Page 1


Titelfoto (Nr. 8143) RUSSLAND, KAISERREICH Katharina II., 1762-1796. 5 Rubel 1762, St. Petersburg. 8,34 g. Bitkin 6 (R1); Diakov 3 (R2); Fb. 130.


AUKTION 209 Russische Münzen und Medaillen Deutsche Münzen ab 1871

ZEIT

Freitag, 16. März 2012 09.30 Uhr - 13.00 Uhr 14.00 Uhr - 16.30 Uhr

ORT

Steigenberger Hotel Remarque Osnabrück, Natruper-Tor-Wall 1

AUKTIONS-TELEFON

+49 (0)541 60 96 633

AUKTIONS-FAX

+49 (0)541 60 96 634

Auktionen 204-209, März 2012 12. MÄRZ 2012

Auktion 204 Münzen aus der Welt der Antike

12./13. MÄRZ 2012

Auktion 205 1.000 Jahre Europäische Münzgeschichte Glanz und Faszination des Mittelalters

13.-15. MÄRZ 2012

Auktion 206 Münzen und Medaillen der Neuzeit

15. MÄRZ 2012

Auktion 207 Goldprägungen

15. MÄRZ 2012

Auktion 208 Schweden und seine Besitzungen Die Sammlung Julius Hagander, Teil 3

16. MÄRZ 2012

Auktion 209 Russische Münzen und Medaillen Deutsche Münzen ab 1871


Zeitplan/Timetable Auktion 204 Münzen aus der Welt der Antike

Montag, 12. März 2012 09.30 Uhr - 13.00 Uhr Nr. 1 bis Nr. 723 Kelten, Griechen, Römer: Römische Republik, Imperatoren, Kaiserzeit: Augustus - Didius Julianus 14.00 Uhr - 16.00 Uhr Nr. 724 bis Nr. 1113 Kaiserzeit: Septimius Severus - Basiliscus, Kontorniat, Lots Römer, Byzanz, Orient

Auktion 205 1.000 Jahre Europäische Münzgeschichte Glanz und Faszination des Mittelalters

16.00 Uhr - 19.00 Uhr Nr. 1251 bis Nr. 1864 Frühmittelalter, Hoch- und Spätmittelalter: Deutsches Reich Dienstag, 13. März 2012 09.30 Uhr - 13.00 Uhr Nr. 1865 bis Nr. 2563 Hoch- und Spätmittelalter: Deutsches Reich (Fortsetzung), Europa, Kreuzfahrer, Lots

Auktion 206 Münzen und Medaillen der Neuzeit

14.00 Uhr - 19.00 Uhr Nr. 2751 bis Nr. 3723 Europa, Übersee, Habsburgische ErblandeÖsterreich: Tirol, RDR, Kaiserreich Österreich, Lots Habsburg, Geistlichkeit: Olmütz Mittwoch, 14. März 2012 09.30 Uhr - 13.00 Uhr Nr. 3724 bis Nr. 4326 Geistlichkeit: Salzburg - Wien, Standesherren, Städte, Deutschland: Aachen - Brandenburg in Franken 14.00 Uhr - 19.00 Uhr Nr. 4327 bis Nr. 5393 Deutschland: Brandenburg-Preußen - Ostfriesland Donnerstag, 15. März 2012 09.00 Uhr - 11.30 Uhr Nr. 5394 bis Nr. 5878 Deutschland: Paderborn - Würzburg, Medaillen, Papiergeld, Prägewerkzeuge, Münzbecher, Lots, Literatur

Auktion 207 Goldprägungen

11.30 Uhr - 13.00 Uhr Nr. 6001 bis Nr. 6303 Europa: Albanien - Italien 14.00 Uhr - 17.30 Uhr Nr. 6304 bis Nr. 7069 Europa: Italien (Fortsetzung) - Zypern, Übersee, Habsburgische Erblande-Österreich, Deutschland, Goldmedaillen, Lots

Auktion 208 Schweden und seine Besitzungen Die Sammlung Julius Hagander Teil 3

Auktion 209 Russische Münzen und Medaillen Deutsche Münzen ab 1871 2

17.30 Uhr - 19.00 Uhr Nr. 7501 bis Nr. 7730 Freitag, 16. März 2012 09.30 Uhr - 13.00 Uhr Nr. 8001 bis Nr. 8511 14.00 Uhr - 16.30 Uhr Nr. 8514 bis Nr. 9019


Sehr geehrte Münzfreunde/Dear Coin Collectors, Ich wünsche Ihnen viel Freude mit unseren neuen Auktionskatalogen und hoffe, Sie finden einige schöne Stücke für Ihre Sammlung. Als Europas führendes Auktionshaus für Münzen, Medaillen und Orden hat sich unser Dienstleistungsspektrum für Sie als unsere Kunden stetig verbessert und erweitert. Einen kleinen Überblick über unsere Angebote finden Sie hier. I wish you a lot of pleasure with our new auction catalogues and I hope you will find a few additonal items for your collection. As Europe´s leading auction company for coins, medals and decorations our range of services for our customers has been steadily improving and expanding. Following is a short overview of our offers. Mit herzlichen Grüßen/With warm regards

Friti z Ru Frit Fr Rudo dolflff K do Kün ünke ün ker ke ker

AUKTIONEN/AUCTIONS Besuchen Sie unsere international bedeutenden Auktionen, die Ihnen viermal jährlich zahlreiche Raritäten bieten. Profitieren Sie als Bieter oder Einlieferer von unserer Erfahrung und Kompetenz. Visit our internationally recognized auctions which take place four times a year and offer many rarities. Benefit from our experience and competence while being a bidder or consigner. GOLDHANDEL/GOLD COIN TRADING Wir bieten Ihnen ein ständiges Angebot sowie den Ankauf von Anlagemünzen aus Deutschland, Europa und aller Welt zu fairen tagesaktuellen Preisen. We are constantly offering as well as purchasing a vast range of German, European and World bullion coins. We buy and sell gold assets at a fair, daily updated market price. ONLINE-SHOP Wir bieten Ihnen in unserem Online-Shop auf www.kuenker.de ein täglich aktualisiertes Münz-Angebot von der Antike bis zur Neuzeit. Kaufen Sie hier unkompliziert zum Festpreis und ohne Risiko. We offer you an exclusive daily updated selection of coins from ancient to modern times. You can order at www.kuenker.com without hassle or risk. eLIVE AUCTION Mit unseren eLive Auctions können Sie über das Internet an regelmäßigen Auktionen mit einem virtuellen Auktionator teilnehmen. Sie können Vorgebote bequem online abgeben und abschließend die Auktion live am Bildschirm für sich entscheiden. With our eLive Auctions, we offer you an opportunity to participate in regular auctions live over the Internet. You can submit preliminary bids online, and up to the last moment of the sale you can win auctions live on your computer screen. ORDEN UND EHRENZEICHEN/ORDERS AND DECORATIONS Einmal im Jahr findet unsere besondere Ordensauktion statt, die sich ganz den dekorativen Ehrenzeichen widmet. Profitieren Sie als Bieter oder Einlieferer von unserer Erfahrung und Kompetenz im Bereich Phaleristik. Once a year there is a special auction dedicated to medals and decorations. Benefit from our experience in the field of phaleristik becoming our bidder or consigner.

TEL +49 (0)541 96 20 20, FAX +49 (0)541 96 20 222, SERVICE@KUENKER.DE, WWW.KUENKER.DE

3


Besichtigung/On View Die Besichtigung des Auktionsgutes kann nach vorheriger telefonischer Absprache erfolgen. Unser besonderer Service anlässlich der Numismata München 2012: Besichtigung von Freitag, 2. März bis Samstag, 3. März von 9.30 – 18.00 Uhr und Sonntag, 4. März von 9.30 – 16.00 Uhr in unseren Münchner Büroräumen am Maximiliansplatz 12a. Auction lots may be viewed by appointment only. Special service for our clients participating in the Numismata Munich 2012: Auction lot viewing is possible in our Munich office at Maximiliansplatz 12a from Friday, March 2 till Saturday, March 3 from 9.30 AM to 6.00 PM and on Sunday, March 4 from 9.30 AM to 4.00 PM.

KUENKER.DE

Online-Katalog/Online Catalogue Betrachten Sie unsere Auktionskataloge im Internet! Unter www.kuenker.de und www.sixbid.com haben Sie die Möglichkeit, Abbildungen zu vergrößern, Ihre Gebote direkt abzugeben und die Ergebnisse der Auktionen abzurufen. Please browse our auction catalogues at www.kuenker.com or at www.sixbid.com! You will have the possibility to zoom all images, to place your bids and to view all auction results online.

Künker-Service Wir sind mittlerweile mit neun eigenen Standorten in Deutschland und Europa vertreten. So können wir Ihnen unseren beliebten Künker-Service auch in Ihrer Nähe anbieten. Unsere Leistungen vor Ort: • Persönliche Beratung und Betreuung in Ihrer Nähe. • Sie können Ihre Münzen direkt einliefern oder verkaufen, ersteigerte Münzen abholen und sich nach Vereinbarung Einlieferungen auszahlen lassen. • Sie können sich von unserem Kooperationspartner auf den Künker-Auktionen vertreten lassen. We are now represented with nine locations in Germany and Europe so that we can also provide you the best service in your vicinity. Our local services: • You always have a point of contact nearby. • You can directly consign or sell your coins, collect purchases and receive by appointment payment for consignments. • You can have our cooperation partner represent you at our auctions. OSNABRÜCK Fritz Rudolf Künker GmbH & Co. KG Gutenbergstraße 23, 49076 Osnabrück Tel. +49 (0)541 96 20 20, E-Mail: service@kuenker.de Haupptstsititz Ha ititz in in Osn s abbrüückk

4

USt-IdNr./VAT-No: DE256270181

TEL +49 (0)541 96 20 20, FAX +49 (0)541 96 20 222, SERVICE@KUENKER.DE, WWW.KUENKER.DE


Standorte/Locations

Drr. H D Huubert rt R Ruß uß

Fraannk Ri Fr Rich chharrds dsen en en

MÜNCHEN Künker Numismatik AG Löwengrube 12, 80333 München Dr. Hubert Ruß Tel. +49 (0)89 242 198 38, service@kuenker-numismatik.de Fritz Rudolf Künker GmbH & Co. KG Maximiliansplatz 12a, 80333 München Frank Richardsen Tel. +49 (0)89 242 16 990, frank.richardsen@kuenker.de BERLIN Fritz Rudolf Künker GmbH & Co. KG Poststraße 22, 10178 Berlin-Mitte Wollankstraße 117, 13187 Berlin-Pankow Michael Otto Tel. +49 (0)30 247 248 91, michael.otto@kuenker.de

M ch Mi chae aell Ot Otto tttoo

Rolaand nd Trraam mppe

HAMBURG Künker Hamburg, c/o Roland Trampe Roland Trampe Tel. +49 (0)541 96 20 20, roland.trampe@kuenker.de KONSTANZ Künker Konstanz, c/o Michael Autengruber Schulthaißstraße 10, 78462 Konstanz Michael Autengruber Tel. +49 (0)7531 28 44 69, michael.autengruber@kuenker.de

Michaeel Autengruubeer

Petr Kov Pe ovaljo jov

ZNOJMO Künker Znojmo, c/o Petr Kovaljov 17. Listopadu 18, 66902 Znojmo, Tschechische Republik Petr Kovaljov Tel. +42 (0)603 81 10 31, petr.kovaljov@kuenker.de ZÜRICH Künker Zürich, c/o Hess-Divo AG Löwenstraße 55, 8001 Zürich, Schweiz Ulf Künker Tel. +41 (0)44 225 40 90, zuerich@kuenker.de

Allekse Alek ekkseseyy O Onncchhuukkovv

MOSKAU Künker Moskau, c/o Russian Coin Co. Ltd. 2/21 Makarenko St., 123001 Moskau, Russland Aleksey Onchukov Tel. +7 (495) 589 56 10, aleksey.onchukov@kuenker.de

TEL +49 (0)541 96 20 20, FAX +49 (0)541 96 20 222, SERVICE@KUENKER.DE, WWW.KUENKER.DE

5


Was ist für Ihre schriftliche Auktionsteilnahme besonders wichtig?

DEUTSCH

• Bitte senden Sie uns Ihre Aufträge möglichst frühzeitig zu. Wenn uns Ihr Auftrag erst kurz vor der Auktion erreicht, können sich bei der Bearbeitung Fehler einschleichen. Das beiliegende Formular erleichtert Ihnen die Abgabe eines schriftlichen Gebots. Gerne nehmen wir Ihre Gebote per Post, Fax oder Email entgegen. • Wenn Sie noch nicht bei uns gekauft haben, bitten wir Sie, uns als Referenz eine Münzhandlung anzugeben, mit der Sie bereits in Geschäftsverbindung stehen. • Wir gewährleisten die Echtheit aller verkauften Objekte auch über die gesetzliche Frist hinaus.

Sie möchten telefonisch an der Auktion teilnehmen? Die telefonische Teilnahme an der Auktion ist bei uns selbstverständlich möglich. Wir rufen Sie während der Auktion gerne an und helfen Ihnen, die gewünschten Stücke zu ersteigern. Aus organisatorischen Gründen bitten wir Sie, die folgenden Punkte zu beachten:

Ulrich Künker Leiter Kundenbetreuung

• Telefonisches Bieten ist nur bei Losen mit einer Taxe von mind. € 500,– möglich. • Bitte teilen Sie uns mindestens 48 Stunden vor der Auktion mit, zu welchen Stücken Sie angerufen werden möchten. • Bitte achten Sie darauf, dass Sie erreichbar sind, wenn Ihre Stücke versteigert werden. Der Zeitplan in diesem Katalog hilft Ihnen dabei, den Zeitpunkt der Versteigerung abzuschätzen. • Für den Fall, dass wir Sie nicht erreichen können, bieten wir in Ihrem Namen bis zur Höhe Ihres schriftlichen Gebotes, mindestens aber bis zur Höhe des Schätzpreises. • Bitte beachten Sie, dass telefonisches Bieten eine unsichere Variante der Auktionsteilnahme sein kann. Wir können keine Garantie für das Zustandekommen der telefonischen Verbindung übernehmen. Wenn Sie sicher gehen wollen, besuchen Sie bitte unsere Auktion persönlich oder geben Sie uns ein schriftliches Gebot.

Was passiert nach der Auktion? Barbara Westmeyer deutschsprachige Kundenbetreuung

Telefon: +49 (0)541 96 20 20 Fax: +49 (0)541 96 20 222 Gebührenfrei: 0800 58 36 537 E-Mail: service@kuenker.de Internet: www.kuenker.de Montag – Donnerstag 8.30 – 17.00 Uhr Freitag 8.00 – 15.30 Uhr

6

• Der Versand der Auktionsware startet sofort nach Beendigung der Auktion und dauert in der Regel 8 Tage. • Alle Kunden, die an unserer Auktion schriftlich teilgenommen haben, erhalten innerhalb von 2 Wochen nach der Auktion unsere Ergebnisliste gratis. • Alle Ergebnisse sind spätestens einen Tag nach Auktionsende auf unserer Internetseite verfügbar.

Sie möchten Ihre Münzen in unsere Auktion einliefern? Sollten Sie sich zum Verkauf Ihrer Münzen entschlossen haben, kommen Sie zu uns. Seit 1985 beweisen wir mit derzeit 4 Auktionsterminen und ca. 15 Katalogen pro Jahr unsere Kompetenz und Zuverlässigkeit. Wichtige Informationen für Sie im Überblick: • Ihre Münzen werden von unseren Experten nach neuestem numismatischem Standard bestimmt und in hochwertigen Farbkatalogen präsentiert. • Wir verfügen mit mehr als 10.000 Kunden über eine der besten Kundendateien weltweit. Im Durchschnitt verkaufen wir mehr als 95 % der Stücke einer Auktion, nicht selten erzielen wir dabei Rekordzuschläge. Für nicht verkaufte Objekte werden keine Gebühren erhoben. • Ab der Übergabe an uns sind Ihre Münzen mit dem doppelten Schätzwert versichert. Unsere Kundenbetreuung bespricht gerne mit Ihnen wie Ihre Stücke sicher zu uns gelangen können. • Ihre Einlieferung wird Ihnen sofort nach der Übernahme quittiert. Spätestens 5 Wochen vor der Auktion erhalten Sie eine Auflistung Ihrer Stücke inkl. Katalognummern und Schätzpreisen. • Unmittelbar nach der Auktion erhalten Sie die Ergebnisliste und können dann alle erzielten Preise feststellen. Den Auktionserlös erhalten Sie innerhalb von 45 Tagen nach der Auktion.

TEL +49 (0)541 96 20 20, FAX +49 (0)541 96 20 222, SERVICE@KUENKER.DE, WWW.KUENKER.DE


Important facts for a written participation in the auction • Please send us your instructions as early as possible. The likelihood of errors occurring increases if we receive your instructions only shortly before the auction. The enclosed form should make it simple for you to submit a written bid, you may send your bids by mail, fax or e-mail. • If you are a new customer who has not yet purchased from us, we do request references. Please name a coin dealer with whom you have already done business. • The genuineness of all objects sold is warranted beyond the statutory length of time.

ENGLISH

Do you wish to participate by telephone? You are welcome to participate in our auction by telephone. We are glad to call you during the auction and to assist you in bidding for your items. Please take notice of the following conditions: • Telephone bidding is accepted exclusively on lot numbers with estimates at 500 Euro or above. • Please inform us at least 48 hours in advance if you wish to register for telephone bidding, even for single lots. We do need 48 hours to schedule all incoming requests. • Please be available, when your lots will be sold. The time schedule in the catalogue will help you to estimate the approximate time when your items are going to be sold. • Should you not be available by phone, we will bid on your behalf up to your submitted written limit or at least up to the estimate of the lot for which you requested to be called. • Please be aware that telephone bidding is a risky way of participation in our auction. We do not assume liability should the telephone line be interrupted or not be achieved. We advise you to attend the auction in person or to send written bids.

Nadine Zuber English, Deutsch

What occurs after the auction? • The shipment of all auction goods starts immediately after the completion of the entire auction week and it usually takes 8 days to be completed. • All auction results are available on our website one day after the end of the auction week. • All clients who submitted bids for the auction will automatically receive the list of auction results free of charge within two weeks after the end of auction.

Do you wish to consign your coins to our auction? Should you decide to sell your coins, we are ready to assist you. Since 1985 we have earned our bona fides in conducting over 4 auctions and in publishing 15 catalogues per year. In the following you will find the most important information on consigning: • We guarantee the professional handling of your consignment following the latest numismatic level of expertise including its presentation in colour catalogues of outstanding quality. • We possess one of the best customer lists worldwide. On average we sell more than 95 % of all items in our auction, and it is not unusual for us to achieve record hammer prices for lots submitted. Unsold items incur no fees. • Once the coins are consigned they are covered by our insurance at double the estimate. Upon consultation with our customer service we try to advise you on the safest way of shipping for your coins. • Your delivery will be confirmed in writing immediately on receipt. At least five weeks before the auction, you will receive an exact list of your objects with the relevant catalogue numbers and descriptions. • Within a week of the end of auction, you will receive a list of auction results in order to see what prices were reached for each individual lot. As a consignor, you will receive the auction proceeds within 45 days after the end of auction.

Marion Künker English, Deutsch

Phone: +49 (0)541 96 20 20 Fax: +49 (0)541 96 20 222 E-Mail: service@kuenker.de Website: www.kuenker.com Monday –Thursday 8.30 AM – 5 PM Friday 8 AM – 3.30 PM

TEL +49 (0)541 96 20 20, FAX +49 (0)541 96 20 222, SERVICE@KUENKER.DE, WWW.KUENKER.DE

7


Votre participation par écrit – Les points essentiels

FRANCAIS

• Veuillez nous faire parvenir vos ordres le plus tôt possible. Si vos ordres nous parviennent juste avant la vente aux enchères, des erreurs risquent d’être commises lors de leur traitement. Le formulaire ci-joint vous aidera à rédiger facilement votre offre. Vous pouvez nous envoyer vos ordres par la poste, par fax ou par e-mail. • Si vous n’avez encore fait aucune acquisition chez nous, nous vous prions de nous indiquer une ou deux références d’autres maisons numismatiques où vous avez déjà acheté. • L’authenticité des pièces vendues est garantie même au-delà des délais légaux.

Vous voulez participer par téléphone? La participation par téléphone est bien sûr possible. Nous vous appelons volontiers pour vous aider à acquérir les pièces voulues. Pour des raisons d´organisation veuillez noter les points suivants:

Alexandra Elflein, M. A. Français, Deutsch, English, Italiano

• La participation par téléphone est possible seulement pour les lots estimé à plus de 500 Euros chacun. • Veuillez nous informer au moins 48 heures avant la vente de la liste des pièces pour lesquelles vous voudriez être appelé. • Veuillez prendre soin d´être joignable quand vos pièces seront mises en vente. L’ordre de vente dans ce catalogue vous aidera à estimer l´heure de la vente. • Dans le cas où nous ne parviendrions pas à vous joindre, nous enchérirons pour vous jusqu’au montant que vous nous indiquez par écrit, égal ou supérieur au prix d’estimation. • La participation par téléphone présente des risques, et nous déclinons toute responsabilité dans le cas où la communication téléphonique serait interrompue, ou bien ne pourrait être établie.

Ce qui se passe après la vente Kmar Chachoua Français, Deutsch, English, Arabic

Tél. +49 (0)541 96 20 20 Facs. +49 (0)541 96 20 222 E-Mail: service@kuenker.de Site: www.kuenker.de Lundi à Jeudi de 8h30 à 17h00 Vendredi de 8h00 à 15h30

8

• L´expédition des biens va commencer immédiatement après la fin de la vente complète, et prend généralement 8 jours. • Tous les clients qui ont participé à l’une de nos ventes aux enchères recevront gratuitement une liste de résultats dans les deux semaines qui suivent. • Les résultats seront disponibles sur notre site internet, au plus tard un jour après la fin de la vente.

Vous voulez confier vos monnaies pour nos ventes aux enchères? Contactez nous si vous envisagez de vendre vos pièces. Notre compétence et fiabilité est prouvée depuis 1985 par actuellement 4 ventes aux enchères et environ 15 catalogues par an. Le plus important pour vous est que: • Vos pièces seront décrites par notre équipe d’experts selon les standards numismatiques les plus récents, et elles seront présentées dans des catalogues de haute qualité en couleurs. • Nous avons un des meilleurs fichiers-clientèle du monde avec plus de 10.000 clients. Nous vendons en moyenne plus de 95% de la vente aux enchères, et obtenons souvent des prix records. Les monnaies invendues n’encourent aucun frais. • Notre service clientèle est disponible pour vous conseiller pour l’envoi de vos pièces, et dès leur réception vos pièces seront assurées pour le double de la valeur d´estimation. • Vous recevrez une liste détaillée des pièces fournies au moment de la prise en charge puis, au plus tard cinq semaines avant la vente aux enchères, vous recevrez leur liste exacte avec les numéros de catalogue correspondants. • Immédiatement après la vente aux enchères, vous recevrez la liste des résultats et pourrez prendre connaissance des prix obtenus. Vous recevrez le produit de la vente dans les 45 jours après les enchères.

TEL +49 (0)541 96 20 20, FAX +49 (0)541 96 20 222, SERVICE@KUENKER.DE, WWW.KUENKER.DE


I punti piú importanti per la Sua partecipazione per iscritto • La preghiamo di farci pervenire i Suoi ordini al piú presto possibile. Se i Suoi ordini ci arrivano poco prima dell´inizio dell´asta possono verificarsi errori. Il formulario allegato Le faciliterá l´invio dei Suoi ordini per iscritto. Ci puó far pervenire i Suoi ordini per posta, per fax o per email. • Se non ha mai acquistato presso di noi, La preghiamo di volerci indicare a titolo di referenza il nome di uno o due commercianti numismatici presso i quali è giá cliente. • L’autenticità di tutti gli oggetti venduti viene garantita anche oltre i termini previsti dalla legge.

ITALIANO

Desidera partecipare telefonicamente alla nostra asta? La partecipazione telefonica è naturalmente da noi possibile. La chiameremo durante l´asta e La assisteremo volentieri per ottenere l´aggiudicazione dei pezzi desiderati. Per motivi di organizzazione La preghiamo di voler tenere conto dei seguenti punti: • La partecipazione telefonica è possibile solo per lotti stimati con almeno 500,– € l´uno. • La preghiamo di volerci comunicare almeno 48 ore prima dell´inizio dell´asta per quali pezzi desidera essere chiamato. • La preghiamo di aver cura di essere raggiungibile telefonicamente al momento in cui vengono messi all´asta i pezzi che Le interessano. Lo schema orario in catalogo La aiuterá a stimare a che ora verranno messi all´asta i pezzi che Le interessano. • Nel caso in cui non riuscissimo a contattarLa telefonicamente, provvederemo ad offrire a Suo nome fine all´importo massimo indicatoci per iscritto, in ogni caso offriremo a Suo nome come minimo il prezzo di stima. • La partecipazione telefonica è un modo incerto di partecipare alle aste. Non assumiamo nessuna responsabilità se per esempio la linea telefonica è occupata o interrotta o se Lei non sará raggiungibile per altri motivi.

Sonia Russo, M. A. Italiano, Deutsch, English, Español

Cosa succede dopo l´asta? • La spedizione del materiale d´asta comincia subito dopo la fine dell´intera asta e termina normalmente entro 8 giorni. • Tutti i clienti che hanno partecipato all´asta ricevono entro 2 settimane dopo l´asta la lista dei prezzi di realizzo. • I prezzi di realizzo sono visionabili sul nostro sito internet al piú tardi un giorno dopo la fine dell´intera asta.

Vuole consegnarci le Sue monete per una nostra asta? Ci contatti se ha deciso di vendere le Sue monete. Dal 1985 la nostra competenza ed affidabilità è dimostrata da attualmente 4 aste e circa 15 cataloghi all´anno. Quali sono i punti di maggior importanza per Lei:

Cristina Welzel Italiano, Deutsch, English, Français

Tel.: +49 (0)541 96 20 20 Fax: +49 (0)541 96 20 222 E-Mail: service@kuenker.de Internet: www.kuenker.de Lunedì a giovedì dalle 8.30 alle 17.00 Venerdì dalle 8.00 alle 15.30

• Le Sue monete vengono valutate dal nostro staff di esperti secondo i piú attuali standard numismatici e vengono presentati in cataloghi di alto valore a colori. • Con piú di 10.000 clienti disponiamo di una delle migliori banca dati clienti del mondo. In media vendiamo oltre il 95% del materiale d´asta realizzando spesso prezzi da record. Per i pezzi invenduti non ci sono nessune spese da pagare. • Dal momento della consegna le Sue monete sono assicurate per il doppio del valore di stima. Il nostro servizio clientela Le consiglierá volentieri come farci avere le Sue monete nel modo piú sicuro. • La Sua consegna Le verrá immediatamente quietanzata al momento della resa dei pezzi. Al piú tardi 5 settimane prima dell´asta riceverá una lista dettagliata dei Suoi pezzi con i numeri di catalogo ed i prezzi di stima. • Subito dopo l´asta riceverá la lista con i risultati d´asta dalla quale potrá subito controllare i prezzi realizzati. Riceverá l´importo di realizzo entro 45 giorni dopo la fine dell´asta.

TEL +49 (0)541 96 20 20, FAX +49 (0)541 96 20 222, SERVICE@KUENKER.DE, WWW.KUENKER.DE

9


Что особенно важно при заочном участии на аукционе?

RUSSKIJ

• Тщательно изучите наш каталог и запишите те лоты, которые Вас заинтересовали. Заполните приложенный формуляр и отправьте нам его заранее по почте, факсу или электронной почте. Мы обращаем внимание на то, что если Ваши ставки придут перед самым началом аукциона либо во время аукциона, то существует вероятность допуска ошибки в процессе обработки заказа. • Если Вы впервые принимаете участие в нашем аукционе, то мы рекомендуем Вам указать Ваш референц – аукционные дома, с которыми Вы уже сотрудничали. Или свяжитесь с нами по телефону +49(0)541 9620268. • Подлинность купленных на нашем аукционе лотов гарантируется нами на протяжении неограниченного времени.

Вы хотели бы принять участие на аукционе по телефону? У нас, конечно, есть возможность организовать Ваше телефонное участие на торгах, но мы бы хотели обратить внимание на следующие пункты: Anastasija Koepsell Russkij, Deutsch

• Участие в телефонных торгах возможно только для лотов со стартовой ценой свыше 500 евро. • Для участия в торгах по телефону просим Вас связаться с нами не позднее 48 часов до начала аукциона. • Мы хотим подчеркнуть, что телефонное участие на аукционе – не самый безопасный способ: в случае плохой связи, недоступности клиента во время торгов либо других технических проблем мы не несем ответственности.

Что происходит после окончания аукциона?

Dzmitry Nikulin Russkij, Deutsch, English

Телефон: +49 (0)541 96 20 20 Факс: +49 (0)541 96 20 222 E-Mail: service@kuenker.de интернет: www.kuenker.de понедельник – четверг 8.30 – 17.00 пятница 8 – 15.30

10

• Результаты аукционов доступны на нашем сайте на следующий день после окончания торгов. • Вы можете лично забрать приобретенные лоты. По окончании торгов мы готовим все необходимые документы на вывоз из Евросоюза. • Почтовые отправки в Россию ( Беларусь, Украину ) осуществляются по предварительной договоренности. Для связи с нами звоните по телефону +49 (0)541 9620268.

Вы хотели бы выставить Ваши предметы на аукцион? Более 160-ти успешно проведенных аукционов, тысячи участников, 4 аукциона в год - эти и другие преимущества, которые говорят в пользу выставления Ваших коллекций на аукцион Кюнкер: • Ваши монеты будут оценены нашими экспертами по самым новым нумизматическим стандартам и представлены в высококачественном цветном каталоге. • Более 10000 клиентов со всего мира оказывают нам свое доверие. В среднем мы продаем более 95% всех выставляемых предметов, при этом зачастую достигая рекордных сумм. • Все Ваши предметы, после передачи их нам, хранятся у нас до начала аукциона застрахованными. Не позднее 5-ти недель до начала аукциона Вы получите по почте подробное описание Ваших лотов с указаннами номерами в каталоге, а также их оценочной стоимостью. • Результаты аукционов также будут высланы Вам по почте после окончания торгов. В течение 45 дней после аукциона Вам будет выплачено Ваше вознаграждение.

TEL +49 (0)541 96 20 20, FAX +49 (0)541 96 20 222, SERVICE@KUENKER.DE, WWW.KUENKER.DE


INHALT AUKTION 209 Nr.

Seite

RUSSISCHE MÜNZEN UND MEDAILLEN

8001

-

8511

15

Kaiserreich

8001

-

8458

15

Zar Alexei Michailowitsch, 1645-1676 Ein Viertelrubel des Zaren Alexei Michailowitsch Russische Gegenstempel von 1655 (Jefimki) auf europäischen Talern

8001

-

8003

15

8001

15 15

8002

-

8003

8004

-

8037

-

101 94

3

Zar Peter I., der Große, 1682-1725 Eine Gemeinschaftsprägung des Zaren Peter I. mit Ivan V. und Prinzessin Sophia für die Ukraine Silbermünzen aus dem Moskauer Münzhof Kadashevsky Silbermünzen aus dem Roten Münzhof in Moskau Zwei Sonnenrubel aus der Münzstätte St. Petersburg Eine Kupferkopeke aus dem Moskauer Münzhof Kadashevsky Medaillen des Zaren Peter I.

15

-

8004

22

15

8005

-

8015

15

-

17

8016

-

8026

17

-

19

8027

-

8028

8030

-

8029 8037

19

-

19 22

Zarin Katharina I., 1725-1727 Silbermünzen aus dem Roten Münzhof in Moskau Ein Rubel aus der Münzstätte St. Petersburg

8038

-

8043

22

-

23

8038

-

8042

22

-

23

Zar Peter II., 1727-1730 Ein Rubel aus dem Roten Münzhof in Moskau Silbermünzen aus dem Moskauer Münzhof Kadashevsky Kupfermünzen aus dem Moskauer Münzhof Kadashevsky Eine Medaille des Zaren Peter II.

8044

Zarin Anna, 1730-1740 Silbermünzen aus dem Moskauer Münzhof Kadashevsky Ein Rubel des Stempelschneiders Dmitriev aus dem Roten Münzhof in Moskau Eine Kupferprägung der Zarin Anna Eine Medaille der Zarin Anna

19

8043 -

8053

23 24

-

8044

25 24

8045

-

8050

8051

-

8052 8053

8054

-

8068

26

-

28

8054

-

8065

26

-

28

-

24

-

25 25 25

8066 8067 8068

28 28 28

8070

29

8069

29

8070

29

Zar Ivan III., 1740-1741 Ein Grivennik aus dem Roten Münzhof in Moskau Ein Rubel aus der Münzstätte St. Peterburg

8069

Zarin Elisabeth, 1741-1761 Goldmünzen aus dem Roten Münzhof in Moskau

8071

-

8127

29

-

38

8071

-

8075

29

-

30 11


Nr. Ein goldenes 2 Rubel-Stück aus der Münzstätte St. Petersburg Silbermünzen aus dem Roten Münzhof in Moskau Silbermünzen aus der Münzstätte St. Petersburg Kupferprägungen der Zarin Elisabeth Eine Prägung für Livland und Estland Prägungen für Ostpreußen Medaillen der Zarin Elisabeth Zar Peter III., 1762 Ein Rubel aus dem Roten Münzhof in Moskau Silbermünzen aus der Münzstätte St. Petersburg Kupferprägungen des Zaren Peter III. Zwei Taler des Zaren Peter III. als Herzog von Schleswig-Holstein-Gottorp

Seite 8076

30

8077

-

8084

30

-

31

8085 8099

-

31

-

8110 8120

-

8098 8108 8109 8119 8127

35 36

-

33 34 35 36 38

8128

-

8142

39

-

41

8128

39

8129

-

8135

39

8136

-

8140

40

8141

-

8142

41

Zarin Katharina II., 1762-1796 Goldmünzen der Zarin Katharina II. Silbermünzen aus dem Roten Münzhof in Moskau Silbermünzen aus der Münzstätte St. Petersburg Prägungen für Sibirien Eine Kupferprägung für Moldawien und die Walachei Eine Silbermedaille der Zarin Katharina II.

8143 8143

-

8223 8152

8153

-

8157

8158 8208

-

8207 8211

8213

-

8223

51

-

55

Zar Paul I., 1796-1801 Silbermünzen aus der Münzstätte St. Petersburg Eine Kupferprägung aus der Münzstätte Ekaterinburg Medaillen des Zaren Paul I.

8224

-

8237

56

-

58

8224

-

8233

56

-

57

8235

-

8234 8237

8238

-

8271

58

-

63

8238

-

8257

58

-

61

8258 8262 8267

-

8261 8266 8271

62

-

61 63 63

8272

-

8347

64

-

76

8272 8280

-

8279 8285

65

-

64 66

8286

-

8317

66

-

70

8319 8321 8332

-

8318 8320 8331 8347

-

70 70 72 76

41 41

-

-

40

55 42 43

43 50

-

8212

50 51 51

57 58

3

Zar Alexander I., 1801-1825 Silbermünzen aus der Münzstätte St. Petersburg Kupferprägungen des Zaren Alexander I. Prägungen für Polen Medaillen des Zaren Alexander I. Zar Nikolaus I., 1825-1855 Goldmünzen des Zaren Nikolaus I. Platinmünzen des Zaren Nikolaus I. Silbermünzen aus der Münzstätte St. Petersburg Eine Kupferprägung aus der Münzstätte Suzun (Kolyvan) Gedenkmünzen des Zaren Nikolaus I. Prägungen für Polen Medaillen des Zaren Nikolaus I. 12

70 72


Nr. Zar Alexander II., 1855-1881 Goldmünzen des Zaren Alexander II. Silbermünzen des Zaren Alexander II. aus der Münzstätte St. Petersburg Eine Prägung aus der Münzstätte Warschau Kupferprägungen des Zaren Alexander II. Gedenkmünzen des Zaren Alexander II. Eine Prägung für Finnland Medaillen des Zaren Alexander II.

Seite

8348 8348

-

8375 8356

76 76

-

80 77

8357

-

8365

77

-

78

8367 8369

-

8373

Zar Alexander III., 1881-1894 Goldmünzen des Zaren Alexander III. Silbermünzen des Zaren Alexander III. Eine Kupferprägung des Zaren Alexander III. Gedenkmünzen des Zaren Alexander III. Eine Prägung für Finnland Feingewichtsbarren aus der Münzstätte St. Petersburg Medaillen des Zaren Alexander III. Zar Nikolaus II., 1894-1917 Goldmünzen des Zaren Nikolaus II. Silbermünzen des Zaren Nikolaus II. Gedenkmünzen des Zaren Nikolaus II. Eine Kupferprägung für Finnland Medaillen des Zaren Nikolaus II.

-

8366 8368 8371 8372 8375

79

-

78 79 79 79 80

8376 8376 8387

-

8412 8386 8397

81 81 82

-

86 82 83

8399

-

8398 8401 8402

8403 8407

-

8406 8412

8413 8413 8419 8438

-

8447

-

8458 8418 8437 8445 8446 8458

Russische Imitationen eines niederländischen Dukaten

8459

-

8460

Sowjetunion, 1917-1991

8461

-

8475

94

-

96

Russische Republik seit 1992

8476

-

8490

97

-

99

Lots und Sammlungen russischer Münzen und Medaillen

8491

-

8506

99

-

100

Krim

8507

-

8508

100

8509

101 101

Münzschmuck Sonstige Objekte

8510

-

8511

DEUTSCHE MÜNZEN AB 1871

8514

-

9019

Reichskleinmünzen

8514

-

8521

Reichssilbermünzen Anhalt Baden Bayern Braunschweig Bremen Hamburg Hessen Lippe Lübeck Mecklenburg-Schwerin Mecklenburg-Strelitz Oldenburg Preußen

8522 8522 8531 8544 8554 8568 8570 8577 8592 8596 8601 8608 8612 8615

-

8696 8530 8543 8553 8567 8569 8576 8591 8595 8600 8607 8611 8614 8630

83 84 84

85

-

87

-

87 89

-

91

-

84 86 94 87 89 90 90 94 94

102

-

149 102

103

-

103 105 106

-

108

-

110

-

112

-

121 103 105 106 107 107 108 110 110 111 111 112 112 114 13


Nr.

