CNUDCPF\WUCOOGP OKV$TWUVUVGTP5KNDGT#WHNCIG5KNDGTXGTIQNFGVCWHFGT4Ã&#x2019;EMUGKVG\YGK*QJNPKGVGPCP0CFGNFKGUGOKV 5KNDGTRWP\GKOQTKIKPCNGPIQNFGPDGFTWEMVGP8GTNGKJWPIUGVWK-&10/C E  1'- 5VÃ&#x2019;EM4+p++ 



1TFGP XQO &GWVUEJGP #FNGT  /QFGNN OKV UVKNKUKGTVGT #MCPVJWU#ITCHHG WPVGTJCND FGT ¤UG  8GTFKGPUVMTGW\5VWHG CD-NCUUG 5KNDGTXGTIQNFGVWPFGOCKNNKGTVKPFGT¤UG5KNDGT RWP\GWPF*GTUVGNNGTRWP\GFGT(KTOC)GDTÃ&#x2019;FGT)QFGV%QKP$GTNKPCOQTKIKPCNGPWPIGVTCIGP *CNUDCPF KO QTKIKPCNGP IQNFHCTDGP DGFTWEMVGP 8GTNGKJWPIUGVWK <WUCOOGP OKV FGT QTKIKPCNGP 8GTNGK   JWPIUWTMWPFG HÃ&#x2019;T &T +YCP #RQUVQNQHH &GMCP FGT 4GEJVUHCMWNV·V FGT 7PKXGTUKV·V 5QHKC FCVKGTV $GTNKP   CO#WIWUVOKVITQ­GO2T·IGUKGIGPWPF7PVGTUEJTKHVGP#*KVNGT 1TKIKPCNKV·VPKEJVIGRTÃ&#x2019;HV  WPF/GKUUPGTKPGVYCUXGTUEJOWV\VGT&QMWOGPVGPOCRRGUQYKG*GHVOKVFGT8GTQTFPWPIWPF5CV\WPI -&10/C1'- ++  'ZGORNCTFGT#WMVKQP(TKV\4WFQNH-Ã&#x2019;PMGT1UPCDTÃ&#x2019;EM0T

9107





38

9108

'JTGP\GKEJGPFGU&GWVUEJGP4QVGP-TGW\GU/QFGNN  -TGW\-NCUUG$TQP\GXGTIQN FGV WPF GOCKNNKGTV \WUCOOGP OKV $CPFCDUEJPKVV WPF (GNFURCPIG OKV MQODKPKGTVGP $CPF FGU 'KUGTPGP   -TGW\GU++-NCUUG KOQTKIKPCNGP8GTNGKJWPIUGVWK-&10/G1'- ++



'JTGP\GKEJGPFGU&GWVUEJGP4QVGP-TGW\GU/QFGNN  -TGW\-NCUUG$TQP\GXGTIQN FGVWPFGOCKNNKGTV'OCKNNGCWUDTWEJCWH#XGTUWPF4GXGTUGKPGT-TGW\GEMGOKP*CCTTK­CWHFGT4Ã&#x2019;EM UGKVG-&10/G1'- ++p




DRITTES REICH 

'JTGP\GKEJGP FGU &GWVUEJGP 4QVGP -TGW\GU /GFCKNNG FGU &GWVUEJGP 4QVGP -TGW\GU XGTUKNDGTV   VGKNYGKUGXGTIQNFGVGOCKNNKGTVCO$CPF-&10/K1'- ++





'JTGP\GKEJGP HÒT &GWVUEJG 8QNMURHNGIG -TGW\  5VWHG $WPVOGVCNN XGTIQNFGV WPF GOCKNNKGTV CO   $CPF-&10/1'- ++





1TFGP FGU -TKGIUXGTFKGPUVMTGW\GU -TKGIUXGTFKGPUVMTGW\  -NCUUG OKV 5EJYGTVGTP 9GK­OGVCNN   XGTUKNDGTV  I QJPG *GTUVGNNGTDG\GKEJPWPI CP DTGKVGT HNCEJGT 0CFGN KO QTKIKPCNGP UKNDGTHCTDGP   DGFTWEMVGP8GTNGKJWPIUGVWK-&10/1'- ++



&KGPUVCWU\GKEJPWPI FGT 9GJTOCEJV  5VWHG HÒT  &KGPUVLCJTG  WPF  5VWHG HÒT  &KGPUVLCJTG    LGYGKNU 'KUGP XGTIQNFGV D\Y XGTUKNDGTV CP <YGKGT$QIGPDCPFURCPIG OKV CWHIGNGIVGP *GGTGU D\Y   /CTKPG#FNGTP CP 0CFGN \WUCOOGP OKV 8GTNGKJWPIUWTMWPFG HÒT FGP (GNFYGDGN #TPQ $KUEJQH XQO   +PHCPVGTKG4GIKOGPVFCVKGTV&TGUFGPCO1MVQDGT1TKIKPCNWPVGTUEJTKHVFGU4GIKOGPVUMQO OCPFGWTU OGJTHCEJ IGHCNVGV &C\W 4GRTQFWMVKQP GKPGU 9GJTOCEJVUIGPGTCNU WPF -QOOCPFGWTU FGU   /KNKV·T5V*GKPTKEJU1TFGPU-&10/C C 1'-  5VÒEM++





9113



5EJCTHUEJÒV\GP#D\GKEJGP-QORNGVVGT5CV\FGTWPF5VWHGFGU#D\GKEJGPUCWH7PKHQTOVWEJ IGUVKEMV GKPGU OKV IQNFHCTDGPGT GKPGU OKV UKNDGTHCTDGPGT WPF GKPGU QJPG 4CPFMQTFGN -&1    0/CE1'- 5VÒEM444++  8QP CNNGTITÌ­VGT 5GNVGPJGKV <WT )GUEJKEJVG FKGUGU #D\GKEJGP UKGJG 6JQOCU 8QUU  &CU 5EJCTHUEJÒV\GPCD\GKEJGP   FGT &GWVUEJGP 9GJTOCEJV WPF UGKPG )GUEJKEJVG 0QTFGTUVGFV  7PF 4QNH /KEJCGNKU  &CU 5EJCTHUEJÒV\GP   #D\GKEJGP$GTNKP

39


DDR 

7OHCPITGKEJGT 0CEJNC­ FGU .GWVPCPVU FGT  5VCHHGN FGU -CORHIGUEJYCFGTU  9CNVGT &KNEJGT  

IGHCNNGP   $GUVGJGPF CWU   $GQDCEJVGT#D\GKEJGP $WPVOGVCNN VGKNYGKUG XGTUKNDGTV CWH FGO   4GXGTUFGU#FNGTU*GTUVGNNGTDG\GKEJPWPI9&'7/'4.ª&'05%*'+&CPTWPFGT0CFGNKO'VWK OKV#WHUEJTKHV$GQDCEJVGTOKV8GTNGKJWPIUWTMWPFG 'KUGTPGU-TGW\+-NCUUGQJPG*GTUVGNNGT DG\GKEJPWPI CP 0CFGN KO UKNDGTDGFTWEMVGP 8GTNGKJWPIUGVWK   'KUGTPGU -TGW\  ++ -NCUUG CO   NCPIGP$CPFKP8GTNGKJWPIUVÒVGOKVXQTN·WHKIGO$GUKV\\GWIPKUWPF8GTNGKJWPIUWTMWPFG 5#9GJT CD\GKEJGPKP$TQP\GCWHFGO4GXGTU+PUEJTKHV+)'067/&%*'(5&#75$+.&70)59'5'05 $100'4  -7056#$<  $'&#4(  $100 C 4* OKV /CVTKMGNPWOOGT  CP 0CFGN    4GKEJUURQTVCD\GKEJGPKP$TQP\GTÒEMUGKVKIG*GTUVGNNGTDG\GKEJPWPIFGT(KTOC9GTPUVGKPKP,GPCCP 0CFGN 2NCMGVVGHÒTFKG6GKNPGJOGTFGU05(-&GWVUEJNCPFHNWIGUOKV$GUKV\WTMWPFGKO1TKIK PCNGVWK   #D\GKEJGP FGU 05(-&GWVUEJNCPFHNWIGU < XGTUKNDGTV WPF GOCKNNKGTV CWH FGO 4GXGTU   *GTUVGNNGTDG\GKEJPWPIFGT(KTOC$TGJOGTKP/CTMPGWMKTEJGPCP0CFGN 'JTGPMTGW\FGT&GWVUEJGP /WVVGTKP$TQP\G\YGKVGU/QFGNNKPFGT8GTNGKJWPIUVÒVGXQP,CMQD$GPIGNKP+FCT1DGTUVGKP &TGK 2CCT-TCIGPURKGIGNGKPGU.GWVPCPVUFGT.WHVYCHHGOKV\WIGJÌTKIGP5EJWNVGTUVÒEMGPUQYKGGKPIGUVKEMVGT .WHVYCHHGPCFNGT   5KNDGT\KRHGN   <WUCOOGP OKV OGJTGTGP2JQVQCNDGPOKV\CJNTGKEJGP2JQVQUCWU FGO <YGKVGP 9GNVMTKGI XKGNGP <GKVWPIUCWUUEJPKVVGP &KGPUVDÒEJGT HNWIVGEJPKUEJG #PNGKVWPIGP WPF   (CEJNKVGTCVWTWP\·JNKIGRGTUÌPNKEJG&QMWOGPVGWPF7PVGTNCIGP+PWPVGTUEJKGFNKEJGO<WUVCPF  5VÒEM++++p+++  #WUFGT#WMVKQP(TKV\4WFQNH-ÒPMGT1UPCDTÒEM0T9CNVGT&KNEJGTYWTFG,WNKCNU5QJP FGU1DGTUVGKIGT*GKPTKEJ&KNEJGTWPFUGKPGT(TCW.WKUG IGD-NGRRG KP5QODQTP -TGKU&QTVOWPF IGDQTGP#O 1MVQDGTYWTFGGTKO8GTNCWHFGT.WHVUEJNCEJVWO'PINCPFÒDGT$TKIJVQPCDIGUEJQUUGP

9116 9115



9117

9119

9120

2GMVQTCNG $TWUVMTGW\  HÒT GXCPIGNKUEJG RTQVGUVCPVKUEJG WPF TGHQTOKGTVG  (GNFIGKUVNKEJG  Z   OO5KNDGTCWHFGT4ÒEMUGKVG*GTUVGNNGTDG\GKEJPWPIFGT(KTOC%',WPEMGTKP$GTNKPWPF5KNDGT RWP\GCPFGTQTKIKPCNGP-GVVG*ª ++





2GMVQTCNG $TWUVMTGW\  HÒT GXCPIGNKUEJG RTQVGUVCPVKUEJG WPF TGHQTOKGTVG  (GNFIGKUVNKEJG  Z   OO5KNDGTCWHFGT4ÒEMUGKVG5KNDGTRWP\GCPFGTQTKIKPCNGP-GVVG*ª ++





2GMVQTCNG $TWUVMTGW\ HÒTMCVJQNKUEJG(GNFIGKUVNKEJGZOO5KNDGT*QN\NCEMKGTVCWHFGT 4ÒEMUGKVG5KNDGTRWP\GWPFFTGKHCEJXGTPKGVGVCPFGTQTKIKPCNGP-GVVG*ª ++





-QPXQNWV XQP EC  -NGKPCD\GKEJGP FGU &GWVUEJGP 4GKEJGU XQP  DKU  1TKIKPCNG WPF   -QRKGPKPXGTUEJKGFGPGP/GVCNNGPVGKNUGOCKNNKGTVOGKUVCP0CFGNPKPWPVGTUEJKGFNKEJGP'TJCNVWPIGP ++



'ZGORNCTFGT#WMVKQP(TKV\4WFQNH-ÒPMGT1UPCDTÒEM0T

&'765%*'&'/1-4#6+5%*'4'27$.+-   



40

8CVGTN·PFKUEJGT 8GTFKGPUVQTFGP 5KNDGTUVWHG  #WUICDG $WPVOGVCNN &GMQTCVKQP OKV PKEJVNÌUDCTGT   8GTDKPFWPI\WT6TCIGURCPIG $WPVOGVCNNXGTUKNDGTVWPFGOCKNNKGTVCP6TCIGURCPIGFKGUG CWH FGT 4ÒEMUGKVG XGTUEJTCWDV \WUCOOGP OKV +PVGTKOUURCPIG CWHFGT4ÒEMUGKVGXGTUEJTCWDVKOIGND YGK­GP'VWK$#E-&1 ++



8CVGTN·PFKUEJGT 8GTFKGPUVQTFGP $TQP\GUVWHG  #WUICDG $WPVOGVCNN &GMQTCVKQP OKV PKEJVNÌUDCTGT   8GTDKPFWPI\WT6TCIGURCPIG $WPVOGVCNNDTQP\KGTV4ÒEMUGKVGINCVVCP6TCIGURCPIGFKGUG CWH FGT 4ÒEMUGKVG XGTUEJTCWDV \WUCOOGP OKV +PVGTKOUURCPIG CWHFGT4ÒEMUGKVGXGTUEJTCWDVKOIGND YGK­GP'VWK$#C-&1 ++




BUNDESREPUBLIK DEUTSCHLAND

9121 (1:1)

$70&'54'27$.+-&'765%*.#0& 5'+6  1TFGP WPF 'JTGP\GKEJGP FGT $WPFGUTGRWDNKM &GWVUEJNCPF WPF KJTGT $WPFGUN·PFGT GDGPUQ YKG   FGTGP /KPKCVWTGP $CPFUVGIG -PQRHNQEJUEJNGKHGP WPF $CPFUEJPCNNGP FÒTHGP IGO·­ h  #DU    )GUGV\ÒDGT6KVGN1TFGPWPF'JTGP\GKEJGPPWTCP$GTGEJVKIVGCDIGIGDGPYGTFGP#NU$GTGEJVKIVG IGNVGP JKGTDGK PGDGP FGP $GNKGJGPGP CWEJ CNNG FKGLGPKIGP 2GTUQPGP FKG KO $GUKV\ GKPGT   5COOGNIGPGJOKIWPI UKPF &KGUG 5COOGNIGPGJOKIWPI GTVGKNV CWH #PHTCIG FKG LGYGKNU \WUV·PFKIG   $GJÌTFG &KG <WUV·PFKIMGKV KUV KP FGP GKP\GNPGP $WPFGUN·PFGTP WPVGTUEJKGFNKEJ IGTGIGNV  &KG   'TVGKNWPI GKPGT UQNEJGP )GPGJOKIWPI MCPP IGO·­ FGU -QOOGPVCTU \WO )GUGV\ XQP FGT   \WUV·PFKIGP $GJÌTFG PWT DGK 8QTNKGIGP UEJYGTYKGIGPFGT )TÒPFG XGTYGKIGTV YGTFGP /KV GKPGO   )GDQV CWH 1TFGP WPF 'JTGP\GKEJGP FGT $WPFGUTGRWDNKM WPF KJTGT $WPFGUN·PFGT XGTUKEJGTV FGT   $KGVGTKOQTFPWPIUIGO·­GP$GUKV\GKPGTUQNEJGP5COOGNIGPGJOKIWPI\WUGKP 

8GTFKGPUVQTFGP FGT $WPFGUTGRWDNKM &GWVUEJNCPF $TWUVUVGTP \WO )TQ­GP 8GTFKGPUVMTGW\ OKV 5VGTP   GTUVG#WUHÒJTWPIGKPGUOÌINKEJGTYGKUGDKUJGTPKEJVKFGPVKHK\KGTVGP*GTUVGNNGTU YQJNPKEJV5VGKPJCWGT .ÒEMKP.ÒFGPUEJGKF \YKUEJGPWPFEC&WTEJOGUUGTIGUCOVOO UVCVVD\YUR·VGT OO WPFFGU1TFGPUMTGW\GUOO UVCVVOOD\YUR·VGTOO $WPVOGVCNN  XGTIQNFGV WPFVGKNYGKUGGOCKNNKGTVCWHFGT4ÒEMUGKVG\YGK*QJNPKGVGPQJPG*GTUVGNNGTDG\GKEJPWPIQFGT2WP\GPCP 0CFGNDTGKVGT0CFGNJCMGPOKV4KNNG-&1XCT5.XCT 44++



&CU XQTNKGIGPFG 'ZGORNCT YGKUV KP #WUOC­GP YKG CWEJ (GTVKIWPIUSWCNKV·V FGWVNKEJG 7PVGTUEJKGFG UQYQJN \W FGP   HTÒJGP XQP 5VGKPJCWGT  .ÒEM YKG CWEJ \W FGP XQP 5EJWNGT  -WP JGTIGUVGNNVGP 'ZGORNCTGP CWH WPF FÒTHVG XQP   ITQ­GT 5GNVGPJGKV UGKP )GKIGT .KPFPGT WPF 9ÌTPGT UEJTGKDGP KP )GKIGT 4QNH .KPFPGT ,ÒTIGP WPF 9ÌTPGT   (TCPM,CJTG8GTFKGPUVQTFGPFGT$WPFGUTGRWDNKM&GWVUEJNCPF+P1TFGPWPF'JTGP\GKEJGP&CU/CIC\KPHÒT 5COONGTWPF(QTUEJGT,CJTICPI*GHV#WIWUV ÒDGTGKPPCEJYGKUNKEJCPIGHGTVKIVGUWPF CPFGP ,WUVK\OKPKUVGTC&&T,QUGH$G[GTNG XGTNKGJGPGU'ZGORNCTFGU)TQ­GP8GTFKGPUVMTGW\GUOKV5VGTPKPFGT#WUHÒJ TWPIDKU\WO,WPK CWH5 &GTDGKNKGIGPFGSWCFTCVKUEJG5VGTPJCVGKPGP&WTEJOGUUGTXQPOO &CU CWH FGP 5VGTP CWHIGNGIVG 1TFGPU\GKEJGP JCV GKPGP &WTEJOGUUGT XQP  OO WPF KUV OKV \YGK 0KGVGP CWH FGO   5VGTPMÌTRGT DGHGUVKIV &KG GTJCDGPGP 6GKNG FGU 5VGTPU UKPF OKV GKPGO 2QNKGTUVCD DGCTDGKVGV &KG CWH FGO 5VGTP   CWHIGNGIVG 1TFGPUFGMQTCVKQP KUV GDGPHCNNU ·W­GTUV HGKP DGCTDGKVGV &CU TQVG 'OCKN YWTFG HNCEJIGUEJNKHHGP &CU   /GFCKNNQPKO-TGW\JCVGKPGP&WTEJOGUUGTXQPOO9GFGTFGT5VGTPMÌTRGTPQEJFKG0CFGNUKPFIGRWP\V&CJGT IGJGP YKT XQP \YGK #PPCJOGP CWU <WO GKPGP JCPFGNV GU UKEJ DGK FKGUGO 'ZGORNCT WO GKPGP 5VGTPMÌTRGT CWU   $WPVOGVCNNFGTCWUFKGUGO)TWPFMGKPG5KNDGTIGJCNVURWP\GDGUKV\V<WOCPFGTGP\GKIVWPUFCU(GJNGPFGT*GTUVGN NGTRWP\GFC­KPFGO(GTVKIWPIU\GKVTCWOMGKP$GFCTHDGUVCPFFGPP5VGTP\WMGPP\GKEJPGP*GTIGUVGNNVYWTFG FKGU#WU\GKEJPWPIXQP5VGKPJCWGT.ÒEM7PFYGKVGTUEJTGKDGP5KGÒDGTFGP$TWUVUVGTPFGU)TQ­GP8GT FKGPUVMTGW\GUOKV5VGTPKPFGT#WUHÒJTWPIPCEJFGO,WPK 5 #NU1TFGPUUVGTPYKTFFGTHNCEJG SWCFTCVKUEJG 5VGTP FGT DKUJGT CWEJ \WO )TQ­GP 8GTFKGPUVMTGW\ OKV 5VGTP IGVTCIGP YWTFG YGKVGTIGVTCIGP 9KG   NCPIGPQEJ1TFGPUUVGTPGXQP5VGKPJCWGT.ÒEMCWUXGTIQNFGVGO$WPVOGVCNNCWUIGIGDGPYWTFGPKUVWPMNCT&KGUG 5VGTPG UKPF OKV CP 5KEJGTJGKV ITGP\GPFGT 9CJTUEJGKPNKEJMGKV KFGPVKUEJ OKV FGO CP &T $G[GTNG XGTNKGJGPGP 5VGTP   5R·VGT YKTXGTOWVGPPCEJ YWTFGPFKG5VGTPGCWUXGTIQNFGVGOGT5KNDGTJGTIGUVGNNV5GKVFGT8GTYGPFWPI XQPGT5KNDGTVTCIGPCNNG5VGTPGGKPG*GTUVGNNGTWPF5KNDGTRWP\G5GKVHGTVKIVGCWEJFKG2HQT\JGKOGT (KTOC 5EJWNGT  -WP    &KG XQP 5EJWNGT  -WP JGTIGUVGNNVGP 1TFGPUUVGTPG JCDGP GKPGP &WTEJOGUUGT XQP   OODKUFKG(KTOC#PHCPIFGTUGEJ\KIGT,CJTGFKG2TQFWMVKQPFGU8GTFKGPUVQTFGPUGKPUVGNNVG&CUGDGPHCNNUOO ITQ­G1TFGPUMTGW\KUVOKVXKGT0KGVGPCWHFGO5VGTPMÌTRGTDGHGUVKIV&KG5VGTPGUKPFFWTEJYGIIGRWP\VWPFYGKUGP UKEJFWTEJGKPGXQT\ÒINKEJG(GTVKIWPIWPFGKPGIGUEJNKHHGPG'OCKNCWU



-QPXQNWVXQPXKGT(GWGTYGJTCWU\GKEJPWPIGPWPF\YGK5RQTVCD\GKEJGP 0QTFTJGKP9GUVHCNGPHÒT ,CJTG 4JGKPNCPF2HCN\/QFGNNHÒT,CJTGDGKFGCO$CPF\WUOKV+PVGTKOURCPIGPKP'VWKU  (9.GKUVWPIUCD\GKEJGPFGU'THVMTGKUGUKP5KNDGTXGTUKNDGTV (9.GKUVWPIUCD\GKEJGPFGU'THVMTGK UGU KP $TQP\G DGKFG CP 0CFGN FC\W .GKUVWPIUPCEJYGKU*GHV   5RQTVCD\GKEJGP KP )QNF XGTIQNFGV    5RQTVCD\GKEJGPKP)QNFOKV<CJNLGYGKNUCP0CFGN\WUCOOGPOKV/KPKCVWTGPKP'VWKU&C\W$TQP \GOGFCKNNGFGT4WFGT4GICVVCKP*CODWTICWHFGT#NUVGTCP5EJNGKHG 5VÒEM++

 41


DEUTSCHLAND - ORDENSSCHNALLEN

9123 (1:1)

&'765%*.#0&14&'055%*0#..'0 9GKVGTGKPVGTGUUCPVG1TFGPUUEJPCNNGPOKVFGWVUEJGO$G\WIHKPFGP5KGWPVGT 14&'055%*0#..'0+06'40#6+10#.WPFWPVGT5%*9'&'0 

)TQ­G MTCWUG 1TFGPUUEJPCNNG FGU FGWVUEJGP /CTKPGHNKGIGTU .GWVPCPV \ 5 *CPU 4QNUJQXGP    'KUGTPGU-TGW\++-NCUUGIGUEJY·T\VGT'KUGPMGTP5KNDGT\CTIG -ÌPKINKEJGT*CWUQTFGPXQP *QJGP\QNNGTP4KVVGTMTGW\OKV5EJYGTVGTP)QNF  GOCKNNKGTVFGTCDIGDTQEJGPG)TKHHFGUTGEJVUGKVKIGP 5EJYGTVGU UR·VGT KP 5KNDGT XGTIQNFGV GTI·P\V   .ÒDGEM *CPUGCVGPMTGW\ #P 0CFGN #PIGDQVGP OKV   GKPKIGP$N·VVGTPDKQITCRJKUEJGP+PJCNVUÒDGT4QNUJQXGPCWUFGO+PVGTPGV 44++  #WHITWPF FGT 0CEJHQTUEJWPIGP XQP &CPKGN -TCWUG KP 2QVUFCO  FGO JKGTOKV JGT\NKEJ IGFCPMV YKTF  MQPPVG FKG   1TFGPUUEJPCNNG GKPFGWVKI FGO /CTKPGHNKGIGT .GWVPCPV \ 5 *CPU 4QNUJQXGP \WIGQTFPGV YGTFGP &CDGK JCPFGNV GU   UKEJWOGKPG1TFGPUUEJPCNNGGKPGUYKEJVKIGP2KQPKGTUCWUFGT#PHCPIU\GKVFGTFGWVUEJGPOKNKV·TKUEJGP5GGHNKGIGTGK FGTGPJKUVQTKUEJG$GFGWVWPIWPF9GTVCWEJFWTEJFKG4GRCTCVWTCOUGNVGPGPGEJVIQNFGPGP4KVVGTMTGW\FGU-ÌPKINK EJGP*CWUQTFGPUXQP*QJGP\QNNGTPPKEJVDGGKPVT·EJVKIVYKTF0CEJFGO4QNUJQHGPIGDQTGPKP5VTCNUWPFUEJQP DGKODTKVKUEJGP#GTQ%NWDUGKPG2KNQVGPRTÒHWPICDIGNGIVJCVVGOGNFGVGGTUKEJPCEJ-TKGIUDGIKPPHTGKYKNNKICNU 5GGMCFGVV \W FGP 5GGHNKGIGTP KP -KGN*QNVGPCW 'PFG  CDMQOOCPFKGTV KP FCU DGUGV\VG (NCPFGTP DCWVG GT KP   <GGDTÒIIG\WUCOOGPOKV1DGTNGWVPCPV\5(TKGFTKEJX#TPCWNFFKG5GGHNWIUVCVKQP(NCPFGTP+CWHWPFYWTFG\WO .GWVPCPV \ 5 DGHÌTFGTV 'T HNQI KP FGT (QNIG\GKV \CJNTGKEJG 'KPU·V\G UQYQJN CNNGKPG CNU CWEJ KO 8GTDCPF FGT   5GGHNWIUVCHHGN+++<WGKPGOWPDGMCPPVGP<GKVRWPMVYWTFGPKJOFCU'-++WPFFCU'-+XGTNKGJGP0CEJFGO#D UEJW­ GKPGT DTKVKUEJGP /CUEJKPG YWTFG KJO QHHK\KGNN GKP .WHVUKGI \WGTMCPPV #O  1MVQDGT  GTJKGNV GT FCU   4KVVGTMTGW\OKV5EJYGTVGTPFGU-ÌPKINKEJGP*CWUQTFGPUXQP*QJGP\QNNGTPPWTMWT\DGXQTGTCO1MVQDGTFGU INGKEJGP,CJTGUDGKFGT-QNNKUKQPOKVGKPGTCPFGTGP/CUEJKPGUGKPGT5VCHHGNUEJYGTXGTNGV\VYWTFGYWTFGKJO FCU.ÒDGEMGT*CPUGCVGPMTGW\XGTNKGJGP0CEJN·PIGTGT)GPGUWPIGTJKGNVGTFGP$GHGJNKP0KGWYOWPUVGTCNU5VCHHGN HÒJTGT FKGPGWG5GGHTQPVUVCHHGN+CWH\WUVGNNGP4QNUJQXGPUVCTDCO/CKDGKO#DUVWT\UGKPGT/CUEJKPGXQT &ÒPMKTEJGPDGKGKPGO7PHCNNDGKTCWGT5GGICD6JGQ'OKN5ÌPPKEJUGPGKPGP6GKNUGKPGU6CIGDWEJUWPVGTFGO 6KVGN 5GGHNKGIGT KP (NCPFGTP  CWU FGP 6CIGDWEJDN·VVGTP FGU .GWVPCPVU \WT 5GG *CPU 4QNUJQXGP GTUEJKGPGP DGK   /KVVNGTWPFUQJPKP$GTNKP JGTCWU

9124



)TQ­GINCVVG1TFGPUUEJPCNNGOKVUKGDGPCPJ·PIGPFGP#WU\GKEJPWPIGP $TCWPUEJYGKI-TKGIUXGT FKGPUVMTGW\CO$CPFHÒT-·ORHGT $TCWPUEJYGKI*GT\QINKEJ$TCWPUEJYGKIKUEJGT*CWUQTFGP*GKP TKEJFGU.ÌYGP8GTFKGPUVMTGW\-NCUUGCWHFGT4ÒEMUGKVGRWP\KGTV/QPF-TQPG5 /GEMNGP DWTI5VTGNKV\-TGW\HÒT#WU\GKEJPWPIKO-TKGIG-NCUUG$TQP\GXGTUKNDGTVCO PKEJVMQTTGM VGP $CPFFGTUEJYGTKPKUEJGP8GTFKGPUVOGFCKNNG(TKGFTKEJ(TCP\++QFGTFGU(TKGFTKEJ(TCP\#NGZCPFTC -TGW\GU   .KRRG &GVOQNF  (ÒTUVNKEJ .KRRKUEJGT *CWUQTFGP  /QFGNN OKV /QPQITCOO .  CD     'JTGPMTGW\  -NCUUG ++ #DVGKNWPI OKV 5EJYGTVGTP #PHGTVKIWPI XQP % ( <KOOGTOCPP KP   2HQT\JGKO 5KNDGT 4QUG 5KNDGT XGTIQNFGV VGKNYGKUG GOCKNNKGTV MCWO UKEJVDCTGT %JKR KP GKPGO 4QUGP   DNCVV   1NFGPDWTI (TKGFTKEJ #WIWUV-TGW\ ++ -NCUUG 'KUGP OKV 4GUVUEJY·T\WPI   2TGW­GP <GP   VGPCTOGFCKNNG    0KGFGTNCPFG $TQP\GOGFCKNNG HÒT VTGWGP &KGPUV KP FGT #TOGG  /QFGNN OKV   /QPQITCOO91JPGTÒEMUGKVKIG#DFGEMWPICP0CFGN ++ 'ZGORNCT FGT #WMVKQP (TKV\ 4WFQNH -ÒPMGT  1UPCDTÒEM  0T  /ÌINKEJGTYGKUG KUV FCU WTURTÒPINKEJ   XQTJCPFGPG WPF XGTNQTGP IGICPIGPG UEJYGTKPKUEJG (TKGFTKEJ (TCP\#NGZCPFTC -TGW\ H·NUEJNKEJGTYGKUG FWTEJ FCU   UVTGNKV\KUEJG-TGW\HÒT#WU\GKEJPWPIKO-TKGIG-NCUUGGTUGV\VYQTFGP&CU'JTGPMTGW\-NCUUG++#DVGK NWPI OKV 5EJYGTVGTP JCPFGNV GU UKEJ WO GKP \YGKHGNUHTGKGU 1TKIKPCNGZGORNCT FCU NCWV 5EJYCTM KP5-50T DE FGT(KTOC%(<KOOGTOCPPKP2HQT\JGKOCNU*GTUVGNNGT\WIGYKGUGPMCPPFGTFKGUGU-TGW\XQPDKU IGHGTVKIVJCV'DGPHCNNUNCWV5EJYCTM KP5-50TD UKPFXQO#WIWUVDKU0QXGODGT PWT'JTGPMTGW\G-NCUUG++#DVGKNWPIOKV5EJYGTVGTPXGTNKGJGPYQTFGP

42




DEUTSCHLAND - ORDENSSCHNALLEN

9125



9126

)TQ­G JGUUKUEJG 1TFGPUUEJPCNNG OKV XKGT CPJ·PIGPFGP #WU\GKEJPWPIGP   )TQ­JGT\QINKEJ *GUUK   UEJGT 8GTFKGPUV1TFGP 2JKNKRRU FGU )TQ­OÒVJKIGP D\Y)TQ­JGT\QINKEJ*GUUKUEJGT2JKNKRRU1TFGP CD    /QFGNN   OKV FGT $ÒUVG FGU .CPFITCHGP 2JKNKRR  4KVVGTMTGW\ ++ -NCUUG OKV   5EJYGTVGTPCWHFGOTÒEMUGKVKIGP/GFCKNNQPTKPI.7&18+%75++/#)05KNDGT/GFCKNNQPU )QNF GOCKNNKGTV FGT .ÌYG CWH FGT 4ÒEMUGKVG WPDGUEJ·FKIV FKG 5EJYGTVGT OKVXGTIQNFGVGP)TKHHGPIG UEJTCWDV  *GUUGP &CTOUVCFV &KGPUVGJTGP\GKEJGPHÒT&KGPUVLCJTGHÒT7PVGTQHHK\KGTGWPF5QNFC VGP  #WUICDG OKV CTCDKUEJGP <KHHGTP 5KNDGT   *GUUGP &CTOUVCFV  (GNFFKGPUV\GKEJGP   $CFGP   )GF·EJVPKUOGFCKNNGHÒTDCFKUEJG#WUICDGOKV-CWHFGO#XGTU(·FGPCWHFGT4ÒEMUGKVGPKEJV HNWQTGU\KGTGPFQJPGTÒEMUGKVKIG#DFGEMWPICP0CFGN 44++



'ZGORNCTFGT#WMVKQP(TKV\4WFQNH-ÒPMGT1UPCDTÒEM0T#WHITWPFFGU4KVVGTMTGW\GU++-NCUUG OKV5EJYGTVGTPFÒTHVGGUUKEJWOFKG5EJPCNNGGKPGU1HHK\KGTUJCPFGNP1DFCUOÌINKEJGTYGKUGWTURTÒPINKEJCPFGT 5EJPCNNGDGHKPFNKEJG&KGPUVGJTGP\GKEJGPHÒT&KGPUVLCJTGHÒT1HHK\KGTGKP)QNFFWTEJFCULGPKIGHÒT7PVGTQHHK\KGTG WPF5QNFCVGPKP5KNDGTGTUGV\VYQTFGPKUVN·­VUKEJPKEJVHGUVUVGNNGP<WT0KGFGTUEJNCIWPIFGTDCFKUEJGP4GXQNWVKQP XQP  YWTFGP WPVGT (ÒJTWPI XQP 2TKP\ 9KNJGNO XQP 2TGW­GP   FGO UR·VGTGP -CKUGT 9KNJGNO +   PGDGPRTGW­KUEJGPNKGEJVGPUVGKPKUEJGP  IGIGPFGP9KGFGTUVCPFFGTJGUUKUEJGP$GXÌNMGTWPICWEJJGUUKUEJG6TWR RGPPCEJ$CFGPGPVUCPFVFKGKPFGT(QNIG\GKVDKUWPVGTCPFGTGOCWEJFKG5VCFV-QPUVCP\DGUGV\VJKGNVGP



2TGW­KUEJG1TFGPUUEJPCNNGCWUFGO&GWVUEJ(TCP\ÌUKUEJGP-TKGIOKV\YGK#WU\GKEJPWPIGP #NN IGOGKPGU 'JTGP\GKEJGP  -NCUUG OKV FGO )GPHGT -TGW\ 5KNDGT VGKNYGKUG GOCKNNKGTV   -TKGIUFGPM   OÒP\GHÒT-·ORHGT)GUEJÒV\DTQP\GOKV4CPFRT·IWPI#75'41$'46'/)'5%*7'6< OKV\YGK)GHGEJVUURCPIGP8+108+..'/#45.#6174WPF)4#8'.166'5624+8#6CP 0CFGN ++



9127

9128





)TQ­GDC[GTKUEJG1TFGPUUEJPCNNGOKV\YGKXQPWTURTÒPINKEJXKGT#WU\GKEJPWPIGP $C[GTP/KNK V·TKUEJG ,WDKN·WOU/GFCKNNG OKV -TQPG WPF FGP ,CJTGU\CJNGP  $TQP\G XGTIQNFGV   NGGTGU   $CPFFGURTGW­KUEJGP-TQPGPQTFGPUQFGTFGUYÒTVVGODGTIKUEJGP(TKGFTKEJ1TFGPU &GWVUEJGU4GKEJ -QNQPKCN)GFGPMOÒP\G HÒT 9GK­G OKV $CPFURCPIG &'765%*156#(4+-#    .GGTGU   $CPFFGT$C[GTKUEJGP/KNKV·T&KGPUVCWU\GKEJPWPI0CFGNCDIGDTQEJGP 5VÒEM++



)TQ­G DC[GTKUEJG 1TFGPUUEJPCNNG OKV UGEJU #WU\GKEJPWPIGP   2TGW­GP 'KUGTPGU -TGW\    ++-NCUUG5KNDGT\CTIG$CPFTKPIRWP\KGTV5 $C[GTP/KNKV·T8GTFKGPUVOGFCKNNGD\Y CD/·T\  6CRHGTMGKVUOGFCKNNG  /QFGNN OKV 2QTVTCKV XQP -ÌPKI /CZ + ,QUGRJ  CD    #WUHÒJTWPI  

ITÌ­GTGT -QRH OKV 5VGORGNUEJPGKFGTUKIPCVWT ,4+'5  EC  5KNDGTPG /GFCKNNG VGKN   YGKUG UEJYCEJG #WURT·IWPI   $C[GTP /KNKV·T8GTFKGPUVQTFGP /KNKV·T8GTFKGPUVMTGW\  /QFGNN  

  -TGW\ ++ -NCUUG OKV 5EJYGTVGTP   &GWVUEJGU 4GKEJ 'JTGPMTGW\ FGU 9GNVMTKGIGU HÒT   (TQPVM·ORHGT'KUGPDTQP\KGTVCWHFGT4ÒEMUGKVG*GTUVGNNGTDG\GKEJPWPI) $C[GTP,WDKN·WOUOG FCKNNG HÒT FKG DC[GTKUEJG #TOGG    $C[GTP /KNKV·T&KGPUVCWU\GKEJPWPI  /QFGNN     /GFCKNNG ++ -NCUUG HÒT :++ &KGPUVLCJTG &KG $·PFGT VGKNYGKUG GVYCU \GTUEJNKUUGP GKPGU DGUEJ·FKIV CP   0CFGN 5VÒEM++  43


DEUTSCHLAND - ORDENSSCHNALLEN 



)TQ­G 1TFGPUUEJPCNNG OKV UGEJU #WU\GKEJPWPIGP   &GWVUEJGU 4GKEJ 'JTGPMTGW\ FGU 9GNVMTKGIGU   HÒT(TQPVM·ORHGT &GWVUEJGU4GKEJ&KGPUVCWU\GKEJPWPIFGT9GJTOCEJV5VWHG-TGW\HÒT&KGPUV LCJTG OKV *GGT D\Y /CTKPGCFNGT   &GWVUEJGU 4GKEJ &KGPUVCWU\GKEJPWPI FGT9GJTOCEJV5VWHG -TGW\HÒT&KGPUVLCJTGOKV*GGTD\Y/CTKPGCFNGT5VWHG/GFCKNNGHÒT&KGPUVLCJTGOKV*GGT D\Y /CTKPGCFNGT   ¤UVGTTGKEJ -TKGIUGTKPPGTWPIUOGFCKNNG  OKV 5EJYGTVGTP   7PICTP   -TKGIUGTKPPGTWPIUOGFCKNNG  OKV 5EJYGTVGTP   (KPPNCPF (TGKJGKVUMTKGIU'TKPPGTWPIU   OGFCKNNGCP0CFGN<WUCOOGPOKVRCUUGPFGT(GNFUEJPCNNG 5VÒEM++



)TQ­GQNFGPDWTIKUEJG1TFGPUUEJPCNNGOKVHÒPH#WU\GKEJPWPIGP 2TGW­GP'KUGTPGU-TGW\++ -NCUUG   1NFGPDWTI (TKGFTKEJ #WIWUV-TGW\ ++ -NCUUG 'KUGP IGUEJY·T\V OKV $CPFURCPIG 814   &'/('+0&''KUGPIGUEJY·T\V &GWVUEJGU4GKEJ'JTGPMTGW\FGU9GNVMTKGIGUHÒT(TQPVM·ORHGT  &GWVUEJGU4GKEJ&KGPUVCWU\GKEJPWPIFGT9GJTOCEJV5VWHG-TGW\HÒT&KGPUVLCJTGOKVUKNDGT HCTDGPGO *GGT D\Y /CTKPGCFNGT   &GWVUEJGU 4GKEJ &KGPUVCWU\GKEJPWPI FGT 9GJTOCEJV  5VWHG /GFCKNNGHÒT&KGPUVLCJTGOKVUKNDGTHCTDGPGO*GGTD\Y/CTKPGCFNGTCP0CFGN 5VÒEM++



9131







9132

)TQ­GQNFGPDWTIKUEJG1TFGPUUEJPCNNGOKVFTGK#WU\GKEJPWPIGP 2TGW­GP'KUGTPGU-TGW\++ -NCUUG   1NFGPDWTI (TKGFTKEJ #WIWUV-TGW\ ++ -NCUUG 'KUGP IGUEJY·T\V OKV $CPFURCPIG 814   &'/('+0&''KUGPUKNDGTHCTDGP &GWVUEJGU4GKEJ'JTGPMTGW\FGU9GNVMTKGIGUHÒT(TQPVM·ORHGT CP0CFGN\WUCOOGPOKVRCUUGPFGT(GNFURCPIGWPF-PQRHNQEJTQUGVVG 5VÒEM++



)TQ­GQNFGPDWTIKUEJG1TFGPUUEJPCNNGOKVFTGK#WU\GKEJPWPIGP 2TGW­GP'KUGTPGU-TGW\++ -NCUUG   1NFGPDWTI (TKGFTKEJ #WIWUV-TGW\ ++ -NCUUG 'KUGP IGUEJY·T\V   &GWVUEJGU 4GKEJ 'J   TGPMTGW\FGU9GNVMTKGIGUHÒT(TQPVM·ORHGTCP0CFGN\WUCOOGPOKVRCUUGPFGT(GNFUEJPCNNG/KPKCVW TGPCPUVGEMPCFGNWPF-PQRHNQEJTQUGVVG 5VÒEM++



)TQ­GFGWVUEJG1TFGPUUEJPCNNGOKV#WU\GKEJPWPIGP &GWVUEJGU4GKEJ'JTGP\GKEJGP HÒT,CJTGVTGWG#TDGKV 6TGWGMTGW\-NCUUGFGT1NFGPDWTIKUEJGP+PFWUVTKGWPF*CPFGNUMCOOGT #P0CFGN ++



9134



)TQ­G MTCWUG YÒTVVGODGTIKUEJG 1TFGPUUEJPCNNG OKV FTGK #WU\GKEJPWPIGP   2TGW­GP 'KUGTPGU   -TGW\#WUICDG-TGW\++-NCUUG'KUGPMGTPIGUEJY·T\V<CTIG5KNDGT 9ÒTVVGODGTI/KNKV·T 8GTFKGPUVQTFGP/QFGNN OKV/QPQITCOO-ÌPKI9KNJGNO++QJPG<CEMGPMTQPG 4KV VGTMTGW\ #PHGTVKIWPI FGU -ÌPKINKEJGP /ÒP\COVU KP 5VWVVICTV 5KNDGT XGTIQNFGV WPF GOCKNNKGTV GKPKIG   PCJG\WWPUKEJVDCTG#DRNCV\WPIGPKPFGTITÒPGP'OCKNNGFGUTÒEMUGKVKIGP-TCP\GU$CPFTKPIGTI·P\VCWH FGO $CPF GOCKNNKGTVGT .QTDGGTMTCP\   &GWVUEJGU 4GKEJ 'JTGPMTGW\ FGU 9GNVMTKGIGU  HÒT   (TQPVM·ORHGT'KUGPDTQP\KGTVCWHFGT4ÒEMUGKVG*GTUVGNNGTDG\GKEJPWPI94#P0CFGN 5VÒEM++

9135



'ZGORNCTFGT#WMVKQP(TKV\4WFQNH-ÒPMGT1UPCDTÒEM0T



)TQ­G1TFGPUUEJPCNNGFGU-QPVTGCFOKTCNU,QJCPP%JTKUVKCP9KNJGNO$GTVTCOOKVHÒPH#WU\GKEJ PWPIGP 2TGW­GP'KUGTPGU-TGW\++-NCUUG 2TGW­GP4QVGT#FNGT1TFGP/QFGNN OKV \KGIGNTQVGO#FNGT -TGW\-NCUUGOKVFGT5EJNGKHG)QNFGOCKNNKGTVHGKPUVG'OCKNNGOCNG TGKCWHFGO4CPFFGUWPVGTGP-TGW\CTOU4KV\OCTMG9FGT(KTOC9CIPGTKP$GTNKP$CPFOKVCWHIG NGIVGT5EJNGKHG 2TGW­GP&KGPUV#WU\GKEJPWPIU-TGW\ HÒTCMVKXG1HHK\KGTG XKGTVG#WUHÒJTWPI OKV ITÌDGT IGMÌTPVGP -TGW\CTOGP  EC     &GWVUEJGU 4GKEJ 'JTGPMTGW\ FGU 9GNVMTKGIGU HÒT   -TKGIUVGKNPGJOGT UKE 'KUGPDTQP\KGTV 2TGW­GP<GPVGPCTOGFCKNNG 5VÒEM+p++  &GT4QVG#FNGT1TFGP-NCUUGOKVFGT5EJNGKHGYWTFGCO,CPWCTCPFGP-CRKV·P\WT5GGWPFUR·VGTGP -QPVTGCFOKTCN ,QJCPP %JTKUVKCP 9KNJGNO $GTVTCO OKNKV·TKUEJGU /KVINKGF FGU 4GKEJUOKNKV·TIGTKEJVU XGTNKGJGP  

7TMWPFGP0CEJNC­UKGJG-CV0T 

44


DEUTSCHLAND - MINIATURENSCHNALLEN

9137

9136 9138

&'765%*.#0&/+0+#674'05%*0#..'070&-'66%*'0 







/KPKCVWTGPMGVVEJGPOKVFGWVUEJGO$G\WIHKPFGP5KGCWEJWPVGT/+0+#674'05%*0#..'070&-'66%*'0 +06'40#6+10#.(+00.#0&WPF5%*9'&'0 /KPKCVWTGPMGVVEJGPOKV/KPKCVWTGPXQPHÒPH1TFGPWPF'JTGP\GKEJGP 9ÒTVVGODGTI-ÌPKINKEJ 9ÒTVVGODGTIKUEJGT(TKGFTKEJU1TFGP/QFGNN OGJTMNCUUKI 4KVVGTMTGW\D\Y CD  4KVVGTMTGW\GU  -NCUUG )QNF GOCKNNKGTV   2TGW­GP -TKGIUFGPMOÒP\G  HÒT -QODCVVCPVGP    9ÒTVVGODGTI5KNDGTPG4GIKGTWPIULWDKN·WOU/GFCKNNG-ÌPKI-CTN5KNDGT (TCPMTGKEJ0CVKQPCNGT 1TFGPFGT'JTGPNGIKQP/QFGNN  4KVVGTFGMQTCVKQP5KNDGT/GFCKNNQPU OGJTVGKNKI )QNF GOCKNNKGTV 2TGW­GP<GPVGPCTOGFCKNNG#PGEJVIQNFGPGO-GVVEJGPOKV-PQRH)GUCOVIGYKEJV I 5VÒEM++



/KPKCVWTGPMGVVEJGPOKVPGWP#WU\GKEJPWPIUOKPKUVWTGP 2TGW­GP'KUGTPGU-TGW\++-NCUUG  2TGW­GP4QVGT#FNGT1TFGP/QFGNN  -TGW\-NCUUG#WUICDG OKVINCVVGP-TGW \CTOGP 5KNDGTVGKNYGKUGGOCKNNKGTVHGKPUVG'OCKNNGOCNGTGK 5EJYCT\GU8GTYWPFGVGPCD \GKEJGP    ¤UVGTTGKEJ /KNKV·T8GTFKGPUVMTGW\  -NCUUG OKV FGT -TKGIUFGMQTCVKQP 5KNDGT GOCKN   NKGTV /KPKCVWTGKPGTWPDGMCPPVGP#WU\GKEJPWPIKP(QTOGKPGU'KUGTPGP-TGW\GUITÒPGOCKNNKGTVOKV YGK­GP 4·PFGTP   2TGW­GP 'TKPPGTWPIUMTGW\ 6TGWGP -TKGIGTP    2TGW­GP -TKGIUFGPMOÒP\G   HÒT-QODCVVCPVGP 2TGW­GP1HHK\KGTU&KGPUVCWU\GKEJPWPIHÒT::8&KGPUVLCJTG 2TGW ­GP.CPFYGJT&KGPUVCWU\GKEJPWPI++-NCUUG/QFGNN CD /GFCKNNGCP\YGK0CFGNP  5VÒEM++



/KPKCVWTGPMGVVEJGPOKV\YGK#WU\GKEJPWPIUOKPKCVWTGP 2TGW­GP'KUGTPGU-TGW\++-NCUUG  $CFGP)TQ­JGT\QINKEJGT1TFGPXQO<·JTKPIGT.ÌYGP4KVVGTMTGW\++-NCUUGOKV5EJYGTVGTP5KNDGT VGKNYGKUG XGTIQNFGV /GFCKNNQPU )QNF VGKNYGKUG GOCKNNKGTV HGKPUVG 'OCKNNGOCNGTGK )NCUHNW­ OKV \YGK   0CFGNP 5VÒEM++



9139







9140

9141

/KPKCVWTGPMGVVEJGPOKVXKGT#WU\GKEJPWPIUOKPKCVWTGP 2TGW­GP'KUGTPGU-TGW\-NCUUG  $C[GTP/KNKV·T8GTFKGPUVQTFGP-TGW\-NCUUGOKV5EJYGTVGTP5KNDGTGOCKNNKGTV 9ÒTVVGODGTI 5KNDGTPG/KNKV·TXGTFKGPUVOGFCKNNG/QFGNNOKVFGO2QTVTCKV-ÌPKI9KNJGNOU++ 1NFGPDWTI(TKGFTKEJ #WIWUV-TGW\-NCUUGCP-GVVEJGPOKV\YGK*CMGP ++



1NFGPDWTIKUEJGU/KPKCVWTGPMGVVEJGPOKVXKGT#WU\GKEJPWPIUOKPKCVWTGP 2TGW­GP'KUGTPGU-TGW\ ++-NCUUG 1NFGPDWTI(TKGFTKEJ#WIWUV-TGW\+-NCUUG 1NFGPDWTI(TKGFTKEJ#WIWUV-TGW\ ++-NCUUGOKV$CPFURCPIG814&'/('+0&' 'JTGPMTGW\++-NCUUGFGU*CWUWPF8GTFKGPUVQT FGPUFGU*GT\QIU2GVGT(TKGFTKEJ.WFYKICP-GVVEJGPOKV\YGK0CFGNP 5VÒEM++



/KPKCVWTGPMGVVEJGP FGU -QPVTGCFOKTCNU ,QJCPP %JTKUVKCP 9KNJGNO $GTVTCO OKV UKGDGP #WU\GKEJ   PWPIOKPKCVWTGP   2TGW­GP -ÌPKINKEJGT -TQPGPQTFGP  -NCUUG   *GUUGP )TQ­JGT\QINKEJ *GUUK   UEJGT 2JKNKRRU1TFGP -QOVWTMTGW\   'KUGTPGU -TGW\  ++ -NCUUG   2TGW­GP 4QVGT #FNGT1T   FGP/QFGNN OKV\KGIGNTQVGO#FNGT -TGW\-NCUUGOKVFGT5EJNGKHG)QNFGOCKNNKGTV HGKPUVG 'OCKNNGOCNGTGK   2TGW­GP &KGPUV#WU\GKEJPWPIU-TGW\ HÒT CMVKXG 1HHK\KGTG    2TGW­GP   <GPVGPCTOGFCKNNG    4W­NCPF 5V 5VCPKUNCWU1TFGP ++ -NCUUG 'OCKNNGEJKR KO XQTFGTUGKVKIGP   /GFCKNNQPMGVVEJGPOKV\YGK0CFGNP 5VÒEM++

 45


DEUTSCHLAND - ALLGEMEINE KONVOLUTE

9142







9143

-QPXQNWV XQP  1TFGPUMGVVEJGP OKV KPUIGUCOV ÒDGT  #WU\GKEJPWPIUOKPKCVWTGP 8QP 5KGDGPGT   DKU <YGKGT-GVVEJGP OKV /KPKCVWTGP W C CWU $CFGP$C[GTP$WNICTKGPFGO&GWVUEJGP4GKEJ*GU UGP .ÒDGEM /GEMNGPDWTI5EJYGTKP /GEMNGPDWTI5VTGNKV\ ¤UVGTTGKEJ 1NFGPDWTI 2TGW­GP 7PICTP   WPF 9ÒTVVGODGTI KP XGTUEJKGFGPGP /GVCNNGP VGKNU XGTIQNFGV VGKNU XGTUKNDGTV GKPKIG VGKNYGKUG GOCKN   NKGTVFKG-GVVEJGPOGKUVCP0CFGNPKPWPVGTUEJKGFNKEJGP'TJCNVWPIGP 5VÒEM++++p+++



-QPXQNWVXQP(GNFUEJPCNNGPFGU&GWVUEJGP4GKEJGU&CTWPVGT#EJVGT5GEJUGT(ÒPHGTWPF  8KGTGT5EJPCNNGP OKV KPUIGUCOV  $·PFEJGP HÒT #WU\GKEJPWPIGP W C CWU $CFGP $C[GTP $TCWP   UEJYGKI$WNICTKGP.KRRG/GEMNGPDWTI¤UVGTTGKEJ2TGW­GP7PICTP9CNFGEMWPF9ÒTVVGODGTIOKV ÒDGT/GVCNNCWHNCIGPLGYGKNUCP0CFGNPOGKUVKPQTFGPVNKEJGP'TJCNVWPIGP 5VÒEM++++p+++



-QPXQNWV XQP  (GNFUEJPCNNGP FGU &GWVUEJGP 4GKEJGU XQP  DKU  &CTWPVGT  #EJVGT   5KGDGPGT5GEJUGT(ÒPHGTWPF8KGTGT5EJPCNNGPOKVKPUIGUCOV$·PFEJGPHÒT#WU\GKEJPWP IGPWCCWU$CFGP$C[GTP$WNICTKGP*GUUGP+VCNKGP/GEMNGPDWTI1NFGPDWTI2TGW­GP4WO·PKGP 5CEJUGP7PICTPWPF9ÒTVVGODGTIOKVÒDGT/GVCNNCWHNCIGPLGYGKNUCP0CFGNPOGKUVKPQTFGPVNK EJGP'TJCNVWPIGP'KPUEJÌPGU-QPXQNWVOKVKPVGTGUUCPVGP-QODKPCVKQPGP 5VÒEM++++p+++



&'765%*.#0&#..)'/'+0'-1081.76' 



-QPXQNWV OKV  #WU\GKEJPWPIGP WPF #D\GKEJGP 7 C CWU #PJCNV $CFGP 2TGW­GP 9ÒTVVGODGTI   WPF FGT 9GKOCTGT 4GRWDNKM KP XGTUEJKGFGPGP /GVCNNGP CWEJ 5KNDGT VGKNU XGTIQNFGV VGKNU XGTUKNDGTV   VGKNUCP$·PFGTPKPWPVGTUEJKGFNKEJGP'TJCNVWPIGP 5VÒEM++++p+++



-QPXQNWVXQPXGTUEJKGFGPGP'JTGPWPF#D\GKEJGP&CTWPVGTCWU*GUUGP/GEMNGPDWTI5EJYGTKP 2TGW­GP WPF FGO &GWVUEJGP -CKUGTTGKEJ KP XGTUEJKGFGPGP /GVCNNGP CWEJ 5KNDGT VGKNU XGTIQNFGVVGKNU CP$·PFGTPVGKNUCP0CFGNPKPWPVGTUEJKGFNKEJGP'TJCNVWPIGP&C\WÌUVGTTGKEJKUEJGU5KIPWO.CWFKUKP $TQP\GCP$CPFTGUV 5VÒEM++++++8



ex 9147







46

ex 9149

-QPXQNWV XQP  'JTGP WPF #D\GKEJGP 7 C CWU $C[GTP 5EJCWODWTI.KRRG 5CEJUGP WPF FGO   &GWVUEJGP4GKEJXGTUEJKGFGP/GVCNNGCWEJ5KNDGTVGKNUXGTIQNFGVVGKNUXGTUKNDGTVGKPGUGOCKNNKGTVVGKNU CP$·PFGTPVGKNUCP0CFGNPKPWPVGTUEJKGFNKEJGP'TJCNVWPIGP 5VÒEM++++p++++++



-QPXQNWV XQP  'KP\GN/KPKCVWTGP WPF -NGKPCD\GKEJGP 7 C (NWI\GWIHÒJTGT#D\GKEJGP .CPF   9GNVMTKGI$GQDCEJVGT#D\GKEJGP9GNVMTKGI#D\GKEJGPXQP(TKGFTKEJWPF.WKUGXQP$CFGP-CKUGT 9KNJGNO++-CKUGT(TKGFTKEJ+++*KPFGPDWTIWCXGTUEJKGFGPG/GVCNNGVGKNUXGTIQNFGVVGKNUXGTUKN DGTV\YGKVGKNYGKUGGOCKNNKGTVLGYGKNUCP0CFGNPKPWPVGTUEJKGFNKEJGP'TJCNVWPIGP 5VÒEM++p+++



-QPXQNWV XQP  /KPKCVWTGP FGWVUEJGT 1TFGPWPF'JTGP\GKEJGP8GTUEJKGFGPG/GVCNNGOGKUVXGT IQNFGV VGKNU GOCKNNKGTV VGKNU CP $·PFEJGP KP WPVGTUEJKGFNKEJGP 'TJCNVWPIGP &C\W #D\GKEJGP 4GKEJU   MTKGIUHNCIIG 5KNDGTXGTIQNFGVWPFGOCKNNKGTV'OCKNNGOCNGTGKCWHFGT4ÒEMUGKVG5KNDGTRWP\GCP 0CFGN 5VÒEM++




ORDENSSCHNALLEN INTERNATIONAL

ex 9150







ex 9151

9152

-QPXQNWV XQP  $CPFUVÒEMGP OKV CWHIGNGIVGP OO /KPKCVWT#WHNCIGP HÒT (GNFUEJPCNNGP XQP   ÒDGTYKGIGPFFGWVUEJGP'JTGP\GKEJGP7CCWU#PJCNV$WNICTKGP/GEMNGPDWTI5EJYGTKP/GEMNGP DWTI5VTGNKV\¤UVGTTGKEJFGO1UOCPKUEJGP4GKEJ4GW­WPF9CNFGEMVGKNUXGTIQNFGVVGKNUXGTUKNDGTV HÒPHGOCKNNKGTV 5VÒEM++



+PVGTCNNKKGTVG 5KGIGUOGFCKNNG  -QPXQNWV XQP  XGTUEJKGFGPGP QHHK\KGNNGP #WUICDGP CWU $GNIKGP   (TCPMTGKEJ )TQ­DTKVCPPKGP +VCNKGP 5ÒFCHTKMC 6UEJGEJQUNQYCMGK WPF FGP 75# $TQP\G LGYGKNUCP $·PFGTPFKGCOGTKMCPKUEJGOKV$CPFURCPIG(4#0%'KPQTFGPVNKEJGP'TJCNVWPIGP 5VÒEM++



(ÒPH /KPKCVWTGP XQP 4QV-TGW\#WU\GKEJPWPIGP #WU FGO &GWVUEJGP 4GKEJ -WDC 2QTVWICN 5GT   DKGPWPF7PICTP&C\WFTGKYGKVGTG/KPKCVWTGP8GTUEJKGFGPG/GVCNNGCWEJ5KNDGT)QNFVGKNUXGTIQN FGV VGKNU XGTUKNDGTV UGEJU GOCKNNKGTV KP WPVGTUEJKGFNKEJGP 'TJCNVWPIGP \WUCOOGP OKV WPMQTTGMVGP   $·PFEJGPCPGKPGT1TFGPUUEJPCNNGQJPG0CFGN 5VÒEM++++p+++



9153

14&'055%*0#..'0+06'40#6+10#. +ORQUCPVGWPFUGJTUGNVGPG)TWRRGGKPGUJQJGP&KRNQOCVGPQFGT5VCCVUDGCOVGPCWUFGO\YGKVGP&TKVVGNFGU,J OKV\YGKGEJVIQNFGPGP1TFGPUKPUKIPKGPWPFGKPGOKPFKGUGTPKGFTKIGP-NCUUGOKVGEJVIQNFGPGP#WHNCIGPDGUQPFGTU UGNVGPGP·I[RVKUEJGP0KNQTFGPCNNG5VÒEMGKPJGTXQTTCIGPFGT8GTCTDGKVWPIUYKGCWEJ'TJCNVWPIUSWCNKV·V#WHITWPF FKGUGT PCJG\W GKPOCNKIGP-QODKPCVKQPFÒTHVGGUCWEJPKEJVCNN\WUEJYGTUGKPFGP6T·IGTFKGUGT)TWRRG\WGTHQT UEJGP&KG/KPKCVWTGPUEJPCNNGFGU6T·IGTUFKGUGTDGKFGP1TFGPUUEJPCNNGPUKGJG-CV0T  9GKVGTGUEJÌPG1TFGPUUEJPCNNGPHKPFGP5KGWPVGT5%*9'&'0



)TQ­G 1TFGPUITWRRG GKPGU UEJYGFKUEJGP &KRNQOCVGP DGUVGJGPF CWU \YGK \WUCOOGPIGJÌTGPFGP   ITQ­GP 1TFGPUUEJPCNNGP OKV KPUIGUCOV  #WU\GKEJPWPIGP 'TUVG 5EJPCNNG   )GF·EJVPKU'JTGP\GK   EJGP\WO)GDWTVUVCI-ÌPKI)WUVCXU8CO,WPK5KNDGTXGTIQNFGVCWHFGO4GXGTUOGJT HCEJRWP\KGTV WC5%QHÒTFGP*GTUVGNNGT5RQTTQPI5HÒT5KNDGTWPF,CJTGURWP\G:HÒT   'TKPPGTWPIUOGFCKNNG\WO)GDWTVUVCI-ÌPKI)WUVCXU8+#FQNH5KNDGT -ÌPKINKEJGT9CUC 1TFGP  /QFGNN UGKV   4KVVGTMTGW\ UGKV  4KVVGTMTGW\  -NCUUG  )QNF GOCKNNKGTV CWH FGO   4CPFFGUTGEJVGP-TGW\CTOUOGJTHCEJRWP\KGTV WC%(%HÒTFGP*GTUVGNNGT%(%CTNOCPKP5VQEM JQNO-HÒTEVQJPG,CJTGURWP\G  5KNDGTPG)GFGPMOGFCKNNG\WT,CJTHGKGTFGT)TÒPFWPI FGT UEJYGFKUEJGP -QNQPKG 5WGEKC 0QXC  5KNDGT   0QTYGIGP -ÌPKINKEJ 0QTYGIKUEJGT 5CPMV   1NCXU1TFGP/QFGNN QJPG.ÌYGÒDGTFGT-TQPGUGKV 4KVVGTMTGW\-NCUUG)QNFGOCKNNKGTV  (KPPNCPF1TFGPFGT(KPPKUEJGP9GK­GP4QUG4KVVGTMTGW\-NCUUG6[R CDYCCIGTGEJV \WO-TGW\UVGJGPFG¤UG 5KNDGTXGTIQNFGVWPFGOCKNNKGTV¤UGRWP\KGTVOKV4QUGVVG +UNCPF4GRW DNKM+UN·PFKUEJGT(CNMGPQTFGP/QFGNN UGKVQJPG-ÌPKIUMTQPG 4KVVGTMTGW\5KNDGTXGTIQNFGV WPF GOCKNNKGTV   )TQ­DTKVCPPKGP -ÌPKINKEJGT 8KMVQTKC1TFGP 1HHK\KGTUMTGW\ 5KNDGT XGTIQNFGV WPF   GOCKNNKGTV CWH FGT 4ÒEMUGKVG /CVTKMGNPWOOGT  OKV 4QUGVVG ņ <YGKVG 5EJPCNNG   VJKQRKGP   1TFGP FGU 5VGTPU XQP VJKQRKGP 1HHK\KGTUFGMQTCVKQP $TQP\G XGTIQNFGV OKV 4QUGVVG   )TKGEJGPNCPF    4GRWDNKM   2JÌPKZ1TFGP  /QFGNN QJPG -TQPG    5KNDGTPGU -TGW\  

4KVVGTMTGW\ 5KNDGTGOCKNNKGTV I[RVGP-ÌPKITGKEJ1TFGPFGU0KNU/QFGNN  &GMQ TCVKQP  -NCUUG 5KNDGT DTKNNCPVKGTV VGKNYGKUG XGTIQNFGV #WHNCIGP WPF ªDGTJÌJWPI )QNF   VGKNYGKUG   GOCKNNKGTV   +TCM -ÌPKITGKEJ 1TFGP FGT \YGK (NÒUUG 4CHKFCKP1TFGP  &GMQTCVKQP -NCUUG5KNDGT VGKNYGKUG XGTIQNFGV WPF GOCKNNKGTV   2GTUKGP+TCP -CKUGTTGKEJ *QOC[QWP1TFGP &GMQTCVKQP   -NCUUG5KNDGTVGKNYGKUGXGTIQNFGVWPFGOCKNNKGTV'OCKNNGOCNGTGKCWHFGT4ÒEMUGKVG*GTUVGNNGTDG\GKEJ PWPI FGT (KTOC #TVJWU $GTVTCPF KP 2CTKU   5[TKGP HTCP\ÌUKUEJGU /CPFCVUIGDKGV 'JTGPOGFCKNNG HÒT   8GTFKGPUVG WO 5[TKGP 5KNDGTPG /GFCKNNG $TQP\G XGTUKNDGTV WPF GOCKNNKGTV $GKFG 1TFGPUUEJPCNNGP OKV   0CFGNPUEJYGFKUEJGT#TV 5VÒEM+p++  47


ORDENSSCHNALLEN INTERNATIONAL

9154



)TQ­G 1TFGPUUEJPCNNG GKPGU UEJYGFKUEJGP &KRNQOCVGP OKV UGEJU 1TFGP   (KPPNCPF (KPPKUEJGT   .ÌYGPQTFGP4KVVGTMTGW\-NCUUG5KNDGTXGTIQNFGVWPFGOCKNNKGTVKPFGT¤UGRWP\KGTV VJKQRKGP 1TFGP /GPGNKM ++ 1HHK\KGTUMTGW\ $TQP\G XGTIQNFGV WPF GOCKNNKGTV   $GNIKGP -TQPGP1TFGP 1HHK   \KGTUFGMQTCVKQP 5KNDGT XGTIQNFGV WPF GOCKNNKGTV   .KDGTKC 1TFGP FGT #HTKMCPKUEJGP 'TNÌUWPI 1HHK   \KGTUFGMQTCVKQP 5KNDGT XGTIQNFGV WPF GOCKNNKGTV #DRNCV\WPIGP KP FGP /GFCKNNQPTKPIGP XQP #XGTU WPF   4GXGTU   6WPGUKGP 1TFGP FGT 4GRWDNKM  /QFGNN OKV FGO 2QTVTCKV FGU 2T·UKFGPVGP $QWTIWKDC      $TQP\G XGTIQNFGV WPF VGKNYGKUG GOCKNNKGTV   6JCKNCPF 1TFGP FGT -TQPG XQP 6JCKNCPF   &GMQTCVKQP-NCUUG5KNDGTVGKNYGKUGXGTIQNFGVWPFGOCKNNKGTVCWHFGT4ÒEMUGKVGFGT-TQPGVJCKN·PFK UEJG *GTUVGNNGTDG\GKEJPWPI #WHCNNGPUGEJU$·PFGTPKUVGKPG$CPFTQUGVVG\WT-GPP\GKEJPWPIFGT1HHK \KGTU4KVVGT-NCUUGQFGT-NCUUGCWHIGNGIV#PUEJYGFKUEJGT6TCIGURCPIG 5VÒEM++



5GJT KORQUCPVG 5EJPCNNG $GUQPFGTU FCU  /QFGNN FGU VWPGUKUEJGP 1TFGPU FGT 4GRWDNKMKUVKPCNNGPUGKPGP5VWHGP CWHITWPFFGTUGJTMWT\GP8GTNGKJWPIU\GKVPWTUGJTUGNVGP\WHKPFGP&KG/KPKCVWTGPUEJPCNNGFGU6T·IGTUFKGUGT1TFGPU UEJPCNNGHKPFGP5KGWPVGT-CV0T

9155



48

)TQ­G1TFGPUUEJPCNNGGKPGUHKPPKUEJGP8GVGTCPGPFGTHKPPKUEJGPWPFGUVPKUEJGP(TGKJGKVUMTKGIGXQP  DKU  WPF FGU9KPVGTMTKGIGUXQPOKV#WU\GKEJPWPIGP (KPPNCPF1TFGPFGU (TGKJGKVUMTGW\GU/QFGNN OKVFGT,CJTGU\CJN -TGW\-NCUUGOKV5EJYGTVGTPXGTUKNDGTVWPF VGKNYGKUG GOCKNNKGTV   (KPPNCPF -TKGIUGTKPPGTWPIUOGFCKNNG  5KNDGT CWH FGT 4ÒEMUGKVG RWP\KGTV     (KPPNCPF -TKGIUGTKPPGTWPIUOGFCKNNG  HÒT (KPPGP OKV 5EJYGTVGT#WHNCIG CWHFGO$CPF  (KPPNCPF-TGW\HÒT-TKGIGKPXGTYCPFVGP0CVKQPGP 'UVNCPF1TFGPFGU(TGKJGKVUMTGW\GU -TGW\)TCF+++-NCUUG'KUGP5KNDGTVGKNYGKUGXGTIQNFGVVGKNYGKUGGOCKNNKGTVCNVG'OCKNNGCDRNCV\WP IGP CWH #XGTU WPF 4GXGTU   'UVNCPF 'TKPPGTWPIUOGFCKNNG CP FGP 7PCDJ·PIKIMGKVUMTKGI      .GVVNCPF /GFCKNNG \WO L·JTKIGP ,WDKN·WO FGU $GUVGJGPU .GVVNCPFU OKV 5EJYGTVGTP $CPF OKV   5EJYGTVGTCWHNCIG 5VÒEM++




MINIATURENSCHNALLEN INTERNATIONAL

9156

/+0+#674'05%*0#..'070&-'66%*'0+06'40#6+10#. 

9GKVGTGUEJÌPG/KPKCVWTGPUEJPCNNGPWPFMGVVEJGPHKPFGP5KGWPVGT&'765%*.#0&/+0+#674'05%*0#..'070& -'66%*'0(+00.#0&(4#0-4'+%*WPF5%*9'&'0



)TQ­G /KPKCVWTGPUEJPCNNG GKPGU UEJYGFKUEJGP &KRNQOCVGP OKV  #WU\GKEJPWPIGP   )GF·EJVPKU   'JTGP\GKEJGP \WO  )GDWTVUVCI -ÌPKI )WUVCXU 8 CO  ,WPK  5KNDGT XGTIQNFGV   'TKPPG   TWPIUOGFCKNNG\WO)GDWTVUVCI-ÌPKI)WUVCXU8+#FQNH5KNDGT -ÌPKINKEJGT9CUC1TFGP  /QFGNN UGKV   4KVVGTMTGW\ UGKV  4KVVGTMTGW\  -NCUUG  )QNF GOCKNNKGTV   5KNDGTPG )G   FGPMOGFCKNNG \WT ,CJTHGKGT FGT )TÒPFWPI FGT UEJYGFKUEJGP -QNQPKG 5WGEKC 0QXC  5KNDGT    &·PGOCTM&CPPGDTQI1TFGP/QFGNN#WUICDG OKV/QPQITCOO-ÌPKI%JTKUVKCP+:   4KVVGTMTGW\ )QNF GOCKNNKGTV   0QTYGIGP -ÌPKINKEJ 0QTYGIKUEJGT 5CPMV 1NCXU1TFGP   /QFGNN QJPG.ÌYGÒDGTFGT-TQPGUGKV 4KVVGTMTGW\-NCUUG)QNFGOCKNNKGTV (KPPNCPF 1TFGPFGT(KPPKUEJGP9GK­GP4QUG4KVVGTMTGW\-NCUUG5KNDGTXGTIQNFGVWPFGOCKNNKGTVOKV4QUGVVG   +UNCPF 4GRWDNKM +UN·PFKUEJGT (CNMGPQTFGP  /QFGNN UGKV   QJPG -ÌPKIMTQPG  4KVVGTMTGW\   )QNF GOCKNNKGTV   )TQ­DTKVCPPKGP -ÌPKINKEJGT 8KMVQTKC1TFGP 1HHK\KGTUMTGW\ 5KNDGT XGTIQNFGV WPF   GOCKNNKGTV   VJKQRKGP 1TFGP FGU 5VGTPU XQP VJKQRKGP 1HHK\KGTUFGMQTCVKQP 5KNDGT XGTIQNFGV OKV   4QUGVVG I[RVGP-ÌPKITGKEJ1TFGPFGU0KNU/QFGNN  &GMQTCVKQP-NCUUG5KNDGT VGKNYGKUGXGTIQNFGVWPFGOCKNNKGTV )TKGEJGPNCPF4GRWDNKM  2JÌPKZ1TFGP/QFGNN

QJPG-TQPG 5KNDGTPGU-TGW\ 4KVVGTMTGW\ 5KNDGTGOCKNNKGTV +TCM-ÌPKITGKEJ1TFGP FGT \YGK (NÒUUG 4CHKFCKP1TFGP  &GMQTCVKQP  -NCUUG 5KNDGT XGTIQNFGV WPF GOCKNNKGTV   2GT   UKGP+TCP -CKUGTTGKEJ *QOC[QWP1TFGP &GMQTCVKQP  -NCUUG 5KNDGT VGKNYGKUG XGTIQNFGV WPF GOCKN   NKGTV'OCKNNGOCNGTGKHCUVXQNNUV·PFKIXGTICPIGP 5[TKGPHTCP\ÌUKUEJGU/CPFCVUIGDKGV'JTGPOGFCKNNG HÒT8GTFKGPUVGWO5[TKGP5KNDGTPG/GFCKNNG5KNDGTGOCKNNKGTV1JPG0CFGN 5VÒEM++



+ORQUCPVG/KPKCVWTGPUEJPCNNGFGU+PJCDGTUFGT)TWRRG-CV0T

9157



/KPKCVWTGPMGVVEJGP OKV  #WU\GKEJPWPIUOKPKCVWTGP   5EJYGFGP -ÌPKINKEJGT 9CUC1TFGP   /QFGNN UGKV -QOOCPFGWTMTGW\ZOO)QNFGOCKNNKGTV $CFGP1TFGPXQO<·JTKP IGT.ÌYGP-QOVWTMTGW\ZOO)QNFVGKNYGKUGGOCKNNKGTV'OCKNNGOCNGTGK)NCUHNW­8QT FGT WPF 4ÒEMUGKVGPOGFCKNNQP XGTVCWUEJV   2TGW­GP 4QVGT #FNGT1TFGP  /QFGNN OKV NKNCTQVGO   #FNGT -TGW\-NCUUGZOO)QNFGOCKNNKGTVHGKPUVG'OCKNNGOCNGTGK +VCNKGP 1TFGP FGT -TQPG XQP +VCNKGP -QOOCPFGWTMTGW\ )QNF GOCKNNKGTV 4ÒEMUGKVGPOGFCKNNQP HGJNV 5CEJ UGP-ÌPKINKEJ5·EJUKUEJGT#NDTGEJVUQTFGP-QOVWTMTGW\Z2QTVTCKVPCEJNKPMU)QNFGOCKN NKGTV4ÒEMUGKVGPOGFCKNNQPFGUJGUUKUEJGP2JKNKRRU1TFGPU 2QTVWICN%JTKUVWUQTFGP/QFGNN   UQIGPOQFKUEJG#WUHÒJTWPI-QOOCPFGWTMTGW\ZOO)QNFGOCKNNKGTV *GUUGP )TQ­JGT\QINKEJ JGUUKUEJGT 1TFGP 2JKNKRRU FGU )TQ­OÒVJKIGP -QOOCPFGWTMTGW\  Z  OO   )QNF GOCKNNKGTV 4GXGTUOGFCKNNQP FGU U·EJUKUEJGP #NDTGEJVUQTFGPU   1UOCPKUEJGU 4GKEJ /GFLKFLKG   1TFGP &GMQTCVKQP  QFGT  -NCUUG 5KNDGT /GFCKNNQPU WPF ªDGTJÌJWPI)QNFGOCKNNKGTV 2GTUKGP 5QPPGP WPF .ÌYGP1TFGP  /QFGNN UGKV   #WUHÒJTWPI HÒT #WUN·PFGT 5VGTP  -NCUUG 5KNDGT   DTKNNCPVKGTV )QNF GOCKNNKGTV 'OCKNNGOCNGTGK   ¤UVGTTGKEJ -CKUGTNKEJ ¤UVGTTGKEJKUEJGT (TCP\,QUGRJ 1TFGP-QOVWTMTGW\ZOO)QNFGOCKNNKGTV#OGEJVIQNFGPGP1TFGPUMGVVEJGPMQODKPKGTV OKV GKPGO -QOVWTMGVVEJGP FGU ÌUVGTTGKEJKUEJGP (TCP\ ,QUGRJ1TFGPU )QNF VGKNYGKUG GOCKNNKGTV CP   0CFGNP)GUCOVIGYKEJVI 5VÒEM++++p++++++  2T·EJVKIGU/KPKCVWTGPMGVVEJGPCWUFGT\YGKGP*·NHVGFGU,J

49


MINIATURENSCHNALLEN INTERNATIONAL

9158



/KPKCVWTGPUEJPCNNG GKPGU UEJYGFKUEJGP &KRNQOCVGP QFGT JQJGP $GCOVGP OKV  XQP WTURTÒPINKEJ    #WU\GKEJPWPIGP   5EJYGFGP<YGKNGGTGJGNNDNCWG$·PFEJGPHÒTMÌPKINKEJG'TKPPGTWPIU'JTGP \GKEJGPQFGTHÒTFGP5GTCRJKOQTFGPQJPG/KPKCVWTGP 5EJYGFGP.GGTGU$·PFEJGPFGU-ÌPKINKEJGP 5EJYGTVQTFGPU QJPG /KPKCVWT   5EJYGFGP -TGW\ FGT 'JTGPTKVVGT FGT 5EJYGFKUEJGP )GPQUUGPUEJCHV   FGU ,QJCPPKVGTQTFGPU 5KNDGT XGTIQNFGV WPF GOCKNNKGTV   (KPPNCPF .GGTGU $·PFEJGP \WO (KPPKUEJGP   .ÌYGPQTFGP-QOVWTMTGW\OKVCWHIGNGIVGT5KNDGT.KV\GWPF4QUGVVGQJPG/KPKCVWT )TQ­DTKVCPPKGP -ÌPKINKEJGT 8KMVQTKC1TFGP -QOOCPFGWTMTGW\ 5KNDGT XGTIQNFGV WPF GOCKNNKGTV $·PFEJGP OKV CWHIG   NGIVGT 5KNDGT.KV\G WPF 4QUGVVG   $WPFGUTGRWDNKM &GWVUEJNCPF $WPFGUXGTFKGPUVQTFGP )TQ­GU 8GT   FKGPUVMTGW\$·PFEJGPOKVCWHIGNGIVGT5KNDGT.KV\GWPF4QUGVVG $GNIKGP-TQPGP1TFGP1HHK\KGTUFG MQTCVKQP5KNDGTXGTIQNFGVWPFGOCKNNKGTV$·PFEJGPOKVCWHIGNGIVGT4QUGVVG VJKQRKGP1TFGP/GPG NKM ++ 1HHK\KGTUMTGW\ 5KNDGT XGTIQNFGV WPF GOCKNNKGTV $·PFEJGP OKV CWHIGNGIVGT 4QUGVVG   .KDGTKC   1TFGPFGT#HTKMCPKUEJGP'TNÌUWPI1HHK\KGTUFGMQTCVKQP5KNDGTXGTIQNFGVWPFGOCKNNKGTV'OCKNNGOCNGTGK $·PFEJGP OKV CWHIGNGIVGT 4QUGVVG   /GZKMQ 1TFGP FGU #\VGMGP#FNGTU -QOOCPFGWTFGMQTCVKQP   5KNDGTXGTIQNFGVWPFGOCKNNKGTV$·PFEJGPOKVCWHIGNGIVGT5KNDGT.KV\GWPF4QUGVVG 6WPGUKGP1TFGP FGT 4GRWDNKM  /QFGNN OKV FGO 2QTVTCKV FGU 2T·UKFGPVGP $QWTIWKDC    $TQP\G XGTIQNFGV   WPF VGKNYGKUG GOCKNNKGTV $·PFEJGP OKV CWHIGNGIVGT 4QUGVVG   6JCKNCPF 1TFGP FGT -TQPG XQP 6JCK   NCPF&GMQTCVKQP-NCUUG5KNDGTVGKNYGKUGXGTIQNFGVWPFGOCKNNKGTV$·PFEJGPOKVCWHIGNGIVGTVJCKN·P FKUEJGT-TQPG1JPG0CFGN 5VÒEM++



&KGITQ­G1TFGPUUEJPCNNGFGU6T·IGTUFKGUGT/KPKCVWTGPUEJPCNNGUKGJG-CV0T

9159





50

9160

/KPKCVWTGPUEJPCNNGGKPGUUEJYGFKUEJGP/CTKPGQHHK\KGTUOKVPGWP/KPKCVWTGP 5EJYGFGP-ÌPKINK EJGT 5EJYGTVQTFGP 4KVVGTMTGW\ )QNF GOCKNNKGTV   5EJYGFGP -ÌPKINKEJGT 9CUC1TFGP 4KVVGTMTGW\   )QNF GOCKNNKGTV   5EJYGFGP 'JTGP\GKEJGP FGU 5EJYGFKUEJGP /CTKPGXGTDCPFGU XGTIQNFGV VGKNYGKUG   GOCKNNKGTV   5EJYGFGP )QNFGPG 9CHHGPDTÒFGTUEJCHVU/GFCKNNG 5KNDGT XGTIQNFGV OGJTHCEJ RWP\KGTV    &·PGOCTM&CPPGDTQI1TFGP/QFGNN OKV/QPQITCOO-ÌPKI%JTKUVKCPU: 4KVVGT MTGW\5KNDGTXGTIQNFGVWPFGOCKNNKGTV $GNIKGP.GQRQNF1TFGP/QFGNN  4KVVGTMTGW\ OKV 5EJYGTVGTP 5KNDGT /GFCKNNQPU )QNF GOCKNNKGTV   2QNGP 1TFGP 2QNQPKC 4GUVKVWVKQP 1HHK   \KGTUMTGW\XGTIQNFGVWPFGOCKNNKGTV 4WUUKUEJGU4GKEJ5V5VCPKUNCWU1TFGP-TGW\-NCUUG)QNF GOCKNNKGTV   5RCPKGP -ÌPKITGKEJ /CTKPG8GTFKGPUVQTFGP 9GK­G #DVGKNWPI )QNF GOCKNNKGTV 1JPG   0CFGN 5VÒEM++



/KPKCVWTGPUEJPCNNG GKPGU UEJYGFKUEJGP 1HHK\KGTU OKV PGWP /KPKCVWTGP   5EJYGFGP -ÌPKINKEJGT   5EJYGTVQTFGP 4KVVGTMTGW\ )QNF GOCKNNKGTV $·PFEJGP OKV CWHIGNGIVGT 4QUGVVG   5EJYGFGP -ÌPKINK   EJGT0QTFUVGTPQTFGP4KVVGTMTGW\)QNFGOCKNNKGTV 5EJYGFGP-ÌPKINKEJGT9CUC1TFGP4KVVGTMTGW\ )QNF GOCKNNKGTV   0QTYGIGP 1NCX1TFGP  /QFGNN UGKV   4KVVGTMTGW\  -NCUUG )QNF GOCKN   NKGTV   (KPPNCPF 1TFGP FGU (TGKJGKVUMTGW\GU  -NCUUG OKV 5EJYGTVGTP 5KNDGT XGTIQNFGV   &·PG   OCTM &CPPGDTQI1TFGP  /QFGNN OKV /QPQITCOO -ÌPKI %JTKUVKCPU :    4KVVGTMTGW\   5KNDGT XGTIQNFGV WPF GOCKNNKGTV   &·PGOCTM 2TQ &CPKC/GFCKNNG 5KNDGT   4WUUKUEJGU 4GKEJ 5V   5VCPKUNCWU1TFGP-TGW\-NCUUG)QNFGOCKNNKGTV 2QTVWICN4GRWDNKM#XK\1TFGP/QFGNN UGKV  4KVVGTMTGW\5KNDGTXGTIQNFGVWPFGOCKNNKGTV1JPG0CFGN 5VÒEM++




MINIATURENSCHNALLEN INTERNATIONAL

9161 1:2 9162 1:2





/KPKCVWTGPUEJPCNNG GKPGU UEJYGFKUEJGP 1HHK\KGTU OKV  /KPKCVWTGP   5EJYGFGP )GF·EJVPKU   'JTGP\GKEJGP\WO)GDWTVUVCI-ÌPKI)WUVCXU8CO,WPK5KNDGTXGTIQNFGV 5EJYGFGP -ÌPKINKEJGT 5EJYGTVQTFGP 4KVVGTMTGW\ 5KNDGT XGTIQNFGV WPF GOCKNNKGTV   5EJYGFGP -ÌPKINKEJGT   9CUC1TFGP4KVVGTMTGW\)QNFGOCKNNKGTV 5EJYGFGP)QNFGPG8GTFKGPUVOGFCKNNGFGU5EJYGFKUEJGP 4GKEJUXGTDCPFGU FGT 1TEJGUVGTXGTGKPKIWPIGP /QFGNN OKV 2QTVTCKV -ÌPKI )WUVCXU 8 5KNDGT XGTIQNFGV    5EJYGFGP5EJYGFKUEJGU)QNFGPGU1N[ORKC4GKVGT'JTGP\GKEJGPXGTIQNFGV 5EJYGFGP5KNDGTPGU 'JTGP\GKEJGPFGU4GKEJU.WHVUEJWV\8GTDCPFGU5KNDGT &·PGOCTM&CPPGDTQI1TFGP/QFGNN OKV /QPQITCOO-ÌPKI%JTKUVKCPU: 4KVVGTMTGW\5KNDGTXGTIQNFGVWPFGOCKNNKGTV 0QTYG IGP1NCX1TFGP/QFGNN UGKV 4KVVGTMTGW\-NCUUG5KNDGTXGTIQNFGVWPFGOCKNNKGTV +UNCPF +UN·PFKUEJGT(CNMGPQTFGP/QFGNN UGKV 4KVVGTMTGW\5KNDGTXGTIQNFGVWPFGOCKNNKGTV )TQ­ DTKVCPPKGP-ÌPKINKEJGT8KMVQTKC1TFGP-TGW\FGT/KVINKGFGT5KNDGTVGKNYGKUGXGTIQNFGVWPFGOCKNNKGTV 1JPG0CFGN 5VÒEM++



/KPKCVWTGPMGVVEJGP OKV UGEJU 1TFGPUOKPKCVWTGP   5EJYGFGP -ÌPKINKEJGT 0QTFUVGTPQTFGP 4KVVGT   MTGW\)QNFGOCKNNKGTV 5EJYGFGP-ÌPKINKEJGT9CUC1TFGP4KVVGTMTGW\)QNFGOCKNNKGTV (TCPM TGKEJ4GRWDNKM1TFGPFGT'JTGPNGIKQP/QFGNN  1HHK\KGTUFGMQTCVKQP5KNDGTXGTIQNFGV WPF GOCKNNKGTV   )TKGEJGPNCPF  4GRWDNKM   2JÌPKZ1TFGP  /QFGNN QJPG -TQPG     )QNFGPGU-TGW\ 1HHK\KGTUMTGW\ )QNFGOCKNNKGTV 4WO·PKGP-ÌPKITGKEJ1TFGP-TQPG 4WO·PKGPU/QFGNN  1HHK\KGTUMTGW\)QNFGOCKNNKGTV I[RVGP-ÌPKITGKEJ1TFGPFGU 0KNU &GMQTCVKQP  -NCUUG 5KNDGT DTKNNCPVKGTV XGTIQNFGV WPF VGKNYGKUG GOCKNNKGTV #O GEJV IQNFGPGP   -GVVEJGPOKV\YGK0CFGNP 5VÒEM++



9163



/KPKCVWTGPMGVVEJGPOKVPGWPITQ­GP1TFGPUOKPKCVWTGP 2TGW­GP-TQPGPQTFGP-TGW\-NCUUG XGTIQNFGV VGKNYGKUG GOCKNNKGTV #DRNCV\WPIGP KO /GFCKNNQPTKPI FGT 4ÒEMUGKVG   $GNIKGP .GQRQNF   1TFGP  /QFGNN   4KVVGTMTGW\ OKV 5EJYGTVGTP 5KNDGT /GFCKNNQPU )QNF GOCKNNKGTV     5·EJUKUEJG *GT\QIVÒOGT *GT\QINKEJ 5·EJUKUEJ'TPGUVKPKUEJGT *CWUQTFGP  /QFGNN 4KVVGTMTGW\    -NCUUG 5KNDGTXGTIQNFGV/GFCKNNQPU)QNFGOCKNNKGTVFKG-WIGNGKPGT-TGW\CTOURKV\GCDIGDTQEJGP   ¤UVGTTGKEJ -CKUGTTGKEJ (TCP\ ,QUGRJ1TFGP 1TFGPUMTGW\ )QNF GOCKNNKGTV   4WUUKUEJGU 4GKEJ   5V5VCPKUNCWU1TFGP1TFGPUMTGW\)QNFGOCKNNKGTV'OCKNNGCDRNCV\WPIKO4GXGTUOGFCKNNQP )TKGEJGP NCPF -ÌPKITGKEJ 'TNÌUGT1TFGP  /QFGNN OKV $KNF FGU 'TNÌUGTU WPF -TQPG   WPF    5KNDGTPGU-TGW\ 4KVVGTMTGW\ 5KNDGT/GFCKNNQPU)QNFGOCKNNKGTV'OCKNNGOCNGTGK 1TFGPFGT 'ORH·PIPKU7PUGTGT.KGDGP(TCWXQP8KNNC8KEQUC1TFGPUFGMQTCVKQP)QNFGOCKNNKGTV 1UOCPKUEJGU 4GKEJ /GFLKFLKG1TFGP 1TFGPUFGMQTCVKQP 5KNDGT /GFCKNNQPU WPF ªDGTJÌJWPI )QNF GOCKNNKGTV     6WPGUKGP 1TFGP FGU 4WJOU =0KUEJCP +HVKMJCT?  /QFGNN  #WUICDG OKV FGO /QPQITCOO XQP   /QJCOOGF ++ CU5CFQM $G[    1TFGPUFGMQTCVKQP 5KNDGT VGKNYGKUG GOCKNNKGTV CP GEJV   IQNFGPGO 1TFGPUMGVVEJGP OKV -PQRH OKV *GTUVGNNGTDG\GKEJPWPI FGT (KTOC )QFGV KP $GTNKP WPF OKV   0CFGN 5VÒEM++

 51


KONVOLUTE INTERNATIONAL

9164





/KPKCVWTGPUEJPCNNG OKV FTGK #WU\GKEJPWPIGP   6WPGUKGP 1TFGP FGU 4WJOU =0KUEJCP +HVKMJCT?   /QFGNN#WUICDG OKVFGO/QPQITCOOXQP/QJCOOGF+8CN*CFK$G[ 1TFGPUFGMQ TCVKQP5KNDGTVGKNYGKUGGOCKNNKGTV )TKGEJGPNCPF-ÌPKITGKEJ'TNÌUGT1TFGP/QFGNN OKV$KNFFGU 'TNÌUGTU WPF -TQPG   WPF   )QNFGPGU -TGW\ 1HHK\KGTUMTGW\  5KNDGT XGTIQNFGV   /GFCKNNQPU )QNF GOCKNNKGTV 'OCKNNGOCNGTGK   1UOCPKUEJGU 4GKEJ /GFLKFLKG1TFGP &GMQTCVKQP   QFGT-NCUUG5KNDGTVGKNYGKUGXGTIQNFGVWPFGOCKNNKGTVCP0CFGN 5VÒEM++



/KPKCVWTGPUEJPCNNG OKV UKGDGP #WU\GKEJPWPIUOKPKCVWTGP   5EJYGFGP )GF·EJVPKU'JTGP\GKEJGP   \WO)GDWTVUVCI-ÌPKI)WUVCXU8CO,WPK5KNDGTXGTIQNFGVWPFGOCKNNKGTV 5EJYGFGP -ÌPKINKEJGT 0QTFUVGTPQTFGP 4KVVGTMTGW\ 5KNDGT XGTIQNFGV /GFCKNNQPU )QNF GOCKNNKGTV   5EJYGFGP   -ÌPKINKEJGT 9CUC1TFGP 4KVVGTMTGW\ )QNF GOCKNNKGTV   5EJYGFGP )QNFGPG 8GTFKGPUVOGFCKNNG FGU   5EJYGFKUEJGP 4GKEJUXGTDCPFGU FGT 1TEJGUVGTXGTGKPKIWPIGP /QFGNN OKV 2QTVTCKV -ÌPKI )WUVCXU 8   5KNDGT XGTIQNFGV   $GNIKGP .GQRQNF1TFGP  /QFGNN   4KVVGTMTGW\ OKV 5EJYGTVGTP 5KN   DGT/GFCKNNQPU)QNFGOCKNNKGTV 5RCPKGP-ÌPKITGKEJ  /KNKV·T8GTFKGPUVQTFGP9GK­G #DVGKNWPI -TGW\  -NCUUG )QNF GOCKNNKGTV   .GVVNCPF  4GRWDNKM   1TFGP FGT FTGK   5VGTPG/QFGNN1HHK\KGTUMTGW\)QNFGOCKNNKGTVGKPG-TGW\CTOURKV\GXGTDQIGP$·PFEJGPOKVCWHIG NGIVGT4QUGVVG 5VÒEM++



9166







9165

9167

9168

/KPKCVWTGPUEJPCNNG OKV FTGK #WU\GKEJPWPIUOKPKCVWTGP   5EJYGFGP -ÌPKINKEJGT 9CUC1TFGP   /QFGNN CD )QNFGPG9CUC/GFCKNNG)QNFI *GKNKIGT5VWJN 8CVKMCP )QNFGPGU'JTGP MTGW\ 2TQ 'EENGUKC GV 2QPVGHKEG )QNF   (TCPMTGKEJ  4GRWDNKM 'JTGP\GKEJGP GKPGU 1HHK\KGTU FGT   8QNMUGT\KGJWPI UQIGP )QNFGPG #MCFGOKUEJG 2CNOGP  #WUHÒJTWPI  5KNDGT XGTIQNFGV WPF   VGKNYGKUGGOCKNNKGTV1JPG0CFGN 5VÒEM++



/KPKCVWTGPMGVVEJGP GKPGU UEJYGFKUEJGP 1HHK\KGTU OKV HÒPH /KPKCVWTCWU\GKEJPWPIGP   5EJYGFGP   -ÌPKINKEJGT5EJYGTVQTFGP4KVVGTMTGW\)QNFGOCKNNKGTV (TCPMTGKEJ4GRWDNKM1TFGPFGT'JTGPNG IKQP /GFCKNNQPU HGJNGP   5EJYGFGP /GFCKNNG \WT HÒPHVGP 1N[ORKCFG KP 5VQEMJQNO  5KNDGT     (TCPMTGKEJ  4GRWDNKM 1TFGP FGT 'JTGPNGIKQP  /QFGNN   4KVVGTFGMQTCVKQP 5KNDGT   /GFCKNNQPU)QNFGOCKNNKGTV'OCKNNGCDRNCV\WPIGP 0QTYGIGP1NCXU1TFGP/QFGNN   /KPKCVWTFGU4KVVGTMTGW\GU-NCUUG)QNFGOCKNNKGTV-GVVEJGPOKV\YGK0CFGNP 5VÒEM++



/KPKCVWTGPMGVVEJGP OKV XKGT 1TFGPUOKPKCVWTGP   2TGW­GP -ÌPKINKEJGT -TQPGP1TFGP  /QFGNN  

CD EC   -TGW\  -NCUUG )QNF   &·PGOCTM &CPPGDTQI1TFGP  /QFGNN  #WUICDG OKV   /QPQITCOO -ÌPKI %JTKUVKCP +:    4KVVGTMTGW\ )QNF   5EJYGFGP -ÌPKINKEJGT   5EJYGTVQTFGP 4KVVGTMTGW\ )QNF   5EJYGFGP -ÌPKINKEJGT 9CUC1TFGP 4KVVGTMTGW\ )QNF CP \YGK   0CFGNP 5VÒEM++



-1081.76'+06'40#6+10#. 