Seite

Reuß älterer Linie Reuß jüngerer Linie Sachsen Sachsen-Altenburg Sachsen-Coburg-Gotha Sachsen Meinigen Sachsen-Weimar-Eisenach Schaumburg-Lippe Schwarzburg-Rudolstadt Schwarzburg-Sondershausen Waldeck-Pyrmont Württemberg

8631 8640 8642 8648 8655 8662 8671 8674

-

8683 8685 8690

-

Reichsgoldmünzen Anhalt Baden Bayern Braunschweig Bremen Hamburg Hessen Lübeck Mecklenburg-Schwerin Mecklenburg-Strelitz Preußen Sachsen Sachsen-Coburg-Gotha Schaumburg-Lippe Schwarzburg-Rudolstadt Schwarzburg-Sondershausen Württemberg Deutsch-Ostafrika Danzig Bundesrepublik Deutschland

8697 8697 8699 8703

-

8721 8723 8726

-

8731

-

8735 8753 8757

-

8761

-

8764 8778 8791

-

Lots von Reichsgoldmünzen

8796

-

8806

130

Weltkrieg und Inflation

8807

-

8808

131

Weimarer Republik

8809

-

8884

Drittes Reich

8885

-

8889

BRD

8890

-

8933

138

-

141

DDR

8934

-

8951

141

-

143

Zweiter Weltkrieg

8639 8641 8647 8654 8661 8670 8673 8681 8682 8684 8689 8696 8806 8698 8702 8719 8720 8722 8725 8729 8730 8733 8734 8752 8756 8759 8760 8762 8763 8777 8790 8794 8795

-

115

-

117

-

119

-

120

-

121

-

121 122

-

124

-

127 128

-

131

-

115 115 116 116 117 118 118 119 119 120 120 121 130 121 122 123 123 123 123 123 124 124 124 126 126 126 126 127 127 128 129 130 130

138 138

8952

143 143

Deutsche Kolonien

8953

-

8955

Staatliche Notmünzen

8956

-

8963

Notmünzen aus Porzellan und Steinzeug

8964

-

8965

Danzig

8966

-

8982

145

-

146

Proben

8983

-

8992

146

-

147

Lots

8993

-

9019

148

-

149

Ein Stichwortverzeichnis finden Sie am Ende des Auktionskataloges 207. 14

114

143

-

144 144


PETER I. DER GROSSE

4755+5%*'/ª0<'070&/'&#+..'0

8002

8001

8003

<#4#.':'+/+%*#+.19+65%* 'KP8KGTVGNTWDGNFGU<CTGP#NGZGK/KEJCKNQYKVUEJ 

4WDGNI-CKO  441TKIKPCNRT·IWPIªDGTRT·IWPIUURWTGP2T·IGUEJY·EJGUGJTUEJÌP



4WUUKUEJG)GIGPUVGORGNXQP ,GHKOMK CWHGWTQR·KUEJGP6CNGTP 



,GHKOQMÒDGTRT·IVCWHGKPGO4GKEJUVCNGTXQP<GGNCPFI/KV\YGK)GIGPUVGORGNPCWH FGT4ÒEMUGKVG 5V)GQTIKO-CORHOKVFGO&TCEJGP ,CJTGU\CJN&CXp \W &GNOp

\W  (GKPG2CVKPC/ÒP\GWPF)GIGPUVGORGNUGJTUEJÌP



,GHKOQMÒDGTRT·IVCWHGKPGO5RGEKGFCNGTXQP0QTYGIGP%JTKUVKCP+8/ÒP\ UV·VVG%JTKUVKCPKCI/KV\YGK)GIGPUVGORGNPCWHFGT4ÒEMUGKVG 5V)GQTIKO-CORHOKVFGO &TCEJGP ,CJTGU\CJN#JNUVTÌOp \W &CXp \W   44(GKPG2CVKPCYKP\5EJTÌVNKPIUTK­UGJTUEJÌP



8004

8005

8005

<#42'6'4+&'4)4155' 'KPG )GOGKPUEJCHVURT·IWPI FGU <CTGP 2GVGT + OKV +XCP 8 WPF 2TKP\GUUKP 5QRJKC   HÒTFKG7MTCKPG 

%JGMJ5GXUMHÒTFKG7MTCKPGI)GOGKPUEJCHVURT·IWPIOKV+XCP8WPF2TKP\GUUKP5QRJKC &KCMQXHH5GXGTKP 8QPITQ­GT5GNVGPJGKV5GJTUEJÌP



5KNDGTOÒP\GPCWUFGO/QUMCWGT/ÒP\JQH-CFCUJGXUM[ 

4WDGN M[TKNNKUEJ /QUMCW/ÒP\JQH-CFCUJGXUM[I$KVMKP&CX&KCMQX  442CVKPCMN5EJTÌVNKPIUHGJNGTUGJTUEJÌP

 15


PETER I. DER GROSSE

8007

8006

8008



4WDGN M[TKNNKUEJ /QUMCW/ÒP\JQH-CFCUJGXUM[I)GJCTPKUEJVGU$TWUVDKNFTOKV.QT DGGTMTCP\ WPF WOIGNGIVGO /CPVGN CO #TOCDUEJPKVV FKG 5KIPCVWT *)GMTÌPVGT&QRRGNCFNGTOKV<GR VGTWPF4GKEJUCRHGNKPFGP(·PIGPQDGP-TQPG$KVMKP&CX&KCMQX  44(GNFGTHGKPIGIN·VVGVMN5EJTÌVNKPIUHGJNGTUGJTUEJÌP 



4WDGN M[TKNNKUEJ /QUMCW/ÒP\JQH-CFCUJGXUM[I$KVMKP 4 &CX&KCMQX 45GJTUEJÌP





4WDGN M[TKNNKUEJ /QUMCW/ÒP\JQH-CFCUJGXUM[I$KVMKP 4 &CX&KCMQX -N-TCV\GTHCUVUGJTUEJÌP



8009

8010

8011



4WDGN M[TKNNKUEJ /QUMCW/ÒP\JQH-CFCUJGXUM[I$KVMKP&CX&KCMQX  5EJTÌVNKPIUHGJNGTUGJTUEJÌPpXQT\ÒINKEJ





4WDGN M[TKNNKUEJ /QUMCW/ÒP\JQH-CFCUJGXUM[I$KVMKP 4 &CX&KCMQX 49KP\5VGORGNHGJNGTCVVTCMVKXGU'ZGORNCTUGJTUEJÌPpXQT\ÒINKEJ





4WDGN  M[TKNNKUEJ  /QUMCW /ÒP\JQH -CFCUJGXUM[  I $KVMKP  &CX    &KCMQXXCT $GTKGDGPUGJTUEJÌP

16




PETER I. DER GROSSE

8012

8013



4WDGN 2QNVKPC  M[TKNNKUEJ /QUMCW/ÒP\JQH-CFCUJGXUM[I$KVMKP 4 &KCMQX 4-TCV\GTUGJTUEJÌP





4WDGN 2QNVKPC  M[TKNNKUEJ /QUMCW/ÒP\JQH-CFCUJGXUM[I$KVMKP 4 &KCMQX 44#VVTCMVKXGUUGJTUEJÌPGU'ZGORNCT



8015

8014



4WDGN 2QNVKPC  M[TKNNKUEJ /QUMCW/ÒP\JQH-CFCUJGXUM[I$KVMKP 4 &KCMQX 44-TCV\GTKO(GNFFGT4ÒEMUGKVGHCUVXQT\ÒINKEJ



 4WDGN 2QNVKPC   M[TKNNKUEJ  /QUMCW /ÒP\JQH -CFCUJGXUM[ I$KVMKP&KCMQX 5GJTUEJÌP 

8016

8017



8018

5KNDGTOÒP\GPCWUFGO4QVGP/ÒP\JQHKP/QUMCW 

4WDGN/QUMCW4QVGT/ÒP\JQHI$KVMKP&CX&KCMQXXCT  -TCV\GTUGJTUEJÌP





4WDGN/QUMCW4QVGT/ÒP\JQHI$KVMKP&CX&KCMQX  -N5EJTÌVNKPIUHGJNGTUGJTUEJÌP





4WDGN/QUMCW4QVGT/ÒP\JQHI$KVMKP&CX&KCMQX



5GJTUEJÌP

17


PETER I. DER GROSSE

8019

8021

8020



4WDGN/QUMCW4QVGT/ÒP\JQHI$KVMKP&CX&KCMQX  'VYCU$GNCI-TCV\GTUGJTUEJÌP





4WDGN/QUMCW4QVGT/ÒP\JQHI$KVMKPXCT&CX&KCMQXXCT  9KP\5EJTÌVNKPIUHGJNGTUGJTUEJÌP





4WDGN/QUMCW4QVGT/ÒP\JQHI$KVMKP&CX&KCMQX



(CUVUGJTUEJÌP

8023

8022

8022



4WDGN/QUMCW4QVGT/ÒP\JQHI$KVMKPXCT&CX&KCMQXXCT  -N5EJTÌVNKPIUHGJNGTUGJTUEJÌP





4WDGN 2QNVKPC  M[TKNNKUEJ /QUMCW4QVGT/ÒP\JQHI$KVMKP 4 &KCMQX  45VGORGNHGJNGTCO4CPFMN-TCV\GTHCUVXQT\ÒINKEJ



8025 8024

8024



4WDGN 2QNVKPC /QUMCW4QVGT/ÒP\JQHI$KVMKPXCT 4 &KCMQXXCT  45VGORGNHGJNGTHCUVUGJTUEJÌP





)TKXPC M[TKNNKUEJ /QUMCW4QVGT/ÒP\JQHI$KVMKP&KCMQX



18

5GJTUEJÌP


PETER I. DER GROSSE

1,5:1



8026

1,5:1

-QRGMGP #NV[P  M[TKNNKUEJ /QUMCW4QVGT/ÒP\JQHI$KVMKP&KCMQX  5GJTUGNVGPKPFKGUGT'TJCNVWPI2TCEJVGZGORNCT8QT\ÒINKEJp5VGORGNINCP\



8027

<YGK5QPPGPTWDGNCWUFGT/ÒP\UV·VVG5V2GVGTUDWTI 

4WDGN5V2GVGTUDWTI5QPPGPTWDGNI8CTKCPVGOKV5V#PFTGCU-TGW\UVCVV5QPPG)GJCT PKUEJVGU$TWUVDKNFTOKV.QTDGGTMTCP\WPFWOIGNGIVGO/CPVGN8KGTIGMTÌPVG/QPQITCOOGKPU-TGW\ IGUVGNNVKPFGT/KVVG-TGW\WPFFKGIGVGKNVG,CJTGU\CJN$KVMKP 4 &CX&KCMQX 8QPITQ­GT5GNVGPJGKV5GJTUEJÌP 

8029 8028

8028



4WDGN5V2GVGTUDWTI5QPPGPTWDGNI$KVMKP 4 &CX&KCMQX  4(CUVUGJTUEJÌP



'KPG-WRHGTMQRGMGCWUFGO/QUMCWGT/ÒP\JQH-CFCUJGXUM[ 

-W-QRGMG M[TKNNKUEJ /QUMCW/ÒP\JQH-CFCUJGXUM[I$KVMKP&KCMQX  5GJTUEJÌP



8030

/GFCKNNGPFGU<CTGP2GVGT+ 

5KNDGTOGFCKNNG  XQP ) *CWVUEJ WPF . ) .CWHHGT CWH FKG JGKNKIG #NNKCP\ \YKUEJGP 4W­NCPF   2QNGP 8GPGFKI WPF FGO -CKUGT .GQRQNF + IGIGP FKG 6ÒTMGP 8KMVQTKC UKV\V PCEJ N OKV (ÒNNJQTP WPF   XKGT 2HGKNGP FKG #NNKKGTVGP  CO $QFGP T UKV\V   GKP IGHGUUGNVGT 6ÒTMG KO *KPVGTITWPF XGPG\KCPKUEJG   5·WNGPJCNNG OKV FGP 9CRRGP FGT #NNKKGTVGP QDGP   JCNVGP \YGK CWU 9QNMGP MQOOGPFG *·PFG \YGK   2CNO\YGKIGWPFGKP%JTKUVQITCOO<GKNGP5EJTKHVFCTWPVGT5KIPCVWTOOI&KCMQXp *%\5NI/QPVGPWQXQ8QNVQNKPC (GKPG6ÌPWPIXQT\ÒINKEJp5VGORGNINCP\  19


PETER I. DER GROSSE

8031



8032

8033

$TQP\GOGFCKNNG  WPUKIPKGTV XQP 6 +YCPQHH UR·VGTG 2T·IWPI WO   CWH FKG 'TDCWWPI FGT   (GUVWPI -TQPUEJNQ­ FKG GTUVGP 6GKNG YWTFGP CO  /CK  GKPIGYGKJV  #PUKEJV FGT (GUVWPI   5QPPGWPF9QNMGPÒDGTFGODCNVKUEJGP/GGTOKV\YGK5GIGNUEJKHHGPKO8QTFGTITWPFTUVGJV/KPGTXC FKG CWH GKPG /ÌYG KP KJTGO 0GUV \GKIV FCU KO /GGT UEJYKOOV  OO  I &KCMQX    8QT\ÒINKEJ



2GVGT+FGT)TQ­GNKG­CWHFGTKO(KPPKUEJGP/GGTDWUGPFKTGMVXQT5V2GVGTUDWTINKGIGPFGP+PUGN-QVNKPFKGIGYCN VKIG(GUVWPI-TQPUEJNQ­GTTKEJVGPWOUGKPG5VCFVXQT#PITKHHGPXQPFGT/GGTUGKVG\WUEJÒV\GP&GT<CTYQNNVGCWH FGT+PUGNGKPG8QT\GKIGUVCFVGKP\YGKVGU#OUVGTFCOGTTKEJVGP0CEJFGO6QFFGU<CTGPIGTKGVGPFKG$CWCTDGKVGP LGFQEJ\WP·EJUVKPU5VQEMGPWPFYWTFGPGTUVPCEJGKPGTUEJYGTGPªDGTUEJYGOOWPIHQTVIGUGV\V&KG(GUVWPI -TQPUEJNQ­ UR·VGT -TQPUVCFV IGPCPPV  JKPFGTVG PKEJV PWT FKG 5EJYGFGP KO 0QTFKUEJGP -TKGI UQPFGTP CWEJ FKG   &GWVUEJGPKO<YGKVGP9GNVMTKGICO<WICPI\W5V2GVGTUDWTI



<KPPOGFCKNNGXQP1-CNCUJPKMQX UR·VGTG2T·IWPIFGU,CJTJWPFGTVU CWHFKGTWUUKUEJG(NQV VGPGZRGFKVKQP KP FGP (KPPKUEJGP /GGTDWUGP KO ,WNK )GJCTPKUEJVGU$TWUVDKNFTOKV.QTDGGTMTCP\ WPF WOIGNGIVGO /CPVGN&KG CWUNCWHGPFG (NQVVG KO 8QTFGTITWPF T GKP (GNUXQTURTWPI  OO   I&KCMQX 8QT\ÒINKEJ



0CEJFGO2GVGT+FCU$CNVKMWOWPF5ÒFHKPPNCPFYGKVIGJGPFWPVGTUGKPG-QPVTQNNGIGDTCEJVJCVVGYQNNVGGTCWEJFKG UEJYGFKUEJG (NQVVG DGUKGIGP FKG HÒT 4W­NCPF YGIGP FGT DGUUGTGP #WUTÒUVWPI GKPG DGFGWVGPFG )GHCJT FCTUVGNNVG   'TJCVVGGNHPGWGXQNNCWUIGTÒUVGVG-TKGIUUEJKHHGIGMCWHVWPFDGQDCEJVGVGKO/CKWPF,WPKXQPUGKPGT(GUVWPI -TQPUNQV JGWVG-TQPUVCFVCWHFGT+PUGN-QVNKPKO(KPPKUEJGP/GGTDWUGPMOYGUVNKEJXQP5V2GVGTUDWTI CWUFKG (NQVVGPOCPÌXGT #WH $GHGJN FGU <CTGP UGIGNVG FKG PGW CWUIGTÒUVGVG TWUUKUEJG (NQVVG CO  ,WNK  CD WO FKG   UEJYGFKUEJG(NQVVG\WUEJNCIGP#O,WNKMCOGUDGKFGT JGWVGTWUUKUEJGP +PUGN*QINCPF MOUÒFNKEJ FGT HKPPKUEJGP 5VCFV -QVMC  MO YGUVNKEJ XQP 5V 2GVGTUDWTI  \W GKPGO 5GGIGHGEJV FCU LGFQEJ WPGPVUEJKGFGP   XGTNKGH  &KG /GFCKNNG \GKIV UVQN\ FKG PGWGP TWUUKUEJGP -TKGIUUEJKHHG YQJN CWEJ CNU /CEJVFGOQPUVTCVKQP IGIGPÒDGT FGT   UEJYGFKUEJGP#FOKTCNKV·V



20

<KPPOGFCKNNG  WPUKIPKGTV XGTOWVNKEJ UR·VGTG 2T·IWPI FGU  ,CJTJWPFGTVU  CWH FKG 5GGUEJNCEJV   DGKOHKPPKUEJGP*CPMQ TWUUKUEJ)CPIWVUEJYGFKUEJ*CPIÌ CO,WNK)GJCTPKUEJVGU$TWUV DKNF T OKV .QTDGGTMTCP\ WPF WOIGNGIVGO /CPVGN&CTUVGNNWPI FGT 5GGUEJNCEJV  OO   I&KCMQX 8QT\ÒINKEJ




PETER I. DER GROSSE +O5QOOGTYCTFKG#WHTÒUVWPIFGTTWUUKUEJGP/CTKPGUQYGKVHQTVIGUEJTKVVGPFC­GKP#PITKHHCWHFKGUEJYG FKUEJG (NQVVG GTHQNIUXGTURTGEJGPF GTUEJKGP <CT 2GVGT + YQNNVG FKGUG HÒT FKG LWPIG 1UVUGGOCEJV 4W­NCPF UGJT IG   H·JTNKEJG (NQVVG WPUEJ·FNKEJ OCEJGP WPF CWEJ FGP 0CEJUEJWD HÒT FKG TWUUKUEJGP 'TQDGTWPIGP CP FGT HKPPKUEJGP   -ÒUVG UKEJGTP FGT FWTEJ FKG 5EJYGFGP CWH FGO 5GGYGI TGIGNO·­KI WPVGTDTQEJGP YWTFG &KG UEJYGFKUEJG (NQVVG   WPVGT#FOKTCN)WUVCX9CVVTCPIJCVVGDGTGKVUKO(TÒJUQOOGTDGKFGT*CPMQ*CNDKPUGN UEJYGFKUEJ*CPIÌWFF  2QUKVKQPDG\QIGPWOUKEJFGP4WUUGPGPVIGIGP\WUVGNNGP&KGTWUUKUEJG(NQVVGWPVGT#FOKTCN)TCH(GFQT#RTCMUKP YWTFGFWTEJYGKVGTGCWUFGO$CNVKMWOJGTDGKIG\QIGPG-TKGIUUEJKHHGXGTUV·TMVWPFCWEJ<CT2GVGT+GKNVGRGTUÌP NKEJPCEJ5ÒFHKPPNCPF0CEJFGOFGTWTURTÒPINKEJG2NCPFGUTWUUKUEJGP#FOKTCNUGKPGP6GKNUGKPGT5EJKHHGÒDGTFGP .CPFTÒEMGPFGT*CNDKPUGN\W\KGJGPWPFUQFKGUEJYGFKUEJG(NQVVG\WWO\KPIGNPIGUEJGKVGTVYCTDGUEJNQ­GTCO ,WNKFGPFKTGMVGP&WTEJDTWEJÒDGT5GGFWTEJFKGUEJYGFKUEJGP.KPKGP$GKTWJKIGO9GVVGTNKG­GPUKEJFKG MNGKPGP YGPFKIGP 4WFGTUEJKHHG FGT 4WUUGP FGWVNKEJ DGUUGT OCPÌXTKGTGP CNU FKG UEJYGTGP UEJYGFKUEJGP -TKGIU   UEJKHHG0CEJGTUVGP'THQNIGPCO,WNKIGNCPIGUFGT\CJNGPO·­KIYGKVÒDGTNGIGPGPTWUUKUEJGP(NQVVGCO,WNK KPFGTDGKPCJGFTGK5VWPFGPCPFCWGTPFGPJGHVKIGP5GGUEJNCEJVFKGUEJYGFKUEJGP5EJKHHG\WGPVGTPWPFFGPXGTYWP FGVGPUEJYGFKUEJGP-QPVGTCFOKTCN0KNU'JTGPUMÌNFIGHCPIGP\WPGJOGP  'UYCTFGTGTUVGDGFGWVGPFG5GGUKGIKPFGTTWUUKUEJGP)GUEJKEJVGWPF<CT2GVGT+HGKGTVGUGKPGP'THQNIOKVGKPGO RQORÌUGP6TKWORJ\WIKP5V2GVGTUDWTIKPFGOCWEJFGTUEJYGFKUEJG-QPVGTCFOKTCN'JTGPUMÌNFOKVIGHÒJTVYWTFG &GT  ,WNK YWTFG XQP FGT TWUUKUEJGP -KTEJG \WO (GKGTVCI GTJQDGP FGT OKV FGP INGKEJGP <GTGOQPKGP YKG FGT   2QNVCYC6CI ,WPK DGICPIGPYGTFGPUQNNVG(ÒTFGP*GKNKIGPFGU,WNKFGP/·TV[TGT2CPVGNGKOQPYWTFGKP 5V2GVGTUDWTIGKPG-KTEJGGTTKEJVGV

8035

8034



8034

$TQP\GOGFCKNNGWPUKIPKGTV XGTOWVNKEJUR·VGTG2T·IWPIFGU,CJTJWPFGTVU CWHFCU-QOOCPFQ FGU<CTGPÒDGTFCU/CPÌXGTFGTXKGTCNNKKGTVGP(NQVVGP 4W­NCPF&·PGOCTM'PINCPF*QNNCPF DGKFGT F·PKUEJGP+PUGN$QTPJQNOXQODKU#WIWUV$ÒUVGTCWHGKPGO2QUVCOGPVFCJKPVGT9CHHGP FGT -TKGIUOCTKPG0GRVWP OKV &TGK\CEM CP FGO FKG TWUUKUEJG (CJPG DGHGUVKIV KUV YKTF KP GKPGT -WV   UEJG XQP \YGK 2HGTFGP PCEJ T FWTEJ FCU VQUGPFG /GGT IG\QIGP CP FGT -WVUEJG UKPF FKG (CJPGP XQP   &·PGOCTM'PINCPFWPF*QNNCPFDGHGUVKIVOOI&KCMQX  *ÒDUEJG2CVKPCXQT\ÒINKEJp5VGORGNINCP\



<CT 2GVGT + YQNNVG PCEJ UGKPGP 5KGIGP DGK 2QNVCYC WPF XQT *CPMQ )CPIWV  PCEJ 5EJYGFGP GKPOCTUEJKGTGP WO   UGKPGP 4KXCNGP -CTN :++ GPFIÒNVKI \W DGUKGIGP +O ,WPK  DGUEJNQ­ GT OKV FGO F·PKUEJGP -ÌPKI (TGFGTKM +8   FGPIGOGKPUCOGP'KPOCTUEJKP5EJQPGP 5M¹PG &KGDGKFGPJQHHVGPFC­FKG(NQVVGPFGTCNNKKGTVGP'PIN·PFGTWPF *QNN·PFGT FGP *CHGPXQP-CTNUMTQPCFKG$CUKUFGTUEJYGFKUEJGP-TKGIUOCTKPGDNQEMKGTGPYÒTFGP&KGXKGTCNNK KGTVGP(NQVVGPXGTCPUVCNVGVGP#PHCPI#WIWUVGKPITQ­CPIGNGIVGU/CPÌXGTDGKFGT+PUGN$QTPJQNOFCUXQP<CT 2GVGT + RGTUÌPNKEJ IGNGKVGV YWTFG 5QYQJN DGK FGP 'PIN·PFGTP WPF *QNN·PFGTP CNU CWEJ DGK FGP &·PGP YWEJUGP   LGFQEJ $GFGPMGP WPF /K­VTCWGP IGIGP FKG TCUCPV YCEJUGPFG /CEJV FGU <CTGP KO 1UVUGGTCWO &KG IGOGKPUCOG   (NQVVGPCMVKQPDNKGDCWHFCU/CPÌXGTDGUEJT·PMV  &GT /CEJVCPURTWEJ FGU <CTGP FGT FGP 8GTDÒPFGVGP WPJGKONKEJ YWTFG KUV CWEJ CWH FGT XQTNKGIGPFGP /GFCKNNG   GTMGPPDCT&KGM[TKNNKUEJG4ÒEMUGKVGPWOUEJTKHVDGFGWVGV'THÒJTV$GHGJNÒDGTFKGXKGT=(NQVVGP?DGK$QTPJQNO



$TQP\GOGFCKNNGXQP1-CNCUJPKMQX UR·VGTG2T·IWPIFGU,CJTJWPFGTVU 6CRHGTMGKVUOGFCKNNG HÒT6GKNPGJOGTFGT5GGUEJNCEJVDGKFGTPÌTFNKEJXQP)QVNCPFIGNGIGPGP+PUGN5CPFÌCO/CK)GJCT PKUEJVGU $TWUVDKNF T OKV .QTDGGTMTCP\ WPF WOIGNGIVGO /CPVGN&CTUVGNNWPI FGT 5GGUEJNCEJV    OOI&KCMQX 4)TÒPURCPHNGEMXQT\ÒINKEJp5VGORGNINCP\



7OFKGUEJYGFKUEJG5EJKHHCJTV\WUKEJGTPUGIGNVGPKO/CKFTGKUEJYGFKUEJG(TGICVVGPWPVGTFGO-QOOCPFQ XQP#PVQP,QJCP9TCPIGNXQP5VQEMJQNOKP4KEJVWPI$CNVKMWO#NUFGTTWUUKUEJG#FOKTCN(GFQT#RTCMUKPFGTUKEJ KP 4GXCN CWHJKGNV FCXQP GTHWJT GPVUCPFVG GT GKPG (NQVVG OKV UGEJU (TGICVVGP WO FKG UEJYGFKUEJGP 5EJKHHG CWH\W   DTKPIGP #O  /CK  MCO GU XQT FGT UEJYGFKUEJGP +PUGN 5CPFÌ PÌTFNKEJ XQP )QVNCPF  \W GKPGO DTWVCNGP   5GGIGHGEJVDGKFGOFKG5EJYGFGPCNNGFTGK5EJKHHGXGTNQTGP

21


KATHARINA I.

8036



$TQP\GOGFCKNNG  WPUKIPKGTV XGTOWVNKEJ UR·VGTG 2T·IWPI WO   CWH FGP (TKGFGP XQP 0[UVCF   \YKUEJGP 5EJYGFGP WPF 4W­NCPF XQO  #WIWUV  &KG #TEJG 0QCJ CWH 5GG FCTÒDGT HNKGIV GKPG   6CWDGNOKV¤N\YGKIKO5EJPCDGNKO*KPVGTITWPFXGTDKPFGVGKP4GIGPDQIGPFKG5V·FVG5V2GVGTUDWTI WPF5VQEMJQNO<GKNGP5EJTKHVOOI&KCMQX  -N4CPFHGJNGTUGJTUEJÌPpXQT\ÒINKEJ



&KG 5EJTKHV KO #DUEJPKVV FGT 8QTFGTUGKVG GPVJ·NV KTTVÒONKEJ FKG ,CJTGU\CJN  CPUVCVV  CNU %JTQPQITCOO    0CEJFGO FKG 4WUUGP KP FGP 5QOOGTOQPCVGP FGT ,CJTG  WPF  OGJTGTG UEJYGFKUEJG 5V·FVG  

WC0QTTMÌRKPIWPF7OG¹ \GTUVÌTVJCVVGPOW­VG5EJYGFGPUEJNKG­NKEJCO5GRVGODGTKPFGP(TKGFGP XQP0[UVCF HKPPKUEJ7WUKMCWRWPMKIGNGIGPKP9GUVHKPPNCPFECMOPQTFYGUVNKEJXQP6WTMW’DQ GKPYKNNKIGP &GT(TKGFGYCTGKPITQ­GT6TKWORJFGUTWUUKUEJGP<CTGP2GVGT+5EJYGFGPOW­VG'UVNCPF.KXNCPFOKVFGP+PUGNP ¤UGNWPF&CIÌ+PIGTOCPNCPF FCU)GDKGV\YKUEJGP5V2GVGTUDWTIWPF0CTXC UQYKG-CTGNKGPOKV8KDQTICP4W­ NCPFCDVTGVGPWPFGTJKGNVNGFKINKEJFCUXQP2GVGT+GTQDGTVG(KPPNCPF\WTÒEM

8037



8GTIQNFGVG $TQP\GOGFCKNNG  XQP # 5EJWNV\ XGTOWVNKEJ UR·VGTG 2T·IWPI  CWH FGP (TKGFGP XQP   0[UVCF\YKUEJGP5EJYGFGPWPF4W­NCPFXQO#WIWUV)GJCTPKUEJVGU$TWUVDKNFTOKV.QTDGGT MTCP\WPFWOIGNGIVGO/CPVGN<GKNGP5EJTKHVOOI&KCMQX 4   8QPITQ­GT5GNVGPJGKV8GTIQNFGVXQT\ÒINKEJ



8038

<#4+0-#6*#4+0#+ 5KNDGTOÒP\GPCWUFGO4QVGP/ÒP\JQHKP/QUMCW  22

4WDGN/QUMCW4QVGT/ÒP\JQHI$KVMKP&CX&KCMQX  (GKPG2CVKPCUGJTUEJÌP




KATHARINA I.

8039

8041

8040



4WDGN/QUMCW4QVGT/ÒP\JQHI$KVMKP&CX&KCMQX

5GJTUEJÌP





4WDGN/QUMCW4QVGT/ÒP\JQHI$KVMKP&CX&KCMQX

(CUVUGJTUEJÌP





4WDGN/QUMCW4QVGT/ÒP\JQHI$KVMKP&CX&KCMQX  5EJTÌVNKPIUHGJNGTUGJTUEJÌP



8042



4WDGN/QUMCW4QVGT/ÒP\JQHI$KVMKP&CX&KCMQX

8043

45GJTUEJÌP



8043 1,5:1



'KP4WDGNCWUFGT/ÒP\UV·VVG5V2GVGTUDWTI

4WDGN5V2GVGTUDWTII$KVMKP&CX&KCMQX

445GJTUEJÌP

 23


PETER II.

8044

8045

8046

<#42'6'4++ 'KP4WDGNCWUFGO4QVGP/ÒP\JQHKP/QUMCW 

4WDGN/QUMCW4QVGT/ÒP\JQHI$KVMKPXCT&CX&KCMQXXCT  5GJTUEJÌPpXQT\ÒINKEJ



5KNDGTOÒP\GPCWUFGO/QUMCWGT/ÒP\JQH-CFCUJGXUM[ 

4WDGN/QUMCW/ÒP\JQH-CFCUJGXUM[I/KVHGJNGTJCHVGT4CPFUEJTKHV4WGNUVCVV4WDN $KVMKPHHXCT&CX&KCMQXHHXCT 44(CUVUGJTUEJÌP



4WDGN/QUMCW/ÒP\JQH-CFCUJGXUM[I$KVMKP&CX&KCMQXXCT

 5GJTUEJÌP

 

8048

8047

8047



4WDGN/QUMCW/ÒP\JQH-CFCUJGXUM[I$KVMKP&CX&KCMQX

5GJTUEJÌP





4WDGN/QUMCW/ÒP\JQH-CFCUJGXUM[I$KVMKP&CX&KCMQX  -N5EJTÌVNKPIUHGJNGTUGJTUEJÌP



24


PETER II.

8050

8049

8049



4WDGN/QUMCW/ÒP\JQH-CFCUJGXUM[I$KVMKPXCT&CX&KCMQXXCT  (CUVUGJTUEJÌP





4WDGN/QUMCW/ÒP\JQH-CFCUJGXUM[I$KVMKP&CX&KCMQX  *ÒDUEJG2CVKPCUGJTUEJÌPUGJTUEJÌPpXQT\ÒINKEJ



8052

8051

-WRHGTOÒP\GPCWUFGO/QUMCWGT/ÒP\JQH-CFCUJGXUM[ 

-W-QRGMG/QUMCW/ÒP\JQH-CFCUJGXUM[I$KVMKP 4 &KCMQX  4<CRQPKGTVXQT\ÒINKEJ





-W-QRGMG/QUMCW/ÒP\JQH-CFCUJGXUM[I$KVMKPXCT&KCMQXXCT 5GJTUEJÌP



8053

'KPG/GFCKNNGFGU<CTGP2GVGT++ 

$TQP\GOGFCKNNG  XQP # 5EJWNV\ UR·VGTG 2T·IWPI FGU  ,CJTJWPFGTVU  CWH UGKPG -TÌPWPI KP   /QUMCW CO  (GDTWCT )GJCTPKUEJVGU $TWUVDKNF T OKV .QTDGGTMTCP\ WPF #PFTGCUQTFGP#NVCT OKV   -TÌPWPIUKPUKIPKGPQDGPUVTCJNGPFGU)QVVGUCWIGOOI&KCMQX 4   44-N5EJTÌVNKPIUHGJNGTXQT\ÒINKEJ  25


ANNA

8054

8055

8056

<#4+0#00# 5KNDGTOÒP\GPCWUFGO/QUMCWGT/ÒP\JQH-CFCUJGXUM[ 

4WDGN/QUMCW/ÒP\JQH-CFCUJGXUM[I$KVMKP 4 &CX&KCMQX  45GJTCVVTCMVKXGU'ZGORNCTOKVJÒDUEJGT2CVKPC<CKPGPFGXQT\ÒINKEJp5VGORGNINCP\





4WDGN/QUMCW/ÒP\JQH-CFCUJGXUM[I$KVMKPXCT&CX&KCMQXXCT  5GJTUEJÌP





4WDGN/QUMCW/ÒP\JQH-CFCUJGXUM[I$KVMKPHHXCT&CX&KCMQXHHXCT /KPDGTKGDGPHCUVUGJTUEJÌP



8057

8058

8059



4WDGN/QUMCW/ÒP\JQH-CFCUJGXUM[I$KVMKPHHXCT&CX&KCMQXHHXCT (GKPG2CVKPCUGJTUEJÌP



4WDGN/QUMCW/ÒP\JQH-CFCUJGXUM[I$KVMKP 4 &CX&KCMQX  44*ÒDUEJG2CVKPCMN<CKPGPFGXQT\ÒINKEJ





4WDGN/QUMCW/ÒP\JQH-CFCUJGXUM[I$KVMKPXCT 4 &CX&KCMQX  8QPITQ­GT5GNVGPJGKV(CUVXQT\ÒINKEJ



26




ANNA

8060

1,5:1



1,5:1

4WDGN/QUMCW/ÒP\JQH-CFCUJGXUM[I)GMTÌPVGU$TWUVDKNFTOKVWOIGNGIVGO1TFGPU DCPF)GMTÌPVGT&QRRGNCFNGTOKV<GRVGTWPF4GKEJUCRHGNKPFGP(·PIGPCWHFGT$TWUV5V)GQTIUUEJKNF WOJGTFKG-GVVGFGU#PFTGCUQTFGPUQDGP-TQPG$KVMKP 4 &CX&KCMQX  44#VVTCMVKXGU'ZGORNCTYKP\5EJTÌVNKPIUHGJNGTXQT\ÒINKEJ 

8061



8061

1,5:1

4WDGN/QUMCW/ÒP\JQH-CFCUJGXUM[I)GMTÌPVGU$TWUVDKNFTOKVWOIGNGIVGO1TFGPU DCPF)GMTÌPVGT&QRRGNCFNGTOKV<GRVGTWPF4GKEJUCRHGNKPFGP(·PIGPCWHFGT$TWUV5V)GQTIUUEJKNF WOJGTFKG-GVVGFGU#PFTGCUQTFGPUQDGP-TQPG$KVMKP 4 &CX&KCMQX  8QPITQ­GT5GNVGPJGKV-N<CKPGPFGUGJTUEJÌP 

8062

8063



4WDGN/QUMCW/ÒP\JQH-CFCUJGXUM[I$KVMKP&CX&KCMQX

 5GJTUEJÌP





4WDGN/QUMCW/ÒP\JQH-CFCUJGXUM[I$KVMKP&CX&KCMQX  *ÒDUEJG2CVKPCUGJTUEJÌP

 27


ANNA

8064

8065



4WDGN 2QNVKPC /QUMCW/ÒP\JQH-CFCUJGXUM[I8CTKCPVGOKV2WPMVGPKPFGT4ÒEM UGKVGPWOUEJTKHV$KVMKPHH&KCMQX 5EJTÌVNKPIUHGJNGTHCUVXQT\ÒINKEJ





4WDGN 2QNVKPC /QUMCW/ÒP\JQH-CFCUJGXUM[I$KVMKP&KCMQX  *ÒDUEJG2CVKPCUGJTUEJÌP



8066

8066 1,5:1

'KP4WDGNFGU5VGORGNUEJPGKFGTU&OKVTKGXCWUFGO4QVGP/ÒP\JQHKP/QUMCW 

4WDGN  /QUMCW 4QVGT /ÒP\JQH  I &OKVTKGX U 2T·IWPI XQP FGP 5VGORGNP *GFNKPIGTU   )GMTÌPVGU $TWUVDKNF T OKV WOIGNGIVGO /CPVGN)GMTÌPVGT &QRRGNCFNGT OKV <GRVGT WPF 4GKEJUCRHGN KP   FGP (·PIGP CWH FGT $TWUV 5V )GQTIUUEJKNF WOJGT FKG -GVVG FGU #PFTGCUQTFGPU QDGP -TQPG $KVMKP    4 &CX&KCMQX 44*ÒDUEJG2CVKPCMN5EJTÌVNKPIUHGJNGTUGJTUEJÌPpXQT\ÒINKEJ 

8067

8068



'KPG-WRHGTRT·IWPIFGT<CTKP#PPC

8068

-W2QNWUEJMC/QUMCW9KPFOÒJNGCO,CW\CI$KVMKP&KCMQX

8QT\ÒINKEJ



'KPG/GFCKNNGFGT<CTKP#PPC 

28

$TQP\GOGFCKNNGQ,XQP6+YCPQHHWPF5,WFKPIGHGTVKIV\W'JTGPFGT<CTKP)GMTÌPVGU$TWUVDKNFT OKV WOIGNGIVGO /CPVGN/KPGTXC OKV *GNO 5RGGT WPF 5EJKNF UKV\V X X CWH 9QNMGPTCWHFGO$Q FGP NKGIGP #VVTKDWVG XQP -WPUV WPF 9KUUGPUEJCHV  OO  I &KCMQX XIN  FQTV OKV   5KIPCVWTXQP(9)CUUCWHFGT4ÒEMUGKVG  8QT\ÒINKEJ




ELISABETH

1,5:1

8069

1,5:1

<#4+8#0+++ 'KP)TKXGPPKMCWUFGO4QVGP/ÒP\JQHKP/QUMCW 

-QRGMGP )TKXGPPKM /QUMCW4QVGT/ÒP\JQHI$KVMKP 4 &KCMQX  44(CUVUGJTUEJÌP



8070

1,5:1

1,5:1

'KP4WDGNCWUFGT/ÒP\UV·VVG5V2GVGTUDWTI 

4WDGN5V2GVGTUDWTII$TWUVDKNFTOKV.QTDGGTMTCP\WOIGNGIVGO/CPVGNWPF#PFTGCU QTFGP)GMTÌPVGT &QRRGNCFNGT OKV <GRVGT WPF 4GKEJUCRHGN KP FGP (·PIGP CWH FGT $TWUV 5V )GQTIU   UEJKNFWOJGTFKG-GVVGFGU#PFTGCUQTFGPUQDGP-TQPG$KVMKP 4 &CX&KCMQX  5GJTUGNVGPKPFKGUGT'TJCNVWPI 5GJTCVVTCMVKXGU'ZGORNCTYKP\5EJTÌVNKPIUHGJNGTXQT\ÒINKEJ 

8071

1,5:1

8072

<#4+0'.+5#$'6* )QNFOÒP\GPCWUFGO4QVGP/ÒP\JQHKP/QUMCW 

4WDGN/QUMCW4QVGT/ÒP\JQHI$KVMKP 4 &KCMQX 4 (D  )1.&(CUVXQT\ÒINKEJ





4WDGN/QUMCW4QVGT/ÒP\JQHI$KVMKP 4 &KCMQX 4 (D  )1.&440WT'ZGORNCTGIGRT·IV5GJTUEJÌP



'U JCPFGNV UKEJ WO FGP UGNVGPUVGP 6[R FGT4WDGN5VÒEMGXQP<CTKP'NKUCDGVJ'UYWTFGPNGFKINKEJ5VÒEMG IGRT·IV Y·JTGPF XQO ,CJTICPI  KP FGT /QUMCWGT /ÒP\UV·VVG -TCUP[ KO )GIGPUCV\ \WO XQTNKGIGPFGP ,CJT   ICPI    'ZGORNCTG WPF KP FGT /ÒP\UV·VVG 5V 2GVGTUDWTI  'ZGORNCTG JGTIGUVGNNV YWTFGP   &CUXQTNKGIGPFG4WDGN5VÒEMXQP\·JNV\WFGPIGUWEJVGP4CTKV·VGPWPVGTFGP)QNFRT·IWPIGPFGUTWUUKUEJGP <CTGPTGKEJGU

29


ELISABETH

8073

1,5:1

8074

8073

1,5:1

8074



4WDGN/QUMCW4QVGT/ÒP\JQHI$KVMKP 4 &KCMQX 4 (D  )1.&8QT\ÒINKEJ





4WDGN ,CJTGU\CJNKO5VGORGNCWUIG·PFGTV /QUMCW4QVGT/ÒP\JQHI$KVMKP 4  &KCMQX 4 (D  )1.&4-N5EJTÌVNKPIUHGJNGT4GUVGXQP<CRQPNCEMUGJTUEJÌPpXQT\ÒINKEJ



1,5:1



1,5:1

4WDGN 2QNVKPC /QUMCW4QVGT/ÒP\JQHI$KVMKP 4 &KCMQX 4 (D  )1.&#VVTCMVKXGUXQT\ÒINKEJGU'ZGORNCT

1,5:1



8075

8076

'KPIQNFGPGU4WDGN5VÒEMCWUFGT/ÒP\UV·VVG5V2GVGTUDWTI

1,5:1

4WDGN5V2GVGTUDWTII$KVMKP 4 &KCMQX 4 (D

8077

8078



)1.&8QT\ÒINKEJ



8079

5KNDGTOÒP\GPCWUFGO4QVGP/ÒP\JQHKP/QUMCW 

4WDGN  /QUMCW 4QVGT /ÒP\JQH  I &GWVNKEJ ÒDGTRT·IV CWH GKPGO 4WDGN 'NKUCDGVJU FGT   /ÒP\UV·VVG5V2GVGTUDWTI$KVMKP\W&CX&KCMQX\W 448QT\ÒINKEJ 



4WDGN/QUMCW4QVGT/ÒP\JQHI$KVMKPXCT 4 &CX&KCMQXXCT  5GJTUEJÌP





4WDGN/QUMCW4QVGT/ÒP\JQHI$KVMKP&CX&KCMQX  5EJÌPG2CVKPCYKP\5EJTÌVNKPIUHGJNGTWPFYKP\-TCV\GTCVVTCMVKXGUUGJTUEJÌPGU'ZGORNCT



30


ELISABETH

8083

8080

8081

8084



4WDGN/QUMCW4QVGT/ÒP\JQHI$KVMKP&CX&KCMQX  9KP\4CPFHGJNGTUGJTUEJÌP





4WDGN/QUMCW4QVGT/ÒP\JQHI$KVMKP&CX&KCMQX





 4WDGN 2QNWRQNVKPPKM    DGKFG /ÒP\UV·VVG /QUMCW 4QVGT /ÒP\JQH  I WPF  I   $KVMKP&KCMQX 5VÒEM)GNQEJV Z -TCV\GT Z UGJTUEJÌP





4WDGN 2QNWRQNVKPPKM /QUMCW4QVGT/ÒP\JQHI$KVMKP&KCMQX





-QRGMGP )TKXGPPKM /QUMCW4QVGT/ÒP\JQH+P752NCUVKMJQNFGTFGT2%)5OKVFGT$GYGT VWPI/5$KVMKP&KCMQX 8QT\ÒINKEJ

'ZGORNCTFGT#WMVKQP4CWEJ9KGP0T

8085

8086

5GJTUEJÌP

5GJTUEJÌP



8087

5KNDGTOÒP\GPCWUFGT/ÒP\UV·VVG5V2GVGTUDWTI 

4WDGN5V2GVGTUDWTII$KVMKPNGKEJVXCT&CX&KCMQXNGKEJVXCT

 5GJTUEJÌP





4WDGN5V2GVGTUDWTII$KVMKP&CX&KCMQX  5GJTUEJÌPUGJTUEJÌPpXQT\ÒINKEJ





4WDGN5V2GVGTUDWTII$KVMKP&CX&KCMQX*ÒDUEJG2CVKPCHCUVXQT\ÒINKEJ

 31


ELISABETH

8088

8090

8089



4WDGN5V2GVGTUDWTII$KVMKPXCT&CX&KCMQX

5GJTUEJÌP





4WDGN5V2GVGTUDWTII$KVMKPXCT&CX&KCMQXXCT  -N5EJTÌVNKPIUHGJNGTCO4CPFUGJTUEJÌP





4WDGN5V2GVGTUDWTII$KVMKP&CX&KCMQX  *ÒDUEJG2CVKPC-TCV\GTKO(GNFFGT8QTFGTUGKVGHCUVXQT\ÒINKEJXQT\ÒINKEJ



8091

8092

8093



4WDGN5V2GVGTUDWTII$KVMKP&CX&KCMQX

(GKPG2CVKPCUGJTUEJÌP





4WDGN5V2GVGTUDWTI5QIGPCPPVGT5EQVV4WDGNI$KVMKP&CX&KCMQX  2TCEJVXQNNG2CVKPCHCUVXQT\ÒINKEJ





4WDGN5V2GVGTUDWTI5QIGPCPPVGT5EQVV4WDGNI$KVMKP&CX&KCMQX  &WPMNG2CVKPCUGJTUEJÌPpXQT\ÒINKEJXQT\ÒINKEJ



32


ELISABETH

8094

8095

8096



4WDGN5V2GVGTUDWTI5QIGPCPPVGT5EQVV4WDGNI$KVMKP&CX&KCMQX  5GJTUEJÌPpXQT\ÒINKEJXQT\ÒINKEJ





4WDGN5V2GVGTUDWTI5QIGPCPPVGT5EQVV4WDGNI$KVMKP&CX&KCMQX  5GJTUEJÌPpXQT\ÒINKEJ



4WDGN 5V2GVGTUDWTI5QIGPCPPVGT5EQVV4WDGNI$KVMKP&CX&KCMQX 5GJTUEJÌP



'ZGORNCTFGT#WMVKQP4CWEJ9KGP0T



8097



4WDGN 2QNVKPC 5V2GVGTUDWTII$KVMKP 4 &KCMQX 4   4-N5EJTÌVNKPIUHGJNGTGVYCUDGTKGDGPUGJTUEJÌPpXQT\ÒINKEJ



8098

1,5:1



1,5:1

4WDGN 2QNVKPC 5V2GVGTUDWTII$KVMKP 4 &KCMQX 4   5GJTUGNVGPDGUQPFGTUKPFKGUGT'TJCNVWPI#VVTCMVKXGUXQT\ÒINKEJGU'ZGORNCT

 33


ELISABETH

8100

8099

8099

-WRHGTRT·IWPIGPFGT<CTKP'NKUCDGVJ 

-W-QRGMG/QUMCW4QVGT/ÒP\JQHI$KVMKP&KCMQX  -N2T·IGUEJY·EJGXQT\ÒINKEJ





-W-QRGMGP'MCVGTKPDWTII$KVMKP&KCMQX  5GNVGPKPFKGUGT'TJCNVWPI8QT\ÒINKEJ



8101

8102



-W -QRGMGP  'MCVGTKPDWTI  I ªDGTRT·IV CWH GKPGT -W-QRGMG  FGT /ÒP\UV·VVG   /QUMCW $KVMKP $KVMKPp XIN &KCMQXp XIN  48QT\ÒINKEJ





-W -QRGMGP  'MCVGTKPDWTI  I ªDGTRT·IV CWH GKPGT -W-QRGMG !    6[R$KVMKP $KVMKPp XIN &KCMQXp XIN  48QT\ÒINKEJp5VGORGNINCP\



8103

8104



-W -QRGMGP  'MCVGTKPDWTI  I #WH WPIGYÌJPNKEJ MNGKPGO WPF UEJYGTGP 5EJTÌVNKPI   IGRT·IV$KVMKPXIN&KCMQXXIN 48QT\ÒINKEJp5VGORGNINCP\





-W-QRGMGP ,CJTGU\CJNKO5VGORGNCWUIG·PFGTV 'MCVGTKPDWTII#WHWPIGYÌJP NKEJMNGKPGO5EJTÌVNKPIIGRT·IV$KVMKPXIN&KCMQXXIN 48QT\ÒINKEJ





-W-QRGMG'MCVGTKPDWTII$KVMKP&KCMQX

8QT\ÒINKEJ



8107

8106

8108



-W-QRGMG  'MCVGTKPDWTI 0QXQFGN OKV INCVVGO 4CPF  I $KVMKP *  &KCMQX 5    0 448QT\ÒINKEJp5VGORGNINCP\





-W2QNWUEJMC'MCVGTKPDWTII$KVMKP 4 &KCMQX





-W-QRGMG  5V 2GVGTUDWTI  I 5KEJVDCT ÒDGTRT·IV CWH GKPGO -W -QRGMGP5VÒEM    XQP#PPC$KVMKP 4 &KCMQX 45GJTUEJÌP

34

45GJTUEJÌP




ELISABETH

8109 1,5:1

1,5:1

'KPG2T·IWPIHÒT.KXNCPFWPF'UVNCPF 

 .KXQPCKUG  4WDGN \W  -QRGMGP   /QUMCW 4QVGT /ÒP\JQH IGRT·IV HÒT .KXNCPF WPF   'UVNCPFI)GMTÌPVGU$TWUVDKNFTOKV1TFGPUDCPFWPFWOIGNGIVGO/CPVGN)GMTÌPVGT&QRRGNCFNGT OKV<GRVGTWPF4GKEJUCRHGNKPFGP(·PIGPCWHFGT$TWUVFKG5EJKNFGXQP4KICWPF4GXCNQDGP-TQPG $KVMKPNGKEJVXCT&KCMQXNGKEJVXCT 4   W­GTUVUGNVGPKPFKGUGT'TJCNVWPI(GKPG2CVKPCXQT\ÒINKEJp5VGORGNINCP\ 

8110

8111

8111 1,5:1

2T·IWPIGPHÒT1UVRTGW­GP 

 6CNGT  -ÌPKIUDGTI IGRT·IV HÒT 1UVRTGW­GP WPVGT TWUUKUEJGT $GUCV\WPI  I   $KVMKP 4 &KCMQX 4 1NF# 5GJTUEJÌPpXQT\ÒINKEJ



 )TQUEJGP  -ÌPKIUDGTI IGRT·IV HÒT 1UVRTGW­GP WPVGT TWUUKUEJGT $GUCV\WPI  I   /KV XCTKKGTGPFGT 8QTFGTUGKVGPWOUEJTKHV '.+5#$'6*# Û + Ù & Ù ) Ù +/2 Ù 616 Ù 4755   $KVMKPXCT 4 &KCMQXXCT 4 1NFEXCT  8QPITQ­GT5GNVGPJGKV(GKPG2CVKPCHCUVXQT\ÒINKEJ 

8112

8113

8114



8115



 6CNGT  -ÌPKIUDGTI IGRT·IV HÒT 1UVRTGW­GP WPVGT TWUUKUEJGT $GUCV\WPI  I   $KVMKP 4 &KCMQX1NFC &WPMNG2CVKPCHCUVXQT\ÒINKEJ





 6CNGT  -ÌPKIUDGTI IGRT·IV HÒT 1UVRTGW­GP WPVGT TWUUKUEJGT $GUCV\WPI  I   $KVMKP 4 &KCMQX1NFC 5GJTUEJÌPpXQT\ÒINKEJ





 6CNGT  -ÌPKIUDGTI IGRT·IV HÒT 1UVRTGW­GP WPVGT TWUUKUEJGT $GUCV\WPI  I   $KVMKP 4 &KCMQX1NFD 5GJTUEJÌP





)TÌUEJGT  -ÌPKIUDGTI IGRT·IV HÒT 1UVRTGW­GP WPVGT TWUUKUEJGT $GUCV\WPI  I $KVMKP    &KCMQX1NFC 5GJTUEJÌPpXQT\ÒINKEJ

 35


ELISABETH

8119 8116

8117



)TÌUEJGT  -ÌPKIUDGTI IGRT·IV HÒT 1UVRTGW­GP WPVGT TWUUKUEJGT $GUCV\WPI  I $KVMKP    &KCMQX1NFC (CUVXQT\ÒINKEJ





)TÌUEJGT/QUMCW4QVGT/ÒP\JQHIGRT·IVHÒT1UVRTGW­GPWPVGTTWUUKUEJGT$GUCV\WPII $KVMKP 4 &KCMQX 4 1NF (CUVXQT\ÒINKEJ





)TÌUEJGT/QUMCW4QVGT/ÒP\JQHIGRT·IVHÒT1UVRTGW­GPWPVGTTWUUKUEJGT$GUCV\WPII $KVMKP 4 &KCMQX 4 1NF &WPMNG2CVKPCUGJTUEJÌP





)TÌUEJGT/QUMCW4QVGT/ÒP\JQHIGRT·IVHÒT1UVRTGW­GPWPVGTTWUUKUEJGT$GUCV\WPII $KVMKP 4 &KCMQX1NFC 5GJTUEJÌP



8120

/GFCKNNGPFGT<CTKP'NKUCDGVJ 

$TQP\GOGFCKNNG  XQP 6 +YCPQHH XGTOWVNKEJ UR·VGTG 2T·IWPI FGU  ,CJTJWPFGTVU  CWH KJTG   6JTQPDGUVGKIWPI )GMTÌPVGU$TWUVDKNFTOKVWOIGNGIVGO/CPVGN&KG<CTKPOKV-TGW\KPFGT4GEJVGP HÒJTV 6TWRRGP FWTEJ GKPG 5VTC­G WPF FGWVGV OKV FGT .KPMGP CWH GKP )GD·WFG  OO  I   &KCMQX 8QT\ÒINKEJ



8121



36

$TQP\GOGFCKNNG  XQP 6 +YCPQHH WPF , ) 9CGEJVGT UR·VGTG 2T·IWPI FGU  ,CJTJWPFGTVU    CWH FKG CNNIGOGKPG #OPGUVKG )GMTÌPVGU $TWUVDKNF T OKV WOIGNGIVGO /CPVGN&KG RGTUQPKHK\KGTVG   )PCFG NÌUV FKG (GUUGNP XQP FTGK )GHCPIGPGP KO *KPVGTITWPF )GH·PIPKUIGD·WFG CWU FGO YGKVGTG   )GHCPIGPGUVTÌOGPOOI&KCMQX 9KP\4CPFHGJNGTXQT\ÒINKEJ




ELISABETH

8123

8122





8122

$TQP\GOGFCKNNGWPUKIPKGTV XGTOWVNKEJUR·VGTG2T·IWPIFGU,CJTJWPFGTVU CWHFGP(TKGFGPXQP ’DQ HKPPKUEJ 6WTMW  OKV FGP 5EJYGFGP )GMTÌPVGU $TWUVDKNF T OKV WOIGNGIVGO /CPVGN.CPFUEJCHV   OKV FGO (NW­ -KOKU\G FCTÒDGT JCNVGP \YGK CWU 9QNMGP MQOOGPFG *·PFG GKPGP -TCP\ FCTKP FGT   IGMTÌPVG TWUUKUEJG &QRRGNCFNGT ÒDGT FGP 9CRRGPUEJKNFGP XQP 5EJYGFGP WPF 5EJNGUYKI  OO   I&KCMQX*KNFGDTCPF++52CZKP0WOOKUp  -N5VGORGNHGJNGTMN5EJTÌVNKPIUHGJNGTUGJTUEJÌPpXQT\ÒINKEJ



5KNDGTOGFCKNNGWPUKIPKGTVCWHFGP(TKGFGPXQP’DQ HKPPKUEJ6WTMW OKVFGP5EJYGFGP)GMTÌP VGU $TWUVDKNF T OKV WOIGNGIVGO /CPVGN.CPFUEJCHV OKV FGO (NW­ -KOKU\G FCTÒDGT JCNVGP \YGK CWU   9QNMGP MQOOGPFG *·PFG GKPGP -TCP\ FCTKP FGT IGMTÌPVG TWUUKUEJG &QRRGNCFNGT ÒDGT FGP 9CRRGP   UEJKNFGPXQP5EJYGFGPWPF5EJNGUYKIOOI$KVMKP/XCT 4 &KCMQX 4  2CZKP0WOOKUp 44*ÒDUEJG2CVKPCUGJTUEJÌP  'KPGT FGT GTUVGP CW­GPRQNKVKUEJGP 5EJTKVVG FGTTWUUKUEJGP<CTKP'NKUCDGVJFKGUKEJKO#RTKNUGNDUVFKG-TQPG CWHU *CWRV IGUGV\V JCVVG YCT FKG $GGPFKIWPI FGU\YCTGTHQNITGKEJGPCDGTCWHYGPFKIGP-TKGIGUIGIGP5EJYGFGP &KGUGP -TKGI JCVVG FKG UEJYGFKUEJG 2CTVGK FGT *ÒVG XQO <CWP IGDTQEJGP FKG DÒPFPKURQNKVKUEJ PCEJ (TCPMTGKEJ   QTKGPVKGTV YCT $GTGKVU KP FGP 8QTXGTJCPFNWPIGP \W GKPGO (TKGFGPUUEJNW­ UGV\VG <CTKP 'NKUCDGVJ FKG 9CJN FGU   .ÒDGEMGT$KUEJQHU#FQNH(TKGFTKEJ\WOUEJYGFKUEJGP6JTQPHQNIGTFWTEJ#FQNH(TKGFTKEJXQP*QNUVGKP)QVVQTRYCT FGT $TWFGT KJTGU GJGOCNKIGP DGTGKVU KO #NVGT XQP  ,CJTGP   XGTUVQTDGPGP 8GTNQDVGP -CTN #WIWUV XQP   *QNUVGKP)QVVQTR&GTHCXQTKUKGTVG6JTQPHQNIGTYCTCW­GTFGOFGT8GVVGTKJTGUDGTGKVUXGTUVQTDGPGP5EJYCIGTU *GT\QI -CTN (TKGFTKEJ XQP *QNUVGKP)QVVQTR FGUUGP 5QJP -CTN 2GVGT 7NTKEJ FKG <CTKP DGTGKVU \W KJTGO GKIGPGP   6JTQPHQNIGTGTPCPPVJCVVG UR·VGT<CT2GVGT+++ &GTUEJYGFKUEJTWUUKUEJG-TKGIYWTFGUEJNKG­NKEJCO  #WIWUV  PCEJ ITGIQTKCPKUEJGO -CNGPFGT CO  #WIWUV  OKV FGO (TKGFGP KO HKPPKUEJGP ’DQ HKPPKUEJ   6WTMW DGGPFGV

8124



$TQP\GOGFCKNNGXQP6+YCPQHH XGTOWVNKEJUR·VGTG2T·IWPIFGU,CJTJWPFGTVU CWHFKG'TÌHH PWPI FGT /CTKPGYGTHV KP -TQPUVCFV )GMTÌPVGU $TWUVDKNF T OKV WOIGNGIVGO /CPVGN'KP KO $CW   DGHKPFNKEJGU5EJKHHFCJKPVGT-CPCNOKV$TÒEMGKO*KPVGTITWPF*CHGPCPUKEJVXQP-TQPUVCFVOO I&KCMQX -N4CPFHGJNGTXQT\ÒINKEJ

 37


ELISABETH

8125



$TQP\GOGFCKNNG  XQP 6 +YCPQHH XGTOWVNKEJ UR·VGTG 2T·IWPI FGU  ,CJTJWPFGTVU  CWH FKG   )TÒPFWPI0GW5GTDKGPU)GMTÌPVGU$TWUVDKNFTOKVWOIGNGIVGO/CPVGN/KPGTXCOKV*GNO5RGGTWPF 5EJKNFUVGJVXXFKG4GEJVGGTJQDGPKO*KPVGTITWPFN5·WNGOKVFGO9CRRGP0GW5GTDKGPUWOJGT NKGIGP)GIGPUV·PFGFGU#EMGTDCWUCO$QFGPOOI&KCMQX 8QT\ÒINKEJ



8126



$TQP\GOGFCKNNGXQP6+YCPQHH XGTOWVNKEJUR·VGTG2T·IWPIFGU,CJTJWPFGTVU CWHFKG)TGP\ TGIWNKGTWPI )GMTÌPVGU $TWUVDKNF T OKV WOIGNGIVGO /CPVGN&KG RGTUQPKHK\KGTVG )GTGEJVKIMGKV XGTUGV\V   FGTCO$QFGPNKGIGPFGPRGTUQPKHK\KGTVGP<YKGVTCEJVGKPGP6TKVVN/G­VKUEJT)TGP\U·WNGKO*KPVGT ITWPFN\YGK.CPFXGTOGUUGTOOI&KCMQX -N4CPFHGJNGTXQT\ÒINKEJ



8127



4WDGNHÌTOKIG 5KNDGTOGFCKNNGXQP6+YCPQHHCWHFGP5KGIÒDGTFKG2TGW­GPKPFGT5EJNCEJVDGK -WPGTUFQTH CO  #WIWUV )GMTÌPVGU $TWUVDKNF T OKV WOIGNGIVGO /CPVGN-TKGIGT KP CPVKMGT4ÒUVWPI UVGJVPCEJTCWH5EJNCEJVHGNFFGPNKPMGP(W­CWHGKPG3WGNNWTPGIGUVGNNVKPDGKFGP*·PFGPJ·NVGTGKPGP 5RGGTWOJGT-TKGIUVTQRJ·GPWPF)GHCNNGPGOOI$KVMKP/ 4 &KCMQX 4  44'PVHGTPVG6TCIGÌUGHCUVUGJTUEJÌP #WUFGT5COONWPI,QJCPPGU<KGTCEJ'ZGORNCTFGT#WMVKQP$GTNKPGT/ÒP\%CDKPGV$GTNKP0T

38




PETER III.

8129

8128

8128

<#42'6'4+++ 'KP4WDGNCWUFGO4QVGP/ÒP\JQHKP/QUMCW 

4WDGN/QUMCW4QVGT/ÒP\JQHI$KVMKP 4 &CX&KCMQX

45GJTUEJÌP



4WDGN5V2GVGTUDWTII$KVMKP&CX&KCMQX 4   4#VVTCMVKXGU'ZGORNCTOKVJÒDUEJGT2CVKPCMN5EJTÌVNKPIUHGJNGTXQT\ÒINKEJ



'ZGORNCTFGT#WMVKQP*&4CWEJ)OD*9KGP0T

5KNDGTOÒP\GPCWUFGT/ÒP\UV·VVG5V2GVGTUDWTI 

8130

8131

8132



4WDGN5V2GVGTUDWTII$KVMKP&CX&KCMQX 4   4)WVCWUIGRT·IVGU'ZGORNCT*GPMGNURWTHCUVXQT\ÒINKEJ



4WDGN5V2GVGTUDWTII$KVMKP&CX&KCMQX 4 

45GJTUEJÌP





4WDGN5V2GVGTUDWTII$KVMKP&CX&KCMQX 4   4-N5EJTÌVNKPIUHGJNGTUGJTUEJÌP





39


PETER III.

8135

8133

8134



4WDGN5V2GVGTUDWTII$KVMKP&CX&KCMQX 4 

4(CUVUGJTUEJÌP





4WDGN5V2GVGTUDWTII$KVMKP&CX&KCMQX 4 

(CUVUGJTUEJÌP





4WDGN 2QNVKPC 5V2GVGTUDWTII$KVMKP 4 &KCMQX 4   4.GKEJVMQTTQFKGTVUGJTUEJÌP



8137 8136

8136

-WRHGTRT·IWPIGPFGU<CTGP2GVGT+++ 

-W -QRGMGP  WPDGUVKOOVG /ÒP\UV·VVG  I ªDGTRT·IV CWH GKPGO -W -QRGMGP5VÒEM   XQP'NKUCDGVJ$KVMKP 4 &KCMQXHHXCT 4-N<CKPGPFGUGJTUEJÌP





-W-QRGMGPWPDGUVKOOVG/ÒP\UV·VVGI$KVMKP&KCMQX



8138

5GJTUEJÌP

8140



-W -QRGMGP  WPDGUVKOOVG /ÒP\UV·VVG  I ªDGTRT·IV CWH GKPGO -QRGMGP5VÒEM XQP   'NKUCDGVJ$KVMKP&KCMQX ªDGTRT·IWPIUURWTGPHCUVUGJTUEJÌP





-W-QRGMGPWPDGUVKOOVG/ÒP\UV·VVGI$KVMKP&KCMQX  -N4CPFHGJNGTHCUVUGJTUEJÌP





-W -QRGMGP  WPDGUVKOOVG /ÒP\UV·VVG  I ªDGTRT·IV CWH GKPGO -QRGMGP5VÒEM XQP   'NKUCDGVJ$KVMKPXCT&KCMQX 4ªDGTRT·IWPIUURWTGPUGJTUEJÌP



40


KATHARINA II.

8141

<YGK6CNGTFGU<CTGP2GVGT+++CNU*GT\QIXQP5EJNGUYKI*QNUVGKP)QVVQTR 

#NDGTVWUVCNGT  /CPPJGKO 2T·IWPI HÒT 5EJNGUYKI*QNUVGKP)QVVQTR CNU *GT\QI -CTN2GVGT7NTKEJ   I /KV 4CPFUEJTKHV 0#%* É &'/ É (75 É &'4 É #.$'4675 É 6*#.'4   ÉÜ É$KVMKP 4 &CX&KCMQX 4 *CCUNGKEJVXCT.CPIGNGKEJVXCT  445GJTUEJÌPpXQT\ÒINKEJXQT\ÒINKEJ 

8142



#NDGTVWUVCNGT  /CPPJGKO 2T·IWPI HÒT 5EJNGUYKI*QNUVGKP)QVVQTR CNU *GT\QI -CTN2GVGT7NTKEJ I/KV4CPFUEJTKHV0#%*É&'/É(75É&'4ÉÜÉ#.$'4675É6*#.'4 $KVMKP 4 &CX&KCMQX 4 *CCU.CPIG 445GJTUEJÌPpXQT\ÒINKEJ 

8143

1,5:1

1,5:1

<#4+0-#6*#4+0#++ )QNFOÒP\GPFGT<CTKP-CVJCTKPC++ 

 4WDGN  5V 2GVGTUDWTI  I )GMTÌPVGU $TWUVDKNF T OKV WOIGNGIVGO /CPVGN8KGT IGMTÌPVG   9CRRGPKPU-TGW\IGUVGNNVKPFGT/KVVG#FNGTUEJKNFKPFGP9KPMGNPFKGIGVGKNVG,CJTGU\CJN $KVMKP 4 &KCMQX 4 (D )1.&5GJTUGNVGPDGUQPFGTUKPFKGUGT'TJCNVWPI 2TCEJVGZGORNCTOKVJGTTNKEJGT)QNFRCVKPC8QT\ÒINKEJp5VGORGNINCP\ 

8144



4WDGN5V2GVGTUDWTII$KVMKPNGKEJVXCT 4 &KCMQXNGKEJVXCT(DC  )1.&4*GPMGNURWT2TÒHURWTGVYCUDGTKGDGPUGJTUEJÌP

 41


KATHARINA II.

8145 1,5:1



1,5:1

4WDGN5V2GVGTUDWTII)GMTÌPVGU$TWUVDKNFTOKVWOIGNGIVGO/CPVGN8KGTIGMTÌPVG 9CRRGPKPU-TGW\IGUVGNNVKPFGT/KVVG#FNGTUEJKNFKPFGP9KPMGNPFKGIGVGKNVG,CJTGU\CJN $KVMKP 4 &KCMQX 4 (DC )1.&45GJTUEJÌPpXQT\ÒINKEJ

8146



1,5:1

8146

4WDGN5V2GVGTUDWTII$KVMKP 4 &KCMQX 4 (DC  )1.&4-TCV\GTKO(GNFFGT8QTFGTUGKVGHCUVUGJTUEJÌP

8147



8148

1,5:1

1,5:1



1,5:1

1,5:1



4WDGN5V2GVGTUDWTII$KVMKP 4 &KCMQX(D

)1.&4(CUVXQT\ÒINKEJ





4WDGN5V2GVGTUDWTII$KVMKP 4 &KCMQX(D  )1.&45GJTUEJÌPpXQT\ÒINKEJ



8149

1,5:1

8149

8150

1,5:1

8150



4WDGN 2QNVKPC 5V2GVGTUDWTII$KVMKP 4 &KCMQX(D  )1.&45GJTUEJÌPpXQT\ÒINKEJ





4WDGN 2QNVKPC 5V2GVGTUDWTII$KVMKP 4 &KCMQX(D  )1.&5GJTUEJÌPpXQT\ÒINKEJ



8151

1,5:1

8151

8152

1,5:1

8152



4WDGN 2QNVKPC 5V2GVGTUDWTII$KVMKP 4 &KCMQX(D  )1.&.GKEJVIGYGNNVUGJTUEJÌPpXQT\ÒINKEJ





4WDGN 2QNVKPC 5V2GVGTUDWTII$KVMKP 4 &KCMQX(D  )1.&.GKEJVIGYGNNVUGJTUEJÌPpXQT\ÒINKEJ



42


KATHARINA II.

  

8155

8154

8153

5KNDGTOÒP\GPCWUFGO4QVGP/ÒP\JQHKP/QUMCW

4WDGN/QUMCW4QVGT/ÒP\JQHI$KVMKP&CX&KCMQX (CUVUGJTUEJÌP 4WDGN/QUMCW4QVGT/ÒP\JQHI$KVMKP 4 &CX&KCMQX 45GJTUEJÌP 4WDGN/QUMCW4QVGT/ÒP\JQHI$KVMKP&CX&KCMQX 5GJTUEJÌP

  

8157

8156



4WDGN 2QNVKPC /QUMCW4QVGT/ÒP\JQHI$KVMKP 4 &KCMQX 4   4*ÒDUEJG2CVKPCUGJTUEJÌP





4WDGN 2QNWRQNVKPPKM /QUMCW4QVGT/ÒP\JQHI$KVMKP&KCMQX



8158

  

5KNDGTOÒP\GPCWUFGT/ÒP\UV·VVG5V2GVGTUDWTI

8159

4WDGN5V2GVGTUDWTII$KVMKP&CX&KCMQX 4WDGN5V2GVGTUDWTII$KVMKP&CX&KCMQX 4WDGN5V2GVGTUDWTII$KVMKP&CX&KCMQX

8QT\ÒINKEJ

8160

5GJTUEJÌP 5GJTUEJÌP 5GJTUEJÌPpXQT\ÒINKEJ

   43


KATHARINA II.

8161

8162

8163



4WDGN5V2GVGTUDWTII$KVMKP&CX&KCMQX

5GJTUEJÌP





4WDGN5V2GVGTUDWTII$KVMKP&CX&KCMQX

5GJTUEJÌP





4WDGN5V2GVGTUDWTII$KVMKP&CX&KCMQX

5GJTUEJÌP



8164

8165

8166



4WDGN5V2GVGTUDWTII$KVMKP&CX&KCMQX

5GJTUEJÌPpXQT\ÒINKEJ





4WDGN5V2GVGTUDWTII$KVMKP&CX&KCMQX

(CUVUGJTUEJÌP





4WDGN5V2GVGTUDWTII$KVMKP 4 &CX&KCMQX

445GJTUEJÌP



4WDGN5V2GVGTUDWTII$KVMKP&CX&KCMQX  9KP\-TCV\GTUGJTUEJÌPpXQT\ÒINKEJ



8167

 44


KATHARINA II.

8168

8170

8169



4WDGN5V2GVGTUDWTII$KVMKP&CX&KCMQX

5GJTUEJÌPpXQT\ÒINKEJ



4WDGN5V2GVGTUDWTII$KVMKP&CX&KCMQX 5EJTÌVNKPIUHGJNGTUGJTUEJÌP





4WDGN5V2GVGTUDWTII$KVMKP&CX&KCMQX



(CUVXQT\ÒINKEJ

8172

8171



8173



4WDGN5V2GVGTUDWTII$KVMKP&CX&KCMQX

5GJTUEJÌPpXQT\ÒINKEJ



4WDGN5V2GVGTUDWTII$KVMKP&CX&KCMQX

5GJTUEJÌPpXQT\ÒINKEJ





4WDGN5V2GVGTUDWTII$KVMKP&CX&KCMQX

(CUVXQT\ÒINKEJ



8174



8175



4WDGN5V2GVGTUDWTII$KVMKP&CX&KCMQX

5GJTUEJÌPpXQT\ÒINKEJ





4WDGN5V2GVGTUDWTII$KVMKP&CX&KCMQX  -N5EJTÌVNKPIUHGJNGTCO4CPFHCUVXQT\ÒINKEJ

 45


KATHARINA II.

8176

1,5:1

1,5:1



4WDGN5V2GVGTUDWTII$KVMKP&CX&KCMQX  2TCEJVGZGORNCT8QT\ÒINKEJp5VGORGNINCP\

8177

8178



8179



4WDGN5V2GVGTUDWTII$KVMKP&CX&KCMQX  5EJTÌVNKPIUHGJNGTUQPUVXQT\ÒINKEJp5VGORGNINCP\





4WDGN5V2GVGTUDWTII$KVMKP&CX&KCMQX  9KP\5EJTÌVNKPIUHGJNGTXQT\ÒINKEJ





4WDGN5V2GVGTUDWTII$KVMKP&CX&KCMQX

(CUVXQT\ÒINKEJ



4WDGN5V2GVGTUDWTII$KVMKP&CX&KCMQX  -N5EJTÌVNKPIUHGJNGTXQT\ÒINKEJ



8180

 46


KATHARINA II.

8181

8182

8183



4WDGN5V2GVGTUDWTII$KVMKP&CX&KCMQX  -N5EJTÌVNKPIUHGJNGTUGJTUEJÌP





4WDGN5V2GVGTUDWTII$KVMKP&CX&KCMQX  /KPMQTTQFKGTVXQT\ÒINKEJXQT\ÒINKEJp5VGORGNINCP\





4WDGN5V2GVGTUDWTII$KVMKP&CX&KCMQX



8184

8186

(CUVXQT\ÒINKEJ

8187



4WDGN5V2GVGTUDWTII$KVMKP&CX&KCMQX

5GJTUEJÌP



4WDGN5V2GVGTUDWTIIWPFI$KVMKP&CX Z &KCMQX 5VÒEM-N5EJTÌVNKPIUHGJNGT Z MN-TCV\GT Z UGJTUEJÌPpXQT\ÒINKEJWPFXQT\ÒINKEJ

 

4WDGN5V2GVGTUDWTII$KVMKP&CX&KCMQX 4WDGN5V2GVGTUDWTII$KVMKP&CX&KCMQX

 

8QT\ÒINKEJp5VGORGNINCP\ 8QT\ÒINKEJp5VGORGNINCP\

 

8QT\ÒINKEJ



8188



4WDGN5V2GVGTUDWTII$KVMKP&CX&KCMQX

47


KATHARINA II.

8189

8190



4WDGN5V2GVGTUDWTII$KVMKP&CX&KCMQX  9KP\5EJTÌVNKPIUHGJNGTXQT\ÒINKEJ





4WDGN5V2GVGTUDWTII$KVMKP&CX&KCMQX  -N5EJTÌVNKPIUHGJNGTCO4CPFUGJTUEJÌPpXQT\ÒINKEJ



8191

1,5:1

1,5:1



4WDGN5V2GVGTUDWTII$KVMKP&CX&KCMQX  2TCEJVGZGORNCT(CUV5VGORGNINCP\

8192

8193



8194



4WDGN5V2GVGTUDWTII$KVMKP&CX&KCMQX

8QT\ÒINKEJp5VGORGNINCP\





4WDGN5V2GVGTUDWTII$KVMKP&CX&KCMQX 4   9KP\5EJTÌVNKPIUHGJNGTCO4CPFXQT\ÒINKEJ





4WDGN5V2GVGTUDWTII$KVMKP&CX&KCMQX 4   9KP\5EJTÌVNKPIUHGJNGTXQT\ÒINKEJ



48


KATHARINA II.

8195

8196

8197



4WDGN5V2GVGTUDWTII$KVMKP 4 &CX&KCMQX 4   449KP\5EJTÌVNKPIUHGJNGTCO4CPFHCUVUGJTUEJÌP





4WDGN5V2GVGTUDWTII$KVMKP 4 &CX&KCMQX 4   4-N5EJTÌVNKPIUHGJNGTCO4CPFXQT\ÒINKEJ





4WDGN5V2GVGTUDWTII$KVMKP&CX&KCMQX 4 

8198

8199

 8QT\ÒINKEJp5VGORGNINCP\



8200



4WDGN5V2GVGTUDWTII$KVMKP&CX&KCMQX 4 

5GJTUEJÌPpXQT\ÒINKEJ





4WDGN5V2GVGTUDWTII$KVMKP&CX&KCMQX 4 

48QT\ÒINKEJ





4WDGN5V2GVGTUDWTII$KVMKP&CX&KCMQX  9KP\-TCV\GTXQT\ÒINKEJp5VGORGNINCP\

 49


KATHARINA II.

8201

8202

8203



4WDGN5V2GVGTUDWTII$KVMKP&CX&KCMQX

8QT\ÒINKEJ





4WDGN5V2GVGTUDWTII$KVMKP&CX&KCMQX 4 

8QT\ÒINKEJ





4WDGN5V2GVGTUDWTII$KVMKP&CX&KCMQX 4   48QT\ÒINKEJp5VGORGNINCP\



8205

8204



-QRGMGP5V2GVGTUDWTII$KVMKP&KCMQX

-N5EJTÌVNKPIUHGJNGTXQT\ÒINKEJ





-QRGMGP5V2GVGTUDWTII$KVMKP&KCMQX  5GJTUGNVGPKPFKGUGT'TJCNVWPI8QT\ÒINKEJp5VGORGNINCP\



8207

8206



-QRGMGP5V2GVGTUDWTII$KVMKP 4 &KCMQX 4 

45GJTUEJÌP





-QRGMGP )TKXGPPKM 5V2GVGTUDWTII$KVMKP&KCMQX 4   4'VYCUFG\GPVTKGTVXQT\ÒINKEJ5VGORGNINCP\



8208

2T·IWPIGPHÒT5KDKTKGP  50

-W-QRGMGP5W\WP -QN[XCP HÒT5KDKTKGPI$KVMKP&KCMQX

8QT\ÒINKEJ




KATHARINA II.

8209

1,5:1



1,5:1

-W-QRGMGP5W\WP -QN[XCP HÒT5KDKTKGP+P752NCUVKMJQNFGTFGT2%)5OKVFGT$GYGTVWPI /5$0$KVMKP&KCMQX  5GJTUGNVGPKPFKGUGT'TJCNVWPI2TCEJVGZGORNCT5VGORGNINCP\



8210

8212

8212 8211



-W&GPIC5W\WP -QN[XCP HÒT5KDKTKGPI$KVMKP 4 &KCMQX 4   8QPITQ­GT5GNVGPJGKV.GKEJVDGTKGDGPHCUVUGJTUEJÌP





-W2QNWUEJMC5W\WP -QN[XCP HÒT5KDKTKGPI$KVMKP 4 &KCMQX 4   8QPITQ­GT5GNVGPJGKV.GKEJVG-QTTQUKQPUURWTGPUGJTUEJÌP



'KPG-WRHGTRT·IWPIHÒT/QNFCYKGPWPFFKG9CNCEJGK 

-W2CTC  &GPICU   5CFQIWTC IGRT·IV Y·JTGPF FGT TWUUKUEJGP $GUGV\WPI /QNFCYKGPU WPF FGT   9CNCEJGKY·JTGPFFGUVÒTMKUEJTWUUKUEJGP-TKGIGUJGTIGUVGNNVCWU-CPQPGPDTQP\GI$KVMKP

4 $TCWUG/CPUHGNF6HXCT FQTVCPFGTGT,CJTICPI &KCMQX 4   44.GKEJVG-QTTQUKQPUURWTGPHCUVUGJTUEJÌP

9·JTGPF FGU TWUUKUEJVÒTMKUEJGP -TKGIGU  XGTFT·PIVGP FKG TWUUKUEJGP 5VTGKVMT·HVG FKG 6ÒTMGP CWU FGO   OQNFCYKUEJGP)GDKGVWPFFGT9CNCEJGK(ÒTFKGPWPGTHQTFGTNKEJG/ÒP\RT·IWPIXGTYGPFGVGOCPFCU/GVCNNGTDGW VGVGTVÒTMKUEJGT)GUEJÒV\G



8213

/GFCKNNGPFGT<CTKP-CVJCTKPC++ 

5KNDGTOGFCKNNGXQP6+YCPQHHCWHFKG<GTUVÌTWPIFGT6ÒTMKUEJGP(NQVVGKOI·KUEJGP/GGTDGK 6UEJGUOG FWTEJ )TCH #NGZGKL )TGIQTKGYKVUEJ 1TNQHH )GMTÌPVGU $TWUVDKNF T OKV WOIGNGIVGO /CPVGN   8KGTTWUUKUEJG5EJKHHGKO*KPVGTITWPFFKGDTGPPGPFGVÒTMKUEJG(NQVVGKO*CHGPXQP6UEJGUOGOO I&KCMQX 4  44*GPMGNURWTUEJÌP  51


KATHARINA II.