52

-QPXQNWVXQP#WU\GKEJPWPIGP7CCWU$C[GTP(TCPMTGKEJ¤UVGTTGKEJ5RCPKGPWPF7PICTPKP XGTUEJKGFGPGP/GVCNNGP CWEJ5KNDGT VGKNUXGTIQNFGVVGKNUGOCKNNKGTVVGKNUCP$·PFGTPKPWPVGTUEJKGFNK EJGP'TJCNVWPIGP&C\WGKPGTWO·PKUEJG/KPKCVWTCO$·PFEJGP 5VÒEM++++p+++++++8



-QPXQNWV XQP UKGDGP XGTUEJKGFGPGP 1TFGP WPF 'JTGP\GKEJGP 7 C CWU $GNIKGP (KPPNCPF ¤UVGT   TGKEJ 5RCPKGP WPF FGP 75#  8GTUEJKGFGPG /GVCNNG CWEJ 5KNDGT VGKNU XGTIQNFGV XKGT GOCKNNKGTV   LGYGKNUCPMQTTGMVGP$·PFGTP\YGKKO'VWKKPUGJTQTFGPVNKEJGT'TJCNVWPI 5VÒEM++




KONVOLUTE INTERNATIONAL

ex 9171

ex 9172

ex 9176

ex 9177



-QPXQNWVXQPXGTUEJKGFGPGP#WU\GKEJPWPIGP7CCWU$GNIKGP)TKGEJGPNCPF)TQ­DTKVCPPKGPWPF 4WO·PKGPXGTUEJKGFGPG/GVCNNG CWEJ5KNDGT VGKNUCP$·PFGTPKPWPVGTUEJKGFNKEJGP'TJCNVWPIGP  5VÒEM++





#PURTWEJUXQNNGU-QPXQNWVXQPÒDGT1TFGP'JTGPWPF#D\GKEJGP7CCWUI[RVGPVJKQRKGP

-UT $QNKXKGP$WNICTKGP -IT 84 &GWVUEJNCPF(TCPMTGKEJ)TQ­DTKVCPPKGP+PFKGP/QPIQNGK 2QNGP 4WO·PKGP 4W­NCPF -UT  5QYLGVWPKQP WPF FGT 6UEJGEJQUNQYCMGK  4GR  XGTUEJKGFGPG   /GVCNNGVGKNUXGTIQNFGVVGKNUXGTUKNDGTVVGKNUGOCKNNKGTVVGKNUNCEMKGTVVGKNUCP$·PFGTPVGKNUCP$CFURCP IGP VGKNU CP 6TCIURCPIGP VGKNU CP 0CFGN VGKNU CP 5EJTCWDGP OKV 5EJTCWDUEJGKDGP \YGK KP 'VWKU KP   QTFGPVNKEJGP'TJCNVWPIGP 5VÒEM++++p+++





-QPXQNWV OKV  XGTUEJKGFGPGP 1TFGP WPF 'JTGP\GKEJGP 7 C CWU (TCPMTGKEJ FGP 0KGFGTNCPFGP   ¤UVGTTGKEJ2QNGP4WO·PKGP5GTDKGP6JCKNCPFWPF7PICTPKPXGTUEJKGFGPGP/GVCNNGPCWEJKP5KNDGT VGKNU XGTIQNFGV VGKNU XGTUKNDGTV VGKNU GOCKNNKGTV VGKNU CP $·PFGTP KP QTFGPVNKEJGP 'TJCNVWPIGP &C\W   #D\GKEJGPFGTLCRCPKUEJGP-TKGIUOCTKPGCP0CFGN 5VÒEM++





-QPXQNWV XQP  1TFGP WPF 'JTGP\GKEJGP 7 C CWU $GNIKGP $WNICTKGP &GWVUEJNCPF ,CRCP FGP   0KGFGTNCPFGP4WO·PKGPWPFFGP8GTGKPVGP0CVKQPGPXGTUEJKGFGPG/GVCNNGFCXQPFTGKKP5KNDGTVGKNU XGTIQNFGVVGKNUXGTUKNDGTV\YGKGOCKNNKGTVCP$·PFGTPKPWPVGTUEJKGFNKEJGP'TJCNVWPIGP\YGKKP'VWKU &C\WGKPG/KPKCVWTOGFCKNNGWPFGKP4GXGTUCD\GKEJGP 5VÒEM++++p+++





-QPXQNWVXQPXKGT#WU\GKEJPWPIGP 2TGW­GP'-++CP'KPGT5RCPIG /GEMNGPDWTI5EJYG TKP/KNKV·TXGTFKGPUVMTGW\++-NCUUGCO$CPF ¤UVGTTGKEJ-NGKPG5KNDGTPG6CRHGTMGKVUOGFCKNNG (TCP\,QUGRJ5KNDGTCO&TGKGEMUDCPF (TCPMTGKEJ#MCFGOKUEJG2CNOGPKP5KNDGTVGKNYGKUGGOCKN NKGTVCO$CPFKPQTFGPVNKEJGP'TJCNVWPIGP 5VÒEM++





-QPXQNWV XQP  1TFGP WPF 'JTGP\GKEJGP 7 C CWU $GNIKGP $GNIKUEJ -QPIQ &GWVUEJNCPF (KPP   NCPF (TCPMTGKEJ +VCNKGP FGP 0KGFGTNCPFGP 0QTYGIGP ¤UVGTTGKEJ 4WO·PKGP 5RCPKGP FGP 75#   WPF FGO *GKNKIGP 5VWJN 8CVKMCP  XGTUEJKGFGPG /GVCNNG CWEJ 5KNDGT VGKNU XGTIQNFGV VGKNU XGTUKNDGTV   VGKNU GOCKNNKGTV OGKUV CP $·PFGTP KP WPVGTUEJKGFNKEJGP 'TJCNVWPIGP &C\W GKP WPICTKUEJGU #D\GKEJGP   GOCKNNKGTVOKV-PQRH 5VÒEM++++p+++



-QPXQNWVXQP1TFGPWPF'JTGP\GKEJGP7CCWUVJKQRKGP$GNIKGP$WNICTKGP(TCPMTGKEJFGO -KTEJGPUVCCV5EJYGFGPWPF5RCPKGPXGTUEJKGFGPG/GVCNNGCWEJ5KNDGTVGKNUXGTIQNFGVVGKNUXGTUKNDGTV VGKNUGOCKNNKGTVVGKNUCP$·PFGTPGKP1TFGPKO'VWKKPWPVGTUEJKGFNKEJGP'TJCNVWPIGP 5VÒEM++





ex 9178 (1:1)



-QPXQNWVXQPXGTUEJKGFGPGP#WU\GKEJPWPIUOKPKCVWTGP7CCWU$GNIKGPFGO&GWVUEJGP4GKEJ (KPPNCPF(TCPMTGKEJ)TKGEJGPNCPF+VCNKGPFGP0KGFGTNCPFGP¤UVGTTGKEJ2QNGP2TGW­GP4WO·PKGP 5EJYGFGPWPF7PICTPKPXGTUEJKGFGPGP/GVCNNGPCWEJ)QNFWPF5KNDGTVGKNUXGTIQNFGVVGKNUXGTUKNDGTV GOCKNNKGTVKPWPVGTUEJKGFNKEJGP'TJCNVWPIGPCP$·PFEJGPFCXQPXKGTOKVCWHIGNGIVGP4QVVGPQFGT 5EJNGKHEJGP 5VÒEM++

 53


BELGIEN 

-QPXQNWVXQPHÒPH1TFGPUOKPKCVWTGP#NNGKP)QNF $GNIKGP.GQRQNF1TFGP $WNICTKGP<KXKN 8GTFKGPUVQTFGP -TQPG HGJNV   &·PGOCTM &CPPGDTQI1TFGP /QFGNN OKV FGO /QPQITCOO -ÌPKI   %JTKUVKCPU+: +VCNKGP/CWTKVKWUWPF.C\CTWU1TFGP1HHK\KGTUMTGW\/QFGNN OKV.QTDGGTMTCP\   7PDGMCPPVGU1TFGPUMTGW\,GYGKNUGOCKNNKGTVVGKNYGKUGOKV'OCKNNGEJKRUFC\W.QTDGGTMTCP\ªDGT JÌJWPI OKV $CPFTKPI )QNF GOCKNNKGTV 'OCKNNGCDRNCV\WPI YQJN \WO URCPKUEJGP 1TFGP +UCDGNNCU FGT   -CVJQNKUEJGPIGJÌTKI<WUCOOGPI ++p++++8



ex 9180



-QPXQNWV XQP  /KPKCVWTGP XQP 1TFGP WPF 'JTGP\GKEJGP 7 C CWU &·PGOCTM (KPPNCPF (TCPM   TGKEJ +VCNKGP FGP 0KGFGTNCPFGP )TKGEJGPNCPF ¤UVGTTGKEJ 2GTUKGP 2QNGP FGO 4WUUKUEJGP 4GKEJ   5EJYGFGP5RCPKGP6WPGUKGPWPF7PICTPXGTUEJKGFGPG/GVCNNGXKGN5KNDGTVGKNUXGTIQNFGVGKPKIGOKV GEJV IQNFGPGP /GFCKNNQPU ITÌ­VGPVGKNU CP $·PFEJGP FCXQP GKPKIG OKV 4QUGVVGP#WHNCIGP KP OGKUV   QTFGPVNKEJGP 'TJCNVWPIGP GKPKIG YGPKIG OKVHGJNGPFGP/GFCKNNQPUWPFGKPKIGYGPKIGOKV'OCKNNGEJKRU QFGTTGRCTCVWTGP ++



)TQ­GU -QPXQNWV ÒDGT  4GXGTU4QUGVVGP 5EJNGKHEJGP $CPFTÌNNEJGP GVE 7 C CWU VJKQRKGP   $GNIKGPFGO&GWVUEJGP4GKEJ'UVNCPF(TCPMTGKEJ4WO·PKGP¤UVGTTGKEJ4W­NCPF5EJYGFGP6WPG UKGPWPFXKGNGPYGKVGTGP.·PFGTPXKGNGOKV5KNDGTWPFQFGT)QNFNKV\GPWPVGTNGIV\CJNTGKEJGOKVOGJT HCEJMQODKPKGTVGP$·PFEJGPGKPKIGOKV#WHNCIGPOGKUVCP-PÌRHGPHÒTFCU4GXGTU-PQRHNQEJXQTYKG IGPFKPQTFGPVNKEJGT'TJCNVWPI 5VÒEM++++p+++



'KPGYCJTG(WPFITWDGHÒT/KPKCVWTGPUCOONGT



'KPGYCJTG(WPFITWDGHÒTFKG'TI·P\WPIFGTQHVKPFGP8GTNGKJWPIUGVWKUHGJNGPFGP4QUGVVGP

9182 (1:1)

-¤0+)4'+%*$'.)+'0 

.GQRQNF1TFGP=1TFTGFG.¾QRQNF.GQRQNFUQTFG?/QFGNN OKVGKPURTCEJKIGT/GFCKNNQPWOUEJTKHV  $TWUVUVGTP\WO)TQ­EQTFQPOKV5EJYGTVGTP5KNDGTDTKNNCPVKGTV#WHNCIGP5KNDGTXGTIQNFGV .ÌYG)QNFVGKNYGKUGGOCKNNKGTVOKP#DURNKVVGTWPIGPKPFGTTQVGP'OCKNNGGKPG5EJYGTVGTMNKPIGHGJNV CWHFGT4ÒEMUGKVG*GTUVGNNGTDG\GKEJPWPIFGT(KTOC)WUVCXG9QNHGTUKP$TÒUUGNCP0CFGNFKGUGXGTDQ IGPOKV\YGK5GKVGPJCMGP$9-<- 4++p+++ #PHGTVKIWPIWO5EJQPMWT\PCEJFGT6JTQPDGUVGKIWPI CO,WPK JCV-ÌPKI.GQRQNF+CO,WNK FGPCNU\WP·EJUVXKGTMNCUUKIGP<KXKNWPF/KNKV·TXGTFKGPUVQTFGPIGUVKHVGV/KV-ÌPKINKEJGO&GMTGVXQO/CK GTJKGNVFGT1TFGPGKPGYGKVGTG-NCUUGFKGFGT)TQ­QHHK\KGTGFKGPWTCWUGKPGO$TWUVUVGTPQJPGYGKVGTG+PUK IPKGP YKG *CNU QFGT $TWUVMTGW\G DGUVCPF 7O FGT <YGKURTCEJKIMGKV FGU .CPFGU 4GEJPWPI \W VTCIGP JCV -ÌPKI   $CWFQWKP+UEJQPMWT\PCEJªDGTPCJOGFGT4GIKGTWPI CO,WNK OKV&GMTGVXQP1MVQDGTXGT HÒIV FC­ MÒPHVKI CWH CNNGPUVCCVNKEJGP1TFGPWPF'JTGP\GKEJGPFKG+PUEJTKHVGPUQYQJNKPHTCP\ÌUKUEJYKGCWEJHN· OKUEJCP\WDTKPIGPUKPF

54




BELGIEN

9183 (1:1)



.GQRQNF1TFGP=1TFTGFG.¾QRQNF.GQRQNFUQTFG?/QFGNN OKVGKPURTCEJKIGT/GFCKNNQPWOUEJTKHV  -QOOCPFGWTMTGW\ZOO#PHGTVKIWPIFGT(KTOC%,$WNUKP$TÒUUGN)QNF VGKNYGKUG HGKPUV \KUGNKGTV GOCKNNKGTV  I KP FGP /GFCKNNQPTKPIGP MCWO UKEJVDCTG QDGTHN·EJNKEJG   'OCKNNGEJKRUWPFURTÒPIGOKVHGKPIGMÌTFGNVGOUVCTTGO#WHJ·PIWPIUTKPICOCNVGP*CNUDCPF$9- <- ++



'ZGORNCT FGT #WMVKQP (TKV\ 4WFQNH -ÒPMGT  1UPCDTÒEM  0T  *GTXQTTCIGPFG #PHGTVKIWPI CWU FGT   /KVVG FGU 0GWP\GJPVGP ,CJTJWPFGTVU OKV IGYÌNDVGO 8QTFGTUGKVGPOGFCKNNQP KP QRVKOCNGT 'TJCNVWPIUSWCNKV·V FKG   UKEJNCWV4WQMQPGP KP4-$5 FGO*GTUVGNNGT%,$WNUKP$TÒUUGN\WQTFPGPN·­VFGT\YKUEJGPWPFFGP GT,CJTGPIGCTDGKVGVJCV

9184

9185

9186



.GQRQNF1TFGP=1TFTGFG.¾QRQNF.GQRQNFUQTFG?/QFGNN OKVGKPURTCEJKIGT/GFCKNNQPWOUEJTKHV    4KVVGTMTGW\ 6[R OKV -TQPG FGU 6[RWU ¾NCTIK EC EC   5KNDGT /GFCKNNQPU   )QNF GOCKNNKGTV -TGW\URKV\GP VGKNYGKUG GVYCU IGUVCWEJV WPF OKV OKP 'OCKNNGCWUDTÒEJGP .ÌYG KO   /GFCKNNQPNGKEJVXGTFTGJVCOMWT\GPQTKIKPCNGP$CPFUVÒEM$9-<- ++





.GQRQNF1TFGP=1TFTGFG.¾QRQNF.GQRQNFUQTFG?/QFGNN OKVGKPURTCEJKIGT/GFCKNNQPWOUEJTKHV    4GFWMVKQP FGU 4KVVGTMTGW\GU OKV 5EJYGTVGTP  Z  OO 5KNDGT /GFCKNNQPU )QNF   GOCKNNKGTVCOUR·VGTGP$CPF +p++



.GQRQNF1TFGP =1TFTG FG .¾QRQNF  .GQRQNFUQTFG?  /QFGNN OKV \YGKURTCEJKIGT /GFCKNNQPWO   UEJTKHVUGKV 4KVVGTMTGW\OKV5EJYGTVGTPZOOXGTUKNDGTVVGKNYGKUGXGTIQNFGVGOCKN NKGTVCO$CPFOKVCWHIGNGIVGPIGMTGW\VGP5EJYGTVGTP +p++





55


BELGIEN

9187 ex 9188

ex 9189



'KUGTPGU -TGW\ XQP  )QNFGPGU -TGW\ 'KUGP -TGW\CTOG 'KUGP (CUUWPI )QNF CO IGMÌTFGNVGP   $CPFTKPIQJPG$CPF$9- ++





-ÌPKIKP'NKUCDGVJ/GFCKNNG=/¾FCKNNGFGNC4GKPG'NKUCDGVJ?/GFCKNNGQJPG4QVGU-TGW\$TQP\GCO QTKIKPCNGP $CPFOKVDTKVKUEJGT6TCIGDTQUEJKGTWPI&C\W$TKVKUEJG-TÌPWPIUOGFCKNNG5KNDGTCP &COGPUEJNGKHGFKG0CFGNFGTTÒEMUGKVKIGP$TQUEJKGTWPICDIGDTQEJGP$9-/;$  5VÒEM++



,GYGKNUXGTNKGJGPCP&QTQVJ[.[QP&CNDGTI#EVQP.CF[#EVQP  )GOCJNKPXQP4KEJCTF.[QP&CNDGTI #EVQPPF$CTQP#EVQP  DTKVKUEJGT&KRNQOCVKPFGT5EJYGK\WPFKP*GUUGPXQPDKUDTKVK UEJGT )GUCPFVGT KP (KPPNCPF 'Z #WMVKQP 1TFGTU &GEQTCVKQPU /GFCNU CPF /KNKVCTKC DGK &KZ 0QQPCP 9GDD KP   .QPFQPCO,WNK -CV0T \WUCOOGPOKVYGKVGTGP1TFGPUKPUKIPKGPCWUFGO$GUKV\FGT(COKNKG#EVQP 5KGJGCWEJ-CVCNQI0T



$KLQW FGT .QIG FGT 2JKNCPVJTQRGP KP $TÒUUGN 5KNDGT VGKNYGKUG XGTIQNFGV CO $CPF OKV CWHIGNGIVGT   5EJNGKHG &C\W (TCP\ÌUKUEJG+PFQEJKPC/GFCKNNGCO$CPFWPFKPFKUEJG/GFCKNNGQJPG$CPFKOVJCK N·PFKUEJGP'VWK 5VÒEM++



9190



56

#WU\GKEJPWPIUPCEJNC­ FGU UVGNNXGTVTGVGPFGP 2QNK\GKMQOOKUUCTU #EJKNNG %QRRKPG CWU )GPV DGUVG   JGPFCWUUKGDGP#WU\GKEJPWPIGP 5KNDGTPGU<KXKNXGTFKGPUVMTGW\5KNDGTGOCKNNKGTVMN'OCKNNGUEJ· FGP   $GNIKUEJ -QPIQ 5KNDGTPG /GFCKNNG FGU -ÌPKINKEJGP )GUGNNUEJCHV FGT .GDGPUTGVVGT 5KNDGT CWH   FGT 4ÒEMUGKVG 6T·IGTITCXWT   )TQ­G 5KNDGTOGFCKNNG FGT 2TQXKP\ 1UVHNCPFGTP HÒT 8GTFKGPUVG WO FGP   5EJWV\FGT/·TV[TGT-KPFGTCO0QXGODGT5KNDGTCWHFGT4ÒEMUGKVG6T·IGTITCXWT 5KNDGT PGU'JTGP\GKEJGPFGU$GNIKUEJGP4QVGP-TGW\GUHTÒJG#WUHÒJTWPI5KNDGTVGKNYGKUGGOCKNNKGTVCWHFGT 4ÒEMUGKVG6T·IGTITCXWT )TQ­G5KNDGTOGFCKNNGFGT2TQXKP\1UVHNCPFGTPHÒT8GTFKGPUVGWOFGP5EJWV\ FGT /·TV[TGT-KPFGT CO  &G\GODGT  5KNDGT CWH FGT 4ÒEMUGKVG 6T·IGTITCXWT   $GNIKUEJ   -QPIQ5KNDGTPG/GFCKNNGHÒT/WVWPF#WHQRHGTWPI5KNDGTCWHFGT4ÒEMUGKVG6T·IGTITCXWT 'TKPPG TWPIUOGFCKNNGFGT2TQXKP\1UVHNCPFGTP\WO,WDKN·WOFGT7PCDJ·PIKIMGKV$GNIKGPU$TQP\GOQPVKGTV KPDGUEJ·FKIVGO5VWEMTCJOGP 5VÒEM++




BULGARIEN

ex 9191

9198 Rv. (1:1) 9193





9195

9197

9194

-QPXQNWV XQP  #WU\GKEJPWPIGP 7 C 4KVVGTMTGW\ FGU .GQRQNF1TFGP UVCTM DGUEJ·FKIV )QNFGPG   2CNOGPWPF)QNFGPG8GTFKGPUVOGFCKNNGFGU-TQPGPQTFGPULGYGKNU$TQP\GXGTIQNFGV5KNDGTPGU<KXKNXGT FKGPUVMTGW\ Z WPF)QNFGPG 5KNDGTXGTIQNFGV WPF5KNDGTPG<KXKNXGTFKGPUVOGFCKNNG Z XGTUEJKGFGPG /GVCNNG UKGDGP KP 5KNDGT VGKNU XGTIQNFGV VGKNU XGTUKNDGTV HÒPH ICP\ QFGT VGKNYGKUG GOCKNNKGTV \GJP CP   $·PFGTPFCXQPGKPGUOKVCWHIGNGIVGT4QUGVVGKPWPVGTUEJKGFNKEJGP'TJCNVWPIGP&C\W5V*GNGPC/G FCKNNGFGU<YGKVGPHTCP\ÌUKUEJGP-CKUGTTGKEJU$TQP\GQJPG$CPF 5VÒEM++



4GXGTUUEJNGKHEJGP\WDGNIKUEJGP#WU\GKEJPWPIGPWPFFTGK#WU\GKEJPWPIUOKPKCVWTGP<WUCOOGP CWHFWPMNGO5COVJKPVGTITWPFOQPVKGTVKPDGUEJ·FKIVGO5VWEMTCJOGP 5VÒEM++



$'.)+5%*-10)1 

&KGPUV/GFCKNNG =/¾FCKNNG FG 5GTXKEG?  /QFGNN OKV FGO 2QTVTCKV -ÌPKI .GQRQNF +++  $TQP\GOGFCKNNGCOIGNDGP$CPFOKV\YGK$CPFURCPIGPOKVLGFTGK5VGTPGP 4++



$7.)#4+'0 <#4'067/   



1TFGP5V#NGZCPFGT=Îðäåí " Ñâ. Àëåêñàíäúð?/QFGNN OKVUQIGPGEMKIGTDWNICTKUEJGT<CTGP MTQPG    -TGW\ +8 -NCUUG OKV 5EJYGTVGTP 5KNDGT XGTIQNFGV WPF GOCKNNKGTV 'OCKNNG   #DRNCV\WPI KO /GFCKNNQPTKPI CO QTKIKPCNGP CNVGP &TGKGEMUDCPF QJPG CWHIGNGIVG 4QUGVVG $9-    <- ++p



1TFGP (ÒT 6CRHGTMGKV =Îðäåí "Çà Õðàáðîñò"?  /QFGNN OKV FGT ,CJTGU\CJN  CWH FGO XQT   FGTUGKVKIGP/GFCKNNQPTKPI 5QNFCVGPMTGW\HÒT6CRHGTMGKV+++-NCUUG$TQP\G&TGKGEMUDCPF $-$9-<- 44++



&KG5QNFCVGPMTGW\GFGU/QFGNNUOKVFGT,CJTGU\CJNUKPFKPCNNGPFTGK-NCUUGPXQPITQ­GT5GNVGPJGKV

-¤0+)4'+%*&0'/#4- 

&CPPGDTQI1TFGP =&CPPGDTQIQTFGPGP? .GGTGU 8GTNGKJWPIUGVWK \WO )TQ­MTGW\ FGT (KTOC #   /KEJGNUGPKP-QRGPJCIGPCWUFGT4GIKGTWPIU\GKV-ÌPKI(TGFGTKMU+:QFGT-ÌPKIKP/CTICTGVJGU++ ++



&GT &CPPGDTQI1TFGP YWTFG CO  1MVQDGT  XQP -ÌPKI %JTKUVKCP 8 XQP &·PGOCTM WPF 0QTYGIGP     KP'TPGWGTWPIGKPGUUEJQPXQP-ÌPKI9CNFGOCT++XQP&·PGOCTM  IGUVKHVGVGP4KVVGTQTFGPU GTPGWGTV<WP·EJUVPWTCWUGKPGT-NCUUGDGUVGJGPFGTYGKVGTVGKJP-ÌPKI(TGFGTKM8+XQP&·PGOCTMWPF0QTYGIGP

  CO ,WPK\WGKPGOCWUXKGT-NCUUGP )TQ­MQOOCPFGWTCDFKGQDGTUVG-NCUUG)TQ­ MTGW\4KVVGT -QOOCPFGWT WPF 4KVVGT  DGUVGJGPFGP CNNIGOGKPGP 8GTFKGPUVQTFGP CNU ·W­GTGU <GKEJGP CPGTMCPPVGT   $ÒTIGTRHNKEJV HÒT CNNG 7PVGTVCPGP QJPG4ÒEMUKEJVCWH5VCPFQFGT#FGN 1JO*KGTQP[OWUUGPKP'15  YWTFGFKG-QOOCPFGWTUMNCUUGFKG4KVVGTMNCUUGKPLGYGKNU\YGK)TCFGWPVGTVGKNV&GO1TFGPKUVUGKVFCU 'JTGP\GKEJGP FGU &CPGDTQI1TFGPU 5KNDGTPGU -TGW\  CPIGUEJNQUUGP       WPF    PCEJ 4GIKGTWPIUCPVTKVV FGU LGYGKNKIGP 5QWXGT·PU YWTFG FKG)GUVCNVWPIFGT1TFGPUMTGW\GFWTEJ#PDTKPIWPI FGULGYGKNKIGPMÌPKINKEJGP/QPQITCOOUXGT·PFGTV



&CPPGDTQI1TFGP=&CPPGDTQIQTFGPGP?/QFGNN#WUICDG OKV/QPQITCOO-ÌPKI%JTKUVKCP+:  5KNDGTPGU-TGW\5KNDGTCOQTKIKPCNGPCNVGP$CPF<- 4++





&CPPGDTQI1TFGP =&CPPGDTQIQTFGPGP?  /QFGNN OKV FGO /QPQITCOO -ÌPKI (TGFGTKMU 8++      /KPKCVWT FGU 4KVVGTMTGW\GU )QNF GOCKNNKGTV 'OCKNNGUEJ·FGP CWH #XGTU WPF 4GXGTU QJPG   $·PFEJGP +++

 57


DÄNEMARK

9200 (1:1)

9201 (1:1)

9199 (1:1)



9199 (1:1)

&CPPGDTQI1TFGP=&CPPGDTQIQTFGPGP?/QFGNNOKV/QPQITCOO-ÌPKI%JTKUVKCPU:   -QOOCPFGWTMTGW\ 5KNDGT XGTIQNFGV WPF GOCKNNKGTV OKP QDGTHN·EJNKEJGT %JKR CWH FGT 8QTFGTUGKVG FGT   NKPMGP 'EMG FGU WPVGTGP -TGW\CTOU QTKIKPCNGO *CNUDCPF KO 1TKIKPCNGVWK FGT (KTOC #/KEJGNUGPKP -QRGPJCIGP$9-<- ++





&CPPGDTQI1TFGP=&CPPGDTQIQTFGPGP?/QFGNNOKV/QPQITCOO-ÌPKI%JTKUVKCPU:   /KPKCVWTFGU1TFGPUMTGW\GU)QNFGOCKNNKGTVCO$·PFEJGP ++





&CPPGDTQI1TFGP =&CPPGDTQIQTFGPGP?  /QFGNN OKV FGO /QPQITCOO -ÌPKIKP /CTICTGVJGU ++  

UGKV /KPKCVWTFGU4KVVGTMTGW\GU-NCUUG5KNDGTXGTIQNFGVWPFGOCKNNKGTVCO&COGPUEJNGKHEJGP OKVCWHIGNGIVGT4QUGVVG ++



ex 9203 9202 (1:1)



9202 (1:1)

/GFCKNNGHÒTFKGGFNG6CV=/GFCNLGPHQT“FGN&CCF?/QFGNN OKVFGO2QTVTCKVXQP-ÌPKI%JTKUVKCP :    /GFCKNNG OKV *GPMGN &WTEJOGUUGT  OO  I OKV 5VGORGNUEJPGKFGTUKIPCVWT   .+0&#*.OKV4CPFITCXWT*CPU#FQNH.WFYKI#PFGTUGPQJPG$CPF$9- 444++  .CWV5VGXPUDQTI KP5685 UKPFXQPFKGUGT/GFCKNNG'ZGORNCTGJGTIGUVGNNVYQTFGPYQXQPXGTNKGJGP YQTFGPUKPF



-NGKPG-ÌPKINKEJG$GNQJPWPIUOGFCKNNG UQIGP.CMCKGP/GFCKNNG /QFGNN OKVFGO2QTVTCKV-ÌPK IKP/CTICTGVJGU++UGKV )QNFGPG/GFCKNNGQJPG-TQPG#WUHÒJTWPIQJPGTÒEMUGKVKIG+PUEJTKHV

UGKV   5KNDGT XGTIQNFGV CO $CPF &C\W 5KNDGTPGU 'TKPPGTWPIUCD\GKEJGP CP -ÌPKI %JTKUVKCP :   5KNDGTGOCKNNKGTVCP6TCIGURCPIGKO'VWK 5VÒEM4++p .CWV5VGXPUDQTI KP5685 UKPFXQPFKGUGT/GFCKNNGDKU'PFGKPUIGUCOVIGRT·IVYQTFGPYQXQP \YKUEJGPDKUPWTXGTNKGJGPYQTFGPUKPF

58




ESTLAND

ex 9206 ex 9205 (1:1) 9204

'56.#0&

'456' 4'27$.+-   





'JTGP\GKEJGP FGU 'UVPKUEJGP 4QVGP -TGW\GU ='GUVK 2WPCUG 4KUVK VGGPGVGOCGTM?  /QFGNN  

  -TGW\  -NCUUG 5KNDGT XGTIQNFGV WPF GOCKNNKGTV MCWO UKEJVDCTG 4GRCTCVWT KP FGT   YGK­GP'OCKNNGFGUQDGTGP-TGW\CTOUCO$QIGPDCPFUEJYGFKUEJGT0·JCTV$9-<- ++p



'JTGP\GKEJGP FGU 'UVPKUEJGP 4QVGP -TGW\GU ='GUVK 2WPCUG 4KUVK VGGPGVGOCGTM?  /QFGNN  

 /KPKCVWTFGU-TGW\GU-NCUUG5KNDGTXGTIQNFGVWPFGOCKNNKGTVCO$·PFEJGPFC\W GKPYGKVGTGU'ZGORNCT)QNFGOCKNNKGTV/GFCKNNQPUHGJNGPCO$·PFEJGP 5VÒEM+++8



'JTGP\GKEJGPHÒT'KHGTKPFGT(GWGTYGJT=6WNGVQTLGJQQNUWUO·TIKF?-QPXQNWVXQP'JTGP\GKEJGP   )QNFGPGU -TGW\  -NCUUG $TQP\G XGTIQNFGV   5KNDGTPGU -TGW\ $TQP\G XGTUKNDGTV   )QNFGPG   /GFCKNNG 5KNDGT XGTIQNFGV      5KNDGTPG /GFCKNNG 5KNDGT Z  LGYGKNU CP MQTTGMVGP QTKIKPCNGP   LGFQEJVGKNYGKUGGVYCUXGTUEJOWV\VGP$·PFGTPKPWPVGTUEJKGFNKEJGP'TJCNVWPIGP 5VÒEM+++++++



9207

9208

4'27$.+-(+00.#0& 

'KPGKPVGTGUUCPVGHKPPKUEJGUVPKUEJG1TFGPUUEJPCNNGHKPFGP5KGWPVGT14&'055%*0#..'0+06'40#6+10#. <WT5VCCVU5[ODQNKMFGT4GRWDNKM(KPPNCPFIGJÌTVPGDGPFGO.ÌYGPKOHKPPKUEJGP5VCCVUYCRRGP CWEJ GKP CNU (TGKJGKVUMTGW\ DG\GKEJPGVGU *CMGPMTGW\ &KGUGU (TGKJGKVUMTGW\ YWTFG DGTGKVU   Y·JTGPFFGU'TUVGP9GNVMTKGIU\WO5[ODQNFGTHKPPKUEJGP(TGKJGKVUDGYGIWPIIGIGPFKG\CTKUVKUEJ TWUUKUEJG *GTTUEJCHV WPF JCV UQOKV PKEJVU IGOGKP OKV FGO GTUV UR·VGT GPVUVCPFGPGP 5[ODQN FGU   0CVKQPCNUQ\KCNKUOWU $KU JGWVG KUV GU CWH FGO JÌEJUVGP HKPPKUEJGP 1TFGP FGO 1TFGP FGU   (TGKJGKVUMTGW\GU \W UGJGP WPF FKGPV \ $ CWEJ CNU 5[ODQN HÒT FGP HKPPKUEJGP 5VCCVURT·UKFGPVGP   D\Y FKG 5VCCVURT·UKFGPVKP KP FGUUGP D\Y FGTGP 5VCPFCTVG 5QOKV MCPP CWUFTÒEMNKEJ HGUVIGUVGNNV   YGTFGP FC­ FKGUGU (TGKJGKVUMTGW\ CNU PKEJV FGO 0CVKQPCNUQ\KCNKUOWU \WIGJÌTKIGU 5[ODQN PKEJV   WPVGTFKG$GUVKOOWPIGPFGThhC#DUD\Y#DU5V)$H·NNV



1TFGPFGU(TGKJGKVUMTGW\GU=8CRCWFGPTKUVKPTKVCTKMWPVC?/QFGNN OKVFGT,CJTGU\CJN -TGW\ -NCUUGOKV5EJYGTVGTP5KNDGTXGTIQNFGVQJPG$CPF$9-<- 4++



*CPMKOQIKDV KP(-5 HÒTFKGUG-NCUUGGKPG8GTNGKJWPIU\CJNXQPPWTCP



4KVVGTQTFGP FGT (KPPKUEJGP 9GK­GP 4QUG =5WQOGP 8CNMQKUGP 4WWUWP TKVCTKMWPVC? $TWUVUVGTP \WO   -QOOCPFGWT  -NCUUG  #WUHÒJTWPI $TWUVUVGTP CWH \YGK 5RKV\GP UVGJGPF  UGKV   5KNDGT VGKN   YGKUGXGTIQNFGVWPFGOCKNNKGTVCWHFGT4ÒEMUGKVGOGJTHCEJRWP\KGTVWC5KNDGTRWP\GWPF,CJTGU RWP\G;HÒTCPXGTIQNFGVGT0CFGN$9-<- ++

 59


FINNLAND

9210

9209





4KVVGTQTFGP FGT (KPPKUEJGP 9GK­GP 4QUG =5WQOGP 8CNMQKUGP 4WWUWP TKVCTKMWPVC? -QOOCPFGWT   MTGW\#WUHÒJTWPI OKVJQTK\QPVCNCPIGNÌVGVGT¤UGUGKV 5KNDGTXGTIQNFGVWPFGOCKNNKGTVKPFGT ¤UGOGJTHCEJRWP\KGTV WC#6HÒTFKG(KTOC#6KNNCPFGTKP*GNUKPMKWPF5KNDGTRWP\G CO*CNU DCPFKOQTKIKPCNGPIQNFHCTDGPDGFTWEMVGP8GTNGKJWPIUGVWKFGT(KTOC6KNNCPFGT$9-<- ++



(KPPKUEJGT .ÌYGPQTFGP =5WQOGP .GKLQPCP 4KVCTKMWPVC? -QOOCPFGWTUGV  -NCUUG DGUVGJGPF CWU   -QOOCPFGWTMTGW\5KNDGTXGTIQNFGVWPFGOCKNNKGTVKPFGT¤UGOGJTHCEJRWP\KGTVWC*GTUVGNNGTRWP\G #6FGT(KTOC6KNNCPFGTKP*GNUKPMKWPF*5KNDGTRWP\GCO'KPJ·PIG*CNUDCPFWPF$TWUVUVGTP 5KNDGTVGKNYGKUGXGTIQNFGVWPFGOCKNNKGTVCWHFGT4ÒEMUGKVGOGJTHCEJRWP\KGTVWC*GTUVGNNGTRWP\G# 6+..#0&'4WPF,CJTGURWP\GP1WPF2HÒTWPFCPXGTIQNFGVGT0CFGN$9- <- 5VÒEM++



9211

9213 (1:1)

9212 (1:1)



(KPPKUEJGT.ÌYGPQTFGP=5WQOGP.GKLQPCP4KVCTKMWPVC?/KPKCVWTFGU4KVVGTMTGW\GU-NCUUG5KNDGT XGTIQNFGV WPF GOCKNNKGTV \WUCOOGP OKV FGO 4KVVGTMTGW\ FGU 5RCPKUEJGP <KXKN8GTFKGPUVQTFGPU 5KNDGT   VGKNYGKUGXGTIQNFGVVGKNYGKUGGOCKNNKGTVCP\YGK\WUCOOGPOQPVKGTVGP&COGPUEJNGKHEJGP 5VÒEM++





1TFGP FGU *GKNKIGP .COOGU =2[J·P -CTKVUCP TKVCTKMWPVC? $TWUVUVGTP \WO -QOOCPFGWT-NCUUG 5KNDGTVGKNYGKUGXGTIQNFGVWPFGOCKNNKGTVCWHFGT4ÒEMUGKVGOGJTHCEJRWP\KGTVWC5KNDGTRWP\G* WPF,CJTGURWP\G8HÒTCP0CFGN$9-<- 44+p++ 



1TFGPFGU*GKNKIGP.COOGU=2[J·P-CTKVUCPTKVCTKMWPVC?-QOOCPFGWTMTGW\5KNDGTXGTIQNFGVWPF GOCKNNKGTVCWHFGT4ÒEMUGKVGOGJTHCEJRWP\KGTVWC5KNDGTRWP\G*WPF,CJTGURWP\G8HÒT QJPG*CNUDCPF$9-<- 4+p++

60




FINNLAND

9214

9215 9216



9KPVGTMTKGIU6GKNPGJOGT/GFCKNNG  HÒT CWUN·PFKUEJG (TGKYKNNKIG 'KUGP IGUEJY·T\V CO   QTKIKPCNGP$CPFOKV$CPFURCPIG-'066#4/'+,#WPFIGMTGW\VGP5·DGNP$9- ++





8GTFKGPUVOGFCKNNG HÒT CWUN·PFKUEJGP KPFKTGMVGP $GKUVCPF KO 9KPVGTMTKGI  $TQP\G CO   $CPF \WUCOOGP CP <YGKGT1TFGPUUEJPCNNG OKV 5KNDGTPGT 8GTFKGPUVOGFCKNNG FGU .CPFUVWTOXGTDCPFGU   XQP&CNCTP5KNDGT 4++



/KPKCVWTGPUEJPCNNGGKPGUCWUN·PFKUEJGP(TGKYKNNKIGPCO9KPVGTMTKGIOKVHÒPH#WU\GKEJ PWPIUOKPKCVWTGP 1TFGPFGU(TGKJGKVUMTGW\GU-NCUUGOKV5EJYGTVGTP5KNDGTXGTIQNFGV 1TFGP FGU (TGKJGKVUMTGW\GU  -NCUUG OKV 5EJYGTVGTP 5KNDGT   1TFGP FGT (KPPKUEJGP 9GK­GP 4QUG 4KVVGT   MTGW\5KNDGT 5KNDGTPG8GTFKGPUVOGFCKNNGFGU(KPPKUEJGP4QVGP-TGW\GU 9KPVGTMTKGIU6GKNPGJOGT /GFCKNNG  HÒT CWUN·PFKUEJG (TGKYKNNKIG $·PFEJGP OKV IGMTGW\VGP 5EJYGTVGTP QJPG 0CFGN   4++





'KPG KPVGTGUUCPVG HKPPKUEJGUVPKUEJG 1TFGPUUEJPCNNG HKPFGP 5KG WPVGT 14&'055%*0#..'0  +06'40#6+1   0#. 9GKVGTG UEJÌPG /KPKCVWTGPUEJPCNNGP WPF MGVVEJGP HKPFGP 5KG WPVGT &'765%*.#0&  /+0+#674'0   5%*0#..'0 70& -'66%*'0 /+0+#674'05%*0#..'0 70& -'66%*'0  +06'40#6+10#.   (4#0-4'+%*WPF5%*9'&'0

9218 9217









ex 9220

/KPKCVWTGPUEJPCNNG OKV XKGT #WU\GKEJPWPIUOKPKCVWTGP   1TFGP FGU (TGKJGKVUMTGW\GU  -NCUUG OKV   'KEJGPNCWD WPF 5EJYGTVGTP 5KNDGT   1TFGP FGU (TGKJGKVUMTGW\GU  -NCUUG OKV 5EJYGTVGTP 5KNDGT    (KPPKUEJGT.ÌYGP1TFGP4KVVGTMTGW\-NCUUG5KNDGTXGTIQNFGVWPFGOCKNNKGTV$·PFEJGPOKV4QUGVVG  5EJYGFGP/GFCKNNGHÒT8GTFKGPUVGWOFCU5EJYGFKUEJG4QVG-TGW\/QFGNNOKVFGO2QTVTCKV-ÌPKI )WUVCXU85KNDGTQJPG0CFGN ++



/KPKCVWTGPUEJPCNNG GKPGU UEJYGFKUEJGP 8GVGTCPGP FGU <YGKVGP 9GNVMTKGIU OKV UGEJU #WU\GKEJ   PWPIUOKPKCVWTGP   $TQP\GPGU 8GTFKGPUVMTGW\ FGT <KXKNICTFG   -TKGIUGTKPPGTWPIUOGFCKNNG HÒT FGP   9KPVGTMTKGIOKV$CPFURCPIG-'066#4/'0# -TKGIUGTKPPGTWPIUOGFCKNNGFGU-TKGIGU  2TQ$GPKIPKVCG*WOCPC/GFCKNNGFGU(KPPKUEJGP4QVGP-TGW\GU -TGW\HÒTFKGUEJYG FKUEJGP(TGKYKNNKIGPKP(KPPNCPF .CRRNCPF5EJNCEJV'TKPPGTWPIUMTGW\QJPG0CFGN ++



<YGK/KPKCVWTGPMGVVEJGPOKVKPUIGUCOV#WU\GKEJPWPIUOKPKCVWTGP'TUVGU-GVVEJGP (KPPKUEJGT .ÌYGPQTFGP 4KVVGTMTGW\  -NCUUG 5KNDGT XGTIQNFGV WPF GOCKNNKGTV $·PFEJGP OKV 4QUGVVGP#WHNCIG     /GFCKNNG HÒT FGP (TGKJGKVUMTKGI  OKV $CPFURCPIG   9KPVGTMTKGIU/GFCKNNG  OKV   $CPFURCPIG-16+,17-16 -TKGIUOGFCKNNG $TQP\GPG8GTFKGPUVOGFCKNNGFGT<KXKNICTFG <YGKVGU -GVVEJGP   (TGKJGKVUOGFCKNNG  -NCUUG    2TGW­GP 'KUGTPGU -TGW\ ++ -NCUUG      1TFGP FGU (TGKJGKVUMTGW\GU /QFGNN  (TGKJGKVUMTGW\ +8 -NCUUG OKV 5EJYGTVGTP   1TFGP FGU   (TGKJGKVUMTGW\GU /QFGNN  (TGKJGKVUMTGW\ +8 -NCUUG OKV 5EJYGTVGTP GKP \YGKVGU 'ZGORNCT    (TGKJGKVUOGFCKNNG-NCUUG (TGKJGKVU-TKGIUGTKPPGTWPIUOGFCKNNG'KPG0CFGNHGJNV ++



-QPXQNWV XQP CEJV #WU\GKEJPWPIGP WPF FTGK #D\GKEJGP   1TFGP FGU (TGKJGKVUMTGW\GU -TGW\   -NCUUGOKV5EJYGTVGTP#WUICDG 1TFGPFGU(TGKJGKVUMTGW\GU-TGW\-NCUUGOKV5EJYGTVGTP #WUICDG    (TGKJGKVUOGFCKNNG  -NCUUG #WUICDG  5KNDGT   (TGKJGKVUOGFCKNNG  -NCUUG   #WUICDG (TGKJGKVUOGFCKNNG-NCUUG#WUICDG /GFCKNNGHÒTFGP9KPVGTMTKGIHÒT +PN·PFGT   /GFCKNNGHÒTFKG-TKGI /GFCKNNGHÒTFGP-TKGIOKV$CPFURCPIG .#2+0516# 5KNDGTPGU#D\GKEJGPFGT.QVVC5X·TF5KNDGTOKV/CVTKMGNPWOOGTWPF5KNDGT RWP\GP   5KNDGTPGU #D\GKEJGP FGT *GKOYGJT 5KNDGT OKV /CVTKMGNPWOOGT  5KNDGTRWP\GP    7PDGMCPPVGU#D\GKEJGPOKVFGO(TGKJGKVUMTGW\CP5EJTCWDGOKV5EJTCWDUEJGKDG 5VÒEM++

 61


FRANKREICH

9221

9222

9224

9223

(4#0-4'+%* -¤0+)4'+%* 4'56#74#6+10  

-ÌPKINKEJGT1TFGPFGT'JTGPNGIKQP=1TFTG4Q[CNFGNC.¾IKQPF JQPPGWT?  /Q FGNN OKV2QTVTCKV-ÌPKI*GKPTKEJU+8CWHFGO8QTFGTUGKVGPWPFFTGK.KNKGPCWHFGO4ÒEM UGKVGPOGFCKNNQPFKG&GMQTCVKQPÒDGTJÌJVXQPGKPGT.KNKGPMTQPG 1HHK\KGTUFGMQTCVKQPKPNGKEJVTGFW\KGT VGT)TÌ­GZOO)QNFGOCKNNKGTVIFGT-QRH*GKPTKEJU+8PCEJTGEJVUFCUWTURTÒPI NKEJG4ÒEMUGKVGPOGFCKNNQPOKVFGPFTGK$QWTDQPGPNKNKGPCWUIGVCWUEJVFWTEJFCU/GFCKNNQPFGU$ÒTIGTMÌ PKIVWOUOKVFGPDGKFGPIGMTGW\VGP6TKMQNQTGPCOMCPPGNKGTVGP$CPFTKPIIGTGKPKIVQJPG$CPF$9- XCT<-XCT ++





-ÌPKINKEJGT1TFGPFGT'JTGPNGIKQP=1TFTG4Q[CNFGNC.¾IKQPF JQPPGWT?  /Q FGNN OKV2QTVTCKV-ÌPKI*GKPTKEJU+8CWHFGO8QTFGTUGKVGPWPFFTGK.KNKGPCWHFGO4ÒEM UGKVGPOGFCKNNQPFKG&GMQTCVKQPÒDGTJÌJVXQPGKPGT.KNKGPMTQPG ITÌ­GPTGFW\KGTVG4KVVGTFGMQTCVKQP UQIGP *CNDOKPKCVWT   Z  OO FWTEJ #WUVCWUEJFGT/GFCKNNQPUVTCPUHQTOKGTVG#WUHÒJTWPICWH$CUKU FGT#WUHÒJTWPIFGU/QFGNNU 0CRQN¾QPHÒPHDÒIGNKIG.CWDMTQPG 5KNDGT/GFCKNNQPU)QNFGOCKN NKGTVOKP'OCKNNGUEJ·FGPOKVMCPPGNKGTVGO$CPFTKPICOMWT\GPQTKIKPCNGPCNVGP$CPFUVÒEM ++p+++





'JTGP\GKEJGPFGT.KNKGFG6TGWG=&¾EQTCVKQPFWN[UFGNCHKF¾NKV¾?+P.KNKGPHQTOOKV-TQPG5KNDGT COMWT\GPQTKIKPCNGPCNVGP$CPFUVÒEM$9- ++





'JTGP\GKEJGPFGT.KNKGFG6TGWG=&¾EQTCVKQPFWN[UFGNCHKF¾NKV¾?+P(QTOGKPGU-TGW\GUOKVFGO 2QTVTCKV .WFYKIU :8+++ WPF )#)' & 70+10 5KNDGT GOCKNNKGTV FKG TÒEMUGKVKIGP -TGW\CTOG DNCW   GOCKNNKGTV 'OCKNNKGTWPIVGKNYGKUGIGEJKRVCOQTKIKPCNGPCNVGP$CPF$9- +++++



ex 9225

9226

9227 ex 9228



'JTGP\GKEJGPFGT.KNKGFG6TGWG=&¾EQTCVKQPFWN[UFGNCHKF¾NKV¾?+P(QTOGKPGU-TGW\GUOKVFGO 2QTVTCKV.WFYKIU:8+++WPF8+8'.'41+5KNDGTGOCKNNKGTV'OCKNNKGTWPIVGKNYGKUGIGEJKRVCPQTKIK PCNGTCNVGT$CPFUEJNKGHG&C\WGKPYGKVGTGUITÌ­GPTGFW\KGTVGU'ZGORNCTOKV'OCKNNGUEJ·FGP$9- 5VÒEM+++





'JTGP\GKEJGPFGT.KNKGFG6TGWG=&¾EQTCVKQPFWN[UFGNCHKF¾NKV¾?+P(QTOGKPGU-TGW\GUOKV\YGK .KNKGP WPF 8+8' .' 41+ 5KNDGT GOCKNNKGTV 'OCKNNKGTWPI VGKNYGKUG IGEJKRV CO UR·VGTGP $·PFEJGP   $9- ++



'JTGPNGIKQP=.¾IKQPF JQPPGWT?/QFGNN #XGTUOGFCKNNQPOKVFGO2QTVTCKV*GKPTKEJU+84GXGTU OGFCKNNQP OKV IGMTGW\VGP (CJPGP    4KVVGTFGMQTCVKQP 5KNDGT /GFCKNNQPU )QNF GOCKNNKGTV   CWH#XGTUWPF4GXGTUOGJTGTG'OCKNNGCDRNCV\WPIGP$9-<- +++



'JTGPNGIKQP=.¾IKQPF JQPPGWT?/QFGNN #XGTUOGFCKNNQPOKVFGO2QTVTCKV*GKPTKEJU+84GXGTU OGFCKNNQP OKV IGMTGW\VGP (CJPGP    ITÌ­GPTGFW\KGTVG 4KVVGTFGMQTCVKQP UQIGP *CNDOKPKC   VWT   Z  OO FWTEJ #WUVCWUEJ FGT /GFCKNNQPU VTCPUHQTOKGTVG #WUHÒJTWPI CWH $CUKU FGT   #WUHÒJTWPIFGU/QFGNNU 0CRQN¾QPHÒPHDÒIGNKIG.CWDMTQPG 5KNDGT/GFCKNNQPU)QNFGOCKNNKGTV 'OCKNNGUEJ·FGP OKV $CPFTKPI CO CNVGP $CPF &C\W /KPKCVWT FGT 4KVVGTFGMQTCVKQP FGU INGKEJGP /Q   FGNNU5KNDGT/GFCKNNQPU)QNFGOCKNNKGTVCO$·PFEJGP 5VÒEM+++







62


FRANKREICH

9229 (1:1)



'JTGPNGIKQP =.¾IKQP F JQPPGWT?  /QFGNN   OKV 2QTVTCKV -ÌPKI *GKPTKEJU +8 CWH FGO   8QTFGTUGKVGP WPF IGMTGW\VG 6TKMQNQTGP CWH FGO 4ÒEMUGKVGPOGFCKNNQP FKG &GMQTCVKQP ÒDGTJÌJV XQP   GKPGT.CWDMTQPGQJPG-TGW\ÒDGTFGO4GKEJUCRHGN $TWUVUVGTP\WO)TQ­QHHK\KGT&WTEJOGUUGTOO 5KNDGTDTKNNCPVKGTVWPFTGRGTEKGTV#WHNCIGP)QNFVGKNYGKUGDTKNNCPVKGTVWPFITCXKGTVVGKNYGKUGGOCKNNKGTV -QRH*GKPTKEJ+8PCEJTGEJVUCWHFGT4ÒEMUGKVGITCXKGTVGVGKNYGKUGWPNGUGTNKEJG*GTUVGNNGTDG\GKEJPWPI %JCWUUGAAAAA2CNCKU 4Q[CN 0Q  # 2#4+5 QJPG UKEJVDCTG 2WP\KGTWPI GVYCU XGTUEJOWV\V 0CFGN   WPF5GKVGPJCMGPHGJNGP$9-<- 44++  5GJT HGKPG #PHGTVKIWPI GKPGU WPU WPDGMCPPVGP ,WYGNKGTU CWU FGT #PHCPIU\GKVFGU$ÒTIGTMÌPKIVWOU6TQV\FGT'KP UEJT·PMWPIGP KO $GHGUVKIWPIUU[UVGO CPUQPUVGP KP JGTXQTTCIGPFGT 'TJCNVWPI WPF KP FKGUGT *GTUVGNNWPIUSWCNKV·V   UGNVGP$GK%QNNKIPQP %QNNKIPQP,GCP2KGTTG1TFTGFG%JGXCNGTKG&¾EQTCVKQPUGVO¾FCKNNGUFG(TCPEG FGUQTKIK PGU ¯ NC HKP FW 5GEQPF 'ORKTG  .C /QVJG#TEJCTF   KUV VTQV\ \CJNTGKEJGT #DDKNFWPIGP XQP 1TFGPUUVGTPGP   FKGUGU/QFGNNUMGKPKPFGT*GTUVGNNWPIUSWCNKV·VXGTINGKEJDCTGU'ZGORNCTCDIGDKNFGV2TQXGPKGP\'OOGTKEJ,QUGRJ &WE FG &CNDGTI   FGUUGP GKP\KIG 6QEJVGT /CTKG .QWKUG 2GNNKPG XGTJ .CF[ #EVQP   FGTGP   5QJP,QJP'OGTKEJ'FYCTF&CNDGTI#EVQPUV$CTQP#EVQP  FGUUGP5QJP4KEJCTF/CZKOKNKCP.[QP &CNDGTI#EVQP PF $CTQP #EVQP ņ  FGUUGP 'TDGP WPF 0CEJGTDGP #WMVKQP 1TFGTU &GEQTCVKQPU /G   FCNUCPF/KNKVCTKCDGK&KZ0QQPCP9GDDKP.QPFQPCO,WNK -CV0T \WUCOOGPOKVYGKVGTGP1T FGPUKPUKIPKGPCWUFGO$GUKV\FGT(COKNKG#EVQP5KGJGCWEJWPUGTG-CV0T.CWV FGP#MVGPFGT'JTGPNGIKQPYWTFG'OOGTKEJ,QUGRJ(TGKJGTTXCD&WEFG&CNDGTI  MCKUGTNKEJGT 5VCCVUTCV  KP FKG 'JTGPNGIKQP CWHIGPQOOGP #NU /KVINKGF FGT 4GIKGTWPI 6CNNG[TCPF XGTNKGJ -ÌPKI .WFYKI   :8+++UEJQPY·JTGPFFGT'TUVGP4GUVCWTCVKQPKO,WNKFCU)TQ­MQTFQPFGU-ÌPKINKEJGP1TFGPUFGT'JTGPNG IKQP#O,WNKYWTFGKJOFCPPFGHKPKVKXXQP.WFYKI:8+++FCU)TQ­MTGW\XGTNKGJGP&CNDGTIUGNDUVYCT PKG )TQ­QHHK\KGT FGT 'JTGPNGIKQP UQ FC­ GU OÌINKEJ GTUEJGKPV FC­ GT FKGUGP $TWUVUVGTP GTYQTDGP JCV WO KJP   \WUCOOGPOKVUGKPGPCPFGTGP$TWUVUVGTPGPUVCVVFGUÒDGTOOKO&WTEJOGUUGTCWHYGKUGPFGP)TQ­MTGW\$TWUV UVGTPUVTCIGP\WMÌPPGP

9230

<9'+6'5 (4#0<¤5+5%*'5-#+5'44'+%*   

/GFCKNNG FGT /GZKMQ'ZRGFKVKQP  =/¾FCKNNG FG N 'ZR¾FKVKQP FW /¾ZKSWG ?   #WUHÒJTWPIOKV5VGORGNUEJPGKFGTUKIPCVWT$#44'5KNDGTCO\GKVIGPÌUUKUEJGP1TKIKPCNDCPFOKVGKPIG YQDGPGPOGZKMCPKUEJGP#FNGTP<WUCOOGPOKV/KPKCVWTFGT/GFCKNNGQJPG$·PFEJGP$9- ++

 63


FRANKREICH

9231 (1:1)

&4+66' (4#0<¤5+5%*'4'27$.+-   

0CVKQPCNGT 1TFGP FGT 'JTGPNGIKQP =1TFTGPCVKQPCNFGNC.¾IKQPF JQPPGWT?/QFGNN OKV/CTK CPPG WPF <CJN  KO 8QTFGTUGKVGPOGFCKNNQP    )TQ­MTGW\  Z  OO   PQTOCNG   UQIGP 1TFQPPCP\#WUHÒJTWPI )QNF GOCKNNKGTV PCJG\W WPUKEJVDCTG 4GRCTCVWTGPWPF*CCTTKUUGKPGKPK IGP 5RKV\GP CWH FGP $CPFGPFGP FGU .QTDGGT'KEJGPNCWDMTCP\GU WPF CWH FGO $CPFTKPI 2CTKUGT )QNF   RWP\G #FNGTMQRHUGKV COUR·VGTGP5EJWNVGTDCPF ++  5GNVGP'UJCPFGNVUKEJJKGTDGKWOGKPYKTMNKEJGU)TQ­MTGW\MNGKPQFWPFPKEJVWOGKPG-QOOCPFGWTFGMQTCVKQPCP GKPGO5EJWNVGTDCPF

9232







64

ex 9233

9234

0CVKQPCNGT 1TFGP FGT 'JTGPNGIKQP =1TFTGPCVKQPCNFGNC.¾IKQPF JQPPGWT?/QFGNN OKV/CTK CPPGWPF<CJNKO8QTFGTUGKVGPOGFCKNNQP 4KVVGTFGMQTCVKQPUQIGP,WYGNKGTUCWUHÒJ TWPI5KNDGT/GFCKNNQPU)QNFGOCKNNKGTVCWHFGT4ÒEMUGKVGMNGKPGT'OCKNNGCWUDTÒEJGKO/GFCKNNQPTKPI WPF\YGK#DRNCV\WPIGPKPFGTITÒPGP'OCKNNG$9-<- +++p



0CVKQPCNGT 1TFGP FGT 'JTGPNGIKQP =1TFTG PCVKQPCN FG NC .¾IKQP F JQPPGWT? -QPXQNWV XQP FTGK   &GMQTCVKQPGP 1HHK\KGTUFGMQTCVKQPUQIGP1TFQPPCP\CWUHÒJTWPI5KNDGTXGTIQNFGV/GFCKNNQPU)QNF GOCKNNKGTVCO$CPFOKVCWHIGNGIVGT4QUGVVG 4KVVGTFGMQTCVKQPUQIGP.WZWUCWUHÒJTWPI5KNDGT/G FCKNNQPU OGJTVGKNKIG )QNFGOCKNNKGTVCO$CPF 4KVVGTFGMQTCVKQPKPNGKEJVTGFW\KGTVGT)TÌ­GUQIGP .WZWUCWUHÒJTWPI5KNDGT/GFCKNNQPU OGJTVGKNKIG )QNFGOCKNNKGTVCO$CPFCNNGFTGK'ZGORNCTGOKV 'OCKNNGUEJ·FGP 5VÒEM++++p+++



'TKPPGTWPIUOGFCKNNG HÒT %JKPC    UQIGP $QZGTMTKGI  =/¾FCKNNG %QOO¾OQTCVKXG FG   %JKPG?5KNDGTOKV5VGORGNUEJPGKFGTUKIPCVWT)'14)'5.'/#+4'KO4CPFRWP\KGTV #4)'06COQTKIKPCNGPCNVGP$CPFOKV$CPFURCPIG%*+0'$9- ++ &KG<KXKN8GTFKGPUVOGFCKNNGFGTHTCP\ÌUKUEJGP0KGFGTNCUUWPI6KGPVUKP=/¾FCKNNGFW/¾TKVGEKXKSWGFGNC %QPEGUUKQP(TCP¼CKUG¯6KGPVUKP?HKPFGP5KGWPVGT%*+0#+06'40#6+10#.'8'49#.670)810 6+'065+0-CV0T




FRANKREICH

ex 9235







ex 9237

-QPXQNWV XQP UKGDGP 1TFGP WPF 'JTGP\GKEJGP 7C 4KVVGTFGMQTCVKQP FGU 1TFGPU FGT 'JTGPNGIKQP   4KVVGTFGMQTCVKQPFGU1TFGPUHÒT8GTFKGPUVGWOFKG-WPUV(TCP\ÌUKUEJG'JTGPOGFCKNNGOKVTÒEMUGKVKIGT +PUEJTKHV/#+WPF)QNFGPG#MCFGOKUEJG2CNOGPXGTUEJKGFGPG/GVCNNGCWEJ5KNDGTVGKNUXGTIQN FGVVGKNUXGTUKNDGTVCP$·PFGTP\YGKOKVCWHIGNGIVGT4QUGVVGKPWPVGTUEJKGFNKEJGP'TJCNVWPIGP&C\W /CTQMMQ#NCQWKVG5JGTKHKGP1TFGP1HHK\KGTUFGMQTCVKQP5KNDGTXGTIQNFGVWPFGOCKNNKGTVCO$CPFOKV CWHIGNGIVGT4QUGVVG 5VÒEM++++p++



-QPXQNWVXQPFTGK'JTGP\GKEJGP /KNKV·TOGFCKNNG/QFGNN  #WUHÒJTWPIOKVDGKFUGK VKICWUIGRT·IVGT6TQRJ·G5KNDGTVGKNYGKUGXGTIQNFGVGOCKNNKGTV4ÒEMUGKVGQJPG'OCKNNGCO-QODKPCVK QPUDCPF OKV FGO FGU -TKGIUMTGW\GU    /KNKV·TOGFCKNNG  /QFGNN   #WUHÒJTWPI   OKV JQJN IGRT·IVGT 6TQRJ·G 5KNDGT VGKNYGKUG XGTIQNFGV GOCKNNKGTV 4ÒEMUGKVG OKV 'OCKNNGUEJ·FGP CO   $CPF -TKGIUMTGW\CO$CPF&C\W$TQP\GMTGW\FGT8GVGTCPUQHHQTGKIP9CTUQJPG $CPF 5VÒEM+++++



-QPXQNWV XQP  XGTUEJKGFGPGP 'JTGP\GKEJGP 7 C /CFCICUMCT/GFCKNNG  .GXCPVG/GFCKNNG   /GFCKNNGHÒTFGP/KVVNGTGP1UVGP1TKGPV/GFCKNNG/CTQMMQ/GFCKNNGWPF&CTFCPGNNGP/GFCKNNG8GT UEJKGFGPG/VCNNGCWEJ5KNDGTCPFGPMQTTGMVGP$·PFGTPUGEJUOKV$CPFURCPIGPGKPGKO'VWKKPOGKUV QTFGPVNKEJGP'TJCNVWPIGP 5VÒEM++++p+++



9239

ex 9238

&4+66' (4#0<¤5+5%*'4'27$.+-   



#WU\GKEJPWPIU0CEJNC­XQP8KEVQT$CKNN[$GUVGJGPFCWUFGT5KNDGTPGP/GFCKNNGFGU/KPKUVGTKWOUHÒT *CPFGN WPF +PFWUVTKG HÒT NCPIL·JTKIG #TDGKV 5KNDGT FCVKGTV  WPF FGT $TQP\GOGFCKNNG HÒT CWHQR   HGTPFG 6CVGP 4GVVWPIUOGFCKNNG  FGU +PPGPOKPKUVGTKWOU $TQP\G FCVKGTV  $GKFG OKV 6T·IGTPC   OGPCP$·PFGTP<WUCOOGPKPGKPGOCWHYGPFKIGP'VWKOKVFGP+PKVKCNGP8$ 5VÒEM++



/KPKCVWTGPMGVVEJGPOKVHÒPH#WU\GKEJPWPIUOKPKCVWTGP 1TFGPFGT'JTGPNGIKQP/QFGNN    1HHK\KGTUFGMQTCVKQP $·PFEJGP OKV CWHIGNGIVGT 4QUGVVG   1TFGP FGU 5VGTPU XQP $¾PKP -QO   OCPFGWTMTGW\ $·PFEJGP OKV CWHIGNGIVGT 5KNDGTNKV\G WPF 4QUGVVG   5KNDGTPG 2CNOGP FGT #MCFGOKG   #WUHÒJTWPI5KNDGTDGUGV\VOKV&KCOCPVTQUGP IGRTÒHV WPFHÒPH4WDKPTQUGP #NCQWKVG 5JGTKHKGP1TFGP  /QFGNN   1HHK\KGTUFGMQTCVKQP $·PFEJGP OKV CWHIGNGIVGT 4QUGVVG    .KDCPQP)QNFGPG.KDCPGUKUEJG8GTFKGPUVOGFCKNNGXGTIQNFGVCP-GVVEJGPOKV\YGK0CFGNP  5VÒEM++

 65


FRANKREICH

9241

9240



/KPKCVWTGPUEJPCNNGOKVUGEJU#WU\GKEJPWPIUOKPKCVWTGP 1TFGPFGT'JTGPNGIKQP/QFGNN    4KVVGTFGMQTCVKQP   /KNKV·TOGFCKNNG  /QFGNN     -TKGIUMTGW\  $·PF   EJGPOKV$TQP\GUVGTPWPF$TQP\GRCNOGP#WHNCIG 1TFGPFGU5VGTPUXQP$¾PKP4KVVGTMTGW\ )QN FGPG2CNOGPGKPGU1HHK\KGTUFGT8QNMUGT\KGJWPI#WUHÒJTWPI5KNDGTXGTIQNFGV$·PFEJGPOKV CWHIGNGIVGT4QUGVVG ªDGTUGG/GFCKNNGQJPG0CFGN 5VÒEM++



(ª0(6' (4#0<¤5+5%*'4'27$.+- 5'+6  

'JTGPOGFCKNNG HÒT VTGWG #TDGKV FGU 8GTVGKFKIWPIUOKPKUVGTKWOU  .CPF =/¾FCKNNG F JQPPGWT FW   6TCXCKN FW /KPKUV½TG FG NC &¾HGPUG  6GTTG?  /QFGNN )QNFGPG /GFCKNNG )QNF    I CWH FGT   4ÒEMUGKVG8GTNGKJWPIUITCXWT,*#4+610CO$CPFKOQTKIKPCNGP8GTNGKJWPIUGVWKFGT/ÒP\GKP 2CTKU 44+



9242 9243

9244

-1.10+#.'#75<'+%*070)'0 





66

5WNVCPCV 6CLWTCJ KP (TCP\ÌUKUEJ 5QOCNKC 'N #PPQWCT1TFGP =0KUEJCP GN #PPQWCT? H·NUEJNKEJGT   YGKUG OGKUV 0KUEJCPGN#PPQWCT1TFGP IGPCPPV  -QOOCPFGWTFGMQTCVKQP 5KNDGT DTKNNCPVKGTV WPF   TGRGTEKGTV VGKNYGKUG XGTIQNFGV VGKNYGKUG GOCKNNKGTV \YGK 'OCKNNGCWUDTÒEJG KO /GFCKNNQPTKPI -TQPGP   ÒDGTJÌJWPICDIGDTQEJGPWPFXGTNQTGPQJPG$CPF +8



5WNVCPCV#PLQWCPCWHFGP-QOQTGP-ÌPKINKEJGT DKU 1TFGPFGU5VGTPUXQP#PLQWCP=1TFTG

4Q[CN FGN 'VQKNGF #PLQWCP?/QFGNN OKV41;#.KPFGT$G\GKEJPWPIWPFJGNNDNCWGO$CPFOKV \YGKQTCPIGHCTDGPGP5GKVGPUVTGKHGP 4KVVGTFGMQTCVKQP5KNDGTXGTIQNFGVWPFVGKNYGKUGGOCKN NKGTVCOQTKIKPCNGP$CPF$9- ++



)TQ­G1TFGPUUEJPCNNGOKVFTGK-QNQPKCNQTFGP -CKUGTTGKEJ#PPCO1TFGPFGU&TCEJGPXQP#PPCO =1TFTG FW &TCIQP F #PPCO? 4KVVGTFGMQTCVKQP 5KNDGT DTKNNCPVKGTV WPF TGRGTEKGTV VGKNYGKUG GOCKNNKGTV   'OCKNNGCWUDTWEJ KO /GFCKNNQPTKPI CO $CPF HÒT <KXKNXGTFKGPUVG   6WPGUKGP 1TFGP FGU 4WJOGU   =0KUEJCP CN +HVKMJCT?  /QFGN  #WUHÒJTWPI OKV FGO /QPQITCOO /QJCOOGF 8+ CN *CDKD $G[      &GMQTCVKQP  -NCUUG 5KNDGT DTKNNCPVKGTV   /CTQMMQ #NCQWKVG 5JGTKHKGP1TFGP   =1WKUUCO#NCQWKVG5JGTKHKGP?/QFGNN OKV5EJTKHV\GKEJGPCWHFGP5VTCJNGP 4KVVGTFGMQ TCVKQP5KNDGTXGTIQNFGVWPFGOCKNNKGTV#DRNCV\WPIGPKPFGT'OCKNNG 5VÒEM++++p++++++




GRIECHENLAND

9246

9248

9245

ex 9247

+01((+<+'..'#75<'+%*070)'0 

1TFGP FGU JN )GQTI XQP $WTIWPF =1TFTG FG 5V )GQTIGU GP $QWTIQIPG? 1HHK\KGTUMTGW\ 5KNDGT   XGTIQNFGVWPFGOCKNNKGTVOKP'OCKNNGCWUDTWEJCWHFGT8QTFGTUGKVGWPF'OCKNNGTGRCTCVWTCWHFGT4ÒEM UGKVGCO$CPFOKVCWHIGNGIVGT4QUGVVG ++p



'JTGP\GKEJGP&KG*WOCPKV·TG9GNV=%TQKZF JQPPGWT.GOQPFGJWOCPKVCKTG?5KNDGTXGTIQNFGV GOCKNNKGTV JQJN IGHGTVKIV FKG /GFCKNNQPU OGJTVGKNKI #DRNCV\WPIGP KP FGT ITÒPGP 'OCKNNG QJPG $CPF   ++





+PQHHK\KGNNG 'TKPPGTWPIUFGMQTCVKQP CP -CKUGT 0CRQN¾QP YQJN +++  5KNDGT VGKNYGKUG GOCKNNKGTV CP   6TCIGURCPIG&C\WGKPUGRCTCVGT#FNGTGKPGU#D\GKEJGPU5KNDGTXGTIQNFGVOKV¤UGP 5VÒEM++





/GFCKNNGFGT8GTGKPKIWPIHÒT(TGWPFUEJCHVWPF2JKNCPVJTQRKGFGTGJGOCNKIGP5RCJKU=/¾FCKNNGFG N #UUQEKCVKQPCOKECNGGVRJKNCPVJTQRKSWGFGUCPEKGPU5RCJKU?$TQP\GXGTUKNDGTVCO$CPFOKVCWHIG NGIVGO#D\GKEJGP.'$1740175 4++





5GJTSWCNKV·VUXQNNG#PHGTVKIWPI

9249 (1:1)

)4+'%*'0.#0&

<9'+6'5 -¤0+)4'+%*   

-ÌPKINKEJGT 'TNÌUGT1TFGP =Βασιλικον Ταγμα Αριστειας τον Σοτηρος?  /QFGNN OKV $KNF FGU   'TNÌUGTU WPF -TQPG   WPF   )QNFGPGU -TGW\ 1HHK\KGTUMTGW\  #PHGTVKIWPI FGT   (KTOC.GOCKVTGKP2CTKU)QNFGOCKNNKGTV-TQPGGTI·P\V=ETQYPTGPGYGF?QJPG$CPF<- +++



$GTGKVUCO,WNKXQPFGT2TQXKUQTKUEJGP)TKGEJKUEJGP4GIKGTWPIIGUVKHVGVMCOGTGTUVPCEJUGKPGT'TPGWG TWPIFWTEJ-ÌPKI1VVQ+ CWUFGO*CWUG9KVVGNUDCEJ \WT8GTNGKJWPI0CEJUGKPGT#DFCPMWPIWPFFGT9CJN )GQTIU + 2TKP\ XQP &·PGOCTM  \WO -ÌPKI  GTPGWGTVG FKGUGT FGP 1TFGP WPF XGT·PFGTVG FKG /GFCKNNQPU FGT   +PUKIPKGP&GTHÒPHMNCUUKIGCNNIGOGKPG8GTFKGPUVQTFGPYWTFGPCEJ'TTKEJVWPIFGT4GRWDNKMCWHIGJQDGPCDGT PCEJ FGT 9KGFGTGKPHÒJTWPI FGT /QPCTEJKG  YKGFGT GTTKEJVGV  YWTFG FGT 1TFGP XQP FGT 4GRWDNKM ÒDGT   PQOOGPYQDGKFKG-TQPGFWTEJGKPGP.QTDGGTWPF'KEJGPDN·VVGTMTCP\GTUGV\VYWTFG=<WT6[RQNQIKGFGU1TFGPU XIN6C\GFCMKU2CPQU06JG1TFGTQHVJG4GFGGOGT#PCVQO[CPFRCVJQNQI[QHVJGKPUKIPKCQHVJG)TGGM1TFGT QHVJG4GFGGOGT#VJGP 6< ?

67


GROSSBRITANNIEN UND NORDIRLAND

9250

8'4'+0+)6'5-¤0+)4'+%*810)4155$4+6#00+'070& 014&+4.#0& 

&GTUGJT'FNG1TFGPXQO*QUGPDCPF=6JG/QUV0QDNG1TFGTQHVJG)CTVGT?*QUGPDCPF=)CTVGT? FKG GKIGPVNKEJG1TFGPUKPUKIPKG5GKFGKPIQNFHCTDGPGP(·FGPOKVFGO1TFGPUOQVVQ*10+51+637+ /#.;2'05'=$GUEJ·OVUGKYGTUEJNGEJVFCTÒDGTFGPMV?DGUVKEMVOKP6TCIGWPF#DPWV\WPIUURW TGP5EJPCNNG)QNF.·PIGOO$TGKVGOO$9-<- 4++p  1TKIKPCNGUWPFIGVTCIGPGU'ZGORNCTCWUFGTGTUVGP*·NHVGFGU,CJTJWPFGTVU(ÒTFKGXKGNGT\·JNVG.GIGPFGXQP FGT 5VKHVWPI FGU 1TFGPU WPF FGT 'PVUVGJWPI FGU 1TFGPUOQVVQU IKDV GU MGKPGTNGK JKUVQTKUEJG 0CEJYGKUG &KGUGT\W HQNIG JCDG %CVJGTKPG /QPVCIW %QWPVGUU QH 5CNKUDWT[   Y·JTGPF GKPGU (GUVGU CO  #RTKN  CWH   5EJNQ­ 'NVJCO DGK .QPFQP DGKO 6CP\ OKV -ÌPKI 'FWCTF +++   XQP 'PINCPF KJT 5VTWORHDCPF XGTNQTGP   YQPCEJGUFGT-ÌPKIOKVFGP9QTVGP*QPKUQKVSWKOCN[RGPUGCWHIGJQDGPJCDG9GKVGTJCDGGTIGUCIVGU\WO GJTGPXQNNUVGP5VTWORHDCPFOCEJGP\WYQNNGPFCULGIGVTCIGPYQTFGPUGK(GUVUVGJVPWTFC­'FWCTF+++XQP'PI NCPFFGP1TFGPWOIGUVKHVGVJCV+O#NNIGOGKPGPHQNIVOCPJGWVGFGP#WUHÒJTWPIGPXQP'NKCU#UJOQNGXQP  FC­ GT  IGUVKHVGV YQTFGPUGK&GT1TFGPDGUVCPF WPFDGUVGJVCWEJJGWVGPQEJ CWUFGO/QPCTEJGPCNU FGUUGP1TFGPU5QWXGT·P=5QXGTGKIP?FGO2TKP\GPXQP9CNGUWPF1TFGPUTKVVGTP=-PKIJVU%QORCPKQPU?YQDGKGU UEJQP DCNF ÒDNKEJ IGYQTFGP KUV YGKVGTG /KVINKGFGT FGT MÌPKINKEJGP (COKNKG WPF PKEJVGPINKUEJG 5QWXGT·PG WPF   2TKP\GPCNUÒDGT\·JNKIG=UWRGTPWOGTCT[?1TFGPUTKVVGTCWH\WPGJOGP5GKVFGO,CJTJWPFGTVGTHQNIVGFKG'TPGP PWPIPGWGT1TFGPUTKVVGTCWH8QTUEJNCIFGT4GIKGTWPIMCOLGFQEJ-ÌPKI)GQTI8+  OKV2TGOKGT OKPKUVGT %NGOGPV#VNGG  WPF1RRQUKVKQPUHÒJTGT9KPUVQP%JWTEJKNN  ÒDGTGKPFC­FGTRQNKVK UEJG 'KPHNW­ CWH FGP *QUGPDCPF YKG CWEJ CWH FGP &KUVGN1TFGP YKGFGT CWHIGJQDGP YGTFGP OW­VGWPFGUMÒPHVKI YKGFGT CNNGKPKIGU WPF WPMQPVTQNNKGTVGU 4GEJV FGU /QPCTEJGP UGKP UQNNVG PGWG 1TFGPUOKVINKGFGT \W GTPGPPGP 5GKV   5VKHVWPI FGU 1TFGPU DGUVGJV FCU GKIGPVNKEJG 1TFGPU\GKEJGP CWU FGO UQIGP *QUGPDCPF =)CTVGT? GKPGO DNCWGP   $CPF OKV IQNFGPGP $QTVGP FGO IGUVKEMVGP QFGT OGVCNNGPGO 1TFGPUOQVVQ WPF GKPGT IQNFGPGP 5EJPCNNG +P FKGUGT   (QTOVCWEJVGUWO9CRRGPUEJKNFGIGUEJNWPIGPCWEJJ·WHKIKPFGTGPINKUEJGP*GTCNFKMCWH'UYWTFGWPFYKTFXQP FGP1TFGPUTKVVGTPWPVGTJCNDFGUNKPMGP-PKGUXQPFGP1TFGPUFCOGPCONKPMGP1DGTCTOIGVTCIGP$TKVGPWPF#PIG JÌTKIG FGT .·PFGT KP FGPGP FGT DTKVKUEJG 5QWXGT·P GDGPHCNNU 5VCCVUQDGTJCWRV KUV GTJCNVGP DGK FGT 8GTNGKJWPI FGU   1TFGPU FGP 4KVVGTUEJNCI YQOKV UKG KP FGP RGTUÌPNKEJGP #FGNUUVCPF GTJQDGP YGTFGP WPF FCU 4GEJV GTJCNVGP FCU   2T·FKMCV5KT UGKVDGK(TCWGP.CF[ WPFJKPVGTFGO0CEJPCOGPFKG$WEJUVCDGP-)HÒT-PKIJVQHVVJG )CTVGT =4KVVGT FGU *QUGPDCPFGU? QFGT .) HÒT .CF[ QH VJG )CTVGT =&COG FGU *QUGPDCPFGU? \W HÒJTGP 8IN   CWEJ #WVGPITWDGT /KEJCGN $GUEJ·OV UGK YGT UEJNGEJV FCTÒDGT FGPMV ņ &GT GPINKUEJG *QUGPDCPFQTFGP +P   /ÒP\GP5COOGNP0T&G\GODGT5 

68


GROSSBRITANNIEN UND NORDIRLAND

9252 (1:1)

9251 (1:1)



9253 (1:1)

&GTUGJT'JTGPYGTVG$CVJ1TFGP=6JG/QUV*QPQWTCDNG1TFGTQHVJG$CVJ?/QFGNN UGKV  \KXKNG #DVGKNWPI &GMQTCVKQP FGT -QORCIPQPU %QORCPKQPQHVJG$CVJ%$ #WUHÒJTWPI 5KNDGT XGTIQNFGVCO$TWUVDCPF 5KNDGTXGTIQNFGVOKV*GTUVGNNGTRWP\G5)FGT(KTOC)CTTCTFWPF .QPFQPGT 5KNDGT WPF ,CJTGURWP\G H HÒT  CP 6TCIGTCJG OKV $CPF WPF 6TCIGUEJPCNNG CP 0CFGN   $9-<- ++



-ÌPKI)GQTI+ CWUFGO*CWUG*CPPQXGT TKGHFGPCNU'TPGWGTWPIGKPGU·NVGTGP$CVJ1TFGPUFGTUEJQPXQP -ÌPKI *GKPTKEJ +8 IGUVKHVGV YQTFGP YCT OKV 2CVGPV XQO  /CK  CNU PGWGP 1TFGP YKGFGTKPU.GDGP YWTFGFGTWTURTÒPINKEJGKPMNCUUKIG1TFGPFWTEJ2TKP\4GIGPV)GQTIFGOUR·VGTGP-ÌPKI)GQTI+8KPGKPG\KXKNG WPF KP GKPG OKNKV·TKUEJG #DVGKNWPI OKV WPVGTUEJKGFNKEJGP +PUKIPKGP OKV LGYGKNU FTGK -NCUUGP )TQ­MTGW\4KVVGT   -QOOCPFGWT4KVVGT WPF )GHQNIUOCPP  WPVGTVGKNV &KG $GNGKJWPI OKV FGP DGKFGP JÌEJUVGP -NCUUGP HÒJTV HÒT $TKVGP  

WPFHTÒJGTCWEJHÒT-CPCFKGT#WUVTCNKGT0GWUGGN·PFGTGVE FKG#WHPCJOGKPFKG4KVVGTUEJCHVOKVUKEJOKVFGO 4GEJVFKG#PTGFG5KTQFGT&COG\WHÒJTGP&KG\KXKNG#DVGKNWPIYKTFHÒTJGTXQTTCIGPFG\KXKNG8GTFKGPUVGXQTYKG IGPF KO $GTGKEJ FGT &KRNQOCVKG XGTNKGJGP FKG OKNKV·TKUEJG HÒT JGTXQTTCIGPFG OKNKV·TKUEJG 8GTFKGPUVG (TCWGP   YGTFGP UGKV  KP FGP 1TFGP CWHIGPQOOGP #WUN·PFKUEJG 5VCCVQDGTJ·WRVGT GTJCNVGP UQHGTP GU UKEJ PKEJV WO   DGHTGWPFGVG/QPCTEJGPJCPFGNVFCU)TQ­MTGW\FGT\KXKNGP#DVGKNWPIXGTNKGJGP 5KGJGCWEJ4KUM,COGU%6JG *KUVQT[ QH 6JG 1TFGT QH VJG $CVJ CPF KUV KPUKIPKC .QPFQP  7PF )CNNQYC[ 2GVGT 6JG 1TFGT QH VJG $CVJ   %JKEJGUVGT 





&GTUGJT'JTGPYGTVG$CVJ1TFGP=6JG/QUV*QPQWTCDNG1TFGTQHVJG$CVJ?/QFGNN UGKV  \KXKNG #DVGKNWPI &GMQTCVKQP FGT -QORCIPQPU %QORCPKQPQHVJG$CVJ%$ #WUHÒJTWPI 5KNDGT XGTIQNFGVCO*CNUDCPFUGKV 5KNDGTXGTIQNFGVOKV*GTUVGNNGTRWP\G5)FGT(KTOC)CTTCTFWPF .QPFQPGT5KNDGTWPF,CJTGURWP\G+HÒTQJPG*CNUDCPF$9-<- ++



&GTUGJT'JTGPYGTVG$CVJ1TFGP=6JG/QUV*QPQWTCDNG1TFGTQHVJG$CVJ?/QFGNN UGKV  OKNKV·TKUEJG#DVGKNWPI-TGW\FGT-QORCIPQPU=%QORCPKQPQHVJG$CVJ%$?#WUHÒJTWPI 5KNDGT XGTIQNFGVCO*CNUDCPFUGKV 5KNDGTXGTIQNFGVVGKNYGKUG\KUGNKGTVGOCKNNKGTVCOUR·VGTGP*CNU DCPFCDUEJPKVV$9-<- ++



'UJCPFGNVUKEJJKGTDGKWTURTÒPINKEJWOGKPG#WUHÒJTWPI 5KNDGTXGTIQNFGVCO$TWUVDCPF OKVXGTVK MCNCPIGDTCEJVGT¤UGFGTGPWTURTÒPINKEJG6TCIGYGKUGKP(QNIGFGTPGWGP6TCIGXQTUEJTKHVXQPFWTEJ'PVHGT PWPIFGT$CPFTCJGWPF#PDTKPIWPIFGUMCPPGNKGTVGP$CPFTKPIGUQHHK\KGNNIG·PFGTVYQTFGPKUV

69


GROSSBRITANNIEN UND NORDIRLAND

9254



70

&GTUGJT#WUIG\GKEJPGVG1TFGPXQOJN/KEJCGNWPFXQOJN)GQTI=6JG/QUV&KUVKPIWKUJGF1T FGTQH5CKPV/KEJCGNCPF5CKPV)GQTIG?1TFGPUMQNNCPGDGUVGJGPFCEJV-TGW\CEJV/QPQITCOOWPF \GJP .ÌYGP)NKGFGTP 5KNDGT XGTIQNFGV VGKNYGKUG GOCKNNKGTV  I OKV 6TCIGTKPI QJPG -NGKPQF   $9-<- ++ 


GROSSBRITANNIEN UND NORDIRLAND

9255 (1:1)



&GT 5GJT $GFGWVGPFG 1TFGP FGU $TKVKUEJGP 'ORKTGU =6JG /QUV 'ZEGNNGPV 1TFGT QH VJG $TKVKUJ   'ORKTG?/QFGNN OKV2QTVTCKVUXQP-ÌPKI)GQTI8WPF3WGGP/CT[UGKV <KXKNG#DVGKNWPI 5GV FGT -QOOCPFGWT4KVVGT -PKIJV %QOOCPFGT  -$'  DGUVGJGPF CWU -QOOCPFGWTMTGW\ 5KNDGT   XGTIQNFGVWPFGOCKNNKGTVOKVWPIGVTCIGPGONCPIGO*CNUDCPFUQYKGNGKEJVIGVTCIGPGOUEJOCNGP*CNU DCPF WPF $TWUVUVGTP 5KNDGT DTKNNCPVKGTV WPF TGRGTEKGTV VGKNYGKUG XGTIQNFGV WPF GOCKNNKGTV CP 5KNDGT   XGTIQNFGVGT 0CFGN DGKFG 5VÒEMG QJPG LGINKEJG 2WP\KGTWPI KO QTKIKPCNGP 8GTNGKJWPIUGVWK FGU -TQP   LWYGNKGTU)CTTCTF%QKP.QPFQP$9-<- 5VÒEM+p++  5GJTUEJÌPG#PHGTVKIWPIUSWCNKV·VCWUFGT\YGKVGP*·NHVGFGU,CJTJWPFGTVUKPJGTXQTTCIGPFGO'TJCNVWPIU\WUVCPF

9256 (1:1)



/GFCKNNGHÒTI[RVGP='I[RV/GFCN?/GFCKNNGKP5KNDGT&WTEJOGUUGTOOI CPCNVGT¤UGLGFQEJOKV$CPFTKPIWPFKPMQTTGMVGOUR·VGTGP$CPF &KG/GFCKNNGYWTFGCPGKPGTUCPFHCT DGPGP5EJPWTWOFGP*CNUIGVTCIGP $//; 4+p++  5GNVGP WPF KP JGTXQTTCIGPFGT 'TJCNVWPI  &KG /GFCKNNG YWTFG XQP FGT 1UVKPFKGP)GUGNNUEJCHV =*QPQWTCDNG 'CUV   +PFKCP%QORCP[?KP)QNFWPF5KNDGTCWUIGIGDGPWPFXQODTKVKUEJGP)GPGTCNIQWXGTPGWTKP+PFKGPCO,WNK KP(QTV9KNNKCOCWVQTKUKGTV8QPFGT5KNDGTOGFCKNNGYWTFGP'ZGORNCTGIGRT·IVYQXQPCPFKG$GPICNKUEJG #TOGG WPF  CP FKG #TOGG XQP $QODC[ XGTNKGJGP YWTFGP FKG WPVGT )GPGTCNOCLQT 5KT &CXKF $CKTF CP FGT   DTKVKUEJGP'TQDGTWPII[RVGPUWPVGT5KT4CNRJ#DGTEQODIGIGP0CRQN¾QP$QPCRCTVGVGKNIGPQOOGPJCVVGP

71


GROSSBRITANNIEN UND NORDIRLAND

9258 Rv. 9259 (1:1)

9257



9260

+PQHHK\KGNNGU 'TKPPGTWPIUOGFCKNNQP CWH FKG 5GGUEJNCEJV XQP -QRGPJCIGP CO  #RTKN   Z   OOJQJNIGCTDGKVGVXGTIQNFGVCWHCNVGO2CRKGTUVÃ&#x2019;EMDGHGUVKIV 4++



5GJTHGKPIGCTDGKVGVGU'ZGORNCT#O#RTKNDGUKGIVGFKGDTKVKUEJG(NQVVGWPVGT#FOKTCN*QTCVKQ0GNUQPFGO UR·VGTGP5KGIGTFGT5EJNCEJVXQP6TCHCNICTXQT-QRGPJCIGPFKGF·PKUEJG(NQVVGWPFXGTPKEJVGVGUKGYGKVIGJGPF



+PFKUEJG #NNIGOGKPG 'KPUCV\/GFCKNNG =+PFKC )GPGTCN 5GTXKEG /GFCN?  5KNDGT OKV 5VGORGN   UEJPGKFGTUKIPCVWT.%9;10(OWVOC­NKEJOKVUR·VGTGTI·P\VGO4CPFPCOGP=RQUUKDN[TGPCOGF? 0u26',..1;&%%1/+UV&%.+OKV$CPFURCPIG$74/#COCNVGP$CPF /;Z ++





#HIJCPKUVCP/GFCKNNG =#HIJCPKUVCP /GFCN?  5KNDGT OKV ITCXKGTVGO 4CPFPCOGP  2VG 6   *'0&'4510UV4')VCO$CPFOKVNQUGT$CPFURCPIG#.+/75,+&/; ++ 



#HIJCPKUVCP/GFCKNNG=#HIJCPKUVCP/GFCN?5KNDGTOKVITCXKGTVGO4CPFPCOGP$26' 2%1001456*4')6COHCNUEJGP$CPF/; ++

9261



9262



9263

&KGPUVCWU\GKEJPWPIU/GFCKNNG FGT 'JTYÃ&#x2019;TFKIGP )GUGNNUEJCHV FGU /GUUGTUEJOKGFG XQP .QPFQP   5KNDGTPG /GFCKNNG &WTEJOGUUGT  OO   5KNDGT CWH FGT 4Ã&#x2019;EMUGKVG 6T·IGTITCXWT &QGNN 6JQTPG   .+8'4;VJ/CTEJCOQTKIKPCNGP$CPFOKV6TCIGURCPIG 4++





&KGPUVCWU\GKEJPWPIU/GFCKNNG FGT 'JTYÃ&#x2019;TFKIGP )GUGNNUEJCHV FGU /GUUGTUEJOKGFG XQP .QPFQP   5KNDGTPG/GFCKNNG&WTEJOGUUGTOO  5KNDGTCWHFGT4Ã&#x2019;EMUGKVG6T·IGTITCXWT)GQTIG%NKHHQTF 2QEQEM.+8'4;UV/C[COQTKIKPCNGP$CPFOKV6TCIGURCPIGKOQTKIKPCNGP8GTNGKJWPIUGVWK FGT(KTOC($6JQOCU%QOR[KP.QPFQP 4++





8GTFKGPUVMTGW\FGT)GUGNNUEJCHVHÃ&#x2019;T'PVJCNVUCOMGKVFGT+PFKUEJGP#TOGG=+PFKC#TO[6GORGTCPEG #UUQEKCVKQP? )QNFGPGU 8GTFKGPUVMTGW\ 5KNDGT XGTIQNFGV CWH FGT 4Ã&#x2019;EMUGKVG OGJTHCEJ RWP\KGTV W C   *GTUVGNNGTRWP\G )-5 FGT (KTOC -GPPKPI KP .QPFQP WPF .QPFQPGT ,CJTGURWP\G P HÃ&#x2019;T  CO   $CPFOKV6TCIGURCPIG5KNDGTOKV0CFGNKOQTKIKPCNGP'VWKFGT(KTOC-GPPKPI ++



72


GROSSBRITANNIEN UND NORDIRLAND

ex 9266

ex 9265

9264



-TGW\FGT)GUGNNUEJCHVHÒT'PVJCNVUCOMGKVFGT+PFKUEJGP#TOGG=+PFKC#TO[6GORGTCPEG#UUQEKC VKQP?HÒTHÒPH,CJTG6TGWG5KNDGTVGKNYGKUGGOCKNNKGTVQJPG$CPF ++





/KPKCVWTGPUEJPCNNG GKPGU 2QNK\KUVGP WPF 8GVGTCPGP FGU <YGKVGP 9GNVMTKGIGU OKV  /KPKCVWTGP   $GUVGJGPFCWU 1TFGPFGU$TKVKUEJGP'ORKTGU/QFGNN UGKV -TGW\FGT/KVINKGFGT   5VGTP   (TCPMTGKEJ WPF &GWVUEJNCPF5VGTP   8GTVGKFKIWPIUOGFCKNNG    -TKGIUOG   FCKNNG    -TÌPWPIUOGFCKNNG    &KGPUVCWU\GKEJPWPIU/GFCKNNG FGT 2QNK\GK /QFGNN   'NKUCDGVJ ++ #P 0CFGN &C\W &TGKGT/KPKCVWTGPUEJPCNNG   /KNKV·TMTGW\ #WUICDG )GQTI 8    -TKGIUOGFCKNNG +PVGTCNNKKGTVG5KGIGUOGFCKNNGOKV.QTDGGTURCPIG#P0CFGN7PF &TGKG/KPKCVWTGPUEJPCNNG    5VGTP   -TKGIUOGFCKNNG    +PVGTCNNKKGTVG 5KGIGUOG   FCKNNG#P0CFGN 5VÒEM++



-QPXQNWV XQP  /KPKCVWTGP DTKVKUEJGT 1TFGP WPF 'JTGP\GKEJGP 7 C /KVINKGF FGU 8KMVQTKC1T   FGPU/KVINKGFFGU1TFGPUFGU$TKVKUEJGP'ORKTGU/KNKV·TMTGW\ OKVXGTUEJKGFGPGP/QPQITCOOGP  7PVGTUEJKGFNKEJG /GVCNNG CWEJ 5KNDGT \YGK VGKNYGKUG GOCKNNKGTV LGYGKNU CP $·PFEJGP XKGT OKV   $CPFURCPIGP\YGKOKV6TCIGURCPIGP 5VÒEM++





9268 9267



7PDGMCPPVGU #D\GKEJGP CWH -ÌPKIKP 8KEVQTKC )GHGTVKIV CWU GKPGT  %TQYP/ÒP\G 8KEVQTKC    WOIGDGPXQPGKPGO.QTDGGTMTCP\WPFÒDGTJÌJVXQPFGT5V'FWCTFU-TQPG5KNDGTVGKNYGKUGIGIQUUGP CWH FGT 4ÒEMUGKVG PWT VGKNYGKUG NGUDCTG *GTUVGNNGTRWP\G WPF GPINKUEJG .ÌYGPRWP\G CO CNVGPIGP·JVGP 5EJWNVGTDCPFFGUTWO·PKUEJGP-TQPGPQTFGPU/QFGNN ++



-WTKQUGU'ZGORNCTFCUGPVYGFGTKO<WUCOOGPJCPIOKVKJTGO&KCOCPVGPGP4GIKGTWPIULWDKN·WOKJTGO6QF KO,CJTGQFGTKJTGO)GDWTVUVCIKO,CJTGGPVUVCPFGPUGKPFÒTHVG

(4'+/#74'4 

/KVINKGFU$KLQWFGT<CODGUKC.QIG5ÒF4JQFGUKGP0T0%KP$WNCYC[Q5KNDGTXGTIQNFGVWPF GOCKNNKGTVHGKPUVG'OCKNNGOCNGTGKCWHFGT4ÒEMUGKVGOGJTHCEJRWP\KGTVWC.QPFQPGT,CJTGURWP\G5 HÒTWPF*GTUVGNNGTDG\GKEJPWPIFGT(KTOC6Q[G%QKP.QPFQPCO$CPFOKV6TCIGURCPIG5KNDGT XGTIQNFGVWPFGOCKNNKGTVCP0CFGNKO1TKIKPCNGVWKFGT(KTOC6Q[G%Q 4++

 73


ISLAND

9269

9270





$KLQWFGT<CODGUKC.QIG5Ã&#x2019;F4JQFGUKGP0T0%)QNFEVVGKNYGKUGGOCKNNKGTVHGKPUVG'OCKN NGOCNGTGKCWHFGT4Ã&#x2019;EMUGKVG&GFKMCVKQPUITCXWT24'5'06'&618914$41#$'4056'+0#5# 61-'01('56''/WPFOGJTHCEJRWP\KGTVWC)QNFRWP\GWPFHÃ&#x2019;TEVCO$CPF OKV6TCIGURCPIG)QNFEVCP0CFGNKO1TKIKPCNGVWKFGT(KTOC.GYKU,CUQPKP$WNCYC[Q 44++



(TÃ&#x2019;JGT $TWUVUVGTP FGU HTGKOCWTGTKUEJGP 6GORNGT1TFGPU KPPGTJCND FGT )TQ­NQIG XQP 'PINCPF   &WTEJOGUUGT  OO 5KNDGT CWH FGT 4Ã&#x2019;EMUGKVG*GTUVGNNGTDG\GKEJPWPIFGT(KTOC5RGPEGTKP.QPFQP WPF5KNDGTWPF,CJTGURWP\GJXQP$KTOKPIJCOHÃ&#x2019;TCP0CFGNFKGUGTGRCTKGTV +++



9273

9271

9274 Rv.

9272

+5.#0& 4'27$.+- 5'+6  

+UN·PFKUEJGT(CNMGPQTFGP=+UNGP\MC(±NMCQTFC?/QFGNN UGKV -TGW\FGT)TQ­TKVVGT -QOOCP FGWT 5KNDGTXGTIQNFGVWPFGOCKNNKGTVCO*CNUDCPF<- ++





+UN·PFKUEJGT (CNMGPQTFGP =+UNGP\MC (±NMCQTFC?  /QFGNN UGKV   -TGW\ FGT )TQ­TKVVGT  

-QOOCPFGWT  5KNDGT XGTIQNFGV WPF GOCKNNKGTV 'OCKNNGTGRCTCVWTGP KO #XGTUOGFCKNNQP CO *CNUDCPF   <- ++p+++





'JTGPOGFCKNNGFGUKUN·PFKUEJGP2T·UKFGPVGP=*GKFWTURGPKPIWTHQTUGVC+UNCPFU?5KNDGTCO$CPF  4++





'JTGPOGFCKNNGFGUKUN·PFKUEJGP2T·UKFGPVGP=*GKFWTURGPKPIWTHQTUGVC+UNCPFU?5KNDGTCO$CPF  4++



74


ITALIEN

9276

ex 9277 9275

-¤0+)4'+%*   

+6#.+'0

1TFGP FGT JGKNKIGP /CWTKVKWU WPF .C\CTWU =1TFKPG FGK 5CPVK /CWTK\KQ G .C\CTQ? 1HHK\KGTUMTGW\   /QFGNN OKV-TQPGUGKV 5KNDGTXGTIQNFGVWPFGOCKNNKGTVGKPG-WIGNGVYCUDGUEJ·FKIVCO$CPF KOQTKIKPCNGP8GTNGKJWPIUGVWKFGT(KTOC.4CXKQNQ')CTFKPQUWEEGUUQTK&EQ%TCXCP\QNCKP4QOOKV IQNFHCTDGPGO/QPQITCOO-ÌPKI8KMVQT'OCPWGNU+++<- ++



&KG*GTUVGNNWPIU\GKVFKGUGU-TGW\GUN·­VUKEJCWHFGP<GKVTCWO\YKUEJGPWPFDGITGP\GP



1TFGPFGTJGKNKIGP/CWTKVKWUWPF.C\CTWU=1TFKPGFGK5CPVK/CWTK\KQG.C\CTQ?4KVVGTMTGW\)QNF GOCKNNKGTVFKG-WIGNPKPVCMVCO$CPFOKVHTCP\ÌUKUEJGT6TCIGTCJGKOQTKIKPCNGPITÒPUCOVGPGP8GTNGK JWPIUGVWKFGT(KTOC&EQ%TCXCP\QNCKP4QOOKVIQNFHCTDGPGO/QPQITCOO-ÌPKI8KMVQT'OCPWGNU+++ <- +p++





/KNKV·TKUEJG 6CRHGTMGKVUOGFCKNNG =/GFCINKC #N 8CNQTG /KNKVCTG? $TQP\GOGFCKNNG QHHK\KGNNG #WUICDG   FGTMÌPKINKEJGP/ÒP\GOKVIGMTÌPVGO<WPF5VGORGNUEJPGKFGT\GKEJGP()QJPGTÒEMUGKVKIG)TCXWT COMWT\GP1TKIKPCNDCPF&C\W-TKGIUXGTFKGPUVMTGW\CO$CPF.KD[GP/GFCKNNG5KNDGTCO$CPFOKV $CPFURCPIG  -TKGIUGTKPPGTWPIU/GFCKNNG  CO $CPF OKV $CPFURCPIGP     WPFFC\WFKG/KPKCVWTCO$·PFEJGPQJPG$CPFURCPIGP 5VÒEM++



ex 9279 (1:1) ex 9278

9280



8GTFKGPUVOGFCKNNG FGT 5VCFV 4QO  /QFGNN 5KNDGTPG WPF $TQP\GPG 8GTFKGPUVOGFCKNNG 5KNDGT WPF   $TQP\GCP$·PFGTP&C\WFKG'TKPPGTWPIUOGFCKNNGFGT5VCFV4QOCPFGP5KGIKO9GNVMTKGIHÒTFKG 5QNFCVGPFGT5VCFVCO$CPF 5VÒEM++





-QPXQNWV XQP UKGDGP 'JTGP\GKEJGP &CTWPVGT 'TKPPGTWPIUMTGW\ FGT   $TQP\G 8GTFKGPUVOG   FCKNNGHÒTNCPIL·JTKIG-QOOCPFQ+PJCDGT-TKGIUHTGKYKNNKIGP/GFCKNNG6CRHGTMGKVU/GFCKNNG KP $TQP\G 8GTUKNDGTV <YGKVCPHGTVKIWPI  #NDCPKUEJGU -TKGIUGTKPPGTWPIU#D\GKEJGP HÒT FKG TÌOKUEJGP   5QNFCVGP FGT )TKGEJGPNCPF WPF 4W­NCPFHTQPV 8GTUEJKGFGPG /GVCNNG VGKNU XGTUKNDGTV VGKNU GOCKNNKGTV   FTGK CP $·PFGTP \YGK CP 0CFGN KP WPVGTUEJKGFNKEJGP 'TJCNVWPIGP &C\W .GGTGU 'VWK HÒT FCU 4KVVGT   QFGT1HHK\KGTUMTGW\FGU1TFGPUFGT-TQPGXQP+VCNKGP 5VÒEM+++++



+6#.+'0+5%*'4'27$.+- 5'+6  

8GTFKGPUVQTFGP FGT #MCFGOKG XQP 0GCRGN $TWUVUVGTP 5KNDGT DTKNNCPVKGTV /GFCKNNQP GOCKNNKGTV OKP   MCWOUKEJVDCTG'OCKNNGTGRCTCVWTGPKO/GFCKNNQPTKPICP0CFGNOKV\YGK5GKVGPJCMGP 44++

 75


LETTLAND

9281 9282

'456' 4'27$.+-  

9283

.'66.#0&



#D\GKEJGP FGU  #K\RWVG +PHCPVGTKG4GIKOGPVU 5KNDGT #WHNCIGP 5KNDGT VGKNYGKUG XGTIQNFGV WPF   GOCKNNKGTVCP5EJTCWDGOKV5EJTCWDUEJGKDGFKGUGOGJTHCEJRWP\KGTV ++





1TFGP FGT &TGK 5VGTPG =6TKLW <XCKIÄ»PW QTFGPKU?  /QFGNN   -TGW\  -NCUUG 5KNDGT   XGTIQNFGVWPFGOCKNNKGTVFKGFTGK5VGTPG)QNFCWHFGO4GXGTUFGT#WHJ·PIWPIOGJTHCEJRWP\KGTV WC *GTUVGNNGTRWP\G(/HÃ&#x2019;TFKG(KTOC9(/Ã&#x2019;NNGTKP4KICWPFGT5KNDGTRWP\G KO$CPFTKPIYGKVGTG 2WP\GCOQTKIKPCNGP*CNUDCPFKOQTKIKPCNGPIQNFGPDGFTWEMVGP8GTNGKJWPIUGVWK<- ++



1TFGP FGT &TGK 5VGTPG =6TKLW <XCKIÄ»PW QTFGPKU?  /QFGNN   -TGW\  -NCUUG 5KNDGT   XGTIQNFGVWPFGOCKNNKGTVFKGFTGK5VGTPG)QNFCWHFGO4GXGTUFGT#WHJ·PIWPIOGJTHCEJRWP\KGTV WC *GTUVGNNGTRWP\G(/HÃ&#x2019;TFKG(KTOC9(/Ã&#x2019;NNGTKP4KICWPFGT5KNDGTRWP\G KO$CPFTKPIYGKVGTG 2WP\GCOQTKIKPCNGP'KPJ·PIGJCNUDCPF<- ++





9285

9286

9284



1TFGP FGT &TGK 5VGTPG =6TKLW <XCKIÄ»PW QTFGPKU?  /QFGNN   -TGW\  -NCUUG 5KNDGT   XGTIQNFGVWPFGOCKNNKGTVFKGFTGK5VGTPG)QNFCWHFGO#XGTUFGT#WHJ·PIWPIOGJTHCEJRWP\KGTV WC *GTUVGNNGTRWP\G(/HÃ&#x2019;TFKG(KTOC9(/Ã&#x2019;NNGTKP4KICWPFGT5KNDGTRWP\G KO$CPFTKPIYGKVGTG 2WP\GCOQTKIKPCNGPDGUEJ·FKIVGPWPFMWT\GP*CNUDCPFCDUEJPKVV<- ++



'ZGORNCTFGT#WMVKQP(TKV\4WFQNH-Ã&#x2019;PMGT1UPCDTÃ&#x2019;EM0T





76

1TFGP FGT &TGK 5VGTPG =6TKLW <XCKIÄ»PW QTFGPKU?  /QFGNN   -TGW\  -NCUUG 5KNDGT   XGTIQNFGVWPFGOCKNNKGTVFKGFTGK5VGTPG)QNFCWHFGO#XGTUFGT#WHJ·PIWPIOGJTHCEJRWP\KGTV WC *GTUVGNNGTRWP\G(/HÃ&#x2019;TFKG(KTOC9(/Ã&#x2019;NNGTKP4KICWPFGT5KNDGTRWP\G COQTKIKPCNGP$CPF \WUCOOGPOKV-PQRHNQEJUEJNGKHGKOQTKIKPCNGPIQNFGPDGFTWEMVGP8GTNGKJWPIUGVWK<- ++



1TFGP FGT &TGK 5VGTPG =6TKLW <XCKIÄ»PW QTFGPKU?  /QFGNN   -TGW\  -NCUUG 5KNDGT   XGTIQNFGVWPFGOCKNNKGTVFKGFTGK5VGTPG)QNFCWHFGO#XGTUFGT#WHJ·PIWPIOGJTHCEJRWP\KGTV WC *GTUVGNNGTRWP\G(/HÃ&#x2019;TFKG(KTOC9(/Ã&#x2019;NNGTKP4KICWPFGT5KNDGTRWP\G COQTKIKPCNGP$CPF KOQTKIKPCNGPIQNFGPDGFTWEMVGP8GTNGKJWPIUGVWK<- ++




LUXEMBURG

ex 9288

ex 9287



1TFGP FGT &TGK 5VGTPG =6TKLW<XCKIÄ»PWQTFGPKU?/QFGNN  )QNFGPG/GFCKNNGFGU1T FGPU5KNDGTXGTIQNFGVCO&TGKGEMUDCPFOKV0CFGN&C\WFKG5KNDGTPG/GFCKNNGFGU1TFGPU5KNDGTCO &TGKGEMUDCPFOKV0CFGN<- 5VÃ&#x2019;EM++



&KG)QNFGPG/GFCKNNGFGU1TFGPUKUVPKEJVJ·WHKI\WHKPFGP



'JTGP\GKEJGP(Ã&#x2019;TJGTXQTTCIGPFG8GTFKGPUVGKPFGT(GWGTYGJT'JTGP\GKEJGP-NCUUG#WUICDG

QJPG6TCIGURCPIG 5KNDGTXGTIQNFGVWPFGOCKNNKGTVCWHFGT4Ã&#x2019;EMUGKVG8GTNGKJWPIUITCXWT2#4+%+.75 012'.0+'/7)705&<'5+$# QJPG $CPF &C\W FCU 'JTGP\GKEJGP  -NCUUG $TQP\G CWH FGT   4Ã&#x2019;EMUGKVG8GTNGKJWPIUITCXWT2#4012'.0+'/7)705&<'5+$#QJPG$CPF 5VÃ&#x2019;EM++



$GUQPFGTUFCU'JTGP\GKEJGP-NCUUGKUVPWTUGJTUGNVGP\WHKPFGP

9289

.+'%*6'056'+0 

(Ã&#x2019;TUVNKEJNKGEJVGPUVGKPKUEJGT8GTFKGPUVQTFGP#WUHÃ&#x2019;JTWPI COTQVGP$CPFOKVDNCWGP5GKVGPUVTGKHGP UGKV 4KVVGTMTGW\HÃ&#x2019;T*GTTGPXGTIQNFGVWPFGOCKNNKGTVCO&TGKGEMUDCPF<- +p++



+PUGKPGPWPVGTGP-NCUUGPKUVFGT1TFGPPQEJYGUGPVNKEJUGNVGPGT\WHKPFGPCNUKPUGKPGPQDGTGP

9290

)4155*'4<1)67/.7:'/$74) 

1TFGP FGT 'KEJGPMTQPG =1TFTG FG NC %QWTQPPG FG %J¿PG? /KPKCVWT FGU 1HHK\KGTUMTGW\GU )QNF   GOCKNNKGTV'OCKNNGEJKRUCWHDGKFGP5GKVGPFGUQDGTGP-TGW\CTOGUQJPG$·PFEJGP ++

 77


MONACO

9291 (1:1)

(ª456'067//10#%1 

78

1TFGPFGUJN-CTN=1TFTGFG5V%JCTNGU?#WUHÒJTWPI OKVFTGK5VGTPGPKO/GFCKNNQPTKPIUGKV   )TQ­MTGW\UGV DGUVGJGPF CWU -NGKPQF )QNF VGKNYGKUG \KUGNKGTV WPF ITCXKGTV GOCKNNKGTV MCWO   UKEJVDCTG 'OCKNNGTGRCTCVWTGP KP FGP /GFCKNNQPTKPIGP CO QTKIKPCNGP GKPMPÌRHDCTGP *CND5EJWNVGTDCPF   WPF$TWUVUVGTP5KNDGTDTKNNCPVKGTVWPFTGRGTEKGTV#WHNCIGP)QNFVGKNYGKUGITCXKGTVWPFGOCKNNKGTVOKP 6GKNFGU/QPQITCOOUHGJNVCWHFGO4GXGTU*GTUVGNNGTDG\GKEJPWPIFGT(KTOC*CNNG[KP2CTKUCP0C FGNOKV\YGK5GKVGPJCMGP<- 5VÒEM++ 


NIEDERLANDE

9292 (1:1)

-¤0+)4'+%*&'40+'&'4.#0&' 

1TCPKGP0CUUCW1TFGP =1TFG XCP 1TCPLG0CUUCW? 1HHK\KGTUMTGW\ )QNF GOCKNNKGTV MCWO UKEJVDCTG   'OCKNNGTGRCTCVWTGP KO XQTFGTUGKVKIGP/GFCKNNQPTKPICOQTKIKPCNGPCNVGP$CPFOKVCWHIGNGIVGT4QUGVVG <- ++



9293 9294



1TCPKGP0CUUCW1TFGP =1TFG XCP 1TCPLG0CUUCW? 4KVVGTMTGW\ OKV 5EJYGTVGTP )QNF GOCKNNKGTV   5KNDGT CO $CPF OKV (GNFUEJPCNNG WPF 8GTNGKJWPIUFGMTGV HÃ&#x2019;T FGP COGTKMCPKUEJGP /CLQT * 6WTPG[   *KEJFCVKGTV/·T\OKV2T·IGUKGIGNWPF1TKIKPCNWPVGTUEJTKHVFGU-CP\NGTUFGT0KGFGTN·PFKUEJGP 1TFGP)GPGTCNOCLQTFGT4GUGTXG*-QQHIGHCNVGV\WUCOOGPKO$KNFGTTCJOGP<- ++



'ZGORNCTFGT#WMVKQP(TKV\4WFQNH-Ã&#x2019;PMGT1UPCDTÃ&#x2019;EM0T



-TGW\HÃ&#x2019;TYKEJVKIG-TKGIU'KPU·V\G=-TWKUXQQTDGNCPITKLMGMTKLIUXGTTKEJVKPIGP?-WRHGT0KEMGNCO $CPF OKV FTGK $CPFURCPIGP #6,'*  #6,'*  WPF #6,'*  CP   0CFGN ++

 79


NORWEGEN

9296 (1:1)

9295 (1:1)

0149')'0 -¤0+)4'+%*2'4510#.70+10/+65%*9'&'0 $+5  

-ÌPKINKEJ 0QTYGIKUEJGT 5CPMV 1NCXU1TFGP =-QPIGNKIG 0QTUM 5V 1NCXUQTFGP?  /QFGNN     /KPKCVWTFGU4KVVGTMTGW\GU-NCUUG)QNFGOCKNNKGTVQJPG$·PFEJGP +p++





-ÌPKINKEJ 0QTYGIKUEJGT 5CPMV 1NCXU1TFGP =-QPIGNKIG 0QTUM 5V 1NCXUQTFGP?  /QFGNN     /KPKCVWTFGU4KVVGTMTGW\GU-NCUUG)QNFGOCKNNKGTVCO$·PFEJGP ++



9297 (1:1)

5'.$560&+)'5 -¤0+)4'+%* 5'+6  

-ÌPKINKEJ 0QTYGIKUEJGT 5CPMV 1NCXU1TFGP =-QPIGNKIG 0QTUM 5V 1NCXUQTFGP?  /QFGNN    OKVGKPGO.ÌYGPÒDGTFGT-TQPG -QOOCPFGWTMTGW\)QNFGOCKNNKGTVIFKG8QTFGTUGKVG FGUNKPMGP-TGW\CTOUPCEJGOCKNNKGTV=CXGTUGQHNGHVETQUUCTOTGGPCOGNGF?CWHFGT4ÒEMUGKVGFGU$CP FTKPIGU *GTUVGNNGTDG\GKEJPWPI FGT (KTOC 6QUVTWR KP -TKUVKCPKC WPF GT )QNFRWP\G CO CNVGP *CNU   DCPFCDUEJPKVV<- ++p  #WHITWPF FGT CNVGP 1TVUDG\GKEJPWPI -TKUVKCPKC HÒT 1UNQ \YKUEJGP  WPF  CPIGHGTVKIV &GT \WP·EJUV FTGK   MNCUUKIG 1TFGP YWTFG CO  #WIWUV  XQP -ÌPKI 1UECT + HÒT FCU OKV 5EJYGFGP KP 2GTUQPCNWPKQP XGTDWP   FGPG-ÌPKITGKEJ0QTYGIGPIGUVKHVGV$KUECYCTGPFKGXGTNKGJGPGP$TWUVUVGTPGYKGKP5EJYGFGPIGUVKEMV

 YWTFGGTCWHXKGT -QOOCPFGWTWPF-NCUUGUR·VGT-QOOCPFGWTOKV5VGTPWPF-QOOCPFGWT  CWHHÒPH-NCUUGP 4KVVGT-NCUUGWPF4KVVGT GTYGKVGTVPCEJFGODGTGKVUFKG-QNNCPGGKPIGHÒJTVYQTFGPYCT 0CEJ FGT #WHNÌUWPI FGT 2GTUQPCNWPKQP OKV 5EJYGFGP DGUV·VKIVG FGT PGW IGY·JNVG -ÌPKI *CCMQP 8++ CO  ,WPK    FGP 1TFGP KP GVYCU XGT·PFGTVGT )GUVCNVWPI YQDGK FCU DKUJGTKIG -NCUUGPU[UVGO GTJCNVGP DNKGD  XGT   UEJYCPF UEJNKG­NKEJ FGT MNGKPG .ÌYG ÒDGT FGO -TGW\ FGT -TQPG YQOKV FGT 1TFGP UGKPG JGWVKIG )GUVCNV GTJKGNV   #NNG -NCUUGP FGU 1TFGPU MÌPPGP CWEJ OKV 5EJYGTVGTP XGTNKGJGP YGTFGP FKG LGFQEJ PWT CWH FGP 1TFGPUMTGW\GP   PKEJV CWH FGP $TWUVUVGTPGP CPIGDTCEJV YGTFGP #NU DGUQPFGTU JQJG #WU\GKEJPWPI MCPP FGT 1TFGP KP $TKNNCPVGP   XGTNKGJGPYGTFGP#NNG+PUKIPKGPFGU1TFGPUCW­GTFKGLGPKIGPOKV$TKNNCPVGPUKPFUVTGPITÒEMICDGRHNKEJVKI

80


NORWEGEN

9298 (1:1)



-ÌPKINKEJ0QTYGIKUEJGT5CPMV1NCXU1TFGP=-QPIGNKIG0QTUM5V1NCXUQTFGP?/QFGNN UGKV QJPG .ÌYGP ÒDGT FGT -TQPG  )TQ­MTGW\UGV DGUVGJGPF CWU -NGKPQF 5KNDGT XGTIQNFGV WPF GOCKNNKGTV   COQTKIKPCNGP5EJWNVGTDCPFWPF$TWUVUVGTP5KNDGTDTKNNCPVKGTV#WHNCIGP5KNDGTXGTIQNFGVWPFGOCKNNKGTV CWH FGT 4ÒEMUGKVG *GTUVGNNGTDG\GKEJPWPI FGT (KTOC 6QUVTWR KP 1UNQ CP 0CFGN KO QTKIKPCNGP IQNFGP   DGFTWEMVGP8GTNGKJWPIUGVWKOKVGKPGODGUEJ·FKIVGP8GTUEJNW­<- 5VÒEM++  'ZGORNCTFGT#WMVKQP(TKV\4WFQNH-ÒPMGT1UPCDTÒEM0T

81


ÖSTERREICH

9300

9299





(TGKJGKVUMTGW\ -ÌPKI *CCMQP U 8++ 5KNDGT XGTIQNFGV WPF GOCKNNKGTV CWH FGO 4GXGTU *GTUVGNNGTDG   \GKEJPWPI FGT (KTOC 6QUVTWR KP 1UNQ CP QTKIKPCNGT &COGPUEJNGKHG KO QTKIKPCNGP GVYCU DGTKGDGPGP   8GTNGKJWPIUGVWKFGT(KTOC6QUVTWROKVIQNFHCTDGPGO/QPQITCOO-ÌPKI*CCMQP U8++'1 ++



(TGKJGKVUOGFCKNNG -ÌPKI *CCMQP U 8++ $TQP\G CO $CPF OKV 6TCIGURCPIG KO QTKIKPCNGP GVYCU DG   UEJ·FKIVGP8GTNGKJWPIUGVWKFGT(KTOC6QUVTWROKVIQNFHCTDGPGO/QPQITCOO-ÌPKI*CCMQP U8++ ++



9301 (1:1)

9303 (1:1)

9302 (1:1)

-#+5'44'+%*   





¤56'44'+%*

¤UVGTTGKEJKUEJ-CKUGTNKEJGT 1TFGP FGT 'KUGTPGP -TQPG  /QFGNN EC   /KPKCVWT FGT   &GMQTCVKQP-NCUUGZOO)QNFVGKNYGKUGGOCKNNKGTV'KUGPTKPIKPPGTJCNDFGT-TQPGQJPG 2WP\KGTWPIQJPG$·PFEJGP ++



¤UVGTTGKEJKUEJ-CKUGTNKEJGT 1TFGP FGT 'KUGTPGP -TQPG  /QFGNN EC   &GMQTCVKQP   -NCUUG)QNFVGKNYGKUGGOCKNNKGTV'KUGPTKPIKPPGTJCNDFGT-TQPGI OKV$CPF CWHFGT4ÒEMUGKVG FGT -TQPGPRGPFKNKGP *GTUVGNNGTDG\GKEJPWPI FGT (KTOC 4QVJG KP 9KGP -TQPG OÌINKEJGTYGKUG GTI·P\V   LGFQEJKP)QNF6TCIGTKPIYQJNGTI·P\VFCQJPG2WP\KGTWPICO$QIGPDCPF$9-<- ++



-CKUGTNKEJ¤UVGTTGKEJKUEJGT (TCP\,QUGRJ1TFGP )TQ­MTGW\-NGKPQF )QNF GOCKNNKGTV 4GXGTUOG   FCKNNQPCWHMNCRRDCTKO4KPI*GTUVGNNGTRWP\G8/FGT(KTOC8KPE/G[GT U5ÌJPGKP9KGP)GOUMQRH #2WP\GHÒTGT)QNFDGK-NGKPGP9GTMGPXQPDKUCOQTKIKPCNGPCNVGPOQKTKGTVGP5GK FGP5EJWNVGTDCPF$9-<- ++  'ZGORNCT FGT #WMVKQP (TKV\ 4WFQNH -ÒPMGT  1UPCDTÒEM  0T  &GT \WP·EJUV PWT FTGKMNCUUKIG CNNIG   OGKPG 8GTFKGPUVQTFGP YWTFG CO  &G\GODGT  XQP -CKUGT (TCP\ ,QUGRJ MWT\ PCEJ UGKPGT 6JTQPDGUVGKIWPI   IGUVKHVGV 'T YWTFG OGJTHCEJ XGT·PFGTV WPF GTYGKVGV = -QOVWT OKV 5VGTP   PFGTWPI FGT $TWUVUVGTP     1HHK\KGTUMTGW\   -KGIUFGMQTCVKQP \W CNNGP -NCUUGP  WPF  5EJYGTVGT 5QOKVDGUVCPFFGT1TFGPCD  CWU HÒPH -NCUUGP )TQ­MTGW\ -QOVWT OKV WPF QJPG 5VGTP 1HHK\KGTUMTGW\ 4KVVGTMTGW\  /KV FGO 8GT\KEJV   -CKUGT-CTNU+CWHFKG#WUÒDWPIFGT4GIKGTWPIKOÌUVGTTGKEJKUEJGP4GKEJUVGKNCO0QXGODGTGTNQUEJFGT 1TFGPHCMVKUEJ

82


ÖSTERREICH

9304 (1:1)

9306

9307

9308

ex 9305



-CKUGTNKEJ¤UVGTTGKEJKUEJGT (TCP\,QUGRJ1TFGP /KPKCVWT FGU -QOVWTMTGW\GU  Z  OO   )QNFGOCKNNKGTVQJPG2WP\KGTWPIQJPG$·PFEJGP ++





'JTGP\GKEJGPXQO4QVGP-TGW\-QPXQNWV 'JTGP\GKEJGP-NCUUGOKVFGT-TKGIUFGMQTCVKQP5KNDGT GOCKNNKGTVCO&TGKGEMUDCPF 'JTGP\GKEJGP-NCUUG4ÒEMUGKVGDGJGNHUO·­KITGUVCWTKGTVQJPG$CPF  $TQP\GPG/GFCKNNGOKVFGT-TKGIUFGMQTCVKQPVGKNYGKUGGOCKNNKGTVCO$CPF 5VÒEM+++++



/KNKV·T8GTFKGPUVMTGW\ -TGW\  -NCUUG OKV FGT -TKGIUFGMQTCVKQP 5KNDGT VGKNYGKUG XGTIQNFGV WPF   GOCKNNKGTVKPFGT¤UG*GTUVGNNGTRWP\G(4FGT(KTOC(TKGFTKEJ4QVJGWPF2WP\GHÒTGT5KNDGTXQP  9KPFJWPFMQRH# CO&TGKGEMUDCPF&C\WFKG(GNFUEJPCNNGOKV#WHNCIG$9- +p++



8GTFKGPUVMTGW\)QNFGPGU8GTFKGPUVMTGW\#WUHÒJTWPI)QNFGOCKNNKGTVIKO$CPFTKPI *GTUVGNNGTDG\GKEJPWPI*/#;'45¤*0'WPF9+'0UQYKG)GOUMQRH#2WP\GHÒTGT)QNF DGK-NGKPGP9GTMGPXQPDKUCOQTKIKPCNGP&TGKGEMUDCPFOKVDGHGUVKIVGT0CFGNKOQTKIKPCNGP 8GTNGKJWPIUGVWKFGT(KTOC8/C[GTU5ÌJPG$9-/-D +







'ZGORNCTYKGCWEJFCU'VWKKPJGTXQTTCIGPFGT'TJCNVWPI



8GTFKGPUVMTGW\ )QNFGPGU 8GTFKGPUVMTGW\ #WUHÒJTWPI  )QNF GOCKNNKGTV  I OKP #WU   DTÒEJGWPF%JKRUKPFGTYGK­GPWPFTQVGP'OCKNNGKO$CPFTKPI*GTUVGNNGTDG\GKEJPWPI$#%*47%* WPF$7&#2'56UQYKG)GOUMQRH#2WP\GHÒTGT)QNFDGK-NGKPGP9GTMGPXQPDKU COQTKIKPCNGP&TGKGEMUDCPF$9-/-D ++p++



9311

9310 9309





/KNKV·TFKGPUV\GKEJGPHÒT1HHK\KGTG/QFGNN #FNGTMÌRHGQJPG-TQPGP -TGW\+-NCUUG HÒT&KGPUVLCJTG$TQP\GXGTIQNFGV#FNGT5KNDGT FKGUGTKO9CRRGPUEJKNFUVCTMCDIGPWV\V CO&TGK GEMUDCPF$9- ++p



8GTFKGPUVOGFCKNNG FGU 2TCIGT (TGKYKNNKIGP 4GVVWPIUMQTRU  /QFGNN   $TQP\GPG 8GT   FKGPUVOGFCKNNG$TQP\GCO&TGKGEMUDCPF$9-2)# 44++



&KG/GFCKNNGKUVKPDGKFGP/QFGNNGPYKGCWEJKPDGKFGP5VWHGPXQPITQ­GT5GNVGPJGKV



'TKPPGTWPIUOGFCKNNG \WO L·JTKIGP ,WDKN·WO FGT 'TPGPPWPI XQP (GNFOCTUEJCNN 'T\JGT\QI ,Q   UGRJ XQP ¤UVGTTGKEJ   \WO 2CNCVKP XQP 7PICTP 5KNDGT &WTEJOGUUGT  OO 5KNDGT   UVCTMIGVTCIGPQJPG$CPF ++p+++

 83


ÖSTERREICH

9312

9315 (1:1) ex 9313



ex 9314

)TQ­G 1TFGPUUEJPCNNG OKV CEJV #WU\GKEJPWPIGP   5KIPWO .CWFKU KP $TQP\G CO -TKGIUDCPF     5KIPWO .CWFKU KP $TQP\G CO (TKGFGPUDCPF   -CTNU6TWRRGPMTGW\   -TKGIUOGFCKNNG   5KIPWO   /GOQTKCG    ,WDKN·WOUMTGW\  HÒT FKG $GYCHHPGVG /CEJV   /QDKNKUCVKQPUMTGW\    #WUHÒJTWPIOKVGTJCDGPGP,CJTGU\CJNGP$CPF\GTUEJNKUUGP 1HHK\KGTU&KGPUVCWU\GKEJPWPI/QFGNN

  -TGW\  -NCUUG HÒT  &KGPUVLCJTG COWPMQTTGMVGP$CPF#WHFGO4GXGTU\YGK*CMGP \WO'KPJ·PIGP ++



'ZGORNCTFGT#WMVKQP-ÒPMGT1UPCDTÒEM0T





-NGKPG 5COONWPI XQP  XGTUEJKGFGPGP 'JTGP\GKEJGP   5KNDGTPG /KNKV·TXGTFKGPUVOGFCKNNG 5KIPWO   .CWFKU-CKUGT-CTNOKV5EJYGTVGTP5KNDGT $TQP\GPG/KNKV·TXGTFKGPUVOGFCKNNG5KIPWO.CWFKU-CKUGT (TCP\ ,QUGRJ KO 'VWK XQP 5EJGKF   /KNKV·TXGTFKGPUVMTGW\ +++ -NCUUG OKV -TKGIUFGMQTCVKQP WPF   5EJYGTVGTP %JKR KP FGT TQVGP 'OCKNNG   5KNDGTPGU 8GTFKGPUVMTGW\ OKV FGT -TQPG 5KNDGT *GTUVGNNGT   -WP\   )TQ­G  5KNDGTPG 6CRHGTMGKVUOGFCKNNG + -NCUUG -CKUGT (TCP\,QUGRJ  5KNDGT OKV   5VGORGNUEJPGKFGT   -TKGIUOGFCKNNG  $TQP\G   -TKGIUOGFCKNNG  KP -TKGIUOGVCNN UGNVGP     /GFCKNNGHÒT,CJTGVTGWG&KGPUVGHÒT/KNKV·TRGTUQPCN 8GTYWPFGVGPOGFCKNNG$TQP\GXGTUKNDGTVCO $CPFHÒT\YGK8GTYWPFWPIGP 8GTYWPFGVGPOGFCKNNG-TKGIUOGVCNNCO$CPFHÒTGKPG8GTYWPFWPI  /QDKNKUCVKQPUMTGW\OKVGTJCDGPGP<CJNGP /KNKV·T,WDKN·WOUMTGW\8GTUEJKGFGPG /GVCNNGXKGTKP5KNDGTCNNGCP&TGKGEMUD·PFGTPFCXQPCEJVCNVCNNGKPQTFGPVNKEJGO<WUVCPF&C\WGKPG (GNFUEJPCNNGOKV-NCOOGTP 5VÒEM++++p+++



-QPXQNWV XQP CEJV XGTUEJKGFGPGP 'JTGP\GKEJGP &CDGK )TQ­G 5KNDGTPG 6CRHGTMGKVUOGFCKNNG  

-NCUUG /QFGNN(TCP\,QUGRJ5KNDGT6CRHGTMGKVUOGFCKNNG/QFGNN-CKUGT-CTN 5KNDGT OKV 9KGFGTJQNWPIUURCPIG 'JTGP\GKEJGP XQO 4QVGP-TGW\++-NCUUGOKVFGT-TKGIUFGMQTCVKQP WPF /KNKV·TFKGPUV\GKEJGP HÒT 1HHK\KGTG HÒT  &KGPUVLCJTG /QFGNN  8GTUEJKGFGPG /GVCNNG   XKGTKP5KNDGTVGKNUXGTIQNFGVGKPGUGOCKNNKGTVHÒPHCP&TGKGEMUD·PFGTPKPWPVGTUEJKGFNKEJGP'TJCNVWP IGP ++++p+++



*1*'4&'765%*'44+66'414&'0 

1TFGPUKPUKIPKGP-TGW\FGT'JTGPTKVVGT/QFGNN UGKV #WUHÒJTWPI QJPG*CNUMGVVEJGPOKV -TGW\EJGPCWHFGO*GNO 5KNDGTXGTIQNFGVWPFGOCKNNKGTVCONCPIGP*CNUDCPFCDUEJPKVV 44++ &KG #P\CJN FGT NGDGPFGP 'JTGPTKVVGT KUV CWH \YÌNH DGUEJT·PMV <YKUEJGP  WPF \YKUEJGPWPF GTHQNIVGP MGKPG 'TPGPPWPIGP  UKPF PWT  'JTGPTKVVGT FGU 1TFGPU GTPCPPV YQTFGP FCTWPVGT $WPFGUMCP\NGT &T   -QPTCF #FGPCWGT   (ÒTUV (TCP\ ,QUGRJ ++ XQP .KGEJVGPUVGKP   (TCP\ -CTFKPCN -ÌPKI   WPF &T   1VVQ XQP *CDUDWTI.QVJTKPIGP   *GWVG UKPF %JTKUVQRJ -CTFKPCN 5EJÌPDQTP   WPF %CTN *GT\QI XQP   9ÒTVVGODGTI  'JTGPTKVVGTFGU1TFGPU

84




PORTUGAL

9316 (1:1) 9318

9317



/CTKCPGTMTGW\/KPKCVWTFGU*CNUMTGW\GUZOO5KNDGT#XGTU/GFCKNNQP)QNFGOCKNNKGTV ++





/CTKCPGTMTGW\5KNDGTVGKNYGKUGXGTIQNFGVWPFGOCKNNKGTVKPFGT¤UG*GTUVGNNGTRWP\G*79FGT(KTOC *GKPTKEJ 7NDTKEJVU 9KVYG WPF 2WP\G HÒT GT 5KNDGT XQP  DKU  &KCPCMQRH  CO QTKIKPCNGP   CNVGPOKP\GTUEJNKUUGPGP&TGKGEMUDCPF$9-<- ++



'456' 4'27$.+-   

21.'0

#D\GKEJGP FGU  -CPKQYUMK (ÒUKNKGT4GIKOGPVU #WEJ DGMCPPV CNU FCU #D\GKEJGP FGT -KPFGT XQP   .QF\#WUHÒJTWPI OKVFGP5V·FVGPCOGP 5KNDGTGOCKNNKGTVCP5EJTCWDGOKV5EJTCWDUEJGKDGFCTCWH *GTUVGNNGTDG\GKEJPWPIFGT(KTOC9)QPVCTE\[MKP9CTUEJCW95 ++



9319 (1:1)

21467)#. -¤0+)4'+%* $+5  

/KNKV·TKUEJGT1TFGP7PUGTGU*GTTP,GUWU%JTKUVWU=/KNKVCT1TFGOFG0QUUQ5GPJQT,GUWU%JTKUVQ?  /QFGNN OKV UQIGP *GT\ ,GUW&GMQTCVKQP    $TWUVUVGTP \WO )TQ­MTGW\ GTMGPPVNKEJ CP   FGPHÒPH$NÒVGPCWHFGO/GFCKNNQPTKPI RQTVWIKGUKUEJG#WUHÒJTWPI OKVUVTCJNKIGPUQIGP)NCP\MÌT RGT  OKV DTKNNCPVKGTVGP 5VTCJNGP KP ITQ­GT HTCP\ÌUKUEJGT #PHGTVKIWPI &WTEJOGUUGT  OO  5KNDGT   DTKNNCPVKGTV #WHNCIGP )QNF VGKNYGKUG \KUGNKGTV WPF VGKNYGKUG GOCKNNKGTV QJPG *GTUVGNNGTDG\GKEJPWPICP 0CFGNOKV\YGK5GKVGPJCMGP<- +p++



5GJT SWCNKV·VUXQNNG WPF ITQ­G HTCP\ÌUKUEJG #PHGTVKIWPI CWU FGT /KVVG FGU 0GWP\GJPVGP ,CJTJWPFGTVU KP CNNGTDGUVGT   'TJCNVWPI

85


RUMÄNIEN

9321 (1:1)

9320



/KNKV·TKUEJGT1TFGP7PUGTGU*GTTP,GUWU%JTKUVWU=/KNKVCT1TFGOFG0QUUQ5GPJQT,GUWU%JTKUVQ?  /QFGNN OKV UQIGP *GT\ ,GUW&GMQTCVKQP    $TWUVUVGTP \WO )TQ­MTGW\ GTMGPPVNKEJ CP   FGPHÒPH$NÒVGPCWHFGO/GFCKNNQPTKPI RQTVWIKGUKUEJG#WUHÒJTWPI OKVUVTCJNKIGPUQIGP)NCP\MÌT RGT  OKV DTKNNCPVKGTVGP 5VTCJNGP KP UQIGP FC %QUVC#PHGTVKIWPI OKV IQNFGPGO 5VTCJNGPMTCP\ WO FCU   /GFCKNNQP JGTWO  5KNDGT DTKNNCPVKGTV #WHNCIGP )QNF VGKNYGKUG ITCXKGTV WPF \KUGNKGTV VGKNYGKUG GOCKN   NKGTVQJPG*GTUVGNNGTDG\GKEJPWPI&QRRGNPCFGNHGJNV<-XCT 4++



1TFGPFGT'ORH·PIPKU7PUGTGT.KGDGP(TCWXQP8KNNC8KEQUC/KPKCVWTFGT-QOOCPFGWTFGMQTCVKQP ZOO)QNFGOCKNNKGTVQJPG$·PFEJGP ++



5GJT UGNVGPG #PHGTVKIWPI .CWV 6TKIWGKTQU WPF 6COOCPP KP 64) 5   XGTUCJ FKG (KTOC FC %QUVC CD EC    )TQ­MTGW\UVGTPG CNU 7PVGTUEJGKFWPIUOGTMOCN \WO -QOOCPFGWTUVGTP OKV GKPGO IQNFGPGP 5VTCJNGPMTCP\ WO FCU   /GFCKNNQPJGTWO'DGPHCNNUNCWV6TKIWGKTQUWPF6COOCPP KP64)5 KUVFGT1TFGPKPFKGUGT-NCUUGXQP DKUPWTOCNCP2QTVWIKGUGPWPFOCNCP#WUN·PFGTXGTNKGJGPYQTFGP



9323

9322 (1:1) 9324

47/0+'0 -¤0+)4'+%*   

)GUEJGPMDTQUEJG-ÌPKI%CTQNU+&WTEJOGUUGT)QNFVGKNYGKUGGOCKNNKGTVDGNGIVOKV\CJNTGKEJGPMNGK PGP2GTNGPICP0CFGN 448QPJGTXQTTCIGPFGT#PHGTVKIWPIUSWCNKV·V+p++





/KNKV·TKUEJGT -TKGIUQTFGP /KEJCGN FGT 6CRHGTG =1TFKPWN /KNKVCT FG 4C\DQK /KJCK 8KVGC\WN?   /QFGNN OKV/QPQITCOO-ÌPKI(GTFKPCPFUWPF,CJTGU\CJN -TGW\-NCUUG$TQP\G XGTIQNFGVWPFGOCKNNKGTVCOCNVGP1TKIKPCNDCPFTWO·PKUEJGT0·JCTV<- ++



/KNKV·TKUEJGT -TKGIUQTFGP /KEJCGN FGT 6CRHGTG =1TFKPWN /KNKVCT FG 4C\DQK /KJCK 8KVGC\WN?    /QFGNN OKV /QPQITCOO -ÌPKI /KJCK U + WPF ,CJTGU\CJN     5COONGTCPHGTVKIWPI   =EQR[?FGU-TGW\GU-NCUUG$TQP\GXGTIQNFGVWPFGOCKNNKGTV 'OCKNNGNGKEJVYGNNKI OKVCNVGO$CPF UVÒEM ++





*GTXQTTCIGPFIGHGTVKIVGT'TUCV\FGT(KTOC5QWXCNKP9KGP 5QWXCNYCTY·JTGPFXQPDKU*GTUVGNNGTFGU /QFGNNU HÒTFKGUGKO1TKIKPCNPKEJV\WDGUEJCHHGPFG-NCUUGFKGPCEJ+EJKO +EJKO'WIGP1TFKPWN/KNKVCTFG 4C\DQK/KJCK8KVGC\WN$WMCTGUV KO1TKIKPCNPWTOCNCPUQYLGVKUEJG/CTUEJ·NNGWPF)GPGT·NGXGTNKGJGP YWTFG

86


RUMÃ&#x201E;NIEN

9325 (1:1)



1TFGP6TGWG&KGPUVG=1TFKPWN5GTXKEKWN%TGFGPEKQU?/QFGNN  )TQ­MTGW\UGVDGUVGJGPF CWU-NGKPQF5KNDGTXGTIQNFGVWPFGOCKNNKGTVKO$CPFTKPIOGJTHCEJRWP\KGTVWC*GTUVGNNWPIUPWOOGT *GTUVGNNGTRWP\G*9FGT(KTOC9GKUUKP$WMCTGUVWPF,CJTGURWP\GHÃ&#x2019;TQJPG5EJWNVGT DCPFWPF$TWUVUVGTP\WO)TQ­MTGW\#WUHÃ&#x2019;JTWPI XKGTUVTCJNKI &WTEJOGUUGTOO 5KNDGT XGTIQNFGV VGKNYGKUG GOCKNNKGTV CP 0CFGN FKGUG OGJTHCEJ RWP\KGTV *GTUVGNNWPIUPWOOGT    *GTUVGNNGTRWP\G*9FGT(KTOC9GKUUKP$WMCTGUVWPF,CJTGURWP\GHÃ&#x2019;T<-  5VÃ&#x2019;EM44++  'PUGODNGKPUGNVGPIWVGT'TJCNVWPI

87


RUMÄNIEN

9326



1TFGP 5VGTP 4WO·PKGPU =1TFKPWN 5VGCWC 4QO³PKGK? CWEJ 1TFGP FGU 5VGTPU XQP 4WO·PKGP    /QFGNN  $TWUVUVGTP\WO)TQ­MTGW\#WUHÒJTWPIHÒT<KXKNXGTFKGPUV5KNDGTDTKNNCPVKGTVWPF TGRGTEKGTV#WHNCIGPXGTIQNFGVWPFVGKNYGKUGGOCKNNKGTV'OCKNNGTGRCTCVWTCWHFGOQDGTGP-TGW\CTOWPF 'OCKNNGEJKRUCWHFGOWPVGTGP-TGW\CTOWPFKO/GFCKNNQPTKPICWHFGT4ÒEMUGKVG*GTUVGNNGTDG\GKEJPWPI FGT(KTOC,QUGRJ4GUEJ(KNUKP$WMCTGUVCP0CFGNFKGUGOKVHTCP\ÌUKUEJGT'KPHWJTRWP\GXQP DKU 5EJYCPGPRWP\G <- ++p+++



9327

9328





88

1TFGP 5VGTP 4WO·PKGPU =1TFKPWN 5VGCWC 4QO³PKGK? CWEJ 1TFGP FGU 5VGTPU XQP 4WO·PKGP     /QFGNN   )TQ­MTGW\-NGKPQF #WUHÒJTWPI HÒT /KNKV·TXGTFKGPUV KP (TKGFGPU\GKVGP OKV   5EJYGTVGTP ÒDGT FGO -TGW\  5KNDGT XGTIQNFGV WPF GOCKNNKGTVCWH8QTFGTWPF4ÒEMUGKVG%JKRUKPFGT DNCWGP'OCKNNGCOCNVGP5EJWNVGTDCPFFGU/QFGNNU<- +++



1TFGP 5VGTP 4WO·PKGPU =1TFKPWN 5VGCWC 4QO³PKGK? CWEJ 1TFGP FGU 5VGTPU XQP 4WO·PKGP    /QFGNN  1HHK\KGTUMTGW\#WUHÒJTWPIHÒT<KXKNXGTFKGPUV5KNDGTXGTIQNFGVWPFGOCKNNKGTVCO QTKIKPCNGP$CPFTWO·PKUEJGT0·JCTVOKVCWHIGNGIVGT4QUGVVGKOQTKIKPCNGPFWPMGNITÒPGP8GTNGKJWPIUG VWKFGU*QHLWYGNKGTU,QUGH4GUEJ(KKKP$WMCTGUVOKV/QPQITCOO-ÌPKI%CTQNU+<- ++




RUMÄNIEN

9330

9329

9331







1TFGP 5VGTP 4WO·PKGPU =1TFKPWN 5VGCWC 4QO³PKGK? CWEJ 1TFGP FGU 5VGTPU XQP 4WO·PKGP    /QFGNN  1HHK\KGTUMTGW\#WUHÒJTWPIHÒT<KXKNXGTFKGPUV$TQP\GXGTIQNFGVWPFGOCKNNKGTV OKP%JKRCWHFGT8QTFGTUGKVGFGUNKPMGP-TGW\CTOUCOQTKIKPCNGP$CPFTWO·PKUEJGT0·JCTVOKVCWH IGNGIVGT4QUGVVG<- ++



1TFGP 5VGTP 4WO·PKGPU =1TFKPWN 5VGCWC 4QO³PKGK? CWEJ 1TFGP FGU 5VGTPU XQP 4WO·PKGP    /QFGNN  4KVVGTMTGW\#WUHÒJTWPIHÒT<KXKNXGTFKGPUV5KNDGTVGKNYGKUGXGTIQNFGVWPFGOCKN NKGTV OKP %JKR CWH FGT 8QTFGTUGKVG FGU NKPMGP -TGW\CTOU CO QTKIKPCNGP CNVGP GVYCU \GTUEJNKUUGPGP   $CPF<- ++



1TFGP 5VGTP 4WO·PKGPU =1TFKPWN 5VGCWC 4QO³PKGK? CWEJ 1TFGP FGU 5VGTPU XQP 4WO·PKGP    /QFGNN  1HHK\KGTUMTGW\#WUHÒJTWPIHÒT/KNKV·TXGTFKGPUVKP(TKGFGPU\GKVGP OKV5EJYGTVGTP ÒDGT FGO -TGW\  5KNDGT XGTIQNFGV WPF GOCKNNKGTV KO $CPFTKPI OGJTHCEJ RWP\KGTV W C *GTUVGNNWPIU   PWOOGT  WPF ,CJTGUPWOOGT  HÒT  CO QTKIKPCNGP $CPF TWO·PKUEJGT 0·JCTV OKV   CWHIGNGIVGT1UGVVG<- 4+p++



9332







9334

1TFGP 5VGTP 4WO·PKGPU =1TFKPWN 5VGCWC 4QO³PKGK? CWEJ 1TFGP FGU 5VGTPU XQP 4WO·PKGP     /QFGNN   4KVVGTMTGW\ #WUHÒJTWPI HÒT /KNKV·TXGTFKGPUV KP -TKGIU\GKVGP OKV 5EJYGTVGTP   FWTEJFKG/KVVG $TQP\GXGTUKNDGTVWPFGOCKNNKGTVCOQTKIKPCNGP$CPFHÒT6CRHGTMGKVTWO·PKUEJGT0·J CTV KO QTKIKPCNGP 8GTNGKJWPIUGVWK FGT /QPGVCTKC 0CVKQPCNC OKV IQNFHCTDGPGO /QPQITCOO -ÌPKI /K   JCK U+<- ++



1TFGP 5VGTP 4WO·PKGPU =1TFKPWN 5VGCWC 4QO³PKGK? CWEJ 1TFGP FGU 5VGTPU XQP 4WO·PKGP     /QFGNN   4KVVGTMTGW\ #WUHÒJTWPI HÒT /KNKV·TXGTFKGPUV KP -TKGIU\GKVGP OKV 5EJYGTVGTP   FWTEJFKG/KVVG $TQP\GXGTUKNDGTVWPFGOCKNNKGTVCOQTKIKPCNGP$CPFHÒT6CRHGTMGKVTWO·PKUEJGT0·J CTV<- ++



1TFGP 5VGTP 4WO·PKGPU =1TFKPWN 5VGCWC 4QO³PKGK? CWEJ 1TFGP FGU 5VGTPU XQP 4WO·PKGP    /QFGNN  4KVVGTMTGW\#WUHÒJTWPIHÒT/KNKV·TXGTFKGPUVKP(TKGFGPU\GKVGP OKV5EJYGTVGTP ÒDGTFGO-TGW\ 5KNDGTVGKNYGKUGXGTIQNFGVWPFGOCKNNKGTVKO$CPFTKPIOGJTHCEJRWP\KGTVWC*GT UVGNNWPIUPWOOGTWPF,CJTGRWP\GHÒTQJPG$CPF<- +p++

 89


RUMÄNIEN

9335 (1:1)



1TFGP-TQPG4WO·PKGPU=1TFKPWN%QTQCPC4QO³PKGK? CWEJ1TFGPFGT-TQPGXQP4WO·PKGP   /QFGNN    #WUICDG OKV PKEJV OCIPGVKUEJGT -TQPG KO /GFCKNNQP      #WUHÒJTWPI OKV DGKFUGKVKI CWUIGRT·IVGP /QPQITCOOGP \YKUEJGP FGP -TGW\CTOGP )TQ­MTGW\ OKV  5EJYGTVGTPHTCP\ÌUKUEJG#PHGTVKIWPI5KNDGTXGTIQNFGVWPFGOCKNNKGTV-TQPG5KNDGTQJPG5EJWNVGTDCPF <- ++p



9338 9336







90

9337

1TFGP-TQPG4WO·PKGPU=1TFKPWN%QTQCPC4QO³PKGK? CWEJ1TFGPFGT-TQPGXQP4WO·PKGP  /QFGNN  #WUICDG OKVPKEJVOCIPGVKUEJGT-TQPGKO/GFCKNNQP $TWUVUVGTP \WO)TQ­QHHK\KGT5KNDGTVGKNYGKUGGOCKNNKGTVCWHFGT4ÒEMUGKVG*GTUVGNNGTDG\GKEJPWPIFGT(KTOC,QUGRJ 4GUEJ(KNUKP$WMCTGUVCP0CFGN<- ++



1TFGP-TQPG4WO·PKGPU=1TFKPWN%QTQCPC4QO³PKGK? CWEJ1TFGPFGT-TQPGXQP4WO·PKGP  /QFGNN  #WUICDG OKVOCIPGVKUEJGT-TQPGKO/GFCKNNQP #WUHÒJTWPIOKV DGKFUGKVKICWUIGRT·IVGP/QPQITCOOGP\YKUEJGPFGP-TGW\CTOGP-QOOCPFGWTMTGW\5KNDGTXGTIQNFGV WPFGOCKNNKGTVGKPG%JKHHTG\YKUEJGPFGP-TGW\CTOGPDGYGINKEJ-TQPGKO/GFCKNNQPGVYCUMQTTQFKGTV KP FGT ¤UG OGJTHCEJ RWP\KGTV W C TWO·PKUEJG 2WP\G HÒT GT 5KNDGT XQP  DKU  (KUEJG +    QJPG*CNUDCPF<- ++p



1TFGP-TQPG4WO·PKGPU=1TFKPWN%QTQCPC4QO³PKGK? CWEJ1TFGPFGT-TQPGXQP4WO·PKGP  /QFGNN  #WUICDG OKVOCIPGVKUEJGT-TQPGKO/GFCKNNQP #WUHÒJTWPIOKV DGKFUGKVKICWUIGRT·IVGP/QPQITCOOGP\YKUEJGPFGP-TGW\CTOGP-QOOCPFGWTMTGW\5KNDGTXGTIQNFGV WPFGOCKNNKGTVQJPG$CPFTKPIOKVQTKIKPCNGOGVYCU\GTUEJNKUUGPGP*CNUDCPF<- ++




RUMÄNIEN

9339



9341

1TFGP-TQPG4WO·PKGPU=1TFKPWN%QTQCPC4QO³PKGK? CWEJ1TFGPFGT-TQPGXQP4WO·PKGP  /QFGNN  #WUICDG OKVOCIPGVKUEJGT-TQPGKO/GFCKNNQP #WUHÒJTWPIOKV PWTXQTFGTUGKVKICWUIGRT·IVGP/QPQITCOOGP\YKUEJGPFGP-TGW\CTOGP1HHK\KGTUMTGW\5KNDGTXGTIQN FGV WPF GOCKNNKGTV KO$CPFTKPIOGJTHCEJRWP\KGTVWCTWO·PKUEJG2WP\GHÒTGT5KNDGTXQP DKU  (KUEJG +  *GTUVGNNGTRWP\G -( FGT (KTOC -CTN (KUEJOGKUVGT KP 9KGP WPF ÌUVGTTGKEJKUEJG   &KCPCMQRHRWP\G HÒT GT 5KNDGT XQP  CO QTKIKPCNGP CNVGP $CPF TWO·PKUEJGT 0·JCTV OKV   CWHIGNGIVGT4QUGVVG<- ++



#WHITWPFFGTXGTUEJKGFGPGP2WP\GPNKGIVFKG*GTUVGNNWPIU\GKVFKGUGU'ZGORNCTU\YKUEEJGPWPF





1TFGP-TQPG4WO·PKGPU=1TFKPWN%QTQCPC4QO³PKGK? CWEJ1TFGPFGT-TQPGXQP4WO·PKGP  /QFGNN  #WUICDG OKVPKEJVOCIPGVKUEJGT-TQPGKO/GFCKNNQP #WUHÒJTWPI OKVDGKFUGKVKICWUIGRT·IVGP/QPQITCOOGP\YKUEJGPFGP-TGW\CTOGP1HHK\KGTUMTGW\5KNDGTXGTIQNFGV WPFGOCKNNKGTVCOQTKIKPCNGPCNVGP$CPFTWO·PKUEJGT0·JCTVQJPG4QUGVVG<- ++



1TFGP-TQPG4WO·PKGPU=1TFKPWN%QTQCPC4QO³PKGK? CWEJ1TFGPFGT-TQPGXQP4WO·PKGP  /QFGNN  #WUICDG OKVPKEJVOCIPGVKUEJGT-TQPGKO/GFCKNNQP #WUHÒJTWPI OKV DGKFUGKVKI CWUIGRT·IVGP /QPQITCOOGP \YKUEJGP FGP -TGW\CTOGP 4KVVGTMTGW\ OKV 5EJYGTVGTP   $TQP\G XGTUKNDGTV WPF GOCKNNKGTV 'OCKNNNGURTÒPIG WPF OKP #DRNCV\WPIGP KP FGP /GFCKNNQP CO $CPF   <-&C\W-TKGIUGTKPPGTWPIUMTGW\$TQP\GCO$CPFOKV\YGKCWHIGNGIVGP$CPFURCP IGP/#4#5'56+WPF%#42#6+ 5VÒEM++



9342





9343

1TFGP-TQPG4WO·PKGPU=1TFKPWN%QTQCPC4QO³PKGK? CWEJ1TFGPFGT-TQPGXQP4WO·PKGP  /QFGNN  )TQ­QHHK\KGTUGV#WUHÒJTWPIHÒT<KXKNXGTFKGPUVDGUVGJGPFCWU)TQ­QHHK\KGTUMTGW\ 5KNDGTXGTIQNFGVWPFGOCKNNKGTVKPFGT¤UGTWO·PKUEJG2WP\GHÒTGT5KNDGTXQP -TQPGPRWP\G CO QTKIKPCNGP *CNUDCPF WPF $TWUVUVGTP \YGKVG MNGKPGTG #WUICDG 5KNDGT VGKNYGKUG XGTIQNFGV WPF GOCKN   NKGTVCP0CFGNFKGUGOGJTHCEJRWP\KGTVWC*GTUVGNNGTRWP\G*9FGT(KTOC*GKPTKEJ9GKUUKP$WMC TGUVWPF,CJTGURWP\GHÒTKOQTKIKPCNGP8GTNGKJWPIUGVWKFGT(KTOC9GKUUOKVIQNFHCTDGPGO /QPQITCOO-ÌPKI%CTQNU++<- 5VÒEM++



1TFGP-TQPG4WO·PKGPU=1TFKPWN%QTQCPC4QO³PKGK? CWEJ1TFGPFGT-TQPGXQP4WO·PKGP  /QFGNN  $TWUVUVGTP\WO)TQ­QHHK\KGT#WUHÒJTWPIHÒT/KNKV·TXGTFKGPUVKP-TKGIU\GKVGP OKV -TQPGWPF5EJYGTVGTP &WTEJOOO5KNDGTVGKNYGKUGXGTIQNFGVWPFGOCKNNKGTVCP0CFGNFKGUG OGJTHCEJRWP\KGTV WC*GTUVGNNGTRWP\G%(<FGT(KTOC%CTN(TKGFTKEJ<KOOGTOCPPKP2HQT\JGKO *GTUVGNNWPIUPWOOGTWPF,CJTGURWP\GHÒT <- ++

 91


RUMÄNIEN

9344 9345





1TFGP-TQPG4WO·PKGPU=1TFKPWN%QTQCPC4QO³PKGK? CWEJ1TFGPFGT-TQPGXQP4WO·PKGP  /QFGNN  -QOOCPFGWTMTGW\#WUHÒJTWPIHÒT/KNKV·TXGTFKGPUVKP-TKGIU\GKVGP OKV-TQPG WPF5EJYGTVGTP 5KNDGTXGTIQNFGVWPFGOCKNNKGTVKO6TCIGTKPIOGJTHCEJRWP\KGTV WC*GTUVGNNGTRWP\G %(< FGT (KTOC %CTN (TKGFTKEJ <KOOGTOCPP KP 2HQT\JGKO *GTUVGNNWPIUPWOOGT  WPF ,CJTGU  RWP\G  HÒT   CO QTKIKPCNGP CNVGP *CNUDCPF HÒT 6CRHGTMGKV KO QTKIKPCNGP 8GTNGKJWPIUGVWK FGT   /QPGVCTKC0CVKQPCNCOKVIQNFHCTDGPGO/QPQITCOO-ÌPKI/KJCK U+<- ++



1TFGP-TQPG4WO·PKGPU=1TFKPWN%QTQCPC4QO³PKGK? CWEJ1TFGPFGT-TQPGXQP4WO·PKGP  /QFGNN  -QOOCPFGWTMTGW\#WUHÒJTWPIHÒT/KNKV·TXGTFKGPUVKP(TKGFGPU\GKVGP PWTOKV -TQPG  UGKV   5KNDGT XGTIQNFGV WPF GOCKNNKGTV KP FGT ¤UG OGJTHCEJ WPNGUGTNKEJ RWP\KGTV QJPG   *CNUDCPF<- 44+p++



9346







9347

9348

9349

1TFGP-TQPG4WO·PKGPU=1TFKPWN%QTQCPC4QO³PKGK? CWEJ1TFGPFGT-TQPGXQP4WO·PKGP  /QFGNN  1HHK\KGTUMTGW\#WUHÒJTWPIHÒT/KNKV·TXGTFKGPUVKP-TKGIU\GKVGP OKV-TQPGWPF 5EJYGTVGTP $TQP\GXGTIQNFGVWPFGOCKNNKGTVCO$CPFHÒT6CRHGTMGKVTWO·PKUEJGT0·JCTV<- ++



1TFGP-TQPG4WO·PKGPU=1TFKPWN%QTQCPC4QO³PKGK? CWEJ1TFGPFGT-TQPGXQP4WO·PKGP  /QFGNN  1HHK\KGTUMTGW\#WUHÒJTWPIHÒT/KNKV·TXGTFKGPUVKP-TKGIU\GKVGP OKV-TQPGWPF 5EJYGTVGTP  $TQP\G XGTIQNFGV WPF GOCKNNKGTV CO UQIGP -TKGIUDCPF KP FGT $TGKVG HÒT FKG 1TFGPU   UEJPCNNG<- ++



1TFGP-TQPG4WO·PKGPU=1TFKPWN%QTQCPC4QO³PKGK? CWEJ1TFGPFGT-TQPGXQP4WO·PKGP   /QFGNN   1HHK\KGTUMTGW\ #WUHÒJTWPI HÒT /KNKV·TXGTFKGPUV KP (TKGFGPU\GKVGP PWT OKV   -TQPG  UGKV   $TQP\G XGTIQNFGV WPF GOCKNNKGTV CO GVYCU CWUIGDNGKEJVGP $CPF QJPG 4QUGVVG   <- +p++



#PHGTVKIWPIFGT/QPGVCTKC0C\KQPCNCKP$WMCTGUV\YKUEJGPWPF



1TFGP-TQPG4WO·PKGPU=1TFKPWN%QTQCPC4QO³PKGK? CWEJ1TFGPFGT-TQPGXQP4WO·PKGP   /QFGNN   4KVVGTMTGW\ #WUHÒJTWPI HÒT /KNKV·TXGTFKGPUV KP -TKGIU\GKVGP OKV -TQPG WPF   5EJYGTVGTP OKV'KEJGPNCWD  $TQP\GXGTUKNDGTVWPFGOCKNNKGTVCO$CPFHÒT6CRHGTMGKVTWO·PKUEJGT 0·JCTVOKVCWHIGNGIVGO'KEJGPNCWD<-XCT 4++ &CU'KEJGPNCWDCNUDGUQPFGTG6CRHGTMGKVUCWU\GKEJPWPI\WO4KVVGTWPF1HHK\KGTUMTGW\FGU1TFGPUYWTFGXQP-ÌPKI /KJCK+OKVMÌPKINKEJGO&GMTGV0TXQO,WPKIGUVKHVGV

92




RUMÄNIEN

9350 9351



9352

1TFGP-TQPG4WO·PKGPU=1TFKPWN%QTQCPC4QO³PKGK? CWEJ1TFGPFGT-TQPGXQP4WO·PKGP  /QFGNN  4KVVGTMTGW\#WUHÒJTWPIHÒT/KNKV·TXGTFKGPUVKP(TKGFGPU\GKVGP PWTOKV-TQPG UGKV   $TQP\G XGTUKNDGTV WPF GOCKNNKGTV CO GVYCU CWUIGDNGKEJVGP $CPF TWO·PKUEJGT 0·JCTV   <- ++



1TFGP #GTQPCWVKUEJG 6WIGPF =1TFKPWN 8KTVWVGC #GTQPCWVKEC? CWEJ (NKGIGT6CRHGTMGKVUQTFGP     /QFGNN OKV /QPQITCOO -ÌPKI /KJCK U +    )QNFGPGU -TGW\ HÒT (NKGIGTXGTFKGPUV OKV   5EJYGTVGTP$TQP\GXGTIQNFGVCOPGWGP-TKGIUDCPFTWO·PKUEJGT0·JCTV<- ++



1TFGP #GTQPCWVKUEJG 6WIGPF =1TFKPWN 8KTVWVGC #GTQPCWVKEC? CWEJ (NKGIGT6CRHGTMGKVUQTFGP     /QFGNN OKV /QPQITCOO -ÌPKI /KJCK U +    )QNFGPGU -TGW\ HÒT (NKGIGTXGTFKGPUV OKV   5EJYGTVGTP$TQP\GXGTIQNFGVQJPG$CPF<- ++



#PHGTVKIWPIFGT/QPGVCTKC0C\KQPCNCKP$WMCTGUV\YKUEJGPWPF





9353



1TFGP-TGW\FGT-ÌPKIKP/CTKC=1TFKPWN%TWEGC4GIKPC/CTKC?-TGW\FGT-NCUUG#WUHÒJTWPI HÒT &COGP 5KNDGT XGTIQNFGV WPF GOCKNNKGTV OKP QDGTHN·EJNKEJG 'OCKNNGEJKRU CO 4CPF OKV MNGKPGO   $CPFTKPIQJPG&COGPUEJNGKHG-47 4++

9354 9355



9356



1TFGP-TGW\FGT-ÌPKIKP/CTKC=1TFKPWN%TWEGC4GIKPC/CTKC?-TGW\FGTY-NCUUG5KNDGTXGT IQNFGVQJPG$CPF-47 4++





/GFCKNNG/CTKVKOG6WIGPF=/GFCNKC8KTVWVGC/CTKVKOC?/GFCKNNG-NCUUGQJPG-TQPG$TQP\G COQTKIKPCNGP$CPFTWO·PKUEJGT0·JCTV-47 ++





/GFCKNNG#GTQPCWVKUEJG6WIGPF=/GFCNKC8KTVWVGC#GTQPCWVKEC? CWEJ(NKGIGT/GFCKNNG /GFCKNNG -NCUUGOKV-TQPGWPF5EJYGTVGTP$TQP\GXGTIQNFGVQJPG$CPF-47 ++

 93


RUMÄNIEN

ex 9359

ex 9357

9361

9358





-TGW\WPF/GFCKNNG6TGWG&KGPUVG=%TWEGCUK/GFCNKC5GTXKEKWN%TGFGPEKQU?-QPXQNWVXQP'ZGO RNCTGP-TGW\/QFGNN)QNFUVWHGZ5KNDGTUVWHG WPVGTUEJKGFNKEJG#WUHÒJTWPIGP -TGW\/QFGNN )QNFUVWHG $TQP\GUVWHG OKV 5EJYGTVGTP /GFCKNNG  /QFGNNZ)QNFUVWHGVGKNUXGTIQNFGVVGKNUXGTUKN DGTVHÒPHCP$·PFGTPKPQTFGPVNKEJGP'TJCNVWPIGP 5VÒEM++



/GFCKNNG(ÒT/CPPJCHVKIMGKVWPF6TGWG)QNFGPG/GFCKNNG$TQP\GXGTIQNFGVCO$CPFTWO·PKUEJGT 0·JCTVOKV$CPFURCPIG%#/2#0+#-47WPF 4++



-NKGVOCPPUEJTGKDV KP-.#45 FC­FKG$CPFURCPIG%#/2#0#CW­GTQTFGPVNKEJUGNVGPKUV







-TGW\/KNKV·TKUEJG6WIGPFWPF/GFCKNNG(ÒT/CPPJCHVKIMGKVWPF6TGWG=%TWEGC8KTVWVGC/KNKVCTC UK /GFCNKC $CTDCVKG UK %TGFKPVC? -QPXQNWV XQP  'ZGORNCTGP -TGW\ 5KNDGTUVWHG WPF $TQP\GUVWHG   /GFCKNNG )QNFUVWHG 5KNDGTUVWHG $TQP\GUVWHG OKV 5EJYGTVGTP VGKNU XGTIQNFGV VGKNU XGTUKNDGTV HÒPH CP   $·PFGTPKPQTFGPVNKEJGP'TJCNVWPIGP 5VÒEM++