8214





$TQP\GOGFCKNNG  XQP ) % 9CGEJVGT WPF , ) 9CGEJVGT XGTOWVNKEJ UR·VGTG 2T·IWPI FGU   ,CJTJWPFGTVU CWHFGPTWUUKUEJGP)TCHGP)TGIQT)TGIQTKGYKVUEJ1TNQYIGUVKHVGVXQO5GPCVHÒTFKG $GM·ORHWPIFGT$GWNGPRGUVKP/QUMCW)GJCTPKUEJVGU$TWUVDKNFFGU)TCHGPNOKVWOIGNGIVGO/CPVGN WPF FGO /GFCKNNQPDKNF FGT <CTKP&GT )TCH TGKVGV N CWH GKPGP (NCOOGPCDITWPF \W KO *KPVGTITWPF   5VCFVCPUKEJVXQP/QUMCWOOI&KCMQX 4 5NI$TGVVCWGT 48QT\ÒINKEJ



$TQP\GOGFCKNNG  XQP ) % 9CGEJVGT WPF , ) 9CGEJVGT XGTOWVNKEJ UR·VGTG 2T·IWPI FGU   ,CJTJWPFGTVU CWHFGPTWUUKUEJGP)TCHGP)TGIQT)TGIQTKGYKVUEJ1TNQHHIGUVKHVGVXQO5GPCVHÒTFKG $GM·ORHWPIFGT$GWNGPRGUVKP/QUMCW)GJCTPKUEJVGU$TWUVDKNFFGU)TCHGPNOKVWOIGNGIVGO/CPVGN WPF FGO /GFCKNNQPDKNF FGT <CTKP&GT )TCH TGKVGV N CWH GKPGP (NCOOGPCDITWPF \W KO *KPVGTITWPF   5VCFVCPUKEJVXQP/QUMCWOOI&KCMQX 4 5NI$TGVVCWGT  4-N4CPFHGJNGTXQT\ÒINKEJ



8216



52

$TQP\GOGFCKNNG  XQP % .GDGTGEJV XGTOWVNKEJ UR·VGTG 2T·IWPI FGU  ,CJTJWPFGTVU  CWH FGP   )GJGKOTCV +YCP +YCPQYKVUEJ $LGVUMQK XGTNKGJGP XQO 5GPCV $ÒUVG FGU )GJGKOTCVU T OKV WOIGNGIVGO   /CPVGNWPF1TFGP&CURGTUQPKHK\KGTVG4W­NCPFUKV\VPCEJTOKV\YGK-KPFGTPPGDGPGKPGO1DGNKUMCP FGO GKP 5EJKNF OKV FGO /QPQITCOO FGU )GJGKOTCVU CPIGDTCEJV KUV FGT XQP GKPGO )GPKWU IGJCNVGP   YKTF FCTWPVGT UVGJV GKP YGKVGTGT )GPKWU OKV GTJQDGPGT .KPMGP N 'NGHCPVWPF5VQTEJKO*KPVGTITWPF FCU+PUVKVWVHÒT'T\KGJWPIKP/QUMCWOOI&KCMQX  9KP\4CPFHGJNGTUGJTUEJÌP




KATHARINA II.

8217



$TQP\GOGFCKNNG  XQP , % ) ,CGIGT WPF 2 $QDTQXUEJKMQX XGTOWVNKEJ UR·VGTG 2T·IWPI FGU    ,CJTJWPFGTVU  CWH FGP TWUUKUEJGP (GNFOCTUEJCNN )TCH 2GVGT #NGZCPFTQYKVUEJ 4WOLCP\QY )GJCT   PKUEJVGU $TWUVDKNF FGU (GNFOCTUEJCNNU T OKV .QTDGGTMTCP\ WPF WOIGNGIVGO .ÌYGPHGNN4ÌOKUEJGT   -TKGIGT UVGJV X X OKV .QTDGGT\YGKI 5EJKNF <YGKI WPF .CP\G KO *KPVGTITWPF T -TKGIUVTQRJ·G   OOI&KCMQX 4  48QT\ÒINKEJ 

8218



5KNDGTOGFCKNNGXQP2$QDTQXUEJKMQXWPF%.GDGTGEJVCWHFKG'TTKEJVWPIFGT4GKVGTUVCVWG2GVGTU+ CWH FGO 5V 2GVGTUDWTIGT &GMCDTKUVGPRNCV\ CO  #WIWUV $TWUVDKNF N OKV .QTDGGTMTCP\ WOIGNGIVGO   /CPVGN WPF #PFTGCUQTFGP#PUKEJV FGT 4GKVGTUVCVWG CWH GKPGO (GNUGP  OO  I &KCMQX    4  4  44'VYCUDGTKGDGPXQT\ÒINKEJ   ,CJTG PCEJ UGKPGT 6JTQPDGUVGKIWPI NKG­ <CTKP -CVJCTKPC ++ HÒT <CT 2GVGT + FGP )TQ­GP CWH FGO   5V 2GVGTUDWTIGT &GMCDTKUVGPRNCV\GKP6QPPGPUEJYGTGU&GPMOCNCWHGKPGO(GNUDNQEMGTTKEJVGPHÒTFCUFGT HTCP\ÌUKUEJG $KNFJCWGT 'VKGPPG/CWTKEG (CNEQPGV \YÌNH ,CJTGDGPÌVKIVG&CU/QPWOGPV\GKIVFGP<CTGP\W2HGTF FCU OKV FGP *KPVGTJWHGP GKPG 5EJNCPIG FKG (GKPFG FGU <CTGP KPUDGUQPFGTG 5EJYGFGP  \GTVTKVV *GWVG \·JNV FCU   &GPMOCN FCU #NGZCPFGT 2WUEJMKP CNU 'JGTPGT 4GKVGT FWTEJ FCU ÒDGTHNWVGVG 5V 2GVGTUDWTI TGKVGP NKG­ \W FGP   DGFGWVGPFGP5GJGPUYÒTFKIMGKVGPFGT5VCFV

53


KATHARINA II.

8219

8220





54

8220

$TQP\GOGFCKNNGQ,  XQP8$G\TQFPQ[WPF2$QDTQXUEJKMQX XGTOWVNKEJUR·VGTG2T·IWPIFGU ,CJTJWPFGTVU CWHFKG)TÃ&#x2019;PFWPIFGT2TQXKP\GP'MCVGTKPQUNCXWPF6CWTKGP)GJCTPKUEJVGU$TWUVDKNF FGU TWUUKUEJGP )GPGTCNHGNFOCTUEJCNNU )TGIQT #NGZCPFTQYKVUEJ 2QVGOMKP T OKV WOIGNGIVGO /CPVGN   .CPFMCTVGOKVFGPGKPIG\GKEJPGVGP2TQXKP\GPOOI&KCMQX 4   49KP\4CPFHGJNGTXQT\Ã&#x2019;INKEJ



<KPPOGFCKNNGXQP,%JT4GKEJCWHFKG4Ã&#x2019;EMICDGRQNPKUEJGT)GDKGVG$TWUVDKNFNOKV9KVYGP UEJNGKGTWPFWOIGNGIVGO/CPVGN6GORGNFCTKPDTKPIGPFTGK'FGNNGWVG-T·P\G\WGKPGO#NVCTCPFGO FCU/QPQITCOO-CVJCTKPCU++CPIGDTCEJVKUVCWHFGO#NVCTNKGIVDGTGKVUGKP-TCP\FCTÃ&#x2019;DGTJ·PIVGKP /GFCKNNQPOKVFGO$TWUVDKNFFGT<CTKPOOI&KCMQX 4 *%\  /KV1TKIKPCNMWRHGTUVKHV8QT\Ã&#x2019;INKEJ




KATHARINA II.

8221



$TQP\GOGFCKNNG  XQP 8 $G\TQFPQ[ WPF 2 9 )CUU CWH FKG 'TQDGTWPI FGT +PUGN $GTG\CP KO   5EJYCT\GP/GGTWPFFGT(GUVWPI1EJCMQX JGWVG7MTCKPG WPVGTFGO-QOOCPFQXQP)GPGTCNHGNFOCT UEJCNN )TGIQT #NGZCPFTQYKVUEJ 2QVGOMKP )GJCTPKUEJVGU $TWUVDKNF FGU )GPGTCNHGNFOCTUEJCNNU T OKV   WOIGNGIVGO /CPVGN6QRQITCRJKUEJG #PUKEJV FGT DGNCIGTVGP +PUGN $GTG\CP WPF FGT (GUVWPI 1EJCMQX   OKVFGPRQUKVKQPKGTVGPTWUUKUEJGP5EJKHHGPOOI&KCMQX 4   4'VYCU$GNCIMN4CPFHGJNGTHCUVXQT\ÒINKEJ +O 8GTNCWH FGU TWUUKUEJVÒTMKUEJGP -TKGIGU  GTUVÒTOVG FKG TWUUKUEJG #TOGG WPVGT FGO 1DGTDGHGJN XQP   (ÒTUV)TGIQT#NGZCPFTQYKVUEJ2QVGOMKP  CO&G\GODGTFKGCPFGT/ÒPFWPIFGT(NÒUUG&PLGRT WPF$WIIGNGIGPG(GUVWPI1EJCMQX&GTTWUUKUEJG(GNFOCTUEJCNNWPF)ÒPUVNKPIFGT<CTKP-CVJCTKPC++GTJKGNVCNU $GNQJPWPI HÒT UGKPG 8GTFKGPUVG FCU ITQ­G $CPF XQO 1TFGP FGU *GKNKIGP )GQTI &GT DGMCPPVG 4KVV FGU $CTQPU   /ÒPEJJCWUGPCWHFGT-CPQPGPMWIGNUQNNY·JTGPFFGT$GNCIGTWPIFGTQUOCPKUEJGP(GUVWPIUVCVVIGHWPFGPJCDGP



8222

8223 1:1,3





8223 1:1,3

1XCNG UKNDGTPG 8GTFKGPUVOGFCKNNG  WPUKIPKGTV HÒT FKG 6GKNPGJOGT CO 4WUUKUEJ6ÒTMKUEJGP -TKGI    )GMTÌPVGU /QPQITCOO5EJTKHV KP HÒPH <GKNGP (ÒT FGP 5KGIGT CO 6CI FGU (TKGFGPUXGT   VTCIUFGP&G\GODGT ZOOI&KCMQX 4   449KGÒDNKEJIGNQEJVUEJÌP



<KPP5WKVGPOGFCKNNGQ, ,CJTJWPFGTV XQP5,WFKPCWHFGP'ZRGFKVKQPU\WIFGU)TQ­HÒTUVGP+IQT OKV UGKPGT (NQVVG PCEJ -QPUVCPVKPQRGN )GJCTPKUEJVGU $TWUVDKNF FGU )TQ­HÒTUVGP +IQT   T OKV   *GNO WPF WOIGNGIVGO /CPVGN5EJKHHUXGTDCPF CWH )GY·UUGT XQT -ÒUVG KO #DUEJPKVV FTGK <GKNGP   5EJTKHV/KV5GTKGPPWOOGTOOI&KCMQXXINXIN 5OKTPQX  8QT\ÒINKEJ

 55


PAUL I.

8224

<#42#7.+ 

5KNDGTOÒP\GPCWUFGT/ÒP\UV·VVG5V2GVGTUDWTI 4WDGN5V2GVGTUDWTII$KVMKP&CX

(CUVUGJTUEJÌP



8225

1,5:1

1,5:1



4WDGN5V2GVGTUDWTII$KVMKP&CX  5GJTUGNVGPKPFKGUGT'TJCNVWPI2TCEJVXQNNG2CVKPCHCUV5VGORGNINCP\

8226

8227



ex 8228



4WDGN5V2GVGTUDWTII$KVMKP 4 &CX  4/KP5EJTÌVNKPIUHGJNGTUGJTUEJÌPpXQT\ÒINKEJ





4WDGN5V2GVGTUDWTII$KVMKP&CX /KP-TCV\GTUEJÌPG2CVKPCHCUVXQT\ÒINKEJ





4WDGN5V2GVGTUDWTIIWPFI$KVMKP&CX  5VÒEM(GKPG2CVKPCUGJTUEJÌPpXQT\ÒINKEJWPFUGJTUEJÌP



56


PAUL I.

8229

1,5:1

1,5:1



4WDGN 2QNVKPC 5V2GVGTUDWTII8KGTIGMTÌPVG/QPQITCOOGKPU-TGW\IGUVGNNVKPFGT /KVVGTÌOKUEJG<KHHGT+8GT\KGTVG6CHGNOKVXKGT<GKNGP5EJTKHV$KVMKP  W­GTUVUGNVGPKPFKGUGT'TJCNVWPI2TCEJVGZGORNCT5VGORGNINCP\

8230

8233

8232



4WDGN 2QNWRQNVKPPKM 5V2GVGTUDWTII$KVMKP 4 



-QRGMGP5V2GVGTUDWTII$KVMKP



-QRGMGP5V2GVGTUDWTII$KVMKP



-QRGMGP5V2GVGTUDWTII$KVMKP 4 



8231

45GJTUEJÌP



5GJTUEJÌP



*ÒDUEJG2CVKPCMN4CPFHGJNGTUGJTUEJÌP



4-N-NGDGTGUVUGJTUEJÌP



8234

'KPG-WRHGTRT·IWPICWUFGT/ÒP\UV·VVG'MCVGTKPDWTI 

-W-QRGMGP'MCVGTKPDWTIIªDGTRT·IVKO,CJTKO#WHVTCIXQP<CT2CWN+ $KVMKP 4 &KCMQX 4FQTVWPVGT-CVJCTKPC++  44ªDGTRT·IWPIUURWTGPUGJTUEJÌP



-CVJCTKPC ++ DGUEJNQ­ KP KJTGO NGV\VGP 4GIKGTWPIULCJT  GKPG IGYCNVKIG /ÒP\TGHQTO &KG -WRHGTOÒP\GP \W   -QRGMGPYWTFGPWOCDIGYGTVGVKPFGOUKGOKVPGWGP5VGORGNPOKVFGO9GTV-QRGMGPWPFFGT,CJTGU \CJN  ÒDGTRT·IV YWTFGP 0CEJ FGO 6QF -CVJCTKPCU CO  0QXGODGT  UVQRRVG <CT 2CWN + FKGUG #MVKQP   WPXGT\ÒINKEJWPFNKG­FKGÒDGTRT·IVGP/ÒP\GPKO,CJTYKGFGTWOOKVFGPCNVGP5VGORGNPWPFFGTWTURTÒPINK EJGP,CJTGU\CJNÒDGTRT·IGP&CU-QRGMGP5VÒEMFCUKPUGKPGO'PVUVGJWPIULCJTHÒTGKPKIG/QPCVG\WGKPGO  -QRGMGP5VÒEM IGYQTFGP YCT IGJÌTV UQOKV \W FGP PWOKUOCVKUEJ DGUQPFGTU KPVGTGUUCPVGP 'TUEJGKPWPIGP FGT   TWUUKUEJGP/ÒP\IGUEJKEJVG

57


ALEXANDER I.

8235

/GFCKNNGPFGU<CTGP2CWN+ 

5KNDGTOGFCKNNGQ,  XQP%.GDGTGEJVCWHUGKPG-TÌPWPIKP/QUMCW7PKHQTOKGTVGU$TWUVDKNFT OKVWOIGNGIVGO/CPVGN-TGW\OOI&KCMQX 4  45GJTUEJÌPpXQT\ÒINKEJ



8236



5KNDGTLGVQP Q ,   WPUKIPKGTV CWH UGKPG -TÌPWPI KP /QUMCW )GMTÌPVGU /QPQITCOO-TGW\   OOI$KVMKP 4 &KCMQX\W *GTTNKEJG2CVKPCXQT\ÒINKEJ



8237



8GTIQNFGVG $TQP\GOGFCKNNG  XQP % * -WJNGT CWH FGP TWUUKUEJGP (GNFJGTTP )TCH #NGZCPFGT   9CUUKNLGYKVUEJ5WYQTQYWPFUGKPG5KGIGÒDGTFKG(TCP\QUGPKP0QTFKVCNKGP)GJCTPKUEJVGU$TWUVDKNFFGU )TCHGPTOKVWOIGNGIVGO/CPVGN-TKGIGTKPCPVKMGT4ÒUVWPIUVGJVXXKPFGT4GEJVGP.CP\GFCTCP XKGT -TQPGP OKV FGT .KPMGP J·NV GT FKG *CPF FGT +VCNKC FKG PCEJ N CWH GKPGO )NQDWU UKV\V CWH FGO   +VCNKGP\WUGJGPKUVNMPKGVGKPXGTYWPFGVGTHTCP\ÌUKUEJGT5QNFCVOOI&KCMQX 4  49KP\4CPFHGJNGTXQT\ÒINKEJ



8238

<#4#.':#0&'4+ 5KNDGTOÒP\GPCWUFGT/ÒP\UV·VVG5V2GVGTUDWTI  58

4WDGN5V2GVGTUDWTII$KVMKP&CX

5GJTUEJÌPpXQT\ÒINKEJ




ALEXANDER I.

8239

1,5:1

1,5:1



4WDGN5V2GVGTUDWTII$KVMKP&CX  -CDKPGVVUVÒEM2TCEJVXQNNG2CVKPCXQT\ÒINKEJp5VGORGNINCP\



8241 8240

8240



4WDGN5V2GVGTUDWTII$KVMKP&CX  -N5EJTÌVNKPIUHGJNGTCO4CPFHCUVUGJTUEJÌP





4WDGN 2QNVKPC 5V2GVGTUDWTII$KVMKP 4   4.GKEJVG-QTTQUKQPUURWTGP-TCV\GTUGJTUEJÌP



8242

8243

8244



4WDGN5V2GVGTUDWTII$KVMKP&CX  5GJTUGNVGPKPFKGUGT'TJCNVWPI(GKPG2CVKPCOKPLWUVKGTVXQT\ÒINKEJ





4WDGN5V2GVGTUDWTII$KVMKPXCT 4 &CX  4*ÒDUEJG2CVKPCNGKEJVLWUVKGTVHCUVXQT\ÒINKEJ





4WDGN5V2GVGTUDWTII$KVMKP&CX



*ÒDUEJG2CVKPCXQT\ÒINKEJ

59


ALEXANDER I.

8245

8246



4WDGN5V2GVGTUDWTII$KVMKP&CX  #VVTCMVKXGU'ZGORNCTOKVHGKPGT2CVKPCMN5EJTÌVNKPIUHGJNGTXQT\ÒINKEJ





4WDGN5V2GVGTUDWTII$KVMKP&CX



8247

*ÒDUEJG2CVKPCHCUVXQT\ÒINKEJ

8249



4WDGN5V2GVGTUDWTII$KVMKP&CX

-N5EJTÌVNKPIUHGJNGTXQT\ÒINKEJ





4WDGN5V2GVGTUDWTI Z IWPFI$KVMKP Z &CX Z   5VÒEM5EJÌPpUGJTUEJÌPWPFUGJTUEJÌP





4WDGN5V2GVGTUDWTII$KVMKP&CX



8250

(CUVXQT\ÒINKEJ

8251



4WDGN5V2GVGTUDWTII$KVMKP&CX  (GKPG2CVKPCYKP\5EJTÌVNKPIUHGJNGTCO4CPFHCUVXQT\ÒINKEJ





4WDGN5V2GVGTUDWTII$KVMKP&CX  2TCEJVGZGORNCT(GKPG2CVKPCHCUV5VGORGNINCP\



8252

8253



4WDGN5V2GVGTUDWTII$KVMKP&CX

8QT\ÒINKEJ





4WDGN5V2GVGTUDWTII$KVMKP&CX

8QT\ÒINKEJ



60


ALEXANDER I.

8254

8255



4WDGN 2QNVKPC 5V2GVGTUDWTII$KVMKP  2TCEJVXQNNG2CVKPCXQT\ÒINKEJp5VGORGNINCP\





4WDGN 2QNVKPC 5V2GVGTUDWTII$KVMKP



8QT\ÒINKEJp5VGORGNINCP\

8257

8256



-QRGMGP5V2GVGTUDWTII$KVMKP

2TCEJVGZGORNCT(CUV5VGORGNINCP\





-QRGMGP5V2GVGTUDWTII$KVMKP

8QT\ÒINKEJ



#VVTCMVKXGU'ZGORNCTXQT\ÒINKEJ



8258

-WRHGTRT·IWPIGPFGU<CTGP#NGZCPFGT+ 

-W-QRGMGP'MCVGTKPDWTII$KVMKP

8259

1,5:1



-W&GPIC'MCVGTKPDWTII$KVMKP 4 

1,5:1

448QT\ÒINKEJp5VGORGNINCP\



8261

8260

8260



-W-QRGMGP5W\WP -QN[XCP I$KVMKP 4 

 4-N5EJTÌVNKPIUHGJNGTUGJTUEJÌP





-W2QNWUEJMC5W\WP -QN[XCP I$KVMKP 4 

445GJTUEJÌP

 61


ALEXANDER I.

8262

2:1

2:1

2T·IWPIGPHÒT2QNGP 

<NQV[EJ9CTUEJCWHÒT2QNGPI$KVMKP 4 (D FQTVWPVGT2QNGP 5EJN FQTV WPVGT2QNGP  )1.&440WT'ZGORNCTGIGRT·IV#VVTCMVKXGUXQT\ÒINKEJGU'ZGORNCT 

1,5:1



1,5:1

<NQV[EJ9CTUEJCWHÒT2QNGPI$KVMKP 4 (D FQTVWPVGT2QNGP 5EJN FQTV WPVGT2QNGP  )1.&5GNVGPDGUQPFGTUKPFKGUGT'TJCNVWPI 2TCEJVGZGORNCTOKVHGKPGT)QNFVÌPWPI(CUV5VGORGNINCP\

1,5:1



8263

8264



1,5:1

<NQV[EJ9CTUEJCWHÒT2QNGPI$KVMKP 4 (D FQTVWPVGT2QNGP 5EJN FQTV WPVGT2QNGP  )1.&45GJTUEJÌPpXQT\ÒINKEJ



8265

1,5:1



62

1,5:1

<NQV[EJ9CTUEJCWHÒT2QNGPI$KVMKP 4 &CX FQTVWPVGT2QNGP   5GNVGPDGUQPFGTUKPFKGUGT'TJCNVWPI0WT'ZGORNCTGIGRT·IV #VVTCMVKXGUXQT\ÒINKEJGU'ZGORNCTOKVJGTTNKEJGT2CVKPC




ALEXANDER I.

8267

8266



<NQV[EJ9CTUEJCWHÒT2QNGP+P752NCUVKMJQNFGTFGT0)%OKVFGT$GYGTVWPI#7$KVMKP 8QT\ÒINKEJ



2TQDGOÒP\G Q , WO   WPUKIPKGTV XQP % -WGEJNGT 9GTMUVCVV /CVVJGY $QWNVQP $KTOKPIJCO   CWHFGP6QFFGT<CTKP-CVJCTKPC++KO,CJT2TKXCVG2TQDGRT·IWPIKP-WRHGT)GMTÌPVGU$TWUVDKNF -CVJCTKPCU ++ T OKV WOIGNGIVGO /CPVGN)GMTÌPVGT &QRRGNCFNGT OKV 4GKEJUCRHGN WPF <GRVGT KP FGP   (·PIGP CWH FGT $TWUV 5V )GQTIUUEJKNF WOJGT FKG -GVVG FGU #PFTGCUQTFGPU QDGP -TQPG  OO   I$KVMKP 4 &KCMQX FQTVWPVGT-CVJCTKPC++4   4*GTTNKEJG-WRHGTRCVKPCMN-TCV\GTXQT\ÒINKEJp5VGORGNINCP\



/GFCKNNGPFGU<CTGP#NGZCPFGT+

8268



8269



5KNDGTOGFCKNNG  XQP%.GDGTGEJV#WU\GKEJPWPIFGTGJGOCNUHKPPKUEJGP#TOGGHÒTKJTG-TKGIGT $ÒUVGT9GKDNKEJG)GUVCNVOKV¤N\YGKIUVGJVHCUVXXWPFMT·P\VGKPGPXQTKJTUVGJGPFGPIGHNÒIGNVGP )GPKWUFGTKPFGT4GEJVGPGKPGP2CNO\YGKIWPFOKVFGT.KPMGPGKPGP5EJKNFJ·NVOOI &KCMQX 4  8QPITQ­GT5GNVGPJGKV&WPMNG2CVKPC4CPFHGJNGTUGJTUEJÌP 



'KPUGKVKIGUXGTIQNFGVGU$TQP\GMNKUEJGGWPUKIPKGTV&KG$TWUVDKNFGTXQP#NGZCPFGT+WPF'NKUCDGVJ GKPCPFGTIGIGPÒDGTOOI&KCMQXp 5GJTUEJÌP



8271

8270



8270

$TQP\GOGFCKNNGXQP*($TCPFVCWHFKG)TWPFUVGKPNGIWPIFGU5KGIGUFGPMOCNUCWHFGO-TGW\ DGTIKP$GTNKPIGOGKPUCOOKV-ÌPKI(TKGFTKEJ9KNJGNO+++XQP2TGW­GP\WT'TKPPGTWPICPFKG5KGIG ÒDGT 0CRQN¾QP + &KG $ÒUVGP XQP #NGZCPFGT + WPF (TKGFTKEJ 9KNJGNO +++ PGDGPGKPCPFGT N WOJGT   .QTDGGTMTCP\#PUKEJV FGU 5KGIGUFGPMOCNU WOJGT FKG ,CJTGU\CJNGP      UQYKG GKP   FTGK\GKNKIGT5EJTKHVMTGKUOOI&KCMQX 4 .GJPGTV/CTKGPD  8QT\ÒINKEJp5VGORGNINCP\



5KNDGTPG /KPKCVWTOGFCKNNG  WPUKIPKGTV $ÒUVG OKV .QTDGGTMTCP\ T FCTÒDGT 5VGTP5EJYGTV WPF   <GRVGTIGMTGW\VQDGP-TQPGWPVGP4GKEJUCRHGNOOI 8QT\ÒINKEJ



#WUFGT5COONWPI,QJCPPGU<KGTCEJ



63


NIKOLAUS I.

8272 1,5:1

1,5:1

<#40+-1.#75+ )QNFOÒP\GPFGU<CTGP0KMQNCWU+ 

4WDGN5V2GVGTUDWTII$KVMKP(D5EJN  )1.&4#VVTCMVKXGUHCUVXQT\ÒINKEJGU'ZGORNCT

8273





8273

1,5:1

4WDGN5V2GVGTUDWTII$KVMKP(D5EJN  )1.&5GJTUGNVGPGT,CJTICPI*GPMGNURWTUGJTUEJÌP



8274 1,5:1



1,5:1

4WDGN5V2GVGTUDWTII$KVMKP(D5EJN

8275

8276

8277

)1.&8QT\ÒINKEJp5VGORGNINCP\

8278



8279



4WDGN5V2GVGTUDWTII$KVMKP(D5EJN  )1.&-N4CPFHGJNGTMN-TCV\GTXQT\ÒINKEJ





4WDGN5V2GVGTUDWTII$KVMKP(D5EJN  )1.&9KP\-TCV\GTMN4CPFHGJNGTHCUVXQT\ÒINKEJ





4WDGN5V2GVGTUDWTII$KVMKP(D5EJN

)1.&8QT\ÒINKEJ





4WDGN5V2GVGTUDWTII$KVMKP(D5EJN

)1.&5GJTUEJÌP





4WDGN5V2GVGTUDWTII$KVMKP(D5EJN

)1.&8QT\ÒINKEJ



64


NIKOLAUS I.

8280 Pt

1,5:1

1,5:1

2NCVKPOÒP\GPFGU<CTGP0KMQNCWU+ 

4WDGN2NCVKP5V2GVGTUDWTII$KVMKP 4 (D5EJN  2.#6+0445GJTUEJÌPpXQT\ÒINKEJ



8281 Pt

1,5:1



1,5:1

4WDGN2NCVKP5V2GVGTUDWTII)GMTÌPVGT&QRRGNCFNGT9GTVCPICDGWPF,CJTGU\CJN  $KVMKP 4 (D5EJN  2.#6+08QPITQ­GT5GNVGPJGKV0WT'ZGORNCTGIGRT·IV5EJÌPpUGJTUEJÌP



8282 Pt 1,5:1



1,5:1

4WDGN2NCVKP5V2GVGTUDWTII$KVMKP 4 (D5EJN

2.#6+08QT\ÒINKEJ



8283 Pt 1,5:1



4WDGN2NCVKP5V2GVGTUDWTII$KVMKP 4 (D5EJN

1,5:1

2.#6+08QT\ÒINKEJ

 65


NIKOLAUS I.

8284 Pt 1,5:1



4WDGN2NCVKP5V2GVGTUDWTII$KVMKP 4 (D5EJN

1,5:1



 2.#6+048QT\ÒINKEJ



8285 Pt 1,5:1

4WDGN2NCVKP5V2GVGTUDWTI+P752NCUVKMJQNFGTFGT0)%OKVFGT$GYGTVWPI8($KVMKP 4  (D5EJN 2.#6+045GJTUEJÌP

8286



1,5:1

8287

5KNDGTOÒP\GPCWUFGT/ÒP\UV·VVG5V2GVGTUDWTI 4WDGN5V2GVGTUDWTII$KVMKP&CX



8288

5GJTUEJÌPpXQT\ÒINKEJ





4WDGN5V2GVGTUDWTI+P752NCUVKMJQNFGTFGT2%)5OKVFGT$GYGTVWPI#7$KVMKP&CX 5GJTUEJÌPpXQT\ÒINKEJ





4WDGN5V2GVGTUDWTII$KVMKP&CX



5GJTUEJÌPpXQT\ÒINKEJ

8289

 66

4WDGN5V2GVGTUDWTI+P752NCUVKMJQNFGTFGT2%)5OKVFGT$GYGTVWPI/5$KVMKP&CX 8QT\ÒINKEJp5VGORGNINCP\




NIKOLAUS I.

8292

8290

8290 8293



4WDGN5V2GVGTUDWTII$KVMKP&CX



4WDGN  5V 2GVGTUDWTI  I $KVMKP  &CX  &C\W 4WDGN  5V 2GVGTUDWTI   I$KVMKP&CX 5VÒEM5GJTUEJÌP





4WDGN 2QNVKPC 5V2GVGTUDWTII$KVMKP

44GUVGXQP<CRQPNCEMUGJTUEJÌP





-QRGMGP5V2GVGTUDWTII$KVMKP

5GJTUEJÌPpXQT\ÒINKEJ



8294

8QT\ÒINKEJ



8295



4WDGN5V2GVGTUDWTII$KVMKP&CX  2CVKPCYKP\5EJTÌVNKPIUHGJNGTCO4CPFUGJTUEJÌP





4WDGN5V2GVGTUDWTII$KVMKP&CX



5GJTUEJÌP

8296

1,5:1



1,5:1

4WDGN  5V 2GVGTUDWTI +P 752NCUVKMJQNFGT FGT 2%)5 OKV FGT $GYGTVWPI /5   $KVMKP    &CX 2TCEJVGZGORNCT*GTTNKEJG2CVKPCHCUV5VGORGNINCP\  67


NIKOLAUS I.

8298

8297



4WDGN5V2GVGTUDWTII$KVMKP&CX  (GKPG2CVKPCYKP\4CPFHGJNGTHCUVXQT\ÒINKEJ





4WDGN5V2GVGTUDWTII$KVMKP&CX

8QT\ÒINKEJ





4WDGN5V2GVGTUDWTII$KVMKP&CX  2TCEJVXQNNG2CVKPCMN4CPFHGJNGTXQT\ÒINKEJ





4WDGN5V2GVGTUDWTII$KVMKP&CX



8299

8300

8301

(CUVXQT\ÒINKEJ

8302



4WDGN5V2GVGTUDWTII$KVMKP&CX  -N)TCHHKVKKO(GNFFGT8QTFGTUGKVGUGJTUEJÌP



4WDGN5V2GVGTUDWTII$KVMKP&CX

8303

-N4CPFHGJNGTXQT\ÒINKEJp5VGORGNINCP\

 

8304

8304 1,5:1



4WDGN5V2GVGTUDWTII$KVMKP&CX

*ÒDUEJG2CVKPCUGJTUEJÌPpXQT\ÒINKEJ





4WDGN5V2GVGTUDWTII$KVMKP&CX  2TCEJVGZGORNCT*GTTNKEJG2CVKPCXQT\ÒINKEJp5VGORGNINCP\CWURQNKGTVGT2NCVVG



68


NIKOLAUS I.

8305

8306

8307



4WDGN5V2GVGTUDWTII$KVMKP&CX

8QT\Ã&#x2019;INKEJ





4WDGN5V2GVGTUDWTII$KVMKP&CX

8QT\Ã&#x2019;INKEJ





4WDGN5V2GVGTUDWTII$KVMKP&CX  9KP\4CPFHGJNGTXQT\Ã&#x2019;INKEJCWURQNKGTVGT2NCVVG



8308

8309



4WDGN 2QNVKPC 5V2GVGTUDWTII$KVMKP

(GKPG2CVKPCXQT\Ã&#x2019;INKEJp5VGORGNINCP\





4WDGN 2QNVKPC 5V2GVGTUDWTII$KVMKP

8QT\Ã&#x2019;INKEJ



8310

8311



4WDGN 2QNVKPC 5V2GVGTUDWTII$KVMKP

8QT\Ã&#x2019;INKEJp5VGORGNINCP\





4WDGN 2QNVKPC 5V2GVGTUDWTII$KVMKP  5GNVGPKPFKGUGT'TJCNVWPI8QT\Ã&#x2019;INKEJp5VGORGNINCP\CWURQNKGTVGT2NCVVG



8312



4WDGN 2QNVKPC 5V2GVGTUDWTII$KVMKP



-QRGMGP5V2GVGTUDWTII$KVMKP

8313

9KP\4CPFHGJNGTXQT\Ã&#x2019;INKEJ



9KP\-TCV\GTHCUV5VGORGNINCP\

 69


NIKOLAUS I.

8314

8315

8314



-QRGMGP5V2GVGTUDWTI+P752NCUVKMJQNFGTFGT2%)5OKVFGT$GYGTVWPI/5$KVMKP 2TCEJVGZGORNCT(CUV5VGORGNINCP\





-QRGMGP5V2GVGTUDWTII$KVMKP



8QT\ÒINKEJp5VGORGNINCP\CWURQNKGTVGT2NCVVG

8316

8317



4WDGN 2QNVKPC 9CTUEJCWI$KVMKP

(CUVXQT\ÒINKEJ





4WDGN 2QNVKPC 9CTUEJCWI$KVMKP

(CUVXQT\ÒINKEJ



8318

8318 1,5:1

'KPG-WRHGTRT·IWPICWUFGT/ÒP\UV·VVG5W\WP -QN[XCP  

-W-QRGMG5W\WP -QN[XCP 0QXQFGNI$KVMKP* 4 

8319

445VGORGNINCP\



8320

)GFGPMOÒP\GPFGU<CTGP0KMQNCWU+ 

4WDGN5V2GVGTUDWTI&GPMOCNHÒT#NGZCPFGT+I$KVMKP 4 &CX  *GTTNKEJG2CVKPCMN4CPFHGJNGTHCUVXQT\ÒINKEJ





4WDGN5V2GVGTUDWTI&GPMOCNHÒT#NGZCPFGT+I$KVMKP 4 &CX  -TCV\GTYKP\4CPFHGJNGTUGJTUEJÌPpXQT\ÒINKEJ



8321

8322

2T·IWPIGPHÒT2QNGP 

<NQV[9CTUEJCWHÒT2QNGPI$KVMKP  5GNVGPKPFKGUGT'TJCNVWPI(GKPG2CVKPCXQT\ÒINKEJ





<NQV[9CTUEJCWHÒT2QNGPI$KVMKP



70

(CUVXQT\ÒINKEJ


NIKOLAUS I.

8323

8324

8325



4WDGN <NQV[EJ 5V2GVGTUDWTIHÒT2QNGPI$KVMKP&CX

5GJTUEJÌP





4WDGN <NQV[EJ 5V2GVGTUDWTIHÒT2QNGPI$KVMKP&CX  5GJTUEJÌPpXQT\ÒINKEJ





4WDGN <NQV[EJ 5V2GVGTUDWTIHÒT2QNGPI$KVMKP&CX



8326

8327

8QT\ÒINKEJ

8328



4WDGN <NQV[EJ 5V2GVGTUDWTIHÒT2QNGPI$KVMKP&CX

5GJTUEJÌP





4WDGN <NQV[EJ 9CTUEJCWHÒT2QNGPI$KVMKP&CX

5GJTUEJÌP





4WDGN <NQV[EJ 9CTUEJCWHÒT2QNGPI$KVMKP 4 &CX 45GJTUEJÌP

 71


NIKOLAUS I.

8331 8330

8329

 

-QRGMGP <NQVG 9CTUEJCWHÒT2QNGPI$KVMKP -W)TQU\[9CTUEJCWHÒT2QNGPI$KVMKP

5GJTUEJÌP 5GJTUEJÌPpXQT\ÒINKEJ

 



-QRGMGP )TQU\[ 9CTUEJCWHÒT2QNGPI$KVMKP FQTVHCNUEJDGUEJTKGDGP   *ÒDUEJG2CVKPCXQT\ÒINKEJ



8332

/GFCKNNGPFGU<CTGP0KMQNCWU+ 

5KNDGTOGFCKNNG  XQP 8 #NGZGGX WPF + .CXTGVUQX CWH UGKPG -TÌPWPIKP/QUMCWCO#WIWUV $ÒUVG T-TQPG NKGIV CWH GKPGT 5·WNG CP FGT GKPG 6CHGN OKV TWUUKUEJGT +PUEJTKHV &CU )GUGV\  CPIG   DTCEJVKUVQDGPUVTCJNGPFGU)QVVGUCWIGOOI&KCMQX 4   44*GTTNKEJG2CVKPCYKP\4CPFHGJNGTXQT\ÒINKEJ 

8333



72

$TQP\GOGFCKNNGXQP8#NGZGGXWPF)5CDWTQXCWHUGKPG-TÌPWPIKP/QUMCWCO#WIWUV $ÒUVG T-TQPG NKGIV CWH GKPGT 5·WNG CP FGT GKPG 6CHGN OKV TWUUKUEJGT +PUEJTKHV &CU )GUGV\  CPIG   DTCEJVKUVQDGPUVTCJNGPFGU)QVVGUCWIGOOI&KCMQX  -N4CPFHGJNGTYKP\-TCV\GTHCUVXQT\ÒINKEJ




NIKOLAUS I.