/GFCKNNG'TKPPGTWPIUMTGW\CPFGP-TKGI=/GFCNKC%TWEGC%QOGOQTCVKXCCTC\DQKWNWK ? -QPXQNWV XQP FTGK #WUICDGP  WPF \YGK #WUICDGP  WPVGTUEJKGFNKEJG   #WUHÒJTWPIGPFTGKOKV$·PFGTPFCXQP\YGKOKVLG\YGK$CPFURCPIGPWPF6#4)7.1%0# D\YWPF%#42#6+KPQTFGPVNKEJGP'TJCNVWPIGP 5VÒEM++



/KNKV·T WPF <KXKN&KGPUVCWU\GKEJPWPIGP -QPXQNWV XQP XKGT 'ZGORNCTGP /GFCKNNG HÒT :8 ,CJTG   &GMQTCVKQP HÒT ::8 ,CJTG Z  WPF <KXKNMTGW\ HÒT ::8 ,CJTG WPVGTUEJKGFNKEJG /GVCNNG VGKNYGKUG   XGTIQNFGV\YGKCP$·PFGTPKPQTFGPVNKEJGT'TJCNVWPI ++



9362

9363

ex 9364

9365



1TFGP .CPFGUYCEJV =1TFKPWN 5VTCLC 6CTKK? -TGW\ ++ -NCUUG 8GTIQNFWPI ITÌ­VGPVGKNU XGTICPIGP   VGKNYGKUGGOCKNNKGTV'OCKNNGOCNGTGKFKGUGVGKNYGKUGDGTKGDGPCP0CFGN ++





/GFCKNNG.CPFGUYCEJV=/GFCNKC5VTCLC6CTKK?/QFGNN OKVFGP$WEJUVCDGP1'64 $TQP\G OGFCKNNG$TQP\GCO$CPF ++





/GFCKNNG HÒT 8GTFKGPUVG WO *CPFGN WPF +PFWUVTKG -QPXQNWV XQP FTGK /GFCKNNGP   )QNFGPG /G   FCKNNG$TQP\GXGTIQNFGV 5KNDGTPG/GFCKNNG$TQP\GXGTUKNDGTV $TQP\GPG/GFCKNNG,GYGKNUCPFGP QTKIKPCNGP$·PFGTPTWO·PKUEJGT0·JCTV-47 5VÒEM++



/GFCKNNG (GTFKPCPF + /GFCKNNG HÒT /KNKV·TCPIGJÌTKIG $TQP\G CO QTKIKPCNGP $CPF TWO·PKUEJGT   0·JCTVOKVCWHIGNGIVGP5EJYGTVGTP-4 ++



 94


RUMÄNIEN

9368

ex 9372 (1:1)

ex 9371 (1:1) ex 9366















-QPXQNWV XQP  'TKPPGTWPIUOGFCKNNGP /GFCKNNG (GTFKPCPF Z OKV WPF Z QJPG $CPF /GFCKNNG   2GNGU CO $CPF KO 1TKIKPCNGVWK /GFCKNNG *WPFGTVLCJTHGKGT -ÌPKI %CTQN + Z OKV $CPF WPF   $CPFURCPIG 241 2#64+# Z OKV $CPF WPF Z QJPG $CPF /GFCKNNG #WHUEJYWPI FGU .CPFGU Z   OKV$CPFWPF$CPFURCPIG%#42#6+WPFZOKV$CPF<KXKNG,WDKN·WOUOGFCKNNG%CTQN+ZOKV $CPF+PUGJTQTFGPVNKEJGP'TJCNVWPIGP 5VÒEM++



/GFCKNNG$GNQJPWPIFGT#TDGKVHÒTFKG-KTEJG=/GFCNKC4CURNCVC/WPEKKRGPVTW$KUGTKEC?/Q FGNN   /GFCKNNG  -NCUUG $TQP\G XGTIQNFGV CO QTKIKPCNGP $CPF KP TWO·PKUEJGT 0·JCTV   &C\W /GFCKNNG $GNQJPWPI FGT #TDGKV KP FGT 8QNMUGT\KGJWPI /GFCKNNG-NCUUGXGTUKNDGTVCO$CPF TWO·PKUEJGT0·JCTV 5VÒEM++



)TQ­G1TFGPUUEJPCNNGGKPGU1HHK\KGTUCWUFGO'TUVGP9GNVMTKGIOKVHÒPH#WU\GKEJPWPIGP 1TFGP -TQPG4WO·PKGPU/QFGNN  #WUICDG OKV-TQPGKP5KNDGT 4KVVGTMTGW\ OKV 5EJYGTVGTP HTCP\ÌUKUEJG #PHGTVKIWPI 5KNDGT GOCKNNKGTV   1TFGP 5VGTP 4WO·PKGPU  /QFGNN  

  #WUHÒJTWPI HÒT /KNKV·TXGTFKGPUV KP (TKGFGPU\GKVGP OKV 5EJYGTVGTP ÒDGT FGO -TGW\    4KVVGTMTGW\ GKPHCEJG #PHGTVKIWPI $TQP\G XGTUKNDGTV WPF GOCKNNKGTV OKV %JKRU   /KNKV·T&KGPUVCW   \GKEJPWPI HÒT 1HHK\KGTG &GMQTCVKQP HÒT ::8 &KGPUVLCJTG $TQP\G XGTIQNFGV VGKNYGKUG 8GTUKNDGTV     'TKPPGTWPIUMTGW\ HÒT FGP -TKGI  OKV  $CPFURCPIGP #4&'#. %#42#6+ ,+7   1+67<6)1)0#WPF #NNKKGTVG5KGIGUOGFCKNNG#P0CFGN ++



-QPXQNWV XQP  'JTGP\GKEJGP WPF /GFCKNNGP )TÌ­VGPVGKNU KP $TQP\G CDGT CWEJ KP 5KNDGT VGKNU   GOCKNNKGTVVGKNUCP$·PFGTPKPWPVGTUEJKGFNKEJGP'TJCNVWPIGPUQYKG\YGKNGGTG8GTNGKJWPIUGVWKUFC\W GKPG/GFCKNNGFGT8QNMUTGRWDNKMCP2GPVCIQPCNURCPIG 5VÒEM++



-QPXQNWVXQPUGEJUXGTUEJKGFGPGP#WU\GKEJPWPIGP&CTWPVGT2GNGUEJ/GFCKNNG-ÌPKI%CTQN,WDKN· WOUOGFCKNNGHÒT/KNKV·TCPIGJÌTKIGCO&TGKGEMUDCPFHÒT#WUN·PFGT5CPKV·VU8GTFKGPUVMTGW\-NCUUG #D\GKEJGP FGT 0CVKQPCNGP )GUGNNUEJCHV HÒT .GKDGUÒDWPIGP WPF 5RQTV 10'( 8GTUEJKGFGPG /GVCNNG   VGKNU XGTIQNFGV VGKNU XGTUKNDGTV GKPGU VGKNYGKUG GOCKNNKGTV XKGT CP$·PFGTPGKPGUCP0CFGNKPUGJTQT FGPVNKEJGP'TJCNVWPIGP 5VÒEM++



-QPXQNWV XQP FTGK 1TFGPUOKPKCVWTGP   1TFGP 5VGTP 4WO·PKGPU  /QFGNN 4KVVGTMTGW\ OKV   5EJYGTVGTP 1TFGP5VGTP4WO·PKGPU/QFGNN4KVVGTMTGW\ 1TFGP-TQPG4WO·PKGPU/QFGNN 1HHK\KGTUMTGW\OKV5EJYGTVGTP QJPG-TQPG 8GTUEJKGFGPG/GVCNNGVGKNUXGTIQNFGVVGKNUXGTUKNDGTVLGY GOCKNNKGTVGKPGUCO$·PFEJGPKPUGJTQTFGPVNKEJGP'TJCNVWPIGP&C\W\YGK-PQRHNQEJTQUGVVGP  5VÒEM++



-QPXQNWV XQP UKGDGP XGTUEJKGFGPGP 'JTGP\GKEJGP/KPKCVWTGP   8GTFKGPUVOGFCKNNG HÒT *CPFGN WPF   +PFWUVTKG-NCUUG 8GTFKGPUVOGFCKNNGHÒT*CPFGNWPF+PFWUVTKG-NCUUG 8GTFKGPUVOGFCKNNGHÒT *CPFGN WPF +PFWUVTKG  -NCUUG   2GNGUEJ/GFCKNNG   /GFCKNNG #WHUEJYWPI FGU .CPFGU   -ÌPKI   %CTQN+,WDKN·WOUOGFCKNNGHÒT<KXKN -TKGIUGTKPPGTWPIUMTGW\VGKNUXGTIQNFGVVGKNUXGTUKN DGTVCNNGCP$·PFEJGPKPUGJTQTFGPVNKEJGP'TJCNVWPIGP 5VÒEM++



/KPKCVWTGPXQPTWO·PKUEJGP'JTGP\GKEJGPUKPFYGKVCWUUGNVGPGT\WHKPFGPCNUFKG/KPKCVWTGPFGT1TFGP

95


RUMÄNIEN

9373 9375

9374







-ÌPKINKEJ 4WO·PKUEJG /KNKV·TCMCFGOKG #D\GKEJGP HÒT .GJTGT WPF JÌJGTG 8GTYCNVWPIUCPIGUVGNNVG   5KNDGT VGKNYGKUG GOCKNNKGTV 'OCKNNGOCNGTGK OKV #DURNKVVGTWPIGP KP FGT YGK­GP 'OCKNNG GKPKIGT   -TQPGPRGTNGPKPFGTTQVGP'OCKNNGFGT-TQPGPJCWDGCPFGT5RKV\GFGU9CRRGPUWPFCWH\YGK$N·VVEJGP FGU -TCP\GU CWH FGT 4ÒEMUGKVG OGJTHCEJ RWP\KGTV W C GT 5KNDGTRWP\G WPF *GTUVGNNGTDG\GKEJPWPI   FGT(KTOC$TÒFGT5EJPGKFGTKP9KGPCP0CFGNFKGUGGDGPHCNNUIGRWP\V 44++



-ÌPKINKEJ 4WO·PKUEJG /KNKV·TCMCFGOKG )QNFGPGU #D\GKEJGP HÒT JÌJGTG #DUQNXGPVGP 5KNDGT VGKN   YGKUGXGTIQNFGVVGKNYGKUGGOCKNNKGTV'OCKNNGOCNGTGK8GTIQNFWPIVGKNYGKUGDGTKGDGP'OCKNNGUEJ·FGPKO 9CRRGPWPFKPFGT-TQPGCWHFGT4ÒEMUGKVG.ÌVURWTGPCWHITWPFFGT9KGFGTDGHGUVKIWPIFGU#FNGTUCP 0CFGN 44++p+++



7PDGMCPPVGUOKNKV·TKUEJGU#D\GKEJGP5KNDGTVGKNYGKUGXGTIQNFGVWPFGOCKNNKGTVCWHFGT4ÒEMUGKVG*GT UVGNNGTDG\GKEJPWPIFGT(KTOC&GEQOGFKP$WMCTGUV*GTUVGNNGTRWP\G--WPFGT5KNDGTRWP\G ++



9376



9377

9378

9379

#D\GKEJGP HÒT #DUQNXGPVGP FGU /KNKV·T)[OPCUKWUOU  /QFGNN )QNFGPGU #D\GKEJGP 5KNDGT VGKN   YGKUG XGTIQNFGV 8GTIQNFWPI ITÌ­VGPVGKNU DGTKGDGP VGKNYGKUG GOCKNNKGTV CWH FGT 4ÒEMUGKVG /CVTKMGN   PWOOGTOKV$GHGUVKIWPIUURCPIG 4++





#D\GKEJGP HÒT #DUQNXGPVGP FGU /KNKV·T)[OPCUKWUOU  /QFGNN 5KNDGTPGU #D\GKEJGP $TQP\G XGT   UKNDGTVVGKNYGKUGGOCKNNKGTVCP0CFGN ++





8QTOKNKV·TKUEJGU #D\GKEJGP =+PUKIPC 2TGOKNKVCTC?  /QFGNN OKV /QPQITCOO -ÌPKI %CTQNU ++     #D\GKEJGP-NCUUGXGTUKNDGTVVGKNYGKUGGOCKNNKGTV'OCKNNGOCNGTGKCP0CFGN-47 ++



#D\GKEJGP FGT 1TICPKUCVKQP FGT 4GUGTXKUVGP WPF RGPUKQPKGTVGP 1HHK\KGTG 5KNDGT XGTIQNFGV WPF VGKN   YGKUGGOCKNNKGTVCWHFGT4ÒEMUGKVG/CVTKMGNPWOOGT0QCP0CFGNFKGOKV*GTUVGNNGTRWP\G/0 WPF5KNDGTRWP\GHÒTGT5KNDGTDKU\WUCOOGPOKV/KPKCVWTCD\GKEJGPCP5EJTCWDGOKV5EJTCWD UEJGKDGKOQTKIKPCNGP8GTNGKJWPIUGVWKFGT(KTOC%CTPKQNOKVIQNFHCTDGPGO/QPQITCOO-ÌPKI%CTQNU++ 5VÒEM+p++





96


RUMÄNIEN

9381

9383

9380 9382



#D\GKEJGP4GIKOGPVUFGTTWO·PKUEJGP)GDKTIUL·IGT5KNDGTGOCKNNKGTV'OCKNNGOCNGTGKCP0CFGN FKGUGOGJTHCEJRWP\KGTVWCOKV*GTUVGNNGTRWP\G--*GTUVGNNWPIUPWOOGTWPF,CJTGURWP\G HÒT 44++





#D\GKEJGP YCJTUEJGKPNKEJ FGT -ÌPKINKEJ 4WO·PKUEJGP #WVQOQDKN)GUGNNUEJCHV 5KNDGT GOCKNNKGTV   OKP#WUDTWEJKPFGTTQVGP'OCKNNGKOQTKIKPCNGP8GTNGKJWPIUGVWKFGT(KTOC&GEQOGFKP$WMCTGUVOKV FGOIQNFHCTDGPGP/QPQITCOO-ÌPKI%CTQNU++ VGKNYGKUGXGTDNC­V  ++



#D\GKEJGP GKPGT WPDGMCPPVGP -ÌPKINKEJ TWO·PKUEJGP )GUGNNUEJCHV $TQP\GUVWHG $TQP\G VGKNYGKUG   GOCKNNKGTV CWH FGT 4ÒEMUGKVG /CVTKMGNPWOOGT  CP 0CFGN GKPGO YQJN PKEJV RCUUGPFGP 8GTNGK   JWPIUGVWKFGT(KTOC&GEQTOGFKP$WMCTGUV ++



7PDGMCPPVGU #D\GKEJGP YCJTUEJGKPNKEJ GKPGU TWO·PKUEJGP 4GIKOGPVU 5KNDGT CWH FGT 4ÒEMUGKVG   $TQUEJKGTWPIUU[UVGOKOQTKIKPCNGP8GTNGKJWPIUGVWKFGT(KTOC*GKPTKEJ9GKUUKP$WMCTGUVOKVIQNFHCT DGPGO/QPQITCOO-ÌPKI%CTQNU++ 4++



 

ex 9384

ex 9385

ex 9387

ex 9388



#WU\GKEJPWPIU#D\GKEJGP FGT 0CVKQPCNGP )GUGNNUEJCHV XQO 4QVGP -TGW\ KP 4WO·PKGP $TQP\G   GOCKNNKGTVOKP'OCKNNGEJKRCWHFGT4ÒEMUGKVG/CVTKMGNPWOOGTCP0CFGN\WUCOOGPOKVFGT QTKIKPCNGP8GTNGKJWPIUWTMWPFGOKVKFGPVKUEJGT/CVTKMGNPWOOGTHÒT1PQFK,GTQPCFCVKGTV,WPK OKV1TKIKPCNWPVGTUEJTKHVGPFGU2T·UKFGPVGPWPFFGU)GPGTCNUGMTGV·TUFGT)GUGNNUEJCHVOGJTHCEJIGHCNVGV WPFGVYCUDGUEJ·FKIV 5VÒEM+++++





#WU\GKEJPWPIU#D\GKEJGP FGT 0CVKQPCNGP )GUGNNUEJCHV XQO 4QVGP -TGW\ KP 4WO·PKGP $TQP\G   GOCKNNKGTV OKP 'OCKNNGEJKR CWH FGT 4ÒEMUGKVG /CVTKMGNPWOOGT  CP 0CFGN \WUCOOGP OKV   #D\GKEJGP FGT 0CVKQPCNGP )GUGNNUEJCHV XQO 4QVGP -TGW\ KP 4WO·PKGP $TQP\G CWH FGT 4ÒEMUGKVG   *GTUVGNNWPIUDG\GKEJPWPI/0FGT/QPGVCTKC0CVKQPCNCWPF/CVTKMGNPWOOGTCP0CFGN  5VÒEM++



-QPXQNWV XQP  #D\GKEJGP -NGKPCD\GKEJGP GVE 8QTYKGIGPF CWU FGO -ÌPKITGKEJ 4WO·PKGP KP   XGTUEJKGFGPGP/GVCNNGPVGKNUXGTIQNFGVVGKNUXGTUKNDGTVVGKNUGOCKNNKGTVVGKNUCP0CFGNPKPWPVGTUEJKGFNK EJGP'TJCNVWPIGP 5VÒEM++++p++++++





81.-54'27$.+-    

1TFGPFGT#TDGKV=1TFKPWN/WPEKK?/QFGNN OKV424KO9CRRGP &GMQTCVKQP-NCUUG DTQP\KGTV WPF VGKNYGKUG GOCKNNKGTV CP 0CFGN &C\W /GFCKNNG FGT #TDGKV 5KNDGT   CP 2GPVCIQPCN   $CPFURCPIG54<- 5VÒEM++



-QPXQNWV XQP FTGK 1TFGP FGT 8QNMUTGRWDNKM 4WO·PKGP 424    1TFGP 5VGTP FGT 8QNMUTGRWDNKM   4WO·PKGP  /QFGNN   5VGTP  -NCUUG 5KNDGT CP 0CFGN   1TFGP /KNKV·T8GTFKGPUV    /QFGNN    -NCUUG CP 2GPVCIQPCN$CPFURCPIG   1TFGP #WIWUV/QFGNN     -NCUUG CP 2GPVCIQPCN$CPFURCPIG LGYGKNU KO QTKIKPCNGP 8GTNGKJWPIUGVWK &C\W   1TFGP   /KNKV·T8GTFKGPUV  /QFGNN    -NCUUG CP 2GPVCIQPCN$CPFURCPIG 0KEJV VTCIDCTG   /GFCKNNG,WNKWU(WEKMLGYGKNUKO'VWK 5VÒEM++

 97


RUMÃ&#x201E;NIEN

ex 9389

ex 9391

ex 9390

51<+#.+56+5%*'4'27$.+-   





1TFGP6WFQT8NCFKOKTGUEW=1TFKPWN6WFQT8NCFKOKTGUEW?-QPXQNWVFGT$TWUVUVGTPGWPFDKU -NCUUGXGTIQNFGVD\YXGTEJTQOVD\YDTQP\GHCTDGPVGKNUGOCKNNKGTVFKG-NCUUGDGUGV\V¯LQWTOKV 5KOKNKUVGKPGPLGYGKNUCP0CFGNP54<- 5VÃ&#x2019;EM+p++



1TFGP8GTVGKFKIWPIFGU8CVGTNCPFGU=1TFKPWN#RCTCTGC2CVTKGK?/QFGNN OKV454KO/GFCKN NQP    XQNNUV·PFKIGT 5CV\ FGT  DKU  -NCUUG $WPVOGVCNN VGKNYGKUG XGTUKNDGTV VGKNYGKUG   XGTIQNFGVVGKNYGKUGGOCKNNKGTVCP0CFGND\YCP2GPVCIQPCNDCPFURCPIG54<-  5VÃ&#x2019;EM+p++



1TFGP HÃ&#x2019;T DGUQPFGTG IGNGKUVGVG &KGPUVG \WT 8GTVGKFKIWPI FGT UQ\KCNGP 1TFPWPI WPF FGU 5VCCVGU   =1TFKPWNRGPVTW5GTXKEKK&GQUGDKVG#FWUGÃ&#x201E;P#RCTCTGC1TÃ&#x201E;PFWKTKK5QEKCNGUKFG5VCV?$TWUVUVGTPGFGT  WPF  -NCUUG $WPVOGVCNN XGTUKNDGTV D\Y DTQP\KGTV VGKNYGKUG GOCKNNKGTV LGYGKNU OKV 5KOKNKUVGKPGP   DGUGV\VLGYGKNUCP0CFGNWPF/GFCKNNGXGTUKNDGTVCP$CPFURCPIG54<-  5VÃ&#x2019;EM++



ex 9392













98

ex 9393

ex 9394

ex 9395

1TFGP5CPKV·VU8GTFKGPUV=1TFKPWN/GTKVWN5CPKVCT?$TWUVUVGTPGWPF-NCUUG$TQP\GXGTUKNDGTV D\Y DTQP\GHCTDGP LGYGKNU VGKNYGKUG GOCKNNKGTVWPFOKV5KOKNKUVGKPGPDGUGV\VCP0CFGNP&C\W1TFGP FGT #TDGKV =1TFKPWN /WPEKK?  /QFGNN OKV 454 KO 9CRRGP    &GMQTCVKQP  WPF    -NCUUG XGTIQNFGV VGKNYGKUG XGTUKNDGTV D\Y DTQP\KGTV VGKNYGKUG GOCKNNKGTV CP 0CFGN 54    <- 5VÃ&#x2019;EM+p++



1TFGP 9KUUGPUEJCHVU8GTFKGPUV =1TFKPWN /GTKVWN 5VKKPVKHKE? 8QNNUV·PFKIGT 5CV\ FGT $TWUVUVGTPG    DKU  -NCUUG $TQP\G XGTIQNFGV D\Y XGTUKNDGTV D\Y DTQP\GHCTDGP LGYGKNU GOCKNNKGTV CP 0CFGNP   UQYKGFGT/GFCKNNGXGTIQNFGVCO$CPF54<- 5VÃ&#x2019;EM+p++



1TFGP 8GTFKGPUV WO FKG -WNVWT =1TFKPWO /GTKVWN %WNVWTCN? 8QNNUV·PFKIGT 5CV\ FGT  DKU    -NCUUG XGTIQNFGV D\Y XGTUKNDGTV D\Y DTQP\GHCTDGP LGYGKNU GOCKNNKGTV CP 0CFGNP 54    <- 5VÃ&#x2019;EM+p++



1TFGP8GTFKGPUVGWOFKG.CPFYKTVUEJCHV=1TFKPWN/GTKVWN#ITKEQN?8QNNUV·PFKIGT5CV\FGTDKU  -NCUUG XGTIQNFGV D\Y XGTUKNDGTV D\Y DTQP\GHCTDGP LGYGKNU VGKNYGKUG GOCKNNKGTV CP 0CFGNP   54<- 5VÃ&#x2019;EM+p++



/KNKV·T8GTFKGPUVQTFGP =1TFKPWN /GTKVWN /KNKVCT?  /QFGNN OKV 454 KO 9CRRGP      XQNNUV·PFKIGT5CV\FGTDKU-NCUUGXGTIQNFGVD\YXGTUKNDGTVD\YDTQP\GHCTDGPLGYGKNUGOCKNNKGTV CP 2GPVCIQPCN$CPFURCPIGP KP KJTGP IQNFHCTDGP DGFTWEMVGP 8GTNGKJWPIUGVWKU &C\W  -NCUUG FGU    /QFGNNU OKV 424 KO 9CRRGP    $TQP\G GOCKNNKGTV CP 2GPVCIQPCN$CPFURCPIG KO   IQNFHCTDGPDGFTWEMVGP8GTNGKJWPIUGVWK54 5VÃ&#x2019;EM++



-QPXQNWVXQP#WU\GKEJPWPIGPFGT8QNMUTGRWDNKMFGT5Q\KCNKUVKUEJGP4GRWDNKMWPFFGT$Ã&#x2019;TIGT NKEJGP 4GRWDNKM CD  8GTUEJKGFGPG /GVCNNG VGKNU XGTIQNFGV VGKNU XGTUKNDGTV VGKNU GOCKNNKGTV CP   $CPFURCPIGP 2GPVCIQPCN$CPFURCPIGP QFGT 6TCIGURCPIGP KP QTFGPVNKEJGP 'TJCNVWPIGP FTGK KP 'VWKU   &C\W\YGK#D\GKEJGPXGTIQNFGVWPFGOCKNNKGTVCP0CFGNP 5VÃ&#x2019;EM++




RUSSLAND

9398

&4+66'4'27$.+- UGKV  

1TFGP 5VGTP 4WO·PKGPU =1TFKPWN 5VGCWC 4QO³PKGK? CWEJ 1TFGP FGU 5VGTPU XQP 4WO·PKGP     /QFGNN UGKV   QHHK\KGNNG /KPKCVWT \WO 1HHK\KGTUMTGW\ 5KNDGT XGTIQNFGV WPF GOCKNNKGTV WPF   QHHK\KGNNG /KPKCVWT \WO 4KVVGTMTGW\ 5KNDGT GOCKNNKGTV &C\W &QMWOGPVCVKQP KP TWO·PKUEJGT WPF   GPINKUEJGT5RTCEJG 5VÒEM4++ 8QP FKGUGP XQP FGT /QPGVCTKC 5VCVCNWK KP $WMCTGUV JGTIGUVGNNVGP QHHK\KGNNGP /KPKCVWTGP FGU JÌEJUVGP TWO·PKUEJGP   1TFGPU YWTFGP NCWV FGT DGKIGHÒIVGP &QMWOGPVCVKQP PWT  5VÒEM FGU 1HHK\KGTUMTGW\GU WPF  5VÒEM FGU 4KVVGT   MTGW\GURTQFW\KGTV0CEJFGT2WDNKMCVKQPFGU)GUGV\GUXQPKUVFKGQHHK\KGNNG*GTUVGNNWPIFKGUGT/KPKCVWTGP GKPIGUVGNNVYQTFGP



9399 (1:1)

4755.#0& 4WUUKUEJG7TMWPFGPUKGJG-CV0TP

<#4'067/ $+5  

-CKUGTNKEJGT 1TFGP FGU JGKNKIGP (ÒTUVGP #NGZCPFGT 0GYUM[ =Îðäåí èìïåðáòîðñêèé Ñâÿàòîãî   Êíÿçÿ Àëåêñàíäðà Íåâñêîãî?/QFGNN  $TWUVUVGTPFGT1TFGPUTKVVGTZOO )QNFWPF5KNDGTNCCP5VKEMGTGK2CKNNGVVGPFKG5VTCJNGPFGU5VGTPUWPFFCU/GFCKNNQPHGNFCWU5KNDGTDNGEJ FKG 5EJNCWHGP \WO #PP·JGP CNNGTITÌ­VGPVGKNU PQEJ XQTJCPFGP FKG TÒEMUGKVKIG 2CRKGTCDFGEMWPI IGNÌUV   CWH FGT 2CRKGTCDFGEMWPI KUV \WT 8GTUV·TMWPI PQEJ GKPG 5EJGKDG CWU JGNNGO .GFGT CWHIGDTCEJV <-    44++ 

5GJTUGNVGPGU'ZGORNCTCWUFGOGTUVGP8KGTVGNFGU,CJTJWPFGTVUKPHÒTUGKP#NVGTJGTXQTTCIGPFGT'TJCNVWPIWPF XQP CNNGTITÌ­VGT 5GNVGPJGKV &GT GKPMNCUUKIG 1TFGP YWTFG XQP <CTKP -CVJCTKPC + #NGZGKLGYPC   OKV   7MCUXQO/CKIGUVKHVGV'TYWTFGPCEJ#NGZCPFGT,CTQUNCYKVUEJ0GYUMK(ÒTUVXQP0QYIQTQFWPF)TQ­ HÒTUVXQP9NCFKOKT  DGPCPPV'TUVCO#RTKNFGO6CIUGKPGT-TÌPWPIYWTFGPXQP<CT2CWN+ 2GVTQYKVUEJ  FKG1TFGPUUVCVWVGPCRRTQDKGTV#NUDGUQPFGTGT)PCFGPGTYGKUFGU<CTGPMQPPVGFGT1TFGP KP$TKNNCPVGPXGTNKGJGPYGTFGPYQDGKCWHFGP$TWUVUVGTPGPÒDGTFGO/GFCKNNQPGKPGMCKUGTNKEJG-TQPGCPIGDTCEJV YWTFG5GKVFGO#WIWUVMQPPVGPIGO·­GKPGTLGYGKNKIGPRGTUÌPNKEJGP'PVUEJGKFWPIFGU<CTGP4KVVGTFGU 5V#PFTGCU1TFGPUFKGFGP5V#NGZCPFGT0GYUM[1TFGPPQEJPKEJVGTJCNVGPJCVVGPFKGUGPINGKEJ\GKVKIOKVLGPGO GTJCNVGP #O  #WIWUV  YWTFGP FKG -NGKPQFG WPF CO  1MVQDGT  FKG $TWUVUVGTPG HÒT 0KEJV%JTKUVGP   GKPIGHÒJTV  YWTFG FKG 8GTNGKJWPIXQP$TWUVUVGTPGPKP/GVCNNQHHK\KGNNGKPIGHÒJTV/KVMCKUGTNKEJGO7MCU<CT #NGZCPFGT ++ 0KMQNCLGYKVUEJ   XQO  #WIWUV  YWTFGP IGMTGW\VG 5EJYGTVGT CWH FGP +PUKIPKGP HÒT   8GTNGKJWPIGP HÒT 6CRHGTMGKV KO -CORH GKPIGHÒJTV /KV #DUEJCHHWPI FGT /QPCTEJKG  XGTUEJYCPF CWEJ FGT   1TFGP +P IGYKUUGT 9GKUG YWTFG FKG 6TCFKVKQP FGU 1TFGPU CWEJ KP FGT UR·VGTGP 5QYLGVWPKQP HQTVIGHÒJTV FC OKV   &GMTGVFGU2T·UKFKWOUFGU1DGTUVGP5QYLGVUFGT7F554XQO,WNKGKP#NGZCPFGT0GYUM[1TFGPIGUVKHVGV YWTFG FGT HÒT ÒDGTTCIGPFG -CORHGUHÒJTWPI WPF RGTUÌPNKEJG 6CRHGTMGKV Y·JTGPF FGU )TQ­GP 8CVGTN·PFKUEJGP   -TKGIGU XQP  DKU  UQYQJN CP 'KP\GNRGTUQPGP YKG CWEJ CP ICP\G 'KPJGKVGP XGTNKGJGP YGTFGP MQPPVG &GT   XQP2T·UKFGPV$QTKU0,GN\KPOKV7MCUXQO/·T\IGUVKHVGVGXKGTMNCUUKIG1TFGP(ÒT8GTFKGPUVGWPFFCU8CVGT NCPFPCJOGKPKIG)GUVCNVWPIUGNGOGPVG TQVG(CTDGFGU-TGW\GUWPFFGU$CPFGU&QRRGNCFNGTWPF1TFGPUOQVVQ FGU \CTKUVKUEJGP5V#NGZCPFGT0GYUMK1TFGPUYKGFGTCWH

99


RUSSLAND

9400 (1:1)



-CKUGTNKEJGT 1TFGP FGU JGKNKIGP (ÒTUVGP #NGZCPFGT 0GYUM[ [Îðäåí èìïåðáòîðñêèé Ñâÿàòîãî   Êíÿçÿ Àëåêñàíäðà Íåâñêîãî]/QFGNN  1TFGPUUGVDGUVGJGPFCWU-NGKPQFOKV5EJYGT VGTPZOO.·PIGFGT5EJYGTVGTWPFOO)QNFGOCKNNKGTVI'OCKNNGOCNGTGK CWH FGP 5EJYGTVGTITKHHGP -QMQUEJPKMRWP\GP XQP  DKU  KP FGT ¤UG  <QNQVPKMK -Q   MQUEJPKM )QNFRWP\G XQP  DKU  WPF CWH FGO $CPFTKPI -QMQUEJPKMRWP\G XQP  DKU    QJPG 5EJWNVGTDCPF WPF $TWUVUVGTP OKV 5EJYGTVGTP JQEJIGYÌNDVG #PHGTVKIWPI FGT (KTOC   'FWCTFKP5V2GVGTUDWTI&WTEJOGUUGTOO5KNDGTTÒEMUGKVKIXGTIQNFGV#WHNCIGPVGKNYGKUG)QNF VGKNYGKUGGOCKNNKGTVICWHFGT4ÒEMUGKVG*GTUVGNNGTDG\GKEJPWPIÝÄÓÀÐÄÚ/GKUVGTOCTMGÂÄ HÒT8NCFKOKT&KPCMQX WPFPKEJVYKGDKUJGTQHV\KVKGTVHÒT8CTXCTC2GVTQYPC&KGVYCNF 5V2GVGTUDWTIGT  <QNQVPKMK -QMQUEJPKM 5KNDGTRWP\G XQP  DKU  UQYKG -QMQUEJPKMRWP\G XQP  DKU   CP0CFGNFKGUGGDGPHCNNUOKV-QMQUEJPKMRWP\GXQPDKU<- 5VÒEM8QPITQ­GT5GNVGPJGKV++  5GJTUR·V 'PFGQFGT#PHCPI CPIGHGTVKIVGUWP\YGKHGNJCHV\WUCOOGPIGJÌTGPFGUWPFQTKIKPCNGU5GVFGU\YGKV JÌEJUVGP TWUUKUEJGP 1TFGPU JKGT KPGKPGTDGUQPFGTUUGNVGPGP#WUHÒJTWPIOKV5EJYGTVGTPFGTPQEJCPGKPGP DGFGWVGPFGP)GPGTCNFGT#NNKKGTVGPXGTNKGJGPYWTFG5QYQJNFGTXQPFGT*GTUVGNNGTHKTOC'FWCTFKP5V2GVGTUDWTI IGMGPP\GKEJPGVG HÒT KJP V[RKUEJ JQEJIGYÌNDVG $TWUVUVGTP YKG CWEJ FCU -NGKPQF FCU YKT CWEJ QJPG CWUFTÒEMNKEJ   XQTJCPFGPG $G\GKEJPWPI FKGUGO *GTUVGNNGT \WUEJTGKDGP YGKUGP FKGV[RKUEJGP/GTMOCNGFGTUR·VGP#PHGTVKIWPIGP FKGUGT(KTOCCWH5QKUVFKG#PHGTVKIWPIUSWCNKV·VKP)TCXWT'OCKNNKGTWPF.ÌV#TDGKVGPFGWVNKEJIGTKPIGTCNUDGK FGP'FWCTF'ZGORNCTGPXQPXQT$GIKPPFGU'TUVGP9GNVMTKGIGUWPFJCNVGPMGKPGOSWCNKV·VUO·­KIGP8GTINGKEJOKV 5VÒEMGP FGT (KTOC -GKDGN UVCPF FKG LC PWT DKU  FKG GZMNWUKXG QHHK\KGNNG .KGHGTCPVKP FGU 1TFGPUMCRKVGNU YCT   $GOGTMGPUYGTV KUV CWEJ PQEJ GKP \WU·V\NKEJ DGOGTMDCTGU 3WCNKV·VUIGH·NNG DGK 5VÒEMGP ņ IGTCFG CWEJ XQP JQJGP   1TFGPWPF1TFGPUMNCUUGPņFKGPKEJVFWTEJFGP<CTGPQFGTCPFGTGO·PPNKEJG/KVINKGFGTFGTMCKUGTNKEJGP(COKNKG ōKP RGTUQPCOŋ XGTNKGJGP YWTFGP UQPFGTP FKG DGUQPFGTU DGK JQJGP /KNKV·T WPF 4GIKGTWPIUCPIGJÌTKIGP FGT   CWUN·PFKUEJGP #NNKKGTVGP \WUCOOGP OKV FGP 8GTNGKJWPIUWTMWPFGP FWTEJ FKG LGYGKNKIGP TWUUKUEJGP $QVUEJCHVGT   ÒDGTTGKEJVQFGTÒDGTJCWRVPWTRGT8GTUCPFCPFKG$GNKGJGPGPCWUIGJ·PFKIVYWTFGP  &KG(KTOC'FWCTFYWTFG\YKUEJGPWPFXQP'FWCTF(GTPCPFQYKEJ&KGVYCNFIGITÒPFGVWPFNKGHGTVGUGKV FGO 4WUUKUEJ,CRCPKUEJGP -TKGI CNUQ CD  CNU QHHK\KGNNGT .KGHGTCPV FGU 1TFGPUMCRKVGNU \WUCOOGP OKV FGT   # #FNGT IGJÌTGPFGP (KTOC 1UKRQX  FGP ITÌ­VGP #PVGKN TWUUKUEJGT 1TFGP 0CEJ UGKPGO 6QF  HÒJTVG UGKPG   9KVYG 8CTXCTC 2GVTQYPC &KGVYCNF FKG (KTOC YQJN DKU   YGKVGT WPF NKGHGTVG CWEJ PQEJ DKU \WT 1MVQDGT   4GXQNWVKQP1TFGPUKPUKIPKGPCPFKG2TQXKUQTKUEJG4GIKGTWPI

100


RUSSLAND 

-CKUGTNKEJGT 1TFGP FGU JGKNKIGP (ÒTUVGP #NGZCPFGT 0GYUM[ =Îðäåí èìïåðáòîðñêèé Ñâÿàòîãî   Êíÿçÿ Àëåêñàíäðà Íåâñêîãî?1TKIKPCNGU5EJ·TRGPUVÒEM\WO-NGKPQFOQKTKGTVEODTGKVEO NCPI ++



9402 (1:1)

1,5:1

1,5:1



-CKUGTNKEJGT 1TFGP FGU JGKNKIGP (ÒTUVGP #NGZCPFGT 0GYUM[ =Îðäåí èìïåðáòîðñêèé Ñâÿàòîãî   Êíÿçÿ Àëåêñàíäðà Íåâñêîãî? 4GFWMVKQP FGU 1TFGPUMNGKPQFU KP GKPGT ÌUVGTTGKEJKUEJGP #PHGTVKIWPI   CWUFGOGTUVGP&TKVVGNFGU,J)QNFGOCKNNKGTVIZOOQJPGLGINKEJG2WP\KGTWPIQJPG $CPF ++  'U JCPFGNV UKEJ JKGTDGK FGO /QFGIGUEJOCEM FGT FCOCNKIGP <GKV HQNIGPF WO GKPG 4GFWMVKQPKPGKPGTUGJTSWCNK V·VUXQNNGP'KP\GNPCPHGTVKIWPI WPVGT8GTYGPFWPIGKPGTIGRT·IVGPÌUVGTTGKEJKUEJGP-CKUGTMTQPG FKGCFKPVGTKOCO $CPFKO-PQRHNQEJIGVTCIGPYWTFG

9403 (1:1)



1,5:1

9403 (1:1)

-CKUGTNKEJGT 1TFGP FGU JGKNKIGP )TQ­O·TV[TGTU )GQTI FGU 5KGITGKEJGP =Îðäåí èìïåðáòîðñêèé   Ñâÿàòîãî Âåëèêîìó÷åíèêà è Ïîáåäîíîñöà Ãåîðãèÿ?-TGW\-NCUUG)QNFGOCKNNKGTVI QJPG $CPFTKPI 'OCKNNGOCNGTGKCWHFGT4ÒEMUGKVGVTCIGDGFKPIVNGKEJVG#DUEJÒTHWPIGPKO/GFCKNNQPKPFGT ¤UG<QNQVPKMK-QMQUEJPKM)QNFRWP\GXQPDKUWPFWPNGUGTNKEJG/GKUVGTOCTMGCPRGP VCIQPCNIGHCNVGVGO$CPF<- ++  101


RUSSLAND

9404 (1:1)



-CKUGTNKEJGT 1TFGP FGU JGKNKIGP )TQ­O·TV[TGTU )GQTI FGU 5KGITGKEJGP =Îðäåí èìïåðáòîðñêèé   Ñâÿàòîãî Âåëèêîìó÷åíèêà è Ïîáåäîíîñöà Ãåîðãèÿ?-PQRHNQEJOKPKCVWTFGU1TFGPUMTGW\GUZ OO5KNDGT/GFCKNNQP)QNFGOCKNNKGTV'OCKNNGOCNGTGKCWHIGNGIVCWH$CPFTQUGVVGCP-PQRHFGT 1TFGPUHKTOC5GFNCV\GMKP$GTNKP ++



9405 (1:1)

1,5:1

1,5:1



-CKUGTNKEJGT 1TFGP FGU JGKNKIGP )TQ­O·TV[TGTU )GQTI FGU 5KGITGKEJGP =Îðäåí èìïåðáòîðñêèé   Ñâÿàòîãî Âåëèêîìó÷åíèêà è Ïîáåäîíîñöà Ãåîðãèÿ? 5V )GQTIU5QNFCVGPMTGW\ #WUICDG HÒT FKG   2TGW­KUEJGP#NNKKGTVGPZOO5KNDGTCWHFGO4GXGTU6T·IGTPWOOGT0CNVG2TÒH -TCV\URWTCWHFGO4CPFFGUWPVGTGP-TGW\CTOUQJPG$CPF&+# ++  'ZGORNCTFGT#WMVKQP(TKV\4WFQNH-ÒPMGT1UPCDTÒEM0T





<CT0KMQNCWU+2CYNQYKVUEJ  UVKHVGVGFCU-TGW\KO,WNKCWU#PNC­FGT'PVJÒNNWPIFGU&GPMOCNUHÒT FKG 5EJNCEJV XQP $QTQFKPQ  5GRVGODGT   WPF XGTNKGJ GU CP CNNG PQEJ NGDGPFGP RTGW­KUEJGP 8GVGTCPGP FGT   5EJNCEJVGP\YKUEJGPWPF

9406





102

-CKUGTNKEJGT 1TFGP FGU JGKNKIGP )TQ­O·TV[TGTU )GQTI FGU 5KGITGKEJGP =Îðäåí èìïåðáòîðñêèé   Ñâÿàòîãî Âåëèêîìó÷åíèêà è Ïîáåäîíîñöà Ãåîðãèÿ? 5V )GQTIU5QNFCVGPMTGW\  /QFGNN  

XKGTMNCUUKI #WUHÒJTWPI  -TGW\-NCUUG5KNDGTCWHFGO4GXGTUPWOOG TKGTV0QCOCNVGP$CPFOKV$CPFUEJNGKHG&+# ++



-CKUGTNKEJGT 1TFGP FGU JGKNKIGP #RQUVGNINGKEJGP (ÒTUVGP 9NCFKOKT =Îðäåí èìïåðáòîðñêèé   Ñâÿàòîãî Ðàâíîàïîñòîëüíîãî Êíÿçÿ Âëàäèìèðà? 1TKIKPCNGU 5EJWNVGTDCPF \WT  -NCUUG OQKTKGTV   EODTGKVEONCPIVGKNYGKUGIGP·JV ++




RUSSLAND

9408 (1:1)

1,5:1



-CKUGTNKEJGT WPF -ÌPKINKEJGT 1TFGP XQO JGKNKIGP 5VCPKUNCWU =Îðäåí èìïåðáòîðñêèé è   êîðîëéâñêèé Ñâÿòîãî Ñòàíèñëàâà?/QFGNN  5GVFGT-NCUUGOKV5VGTPDGUVGJGPFCWU *CNUMTGW\#WUHÒJTWPI  ZOO)QNFGOCKNNKGTVI'OCKNNGOCNGTGK#D URNKVVGTWPIGP KP FGT ITÒPGP 'OCKNNG FGU .QTDGGTMTCP\GU FGT 8QTFGTUGKVG CWH FGO 4GXGTU FGU QDGTGP   -TGW\CTOUPWTVGKNYGKUGKFGPVKHK\KGTDCTG/GKUVGTOCTMG"?Ä"KPFGT¤UG<QNQVPKMK-QMQUEJPKM)QNF RWP\GXQPDKUCWHFGO$CPFTKPI-QMQUEJPKMRWP\GXQPDKUOKVQTKIKPCNGO CNVGO *CNUDCPFCDUEJPKVV \WUCOOGP OKV $TWUVUVGTP 5KNDGT VGKNYGKUG XGTIQNFGV WPF GOCKNNKGTV CWH FGT   4ÒEMUGKVG &QRRGNCFNGTRWP\G FGT *QHNKGHGTCPVGP XQP  DKU  *GTUVGNNGTDG\GKEJPWPI FGT (KTOC   -GKDGNKP5V2GVGTUDWTIWPF<QNQVPKMK-QMQUEJPKM5KNDGTRWP\GXQPDKUCP0CFGNFKGUG CWH FGT +PPGPUGKVG OKV FGP INGKEJGP 2WP\KGTWPIGP KO QTKIKPCNGP OKV FGT $G\GKEJPWPI IQNFHCTDGP DG   FTWEMVGP8GTNGKJWPIUGVWK 5VÒEM4++  +OQTKIKPCNGP8GTNGKJWPIUGVWKPKEJVJ·WHKI\WHKPFGP

103


RUSSLAND

9409 (1:1)

9409 (1:1)

1,5:1



-CKUGTNKEJGT WPF -ÌPKINKEJGT 1TFGP XQO JGKNKIGP 5VCPKUNCWU =Îðäåí èìïåðáòîðñêèé è   êîðîëéâñêèé Ñâÿòîãî Ñòàíèñëàâà?  /QFGNN   -TGW\ FGT  -NCUUG  #WUHÒJTWPI  

   Z  OO )QNF GOCKNNKGTV  I 'OCKNNGOCNGTGK OKP #DURNKVVGTWPIGP KP FGT   ITÒPGP'OCKNNGFGU.QTDGGTMTCP\GUCWHFGO4GXGTUFGUQDGTGP-TGW\CTOU&QRRGNCFNGTRWP\GFGT*QH NKGHGTCPVGPXQPDKUWPFCWHFGO4GXGTUFGUWPVGTGP-TGW\CTOU/GKUVGTOCTMG#-HÒT#NDGTV -GKDGNKP5V2GVGTUDWTICWHFGT¤UG<QNQVPKMK)QNFRWP\GXQPDKUOKVFGO2TQDKGTOGK UVGT\GKEJGP ßË HÒT ;CMQX .[CRWPQX OKV NCPIGO *CNUDCPFCDUEJPKVV KO QTKIKPCNGP OKV FGT $G\GKEJ   PWPIIQNFHCTDGPDGFTWEMVGP8GTNGKJWPIUGVWK<- ++  ;CMQX.[CRWPQXYCTCNU2TQDKGTOGKUVGTPWTXQPDKUV·VKI

9410 (1:1)



-CKUGTNKEJGT WPF -ÌPKINKEJGT 1TFGP XQO JGKNKIGP 5VCPKUNCWU =Îðäåí èìïåðáòîðñêèé è   êîðîëéâñêèé Ñâÿòîãî Ñòàíèñëàâà?  /QFGNN   -TGW\ FGT  -NCUUG  #WUHÒJTWPI  

 ZOO)QNFGOCKNNKGTVI'OCKNNGOCNGTGKOKPMCWOUKEJVDCTG#DRNCV\WP IGP KP FGT 'OCKNNG FGU .QTDGGTMTCP\GU CWH FGO 4GXGTU FGU QDGTGP -TGW\CTOU &QRRGNCFNGTRWP\G FGT   *QHNKGHGTCPVGPXQPDKUWPFCWHFGO4GXGTUFGUWPVGTGP-TGW\CTOU/GKUVGTOCTMG#-HÒT #NDGTV -GKDGN KP 5V 2GVGTUDWTI CWH FGT ¤UG 5V 2GVGTUDWTIGT  <QNQVPKMK )QNFRWP\G XQP  DKU   KO$CPFTKPI5V2GVGTUDWTIGT5VCFVRWP\GXQPDKUQJPG*CNUDCPF<- ++  8GTNKGJGP CO  5GRVGODGT  CP FGP -CRKV·PNGWVPCPV WPF UR·VGTGP -QPVTGCFOKTCN ,QJCPP %JTKUVKCP 9KNJGNO   $GTVTCOOKNKV·TKUEJGU/KVINKGFFGU4GKEJUOKNKV·TIGTKEJVU 7TMWPFGP0CEJNC­UKGJG-CV0T 

104


RUSSLAND

9411 (1:1)



-CKUGTNKEJGT WPF -ÌPKINKEJGT 1TFGP XQO JGKNKIGP 5VCPKUNCWU =Îðäåí èìïåðáòîðñêèé è   êîðîëéâñêèé Ñâÿòîãî Ñòàíèñëàâà?  /QFGNN   -TGW\ FGT  -NCUUG  #WUHÒJTWPI  

 ZOO)QNFGOCKNNKGTVI'OCKNNGOCNGTGKCWHFGO4GXGTUFGUQDGTGP-TGW \CTOUMCWOUKEJVDCTG&QRRGNCFNGTRWP\GFGT*QHNKGHGTCPVGPXQPDKUWPFCWHFGO4GXGTUFGU WPVGTGP -TGW\CTOU /GKUVGTOCTMG +- HÒT ,WNKWU -GKDGN KP 5V 2GVGTUDWTI CWH FGT ¤UG  <QNQVPKMK   )QNFRWP\GWPF,CJTGURWP\G!COQTKIKPCNGPCNVGP*CNUDCPF<- +p++  ,WNKWU +XCP  'FWCTF -GKDGN   NGTPVG DGK UGKPGO 8CVGT ,QJCPP 9KNJGNO -GKDGN   WPF YWTFG    /GKUVGT 0CEJ FGUUGP 6QF  ÒDGTPCJO GT UEJNKG­NKEJ FKG (KTOC WPF YWTFG FCOKV 'ZMNWUKXNKGHGTCPV FGU   1TFGUMCRKVGNU0CEJUGKPGO6QFÒDGTPCJOUGKP5QJP#NDGTV-QPUVCPVKP-GKDGN  FCU)GUEJ·HV

9412 (1:1)



-CKUGTNKEJGT WPF -ÌPKINKEJGT 1TFGP XQO JGKNKIGP 5VCPKUNCWU =Îðäåí èìïåðáòîðñêèé è   êîðîëéâñêèé Ñâÿòîãî Ñòàíèñëàâà?  /QFGNN   -TGW\ FGT  -NCUUG  #WUHÒJTWPI  

 ZOO)QNFGOCKNNKGTVI OKV$CPF 'OCKNNGOCNGTGKOKP#DRNCV\WPIGP KPFGTITÒPGP'OCKNNGFGU.QTDGGTMTCP\GUCWHFGO4GXGTUFGUQDGTGP-TGW\CTOUMCWOUKEJVDCTG&QR RGNCFNGTRWP\G FGT *QHNKGHGTCPVGP XQP  DKU  WPF CWH FGO 4GXGTU FGUWPVGTGP-TGW\CTOU/GK UVGTOCTMG#-HÒT#NDGTV-GKDGNKP5V2GVGTUDWTICWHFGT¤UG5V2GVGTUDWTIGT<QNQVPKMK)QNFRWP\G XQPDKUCOQTKIKPCNGPCNVGP$CPF<- ++



0CEJFGO6QFXQP,WNKWU+XCP-GKDGNKO,CJTÒDGTPCJOUGKP5QJP#NDGTV-QPUVCPVKP-GKDGN  FCU )GUEJ·HV8QPDKUJCVVGGTCNUQHHK\KGNNGT1TFGPULWYGNKGTGKPGP'ZNWUKXXGTVTCIOKVFGO1TFGPUMCRKVGN&C FGT8GTVTCIXQP#NDGTV-GKDGNOKVFGO1TFGPUMCRKVGNPKEJVGTPGWGTVYWTFGNKGHGTVGGTFQTVJKPPWTDKU

9413



/KNKV·T1TFGP8KTVWVK/KNKVCTKŌ/QFGNN OKVFGT,CJTGU\CJN -TGW\-NCUUGZ OO5KNDGTQJPG$CPF<- ++p



&GT 1TFGP KUV Y·JTGPF FGU RQNPKUEJGP #WHUVCPFGU FCU 5[ODQN FGU 9KGFGTUVCPFGU IGIGP FKG TWUUKUEJG *GTTUEJCHV   IGYQTFGPWPFDGUQPFGTUKPFGPWPVGTGP-NCUUGPKPGKPGTITÌ­GTGP#P\CJN /QFGNN XGTNKGJGPYQTFGP7OPCEJ FGT GPFIÒNVKIGP 0KGFGTUEJNCIWPI KO *GTDUV  FCU RQNPKUEJG CWHUV·PFKUEJG /KNKV·T \W FGOÒVKIGP PCJO <CT   0KMQNCWU+  FGP1TFGPWPVGTFKGTWUUKUEJGPCWHOKVFGT,CJTGU\CJNCWHFGT4ÒEMUGKVG /QFGNN  WPFXGTICDFKGUGPHÒT6CRHGTMGKVCPFKGUKGITGKEJGPTWUUKUEJGP1HHK\KGTG7PVGTQHHK\KGTGWPF5QNFCVGPYQDGK GDGPHCNNUFKG-NCUUGJ·WHKI\WT8GTNGKJWPIMCO2QNPKUEJG2JCNGTKUVKMGTDGVTCEJVGPVGKNYGKUGFKGUGU/QFGNNCNU PKEJVFGO1TFGP\WIGJÌTKI

105


RUSSLAND

9414 (1:1)

9414 (1:1) 1,5:1



/GFCKNNGHÒT'KHGT=[Ìåäàë "Çà Óñåðä³å?/QFGNN OKVFGO2QTVTCKV<CT#NGZCPFGT++PCEJTGEJVUņ !  )TQ­G )QNFOGFCKNNG #WUHÒJTWPI OKV 5VGORGNUEJPGKFGT\GKEJGPÏ.Ì.KO*CNUDCPFCDUEJPKVV )QNFI OKV$CPF CO*CNUDCPFFGU5V#PPGP1TFGPU&+# +p++  'ZGORNCTFGT#WMVKQP(TKV\4WFQNH-ÒPMGT1UPCDTÒEM0T&KCMQXPGPPVFKGUG#WUHÒJTWPIPKEJV

9418

9415 9416 9417



5V)GQTIU/GFCKNNGHÒT6CRHGTMGKV/GFCKNNG5VWHG5KNDGTCWHFGT4ÒEMUGKVG6T·IGTPWOOGT0Q QJPG$CPF&+# ++





/GFCKNNGHÒT'KHGT=Ìåäàë "Çà Óñåðä³å"?/QFGNN OKVFGO2QTVTCKV<CT0KMQNCWU++  -NGKPG 5KNDGTOGFCKNNG  ITÌ­GTG  #WUHÒJTWPI &WTEJOGUUGT  OO CO $CPF FGU 5V 5VCPKUNCWU   1TFGPU&+# ++



-TGW\ HÒT FKG 'TUVÒTOWPI FGT (GUVWPIXQP1EJCMQY#NVGTGKPUGKVKIGT<KPPCDUEJNCI=QNFQPG UKFG EQNNGEVQT U EQR[ OCFG HTQO VJG QTKIKPCN UVCOR? FGT4ÒEMUGKVGCOCNVGP$CPFUVÒEMFGU5V9NCFK OKT1TFGPU ++





'ZGORNCT FGT #WMVKQP (TKV\ 4WFQNH -ÒPMGT  1UPCDTÒEM  0T  +O 1TKIKPCN YCT FCU -TGW\ KP )QNF   IGHGTVKIV

 106

/GFCKNNG HÒT 6CRHGTMGKV KP FGP (KPPKUEJGP )GY·UUGTP CO  #WIWUV   6[R 5KNDGT UVCTM   IGVTCIGP&+# +++p+8




RUSSLAND

9419

9420



/GFCKNNGHÒTFKG'TQDGTWPIXQP2CTKU5KNDGTPG/GFCKNNG5KNDGTQJPG$CPF&+#

++





)GFGPMMTGW\CPFGP-TKOMTKGIHÒT(GNFIGKUVNKEJG-WRHGTQJPG$CPF&+#

++



'ZGORNCTFGT#WMVKQP(TKV\4WFQNH-ÒPMGT1UPCDTÒEM0T

9421 (1:1)



)QNFGPG UEJYGK\GT )GUEJGPMUCXQPPGVVG<CT0KMQNCWU++D\YXQP/KVINKGFGTPFGT<CTGPHCOKNKG )QNF)GUCOVIGYKEJVI&WTEJOGUUGTOOYGK­GU<KHHGTPDNCVVOKVTÌOKUEJGP<CJNGPWPF UGRCTCVG 5GMWPFGPCP\GKIG CWH 8+ 7JT XQNN HWPMVKQPUVÒEJVKI MQPVTQNNKGTV  FGT XQTFGTUGKVKIG &GEMGN   DGNGIVOKVFGOUQIGPCPPVGPMNGKPGTGPTWUUKUEJGP/CLGUV·VUYCRRGPKPFGT#WUHÒJTWPIXQPDKU KP )QNF OKV DNCW GOCKNNKGTVGP -TQPGPRGPFKNKGP OKP 'OCKNNGCWUDTÒEJG  KPPGPUGKVKI UEJYGK\GT )QNF   RWP\GUQYKGUEJYGK\GT'KEJJQTPRWP\GHÒTGT)QNFHÒTMNGKPG9GTMGKP)GDTCWEJXQP  DKU  CWH FGO TÒEMUGKVKIGP $QFGP ITCXKGTVG *GTUVGNNGTDG\GKEJPWPI Ïàâåëú Áóðå /   ïîñòàâùèêú / Äâîðà Åëî ÂåëèúåñòâàFGT(KTOC2CYGN$WTGWPF(CDTKMCVKQPUPWOOGTKO TÒEMY·TVKIGP&GEMGNKPPGPUGKVKIUEJYGK\GT)QNFRWP\GPWPF-FGT(KTOC2CYGN$WTGWPF (CDTKMCVKQPUPWOOGT  KO TÒEMY·TVKIGP &GEMGN KPPGPUGKVKI UEJYGK\GT )QNFRWP\GP  WPF   -UEJYGK\GT'KEJJQTPRWP\GHÒTGT)QNFHÒTMNGKPG9GTMGKP)GDTCWEJXQPDKUWPF 9GTMUPWOOGT+OPKEJVQTKIKPCNGP'VWK 4++  &KGGJGOCNUKP5V2GVGTUDWTIWPF/QUMCWCPU·UUKIGCWHFGPCWUFGT5EJYGK\UVCOOGPFGP7JTOCEJGT'FWCTF$WTG \WTÒEMIGJGPFG(KTOC2CYGN$WTGNKGHGTVGXQPDKUWPVGTGKIGPGO0COGPWCCWEJUEJYGK\GT7JTGPCP FGP TWUUKUEJGP <CTGPJQH #WHITWPFFGT2WP\GPMCPPFKG*GTUVGNNWPIU\GKVFKGUGU'ZGORNCTUCWHFGP<GKVTCWO\YK UEJGP\WP·EJUVWPFGKPIGITGP\VYGTFGPYQDGKCWHITWPFFGTJQJGP9GTMUPWOOGTGKPG*GTUVGNNWPIPCEJ CP\WPGJOGPKUV

107


RUSSLAND

9424 (1:1) 9422 (1:1)

9423 (1:1)

9425

9426



,GVQPFGT1NQPG\MCLC'KUGPDCJPNKPKG5KNDGT)QNFVGKNYGKUGGOCKNNKGTVI'OCKNNGOCNGTGKQDGT HN·EJNKEJG 'OCKNNGEJKRU KP FGT ¤UG /GKUVGTOCTMG 6-  <QNQVPKMK -QMQUEJPKM5KNDGTRWP\G XQP   DKUWPF-QMQUEJPKM2WP\GXQPDKUCO4KPI ++ 



#D\GKEJGPHÒTRTQOQXKGTVG/KNKV·T·T\VG CPFGT-CKUGTNKEJGP/GFK\KPKUEJ%JKTWTIKUEJGP#MCFGOKG WPFCP4WUUKUEJGP7PKXGTUKV·VGP #WUHÒJTWPIOKVIQNFGPGP5EJNCPIGP CD 4GFWMVKQP ZOO5KNDGTVGKNYGKUGXGTIQNFGVCWHFGT4ÒEMUGKVG/GKUVGTOCTMG#?" OÌINKEJGTYGKUGHÒT# $NCUPQY  5V 2GVGTUDWTIGT  <QNQVPKMK -QMQUEJPKM5KNDGTRWP\G XQP  DKU  OKV FGO $GUEJCW   OGKUVGT\GKEJGP#2HÒT#4KMJVGTCP5EJTCWDGOKV5EJTCWDUEJGKDGFKGUGGDGPHCNNUOKV/GKUVGTOCTMG #!WPF-QMQUEJPKM5KNDGTRWP\GXQPDKU#09XCT2$5#5XCT ++



&CU#D\GKEJGPYWTFGOKV&GMTGVXQO(GDTWCTGKPIGHÒJTV#$NCUPQYUQNNCWEJHÒTFCU*CWU(CDGTI¾ IGCTDGKVGVJCDGP#4KMMJVGTYCTCNU2TQDKGTOGKUVGTPWTXQPDKUV·VKI



#D\GKEJGPFGT4GKVDTKICFGFGT)CTFG#TVKNNGTKG/KPKCVWTVGKNYGKUGXGTIQNFGVVGKNYGKUGIGUEJY·T\V CP5EJTCWDGOKV5EJTCWDUEJGKDG8IN5#5 ++



&CU#D\GKEJGPYWTFGCO/CKGKPIGHÒJTV





#DUQNXGPVGPCD\GKEJGP FGU 2CIGP-CFGVVGPMQTRU KP 5V 2GVGTUDWTI 5KNDGT GOCKNNKGTV 'KUGP )QNF   OKP %JKRU WPF -TCV\GT KP FGT 'OCKNNG CWH FGT 4ÒEMUGKVG /GKUVGTOCTMG ÇÊ CP 5EJTCWDG OKV   5EJTCWDUEJGKDGFKGUGGDGPHCNNUOKV/GKUVGTOCTMGÇÊWPF-QMQUEJPKM2WP\G5#5 ++



#D\GKEJGP \WO 'KPJWPFGTVL·JTKIGP $GUVGJGP FGU -TKGIUOKPKUVGTKWOU  5GJT GKPHCEJG #PHGTVK   IWPI OÌINKEJGTYGKUG-QRKG! =RTQDCDN[EQR[!?XGTUKNDGTVVGKNYGKUGXGTIQNFGVVGKNYGKUGGOCKNNKGTVCP 5EJTCWDGOKV5EJTCWDUEJGKDG5#5 ++



9428

9427 (1:1)



)TCFWKGTWPI#D\GKEJGPHÒT8GTOGUUWPIU+PIGPKGWTG5KNDGTVGKNYGKUGXGTIQNFGV#WHNCIGNQEMGTCP 5EJTCWDGOKV5EJTCWDUEJGKDGFKGUGOKV*GTUVGNNGTDG\GKEJPWPI ++





-CWMCUWUMTKGIU5QWXGPKT KP (QTOC GKPGU $WEJGU  Z  OO  I $WEJFGEMGN 5KNDGT OKV   GOCKNNKGTVGT #WHUEJTKHV ÏÎËÅÂÀß ÊÍÈÆÊÀ =(GNFDWEJ? WPF CWHIGNGIVGT /KPKCVWT FGU -CWMCUWU   MTGW\GU )QNF CWHFGOTÒEMUGKVKIGP$WEJFGEMGNCWHIGNGIVGU/QPQITCOO*$KP)QNFOKVFTGK+PPGP UGKVGP KP )QNF FKG WTURTÒPINKEJ XQTJCPFGPG ITCXKGTVG 5EJTKHVHCUVXQNNUV·PFKIXGTICPIGPCP6TCIGMGVV EJGP ++



108


RUSSLAND

9430 9429 (1:1)

ex 9431



,GVQPFGT-CFGVVGPUEJWNG#NGZCPFGT++)QNFGOCKNNKGTVCP-GVVEJGPI

++



-COOGTJGTTGP5EJNÃ&#x2019;UUGN#WUHÃ&#x2019;JTWPIFGT4GIKGTWPIU\GKV<CT0KMQNCWU+XQPDKU$TQP\G XGTIQNFGVCNVG4GRCTCVWTFGU4GKEJUCRHGNUFGT-TQPGFWTEJ#PDTKPIWPIGKPGT8GTUV·TMWPIURNCVVG ++p+++

 

'ZGORNCTFGT#WMVKQP(TKV\4WFQNH-Ã&#x2019;PMGT1UPCDTÃ&#x2019;EM0T



'KP2CCT5EJWRRGP'RCWNGVVGP/KVIGNDGO7PVGTHWVVGTGVYCUXGTUEJOWV\V

5VÃ&#x2019;EM++



'ZGORNCTFGT#WMVKQP(TKV\4WFQNH-Ã&#x2019;PMGT1UPCDTÃ&#x2019;EM0T

9432 (1:1)

ex 9433 (1:1)

9432 (1:1)

70+10&'451<+#.+56+5%*'0519,'64'27$.+-'0 519,'670+10  

8GTFKGPUVOGFCKNNG FGT )GUCOV5QYLGVKUEJGP .CPFYKTVUEJCHVU#WUUVGNNWPI $%:$ #WUICDG    -NGKPG)QNFGPG/GFCKNNG&WTEJOGUUGTOOCWHFGT4Ã&#x2019;EMUGKVG6T·IGTPWOOGT0QFGWVNKEJ IGVTCIGP CP 6TCIGURCPIG OKV 5EJTCWDG QJPG 5EJTCWDUEJGKDG )GUCOVIGYKEJV OKV 6TCIGURCPIG    I#8C ++p+++



4755+5%*'(¤&'4#6+1065%*'65%*'0+5%*'4'27$.+-+65%*-'4+# 

5'+6  

/KNKV·T8GTFKGPUVQTFGP &GMQTCVKQP  WPF  -NCUUG /GUUKPI XGTEJTQOV D\Y /GUUKPI VGKNYGKUG   GOCKNNKGTVCP5EJTCWDGPOKV5EJTCWDUEJGKDGP 5VÃ&#x2019;EM4++

 109


SCHWEDEN

9437

9436

9434

4'27$.+-5#0/#4+01 

<KXKN WPF /KNKV·TXGTFKGPUVQTFGP XQO JGKNKIGP /CTKPWU=1TFKPG%KXKNGG/KNKVCTGFK5CP/CTKPQ?  /QFGNN 4GXGTUUGKVKIG /GFCKNNQPKPUEJTKHV OKV %+8+.' ' /+.+6#4'  UGKV EC   -QOOCP   FGWTMTGW\ 5KNDGT XGTIQNFGV WPF GOCKNNKGTV UGJT HGKPG 'OCKNNGOCNGTGK CO QTKIKPCNGP CNVGP *CNUDCPF   <- ++



'ZGORNCT FGT #WMVKQP (TKV\ 4WFQNH -ÒPMGT  1UPCDTÒEM  0T  5GJT SWCNKV·VUXQNNG #PHGTVKIWPI WO    &GT <GKVRWPMV FGU 9GEJUGNU XQO  /QFGNN OKV /'4+61 %+8+.' WPF /'4+61 /+.+6#4'  \WO    /QFGNN OKV /'4+61 %+8+.' ' /+.+6#4'  MQPPVG DKUJGT PQEJ PKEJV GTOKVVGNV YGTFGP )GUVKHVGV YWTFG FGT   HÒPHMNCUUKIG 1TFGP OKV &GMTGV XQO  /·T\  FWTEJFKGDGKFGP%CRKVCPK4GIIGPVKFGT4GRWDNKMYWTFG FKG)TQ­OGKUVGT&GMQTCVKQP WPFFCOKVFKG#OVUKPUKIPKGFGTCNU5VCCVUQDGTJ·WRVGTHWPIKGTGPFGP%CRKVCPK4GIIGPVK  WPFCO#RTKNFKG1TFGPUMQNNCPGGKPIGHÒJTV 8INCWEJ#WVGPITWDGT/KEJCGN&KG1TFGPWPF'JTGP\GKEJGP FGT4GRWDNKM5CP/CTKPQKP+PVGTPCVKQPCNGU/KNKVCTKC/CIC\KP0T  5HH 

-¤0+)4'+%*5%*9'&'0 

-ÌPKINKEJGT 5EJYGTVQTFGP =-WPINKIC 5X·TFUTQTFGP? 1TKIKPCNGU CNVGU 5EJWNVGTDCPFUVÒEM \WO )TQ­   MTGW\CWUFGONGV\VGP8KGTVGNFGU,JEODTGKVECEONCPIWPMQPHGMVKQPKGTV ++



#O  (GDTWCT  UVKHVGVG -ÌPKI (TGFTKM + XQP 5EJYGFGP CWU FGO *CWUG *GUUGP-CUUGN  FGP \WP·EJUV   \YGKMNCUUKIGP -QOOCPFGWT WPF 4KVVGT  1TFGP \WUCOOGP OKV FGO -ÌPKINKEJGP 5GTCRJKO1TFGP  TGQTICPK   UKGTVG-ÌPKI)WUVCX+++FGP1TFGPKPFGOGTGKP)TQ­MTGW\UVKHVGVG YQDGKFKG+PJCDGTFKGUGT-NCUUG-QOOCPFGWT OKV )TQ­MTGW\ IGPCPPV YWTFGP   UVKHVGVG GT HÒT -TKGIU\GKVGP FKG -NCUUG FGT 4KVVGT OKV FGO )TQ­GP -TGW\   -NCUUGFGU5EJYGTVQTFGPU 4KVVGTMTGW\CO*CNUOKVCWHTGEJVUVGJGPFGO5EJYGTVCWHFGTNKPMGP$TWUV FKGFWTEJ -ÌPKI-CTN:+++WOFKG-NCUUGFGT4KVVGTOKVFGO)TQ­GP-TGW\FGU5EJYGTVQTFGPU 4KVVGTMTGW\CO*CNUOKV IGMTGW\VGP5EJYGTVGTPCWHFGTNKPMGP$TWUV GTYGKVGTVYWTFG#O,WPKUVKHVGVG-ÌPKI1UECT+FCUCHHKNKKGTVG 5EJYGTV\GKEJGPWPFFKGCHHKNKKGTVG5EJYGTVOGFCKNNGHÒT7PVGTQHHK\KGTGWPF/CPPUEJCHVGP+O/CKYWTFG-CKUGT 9KNJGNO+XQP-ÌPKI1UECT++GKPGIQNFGPG5EJYGTVOGFCKNNGXGTNKGJGPFKG\YCTGDGPHCNNUIGUVKHVGVYQTFGP YCTCDGTPWTGKPOCNXGTNKGJGPYWTFGGDGPCP-CKUGT9KNJGNO+ XIN'85H -ÌPKI%CTN:8UVKHVGVG GKPGP$TWUVUVGTP\WO-QOOCPFGWTWPF-ÌPKI1UECT++WPVGTVGKNVGCWU#PNC­UGKPGT-TÌPWPIFKG-QOOCP FGWTG KP -QOOCPFGWTG  -NCUUG OKV $TWUVUVGTP  WPF -QOOCPFGWTG  -NCUUG QJPG $TWUVUVGTP CD    -QOOCPFGWT IGPCPPV  YQDGK NGV\VGTG DKU \WO  5GRVGODGT  #WUN·PFGTP XQTDGJCNVGP YCT $GTGKVU    YCTGPFKGDKUFCJKPIGUVKEMVGP$TWUVUVGTPGQHHK\KGNNKP/GVCNNUVGTPGWOIGYCPFGNVYQTFGPFGTGP#TOHN·EJGPDKU DTKNNCPVKGTV XQP  DKU  IGUEJWRRV WPF UGKV FKGUGO <GKVRWPMV INCVV YCTGP /KV FGP PGWGP 5VCVWVGP XQO   0QXGODGTYWTFGCWEJFKG4KVVGTMNCUUGKP4KVVGT-NCUUGWPF4KVVGT-NCUUG CD4KVVGTIGPCPPV  WPVGTVGKNVYQDGKNGV\VGTG\WP·EJUVGDGPHCNNUPWT#WUN·PFGTPXQTDGJCNVGPYCTYWTFGFCU5EJYGTV\GKEJGPQJPG 5EJYGTVGTXQP-ÌPKI1UECT++IGUVKHVGV#O/·T\GTNKG­-ÌPKI)WUVCX8+#FQNHPGWG5VCVWVGPOKVFGPGP HÒT -TKGIU\GKVGP GKP FTGKMNCUUKIGU CHHKNKKGTVGU -TKGIUMTGW\ FGU 5EJYGTVQTFGPU IGUVKHVGV YWTFG #WH $GUEJNW­ FGU   5EJYGFKUEJGP4GKEJUVCIGUXQO,WPKYWTFGFKG8GTNGKJWPIFGU5EJYGTVQTFGPUOKV9KTMWPIXQO,CPWCT IGPGTGNNGKPIGUVGNNV





-ÌPKINKEJGT5EJYGTVQTFGP=-WPINKIC5X·TFUTQTFGP?/QFGNN UGKV $TWUVUVGTP\WO-QOOCP FGWT-NCUUG#WUICDG OKVINCVVGP-TGW\CTOHGNFGTPUGKV 5KNDGTVGKNYGKUGXGTIQNFGVVGKN YGKUG GOCKNNKGTV CWH FGO 0CFGNDQEM OGJTHCEJ RWP\KGTV W C %(% HÒT FGP *GTUVGNNGT %CTNOCP KP   5VQEMJQNOWPF,CJTGURWP\G-HÒT CP0CFGN<- ++



-ÌPKINKEJGT5EJYGTVQTFGP=-WPINKIC5X·TFUTQTFGP?/QFGNN UGKV /KPKCVWTFGU$TWUVUVGTPU \WO-QOOCPFGWT-NCUUG5KNDGTDTKNNCPVKGTV/GFCKNNQP)QNFGOCKNNKGTVPCJG\WWPUKEJVDCTG4GRCTC VWTKPFGTDNCWGP'OCKNNGCWH4QUGVVGOKVFGP$·PFGTPFGU5EJYGTVFGU0QTFUVGTPWPFFGU9CUCQT FGPUOQPVKGTVCP4GXGTUMPQRH ++



'ZGORNCTFGT#WMVKQP(TKV\4WFQNH-ÒPMGT1UPCDTÒEM0T

110


SCHWEDEN

9438 (1:1)



-ÌPKINKEJGT5EJYGTVQTFGP=-WPINKIC5X·TFUTQTFGP?/QFGNN UGKV -QOOCPFGWTMTGW\)QNF GOCKNNKGTV  I KO 4CPF FGU TGEJVGP WPVGTGP -TGW\CTOU OGJTHCEJ RWP\KGTV W C *GTUVGNNGTRWP\G   %(%FGT(KTOC%CTNOCPKP5VQEMJQNO)QNFRWP\G-HÒTEVWPFVGKNYGKUGWPNGUGTNKEJG,CJTGU RWP\G \YKUEJGP  WPF  CO IGVTCIGPGP *CNUDCPF KO QTKIKPCNGP 8GTNGKJWPIUGVWK FGT (KTOC   %CTNOCPQJPG'KPNCIG<- +p++ 

9439 9440







9441

-ÌPKINKEJGT 5EJYGTVQTFGP =-WPINKIC 5X·TFUTQTFGP?  /QFGNN UGKV   4KVVGTMTGW\ CD    4KVVGTMTGW\-NCUUG )QNFGOCKNNKGTVICWHFGO4CPFFGUTGEJVGPWPVGTGP-TGW\CTOUOGJTHCEJ RWP\KGTVWC%(%HÒTFGP*GTUVGNNGT%(%CTNOCPKP5VQEMJQNO-HÒTEV)QNFWPF,CJTG URWP\G/HÒTCO$CPFOKV0CFGNKOQTKIKPCNGP8GTNGKJWPIUGVWKFGT(KTOC%CTNOCPKP5VQEM JQNO<- +p++



-ÌPKINKEJGT 5EJYGTVQTFGP =-WPINKIC 5X·TFUTQTFGP?  /QFGNN UGKV   4KVVGTMTGW\ CD    4KVVGTMTGW\-NCUUG )QNFGOCKNNKGTVI QJPG$CPFTKPI CWHFGO4CPFFGUNKPMGPWPVGTGP-TGW \CTOUOGJTHCEJRWP\KGTVWC%(%HÒTFGP*GTUVGNNGT%(%CTNOCPKP5VQEMJQNOWPF-HÒT EV)QNFQJPG,CJTGURWP\GCO$CPFOKV0CFGNKOQTKIKPCNGP8GTNGKJWPIUGVWKFGT(KTOC%CTNOCPKP 5VQEMJQNO<- +p++



-ÌPKINKEJGT 5EJYGTVQTFGP =-WPINKIC 5X·TFUTQTFGP?  /QFGNN UGKV   4KVVGTMTGW\ CD    4KVVGTMTGW\-NCUUG 5KNDGTXGTIQNFGV  /GFCKNNQP)QNFCO$CPFKPGKPGO'VWKFGT(KTOC5XGCU XGTUQPKP5VQEMJQNO<- ++



&KG5VÒEMGKPXGTIQNFGVGO5KNDGTUKPFYGKVCWUUGNVGPGTCNUFKGGEJVIQNFGPGP

111


SCHWEDEN

9442 (1:1)



ex 9444 (1:1)

9443 (1:1)

-ÌPKINKEJGT5EJYGTVQTFGP=-WPINKIC5X·TFUTQTFGP?/QFGNN UGKV /KPKCVWTFGU4KVVGTMTGW \GU)QNFGOCKNNKGTVOKP%JKRKOXQTFGTUGKVKIGP/GFCKNNQPQJPG$·PFEJGP ++



NVGTG#PHGTVKIWPICWUFGT/KVVGFGU,J



-ÌPKINKEJGT5EJYGTVQTFGP=-WPINKIC5X·TFUTQTFGP?/QFGNN UGKV /KPKCVWTFGU4KVVGTMTGW \GU)QNFGOCKNNKGTVCO$·PFEJGP +p++





-ÌPKINKEJGT5EJYGTVQTFGP=-WPINKIC5X·TFUTQTFGP?/QFGNN UGKV \YGK/KPKCVWTGPFGU4KVVGT MTGW\GU CD  4KVVGTMTGW\  -NCUUG     Z  OO )QNF GOCKNNKGTV -TQPG DGUEJ·FKIV    ZOO5KNDGTXGTIQNFGVGV/GFCKNNQPU)QNFGOCKNNKGTV$GKFGCO$·PFEJGP  5VÒEM+++++



9445





-ÌPKINKEJGT 5EJYGTVQTFGP =-WPINKIC 5X·TFUTQTFGP?  /QFGNN UGKV   5EJYGTVGTMTGW\ OKV   5EJYGTVGTP UGKV    #WUICDG OKV IQNFGPGO #XGTU/GFCKNNQP  5KNDGT #XGTU/GFCKNNQP )QNF   GOCKNNKGTVCOCNVGP$QIGPDCPFOKVUEJYGFKUEJGT$TQUEJKGTWPI<- +p++



-ÌPKINKEJGT 5EJYGTVQTFGP =-WPINKIC 5X·TFUTQTFGP?  /QFGNN UGKV   5EJYGTVGTMTGW\ OKV   5EJYGTVGTP UGKV    #WUICDG OKV IQNFGPGO #XGTU/GFCKNNQP  5KNDGT #XGTU/GFCKNNQP )QNF   GOCKNNKGTVCOCNVGP$QIGPDCPFOKVUEJYGFKUEJGT$TQUEJKGTWPI<- +p++



9447







112

9446

9448

9449

-ÌPKINKEJGT 5EJYGTVQTFGP =-WPINKIC 5X·TFUTQTFGP?  /QFGNN UGKV   5EJYGTVGTMTGW\ OKV   5EJYGTVGTP UGKV    #WUICDG OKV IQNFGPGO #XGTU/GFCKNNQP  5KNDGT #XGTU/GFCKNNQP )QNF   GOCKNNKGTVCOCNVGP$CPF<- +p++



-ÌPKINKEJGT 5EJYGTVQTFGP =-WPINKIC 5X·TFUTQTFGP?  /QFGNN UGKV   5EJYGTVGTMTGW\ OKV   5EJYGTVGTP UGKV    #WUICDG OKV IQNFGPGO #XGTU/GFCKNNQP  5KNDGT #XGTU/GFCKNNQP )QNF   GOCKNNKGTVCOCNVGP$CPFOKV0CFGN<- +p++



-ÌPKINKEJGT 5EJYGTVQTFGP =-WPINKIC 5X·TFUTQTFGP?  /QFGNN UGKV   5EJYGTVGTMTGW\ OKV   5EJYGTVGTP UGKV    #WUICDG OKV IQNFGPGO #XGTU/GFCKNNQP  5KNDGT #XGTU/GFCKNNQP )QNF   GOCKNNKGTVCONCPIGPCNVGP$CPF<- ++




SCHWEDEN

9450



-ÌPKINKEJGT 0QTFUVGTPQTFGP =-WPINKIC 0QTFUVL·TPGQTFGP? 1TFGPUMQNNCPG DGUVGJGPF CWU  /QPQ   ITCOOWPF5VGTP)NKGFGTP5KNDGTXGTIQNFGVWPFVGKNYGKUGGOCKNNKGTVFKGYGK­G'OCKNNGFGT5VGTPG VGKNYGKUG GVYCU \GTMTCV\V UQYKG DGK \YGK 5VGTPGP NGKEJV QDGTHN·EJNKEJ IGEJKRV QJPG 2WP\KGTWPIGP KO   PGWGPPGWVTCNGP'VWK<- 4++  5GJT SWCNKV·VUXQNNG #PHGTVKIWPI CWU FGT GTUVGP *·NHVG FGU  ,CJTJWPFGTVU  #O  (GDTWCT  UVKHVGVG -ÌPKI   (TGFTKM + XQP 5EJYGFGP CWU FGO *CWUG *GUUGP-CUUGN  FGP \WP·EJUV \YGKMNCUUKIGP -QOOCPFGWT WPF 4KVVGT    1TFGP \WUCOOGP OKV FGO -ÌPKINKEJGP 5GTCRJKO1TFGP WPF FGO -ÌPKINKEJGP 5EJYGTVQTFGP  UVKHVGVG -ÌPKI   )WUVCX +++ -QNNCPGP HÒT FKG -QOOCPFGWTG -ÌPKI 1UECT + UVKHVGVG  FKG )TQ­MTGW\MNCUUG IGPCPPV   -QOOCPFGWTOKV)TQ­MTGW\-ÌPKI%CTN:8UVKHVGVGGKPGP$TWUVUVGTP\WO-QOOCPFGWTWPF-ÌPKI1UECT ++ WPVGTVGKNVG  CWU #PNC­ UGKPGT -TÌPWPI FKG -QOOCPFGWTG KP -QOOCPFGWTG  -NCUUG OKV $TWUVUVGTP  WPF   -QOOCPFGWTG  -NCUUG QJPG $TWUVUVGTP CD  -QOOCPFGWT IGPCPPV  YQDGK NGV\VGTG DKU  #WUN·PFGTP   XQTDGJCNVGP YCT $GTGKVU  YCTGP FKG DKU FCJKP IGUVKEMVGP $TWUVUVGTPG QHHK\KGNN KP /GVCNNUVGTPG WOIGYCPFGNV   YQTFGPFGTGP#TOHN·EJGPDKUDTKNNCPVKGTVXQPDKUIGUEJWRRVWPFUGKVFKGUGO<GKVRWPMVINCVVYCTGP +PDGUQPFGTGP(·NNGPMQPPVGPFKG+PUKIPKGPCNNGT-NCUUGPCWEJOKV$TKNNCPVGPXGTNKGJGPYGTFGP#WH$GUEJNW­FGU 5EJYGFKUEJGP4GKEJUVCIGUXQO,WPKYWTFGFKG8GTNGKJWPIFGU0QTFUVGTPQTFGPUCPUEJYGFKUEJG5VCCVUDÒTIGT OKV9KTMWPIXQO,CPWCTGKPIGUVGNNV/KVFGT4GHQTOFGUUEJYGFKUEJGP1TFGPUYGUGPUXQPYWTFGCWEJ FKG4KVVGTMNCUUGKP4KVVGT-NCUUGWPF4KVVGTCWHIGVGKNVUQYKGGKPGPGWG$CPFHCTDG DNCWOKVIGNDGP4CPFUVTGKHGP  GKPIGHÒJTV  YWTFG XQP -ÌPKI %CTN :8+ )WUVCX FKG FGO 1TFGP CHHKNKKGTVG 0QTFUVGTPOGFCKNNG IGUVKHVGV /KV   &CVWOXQO#WIWUVGTJKGNVFGT1TFGPPGWG5VCVWVGP

113


SCHWEDEN

9451 (1:1)



-ÌPKINKEJGT 0QTFUVGTPQTFGP =-WPINKIC 0QTFUVL·TPGQTFGP? -QOOCPFGWTMTGW\ HTÒJG #PHGTVKIWPI   QJPG-ÒIGNEJGPCPFGP-TGW\CTOGPFGP)QNFGOCKNNKGTVICWHFGT4ÒEMUGKVGGKPGMCWOUKEJVDCTG 'OCKNNGTGRCTCVWTKP\YGK-TGW\CTOURKV\GPUQYKGMCWOUKEJVDCTG'OCKNNGURTÒPIGCWHDGKFGP/GFCKNNQPU CWHFGO$CPFTKPIPKEJVKFGPVKHK\KGTDCTG2WP\GCONCPIGPQTKIKPCNGPCNVGP*CNUDCPFCDUEJPKVV<- ++ 

5GJTSWCNKV·VUXQNNG#PHGTVKIWPICWUFGO\YGKVGP&TKVVGNFGU0GWP\GJPVGP,CJTJWPFGTVU

9455 (1:1) 9452





9456 (1:1) 9453

9454

-ÌPKINKEJGT 0QTFUVGTPQTFGP =-WPINKIC 0QTFUVL·TPGQTFGP? 4KVVGTMTGW\ UGKV  4KVVGTMTGW\   -NCUUG )QNFGOCKNNKGTVI QJPG$CPFTKPI CWHFGO4CPFFGUWPVGTGP-TGW\CTOUOGJTHCEJRWP \KGTV WC%(%HÒTFGP*GTUVGNNGT%(%CTNOCPKP5VQEMJQNO-HÒTEVQJPG,CJTGURWP\G  CO$CPFKOQTKIKPCNGP8GTNGKJWPIUGVWKFGT(KTOC%CTNOCP<- +p++



-ÌPKINKEJGT 0QTFUVGTPQTFGP =-WPINKIC 0QTFUVL·TPGQTFGP? 4KVVGTMTGW\ UGKV  4KVVGTMTGW\   -NCUUG )QNFGOCKNNKGTVI QJPG$CPFTKPI QJPG2WP\KGTWPICO$CPF<- +p++



#PHGTVKIWPICWUFGONGV\VGP8KGTVGNFGU,J



-ÌPKINKEJGT 0QTFUVGTPQTFGP =-WPINKIC 0QTFUVL·TPGQTFGP? 4KVVGTMTGW\ UGKV  4KVVGTMTGW\   -NCUUG 5KNDGTXGTIQNFGV/GFCKNNQPU)QNFGOCKNNKGTVCP&COGPUEJNGKHGOKV0CFGNKOQTKIKPCNGP8GT NGKJWPIUGVWKFGT(KTOC%(%CTNOCPKP5VQEMJQNO<- 4++





-ÌPKINKEJGT 0QTFUVGTPQTFGP =-WPINKIC 0QTFUVL·TPGQTFGP? /KPKCVWT FGU 4KVVGTMTGW\GU UGKV    4KVVGTMTGW\-NCUUG )QNFGOCKNNKGTVQJPG2WP\KGTWPIGPCO$·PFEJGP ++





-ÌPKINKEJGT 0QTFUVGTPQTFGP =-WPINKIC 0QTFUVL·TPGQTFGP? /KPKCVWT FGU 4KVVGTMTGW\GU UGKV    4KVVGTMTGW\-NCUUG )QNFGOCKNNKGTVQJPG2WP\KGTWPIGPCO$·PFEJGPOKV-PQRH ++



114


SCHWEDEN

9457 (1:1)

9458 (1:1)

9460 (1:1)

9459 (1:1)

9461 (1:1)



-ÌPKINKEJGT 0QTFUVGTPQTFGP =-WPINKIC 0QTFUVL·TPGQTFGP? /KPKCVWT FGU 4KVVGTMTGW\GU UGKV    4KVVGTMTGW\-NCUUG )QNFGOCKNNKGTVQJPG2WP\KGTWPIGPCO$·PFEJGP ++





-ÌPKINKEJGT 0QTFUVGTPQTFGP =-WPINKIC 0QTFUVL·TPGQTFGP? /KPKCVWT FGU 4KVVGTMTGW\GU UGKV    4KVVGTMTGW\-NCUUG )QNFGOCKNNKGTVQJPG2WP\KGTWPIGPCO$·PFEJGP ++





-ÌPKINKEJGT 0QTFUVGTPQTFGP =-WPINKIC 0QTFUVL·TPGQTFGP? /KPKCVWT FGU 4KVVGTMTGW\GU UGKV    4KVVGTMTGW\  -NCUUG  )QNF GOCKNNKGTV QJPG 2WP\KGTWPIGP \WUCOOGP OKV /KPKCVWT FGU 4KVVGTMTGW\GU   FGU -ÌPKINKEJGP 9CUC1TFGPU )QNF GOCKNNKGTV QJPG 2WP\KGTWPIGP CP <YGKGT/KPKCVWTGPUEJPCNNG OKV   6TCIGMPQRH 5VÒEM++



-ÌPKINKEJGT 0QTFUVGTPQTFGP =-WPINKIC 0QTFUVL·TPGQTFGP? /KPKCVWT FGU 4KVVGTMTGW\GU UGKV    4KVVGTMTGW\  -NCUUG  )QNF GOCKNNKGTV QJPG 2WP\KGTWPIGP \WUCOOGP OKV /KPKCVWT FGU 4KVVGTMTGW\GU   FGU-ÌPKINKEJGP9CUC1TFGPU)QNFGOCKNNKGTVQJPG2WP\KGTWPIGP$·PFEJGP\WUCOOGPIGP·JV  5VÒEM+p++



-ÌPKINKEJGT 0QTFUVGTPQTFGP =-WPINKIC 0QTFUVL·TPGQTFGP? /KPKCVWT FGU 4KVVGTMTGW\GU UGKV    4KVVGTMTGW\  -NCUUG  )QNF GOCKNNKGTV QJPG 2WP\KGTWPIGP \WUCOOGP OKV /KPKCVWT FGU 4KVVGTMTGW\GU   FGU-ÌPKINKEJGP9CUC1TFGPU)QNFGOCKNNKGTVQJPG2WP\KGTWPIGP$·PFEJGP\WUCOOGPIGP·JV +p++







9462 (1:1)



-ÌPKINKEJGT 9CUC1TFGP =-WPINKIC 8CUCQTFGP?  /QFGNN   4KVVGTFGMQTCVKQP  Z    OO )QNF HGKPUV ITCXKGTV GOCKNNKGTV  I CO NCPIGP QTKIKPCNGP CNVGP $CPF KOUR·VGTGP'VWK FGT-2CVTKQVKUMC5·NNUMCRGV<- +p  *GTXQTTCIGPFG #PHGTVKIWPI CWU FGT /KVVG FGU 0GWP\GJPVGP ,CJTJWPFGTVU  )GUVKHVGV CO  /CK  XQP -ÌPKI   )WUVCX +++   CNU \WP·EJUV FTGKMNCUUKIGT -QOOCPFGWT OKV )TQ­MTGW\ -QOOCPFGWT 4KVVGT  1TFGP HÒT   8GTFKGPUVGWOFKG.CPFYKTVUEJCHV*CPFGN)GYGTDGWPF+PFWUVTKG-WPUVWPF9KUUGPUEJCHV&WTEJ-ÌPKI1UECT+ GTJKGNVGP  FCU -NGKPQF FGU )TQ­MTGW\GU WPF FKG -QOOCPFGWTFGMQTCVKQP LGYGKNU GKPG MÌPKINKEJG -TQPG CNU   ªDGTJÌJWPI #O  #RTKN  TGQTICPKUKGTVG -ÌPKI %CTN :8   FGP 1TFGP ICD FGP +PUKIPKGP GKPG   )GUVCNVWPFHÒJTVGGKPGP$TWUVUVGTP\WO-QOOCPFGWTGKP#WU#PNC­UGKPGT-TÌPWPIVGKNVG-ÌPKI1UECT++   FKG-QOOCPFGWTMNCUUGKP-QOOCPFGWTG-NCUUG OKV$TWUVUVGTP WPF-QOOCPFGWTG-NCUUG QJPG $TWUVUVGTPCD-QOOCPFGWTIGPCPPV YQDGKNGV\VGTGDKU\WO5GRVGODGT#WUN·PFGTPXQTDGJCNVGP YCT $GTGKVU  YCTGP FKG DKUFCJKPIGUVKEMVGP$TWUVUVGTPGQHHK\KGNNKP/GVCNNUVGTPGWOIGYCPFGNVYQTFGPFGTGP #TOHN·EJGPDKUDTKNNCPVKGTVXQPDKUIGUEJWRRVWPFUGKVFKGUGO<GKVRWPMVINCVVYCTGP/KVFGPPGWGP 5VCVWVGP XQO  0QXGODGT  YWTFG CWEJ FKG 4KVVGTMNCUUG KP 4KVVGT  -NCUUG WPF 4KVVGT  -NCUUG CD    4KVVGT IGPCPPV  WPVGTVGKNV YQDGK NGV\VGTG \WP·EJUV GDGPHCNNU PWT#WUN·PFGTPXQTDGJCNVGPYCT#O0QXGODGT  UVKHVGVG 1UECT ++ FCU 9CUC\GKEJGP WPF FKG OGJTUVWHKIG 9CUC/GFCKNNG KP )QNF WPF 5KNDGT #O  ,WPK    DGUEJNQ­FGT4GKEJUVCIFCUUEJYGFKUEJG2CTNCOGPVFC­FKGUEJYGFKUEJGP1TFGPWPFUQOKVCWEJFGT9CUC1TFGP MÒPHVKI PWT PQEJ #WUN·PFGTP XQTDGJCNVGP UGKWPFOKVFGPPGWGP5VCVWVGPFGTUEJYGFKUEJGP1TFGPXQO#WIWUV YWTFGFKG8GTNGKJWPIFGU9CUC1TFGPU YKGCWEJFGU5EJYGTVQTFGPU IGPGTGNNGKPIGUVGNNV

115


SCHWEDEN







9465

9464

9463

-ÌPKINKEJGT9CUC1TFGP=-WPINKIC8CUCQTFGP?/QFGNN UGKV 4KVVGTMTGW\ UGKV4KVVGT MTGW\-NCUUG )QNFGOCKNNKGTVICWHFGO4CPFFGUWPVGTGP-TGW\CTOUOGJTHCEJRWP\KGTV WC %(%HÒTFGP*GTUVGNNGT%(%CTNOCPKP5VQEMJQNO-HÒTEVQJPG,CJTGURWP\G COCNVGP CO $QIGPDCPF UEJYGFKUEJGT 0·JCTV CP UEJYGFKUEJGT 6TCIGURCPIG KO 1TKIKPCNGVWK XQP %CTNOCP   <- ++



-ÌPKINKEJGT9CUC1TFGP=-WPINKIC8CUCQTFGP?/QFGNN UGKV 4KVVGTMTGW\ UGKV4KVVGT MTGW\-NCUUG )QNFGOCKNNKGTVI QJPG$CPFTKPI CWHFGO4CPFFGUWPVGTGP-TGW\CTOUOGJT HCEJRWP\KGTV WC%(%HÒTFGP*GTUVGNNGT%(%CTNOCPKP5VQEMJQNO-HÒTEVWPF,CJTGU RWP\G<HÒTFCU,CJT CO$CPFOKV6TCIGURCPIGKO1TKIKPCNGVWKXQP%CTNOCP<- +p++



-ÌPKINKEJGT9CUC1TFGP=-WPINKIC8CUCQTFGP?/QFGNN UGKV 4KVVGTMTGW\ UGKV4KVVGT MTGW\-NCUUG )QNFGOCKNNKGTVI QJPG$CPFTKPI CWHFGO4CPFFGUNKPMGP-TGW\CTOUOGJT HCEJRWP\KGTV WC%(%HÒTFGP*GTUVGNNGT%(%CTNOCPKP5VQEMJQNO-HÒTEVWPF,CJTGU RWP\G/HÒTFCU,CJT CO$CPFOKV0CFGN<- +p++



9466 (1:1)

9468 (1:1)

9467 (1:1)

9469 (1:1)



-ÌPKINKEJGT 9CUC1TFGP =-WPINKIC 8CUCQTFGP? /KPKCVWT FGU 4KVVGTMTGW\GU )QNF GOCKNNKGTV QJPG   $·PFEJGP ++





-ÌPKINKEJGT 9CUC1TFGP =-WPINKIC 8CUCQTFGP? /KPKCVWT FGU 4KVVGTMTGW\GU )QNF GOCKNNKGTV CO   NCPIGP$·PFEJGP&C\W-PQRHNQEJUEJNGKHGOKV#WHNCIGFGU1TFGPUMTGW\GU ++





-ÌPKINKEJGT 9CUC1TFGP =-WPINKIC 8CUCQTFGP? /KPKCVWT FGU 4KVVGTMTGW\GU )QNF GOCKNNKGTV CO   $·PFEJGP ++





-ÌPKINKEJGT 9CUC1TFGP =-WPINKIC 8CUCQTFGP? /KPKCVWT FGU 4KVVGTMTGW\GU )QNF GOCKNNKGTV CO   $·PFEJGP ++



9470 (1:1)

 116

/GFCKNNGHÒT6CRHGTMGKVKO(GNF5KNDGTPG/GFCKNNG5KNDGTQJPG$CPF

4++




SCHWEDEN

9471 (1:1)

9472 (1:1) 9473 (1:1)



/GFCKNNGHÒT6CRHGTMGKVKO(GNF/KPKCVWTFGT5KNDGTPGP/GFCKNNG5KNDGTQJPG$·PFEJGP



/GFCKNNGHÒTWOUKEJVKIG(ÒTUQTIGHÒTCTOG-KPFGT/QFGNNOKVFGO2QTVTCKV-ÌPKI1UECTU+   5KNDGTPG/GFCKNNGCPFGTQTKIKPCNGPUKNDGTPGP6TCIGMGVVG 44++





7PDGMCPPVG/GFCKNNGOKVFGO2QTVTCKV-ÌPKI1UECTU++/KPKCVWTFGT/GFCKNNG)QNFI4ÒEM UGKVG NGGT CP OGJTGTGP -GVVEJGP CP 6TCIGURCPIG KP FGT #TV FGT 5GTCRJKO/GFCKNNG  0CFGN CDIGDTQ   EJGP 44++



9474 (1:1)

++



9474 (1:1) 1,5:1



/GFCKNNGHÒT/KVDÒTIGTNKEJG8GTFKGPUVG/QFGNNOKVFGO2QTVTCKV-ÌPKI)WUVCXU8MNGKPG)QNFGPG/G FCKNNG FGT)TÌ­G )QNFICWHFGT4ÒEMUGKVGOKVIGRT·IVGT8GTNGKJWPIUPCOG)1&5)#4'0 %1&'0%4#065KO4CPFRWP\KGTV)7.&WPFQJPG$CPF 44++

9475



9476



9477

/GFCKNNG \WT 5KNDGTPGP *QEJ\GKV FGU UEJYGFKUEJGP -TQPRTKP\GPRCCTGU )WUVCX WPF 8KEVQTKC XQP   $CFGP 5KNDGTPG/GFCKNNG5KNDGTCP&COGPUEJNGKHG6*15 ++



.CWV6JQTPKV KP6*15 YWTFGP/GFCKNNGPXGTNKGJGP



)GF·EJVPKU'JTGP\GKEJGP\WO)GDWTVUVCI-ÌPKI)WUVCXU8CO,WPK$TQP\GXGTIQNFGV WPFGOCKNNKGTVCP&COGPUEJNGKHG6*15 ++



)GF·EJVPKU'JTGP\GKEJGP \WO  )GDWTVUVCI -ÌPKI )WUVCXU 8 CO  ,WPK  )GF·EJVPKU   'JTGP\GKEJGP\WO)GDWTVUVCI-ÌPKI)WUVCXU8CO,WPK5KNDGTXGTIQNFGVCWHFGO4GXGTU OGJTHCEJRWP\KGTV WC5%QHÒTFGP*GTUVGNNGT5RQTTQPI5HÒT5KNDGTWPF,CJTGURWP\G:HÒT  WPUVCVWCTKUEJG/QPVKGTWPICP$TQUEJKGTWPIUVCVVCO$CPF ++



6JQTPKVIKDV KP6*15 GKPG8GTNGKJWPIU\CJNXQPCP



117


SCHWEDEN

9478



ex 9479

ex 9480

ex 9481

9482

'JTGP\GKEJGP \WO  )GDWTVUVCI -ÌPKI %CTNU :8+ )WUVCX  5KNDGT XGTIQNFGV CWH FGT 4ÒEM   UGKVG OGJTHCEJ RWP\KGTV W C 5KNDGTRWP\G  WPF,CJTGURWP\G:HÒT\WUCOOGPOKVFGT )TQ­GP )QNFGP *QH8GTFKGPUVOGFCKNNG #WUHÒJTWPI OKV FGO LÒPIGTGP 2QTVTCKV -ÌPKI %CTNU :8+   )WUVCX5KNDGTXGTIQNFGVCWHFGT4ÒEMUGKVGOKV8GTNGKJWPIUITCXWT'8.#4510\WUCOOGP OKVFGP/KPKCVWTGPWPF+PVGTKOURCPIGHÒTDGKFG'JTGP\GKEJGP 5VÒEM44++



&KG/GFCKNNG\WO)GDWTVUVCI-ÌPKI%CTNU:8+)WUVCXKUVXQPITQ­GT5GNVGPJGKV









*QH8GTFKGPUVOGFCKNNG/QFGNNOKVFGO2QTVTCKV)WUVCXU85KNDGTPG/GFCKNNG5KNDGTCWHFGT4ÒEM UGKVG 6T·IGTITCXWT )'14) &,#2101(( CO $CPF &C\W 'TKPPGTWPIUOGFCKNNG \WO L·JTKIGP   ,WDKN·WOFGT#PMWPHVUEJYGFKUEJGT5KGFNGTKP0QTFCOGTKMC5KNDGTQJPG$CPF7PF/KPKCVWTFGT )QNFGPGP*QH8GTFKGPUVOGFCKNNG#WUHÒJTWPIOKVFGOLÒPIGTGP2QTVTCKV-ÌPKI%CTNU:8+)WUVCXCP &COGPUEJNGKHEJGP5QYKG/KPKCVWTFGT%CTN,QJCPPU/GFCKNNG5KNDGTQJPG$·PFEJGP 5VÒEM++



8GTFKGPUVOGFCKNNG FGU 5EJYGFKUEJGP4QVGP-TGW\GU-NGKPG)QNFGPG8GTFKGPUVOGFCKNNG#WUHÒJTWPI OKVFGOLÒPIGTGP2QTVTCKV-ÌPKI%CTNU:8)WUVCX5KNDGTXGTIQNFGVCWHFGT4ÒEMUGKVG8GTNGKJWPIUITC XWT'+F¾PKO4CPFOGJTHCEJRWP\KGTVWCOKV*GTUVGNNGTRWP\G52144FGT(KTOC5RQTTQPI 5KNDGTRWP\G5WPF,CJTGURWP\G#HÒTCO$CPF&C\W5KNDGTPG8GTFKGPUVOGFCKNNG#WUHÒJ TWPIOKVFGO2QTVTCKV-ÌPKI)WUVCXU8+#FQNHCWHFGT4ÒEMUGKVG8GTNGKJWPIUITCXWT'+F¾PKO 4CPFRWP\KGTV5+.8'4WPFCP&COGPUEJNGKHGKOQTKIKPCNGP8GTNGKJWPIUGVWK 5VÒEM++



'JTGPCD\GKEJGP FGU 5EJYGFKUEJGP 4QVGP -TGW\GU 5KNDGT XGTIQNFGV WPF VGKNYGKUG GOCKNNKGTV CWH   $CPFMTGW\CWHIGNGIVCP0CFGNKOQTKIKPCN8GTNGKJWPIUGVWKFGU-ÌPKINKEJGP*QHLWYGNKGTU)WUVCX/ÌN NGPDQTIKP5VQEMJQNO ++



-ÌPKINKEJG2CVTKQVKUEJG)GUGNNUEJCHV)TQ­G)QNFOGFCKNNGHÒTNCPIL·JTKIGPVTGWGP&KGPUVOKV2QTVTCKV -ÌPKI)WUVCXU8$TQP\GXGTIQNFGVCWHFGT4ÒEMUGKVGITCXKGTVGT6T·IGTPCOGP#7)7565*#/#4 QJPG$CPF +p++



9483 (1:1)



9484 (1:1)

-ÌPKINKEJ 5EJYGFKUEJG 2CVTKQVKUEJG )GUGNNUEJCHV )QNFOGFCKNNG HÒT NCPIG VTGWG &KGPUVG #WUHÒJTWPI   OKV INCVVGO 4GXGTUHGNF )QNF  I OKV $CPF  CWH FGT 4ÒEMUGKVG OKV )TCXWT ’V,7.+75 2#7.    .14;HÌTN¹PIXCTKIVTQIGPVLGPUVCOQTKIKPCNGPCNVGP$CPF +p  )NGKEJGT+PJCDGTFGTHQNIGPFGP0WOOGT



-ÌPKINKEJ 5EJYGFKUEJG 2CVTKQVKUEJG )GUGNNUEJCHV )QNFOGFCKNNG HÒT NCPIG VTGWG &KGPUVG #WUHÒJTWPI   OKVVGKNYGKUGIGRT·IVGO4GXGTUHGNF)QNFI OKV$CPF CWHFGT4ÒEMUGKVGOKV)TCXWTFGU6T·IGT PCOGP,7.+752#7..14;COQTKIKPCNGPCNVGP$CPF +p  )NGKEJGT+PJCDGTFGTXQTJGTIGJGPFGP0WOOGT

118


SCHWEDEN

9485



9486

8GTFKGPUVOGFCKNNG FGU 5EJYGFKUEJGP (GWGTYGJT8GTDCPFGU #WUICDG OKV FGO LÒPIGTGP 2QTVTCKV   -ÌPKI %CTNU :8+ )WUVCX )QNFGPG 8GTFKGPUVOGFCKNNG 5KNDGT XGTIQNFGV CWH FGT 4ÒEMUGKVG OGJTHCEJ   RWP\KGTV WC*GTUVGNNGTRWP\G52144FGT(KTOC5RQTTQPI5KNDGTRWP\G5WPF,CJTGURWP\G$ HÒT OKV9KFOWPIUITCXWT#*+.&+0)CP$CPFOKV0CFGNKOQTKIKPCNGP8GTNGKJWPIU GVWK ++ 'ZGORNCTFGT#WMVKQP(TKV\4WFQNH-ÒPMGT1UPCDTÒEM0T 

9GKVGTGKPVGTGUUCPVGUEJYGFKUEJG1TFGPUUEJPCNNGPHKPFGP5KGWPVGT14&'055%*0#..'0 +06'40#6+10#. 



 

)TQ­G1TFGPUUEJPCNNGOKVHÒPH#WU\GKEJPWPIGP 'JTGP\GKEJGP\WT)QNFGPGP*QEJ\GKV-ÌPKI1U ECTU++WPF-ÌPKIKP5QRJKCUCO,WPK5KNDGTXGTIQNFGV 'JTGP\GKEJGP\WO5KNDGTPGP4GIKG TWPIULWDKN·WO-ÌPKI1UECTU++#WUHÒJTWPIOKVJGNNDNCWGO*KPVGTITWPFHÒT/KVINKGFGTFGTMÌPKINKEJGP (COKNKGMÌPKINKEJGWPFHÒTUVNKEJG)·UVG5KNDGTXGTIQNFGVWPFVGKNYGKUGGOCKNNKGTV )GF·EJVPKU'JTGP \GKEJGP \WO  )GDWTVUVCI -ÌPKI )WUVCXU 8 CO  ,WPK  $TQP\G XGTIQNFGV WPF GOCKNNKGTV    )GF·EJVPKU'JTGP\GKEJGP\WO)GDWTVUVCI-ÌPKI)WUVCXU8CO,WPK5KNDGTXGTIQNFGV CWH FGO 4GXGTU OGJTHCEJ RWP\KGTV W C 5  %Q HÒT FGP *GTUVGNNGT 5RQTTQPI 5 HÒT 5KNDGT WPF   ,CJTGURWP\G:HÒT  5KNDGTPG/GFCKNNG\WO'KPJWPFGTVL·JTKIGP$GUVGJGPFGU5EJYGFKUEJGP ,·IGT8GTDCPFGU 5VÒEM++



5GNVGPG5EJPCNNGGKPGU/KVINKGFUFGUUEJYGFKUEJGP*QEJCFGNU6JQTPKV KP6*15 IKDVCPFC­XQO'JTGP\GK EJGP\WT)QNFGPGP*QEJ\GKVPWT5VÒEMCPIGHGTVKIVYQTFGPUKPF'DGPHCNNUNCWV6JQTPKV KP6*15 KUVFCU 'JTGP\GKEJGP \WO 5KNDGTPGP 4GIKGTWPIULWDKN·WO -ÌPKI 1UECTU ++ KP FKGUGT #WUHÒJTWPI PWT  OCN XGTNKGJGP   YQTFGP(ÒTFCU)GF·EJVPKU'JTGP\GKEJGP\WO)GDWTVUVCI-ÌPKI)WUVCXU8IKDVGT KP6*15 8GTNGK JWPIGPCPWPFHÒTFCU)GF·EJVPKU'JTGP\GKEJGP\WO)GDWTVUVCI-ÌPKI)WUVCXU8 KP6*15 8GTNGK JWPIGP

9487



)TQ­G 1TFGPUUEJPCNNG FGU /KVINKGFU FGU 5EJYGFKUEJGP 4QVGP -TGW\GU 5 ' 6 2GTIPGT OKV XKGT   #WU\GKEJPWPIGP -ÌPKINKEJGT0QTFUVGTP1TFGP4KVVGTMTGW\ UGKV4KVVGTMTGW\-NCUUG )QNF GOCKNNKGTVCWHFGO4CPFFGUWPVGTGP-TGW\CTOUOGJTHCEJRWP\KGTV WC%(%HÒTFGP*GTUVGNNGT%( %CTNOCPKP5VQEMJQNO-HÒTEVQJPG,CJTGURWP\G  8GTFKGPUVOGFCKNNGFGU5EJYGFKUEJGP4QVGP -TGW\GU/QFGNNOKVFGO2QTVTCKV-ÌPKI)WUVCXU8  )QNFGPG8GTFKGPUVOGFCKNNG)QNFCWH FGT 4ÒEMUGKVG 8GTNGKJWPIUITCXWT 5'62'4)0'4   &GWVUEJGU 4GKEJ 9GKOCTGT 4GRWDNKM   -TKGIUFGPMOÒP\G  FGT &GWVUEJGP 'JTGPNGIKQP XGTIQNFGV   2TGW­GP -ÌPKITGKEJ 4QV   -TGW\/GFCKNNG-NCUUG-TKGIUOGVCNN/KV0CFGNUEJYGFKUEJGT#TV 5VÒEM++ &KG/KPKCVWTGPUEJPCNNGXQP5'62GTIPGTUKGJG-CV0T

 119


SCHWEDEN

9489 (1:2) 9488 (1:2)





)TQ­G1TFGPUUEJPCNNGFGU1HHK\KGTUFGTUEJYGFKUEJGP.WHV#DYGJT%#)$GTIOCPOKV#WU \GKEJPWPIGP -ÌPKINKEJGT9CUC1TFGP/QFGNN UGKV 4KVVGTMTGW\)QNFGOCKNNKGTVCWHFGO 4CPFFGUWPVGTGP-TGW\CTOUOGJTHCEJRWP\KGTV WC%(%HÒTFGP*GTUVGNNGT%(%CTNOCPKP5VQEM JQNO - HÒT  EV QJPG ,CJTGURWP\G    5KNDGTPG 8GTFKGPUOGFCKNNG FGU 5EJYGFKUEJGP <GPVTCN   XGTDCPFGU HÒT 1HHK\KGTUCWUDKNFWPI /QFGNN OKV FGO 2QTVTCKV -ÌPKI )WUVCXU 8 5KNDGT 2WP\KGTWPIGP   8GTNGKJWPIUITCXWT    5KNDGTPG 8GTFKGPUVOGFCKNNG FGU 4GKEJUXGTDCPFGU HÒT 9GKDNKEJG 8GTVGKFK   IWPIUJGNHGTKPPGP 5KNDGT 2WP\KGTWPIGP 8GTNGKJWPIUITCXWT    )QNFGPG 8GTFKGPUVOGFCKNNG FGU   5VQEMJQNOGT 8GTDCPFGU HÒT 1HHK\KGTUCWUDKNFWPI 5KNDGT XGTIQNFGV 2WP\KGTWPIGP 8GTNGKJWPIUITCXWT    )QNFGPG8GTFKGPUVOGFCKNNGFGU5EJYGFKUEJGP8GTDCPFGUHÒT.WHVªDGTYCEJWPI5KNDGTXGTIQN FGV2WP\KGTWPIGP8GTNGKJWPIUITCXWT 5KNDGTPG/GFCKNNGFGU5VQEMJQNOGT8GTYCJTWPIU-QOK VGGUHÒTHTGKYKNNKIG/KVCTDGKV5KNDGT2WP\KGTWPIGP8GTNGKJWPIUITCXWT 5KNDGTPG8GTFKGPUVOG FCKNNGFGT5VQEMJQNOGT.WHVCDYGJT8GTGKPKIWPI5KNDGT2WP\KGTWPIGP6T·IGTPCOG 5KNDGTPGU'JTGP \GKEJGP FGU 4GKEJU.WHVUEJWV\8GTDCPFGU 5KNDGT 2WP\KGTWPIGP 8GTNGKJWPIUITCXWT    5KNDGTPG   8GTFKGPUVOGFCKNNG FGU 4GKEJUXGTDCPFGU FGT YGJTRHNKEJVKIGP 1HHK\KGTG 5KNDGT 2WP\KGTWPIGP 8GTNGK   JWPIUITCXWT    )QNFGPG 8GTFKGPUVOGFCKNNG FGT 5VQEMJQNOGT .WHVªDGTYCEJWPIU8GTGKPKIWPI   5KNDGT XGTIQNFGV 2WP\KGTWPIGP 8GTNGKJWPIUITCXWT    5KNDGTPG 8GTFKGPUVOGFCKNNG FGT #FQNH   (TKGFTKEJ.CPFUVWTO8GTGKPKIWPI5KNDGTCP0CFGN 5VÒEM++



)TQ­G1TFGPUUEJPCNNGXQP(QNMG*QNOGDGTIOKVFTGK#WU\GKEJPWPIGP -ÌPKINKEJGT9CUC1TFGP /QFGNN UGKV 4KVVGTMTGW\)QNFGOCKNNKGTVI QJPG$CPFTKPI CWHFGO4CPFFGUWPVGTGP -TGW\CTOUOGJTHCEJRWP\KGTV WC%(%HÒTFGP*GTUVGNNGT%(%CTNOCPKP5VQEMJQNO-HÒTEV QJPG ,CJTGURWP\G  CWH FGT 4ÒEMUGKVG FGU WPVGTGP -TGW\CTOU 'OCKNNGEJKR WPF *CCTTKUUG   )QNFGPG   /GFCKNNG FGU 8GTDCPFGU FGT 8QNMUHÒTUQTIG HÒT YGTVXQNNGP 'KPUCV\ /QFGNN OKV 2QTVTCKV -ÌPKI )WUVCXU   8 5KNDGT XGTIQNFGV 2WP\KGTWPIGP   )QNFGPG 8GTFKGPUVOGFCKNNG FGU 5RQTVXGTDCPFGU FGT .CPFUEJCHV   ,·OVNCPF*·TLGFCN5KNDGTXGTIQNFGV2WP\KGTWPIGP8GTNGKJWPIUITCXWT#P0CFGN 5VÒEM++



9491 (1:2) 9490 (1:2)





120

)TQ­G 1TFGPUUEJPCNNG FGU 1HHK\KGTU ) 6 % 'JTGPDQTI OKV HÒPH #WU\GKEJPWPIGP   -ÌPKINKEJGT   0QTFUVGTP1TFGP 4KVVGTMTGW\ UGKV  4KVVGTMTGW\  -NCUUG  5KNDGT XGTIQNFGV /GFCKNNQPU )QNF   GOCKNNKGTV   5KNDGTPG /GFCKNNG HÒT 8GTFKGPUVG WO FGP 5EJYGFKUEJGP .CPFUVWTO /QFGNN OKV 2QTVTCKV   -ÌPKI )WUVCXU 8 5KNDGT 2WP\KGTWPIGP   )QNFGPG 8GTFKGPUVOGFCKNNG FGU 5VQEMJQNOGT 5EJÒV\GPXGT   DCPFGU5KNDGTXGTIQNFGV8GTNGKJWPIUITCXWT 5KNDGTPG8GTFKGPUVOGFCKNNGFGT5VQEMJQNOGT.CPF UVWTO8GTDCPFGU 5KNDGT OKV 8GTNGKJWPIUITCXWT    0KGFGTNCPFG 1TCPKGP0CUUCW1TFGP 1HHK   \KGTUMTGW\OKV5EJYGTVGTP)QNF5KNDGTGOCKNNKGTV$CPFOKVCWHIGNGIVGT4QUGVVG#P0CFGN  5VÒEM++



)TQ­G1TFGPUUEJPCNNGOKVFTGKXQPWTURTÒPINKEJXKGT#WU\GKEJPWPIGP )GF·EJVPKU'JTGP\GKEJGP \WO)GDWTVUVCI-ÌPKI)WUVCXU8CO,WPK5KNDGTXGTIQNFGVWPFGOCKNNKGTV .GGTGU$CPF FGU0QTFUVGTPQTFGPU 5KNDGTPG/GFCKNNGHÒT8GTFKGPUVGWOFGP5EJYGFKUEJGP.CPFUVWTO/QFGNNOKV 2QTVTCKV-ÌPKI)WUVCXU85KNDGT (KPPNCPF'KUGTPGU8GTFKGPUVMTGW\FGTHKPPKUEJGP<KXKNICTFG#P 0CFGN 5VÒEM++




SCHWEDEN

9492



)TQ­G 1TFGPUUEJPCNNG FGU 5EJKHCJTGTU *GTOCPP 'TKEUUQP OKV \YGK #WU\GKEJPWPIGP   5KNDGTPG   2TGKUOGFCKNNGFGT8GTGKPKIWPI\WT(ÌTFGTWPIFGU5EJKNCWHUKP5EJYGFGP5KNDGTOKV8GTNGKJWPIUITCXWT *GTOCPP4GKUUQPMO 4WUUKUEJGU4GKEJ-NGKPG5KNDGTPG/GFCKNNG(ÒT'KHGT/QFGNN OKVFGO2QTVTCKV<CT0KMQNCWU ++CP0CFGN 5VÒEM++



9493



)TQ­G 1TFGPUUEJPCNNG FGU /KVINKGFU FGU 5EJYGFKUEJGP 4QVGP -TGW\GU WPF -QTGC-TKGIUVGKNPGJ   OGTU51$LÌTNKPOKVHÒPH#WU\GKEJPWPIGP 5KNDGTPG8GTFKGPUVOGFCKNNGFGU5EJYGFKUEJGP4QVGP -TGW\GU/QFGNN)WUVCX8+#FQNH  OKV6T·IGTITCXWT51$LÌTNKP 75#(TGKJGKVU /GFCKNNG=(TGGFQO/GFCN? 701-QTGC-TKGIUOGFCKNNGGPINKUEJURTCEJKIG#WUHÒJTWPI 7PDG MCPPVG#WU\GKEJPWPIGPFGU4QVGP-TGW\GU 5ÒFMQTGC-QTGC-TKGIUOGFCKNNGCP0CFGN/KVFC\WIG JÌTKIGT /KPKCVWTGPUEJPCNNG FCTCP GKPG ITCXKGTVG /KPKCVWT FGT COGTKMCPKUEJGP (TGKJGKVUOGFCKNNG CP   6TCIGMPQRH 5VÒEM++ 9GKVGTGKPVGTGUUCPVGUEJYGFKUEJG/KPKCVWTGPUEJPCNNGPWPFMGVVEJGPHKPFGP5KGWPVGT/+0+#674'0 5%*0#..'070&-'66%*'0+06'40#6+10#.



9494



/KPKCVWTGPMGVVEJGPOKVHÒPH#WU\GKEJPWPIUOKPKCVWTGP 'JTGP\GKEJGP\WO5KNDGTPGP4GIKGTWPIU LWDKN·WO-ÌPKI1UECTU++5KNDGTXGTIQNFGV#WUHÒJTWPIOKVJGNNDNCWGO*KPVGTITWPFHÒT/KVINKGFGTFGT MÌPKINKEJGP (COKNKG MÌPKINKEJG WPF HÒTUVNKEJG )·UVG   )GF·EJVPKU'JTGP\GKEJGP \WO  )GDWTVUVCI   -ÌPKI )WUVCXU 8 CO  ,WPK  5KNDGT XGTIQNFGV WPF GOCKNNKGTV   -ÌPKINKEJGT 0QTFUVGTPQTFGP   1TFGPUMTGW\)QNFGOCKNNKGTV -ÌPKINKEJGT9CUC1TFGP1TFGPUMTGW\)QNFGOCKNNKGTV 4W­KUEJGU 4GKEJ-CKUGTNKEJGT1TFGPFGTJN#PPC1TFGPUMTGW\)QNFGOCKNNKGTV'OCKNNGOCNGTGK1TFGPUMGVVEJGP )QNFCP\YGK0CFGNP 5VÒEM++



.CWV 6JQTPKV KP 6*1 5   KUV FCU 'JTGP\GKEJGP \WO 5KNDGTPGP 4GIKGTWPIULWDKN·WO -ÌPKI 1UECTU ++ KP FKGUGT   #WUHÒJTWPIPWTOCNXGTNKGJGPYQTFGP

121


SCHWEDEN

9495





9496

/KPKCVWTGPUEJPCNNG FGU 5VQEMJQNOGT (TKUGWTOGKUVGTU % # $TKPEM OKV UKGDGP XQP WTURTÒPINKEJ   CEJV #WU\GKEJPWPIUOKPKCVWTGP   9CUC1TFGP 4KVVGTMTGW\ 5KNDGT XGTIQNFGV WPF GOCKNNKGTV   )QN   FGPG &KGPUVCWU\GKEJPWPIU/GFCKNNG FGT -ÌPKINKEJ 5EJYGFKUEJGP 2CVTKQVKUEJGP )GUGNNUEJCHV /QFGNN   -ÌPKI )WUVCXU 8   )QNFGPG 8GTFKGPUVOGFCKNNG FGT -ÌPKINKEJ 5EJYGFKUEJGP 2CVTKQVKUEJGP )GUGNN   UEJCHV/QFGNN-ÌPKI)WUVCXU8 7PDGMCPPVG5KNDGTPG8GTFKGPUVOGFCKNNGGKPGT)GUGNNUEJCHV/QFGNN -ÌPKI )WUVCXU 8   )QNFGPG 8GTFKGPUVOGFCKNNG FGU 5EJYGFKUEJGP (TKUGWTXGTDCPFGU   )QNFGPG   8GTFKGPUVOGFCKNNG FGT 8GTGKPKIWPI FGT (TKUGWTOGKUVGT XQP 5VQEMJQNO #NNG KP 5KNDGT VGKNU XGTIQNFGV   VGKNUOGJTHCEJRWP\KGTV1JPG0CFGN 5VÒEM++



/KPKCVWTGPUEJPCNNG OKV XKGT #WU\GKEJPWPIUOKPKCVWTGP   'JTGP\GKEJGP \WT )QNFGPGP*QEJ\GKV-Ì PKI1UECTU++WPF-ÌPKIKP5QRJKCUCO,WPK5KNDGTXGTIQNFGV )GF·EJVPKU'JTGP\GKEJGP\WO  )GDWTVUVCI -ÌPKI )WUVCXU 8 CO  ,WPK  $TQP\G XGTIQNFGV WPF GOCKNNKGTV   )GF·EJVPKU   'JTGP\GKEJGP \WO  )GDWTVUVCI -ÌPKI )WUVCXU 8 CO  ,WPK  5KNDGT XGTIQNFGV   'TKPPG   TWPIUOGFCKNNG\WO)GDWTVUVCI-ÌPKI)WUVCXU8+#FQNH5KNDGT 5VÒEM++



6JQTPKV KP 6*1 5   IKDV CP FC­ XQO 'JTGP\GKEJGP \WT)QNFGPGP*QEJ\GKVPWT5VÒEMCPIGHGTVKIVYQTFGP UKPF (ÒT FCU )GF·EJVPKU'JTGP\GKEJGP \WO  )GDWTVUVCI-ÌPKI)WUVCXU8IKDVGT KP6*15 8GTNGK JWPIGPCPHÒTFCU)GF·EJVPKU'JTGP\GKEJGP\WO)GDWTVUVCI-ÌPKI)WUVCXU8 KP6*15 8GTNGKJWP IGPWPFHÒTFKG'TKPPGTWPIUOGFCKNNG\WO)GDWTVUVCI-ÌPKI)WUVCX8+#FQNH KP6*15 8GTNGKJWP IGP

9497



9498

9499

/KPKCVWTGPUEJPCNNGFGU/KVINKGFUFGU5EJYGFKUEJGP4QVGP-TGW\GU5'62GTIPGTOKVXKGT#WU \GKEJPWPIGP   -ÌPKINKEJGT 0QTFUVGTP1TFGP 4KVVGTMTGW\ UGKV  4KVVGTMTGW\  -NCUUG  )QNF   GOCKNNKGTV 8GTFKGPUVOGFCKNNGFGU5EJYGFKUEJGP4QVGP-TGW\GU/QFGNNOKVFGO2QTVTCKV-ÌPKI)W UVCXU 8   )QNFGPG 8GTFKGPUVOGFCKNNG )QNF   &GWVUEJGU 4GKEJ 9GKOCTGT 4GRWDNKM   -TKGIUFGPMOÒP\G  FGT &GWVUEJGP 'JTGPNGIKQP XGTIQNFGV   2TGW­GP -ÌPKITGKEJ 4QV   -TGW\/GFCKNNG-NCUUG-TKGIUOGVCNN1JPG0CFGN 5VÒEM++



&KGITQ­G1TFGPUUEJPCNNGXQP5'62GTIPGTUKGJG-CV0T



/KPKCVWTGPUEJPCNNGOKVUGEJU#WU\GKEJPWPIUOKPKCVWTGP )GF·EJVPKU'JTGP\GKEJGP\WO)GDWTVU VCI-ÌPKI)WUVCXU8CO,WPK5KNDGTXGTIQNFGV 'TKPPGTWPIUOGFCKNNG\WO)GDWTVUVCI -ÌPKI )WUVCXU 8+ #FQNH  5KNDGT   /GFCKNNG \WO 6QF -ÌPKI )WUVCXU 8  5KNDGT     5GTCRJKO1TFGP 1TFGPUMTGW\ )QNF GOCKNNKGTV   -ÌPKINKEJGT 9CUC1TFGP /QFGNN UGKV  4KVVGTMTGW\ UGKV4KVVGTMTGW\-NCUUG )QNFGOCKNNKGTV 5KNDGTPG8GTFKGPUVOGFCKNNGFGU4QVGP -TGW\GU/QFGNN-ÌPKI)WUVCXU85KNDGT 5VÒEM+p++



/KPKCVWTGPFGU5GTCRJKO1TFGPUUKPFXQPITQ­GT5GNVGPJGKV



122

/KPKCVWTGPUEJPCNNG OKV XKGT #WU\GKEJPWPIUOKPKCVWTGP   -ÌPKINKEJGT 9CUC1TFGP  /QFGNN UGKV     4KVVGTMTGW\ UGKV  4KVVGTMTGW\  -NCUUG  )QNF GOCKNNKGTV   7PDGMCPPVGU 8GTFKGPUVMTGW\   5KNDGTXGTIQNFGVWPFGOCKNNKGTV'OCKNNGEJKRKO/GFCKNNQP )QNFGPG8GTFKGPUVOGFCKNNGFGU5EJÒV\GP XGTDCPFGU 1UV)QVNCPF )QNF   )QNFGPG 8GTFKGPUVOGFCKNNG FGU 5EJÒV\GPXGTDCPFGU .KPMÌRKPI )QNF   CP0CFGN 5VÒEM++




SCHWEDEN

9500





9501

/KPKCVWTGPUEJPCNNG OKV FTGK #WU\GKEJPWPIUOKPKCVWTGP   -ÌPKINKEJGT 0QTFUVGTPQTFGP 4KVVGTMTGW\   5KNDGTXGTIQNFGV/GFCKNNQPU)QNFGOCKNNKGTV -ÌPKINKEJGT9CUC1TFGP4KVVGTMTGW\)QNFGOCKNNKGTV  ¤UVGTTGKEJ-CKUGTTGKEJ'JTGP\GKEJGPXQO4QVGP-TGW\-NCUUGOKVFGT-TKGIUFGMQTCVKQP5KNDGT VGKNYGKUGXGTIQNFGVGOCKNNKGTV1JPG0CFGN 5VÒEM++



/KPKCVWTGPMGVVEJGPGKPGU1HHK\KGTUOKVHÒPH/KPKCVWTCWU\GKEJPWPIGP -ÌPKINKEJGT5EJYGTVQTFGP 4KVVGTMTGW\ 5KNDGT XGTIQNFGV /GFCKNNQP )QNF GOCKNNKGTV   -ÌPKINKEJGT 9CUC1TFGP 4KVVGTMTGW\   )QNFGOCKNNKGTV )QNFGPG8GTFKGPUVOGFCKNNGFGU5EJYGFKUEJGP4GKEJU.WHVUEJWV\8GTDCPFGU/QFGNN -ÌPKI )WUVCXU 8 5KNDGT XGTIQNFGV   )QNFGPGU 'JTGP\GKEJGP FGU 5EJYGFKUEJGP 4GKEJU.WHVUEJWV\   8GTDCPFGU 5KNDGT XGTIQNFGV CWH FGT 4ÒEMUGKVG OGJTHCEJ RWP\KGTV   $GNIKGP /KNKV·TMTGW\ )QNF   GOCKNNKGTVCP-GVVEJGP5KNDGTXGTIQNFGVOKV\YGK0CFGNP 5VÒEM++



9503 9502





/KPKCVWTGPUEJPCNNGGKPGU-KTEJGPOWUKMGTUOKVXKGT#WU\GKEJPWPIUOKPKCVWTGP -ÌPKINKEJGT0QTF UVGTPQTFGP 4KVVGTMTGW\ 5KNDGT XGTIQNFGV /GFCKNNQP )QNF GOCKNNKGTV   )QNFGPG 8GTFKGPUVOGFCKNNG   FGU5EJYGFKUEJGP4GKEJUXGTDCPFGUFGT1TEJGUVGTXGTGKPKIWPIGP/QFGNNOKV2QTVTCKV-ÌPKI)WUVCXU8 5KNDGT XGTIQNFGV   )QNFGPG 8GTFKGPUVOGFCKNNG FGU 5EJYGFKUEJGP -KTEJGPIGUCPIU8GTDCPFGU 5KNDGT   XGTIQNFGV2WP\KGTWPIGP )QNFGPG8GTFKGPUVOGFCKNNGGKPGU/WUKMGT4GKEJUXGTDCPFGU=/WUKMNCTCTPCT? CP-PQRH 5VÒEM++



/KPKCVWTGPUEJPCNNG OKV \YGK #WU\GKEJPWPIUOKPKCVWTGP   -ÌPKINKEJGT 0QTFUVGTPQTFGP4KVVGTMTGW\ )QNF GOCKNNKGTV   )QNFGPG /GFCKNNG HÒT YCEJUCOG 2HNGIG FGT 'TKPPGTWPI CP )WUVCX ++ #FQNH XQP   5EJYGFGP$TQP\GXGTIQNFGVWPFGOCKNNKGTVCP-PQRH 5VÒEM++



9504





9505

/KPKCVWTGPUEJPCNNG GKPGU 6KGTUEJÒV\GTU OKV XKGT #WU\GKEJPWPIUOKPKCVWTGP   -ÌPKINKEJGT 9CUC   1TFGP/QFGNN UGKV 4KVVGTMTGW\ UGKV4KVVGTMTGW\-NCUUG )QNFGOCKNNKGTV )QNFGPG 8GTFKGPUVOGFCKNNG FGU UEJYGFKUEJGP 4GKEJUXGTDCPFU FGT 6KGTUEJWV\8GTGKPKIWPIGP /QFGNN OKV FGO   2QTVTCKV-ÌPKI)WUVCXU8+#FQNH$TQP\GXGTIQNFGV 6KGTUEJWV\#WU\GKEJPWPIFGTIWVG*KTVG5KNDGT XGTIQNFGV /GFCKNNGHÒT8GTFKGPUVGWOFCU5EJYGFKUEJG4QVG-TGW\/QFGNNOKVFGO2QTVTCKV-ÌPKI )WUVCXU85KNDGTCP-PQRH 5VÒEM++



/KPKCVWTGPUEJPCNNG OKV FTGK #WU\GKEJPWPIUOKPKCVWTGP   -ÌPKINKEJGT 9CUC1TFGP  /QFGNN UGKV     4KVVGTMTGW\ UGKV  4KVVGTMTGW\  -NCUUG  5KNDGT XGTIQNFGV /GFCKNNQPU )QNF GOCKNNKGTV    /GFCKNNGHÒT8GTFKGPUVGWOFCU5EJYGFKUEJG4QVG-TGW\/QFGNNOKVFGO2QTVTCKV-ÌPKI)WUVCXU8 5KNDGT 7PDGMCPPVGUMQOOWPCNGU/CTKPG8GTFKGPUVMTGW\CP-PQRH 5VÒEM++

 123


SCHWEDEN 





-QPXQNWVXQP#WU\GKEJPWPIGP7C)GF·EJVPKU'JTGP\GKEJGP\WO)GDWTVUVCI-ÌPKI)WUVCXU 8CO,WPK Z 5KNDGTPG*QH8GTFKGPUVOGFCKNNG)WUVCXU8/GFCKNNG\WO,CJTGUVCIFGT )TÒPFWPIFGT-QNQPKG0GW5EJYGFGPKP#OGTKMC-NGKPG)QNFGPG8GTFKGPUVOGFCKNNGFGU5EJYGFKUEJGP 4QVGP-TGW\GU/QFGNNOKV2QTVTCKV-ÌPKI)WUVCXU8+#FQNH5KNDGTXGTIQNFGVKO'VWK)QNFGPG8GT FKGPUVOGFCKNNG FGU 5EJYGFKUEJGP 5·PIGTDWPFGU Z  /GFCKNNG \WO  ,CJTGUVCI FGT )TÒPFWPI FGU   9GNVRQUVXGTGKPU XGTUEJKGFGPG /GVCNNG OGKUV 5KNDGT VGKNU XGTIQNFGV VGKNU GOCKNNKGTV VGKNU CP $·PFGTP   &C\WFTGKGOCKNNKGTVG#D\GKEJGP 5VÒEM++



-QPXQNWVXQPUEJYGFKUEJGP/KPKCVWTGP7C9CUC1TFGP4KVVGTMTGW\ Z 5EJYGTVGTMTGW\OKV 5EJYGTVGTP#OCTCPVJGP1TFGPWPF'JTGP\GKEJGP\WO5KNDGTPGP4GIKGTWPIULWDKN·WO-ÌPKI1UECTU++ #WUHÒJTWPIOKVJGNNDNCWGO*KPVGTITWPFXGTUEJKGFGPG/GVCNNGOGKUV5KNDGTXGTIQNFGVCDGTCWEJ)QNF GOCKNNKGTV/GFCKNNGP\WUCOOGPCP/KPKCVWTGPUEJPCNNGKPUGJTQTFGPVNKEJGT'TJCNVWPI 5VÒEM++



-QPXQNWV XQP  /KPKCVWTGP UEJYGFKUEJGT 1TFGP WPF 'JTGP\GKEJGP 9GPKIG &WDNGVVGP XGTUEJKG   FGPG /GVCNNG OGKUV 5KNDGT VGKNU XGTIQNFGV VGKNU RWP\KGTV GKPKIG GOCKNNKGTV OGKUV CP $·PFEJGP GKPKIG   FCXQPOKV6TCIGMPQRHOGKUVKPQTFGPVNKEJGP'TJCNVWPIGP 5VÒEM++++p++++++



'KPGYCJTG(WPFITWDGHÒT/KPKCVWTGPUCOONGT



-QPXQNWV XQP HÒPH MNGKPGP /KPKCVWTGP XQP 4KVVGTMTGW\GP UEJYGFKUEJGT 1TFGP Z -ÌPKINKEJGT   5EJYGTVQTFGP Z -ÌPKINKEJGT 0QTFUVGTP1TFGP WPF Z -ÌPKINKEJGT 9CUC1TFGP LGYGKNU )QNF GOCKN   NKGTV\WUCOOGPIKPQTFGPVNKEJGP'TJCNVWPIGPQJPG$·PFEJGP&C\W\YGK-PQRHNQEJUEJNGKHEJGP LGYGKNUOKV/KPKCVWT1TFGPMTGW\#WHNCIGPCP-PÌRHGP 5VÒEM++++p+++



9511

9512

ex 9510 (1:1)





-QPXQNWV XQP HÒPH /KPKCVWTGP XQP 4KVVGTMTGW\GP UEJYGFKUEJGT 1TFGP Z -ÌPKINKEJGT 5EJYGTVQT   FGPZ-ÌPKINKEJGT9CUC1TFGPFCXQPGKPGZOOCWUFGONGV\VGP&TKVVGNFGU,CJTJWP FGTVUWPVGTJCNDFGT-TQPGTGRCTKGTVLGYGKNU)QNFGOCKNNKGTV\WUCOOGPICW­GTFGOTGRCTKGTVGP 'ZGORNCTKPQTFGPVNKEJGP'TJCNVWPIGP\YGKOKV$·PFEJGP 5VÒEM++



&GMQTCVKQP FGT *QHFCOGP FGT -ÌPKIKP .QWKUG XQP 5EJYGFGP 5KNDGT XGTIQNFGV CWHIGNGIV CWH GKPG   $CPFUEJNGKHGCP0CFGN 44++



.QWKUG   /QWPVDCVVGP IGD 2TKP\GUUKP XQP $CVVGPDGTI GKPG 0GDGPNKPKG FGU ITQ­JGT\QINKEJ JGUUKUEJGP   *CWUGU YCT FKG \YGKVG 6QEJVGT XQP 2TKP\ .WFYKI XQP $CVVGPDGTI CD  .QWKU /QWPVDCVVGP UV /CTSWGUU QH   /KNHQTF*CXGP  WPFUGKPGT)CVVKP8KMVQTKCXQP*GUUGP&CTOUVCFV  -TQPRTKP\)WUVCX#FQNH XQP 5EJYGFGP   JGKTCVGVG UKG  PCEJ FGO 6QFG UGKPG GTUVGP (TCW /CTICTGV XQP %QPPCWIJV      0CEJ FGO 6QFG +JTGU 5EJYKGIGTXCVGTU )WUVCX 8   YWTFG UKG CP FGT 5GKVG KJTGU /CPPGU FGU   PWPOGJTKIGP-ÌPKIU)WUVCX8+#FQNH-ÌPKIKPXQP5EJYGFGP5KGYCTGKPG6CPVGFGTDTKVKUEJGP-ÌPKIKP'NK\CDGVJ++

IGD YKGCWEJXQPFGTGP'JGOCPP2TKP\2JKNKRR*GT\QIXQP'FKPDWTIJ IGD 

 124

-COOGTJGTTGP5EJNÒUUGN$TQP\GXGTIQNFGVZOOCWHIGNGIVCWHFWPMGNDNCWGT$CPFTQUGVVG OKV$GHGUVKIWPIUMQTFGN&95 ++




SLOWAKEI

9513

9514

ex 9515

9516

5'4$+'070&,7)15.#9+'0 (ª456'067/70&-¤0+)4'+%*5'4$+'0   

-TGW\ FGT )GUGNNUEJCHV FGU 4QVGP -TGW\GU FGU -ÌPKITGKEJU 5GTDKGP  /QFGNN OKV -TQPG      #PHGTVKIWPIFGT(KTOC*WIWGPKP(T½TGUKP.G.QENG5KNDGTGOCKNNKGTVCWHFGT4ÒEMUGKVGPCJG\W WPUKEJVDCTG'OCKNNGTGRCTCVWTKPGKPGT'EMGQJPG$CPF%/-4% ++



-TGW\ FGT )GUGNNUEJCHV FGU 4QVGP -TGW\GU FGU -ÌPKITGKEJU 5GTDKGP  /QFGNN OKV -TQPG       #PHGTVKIWPI FGT (KTOC *WIWGPKP (T½TGU KP .G .QENG 5KNDGT GOCKNNKGTV CO CNVGP &TGKGEMUDCPF   %/-4% ++



-QPXQNWV XQP UKGDGP #WU\GKEJPWPIGP   )TQ­G /KNQUEJ 1DKNKVUEJ/GFCKNNG HÒT 6CRHGTMGKV KP )QNF   XGTIQNFGV )TQ­G/KNQUEJ1DKNKVUEJ/GFCKNNGHÒT6CRHGTMGKVKP5KNDGTXGTUKNDGTV 'TKPPGTWPIUMTGW\ CPFGP-TKGIIGIGP$WNICTKGP WPF $CNMCP-TKGIUOGFCKNNG Z  -TKGIUGTKPPG TWPIUMTGW\    /GFCKNNG HÒT 8CVGTNCPFUVTGWG UQIGP #NDCPKGP/GFCKNNG 8GTUEJKGFGPG /G   VCNNGVGKNUXGTIQNFGVVGKNUXGTUKNDGTVLGYGKNUCP$·PFGTPKPQTFGPVNKEJGP'TJCNVWPIGP 5VÒEM++++p



.CWV%CTWPF/WJKE KP%#/5H N·­VUKEJFKGUGU-TGW\GKPFGWVKIFGO5EJYGK\GT*GTUVGNNGT\WQTFPGP8GTNKG JGP CP &QTQVJ[ .[QP&CNDGTI#EVQP .CF[ #EVQP   )GOCJNKP XQP 4KEJCTF .[QP&CNDGTI#EVQP PF   $CTQP#EVQP  DTKVKUEJGT&KRNQOCVKPFGT5EJYGK\WPFKP*GUUGPXQPDKUDTKVKUEJGT)GUCPF VGT KP (KPPNCPF 'Z #WMVKQP 1TFGTU &GEQTCVKQPU /GFCNU CPF /KNKVCTKC DGK &KZ 0QQPCP 9GDD KP .QPFQP CO   ,WNK .QV0T \WUCOOGPOKVYGKVGTGP1TFGPUKPUKIPKGPCWUFGO$GUKV\FGT(COKNKG#EVQP5KGJGCWEJ -CVCNQI0T



.CWV%CTWPF/WJKE KP%#/5H N·­VUKEJFKGUGU-TGW\GKPFGWVKIFGO5EJYGK\GT*GTUVGNNGT\WQTFPGP





-¤0+)4'+%*&'45'4$'0-41#6'070&5.19'0'0$<9  -¤0+)4'+%*,7)15.#9+'0  

1TFGP FGU JGKNKIGP 5CXC  /QFGNN  #WUHÒJTWPI FGT *GKNKIG KO ITÒPGP )GYCPF  UGKV     &GMQTCVKQP +8 -NCUUG #PHGTVKIWPI FGT (KTOC *WIWGPKP (T½TGU KP .G .QENG 5KNDGT XGTIQNFGV   'OCKNNGOCNGTGKCOPGWGP$CPF<- ++

ex 9517



ex 9518

5.19#-'+

'456' 5.19#-+5%*'4'27$.+-   

1TFGP XQO -TKGIU5KGIGUMTGW\  -NCUUG )QNFGPG /GFCKNNG  XGTIQNFGV  -NCUUG 5KNDGTPG /G   FCKNNG 5KNDGTWPF-NCUUG $TQP\GPG/GFCKNNG LGYGKNUCOQTKIKPCNGP$CPFOKVUNQYCMKUEJGT6TCIG URCPIG<- 5VÒEM++





1TFGP XQO -TKGIU5KGIGUMTGW\  -NCUUG OKV 5EJYGTVGTP 5KNDGTPG /GFCKNNG  5KNDGT WPF  -NCUUG   OKV 5EJYGTVGTP DTQP\GPG /GFCKNNG  LGYGKNU CO QTKIKPCNGP $CPF OKV UNQYCMKUEJGT 6TCIGURCPIG <-   &C\W6KUQ/GFCKNNGKP$TQP\GCO$CPFWPF)GFGPM#D\GKEJGPHÒTFGP(GNF\WIIGIGPFKG 7F554-NCUUG$TQP\GCP0CFGN 5VÒEM++

 125


SPANIEN

9519 (1:1)

52#0+'0 

&4+66'5 -¤0+)4'+%*4'56#74#6+10  

-ÌPKINKEJGTWPF/KNKV·TKUEJGT1TFGPFGUJN*GTOGPGIKNFQ=4GCN[/KNKVCT1TFGPFG5CP*GTOG PGIKNFQ?/QFGNN WPF 4KVVGTMTGW\)QNFVGKNYGKUGGOCKNNKGTVFKG-TGW\CTO HN·EJGPCWU'NHGPDGKPFCXQPGKPGTDGUEJ·FKIVIQJPG$CPFTKPIWPFQJPG$CPF2)XCT<-  44++



$GFGWVGPFGUHTÒJGU'ZGORNCTWOYQJNCWUFGPPCRQNGQPKUEJGP-TKGIGPXQPITQ­GT5GNVGPJGKV'ZGORNCTFGT #WMVKQPFGT%CUCF #UVG5CP)KQTIKQ)GPWC0TWPFFGT#WMVKQP(TKV\4WFQNH-ÒPMGT1UPCDTÒEM  0T  &GT FTGKMNCUUKIG )TQ­MTGW\ 5VGTP WPF -TGW\  /KNKV·T8GTFKGPUVQTFGP YWTFG OKV MÌPKINKEJGO   &GMTGV XQO  0QXODGT XQP-ÌPKI(GTFKPCPF8++  IGUVKHVGVFCU4GIQNCOGPVQFCVKGTVXQO ,WNK  /KV -ÌPKINKEJGO &GMTGV XQO  ,CPWCT  GTJKGNV FCU $CPF PGWG (CTDGP WPF PQEJ GKPOCN FWTEJ   -ÌPKI#NHQPU:++  OKV-ÌPKINKEJGO&GMTGVXQO,WPK /QFGNN &KG<YGKVG4GRWDNKMÒDGT PCJOKO*GTDUVFGP1TFGPGTUGV\VGLGFQEJFKG-ÌPKIUMTQPGFWTEJGKPG/CWGTMTQPGWPFGPVHGTPVGFCU5VKHVGT OQPQITCOO CWH FGT 4ÒEMUGKVG FGU /GFCKNNQPU  /QFGNN  5VCCVUEJGH )GPGTCN (TCPEKUEQ (TCPEQ [ $CJCOQPFG  

 ÒDGTPCJOFGP1TFGP\WP·EJUVOKVFGTUQIGPCPPVGPKORGTKCNGP-TQPGFGTMCVJQNKUEJGP-ÌPKIGGTUGV\VG FKGU LGFQEJ OKV &GMTGV XQO  /CK  XGTÌHHGPVNKEJV KO $1' 0T  XQO  ,WPK  FWTEJ FKG WTURTÒPINKEJG   -ÌPKIUMTQPG /KV MÌPKINKEJGO &GMTGV  XQO  (GDTWCT  XGTÌHHGPVNKEJV KP $1' 0T  XQO    (GDTWCT HÒIVG-ÌPKI,WCP%CTNQU+WPVGTJCNDFGU5VGTPU=2NCEC?GKPG-QOOCPFGWTUMNCUUGGKP0GWG5VCVWVGPYWT FGPUEJNKG­NKEJOKV-ÌPKINKEJGO&GMTGVXQO,WPKGTNCUUGP

9520 (1:1)

9520 (1:1) 1,5:1



-TGW\HÒTFKG5EJNCEJVXQP6CNCXGTCFGNC4GKPC CO,WNK =%TW\FG6CNCXGTCFGNC4GKPC? )TQ­G #WUHÒJTWPI  Z  OO )QNF VGKNYGKUG HGKP \KUGNKGTV GOCKNNKGTV  I HGKPUVG )QNF   UEJTKHV CNVG MCWO UKEJVDCTG 'OCKNNGTGRCTCVWTGP KP FGT ¤UG RWP\KGTV OKV CNVGO $CPF OKV IQNFGPGT   5RCPIG2) 44++  'ZGORNCTFGT#WMVKQP(TKV\4WFQNH-ÒPMGT1UPCDTÒEM0T5GNVGPG#WU\GKEJPWPICWUFGP0CRQ N¾QPKUEJGP-TKGIGP&CU-TGW\KUVCO&G\GODGTOKV-ÌPKINKEJGT8GTQTFPWPIXQP(GTFKPCPF8++IGUVKHVGV YQTFGP

126


SPANIEN

1,5:1

9521 (1:1)



-TGW\HÒTFKG5EJNCEJVXQP%JKENCPC=%TW\FG%JKENCPC?ZOO)QNFGOCKNNKGTVIMN 'OCKNNGCWUDTWEJCWHFGOQDGTGP-TGW\CTOQJPG$·PFEJGP2) 44++



'ZGORNCTFGT#WMVKQP(TKV\4WFQNH-ÒPMGT1UPCDTÒEM0T5GNVGPGU-TGW\CWUFGP0CRQN¾QPKUEJGP -TKGIGP&CU-TGW\KUVCO(GDTWCTOKV-ÌPKINKEJGT8GTQTFPWPIXQP(GTFKPCPF8++IGUVKHVGVYQTFGP

1,5:1

9522 (1:1)



9522 (1:1)

-TGW\FGT<YGKVGP#TOGGQFGTFGT#TOGGXQP/WTEKC=%TW\FGN5GIWPFQ'L¾TEKVQ?ZOO )QNFGOCKNNKGTVIOGJTGTGCNVGTUDGFKPIVG'OCKNNGUEJ·FGPQJPG$CPF2) 44+++



'ZGORNCTFGT#WMVKQP(TKV\4WFQNH-ÒPMGT1UPCDTÒEM0T5GNVGPGU-TGW\CWUFGP0CRQN¾QPKUEJGP -TKGIGP&CU-TGW\KUVCO/·T\OKV-ÌPKINKEJGT8GTQTFPWPIXQP(GTFKPCPF8++IGUVKHVGVYQTFGP

9523 (1:1)



-TGW\FGT&TKVVGP#TOGG=%TW\FGN6GTEGT'L¾TEKVQ?#WUHÒJTWPIOKV6'4%'4','4%+61CWH FGO4GXGTUOGFCKNNQPWPFUVCTTDGHGUVKIVGO.QTDGGTMTCP\OOZOO)QNFGOCKNNKGTVI

OKV$CPF COQTKIKPCNGP$CPF2) 44++



'ZGORNCTFGT#WMVKQP(TKV\4WFQNH-ÒPMGT1UPCDTÒEM0T

127


SPANIEN

9526

9524 9525 (1:1)

&4+66'5 -¤0+)4'+%*4')+'470)+5#$'..#5++   

-ÌPKINKEJGT WPF 8GTFKGPUVXQNNGT 1TFGP -CTNU +++ =4GCN [ &KUVKPIWKFC 1TFGP FG %CTNQU +++?    /QFGNN   $TWUVUVGTP \WO )TQ­MTGW\ 5KNDGT DTKNNCPVKGTV WPF TGRGTEKGTV /GFCKNNQP )QNF   GOCKNNKGTV \YGK OKP 5RTÒPIG KO /GFCKNNQPHGNF HGKPUVG 'OCKNNGOCNGTGK CWH FGO 4GXGTU*GTUVGNNGTDG \GKEJPWPIFGT(KTOC);TCDWTQKP/CFTKFCP0CFGNOKV\YGK5GKVGPJCMGP2)<- ++



5GJTHGKPG#PHGTVKIWPIWO'ZGORNCTFGT#WMVKQPFGT%CUCF #UVG5CP)KQTIKQ)GPWC0TWPFFGT #WMVKQP(TKV\4WFQNH-ÒPMGT1UPCDTÒEM0T&GT\WP·EJUVXKGTMNCUUKIG )TQ­MTGW\-QOOCPFGWT 4KVVGTOKV2GPUKQPWPF4KVVGTXQP0WOOGT 1TFGPYWTFGXQP-ÌPKI%CTNQU+++  OKV7TMWPFGXQO 5GRVGODGTIGUVKHVGV /QFGNN XQP-ÌPKI%CTNQU+8  OKV-ÌPKINKEJGO&GMTGVXQO,WPK

/QFGNN WPFXQP-ÌPKI(GTPCPFQ8++  OKV&GMTGVXQO#RTKNXGT·PFGTV'KPG8GT·PFGTWPI FGT +PUKIPKGP YWTFG FWTEJ &GMTGVG -ÌPKIKP +UCDGNNCU ++   XQO  ,WNK  WPF 8GTQTFPWPI XQO    5GRVGODGT 5VKHVWPIFGT-QNNCPGWPFFGU-QOOCPFGWTUXQP0WOOGT#DUEJCHHWPIFGT4KVVGTOKV2GPUKQPWPF FGT 4KVVGT XQP 0WOOGT \W )WPUVGP FGT GKPHCEJGP 4KVVGT  FWTEJIGHÒJTV  /QFGNN  &KG RTQXKUQTKUEJG 4GIKGTWPI   WPVGT4GIGPV(TCPEKUEQ5GTTCPQ&QOÃPIWG\XGTNKGJFGP1TFGPOKVGPVHGTPVGPDQWTDQPKUEJGP.KNKGPDKU\WO'PFGFGT 4GIGPVUEJCHVYGKVGT /QFGNN -ÌPKI#OCFGQ  YKGCWEJFKG'TUVG5RCPKUEJG4GRWDNKMXGTNKGJGPFGP 1TFGPPKEJV-ÌPKI#NHQPUQ:++  PCJOPCEJUGKPGT6JTQPDGUVGKIWPICO&G\GODGTHQTONQUFKG 8GTNGKJWPIGPFGU1TFGPUCDYKGFGTCWH /QFGNN /KV-ÌPKINKEJGO&GMTGVXQO5GRVGODGTUVKHVGVG #NHQPU:++GTI·P\VFWTEJ&GMTGVXQO,WNK XGTÌHHGPVNKEJKPFGT)CEGVCFG/CFTKFXQO1MVQDGT \W FGT DGTGKVU UGKV  GZKUVKGTGPFGP -QNNCPG FGU 1TFGPU DGUQPFGTG )TQ­MTGW\+PUKIPKGP FKG \WUCOOGP OKV FKGUGT   XGTNKGJGPYWTFGP/KV&GMTGVXQO,CPWCT XGTÌHHGPVNKEJVKPFGT)CEGVCFG/CFTKFXQO,CPWCT YWTFG FGT1TFGPWPVGT-ÌPKI#NHQPUQ:+++  CDGTOCNUXGT·PFGTVWOPCEJFGT#WUTWHWPIFGT4GRWDNKM CO #RTKN   CWHIGJQDGP \W YGTFGP 5VCCVUEJGH)GPGTCN(TCPEKUEQ(TCPEQ[$CJCOQPFG  GTPGWGTVGFGP 1TFGPOKV&GMTGVXQO/CKXGTÌHHGPVNKEJVKO$1'XQO#WIWUV /QFGNN &KGNGV\VGP'TYGKVGTWPIGP YWTFGP XQP -ÌPKI ,WCP %CTNQU + IGD   OKV &GMTGV  XQO  #WIWUV  XGTÌHHGPVNKEJV KO $1'   XQO#WIWUV 8GTQTFPWPIXQO1MVQDGT XGTÌHHGPVNKEJVKO$1'XQO1MVQDGT  5VKHVWPIFGT)TQ­ MTGW\=$CPFC?WPF4KVVGTMNCUUG=.C\Q?HÒT&COGP WPF8GTQTFPWPIXQO/CK XGTÌHHGPVNKEJVKO$1'XQO /CK FWTEJIGHÒJTV #DUEJCHHWPIFGTDGKFGP&COGP-NCUUGPWPFIGPGTGNNG¤HHPWPICNNGT-NCUUGPFGU1TFGPUHÒT (TCWGPYQDGKFKGWPVGTUVG-NCUUG4KVVGTKP-TGW\WODGPCPPVYWTFG 



-ÌPKINKEJGT WPF 8GTFKGPUVXQNNGT 1TFGP -CTNU +++ =4GCN [ &KUVKPIWKFC 1TFGP FG %CTNQU +++?    /QFGNN   $TWUVUVGTP \WO )TQ­MTGW\ 5KNDGT DTKNNCPVKGTV WPF TGRGTEKGTV /GFCKNNQP )QNF   GOCKNNKGTV HGKPUVG 'OCKNNGOCNGTGK CP 0CFGN FKGUG GVYCU XGTDQIGP OKV \YGK 5GKVGPJCMGP 2)  <-    ++  5GJTHGKPG#PHGTVKIWPIWO'ZGORNCTFGT#WMVKQPFGT%CUCF #UVG5CP)KQTIKQ)GPWC0TWPFFGT #WMVKQP(TKV\4WFQNH-ÒPMGT1UPCDTÒEM0T



-ÌPKINKEJ #OGTKMCPKUEJGT 1TFGP +UCDGNNCU FGT -CVJQNKUEJGP =4GCN 1TFGP #OGTKECPC FG +UCDGN NC   %CVÉNKEC?  /QFGNN OKV /QPQITCOO ,4    $TWUVUVGTP \WO -QOOCPFGWT XQP 0WOOGT   5KNDGT XGTIQNFGV #WHNCIGP)QNFGOCKNNKGTVHGKPUVG'OCKNNGOCNGTGKCWHFGO4GXGTU*GTUVGNNGTDG\GKEJ PWPIFGT(KTOC(C[QNNG$TKSWGVKP2CTKUCP0CFGNOKV\YGK5GKVGPJCMGP2)XCT<- ++ 'ZGORNCT FGT #WMVKQP (TKV\ 4WFQNH -ÒPMGT  1UPCDTÒEM  0T  &KG 5VGTPG FGT -QOOCPFGWTG XQP   0WOOGTYWTFGPCNNGKPGQJPGYGKVGTG+PUKIPKGPYKG*CNUQFGT$TWUVMTGW\XGTNKGJGPWPFIGVTCIGP

128




SPANIEN

9527

9528



9528

-ÌPKINKEJ #OGTKMCPKUEJGT 1TFGP +UCDGNNCU FGT -CVJQNKUEJGP =4GCN 1TFGP #OGTKECPC FG +UCDGN NC   %CVÉNKEC?  /QFGNN OKV /QPQITCOO ,4    $TWUVUVGTP \WO -QOOCPFGWT XQP 0WOOGT   HTCP\ÌUKUEJG #PHGTVKIWPI 5KNDGT XGTIQNFGV #WHNCIGP )QNF GOCKNNKGTV 'OCKNNGUEJ·FGP CWH \YGK -TGW   \CTOGPHGKPUVG'OCKNNGOCNGTGK-TQPGÒDGTFGO/GFCKNNQPDGUEJ·FKIVCP0CFGNOKV\YGK5GKVGPJCMGP 2)XCT<- +++



'ZGORNCT FGT #WMVKQP (TKV\ 4WFQNH -ÒPMGT  1UPCDTÒEM  0T  &KG 5VGTPG FGT -QOOCPFGWTG XQP   0WOOGTYWTFGPCNNGKPGQJPGYGKVGTG+PUKIPKGPYKG*CNUQFGT$TWUVMTGW\XGTNKGJGPWPFIGVTCIGP



-ÌPKINKEJ #OGTKMCPKUEJGT 1TFGP +UCDGNNCU FGT -CVJQNKUEJGP =4GCN 1TFGP #OGTKECPC FG +UCDGN NC   %CVÉNKEC?/QFGNN OKV/QPQITCOO,4 -QOOCPFGWTMTGW\HTCP\ÌUKUEJG#PHGTVKIWPI )QNF JQJN IGCTDGKVGV GOCKNNKGTV  I HGKPUVG 'OCKNNGOCNGTGK .QTDGGTMTCP\ OKP XGTDQIGP WPF OKV   GKPKIGPOKP'OCKNNGEJKRUQJPG*CNUDCPF2)<- ++



'ZGORNCTFGT#WMVKQP-ÒPMGT1UPCDTÒEM-CV0T

9530

9531

9529



-ÌPKINKEJGT WPF /KNKV·TKUEJGT1TFGPFGUJN(GTFKPCPF=4GCN[/KNKVCT1TFGPFG5CP(GTPCPFQ? /QFGNN  $TWUVUVGTP-NCUUGHÒT1HHK\KGTG5KNDGTDTKNNCPVKGTVWPFTGRGTEKGTV/GFCKNNQP )QNFGOCKNNKGTVMCWOUKEJVDCTG#DURNKVVGTWPIKO5EJYGTVGTMTGW\CP0CFGN2)<- +p++



'ZGORNCTFGT#WMVKQP(TKV\4WFQNH-ÒPMGT1UPCDTÒEM0TW­GTUVSWCNKV·VXQNNG#PHGTVKIWPIWO CWUFGT5VKHVWPIU\GKVFKGUGU5VGTPGU



-ÌPKINKEJGT WPF /KNKV·TKUEJGT1TFGPFGUJN(GTFKPCPF=4GCN[/KNKVCT1TFGPFG5CP(GTPCPFQ? /QFGNN   5EJYGTVGT -TGW\FGFKCTKQ-NCUUGHÒT1HHK\KGTG)QNFGOCKNNKGTVI \CJNTGKEJG MNGKPG 'OCKNNGCDURNKVVGTWPIGP &WTEJOGUUGT  OO CP 0CFGN 0CFGNJCMGP XGTDQIGP   2)<- +++



'ZGORNCTFGT#WMVKQP(TKV\4WFQNH-ÒPMGT1UPCDTÒEM0T#PHGTVKIWPIWO



-ÌPKINKEJGTWPF/KNKV·TKUEJGT1TFGPFGUJN*GTOGPGIKNFQ=4GCN[/KNKVCT1TFGPFG5CP*GTOG PGIKNFQ?  /QFGNN  WPF  4KVVGTMTGW\ KPTGFW\KGTVGT#WUHÒJTWPI )QNFGOCKN NKGTVICOCNVGP1TKIKPCNDCPF2)<- ++



'ZGORNCTFGT#WMVKQP(TKV\4WFQNH-ÒPMGT1UPCDTÒEM0T#PHGTVKIWPIWOEC

129


SPANIEN

9532 (1:1)



/KNKV·T8GTFKGPUVQTFGP=1TFGPFGN/¾TKVQ/KNKVCT?/QFGNN OKV/QPQITCOO-ÌPKIKP+UCDGNNCU++ CWHFGO4GXGTU YGK­G#DVGKNWPIHÒT8GTFKGPUVKP(TKGFGPU\GKVGP-TGW\-NCUUG)QNF GOCKNNKGTVI OKV$CPF COCNVGP\GKVIGPÌUUKUEJGP1TKIKPCNDCPF2)<- 4+p



'ZGORNCTFGT#WMVKQP(TKV\4WFQNH-ÒPMGT1UPCDTÒEM0T 1TFGPWPF'JTGP\GKEJGP'KPG5COO NWPICWUCNVGO#FGNUDGUKV\ WPFFGT#WMVKQP(TKV\4WFQNH-ÒPMGT1UPCDTÒEM0T&KGUGTCWHITWPF UGKPGTJKUVQTKUEJGP'PVYKEMNWPIYQJNXCTKCPVGPTGKEJUVGTURCPKUEJG1TFGPYWTFGXQP-ÌPKIKP+UCDGNNC++   OKV-ÌPKINKEJGO&GMTGVXQO#WIWUVKPXKGT-NCUUGP )TQ­MTGW\-NCUUG IGUVKHVGVFKG4GINCOGPVQU FCVKGTGP XQO  5GRVGODGT   /QFGNN  /KV -ÌPKINKEJGO &GMTGV XQO  /CK  GTJKGNV FGT 1TFGP GKP   PGWGU$CPFUQYKGCNUWPVGTUVG-NCUUGFCU5KNDGTPG-TGW\+O5GRVGODGTPCEJFGT(NWEJV-ÌPKIKP+UCDGNNCU++ YWTFG XQP FGT RTQXKUQTKUEJGP 4GIKGTWPI GKPG 8GTQTFPWPI GTNCUUGP IGO·­ FGT 1TFGP MÒPHVKI MGKPG .KNKGP FCU   5[ODQNFGT$QWTDQPGPOGJTVTCIGPFWTHVGP#WEJU·OVNKEJG/QPQITCOOG+UCDGNNCUYCTGPCDUQHQTVGTUCV\NQU\W GPVHGTPGP /QFGNN 'TUVCO&G\GODGTFGUINGKEJGP,CJTGUYWTFGFCPPGKPG8GTQTFPWPIGTNCUUGPIGO·­FGT /KNKV·T8GTFKGPUVQTFGP MÒPHVKI FCU /QPQITCOO // HÒT /GTKVQ /KNKVCT  CWH FGT 4ÒEMUGKVG \W \GKIGP JCVVG  

/QFGNN 0CEJFGT6JTQPDGUVGKIWPI-ÌPKI#OCFGQU+  YWTFGCWHITWPFFGT-ÌPKINKEJGP8GTQTFPWP IGPXQO/CKWPFXQO1MVQDGTFCU5CXQ[GT9CRRGP YGK­GU-TGW\KPTQV KPFCU9CRRGPGKPIGHÒIV

 /QFGNN  /KV 8GTQTFPWPI XQO  1MVQDGT  FGT 'TUVGP 4GRWDNKM YWTFGP CNNG OQPCTEJKUEJGP 5[ODQNG CWU   FGP &GMQTCVKQPGP GPVHGTPV  /QFGNN  0CEJ UGKPGT 6JTQPDGUVGKIWPI CO  &G\GODGT  PCJO -ÌPKI #NHQPU   :++   FKG 8GTNGKJWPIGP FGU 1TFGPU KP UGKPGT WTURTÒPINKEJGP (QTO YKGFGT CWH LGFQEJ OKV FGO /QPQ   ITCOO//CWHFGO4GXGTUOGFCKNNQPFGT-TGW\G /QFGNN 9GKVGTG8GT·PFGTWPIGPGTHQNIVGPOKV-ÌPKINKEJGP 8GTQTFPWPIGPXQO/CKWPFXQO,WNKUQYKGOKV)GUGV\XQO,WPK-ÌPKI#NHQPU:+++

 TGQTICPKUKGTVGFGP1TFGPOKVFGP-ÌPKINKEJGP&GMTGVGPXQO/·T\WPFXQO#RTKN YQFWTEJFKG$KEQNQT#DVGKNWPIGKPIGHÒJTVYWTFG /QFGNN 9·JTGPFFGT<YGKVGP4GRWDNKMYWTFGPFKG+PUKIPKGP FGU 1TFGPU OGJTHCEJ XGT·PFGTV \WP·EJUV YWTFG FCU /KVVGNUEJKNF OKV FGP .KNKGP  FGU 9CRRGPUÒDGTFGEMVWPFFKG .KNKGP GPVHGTPV  /QFGNN  FCPP YWTFG FGT /KVVGNUEJKNF ICP\ GPVHGTPV  /QFGNN  WPF UEJNKG­NKEJ GKP ICP\ PGWGU   9CRRGP GKPIGHÒIV  /QFGNN  )GPGTCN (TCPEKUEQ (TCPEQ [ $CJCOQPFG   ÒDGTPCJO  FGP 1TFGP   WPFRNCV\KGTVGÒDGTFGO-TGW\FKGUQIGPKORGTKCNG-TQPGFGTMCVJQNKUEJGP-ÌPKIGUQYKG.ÌYGPWPF6ÒTOGCPFGT 5VGNNG FGT 5VGTPG YQ UKEJ HTÒJGT FKG .KNKGP DGHCPFGP  /QFGNN  /KV &GMTGV  XQO  /·T\   

XGTÌHHGPVNKEJV KP $1' 0T  XQO  /CK  GTJKGNVGP FKG +PUKIPKGP YKGFGT GKPG -ÌPKIUMTQPG WPF FGT 1TFGP GKP   PGWGU 4GINCOGPVQ  /QFGNN  5GKVJGT DGUVGJV GT CWU )TQ­MTGW\ -TGW\  -NCUUG $TWUVUVGTP  -TGW\  DKU    -NCUUG -TGW\GCO$CPF 

9533



/KNKV·T8GTFKGPUVQTFGP=1TFGPFGN/¾TKVQ/KNKVCT?/QFGNN OKV/QPQITCOO-ÌPKIKP+UCDGNNCU++ CWHFGO4GXGTU YGK­G#DVGKNWPIHÒT8GTFKGPUVKP(TKGFGPU\GKVGP-TGW\-NCUUGKPGVYCU TGFW\KGTVGT#WUHÒJTWPI)QNFGOCKNNKGTVI OKV$CPFWPF6TCIGURCPIG COCNVGP\GKVIGPÌUUKUEJGP 1TKIKPCNDCPFOKV6TCIGURCPIG2)<- 4+p 'ZGORNCTFGT#WMVKQP(TKV\4WFQNH-ÒPMGT1UPCDTÒEM0T

130




SPANIEN

9534 (1:1)

9535 (1:1)



9535 (1:1)

/KNKV·TKUEJGT 1TFGP XQO JGKNKIGP ,CMQDWU =1TFGP /KNKVCT FG 5CPVKCIQ? 1TFGPUOGFCKNNQP )QNF   GOCKNNKGTVI OKV5EJNGKHG CPUR·VGTGT5EJNGKHGOKV0CFGN ++



'ZGORNCTFGT#WMVKQP(TKV\4WFQNH-ÒPMGT1UPCDTÒEM0T#PHGTVKIWPICWUFGO\YGKVGP8KGTVGN FGU,CJTJWPFGTVU



-TGW\HÒT8GTFKGPUVWOFCUOKNKV·TKUEJG)GUWPFJGKVUYGUGP=%TW\FG5CPKFCF/KNKVCT?ZOO )QNF GOCKNNKGTV  I OKV $CPF WPF 5RCPIG  CO QTKIKPCNGP \GKVIGPÌUUKUEJGP $CPF OKV6TCIGURCPIG 2) 4++



'ZGORNCT FGT #WMVKQP (TKV\ 4WFQNH -ÒPMGT 1UPCDTÒEM0T&CU-TGW\KUVCO#RTKNOKV -ÌPKINKEJGT8GTQTFPWPIXQP+UCDGNNC++IGUVKHVGVYQTFGP

9536 (1:1)

2418+514+5%*'52#0+5%*'4')+'470)4')'065%*#(6   

-ÌPKINKEJGTWPF/KNKV·TKUEJGT1TFGPFGUJN*GTOGPGIKNFQ=4GCN[/KNKVCT1TFGPFG5CP*GTOG PGIKNFQ?  /QFGNN  WPF   $TWUVUVGTP FGT  -NCUUG  )QNF 5KNDGT DTKNNCPVKGTV   WPFTGRGTEKGTV/GFCKNNQP)QNFGOCKNNKGTVICWHFGO4GXGTU*GTUVGNNGTDG\GKEJPWPIFGT(KTOC$ )WVKGTTG\KP*CDCPC -WDC CP0CFGNOKV\YGK5GKVGPJCMGP2)<- 4++  'ZGORNCTFGT#WMVKQP(TKV\4WFQNH-ÒPMGT1UPCDTÒEM0T5GJTSWCNKV·VUXQNNGMWDCPKUEJG#PHGTVK IWPIWOOKV-TGW\MQTRWUKPOCUUKX)QNF

131


SPANIEN

9537 (1.1)

9537



-QODKPKGTVG1TFGPUFGMQTCVKQP$GUVGJGPFCWUFGO$TWUVUVGTP\WT-QNNCPGFGU1TFGPU-CTNU+++FGO $TWUVMTGW\FGU/KNKV·TKUEJGP1TFGPUXQOJN,CMQDWUXQO$TWUVMTGW\FGT-ÌPKINKEJGP-ÌTRGTUEJCHVFGT *KLQUFCNIQ4KVVGTFGU#FGNUXQP/CFTKFWPFFGT-ÌPKINKEJGP/GKUVGTGKFGT4KVVGTUEJCHVXQP5CTCIQUUC 5KNDGT XGTIQNFGV )QNF GOCKNNKGTV CWH FGO 4GXGTU VGKNYGKUG XGTFGEMVG *GTUVGNNGTDG\GKEJPWPI GKPGT   (KTOCKP/CFTKFKOQTKIKPCNGP5EJ·EJVGNEJGPOKVMÌPKINKEJGO/QPQITCOO#OKVIGPCWGTOCUEJKPGP UEJTKHVNKEJGT $G\GKEJPWPI <WUCOOGP OKV QTKIKPCNGO -CDKPGVVURJQVQ FGU 6T·IGTU 2TKP\ #NHQPU XQP   $C[GTP \WUCOOGPOKVUGKPGT)GOCJNKP.QWKUG8KEVQKTG FCVKGTVCWHFGOGTFKGUG1TFGPUFGMQTC VKQPVT·IVUQYKG1TKIKPCN6GNGITCOOOKV6TCIGIGPGJOKIWPI-ÌPKI#NHQPU:+++HÒTFKGUG-QODKPCVKQP CWU.QPFQPMQOOGPFXQO,WNKOKVGKIGPJ·PFKIGTJCPFUEJTKHVNKEJGT'TN·WVGTWPIFGU2TKP\GP OKV7PVGTUEJTKHV 5VÒEM8QPITÌ­VGT5GNVGPJGKV++  'ZGORNCTFGT#WMVKQP(TKV\4WFQNH-ÒPMGT1UPCDTÒEM0T$GFGWVGPFGU'ZGORNCTCWUFGO$GUKV\ XQP 2TKP\ #NHQPU XQP $C[GTP   FGT GU PCJG\W UV·PFKI CWH UGKPGT 7PKHQTO VTWI \WUCOOGP OKV   RJQVQITCRJKUEJGO WPF JCPFUEJTKHVNKEJGO 0CEJYGKU FGT 2TQXGPKGP\ 'KP ·JPNKEJGU 'ZGORNCT LGFQEJ OKV 5VGKPGP   DGUGV\VDGHKPFGVUKEJKPFGT5COONWPIXQP&T#PVQPKQ5RCFC$TGUEKCWPFKUVKO#WUUVGNNWPIMCVCNQI*QPPGWTGV )NQKTG  .GU VT¾UQTU FG NC EQNNGEVKQP 5RCFC \WT INGKEJPCOKIGP #WUUVGNNWPI KO /WU¾G PCVKQPCN FG NC .¾IKQP   F *QPPGWTGVFGUQTFTGUFGEJGXCNGTKGKP2CTKUKO*GTDUVWPFKO(TÒJLCJTCWH5GKVGRWDNK\KGTV