8334



5KNDGTOGFCKNNGQ, IGUVKHVGV WPUKIPKGTV2T·OKGHÒTFKG2QEMGPKORHWPIXGTNKGJGPCP+ORH·T\VG )GMTÌPVGU $TWUVDKNF FGT <CTKP -CVJCTKPC ++ T OKV WOIGNGIVGO /CPVGN*[IKGKC UVGJV X X WPF J·NV   DGUEJÒV\GPF KJTG #TOG ÒDGT UKGDGP -KPFGT FKG WO UKG XGTUCOOGNV UKPF  OO  I &KCMQX    4 5NI$TGVVCWGT 445GJTUEJÌPpXQT\ÒINKEJ  +O,CJTGNWF-CVJCTKPC++FGPGPINKUEJGP#T\V6JQOCU&KOUFCNGFGTGKP$WEJÒDGTFKG2QEMGPUEJWV\ KORHWPIXGTHC­VJCVVGPCEJ5V2GVGTUDWTIGKPWOFKG9KTMUCOMGKVUGKPGT+ORHOGVJQFGCOGKIGPGP.GKD\WVGUVGP YCUIGIGPFGP9KNNGPKJTGTT\VGIGUEJCJ#O1MVQDGTPCJO&KOUFCNGFKG+ORHWPIXQTKPFGOGTFGP #TO FGT <CTKP OKV GKPGT RQEMGPKPHK\KGTVGP .CP\GVVG TKV\VG 'U MCO \W MGKPGTNGK -QORNKMCVKQPGP CWEJ PKEJV DGK   KJTGO5QJP2CWN2GVTQYKVUEJ UR·VGT<CT2CWN+ FGTGDGPHCNNUIGKORHVYQTFGPYCT&WTEJFKGUGUOWVKIG$GKURKGN XGTJCNH-CVJCTKPCFGT2QEMGPUEJWV\KORHWPIKP4W­NCPF\WO&WTEJDTWEJ  <CT 0KMQNCWU + FGT FKG #WUICDG XQP 2T·OKGPOGFCKNNGP HÒT FKG 2QEMGPKORHWPI CP T\VGXGTCPNC­VGGJTVOKVFGT 8QTFGTUGKVGPFCTUVGNNWPIFKGUGT2T·IWPIGPFKGVCRHGTG<CTKP  &KCMQXHÒJTVFKGUG2T·OKGPOGFCKNNGPCWEJ\WU·V\NKEJWPVGTFGT4GIGPVUEJCHV-CVJCTKPCU++CWH UKGJG0THH  XGTNKGJGPYWTFGPUKGLGFQEJGTUVWPVGT0KMQNCWU+

8335







8336

8337

5KNDGTOGFCKNNG  XQP * )WDG CWH FKG -TKGIUGTMN·TWPI CP FKG 6ÒTMGK CO  #RTKN $ÒUVG T   &KGRGTUQPKHK\KGTVG4GNKIKQPÒDGTTGKEJVFGO<CTGPGKP5EJYGTVWPFGKP-TGW\\YKUEJGPKJPGPCWHFGO $QFGPGKP*GNOOOI&KCMQX 4   42TCEJVXQNNG2CVKPCXQT\ÒINKEJp5VGORGNINCP\



$TQP\GOGFCKNNGXQP*)WDG9GTMUVCVV.QQU$GTNKPCWHFKG-TKGIUGTMN·TWPICPFKG6ÒTMGKCO  #RTKN $ÒUVG T&KG RGTUQPKHK\KGTVG 4GNKIKQP ÒDGTTGKEJV FGO <CTGP GKP 5EJYGTV WPF GKP -TGW\   \YKUEJGPKJPGPCWHFGO$QFGPGKP*GNOOOI&KCMQX  9KP\4CPFHGJNGTXQT\ÒINKEJ



5KNDGTOGFCKNNGXQP*)WDGCWHFKG'KPPCJOGXQP8CTPC$ÒUVGT5GEJU<GKNGP5EJTKHVWOJGT .QTDGGTMTCP\OOI&KCMQX 4  2TCEJVXQNNG2CVKPCHCUV5VGORGNINCP\

 73


NIKOLAUS I.

8338

8340

8339



$TQP\GOGFCKNNG  XQP * )WDG CWH FKG 'KPPCJOG XQP 8CTPC $ÒUVG T5GEJU <GKNGP 5EJTKHV   WOJGT.QTDGGTMTCP\OOI&KCMQX 8QT\ÒINKEJp5VGORGNINCP\



5KNDGTOGFCKNNGWPUKIPKGTV9GTMUVCVV).QQUCWHFKG5EJNCEJVDGKFGTVÒTMKUEJGP(GUVWPI5EJWONC

JGWVG $WNICTKGP  $ÒUVG T OKV .QTDGGTMTCP\<GJP <GKNGP 5EJTKHV WOJGT .QTDGGTMTCP\  OO   I&KCMQX 4  2TCEJVGZGORNCT*GTTNKEJG2CVKPCHCUV5VGORGNINCP\ 



$TQP\GOGFCKNNG  XQP 2 7VMKP CWH FKG 'KPYGKJWPI FGU &GPMOCNU HÒT #NGZCPFGT + $ÒUVG T   #PUKEJVFGU&GPMOCNUOOI&KCMQX 9KP\4CPFHGJNGTXQT\ÒINKEJ





8341



74

5KNDGTOGFCKNNGQ, ITCXKGTV XQP*)WDGWPF27VMKP2TGKUOGFCKNNGFGU$GTIDCWKPUVK VWVGU XGTNKGJGP CP 5VWFGPVGP $ÒUVG N)GMTÌPVG YGKDNKEJG )GUVCNV UKV\V PCEJ N CP GKPGP NKGIGPFGP   .ÌYGP IGNGJPV KP FGT .KPMGP 6CODWTKP OKV FGT 4GEJVGP J·NV UKG GKPGP.QTDGGTMTCP\ÒDGTFCU*CWRV GKPGUXQTKJTMPKGPFGP5EJÒNGTUKO#DUEJPKVV)TCXWTOKVFGT,CJTGU\CJNWPF5EJTKHVOO I&KCMQX 4  444CPFHGJNGTUGJTUEJÌPpXQT\ÒINKEJ 


NIKOLAUS I.

8342



$TQP\GOGFCKNNGXQP*)WDGWPF#.[CNKPCWHFKG)TWPFUVGKPNGIWPIFGU2WNMQYQ1DUGTXCVQTK WOU -QRH N#PUKEJV FGU )GD·WFGU WOJGT GKP DTGKVGU 4GNKGHDCPF OKV 6KGTMTGKU\GKEJGP  OO   I&KCMQXXCT 4(CUV5VGORGNINCP\



8345

8343

8344



)QNFOGFCKNNGQ, WO WPUKIPKGTV2T·OKGHÒTGTHQNITGKEJG5VWFKGP)GMTÌPVGT&QRRGNCFNGTOKV <GRVGTWPF4GKEJUCRHGNKPFGP(·PIGPCWHFGT$TWUV5V)GQTIUUEJKNFWOJGTFKG-GVVGFGU#PFTGCUQT FGPU CWH FGP (NÒIGNP LG FTGK YGKVGTG 9CRRGPUEJKNFG QDGP -TQPG/KPGTXC OKV .QTDGGTMTCP\ KP FGT   4GEJVGPWPF¤NNCORGKPFGTGTJQDGPGP.KPMGPUVGJVXXWOIGDGPXQP#VVTKDWVGPFGT9KUUGPUEJCHVGP FKGCWHFGO$QFGPNKGIGPOOI&KCMQX 4   )1.&44*GPMGNURWTUGJTUEJÌP 



$TQP\GOGFCKNNGXQP*)WDGCWHFKG'TÌHHPWPIFGU1DUGTXCVQTKWOUKP2WNMQYQDGK5V2GVGTU DWTI $ÒUVG T#PUKEJV FGU 1DUGTXCVQTKWOU WOJGT 6KGTMTGKU\GKEJGP FC\YKUEJGP 5VGTPG  OO   I&KCMQX /KPDGTKGDGPXQT\ÒINKEJ



6TCIDCTGXGTUKNDGTVG$TQP\GOGFCKNNGWPUKIPKGTVCWHFKG'KPPCJOGXQP#MJWNIQCO#WIWUV XGTNKGJGP CP DGVGKNKIVG /KNKV·TRGTUQPGP T\VG WPF )GKUVNKEJMGKV )GMTÌPVGU /QPQITCOO8KGT <GKNGP   5EJTKHVOOI&KCMQX 8QT\ÒINKEJ





75


ALEXANDER II.

1,5:1 8346

1,5:1



1,5:1

5KNDGTOGFCKNNG\WGKPGO4WDGNXQP*)WDGCWHFKG8GTO·JNWPIUGKPGU5QJPGU)TQ­HÒTUV#NGZ CPFGT0KMQNCLGYKVUEJUR·VGT<CT#NGZCPFGT++OKV/CTKCXQP*GUUGP&CTOUVCFV6QEJVGT.WFYKIU++ $GKFGT $ÒUVGP PGDGPGKPCPFGT N#OQT WPF 2U[EJG NGJPGP CP GKPGT IGMTÌPVGP -CTVWUEJG FCTKP   /QPQITCOO #/  OO  I $KVMKP /  4  &CX XIN  # &KCMQX  4    5EJÒV\ 44#VVTCMVKXGU'ZGORNCTOKVJÒDUEJGT2CVKPCXQT\ÒINKEJ 

8347



$TQP\GOGFCKNNGXQP#-NGRKMQYCWHFKG4GPQXKGTWPIFGU-TGONUKP/QUMCW)GMTÌPVGU/QPQ ITCOO#PUKEJVFGU-TGONUOOI&KCMQX 4  9KP\4CPFHGJNGTXQT\ÒINKEJ

8348 1,5:1



1,5:1

<#4#.':#0&'4++ 

)QNFOÒP\GPFGU<CTGP#NGZCPFGT++

4WDGN5V2GVGTUDWTII$KVMKP(D5EJN

)1.&8QT\ÒINKEJ



8349 1,5:1

 76

4WDGN5V2GVGTUDWTII$KVMKP(D5EJN

1,5:1

)1.&8QT\ÒINKEJ




ALEXANDER II.

8350

8351

8352

8353



4WDGN5V2GVGTUDWTII$KVMKP(D5EJN

)1.&8QT\ÒINKEJ





4WDGN5V2GVGTUDWTII$KVMKP(D5EJN

 )1.&-N*GPMGNURWTUGJTUEJÌP



 

4WDGN5V2GVGTUDWTII$KVMKP(D5EJN 4WDGN5V2GVGTUDWTII$KVMKP(D5EJN

)1.&8QT\ÒINKEJ )1.&(CUVXQT\ÒINKEJ

 

8354

8355



4WDGN5V2GVGTUDWTII$KVMKP(D5EJN  )1.&9KP\4CPFHGJNGTUGJTUEJÌPpXQT\ÒINKEJ





4WDGN5V2GVGTUDWTII$KVMKP(D5EJN  )1.&#VVTCMVKXGUXQT\ÒINKEJGU'ZGORNCTOKVJGTTNKEJGT)QNFRCVKPC



8356

1,5:1

1,5:1



4WDGN5V2GVGTUDWTII$KVMKP 4 (D5EJN

)1.&48QT\ÒINKEJ



8357

1,5:1



1,5:1

5KNDGTOÒP\GPFGU<CTGP#NGZCPFGT++CWUFGT/ÒP\UV·VVG5V2GVGTUDWTI

4WDGN 2QNVKPC 5V2GVGTUDWTII$KVMKP

9KP\-TCV\GTRQNKGTVG2NCVVG

 77


ALEXANDER II.

8358

8359



4WDGN 2QNVKPC 5V2GVGTUDWTII$KVMKP

8QT\ÒINKEJGU'ZGORNCTOKVHGKPGT2CVKPC





4WDGN 2QNVKPC 5V2GVGTUDWTII$KVMKP

 2TCEJVXQNNG2CVKPCXQT\ÒINKEJp5VGORGNINCP\





4WDGN 2QNVKPC 5V2GVGTUDWTII$KVMKP

(CUVXQT\ÒINKEJ



8361

 

8362

4WDGN5V2GVGTUDWTII$KVMKP&CX 4WDGN5V2GVGTUDWTII$KVMKP&CX

8363

 

5GNVGPGT,CJTICPI5GJTUEJÌPpXQT\ÒINKEJ 5GNVGPGT,CJTICPI5GJTUEJÌP

 

8364

4WDGN5V2GVGTUDWTII$KVMKP&CX 4WDGN5V2GVGTUDWTII$KVMKP&CX

(GKPG2CVKPCXQT\ÒINKEJ (GKPG2CVKPCXQT\ÒINKEJp5VGORGNINCP\

 

8365 1,5:1



1,5:1

4WDGN 2QNVKPC 5V2GVGTUDWTII$KVMKP 4   44(GKPG2CVKPCYKP\-TCV\GTXQT\ÒINKEJCWURQNKGTVGT2NCVVG



8366 1,5:1

1,5:1

'KPG2T·IWPICWUFGT/ÒP\UV·VVG9CTUEJCW  78

-QRGMGP9CTUEJCWI$KVMKP 4 

44(GKPG2CVKPCUGJTUEJÌPpXQT\ÒINKEJ




ALEXANDER II.

8368

8367

8367

 

-WRHGTRT·IWPIGPFGU<CTGP#NGZCPFGT++

-W-QRGMGP'MCVGTKPDWTII$KVMKP -W2QNWUEJMC9CTUEJCWI$KVMKP 4 

2TCEJVGZGORNCT(CUV5VGORGNINCP\ 4-N(NGEMHCUV5VGORGNINCP\

8370

8369

 

8371

)GFGPMOÒP\GPFGU<CTGP#NGZCPFGT++ 

4WDGN5V2GVGTUDWTI&GPMOCNHÒT0KMQNCWU+I$KVMKP&CX  -N4CPFHGJNGTXQT\ÒINKEJ





4WDGN5V2GVGTUDWTI&GPMOCNHÒT0KMQNCWU+I$KVMKP&CX  5GJTUEJÌPpXQT\ÒINKEJ





4WDGN5V2GVGTUDWTI&GPMOCNHÒT0KMQNCWU+I$KVMKP&CX  5GJTUEJÌPpXQT\ÒINKEJ



1,5:1

8372

1,5:1

'KPG2T·IWPIHÒT(KPPNCPF 

/CTMMCC*GNUKPMKHÒT(KPPNCPFI$KVMKP 4 (D FQTVWPVGT(KPPNCPF 5EJN

FQTVWPVGT(KPPNCPF  )1.&48QT\ÒINKEJp5VGORGNINCP\



8373

/GFCKNNGPFGU<CTGP#NGZCPFGT++ 

5KNDGTOGFCKNNGQ,XQP-(8QKIVOKVTWUUKUEJGT7OUEJTKHVCWHFGPFGWVUEJGP-QORQPKUVGP)GQTI (TKGFTKEJ *·PFGN  Ó $ÒUVG *·PFGNU N.[TC KP 5VTCJNGP FCTWPVGT 5EJYCP OKV CWUIGDTGK   VGVGP(NÒIGNPCWH\YGKIGMTGW\VGP.QTDGGT\YGKIGPOOI&KCMQXp0KIIN  48QT\ÒINKEJ

 79


ALEXANDER II.

8374



'KUGPIW­OGFCKNNG  XQP 8 #NGZGGX WPF / -WEJMKP CWH FCU L·JTKIG ,WDKN·WOU UGKPGU 8CVGTU   0KMQNCWU + CNU 1DGTDGHGJNUJCDGT FGT DGTKVVGPGP .GKDICTFG $ÒUVGP XQP 0KMQNCWU + WPF #NGZCPFGT ++   PGDGPGKPCPFGTT)GMTÌPVGU/QPQITCOOKP-TCP\FCTWPVGTUKGDGP<GKNGP5EJTKHVÒDGT#TOCVWTGPCWH .QTDGGTWPF'KEJGP\YGKIGPQDGP5VTCJNGPOOI&KCMQX 448QT\ÒINKEJ



8375



80

$TQP\GOGFCKNNGQ, WO XQP.5VGKPOCPWPF80KMQPQXCWHFKGMCKUGTNKEJG.CPFYKTVUEJCHVU IGUGNNUEJCHV XQP 5ÒFTW­NCPF &KG $ÒUVGP XQP#NGZCPFGT++WPF0KMQNCWU+PGDGPGKPCPFGTN2HNÒIGP FGT$CWGTKP.CPFUEJCHVKO*KPVGTITWPFCWHIGJGPFG5QPPGOOI&KCMQX 4  -N2TQDKGTURWTCO4CPFXQT\ÒINKEJ




ALEXANDER III.

8376

2:1

2:1

<#4#.':#0&'4+++ )QNFOÒP\GPFGU<CTGP#NGZCPFGT+++ 

4WDGN5V2GVGTUDWTII$KVMKP 4 (D5EJN  )1.&44-N-TCV\GTXQT\ÒINKEJ



8377 1,5:1

1,5:1



4WDGN5V2GVGTUDWTII$KVMKP(D5EJN  )1.&40WT'ZGORNCTGIGRT·IV-N4CPFHGJNGTXQT\ÒINKEJ

8378

8379

8380



8381



4WDGN5V2GVGTUDWTII$KVMKP(D5EJN

)1.&8QT\ÒINKEJ





4WDGN5V2GVGTUDWTII$KVMKP(D5EJN

)1.&-N-TCV\GTXQT\ÒINKEJ





4WDGN5V2GVGTUDWTII$KVMKP(D5EJN

)1.&(CUVXQT\ÒINKEJ





4WDGN5V2GVGTUDWTII$KVMKP(D5EJN

)1.&5GJTUEJÌP



8382

8383



4WDGN5V2GVGTUDWTII$KVMKP(D5EJN

)1.&8QT\ÒINKEJ





4WDGN5V2GVGTUDWTII$KVMKP(D5EJN

)1.&5GJTUEJÌPpXQT\ÒINKEJ

 81


ALEXANDER III.

8385 8384

8386



4WDGN5V2GVGTUDWTII$KVMKP(D5EJN  )1.&9KP\4CPFHGJNGTMN-TCV\GTUGJTUEJÌPpXQT\ÒINKEJ



 

4WDGN5V2GVGTUDWTII$KVMKP(D5EJN 4WDGN5V2GVGTUDWTII$KVMKP(D5EJN

 

)1.&5GJTUEJÌP )1.&5GJTUEJÌP

8387

1,5:1

1,5:1

5KNDGTOÒP\GPFGU<CTGP#NGZCPFGT+++ 

4WDGN5V2GVGTUDWTII$KVMKP&CX  .GKEJVG)N·VVWPIUURWTGPKO(GNFFGT8QTFGTUGKVGUQPUVXQT\ÒINKEJp5VGORGNINCP\CWURQNKGTVGT2NCVVG

8388

 

4WDGN5V2GVGTUDWTII$KVMKP&CX 4WDGN5V2GVGTUDWTII$KVMKP&CX

8390

  82

4WDGN5V2GVGTUDWTII$KVMKP&CX 4WDGN5V2GVGTUDWTII$KVMKP&CX



8389

9KP\-TCV\GTXQT\ÒINKEJ *ÒDUEJG2CVKPCHCUVXQT\ÒINKEJ

 

8391

2TCEJVXQNNG2CVKPCXQT\ÒINKEJ (CUVXQT\ÒINKEJXQT\ÒINKEJ

 


ALEXANDER III.

8392

1,5:1



1,5:1

-QRGMGP5V2GVGTUDWTI+P752NCUVKMJQNFGTFGT0)%OKVFGT$GYGTVWPI/5$KVMKP 4  48QT\ÒINKEJp5VGORGNINCP\

8393

 



8394

-QRGMGP5V2GVGTUDWTII$KVMKP -QRGMGP5V2GVGTUDWTII$KVMKP

8QT\ÒINKEJp5VGORGNINCP\ (GKPG2CVKPCXQT\ÒINKEJ

 

8395

1,5:1



1,5:1

-QRGMGP5V2GVGTUDWTII$KVMKP 4   W­GTUVUGNVGPKPFKGUGT'TJCNVWPI0WT'ZGORNCTGIGRT·IV -CDKPGVVUVÒEM2TCEJVXQNNG2CVKPC5VGORGNINCP\



8397

8396



-QRGMGP5V2GVGTUDWTI+P752NCUVKMJQNFGTFGT0)%OKVFGT$GYGTVWPI/5$KVMKP *ÒDUEJG2CVKPCXQT\ÒINKEJ





-QRGMGP5V2GVGTUDWTII$KVMKP



1,5:1



8398

'KPG-WRHGTRT·IWPIFGU<CTGP#NGZCPFGT+++

-W-QRGMG5V2GVGTUDWTII$KVMKP 4 

(GKPG2CVKPCXQT\ÒINKEJ

1,5:1

448QT\ÒINKEJ

 83


ALEXANDER III.

8400

8399

ex 8401

)GFGPMOÒP\GPFGU<CTGP#NGZCPFGT+++ 

4WDGN5V2GVGTUDWTICWHUGKPG-TÌPWPII$KVMKP&CX  2TCEJVGZGORNCT8QT\ÒINKEJp5VGORGNINCP\





4WDGN5V2GVGTUDWTICWHUGKPG-TÌPWPII$KVMKP&CX





4WDGN  5V 2GVGTUDWTI CWH UGKPG -TÌPWPI  I $KVMKP  &CX  &C\W 0KMQNCWU ++   -QRGMGP5V2GVGTUDWTI$KVMKP 5VÒEM'VYCUDGTKGDGP Z XQT\ÒINKEJ

8402

1,5:1

5GJTUEJÌP



1,5:1

'KPG2T·IWPIHÒT(KPPNCPF 

 /CTMMCC  *GNUKPMK HÒT (KPPNCPF  I $KVMKP  (D  FQTV WPVGT (KPPNCPF  5EJN   

FQTVWPVGT(KPPNCPF  )1.&8QT\ÒINKEJXQT\ÒINKEJp5VGORGNINCP\



8404

8403

(GKPIGYKEJVUDCTTGPCWUFGT/ÒP\UV·VVG5V2GVGTUDWTI 

<QNQVPKMUQ,5V2GVGTUDWTI+P752NCUVKMJQNFGTFGT2%)5OKVFGT$GYGTVWPI#7$KVMKP 4  448QT\ÒINKEJ



<QNQVPKMQ,5V2GVGTUDWTII$KVMKP



 <QNQVPKM Q , 5V 2GVGTUDWTI  I $KVMKP  &C\W  &QN[CU Q , 5V 2GVGTUDWTI  I   $KVMKP 4  5VÒEM5GJTUEJÌP

1,5:1

 84

8QT\ÒINKEJ

8406

&QN[CUQ,5V2GVGTUDWTII$KVMKP 4 

  

1,5:1

448QT\ÒINKEJ




ALEXANDER III.

8407

/GFCKNNGPFGU<CTGP#NGZCPFGT+++ 

5KNDGTOGFCKNNG Q , XQP # )TKNKEJGU 2T·OKG FGT /·FEJGPUEJWNG HÒT FGP GTHQNITGKEJGP #DUEJNW­   $TWUVDKNF FGT <CTKP /CTKC (GQFQTQYPC T/KPGTXC OKV .QTDGGTMTCP\ KP FGT 4GEJVGP WPF ¤NNCORG KP   FGTGTJQDGPGP.KPMGPUVGJVXXWOIGDGPXQP#VVTKDWVGPFGT9KUUGPUEJCHVGPFKGCWHFGO$QFGPNKG IGPOOI&KCMQX *GTTNKEJG2CVKPCYKP\4CPFHGJNGTHCUVXQT\ÒINKEJ



8408



$TQP\GOGFCKNNG  XQP 5 8C\JGPKP WPF / )CDG CWH FCU L·JTKIG #OVULWDKN·WO FGU 2TKP\GP   # / )QTEJCMQX CNU /KPKUVGT HÒT #WUNCPFUCPIGNGIGPJGKVGP $ÒUVG FGU 5VCCVUOCPPGU N&CVWOUCP   ICDGOOI&KCMQX +P1TKIKPCNGVWK8QT\ÒINKEJ



8409



5KNDGTOGFCKNNGXQP25VCFPKVUM[2TGKUOGFCKNNGFGT$GUUCTCDKUEJGP.CPFYKTVUEJCHVUCWUUVGNNWPIKP -KUJKPGX (ÒPH <GKNGP 5EJTKHV KP (TÒEJVGMTCP\ QDGP IGMTÌPVGU \YGKHGNFKIGU 9CRRGP.CPFUEJCHV   FCTKP 0WV\XKGJ NCPFYKTVUEJCHVNKEJG'T\GWIPKUUGWPF)GT·VGOOI&KCMQX 4  44#VVTCMVKXGU'ZGORNCTOKVHGKPGT2CVKPCYKP\-TCV\GTXQT\ÒINKEJ

 85


ALEXANDER III.

8410



<KPPOGFCKNNGWPUKIPKGTVCWHFGP#DUEJNW­FGUFGWVUEJTWUUKUEJGP*CPFGNUXGTVTCIGU$Ã&#x2019;UVGP#NGZ CPFGTU +++ WPF 9KNJGNOU ++ XQP 2TGW­GP PGDGPGKPCPFGT T <GKNGP \WO 6GKN IGDQIGPG 5EJTKHV KP   TWUUKUEJWPFFGWVUEJOOI&KCMQX/CTKGPD FQTVKP5KNDGT   2TCEJVGZGORNCT5VGORGNINCP\



8411



$TQP\GOGFCKNNGXQP#)TKNKEJGUCWHFKG'KPYGKJWPIFGU&GPMOCNUHÃ&#x2019;T#NGZCPFGT++KP*GNUKPMK $Ã&#x2019;UVG#NGZCPFGTU++T#PUKEJVFGU&GPMOCNUOOI&KCMQX  (CUV5VGORGNINCP\



8412



86

$TQP\GOGFCKNNGXQP#)TKNKEJGULTCWHFKG'KPYGKJWPIFGU&GPMOCNUHÃ&#x2019;T#NGZCPFGT++KP*GN UKPMK$Ã&#x2019;UVG#NGZCPFGTU++T#PUKEJVFGU&GPMOCNUOOI&KCMQX  8QT\Ã&#x2019;INKEJ




NIKOLAUS II.

8413

<#40+-1.#75++ )QNFOÒP\GPFGU<CTGP0KMQNCWU++ 

4WDGN5V2GVGTUDWTII$KVMKPXCT(D5EJN  )1.&8QT\ÒINKEJp5VGORGNINCP\





4WDGN5V2GVGTUDWTI,GI$KVMKP(D5EJN



1,5:1



8415

5VÒEM)1.&5GJTUEJÌP

1,5:1

4WDGN5V2GVGTUDWTII$KVMKP(D5EJN  )1.&5GJTUGNVGPKPFKGUGT'TJCNVWPI2QNKGTVG2NCVVG



8417

8416



4WDGN5V2GVGTUDWTII$KVMKP(D5EJN

 )1.&5GJTUEJÌPpXQT\ÒINKEJ





4WDGN5V2GVGTUDWTII$KVMKP(D5EJN

)1.&5GJTUEJÌP





4WDGN5V2GVGTUDWTIIWPFI$KVMKP(D Z 5EJN  5VÒEM)1.&-N4CPFHGJNGT Z UGJTUEJÌPpXQT\ÒINKEJ



8419

8420

8421

5KNDGTOÒP\GPFGU<CTGP0KMQNCWU++ 

4WDGN5V2GVGTUDWTII$KVMKP&CX

*ÒDUEJG2CVKPCYKP\-TCV\GTXQT\ÒINKEJ





4WDGN5V2GVGTUDWTII$KVMKP&CX  5GJTUGNVGPKPFKGUGT'TJCNVWPI2TCEJVGZGORNCT(CUV5VGORGNINCP\





4WDGN5V2GVGTUDWTII$KVMKP&CX

*GTTNKEJG2CVKPCXQT\ÒINKEJ

 87


NIKOLAUS II.

8422

8423



4WDGN5V2GVGTUDWTII$KVMKP 4 &CX

5GNVGPGT,CJTICPI8QT\ÒINKEJ





4WDGN5V2GVGTUDWTII$KVMKP 4 &CX  5GNVGPGT,CJTICPI5GJTUEJÌPpXQT\ÒINKEJXQT\ÒINKEJ



8424

8425



4WDGN5V2GVGTUDWTII$KVMKP 4 &CXp \W 

 5GNVGPGT,CJTICPI(CUVXQT\ÒINKEJ





4WDGN5V2GVGTUDWTII$KVMKP 4 &CXp \W   5GNVGPGT,CJTICPI(CUVXQT\ÒINKEJXQT\ÒINKEJ



8426

8427

8428



4WDGN5V2GVGTUDWTII$KVMKP&CX

 2TCEJVXQNNG2CVKPCXQT\ÒINKEJp5VGORGNINCP\





4WDGN5V2GVGTUDWTII$KVMKP&CX

8QT\ÒINKEJ





4WDGN5V2GVGTUDWTII$KVMKP 4 &CX  5GNVGPGT,CJTICPI*ÒDUEJG2CVKPCXQT\ÒINKEJ



8429

8430



4WDGN5V2GVGTUDWTII$KVMKP 4 &CX

5GNVGPGT,CJTICPI8QT\ÒINKEJ





4WDGN5V2GVGTUDWTI+P752NCUVKMJQNFGTFGT0)%OKVFGT$GYGTVWPI#7$KVMKP 4   &CX 5GNVGPGT,CJTICPI8QT\ÒINKEJ



88


NIKOLAUS II.

8431 1,5:1

1,5:1



-QRGMGP5V2GVGTUDWTII$KVMKP 4   42TCEJVGZGORNCT(GKPG2CVKPCXQT\ÒINKEJp5VGORGNINCP\

8434

8433



8433



-QRGMGP5V2GVGTUDWTIIWPFI$KVMKP  5VÒEM5GJTUEJÌPpXQT\ÒINKEJ



 

-QRGMGP5V2GVGTUDWTII$KVMKP 4  48QT\ÒINKEJ 4WDGN2CTKUI$KVMKP&CX (GKPG2CVKPCXQT\ÒINKEJXQT\ÒINKEJp5VGORGNINCP\

 

8435

8437

8436

 

4WDGN$TÒUUGNI$KVMKP&CX 4WDGN$TÒUUGNI$KVMKP&CX

9KP\4CPFHGJNGTXQT\ÒINKEJp5VGORGNINCP\ 8QT\ÒINKEJ

 



4WDGN$TÒUUGNI$KVMKP&CX  5GNVGPKPFKGUGT'TJCNVWPI8QT\ÒINKEJp5VGORGNINCP\



8438

8439

)GFGPMOÒP\GPFGU<CTGP0KMQNCWU++ 

4WDGN5V2GVGTUDWTICWHUGKPG-TÌPWPII$KVMKP&CX  -N(NGEMOKP4CPFHGJNGTXQT\ÒINKEJp5VGORGNINCP\





4WDGN5V2GVGTUDWTICWHUGKPG-TÌPWPII$KVMKP&CX  #VVTCMVKXGUHCUVXQT\ÒINKEJGU'ZGORNCTOKVJÒDUEJGT2CVKPC

 89


NIKOLAUS II.

8441

8440



4WDGN5V2GVGTUDWTICWHUGKPG-TÌPWPII$KVMKP&CX  9KP\-TCV\GTUGJTUEJÌPpXQT\ÒINKEJ





4WDGN5V2GVGTUDWTICWHUGKPG-TÌPWPII$KVMKP&CX  .GKEJVDGTKGDGPOKP4CPFHGJNGTHCUVXQT\ÒINKEJ



8442

1,5:1



1,5:1

4WDGN  5V 2GVGTUDWTI CWH FKG ,CJTHGKGT FGU 5KGIGU ÒDGT 0CRQN¾QP  I $KVMKP    &CX 5GJTUGNVGPKPFKGUGT'TJCNVWPI2QNKGTVG2NCVVG 

8443

8444



4WDGN  5V 2GVGTUDWTI CWH FKG ,CJTHGKGT FGU 5KGIGU ÒDGT 0CRQN¾QP  I $KVMKP    &CX 8QT\ÒINKEJ





4WDGN  5V 2GVGTUDWTI CWH FKG ,CJTHGKGT FGU 5KGIGU ÒDGT 0CRQN¾QP  I $KVMKP    &CX *GPMGNURWTXQT\ÒINKEJ



8445



 90

8446

4WDGN5V2GVGTUDWTICWHFKG,CJTHGKGTFGT4QOCPQX&[PCUVKGI$KVMKP&CX 2TCEJVGZGORNCT*GTTNKEJG2CVKPCHCUV5VGORGNINCP\

'KPG-WRHGTRT·IWPIHÒT(KPPNCPF

-W2GPPK·*GNUKPMKHÒT(KPPNCPFI$KVMKP

8QT\ÒINKEJp5VGORGNINCP\

 


NIKOLAUS II.

8447

/GFCKNNGPFGU<CTGP0KMQNCWU++ 

6TCIDCTGUKNDGTPG6CRHGTMGKVUOGFCKNNG-NCUUGQ,WPUKIPKGTV$ÒUVGN&TGK<GKNGP5EJTKHVFC\YK UEJGP#DUEJPKVVUNKPKGWPF)TCXWT0QOOI&KCMQX 4  5GJTUEJÌP



8448



/GUUKPI5VGEMOGFCKNNG Q , 9GTMUVCVV .CWGT 0ÒTPDGTI $ÒUVG N)GMTÌPVGT &QRRGNCFNGT OKV <GRVGT   WPF4GKEJUCRHGNKPFGP(·PIGPCWHFGT$TWUV5V)GQTIUUEJKNFWOJGT1TFGPUMGVVGCWHFGP(NÒIGNPLG XKGTYGKVGTGMNGKPGTG9CRRGPUEJKNFGOOI+PJCNVZ/KPKCVWTIGNFCWUFGO,CJT \WWPF4WDGNWPF-QRGMGP-W-W-WWPF-W-QRGMG &KCMQXp2TG­NGTp 8QT\ÒINKEJ



8450

8449





8449

6TCIDCTG UKNDGTPG 8GTFKGPUVOGFCKNNG Q , WO   WPUKIPKGTV XQP # 8CU[WVKPUM[ WPF -NGPQX   (NGK­RT·OKG HÒT -CWHNGWVG #TDGKVGT $CWGTP 7PVGTQHHK\KGTG WPF -KTEJGPRHNGIGT FKG FGT 4GIKGTWPI   &KGPUVG GTDTCEJV JCVVGP -QRH N5EJTKHV PGDGP XGTUEJNWPIGPGP .QTDGGT 2CNO WPF 'KEJGP\YGKIGP   OOI&KCMQX 4  444CPFHGJNGTUGJTUEJÌPpXQT\ÒINKEJ



6TCIDCTGUKNDGTPG8GTFKGPUVOGFCKNNGQ, WO WPUKIPKGTV(NGK­RT·OKGHÒT-CWHNGWVG#TDGKVGT $CWGTP7PVGTQHHK\KGTGWPF-KTEJGPRHNGIGTFKGFGT4GIKGTWPI&KGPUVGGTDTCEJVJCVVGP-QRHN5EJTKHV PGDGP XGTUEJNWPIGPGP .QTDGGT 2CNO WPF 'KEJGP\YGKIGP  OO  I &KCMQX  4    (CUVXQT\ÒINKEJ

 91


NIKOLAUS II.

8451 1,5:1

1,5:1



6TCIDCTG IQNFGPG 8GTFKGPUVOGFCKNNG Q , WPUKIPKGTV HÒT FKG 4GVVWPI 'TVTKPMGPFGT -QRH N5EJTKHV   PGDGPXGTUEJNWPIGPGP.QTDGGT2CNOWPF'KEJGP\YGKIGPOOI&KCMQX 4   )1.&8QPITQ­GT5GNVGPJGKV9KP\-TCV\GTXQT\ÒINKEJ  /KV'ZRGTVKUGXQP+IQT5EJKT[CMQX5VCCVNKEJGU*KUVQTKUEJGU/WUGWO/QUMCW





&KGIQNFGPG8GTFKGPUVOGFCKNNGHÒTFKG4GVVWPI'TVTKPMGPFGTYWTFGHÒTFKG.GDGPUTGVVWPIPKEJVPWTDGK'TVTKPMGP UQPFGTPCWEJKPCPFGTGP'ZVTGOUKVWCVKQPGP (GWGT0CVWTMCVCUVTQRJGPGVE XGTNKGJGP

8452



5KNDGTOGFCKNNGXQP#8CU[WVKPUM[CWHFKG-TÌPWPIFGU<CTGPRCCTGU&KG-ÌRHGFGU<CTGPWPF UGKPGT )GOCJNKP #NGZCPFTC (GQFQTQYPC PGDGPGKPCPFGT N)GMTÌPVGT &QRRGNCFNGT OKV <GRVGT WPF   4GKEJUCRHGNKPFGP(·PIGPCWHFGT$TWUV5V)GQTIUUEJKNFWOJGTFKG-GVVGFGU#PFTGCUQTFGPUCWHFGP (NÒIGNPLGXKGTYGKVGTG9CRRGPUEJKNFGQDGP-TQPGOOI&KCMQX 4   44(CUVXQT\ÒINKEJ &KG<CTKP#NGZCPFTC(GQFQTQYPCYWTFGCO#RTKNKP&CTOUVCFVCNU2TKP\GUUKP#NKZXQP*GUUGP&CTOUVCFV IGDQTGP#NKZYCTFKG6QEJVGTXQP)TQ­JGT\QI.WFYKI+8XQP*GUUGP&CTOUVCFVWPFUGKPGT)GOCJNKP2TKP\GUUKP #NKEG XQP )TQ­DTKVCPPKGP WPF +TNCPF FGT \YGKV·NVGUVGP 6QEJVGT XQP -ÌPKIKP 8KEVQTKC #O  0QXGODGT    JGKTCVGVGUKG0KMQNCWU++KPFGT'TGOKVCIGKP5CPMV2GVGTUDWTI&KG*QEJ\GKVYCTMGKPG8GTDKPFWPICWHRQNKVKUEJGT 'DGPG UQPFGTP GKPG TGKPG .KGDGUJGKTCV WPF DTCEJVG XKGT 6ÌEJVGT WPF GKPGP 5QJP JGTXQT #NKZ VTCV \WT TWUUKUEJ   QTVJQFQZGP-KTEJGÒDGTWPFYWTFG)TQ­HÒTUVKP#NGZCPFTC(GQFQTQYPC&GTLWPIG<CTICDUGKPGT$TCWVCNNG<GKVFGT 9GNV WPF UVGNNVG KJT GKPGP QTVJQFQZGP 2TKGUVGT \WT 5GKVG FGT UKG KP FKG .GJTGP FGU )NCWDGPU GKPYKGU WPF FGUUGP   <WURTCEJG KJT FGP ªDGTICPI XQO GXCPIGNKUEJGP \WO QTVJQFQZGP )NCWDGP GTNGKEJVGTVG &GT #WUDTWEJ FGU    9GNVMTKGIGU YCT GKP GPVUEJGKFGPFGT /QOGPV HÒT 4W­NCPF WPF #NGZCPFTC 4W­NCPF YCPFVG UKEJ IGIGP &GWVUEJ   NCPF KJTGO *GTMWPHVUNCPF YQ KJT $TWFGT )TQ­JGT\QI XQP *GUUGP WPF KJT %QWUKP -CKUGT 9KNJGNO ++ YCT &KG   <CTKP YWTFG PQEJ WPDGNKGDVGT DGKO TWUUKUEJGP 8QNM WPF IGTKGV KOOGT OGJT KP FGP (QMWU XQP )GTÒEJVGP OCP   DGUEJWNFKIVG UKG UQICT FGT <WUCOOGPCTDGKV OKV &GWVUEJNCPF &GPPQEJ WPVGTUVÒV\VG FGT <CT UGKPG IGNKGDVG (TCW   IGIGP CNNG 8QTYÒTHG KPPGT WPF CW­GTJCND FGT (COKNKG +P FGT (GDTWCTTGXQNWVKQP YWTFG FGT <CT \WT #DFCPMWPI   IG\YWPIGP1DYQJN-ÌPKI)GQTI8FGT%QWUKPXQP#NGZCPFTCWPF0KMQNCWUYCTYGKIGTVGGTUKEJFKG<CTGPHCOK NKG PCEJ 'PINCPF \W GXCMWKGTGP FC GT #WUYKTMWPIGPCWHUGKPGPGKIGPGP6JTQPDGHÒTEJVGVG&KGXQTN·WHKIG4GIKG TWPIUVGNNVGFKG<CTGPHCOKNKGKO#NGZCPFGTRCNCUVWPVGT*CWUCTTGUVDKUUKGKO#WIWUVPCEJ6QDQNUMKP5KDKTKGP CDVTCPURQTVKGTV YWTFG CPIGDNKEJ WO UKG XQP ITÌ­GTGP )GHCJTGP HGTP\WJCNVGP 0CEJ FGT 1MVQDGTTGXQNWVKQP LGFQEJ   YWTFGUKGKPFCUXQP$QNUEJGYKMGPMQPVTQNNKGTVG,GMCVGTKPDWTIIGDTCEJV&QTVYWTFGPFKGIGUCOVG(COKNKGWPFKJTG $GFKGPUVGVGPPCEJOGJTOQPCVKIGT)GHCPIGPUEJCHVKPFGT0CEJV\WO,WNKKPGKPGO-GNNGTGTUEJQUUGP&KG .GKEJGPFGT<CTGPHCOKNKGYWTFGPKPGKPGOWPIGPWV\VGP/KPGPUEJCEJVPÌTFNKEJXQP,GMCVGTKPDWTIXGTITCDGPDKUUKG KPFGPHTÒJGPGTPGZJWOKGTVWPFKFGPVKHK\KGTVYWTFGP+O,CJTYWTFGP#NGZCPFTC0KMQNCWUWPFKJTG-KPFGT

CW­GT/CTKCWPF#NGZGLFGTGP8GTDNGKDDKUJGTWPIGMN·TVKUV PCEJ5V2GVGTUDWTIÒDGTHÒJTVYQUKGOKVGKPGTITQ­GP <GTGOQPKGKPFGT(COKNKGPITWHVFGT4QOCPQYUKPFGT2GVGTWPF2CWN-CVJGFTCNGDGKIGUGV\VYWTFGPYWTFGFKG <CTGPHCOKNKGXQPFGT4WUUKUEJ1TVJQFQZGP-KTEJGJGKNKIIGURTQEJGP

92




NIKOLAUS II.