132


SPANIEN

9538



9540

9539

-ÌPKINKEJGT WPF 8GTFKGPUVXQNNGT 1TFGP -CTNU +++ =4GCN [ &KUVKPIWKFC 1TFGP FG %CTNQU +++?    /QFGNN   $TWUVUVGTP \WO -QOOCPFGWT XQP 0WOOGT 5KNDGT DTKNNCPVKGTV #WHNCIGP )QNF   GOCKNNKGTVCP0CFGNOKV\YGK5GKVGPJCMGP2)<- +p++



#PHGTVKIWPI CWU FGO NGV\VGP 3WCTVCN FGU  ,CJTJWPFGTVU &KG 5VGTPG FGT -QOOCPFGWTG XQP 0WOOGT YWTFGP   CNNGKPGQJPGYGKVGTG+PUKIPKGPYKG*CNUQFGT$TWUVMTGW\XGTNKGJGPWPFIGVTCIGP





-ÌPKINKEJGT WPF 8GTFKGPUVXQNNGT 1TFGP -CTNU +++ =4GCN [ &KUVKPIWKFC 1TFGP FG %CTNQU +++?    /QFGNN   4KVVGTMTGW\ 5KNDGT XGTIQNFGV /GFCKNNQPU )QNF GOCKNNKGTV 'OCKNNGOCNGTGK KP   OGJTGTGP-TGW\URKV\GP'OCKNNGCDRNCV\WPIGPCOQTKIKPCNGP$CPFOKVCWHIGNGIVGT4QUGVVG<-  ++p+++



-ÌPKINKEJ #OGTKMCPKUEJGT 1TFGP +UCDGNNCU FGT -CVJQNKUEJGP =4GCN 1TFGP #OGTKECPC FG +UCDGN NC   %CVÉNKEC?/QFGNN OKV/QPQITCOO(41 -NGKPQF\WO)TQ­MTGW\)QNFGOCKNNKGTV OGJTGTGOKP#WUDTÒEJGKPFGP/GFCKNNQPTKPIGPHGKPUVG'OCKNNGOCNGTGKCOQTKIKPCNGPCNVGP5EJWNVGT DCPF<- ++



'ZGORNCTFGT#WMVKQP(TKV\4WFQNH-ÒPMGT1UPCDTÒEM0T

9542



9541

9542

-ÌPKINKEJ #OGTKMCPKUEJGT 1TFGP +UCDGNNCU FGT -CVJQNKUEJGP =4GCN 1TFGP #OGTKECPC FG +UCDGN NC   %CVÉNKEC?/QFGNN OKV/QPQITCOO(41 $TWUVUVGTP\WO-QOOCPFGWTXQP0WOOGT 5KNDGTXGTIQNFGVWPFGOCKNNKGTVCP0CFGNOKV\YGK5GKVGPJCMGP2)<- ++



&KG5VGTPGFGT-QOOCPFGWTGXQP0WOOGTYWTFGPCNNGKPGQJPGYGKVGTG+PUKIPKGPYKG*CNUQFGT$TWUVMTGW\XGTNKG JGPWPFIGVTCIGP



-ÌPKINKEJ #OGTKMCPKUEJGT 1TFGP +UCDGNNCU FGT -CVJQNKUEJGP =4GCN 1TFGP #OGTKECPC FG +UCDGN NC   %CVÉNKEC?/QFGNN OKV/QPQITCOO(41 -QOOCPFGWTMTGW\5KNDGTXGTIQNFGVWPF GOCKNNKGTVCO*CNUDCPFCDUEJPKVV2)<- ++



#PHGTVKIWPIWO

133


SPANIEN

9543



9545

9544

-ÌPKINKEJ #OGTKMCPKUEJGT 1TFGP +UCDGNNCU FGT -CVJQNKUEJGP =4GCN 1TFGP #OGTKECPC FG +UCDGN NC   %CVÉNKEC?/QFGNN OKV/QPQITCOO(41 -QOOCPFGWTMTGW\5KNDGTXGTIQNFGVWPF GOCKNNKGTVHGKPUVG'OCKNNGOCNGTGKQJPG*CNUDCPF2)<- ++



#PHGTVKIWPIWO



-ÌPKINKEJGT WPF /KNKV·TKUEJGT1TFGPFGUJN(GTFKPCPF=4GCN[/KNKVCT1TFGPFG5CP(GTPCPFQ? /QFGNN  $TWUVUVGTP-NCUUGHÒT1HHK\KGTG5KNDGTDTKNNCPVKGTVWPFTGRGTEKGTV/GFCKNNQP )QNFGOCKNNKGTVFKG-WIGNPCPFGP-TGW\URKV\GPFGPWPFFKG4GXGTUXGTIQNFGVCWHFGO4GXGTU*GTUVGN NGTDG\GKEJPWPI FGT (KTOC , 2 FG #TGNNCPQP KP /CFTKF CP 0CFGN OKV \YGK 5GKVGPJCMGP 2)    <- ++



'ZGORNCT FGT #WMVKQP (TKV\ 4WFQNH -ÒPMGT 1UPCDTÒEM  0T  1TFGP WPF 'JTGP\GKEJGP  'KPG PQTF   COGTKMCPKUEJG2TKXCVUCOONWPI WPFFGT#WMVKQP(TKV\4WFQNH-ÒPMGT1UPCDTÒEM0T#PHGTVKIWPI CWUFGONGV\VGP8KGVGNFGU,CJTJWPFGTVU



-ÌPKINKEJGTWPF/KNKV·TKUEJGT1TFGPFGUJN*GTOGPGIKNFQ=4GCN[/KNKVCT1TFGPFG5CP*GTOG PGIKNFQ?  /QFGNN  WPF   $TWUVUVGTP FGT  -NCUUG  5KNDGTDTKNNCPVKGTVWPFTG RGTEKGTV VGKNYGKUG XGTIQNFGV /GFCKNNQP )QNF GOCKNNKGTV CP 0CFGN OKV \YGK 5GKVGPJCMGP 2)    <- +p++



'ZGORNCT FGT #WMVKQP (TKV\ 4WFQNH -ÒPMGT  1UPCDTÒEM  0T  5GJT SWCNKV·VUXQNNG #PHGTVKIWPI CWU   FGONGV\VGP8KGTVGNFGU,CJTJWPFGTVU

9546 (1:1)



<KXKNGT 1TFGP HÒT 9QJNV·VKIMGKV =1TFGP %KXKN FG $GTPGHKEKGPEKC?  /QFGNN     $TWUV   UVGTPUQIGP-TGW\-NCUUG5KNDGTDTKNNCPVKGTV#WHNCIGP)QNF IGRTÒHV CP0CFGNOKV\YGK5GKVGP JCMGP2)<- ++ &KGUGT$TWUVUVGTPYWTFGUQYQJNCNU$TWUVUVGTP\WO)TQ­MTGW\CNUCWEJCNUUQIGP-TGW\-NCUUGCNNGKPGXGTNKGJGP WPFIGVTCIGP#PHGTVKIWPICWUFGTGTUVGP&GMCFGFGU,CJTJWPFGTVU

134




SPANIEN

ex 9548 (1:1)

9547



/KNKV·T8GTFKGPUVQTFGP=1TFGPFGN/¾TKVQ/KNKVCT?/QFGNN OKV$QWTDQPGPYCRRGPKO<GPVTWO   YGK­G #DVGKNWPI HÒT 8GTFKGPUV KP (TKGFGPU\GKVGP 5VGTP  -NCUUG 5KNDGT DTKNNCPVKGTV WPF   FWTEJDTQEJGPIGCTDGKVGVWPFXGTIQNFGV#WHNCIGP)QNFGOCKNNKGTVVGKNYGKUG5KNDGTMNGKPGT'OCKNNGUEJC FGPKO/GFCKNNQPTÒEMUGKVKIG/GFCKNNQPCDFGEMWPIHGJNVCP0CFGNOKV\YGK5GKVGPJCMGPKOQTKIKPCNGP 8GTNGKJWPIUGVWK FGT (KTOC ,QU¾ (GTPCPFG\ /C[QT KP /CFTKF OKV IQNFHCTDGPGO /QPQITCOO -ÌPKI   #NHQPU:+++2)<- ++



'ZGORNCTFGT#WMVKQP(TKV\4WFQNH-ÒPMGT1UPCDTÒEM0T#PHGTVKIWPICWUFGOGTUVGP8KGTVGNFGU ,CJTJWPFGTVU&KG5VGTPGFGTWPF-NCUUGYWTFGPCNNGKPGQJPGYGKVGTG+PUKIPKGPYKG*CNUQFGT$TWUVMTGW\ XGTNKGJGPWPFIGVTCIGP



/KNKV·T8GTFKGPUVQTFGP=1TFGPFGN/¾TKVQ/KNKVCT?/QFGNN OKV$QWTDQPGPYCRRGPKO<GPVTWO   YGK­G #DVGKNWPI HÒT 8GTFKGPUV KP (TKGFGPU\GKVGP /KPKCVWT FGU -TGW\GU  -NCUUG )QNF   GOCKNNKGTVFC\W\YGKYGKVGTG'ZGORNCTGOKVHGJNGPFGP8QTFGTUGKVGPOGFCKNNQPU)QNFGOCKNNKGTVUQYKG <KXKN8GTFKGPUVQTFGP/QFGNN OKVUQIGPKORGTKCNGT-TQPG /KPKCVWTFGT1TFGPUFGMQ TCVKQP)QNFDTKNNCPVKGTVVGKNYGKUGGOCKNNKGTV#NNGQJPG$·PFEJGP 5VÒEM++



9549 (1:1)



-ÌPKINKEJGT WPF /KNKV·TKUEJGT 1TFGP XQP /CTKC %JTKUVKPC =4GCN [ /KNKVCT 1TFGP FG /CTKC %TK   UVKPC?  /QFGNN   $TWUVUVGTP  -NCUUG &WTEJOGUUGT  OO 5KNDGT #WHNCIGP $TQP\G   WPF)QNF IGRTÒHV VGKNYGKUGGOCKNNKGTVHGKPG'OCKNNGOCNGTGKCWHFGOQDGTGP-TGW\CTO)QNFUEJKNFEJGP OKVFGT)TCXWT/#$7;#CP0CFGNOKV\YGK5GKVGPJCMGP2)C<-6# 44++  'ZGORNCTFGT5COONWPI6COOCPP#WMVKQP7$5$CUGN0TWPFFGT#WMVKQP(TKV\4WFQNH-ÒPMGT 1UPCDTÒEM  0T  #NNG +PUKIPKGP FKGUGU 1TFGPU UKPF XQP CNNGTITÌ­VGT 5GNVGPJGKV #NNGTFKPIU YGTFGP FKG   CWHITWPFKJTGTUGJT·JPNKEJGP)GUVCNVWPIQHVOKVFGO-TKGIUMTGW\XGTYGEJUGNV&GTHÒPHMNCUUKIG1TFGP )TQ­MTGW\ 5VGTP   WPF  -NCUUG 5KNDGTPGU -TGW\  YWTFG CO  ,CPWCT  XQP FGT 4GIGPVKP -ÌPKIKPOWVVGT /CTKC   %JTKUVKPC XQP 5RCPKGP   IGUVKHVGV  /QFGNN  &KG <YGKVG 4GRWDNKM ÒDGTPCJO OKV 4WPFUEJTGKDGP XQO    0QXGODGT  FGP 1TFGP PWPOGJT KP \YGK -NCUUGP )TQ­MTGW\ WPF 5KNDGTPGU -TGW\  WPFWPVGT'PVHGTPWPI CNNGTOQPCTEJKUEJGT5[ODQNG /QFGNN 

135


SPANIEN

9550

9552

9551



/KNKV·TKUEJGT 1TFGP XQO JGKNKIGP ,CMQDWU =1TFGP /KNKVCT FG 5CPVKCIQ? $TWUVMTGW\  Z    OO)QNFGOCKNNKGTVIMCWOUKEJVDCTG'OCKNNGTGRCTCVWTCP0CFGNOKV\YGK5GKVGPJCMGP 44++



'ZGORNCTFGT#WMVKQP(TKV\4WFQNH-ÒPMGT1UPCDTÒEM0T#WUHÒJTWPIGPKPGEJV)QNFUKPFUGNVGP \WHKPFGP



/KNKV·TKUEJGT 1TFGP 7PUGTGT .KGDGP (TCW XQP /QPVGUC =1TFGP /KNKVCT FG 0WGUVTC 5GÇQTC FG   /QPVGUC?1TFGPUFGMQTCVKQP·NVGTG#WUHÒJTWPI5KNDGTXGTIQNFGVWPF)QNFGOCKNNKGTVCO$CPF 4++



'ZGORNCT FGT #WMVKQP (TKV\ 4WFQNH -ÒPMGT  1UPCDTÒEM  0T  5GNVGPG #WUHÒJTWPI CWU FGO NGV\VGP   8KGTVGN FGU 0GWP\GJPVGP ,CJTJWPFGTVU  &GT OKNKV·TKUEJG 4KVVGTQTFGP YWTFG  XQP -ÌPKI ,CKOG ++ XQP #TC   IQPKGPIGUVKHVGVWPFFWTEJR·RUVNKEJG$WNNGXQO,WDKDGUV·VKIV



/KNKV·T8GTFKGPUVQTFGP=1TFGPFG/GTKVQ/KNKVCT?/QFGNN 9CRRGPQJPG/KVVGNUEJKNFOKV/CW GTMTQPGEC YGK­G#DVGKNWPIHÒT8GTFKGPUVKP(TKGFGPU\GKVGP5VGTP-NCUUG5KNDGTDTKN NCPVKGTV -TGW\ 5KNDGT XGTIQNFGV /GFCKNNQP 2N·VVEJGP WPF /CWGTMTQPG )QNF VGKNYGKUG GOCKNNKGTV   'OCKNNGOCNGTGKGKPKIG*CCTTKUUGMNGKPGTQDGTHN·EJNKEJGT'OCKNNGEJKRKPGKPGO9CRRGPHGNF4GXGTU\GP VTWOU#DFGEMWPIHGJNVCP0CFGNOKV\YGK5GKVGPJCMGP<- ++



&KGUGT$TWUVUVGTPYWTFGQJPGYGKVGTG+PUKIPKGPYKG*CNUQFGT$TWUVFGMQTCVKQPGPXGTNKGJGPWPFIGVTCIGP9KGCNNG 1TFGPUKPUKIPKGPFGT<YGKVGP4GRWDNKMUGNVGP\WHKPFGP

9553 (1:1)



1TFGP +UCDGNNCU FGT -CVJQNKUEJGP =1TFGP FG +UCDGN NC %CVÉNKEC?  /QFGNN CWH FGO 4GXGTU FGU   -NGKPQFU/QPQITCOO(A;$TWUVUVGTPOKV-ÌPKITQPGÒDGTFGO/GFCKNNQPUGKV )TQ­MTGW\5GV DGUVGJGPFCWU-NGKPQF)QNFOCUUKXVGKNYGKUGGOCKNNKGTVFKG-TGW\CTOGWPFFGT.QTDGGTMTCP\¯LQWT OKV 5VGKPGP DGUGV\V  I OKV QTKIKPCNGO 5EJWNVGTDCPF WPF $TWUVUVGTP )QNF OCUUKX VGKNYGKUG DTKN   NCPVKGTVVGKNYGKUGGOCKNNKGTVHGKPUVG'OCKNNGOCNGTGKFKG-TGW\CTOGWPFFKG-TGW\CTOMWIGNP¯LQWTOKV 5VGKPGPDGUGV\VIOKV0CFGNWPF\YGK5GKVGPJCMGP 5VÒEM8QPITQ­GT5GNVGPJGKV++  'ZGORNCT FGT #WMVKQP (TKV\ 4WFQNH -ÒPMGT  1UPCDTÒEM  0T  'TNGUGPGU 5GV XQP JGTXQTTCIGPFGT   #PHGTVKIWPIUSWCNKV·VWPFKPOCUUKX)QNFOKV5VGKPGPXQPCNNGTITÌ­VGT5GNVGPJGKV

136


SPANIEN

9554 (1:1)





9555 (1:1)

1TFGP +UCDGNNCU FGT -CVJQNKUEJGP =1TFGP FG +UCDGN NC %CVÉNKEC?  /QFGNN CWH FGO 4GXGTU FGU   -NGKPQFU/QPQITCOO(A;$TWUVUVGTPOKV-ÌPKIMTQPGÒDGTFGO/GFCKNNQPUGKVUGKV  $TWUVUVGTP\WO)TQ­MTGW\)QNFOCUUKXVGKNYGKUGDTKNNCPVKGTVWPFTGRGTEKGTVVGKNYGKUGGOCKNNKGTVHGKPUVG 'OCKNNGOCNGTGKCP\YGK5VGNNGPMCWOUKEJVDCTG'OCKNNGTGRCTCVWTGPGKPG-TGW\URKV\GTGRCTKGTVYGKVGTG MCWOUKEJVDCTG.ÌVUVGNNGFKG-TQPGÒDGTFGO/GFCKNNQPHGJNVICP0CFGNOKV\YGK5GKVGPJCMGP 4++ 'ZGORNCTFGT#WMVKQP(TKV\4WFQNH-ÒPMGT1UPCDTÒEM



1TFGP +UCDGNNCU FGT -CVJQNKUEJGP =1TFGP FG +UCDGN NC %CVÉNKEC?  /QFGNN CWH FGO 4GXGTU FGU   -NGKPQFU/QPQITCOO(A;$TWUVUVGTPOKV-ÌPKIMTQPGÒDGTFGO/GFCKNNQPUGKVUGKV  $TWUVUVGTP\WO)TQ­MTGW\)QNFOCUUKXVGKNYGKUGDTKNNCPVKGTVWPFTGRGTEKGTVVGKNYGKUGGOCKNNKGTVHGKPUVG 'OCKNNGOCNGTGKICP0CFGNFKGUGOKV-NGGDNCVVRWP\GOKV\YGK5GKVGPJCMGP 4++



'ZGORNCTFGT#WMVKQP(TKV\4WFQNH-ÒPMGT1UPCDTÒEM0T

9556 (1:1)



-TGW\FGT/KVINKGFGTFGU-ÌPKINKEJGP4CVGUFGT/KNKV·TKUEJGP1TFGP=%TW\FGNQUKGODTQUFGN4GCN %QPUGLQ FG NCU ÉTFGPGU /KNKVCTGU? 5KNDGT XGTIQNFGV FKG 1TFGPUMTGW\G UGRCTCV CWHIGNGIV OKV )TCXWT   4'#. 14&'0/ QJPG 6TCIGMQTFGN FC\W ITCXKGTVGU #WUUVGNNWPIUUEJKNFEJGP OKV GPINKUEJURTCEJKIGT   $GUEJTGKDWPI2) 4++



&GT4CVFGT/KNKV·TKUEJGP1TFGP IGOGKPVUKPFFGT/KNKV·TKUEJG1TFGPFGUJN,CMQDWUFGT/KNKV·TKUEJG1TFGPXQP #NE±PVCTC FGT /KNKV·TKUEJG 1TFGP XQP %CNCVTCXC WPF FGT /KNKV·TKUEJG 1TFGP 7PUGTGT .KGDGP (TCW XQP /QPVGUC    YWTFGXQP-ÌPKI%CTNQU+ -CKUGT-CTN8 IGITÒPFGV&WTEJFKG<YGKVG4GRWDNKMYWTFGFGT4CV CWHIGNÌUV#O#RTKNGTTKEJVGVG-ÌPKI,WCP%CTNQU+ IGD FGP4CVDGUVGJGPFCWU/KVINKGFGTP WPFGKPGO4CVURT·UKFGPVGPYKGFGTPGW<WO2T·UKFGPVGPFGU4CVGUGTPCPPVGGTUGKPGP8CVGT&QP,WCPFG$QT DÉP)TCHGPXQP$CTEGNQPC  PCEJFGUUGP6QF&QP%CTNQUXQP$QTDÉP&QU5KEKNKCU*GT\QIXQP-CNCD TKGP+PHCPVXQP5RCPKGP IGD 

137


TSCHECHIEN

9557 (1:1)

65%*'%*15.19#-'+70&65%*'%*+5%*'4'27$.+-

'456' 65%*'%*15.19#-+5%*'4'27$.+-   

6UEJGEJQUNQYCMKUEJGT1TFGPXQO9GK­GP.ÌYGP=%GUMQUNQXGPUMÓTCFDÃN¾JQNXC?/QFGNN    -NGKPQF FGT  -NCUUG OKV 5EJYGTVGTP 5KNDGT XGTIQNFGV WPF GOCKNNKGTV CWH FGT 4ÒEMUGKVG OKP   QDGTHN·EJNKEJG%JKRUKPFGTTQVGP'OCKNNGXQP\YGK#TOGPKO4KPIOGJTHCEJRWP\KGTVWC*GTUVGNNGT RWP\G--FGT(KTOC(KTOC-CTPGV-[UGN[KP2TCIQJPG5EJWNVGTDCPF$9-<- 4++ 

9558



138

6UEJGEJQUNQYCMKUEJGT 1TFGP XQO 9GK­GP .ÌYGP  /QFGNN   1HHK\KGTUFGMQTCVKQP HÒT   <KXKNXGTFKGPUV5KNDGTVGKNYGKUGXGTIQNFGVWPFGOCKNNKGTVKO6TCIGTKPIOGJTHCEJRWP\KGTV --HÒTFGP *GTUVGNNGT(KTOC-CTPGV-[UGNÓKP2TCIGT5KNDGTRWP\GWPFHTCP\ÌUKUEJG'KPHWJTRWP\GHÒT5KNDGT XQP  DKU  5EJYCPGPRWP\G  CO QTKIKPCNGP $CPF OKV CWHIGNGIVGT 4QUGVVG $9-    <- ++




KIRCHENSTAAT, VATIKAN

9559 9560 (1:1)

70)#40 70)#4+5%*'81.-54'27$.+-   

1TFGPFGT(CJPGFGT7PICTKUEJGP8QNMTGRWDNKM5VGTP-NCUUG&WTEJOGUUGTOOXGTIQNFGVWPF VGKNYGKUGGOCKNNKGTVCP0CFGN\WUCOOGPOKV/KPKCVWTXGTIQNFGVVGKNYGKUGGOCKNNKGTVCP0CFGN ++



-+4%*'056##6*'+.+)'4567*.70&8#6+-#0 

#NNGTJÌEJUVGT 1TFGP FGT /KNK\ 7PUGTGU *GTTP ,GUWU %JTKUVWU =1TFQ 5WRTGOWU /KNKVKC &QOKPK   0QUVTK ,GUW %JTKUVK? CWEJ 2·RUVNKEJGT %JTKUVWU1TFGP  1TFGPUUGV \YKUEJGP EC  WPF    DGUVGJGPFCWU*CNUMTGW\5KNDGTXGTIQNFGV-TGW\$TQP\GXGTIQNFGVVGKNYGKUGGOCKNNKGTVCOCNVGP*CNU DCPFWPF$TWUVUVGTP5KNDGTDTKNNCPVKGTVVGKNYGKUGXGTIQNFGVWPFGOCKNNKGTV#DRNCV\WPIGPKPFGTITÒPGP 'OCKNNGCP0CFGN 5VÒEM4++++p+++  9·JTGPF FGU 2QPVKHKMCVU 2CRUV .GQU :+++ XQP  DKU   YWTFGP \CJNTGKEJG 1TFGPUTKVVGT CWU ICP\ 'WTQRC  

XQTYKGIGPFKO&GWVUEJGP4GKEJKP(TCPMTGKEJ+VCNKGP¤UVGTTGKEJWPF5RCPKGP GTPCPPVWOPCEJFGO8GTNWUVFGU -KTEJGPUVCCVUWPFCWEJY·JTGPFFGP#WUGKPCPFGTUGV\WPIGPDG\ÒINKEJFGTMKTEJNKEJGP2QUKVKQPGPKO&GWVUEJGP 4GKEJKP(TCPMTGKEJWPFKP5RCPKGPGKPG.QDD[HÒTFKG4ÒEMIGYKPPWPIFGU-KTEJGPUVCCVUD\YHÒTFKGMCVJQNKUEJG 5CEJG\WIGYKPPGP&CFGT8CVKMCPPCEJÒDGTPWTTGNCVKXDGITGP\VG/KVVGNXGTHÒIVGYWTFGP\WFKGUGT<GKVFKG 8GTNGKJWPIGP \YCT CWUIGURTQEJGP WPF FGMTGVKGTV FKG OGKUVGP $GNKGJGPGP OW­VGP UKEJ LGFQEJ FKG 1TFGPUKPUKIPKGP   UGNDUVDGUEJCHHGP&KGUGTMN·TVFKGDGKFGP+PUKIPKGPFKGUGT<GKVXQTMQOOGPFGPITQ­GP7PVGTUEJKGFGKPFGTGP#WU HÒJTWPIWPF#PHGTVKIWPIUSWCNKV·VGDGPLGPCEJ5QNXGP\FGULGYGKNKIGP$GNKGJGPGP  0CEJFGT#WHJGDWPIFGU6GORNGTQTFGPUFWTEJ2CRUV%NGOGPU8GTTKEJVGVG-ÌPKI&[QPUKWUXQP2QTVWICN GKPGP1TFGPFGT4KVVGT%JTKUVKFGOGTFKG)ÒVGTFGU6GORNGTQTFGPUÒDGTNKG­FGP2CRUV,QJCPPGU::++CO/·T\ DGUV·VKIVGWPFFGTKP2QTVWICNPCEJ\CJNTGKEJGP8GT·PFGTWPIGPDKUJGWVGDGUVGJV&C­,QJCPPGU::++FKGUPWT WPVGT FGT $GFKPIWPI VCV FGP 1TFGP CWEJ UGNDUV XGTNGKJGP \W FÒTHGPKUVLGFQEJKPU4GKEJFGT(CDGN\WXGTYGKUGP FGPP FKG GPVURTGEJGPFG $WNNG UCIV JKGTÒDGT PKEJVU CWU &GT2·RUVNKEJG%JTKUVWUQTFGPDGICPPXKGNUR·VGTUGKPG'ZK UVGP\ YQJN WPVGT FGP 2·RUVGP 2CWN 8 TGI  DKU   QFGT )TGIQT :8 TGI  DKU   WPF YWTFG   \WP·EJUV CP -ÒPUVNGT CO R·RUVNKEJGP *QH XGTNKGJGP 5R·VGT GPVYKEMGNVG GT UKEJ \W GKPGO CNNIGOGKPGP 8GTFKGPUVQT   FGPFGTUGNVGPOKV&KCOCPVGPWPFIGNGIGPVNKEJCWEJCP2TQVGUVCPVGPXGTNKGJGPYWTFG+O,CJTJWPFGTVYWTFGFGT 1TFGPUGKVEC\WUCOOGPOKVGKPGO5VGTPTGNCVKXJ·WHKIXGTNKGJGPCDGTYGIGPFGTUVTGPIGP4ÒEMICDGRHNKEJV UKPF FKG 1TFGPUKPUKIPKGP JGWVG UGNVGP 5GKV EC  DGUV·VKIV   KUV FGT %JTKUVWU1TFGP FGT JÌEJUVG R·RUVNKEJG   1TFGP+O<WIGFGTWPVGT2CRUV2KWU: TGIXQPDKU XQTIGPQOOGP4GQTICPKUCVKQPFGUR·RUVNK EJGP1TFGPUYGUGPUGTJKGNVCWEJFGT2·RUVNKEJG%JTKUVWU1TFGPWPVGTGVYCUXGT·PFGTVGO0COGPGKPGPGWG)GUVCNV+P FKGUGT(QTOYWTFGGTXQPDKUPWTOCNXGTNKGJGPYQDGKGTY·JTGPFFGU2QPVKHKMCVUXQP2CRUV,QJCPPGU 2CWN+ TGIXQPDKU NGV\VOCNUXGTNKGJGPYWTFGWPF\YCTCP(T¯#PIGNQ/QLCPCFK%QNQIPC(ÒTUV WPF )TQ­OGKUVGT FGU 5QWXGT·PGP /CNVGUGT 4KVVGTQTFGPU 8IN CWEJ 6COOCP ) # *GKNKIGT 5VWJN %JTKUVWU   1TFGP+P6COOCPP)WUVCX#PFTGCUWPF*QOOGN'PIGNDGTV *I &KG1TFGPWPF'JTGP\GKEJGP-QPTCF#FG PCWGTU6JG1TFGTUCPF&GEQTCVKQPUCYCTFGFVQ-QPTCF#FGPCWGT$CF*QPPGH4JÌPFQTH 

139


KIRCHENSTAAT, VATIKAN

9562

9561



9561

1TFGP FGU JN )TGIQTU FGU )TQ­GP =1TFQ 5CPEVWU )TGIQTKWU /CIPWU?  #WUHÒJTWPI OKV PKEJV   GOCKNNKGTVGP 4GXGTUUGKVGP FGT -TGW\CTOG    EC   -QOOCPFGWTMTGW\ HÒT <KXKNXGTFKGPUV   ZOO)QNFITCXKGTV\KUGNKGTVWPFGOCKNNKGTVI#DURNKVVGTWPIGPKPFGTITÒPGP'OCKNNG FGT.QTDGGTMTCP\ªDGTJÌJWPI$CPFTKPIYQJNUR·VGTGTI·P\VOKVPGWGO*CNUDCPF<- ++



5GJTSWCNKV·VUXQNNG#PHGTVKIWPICWUFGT5VKHVWPIU\GKVFGU1TFGPUCNUQWOECDKU



1TFGP FGU JN )TGIQTU FGU )TQ­GP =1TFQ 5CPEVWU )TGIQTKWU /CIPWU?  #WUHÒJTWPI FKG 4G   XGTUUGKVGP FGT -TGW\CTOG PKEJV GOCKNNKGTV  EC   4KVVGTMTGW\ HÒT <KXKNXGTFKGPUV  Z    OO )QNF ITCXKGTV \KUGNKGTV WPF GOCKNNKGTV  I #DURNKVVGTWPIGP KP FGT ITÒPGP 'OCKNNG FGT   .QTDGGTMTCP\ªDGTJÌJWPICOQTKIKPCNGPCNVGP$CPFOKV/GVCNNUEJNKG­G  <- ++



5GJTSWCNKV·VUXQNNG#PHGTVKIWPICWUFGT5VKHVWPIU\GKVFGU1TFGPUCNUQWOECDKU

9563



140

1TFGP FGU JN )TGIQTU FGU )TQ­GP =1TFQ 5CPEVWU )TGIQTKWU /CIPWU?  #WUHÒJTWPI OKV GOCKN   NKGTVGP 4GXGTUUGKVGP FGT -TGW\CTOG  UGKV EC   )TQ­MTGW\UGV HÒT <KXKNXGTFKGPUV DGUVGJGPF CWU   -NGKPQF 5KNDGT XGTIQNFGV WPF GOCKNNKGTV CO PGWGP 5EJWNVGTDCPF WPF $TWUVUVGTP 5KNDGT DTKNNCPVKGTV   #WHNCIGP5KNDGTXGTIQNFGVWPFGOCKNNKGTVKO8GTNGKJWPIUGVWKFGT(KTOC6CPHCPK$GTVCTGNNKKP4QOOKV FGOIQNFHCTDGPGP9CRRGP2CRUV2KWU:++ TGIXQPDKU <- 5VÒEM++




KIRCHENSTAAT, VATIKAN

9564 (1:1)



1TFGP FGU JN )TGIQTU FGU )TQ­GP =1TFQ 5CPEVWU )TGIQTKWU /CIPWU?  #WUHÒJTWPI OKV GOCKN   NKGTVGP 4GXGTUUGKVGP FGT -TGW\CTOG  UGKV EC   $TWUVUVGTP\WO)TQ­MTGW\5KNDGTDTKNNCPVKGTVWPF TGRGTEKGTV#WHNCIGP5KNDGTXGTIQNFGVWPFGOCKNNKGTVCWHFGT4ÒEMUGKVG*GTUVGNNGTDG\GKEJPWPIFGT(KTOC 6CPHCPK  $GTVCTGNNK KP 4QO OKV $WEJUVCDG # HÒT CIGPVQ  \WT -GPP\GKEJPWPI FGT #WUHÒJTWPI OKV   UKNDGTXGTIQNFGVGP#WHNCIGPCP0CFGNOKV\YGK5GKVGPJCMGP<- ++



9565 (1:1)

9566 (1:1)



1TFGP FGU JN )TGIQTU FGU )TQ­GP =1TFQ 5CPEVWU )TGIQTKWU /CIPWU?  #WUHÒJTWPI OKV GOCKN   NKGTVGP 4GXGTUUGKVGP FGT -TGW\CTOG  UGKV EC   -QOOCPFGWTMTGW\ HÒT <KXKNXGTFKGPUV )QNF VGKN   YGKUGHGKPUV\KUGNKGTVGOCKNNKGTVICONCPIGPCNVGP*CNDCPFCDUEJPKVV<- ++



'ZGORNCTFGT#WMVKQP(TKV\4WFQNH-ÒPMGT1UPCDTÒEM0TªDGTTCIGPFG#PHGTVKIWPIUSWCNKV·VCWU FGONGV\VGP8KGTVGNFGU,CJTJWPFGTVUKPJGTXQTTCIGPFGT'TJCNVWPI



1TFGP FGU JN )TGIQTU FGU )TQ­GP =1TFQ 5CPEVWU )TGIQTKWU /CIPWU?  #WUHÒJTWPI OKV GOCKN   NKGTVGP4GXGTUUGKVGPFGT-TGW\CTOGUGKVEC 4KVVGTMTGW\HÒT<KXKNXGTFKGPUVHTCP\ÌUKUEJG#PHGTVK IWPI XQO 'PFG FGU  ,CJTJWPFGTVU $TQP\G XGTIQNFGV WPF GOCKNNKGTV CO QTKIKPCNGP $CPF KO QTKIK   PCNGP'VWK<- ++

 141


KIRCHENSTAAT, VATIKAN

9567



1TFGP XQO JN 2CRUV 5[NXGUVGT QFGT XQP FGT 4KVVGTNKEJGP )QNFGPGP /KNK\ =1TFQ 5CPEVK 5KNXGUVTK   2CRCGUKXG'SWGUVTK/KNKVKCG#WTCVCG?-QNNCPGFGT-QOOCPFGWTGWPF4KVVGTDGUVGJGPFCWU-GVVGP

FCXQP \YGK OKV $GHGUVKIWPIUJCMGP  WPF GKPGO 6TQRJ·GPINKGF OKV 6TCIGJCMGP HÃ&#x2019;T FCU 1TFGPUMTGW\   $TQP\GXGTIQNFGV<- ++  #PHGTVKIWPI CWU FGO NGV\VGP 8KGTVGN FGU  ,CJTJWPFGTVU 2CRUV)TGIQT:8+YCPFGNVGCO1MVQDGTFGP CNVGP1TFGPFGT)QNFGPGP/KNK\QFGTXQO)QNFGPGP5RQTPWOKPGKPGPPGWGPPWPOGJT\YGKMNCUUKIGP 4KVVGTWPF -QOOCPFGWT 1TFGPXQOJN2CRUV5[NXGUVGTQFGTXQPFGT4KVVGTNKEJGP)QNFGPGP/KNK\FGUUGP+PUKIPKGPPQTOCNGT YGKUG CO *CNU QFGT $TWUVDCPF DGK DGUQPFGTGP HGKGTNKEJGP )GNGIGPJGKVGP LGFQEJ CP GKPGT -GVVG WPF FC\W GKPG   1TFGPU7PKHQTOIGVTCIGPYWTFGP

142


KIRCHENSTAAT, VATIKAN

9568



9569

1TFGP XQO JN 2CRUV 5[NXGUVGT QFGT XQP FGT 4KVVGTNKEJGP )QNFGPGP /KNK\ =1TFQ 5CPEVK 5KNXGUVTK   2CRCGUKXG'SWGUVTK/KNKVKCG#WTCVCG?#WUHÒJTWPI FKG4GXGTUUGKVGPFGT-TGW\CTOGPKEJVGOCKNNKGTV  DKU EC   4KVVGTMTGW\ )QNF GOCKNNKGTV  I OKP *CCTTKUUG KO FGO 4GXGTUOGFCKNNQP PCJG\W   WPUKEJVDCTG 'OCKNNGTGRCTCVWT 5RQTP FTGJDCT CO QTKIKPCNGP CNVGP VTKCPIWNCT CPIGQTFPGVGP $CPF   <- ++



'ZGORNCTFGT#WMVKQP(TKV\4WFQNH-ÒPMGT1UPCDTÒEM0T#PHGTVKIWPICWUFGOFTKVVGP8KGTVGNFGU ,CJTJWPFGTVU



1TFGP FGU JN 2CRUVGU 5[NXGUVGT =1TFQ 5CPEVK 5KNXGUVTK 2CRCG? -QOOCPFGWTMTGW\ )QNF GOCKNNKGTV    I GKP PCJG\W WPUKEJVDCTGT *CCTTK­ GKP .QEJ FGT -WIGNÌUG GVYCU CWUIGDGWNV QJPG *CNUDCPF   <- ++ 'ZGORNCTFGT#WMVKQP(TKV\4WFQNH-ÒPMGT1UPCDTÒEM0T'Z\GNNGPVG#PHGTVKIWPICWUFGOGTUVGP 8KGTVGNFGU<YCP\KIUVGP,CJTJWPFGTVUKPGEJV)QNFPKEJVJ·WHKI\WHKPFGP  #O(GDTWCT·PFGTVG2CRUV2KWU:FGP1TFGPXQOJN2CRUV5[NXGUVGTWPFXQO)QNFGPGP5RQTPKPGKPGP FTGKMNCUUKIGP YQDGK FKG \YGKVG -NCUUG KP \YGK )TCFG  OKV WPF QJPG $TWUVUVGTP  WPVGTVGKNV KUV  CNNIGOGKPGP   8GTFKGPUVQTFGP WO /KV *CPFUEJTGKDGP XQO  ,WNK  XGTHÒIVG 2CRUV ,QJCPPGU 2CWN ++   FC­ FGT   1TFGPHQTVCPKPCNNGP-NCUUGPCWEJCP(TCWGPXGTNKGJGPYGTFGPMCPP



9572 ex 9571







ex 9570

4KVVGTQTFGP XQO *GKNKIGP )TCD XQP ,GTWUCNGO =1TFQ 'SWGUVTKU 5CPEVK 5GRWETK *KGTQUQN[OKVCPK?   /QFGNN UGKV -QOOCPFGWTMTGW\$TQP\GXGTIQNFGVWPFGOCKNNKGTVCO*CNUDCPF\WUCOOGPOKV /KPKCVWTXGTIQNFGVWPFGOCKNNKGTVCO$·PFEJGPWPF-PQRHNQEJTQUGVVGOKV#WHNCIGKOQTKIKPCNGP8GT NGKJWPIUGVWK 5VÒEM++



4KVVGTQTFGP XQO *GKNKIGP )TCD XQP ,GTWUCNGO =1TFQ 'SWGUVTKU 5CPEVK 5GRWETK *KGTQUQN[OKVCPK?   /QFGNN UGKV 4KVVGTMTGW\$TQP\GXGTIQNFGVWPFGOCKNNKGTVCO*CNUDCPF\WUCOOGPOKV/KPKCVWT XGTIQNFGVWPFGOCKNNKGTVCO$·PFEJGPWPF-PQRHNQEJTQUGVVGOKV#WHNCIGKOQTKIKPCNGP8GTNGKJWPIUG VWK 5VÒEM+p++



'JTGPMTGW\2TQ'EENGUKCGV2QPVGHKEG/QFGNN FTGKMNCUUKI )QNFGPGU'JTGPMTGW\$TQP\GXGTIQN FGV CO $CPF OKV 0CFGN KO QTKIKPCNGP NGKEJV DGUEJ·FKIVGP 'VWK FGT (KTOC 6CPHCPK WPF $GTVCTGNNK KP   4QOOKVFGOIQNFHCTDGPGP9CRRGP2CRUV2KWU:++ TGIXQPDKU  ++

 143


KIRCHENSTAAT, VATIKAN

9574

ex 9573

9575 9576



#NNIGOGKPG $GPGOGTGPVK/GFCKNNG /QFGNN OKV 2QTVTCKV XQP 2CRUV .GQ :+++   #WUICDGP   QJPG #PICDG FGU 2QPVKHKMCVULCJTGU \YGK 'ZGORNCTG FGT -NGKPGP 5KNDGTPGP $GPGOGTGPVK/GFCKNNG   &WTEJOGUUGTWPFOOLGYGKNU5KNDGTLGYGKNUQJPG$CPF 5VÒEM++





#NNIGOGKPG $GPGOGTGPVK/GFCKNNG /QFGNN OKV 2QTVTCKV 2CRUV 2KWU :   /KVVNGTG )QNFGPG   $GPGOGTGPVK/GFCKNNG5KNDGTXGTIQNFGVOKV5VGORGNUEJPGKFGTUKIPCVWT$+#0%*+QJPG$CPF 44++p





/GPVCPC-TGW\-TGW\HÒT7PVGTQHHK\KGTGWPF/CPPUEJCHVGP%W0KQJPG$CPF





'JTGPMTGW\\WO)QNFGPGP2TKGUVGTLWDKN·WO2CRUV2KWU:#WUHÒJTWPIOKV5GIGPUURTWEJCWH FGT4ÒEMUGKVG$TQP\GCO$CPF 4++

++



9577

9579

ex 9580 9578



'TKPPGTWPIUOGFCKNNG CP FCU )QNFGPG 2TKGUVGTLWDKN·WO 2CRUV 2KWU :  )QNFGPG /GFCKNNG   $TQP\GXGTIQNFGVQJPG$CPFKOQTKIKPCNGP8GTNGKJWPIUGVWKOKVCWHIGFTWEMVGP2CRUVYCRRGP 4++





'TKPPGTIWPIUOGFCKNNG CP FCU )QNFGPG 2TKGUVGTLWDKN·WO 2CRUV 2KWU :  5KNDGTPG /GFCKNNG   $TQP\GXGTUKNDGTVQJPG$CPF 4++





'JTGPMTGW\ HÒT 8GTFKGPUVG WO FGP  'WEJCTKUVKUEJGP 9GNVMQPITG­ KP &WDNKP  )QNFGPGU   'JTGPMTGW\)QNF  VGKNYGKUGGOCKNNKGTVCWHFGT4ÒEMUGKVGOGJTHCEJRWP\KGTVCP$CPFTCJGOKV$CPF $CPF WPF 6TCIGURCPIG )GUCOVIGYKEJV  I CWH FGT $CPFURCPIG JCPFIGOCNVGT 6T·IGTPCOG * '   %#4&+0#.8#041';KOQTKIKPCNGP8GTNGKJWPIUGVWK 444++



#WU#PNC­FGUL·JTKIGP,WDKN·WOUFGT#PMWPHVFGUJN2CVTKEMKP+TNCPFWPFFGU,CJTGUVCIGUFGT)TÒPFWPI FGU(TGKUVCCVGU+TNCPFVCIVGXQODKU,WPKFGT'WEJCTKUVKUEJG9GNVMQPITG­KPFGTKTKUEJGP*CWRVUVCFV &WDNKP#WUFGTICP\GP9GNVPCJOGPCWEJOGJTGTG-CTFKP·NGFCTCPVGKNUQCWEJ,Q\GH'TPGUV-CTFKPCNXCP4QG[

 'T\DKUEJQHXQP/GEJGNPKP$GNIKGPYQHÒTKJOFKGUGU'JTGPMTGW\KP)QNFXGTNKGJGPYWTFG



144

$GPGOGTGPVK-TGW\HÒT8GTFKGPUVGWOFCU#W­GTQTFGPVNKEJG*GKNKIG,CJTFGT'TNÌUWPI$TQP \GPGU $GPGOGTGPVK-TGW\ $TQP\G CO $CPF KOQTKIKPCNGP8GTNGKJWPIUGVWKOKVIQNFHCTDGPGO9CRRGP 2CRUV2KWU:+\WUCOOGPOKVFGT/KPKCVWTFGU'JTGP\GKEJGPUKOUGRCTCVGP'VWK 5VÒEM++




KIRCHENSTAAT, VATIKAN

9581



















9583

ex 9584

9585

$GPGOGTGPVK/GFCKNNG HÒT 8GTFKGPUVG WO FCU #W­GTQTFGPVNKEJG *GKNKIG ,CJT FGT 'TNÌUWPI    $TQP\GPG $GPGOGTGPVK/GFCKNNG CO $CPF KO PKEJV MQTTGMVGP 'VWK HÒT FKG #NNIGOGKPG $GPGOGTGPVK   /GFCKNNGXQP5,QJPUQP ++



$GPGOGTGPVK/GFCKNNG HÒT 8GTFKGPUVG WO FKG (GKGTNKEJMGKVGP CWU #PNC­ FGT 8GTMÒPFKIWPI FGU   &QIOCU XQP FGT NGKDNKEJGP #WHPCJOG /CTKGPU KP FGP *KOOGN FWTEJ 2CRUV 2KWU :++ KO ,CJTG    5QIGPCPPVG /CFQPPC 5GFWVC 5KNDGTPG /GFCKNNG 5KNDGT 5KNDGTRWP\G CO $CPF OKV 6TCIG   URCPIG ++



$GPGOGTGPVK/GFCKNNG HÒT 8GTFKGPUVG WO FKG (GKGTNKEJMGKVGP CWU #PNC­ FGT 8GTMÒPFKIWPI FGU   &QIOCU XQP FGT NGKDNKEJGP #WHPCJOG /CTKGPU KP FGP *KOOGN FWTEJ 2CRUV 2KWU :++ KO ,CJTG   5QIGPCPPVG/CFQPPC5GFWVC$TQP\G/GFCKNNG$TQP\GCO$CPFOKV6TCIGURCPIG ++



-QPXQNWV XQP FTGK $GPGOGTGPVK WPF 'TKPPGTWPIUOGFCKNNGP 2CRUV 2KWU :++   $TQP\GPG $GPGOG   TGPVK/GFCKNNG HÒT 8GTFKGPUVG WO FKG (GKGTNKEJMGKVGP CWU #PNC­ FGU 5KNDGTPGP $KUEJQHULWDKN·WOU 2CRUV   2KWU:++KO,CJTGCO$CPF 5KNDGTPG$GPGOGTGPVK/GFCKNNGHÒT8GTFKGPUVGWOFKG&WTEJHÒJ TWPIFGU*GKNKIGP,CJTGUXGTUKNDGTVCO$CPFKO'VWK $TQP\GPG'TKPPGTWPIUOGFCKNNGCPFCU *GKNKIG,CJTQJPG$CPF 5VÒEM++



$GPGOGTGPVK/GFCKNNG HÒT 8GTFKGPUVG WO FKG 2KNIGTHCJTV 2CRUV 2CWNU 8+ KPU *GKNKIG .CPF XQO     DKU  ,CPWCT  5KNDGTPG $GPGOGTGPVK/GFCKNNG 5KNDGT CWH FGT 8QTFGTUGKVG 5VGORGNUEJPGKFGT  5KIPCVWT .14+1.+ CWH FGT 4ÒEMUGKVG )+75'22' 2+4410' WPF 5KNDGTRWP\G  CO $CPF OKV   6TCIGURCPIGKOQTKIKPCNGPIQNFHCTDGPDGFTWEMVGP8GTNGKJWPIUGVWK ++



9586



9582

9587

9588

9589

9590

$GPGOGTGPVK/GFCKNNG HÒT 8GTFKGPUVG WO FKG 2KNIGTHCJTV 2CRUV 2CWNU 8+ KPU *GKNKIG .CPF XQO    DKU,CPWCT$TQP\GPG$GPGOGTGPVK/GFCKNNG$TQP\GCWHFGT8QTFGTUGKVG5VGORGNUEJPGKFGT 5KIPCVWT .14+1.+ CWH FGT 4ÒEMUGKVG )+75'22' 2+4410' CO $CPF OKV 6TCIGURCPIG KO   QTKIKPCNGPIQNFHCTDGPDGFTWEMVGPGVYCUDGTKGDGPGP8GTNGKJWPIUGVWK ++



$GPGOGTGPVK/GFCKNNGHÒT8GTFKGPUVGWOFKG&WTEJHÒJTWPIFGU<YGKVGP8CVKMCPKUEJGP-QP\KN DKU  5KNDGTPG $GPGOGTGPVK/GFCKNNG 5KNDGT CWH FGO 4GXGTU 5KNDGTRWP\G  CO $CPF OKV   6TCIGURCPIGKOQTKIKPCNGO8GTNGKJWPIUGVWKOKVOGVCNNGPGO9CRRGP2CRUV2CWNU8+ ++



$GPGOGTGPVK/GFCKNNGHÒT8GTFKGPUVGWOFKG&WTEJHÒJTWPIFGU<YGKVGP8CVKMCPKUEJGP-QP\KN DKU5KNDGTPG$GPGOGTGPVK/GFCKNNGPKEJVVTCIDCTG#WUHÒJTWPIHÒT(TCWGP5KNDGTCWHFGO4GXGTU 5KNDGTRWP\GKOQTKIKPCNGO8GTNGKJWPIUGVWKOKVOGVCNNGPGO9CRRGP2CRUV2CWNU8+ ++



$GPGOGTGPVK/GFCKNNGHÒT8GTFKGPUVGWOFKG&WTEJHÒJTWPIFGU<YGKVGP8CVKMCPKUEJGP-QP\KN DKU  $TQP\GPG $GPGOGTGPVK/GFCKNNG $TQP\G CO $CPF OKV 6TCIGURCPIG KO QTKIKPCNGO 8GTNGK   JWPIUGVWKOKVOGVCNNGPGO9CRRGP2CRUV2CWNU8+ ++



$GPGOGTGPVK/GFCKNNG HÒT 8GTFKGPUVG WO FCU *GKNKIG ,CJT  5KNDGTPG $GPGOGTGPVK/GFCKNNG   5KNDGTCWHFGT8QTFGTUGKVG5VGORGNUEJPGKFGTPCOG'/CPHCKPKWPF5KNDGTRWP\GCO$CPF ++

 145


ÄGYPTEN

9591

9592

9593

9594



$GPGOGTGPVKOGFCKNNG FGT 2·RUVNKEJGP )GUGNNUEJCHV FGT JN 2GVTWU WPF 2CWNWU 5KNDGTPG /GFCKNNG   5KNDGTQJPG$CPFKO6ÒVEJGPFGU*GTUVGNNGTU,QJPUQPKP/CKNCPFWPF4QO 44++





2GMVQTCNG GKPGT )GPGTCNQDGTKP GKPGT KO -TCPMGPRHNGIFKGPUV V·VKIGP MCVJQNKUEJGP 5EJYGUVGTP-QP   ITGICVKQPZOO5KNDGTXGTIQNFGVCWHFGT8QTFGTUGKVGGOCKNNKGTVCWHFGT4ÒEMUGKVG)TCXWT 2#4#4'8+#/&1/+0+=&GO*GTTPFGP9GIDGTGKVGP?CWHFGT4ÒEMUGKVGFGUWPVGTGP-TGW\CTOU 5KNDGTRWP\GKO1TKIKPCNGVWK 4++



#PHGTVKIWPICWUFGO\YGKVGP8KGTVGNFGU,CJTJWPFGTVU





-QPXQNWV XQP HÒPH XGTUEJKGFGPGP $GPGOGTGPVK/GFCKNNGP \W #PN·­GP WPF )GFGPMOGFCKNNGP   &CTWPVGT (GNF\WIUOGFCKNNG  KP $TQP\G $TQP\GPG $GPGOGTGPVKOGFCKNNG \WO )QNFGPGP 2TKGUVGT   LWDKN·WO 2CRUV 2KWU :+  WPF 5KNDGTPG XGTUKNDGTV  'TKPPGTWPIUOGFCKNNG CP FGP #DUEJNW­ FGT   .CVGTCP8GTVT·IG  8GTUEJKGFGPG /GVCNNG GKPG KP 5KNDGT  VGKNU XGTUKNDGTV XKGT CP $·PFGTP KP   QTFGPVNKEJGP'TJCNVWPIGP ++ 6UEJCMMQ#D\GKEJGPFGT2·RUVNKEJGP2CNCVKPICTFGZOO/GUUKPIDNGEJVGKNYGKUGXGTIQNFGV VGKNYGKUGXGTUKNDGTVOKV\YGK&QRRGNURNKPVGP ++

 

9595

-¤0+)4'+%*   

);26'0

1TFGP FGU 0KNU =0KUEJCP CN0KN?  /QFGNN  $TWUVUVGTP\WT-NCUUG5KNDGTDTKNNCPVKGTV VGKNYGKUG XGTIQNFGV VGKNYGKUG GOCKNNKGTV CWH FGT 4ÒEMUGKVG *GTUVGNNGTDG\GKEJPWPI FGT (KTOC .CVVGU KP   -CKTQWPFOGJTGTG2WP\GPWCGT5KNDGTRWP\GWPF,CJTGRWP\G%HÒTCP0CFGNOKV\YGK 5GKVGPJCMGP$9- ++  UVKHVGVG 5WNVCP *WUGKP -GOCN FGP HÒPHMNCUUKIGP 1TFGP  /QFGNN  FGUUGP 5VCVWVGP  GKPKIG PFGTWPIGP   FKGUKEJCWEJCWHFKG)GUVCNVWPIFGT+PUKIPKGPCWUYKTMVGPGTHCJTGPJCDGP /QFGNN &CU/QFGNNWPVGTUEJGKFGV UKEJ XQO  FCTKP FC­ FKG #ITCHHG FGU -NGKPQFU IQNFHCTDGP KUV WPF FGT $TWUVUVGTP XGTIQNFGVG 5VTCJNGP CWHYGKUV   0CEJ #WUTWHWPI FGT 4GRWDNKM  YWTFG GT \WP·EJUV CWHIGJQDGP  LGFQEJ GTPGWV CNU GKPMNCUUKIGT 1TFGPIG UVKHVGV

146




ÄTHIOPIEN

9596 ex 9597

9596

-#+5'444'+%* $+5  



6*+12+'0

1TFGP /GPGNKMU ++ )TQ­QHHK\KGTUUGV DGUVGJGPF CWU *CNUMTGW\ $TQP\G GOCKNNKGTV CO *CNUDCPF WPF   $TWUVUVGTP$TQP\GVGKNYGKUGDTKNNCPVKGTVXGTIQNFGVVGKNYGKUGGOCKNNKGTVCP0CFGNOKV\YGK5GKVGPJCMGP KO·NVGTGP*QN\MCUVGPOKVHGKPUVGP*QN\KPVCTUKGP$9- 5VÒEM++



-QPXQNWV XQP \YGK 1TFGP WPF \YGK 'JTGP\GKEJGP   1TFGP /GPGNKMU ++ -TGW\  -NCUUG $TQP\G   XGTIQNFGVWPFGOCKNNKGTV'OCKNNGTGRCTCVWTCO$CPF 1TFGPXQO5KGIGN-ÌPKI5CNQOQU/QFGNNOKV UVKNKUKGTVGTGWTQR·KUEJGT-TQPG&GMQTCVKQP-NCUUGXGTIQNFGVCO$CPF -TGW\5KGIGUUVGTPHÒTFGP 5KGIÒDGT+VCNKGP#WUICDGHÒT#WUN·PFGTCO$CPF -TGW\HÒTFGP'KPUCV\KP-QTGCCPDGUEJ·FKIVGO $CPFTGUV ++

 147


AFGHANISTAN

9598

#()*#0+56#0 '/+4#670&-¤0+)4'+%*   

1TFGP FGT 5QPPG =0KUEJCPG #NOCT?  /QFGNN   5VCCVUYCRRGP KO /GFCKNNQP CWH GKPGO   5VGTP  1TFGPUMQNNCPG CHIJCPKUEJG (GTVKIWPI DGUVGJGPF CWU  5QPPGP/GFCKNNQPU OKV -NGKPQF YQJN   GKPG-WRHGT0KEMGN.GIKGTWPIFKG5QPPGP/GFCKNNQPUDTKNNCPVKGTV/GFCKNNQPCWHNCIGP-WRHGT$9- 44++  #DFWT 4CJOCP -JCP   'OKT XQP #HIJCPKUVCP UVKHVGVG FKGUGP \YGKMNCUUKIGP 1TFGP YQJN WO    &GP 1TFGPUUVGTP VTWI GT CP GKPGT -CTCMWN/ÒV\GYQFWTEJUKG\WGKPGOMÌPKINKEJGP*GTTUEJGT#VVTKDWVYWTFG+O .CWHG FGT 8GTNGKJWPIU\GKV YWTFG FCU 9CRRGP KO /GFCKNNQP OGJTHCEJ XGT·PFGTV 5Q NKG­ #OCPWNNCJ -JCP      'OKT XQP #HIJCPKUVCP WO  KP FCU /GFCKNNQP FGT +PUKIPKGP UGKPG RGTUÌPNKEJG 6WIJTC GN )JC\K FGT   5KGITGKEJG  WPF UGKP )GDWTVULCJT #*    UGV\GP  /QFGNN   PCJO #OCPWNNCJ FGP 6KVGN 2CFKUEJCJ  

-ÌPKI CPFCU.CPFGUYCRRGPOKVFGT/QUEJGGYWTFGPWPOGJTCWHGKPGOCEJVUVTCJNKIGP5VGTPRNCV\KGTVWPFUQKP FKG+PUKIPKGPCWHIGPQOOGP /QFGNN $GOGTMGPUYGTVKUVFC­FKG+PUKIPKGPFKGUGU/QFGNNUYKGCNNGFCOCNKIGP CHIJCPKUEJGP 1TFGP WPF 'JTGP\GKEJGP CWEJ FKG XQP )QFGV KP $GTNKP IGHGTVKIVGP  PCJG\W FWTEJYGI KP WPGFNGP   /GVCNNGP CPIGHGTVKIV YQTFGP UKPF &KGU OCI OWUNKOKUEJTGNKIKÌU CDGT CWEJ MQOOGT\KGNN OQVKXKGTV IGYGUGP UGKP    ÒDGTPCJO /QJCOOGF 0CFKT 5EJCJ   FKG /CEJV WPF YWTFG -ÌPKI XQP #HIJCPKUVCP 'T ·PFGTVG   YKGFGTWO FCU 5VCCVUYCRRGP KPFGO GT FGP 5VGTP GPVHGTPVG WPF  FKG /QUEJGG XQP GKPGO JTGPMTCP\ WOICD   &KGUGT-TCP\URKGNVFCTCWHCPFC­0CFKT5JCJKO/CPPGUUVCOOXQP#JOCF5EJCJ&WTTCPK  CDUVCOOVG FGTOKVGKPGOJTGPMTCP\IGMTÌPVYQTFGPYCT&GOGPVURTGEJGPFYWTFGCWEJFCU9CRRGPCWHFGP1TFGPUKP UKIPKGPIG·PFGTV /QFGNN 7PVGT0CFKT5EJCJʼnU5QJPWPF0CEJHQNIGT-ÌPKI/QJCOOGF<CJKT5EJCJ   YWTFGP FKG +PUKIPKGP FGU 1TFGPU  FWTEJ GKPG WOHCPITGKEJG 5VCVWVGP·PFGTWPI PQEJ GKPOCN IG·PFGTV #WEJ   PCEJFGO<CJKT5EJCJKPU'ZKNIGICPIGPYCTXGTNKGJGTFGP1TFGPDKU\WUGKPGO6QFCNU*CWUQTFGPYGKVGT+P FGT<GKVFGT&GOQMTCVKUEJGP4GRWDNKM#HIJCPKUVCPYWTFGFGT1TFGPFGT5QPPGCNUGKPMNCUUKIGTUQ\KCNKUVKUEJGT1TFGP PGWIGUVKHVGVWPFDKU\WFGTGP'PFGXGTNKGJGP 8IN#WVGPITWDGT/KEJCGNWPF6COOCPP)#PFTGCU'KP NGKVWPIUVGZV \WO -CRKVGN #HIJCPKUVCP +P 7$5   #WMVKQP 1TFGP CWU CNNGT 9GNV 5COONWPI 6COOCP $CUGN   5H 

148


AFGHANISTAN

9599 (1:1)



1TFGPFGU(ÒJTGTU=0KUEJCPG5CTFCTK?/QFGNN 9CRRGPOKVJTGPMTCP\WOIGDGP  5VGTP  -NCUUG &WTEJOGUUGT  OO CHIJCPKUEJG #PHGTVKIWPI )QNF OCUUKX \YKUEJGP     EV WPF EV YQJN EV IGDT·WEJNKEJKPOWUNKOKUEJGP.·PFGTPI   /GFCKNNQPNGKEJVGKPIGFTÒEMVCPGEJVIQNFGPGT0CFGN$9- ++p  +PFKGUGTUEJYGTGPGEJVIQNFGPGP#PHGTVKIWPIXQPCNNGTITÌ­VGT5GNVGPJGKV&GT5VGTPFGTCNNGKPGQJPGYGKVGTG+PUK IPKGPXGTNKGJGPWPFIGVTCIGPYWTFGFÒTHVGMWT\PCEJKO#WHVTCI-ÌPKI/QJCOOGF0CFKT5EJCJU   KP#WHVTCIIGIGDGPWPFYQJNGKPGO5VCOOGUHÒJTGTXGTNKGJGPYQTFGPUGKPFGTKJPDGKUGKPGO2WVUEJIGIGPUGKPGP 8QTI·PIGT -ÌPKI *CDKDWNNCJ -CNCMCPK EC   WPVGTUVÒV\V JCVVG &GT \YGKVJÌEJUVG CHIJCPKUEJG 1TFGP   YWTFGXQP*CDKDWNNCJ-JCP'OKTXQP#HIJCPKUVCP  CNU\WP·EJUVGKPMNCUUKIGT1TFGPIGUVKHVGV+O .CWHG FGT 8GTNGKJWPIU\GKV YWTFG UGKP #WUUGJGP YKG CWEJ FCU 9CRRGP KO /GFCKNNQP OGJTHCEJ XGT·PFGTV    GTYGKVGTVGKJP#OCPWNNCJ-JCP  'OKTXQP#HIJCPKUVCPCWHXKGT-NCUUGPWPFXGT·PFGTVGUGKPG)GUVCNV

/QFGNN 7ONKG­GTKPFCU/GFCKNNQPFGT+PUKIPKGPUGKPGRGTUÌPNKEJG6WIJTCGN)JC\K FGT5KGITGKEJG  WPF UGKP )GDWTVULCJT #*    UGV\GP  /QFGNN   PCJO #OCPWNNCJ FGP 6KVGN 2CFKUJCJ -ÌPKI  CP   FCU.CPFGUYCRRGPOKVFGT/QUEJGGYWTFGPWPOGJTCWHGKPGOCEJVUVTCJNKIGP5VGTPRNCV\KGTVWPFUQKPFKG+PUKIPKGP CWHIGPQOOGP /QFGNN $GOGTMGPUYGTVKUVFC­FKG+PUKIPKGPFKGUGU/QFGNNUYKGCNNGFCOCNKIGPCHIJCPKUEJGP 1TFGPWPF'JTGP\GKEJGP CWEJFKGXQP)QFGVKP$GTNKPIGHGTVKIVGP PCJG\WFWTEJYGIKPWPGFNGP/GVCNNGPCPIGHGT VKIVYQTFGPUKPF&KGUOCIOWUNKOKUEJTGNKIKÌUCDGTCWEJMQOOGT\KGNNOQVKXKGTVIGYGUGPUGKP<YKUEJGPWPF  MCOGP FKG-CTCMWN/ÒV\GPÒDGTFGP*CNDOQPFGPKP(QTVHCNN /QFGNN ÒDGTPCJO/QJCOOGF0CFKT 5EJCJ  FKG/CEJVWPFYWTFG-ÌPKIXQP#HIJCPKUVCP'T·PFGTVGYKGFGTWOFCU5VCCVUYCRRGPKPFGOGT FGP5VGTPGPVHGTPVGWPFFKG/QUEJGGXQPGKPGOJTGPMTCP\WOICD&GOGPVURTGEJGPFYWTFGCWEJFCU9CR RGP CWH FGP 1TFGPUKPUKIPKGP IG·PFGTV  /QFGNN  7PVGT 0CFKT 5EJCJʼnU 5QJP WPF 0CEJHQNIGT -ÌPKI /QJCOOGF   <CJKT 5EJCJ   YWTFGP FKG +PUKIPKGP FGU 1TFGPU  FWTEJ GKPG WOHCPITGKEJG 5VCVWVGP·PFGTWPI PQEJ   GKPOCNIG·PFGTV /QFGNN 0CEJFGO<CJKT5EJCJKPU'ZKNIGICPIGPYCTYWTFGFKG8GTNGKJWPIFGU1TFGPU GKPIGUVGNNV 8IN #WVGPITWDGT /KEJCGN WPF 6COOCPP)#PFTGCU'KPNGKVWPIUVGZV\WO-CRKVGN#HIJCPKUVCP+P 7$5#WMVKQP1TFGPCWUCNNGT9GNV5COONWPI6COOCP$CUGN5H 

149


CHINA

9600 (1:1)

-#+5'44'+%*   

$4#5+.+'0

/KNKV·TKUEJGT1TFGP7PUGTGU*GTTP,GUW%JTKUVK DTCUKNKCPKUEJGT<YGKI $TWUVUVGTP\WO -QOOCPFGWTMTGW\&WTEJOGUUGTOO  5KNDGT/GFCKNNQPWPF*GT\,GUW&GMQTCVKQP)QNFGOCKN NKGTVPCJG\WWPUKEJVDCTG4GRCTCVWTKPFGTTQVGP'OCKNNGFGT*GT\,GUW&GMQTCVKQPFKGDGKFGPUGKVNKEJGP #TOGFGU-TGW\EJGPUCDIGDTQEJGPTÒEMUGKVKIG&QRRGNPCFGNHGJNV 44++



#PHGTVKIWPI WO  &KG HTÒJGP $TWUVUVGTPG \WO -QOOCPFGWTMTGW\ YKG CWEJ FKG HTÒJGP 4KVVGTFGMQTCVKQPGP FGU   DTCUKNKCPKUEJGP<YGKIGUFGU1TFGPUYCTGPXQPPWTUGJTIGTKPIGT)TÌ­GKO8GTINGKEJ\WFGP+PUKIPKGPFGURQTVWIKG UKUEJGP<YGKIGU.CWV2QNNKCPQ KP215 UKPF\YKUEJGPWPFPWT-QOOCPFGWTMTGW\GXGTNKGJGP YQTFGP#NU,QµQ8+-ÌPKIXQP2QTVWICN$TCUKNKGPWPFFGT#NICTXGPCEJL·JTKIGT*QHJCNVWPIKP4KQFG,CPGKTQ PCEJ2QTVWICN\WTÒEMMGJTVGUGV\VGGTUGKPGP5QJP&QO2GFTQ\WO4GIGPVGPKP$TCUKNKGPGKPOKVFGO4GEJV FKG FTGK RQTVWIKGUKUEJGP 4KVVGTQTFGP %JTKUVWU 5V$GPVQ #XK\ WPF 5V,CMQD XQO 5EJYGTV  FQTV \W XGTNGKJGP  GKP   4GEJVFCUGTUEJQPPCEJXKGT/QPCVGPYKFGTTKGH#O5GRVGODGTGTMN·TVG&QO2GFTQFKG7PCDJ·PIKIMGKV $TCUKNKGPUWPFNKG­UKEJMWT\FCTCWHCNU-CKUGTMTÌPGPPCEJFGOUEJQPXQTJGT.KUUCDQP6TWRRGP\WT8GTJKPFGTWPI FKGUGT'PVYKEMNWPIGPGPVUCPFVJCVVG $TCUKNKCPKUEJGT7PCDJ·PIKIMGKVUMTKGI 7PDGKTTVDGUV·VKIVG&QO2GFTQ+ FGP%JTKUVWU1TFGPCNUDTCUKNKCPKUEJGP1TFGP&GT5VTGKV\YKUEJGP8CVGTWPF5QJPPCJOJQEJRQNKVKUEJG&KOGPUKQ PGPCPFCFKG2QTVWIKGUGPWOFGP1TFGPKJT0CVKQPCNU[ODQNHÒTEJVGVGP#WEJFGT6QF,QµQU8+FGT&QO2GFTQ \WU·V\NKEJ \WO -ÌPKI XQP 2QTVWICN OCEJVG DTCEJVG MGKPG .ÌUWPI FC GT CNU UQNEJGT \WIWPUVGP UGKPGT 6QEJVGT CD   FCPMVG &GT WO GKP 5EJKGFUIGTKEJV CPIGTWHGPG 2CRUV .GQ :++ DGUVKOOVG  FC­ GU HQTVCP \YGK WPCDJ·PIKIG   %JTKUVWU1TFGPOKV\YGK)TQ­OGKUVGTPI·DG#O#RTKNFCPMVG&QO2GFTQ+CNU-CKUGTXQP$TCUKNKGPCD YQOKV FGT DTCUKNKCPKUEJG <YGKI FGU %JTKUVWU1TFGPUGTNQUEJ 8IN#WVGPITWDGT/KEJCGNWPF6COOCPP)#P FTGCU#POGTMWPIGP\W0T+P7$5#WMVKQP1TFGPCWUCNNGT9GNV5COONWPI6COOCPP$CUGN 5 

9602 9601

9601

%*+0# %*+0'5+5%*'-4+')5*'44'0   

7PDGMCPPVG#WU\GKEJPWPI$TQP\GGOCKNNKGTVCOQTKIKPCNGP6TCIGMGVVEJGP

4++



6+'065+0 

<KXKN8GTFKGPUVOGFCKNNGFGTHTCP\ÌUKUEJGP0KGFGTNCUUWPI6KGPVUKP=/¾FCKNNGFW/¾TKVGEKXKSWGFGNC %QPEGUUKQP(TCP¼CKUG¯6KGPVUKP?$TQP\GPG8GTFKGPUVOGFCKNNG$TQP\GCO$CPF 444++ 8QP CNNGTITÌ­VGT 5GNVGPJGKV  +PPGTJCND FGT +PVGTPCVKQPCNGP 8GTYCNVWPI FGT EJKPGUKUEJGP *CHGPUVCFV 6KGPVUKP FKG   XQPDKUUQICTCWVQPQOTGIKGTVGJCVVGCWEJ(TCPMTGKEJPGDGP4WUUNCPF)TQ­DTKVCPPKGP$GNIKGP,CRCP +VCNKGP ¤UVGTTGKEJ7PICTP WPF FGO &GWVUEJGP 4GKEJ GKPG -QP\GUUKQP \WT 0KGFGTNCUUWPI &KGUG -QP\GUUKQPGP   DKNFGVGP MQOOWPCNLWTKUVKUEJ UGNDUVUV·PFKIG 'KPJGKVGP KPPGTJCND FGT +PVGTPCVKQPCNGP 8GTYCNVWPI ·JPNKEJ YKG KP FGT   +PVGTPCVKQPCNGP0KGFGTNCUUWPIXQP5JCPIJCK<WGKPGODKUJGTWPDGMCPPVGP<GKVRWPMVJCVFKG8GTYCNVWPIFGTHTCP\Ì UKUEJGP -QP\GUUKQP FKGUG /GFCKNNG HÒT <KXKNXGTFKGPUV IGUEJCHHGP PCEJ FGO 8QTDKNF FGT 8GTFKGPUVOGFCKNNG FGT   HTCP\ÌUKUEJGP-QP\GUUKQPKPPGTJCNDFGT+PVGTPCVKQPCNGP0KGFGTNCUUWPIXQP5EJCPIJCK

150




CHINA

9603 (1:1)

4'27$.+-   

1TFGPFGT)QNFGPGPJTG=%JKC*Q*UÒP%JCPI?/QFGNN /GFCKNNQPTKPIOKV2WPMVGPKPFGP HÒPH (CTDGP FGT 4GRWDNKM  EC   $TWUVUVGTP \WT  -NCUUG &WTEJOGUUGT  OO 5KNDGT   XGTIQNFGVWPFGOCKNNKGTVCWHFGO4GXGTU*GTUVGNNGTDG\GKEJPWPIFGT1TFGPUHCDTKMFGU$ÒTQUFGT5KGIGN

1TFGPUCDVGKNWPIFGTUVCCVNKEJGP/ÒP\G KP2GMKPIWPF4GRWDNKM%JKPC,CJTKPEJKPGUKUEJGP5EJTKHV \GKEJGPCP0CFGNFKGUGOKVHTCP\ÌUKUEJG'KPHWJTRWP\GXQPDKU 5EJYCPGPRWP\G OKV\YGK 5GKVGPJCMGP$9- +p++  &GTPGWPMNCUUKIG8GTFKGPUVQTFGPYWTFGCO&G\GODGTXQP2T·UKFGPV;WCP5JKMCKIGUVKHVGV&KG)GUVCNVWPI FGT+PUKIPKGPKUVUGJTXQO1TFGPFGU$NCWGP&TCEJGPUDGKPHNW­V&CUGTUVG/QFGNNWPVGTUEJGKFGVUKEJXQO\YGKVGP FWTEJFCUHGKPGTG&GUKIPWPFFKGJÌJGTG3WCNKV·VFGT8GTCTDGKVWPIKPFGT%NQKUUQPP¾'OCKNNG2T·UKFGPV%JKCPI-CK 5JGMJCVFGP1TFGPYKGFGTCWHIGJQDGP

151


ELFENBEINKÜSTE

9605 9604 (1:1)



1TFGP XQO )GUVTGKHVGP 6KIGT =9¿P *W *UÒP %JCPI? &GMQTCVKQP  -NCUUG OKV GKPGO 5VGTP    &WTEJOGUUGTOO5KNDGTXGTIQNFGVWPFGOCKNNKGTV%JKRUOKP#DRNCV\WPIGPWPF'OCKNNGURTÒPIG KPFGT'OCKNNGFGU/GFCKNNQPUWPFFGT5VTCJNGPCWHFGT4ÒEMUGKVG*GTUVGNNGTDG\GKEJPWPIFGT(KTOC6KCP .K CWH FGO $CPFTKPI HTCP\ÌUKUEJG 'KPHWJTRWP\G XQP  DKU  5EJYCPGPRWP\G  CO CNVGP *CNU   DCPFCDUEJPKVV$9- ++p+++  )GUVKHVGVCO&G\GODGTXQP2T·UKFGPV;WCP5JKMCKCNUPGWPMNCUUKIGT1TFGPHÒTTGIWN·TGOKNKV·TKUEJG8GT FKGPUVGKP(TKGFGPUWPF-TKGIU\GKVGP2T·UKFGPV%JKCPI-CK5JGMJCVFGP1TFGPYKGFGTCWHIGJQDGP



%*+0'5+5%*'2418+0<'0

/GFCKNNGFGT0QTFRTQXKP\HÒT$GCOVGHÒT8GTFKGPUVGWOFKG)GYKPPWPIFGU8QNMGU\WT$GYGIWPI FGU0GWGP.GDGPU$TQP\GOKV4GUVXGTIQNFWPIGOCKNNKGTVCWHFGT4ÒEMUGKVGOKVGKPIGRT·IVGT/CVTK MGNPWOOGT  CO QTKIKPCNGP CNVGP $CPFG FCTKP GKPIGUVGEMV CNVGT $GUEJTGKDWPIU\GVVGN KP GPINKUEJGT   5RTCEJG 44++



&KG /GFCKNNG VCWEJV CWEJ KP FGT DGTÒJOVGP *CTT[ ' /QJNGT 5COONWPI CWH LGFQEJ CP GKPGO CPFGTGP UR·VGTGP   $CPFWPFQJPG$GUEJTGKDWPI

9606

4'27$.+-'.('0$'+0-ª56' 

0CVKQPCNQTFGP =1TFTG0CVKQPCN?)TQ­QHHK\KGTUUGVDGUVGJGPFCWU)TQ­QHHK\KGTUMTGW\5KNDGTXGTIQNFGV WPFGOCKNNKGTVOKP4GRCTCVWTGPKPFGTITÒPGP'OCKNNGKO$CPFTKPIHTCP\ÌUKUEJG*GTUVGNNGTRWP\GCO QTKIKPCNGP*CNUDCPFWPF$TWUVUVGTP5KNDGTVGKNYGKUGXGTIQNFGVWPFGOCKNNKGTV4GRCTCVWTGPKPFGTTQVGP 'OCKNNGOKP*CCTTKUUGKPFGTYGK­GP'OCKNNGCP0CFGNFKGUGOKVHTCP\ÌUKUEJGT*GTUVGNNGTRWP\GOKV \YGK5GKVGPJCMGPKOQTKIKPCNGP8GTNGKJWPIUGVWK4(5 ++p 'ZGORNCTFGT#WMVKQP(TKV\4WFQNH-ÒPMGT1UPCDTÒEM0T

152




GUINEA

9607



ex 9608

0CVKQPCNQTFGP=1TFTG0CVKQPCN?-QOOCPFGWTMTGW\5KNDGTXGTIQNFGVWPFGOCKNNKGTVOKP4GRCTCVWTGP KPFGTITÒPGP'OCKNNGKO$CPFTKPIHTCP\ÌUKUEJG*GTUVGNNGTRWP\GCOQTKIKPCNGP*CNUDCPFKOQTKIKPCNGP 8GTNGKJWPIUGVWKFGT(KTOC%JQDKNNQPKP2CTKU4(5 ++



'ZGORNCTFGT#WMVKQP(TKV\4WFQNH-ÒPMGT1UPCDTÒEM0T

)'14)+'0 #76101/'4'27$.+-#$'*#0+0 

.ÌYGP1TFGP 8GTUKNDGTV VGKNYGKUG XGTIQNFGV WPF GOCKNNKGTV CWH FGT 4ÒEMUGKVG /CVTKMGNPWOOGT    CP 5EJTCWDG OKV 5EJTCWDUEJGKDG FCTCWH *GTUVGNNGTDG\GKEJPWPI FGU /ÒP\JQHU KP /QUMCW &C\W /G   FCKNNGHÒT6CRHGTMGKVXGTIQNFGVCPXGTIQNFGVGTWPFGOCKNNKGTVGT6TCIGURCPIG 5VÒEM++



9609 (1:1)

)7+0'# 

0CVKQPCNQTFGP=1TFTG0CVKQPCN?)TQ­MTGW\UGVDGUVGJGPFCWU-NGKPQF5KNDGTXGTIQNFGVWPFGOCKNNKGTV KO $CPFTKPI *GTUVGNNGT WPF 5KNDGTRWP\G FGT (KTOC #TVJWU $GTVTCPF KP 2CTKU CO QTKIKPCNGP 5EJWNVGT   DCPFWPF$TWUVUVGTP5KNDGTVGKNYGKUGXGTIQNFGVWPFGOCKNNKGTV'OCKNNGCDRNCV\WPIKO/GFCKNNQPTKPICP 0CFGNFKGUGOKV*GTUVGNNGTWPF5KNDGTRWP\GFGT(KTOC#TVJWU$GTVTCPFKOQTKIKPCNGP'VWKFGT(KTOC #TVJWU$GTVTCPF4(5 5VÒEM++ 'ZGORNCTFGT5COONWPI6COOCPP#WMVKQP7$5$CUGN0T

 153


KAISERREICH JAPAN

9611

4'27$.+- 

9610

9612

*#+6+

0CVKQPCNGT1TFGPHÃ&#x2019;T'JTGWPF8GTFKGPUV=1TFTGPCVKQPCNF JQPPGWTGVFGO¾TKVG?$TWUVUVGTP\WO )TQ­MTGW\QFGT\WO)TQ­QHHK\KGT5KNDGTCP0CFGNOKV\YGK5GKVGPJCMGP1#0 ++



+PFKGUGTHTÃ&#x2019;JGPIWVGP#PHGTVKIWPIUSWCNKV·VXQPXQTFGO<YGKVGP9GNVMTKGIPKEJVJ·WHKI\WHKPFGP&GTUGEJUMNCU UKIG1TFGP )TQ­MTGW\OKVIQNFGPGO5VGTP)TQ­MTGW\)TQ­QHHK\KGT-QOOCPFGWT1HHK\KGTWPF4KVVGT YWTFGCO /CKXQP.QWKU$QTPQ  2T·UKFGPVXQP*CKVKIGUVKHVGVFKG1TFGPUUVCVWVGPGTNKG­2T·UKFGPV5V¾PKQ 8KPEGPV  CO,CPWCT

-#+5'44'+%*,#2#0 

1TFGP FGT #WHIGJGPFGP 5QPPG =-[QMWLKVUW UJQ?  WPF  /QFGNN &GMQTCVKQP  -NCUUG D\Y FGT   -NCUUGFGT5KNDGTPGP5VTCJNGP5KNDGTGOCKNNKGTVCOQTKIKPCNGP$CPFLCRCPKUEJGT0·JCTV26 +



'Z\GNNGPVGT'TJCNVWPIU\WUVCPF



1TFGP FGT #WHIGJGPFGP 5QPPG =-[QMWLKVUW UJQ?  WPF  /QFGNN &GMQTCVKQP  -NCUUG D\Y FGT   -NCUUG FGT 5KNDGTPGP 5VTCJNGP 5KNDGT GOCKNNKGTV OKP *CCTTKUUG KP FGT YGK­GP 'OCKNNG QJPG $CPF   26 ++

9613



9614



9615

1TFGPFGT)QNFGPGP9GKJG=-KPUJK-WPUJQ?&GMQTCVKQP-NCUUG5KNDGTGOCKNNKGTVCOQTKIKPCNGP $CPFLCRCPKUEJGT0·JCTV26 



'Z\GNNGPVGT'TJCNVWPIU\WUVCPF





1TFGP FGT )QNFGPGP9GKJG=-KPUJK-WPUJQ?&GMQTCVKQP-NCUUG5KNDGTXGTIQNFGVCOQTKIKPCNGP $CPF LCRCPKUEJGT 0·JCTV \WUCOOGP OKV -PQRHNQEJTQUGVVG KO QTKIKPCNGP DGUEJ·FKIVGP 8GTNGKJWPIUGVWK   26 +p++



8GTFKGPUVQTFGPFGU,CRCPKUEJGP4QVGP-TGW\GU8GTFKGPUVQTFGPKP)QNF5KNDGTXGTIQNFGVWPFGOCKN NKGTV CO QTKIKPCNGP $CPF LCRCPKUEJGT 0·JTV \WUCOOGP OKV #PUVGEMOKPKCVWT 5KNDGT XGTIQNFGV WPF   GOCKNNKGTV CP 0CFGN KO QTKIKPCNGP 8GTNGKJWPIUGVWK OKV IQNFHCTDGPGP LCRCPKUEJGP 5EJTKHV\GKEJGP 26   ++



'Z\GNNGPVGT'TJCNVWPIU\WUVCPF

154


KANADA

9616 (1:1)

,14&#0+'0 '/+4#664#05,14&#0+'0  70&*#5%*'/+6+5%*'5  -¤0+)4'+%*,14&#0+'0 5'+6  

7PCDJ·PIKIMGKVU1TFGP 0KUEJCPCN+UVKSNCN /QFGNN UGKV 5GVFGT-NCUUGDGUVGJGPFCWU -NGKPQF5KNDGTVGKNYGKUGXGTIQNFGVWPFGOCKNNKGTVCWHFGO4GXGTU*GTUVGNNGTRWP\GFGT(KTOC)CTTCTF %Q KP.QPFQP WPF,CJTGURWP\G0FGT5VCFV$KTOKPIJCOHÒTCOQTKIKPCNGP5EJWNVGTDCPFHÒT &COGP OODTGKV WPF$TWUVUVGTP5KNDGTVGKNYGKUGXGTIQNFGVWPFGOCKNNKGTVCWHFGO4GXGTUGDGP HCNNU*GTUVGNNGTRWP\GFGT(KTOC)CTTCTF%Q KP.QPFQP WPF,CJTGURWP\G0FGT5VCFV$KTOKPIJCO HÒTCP0CFGN1#081.2'5 5VÒEM4++ )GUVKHVGVCNUHÒPHMNCUUKIGTCNNIGOGKPGT8GTFKGPUVQTFGPXQP*WUUGKP$KP#NK5JGTKHGPXQP/GMMCWPF-ÌPKIFGU *GFUEJCU  /QFGNN  YWTFG GT XQO 'OKTCV 6TCPULQTFCPKGP WPF UEJNKG­NKEJKPGVYCUXGT·PFGTVGT)GUVCNVWPI XQO-ÌPKITGKEJ,QTFCPKGPÒDGTPQOOGP /QFGNN 



9617 (1:1)

-#0#&# 

'TKPPGTWPIUOGFCKNNGCPFKG2KNIGTHCJTV\WO-CPCFKUEJGP0CVKQPCNOQPWOGPV8KO[KP(TCPMTGKEJ )QNFGPG /GFCKNNG XGTIQNFGV CWH FGT 4ÒEMUGKVG *GTUVGNNGTDG\GKEJPWPI FGT (KTOC , 4 )CWPV QJPG   $CPF 4++

&CU -CPCFKUEJG 0CVKQPCNOQPWOGPV XQP 8KO[ KP FGT 0·JG XQP #TTCU KO PQTFHTCP\ÌUKUEJGP &¾RCTVGOGPV 2CUFG   %CNCKUYWTFG\YKUEJGPWPFCWHFGO)GN·PFGFGT5EJNCEJVXQP8KO[GTTKEJVGV&QTVYCTGP\YKUEJGPFGO WPF#RTKNEMCPCFKUEJG5QNFCVGPWPVGTFGO-QOOCPFQXQP)GPGTCN,WNKCP$[PI   UR·VGT(GNFOCTUEJCNN$[PIXKUEQWPV$[PIFG8KO[)%$)%/)/81XQPDKU)GPGTCNIQW XGTPGWTXQP-CPCFCCWHOKPFFGWVUEJG5QNFCVGPWPVGT)GPGTCN.WFYKI(TGKJGTTPXQP(CNMGPJCWUGP    IGVTQHHGP FKG PCJG\W XQNNMQOOGP CWHIGTKGDGP YWTFGP DGK EC  )GHCNNGPGP WPF  XGTYWPFGVGP   -CPCFKGTP



155


LAOS

9618

-1/14'0 (¤&'4#.' +5.#/+5%*' 4'27$.+- &'4 -1/14'0   $<9   70+10&'4-1/14'0 5'+6  

5WNVCPCV#PLQWCPCWHFGP-QOQTGP-ÌPKINKEJGT1TFGPFGU5VGTPUXQP#PLQWCP=1TFTGFGN 'VQKNG F #PLQWCP?/QFGNN TWPFG#WUHÒJTWPIXGT·PFGTVGCTCDKUEJG+PUEJTKHVFGT/QPFGOCKNNKGTV 4KVVGT FGMQTCVKQPXGTIQNFGVWPFVGKNYGKUGGOCKNNKGTVCO$CPF ++



'UFÒTHVGUKEJJKGTDGKWOGKPG#WUHÒJTWPIJCPFGNPFKGFGT5WNVCPXQP#PLQWCPUGKVFGT)TÒPFWPIFGT4GRWDNKMFGT -QOQTGPKO,CJTGCNU*CWUQTFGPXGTNGKJV

9620

ex 9619 9621

9622

-14'# &'/1-4#6+5%*'81.-54'27$.+- 014&  5'+6  



1TFGPFGT0CVKQPCNHNCIIG&GMQTCVKQP5VWHGHÒT+PN·PFGT#WUHÒJTWPIXGTUKNDGTVVGKNYGKUGXGT IQNFGV VGKNYGKUG GOCKNNKGTV CWH FGT 4ÒEMUGKVG /CVTKMGNPWOOGT  CP 0CFGN &C\W /KNKV·T   8GTFKGPUVOGFCKNNG/QFGNNXGTUKNDGTVCP$CPFURCPIG$1+ 5VÒEM++



1TFGP\WO,CJTGUVCIFGT)TÒPFWPIFGT&GOQMTCVKUEJGP8QNMUTGRWDNKM-QTGC$TQP\GXGTIQN FGVVGKNYGKUGGOCKNNKGTVCWHFGT4ÒEMUGKVG/CVTKMGNPWOOGTCP0CFGN$1+ ++



.#15 -¤0+)4'+%*706'4(4#0<¤5+5%*'/2416'-614#6   

1TFGPFGTGKPG/KNNKQP'NGRJCPVGPWPFFGU5QPPGPUEJKTOU&GMQTCVKQP-NCUUG 1HHK\KGT $TQP\G XGTIQNFGVWPFGOCKNNKGTVCO$CPFOKV4QUGVVG 4++





1TFGP FGT GKPG /KNNKQP 'NGRJCPVGP WPF FGU 5QPPGPUEJKTOU &GMQTCVKQP  -NCUUG 4KVVGT  ·NVGTG   #WUHÒJTWPI$TQP\GXGTIQNFGVWPFGOCKNNKGTVCO$CPF ++



156


MONGOLEI

9623

9625

9624



-TÌPWPIUOGFCKNNG-ÌPKI5CXCPI8CVVJCPCU5KNDGTPG/GFCKNNGXGTUKNDGTVQJPG$CPF

4++





-TÌPWPIUOGFCKNNG-ÌPKI5CXCPI8CVVJCPCU$TQP\GPG/GFCKNNG$TQP\GCO$CPF

4++





/GFCKNNGHÒT-·ORHGT$TQP\GXGTIQNFGVWPFVGKNYGKUGGOCKNNKGTVQJPG$CPF

++



9628

9626

9629

9627

-#+5'44'+%*/#0%*7-71 

1TFGP FGT 5·WNGP FGU 5VCCVGU -TGW\ FGT  DKU  -NCUUG 5KNDGT VGKNYGKUG GOCKNNKGTV QJPG $CPF   26 ++



/#41--1 (4#0<¤5+5%*'52416'-614#6 

#NCQWKVG %J¾TKHKGP1TFGP =1WKUUCO #NCQWKVG %J¾TKHKGP?  /QFGNN OKV 5EJTKHV\GKEJGP CWH FGP   5VTCJNGP    1HHK\KGTUFGMQTCVKQP 5KNDGT XGTIQNFGV WPF GOCKNNKGTV XGTUEJKGFGPG OKP #DRNCV   \WPIGPKPFGT'OCKNNGCO$CPFOKVCWHIGNGIVGT4QUGVVG ++p



/10)1.'+ /10)1.+5%*'81.-54'27$.+- 



1TFGPHÒT8GTFKGPUVGKO-CORH/QFGNN OKV+PUEJTKHVCWHTQVGO$CPF #WUHÒJTWPI

OKV\YGK0KGVGP 5KNDGTXGTIQNFGVVGKNYGKUGGOCKNNKGTVTÒEMUGKVKI6T·IGTPWOOGTCP 5EJTCWDGOKV5EJTCWDUEJGKDG$6#*(/5/11/ ++



%JCNEJKP)QN/GFCKNNG $TQP\G VGKNYGKUG XGTUKNDGTV WPF GOCKNNKGTV CP 5EJTCWDG OKV 5EJTCWDUEJGKDG   $6#*(/5/11/ ++

 157


PERSIEN / IRAN

2'45+'0+4#0

9630 (1:1)

-#+5'44'+%*2'45+'0 

8GTFKGPUVOGFCKNNG /KNKV·T8GTFKGPUVOGFCKNNG #WUICDG HÒT +PN·PFGT OKV UVGJGPFGO .ÌYGP  )TQ­G   )QNFGPG/GFCKNNGHÒT6CRHGTMGKVCWHFGT4ÒEMUGKVGFCVKGTV#* #& &WTEJOGUUGTOO )QNFI8QTFGTUGKVGGVYCUCDIGPWV\VIGJGPMGNVQJPG$CPF ++ 

9631 (1:1)



5QPPGP WPF .ÌYGP1TFGP =0KUEJCP K 5EJKT W -JWTUEJKF?  /QFGNN  <KXKNG#DVGK NWPI HÒT +PN·PFGT $TWUVUVGTP FGT  -NCUUG FGU  )TCFGU 0QW[CPG  RGTUKUEJG #PHGTVKIWPI 5KNDGT   DTKNNCPVKGTV VGKNYGKUG GOCKNNKGTV 'OCKNNGOCNGTGK FKGUG GVYCU HNGEMKI FGT (GFGTDWUEJ ÒDGT FGT -TQPG   UQYKGFKG5RKV\GFGU5VTCJNGUCWHFGT2QUKVKQPHGJNGPCP0CFGN 444+++ &KGUGT$TWUVUVGTPFGTGTUVGP-NCUUGFGUQDGTUVGP)TCFGUCNUQFGTJÌEJUVGP5VWHGKPUIGUCOVKPPGTJCNDFGTPQTOCNGP 4CPIHQNIG UKGJVOCPGKPOCNXQPFGPCW­GTJCNDFGT4CPIHQNIGUVGJGPFGPWPFGTUVGKPIGHÒJTVGP#IFCU)QFUG WPF /QWICFCU&GMQTCVKQPGP CD  KUV XQP CW­GTQTFGPVNKEJGT 5GNVGPJGKV WPF UGKPG $GFGWVWPI YKTF CWEJ FWTEJ FGP   HGJNGPFGP(GFGTDWUEJÒDGTFGT-TQPGPKEJVYGUGPVNKEJGKPIGUEJT·PMV&C­GUUKEJJKGTDGKYKTMNKEJWOGKPGP5VGTP FGT-NCUUGWPFPKEJVFGTQFGT-NCUUGJCPFGNVFKGMGKPGP(GFGTDWUEJÒDGTFGT-TQPGCWHYGKUGPKUVNGKEJVCP FGPFTGKWOFCU/GFCKNNQPIGNGIVGPDTKNNCPVKGTVGP4KPIGP\WGTMGPPGPXQPFGPGPFKGNGV\VGTGPPWT\YGKQFGTGKPGP CWHYGKUGP&KGUG-NCUUGFGU)TCFGUYWTFGNCWVFGPXQP/WNFGT KP/'25H XGTÌHHGPVNKEJVGP5VCVWVGPXQP  FKG CWEJ PCEJ FGT 'KPHÒJTWPI FGT 5VCVWVGP XQP  KP FKGUGT *KPUKEJV KJTG )ÒNVKIMGKV DGYCJTVGP PWT CP   )TQ­/CTUEJ·NNGWPFFKGXQTPGJOUVGP#FNKIGPFGU4GKEJUXGTNKGJGP

158




THAILAND

9632



9633

1TFGP &KG 5QPPG XQP 2GTW =1TFGP 'N 5QN FG 2GTÐ? UGKV   -NGKPQF \WO )TQ­MTGW\ D\Y   -QOOCPFGWTFGMQTCVKQP#WUHÒJTWPI OKVPKEJVGOCKNNKGTVGO.QTDGGTMTCP\WOFCU/KVVGNOGFCKNNQP  $TQP\G XGTIQNFGV .QTDGGTMTCP\ÒDGTJÌJWPI 5KNDGT XGTIQNFGV VGKNYGKUG GOCKNNKGTV CWH FGT 4ÒEMUGKVG   *GTUVGNNGTDG\GKEJPWPIFGT%CUC0CEKQPCNFG/QPGFC2CTGLCQJPG$CPF ++



2*+.+22+0'0 

'JTGP\GKEJGP)QNFGPGT2HNWIFGURJKNKRRKPKUEJGP2T·UKFGPVGPHÒT8GTFKGPUVGWOFKG.CPFTGHQTO $TQP\G XGTIQNFGV VGKNYGKUG XGTIQNFGV CWH FGT 4ÒEMUGKVG *GTUVGNNGTDG\GKEJPWPI FGT (KTOC 'N 1TQ   ,6WRC\,TCO*CNUDCPFCDUEJPKVV ++



9634 (1:1)

-¤0+)4'+%*6*#+.#0& $+55+#/  

&GT 5GJT 8QTPGJOG 1TFGP XQP %JWNC %JQO -NCQ &GMQTCVKQP  -NCUUG WPVGTGT )TCF -QOOCP   FGWT  #WUHÒJTWPI HÒT *GTTGP $TQP\G XGTIQNFGV WPF GOCKNNKGTV HGKPUVG 'OCKNNGOCNGTGK CO *CNDDCPF   \WUCOOGP OKV +PVGTKOURCPIG KO QTKIKPCNGP 8GTNGKJWPIUGVWK FGT -ÌPKINKEJGP /ÒP\G KP $CPIMQM OKV   CWHIGNGIVGOOGVCNNGPGP5VCCVUU[ODQN$.6 4+p++

 159


THAILAND

9636 (1:1)

9635



&GT5GJT8QTPGJOG1TFGPXQP%JWNC%JQO-NCQ&GMQTCVKQP-NCUUG5KNDGTVGKNYGKUGGOCKNNKGTV CO$CPF$.6 ++





&GT 5GJT *QJG 1TFGP FGU 9GK­GP 'NGRJCPVGP  /QFGNN   $TWUVUVGTP \WT  -NCUUG   &WTEJOGUUGT  OO 5KNDGT XGTIQNFGV WPF GOCKNNKGTV OGJTGTG MCWO UKEJVDCTG 'OCKNNGEJKRU KP FGP   /GFCKNNQPCWHNCIGPCP0CFGN$.6C/ ++



'ZGORNCTFGT#WMVKQP)CNGTKG5VWMGT$GTPWPFFGT5COONWPI6COOCPP#WMVKQP7$5$CUGN0T &GTWTURTÒPINKEJXKGTMNCUUKIG<KXKNWPF/KNKV·T8GTFKGPUVQTFGPYWTFGXQP-ÌPKI/QPIMWV 4COC+8  IGUVKHVGV9QJNYWTFGGTCWHHÒPH-NCUUGPGTYGKVGTVFKG)GUVCNVWPIUGKPGT+PUKIPKGPYGUGPVNKEJXGT·PFGTV WPFWOFKG)QNFGPGWPF5KNDGTPG/GFCKNNGCNUWPVGTUVG-NCUUGPGTYGKVGTVYWTFGFGT1TFGPTGQTICPKUKGTV CWHCEJV-NCUUGPGTYGKVGTVWPFFGP+PUKIPKGPKJTGLGV\KIG)GUVCNVWPIIGIGDGP

9637 (1:1)





160

9638 (1:1)

&GT5GJT*QJG1TFGPFGU9GK­GP'NGRJCPVGP/QFGNN  &GMQTCVKQP-NCUUG5KNDGT XGTIQNFGVWPFGOCKNNKGTV'OCKNNGOCNGTGKOKP'OCKNNGCDRNCV\WPIGPKO'NGRJCPVGPCOCNVGP&TGKGEMU DCPFOKVCWHIGNGIVGT4QUGVVG$.6C/ ++



&GT5GJT*QJG1TFGPFGU9GK­GP'NGRJCPVGP/QFGNN  &GMQTCVKQP-NCUUG5KNDGT XGTIQNFGV WPF GOCKNNKGTV 'OCKNNGOCNGTGK CO QTKIKPCNGP $CPF OKV CWHIGNGIVGT 4QUGVVG KO QTKIKPCNGP   TQVUCOVGPGP 8GTNGKJWPIUGVWK FGT (KTOC , 9 $GPUQP KP .QPFQP OKV IQNFHCTDGPGO MÌPKINKEJGP   9CRRGP$.6C/ ++




THAILAND

9639 (1:1)



&GT5GJT*QJG1TFGPFGU9GK­GP'NGRJCPVGP/QFGNN UGKV 5GVFGT5QPFGTUVWHGDGUVGJGPF CWU -NGKPQF 5KNDGT VGKNYGKUG XGTIQNFGV WPF GOCKNNKGTV CO QTKIKPCNGP 5EJWNVGTDCPF WPF $TWUVUVGTP   5KNDGT VGKNYGKUG DTKNNCPVKGTV WPF TGRGTEKGTV VGKNYGKUG XGTIQNFGV WPF GOCKNNKGTV CP 0CFGN FKGUG CWH FGT   +PPGPUGKVGOGJTHCEJRWP\KGTVWCOKVFGT<CJNKOTQVUCOVGPGP1TKIKPCNGVWKFGT5VCCVNKEJGP/Ã&#x2019;P\G KP$CPIMQMOKVCWHIGNGIVGOOGVCNNGPGP5VCCVUU[ODQN$.6P/ 5VÃ&#x2019;EM++

 161


THAILAND

9641

9640





9642

&GT5GJT*QJG1TFGPFGU9GK­GP'NGRJCPVGP/QFGNN UGKV 5GVFGT-NCUUGDGUVGJGPFCWU -NGKPQF 5KNDGT VGKNYGKUG XGTIQNFGV WPF GOCKNNKGTV CO QTKIKPCNGP 5EJWNVGTDCPF WPF $TWUVUVGTP 5KNDGT   VGKNYGKUGXGTIQNFGVWPFGOCKNNKGTVCP0CFGNFKGUGOKV*GTUVGNNGTDG\GKEJPWPIKOTQVUCOVGPGP1TKIKPC NGVWKFGUVJCKN·PFKUEJGP*GTUVGNNGTUOKVCWHIGNGIVGOOGVCNNGPGP5VCCVUU[ODQN$.6P/  5VÒEM++



&GT5GJT*QJG1TFGPFGU9GK­GP'NGRJCPVGP/QFGNN UGKV 5GVFGT-NCUUGDGUVGJGPFCWU -NGKPQF 5KNDGT VGKNYGKUG XGTIQNFGV WPF GOCKNNKGTV CO QTKIKPCN 5EJWNVGTDCPF WPF $TWUVUVGTP 5KNDGT   VGKNYGKUGXGTIQNFGVWPFGOCKNNKGTVCP0CFGN KPFGT$GHGUVKIWPIDGJGNHUO·­KITGRCTKGTV FKGUGOKV*GT UVGNNGTRWP\G\WUCOOGPOKV-PQRHNQEJTQUGVVGWPF+PVGTKOUURCPIGLGYGKNUOKV#WHNCIGKO1TKIKPCNGVWK GKPGUVJCKN·PFKUEJGP*GTUVGNNGTUOKVCWHIGNGIVGOOGVCNNGPGP5VCCVUU[ODQN$.6P/ 5VÒEM++



'ZGORNCTFGT#WMVKQP(TKV\4WFQNH-ÒPMGT1UPCDTÒEM0TFCOCNUCWUFGO0CEJNC­GKPGUUEJYG FKUEJGP&KRQOCVGP



162

&GT5GJT*QJG1TFGPFGU9GK­GP'NGRJCPVGP/QFGNN UGKV 5GVFGT-NCUUGDGUVGJGPFCWU -NGKPQF5KNDGTVGKNYGKUGXGTIQNFGVWPFGOCKNNKGTVOKP%JKRKO4ÒUUGNFGU'NGRJCPVGPCOQTKIKPCNGP 5EJWNVGTDCPFWPF$TWUVUVGTP5KNDGTVGKNYGKUGXGTIQNFGVWPFGOCKNNKGTVCP0CFGNFKGUGCWHFGT+PPGP UGKVGRWP\KGTV+KOTQVUCOVGPGP1TKIKPCNGVWKFGT-ÌPKINKEJGP/ÒP\GKP$CPIMQMOKVCWHIGNGIVGO OGVCNNGPGP5VCCVUU[ODQN$.6P/ 5VÒEM++




THAILAND

9643



&GT5GJT*QJG1TFGPFGU9GK­GP'NGRJCPVGP/QFGNN UGKV 5GVFGT-NCUUGDGUVGJGPFCWU *CNUFGMQTCVKQP 5KNDGT VGKNYGKUG XGTIQNFGV WPF GOCKNNKGTV CWH FGT 4ÒEMUGKVG FGT -TQPG *GTUVGNNGTDG   \GKEJPWPI OKV QTKIKPCNGO *CNUDCPF WPF $TWUVUVGTP 5KNDGT VGKNYGKUG XGTIQNFGV WPF GOCKNNKGTV CP   0CFGNFKGUGOKV*GTUVGNNGTDG\GKEJPWPIKOTQVUCOVGPGP1TKIKPCNGVWKFGUVJCKN·PFKUEJGP*GTUVGNNGTUOKV CWHIGNGIVGOOGVCNNGPGP5VCCVUU[ODQN$.6P/ 5VÒEM++



9644



&GT5GJT*QJG1TFGPFGU9GK­GP'NGRJCPVGP/QFGNN UGKV 5GVFGT-NCUUGDGUVGJGPFCWU *CNUFGMQTCVKQP 5KNDGT VGKNYGKUG XGTIQNFGV WPF GOCKNNKGTV CWH FGT 4ÒEMUGKVG FGT -TQPG *GTUVGNNGT   DG\GKEJPWPI OKV QTKIKPCNGO *CNUDCPF WPF $TWUVUVGTP 5KNDGT VGKNYGKUG XGTIQNFGV WPF GOCKNNKGTV CP   0CFGN DGKFG 5VÒEMG GVYCU CPIGNCWHGP KO TQVUCOVGPGP 1TKIKPCNGVWK FGU VJCKN·PFKUEJGP *GTUVGNNGTU OKV   CWHIGNGIVGOOGVCNNGPGP5VCCVUU[ODQN$.6P/ 5VÒEM++



9645



&GT5GJT*QJG1TFGPFGU9GK­GP'NGRJCPVGP/QFGNN UGKV 5GVFGT-NCUUGDGUVGJGPFCWU *CNUFGMQTCVKQP 5KNDGT VGKNYGKUG XGTIQNFGV WPF GOCKNNKGTV OKV QTKIKPCNGO *CNUDCPF WPF $TWUVUVGTP   5KNDGTVGKNYGKUGXGTIQNFGVWPFGOCKNNKGTVCP0CFGNFKGUGCWHFGT+PPGPUGKVGRWP\KGTV+KOTQVUCOVG PGP 1TKIKPCNGVWK FGT -ÌPKINKEJGP /ÒP\G KP $CPIMQM OKV CWHIGNGIVGOOGVCNNGPGP5VCCVUU[ODQN$.6 P/ 5VÒEM++

 163


THAILAND

9647

9646





&GT5GJT*QJG1TFGPFGU9GK­GP'NGRJCPVGP/QFGNN UGKV 5GVFGT-NCUUGDGUVGJGPFCWU *CNUFGMQTCVKQP 5KNDGT VGKNYGKUG XGTIQNFGV WPF GOCKNNKGTV CWH FGT 4Ã&#x2019;EMUGKVG FGT -TQPG *GTUVGNNGTDG   \GKEJPWPI OKV QTKIKPCNGO *CNUDCPF WPF $TWUVUVGTP 5KNDGT VGKNYGKUG XGTIQNFGV WPF GOCKNNKGTV CP   0CFGN FKGUG CWH FGT +PPGPUGKVG OKV *GTUVGNNGTDG\GKEJPWPI DGKFG 5VÃ&#x2019;EMG GVYCU CPIGNCWHGP KO   TQVUCOVGPGP 1TKIKPCNGVWK FGU VJCKN·PFKUEJGP *GTUVGNNGTU OKV CWHIGNGIVGO OGVCNNGPGP 5VCCVUU[ODQN   $.6P/ 5VÃ&#x2019;EM++



&GT5GJT*QJG1TFGPFGU9GK­GP'NGRJCPVGP/QFGNN UGKV 5GVFGT-NCUUGDGUVGJGPFCWU *CNUFGMQTCVKQP $TQP\G VGKNYGKUG XGTIQNFGV VGKNYGKUG XGTUKNDGTV VGKNYGKUG GOCKNNKGTV OKV QTKIKPCNGO   *CNUDCPFWPF$TWUVUVGTP5KNDGTVGKNYGKUGXGTIQNFGVVGKNYGKUGXGTUKNDGTVVGKNYGKUGGOCKNNKGTVCP0CFGN $.6P/ 5VÃ&#x2019;EM++



9648







 164

9649

9650

9651

&GT 5GJT *QJG 1TFGP FGU 9GK­GP 'NGRJCPVGP  /QFGNN UGKV   &GMQTCVKQP  -NCUUG 5KNDGT   VGKNYGKUGXGTIQNFGVWPFGOCKNNKGTVCWHFGT4Ã&#x2019;EMUGKVGFGT-TQPG*GTUVGNNGTDG\GKEJPWPICPIGNCWHGPOKV QTKIKPCNGO*CNUDCPF$.6P/ ++



&GT 5GJT *QJG 1TFGP FGU 9GK­GP 'NGRJCPVGP  /QFGNN UGKV   &GMQTCVKQP  -NCUUG 5KNDGT   VGKNYGKUGXGTIQNFGVWPFGOCKNNKGTVCWHFGT4Ã&#x2019;EMUGKVGFGUQDGTUVGP5VTCJNU*GTUVGNNGTDG\GKEJPWPIGVYCU CPIGNCWHGPOKVQTKIKPCNGO*CNUDCPF$.6P/ ++



&GT 5GJT *QJG 1TFGP FGU 9GK­GP 'NGRJCPVGP  /QFGNN UGKV   &GMQTCVKQP  -NCUUG 5KNDGT   VGKNYGKUGXGTIQNFGVWPFGOCKNNKGTVCNVG'OCKNNGCDRNCV\WPIGPKO'NGRJCPVGPCWHFGT4Ã&#x2019;EMUGKVGFGT-TQPG *GTUVGNNGTD\GKEJPWPICPIGNCWHGPCO*CNDDCPFFGU1TFGPUGTVJCKN·PFKUEJGP-TQPG$.6P/  ++p+++



&GT5GJT*QJG1TFGPFGU9GK­GP'NGRJCPVGP/QFGNN UGKV &GMQTCVKQP-NCUUG$TQP\G VGKNYGKUGXGTIQNFGVVGKNYGKUGXGTUKNDGTVVGKNYGKUGGOCKNNKGTVCO*CNUDCPFCDUEJPKVV$.6P/ ++




THAILAND

9656

ex 9655 9653

9652



&GT 5GJT *QJG 1TFGPFGU9GK­GP'NGRJCPVGP/QFGNN UGKV &GMQTCVKQP-NCUUG5KNDGT VGKNYGKUGXGTIQNFGVWPFGOCKNNKGTVCO$CPFOKVCWHIGNGIVGT4QUGVVG\WUCOOGPOKV-PQRHNQEJTQUGVVGKO QTKIKPCNGP 8GTNGKJWPIUGVWK GKPGU VJCKN·PFKUEJGP *GTUVGNNGTU OKV IQNFHCTDGPGO 5VCCVUU[ODQN <WUCOOGP   OKV QTKIKPCNGT #PPCJOGIGPGJOKIWPI FGU %JGHU FGU $WPFGURT·UKFKCNCOVU HÒT FGP 1DGTTGIKGTWPIUTCV KO   $WPFGURT·UKFKCNCOV*GNOWV/ÒNNGTFCVKGTV$QPPCO/CKWPF2JQVQMQRKGFGU8GT\GKEJPKUUGU XQP  \YKUEJGP  WPF  CP /ÒNNGT XGTNKGJGPGP 1TFGP OKV LGYGKNKIGO 8GTNGKJWPIULCJT   $.6P/ ++



'ZGORNCTFGT#WMVKQP(TKV\4WFQNH-ÒPMGT1UPCDTÒEM0T









&GT 5GJT *QJG 1TFGP FGU 9GK­GP 'NGRJCPVGP  /QFGNN UGKV   &GMQTCVKQP  -NCUUG 5KNDGT   VGKNYGKUGXGTIQNFGVWPFGOCKNNKGTVCWHFGT4ÒEMUGKVGFGT-TQPGVJCKN·PFKUEJG*GTUVGNNGTDG\GKEJPWPICO $CPFOKVCWHIGNGIVGT4QUGVVG$.6P/ ++



&GT5GJT*QJG1TFGPFGU9GK­GP'NGRJCPVGP/QFGNN UGKV &GMQTCVKQP-NCUUG'ZGO RNCTGLGYGKNU5KNDGTVGKNYGKUGXGTIQNFGVWPFGOCKNNKGTVFKGGKPGOKV'OCKNNGCDRNCV\WPIGPKO'NGRJCPVGP FKGGKPGCPFGT&COGPUEJNGKHGFKGCPFGTGCO$CPF$.6P/ ++



&GT5GJT*QJG1TFGPFGU9GK­GP'NGRJCPVGP/QFGNN UGKV &GMQTCVKQP-NCUUG)QNFGPG /GFCKNNG$TQP\GXGTIQNFGV4GUVXGTIQNFWPICO$CPF&GMQTCVKQP-NCUUG5KNDGTPG/GFCKNNG5KNDGT CP&COGPUEJNGKHG/GFCKNNG$TQP\GXGTUKNDGTVCO$CPF$.6P/ +++++



/GFCKNNG HÒT FGP *CY(GNF\WI 5KNDGT CO IGNDGP $CPF OKV YGK­GP 4CPFUVTGKHGP OKV FTGK )GHGEJVU   URCPIGP KO QTKIKPCNGP 8GTNGKJWPIUGVWK FGT /ÒP\G KP 2CTKU OKV CWHIGNGIVGO OGVCNNGPGP 5VCCVUU[ODQN   $.6 4++



9657 9658

9659



7PDGMCPPVG /GFCKNNG CWU FGT 4GIKGTWPIU\GKV -ÌPKI %JWNCNQPIMQTPU 4COC 8  5KNDGT OKV FTGK   )GHGEJVUURCPIGP ++



/GFCKNNGHÒT6GKNPGJOGTFGU<YGKVGP9GNVMTKGIU%W0KCO$CPFOKV6TCIGURCPIG$.6#

++





/GFCKNNGHÒT6GKNPGJOGTFGU-QTGC-TKGIU%W0KCO$CPFOKV6TCIGURCPIG$.6$

++





165


THAILAND

9662

9661

9663

9660



%JCMTC/CNC/GFCKNNGHÒTOKNKV·TKUEJGPVTGWGP&KGPUV5KNDGTVJCKN·PFKUEJG5EJTKHV\GKEJGPCWHDGKFGP 5GKVGPFGT$CPFTCJGCO$CPF$.6 ++





%JCMTC/CNC/GFCKNNGHÒTOKNK·TKUEJGPVTGWGP&KGPUV5KNDGTVJCKN·PFKUEJG5EJTKHV\GKEJGPCWHDGKFGP 5GKVGPFGT$CPFTCJGCO$CPF$.6 ++





&WUJK /CNC/GFCKNNG HÒT 8GTFKGPUVG -NGKPG /GFCKNNG KP 5KNDGT 5KNDGT QJPG $CPF KO QTKIKPCNGP   8GTNGKJWPIUGVWKFGT/ÒP\GKP2CTKUOKVCWHIGNGIVGOOGVCNNGPGP5VCCVUU[ODQN$.6$ 4++





&WUJK /CNC/GFCKNNG HÒT 8GTFKGPUVG )TQ­G /GFCKNNG KP $TQP\G $TQP\G QJPG $CPF KO QTKIKPCNGP   8GTNGKJWPIUGVWKFGT/ÒP\GKP2CTKUOKVCWHIGNGIVGOOGVCNNGPGP5VCCVUU[ODQN$.6% ++



9664

9666

9667

9669

9665



%JCMTCDCTVK/CNC/GFCKNNGHÒT\KXKNGPVTGWGP&KGPUV$TQP\GXGTUKNDGTVCO$CPF$.6

++





&KG)TGP\FKGPUV/GFCKNNG$TQP\GXGTIQNFGVCO$CPFOKV6TCIGURCPIG$.6

++





'TKPPGTWPIUOGFCKNNG\WO4GIKGTWPIULWDKN·WO-ÌPKI%JWNCNQPIMQTPU 4COC8 /GFCKNNG KP $TQP\G CP 6TCIGTCJG OKV XCTKCPVGO $CPF KO QTKIKPCNGP 'VWK FGT /ÒP\G KP 2CTKU HÒT GKPG -NGKPG   &WUJK/CNC/GFCKNNGHÒT8GTFKGPUVGOKVCWHIGNGIVGOOGVCNNGPGP5VCCVUU[ODQN$.6XCT ++



$NCUUHÒJTV KP$.60T PWTGKPGIQNFGPGWPFGKPGUKNDGTPG/GFCKNNGCWH



/GFCKNNG \WO 5KNDGTPGP 4GIKGTWPIULWDKN·WO -ÌPKI $JWOKDQNU #FWN[CFGL 4COC +:   #WU   HÒJTWPIHÒT*GTTGP5KNDGTCO$CPF$.6 ++





/GFCKNNG\WO5KNDGTPGP6JTQPLWDKN·WO-ÌPKI$JWOKDQNU#FWN[CFGL 4COC+: #WUHÒJTWPI HÒT&COGP5KNDGTCP&COGPUEJNGKHG$.6 ++





/GFCKNNG \WT +PXGUVKVWT 2TKP\ 8CLKTCNQPIMQTPU \WO -TQPRTKP\GP  #WUHÒJTWPI HÒT *GTTGP   5KNDGTCO$CPF$.6 ++





/GFCKNNG \WT +PXGUVKVWT 2TKP\ 8CLKTCNQPIMQTPU \WO -TQPRTKP\GP  #WUHÒJTWPI HÒT &COGP   5KNDGTCP&COGPUEJNGKHG$.6 ++



166


TÜRKEI

9671

9672

9674



/GFCKNNG \WT 'TPPGPWPI XQP 2TKP\GUUKP 5KTKPFJQTP \WT 2TKP\GUUKP /CJC %JCMTK #WUHÒJTWPI HÒT   *GTTGPXGTUKNDGTVCO$CPF ++





/GFCKNNG\WO)QNFGPGP6JTQPLWDKN·WO-ÌPKI$JWOKDQNU#FWN[CFGL 4COC+: #WUHÒJTWPI HÒT*GTTGPXGTIQNFGVCO$CPF ++





/GFCKNNG\WO)QNFGPGP6JTQPLWDKN·WO-ÌPKI$JWOKDQNU#FWN[CFGL 4COC+: #WUHÒJTWPI HÒT&COGPXGTIQNFGVCP&COGPUEJNGKHG ++





7PDGMCPPVG/GFCKNNGCWHGKPGPVJCKN·PFKUEJGP2TKP\GP$TQP\GQJPG$CPF



++

9675



)TQ­G1TFGPUUEJPCNNGGKPGUVJCKN·PFKUEJGP1HHK\KGTUOKVHÒPH#WU\GKEJPWPIGP 'NGRJCPVGP1TFGP /QFGNN UGKV &GMQTCVKQP-NCUUG5KNDGTVGKNYGKUGXGTIQNFGVWPFGOCKNNKGTVOKP%JKRUKPFGT 'OCKNNGFGU'NGRJCPVGPCWHFGT4ÒEMUGKVGFGT-TQPGVJCKN·PFKUEJG*GTUVGNNGTDG\GKEJPWPI (TGKJGKVU /GFCKNNG  -NCUUG $TQP\G   %JCMTC /CNC/GFCKNNG HÒT OKNKV·TKUEJG VTGWG &KGPUVG 5KNDGT   -TÌ   PWPIU/GFCKNNG -ÌPKI $JWOKRQNU 4COC +:   5KNDGT   /GFCKNNG \WO  ,CJTGUVCI FGT )TÒP   FWPI$CPIMQMU5KNDGTPG/GFCKNNG5KNDGTCWHFGT4ÒEMUGKVGGKP$GHGUVKIWPIUJCMGPGKPGTHGJNV  44++





-QPXQNWVXQPUKGDGPVJCKN·PFKUEJGP'JTGP\GKEJGP8GTUEJKGFGPG/GVCNNGCWEJ5KNDGTKPWPVGTUEJKGF NKEJGP'TJCNVWPIGPGKPGQJPG¤UGFTGKCP$·PFGTP 5VÒEM++++++8





$WEJ ÒDGT FCU VJCKN·PFKUEJG #WU\GKEJPWPIUU[UVGO FGT -ÌPKINKEJGP 1TFGPUMCP\NGK KP $CPIMQM   $CPIMQM+PVJCKN·PFKUEJGT5RTCEJGOKVGPINKUEJGPªDGTUEJTKHVGP5GKVGPTGKEJKP(CTDGKNNW UVTKGTVIGDWPFGP&C\W'TPUV$NCUU&KG1TFGPWPF'JTGP\GKEJGPXQP6JCKNCPF*CODWTIQJPG,CJT +PFGWVUEJGT5RTCEJG5GKVGPTGKEJKPUYKNNWUVTKGTVMCTVQPKGTV 5VÒEM4++



9678

6ª4-'+ 15/#0+5%*'54'+%* $+5  

1UOCPKUEJG -TKGIUOGFCKNNG UQIGP 'KUGTPGT *CNDOQPF QFGT )CNNKRQNK5VCT 1UOCPKUEJG #PHGTVK   IWPICWHFGT4ÒEMUGKVGQUOCPKUEJGT*GTUVGNNGTUVGORGNXGTUKNDGTVWPFGOCKNNKGTVCP0CFGN ++

 167


TUNESIEN

9680 (1:1) 9679 (1:1)

9679 (1:1)

670'5+'0 4')'065%*#(6670+5 706'4'+0'/$';ņ ņ810$+5  (4#0<¤5+5%*'52416'-614#6 

1TFGPFGU4WJOU=0KUEJCP+HVKMJCT?/QFGNN#WUHÒJTWPI OKV/QPQITCOOXQP#EJOGF+$G[ =‫ دمحأ‬- #JOCF?    &GMQTCVKQP FGT  -NCUUG FGU  )TCFGU D\Y FGT-NCUUGVWPGUKUEJG #PHGTVKIWPIZOO5KNDGT)QNFVGKNYGKUG\KUGNKGTVDGUGV\VOKV&KCOCPV4QUGP IGRTÒHV  FTGKHGJNGPCWHFGT4ÒEMUGKVGUR·VGTLGFQEJCNVCPIGDTCEJVG$TQUEJKGTWPIQJPG$CPF 44++



)GUEJCHHGPCFJQEPCEJFGO8QTDKNFFGU1UOCPKUEJGP1TFGPUFGU4WJOU=0KUCPK+HVKJCT?XGTICD#DW#NPCMWDC /WUVCHC CN *WUUCKPK 2CUEJC $G[    $G[ WPF +PJCDGT FGT 4GIGPVUEJCHV KP 6WPKU KO ,CJT  CP   UGKPGPCW­GPRQNKVKUEJGP$GTCVGT)KWUGRRG%QPVG4CHHQ  GKPGCNU1TFGPFGU4WJOU=0KUEJCPCN+HVKM JCT?DG\GKEJPGVG#WU\GKEJPWPICNU<GKEJGPUGKPGTDGUQPFGTGP9GTVUEJ·V\WPIHÒTFKGKJOWPFUGKPGT(COKNKGIGNGK UVGVGP DGUQPFGTGP 8GTFKGPUVG #WHITWPF GKPGU UGJT FGVCKNNKGTV CWUIGHÒJTVGP )GO·NFG FGU )TCHGP CWH FGO GT CNNG   UGKPG#WU\GKEJPWPIGPVT·IVKUVOCPUGJTIGPCWÒDGTFCU#WUUGJGPFKGUGT&GMQTCVKQPKPHQTOKGTVFKGQHHGPUKEJVNKEJ MGKPYGKVGTGUOCNXGTIGDGPYQTFGPKUV /QFGNN 8GTCPNC­VFWTEJUGKPGPRGTUÌPNKEJGP#FLWVCPVGPFGOCWUFGO -ÌPKITGKEJ 2KGOQPV5CTFKPKGP UVCOOGPFGP 1DGTUV .QWKU %CNNKICTKU   PCJO #DW #DDCU #EJOGF + CN   *WUUCKPK2CUEJC$G[  0CEJHQNIGTXQP/WUVCHC+$G[FGP)GFCPMGPCWHGKPGGKIGPG#WU\GKEJPWPI\W UEJCHHGPXGTYKTMNKEJVGFKG8QTUEJN·IGUGKPGU#FLWVCPVGPWPFUVKHVGVGGKPG\WP·EJUVXKGTUVWHKIG#WU\GKEJPWPI WPVGT FGT $G\GKEJPWPI 0KUEJCP CN +HVKMJCT YQ\W %CNNKICTKU CWEJ FCU 4GINGOGPV XGTHCUUVG  /QFGNN  +P FGT   )GUVCNVWPINGJPVGPUKEJFKGPGWGP+PUKIPKGPFGUWPF)TCFGUGPICPFKG&GMQTCVKQPFGU/QFGNNUCP\GKIVGP CNNGTFKPIUUVCVVFGT0COGPUEJKHHTGFGT&[PCUVKGPWPOGJTFKG0COGPUEJKHHTGFGUTGIKGTGPFGP$G[U#JOGF+(ÒTFKG &GMQTCVKQPGPFGU)TCFGUYWTFGGKPGLGYGKNUUGJTRTWPMXQNNG)GUVCNVWPIKP(QTOGKPGT5VGEMFGMQTCVKQPXGTYKTM NKEJV /QFGNN 



1TFGPFGU4WJOU=0KUEJCP+HVKMJCT?/QFGNN#WUHÒJTWPI OKV/QPQITCOOXQP/QJCOOGF8 CN0CUKT$G[==‫ رصانلا دمحم‬/WJCOOCFCN0CUKT? -NGKPQF\WO)TQ­MTGW\KP$TKNNCPVGP HTCP\ÌUKUEJG#PHGTVKIWPI5KNDGTVGKNYGKUGGOCKNNKGTVDGUGV\VOKVÒDGT5KOKNKUVGKPGP FTGKHGJNGPKP FGT5EJNGKHGFGTªDGTJÌJWPI QJPG5EJWNVGTDCPF 44++ UCJUKEJ#DW#DFWNNCJ/QJCOOGF++CN*WUUCKPK2CUEJC$G[  0CEJHQNIGTXQP#EJOGF+$G[ IG\YWPIGP CWHITWPF FGT GZVTGO JQJGP -QUVGP HÒT FKG *GTUVGNNWPI FGT +PUKIPKGP KP GEJVGP 5VGKPGP FGP1TFGP\W TGQTICPKUKGTGPWPFFKG)GUVCNVWPIFGT&GMQTCVKQPGPYGUGPVNKEJ\WXGT·PFGTP'TDGCWHVTCIVGJKGT\W5K/QJCOOGF )CTCFGP&KTGMVQTFGTVWPGUKUEJGP/ÒP\GKP.G$CTFQFGTFKGPGWGP+PUKIPKGPGPVYCTHWPFFGTGPPGWG)GUVCNVWPI CWEJFKG<WUVKOOWPIXQP/QJCOOGF++$G[HCPFGP&KGPGWGP+PUKIPKGPFGU1TFGPUYWTFGPKPDTKNNCPVKGTVGOWPF VGKNU TGRGTEKGTVGO 5KNDGT WPF VNY GOCKNNKGTV CWUIGHÒJTV  /QFGNN  /QJCOGF GU 5CFQM   $G[ XQP   6WPKUICDFGP+PUKIPKGPOKV&GMTGVXQO(GDTWCT/·T\GKPGPGWG)GUVCNVWPIWPFGTYGKVGTVGKJPCWHPWPOGJT UGEJU-NCUUGP )TQ­MQTFQPDKU-NCUUG /KVFGT#DUGV\WPIFGUNGV\VGP$G[U/QJCOGF'N#OKPFWTEJ 2T·UKFGPV$QWTIWKDCJÌTVGFGT1TFGPCWH\WDGUVGJGP#WHITWPFFGT\YGK/QFGNNGOKVUKGDGPXGTUEJKGFGPGP#WUHÒJ TWPIGPFGU/QFGNNUKP\WFGOLGYGKNU\CJNTGKEJGP8CTKCPVGPIGJÌTVFKGUGT1TFGP\WFGPXKGNUGKVKIUVGPWPFKPVGTGU UCPVGUVGPÒDGTJCWRV

168




USA

9681

$1.+8#4+5%*'4'27$.+-8'0'<7'.# 

-TGW\ FGT <WUCOOGPCTDGKV FGT $GYCHHPGVGP -T·HVG (#%  0CVKQPCNICTFG  =%TW\ FG NCU (WGT\CU   #TOCFCU FG %QQRGTCEKÉP? -TGW\  -NCUUG XGTIQNFGV WPF GOCKNNKGTV CO *CNUDCPF \WUCOOGP OKV   /KPKCVWT CO $·PFEJGP OKV CWHIGNGIVGO 1TFGPUMTGW\ 7PKHQTO$CPFURCPIG OKV CWHIGNGIVGO 1TFGPU   MTGW\WPF-PQRHNQEJTQUGVVGKOQTKIKPCNGPIQNFHCTDGPDGFTWEMVGP8GTNGKJWPIUGVWKFGT&KUVKPVKXQU8GPG \WGNCPQU (CDTKECPVGU \WUCOOGP OKV QTKIKPCNGT 8GTNGKJWPIUWTMWPFG HÒT $TKICFGIGPGTCN #TVJWT /CUEC   TGPJCU(CECPJCFCVKGTV%CTCECUCO,WPKOKV\YGK2T·IGUKGIGNPWPF1TKIKPCNWPVGTUEJTKHVGPFGU 5VCCVURT·UKFGPVGP XQPDKUWPFXQPDKU 4CHCGN%CNFGTC4QFTÃIWG\  WPF FGU8GTVGKFKIWPIUOKPKUVGTU/)CTEÃC 44++



+PFGT-NCUUGOKV1TKIKPCNWTMWPFGXQPCNNGTITÌ­VGT5GNVGPJGKV&GTFTGKMNCUUKIG1TFGPYWTFGIGUVKHVGV &GT DTCUKNKCPKUEJG $TKICFGIGPGTCN #TVJWT /CUECTGPJCU (C¼CPJC IGD   YCT 2T·UKFGPV FGTDTCUKNKCPKUEJGP0C VKQPCNGP-QOOKUUKQPHÒT0WMNGCT'PGTIKG %0'% 

9682 (1:1)

9683

9683

8'4'+0+)6'56##6'0810#/'4+-# 75#  

/GFCKNNG HÒT CWUIG\GKEJPGVGP &KGPUV =&KUVKPIWKUJGF 5GTXKEG /GFCN? #WUHÒJTWPI KP )QNF   )QNF   GOCKNNKGTVI$CPFTCJGCDIGDTQEJGPWPFXGTNQTGPQJPG$CPF 444+++8



+PGEJV)QNFXQPCNNGTITÌ­VGT5GNVGPJGKVVTQV\FGTHGJNGPFGP$CPFTCJG



(TKGFGPUOGFCKNNG FGU COGTKMCPKUEJGP 2T·UKFGPVGP /CTVKP 8CP $WTGP HÒT *·WRVNKPIG XQP +PFKC   PGTUV·OOGP&CVKGTV&WTEJOGUUGTOO$TQP\GIGUEJY·T\VOKV5VGORGNUEJPGKFGTUKIPCVWT (7456(IGNQEJVOGJTGTG4CPFFGNNGPWPF-TCV\GTCP6TCIGUEJPWT ++



'ZGORNCTFGT#WMVKQP(TKV\4WFQNH-ÒPMGT1UPCDTÒEM0T/CTVKPXCP$WTGP  TGIKGTVG FKG8GTGKPKIVGP5VCCVGPXQP#OGTKMCCNUFGTGP2T·UKFGPVXQPDKU

169


ANNAM / VIETNAM

9684





#WU\GKEJPWPI FGT +PVGTPCVKQPCNGP -CNKHQTPKUEJGP /KVVYKPVGT#WUUVGNNWPI KP 5CP (TCPEKUEQ     5KNDGTPGU'JTGP\GKEJGP5KNDGTCWHFGT4ÒEMUGKVG*GTUVGNNGTDG\GKEJPWPIFGT(KTOC%)$TCZOCTKP 0GY;QTMCO*CNUDCPFKODGUEJ·FKIVGP'VWKKOIQNFHCTDGPGT#WHUEJTKHV $TQP\GPGU'JTGP\GKEJGP CO$TWUVDCPFOKV6TCIGURCPIG 5VÒEM++



-QPXQNWV XQP UGEJU OKNKV·TKUEJGP #WU\GKEJPWPIGP &CTWPVGT $TQP\G 5VCT LGYGKNU CP $·PFGTP FTGK   \WUCOOGPOKV+PVGTKOURCPIGPWPF4GXGTUCD\GKEJGPKP'VWKU 5VÒEM++



9686

#00#/8+'60#/ '456'  70&<9'+6'  4'27$.+- 5ª& 8+'60#/ 

0CVKQPCN1TFGP=$CQ3WQ*WCP%JWQPI?$TWUVUVGTP\WO)TQ­QHHK\KGTQFGT\WT-NCUUGXKGVPCOG UKUEJG#PHGTVKIWPIFGTGTQFGTGT,CJTG&WTEJOGUUGTOOVGKNYGKUGXGTIQNFGVVGKNYGKUG XGTUKNDGTVCP0CFGNOKV5GKVGPJCMGP1082'5 ++ )GTCFGKPFGPJÌJGTGP-NCUUGPXQPITQ­GT5GNVGPJGKV'PVIGIGPFGT#WUUCIGPGKPKIGT#WVQTGPYWTFGFGT$TWUVUVGTP FKGUGT -NCUUG FGT KP )TÌ­G WPF #WUUGJGP FGO $TWUVUVGTP \WO )TQ­MTGW\ GPVURTKEJV UVGVU CNNGKPG QJPG YGKVGTG   +PUKIKPKGP YKG *CNU QFGT $TWUVFGMQTCVKQP XGTNKGJGP WPF CWH FGT TGEJVGP $TWUVUGKVG IGVTCIGP  &GT HÒPHMNCUUKIG   CNNIGOGKPG 8GTFKGPUVQTFGP YWTFG XQP $CQ &CK   FGO 5VCCVUEJGH FGU 5VCCVGU 8KGVPCO XQTOCNU FGT   NGV\VGO -CKUGT XQP #PPCO WPF 8KGVPCO OKV 1TFQPCP\ 0T TQC WPF &GMTGV 0T C36 XQO  #WIWUV    IGUVKHVGV WPF PCEJ FGT 2TQMNCOVKQP FGT 4GRWDNKM 5ÒF 8KGVPCO CO  1MVQDGT  FWTEJ 2T·UKFGPV 0IQ &KPJ   &KGO XQP FKGUGT ÒDGTPQOOGP 0CEJ FGT 8GTGKPKIWPI 5ÒF8KGVPCOU OKV FGT &GOQMTCVKUEJGP 4GRWDNKM 0QTF    8KGVPCOCO,WNK\WT5Q\KCNKUVKUEJGP4GRWDNKM8KGVPCOYWTFGFGT1TFGPCDIGUEJCHHV

170




URKUNDEN, DOKUMENTE, STATUTEN

9687 (1:1)

/+0+#674'05%*0#..'070&-'66%*'0+06'40#6+10#. 

/KPKCVWTGPMGVVEJGP OKV XKGT 1TFGPUOKPKCVWTGP   (TCPMTGKEJ 1TFGP HÒT -QODCVVCPVGP8GTFKGPUV   1TFGPUMTGW\   /CNC[UKC 1TFGP FGT 8GTVGKFKIGT FGU -ÌPKITGKEJU 1TFGPUFGMQTCVKQP   6WPGUKGP   1TFGPFGT4GRWDNKM/QFGNN UGKV 1TFGPUFGMQTCVKQP )WCVGOCNC3WGV\CN1TFGP-QOOCP FGWTFGMQTCVKQPCP-GVVEJGPOKV0CFGNP 5VÒEM++



74-70&'0&1-7/'06'56#676'0 +O(QNIGPFGPIGNCPIGP8GTNGKJWPIUWTMWPFGP\W1TFGPWPF'JTGP\GKEJGPCWU&GWVUEJNCPF'WTQRCWPFFGTICP\GP 9GNV\WO#WHTWHVGKNUOKV#WVQITCRJGPDGFGWVGPFGT2GTUÌPNKEJMGKVGPFGT)GUEJKEJVGQFGTCPFKGUGIGTKEJVGV&KG CNNGTOGKUVGP &QMWOGPVG FKG UKEJ XQTYKGIGPF KP GKPGO QTFGPVNKEJGP <WUVCPF DGHKPFGP MÌPPGP FGPPQEJ GKP QFGT   OGJTHCEJ IGHCNVGV UGKP MNGKPG 'KPTKUUG JCDGPQFGTGVYCUUVQEMHNGEMKIUGKP&KGUGCNVGTUDGFKPIVGP)GDTCWEJUURWTGP YGTFGPUQHGTPUKGPKEJVFCUPQTOCNGWPF\WOWVDCTG/C­FGWVNKEJÒDGTUUVGKIGPKPFGT$GUEJTGKDWPIFGTLGYGKNKIGP &QMWOGPVGPKEJVIGUQPFGTVGTY·JPVFKGUG'TJCNVWPIOKVFGO<WUVCPF++MCVGIQTKUKGTVNVGTGCWUN·PFKUEJG7TMWP FGP MÌPPGP \WFGO GVYCU DGUEJPKVVGP UGKP YCU YKT LGFQEJ CWHITWPF HGJNGPFGT 8GTINGKEJUOÌINKEJMGKVGP PKEJV HGUV   UVGNNGPMÌPPGP$KVVGJCDGP5KG8GTUV·PFPKUFCHÒTFC­YKTWPUNGKFGTIGPGTGNNPKEJVKPFGT.CIGUGJGP&QMWOGPVG PCEJ 9WPUEJ \W HQVQMQRKGTGP QFGT GKP\WUECPPGP WPF +JPGP FKGUG -QRKGP QFGT &CVGP \WMQOOGP \W NCUUGP FC   FGTGP (QTOCV OGKUV FCU (CUUWPIUXGTOÌIGP PQTOCNGT -QRKGTGT WPF 5ECPPGT ÒDGTUVGKIV 9KT YGKUGPCWEJCPFKGUGT 5VGNNG PQEJ GKPOCN CWUFTÒEMNKEJ CWH FKG IGIGDGPGP WOHCPITGKEJGP /ÌINKEJMGKVGP \WT 8QTDGUKEJVKIWPI FGT &QMW   OGPVGKO8QTHGNFFGT#WMVKQPJKP

&'765%*'56##6'0 #0*#.6+5%*'(ª456'06ª/'4)'/'+05#/ $+5 70&  *'4<1)67/#0*#.6   

*GT\QINKEJ #PJCNVKUEJGT *CWUQTFGP #NDTGEJV FGU $·TGP 1TFGPUUVCVWVGP KP FGT (CUUWPI XQO   #WIWUV5GKVGPIGNQEJVFQRRGNVIGHCNVGVGVYCUGKPIGTKUUGP ++p





)TQ­JGT\QINKEJGT 1TFGP XQO <·JTKPIGT .ÌYGP 1TFGPUUVCVWVGP KP FGT (CUUWPI XQP   5GKVGP   WPFGKPG$KNFVCHGNMCTVQPKGTVIGMPKEMV ++p



$#;'40-74(ª456'067/ $+5 70&-¤0+)4'+%*   



7TMWPFGPITWRRG FGU .GWVPCPVU (TCP\ 5VKGINGT XQO  $C[GTKUEJGP (W­CTVKNNGTKG4GIKOGPV     2CVGPV \WO (·JPTKEJ &QRRGNDNCVV 2T·IGUKGIGN   2CVGPV \WO .GWVPCPV &QRRGNDNCVV 2T·IGUKGIGN    8GTNGKJWPIUWTMWPFG\WO/KNKV·T8GTFKGPUVQTFGP-NCUUGOKV5EJYGTVGTP&QRRGNDNCVVFCVKGTV,WNK 7PVGTUEJTKHV 8GTNGKJWPIUWTMWPFG\WO'KUGTPGP-TGW\+-NCUUGFCVKGTV/ÒPEJGP,WPK 5VGORGN 1TKIKPCNWPVGTUEJTKHV )GPGTCNNGWVPCPV   8GTNGKJWPIUWTMWPFG \WO 'KUGTPGP -TGW\ + -NCUUG  

UKE  FCVKGTV  ,WPK  5VGORGN 1TKIKPCNWPVGTUEJTKHV /CLQT   8GTNGKJWPIUWTMWPFG \WO 'JTGP   MTGW\ FGU 9GNVMTKGIGU HÒT(TQPVM·ORHGTFCVKGTV/ÒPEJGP&G\GODGT7PVGTUEJTKHV -TKGIU 4CPINKUVG5GKVGPOKV\CJNTGKEJGP'KPVTCIWPIGP,GYGKNUGKPQFGT\YGKOCNIGHCNVGV 5VÒEM++



-ÌPKINKEJ $C[GTKUEJGT /KNKV·T8GTFKGPUVQTFGP 1TFGPUUCV\WPI KP FGT (CUUWPI XQP   5GKVGP   OGJTHCEJIGHCNVGVGVYCUGKPIGTKUUGP ++p+++

 171


URKUNDEN, DOKUMENTE, STATUTEN

$4#705%*9'+)*'4<1)67/ $+5  

*GT\QINKEJGT$TCWPUEJYGKIKUEJGT1TFGP*GKPTKEJFGU.ÌYGP.CPFGUJGTTNKEJGU2CVGPVKPFGT(CUUWPI XQPOKVFGP0CEJVT·IGPDKUGKPUEJNKG­NKEJ5GKVGPWPF$KNFVCHGNPMCTVQPKGTVIGMPKEMV  ++





*CPUGCVGPMTGW\8GTNGKJWPIUWTMWPFGHÒT&T,QUGRJ)KNNGV)GPGTCNQDGTCT\VWPF-QTRUCT\VDGKO )GPGTCNMQOOCPFQFGU:8++#TOGGMQTRUFCVKGTV*CODWTICO,CPWCTOGJTHCEJIGHCNVGV ++





8GTFKGPUVQTFGP 2JKNKRRU FGU )TQ­OÒVJKIGP ªDGTUGPFWPIUUEJTGKDGP HÒT FGP MCKUGTNKEJ TWUUKUEJGP   )GPGTCNOCLQT'OKN2TKP\XQP5C[P9KVVIGPUVGKP$GTNGDWTI\WT8GTNGKJWPIUWTMWPFGHÒTFCUKJOXGTNKG JGPG)TQ­MTGW\PGDUV5VCVWVGP&QRRGNDNCVVFCVKGTV&CTOUVCFVCO0QXGODGTOKV1TKIKPCNWP VGTUEJTKHVFGU1TFGPUMCP\NGTUGKPOCNIGHCNVGV ++



'ZGORNCT CWU FGO $GUKV\ FGU UR·VGTGP TWUUKUEJGP )GPGTCNCFLWVCPVGP 'OKN 2TKP\ \W 5C[P9KVVIGPUVGKP$GTNGDWTI   5GKPG1TFGPCWHIGVGKNVKP\YCP\KIGKP\GNPGP#WMVKQPURQUKVKQPGPYWTFGPCO,WPKKP(TCPMHWTVCO/CKP\W KPUIGUCOV  RNWU #WHIGNF CP XGTUEJKGFGPG +PVGTGUUGPVGP \WIGUEJNCIGP 'OKN -CTN #FQNH 2TKP\ \W 5C[P  9KVVIGPUVGKP$GTNGDWTI &WTEJNCWEJV YWTFG CO  #RTKN  CNU GTUVGT 5QJP FGU ITQ­JGT\QINKEJ JGUUKUEJGP   1DGTUVGP#WIWUV.WFYKI2TKP\\W5C[P9KVVIGPUVGKP$GTNGDWTI  WPFFGUUGP)GOCJNKP(TCP\KUMC    KP &CTOUVCFV IGDQTGP  KO #NVGT XQP  ,CJTGP VTCV GT CNU .GWVPCPV KP FCU ITQ­JGT\QINKEJ JGUUKUEJG   )CTFG%JGXCWNGIGT4GIKOGPV GKP  YWTFG GT \WO 1DGTNGWVPCPV  \WO 4KVVOGKUVGT WPF \WO   (NÒIGNCFLWVCPVGP FGU )TQ­JGT\QIU WPF  \WO /CLQT DGHÌTFGTV +O INGKEJGP ,CJT PCJO GT CNU $GINGKVGT XQP   #NGZCPFGT 2TKP\ XQP *GUUGP   CO -CWMCUWU(GNF\WI WPVGT FGO TWUUKUEJGP 8K\GMÌPKI (ÒTUV /KEJCKN   5GOLQPQYKVUEJ9QTQP\QY  VGKNWPFHQEJVKPFGT5EJNCEJVXQP&CTIQIGIGP+OCO5EJCO[N   PCJOGTWPVGTFGO-QOOCPFQFGURTGW­KUEJGP)GPGTCNU(TKGFTKEJ(TGKJGTTPXQP9TCPIGN 2CRC9TCPIGN   CO 5EJNGUYKI*QNUVGKPKUEJGP -TKGI VGKN #WHITWPF UGKPGT FGWVNKEJ MQPUGTXCVKXGP )GUKPPWPI  CWU   FGOJGUUKUEJGP*GGTGPVNCUUGPVTCVGTKO,CPWCTCNU*CWRVOCPPKPTWUUKUEJG&KGPUVGGKP+O&G\GODGTFGU INGKEJGP ,CJTGU YWTFG GT YKGFGT \WO /CLQT WPF \WO #FLWVCPVGP FGU TWUUKUEJGP 8K\GMÌPKIU KO -CWMCUWU (ÒTUV   9QTQP\QYGTPCPPV'TPCJOKPFGT(QNIG\GKVWPVGT)GPGTCN(ÒTUV#NGZCPFGT$CT[CVKPUMK  CPOGJTGTGP (GNF\ÒIGP KO -CWMCUWU VGKN WPF YWTFG  \WO 1DGTUV  4CPIGU 1DGTUVNGWVPCPV  DGHÌTFGTV 0QEJ KO INGKEJGP   ,CJT DGTKGH KJP <CT 0KMQNCWU + 2CYNQYKVUEJ   \WO (NÒIGNCFLWVCPVGP 9·JTGPF FGU -TKOMTKGIGU      FKGPVG GT \WP·EJUV CNU +PURGMVQT FGT (GNFNC\CTGVVG YWTFG CDGT DCNF YKGFGT KP FGP -CWMCUWU WPVGT FCU   1DGTMQOOCPFQ XQP )GPGTCN /QWTCYKGHH GPVUCPFV YQ GT KO &G\GODGT  \WO 6TWRRGPMQOOCPFGWT GKPGU   -QUCMGP4GIKOGPVU GTPCPPV YWTFG 0CEJ FGO 6QF <CT 0KMQNCWU + CO  (GDTWCT  YWTFG GT \WUCOOGPCNU #FLWVCPVFGU<CTGPOKV7MCUXQPFGUUGP0CEJHQNIGT#NGZCPFGT++  DGUV·VKIV+O/·T\GTHQNIVGFKG $GHÌTFGTWPI \WO 1DGTUVGP  -NCUUG #NU 6GKNPGJOGT DGK FGP (TKGFGPUXGTJCPFNWPIGP KP 2CTKU KO/·T\FKG \WO&TKVVGP2CTKUGT(TKGFGPXQPHÒJTVGPNGTPVGGTFKGCWUFGOTWO·PKUEJOQNFCYKUEJGP*QEJCFGNUVCOOGPFG 2TKP\GUUKP 2WNEJGTKC %CPVCEW\KPQ 2CUECPW   FKG GT UEJQP CO  ,WPK  KP 9KGUDCFGP JGKTCVGVG   <YKUEJGPWPFPCJOGTCPOGJTGTGP(GNF\ÒIGPKO-CWMCUWUVGKNWPFXQPDKUFKGPVGGTWPVGT FGO1DGTMQOOCPFQXQP8K\GMÌPKI)TQ­HÒTUV-QPUVCPVKP0KMQNCLGYKVUEJXQP4W­NCPF  KP9CTUEJCWYQ GT KO /·T\  \WO )GPGTCNOCLQT DGHÌTFGTV CP FGT 0KGFGTUEJNCIWPI FGU RQNPKUEJGP #WHUVCPFU XQP    WPFCPFGT&WTEJHÒJTWPIFGT#ITCTTGHQTOKP2QNGPDGVGKNKIVYCT0CEJFGO6QFUGKPGT)GOCJNKPIKPIGTKP FGP 4WJGUVCPF  JGKTCVGVG GT OQTICPCVKUEJ FKG XQP)TQ­JGT\QI.WFYKI+++XQP*GUUGPWPFDGK4JGKP   \WT(TGKHTCWXQP-NG[FQTHHGTJQDGPGRQNPKUEJG$CNNGVV·P\GTKP%COKNNC5VGH±PUMC  +O)GHQNIGXQP <CT#NGZCPFGT++  PCJOGTPQEJCO4WUUKUEJ1UOCPKUEJGP-TKGIXQPKO&QPCW4CWOVGKN FGT HÒT 4WO·PKGP \WT XÌNNKIGP HÒT $WNICTKGP \WT VGKNYGKUGP 7PCDJ·PIKIMGKV HÒJTVG -TCPMJGKVUDGFKPIV PQEJ XQT   -TKGIUGPFG PCEJ &GWVUEJNCPF \WTÒEMIGMGJTV UVCTD GT CO  5GRVGODGT  KP 'IGTP CO 6GIGTPUGG +O .CWHG   UGKPGT NCPIGP -CTTKGTG JCV GT \CJNTGKEJG JQJG 1TFGP WPF 'JTGP\GKEJGP CWU 5K\KNKGP *GUUGP (TCPMTGKEJ   )TKGEJGPNCPF 0CUUCW FGO 1UOCPKUEJGP 4GKEJ 2GTUKGP 2TGW­GP FGO 4WUUKUEJGP 4GKEJ WPF 5CEJUGP 9GKOCT   XGTNKGJGPDGMQOOGP8INJKGT\W#WVGPITWDGT/KEJCGN9KGGKP*CWHGP1TFGPUGKPG+FGPVKV·V\WTÒEMGTJKGNV +P /KNKVCTKC  ,CJTICPI   *GHV  5  7PF KP <GKVUEJTKHV FGT ¤UVGTTGKEJKUEJGP )GUGNNUEJCHV HÒT   1TFGPUMWPFG0T  5



8GTFKGPUVQTFGP2JKNKRRUFGU)TQ­OÒVJKIGP8GTNGKJWPIUWTMWPFG\WO%QOVJWTMTGW\-NCUUGHÒTFGP MCKUGTNKEJTWUUKUEJGP1DGTUVNKGWVPCPVWPF(NÒIGNCFLWVCPVGPFGU<CTGP'OKN2TKP\XQP5C[P9KVVIGPUVGKP $GTNGDWTIFCVKGTV&CTOUVCFVCO1MVQDGT&QRRGNDNCVVOKV2CRKGTRT·IGUKGIGNWPF1TKIKPCNWP VGTUEJTKHV XQP )TQ­JGT\QI .WFYKI +++   FQRRGNV IGHCNVGV FGWVNKEJGT 'KPTK­ KP DGKFGP $N·V   VGTPLGFQEJNGKEJV\WTGUVCWTKGTGP +++



'ZGORNCTCWUFGO$GUKV\FGUUR·VGTGPTWUUKUEJGP)GPGTCNCFLWVCPVGP'OKN2TKP\\W5C[P9KVVIGPUVGKP$GTNGDWTI



-NCFFG#WU\ÒIGCWUFGT$GTNGDWTIGT%JTQPKMXQO,CJTGPGDUVGKPKIGP0QVK\GPCWUFGO  ,JTJFTV (QTOCV  Z  EO  JCPFIGUEJTKGDGPG 5GKVGP FCVKGTV $GTNGDWTI ,CPWCT    IGHCNVGV &C\W JCPFIGUEJTKGDGPGT ITQ­GT 5VCOODCWO FGT (COKNKG 5C[P XQO $GIKPP FGU  DKU KPU   ,CJTJWPFGTVFQRRGNVIGHCNVGV 4++ 'ZGORNCTCWUFGO$GUKV\FGUUR·VGTGPTWUUKUEJGP)GPGTCNCFLWVCPVGP'OKN2TKP\\W5C[P9KVVIGPUVGKP$GTNGDWTI

172




URKUNDEN, DOKUMENTE, STATUTEN 

'TPGPPWPIU7TMWPFG \WO 5GEQPF .KGWVGPCPV (Ã&#x2019;T 'OKN 2TKP\ XQP 9KVVIGPUVGKP$GTNGDWTI FCVKGTV   &CTOUVCFVCO#RTKN&QRRGNDNCVVOKV2CRKGTRT·IGUKGIGNWPF1TKIKPCNWPVGTUEJTKHVXQP)TQ­JGT \QI.WFYKI++  FQRRGNVIGHCNVGVGTJGDNKEJG'KPTKUUGKPFGP(CNVUVGNNGP +++



'ZGORNCTCWUFGO$GUKV\FGUUR·VGTGPTWUUKUEJGP)GPGTCNCFLWVCPVGP'OKN2TKP\\W5C[P9KVVIGPUVGKP$GTNGDWTI



'TPGPPWPIU7TMWPFG \WO 4KVVOGKUVGT (Ã&#x2019;T 'OKN 2TKP\ XQP 5C[P9KVVIGPUVGKP$GTNGDWTI FCVKGTV   &CTOUVCFVCO#RTKN&QRRGNDNCVVOKV2CRKGTRT·IGUKGIGNWPF1TKIKPCNWPVGTUEJTKHVXQP)TQ­JGT \QI.WFYKI++  FQRRGNVIGHCNVGV ++



'ZGORNCTCWUFGO$GUKV\FGUUR·VGTGPTWUUKUEJGP)GPGTCNCFLWVCPVGP'OKN2TKP\\W5C[P9KVVIGPUVGKP$GTNGDWTI

*1*'0<1..'40 

(Ã&#x2019;TUVNKEJ *QJGP\QNNGTPUEJGT *CWUQTFGP 1TFGPUUVCVWVGP KP FGT (CUUWPI XQP  OKV FGP 'TYGKVG   TWPIGPWPF0CEJVT·IGPDKUGKPUEJNKG­NKEJ5GKVGPIGMPKEMV ++



-1056#0< 

&KURGPUWTMWPFGHÃ&#x2019;T2%CTN.GQRQNFXQP5EJÃ&#x2019;V\&CVKGTV-QPUVCP\CO5GRVGODGTOKV2T· IGUKIGNWPF7PVGTUEJTKHVXQP#PVQP*GKPKIGTKP#DYGUGPJGKVFGU)GPGTCNXKMCTUOGJTHCEJIGHCNVGV ++



.ª$'%- 

*CPUGCVGPMTGW\  8GTNGKJWPIUWTMWPFG HÃ&#x2019;T FGP *CWRVOCPP *CPU 5GJOUFQTH  )GPGTCNUVCDUQHHK   \KGTFGT+PHCPVGTKGFKXKUKQP&QRRGNDNCVVFCVKGTV.Ã&#x2019;DGEMCO,WPK\WUCOOGPOKVFGT8GT NGKJWPIUWTMWPFG \WO JCODWTIKUEJGP *CPUGCVGPMTGW\ GDGPHCNNU HÃ&#x2019;T ,QJCPPGU 5GJOUFQTH FCVKGTV *CO   DWTICO/CK$GKFGOGJTHCEJIGHCNVGV 5VÃ&#x2019;EM++



/'%-.'0$74)5%*9'4+0*'4<1)67/ $+5 70&  )4155*'4<1)67/   



)TQ­JGT\QINKEJ /GEMNGPDWTIKUEJGT *CWU1TFGP FGT 9GPFKUEJGP -TQPG 1TFGPUUVCVWVGP KP FGT   (CUUWPI XQP  5EJYGTKP   5GKVGP WPF GKPG &QRRGNVCHGN GKP #TVKMGN OKV 5VKHV FWTEJIGUVTKEJGP   IGHCNVGV ++



)TQ­JGT\QINKEJ /GEMNGPDWTIKUEJGT )TGKHGP1TFGP 1TFGPUUVCVWVGP KP FGP (CUUWPIGP XQP  WPF    5EJYGTKP OKVFGP<WU·V\GPXQPWPF5GKVGPFQRRGNVIGHCNVGV ++



0#55#775+0)'0(ª456'067/  70&*'4<1)67/0#55#7   

4GKUGRC­FGU*GT\QINKEJ0CUUCWKUEJGP5VCCVUOKPKUVGTKWOU(Ã&#x2019;TFKG2TKP\GUUKPPGP(CPP[WPF2WNEJG TKG 9KVVIGPUVGKP XQP 9KGUDCFGP PCEJ 2CTKU &QRRGNDNCVV FCVKGTV 9KGUDCFGP CO  #RTKN  OKV   5VGORGN WPF 1TKIKPCNWPVGTUEJTKHV FGU &KTGMVQTU FGU 5VCCVUOKPKUVGTKWOU (CDGT OKV 'KPVTCIWPIGP WPF   5VGORGNP FGT 2QNK\GKRT·HGMVWT KP 2CTKU FGT RTGW­KUEJGP )GUCPFVUEJCHV KP 2CTKU FGT PCUUCWKUEJGP )G   UCPFVUEJCHVKP2CTKUWPFFGURTGW­KUEJGP2QNK\GKCOVGUKP5CCTDTÃ&#x2019;EMGPFQRRGNVIGHCNVGV ++



5GJT KPVGTGUUCPVGU &QMWOGPV 'ZGORNCT CWU FGO $GUKV\ FGU UR·VGTGP TWUUKUEJGP )GPGTCNCFLWVCPVGP 'OKN 2TKP\ \W   5C[P9KVVIGPUVGKP$GTNGDWTI

1.&'0$74)*'4<1)67/ $+5 70&)4155*'4<1)67/   

)TQ­JGT\QINKEJ 1NFGPDWTIGT *CWU WPF 8GTFKGPUVQTFGP FGU *GT\QIU 2GVGT (TKGFTKEJ .WFYKI   1TFGPUUVCVWVGPOKVCNNGP0CEJVT·IGPDKUGKPUEJNKG­NKEJ5GKVGPWPFFTGKFQRRGNUGKVKIG$KNFVCHGNP MCTVQPKGTV ++p



173


URKUNDEN, DOKUMENTE, STATUTEN

ex 9706

24'755'0-¤0+)4'+%*   

7TMWPFGP6GKN0CEJNC­ FGU -QPVTGCFOKTCNU ,QJCPP %JTKUVKCP 9KNJGNO $GTVTCO OKNKV·TKUEJGU   /KVINKGF FGU 4GKEJUOKNKV·TIGTKEJVU WPF /KVINKGF FGT )GPGTCN1TFGPUMQOOKUUKQP   <GWIPKU FGT   4GKHG \WO 5GGMCFGVV FCVKGTV $GTNKP CO  /CK  OKV 5VGORGN WPF 1TKIKPCNWPVGTUEJTKHVFGU%JGHU FGT#FOKTCNKV·V%CRTKXK 2CVGPV\WO5GGMCFGVVFCVKGTV$GTNKPCO#RTKNOKVITQ­GO2T·IG UKGIGN 4GKUGQTFTGFCVKGTV.GJGCO1MVQDGTOKV5VGORGNWPF7PVGTUEJTKHVGP 2CVGPV\WO -CRKV·PNGWVPCPV FCVKGTV $GTNKP CO  #RTKN  OKV ITQ­GO 2T·IGUKGIGN WPF 1TKIKPCNWPVGTUEJTKHV   9KNJGNOU ++   4W­NCPF 8GTNGKJWPIUWTMWPFG \WO 5V 5VCPKUNCWU1TFGP  -NCUUG FCVKGTV 5V 2GVGTU   DWTI CO  5GRVGODGT  OKV 2CRKGTUKGIGN WPF 7PVGTUEJTKHVGP \WUCOOGP OKV (QVQMQRKG FGT ªDGT   UGV\WPI WPF (QVQMQRKG GKPGU $NCVVU ÒDGT FKG *KPVGTITÒPFG FGT 8GTNGKJWPI   2CVGPV \WO-QTXGVVGPMC RKV·PFCVKGTV$GTNKPCO/·T\OKVITQ­GO2T·IGUKGIGNWPF1TKIKPCNWPVGTUEJTKHV9KNJGNOU++   8GTNGKJWPIUWTMWPFG \WO 4QVGP #FNGT1TFGP  -NCUUG FCVKGTV $GTNKP CO  5GRVGODGT  OKV   &TWEMUKGIGN WPF 1TKIKPCNWPVGTUEJTKHV FGU 2TKP\GP 5CNO*QTUVOCT   2CVGPV \WO (TGICVVGPMCRKV·P FC   VKGTV8NKUUKPIGP CP$QTFFGT*QJGP\QNNGTP CO0QXGODGTOKVITQ­GO2T·IGUKGIGNWPF1TKIK PCNWPVGTUEJTKHV 9KNJGNOU ++   8GTNGKJWPIUWTMWPFG \WO-ÌPKINKEJGP-TQPGP1TFGP-NCUUGFCVKGTV $GTNKP CO  ,CPWCT  OKV 2T·IGUKGIGN WPF 1TKIKPCNWPVGTUEJTKHV 9KNJGNOU ++   -CDKPGVVUQTFTG   \WT $GHÌTFGTWPI \WO -CRKV·P \WT 5GG FCVKGTV $GTNKP CO  ,CPWCT  -CKUGT U )GDWTVUVCI  OKV   1TKIKPCNWPVGTUEJTKHV 9KNJGNOU ++   2CVGPV \WO -CRKV·P \WT 5GG FCVKGTV $GTNKP CO  ,CPWCT   

-CKUGT U)GDWTVUVCI OKV1TKIKPCNWPVGTUEJTKHV9KNJGNOU++ 8GTNGKJWPIUWTMWPFG\WO4QVGP#FNGT 1TFGP-NCUUGOKVFGT5EJNGKHGFCVKGTV$GTNKPCO,CPWCTOKV2T·IGUKGIGNWPF1TKIKPCNWPVGT UEJTKHV9KNJGNOU++ 8GTNGKJWPIUWTMWPFG\WO-ÌPKINKEJGP-TQPGP1TFGP-NCUUGFCVKGTV$GTNKP CO,CPWCTOKV&TWEMUKGIGNWPF7PVGTUEJTKHV -CDKPGVVUQTFTG\WT$GTWHWPICNU/KVINKGFKP FKG)GPGTCN1TFGPUMQOOKUUKQPFCVKGTV$GTNKPCO(GDTWCTOKV1TKIKPCNWPVGTUEJTKHV9KNJGNOU++   -CDKPGVVUQTFTG \WT 5VGNNWPI \WT &KURQUKVKQP WPF 8GTNGKJWPI FGU %JCTCMVGTU CNU -QPVTGCFOKTCNU   FCVKGTV$GTNKPCO1MVQDGTOKV1TKIKPCNWPVGTUEJTKHV9KNJGNOU++ $GUVCNNWPI\WOUVGNNXGT VTGVGPFGP/KVINKGFFGU2TKUGPIGTKEJVUKP-KGNFCVKGTV$GTNKPCO#WIWUVOKVITQ­GO2T·IGUKG IGN WPF 1TKIKPCNWPVGTUEJTKHV 9KNJGNOU ++ &KG OGKUVGP WPDGUEJTKGDGPGP &QRRGNDN·VVGT FGT &QMWOGPVG   HGJNGP VGKNU GKPHCEJ VGKNU FQRRGNV IGHCNVGV UQPUV DKU CWH\YGKFKGUGOKVOKP'KPTKUUGPQTFGPVNKEJGT <WUVCPF<WUCOOGPKPCNVGO.QIMNCFFGP&GEMGN 5VÒEM++++p+++  5GJTKPVGTGUUCPVGTWPFTGNCVKXXQNNUV·PFKIGT0CEJNC­GKPGU/CTKPGLWTKUVGPFKGOGKUVGP&QMWOGPVGKPUIGUCOV OKVFGT1TKIKPCNWPVGTUEJTKHV-CKUGT9KNJGNOU++





4GVVWPIUOGFCKNNG CO $CPFG 8GTNGKJWPIUWTMWPFG HÒT FGP +PIGPKGWT #NQKU 5VKGINGT CWU 2NCPVK½TGU DGK   /GV\KP'NUC­.QVJTKPIGP&QRRNGNDNCVVFCVKGTV$GTNKPCO#RTKNOKV1TKIKPCNWPVGTUEJTKHV2TKP\ 5CNO*QTUVOCTFQRRGNVIGHCNVGV ++



.WZGODWTIKUEJGT 1TFGP FGT 'KEJGPMTQPG -CDKPGVVUQTFTG -ÌPKI (TKGFTKEJ 9KNJGNOU +8 DGVTGHHGPF   FKG 'TVGKNWPI GKPGT 6TCIGIGPGJOKIWPI HÒT FGP 1TFGP FCVKGTV 'TFOCPPUFQTH CO  #WIWUV  OKV   1TKIKPCNWPVGTUEJTKHVFGU-ÌPKIUFQRRGNVIGHCNVGV ++



5#%*5'0-74(ª456'067/ $+5 70&-¤0+)4'+%*   

-ÌPKINKEJ5·EJUKUEJGT/KNKV·T5V*GKPTKEJU1TFGP1TFGPUUVCVWVGPKPFGT(CUUWPIXQPOKVFGP 0CEJVT·IGPDKUGKPUEJNKG­NKEJ5GKVGPFQRRGNVIGHCNVGV ++





-ÌPKINKEJ5·EJUKUEJGT#NDTGEJVU1TFGP1TFGPUUVCVWVGPKPFGT(CUUWPIXQPOKVFGP0CEJVT·IGP DKUGKPUEJNKG­NKEJ5GKVGP ++





-ÌPKINKEJ5·EJUKUEJGT#NDTGEJVU1TFGP$GUVKOOWPIGPCWUFGP5VCVWVGP5GKVGPFQRRGNVIGHCNVGV  ++



174


URKUNDEN, DOKUMENTE, STATUTEN

9712

5#%*5'0 9'+/#4'+5'0#%*$+5 *'4<1)67/ $+5 70&  )4155*'4<1)67/   

*CWUQTFGPFGT9CEJUCOMGKVQFGTXQO9GK­GP(CNMGP8GTNGKJWPIUWTMWPFG\WO)TQ­MTGW\HÒTFGP MCKUGTNKEJ TWUUKUEJGP )GPGTCN.KGWVGPCPV (ÒTUV 'OKN 5C[P9KVVIGPUVGKP$GTNGDWTI &QRRGNDNCVV FCVKGTV   9GKOCTCO0QXGODGTOKV2T·IGUKGIGNWPF1TKIKPCNWPVGTUEJTKHVXQP)TQ­JGT\QI%CTN#NGZCP FGTFQRRGNVIGHCNVGV ++



'ZGORNCT CWU FGO $GUKV\ FGU UR·VGTGP TWUUKUEJGP )GPGTCNCFLWVCPVGP 'OKN 2TKP\ \W 5C[P9KVVIGPUVGKP$GTNGDWTI    /KV&CVWOXQO0QXGODGTDGFCPMVUKEJ2TKP\5C[P9KVVIGPUVGKP$GTNGDWTIDGK)TQ­JGT\QI%CTN#NGZCP FGTOKVHQNIGPFGP9QTVGP'WTG-ÌPKINKEJG*QJGKVOÌIGPOKTGTNCWDGPOGKPGPUGJTFGOÒVKIGPWPFGTPUVGP&CPM HÒT FKG JQJG #WU\GKEJPWPI CWU\WFTÒEMGP FKG OKT 'WTG -ÌPKINKEJG *QJGKV IGUVGTP IGY·JTV JCDGP &GT (CNMG YCT   UEJQPKOOGTGKPUGJTUEJÌPGU<GKEJGPHÒTOKEJRTQORVOWVKIGPGTIKUEJWPFYCEJUCO+EJYCIG\WJQHHGPFC­ KJP'WTG-ÌPKINKEJG*QJGKVPKEJVGKPGO7PYÒTFKIGPIGY·JTVJCDGP/GKPGITÌ­VG(TGWFGY·TGGUKJPGKPGU6CIGU KP9GKOCTCNUFCWGTJCHVG#WU\GKEJPWPIVTCIGP\WMÌPPGP ªDGTUGV\WPICWUFGO(TCP\ÌUKUEJGPXGTÌHHGPVNKEJV KP5QWXGPKTUGV%QTTGURQPFCPEGFW2TKPEG—OKNGFG5C[P9KVVIGPUVGKP$GTNGDQWTI#KUGFG%COR)¾P¾TCNFG5/ N 'ORGTGWT#NGZCPFTG++FG4WUUKG2CTKU$CPF5 

5%*5+5%*'*'4<1)6ª/'4)'/'+05#/ 

*GT\QINKEJ 5CEJUGP 'TPGUVKPKUEJGT *CWUQTFGP 1TFGPUUVCVWVGP KP FGT (CUUWPI XQP  OKV FGP   0CEJVT·IGPDKUGKPUEJNKG­NKEJ5GKVGP$KPFWPIOKV-NGDGDCPFÒDGTMNGDVIGMPKEMV ++



5%*9#4<$74)(ª456'06ª/'4)'/'+05#/ 

(ÒTUVNKEJ5EJYCT\DWTIKUEJGU'JTGPMTGW\1TFGPUUVCVWVGPKPFGT(CUUWPIXQPOKVFGP0CEJVT·IGP DKUGKPUEJNKG­NKEJ5GKVGPFQRRGNVIGHCNVGV ++



9ª466'/$'4) 

1TFGP FGT -ÌPKINKEJGP 9ÒTVVGODGTIKUEJGP -TQPG 8GTNGKJWPIUWTMWPFG \WO 4KVVGTMTGW\ OKV FGP   .ÌYGPHÒTFGPMÌPKINKEJRTGW­KUEJGP/CLQTX$QGJP-QOOCPFGWTFGU6GNGITCRJGP$CVCKNNQPU0T &QRRGNDNCVVFCVKGTV5VWVVICTVCO,CPWCTOKV2T·IGUKGIGNWPF1TKIKPCNWPVGTUEJTKHVFGU1TFGPU -CP\NGTUX5QFGPIGHCNVGV 4++





-ÌPKINKEJ9ÒTVVGODGTIKUEJGT (TKGFTKEJU1TFGP 1TFGPUUVCVWVGP KP FGT (CUUWPI XQP  OKV FGO   0CEJVTCIXQP5GKVGPFQRRGNVIGHCNVGV ++





-ÌPKINKEJ9ÒTVVGODGTIKUEJGT (TKGFTKEJU1TFGP 1TFGPUUVCVWVGP KP FGT (CUUWPI XQP  OKV FGP   0CEJVT·IGPDKUGKPUEJNKG­NKEJ5GKVGPIGHCNVGV ++

 175


URKUNDEN, DOKUMENTE, STATUTEN

*'+.+)'54¤/+5%*'54'+%*&'765%*'40#6+10 $+5  

&KGPUV\GWIPKU8QP(TGKJGTTXQP4QVJMKTEJHÒTFGP2QTVKGT,QJCPP)GQTI0KEQNOKV.CEMUKGIGNFCVKGTV 4GIGPUDWTICO&G\GODGTOGJTHCEJIGHCNVGV ++



&'765%*.#0&#..)'/'+0'-1081.76' 

-QPXQNWVXQPUGEJU8GTNGKJWPIUWTMWPFGP 5EJYCT\GU8GTYWPFGVGP#D\GKEJGPFCVKGTV&G\GO DGT 2TGW­GP-TKGIUFGPMOÒP\GHÒT-QODCVVCPVGPFCVKGTV/·T\ $CFGP -TKGIUXGTFKGPUVMTGW\ FCVKGTV  ,WNK    $CFGP 4GIKGTWPIU,WDKN·WOUOGFCKNNG FCVKGTV  #RTKN    *GUUGP-TKGIUGJTGP\GKEJGPFCVKGTV,WPK (KPPNCPFFGWVUEJURTCEJKIGU$GUKV\<GWI PKU\WT(KPPKUEJGP(TGKJGKVU/GFCKNNG+-NCUUGFCVKGTV0QXGODGTKPWPVGTUEJKGFNKEJGP'TJCN VWPIGP&C\W(QVQMQRKGPXQPXKGT&QMWOGPVGP 5VÒEM++++p++++++



$7.)#4+'0 <#4'067/   

1TFGP (ÒT /KNKV·T8GTFKGPUV ==Îðäåí "Ça Âîåííà Çàñëóãà"] CWEJ /KNKV·T8GTFKGPUVQTFGP IG   PCPPV 8GTNGKJWPIUWTMWPFG\WO4KVVGTMTGW\OKV-TQPGHÒT1DGTNGWVPCPV#NHTGF-PQGT\GT&QRRGNDNCVV FCVKGTV5QHKCCO#WIWUVOKV2T·IGUKGIGNWPF7PVGTUEJTKHVGPFQRRGNVIGHCNVGV ++



9721

(4#0-4'+%*

<9'+6'5 (4#0<¤5+5%*'5-#+5'44'+%*   

-CKUGTNKEJGT 1TFGPFGT'JTGPNGIKQP=1TFTGKOR¾TKCNFGNC.¾IKQPF JQPPGWT?'TPGPPWPIUWTMWPFG \WO1HHK\KGTHÒTFGP2TKP\GPXQP9KVVIGPUVGKP\YGKVG5GKVGFGU&QRRGNDNCVVGUHGJNVFCVKGTV2CTKUCO ,WPK  OKV 2T·IGUKGIGN WPF 1TKIKPCNWPVGTUEJTKHV FGU )TQ­MCP\NGTU )GPGTCN #PPG%JCTNGU .GDTWP   &WEFG2NCKUCPEGGKPOCNIGHCNVGV ++



'ZGORNCTCWUFGO$GUKV\FGUUR·VGTGPTWUUKUEJGP)GPGTCNCFLWVCPVGP'OKN2TKP\\W5C[P9KVVIGPUVGKP$GTNGDWTI



-CKUGTNKEJGT 1TFGPFGT'JTGPNGIKQP=1TFTGKOR¾TKCNFGNC.¾IKQPF JQPPGWT?'TPGPPWPIUWTMWPFG \WO 4KVVGT HÒT FGP 8K\GRT·UKFGPVGP FGT -NCUUG  FGT 9GNVCWUUVGNNWPI KP *CPPQXGT -CTOCTUEJ &QR   RGNRNCVVFCVKGTV2CTKUCO,WNKOKV2T·IGUKGIGNWPF7PVGTUEJTKHVGKPOCNIGHCNVGV ++



(ª0(6' (4#0<¤5+5%*'4'27$.+- 5'+6  

176

'JTGPWTMWPFG FGU )GPGTCNUGMTGVCTKCVU FGT 2CUUKXGP 8GTVGKFKIWPI KP FGT 2QNK\GKRT·HGMVWT XQP 2C   TKU (ÒT / 8CP &WTGP .GGPFGTV KP #PGTMGPPWPI UGKPGT &KGPUVG WPF UGKPGT 1RHGTDGTGKVUEJCHV Y·JTGPF   FGT$QODCTFKGTWPIFGT4GIKQP2CTKUQJPG&CVWOOKV5VGORGNWPF7PVGTUEJTKHV&C\W5EJOWEMDNCVV FGT%QNQPKC/CTKPC%QPVGUUC/CTKC0GITKÒDGTFGP&WEG$GPKVQ/WUUQNKPKIGHCNVGVWPFGVYCUGKPIGTKU UGP 5VÒEM++




URKUNDEN, DOKUMENTE, STATUTEN

9725

9724

-1.10+#.'#75<'+%*070)'0 



-ÌPKITGKEJ-CODQFUEJC-ÌPKINKEJGT1TFGPXQP-CODQFUEJC=1TFTG4Q[CNFW%CODQFIG?8GT NGKJWPIUWTMWPFG\WO1HHK\KGTHÒT/4QWJGV\YGKURTCEJKIFCVKGTVCO1MVQDGTOKVMÌPKINK EJGO5KGIGNUVGORGNHTCP\ÌUKUEJGO5VGORGNWPF7PVGTUEJTKHVGP'KPFTWEMUXQNNG7TMWPFG ++



-CKUGTTGKEJ#PPCO-CKUGTNKEJGT1TFGPFGU&TCEJGPUXQP#PPCO=1TFTG+OR¾TKCNFW&TCIQPFG N #PPCO?8GTNGKJWPIUWTMWPFG\WO4KVVGTHÒT/4QWJGV\YGKURTCEJKIFCVKGTV*W¾CO/CK OKV5VGORGNPWPF7PVGTUEJTKHVGPOGJTHCEJIGHCNVGV ++