8453



6TCIDCTG5KNDGTOGFCKNNGOKV5KIPCVWT91CWHFGP$GUWEJFGUHTCP\ÌUKUEJGP2T·UKFGPVGP(¾NKZ (CWT¾KP4W­NCPF$TWUVDKNFFGU2T·UKFGPVGPN\YKUEJGP.QTDGGTWPF2CNO\YGKIÒDGT5EJTKHVDCPFWPF -CTVWUEJG9GKDNKEJG )GUVCNV KP TWUUKUEJGT 6TCEJV J·NV GKP 6CDNGVV OKV GKPGO 9KNNMQOOGPUIGUEJGPM   N FKG TWUUKUEJG WPF FKGHTCP\ÌUKUEJG(CJPGKO*KPVGTITWPF5VCFVCPUKEJV/KV2WP\GPCWHFGT4ÒEM UGKVG$WPFOOI&KCMQXp 5GJTUEJÌP



8454





$TQP\GOGFCKNNG  XQP # )TKNKEJGU LT CWH FCU PGWGTTKEJVGVG &GPMOCN #NGZCPFGTU ++ GTDCWV    -QRH #NGZCPFGTU ++ N#PUKEJV FGU&GPMOCNUOOI&KCMQX 4  (CUVXQT\ÒINKEJ



$TQP\GOGFCKNNG  XQP # )TKNKEJGU LT CWH FCU PGWGTTKEJVGVG &GPMOCN #NGZCPFGTU ++ GTDCWV    -QRH #NGZCPFGTU ++ N#PUKEJV FGU&GPMOCNUOOI&KCMQX 4  (CUVXQT\ÒINKEJ



8456 1:1,3



4GEJVGEMKIG $TQP\GRNCMGVVG  XQP 6 5\KTOCN CWH FKG  (TKGFGPUMQPHGTGP\ KP &GP *CCI   'PIGN OKV CWUIGDTGKVGVGP (NÒIGNP -TCP\ WPF 2QUCWPG UVGJV X X \W FGP 5GKVGP /GFCKNNQPU OKV FGP   $TWUVDKNFGTP XQP 0KMQNCWU ++ D\Y FGT PKGFGTN·PFKUEJGP -ÌPKIKP 9KNJGNOKPC GKPCPFGT IGIGPÒDGT   )GMTÌPVG YGKDNKEJG )GUVCNV UKV\V PCEJ T \W KJTGP (Ò­GP 5EJKNF FCXQT 5EJTKHVVCHGN OKV .# Û *#;'     FCTÒDGT XKGT <GKNGP 5EJTKHV UQYKG GKPG /GFCKNNQP OKV FGO IGMTÌPVGP TWUUKUEJGP &QRRGNCFNGT   ZOOI&KCMQX 4  44+P1TKIKPCNGVWK8QT\ÒINKEJp5VGORGNINCP\

 93


SOWJETUNION

8458

8457





5KNDGTOGFCKNNGWPUKIPKGTVXQP)/CN[UJGX9GTMUVCVV#,CMCT'JTGPOGFCKNNGHÒTFCUDGNIKUEJG 8QNM &GT DGNIKUEJG .ÌYG \GTVTCORGNV GKPG FGWVUEJG (CJPG N 5EJKNF OKV FGT +PUEJTKHV . 70+10    (#+6  .#  (14%',G HÒPH <GKNGP KP HTCP\ÌUKUEJGT WPF TWUUKUEJGT 5EJTKHV  OO  I   &KCMQX 4  8QT\ÒINKEJ



5KNDGTOGFCKNNGWPUKIPKGTVXQP)/CN[UJGX9GTMUVCVV#,CMCTCWHFKG8GTDWPFGPJGKVXQP4W­ NCPFWPF2QNGPKO-CORHIGIGPFKG&GWVUEJGP4WUUKUEJGT5QNFCVUVGJVXXWPFNGIVGKPGOPGDGPKJO UKV\GPFGPRQNPKUEJGP5QNFCVGPFKG*CPFCWHFKG5EJWNVGT6CHGNOKVXKGT<GKNGP5EJTKHVQDGPTWUUKUEJGT &QRRGNCFNGTWPVGPFGTRQNPKUEJG#FNGTOOI&KCMQX 4   9KP\4CPFHGJNGTUGJTUEJÌPpXQT\ÒINKEJ



8459 1,5:1

1,5:1

4755+5%*'+/+6#6+10'0 0+'&'4.0&+5%*'44+66'4&7-#6'0 

&WMCV5V2GVGTUDWTII+OKVCVKQPGKPGUPKGFGTN·PFKUEJGP4KVVGTFWMCVGP$KVMKP(D 5EJNp )1.&9KP\4CPFHGJNGTXQT\ÒINKEJ

8460 1,5:1



1,5:1

&WMCV5V2GVGTUDWTII+OKVCVKQPGKPGUPKGFGTN·PFKUEJGP4KVVGTFWMCVGP$KVMKP(D 5EJNp )1.&2TCEJVGZGORNCT(CUV5VGORGNINCP\

8461





8461 1,5:1

519,'670+10  94

4WDGN.GPKPITCFI&CX  4*ÒDUEJG2CVKPCXQT\ÒINKEJp5VGORGNINCP\CWURQNKGTVGT2NCVVG




SOWJETUNION

8462

8463



-QRGMGP.GPKPITCFI;GQ



4WDGN.GPKPITCFI&CX

8463

<CRQPKGTVRQNKGTVG2NCVVGNGKEJVDGTKGDGP



*GTTNKEJG2CVKPCXQT\Ã&#x2019;INKEJp5VGORGNINCP\



8465

8464



-W-QRGMGP/KVINCVVGO4CPFI;GQ

48QT\Ã&#x2019;INKEJ





-W-QRGMGP/KVINCVVGO4CPFI;GQ

48QT\Ã&#x2019;INKEJ



48QT\Ã&#x2019;INKEJ



448QT\Ã&#x2019;INKEJ



8467

8466



-W-QRGMGP/KVINCVVGO4CPFI;GQ



-QRGMGPI;GQ#

8468 Pt

8469 Pt

8470 Pt

8471 Pt



4WDGN2NCVKP.GPKPITCF1N[ORKCFGKP/QUMCW&KUMWUYGTHGTIHGKP(D 5EJN 2.#6+02QNKGTVG2NCVVG





 4WDGN 2NCVKP  .GPKPITCF 1N[ORKCFG KP /QUMCW   #PVKMG 4KPIM·ORHGT  I HGKP   (D5EJN 2.#6+02QNKGTVG2NCVVG





 4WDGN 2NCVKP  .GPKPITCF 1N[ORKCFG KP /QUMCW   #NVQN[ORKUEJGU 9CIGPTGPPGP   IHGKP(D5EJN 2.#6+02QNKGTVG2NCVVG





 4WDGN 2NCVKP  .GPKPITCF 1N[ORKCFG KP /QUMCW   .·WHGT FGT #PVKMG  I HGKP   (D5EJN 2.#6+02QNKGTVG2NCVVG

 95


SOWJETUNION

8472



$TQP\GOGFCKNNG  XQP / /CPKUGT CWH FKG IGRNCPVG /QFGTPKUKGTWPI FGU#ITCTYGUGPUFWTEJ9NC FKOKT +NLKVUEJ .GPKP .GPKP KO )GURT·EJ OKV \YGK .CPFYKTVGP$CWGT OKV 2HGTF WPF 2HNWI DNKEMV CWH   GKPGP#EMGTOKVHÒPH6TCMVQTGPOOI 8QT\ÒINKEJ



ex 8473



5GVXQP5KNDGTOGFCKNNGPQ,  WPUKIPKGTVCWHFGP)GDWTVUVCIFGUTWUUKUEJGP5VCCVUITÒPFGTU 9NCFKOKT +NLKVUEJ .GPKP  5KODKTUMÓ)QTMKLDGK/QUMCW$TWUVDKNF.GPKPUJCNDN9CRRGP \YKUEJGP IGDÒPFGNVGP JTGP WPVGP 6CHGN OKV \YGK <GKNGP 5EJTKHV 8KGT XGTUEJKGFGPG )TÌ­GP    OOIOOIOOIOOI  5VÒEM/KV<GTVKHKMCV2QNKGTVG2NCVVG

8474



8475



)QNFOGFCKNNG\W&WMCVGPQ,OKV5KIPCVWT)8CWUIGIGDGPXQPFGT0WOKUOCVKEC+VCNKCPC/CKNCPF CWH ,QUGH 5VCNKP $ÒUVG 5VCNKPU X X<YGK IGMTGW\VG #TOG OKV 5EJYGTVGTP FCJKPVGT 'ZRNQUKQP WPVGP   \YGKKPGKPCPFGTITGKHGPFG*·PFGFCTÒDGT$QIGPFGTOKVCEJV(NCIIGPDGUVGEMVKUVOOI )1.&+P'VWKFGT0WOKUOCVKEC+VCNKCPC2QNKGTVG2NCVVG



)QNFOGFCKNNG \W  &WMCVGP  XQP + 2QUVQN CWH #RQNNQ5QLWU GTUVGT UQYLGVKUEJCOGTKMCPKUEJGT   4CWOHNWI )NQDWU WPF 5VGTPG4CWOMCRUGN /KV GKPIGRWP\VGT 5GTKGPPT   OO   I$WVVQP-CKUGTp )1.&5VGORGNINCP\  #O,WNKUVCTVGVGPKPGKPGO#DUVCPFXQP5VWPFGPGKP5QLWUWPFGKP#RQNNQ4CWOUEJKHHOKV-QRRNWPIU OQFWN\WGKPGOUQYLGVKUEJCOGTKMCPKUEJGP6TGHHGPKO'TFQTDKV&KGUYCTFGTNGV\VG5VCTVGKPGU#RQNNQ4CWOUEJKHHU WPF GKPGT 5CVWTP84CMGVG KP FGT )GUEJKEJVG FGT 4CWOHCJTV WPF FKG GTUVG WPF HÒT NCPIG <GKV GKP\KIG -QRRNWPI   \YGKGT 4CWOHCJT\GWIG FGT DGKFGP WPVGTUEJKGFNKEJGP 0CVKQPGP #P $QTF FGT \WGTUV UVCTVGPFGP 5QLWU  YCTGP FKG   -QUOQPCWVGP #NGZGK .GQPQY WPF 9CNGTK -WDCUQY CP $QTF FGT PCEJHQNIGPFGP #RQNNQ  YCTGP FKG #UVTQPCWVGP   6QO5VCHHQTF&QPCNF5NC[VQPWPF8CPEG$TCPF#O,WNKHCPFFCPPFKG-QRRNWPIFGTDGKFGP4CWOUEJKHHGUVCVV +P FGP FTGK HQNIGPFGP 6CIGP MQPPVGP XKGNG YKUUGPUEJCHVNKEJG \WO 6GKN IGOGKPUCOG 'ZRGTKOGPVG FWTEJIGHÒJTV   YGTFGP&KG4ÒEMMGJTXQP5QLWUGTHQNIVGCO,WNKFKGXQP#RQNNQCO,WNK&KGUG/KUUKQPYWTFGGKPXQNNGT 'THQNIWPF\GKIVGGTUVOCNUFC­GKPG<WUCOOGPCTDGKVFGTDKUNCPICWUUEJNKG­NKEJMQPMWTTKGTGPFGP0CVKQPGPOÌINKEJ YCT 5KG YCT UQOKV 9GIDGTGKVGT FGT \YCP\KI ,CJTG UR·VGTHQNIGPFGP5JWVVNG/KT/KUUKQPGPWPFHÒTFKGKPVGTPCVKQ PCNG4CWOUVCVKQP

96




RUSSISCHE REPUBLIK

8476

8477

8477

4755+5%*'4'27$.+-5'+6 

4WDGN/QUMCW$·TKPOKV,WPIGPI(GKPIQNF(D5EJN  )1.&40WT'ZGORNCTGIGRT·IV2QNKGTVG2NCVVG





4WDGN/QUMCW4WUUKUEJGU$CNNGVVI(GKPUKNDGT;GQ  +P1TKIKPCNGVWK2QNKGTVG2NCVVG



8478

8479

8479



4WDGN/QUMCW<YGK<QDGNI(GKPIQNF(D5EJN  )1.&42QNKGTVG2NCVVGOKPDGTÃ&#x2019;JTV



4WDGN/QUMCW6KGTYGNV.WEJUI(GKPUKNDGT;GQ



2QNKGTVG2NCVVG



2QNKGTVG2NCVVG



8480



4WDGN/QUMCW0QTFRQNI(GKPUKNDGT;GQ

97


RUSSISCHE REPUBLIK

8481



 4WDGN  /QUMCW #OWT 6KIGT  I (GKPIQNF +P 752NCUVKMJQNFGT FGT 0)% OKV FGT $G   YGTVWPI2(7.64#%#/'1(D  )1.&40WT'ZGORNCTGIGRT·IV2QNKGTVG2NCVVG 

8482



4WDGN5V2GVGTUDWTI-TKGIUUEJKHH2QNVCXCI(GKPUKNDGT;GQ  0WT'ZGORNCTGIGRT·IV+P1TKIKPCNGVWK2QNKGTVG2NCVVG



8483

8484

8484



4WDGN5V2GVGTUDWTI/QUMCWGT5VCFVYCRRGPI(GKPIQNF(D  )1.&+P1TKIKPCNGVWK2QNKGTVG2NCVVG





4WDGN5V2GVGTUDWTI#TVGPUEJWV\I(GKPUKNDGT;GQ



98

2QNKGTVG2NCVVG


LOTS

8485

8486

8487

8488



4WDGN/QUMCW)GDWTVUVCIXQP#NGZCPFGT2WUEJMKPI(GKPIQNF(D  )1.&0WT'ZGORNCTGIGRT·IV+P1TKIKPCNGVWK2QNKGTVG2NCVVG





4WDGN/QUMCW,CJTGUVCIFGT4WUUKUEJGP#MCFGOKGFGT9KUUGPUEJCHVGPI(GKPIQNF ;GQ 0WT'ZGORNCTGIGRT·IV2QNKGTVG2NCVVG





4WDGN/QUMCW,CJTGUVCIFGT#WHPCJOGFKRNQOCVKUEJGT$G\KGJWPIGPOKVFGT8QNMUTGRWDNKM %JKPCI(GKPUKNDGT;GQ 0WT'ZGORNCTGIGRT·IV2QNKGTVG2NCVVG





4WDGN/QUMCW5EJPGGNGQRCTFI(GKPIQNF(D  )1.&0WT'ZGORNCTGIGRT·IV2QNKGTVG2NCVVG



8489

8490



4WDGN5V2GVGTUDWTI'KUJQEMG[9GNVOGKUVGTUEJCHVI(GKPUKNDGT;GQ  0WT'ZGORNCTGIGRT·IV2QNKGTVG2NCVVG





4WDGN/QUMCW(W­DCNN'WTQRCOGKUVGTUEJCHVI(GKPUKNDGT;GQ  0WT'ZGORNCTGIGRT·IV2QNKGTVG2NCVVGOKPDGTÒJTV



.16570&5#//.70)'04755+5%*'4/ª0<'070&/'&#+..'0 

-CVJCTKPC++4WDGN Z 5VÒEM(CUVUGJTUEJÌPWPFUGJTUEJÌP





#NGZCPFGT+8GTUKNDGTVGT$TQP\GLGVQPXQP,65VGVVPGTCWHFKG8ÌNMGTUEJNCEJVDGK .GKR\KIOOI&KCMQX8GTUKNDGTVGT$TQP\GLGVQPXQP,65VGVVPGTCWHFGP'KP \WIFGT#NNKKGTVGPKP2CTKUOOI&KCMQX&C\W2CWN+XGTUKNDGTVGT$TQP\GLGVQP WPUKIPKGTVCWHFGPTWUUKUEJGP(GNFOCTUEJCNN#NGZCPFGT8CUKNKGYKVUEJ5WXQTQXWPFUGKPG5KGIGKP +VCNKGPOOI&KCMQX 5VÒEM8QT\ÒINKEJp5VGORGNINCP\





0KMQNCWU +   4WDGN  <NQV[EJ      CNNG /ÒP\UV·VVG 9CTUEJCW   HÒT2QNGP$KVMKP 5VÒEM(CUVUGJTUEJÌPWPFUGJTUEJÌP





0KMQNCWU++4WDGN4WDGN$GKFG/ÒP\UV·VVG5V2GVGTUDWTI$KVMKP (D   5EJN   &C\W 5QYLGVWPKQP   4WDGN 6UEJGTYQPG\     (DC5EJN+PUIGUCOVI(GKPIQNF 5VÒEM)1.&5GJTUEJÌPpXQT\ÒINKEJ



#NNIGOGKP-NGKPG5COONWPITWUUKUEJGT/ÒP\GPFGU,CJTJWPFGTVUXQPFGT-W-QRGMGDKU\WO 4WDGN Z  FCTWPVGT DGUUGTG 5VÒEMG \ $ 4WDGN        ,CJTG   4QOCPQX  5VÒEM(CUVUGJTUEJÌPpXQT\ÒINKEJ





99


LOTS 

4WDGN Z CNNG/ÒP\UV·VVG5V2GVGTUDWTI4WDGN <NQV[EJ   9CTUEJCW  4WDGN 2QNVKPC   5V 2GVGTUDWTI -W -QRGMGP  'MCVGTKPDWTI   -W-QRGMGP5V2GVGTUDWTI ªDGTRT·IWPIUURWTGP &C\W5KNDGTOGFCKNNGWPUKIPKGTVXQP 58CU[WVKPUM[WPF52QIQPQXCWHFKG-TÌPWPIXQP0KMQNCWU++ 5VÒEM5EJÌPpUGJTUEJÌP





#NGZCPFGT ++ -W -QRGMGP  'MCVGTKPDWTI 0KMQNCWU +  -QRGMGP  5V 2GVGTUDWTI   &C\W2QNGP5KIKUOWPF+++)TQUEJGP 5VÒEM5GJTUEJÌPWPFUGJTUEJÌPpXQT\ÒINKEJ





&KXGTUG TWUUKUEJG /ÒP\GP FGU  ,CJTJWPFGTVU W C 4WDGN    Z       Z &C\W/GFCKNNGP 1XCNG<KPPOGFCKNNGUR·VGTG2T·IWPIFGU,CJT JWPFGTVUCWHFKG*GTTUEJCHV2GVGT+ÒDGTXKGT/GGTG<KPPOGFCKNNGQ,CWHFKG'TQDGTWPIXQP0CTXC $TQP\GOGFCKNNGQ,CWHFKG%JTKUVKCPKUKGTWPIXQP5XCVQUNCXFWTEJUGKPG/WVVGT +PVGTGUUCPVGU.QVDKVVG DGUKEJVKIGP 5VÒEM/GKUVUGJTUEJÌP 



2GVGT +  5QPPGPTWDGN  $KVMKP  *GPMGNURWT UEJÌP  &C\W FKXGTUG -NGKPOÒP\GP   FGU <GKVTCWOGU  W C -W -QRGMGP  4CPF INCVV  GVE +PVGTGUUCPVGU .QV   DKVVGDGUKEJVKIGP 5VÒEM*GPMGNURWT Z UEJÌPpUGJTUEJÌP



-NGKPG5COONWPIXQP/ÒP\GPFGU<GKVTCWOGUXQP-QRGMGPDKU\WO4WDGNWC4WDGN  -TÌPWPI  4 

4QOCPQX   4WDGN         GVE *QEJKPVGTGUUCPVGU .QV   DKVVGDGUKEJVKIGP 5VÒEM(CUVUGJTUEJÌPpXQT\ÒINKEJ 



4WDGN    -QRGMGP&C\W(KFUEJK&QNNCTU75#XGTIQNFGVG5KNDGT OGFCKNNGQ,CWH#DTCJCO.KPEQNP 5VÒEM5GJTUEJÌPpRQNKGTVG2NCVVG





5COONWPI XQP  XGTUEJKGFGPGP/ÒP\UGVU\WWPF4WDGN5KNDGTOÒP\GPFGT,CJTGCWH FKG::++1N[ORKUEJGP5RKGNGKP/QUMCW KPUIGUCOVZ4WDGNWPFZ4WDGN   5GVU5·OVNKEJG5VÒEMGKPFGPTQVGP1TKIKPCNUEJCVWNNGP2QNKGTVG2NCVVG





-NGKPGU.QVXQP-WRHGTOÒP\GPFGU,CJTJWPFGTVUXQO2QNWRQNVKPPKMDKU\W-QRGMGP  5VÒEM5GJTUEJÌP





&KXGTUG/ÒP\GPFGU,CJTJWPFGTVUXQPFGT6TQRHMQRGMGDKU\WO4WDGN&C\WGKP&/5VÒEM FGT$4&+PVGTGUUCPVGU.QVDKVVGDGUKEJVKIGP 5VÒEM/GKUVUGJTUEJÌP



4WDGN   -QRGMGP  +P 752NCUVKMJQNFGT FGT 0)%# OKV FGT $GYGTVWPI /5     -W -QRGMGP  ªDGTRT·IWPIUURWTGP  -W -QRGMGP  -W -QRGMGP  -W&GPIC   &C\W$TQP\GOGFCKNNG UR·VGTG2T·IWPI XQP6+YCPQHHCWHFKG'KPPCJOGXQP0CTXC  5VÒEM6GKNYGKUGOKV(GJNGTPOGKUVUGJTUEJÌPpXQT\ÒINKEJ



#NGZCPFGT++4WDGN 2QNVKPC 5V2GVGTUDWTI#NGZCPFGT+++-QRGMGPDGKFG/ÒP\ UV·VVG5V2GVGTUDWTI 5VÒEM5GJTUEJÌPpXQT\ÒINKEJ









8507

8508

8508

-4+/ 

5JCNKO )KTC[  -W-[TOKU  -QRGMGP    4GIKGTWPIULCJT  $CEJVUEJKUCTCK   I$KVMKP 4 &KCMQXXCT 4  4.GKEJVMQTTQFKGTVUGJTUEJÌP





-W6UEJCN -QRGMGP  4GIKGTWPIULCJT -CHHCI$KVMKP 4 &KCMQX 4  4.GKEJVMQTTQFKGTVUGJTUEJÌP



100


SONSTIGE OBJEKTE

8509 (stark verkleinert)

/ª0<5%*/7%- 

5KNDGTPG*CNUMGVVGOKVTWUUKUEJGP4WDGNPXQP#NGZCPFGT+WPF0KMQNCWU+KPHQNIGPFGT4GKJGPHQNIG         !!    !      UQYKGGKPGT)GOGKPFGXQTUVGJGTOGFCKNNG 5VÒEM5EJÌPpUGJTUEJÌP



&KGUGT(TCWGPUEJOWEM/QPKUVCYCTUGJTRQRWN·TDGKFGP6WTMXÌNMGTP&GP5EJOWEMJCDGP(TCWGPCNNGT#NVGTU MNCUUGPIGVTCIGP&WTEJFKG/GPIGFGT/ÒP\GPJCDGPUKGKJTGP4GKEJVWOIG\GKIV

8511

8510 1:3

51056+)'1$,'-6' 



5KNDGTPGT /ÒP\DGEJGT IGHGTVKIV WO  +O -QTRWU FGU $GEJGTU UKPF XKGT TWUUKUEJG 4WDGN FGU    ,CJTJWPFGTVU GKPIGNCUUGP 4WDGN KO$QFGPFGU$GEJGTUDGHKPFGVUKEJGKP 4WDGN  &GT (W­ FGU $GEJGTU KUV OKV \GJP TWUUKUEJGP -QRGMGP5VÒEMGP XGT\KGTV FCTÒDGT FKG   )TCXWT 0CUFCTQXLG FCTWPVGT FKG *GTUVGNNGTRWP\G WPF FGT (GKPIGJCNVUUVGORGN *ÌJG EC  EO   &WTEJOGUUGTECEO)GYKEJVI 8QT\ÒINKEJG#TDGKV



5KNDGTPG/ÒP\FQUGHÒTWPF-QRGMGPUVÒEMGIGHGTVKIVWO-QTRWUCWU\YGKOKVGKPCP FGTXGTDWPFGPGP\[NKPFTKUEJGP$GJ·NVGTPCPFTGK5GKVGPHGFGTPFIGNCIGTVG¤HHPWPIGP\WT#WHPCJOGFGT -QRGMGPUVÒEMG/KV*GTUVGNNGTWPF(GKPIGJCNVURWP\G$- -QRH ZOOI+PJCNV Z-QRGMGPUQYKGZ-QRGMGP 5GJTUEJÌPG#TDGKV

 101


&'765%*'/ª0<'0#$ &KG0WOOGTPKPFGT\YGKVGP5RCNVGDG\KGJGPUKEJCWHFGP ,CGIGT-CVCNQI&KG&GWVUEJGP/ÒP\GPUGKV#WHNCIG DGKWPUGTJ·NVNKEJHÒT'74 4'+%*5-.'+0/ª0<'0

,CGIGT



 

2HGPPKI, 5GJTUEJÌP



 

/CTM& 445GJTUEJÌP



 

/CTM& 44(CUVUGJTUEJÌP



1,5:1

,CGIGT  

 

 

  102

 /CTM' 5GNVGPDGUQPFGTUKPFKGUGT 'TJCNVWPI 8QT\ÒINKEJp5VGORGNINCP\



/CTM) (CUV5VGORGNINCP\



2HGPPKI, 2TCEJVGZGORNCT (CUV5VGORGNINCP\

2HGPPKI) 45GJTUEJÌP

1,5:1



  

/CTM& 2TCEJVGZGORNCT (CUV5VGORGNINCP\




4'+%*55+.$'4/ª0<'0 #0*#.6

,CGIGT  

,CGIGT  

 

 

 (TKGFTKEJ++ /CTM 9KP\-TCV\GTRQNKGTVG2NCVVG



 

/CTM(CUV5VGORGNINCP\



 

/CTM(CUV5VGORGNINCP\



 

/CTM 8QT\ÒINKEJCWURQNKGTVGT2NCVVG



 (TKGFTKEJ+ /CTM8QT\ÒINKEJ

/CTM8QT\ÒINKEJ

/CTM (GKPG2CVKPCXQT\ÒINKEJ







$#&'0

 

 

/CTM .GKEJVDGTKGDGPXQT\ÒINKEJ

/CTM(CUVXQT\ÒINKEJ





 

(TKGFTKEJ+ /CTM445EJÌPpUGJTUEJÌP



 

/CTM445GJTUEJÌP

 103


,CGIGT  

 /CTM8QT\ÒINKEJ



 

/CTM(CUVXQT\ÒINKEJ



 

 

 

104

/CTM(CUVXQT\ÒINKEJ

/CTM 4GIKGTWPIULWDKN·WO 8QT\ÒINKEJp5VGORGNINCP\

/CTM 4GIKGTWPIULWDKN·WO 8QT\ÒINKEJp5VGORGNINCP\

,CGIGT  

 /CTM8QT\ÒINKEJ



 

/CTM)QNFGPG*QEJ\GKV 8QT\ÒINKEJp5VGORGNINCP\



 

/CTM)QNFGPG*QEJ\GKV 8QT\ÒINKEJp5VGORGNINCP\



 

/CTMOKV.GDGPUFCVGP 8QT\ÒINKEJ



 

(TKGFTKEJ++ /CTM5GJTUEJÌP










,CGIGT ,CGIGT  

/CTM 5GJTUEJÌPpXQT\ÒINKEJ

 

/CTM2TCEJVGZGORNCT (CUV5VGORGNINCP\

 

/CTM *ÒDUEJG2CVKPC UGJTUEJÌPpXQT\ÒINKEJ



 

/CTM5GJTUEJÌP



 

/CTM&(GKPG2CVKPC RQNKGTVG2NCVVGOKPDGTKGDGP



 /CTM&C\W, *CODWTI/CTM5VÒEM 9KP\4CPFHGJNGT Z XQT\ÒINKEJ



 





$#;'40



1,5:1

 

.WFYKI++ /CTM 5GNVGPKPFKGUGT'TJCNVWPI 2TCEJVGZGORNCT (CUV5VGORGNINCP\



 

/CTM 8QT\ÒINKEJp5VGORGNINCP\



 

1VVQ++ /CTM(CUV5VGORGNINCP\



105


,CGIGT ,CGIGT  

 /CTM(CUV5VGORGNINCP\

 

.WFYKI+++ /CTM 8QT\Ã&#x2019;INKEJp5VGORGNINCP\

 

 /CTM1JPG.Ã&#x2019;PGDWTI 4GIKGTWPIUCPVTKVV 48QT\Ã&#x2019;INKEJ



/CTM1JPG.Ã&#x2019;PGDWTI 4GIKGTWPIUCPVTKVV 42CVKPCXQT\Ã&#x2019;INKEJ



/CTM1JPG.Ã&#x2019;PGDWTI 4GIKGTWPIUCPVTKVV 48QT\Ã&#x2019;INKEJp5VGORGNINCP\



 

/CTM1JPG.Ã&#x2019;PGDWTI 4GIKGTWPIUCPVTKVV48QT\Ã&#x2019;INKEJ



 

/CTM1JPG.Ã&#x2019;PGDWTI 4GIKGTWPIUCPVTKVV48QT\Ã&#x2019;INKEJ





  

$4#705%*9'+)

 

1,5:1

 

 

106

'TPUV#WIWUV /CTM1JPG.Ã&#x2019;PGDWTI 4GIKGTWPIUCPVTKVV 48QT\Ã&#x2019;INKEJ



/CTM1JPG.Ã&#x2019;PGDWTI 4GIKGTWPIUCPVTKVV 49KP\4CPFHGJNGTXQT\Ã&#x2019;INKEJ




,CGIGT  

 

 /CTM1JPG.Ã&#x2019;PGDWTI 4GIKGTWPIUCPVTKVV 49KP\4CPFHGJNGTXQT\Ã&#x2019;INKEJ

/CTM1JPG.Ã&#x2019;PGDWTI 4GIKGTWPIUCPVTKVV 4(GKPG2CVKPCXQT\Ã&#x2019;INKEJ

,CGIGT 

 

 /CTM/KV.Ã&#x2019;PGDWTI 4GIKGTWPIUCPVTKVV 9KP\4CPFHGJNGT XQT\Ã&#x2019;INKEJp5VGORGNINCP\



/CTM/KV.Ã&#x2019;PGDWTI 4GIKGTWPIUCPVTKVV 8QT\Ã&#x2019;INKEJ



  

$4'/'0

 

/CTM/KV.Ã&#x2019;PGDWTI 4GIKGTWPIUCPVTKVV (CUV5VGORGNINCP\



   

/CTM/KV.Ã&#x2019;PGDWTI 4GIKGTWPIUCPVTKVV8QT\Ã&#x2019;INKEJ



 

/CTM/KV.Ã&#x2019;PGDWTI 4GIKGTWPIUCPVTKVV 2TCEJVGZGORNCT (CUV5VGORGNINCP\



 

(TGKGWPF*CPUGUVCFV /CTM9KP\-TCV\GT RQNKGTVG2NCVVG



/CTM 8QT\Ã&#x2019;INKEJp5VGORGNINCP\

 107


*#/$74)

,CGIGT ,CGIGT  

 

 

/CTM(CUV5VGORGNINCP\



 

/CTM8QT\ÒINKEJ



 (TGKGWPF*CPUGUVCFV /CTM9KP\4CPFHGJNGT XQT\ÒINKEJ

/CTM 8QT\ÒINKEJp5VGORGNINCP\



*'55'0



   

/CTM(GKPG2CVKPC MN-TCV\GTKO(GNFFGT 8QTFGTUGKVGXQT\ÒINKEJ



 

/CTM2QNKGTVG2NCVVG



 

/CTM 5GNVGPGT,CJTICPI8QT\ÒINKEJ



108



.WFYKI+++ /CTM ªDGTFWTEJUEJPKVVNKEJGTJCNVGP 5GJTUEJÌPpXQT\ÒINKEJ



 

.WFYKI+8 /CTM4(CUVXQT\ÒINKEJGU 'ZGORNCTOKVHGKPGT6ÌPWPI 

 

/CTM4(CUVUGJTUEJÌP




,CGIGT  

 /CTM 9KP\4CPFHGJNGTUGJTUEJÌP

 ,CGIGT  

 

/CTM5GJTUEJÌP

 

'TPUV.WFYKI /CTM9KP\-TCV\GT XQT\ÒINKEJp5VGORGNINCP\

 

/CTM5GJTUEJÌP

 /CTM 5GJTUGNVGPKPFKGUGT'TJCNVWPI (CUV5VGORGNINCP\







 

/CTM$GUUGTGT,CJTICPI (GKPG2CVKPCUGJTUEJÌPpXQT\ÒINKEJ



 

/CTM 2JKNKRRFGT)TQ­OÒVKIG &C\W,/CTM 2JKNKRRFGT)TQ­OÒVKIG 5VÒEM8QT\ÒINKEJ



 

/CTM2QNKGTVG2NCVVG



 

/CTM*ÒDUEJG2CVKPC RQNKGTVG2NCVVGOKPDGTÒJTV





1,5:1

 

/CTM (GKPG2CVKPC XQT\ÒINKEJp5VGORGNINCP\



109


,CGIGT



 

/CTM 8QT\ÒINKEJp5VGORGNINCP\



 

/CTM 5GJTUEJÌPpXQT\ÒINKEJXQT\ÒINKEJ



1,5:1

,CGIGT  

 /CTM 4GIKGTWPIULWDKN·WO 42TCEJVGZGORNCT (CUV5VGORGNINCP\



.ª$'%-

 

/CTM 4GIKGTWPIULWDKN·WO 49KP\4CPFHGJNGT XQT\ÒINKEJp5VGORGNINCP\

 

(TGKGWPF*CPUGUVCFV /CTM 8QT\ÒINKEJp5VGORGNINCP\



 

/CTM8QT\ÒINKEJ



 

/CTM 8QT\ÒINKEJp5VGORGNINCP\





.+22'  

 

110

.GQRQNF+8 /CTM2TCEJVGZGORNCT (CUV5VGORGNINCP\



/CTM 8QT\ÒINKEJp5VGORGNINCP\CWU RQNKGTVGT2NCVVG




,CGIGT

8599 Vs.

,CGIGT  

 

/CTM*QEJ\GKV 2QNKGTVG2NCVVG



 

/CTM,CJTJWPFGTVHGKGT *GTTNKEJG2CVKPCHCUV5VGORGNINCP\



 

/CTM,CJTJWPFGTVHGKGT 8QT\ÒINKEJp5VGORGNINCP\



 

/CTM,CJTJWPFGTVHGKGT 8QT\ÒINKEJ



 

/CTM,CJTJWPFGTVHGKGT 5GJTUEJÌPpXQT\ÒINKEJ



 /CTM -N4CPFHGJNGTUGJTUEJÌP

/CTM2QNKGTVG2NCVVG



 





/'%-.'0$74)5%*9'4+0

1,5:1

 

(TKGFTKEJ(TCP\+8 /CTM 2QNKGTVG2NCVVGOKPDGTÒJTV 

 

/CTM (GKPG2CVKPC XQT\ÒINKEJp5VGORGNINCP\



111


/'%-.'0$74)564'.+6<

1.&'0$74)

,CGIGT  

0KEQNCWU(TKGFTKEJ2GVGT /CTM 5GJTUEJÌPpXQT\ÒINKEJ



 

/CTM5GJTUEJÌP



 

(TKGFTKEJ#WIWUV /CTM *ÒDUEJG2CVKPCXQT\ÒINKEJ



1,5:1

,CGIGT  

 

 #FQNH(TKGFTKEJ8 /CTM2QNKGTVG2NCVVG

/CTM (GKPG2CVKPC XQT\ÒINKEJp5VGORGNINCP\



24'755'0 

 $

 

/CTM(CUV5VGORGNINCP\

112

/CTM8QT\ÒINKEJ

9KNJGNO+ /CTM$ 8QT\ÒINKEJp5VGORGNINCP\



(TKGFTKEJ+++ /CTM# 8QT\ÒINKEJp5VGORGNINCP\





   






,CGIGT  

 

 

 

,CGIGT

 /CTM# (GKPG6ÌPWPIXQT\ÒINKEJ

9KNJGNO++ /CTM#8QT\ÒINKEJ

/CTM# 9KP\4CPFHGJNGT XQT\ÒINKEJp5VGORGNINCP\



 

 /CTM# (GKPG2CVKPC XQT\ÒINKEJCWURQNKGTVGT2NCVVG



 

/CTM#8QT\ÒINKEJ



 

/CTM# *ÒDUEJG2CVKPCHCUVXQT\ÒINKEJ







/CTM#2TCEJVGZGORNCT 'TUVCDUEJNCIHCUV5VGORGNINCP\ 

1,5:1

 

/CTM# 8QT\ÒINKEJp5VGORGNINCP\



 

/CTM# 2QNKGTVG2NCVVGOKPDGTÒJTV

 113


4'755.6'4'4.+0+'

,CGIGT  

 /CTM# 5GIGPFGU/CPUHGNFGT$GTIDCWU 2TCEJVGZGORNCT5VGORGNINCP\



1,5:1

,CGIGT    

 

 

 

114

/CTM# 5GIGPFGU/CPUHGNFGT$GTIDCWU 8QT\ÒINKEJp5VGORGNINCP\

/CTM# 5GIGPFGU/CPUHGNFGT$GTIDCWU 8QT\ÒINKEJp5VGORGNINCP\

/CTM# 5GIGPFGU/CPUHGNFGT$GTIDCWU 8QT\ÒINKEJp5VGORGNINCP\

/CTM# 5GIGPFGU/CPUHGNFGT$GTIDCWU (GKPG2CVKPCXQT\ÒINKEJ

 *GKPTKEJ::++ /CTM2TCEJVGZGORNCT (CUV5VGORGNINCP\





 