)4+'%*'0.#0& 

-¤0+)4'+%*4')+'470)-¤0+)16615  

-ÌPKINKEJGT 'TNÌUGT1TFGP =Βασιλικον Ταγμα Αριστειας τον Σοτηρος? 8GTNGKJWPIUWTMWPFG \WO   -QOOCPFGWTMTGW\HÒT'OKNGXQP5C[P9KVVIGPUVGKP&QRRGNDNCVVFCVKGTV#VJGPCO/CKOKV 2CRKGTUKGIGNWPF1TKIKPCNWPVGTUEJTKHV-ÌPKI1VVQU  FQRRGNVIGHCNVGV ++



'ZGORNCTCWUFGO$GUKV\FGUUR·VGTGPTWUUKUEJGP)GPGTCNCFLWVCPVGP'OKN2TKP\\W5C[P9KVVIGPUVGKP$GTNGDWTI

)4+'%*+5%*146*1&1:'52#64+#4%*#6810,'475#.'/ 

1TVJQFQZGT 1TFGP XQO *GKNKIGP )TCD 7TMWPFG \WO #URKTCPV HÒT FGP 1TFGP HÒT/'FPGTFCVKGTV ,GTWUCNGO CO  5GRVGODGT  OKV 5VGORGN WPF 1TKIKPCNWPVGTUEJTKHV FGU ITKGEJKUEJQTVJQFQZGP   2CVTKCTEJGPXQP,GTWUCNGO&COKCP  FQRRGNVIGHCNVGVOGJTHCEJGKPIGTKUUGP 4++

-#+5'44'+%*  



¤56'44'+%*



/KNKV·TKUEJGT/CTKC6JGTGUKGP1TFGP1TFGPUUVCVWVGPKPFGT(CUUWPIXQP5GKVGPMCTVQPKGTV ++



-CKUGTNKEJ ¤UVGTTGKEJKUEJGT .GQRQNF1TFGP 'ORHCPIUUEJGKP HÒT FKG )TQ­MTGW\+PUKIPKGP FGU )GPG   TCNNKGWVGPCPVU #WIWUV 2TKP\ \W 5C[P9KVVIGPUVGKP$GTNGDWTI FGU 8CVGTU XQP 'OKN 2TKP\ \W 5C[P9KVV   IGPUVGKP$GTNGDWTI &QRRGNDNCVVFCVKGTV9KGPCO(GDTWCTOKV2T·IGUKGIGNFGT1TFGPUMCP\NGK WPF7PVGTUEJTKHVFGU1TFGPU)TGHHKGTUFQRRGNVIGHCNVGV ++





'ZGORNCTCWUFGO$GUKV\FGUUR·VGTGPTWUUKUEJGP)GPGTCNCFLWVCPVGP'OKN2TKP\\W5C[P9KVVIGPUVGKP$GTNGDWTI



-CKUGTNKEJ¤UVGTTGKEJKUEJGT (TCP\,QUGRJ1TFGP 8GTNGKJWPIUWTMWPFG FGU 5VGTPU \WO %QOVJWTMTGW\   HÒTFGPMÌPKINKEJRTGW­KUEJGPIGJ4GIKGTWPIUTCVJ&T4-CTOCTUEJ&QRRNGDNCVVFCVKGTV9KGPCO 1MVQDGTOKV2T·IGUKGIGNWPF1TKIKPCNWPVGTUEJTKHVFGU1TFGPUMCP\NGTUFQRRGNVIGHCNVGVOKP'KP TKUUG ++





-CKUGTNKEJ¤UVGTTGKEJKUEJGT(TCP\,QUGRJ1TFGP1TFGPUUVCVWVGPGKPUEJNKG­NKEJFGU&TKVVGP0CEJVTCIU XQP5GKVGPWPFXKGT(CTDVCHGNPIGDWPFGP ++





-CKUGTNKEJ¤UVGTTGKEJKUEJGT(TCP\,QUGRJ1TFGP1TFGPUUVCVWVGPGKPUEJNKG­NKEJFGU&TKVVGP0CEJVTCIU XQP5GKVGPWPFXKGT(CTDVCHGNP$KPFWPIIGDTQEJGP ++p+++





/KNKV·TXGTFKGPUVMTGW\5VCVWVGPGKPUEJNKG­NKEJFGU0CEJVTCIUXQP5GKVGPWPFFTGK(CTDVCHGNP ++

 177


URKUNDEN, DOKUMENTE, STATUTEN 



&TGK2CVGPVG\WO.KGWVGPCPV1DGTNKGWVGPCPVWPF*CWRVOCPPHÒT,QJCPP8KPVGNGTKW,GYGKNU&QR RGNDN·VVGTFCVKGTV9KGPCO1MVQDGTD\Y#RTKND\Y#RTKNLGYGKNUOKV 2T·IGUKGIGN WPF (CMUKOKNGWPVGTUEJTKHVGP FGU -TKGIUOKPKUVGTU LGYGKNU OGJTHCEJ IGHCNVGV WPF VGKNYGKUG   GVYCUGKIGTKUUGP 5VÒEM++



5VCVWVGPHÒTFKG¤UVGTTGKEJKUEJ-CKUGTNKEJG#MCFGOKGFGT$KNFGPFGP-ÒPUVG9KGP5GKVGP MCTVQPKGTV ++



4755.#0& <#4'067/ $+5  

-CKUGTNKEJGT 1TFGP FGU JGKNKIGP )TQ­O·TV[TGTU )GQTI FGU 5KGITGKEJGP =Îðäåí èìïåðàòîðñêèé   Ñâÿàòîãî Âåëèêîìó÷åíèêà è Ïîáåäîíîñöà Ãåîðãèÿ? 5VCVWVGPJGHV FGU 1TFGPU #WUICDG FGU <CTGP   0KMQNCWU+5GKVGP$KPFWPIDTÒEJKIGKPOCNIGHCNVGV#POCPEJGP5VGNNGPGVYCUGKPIGTKUUGP ++



'ZGORNCT CWU FGO $GUKV\ FGU UR·VGTGP TWUUKUEJGP )GPGTCNCFLWVCPVGP 'OKN 2TKP\ \W 5C[P9KVVIGPUVGKP$GTNGDWTI   #O,WPKKUV2TKP\5C[P9KVVIGPUVGKP$GTNGDWTIFKGNCPIGTUGJPVG-NCUUGFGU5V)GQTIU1TFGPUXGTNKGJGP YQTFGP#PUGKPGP6CWHRCVGP2TKP\'OKNXQP*GUUGP&CTOUVCFV  UEJTGKDVGTJKGT\WCO/CK,WPK &CUKUVXKGNNGKEJVGKPIWVGU<GKEJGPWPFFCU5V)GQTIU-TGW\WPFFKG1DGTUV'RCWNGVVGPUKPFXKGNNGKEJV FQEJPKEJVUQYGKVGPVHGTPVYKGKEJFGPMGWPFCO#WIWUVCWU2CTKUCPUGKPG'NVGTP+EJOW­UEJPGNN FKGITQ­G(TGWFGOKV'WEJVGKNGPFKGOKTIGUVGTPCDGPFXQO*KOOGNIGHCNNGPKUV+EJYQNNVGIGTCFG\W$GVVCNUCWU 5V2GVGTUDWTIGKP(GNFL·IGTCNU-WTKGTUQGDGPCPIGMQOOGPDGKOKTGKPIGVTGVGPKUVWPFOKTXQP5GKVGPFGU-CKUGTU FCU -TGW\ FGU JN )GQTI ÒDGTTGKEJV JCV \WUCOOGP OKV GKPGO $TKGH XQP UGKPGT *CPF FGT NCWVGV YKG HQNIV /GKP   NKGDGT9KVVIGPUVGKPGUKUVOKTGKPGYCJTG(TGWFGFC­KEJ+JPGPFCU-TGW\FGUJN)GQTI XKGTVG-NCUUG XGTNKGJGP JCDGCWHFGP8QTUEJNCIJKPFGPOKTFCU1TFGPUMCRKVGNIGOCEJVJCVWPFKEJÒDGTUGPFG+JPGPFKG#WU\GKEJPWPICNU <GWIPKU OGKPGU UVGVGP 9QJNYQNNGPU HÒT 5KG +EJ YÒPUEJG FC­ 5KG GU VTCIGP OÌIGP WPF FC­ 5KG YKUUGP FC­ KEJ   OKEJFCTÒDGTHTGWGFC­5KGFKG)GNGIGPJGKVJCVVGPGU\WGTJCNVGPFGPPKEJUGJGKP+JPGPGKPGPOWVKIGPWPFYÒTFK IGP 1HHK\KGT WPF GKPGP IWVGP WPF GKHTKIGP &KGPGT +EJ DGINÒEMYÒPUEJG 5KG CWEJ \W +JTGT *QEJ\GKV WPF YÒPUEJG   +JPGPXQPICP\GO*GT\GP)NÒEMWPF9QJNUVCPF#NGZCPFGT $GKFGUªDGTUGV\WPIGPCWUFGO(TCP\ÌUKUEJGP XGTÌHHGPVNKEJVKP5QWXGPKTUCC1$CPF5HWPF

9737



9738

-CKUGTNKEJGT 1TFGP FGU JGKNKIGP #RQUVGNINGKEJGP (ÒTUVGP 9NCFKOKT =Îðäåí èìïåðàòîðñêèé   Ñâÿàòîãî Ðàâíîàïîñòîëüíîãî Êíÿçÿ Âëàäèìèðà? 8GTNGKJWPIUWTMWPFG HÒT FCU -TGW\  -NCUUG HÒT   FGP)GPGTCN/CLQT2TKP\'OKN5C[P9KVVIGPUVGKP$GTNGDWTI&QRRGNDNCVVFCVKGTVCO/CKOKV 2CRKGTUKGIGNWPF7PVGTUEJTKHVGPIGHCNVGV 4++



'ZGORNCTCWUFGO$GUKV\FGUUR·VGTGPTWUUKUEJGP)GPGTCNCFLWVCPVGP'OKN2TKP\\W5C[P9KVVIGPUVGKP$GTNGDWTI  +PGKPGO$TKGHXQO/CKUEJTGKDVGTFCTÒDGTNCRKFCTCPUGKPG(TCW&GT-CKUGTJCVOKT\W1UVGTP FCU-QOOCPFGWTMTGW\FGU1TFGPUXQOJGKNKIGP9NCFKOKTIGUCPFVªDGTUGV\WPICWUFGO(TCP\ÌUKUEJGPXGTÌH HGPVNKEJVKP5QWXGPKTUCC1$CPF5



-CKUGTNKEJGT 1TFGP FGU JGKNKIGP #RQUVGNINGKEJGP (ÒTUVGP 9NCFKOKT =Îðäåí èìïåðàòîðñêèé   Ñâÿàòîãî Ðàâíîàïîñòîëüíîãî Êíÿçÿ Âëàäèìèðà?8GTNGKJWPIUWTMWPFGHÒTFKG5EJYGTVGT\WO-TGW\ -NCUUGFGHCEVQ\WO-TGW\-NCUUGOKV5EJYGTVGTPHÒTFGP)GPGTCN/CLQT2TKP\'OKN5C[P9KVV IGPUVGKP$GTNGDWTI &QRRGNDNCVV FCVKGTV CO  &G\GODGT  2CRKGTUKGIGN HGJNV 7PVGTUEJTKHVGP   IGHCNVGV 4++ 'ZGORNCTCWUFGO$GUKV\FGUUR·VGTGPTWUUKUEJGP)GPGTCNCFLWVCPVGP'OKN2TKP\\W5C[P9KVVIGPUVGKP$GTNGDWTI

178




URKUNDEN, DOKUMENTE, STATUTEN

ex 9739



9740

-CKUGTNKEJGT 1TFGP FGU JGKNKIGP #RQUVGNINGKEJGP (ÒTUVGP 9NCFKOKT =Îðäåí èìïåðàòîðñêèé   Ñâÿàòîãî Ðàâíîàïîñòîëüíîãî Êíÿçÿ Âëàäèìèðà? 8GTNGKJWPIUWTMWPFG \WO -TGW\  -NCUUG OKV   5EJYGTVGTP HÒT 2TKP\ 5C[P9KVVIGPUVGKP$GTNGDWTI &QRRGNDNCVV FCVKGTV CO  /CK  OKV 2CRKGT   UKGIGN WPF 7PVGTUEJTKHVGP IGHCNVGV <WUCOOGP OKV ªDGTUGPFWPIUUEJTGKDGP &QRRGNDNCVV OKV 7PVGT   UEJTKHVGKPGU)GPGTCN/CLQTUIGHCNVGV 5VÒEM++



'ZGORNCT CWU FGO $GUKV\ FGU UR·VGTGP TWUUKUEJGP )GPGTCNCFLWVCPVGP 'OKN 2TKP\ \W 5C[P9KVVIGPUVGKP$GTNGDWTI  +PGKPGO$TKGHXQO,CPWCTUEJTGKDVGTUGKPG5EJYGUVGTFKG)T·HKP)QGTV\FC­OKEJFGT)GPGTCN /QWTCYKGHH GPVIGIGP UGKPGT XQTJGTKIGP )GYQJPJGKV OKV 9QJNYQNNGP GORHCPIGP WPF KP UGJT UEJOGKEJGNJCHVGT   9GKUG DGJCPFGNV JCV WPF OKT VTQV\FGO PWT FKG MNGKPG &GMQTCVKQP FGU 9NCFKOKTU XGTUEJCHHV JCV UVCVV FGU -TGW\GU   XQOJGKNKIGP)GQTIFCUKEJFQEJYKTMNKEJXGTFKGPVJCDGªDGTUGV\WPICWUFGO(TCP\ÌUKUEJGPXGTÌHHGPVNKEJVKP 5QWXGPKTUCC1$CPF5



-CKUGTNKEJGT1TFGPFGTJGKNKIGP#PPC=Îðäåí èìïåðàòîðñêèé Ñâÿòîé Àííbl?8GTNGKJWPIU7MCUFGU -CRKVGNU FGT -CKUGTNKEJ 4WUUKUEJGP 1TFGP \WO -TGW\  -NCUUG OKV -TQPG WPF 5EJYGTVGTP HÒT 'OKN   2TKP\9KVVIGPUVGKPFCVKGTVCO#WIWUVFQRRGNVIGHCNVGVGVYCUGKPIGTKUUGP 4++p



'ZGORNCT CWU FGO $GUKV\ FGU UR·VGTGP TWUUKUEJGP )GPGTCNCFLWVCPVGP 'OKN 2TKP\ \W 5C[P9KVVIGPUVGKP$GTNGDWTI   +PGKPGO$TKGHXQO5GRVGODGTCPUGKPG/WVVGTUEJTGKDVGTJKGT\W#OINGKEJGP6CIKUVOKTGKPG FGT CPIGPGJOUVGP ªDGTTCUEJWPIGP YKFGTHCJTGP CNU KEJ FCU -QOOCPFGWTMTGW\ FGU 1TFGPU FGT JGKNKIGP #PPC OKV   FGT-TQPG GKPDGUQPFGTGU<GKEJGPFGU9QJNYQNNGPUFGU-CKUGTUWPFGKPGITQ­G#WU\GKEJPWPIHÒTOKEJFGTPKEJVU YGKVGT CNU FCU MNGKPG 5VCPKUNCWU-TGW\ JCVVG  GTJKGNV \WUCOOGP OKV GKPGO ÒDGTCWU UEJOGKEJGNJCHVGP 4GUMTKRV FGU   -CKUGTUIG\KGTVOKVCNNGT#TVXQP$GKYQTVGPWPVGT\GKEJPGVXQO-CKUGTFGTUCIVGFC­KEJGUHÒTOGKPG(ÒJTWPIDGK FGT 'KPPCJOG XQP &CTIQ XGTFKGPUV J·VVG  &CU 2·EMEJGP YCT OKT XQT NCPIGT <GKV XQP (ÒTUV 9QTQP\QHH IGUCPFV   YQTFGPDGINGKVGVXQPGKPGO$TKGHXQPKJO FGTOKEJPQEJOGJTCNUFCU-TGW\GTHTGWVJCV ªDGTUGV\WPICWU FGO(TCP\ÌUKUEJGPXGTÌHHGPVNKEJVKP5QWXGPKTUCC1$CPF5

179


URKUNDEN, DOKUMENTE, STATUTEN

9741



9742

-CKUGTNKEJGT 1TFGP FGT JGKNKIGP #PPC =Îðäåí èìïåðàòîðñêèé Ñâÿòîé Àííbl? #NVJCPFMQNQTKGTVGT   -WRHGTUVKEJCWUFGT\YGKVGP*·NHVGFGU,JGKPGP4KVVGTFGU5V#PPGP1TFGPUKPXQNNGO*CDKVFCT UVGNNGPFZEOKP2CUUGRCTVQWV 4++



'ZGORNCTCWUFGO$GUKV\FGUUR·VGTGPTWUUKUEJGP)GPGTCNCFLWVCPVGP'OKN2TKP\\W5C[P9KVVIGPUVGKP$GTNGDWTI



'JTGPU·DGN HÒT 6CRHGTMGKV 8GTNGKJWPIUWTMWPFG HÒT 2TKP\ 5C[P9KVVIGPUVGKP$GTNGDWTI &QRRGNDNCVV   FCVKGTVCO0QXGODGTOKV2CRKGTUKGIGNWPF7PVGTUEJTKHVGPIGHCNVGV ++



'ZGORNCT CWU FGO $GUKV\ FGU UR·VGTGP TWUUKUEJGP )GPGTCNCFLWVCPVGP 'OKN 2TKP\ \W 5C[P9KVVIGPUVGKP$GTNGDWTI   +PGKPGO$TKGHXQO,CPWCT(GDWTCTCPUGKPG'NVGTPUEJTGKDVGTJKGT\W5GKVGKPKIGP6CIGPJCVUKEJ OGKP)NÒEMXQNNMQOOGPIGYGPFGV\WGTUVJCDGKEJKP/QUMCWHÒTFKGUEJÌPG#PIGNGIGPJGKVXQOXGTICPIGPGP ,WPK FGP 'JTGPU·DGN OKV FGT +PUEJTKHV (ÒT 6CRHGTMGKV GTJCNVGP\WUCOOGPOKVGKPGOCW­GTQTFGPVNKEJUEJOGKEJGN JCHVGP4GUMTKRVXGTÌHHGPVNKEJVKO,QWTPCNQHHKEKGN&CUKUVGKPGCPIGPGJOG#WU\GKEJPWPIFGPOCPVT·IVUKGKPCNNGP 4·PIGPOKVFGO$CPFFGUJGKNKIGP)GQTIªDGTUGV\WPICWUFGO(TCP\ÌUKUEJGPXGTÌHHGPVNKEJVKP5QWXGPKTU CC1$CPF5H

9743



)TQ­GU2CVGPV\WO1DGTUV-NCUUG(ÒT2TKP\'OKN5C[P9KVVIGPUVGKP$GTNGDWTIFCVKGTV/·T\ OKV ITQ­GO 2CRKGTUKGIGN WPF 1TKIKPCNWPVGTUEJTKHV FGU -TKGIUOKPKUVGTU UQYKG YGKVGTGP 7PVGTUEJTKHVGP   FQRRGNVIGHCNVGV ++ 'ZGORNCTCWUFGO$GUKV\FGUUR·VGTGPTWUUKUEJGP)GPGTCNCFLWVCPVGP'OKN2TKP\\W5C[P9KVVIGPUVGKP$GTNGDWTI

180




URKUNDEN, DOKUMENTE, STATUTEN 

)TQ­GU2CVGPV\WO1DGTUV-NCUUG 1DGTUVNGWVPCPV (ÒT2TKP\'OKN5C[P9KVVIGPUVGKP$GTNGDWTI FCVKGTVOKVITQ­GO2CRKGTUKGIGNWPFOGJTGTGP7PVGTUEJTKHVGPFQRRGNVIGHCNVGV ++



'ZGORNCTCWUFGO$GUKV\FGUUR·VGTGPTWUUKUEJGP)GPGTCNCFLWVCPVGP'OKN2TKP\\W5C[P9KVVIGPUVGKP$GTNGDWTI



)TQ­GU 2CVGPV \WO /CLQT (ÒT 2TKP\ 'OKN 5C[P9KVVIGPUVGKP$GTNGDWTI FCVKGTV  OKV ITQ­GO   2CRKGTUKGIGNWPFOGJTGTGP7PVGTUEJTKHVGPFQRRGNVIGHCNVGV ++



'ZGORNCTCWUFGO$GUKV\FGUUR·VGTGPTWUUKUEJGP)GPGTCNCFLWVCPVGP'OKN2TKP\\W5C[P9KVVIGPUVGKP$GTNGDWTI



-NGKPGU 2CVGPV \WO *CWRVOCPP (ÒT FGP JGUUKUEJGP /CLQT 2TKP\ 'OKN 5C[P9KVVIGPUVGKP$GTNGDWTI   FCVKGTVOKVITQ­GO2CRKGTUKGIGNWPFOGJTGTGP7PVGTUEJTKHVGPIGHCNVGV ++



'ZGORNCTCWUFGO$GUKV\FGUUR·VGTGPTWUUKUEJGP)GPGTCNCFLWVCPVGP'OKN2TKP\\W5C[P9KVVIGPUVGKP$GTNGDWTI



2JQVQ FGU )GPGTCN#FLWVCPVGP 'OKN 2TKP\ \W 5C[P9KVVIGPUVGKP$GTNGDWTI +P 2CTCFGWPKHQTO OKV   CPIGNGIVGP 1TFGP CWHIGPQOOGP WO  FC\W FTGK 2JQVQU UGKPGT \YGKVGP 'JGHTCW %COKNNC (TGKHTCW   XQP-NG[FQTHH 5VÒEM++



'ZGORNCTCWUFGO$GUKV\FGUUR·VGTGPTWUUKUEJGP)GPGTCNCFLWVCPVGP'OKN2TKP\\W5C[P9KVVIGPUVGKP$GTNGDWTI

5'4$+'070&,7)15.#9+'0 -¤0+)4'+%*&'45'4$'0-41#6'070&5.19'0'0$<9  -¤0+)4'+%*,7)15.#9+'0   

1TFGP FGU JGKNKIGP 5CXC [1RäEí %âGòQã %aâG? 8GTNGKJWPIUWTMWPFG \WT 8 -NCUUG HÒT 2CWN -TGKUC   FCVKGTV,CPWCTOKV2T·IGUKGIGNWPF7PVGTUEJTKHVGPOGJTHCEJIGHCNVGV ++p+++

9749





9750

/GFCKNNG (ÒT $ÒTIGTNKEJG 8GTFKGPUVG 8GTNGKJWPIUWTMWPFG \WT )QNFGPGP /GFCKNNG HÒT FGP %JGH FGT   MÌPKINKEJGP-ÒEJGP*GTOCPP'FPGTFCVKGTV$GNITCFCO0QXGODGTOKV2T·IGUKGIGNWPF7P VGTUEJTKHVGPIGHCNVGVGVYCUGKPIGTKUUGP ++p

 181


URKUNDEN, DOKUMENTE, STATUTEN

52#0+'0

&4+66'5 -┬д0+)4'+%*4'56#74#6+10   







-├МPKINKEJGTWPF8GTFKGPUVXQNNGT1TFGP-CTNU+++=4GCN[&KUVKPIWKFC1TFGPFG%CTNQU+++?)TQ┬нG 8GTNGKJWPIUWTMWPFG\WOCW┬нGTQTFGPVNKEJGP4KVVGTXQP0WOOGTH├ТTFGP)TCHGP,QJCPP1 &QPPGNND\Y 1 &QPGN-COOGTJGTTFGU-CKUGTUXQP┬дUVGTTGKEJFCVKGTVCO0QXGODGTOKVITQ┬нGO2CRKGT UKGIGN WPF 1TKIKPCN! 7PVGTUEJTKHV -├МPKI (GTFKPCPFU 8++ OGJTHCEJ IGHCNVGV WPF GKPIGTKUUGP VGKNU   TGUVCWTKGTV <WUCOOGPOKV\YGK\GKVIGP├МUUKUEJGP<GKVWPIUCTVKMGN\WO6QFFGU)TCHGPD\YUGKPGU8C VGTU 5V├ТEM++p



-├МPKINKEJGTWPF8GTFKGPUVXQNNGT1TFGP-CTNU+++=4GCN[&KUVKPIWKFC1TFGPFG%CTNQU+++?)TQ┬нG 8GTNGKJWPIUWTMWPFG \WO -QOOCPFGWTMTGW\H├ТTFGP/CLQTX&GKPGUFCVKGTV\W5CP+NFGHQPUQCO #WIWUVITQ┬нGU2T┬╖IGUKGIGNWPF(CMUKOKNGWPVGTUEJTKHVFGT-├МPKIKP4GIGPVKP/CTKC%TKUVKPCOGJT HCEJIGHCNVGVGVYCUGKPIGTKUUGPOKVFGOQTKIKPCNGP%QWXGTV<WUCOOGPOKVFGO#PM├ТPFKIWPIUUEJTGK DGPFGUURCPKUEJGP5VCCVUOKPKUVGTKWOU OKV6TCWGTTCPFCWHITWPFFGU6QFGU-├МPKI#NHQPU:++ &QRRGN DNCVVFCVKGTV/CFTKFCO/CKFQRRGNVIGHCNVGVOKP'KPTKUUGOKV\WIGJ├МTKIGO%QWXGTVWPF 6TCIGIGPGJOKIWPI FGU %JGHU FGU )GPGTCNUVCDU FGT RTGW┬нKUEJGP #TOGG &QRRGNDNCVV FCVKGTV $GTNKP CO   ,WNKFQRRGNVIGHCNVGV&C\W'KPNCFWPIUUEJTGKDGP\WT6CWHG-├МPKI#NHQPU:+++FCVKGTV/CFTKF CO/CKOGJTHCEJIGHCNVGV 5V├ТEM++



-├МPKINKEJGTWPF8GTFKGPUVXQNNGT1TFGP-CTNU+++=4GCN[&KUVKPIWKFC1TFGPFG%CTNQU+++?)TQ┬нG 8GTNGKJWPIUWTMWPFG \WO -QOOCPFGWTMTGW\ H├ТT )GQTI X $QTTKGU FCVKGTV CO  0QXGODGT    ITQ┬нGU2T┬╖IGUKGIGNWPF(CMUKOKNGWPVGTUEJTKHV-├МPKI#NHQPU:+++OGJTHCEJIGHCNVGV ++



/KNKV┬╖T8GTFKGPUVQTFGP=1TFGPFGN/┬╛TKVQ/KNKVCT?8GTNGKJWPIUWTMWPFG\WT-NCUUGH├ТTFGP/CLQT DGKO )GPGTCNUVCD FGU FGWVUEJGP *GGTGU UKE  X &GKPGU &QRRGNDNCVV FCVKGTV CO  #RTKN  OKV   2T┬╖IGUKGIGNWPF(CMUKOKNGWPVGTUEJTKHVFGT-├МPKIKP4GIGPVKP/CTKC%TKUVKPCFQRRGNVIGHCNVGVWPF6TCIG IGPGJOKIWPIFGU%JGHUFGURTGW┬нKUEJGP)GPGTCNUVCDGU&QRRGNDNCVVFCVKGTV$GTNKPCO,WNKOKV 1TKIKPCNWPVGTUEJTKHV FGU )GPGTCNOCLQTU )TCH X 5EJNKGHHGP FGU UR┬╖VGTGP %JGHU FGU )GPGTCNUVCDU WPF   #WVQTUFGUUQIGP5EJNKGHHGP2NCPU  5V├ТEM++



-+4%*'056##6*'+.+)'4567*.70&8#6+-#0 

1TFGP FGU JN )TGIQTU FGU )TQ┬нGP =1TFQ 5CPEVWU )TGIQTKWU /CIPWU? 8GTNGKJWPIUWTMWPFG \WO   4KVVGTMTGW\H├ТT.WFQXKEQ6JGQFQTQ#TUGPKQ2KUUQV2GTICOGPVFCVKGTVDGK5V2GVGTCO(GDTWCT OKV5VGORGNWPF1TKIKPCNWPVGTUEJTKHVXQP#NQKUKQ-CTFKPCN/CEEJKCIGHCNVGV ++



ex 9755

-#+5'44'+%* $+5  

%*+0#

-CKUGTNKEJGT1TFGPXQO&QRRGNVGP&TCEJGP=рдВчИит╕муво])TQ┬нG8GTNGKJWPIUWTMWPFG0T\WT -NCUUG5VWHGH├ТTFGP)GPGTCNOCLQTUWPF)GPGTCNU┬пNCUWKVGX&GKPGUXGTNKGJGPIGO┬╖┬н'TNC┬нXQP -CKUGT)W├ЩPIZ├П=тАл]тЕЫ▄втАмXQO6CIFGU/QPCVUKO,CJTUGKPGT4GIKGTWPI  CWUIGHGTVKIVKP FGT8GTDQVGPGP5VCFVKP2GMKPICO6CIFGU/QPCVUKO,CJTUGKPGT4GIKGTWPI  OKV MCKUGTNKEJGO 5KGIGN OGJTHCEJ IGHCNVGV <WUCOOGP OKV FGT 6TCIGIGPGJOKIWPI &QRRGNDNCVV FCVKGTV $GTNKPCO/┬╖T\FQRRGNVIGHCNVGV 5V├ТEM4++ (T├ТJG 7TMWPFG FKG XQP #PHCPI CP FWTEJPWOOGTKGTV YWTFGP *GTTP&T)WKFQ/├ТJNGOCPPXQPFGT7PKXGTUKV┬╖V <├ТTKEJUGKCPFKGUGT5VGNNGJGT\NKEJUVH├ТTUGKPG┬кDGTUGV\WPIUJKNHGIGFCPMV

182




URKUNDEN, DOKUMENTE, STATUTEN

ex 9756



-CKUGTNKEJGT1TFGPXQO&QRRGNVGP&TCEJGP=рдВчИит╕муво]8GTNGKJWPIUWTMWPFG0T\WT-NCUUG 5VWHGH├ТTFGPM├МPKINKEJRTGW┬нKUEJGP4GIKGTWPIURT┬╖UKFGPVGPX$QTTKGUKP/CIFGDWTIXGTNKGJGPIGO┬╖┬н 'FKMVFGT-CKUGTKP4GIGPVKP%├ГZK=сГОс║▒6\ G*UK?PCOGPUFGU-CKUGTU)W├ЩPIZ├П=тАл?тЕЫ▄втАмXQO6CI FGU/QPCVUKO,CJTUGKPGT4GIKGTWPI ,CPWCT CWUIGHGTVKIVKP2GMKPICO6CIFGU /QPCVUKO,CJTFGT4GIKGTWPIXQP-CKUGT2W;├Г=сд│тАл( ?█╝тАмGDTWCT OKVMCKUGTNKEJGO5KGIGN XQP2 ;├ГWPF1TKIKPCNWPVGTUEJTKHVXQP;KMWCPI2TKP\3KPIFGU'TUVGP4CPIGU=сГ╕тЮШсоА?2T┬╖UKFGPVGP FGU /KPKUVGTKWOU FGT #WUY┬╖TVKIGP #PIGNGIGPJGKVGP FQRRGNV IGHCNVGV /KV QHHK\KGNNGT ┬кDGTUGV\WPI FGT -CKUGTNKEJ %JKPGUKUEJGP )GUCPFVUEJCHV KP $GTNKP &QRRGNUGKVG WPF 6TCIGIGPGJOKIWPI FGU +PPGPOKPKUVGTKWOU&QRRGNDNCVVFCVKGTV$GTNKPCO#WIWUV 5V├ТEM44++



*GTTP&T)WKFQ/├ТJNGOCPPXQPFGT7PKXGTUKV┬╖V<├ТTKEJUGKCPFKGUGT5VGNNGTJGT\NKEJUVH├ТTUGKPG┬кDGTUGV\WPIUJKNHG IGFCPMV

ex 9757

-┬д0+)4'+%*6*#+.#0& $+55+#/  

&GT 5GJT 'JTGPYGTVG 1TFGP FGT -TQPG XQP 5KCO 8GTNGKJWPIUWTMWPFG \WO )TQ┬нQHHK\KGT H├ТT FGP   2QNK\GK2T┬╖UKFGPVGPX$QTTKGU&QRRGNDNCVVFCVKGTVCO,WNKOKVM├МPKINKEJGO5KGIGNWPF1TKIK PCNWPVGTUEJTKHV   XQP -├МPKI %JWNCNQPIMQTP 4COC 8  \WUCOOGP OKV FGT QHHK\KGNNGP ┬кDGTUGV\WPI KP   GPINKUEJGT5RTCEJG&QRRGNDNCVVDGKFGFQRRGNVIGHCNVGVWPF%QWXGTVFGTVJCKN┬╖PFKUEJGP1TFGPUMCP\NGK 5V├ТEM4++

 183


URKUNDEN, DOKUMENTE, STATUTEN

ex 9758

6ª4-'+ 15/#0+5%*'54'+%* $+5  







184

/GFLKFLKG1TFGP =/GEKFÄ 0KUCPK? 8GTNGKJWPIUHKTOCP \WT  -NCUUG FGU 1TFGPU HÒT FGP )GJGKOGP   5CPKV·VU4CVJ2TQHGUUQT&T6QDQNFKP$GTNKPFCVKGTVOGJTHCEJIGHCNVGV\WUCOOGPOKV6TCIGIG PGJOKIWPIFGU/KPKUVGTKWOUFGTIGKUVNKEJGP7PVGTTKEJVUWPF/GFKEKPCN#PIGNGIGPJGKVGP&QRRGNDNCVV FCVKGTV $GTNKP CO  /CK  FQRRGNVIGHCNVGV&C\WGKP#PMÒPFKIWPIUUEJTGKDGPFGU)GPGTCNUUGMTG V·TUFGT-CKUGTNKEJGP/GFK\KPKUEJGP)GUGNNUEJCHVDGVTGHHGPFFKG#WHPCJOG2TQHGUUQT6QDQNFUCNUMQTTG URQPFKGTGPFGU/KVINKGFFGT)GUGNNUEJCHVFCVKGTV-QPUVCPVKPQRGNCO,WPKFQRRGNVIGHCNVGV  5VÒEM++



/GFLKFLKG1TFGP =/GEKFÄ 0KUCPK? 8GTNGKJWPIUHKTOCP \WT  -NCUUG FGU 1TFGPU HÒT FGP MCKUGTNKEJGP   .GICVKQPU5GMTGV·T (TGKJGTTP XQP 5GGHTKGF CWH $WVVGPJGKO KP -QRGPJCIGP FCVKGTV  OGJTHCEJ IG   HCNVGV OKV \WIGJÌTKIGO ªDGTUGPFWPIU%QWXGTV \WUCOOGP OKV 6TCIGIGPGJOKIWPI FGU #WUY·TVKIGP   #OVUKP$GTNKP&QRRGNDNCVVFCVKGTV$GTNKPCO1MVQDGTFQRRGNVIGHCNVGV 5VÒEM++



/GFLKFLKG1TFGP =/GEKFÄ 0KUCPK? 8GTNGKJWPIUHKTOCP \WT  -NCUUG FGU 1TFGPU HÒT FGP )GJGKOGP   5CPKV·VU4CVJ2TQHGUUQT&T6QDQNFKP$GTNKPFCVKGTVOGJTHCEJIGHCNVGV\WUCOOGPOKVFGTQHHK\K GNNGP ªDGTUGV\WPI FGT -CKUGTNKEJ 1UOCPKUEJGP $QVUEJCHV KP $GTNKP &QRRGNDNCVV FQRRGNV IGHCNVGV WPF   6TCIGIGPGJOKIWPI FGU /KPKUVGTKWOU FGT IGKUVNKEJGP 7PVGTTKEJVU WPF /GFKEKPCN#PIGNGIGPJGKVGP   &QRRGNDNCVVFCVKGTV$GTNKPCO,CPWCT&QRRGNDNCVVFQRRGNVIGHCNVGV 5VÒEM++



/GFLKFLKG1TFGP =/GEKFÄ 0KUCPK? 8GTNGKJWPIUHKTOCP \WT  -NCUUG FGU 1TFGPU HÒT &T 6QDQNF KP   $GTNKPFCVKGTVOGJTHCEJIGHCNVGVCPGKPKIGP5VGNNGPOKPKOCNGKPIGTKUUGP\WUCOOGPOKV#PMÒPFK IWPIUUEJTGKDGPFGT1UOCPKUEJGP)GUCPFVUEJCHVKP$GTNKPXQO/·T\WPF6TCIGIGPGJOKIWPI &QRRGNDNCVVFCVKGTV$GTNKPCO#RTKNOGJTHCEJIGHCNVGV 5VÒEM++




LITERATURVERZEICHNIS AD BA3/01 BK1 BM7 BOI BT BU BVO

BWK1 BWK2 BYO CAM CL CMK

DA7 DIA DWE EF2 EO2 FK FRW GB4 GBH GD

GK2

HF5

HP1 HS

HÜ2

Tammann, Gustav Andreas und Hommel, Engelbert (Hg.): Die Orden und Ehrenzeichen Konrad Adenauers The Orders and Decorations awarded to Konrad Adenauer. Bad Honnef - Rhöndorf 1999. Bartel, Frank: DDR Spezialkatalog 1949 - 1990 Band I: Staatliche Auszeichnungen. 3. Auflage Berlin 2003. Bretzendorfer, Uwe, und Kuhn, Thomas Bulgarien - Militärorden für Tapferkeit von 1879 bis 1945 Preiskatalog 2007 / 2008. Ludwigsburg 2007. Hayward, John, Birch, Diana, und Bishop, Richard: British Battles and Medals. London, 7. Auflage 2006. Boik, William A.: Orders, Decorations and Medals of the Democratic People's Republic of Korea. Springfield VA, 2008. Battushig, A.: Mongolian Orders, Medals & Badges Ulaanbaatar 2005. Stair Sainty, Guy und Heydel-Mankoo, Rafal, (Hg.): Burke's World Orders of Knighthood & Merit. Wilmington (Delaware/USA) 2006. Geiger, Rolf, Lindner, Jürgen, und Wörner, Frank: 50 Jahre Verdienstorden der Bundesrepublik Deutschland. Hof/Saale 2001. In: Orden und Ehrenzeichen - Das Magazin für Sammler und Forscher. 3. Jahrgang (2001), Heft 14. Barac, Borna: Reference Catalogue - Orders, Medals and Decorations of the World institutes until 1945 - Part I - Iron Book - A-D. Zagreb 2009. Barac, Borna: Reference Catalogue - Orders, Medals and Decorations of the World institutes until 1945 - Part II - Bronze Book - D-G. Zagreb 2010. Beyreiß, Friedhelm: Der Hausorden und die tragbaren Ehrenzeichen des Großherzogtums Oldenburg 1813 1918. Norderstedt 1997. Car, Pavel, und Muhić, Tomislav: Serbische und jugoslawische Orden und Ehrenzeichen von 1859 bis 1941. Wien 2009. Collignon, Jean-Pierre: Ordre de Chevalerie - Décorations et médailles de France (des origines à la fin du Second Empire) La Mothe-Archard 2004. Car, Pavel, und Muhić, Tomislav: Preiskatalog für Serbische und Jugoslawische Orden, Medaille und Abzeichen 1858-1941 / Decorations and Badges of Serbia and Yugoslavia 1858-1941 - Price Guide 2008 / Katalog odlikovanja i znakovlja Srbije i Jugoslavije 1858.-1941. Ljubljana und Zagreb 2008. Michaelis, Rolf: Das Scharfschützen-Abzeichen 1944/1945. Berlin 2010. Diakov, Mikhail E.: Medals of the Russian Empire. Ohne Ortsangabe, veröffentlicht in acht Bänden, 2004 bis 2008. Duwe, Georg: Erzkämmerer, Kammerherren und ihre Schlüssel. Osnabrück 1990. Efler, Gert: Deutsche Feuerwehr-Auszeichnungen. Schwalmstadt 2001. Ohm-Hieronymussen, Paul: Handbuch europäischer Orden in Farbe. Berlin 2. Auflage 1975. Hankimo, Olavi, Bergroth, Tom C., und andere: Vapaudenristin Ritarikunta. Porvoo 1997. Fritsche, Lutz: Die Orden und Ehrenzeichen des Großherzogtums Sachsen-Weimar-Eisenach 1815 - 1918. Ilmenau 2012. Gebauer, Wolfram: Die Orden und Ehrenzeichen von Sachsen einschließlich der sächsischen Verdienst-, Prämien-, Preis- und Auszeichnungsmedaillen. Dresden, 4. Auflage 2004. Gebhardt, Klaus: Alois Börsch - Königlich Bayerischer Münz- und Hofmedailleur. München 1998. Gritzner, Maximilian: Handbuch der im Deutschen Reiche, in Österreich-Ungarn, Dänemark, Schweden und den Russischen Ostseeprovinzen bestehenden Damenstifter und im Range gleichstehender Wohltätigkeitsanstalten nebst den Ordenszeichen der Ersteren. Frankfurt am Main 1888. Klenau, Arnhard Graf: Orden in Deutschland und Österreich (Normalausgabe) - Band 2 - Deutsche Staaten 1806 bis 1918, Teil 1 (Anhaltische Staaten - Baden - Bayern - Braunschweig - Hannover - Großherzogtum Frankfurt) Offenbach 2008. Herfurth, Dietrich: Sowjetische Auszeichnungen 1918-1991 - Auszeichnungen der Mongolischen Volksrepublik 1924-1992. Ein Katalog - Fünfte Ausgabe. - Soviet Awards - Awards of the Mongolian People's Republic. Berlin 5. Auflage 2011. Hüsken, André: Kurfürstentum Brandenburg, Markgrafschaft Brandenburg-Ansbach, Markgrafschaft Brandenburg-Bayreuth, Orden des Königreichs Preußen. Bremen 2001. Hessenthal, Waldemar Edler von, und Schreiber, Georg: Die tragbaren Ehrenzeichen des Deutschen Reiches einschließlich der vormals selbständigen deutschen Staaten sowie des Kaisertums und des Bundesstaates Österreich, der Freien Stadt Danzig, des Großherzogtums Luxemburg, des Fürstentums Liechtenstein und der Ehrenzeichen des NSDAP. Originalgetreuer Nachdruck ohne Ort und ohne Jahr der Ausgabe Berlin 1940. Hüsken, André: Katalog der Orden und Ehrenzeichen des Deutschen Reiches 1871-1945. Hamburg 2. Auflage 1999.

185


KDO8

KR15 KRU MEP MK MST MY10 NI NM3

OEK18 ON2 PG PGA PO PT3 RBT RKB SA2 SK SL4 SMO SR STV05 TA TES TH THO TRG TZ VL1 VO VPE1; VPE2 WB WS ZK2

186

Nimmergut, Jörg, Feder, Klaus, und von der Heyde, Rudolf: Deutsche Orden und Ehrenzeichen - Katalog Drittes Reich, DDR und Bundesrepublik - 1933 bis heute - 8. Auflage. Regenstauf, 8. aktualisierte Auflage 2011. Trost, Ludwig: Die Geschichte des St. Michaels-Ordens in Bayern und der St. Michaels-Bruderschaft seit dem Jahre 1693 bis auf die Gegenwart. Nachdruck Hamburg 1975 der Ausgabe München und Leipzig 1888. Klietmann, Dr. Kurt-Gerhard: Phaleristik Rumänien. Berlin 1975. Mulder, C.P.: Persian Orders 1808-1925. Kopenhagen 1990. Marko, Alexander A.: Auszeichnungen der Österreichisch-Ungarischen Monarchie und der Zwischenkriegszeit - Preiskatalog 1997. Linz 1996. Ohm-Hieronymussen, Peter: Die Mecklenburg-Strelitzer Orden und Ehrenzeichen. Kopenhagen 2000. Mussell, John W. (Hg.): Medal Yearbook 2010. Honiton 16. Auflage 2009. Nimmergut, Jörg: Deutsche Orden und Ehrenzeichen bis 1945 - Gesamtausgabe in fünf Bänden. München 1997 bis 2004. Niemann, Detlev: Bewertungs-Katalog Deutschland - Price Guide Germany - Kaтaлoг - 1871-1945 / Orden, Ehrenzeichen, Verleihungs-Urkunden, Miniaturen und Etuis - Orders, Decorations, Award Documents, Miniatures and Cases of Issue - Oрдена, знaки oтличия, наградньіе документьі, миниатюрьі и футлярьі. Hamburg, 3. Auflage 2008. Nimmergut, Jörg; bearbeitet von Dr. Gerd Scharfenberg: Deutsche Orden und Ehrenzeichen 1800-1945 (18. Ausgabe). Regenstauf, 18. komplett überarbeitete und aktualisierte Auflage 2010. Werlich, Robert: Orders and Decorations of all Nations – Ancient and Modern – Civil and Military. Washington 2. Auflage 1974, zweiter Druck 1990. Pérez Guerra, José Manuel: Ordenes y Condecoraciones de Espana 1800 - 1975. Saragossa 2000. Procházka, Roman Freiherr von: Österreichisches Ordenshandbuch – Große Ausgabe - Band 1 bis 4. München 1979. Poliano, Luis Marques: Ordens Honorificas do Brasil. Rio de Janeiro 1943. Peterson, James W., Weaver, Baryy C. und Quigley, Michael A.: Orders and Medals of Japan and Associated States. San Ramon, 2000. Risk, James Charles: The History of the Order of the Bath and its Insignia. London 1972. Ruokonen, Antti: The Spirit of the Lion - Orders of Belgium. Vaasa 2012. Sanko, W. W. (Hg.): Nagradnie i pamjatnie snaki Rossii - Decorations and Memorial Badges of Russia - Ehrenund Gedenkzeichen Rußlands. Minsk 2003. Schwark, Reiner: Orden und Ehrenzeichen des Fürstentums Lippe Detmold. Detmold 2006. Sallach, Alexander von: Die Orden und Ehrenzeichen unserer Republik - Vierte Auflage. Regenstauf, vierte vollkommen überarbeitete und erheblich erweiterte Auflage 2011. Sonnenberg, Hein: Mongolische Auszeichnungen - Mongolian Awards - 1920-1992. München 2008. Schmitt, Rainer: Die Auszeichnungen der Volksrepublik und der Sozialistischen Republik Rumänien 1948 bis 1989. Offenbach am Main 2001. Stevnsborg, Lars: Kongeriget Danmarks Ordener, Medaljer og Haederstegn. Odense 2005. Autengruber, Michael, und Tammann, G. Andreas: Katalog zur 80. Auktion 5. und 6. November 2008: Orden aus aller Welt – Sammlung Tammann / World Orders – Collection Tammann. Basel 2008. Autorengemeinschaft Schade/Gößwein/Hoffmann/Berger/Oblentz: Die tragbaren Ehrenzeichen des Königreiches Sachsen 1806-1918. Altenburg 2011. Thies, Andreas, und Hapke, Wilhelm.: Orden und Ehrenzeichen des Königreiches Hannover. Hamburg 1981. Thornit, Per: The Royal Commemorative and Coronation Medals of Scandinavia. Kopenhagen 1984. Trigueiros, António M., und Tammann Gustav A.: The Three Portugesse Military Orders of Knighthood 1789 1910. Glassboro 1997. Tazedakis, Panos N.: The Order of the Redeemer - Anatomy and pathology of the insignia of the Greek Order of the Redeemer. Athen 1994. Volle, Henning: Badens Orden. Freiburg 1976. Voss, Thomas: Das Scharfschützenabzeichen der Deutschen Wehrmacht und seine Geschichte. Norderstedt 2003. Volpe, Mario: Signs of Honour - Compendium of orders of knighthood and honours of Italy, Europe and the rest of the World. Rom 2009. Weber, Dieter, Arnold, Paul, und Keil, Peter: Die Orden des Königreichs Sachsen. Offenbach am Main 1997. Wesolowski, Dr. Zdzislaw P.: Polish Orders, Medals, Badges and Insignia - Military and Civilian Decorations 1705 - 1985. Miami 1986. Zeige, Carsten: Europäische Orden (ohne Deutschland) von 1700 - 1990 - Preiskatalog 2009. Hamburg, 2. Ausgabe 2009.


eLive Auction NEU Mit unseren eLive Auctions bieten wir Ihnen die Möglichkeit, direkt und unkompliziert über das Internet an regelmäßigen Auktionen mit einem virtuellen Auktionator live teilzunehmen.

NEW With our eLive Auctions, we offer you a direct and easy opportunity to participate in regular auctions live over the Internet.

Bequem von zuhause oder unterwegs können Sie Vorgebote abgeben und abschließend – ganz wie in einer echten Auktion im Bieterwettstreit mit anderen – den Ausgang der Auktionen live am Bildschirm für sich entscheiden.

From the convenience of your own home or when travelling, you can submit preliminary bids, and up to the last moment of the sale – as in a real auction, vying with other bidders – you can win auctions live on your computer screen.

Weitere Informationen erhalten Sie unter www.elive-auction.de/hilfe

Additional information is available at www.elive-auction.com/help

Künker eLive Auction: live auf www.elive-auction.de


Leitfaden zur erfolgreichen schriftlichen Auktionsteilnahme • • • • •

Studieren Sie den Katalog sorgfältig und notieren Sie alle Lose, die interessant für Sie sind. Legen Sie für jedes Los Ihr persönliches Limit fest, das Sie maximal zu zahlen bereit sind. Füllen Sie das beiliegende Formular aus (siehe unten) und tragen Sie für jedes Los Ihr Höchstgebot ein. Schicken Sie uns Ihren Auftrag frühzeitig. Bei gleich hohen Geboten erhält das zuerst eingegangene Gebot den Zuschlag. Sie haben interessante Lose für insgesamt € 10.000,– gefunden, möchten jedoch nur € 2.000,– ausgeben. Kein Problem: Sie geben als Gesamtlimit (ohne Aufgeld) € 2.000,– an. • Wenn Sie Fragen haben: Die MitarbeiterInnen unserer Kundenbetreuung sind für Sie da: Telefon 0800 583 65 37 (gebührenfrei). • Wenn Sie telefonisch an unseren Auktionen teilnehmen möchten, ist das ab einer Schätzung von € 500,– pro Los möglich. Bitte teilen Sie uns diesen Wunsch mindestens einen Werktag vor Beginn der Versteigerung schriftlich mit.

Musterauftrag für schriftliche Gebote Name, Adresse, Telefon Ihre vollständige Anschrift ist wichtig, damit wir Ihren Auktionsauftrag annehmen und bearbeiten können. Ihre Telefonnummer brauchen wir, um Sie bei Rückfragen zu Ihren Geboten schnell erreichen zu können.

Ihre Kundennummer Die Angabe Ihrer Kundennummer unterstützt uns bei der Bearbeitung Ihres Auktionsauftrages. Viele Vorarbeiten für die Auktion werden dadurch einfacher und es werden Fehler vermieden.

Losnummern und Gebote Listen Sie alle Lose, für die Sie sich interessieren, mit ihrer Katalognummer auf und legen Sie für sich selbst fest, wie viel Sie bereit sind, für jedes einzelne Los zu bieten.

Ihr Limit pro Einzellos An dieser Stelle geben Sie an, was Sie für jedes einzelne Stück maximal bereit sind auszugeben.

„Oder“-Gebote Wenn Sie sich für mehrere Münzen interessieren, aber nur ein Stück davon erwerben wollen, können Sie Ihre Gebote einfach mit einem „Oder“ verbinden. Wichtig: bei den „Oder“Geboten können Sie nicht auf frühere Katalognummern zurückgreifen (z. B. 2890 oder 1558), da die Nr. 1558 dann bereits versteigert ist. Unterschreiben Sie Ihren Auktionsauftrag ... ... nachdem Sie Ihre Angaben noch einmal überprüft haben. Ihre Unterschrift ist wichtig, denn damit bestätigen Sie uns, dass sie tatsächlich teilnehmen wollen.

Überschreitung Ihrer Limits pro Einzellos In der Praxis zeigt sich, dass oft mehrere Bieter mit ihren Geboten dicht beieinander liegen. Deshalb empfiehlt es sich, an dieser Stelle einer geringfügigen Überschreitung Ihrer Gebote zuzustimmen. Dadurch erhöhen sich Ihre Chancen, im Wettbewerb mit anderen den Zuschlag zu erhalten.

Begrenzung Ihres Gesamtlimits Hier können sie die Gesamtsumme Ihrer Gebote begrenzen und festlegen, was Sie insgesamt maximal bereit sind auszugeben. Aufgeld und Mehrwertsteuer kommen später noch hinzu.

TEL +49 (0)541 96 20 20, FAX +49 (0)541 96 20 222, SERVICE@KUENKER.DE, WWW.KUENKER.DE


Wie entsteht der Preis einer Auktion? Der im Auktionskatalog angegebene Preis ist ein Schätzpreis, der durch unsere Experten festgelegt wurde. Das Mindestgebot liegt bei 80 % dieses Wertes. Die Zuschlagpreise sind oft deutlich höher als die Schätzpreise. Als Auktionshaus müssen wir bereits vor der Auktion alle schriftlichen Gebote koordinieren. Folgende Beispiele sind im Bietverfahren möglich: Beispiel 1 (Schätzpreis: € 1.000,–) Es liegt kein schriftlicher Auftrag vor: Der Auktionator ruft das Los in der Auktion mit € 800,– aus. Wenn im Saal nur ein Bieter darauf ein Gebot abgibt, erhält der Saalbieter den Zuschlag für € 800,–.

Beispiel 3 (Schätzpreis: € 1.000,–) Es liegt dem Auktionator nur ein schriftliches Gebot von € 850,– vor: Das Los wird in der Auktion mit € 800,– ausgerufen. Falls kein Bieter im Saal ein Gegenangebot abgibt, erhält der schriftliche Bieter den Zuschlag bei € 800,–.

Beispiel 2 (Schätzpreis: € 1.000,–) Es liegen dem Auktionator drei schriftliche Gebote vor:

Beispiel 4 (Schätzpreis: € 1.000,–) Es liegt dem Auktionator nur ein schriftliches Gebot von € 1.200,– vor: Der Auktionator ruft das Los mit € 800,– aus. Gibt es im Saal keinen Gegenbieter, erhält der schriftliche Bieter den Zuschlag bei € 800,–. Falls es im Saal Gegenbieter gibt, bietet der Auktionator für seinen schriftlichen Bieter bis maximal € 1.200,– und erteilt einem Gegenbieter im Saal erst bei mehr als € 1.200,– den Zuschlag.

Bieter 1: Limit € 2.900,– Bieter 2: Limit € 1.800,– Bieter 3: Limit € 800,– Nach der Versteigerungsordnung muss der Auktionator im Interesse von Bieter 1 und 2 angemessen überbieten (um ca. 5 bis 10 %). Der Ausrufpreis in der Auktion beträgt daher im Interesse von Bieter 1 € 1.900,– (obwohl die Schätzung € 1.000,– beträgt). Falls keine höheren Gebote aus dem Saal erfolgen, erhält Bieter 1 den Zuschlag für € 1.900,–. Das Höchstangebot von € 2.900,– musste nicht ausgeschöpft werden.

Beispiel 5 (Schätzpreis: € 1.000,–) Es liegen drei Gebote von je € 975,– vor: Um Missverständnisse zu vermeiden, überzieht der Auktionator das zuerst eingegangene Gebot geringfügig und erteilt den Zuschlag bei € 1.000,–.

Antworten auf Fragen, die uns oft gestellt werden • Zuschlagpreis/Aufgeld: Wir berechnen als Auktionshaus ein Aufgeld von 15 % auf den Zuschlagpreis, dazu kommt die gesetzliche Mehrwertsteuer. Beispiel 1

Zuschlagpreis Aufgeld 15 % Versandkosten, z. B. * MwSt. 7 % Rechnungs-Betrag

€ € € € €

100,00 15,00 5,90 8,46 129,36

Beispiel 2

Zuschlagpreis Aufgeld 15 % Versandkosten, z. B. * MwSt. 7 % Rechnungs-Betrag

€ 1.000,00 € 150,00 € 5,90 € 80,91 € 1.236,81

• Mehrwertsteuer: üblicherweise in Deutschland 7 %, seit dem 01.01.2000 sind viele Goldmünzen, die nach 1800 geprägt wurden, steuerfrei. Bei Fragen zu der MwSt.-Berechnung rufen Sie uns an, gebührenfrei unter: 0800 583 65 37. • Rücklosverkauf: Alle Lose, die in der Auktion nicht verkauft wurden, können Sie innerhalb von vier Wochen nach der Versteigerung zu 80 % des Schätzpreises (zzgl. Aufgeld und Mehrwertsteuer) erwerben. Achtung: Viele Rücklose sind schnell vergriffen. • Unser Spezialservice: Alle Bieter erhalten gratis die Ergebnisliste innerhalb von zwei Wochen nach der Auktion. Im Internet können Sie die Ergebnisliste der Auktion sofort nach der Auktion unter www.kuenker.de einsehen. * Die Kosten für Versand und Versicherung werden nach Aufwand berechnet.

Besuchen Sie uns doch einmal persönlich auf der Auktion! • Wir freuen uns sehr, wenn Sie persönlich nach Osnabrück kommen möchten. Das Flair einer Auktion und die Stimmung im Auktionssaal sind ein besonderes Erlebnis für Sie als Sammler. Osnabrück ist außerdem immer eine Reise wert und die persönliche Betreuung durch unsere Mitarbeiter wissen immer mehr Kunden zu schätzen. • Bitte rufen Sie uns rechtzeitig an, damit wir Ihnen Tipps für die Anreise geben und Ihnen ein Hotelzimmer reservieren können. Sie erreichen uns gebührenfrei unter: 0800 583 65 37. • Als erfolgreicher Bieter können Sie Ihre neu erworbenen Stücke gleich persönlich mit nach Hause nehmen. Als guter Kunde unseres Hauses haben Sie 20 Tage Zahlungsziel nach der Auktion.

TEL +49 (0)541 96 20 20, FAX +49 (0)541 96 20 222, SERVICE@KUENKER.DE, WWW.KUENKER.DE


Важная информация об участии на аукционе • Наши аукционные правила и условия Вы можете найти в конце каталога. • Мы просим Вас присылать Ваши ставки заранее. В противном случае вероятность ошибки при обработке заказа, присланного перед самым аукционом, возрастает. • Приложенный образец заполнения письменного заказа поможет Вам при отправлении Ваших письменных ставок. Ставки можно отправить как по почте, так и по факсу : +49 (0)541–96 20 222 круглосуточно. • Успешные заказы будут обрабатываться в порядке их поступления к нам. Все участники, которым не удалось что-либо купить на аукционе, будут также проинформированы после аукциона. • Если Вы впервые принимаете участие в нашем аукционе, то мы рекомендуем Вам сообщить нам Ваш референц – аукционные дома, с которыми Вы уже сотрудничали. Или свяжитесь с нами по телефону. • Мы гарантируем подлинность всех предметов, проданных на нашем аукционе, в течении неограниченного времени. • Все участники нашего аукциона получают в течении 2-ух недель результаты торгов бесплатно. • У Вас есть вопросы по определенной монете? Вы хотели бы лично принять участие в аукционе? У Вас возникли другие вопросы? Звоните нам по телефону +49 (0)541-96 20 268, и мы будем рады Вам помочь.

Мое заочное участие на аукционе • • • •

Тщательно изучите наш каталог и запишите те лоты, которые Вас заинтересовали. Определите для Себя ту максимальную сумму, которую Вы готовы заплатить за каждый лот. Заполните приложенный формуляр. Отправьте нам Ваш заказ заранее. При 2-ух и более равных ставок на один и тот же лот преимущество получает ставка, пришедшая к нам первой ( ранее других ). • Если стоимость выбранных Вами лотов составляет например 10.000 евро, а Вы могли бы потратить только 2.000 евро, то в этом случае укажите Ваш общий лимит в размере 2.000 евро. • Если у Вас возникли вопросы по заполнению формуляра, звоните нам по телефону +49 (0)541-96 20 268. Наши сотрудники будут рады Вам помочь.

Мое личное участие в Оснабрюке • Мы будем рады Вашему личному присутствию в Оснабрюке. Атмосфера, которая стоит во время аукционных торгов в зале, особенная и непередаваемая. • Для получения более подробной информации по Вашей поездке в Оснабрюк, в частности, бронирования номеров в гостинице, мы просим Вас заранее связаться с нами по телефону: +49 (0)541-96 20 268. • Приобретенные на аукционе лоты Вы можете лично забрать после окончания торгов. Наши постоянные клиенты осуществляют оплату в течение 20 дней после получения счета. Участвующие в аукционе впервые осуществляют 100%-ую предоплату.

Участие по интернету Все каталоги доступны для просмотра на нашем сайте в интернете по адресу www.kuenker.de. На сайте Вы можете выбрать интересующие Вас лоты и отправить Ваши ставки на нашу электронную почту service@kuenker.de. Если у Вас возникнут дополнительные вопросы, мы просим Вас связаться с нами по телефону +49 (0)5 41-96 20 268.

Участие по телефону Для участия в торгах по телефону просим Вас связаться с нами не позднее 48 часов до начала аукциона. Условием проведения телефонных торгов является письменное подтверждение ставки, равной как минимум стартовой цене. Участие в телефонных торгах возможно только для лотов со стартовой ценой свыше 500 евро. Для получения дополнительной информации и регистрации на аукционе звоните Анастасии Кепселль до аукциона по телефону +49 (0)5 41-96 20 268 и во время аукциона по телефону, указанному на первой странице каталога.

TEL +49 (0)541 96 20 20, FAX +49 (0)541 96 20 222, SERVICE@KUENKER.DE, WWW.KUENKER.DE


Как образовывается цена на аукционе? • Все лоты в нашем каталоге были предварительно оценены нашими экпертами. Минимальная ставка составляет 80 % от оценочной стоимости лота. Конечные цены зачастую намного превышают оценочные. • Ваши письменные ( заочные ) ставки должны быть обязательно обработаны нашими сотрудниками до начала аукциона. Рассмотрим несколько возможных примеров: Пример 1 ( Оценочная стоимость: € 1.000,– ) Заочных ставок нет. Аукционатор начинает торги с € 800,–. Если в зале только один человек, желающий приобрести этот лот, то соответственно он получит его за € 800,–. Пример 2 ( Оценочная стоимость: € 1.000,– ) У аукционатора имеются 3 заочные ставки: Заочный участник 1 : Лимит € 2.900,– Заочный участник 2 : Лимит € 1.800,– Заочный участник 3 : Лимит € 800,– По правилам аукциона аукционатор в интересах заочного участника 1 и 2 должен повышать ставку равномерно ( приблизительно на 5 – 10 % ). Поэтому в нашем случае в интересах заочного участника 1 аукционатор начнет торги с € 1.900,– ( хотя оценочная стоимость составляет € 1.000,–). Если среди очных участников никто не даст более высокую ставку, то заочный участник 1 получит этот лот за € 1.900,–. Его лимит в € 2.900,– ни в коем случае не будет исчерпан.

Пример 4 (Оценочная стоимость: € 1.000,– ) У аукционатора имеется только 1 заочная ставка в размере € 1.200,–. Аукционатор начнет торги с € 800,–. Если среди очных участников никто не даст более высокую ставку, то заочный участник получит этот лот за € 800,–. Если же в зале очный участник согласен на более высокую ставку ( больше € 800,– ), то в этом случае аукционатор в интересах заочного участника имеет право тоговаться до € 1.200,–. Следовательно только при ставке, превышающей € 1.200,–, данный лот получит очный участник в зале. Пример 5 (Оценочная стоимость: € 1.000,– ) У аукционатора имеются 3 заочные ставки, каждая в размере € 975,–. Среди очных участников интереса к лоту не имеется. В этом случае чтобы избежать недоразумений, аукционатор имеет право ненамного повысить лимит и сделать ставку равной € 1.000,–. Данный лот за € 1.000,– получит тот заочный участник, чей письменный формуляр мы получили раньше всего.

Пример 3 (Оценочная стоимость: € 1.000,– ) У аукционатора имеется только 1 заочная ставка в размере € 850,–. Аукционатор начнет торги с € 800,–. Если среди очных участников никто не даст более высокую ставку, то заочный участник получит этот лот за € 800,–.

Как я могу получить приобретенные лоты? Вывоз приобретенных на аукционе предметов осуществляется одним из следующих способов по Вашему выбору: • Вы можете лично забрать Ваши лоты. По окончании торгов мы готовим все необходимые документы на вывоз из Германии. При вывозе за пределы Евросоюза, НДС Вам возвращается. • Почтовые отправки в Россию ( Беларусь, Украину ) приобретенных Вами лотов осуществляются по предварительной договоренности. Для связи с нами звоните нам по телефону +49 (0)541-96 20 268. С 1971 года имя Кюнкер является гарантией надежности и компетентности. Мы не станем изменять нашим принципам и в будущем. Спасибо Вам за Ваше доверие, которое является не только самым сильным стимулом в нашей работе, но и наилучшей ее оценкой. Я желаю Вам успехов на нашем аукционе!

Фриц-Рудольф Кюнкер

TEL +49 (0)541 96 20 20, FAX +49 (0)541 96 20 222, SERVICE@KUENKER.DE, WWW.KUENKER.DE


Versteigerungsbedingungen Die Versteigerung erfolgt im Auftrag und für Rechnung der Eigentümer unter Einhaltung der sich aus der Versteigerungsordnung (BGB1 I 1976, 1346) ergebenden und für Kommissionäre geltenden gesetzlichen Bestimmungen des BGB und HGB gegen Barzahlung des Kaufpreises in €-Währung. Durch Abgabe eines Gebotes werden die Versteigerungsbedingungen anerkannt, dies gilt auch für die schriftlichen Gebote. Der Zuschlagpreis ist Nettopreis im Sinne des Umsatzsteuergesetzes und bildet die Berechnungsgrundlage für das vom Käufer zu zahlende Aufgeld in Höhe von 15 %. Auf den daraus entstehenden Gesamtpreis (Zuschlag + Aufgeld) wird die jeweils gültige Umsatzsteuer erhoben, soweit dies gesetzlich vorgeschrieben ist. Ausländischen Käufern aus Ländern der europäischen Gemeinschaft wird die in Deutschland gültige Umsatzsteuer berechnet. Anderen ausländischen Käufern (aus Drittländern) wird, sofern die Münzen durch uns exportiert werden, ein Aufgeld von 15 % netto auf den Zuschlagpreis berechnet; sie erhalten die Lieferung nur gegen Zahlung des Kaufpreises in €-Währung, bankspesenfrei. Ausländischen Münzhändlern aus Ländern der europäischen Gemeinschaft wird bei Nachweis der Umsatzsteuer-Identifi kationsnummer (§ 27 a USTG) und der sonstigen Voraussetzungen gemäß § 4 Nr. 1 b USTG in Verbindung mit § 6 a USTG die Lieferung ohne Umsatzsteuer berechnet. Sofern nichts anderes vereinbart wird, ist die Zahlung der Auktionsrechnung bei anwesenden Käufern sofort, bei schriftlichen Bietern spätestens 20 Tage nach Erhalt fällig. Bei Zahlungsverzug werden Zinsen von 1 % pro Monat berechnet. Wird die Zahlung nicht sofort an den Versteigerer geleistet oder die Abnahme der zugeschlagenen Sache verweigert, so findet die Übergabe der Sache an den Ersteigerer nicht statt. Der Ersteigerer verliert vielmehr seine Rechte aus dem Zuschlag, und die Sache kann auf seine Kosten erneut versteigert werden. In diesem Fall haftet der Ersteigerer für den Ausfall, dagegen hat er auf den Mehrerlös keinen Anspruch. Der Zuschlag erfolgt nach dreimaligem Ausruf des höchsten Gebotes und verpflichtet zur Abnahme und Zahlung. Bei Meinungsverschiedenheiten über den Zuschlag wird die Nummer noch einmal ausgerufen. Der Versteigerer ist berechtigt, Nummern zu vereinigen oder zu trennen. Eine Vorausnahme von Nummern erfolgt nicht. Der Zutritt zur Versteigerung ist nur Interessenten gestattet, die einen Katalog besitzen. Die Mindeststeigerungsstufen für das Bietungsverfahren betragen: Gebote

Mindeststeigerungsstufe

Schriftliche Aufträge werden von uns ohne Auftragsprovision gewissenhaft ausgeführt. Aufträge von uns unbekannten Sammlern können nur ausgeführt werden, wenn ein Depot hinterlegt wird oder Referenzen benannt werden. Schriftliche Gebote können nur bis 24 Stunden vor Auktionsbeginn verbindlich berücksichtigt werden. Im Bedarfsfall ist der Auktionator berechtigt, die Limits um 3 – 5 % zu überschreiten. Bei mehreren gleichhohen Geboten erhält das zuerst eingegangene den Zuschlag. Unlimitierte Aufträge haben keinen Anspruch auf unbedingte Ausführung. Telefonisches Bieten ist nur in Ausnahmefällen möglich. Telefonische Bieter müssen sich mindestens einen Werktag vor der Auktion voranmelden. Der Versand geht zu Lasten und auf Risiko des Ersteigerers bzw. Empfängers. Das Auktionsgut bleibt bis zur vollständigen Bezahlung aller Forderungen aus Anlass der Versteigerung Eigentum des Verkäufers. Ist der Käufer Vollkaufmann, so ist Osnabrück als Gerichtsstand vereinbart. Für das Mahnverfahren gilt die Zuständigkeit des Amtsgerichts Osnabrück auch in allen anderen Fällen als vereinbart. Ansonsten ist es Osnabrück nur, wenn nur die Firma Fritz Rudolf Künker GmbH & Co. KG ihren allgemeinen Gerichtsstand in der BRD hat, oder wenn alle Ansprüche im Wege des Mahnverfahrens geltend gemacht werden, oder wenn die im Klageweg in Anspruch zu nehmende Vertragspartei nach Vertragsabschluss ihren gewöhnlichen Aufenthaltsort aus dem Geltungsbereich der BRD verlegt hat, oder ihr Wohnsitz oder gewöhnlicher Aufenthaltsort zum Zeitpunkt der Klage nicht bekannt ist. Die Beschreibung im Katalog ist gewissenhaft durchgeführt. Sie begründet jedoch keine Rechts- oder Sachmängelhaftung gemäß §§ 434, 459 ff BGB. Die Angabe der Erhaltung ist streng nach den im deutschen Münzhandel üblichen Erhaltungseinstufungen vorgenommen und gilt als persönliche Beurteilung. Bei der Auktion anwesende Käufer kaufen grundsätzlich „wie besehen“. Da durch Vorbesichtigung Gelegenheit gegeben ist, sich vom Erhaltungszustand des Versteigerungsgutes zu überzeugen, können nach erfolgtem Zuschlag Reklamationen nur bei irrtümlich übersehener Henkel- oder Fassungsspur oder gestopftem Loch berücksichtigt werden. Bei Losen mit mehreren Stücken sind die Stückzahlen nur Circa-Angaben, irrtümliche Zuschreibungen sind im Einzelfall nicht ausgeschlossen. Diese Lose sind nach erfolgtem Zuschlag von jeder Reklamation ausgeschlossen. Der Versteigerer kann bei eventuellen Meinungsverschiedenheiten bzw. Beanstandungen einen vereidigten Sachverständigen seiner Wahl (die Kosten trägt der unterliegende Teil) beauftragen. Eventuelle Beanstandungen können nur innerhalb von 8 Tagen nach der Auktion bzw. nach Erhalt der ersteigerten Stücke berücksichtigt werden. Die Echtheit der Stücke wird bis zur Höhe des Kaufpreises garantiert. Die beigedruckten Preise sind Schätzpreise, die unter- oder überschritten werden können. Aufträge, die unter 80 % des Schätzpreises liegen, können nicht bearbeitet werden.

bis zu

€ 100,–

€ 5,–

bis zu

€ 200,–

€ 10,–

bis zu

€ 500,–

€ 20,–

bis zu

€ 1.000,–

€ 50,–

bis zu

€ 2.000,–

€ 100,–

Soweit nicht anders vermerkt, gelten im übrigen die allgemeinen Versteigerungsbestimmungen und – auch im Verhältnis zu ausländischen Kunden – gilt Deutsches Recht.

bis zu

€ 5.000,–

€ 200,–

Die Ergebnisliste erscheint sofort nach der Auktion.

bis zu

€ 10.000,–

€ 500,–

bis zu

€ 20.000,–

€ 1.000,–

bis zu

€ 50.000,–

€ 2.000,–

bis zu

€ 100.000,–

€ 5.000,–

ab

€ 100.000,–

€ 10.000,–

Ausländische Kunden kaufen nach den Devisen-, Zoll- und Steuerbestimmungen ihres Landes. Versandformalitäten werden vom Versteigerer erledigt.

Die Versteigerer:

Fritz Rudolf Künker Dr. Andreas Kaiser Arne Kirsch Oliver Köpp

TEL +49 (0)541 96 20 20, FAX +49 (0)541 96 20 222, SERVICE@KUENKER.DE, WWW.KUENKER.DE


Terms and Conditions of Auction The auction is conducted on behalf and for the account of the appropriate proprietors of the goods and is subject to the federal Auction Regulation (Versteigerungsordnung, BGB1 I 1976, 1346) published in the Federal Law Gazette Vol. I, 1976, 1346 and the relevant provisions for factors in accordance with the German Civil Code (BGB) and Commercial Code (HGB). Payment of the hammer-price has to be made in cash and in Euro. The submission of an offer implies the express acknowledgement of these Terms and Conditions of Auction; the same applies to the submission of an offer in writing. The hammer-price is exclusive of applicable German VAT according to the prevailing VAT-legislation and represents the basis for calculating the surcharge of 15  percent payable by the purchaser. The total price so calculated (hammer-price plus surcharge) is subject to the VAT (value added tax = Mehrwertsteuer), which is payable additionally. Purchasers from abroad will be charged a surcharge of 15 percent net on the hammerprice, provided the export of the coins is undertaken by the auctioneer. Buyers in European Community (EEC) countries (other than Germany) will be charged value added tax at the rates prevailing in Germany. Dealers from EEC countries (other than Germany) will receive goods free of tax upon presentation of their VAT ID number, and upon fulfillment of the other conditions set forth in Paragraph 4, Nr. 1 b, and Paragraph 6 a of the German Turnover Tax Law Buyers from other countries are not charged value added tax. Delivery will be made against payment in Euro with no bank charges to the auctioneer. Unless mutually agreed otherwise, payment of the auction bill from purchasers present at the auction is due immediately. From purchasers who have submitted a bid in writing, payment is due within 20 days after receipt of the goods. Defaulted payments shall bear an interest charge of 1 % per month in the amount in default. Should payment to the auctioneer not be made immediately or should the acceptance of the awarded item be refused, such item shall not be handed over to the purchaser. Instead the purchaser shall forfeit all right and title in and to such item from the award and the item may again be put to auction at this buyer’s cost. In this event the buyer shall be liable for any shortfall, while he shall have no right or claim towards any excess proceeds. An item will be knocked down after the highest bid has been called three times. The award shall be a binding commitment and liability on the part of the bidder to take acceptance and delivery of the item or items so awarded. In the event of any dispute with regard to the award the lot will be put up again for bidding. The auctioneer reserves the right to combine or to separate lots. Lots will not be called out of sequence. Access to the auction will only be permitted to interested persons who are in possession of the catalogue.

lot, the bid first received by the auctioneer shall be given the award. Unlimited bids shall not oblige the auctioneer to consider, accept or carry out such order. Telephone bidding is generally an option for lots of substantial value only. The registration is required at the latest a day before auction. Shipment (by mail or otherwise) of the goods shall be for the sole cost and risk of the purchaser or recipient, respectively. The auctioned goods remain the sole and exclusive property of the vendor until full payment and settlement of any and all dues and claims in connection with the auction. In the event the purchaser is a merchant (in the sense of the German commercial laws) Osnabrück shall be the agreed and exclusive place of jurisdiction. The competence of the District Court (Amtsgericht) of Osnabrück is agreed in respect of summary proceedings for the collection of defaulted payments (Mahnverfahren) as well as in any and all other cases. Should the purchaser not be a merchant Osnabrück shall be the place of jurisdiction with the District Court of Osnabrück’s competence, if only the auctioneer has his ordinary legal domicile in the Federal Republic of Germany or if claims are made by way of summary proceedings of collection (Mahnverfahren) or if the defendant has moved his ordinary legal domicile outside the jurisdiction of the Federal Republic of Germany or if the legal domicile of the defendant is unknown to the auctioneer at the time of filing a suit. To the exclusion of any other legislation German law, as in force at the time, shall be applied for the settlement of any and all legal or judicial matters. The specifications and descriptions in the catalogue have been prepared diligently and in good faith, however, do not constitute the acceptance by the auctioneer of any warranty or liability in respect of defect in material or title. The state of preservation of items is strictly assessed in accordance with the grades accepted by the German coin trade and only represents an individual and personal assessment. Purchasers present at the auction acquire items strictly on the basis of “as is where is” and “as inspected”. In view of the opportunity of prior inspection to ascertain the state and condition of the auction lots, complaints and objections made after the sale will only be considered, if by obvious error or mistake loop or traces or mountings, traces of trimmings or settings, or the plugging of a hole (eyelet) have remained unnoticed. If and when auctioned in lots, the quantities of individual pieces given, only represent an approximate figure. An error in the allocation of individual pieces to a certain lot cannot be excluded. Such lots are, therefore, excluded from any complaints or objections after the lot is knocked down. In the event of disputes or complaints as to the quality of an item the auctioneer may call upon a generally sworn expert of the trade, which the auctioneer may choose at his sole discretion, for assessment and the rendering of a decision as to the justification of such dispute or complaint. The costs of such expert shall be borne by the party loosing the dispute according to the expert’s decision. Complaints or objections, if justified, will only be considered if made and received by the auctioneer within 8 days after the auction or after receiving the lots, respectively.

The minimum rates of increase for the bidding procedure are: offers up to up to up to up to up to up to up to up to up to up to above

€ 100.– € 200.– € 500.– € 1,000.– € 2,000.– € 5,000.– € 10,000.– € 20,000.– € 50,000.– € 100,000.– € 100,000.–

minimum increase rate € 5.– € 10.– € 20.– € 50.– € 100.– € 200.– € 500.– € 1,000.– € 2,000.– € 5,000.– € 10,000.–

Orders submitted in writing will be carried out diligently and without charge of an extra commission. Orders from collectors unknown to the auctioneer can only be accepted and carried out if a deposit or references to the satisfaction on the auctioneer are given. To be bindingly accepted, written bids need to be received at least 24 hours before auction. If necessary, the auctioneer is allowed to increase the bids by 3 – 5 %. Should several bids be obtained in writing bidding the same price or prices for a given

The authenticity of the coins is warranted up to the total purchase price. The prices set out in the catalogue are estimates only, which may be exceeded or undercut. Orders for less than 80 per cent of the estimated price cannot be accepted. Purchasers from abroad will have to observe all applicable laws and regulations in respect of foreign exchange, customs duties and taxation of their country. The auctioneer will only discharge such formalities, which have to be observed, in the Federal Republic of Germany in connection with the export of the purchased item(s). Unless stipulated otherwise herein, the general rules regulations for auctions applicable in Germany shall govern any transaction in respect of the auction; German Law shall also be applicable in relation to purchasers from abroad. Only the German text has legal force. The prices realized will be published in the form of a list immediately after the auction. The auctioneers:

Fritz Rudolf Künker Dr. Andreas Kaiser Arne Kirsch Oliver Köpp

TEL +49 (0)541 96 20 20, FAX +49 (0)541 96 20 222, SERVICE@KUENKER.DE, WWW.KUENKER.DE


Numismatische Ausdrücke/Numismatic Terms/Expressions Numismatiques/ Termini di Numismatica/Нумизматические Термины DEUTSCH

ENGLISH

FRANCAIS

ITALIANO

RUSSKIJ

Abschlag Am Rand Berieben Blei Dezentriert Doppelschlag Einfassung Einseitig Emailliert Erhaltung Etwas Exemplar Fassungsspuren Fehlprägung

struck at the rim/border slightly polished lead uncentered double struck frame uniface enamelled condition/preservation slightly specimen, copy trace of mounting mis-strike

frappe en tranche frotté plomb décentré double frappe encadrement uniface émaillé conservation un peu exemplaire traces de monture défaut de frappe

coniazione al bordo trattato piombo non centrato ribattitura cornice uniface smaltato conservazione un poco esemplare tracce di montatura difetto di coniazione

Feld(er) Fundexemplar Gedenkmünze Geglättet Gelocht Geprägt Gewellt Goldpatina Henkelspur Hübsch Jahrh. = Jahrhundert Kl. = klein Korrosionsspuren Kratzer Kupfer Legierung Leicht(e) l. = links Min. = minimal Nachahmung Prachtexemplar Prägeschwäche Randdelle Randfehler Randschrift r. = rechts Rückseite

field(s) specimen from a hoard commemorative coin tooled holed minted bent golden patina mount mark attractive century small traces of corrosion scratch(es) copper alloy slightly left minimal imitation attractive, perfect piece weakly struck edge nick edge faults lettered edge to right reverse

champ exemplaire de trouvaille monnaie commémorative retouché troué frappé ondulé patine dorée trace de monture joli siècle petit traces de corrosion rayure cuivre alliage légèrement gauche minime imitation pièce magnifique de frappe faible défaut sur la tranche erreur sur la tranche tranche inscrite droite revers

campo da tesoretto moneta commemorativa liscio bucato coniato ondolato patina d´oro tracce di appicagnolo carino secolo piccolo segni di corrosione graffio(i) rame lega leggero sinistra minimamente contraffazione esemplare magnifico conio stanco ammaccatura al bordo errore nel bordo inscrizione sul bordo destra rovescio

оттиск на гурте потертая свинец ассиметричный двойной чекан кайма односторонняя эмалированная сохранность слегка экземпляр следы обработки ошибка в процессе чеканки поле экземпляр памятная монета отглаженная проколатая отчеканенная волнистая золотая патина следы от ушка красивая столетие маленький следы коррозии царапина медь сплав легкий слева минимальный имитация превосходный экземпляр издержкн при чеканкe вмятина на гурте ошибка на гурте гуртовая надпись справа реверс

TEL +49 (0)541 96 20 20, FAX +49 (0)541 96 20 222, SERVICE@KUENKER.DE, WWW.KUENKER.DE


DEUTSCH

ENGLISH

FRANCAIS

ITALIANO

RUSSKIJ

Schriftspuren

traces of inscription

traces de légende

tracce di leggenda

Schrötling Schrötlingsfehler Schwach ausgeprägt Selten in dieser Erhaltung

flan flan defect weakly struck rare in this condition

flan flan défectueux de frappe faible rare en cet état

tondello errore di tondello conio stanco conservazione rara

Seltener Jahrgang Stempel Stempelfehler Überdurchschnittlich erhalten Überprägt Unediert Unikum Vergoldet Von allergrößter Seltenheit Vorderseite Winz.= winzig Zain Zierrand Zinn ziseliert

rare year die(s) mistake in the die extraordinary condition

année rare coin erreur de frappe conservation extraordinaire

overstruck unpublished unique specimen gilt extremely rare averse tiny flan ornamental border tin chased

surfrappé inédit unique doré de toute rareté en face petit flan tranche ornée étain ciselé

annata rara conio errore di conio conservazione estraordinaria ribattuto inedito pezzo unico dorato di estrema raritá diritto veramente piccolo tondello taglio ornato stagno cesellato

следы предыдущей надписи заготовка брак заготовки слабо отчеканeна редкая в такой сохранности редкий год штамп ошибка штампа сохранность выше среднего перечекан неопубликованная монета уникальная позолоченная наиредчайшая аверс незначительный заготовка декоративный гурт цинк гравированный

Erhaltungsgrade/Grading Terms/Degrès de Conservation/Gradi di Conservazione/ Шкала сохранности DEUTSCH

ENGLISH

FRANCAIS

ITALIANO

RUSSKIJ

Polierte Platte Stempelglanz Vorzüglich Sehr schön Schön Gering erhalten

Proof Uncirculated Extremely fine Very fine Fine Very good

Flan bruni Fleur de coin Superbe Très beau Beau Très bien conservé

Fondo specchio Fior di conio Splendido Bellissimo Molto Bello Bello

полированная превосходная отличная очень хорошая хорошая удовлетворительная

Seltenheitsgrade/Rarity Terms/Degrés de Rareté/Grado di Raritá/ Шкала редкости DEUTSCH

ENGLISH

FRANCAIS

ITALIANO

RUSSKIJ

R = Selten RR = Sehr selten Von großer Seltenheit Von größter Seltenheit Von allergrößter Seltenheit Uneditiert

R = Rare RR = Very rare Very rare Extremely rare Extremely rare Unpublished

Rare Très rare De grande rareté Extrêmement rare De la plus extrême rareté Inédit

raro molto raro di grande raritá di grandissima raritá di estrema raritá inedito

редкая очень редкая большой редкости наибольшей редкости наиредчайшая ранее не описанная

TEL +49 (0)541 96 20 20, FAX +49 (0)541 96 20 222, SERVICE@KUENKER.DE, WWW.KUENKER.DE


IMPRESSUM NUMISMATISCHE BEARBEITUNG FOTOS LAYOUT DRUCK

Michael Autengruber, Dr. Sebastian Steinbach, Jens Ulrich Thormann M. A. Lübke & Wiedemann, Stuttgart danner pc - gesteuerte systeme waiblingen meister print und media, Kassel, Mai 2012 Jeglicher Nachdruck, auch auszugsweise, bedarf der Genehmigung des Auktionshauses

ZAHLUNGEN AUS DEM INLAND Deutsche Bank Osnabrück Commerzbank Osnabrück Sparkasse Osnabrück Volksbank eG Bad Laer-Borgloh-Hilter-Melle Bankhaus Lampe KG, Bielefeld Postbank Hannover HypoVereinsbank München WestLB Dortmund Oldenburgische Landesbank AG Oldenburg Paypal

(BLZ 265 700 90) Konto-Nummer 0 177 006 (BLZ 265 800 70) Konto-Nummer 780 520 200 (BLZ 265 501 05) Konto-Nummer 247 320 (BLZ 265 624 90) Konto-Nummer 1 200 222 400 (BLZ 480 201 51) Konto-Nummer 174 076 (BLZ 250 100 30) Konto-Nummer 2900 60-308 (BLZ 700 202 70) Konto-Nummer 24 17 952 (BLZ 440 500 00) Konto-Nummer 1128 842 (BLZ 280 200 50) Konto-Nummer 508 50338 00 paypal@kuenker.de, Service charge: 3,5 %

ZAHLUNGEN AUS DEM AUSLAND FOREIGN PAYMENTS Deutsche Bank Osnabrück Sparkasse Osnabrück Postbank Hannover Credit Suisse Credit Cards Paypal

IBAN: DE11 2657 0090 0017 7006 00 Swift-Code: DEUTDE3B265 IBAN: DE50 2655 0105 0000 2473 20 Swift-Code: NOLADE22XXX IBAN: DE73 2501 0030 0290 0603 08 Swift-Code: PBNKDEFF IBAN: CH43 0483 5177 3509 0200 0 Swift-Code: CRESCHZZ80A We do accept VISA and MASTERCARD, Service charge: 4,5 % paypal@kuenker.de, Service charge: 3,5 %

ZAHLUNGEN INNERHALB RUSSLANDS PAYMENTS WITHIN RUSSIA Deutsche Bank Moskau ʽʽʽΗʪ̸̨̜̖ʥ̡̦̌Η

ИНН 7728717332; КПП 772801001 Получатель: ЗАО "Кюнкер" счет №: 40702810500000000825; БИК: 044525101 корсчет №: 30101810100000000101


Auktion 215