/CTM8QT\ÒINKEJ



 

/CTM-N4CPFHGJNGT XQT\ÒINKEJXQT\ÒINKEJp5VGORGNINCP\



 

/CTM5GJTUEJÌP



 

/CTM 5GJTUEJÌPpXQT\ÒINKEJXQT\ÒINKEJ










,CGIGT  

 /CTM 8QT\ÒINKEJp5VGORGNINCP\

,CGIGT 

 

 /CTM 9KP\4CPFHGJNGT UGJTUEJÌPpXQT\ÒINKEJ



5#%*5'0

 

*GKPTKEJ::+8 /CTM(GKPG2CVKPC XQT\ÒINKEJp5VGORGNINCP\



1,5:1

 

 

/CTM8QT\ÒINKEJ

/CTM -N4CPFHGJNGTUGJTUEJÌP





 

#NDGTV /CTM2TCEJVGZGORNCT *GTTNKEJG2CVKPC RQNKGTVG2NCVVGOKPDGTÒJTV



 

/CTM(CUV5VGORGNINCP\



 

/CTM8QT\ÒINKEJ



4'755,ª0)'4'4.+0+'

 

*GKPTKEJ:+8 /CTM*GTTNKEJG2CVKPC XQT\ÒINKEJp5VGORGNINCP\



115


,CGIGT  

 

 

,CGIGT  

 /CTM5GJTUEJÌP



 

/CTM (GKPG2CVKPCXQT\ÒINKEJ



 

/CTM(CUVXQT\ÒINKEJ



 

/CTM(CUVXQT\ÒINKEJ



 

/CTM 4GIKGTWPIULWDKN·WO 9KP\4CPFHGJNGTXQT\ÒINKEJ



 /CTMOKV.GDGPUFCVGP 8QT\ÒINKEJp5VGORGNINCP\

)GQTI /CTM 8QT\ÒINKEJp5VGORGNINCP\

/CTMOKV.GDGPUFCVGP 9KP\4CPFHGJNGT HCUV5VGORGNINCP\







5#%*5'0#.6'0$74)

 

  116

'TPUV /CTM(GKPG2CVKPC XQT\ÒINKEJXQT\ÒINKEJp5VGORGNINCP\

/CTM 5GJTUEJÌPpXQT\ÒINKEJ






5#%*5'0%1$74))16*#

,CGIGT  

 

 

 #NHTGF /CTM 5GJTUEJÌPXQT\ÒINKEJ

/CTM 5GJTUEJÌPpXQT\ÒINKEJ

/CTM 9KP\4CPFHGJNGTHCUVXQT\ÒINKEJ

,CGIGT  

 /CTM8QT\ÒINKEJ

 

/CTM2TCEJVGZGORNCT 2QNKGTVG2NCVVGOKPDGTÒJTV

 

/CTM5GJTUEJÌP



%CTN'FWCTF /CTM 8QT\ÒINKEJp5VGORGNINCP\







5#%*5'0/'+0+0)'0



1,5:1

1,5:1

 



  

)GQTI++ /CTM)GDWTVUVCI 2TCEJVGZGORNCT *GTTNKEJG2CVKPCHCUV5VGORGNINCP\

 117


,CGIGT



,CGIGT

 C /CTM.CPIGT$CTV 48QT\ÒINKEJ



 C /CTM.CPIGT$CTV 48QT\ÒINKEJ





 

/CTMOKV.GDGPUFCVGP (CUV5VGORGNINCP\



 

/CTMOKV.GDGPUFCVGP 8QT\ÒINKEJp5VGORGNINCP\



5#%*5'09'+/#4'+5'0#%*

 D /CTM-WT\GT$CTV (CUV5VGORGNINCP\

 D /CTM-WT\GT$CTV 5GJTUEJÌPpXQT\ÒINKEJ

 D /CTM-WT\GT$CTV 8QT\ÒINKEJp5VGORGNINCP\

  118

/CTMOKV.GDGPUFCVGP (CUV5VGORGNINCP\



 

%CTN#NGZCPFGT /CTM8QT\ÒINKEJ



 

/CTM(CUVXQT\ÒINKEJ



 

9KNJGNO'TPUV /CTM*QEJ\GKV 8QT\ÒINKEJp5VGORGNINCP\










5%*#7/$74).+22'

,CGIGT



 

/CTM5GJTUEJÌP



 

/CTM *GTTNKEJG2CVKPC XQT\ÒINKEJp5VGORGNINCP\



/CTM8QT\ÒINKEJ



1,5:1

,CGIGT  

 

 )GQTI /CTM 8QT\ÒINKEJp5VGORGNINCP\



/CTM 8QT\ÒINKEJp5VGORGNINCP\

  

5%*9#4<$74)47&1.56#&6

 

/CTM8QT\ÒINKEJ



 

)ÒPVJGT /CTM 8QT\ÒINKEJXQT\ÒINKEJp5VGORGNINCP\



5%*9#4<$74)510&'45*#75'0  

/CTM 8QT\ÒINKEJCWURQNKGTVGT2NCVVG



   

/CTM2CVKPCXQT\ÒINKEJ



-CTN)ÒPVJGT /CTM 8QT\ÒINKEJp5VGORGNINCP\

 119


,CGIGT  

 /CTM5GJTUEJÌP



9#.&'%-2;4/106

,CGIGT  

 

1,5:1

 /CTM &WPMNG2CVKPCUGJT UEJÌPpXQT\ÒINKEJXQT\ÒINKEJ



/CTM &WPMNG2CVKPC NGKEJVÒDGTCTDGKVGVUGJTUEJÌP



9ª466'/$'4)

 

(TKGFTKEJ /CTM2TCEJVGZGORNCT 5VGORGNINCP\



1,5:1

 

  120

/CTM 8QT\ÒINKEJp5VGORGNINCP\



/CTM &WPMNG2CVKPCXQT\ÒINKEJ



 

-CTN /CTM8QT\ÒINKEJ



 

/CTM8QT\ÒINKEJ




4'+%*5)1.&/ª0<'0 *KPYGKUHÒTWPUGTG-WPFGP 

)GO·­'7.KUVGHÒT#PNCIGIQNFHÒTFCU ,CJTIKNVHÒT4GKEJUIQNFOÒP\GP HQNIGPFG4GIGNWPI 

,CGIGT  

)QNFOCTMUKPF/Y5VRHNKEJVKI   )QNFOCTMUKPF/Y5VHTGKDKUb )QNFOCTMUKPF/Y5VRHNKEJVKI C XQPbb D CDb

 /CTM 5GJTUEJÌPpXQT\ÒINKEJ



)QNFOCTMUKPF/Y5VHTGKDKUb )QNFOCTMUKPF/Y5VRHNKEJVKI C XQPbb D CDb





&KGQDGPIGPCPPVGP$GVT·IGXGTUVGJGPUKEJ KPMNWUKXG#WHIGNF 

&KGCPHCNNGPFG/GJTYGTVUVGWGTYKTFCWH WPUGTGP4GEJPWPIGPUGRCTCVCWUIGYKGUGP

#0*#.6

 

9KNJGNO++ /CTM 5GJTUGNVGPGT,CJTICPI (CUVUGJTUEJÌP



,CGIGT  

 D /CTM5KNDGTJQEJ\GKV *QJGT3WGTUVTKEJKO* (CUV5VGORGNINCP\



 

 (TKGFTKEJ++ /CTM 5GJTUEJÌPpXQT\ÒINKEJ

/CTM 'VYCUDGTKGDGPUGJTUEJÌP





$#&'0

 D /CTM5KNDGTJQEJ\GKV *QJGT3WGTUVTKEJKO* (CUV5VGORGNINCP\

 D /CTM5KNDGTJQEJ\GKV *QJGT3WGTUVTKEJKO* 48QT\ÒINKEJp5VGORGNINCP\

 

(TKGFTKEJ+ /CTM5GJTUEJÌP



 

/CTM 5GJTUEJÌPpXQT\ÒINKEJ



 

/CTM(CUVXQT\ÒINKEJ







121


,CGIGT  

 /CTM 5GJTUEJÌPpXQT\ÒINKEJ

,CGIGT 

 

/CTM 9KP\5EJTÌVNKPIUHGJNGT YKP\4CPFHGJNGT XQT\ÒINKEJp5VGORGNINCP\



 

/CTM(CUVXQT\ÒINKEJ



 

/CTM5GJTUEJÌP



 

/CTM5GNVGPGT,CJTICPI 5GJTUEJÌPpXQT\ÒINKEJ



 

1VVQ++ /CTM9KP\4CPFHGJNGT UGJTUEJÌPpXQT\ÒINKEJ



 

/CTM5GJTUEJÌP



 

/CTM5GJTUEJÌP



$#;'40  

 

 

 

.WFYKI++ /CTM 5VÒEM(CUVUGJTUEJÌP

/CTM 5GJTUEJÌPpXQT\ÒINKEJ

/CTM 5GJTUEJÌPpXQT\ÒINKEJ

/CTM5GJTUEJÌP









 

/CTM5GJTUEJÌP



 

/CTM -N4CPFHGJNGT XQT\ÒINKEJp5VGORGNINCP\



/CTM(CUVXQT\ÒINKEJ



  122




,CGIGT  

 /CTM5GJTUEJÌP



,CGIGT    /CTM8QT\ÒINKEJ



*#/$74)

 

/CTM8QT\ÒINKEJ



1,5:1

 

(TGKGWPF*CPUGUVCFV /CTM(CUVXQT\ÒINKEJ



 

/CTM5GNVGPGT,CJTICPI 5GJTUEJÌP



 

/CTM&C\W5CEJUGP /CTM5VÒEM $GTKGDGP Z UGJTUEJÌP



*'55'0

 

.WFYKI+++ /CTM 48QT\ÒINKEJp5VGORGNINCP\

 

.WFYKI+++ /CTM 9KP\4CPFHGJNGTYKP\-TCV\GT XQT\ÒINKEJp5VGORGNINCP\ 

 

/CTM5GJTUEJÌP



 

.WFYKI+8 /CTM8QT\ÒINKEJ



 

/CTM8QT\ÒINKEJ





$4#705%*9'+)

 

9KNJGNO /CTM9KP\4CPFHGJNGT UGJTUEJÌPpXQT\ÒINKEJ



$4'/'0

 

(TGKGWPF*CPUGUVCFV /CTM 8QT\ÒINKEJp5VGORGNINCP\



123


.ª$'%-

,CGIGT  

/'%-.'0$74)564'.+6<

 (TGKGWPF*CPUGUVCFV /CTM-N4CPFHGJNGT UGJTUEJÌPpXQT\ÒINKEJ



1,5:1

/'%-.'0$74)5%*9'4+0

 

(TKGFTKEJ(TCP\+++ /CTM9KP\-TCV\GT RQNKGTVG2NCVVG 

,CGIGT  

(TKGFTKEJ9KNJGNO /CTM 5GJTUGNVGPKPFKGUGT'TJCNVWPI 2TCEJVGZGORNCT (CUV5VGORGNINCP\



24'755'0

1,5:1

 



 # 9KNJGNO+ /CTM#'TUVCDUEJNCI HCUV5VGORGNINCP\



 # /CTM#5GJTUEJÌP



(TKGFTKEJ(TCP\+8 /CTM 5GNVGPDGUQPFGTUKPFKGUGT 'TJCNVWPI2QNKGTVG2NCVVG OKPDGTÒJTV 

&KGGTUVG4GKEJUIQNFOÒP\G

1,5:1

 # /CTM#5GJTUEJÌP   124

/CTM48QT\ÒINKEJ



 

/CTM% 5VÒEM5GJTUEJÌP

 


,CGIGT 1,5:1

,CGIGT

9KNJGNO++ /CTM#5GJTUEJÌP



 

/CTM#5GJTUEJÌP



 

/CTM#5GJTUEJÌP



 

/CTM# 5GNVGPGT,CJTICPI5GJTUEJÌP





 # /CTM# 5GJTUEJÌPpXQT\ÒINKEJ

 # /CTM# 5GNVGPGT,CJTICPI 5GJTUEJÌPpXQT\ÒINKEJ

 % /CTM%5GJTUEJÌP

 

  1,5:1

 # /CTM# 5GJTUEJÌPpXQT\ÒINKEJ

 











 # /CTM# 5GJTUEJÌPpXQT\ÒINKEJ



(TKGFTKEJ+++ /CTM#(CUV5VGORGNINCP\



 , /CTM, 5GJTUEJÌPpXQT\ÒINKEJ



/CTM#8QT\ÒINKEJ



 , /CTM,5GJTUEJÌP

 125


5#%*5'0%1$74))16*#

1,5:1

,CGIGT  

1,5:1

,CGIGT    %CTN'FWCTF /CTM2QNKGTVG2NCVVG

 /CTM# -CKUGTKP7PKHQTO 5GNVGPGT,CJTICPI 8QT\ÒINKEJp5VGORGNINCP\



&KGNGV\VG)QNFRT·IWPIFGU&GWVUEJGP 4GKEJGU-TKGIUDGFKPIVIGNCPIVGPPWT PQEJYGPKIG'ZGORNCTGKPFGP7ONCWH

5#%*5'0

 

#NDGTV /CTM5GJTUEJÌP





 

/CTM2TCEJVGZGORNCT 2QNKGTVG2NCVVGOKPDGTÒJTV

 

/CTM9KP\4CPFHGJNGT UGJTUEJÌPpXQT\ÒINKEJ 



5%*#7/$74).+22'

 

/CTM 5GNVGPGT,CJTICPI5GJTUEJÌP



1,5:1

 

/CTM(CUV5VGORGNINCP\

 

/CTM 5GJTUEJÌPpXQT\ÒINKEJ

126



  

)GQTI /CTM 5GJTUEJÌPpXQT\ÒINKEJ




5%*9#4<$74)47&1.56#&6

9ª466'/$'4)

1,5:1 1,5:1

,CGIGT ,CGIGT  

 

 )ÒPVJGT8KMVQT /CTM48QT\ÒINKEJ

/CTM4 5GJTUEJÌPpXQT\ÒINKEJ

 

-CTN /CTM8QT\ÒINKEJ



 

/CTM8QT\ÒINKEJ



 

/CTM 5GJTUEJÌPpXQT\ÒINKEJ



 

/CTM 5GJTUEJÌPpXQT\ÒINKEJ



 

/CTM 5GJTUEJÌPpXQT\ÒINKEJ



 

/CTM 5GJTUEJÌPpXQT\ÒINKEJ







5%*9#4<$74)510&'45*#75'0

1,5:1

 

-CTN)ÒPVJGT /CTM 44#VVTCMVKXGU'ZGORNCTOKV HGKPGT)QNFRCVKPCXQT\ÒINKEJ





127


&'765%*156#(4+-#

,CGIGT    /CTM8QT\ÒINKEJ



1,5:1

 

/CTM 5GNVGPGT,CJTICPI5GJTUEJÌP



 

9KNJGNO++ /CTM8QT\ÒINKEJ



,CGIGT



 C 4WRKGP66CDQTC)GRT·IV OKV)QNFCWUFGT5GMGPMG)QNFOKPG KP1UVCHTKMC 5GJTCVVTCMVKXGU XQT\ÒINKEJGU'ZGORNCT   

/CTM8QT\ÒINKEJ



 

/CTM8QT\ÒINKEJ



 

/CTM 9KP\4CPFHGJNGTXQT\ÒINKEJ



 C 4WRKGP66CDQTC)GRT·IV OKV)QNFCWUFGT5GMGPMG)QNFOKPG KP1UVCHTKMC5GJTUEJÌP 

 C 4WRKGP66CDQTC)GRT·IV OKV)QNFCWUFGT5GMGPMG)QNFOKPG KP1UVCHTKMC (CUUWPIUURWTGPUGJTUEJÌP 

 

  128

/CTM8QT\ÒINKEJ

/CTM8QT\ÒINKEJ





 C 4WRKGP66CDQTC)GRT·IV OKV)QNFCWUFGT5GMGPMG)QNFOKPG KP1UVCHTKMC 4CPFDGCTDGKVGVUEJÌPpUGJTUEJÌP 


,CGIGT



 C 4WRKGP66CDQTC)GRT·IV OKV)QNFCWUFGT5GMGPMG)QNFOKPG KP1UVCHTKMC -N5EJNGKHURWTCO4CPF HCUVUGJTUEJÌP 

1,5:1

 D 4WRKGP66CDQTC)GRT·IV OKV)QNFCWUFGT5GMGPMG)QNFOKPG KP1UVCHTKMC 5GJTCVVTCMVKXGU XQT\ÒINKEJGU'ZGORNCT 

 D 4WRKGP66CDQTC)GRT·IV OKV)QNFCWUFGT5GMGPMG)QNFOKPG KP1UVCHTKMC8QT\ÒINKEJ 

 D 4WRKGP66CDQTC)GRT·IV OKV)QNFCWUFGT5GMGPMG)QNFOKPG KP1UVCHTKMC+P752NCUVKMJQNFGT FGT%)5OKVFGT$GYGTVWPI'( 8QT\ÒINKEJ 

,CGIGT



 D 4WRKGP66CDQTC)GRT·IV OKV)QNFCWUFGT5GMGPMG)QNFOKPG KP1UVCHTKMC(CUVXQT\ÒINKEJ 

 D 4WRKGP66CDQTC)GRT·IV OKV)QNFCWUFGT5GMGPMG)QNFOKPG KP1UVCHTKMC(CUVXQT\ÒINKEJ 

 D 4WRKGP66CDQTC)GRT·IV OKV)QNFCWUFGT5GMGPMG)QNFOKPG KP1UVCHTKMC(CUVXQT\ÒINKEJ 

 D 4WRKGP66CDQTC)GRT·IV OKV)QNFCWUFGT5GMGPMG)QNFOKPG KP1UVCHTKMC5EJÌPpUGJTUEJÌP 

 D 4WRKGP66CDQTC)GRT·IV OKV)QNFCWUFGT5GMGPMG)QNFOKPG KP1UVCHTKMC4CPFWPF(GNFGT ÒDGTCTDGKVGVUGJTUEJÌP  129


.1658104'+%*5 )1.&/ª0<'0

&#0<+) ,CGIGT 

,CGIGT,CGIGT   &

 &

 &

 &



)WNFGP 44CPFWPF(GNFGTDGCTDGKVGV UGJTUEJÌP

)WNFGP 8QT\ÒINKEJp5VGORGNINCP\

)WNFGP +P752NCUVKMJQNFGTFGT+%) OKVFGT$GYGTVWPI/5 'TUVCDUEJNCI XQT\ÒINKEJp5VGORGNINCP\

)WNFGP +P752NCUVKMJQNFGTFGT2%)5 OKVFGT$GYGTVWPI/5 8QT\ÒINKEJp5VGORGNINCP\







130







9ÒTVVGODGTI,/CTM ,/CTM&C\W $CFGP,/CTM 5CEJUGP,/CTM 5VÒEM5GJTUEJÌPpXQT\ÒINKEJ 

 

#NNIGOGKP&KXGTUG/CTMUVÒEMG XQP$CFGP*CODWTI2TGW­GPWPF 5CEJUGP, Z $ 5VÒEM5GJTUEJÌP 

 

&KXGTUG/CTMUVÒEMGXQP$CFGP *CODWTI*GUUGP2TGW­GPWPF 9ÒTVVGODGTI,  Z  5VÒEM5GJTUEJÌP 



&KXGTUG/CTMUVÒEMGXQP$CFGP $C[GTP*CODWTI2TGW­GP5CEJ UGPWPF9ÒTVVGODGTI, # Z # Z  5VÒEM 5GJTUEJÌPpXQT\ÒINKEJ 



&KXGTUG/CTMUVÒEMGXQP$C[GTP 2TGW­GPWPF5CEJUGP, $%%

Z 5VÒEM-TCV\GT Z  UGJTUEJÌPpXQT\ÒINKEJ 



&KXGTUG/CTMUVÒEMGXQP$CFGP *CODWTI2TGW­GPWPF9ÒTVVGODGTI , Z   Z  Z  5VÒEM5GJTUEJÌP 



$C[GTP,/CTM *GUUGP,/CTM 5CEJUGP,/CTM 9ÒTVVGODGTI, /CTM5VÒEM /GKUVUGJTUEJÌP

 'WTQ)5GTKG 70'5%19GNVMWNVWTGTDG -NCUUKUEJGU9GKOCT5VGORGNINCP\

*CODWTI,/CTM 5VÒEM 5GJTUEJÌPpXQT\ÒINKEJ



2TGW­GP&KXGTUG/CTM5VÒEMG 9KNJGNOU+(TKGFTKEJU+++WPF 9KNJGNOU++,## Z  $# Z  5VÒEM5GJTUEJÌPpXQT\ÒINKEJ 

$70&'54'27$.+- &'765%*.#0&

 

$C[GTP,/CTM ,/CTM, /CTM5VÒEM 5GJTUEJÌPpXQT\ÒINKEJ











$C[GTP,/CTM *CODWTI,/CTM 2TGW­GP,#/CTM# 5CEJUGP,/CTM 9ÒTVVGODGTI,/CTM 5VÒEM$GTKGDGPUGJTUEJÌP 


9'.6-4+')70&+0(.#6+10

,CGIGT

,CGIGT



 

2HGPPKI&448QT\ÒINKEJ

 

2HGPPKI( (CUV5VGORGNINCP\





 

4GKEJURHGPPKI# 45GJTUEJÌPpXQT\ÒINKEJ



 

4GKEJURHGPPKI# 45GJTUEJÌP



 

4GKEJURHGPPKI' /KV'ZRGTVKUGXQP)W[(TCPSWKPGV %TCKNUJGKO48QT\ÒINKEJ 

 

4GKEJURHGPPKI' 45GJTUEJÌPpXQT\ÒINKEJ



 

4GKEJUOCTM# 2QNKGTVG2NCVVG



 

4GKEJUOCTM& 445GJTUEJÌP



9'+/#4'44'27$.+-

 

4GPVGPRHGPPKI( 45GJTUEJÌP



$GKFKGUGO'ZGORNCTJCPFGNVGUUKEJ WOGKPG5VGORGNMQRRNWPIFGT8QTFGT UGKVGXQO4GPVGPRHGPPKI , WPF FGT4ÒEMUGKVGFGU4GKEJURHGPPKIU ,  



1,5:1

1,5:1

 

4GPVGPRHGPPKI, 5GJTUGNVGPDGUQPFGTUKPFKGUGT 'TJCNVWPI2QNKGTVG2NCVVG



131


,CGIGT  

 4GKEJUOCTM' 45GJTUEJÌP



,CGIGT  

 

 

 

132

4GKEJUOCTM# $TGOGTJCXGP 8QT\ÒINKEJp5VGORGNINCP\CWU RQNKGTVGT2NCVVG



4GKEJUOCTM# $TGOGTJCXGP 5GJTUEJÌPpXQT\ÒINKEJ



4GKEJUOCTM# 0QTFJCWUGP 8QT\ÒINKEJp5VGORGNINCP\



4GKEJUOCTM# 0QTFJCWUGP*GTTNKEJG2CVKPC XQT\ÒINKEJp5VGORGNINCP\



4GKEJUOCTM( 7PKXGTUKV·V6ÒDKPIGP 2QNKGTVG2NCVVGNGKEJVDGTKGDGP



4GKEJUOCTM&4JGKPNCPFG 8QT\ÒINKEJp5VGORGNINCP\   

 



4GKEJUOCTM&4JGKPNCPFG 2TCEJVXQNNG2CVKPC XQT\ÒINKEJp5VGORGNINCP\ 

4GKEJUOCTM#.ÒDGEM 8QT\ÒINKEJp5VGORGNINCP\

4GKEJUOCTM# $TGOGTJCXGP *GTTNKEJG2CVKPCHCUV5VGORGNINCP\



 

 

  


,CGIGT  

 

 4GKEJUOCTM( 7PKXGTUKV·V6ÒDKPIGP 8QT\ÒINKEJp5VGORGNINCP\

4GKEJUOCTM( 7PKXGTUKV·V6ÒDKPIGP 8QT\ÒINKEJp5VGORGNINCP\

,CGIGT 

 



4GKEJUOCTM( 7PKXGTUKV·V6ÒDKPIGP 8QT\ÒINKEJp5VGORGNINCP\



 

4GKEJUOCTM( 7PKXGTUKV·V6ÒDKPIGP8QT\ÒINKEJ



 

4GKEJUOCTM#, 'KEJDCWO-QORNGVVGT,CJTICPI 5VÒEM5GJTUEJÌPpXQT\ÒINKEJ WPFXQT\ÒINKEJ



4GKEJUOCTM#, KEJDCWO-QORNGVVGT,CJTICPI 5VÒEM5GJTUEJÌPpXQT\ÒINKEJ WPFXQT\ÒINKEJ



4GKEJUOCTM#&, 'KEJDCWO5VÒEM 5GJTUEJÌPpXQT\ÒINKEJ



4GKEJUOCTM''KEJDCWO 48QT\ÒINKEJ



  

 

4GKEJUOCTM( 7PKXGTUKV·V6ÒDKPIGP8QT\ÒINKEJ



   

 

4GKEJUOCTM( 7PKXGTUKV·V6ÒDKPIGP 2QNKGTVG2NCVVGOKPDGTKGDGP

4GKEJUOCTM( 7PKXGTUKV·V6ÒDKPIGP 2QNKGTVG2NCVVGOKPDGTÒJTV

 4GKEJUOCTM( 7PKXGTUKV·V6ÒDKPIGP 8QT\ÒINKEJp5VGORGNINCP\ CWURQNKGTVGT2NCVVG





 

 

133


,CGIGT



,CGIGT

 

4GKEJUOCTM('KEJDCWO 8QT\ÒINKEJ



 

4GKEJUOCTM)'KEJDCWO 2QNKGTVG2NCVVG



 

4GKEJUOCTM#'KEJDCWO 8QT\ÒINKEJ



 

  134

4GKEJUOCTM&'KEJDCWO 48QT\ÒINKEJ

4GKEJUOCTM('KEJDCWO 4-N4CPFHGJNGTHCUVXQT\ÒINKEJ



 

4GKEJUOCTM)'KEJDCWO 448QT\ÒINKEJp5VGORGNINCP\ 

 

4GKEJUOCTM)'KEJDCWO /KV'ZRGTVKUGXQP)W[(TCPSWKPGV %TCKNUJGKO 449KP\4CPFHGJNGT XQT\ÒINKEJ 

 

4GKEJUOCTM,'KEJDCWO 4/KP-TCV\GT XQT\ÒINKEJp5VGORGNINCP\



 

4GKEJUOCTM,'KEJDCWO 48QT\ÒINKEJ



 

4GKEJUOCTM#, 'KEJDCWO-QORNGVVGT,CJTICPI 5VÒEM5GJTUEJÌPpXQT\ÒINKEJ



 

4GKEJUOCTM#, 'KEJDCWO-QORNGVVGT,CJTICPI 5VÒEM5GJTUEJÌPpXQT\ÒINKEJ WPFXQT\ÒINKEJ








,CGIGT ,CGIGT

 



 

4GKEJUOCTM,'KEJDCWO 448QT\Ã&#x2019;INKEJ 

 

4GKEJUOCTM&&Ã&#x2019;TGT 8QT\Ã&#x2019;INKEJp5VGORGNINCP\

 



4GKEJUOCTM& &KPMGNUDÃ&#x2019;JN/KP4CPFHGJNGT RQNKGTVG2NCVVG



 

4GKEJUOCTM& &KPMGNUDÃ&#x2019;JN(CUV5VGORGNINCP\



 

4GKEJUOCTM& &KPMGNUDÃ&#x2019;JN8QT\Ã&#x2019;INKEJ



 

4GKEJUOCTM(.GUUKPI 9KP\-TCV\GTRQNKGTVG2NCVVG



 

4GKEJUOCTM#9CNFGEM 2QNKGTVG2NCVVGOKPDGTKGDGP



  

4GKEJUOCTM&&Ã&#x2019;TGT (GKPG2CVKPC XQT\Ã&#x2019;INKEJp5VGORGNINCP\



 

4GKEJUOCTM&&Ã&#x2019;TGT 8QT\Ã&#x2019;INKEJ



 

4GKEJUOCTM&&Ã&#x2019;TGT 8QT\Ã&#x2019;INKEJ



 

4GKEJUOCTM&&Ã&#x2019;TGT 8QT\Ã&#x2019;INKEJ



 4GKEJUOCTM# 0CWODWTI5CCNG (CUV5VGORGNINCP\

135


,CGIGT  

,CGIGT



 

4GKEJUOCTM'/GKUUGP *Ã&#x2019;DUEJG2CVKPCRQNKGTVG2NCVVG



 

4GKEJUOCTM'/GKUUGP 8QT\Ã&#x2019;INKEJ



 

4GKEJUOCTM'/GKUUGP 8QT\Ã&#x2019;INKEJ

 

 

136

4GKEJUOCTM'/GKUUGP 8QT\Ã&#x2019;INKEJ

4GKEJUOCTM& 8GTHCUUWPIUVTGWG (CUV5VGORGNINCP\



 

4GKEJUOCTM# <GRRGNKP8QT\Ã&#x2019;INKEJp5VGORGNINCP\



 

4GKEJUOCTM# <GRRGNKP8QT\Ã&#x2019;INKEJ



 

4GKEJUOCTM# 4JGKPNCPFT·WOWPI 2TCEJVGZGORNCT (CUV5VGORGNINCP\



4GKEJUOCTM# 4JGKPNCPFT·WOWPI 8QT\Ã&#x2019;INKEJp5VGORGNINCP\







  

 4GKEJUOCTM( <GRRGNKP2TCEJVGZGORNCT (CUV5VGORGNINCP\


,CGIGT ,CGIGT  

 

 

 

 

 4GKEJUOCTM& 4JGKPNCPFT·WOWPI 8QT\Ã&#x2019;INKEJp5VGORGNINCP\



 

4GKEJUOCTM'-WTUOÃ&#x2019;P\G 8QT\Ã&#x2019;INKEJ 

 

4GKEJUOCTM#-WTUOÃ&#x2019;P\G (GKPG2CVKPC XQT\Ã&#x2019;INKEJp5VGORGNINCP\ 

 

4GKEJUOCTM(-WTUOÃ&#x2019;P\G 48QT\Ã&#x2019;INKEJ 

 

4GKEJUOCTM#)QGVJG 2QNKGTVG2NCVVGOKPDGTÃ&#x2019;JTV

 

4GKEJUOCTM#)QGVJG -N+PXGPVCTPWOOGT

6KPVGPUEJTKHV CWHFGT8QTFGTUGKVG XQT\Ã&#x2019;INKEJ 



4GKEJUOCTM#/CIFGDWTI 8QT\Ã&#x2019;INKEJ 

4GKEJUOCTM#/CIFGDWTI 8QT\Ã&#x2019;INKEJ 



4GKEJUOCTM#/CIFGDWTI 8QT\Ã&#x2019;INKEJp5VGORGNINCP\ 

4GKEJUOCTM#-WTUOÃ&#x2019;P\G 8QT\Ã&#x2019;INKEJp5VGORGNINCP\ 

137


,CGIGT ,CGIGT  

 

 4GKEJUOCTM#)QGVJG 9KP\4CPFHGJNGTXQT\ÒINKEJ

4GKEJUOCTM#)QGVJG 5GJTUEJÌPpXQT\ÒINKEJ



 

4GKEJUOCTM(5EJKNNGT 2QNKGTVG2NCVVGOKPDGTÒJTV



 

4GKEJUOCTM(5EJKNNGT 8QT\ÒINKEJ



 

4GKEJURHGPPKI' 48QT\ÒINKEJp5VGORGNINCP\







$70&'54'27$.+- &'765%*.#0&

 

4GKEJUOCTM))QGVJG 9KP\4CPFHGJNGT UGJTUEJÌPpXQT\ÒINKEJ



&4+66'54'+%*

 

  138

4GKEJUOCTM'.WVJGT 8QT\ÒINKEJ

4GKEJUOCTM(5EJKNNGT 2QNKGTVG2NCVVGOKPDGTÒJTV

 

  

  

2HGPPKI) $CPM&GWVUEJGT.·PFGT 5VGORGNINCP\



2HGPPKI) $CPM&GWVUEJGT.·PFGT 5VGORGNINCP\



2HGPPKI) $CPM&GWVUEJGT.·PFGT 8QT\ÒINKEJ




,CGIGT  

 2HGPPKI) $CPM&GWVUEJGT.·PFGT -N&TWEMUVGNNGKO(GNFFGT 8QTFGTUGKVGUGJTUEJÌP



 

&/&,JTGP-QORNGVVG 5GTKG5VÒEM(CUV5VGORGNINCP\



 

&/,45GJTUEJÌP



 

 

 

 

&/,4-N4CPFHGJNGT UGJTUEJÌPpXQT\ÒINKEJ

&/& )GTOCPKUEJGU/WUGWO 2TCEJVGZGORNCT2QNKGTVG2NCVVG

,CGIGT  

 &/& )GTOCPKUEJGU/WUGWO 8QT\ÒINKEJp5VGORGNINCP\



 

&/& )GTOCPKUEJGU/WUGWO 8QT\ÒINKEJp5VGORGNINCP\



 

&/& )GTOCPKUEJGU/WUGWO 8QT\ÒINKEJ



 

&/(5EJKNNGT 9KP\-TCV\GTRQNKGTVG2NCVVG



 

&/(5EJKNNGT (GKPG6ÌPWPIHCUV5VGORGNINCP\



 

&/(5EJKNNGT (CUV5VGORGNINCP\



 

&/(5EJKNNGT 8QT\ÒINKEJp5VGORGNINCP\







&/& )GTOCPKUEJGU/WUGWO 8QT\ÒINKEJp5VGORGNINCP\



&/& )GTOCPKUEJGU/WUGWO 8QT\ÒINKEJp5VGORGNINCP\



139


,CGIGT  

 

 

 

 

 

 &/(5EJKNNGT 8QT\Ã&#x2019;INKEJXQT\Ã&#x2019;INKEJp 5VGORGNINCP\



&/(5EJKNNGT 5VÃ&#x2019;EM8QT\Ã&#x2019;INKEJ



&/) /CTMITCHXQP$CFGP -N-TCV\GT GVYCUDGTKGDGPRQNKGTVG2NCVVG



&/) /CTMITCHXQP$CFGP (CUV5VGORGNINCP\



&/) /CTMITCHXQP$CFGP (CUV5VGORGNINCP\

&/) /CTMITCHXQP$CFGP 8QT\Ã&#x2019;INKEJp5VGORGNINCP\

 

&/) /CTMITCHXQP$CFGP8QT\Ã&#x2019;INKEJ

 

&/) /CTMITCHXQP$CFGP 5VÃ&#x2019;EM8QT\Ã&#x2019;INKEJ

 

140

,CGIGT

&/) /CTMITCHXQP$CFGP 5VÃ&#x2019;EM(CUV5VGORGNINCP\







 

&/,'KEJGPFQTHH 2QNKGTVG2NCVVG



 

&/,'KEJGPFQTHH 2QNKGTVG2NCVVGOKPDGTÃ&#x2019;JTV



 

&/,'KEJGPFQTHH (CUV5VGORGNINCP\



 

&/,'KEJGPFQTHH (CUV5VGORGNINCP\



 

&/,'KEJGPFQTHH (CUV5VGORGNINCP\



 

&/,'KEJGPFQTHH 8QT\Ã&#x2019;INKEJp5VGORGNINCP\



 

&/,'KEJGPFQTHH 8QT\Ã&#x2019;INKEJp5VGORGNINCP\



 

&/,'KEJGPFQTHH 5VÃ&#x2019;EM8QT\Ã&#x2019;INKEJp5VGORGNINCP\










 

  ,CGIGT



 

&/,(KEJVG 2QNKGTVG2NCVVG



 

&/,(KEJVG 2QNKGTVG2NCVVG



 

, /CTMITCHXQP$CFGP  , 'KEJGPFQTHH &C\W 2HGPPKI $CPMFGWVUEJGT .·PFGT 5VÒEM 5GJTUEJÌPWPFXQT\ÒINKEJ



&KXGTUG(GJNRT·IWPIGPWPFWPDG RT·IVG5EJTÌVNKPIGFGT$4&XQO 2HGPPKIDKU\WO&/5VÒEM &C\WGKPKIG'WTQXQTN·WHGT

'WTQR·KUEJG7PKQP-CUVGNDWTI 0CRQUVC 5VÒEM 5GJTUEJÌPpHCUV5VGORGNINCP\



 

(CUVMQORNGVVG5GTKGFGT&/ -WTUOÒP\GPOKV#WU PCJOGFGT,CJTI·PIG(,WPF ,5VÒEM5GJTUEJÌP 



&KXGTUG/ÒP\GPFGT$4&XQO 2HGPPKIDKU\WO/CTMUVÒEM FCTWPVGTDGUUGTG6[RGPWC ,&/(KEJVG ,&//GTECVQT

8CTKCPVGOKVNCPIGO4 FKXGTUG WPF/CTMUVÒEMGKPHGKPGP 3WCNKV·VGPGVE+PVGTGUUCPVGU.QV DKVVGDGUKEJVKIGP5VÒEM 8QT\ÒINKEJp5VGORGNINCP\

&/,1N[ORKUEJG5QOOGT URKGNGKP/ÒPEJGP5RKTCNG 8CTKCPVGOKV#TCDGUMGPKPFGT 4CPFUEJTKHV442QNKGTVG2NCVVG  ,CGIGT



&'765%*'&'/1-4#6+5%*' 4'27$.+- 

  -QORNGVVGT5CV\/CTM $TCPFGPDWTIGT6QT +O1TIKPCNTCJOGP 45VGORGNINCP\ 

 

&/,1N[ORKUEJG5QOOGT URKGNGKP/ÒPEJGP5RKTCNG 8CTKCPVGOKV#TCDGUMGPKPFGT 4CPFUEJTKHV442QNKGTVG2NCVVG 

-745/ª0<'056<' &'4$70&'54'27$.+- &'765%*.#0&  

-WTUOÒP\GPUCV\#&( ),5·V\G5VGORGNINCP\



  /CTM %CURCT&CXKF(TKGFTKEJ 8CTKCPVGOKVRQNKGTVGP(GNFGTP 440WT'ZGORNCTGIGRT·IV <CRQPKGTVRQNKGTVG2NCVVG 



  /CTM %CURCT&CXKF(TKGFTKEJ8CTKCPVG OKVRQNKGTVGP(GNFGTP 440WT'ZGORNCTGIGRT·IV <CRQPKGTVMN-TCV\GT RQNKGTVG2NCVVG

.165$70&'54'27$.+- &'765%*.#0&  

-WTUOÒP\GPUCV\) 2QNKGTVG 2NCVVG ) 5VGORGNINCP\  , 5VGORGNINCP\ ,

5VGORGNINCP\ & 5VGORGN INCP\ , 2QNKGTVG2NCVVG  &C\WYGKVGTG/ÒP\GPFGT$4& \CJNTGKEJG6CNGTPCEJRT·IWPIGPKP 5KNDGT4GKEJUUKNDGTOÒP\GPUQYKG GKPKIGCNVFGWVUEJG/ÒP\GP *QEJKPVGTGUUCPVGU.QVDKVVGDGUKEJ VKIGP5VÒEM 5GJTUEJÌPpRQNKGTVG2NCVVG

 141


,CGIGT



 2 /CTM )QGVJGU)CTVGPJCWU/QVKXRTQDG I/KVGKPIGRWP\VGT5GTKGPPT 440WT'ZGORNCTG IGRT·IV<CRQPKGTVRQNKGTVG2NCVVG

 2 /CTM<GVMKP /QVKXRTQDGI/KV GKPIGRWP\VGT5GTKGPPT 440WT'ZGORNCTGIGRT·IV <CRQPKGTV5VGORGNINCP\

,CGIGT





 2 /CTM.WVJGT/CVGTKCN RTQDGKP0GWUKNDGTI/KV GKPIGRWP\VGT5GTKGPPT 440WT'ZGORNCTGIGRT·IV <CRQPKGTV5VGORGNINCP\ 

 2 /CTM/CTZ/QVKXRTQDG I/KVGKPIGRWP\VGT 5GTKGPPT 440WT'ZGORNCTGIGRT·IV <CRQPKGTV5VGORGNINCP\  142



 2 /CTM ,CJTG-CORHITWRRGP /QVKXRTQDGI/KV GKPIGRWP\VGT5GTKGPPT 440WT'ZGORNCTGIGRT·IV <CRQPKGTVHCUV5VGORGNINCP\



 2 /CTM# ,CJTGUVCIFGT$GHTGKWPI XQO(CUEJKUOWU/CVGTKCNRTQDGKP 5KNDGT-WRHGTI 8QPITQ­GT5GNVGPJGKV 0WT'ZGORNCTGIGRT·IV 5VGORGNINCP\ 

 2 /CTM# ,CJTGUVCIFGT$GHTGKWPI XQO(CUEJKUOWU/QVKXRTQDGOKV ITÌ­GTGT8QTFGTUGKVGPFCTUVGNNWPI 1TKIKPCNXGTRCEMVWPFXGTRNQODV 440WT'ZGORNCTGIGRT·IV 5VGORGNINCP\ 

 2 /CTM *WODQNFV7PKXGTUKV·V /QVKXRTQDGI/KV GKPIGRWP\VGT5GTKGPPT 440WT'ZGORNCTGIGRT·IV <CRQPKGTV5VGORGNINCP\ 


<9'+6'49'.6-4+')

,CGIGT ,CGIGT



 

 2 /CTM# <WO)GDWTVUVCIXQP 'TPUV6J·NOCPP/CVGTKCNRTQDGKP 5KNDGT-WRHGTI 440WT'ZGORNCTGIGRT·IV <CRQPKGTV5VGORGNINCP\    /CTM# *KUVQTKUEJGU5VCFVUKGIGN 8CTKCPVGP FCUIGUCOVG5KGIGN FGT8QTFGTUGKVGKUVOCVVKGTV PWT FKGGTJCDGPGP6GKNGFGU5KGIGNUUKPF OCVVKGTV+P5EJCVWNNGOKV 'EJVJGKVU<GTVKHKMCVFGT 5VCCVUDCPM8'$/ÒP\GFGT&&4 5VÒEM+P1TKIKPCNUEJCVWNNG 2QNKGTVG2NCVVG 

 2 /CTM ,CJTG2QUVYGUGP /QVKXRTQDGI 440WT'ZGORNCTGIGRT·IV 5VGORGNINCP\ 

.165&&4 







-NGKPG5COONWPIXQP\WOGKUV UKNDGTPGP)GFGPMOÒP\GP\WWPF /CTMFCTWPVGTDGUUGTG6[RGP +PVGTGUUCPVGU.QVDKVVGDGUKEJVKIGP 5VÒEM8QT\ÒINKEJp5VGORGNINCP\ D\YRQNKGTVG2NCVVG  (CUVMQORNGVVG5COONWPIFGT &&4)GFGPMOÒP\GPWPF /CTM&C\WGKPG /GFCKNNG5VÒEM 8QT\ÒINKEJp5VGORGNINCP\D\Y RQNKGTVG2NCVVG 7OHCPITGKEJG5COONWPIXQP &&4)GFGPMOÒP\GP\W WPF/CTM&C\W\CJNTGKEJG YGKVGTG5VÒEMGKPRQNKGTVGT2NCVVG UQYKG2TQDGP-WTUOÒP\GPU·V\G GVE*QEJKPVGTGUUCPVGU1DLGMVOKV 5GNVGPJGKVGPDKVVGDGUKEJVKIGP 5VÒEM 8QT\ÒINKEJ5VGORGNINCP\D\Y RQNKGTVG2NCVVG -NGKPGU-QPXQNWVXQPWPF /CTM)GFGPMOÒP\GPFGT&&4 FCTWPVGTCWEJ2TQDGRT·IWPIGP UQYKGGKPGWPDGRT·IVG4JQPFG +PVGTGUUCPVGU.QVDKVVGDGUKEJVKIGP 5VÒEM8QT\ÒINKEJp5VGORGNINCP\

 2T·IWPIGPFGT4GKEJUMTGFKV MCUUGP4GKEJURHGPPKI' 45GJTUEJÌP



&'765%*'-1.10+'0

&'765%*0'7)7+0'#  

0GW)WKPGC/CTM# 8QT\ÒINKEJ

 

*GNNGT,5GJTUEJÌP

&'765%*156#(4+-#





-+#765%*17  

%GPV&C\W,%GPV 5VÒEM8QT\ÒINKEJ WPFUGJTUEJÌPpXQT\ÒINKEJ 

56##6.+%*'016/ª0<'0



$4'/'0  0 $TGOGT8GTTGEJPWPIURHGPPKI Q,5GJTUEJÌPpXQT\ÒINKEJ



 0 $TGOGT8GTTGEJPWPIUOCTMQ, 5GJTUEJÌPpXQT\ÒINKEJ







143


9'56(#.'0 ,CGIGT



 0 /CTM6QODCM(TGKJGTT XQO5VGKP4(CUV5VGORGNINCP\



 0 /CTM6QODCM(TGKJGTT XQO5VGKP4-N(NGEMXQT\Ã&#x2019;INKEJ



,CGIGT



 0 $KNNKQP/CTM (TGKJGTTXQO5VGKP8QT\Ã&#x2019;INKEJ

 0 /KNNKQPGP/CTM6QODCM XGTIQNFGV(TGKJGTTXQO5VGKP 42TCEJVGZGORNCT5VGORGNINCP\



016/ª0<'0#75214<'..#0 70&56'+0<'7) 

&'765%*'54'+%*  

2QT\GNNCPIGNF-QORNGVVG5GTKGFGT 2QT\GNNCPOÃ&#x2019;P\GPFGU&GWVUEJGP 4GKEJGUXQP\WWPF 2HGPPKIUQYKGWPF /CTM5EJGWEJCC CCCCC 5VÃ&#x2019;EM5VGORGNINCP\



(4'+56##65#%*5'0  0 /KNNKQPGP/CTM6QODCM XGTIQNFGV(TGKJGTTXQO5VGKP 48QT\Ã&#x2019;INKEJp5VGORGNINCP\



 0 /KNNKQPGP/CTM6QODCM XGTIQNFGV(TGKJGTTXQO5VGKP 48QT\Ã&#x2019;INKEJp5VGORGNINCP\



144

 

2QT\GNNCPIGNF-NGKPG5GTKG2QT\GNNCP IGNFCWUFGT2QT\GNNCP OCPWHCMVWT/GK­GPDGUVGJGPFCWU 2HGPPKI2HGPPKI WPF/CTM,00 5VÃ&#x2019;EM5GJTUGNVGPGT,CJTICPI +P1TKIKPCNGVWK5VGORGNINCP\




&#0<+)

,CGIGT  &

 &



,CGIGT

2HGPPKI 4.GKEJVG-QTTQUKQPUUVGNNGP UGJTUEJÌP



2HGPPKI 5GJTUGNVGPKPFKGUGT'TJCNVWPI 2QNKGTVG2NCVVG



 &

)WNFGP8QT\ÒINKEJ



 &

)WNFGP45GJTUEJÌP



 &

)WNFGP 49KP\-TCV\GTUGJTUEJÌP

 & )WNFGP-QIIG5GJTUEJÌP



 & )WNFGP/CTKGPMKTEJG 8QT\ÒINKEJ



 & )WNFGP/CTKGPMKTEJG 5GJTUEJÌP



 & )WNFGP/CTKGPMKTEJG 5GJTUEJÌP



 & )WNFGP-TCPVQT 5GJTUEJÌPpXQT\ÒINKEJ



 & )WNFGP-TCPVQT 5GJTUEJÌP



 & )WNFGP-TCPVQT 2CVKPCUGJTUEJÌP







145


241$'0810 4'+%*5-.'+0/ª0<'0

,CGIGT



 & )WNFGP-QIIG 9KP\4CPFHGJNGTHCUVXQT\ÒINKEJ

 1,5:1

\W,CGIGT

 & )WNFGP-QIIG 9KP\-TCV\GTUGJT UEJÌPpXQT\ÒINKEJ

 



 

 & )WNFGP4CVJCWU 5GJTUEJÌPpXQT\ÒINKEJ



 

 & )WNFGP4CVJCWU 5GJTUEJÌPpXQT\ÒINKEJ



 

 & )WNFGP4CVJCWU 9KP\4CPFHGJNGTMN-TCV\GT UGJTUEJÌP 146



2HGPPKI&INCVVGT4CPF -WRHGTOOI5EJCCH )5NI$GEMGPDCWGT 42QNKGTVG2NCVVG



2HGPPKI#INCVVGT4CPF -WRHGTOOI5NI $GEMGPDCWGT FQTVXGTUKNDGTV  5EJCCH) 4(GKPG2CVKPCHCUV5VGORGNINCP\



2HGPPKI#INCVVGT4CPF -WRHGTXGTUKNDGTVOO I5EJCCH) 5NI$GEMGPDCWGT 48QT\ÒINKEJ



2HGPPKI#INCVVGT4CPF -WRHGT0KEMGN%COO 5EJCCH)5NI$GEMGPDCWGT XINFQTVCPFGTGU/CVGTKCN +P752NCUVKMJQNFGTFGT0)%OKV FGT$GYGTVWPI#75GJTUEJÌP




241$'0810 4'+%*55+.$'4/ª0<'0

241$'0&'4 9'+/#4'44'27$.+-

$#;'40

\W,CGIGT  

\W,CGIGT  

.WFYKI+++ /CTMQJPG/ÒP\\GKEJGP INCVVGT4CPF5KNDGT %COO5EJCCH) 5NI$GEMGPDCWGT+P75 2NCUVKMJQNFGTFGT0)%OKVFGT $GYGTVWPI2(7.64# %#/'12QNKGTVG2NCVVG



 

241$'0810 4'+%*5)1.&/ª0<'0 $#;'40

 

.WFYKI+++ /CTMQJPG/ÒP\\GKEJGP OKV5KIPCVWT) )QGV\ INCVVGT 4CPF5KNDGT%COO 5EJCCH)5NI$GEMGPDCWGT +P752NCUVKMJQNFGTFGT0)% OKVFGT$GYGTVWPI2(7.64# %#/'12TCEJVGZGORNCT 2QNKGTVG2NCVVG 

9KNJGNO++ /CTM#XGTOWVNKEJOKV 4CPFUEJTKHV)166/+6705 FC\YKUEJGP8GT\KGTWPIGP -WRHGT%COO5EJCCH 5NI$GEMGPDCWGT+P75 2NCUVKMJQNFGTFGT2%)5OKVFGT $GYGTVWPI#7 (CUV5VGORGNINCP\

4GKEJUOCTM&XQP-CTN )QGV\/ÒPEJGPINCVVGT4CPF <KPPOOI5EJCCH ) 8U#FNGTXXFCT WPVGT4'+%*5/#4-4U /·FEJGPMQRHNYGJGPFGU*CCT  5NI$GEMGPDCWGT&C\W<W ,4GKEJUOCTM&XQP -CTN)QGV\/ÒPEJGPINCVVGT4CPF <KPPOOI5EJCCH \WCFC) 8U#FNGTXX 4'+%*5/#4-ÒDGTFGP (NÒIGNP4U/·FEJGPDÒUVGNOKV 'KEJGPMTCP\KO*CCT7OUEJTKHV IGUEJNQUUGP&'765%*'54'+%*  5NI$GEMGPDCWGTXIN

FQTVKP5KNDGT 5VÒEM )GDQIGPD\YMQTTQFKGTVUGJT UEJÌP





241$'0&'4 &'765%*'00'$'0)'$+'6' 5##4.#0&

24'755'0

 

/CTM#OKV4CPFUEJTKHV '+0+)-'+670&4'%*6 70&(4'+*'+6-WRHGT %COO5EJCCH 5NI$GEMGPDCWGT+P75 2NCUVKMJQNFGTFGT0)%OKVFGT $GOGTMWPI70%&'6#+.5 *GTTNKEJG2CVKPCHCUV5VGORGNINCP\

 



(TCPMGPQJPG/ÒP\ \GKEJGPIGTKHHGNVGT4CPF'55#+ KO5VGORGNFGT8QTFGTUGKVG)QNF OOI5EJCCH5 5NI$GEMGPDCWGT 440WT'ZGORNCTGIGRT·IV (CUV5VGORGNINCP\  147


.165



&KXGTUG/ÒP\GPFGU-CKUGTTGKEJU 9GKOCTGT4GRWDNKMWPFFGU&TKVVGP 4GKEJUXQO2HGPPKIDKU\WO /CTMUVÒEM&C\WGKPKIG CNVFGWVUEJG/ÒP\GP+PVGTGUUCPVGU .QVDKVVGDGUKEJVKIGP5VÒEM +P#NDWO5EJÌPpXQT\ÒINKEJ 



&KXGTUG/ÒP\GPFGU-CKUGTTGKEJU FGT9GKOCTGT4GRWDNKMFGU&TKVVGP 4GKEJUWPFFGT$4&XQO2HGPPKI DKU\WO'WTQ5VÒEMFCTWPVGT DGUUGTG6[RGP*QEJKPVGTGUUCPVGU .QVDKVVGDGUKEJVKIGP5VÒEM +P#NDWO(CUVUGJTUEJÌPp HCUV5VGORGNINCP\ 



,$CFGP/CTM

)QNFGPG*QEJ\GKV , &GWVUEJ0GW)WKPGC0GW)WKPGC 2HGPPKI&C\W&CP\KIGT -NGKPOÒP\GP5VÒEM 5GJTUEJÌPpXQT\ÒINKEJ 



5COONWPIXQP/ÒP\GPFGU-CKUGT TGKEJUFGT9GKOCTGT4GRWDNKMFGU &TKVVGP4GKEJUXQO2HGPPKIDKU \WO/CTMUVÒEM&C\W0QVOÒP\GP FGT2TQXKP\9GUVHCNGP+PVGTGUUCP VGU.QVOKVDGUUGTGP6[RGPDKVVG DGUKEJVKIGP5VÒEM (CUVUGJTUEJÌPpXQT\ÒINKEJ 



-QPXQNWVXQPWPF/CTM UVÒEMGPFGU-CKUGTTGKEJUWPFFGT 9GKOCTGT4GRWDNKMFCTWPVGTCWEJ DGUUGTG6[RGP&C\W/ÒP\GP XQP&GWVUEJ1UVCHTKMC+PVGTGUUCP VGU.QVDKVVGDGUKEJVKIGP 5VÒEM/GKUVUGJTUEJÌP 



&KXGTUG/ÒP\GPFGU-CKUGTTGKEJU XQO2HGPPKIDKU\WO/CTMUVÒEM XQP#PJCNVDKU9ÒTVVGODGTI *QEJKPVGTGUUCPVGU.QVDKVVGDGUKEJ VKIGP5VÒEM+P#NDWO 'KPKIGOKVMN(GJNGTPUGJT UEJÌPpXQT\ÒINKEJ 



-NGKPG5COONWPIXQP/ÒP\GPFGT 9GKOCTGT4GRWDNKMFGU&TKVVGP 4GKEJGU&CP\KI5VCCVNKEJG0QV OÒP\GPUQYKGFGT0GDGPIGDKGVG XQO2HGPPKIDKU\WO/CTMUVÒEM *QEJKPVGTGUUCPVGU.QVOKVDGUUGTGP 6[RGPDKVVGDGUKEJVKIGP 5VÒEM+P#NDWO 5GJTUEJÌPpXQT\ÒINKEJ 

#..)'/'+0  

&KXGTUG/ÒP\GPFGU-CKUGTTGKEJU FGT9GKOCTGT4GRWDNKM4GKEJ UQYKGFGT&&4XQO2HGPPKIDKU \WO/CTMUVÒEMFCTWPVGTDGU UGTG6[RGP+PVGTGUUCPVGU.QVDKVVG DGUKEJVKIGP5VÒEM 5GJTUEJÌPp5VGORGNINCP\



 

7OHCPITGKEJG5COONWPIXQP/ÒP \GPFGU-CKUGTTGKEJUFGT9GKOCTGT 4GRWDNKMFGU4GKEJUUQYKGFGT $4&XQO2HGPPKIDKU\WO /CTMUVÒEMFCTWPVGT\CJNTGKEJG DGUUGTG6[RGPUQYKGVGKNYGKUG JÒDUEJG3WCNKV·VGP*QEJKPVGTGU UCPVGU1DLGMVDKVVGDGUKEJVKIGP 5VÒEM+P#NDGP (CUVUGJTUEJÌPpHCUV5VGORGNINCP\ 

 

7OHCPITGKEJG5COONWPIXQP/ÒP \GPCWUFGO-CKUGTTGKEJ9GNVMTKGI WPF+PHNCVKQP9GKOCTGT4GRWDNKM 4GKEJ#NNKKGTVG$GUCV\WPI $4&&&40GDGPIGDKGVG-QNQ PKGP0QVOÒP\GP&CP\KI5CCTNCPF UQYKGGKPKIG2TQDGPWPF8GTRT· IWPIGP&KG5COONWPIKUVITÌ­ VGPVGKNUPCEJ,CJTI·PIGPWPF/ÒP\ UV·VVGP\WUCOOGPIGVTCIGPYQTFGP WPFGPVJ·NV\CJNTGKEJGDGUUGTG 5VÒEMG&C\WGKPKIGKPWPFCWUN·P FKUEJG/ÒP\GPWPF/GFCKNNGPOKV JQJGO5KNDGTCPVGKN'KPJQEJKPVGT GUUCPVGU1DLGMVFCUUKEJJGTXQTTC IGPF\WO#WUDCWQFGTCNU'TI·P \WPIGKPGTDGTGKVUDGUVGJGPFGP 5COONWPIGKIPGVDKVVGWPDGFKPIV DGUKEJVKIGP /GJTGTGVCWUGPF5VÒEM +P#NDGP'KPKIGOKV MN(GJNGTPUEJÌPpRQNKGTVG2NCVVG 

 

 



148

&KXGTUG5KNDGTOÒP\GPFGU-CKUGT TGKEJUFGT9GKOCTGT4GRWDNKMWPF FGU&TKVVGP4GKEJU,  7PKXGTUKV·V.GKR\KI   7PKXGTUKV·V,GPC   4JGKPNCPFG   8GTHCUUWPIUVTGWG   )QGVJG  5EJKNNGT  5VÒEM 8QT\ÒINKEJp5VGORGNINCP\



7OHCPITGKEJG5COONWPIXQP/ÒP \GPFGU-CKUGTTGKEJUWC9GKOC TGT4GRWDNKMFCTWPVGT5GTKGPXQP /CTMWPF/CTMUVÒEMGPFGU -CKUGTTGKEJUUQYKG\CJNTGKEJG WPF/CTMUVÒEMGKPUDGUQPFGTG XQP$C[GTPWPF2TGWUUGP+PVGTGU UCPVGU1DLGMVDKVVGDGUKEJVKIGP 5VÒEM5EJÌPpHCUV5VGORGNINCP\  &KXGTUGWPF/CTMUVÒEMG FGU-CKUGTTGKEJUXQP#PJCNV 9ÒTVVGODGTI+PVGTGUUCPVGU.QV OKVDGUUGTGP,CJTI·PIGPDKVVG DGUKEJVKIGP5VÒEM +P#NDWO5EJÌPpXQT\ÒINKEJ




4'+%*55+.$'4/ª0<'0  

#NNIGOGKP&KXGTUGWPF/CTM UVÒEMGFGU-CKUGTTGKEJUXQP$CFGP DKU9ÒTVVGODGTI&C\WGKPKIG 5VÒEMGFGU4GKEJU+PVGTGUUCPVGU .QVDKVVGDGUKEJVKIGP5VÒEM 5GJTUEJÌPpXQT\ÒINKEJ



&KXGTUG/CTM5VÒEMGXQP$C[GTP 2TGW­GP5CEJUGP5EJYCT\DWTI WPF9ÒTVVGODGTI+PVGTGUUCPVGU .QVDKVVGDGUKEJVKIGP5VÒEM 5GJTUEJÌPpHCUV5VGORGNINCP\ 

 

&KXGTUG/CTM5VÒEMG*CODWTI 2TGW­GP

Z 5CEJUGP5VÒEM /GKUVUGJTUEJÌP

 

&KXGTUG/CTM5VÒEMGXQP$CFGP

Z4GIKGTWPIULWDKN·WO Z)QNFGPG*QEJ\GKV Z $C[GTP Z Z)GDWTVUVCI WPF 2TGW­GP ZZ,CJTG -ÌPKITGKEJZ&GT-ÌPKI TKGHZ4GIKGTWPIULWDKN·WO  5VÒEM 5GJTUEJÌPpXQT\ÒINKEJ

 







-NGKPG5GTKGXQP/ÒP\GPFGU -CKUGTTGKEJUWPFFGT9GKOCTGT 4GRWDNKMKPHGKPGP'TJCNVWPIGP , 5VÒEM 8QT\ÒINKEJp5VGORGNINCP\ ,/GEMNGPDWTI5EJYGTKP /CTM *QEJ\GKV , /GEMNGPDWTI5EJYGTKP/CTM  *QEJ\GKV ,2TGW­GP /CTM#5VÒEM 5GJTUEJÌP Z WPF XQT\ÒINKEJp5VGORGNINCP\



9'+/#4'44'27$.+-



 

$CFGP,/CTM

4GIKGTWPIULWDKN·WO , /CTM DGTKGDGP , /CTMOKV.GDGPUFCVGP 5VÒEM5GJTUEJÌPpXQT\ÒINKEJ

 



,4GKEJUOCTM#

4JGKPNCPFG ,4GKEJUOCTM # .GUUKPI , 4GKEJUOCTM' /GK­GP  ,4GKEJUOCTM#

<GRRGNKP ,4GKEJUOCTM ) 4JGKPNCPFT·WOWPI  ,4GKEJUOCTM#

)QGVJG &C\W0QVOÒP\GPXQP 9GUVHCNGPWPF*CODWTI5VÒEM 5GJTUEJÌPpXQT\ÒINKEJ 

&4+66'54'+%*  



5COONWPIXQPWPF/CTM UVÒEMGPFGU&TKVVGP4GKEJGUWC , Z , Z , ,GVE&KG5COONWPIKUVPCEJ ,CJTI·PIGPWPF/ÒP\UV·VVGP PCJG\WMQORNGVV+PVGTGUUCPVGU 1DLGMVDKVVGDGUKEJVKIGP5VÒEM 5GJTUEJÌPpXQT\ÒINKEJ 

&'765%*'-1.10+'0  

&GWVUEJ0GW)WKPGC0GW )WKPGC2HGPPKI# 0GW)WKPGC/CTM# -QORNGVVG5GTKG, 5VÒEM 5GJTUEJÌPpXQT\ÒINKEJ 

 

-NGKPG6[RGPUCOONWPIXQP/ÒP \GPFGTFGWVUEJGP-QNQPKGPWC XQP&GWVUEJ1UVCHTKMC&GWVUEJ 0GWIWKPGCWPF-KCWVUEJQW *QEJKPVGTGUUCPVGU.QVOKVDGUUGTGP 6[RGPWPFVGKNYGKUGJÒDUEJGP 3WCNKV·VGPDKVVGDGUKEJVKIGP 5VÒEM5GJTUEJÌPpXQT\ÒINKEJ





$C[GTP,/CTM*CO DWTI,/CTM2TGW­GP ,$/CTM$5VÒEM 'VYCUDGTKGDGP Z  OGKUVXQT\ÒINKEJ  ,#PJCNV(TKGFTKEJ++/CTM ,$C[GTP.WFYKI+++ /CTM,9GKOCTGT 4GRWDNKM4GKEJUOCTM#

/CIFGDWTI 5VÒEM $GTKGDGP Z XQT\ÒINKEJ 



&#0<+)  

-NGKPG5GTKG&CP\KIGT/ÒP\GPXQP XQO2HGPPKIDKU\WO )WNFGP5VÒEM+PVGTGUUCPVGU.QV DKVVGDGUKEJVKIGP5VÒEM 5GJTUEJÌPpXQT\ÒINKEJ



149


Bei uns sind Sie goldrichtig!

• Über 35 Jahre Erfahrung im Gold- und Münzenhandel • Faire und objektive Bewertung Ihrer Goldmünzen • Barankauf von Goldmünzen zu tagesaktuellen Preisen • Große Auswahl interessanter Goldmünzen • Vertrauen Sie Europas führendem Auktionshaus für Münzen und Medaillen

Sie möchten Ihre Münzen veräußern? 0800 5836537 (gebührenfrei) Fritz Rudolf Künker GmbH & Co. KG Gutenbergstraße 23 · 49076 Osnabrück · Germany Tel. +49 (0)541 96 20 20 · Fax +49 (0)541 96 20 222 www.kuenker.de · service@kuenker.de Osnabrück · Berlin · München · Zürich · Moskau


Künker eAuctions

Künker eAuctions

Unsere eAuctions umfassen circa 250 Losnummern. In einem festgelegten Zeitraum von 14 Tagen haben Sie die Möglichkeit, online auf die für Sie interessanten Münzen und Medaillen zu bieten. Die einzelnen Losnummern laufen zeitlich versetzt aus. Selbstverständlich werden Sie über Ihren aktuellen Gebotsstatus laufend per Email informiert und können Ihre Gebote bei Bedarf bis zur letzten Sekunde erhöhen.

Our eAuctions contain 250 lots. During a fixed period of 14 days you have the opportunity to submit your bids online on your favourite coins and medals.

Weitere Informationen und die nächsten Termine zu den Künker eAuctions finden Sie unter:

You may find further information and the next dates of the Künker eAuctions here:

www.kuenker.de

www.kuenker.com

Each lot will expire at different times. Certainly you will be informed constantly by email about the current status of your bids so that you permanent have the possibility – if necessary – to raise your bids till the end of the eAuction.

Fritz Rudolf Künker GmbH & Co. KG Gutenbergstraße 23 · 49076 Osnabrück · Germany Tel. +49 (0)541 96 20 20 · Fax +49 (0)541 96 20 222 www.kuenker.de · service@kuenker.de Osnabrück · Berlin · München · Zürich


Leitfaden zur erfolgreichen schriftlichen Auktionsteilnahme • • • • •

Studieren Sie den Katalog sorgfältig und notieren Sie alle Lose, die interessant für Sie sind. Legen Sie für jedes Los Ihr persönliches Limit fest, das Sie maximal zu zahlen bereit sind. Füllen Sie das beiliegende Formular aus (siehe unten) und tragen Sie für jedes Los Ihr Höchstgebot ein. Schicken Sie uns Ihren Auftrag frühzeitig. Bei gleich hohen Geboten erhält das zuerst eingegangene Gebot den Zuschlag. Sie haben interessante Lose für insgesamt € 10.000,– gefunden, möchten jedoch nur € 2.000,– ausgeben. Kein Problem: Sie geben als Gesamtlimit (ohne Aufgeld) € 2.000,– an. • Wenn Sie Fragen haben: Die MitarbeiterInnen unserer Kundenbetreuung sind für Sie da: Telefon 0800 583 65 37 (gebührenfrei). • Wenn Sie telefonisch an unseren Auktionen teilnehmen möchten, ist das ab einer Schätzung von € 500,– pro Los möglich. Bitte teilen Sie uns diesen Wunsch mindestens einen Werktag vor Beginn der Versteigerung schriftlich mit.

Musterauftrag für schriftliche Gebote Name, Adresse, Telefon Ihre vollständige Anschrift ist wichtig, damit wir Ihren Auktionsauftrag annehmen und bearbeiten können. Ihre Telefonnummer brauchen wir, um Sie bei Rückfragen zu Ihren Geboten schnell erreichen zu können.

Ihre Kundennummer Die Angabe Ihrer Kundennummer unterstützt uns bei der Bearbeitung Ihres Auktionsauftrages. Viele Vorarbeiten für die Auktion werden dadurch einfacher und es werden Fehler vermieden.

Losnummern und Gebote Listen Sie alle Lose, für die Sie sich interessieren, mit ihrer Katalognummer auf und legen Sie für sich selbst fest, wie viel Sie bereit sind, für jedes einzelne Los zu bieten.

Ihr Limit pro Einzellos An dieser Stelle geben Sie an, was Sie für jedes einzelne Stück maximal bereit sind auszugeben.

„Oder“-Gebote Wenn Sie sich für mehrere Münzen interessieren, aber nur ein Stück davon erwerben wollen, können Sie Ihre Gebote einfach mit einem „Oder“ verbinden. Wichtig: bei den „Oder“Geboten können Sie nicht auf frühere Katalognummern zurückgreifen (z. B. 2890 oder 1558), da die Nr. 1558 dann bereits versteigert ist. Unterschreiben Sie Ihren Auktionsauftrag ... ... nachdem Sie Ihre Angaben noch einmal überprüft haben. Ihre Unterschrift ist wichtig, denn damit bestätigen Sie uns, dass sie tatsächlich teilnehmen wollen.

Überschreitung Ihrer Limits pro Einzellos In der Praxis zeigt sich, dass oft mehrere Bieter mit ihren Geboten dicht beieinander liegen. Deshalb empfiehlt es sich, an dieser Stelle einer geringfügigen Überschreitung Ihrer Gebote zuzustimmen. Dadurch erhöhen sich Ihre Chancen, im Wettbewerb mit anderen den Zuschlag zu erhalten.

Begrenzung Ihres Gesamtlimits Hier können sie die Gesamtsumme Ihrer Gebote begrenzen und festlegen, was Sie insgesamt maximal bereit sind auszugeben. Aufgeld und Mehrwertsteuer kommen später noch hinzu.

TEL +49 (0)541 96 20 20, FAX +49 (0)541 96 20 222, SERVICE@KUENKER.DE, WWW.KUENKER.DE


Wie entsteht der Preis einer Auktion? Der im Auktionskatalog angegebene Preis ist ein Schätzpreis, der durch unsere Experten festgelegt wurde. Das Mindestgebot liegt bei 80 % dieses Wertes. Die Zuschlagpreise sind oft deutlich höher als die Schätzpreise. Als Auktionshaus müssen wir bereits vor der Auktion alle schriftlichen Gebote koordinieren. Folgende Beispiele sind im Bietverfahren möglich: Beispiel 1 (Schätzpreis: € 1.000,–) Es liegt kein schriftlicher Auftrag vor: Der Auktionator ruft das Los in der Auktion mit € 800,– aus. Wenn im Saal nur ein Bieter darauf ein Gebot abgibt, erhält der Saalbieter den Zuschlag für € 800,–.

Beispiel 3 (Schätzpreis: € 1.000,–) Es liegt dem Auktionator nur ein schriftliches Gebot von € 850,– vor: Das Los wird in der Auktion mit € 800,– ausgerufen. Falls kein Bieter im Saal ein Gegenangebot abgibt, erhält der schriftliche Bieter den Zuschlag bei € 800,–.

Beispiel 2 (Schätzpreis: € 1.000,–) Es liegen dem Auktionator drei schriftliche Gebote vor:

Beispiel 4 (Schätzpreis: € 1.000,–) Es liegt dem Auktionator nur ein schriftliches Gebot von € 1.200,– vor: Der Auktionator ruft das Los mit € 800,– aus. Gibt es im Saal keinen Gegenbieter, erhält der schriftliche Bieter den Zuschlag bei € 800,–. Falls es im Saal Gegenbieter gibt, bietet der Auktionator für seinen schriftlichen Bieter bis maximal € 1.200,– und erteilt einem Gegenbieter im Saal erst bei mehr als € 1.200,– den Zuschlag.

Bieter 1: Limit € 2.900,– Bieter 2: Limit € 1.800,– Bieter 3: Limit € 800,– Nach der Versteigerungsordnung muss der Auktionator im Interesse von Bieter 1 und 2 angemessen überbieten (um ca. 5 bis 10 %). Der Ausrufpreis in der Auktion beträgt daher im Interesse von Bieter 1 € 1.900,– (obwohl die Schätzung € 1.000,– beträgt). Falls keine höheren Gebote aus dem Saal erfolgen, erhält Bieter 1 den Zuschlag für € 1.900,–. Das Höchstangebot von € 2.900,– musste nicht ausgeschöpft werden.

Beispiel 5 (Schätzpreis: € 1.000,–) Es liegen drei Gebote von je € 975,– vor: Um Missverständnisse zu vermeiden, überzieht der Auktionator das zuerst eingegangene Gebot geringfügig und erteilt den Zuschlag bei € 1.000,–.

Antworten auf Fragen, die uns oft gestellt werden • Zuschlagpreis/Aufgeld: Wir berechnen als Auktionshaus ein Aufgeld von 15 % auf den Zuschlagpreis, dazu kommt die gesetzliche Mehrwertsteuer. Beispiel 1

Zuschlagpreis Aufgeld 15 % Versandkosten, z. B. * MwSt. 7 % Rechnungs-Betrag

€ € € € €

100,00 15,00 5,90 8,46 129,36

Beispiel 2

Zuschlagpreis Aufgeld 15 % Versandkosten, z. B. * MwSt. 7 % Rechnungs-Betrag

€ 1.000,00 € 150,00 € 5,90 € 80,91 € 1.236,81

• Mehrwertsteuer: üblicherweise in Deutschland 7 %, seit dem 01.01.2000 sind viele Goldmünzen, die nach 1800 geprägt wurden, steuerfrei. Bei Fragen zu der MwSt.-Berechnung rufen Sie uns an, gebührenfrei unter: 0800 583 65 37. • Rücklosverkauf: Alle Lose, die in der Auktion nicht verkauft wurden, können Sie innerhalb von vier Wochen nach der Versteigerung zu 80 % des Schätzpreises (zzgl. Aufgeld und Mehrwertsteuer) erwerben. Achtung: Viele Rücklose sind schnell vergriffen. • Unser Spezialservice: Alle Bieter erhalten gratis die Ergebnisliste innerhalb von zwei Wochen nach der Auktion. Im Internet können Sie die Ergebnisliste der Auktion sofort nach der Auktion unter www.kuenker.de einsehen. * Die Kosten für Versand und Versicherung werden nach Aufwand berechnet.

Besuchen Sie uns doch einmal persönlich auf der Auktion! • Wir freuen uns sehr, wenn Sie persönlich nach Osnabrück kommen möchten. Das Flair einer Auktion und die Stimmung im Auktionssaal sind ein besonderes Erlebnis für Sie als Sammler. Osnabrück ist außerdem immer eine Reise wert und die persönliche Betreuung durch unsere Mitarbeiter wissen immer mehr Kunden zu schätzen. • Bitte rufen Sie uns rechtzeitig an, damit wir Ihnen Tipps für die Anreise geben und Ihnen ein Hotelzimmer reservieren können. Sie erreichen uns gebührenfrei unter: 0800 583 65 37. • Als erfolgreicher Bieter können Sie Ihre neu erworbenen Stücke gleich persönlich mit nach Hause nehmen. Als guter Kunde unseres Hauses haben Sie 20 Tage Zahlungsziel nach der Auktion.

TEL +49 (0)541 96 20 20, FAX +49 (0)541 96 20 222, SERVICE@KUENKER.DE, WWW.KUENKER.DE


Важная информация об участии на аукционе • Наши аукционные правила и условия Вы можете найти в конце каталога. • Мы просим Вас присылать Ваши ставки заранее. В противном случае вероятность ошибки при обработке заказа, присланного перед самым аукционом, возрастает. • Приложенный образец заполнения письменного заказа поможет Вам при отправлении Ваших письменных ставок. Ставки можно отправить как по почте, так и по факсу : +49 (0)541–96 20 222 круглосуточно. • Успешные заказы будут обрабатываться в порядке их поступления к нам. Все участники, которым не удалось что-либо купить на аукционе, будут также проинформированы после аукциона. • Если Вы впервые принимаете участие в нашем аукционе, то мы рекомендуем Вам сообщить нам Ваш референц – аукционные дома, с которыми Вы уже сотрудничали. Или свяжитесь с нами по телефону. • Мы гарантируем подлинность всех предметов, проданных на нашем аукционе, в течении неограниченного времени. • Все участники нашего аукциона получают в течении 2-ух недель результаты торгов бесплатно. • У Вас есть вопросы по определенной монете? Вы хотели бы лично принять участие в аукционе? У Вас возникли другие вопросы? Звоните нам по телефону +49 (0)541-96 20 268, и мы будем рады Вам помочь.

Мое заочное участие на аукционе • • • •

Тщательно изучите наш каталог и запишите те лоты, которые Вас заинтересовали. Определите для Себя ту максимальную сумму, которую Вы готовы заплатить за каждый лот. Заполните приложенный формуляр. Отправьте нам Ваш заказ заранее. При 2-ух и более равных ставок на один и тот же лот преимущество получает ставка, пришедшая к нам первой ( ранее других ). • Если стоимость выбранных Вами лотов составляет например 10.000 евро, а Вы могли бы потратить только 2.000 евро, то в этом случае укажите Ваш общий лимит в размере 2.000 евро. • Если у Вас возникли вопросы по заполнению формуляра, звоните нам по телефону +49 (0)541-96 20 268. Наши сотрудники будут рады Вам помочь.

Мое личное участие в Оснабрюке • Мы будем рады Вашему личному присутствию в Оснабрюке. Атмосфера, которая стоит во время аукционных торгов в зале, особенная и непередаваемая. • Для получения более подробной информации по Вашей поездке в Оснабрюк, в частности, бронирования номеров в гостинице, мы просим Вас заранее связаться с нами по телефону: +49 (0)541-96 20 268. • Приобретенные на аукционе лоты Вы можете лично забрать после окончания торгов. Наши постоянные клиенты осуществляют оплату в течение 20 дней после получения счета. Участвующие в аукционе впервые осуществляют 100%-ую предоплату.

Участие по интернету Все каталоги доступны для просмотра на нашем сайте в интернете по адресу www.kuenker.de. На сайте Вы можете выбрать интересующие Вас лоты и отправить Ваши ставки на нашу электронную почту service@kuenker.de. Если у Вас возникнут дополнительные вопросы, мы просим Вас связаться с нами по телефону +49 (0)5 41-96 20 268.

Участие по телефону Для участия в торгах по телефону просим Вас связаться с нами не позднее 48 часов до начала аукциона. Условием проведения телефонных торгов является письменное подтверждение ставки, равной как минимум стартовой цене. Участие в телефонных торгах возможно только для лотов со стартовой ценой свыше 500 евро. Для получения дополнительной информации и регистрации на аукционе звоните Анастасии Кепселль до аукциона по телефону +49 (0)5 41-96 20 268 и во время аукциона по телефону, указанному на первой странице каталога.

TEL +49 (0)541 96 20 20, FAX +49 (0)541 96 20 222, SERVICE@KUENKER.DE, WWW.KUENKER.DE


Как образовывается цена на аукционе? • Все лоты в нашем каталоге были предварительно оценены нашими экпертами. Минимальная ставка составляет 80 % от оценочной стоимости лота. Конечные цены зачастую намного превышают оценочные. • Ваши письменные ( заочные ) ставки должны быть обязательно обработаны нашими сотрудниками до начала аукциона. Рассмотрим несколько возможных примеров: Пример 1 ( Оценочная стоимость: € 1.000,– ) Заочных ставок нет. Аукционатор начинает торги с € 800,–. Если в зале только один человек, желающий приобрести этот лот, то соответственно он получит его за € 800,–. Пример 2 ( Оценочная стоимость: € 1.000,– ) У аукционатора имеются 3 заочные ставки: Заочный участник 1 : Лимит € 2.900,– Заочный участник 2 : Лимит € 1.800,– Заочный участник 3 : Лимит € 800,– По правилам аукциона аукционатор в интересах заочного участника 1 и 2 должен повышать ставку равномерно ( приблизительно на 5 – 10 % ). Поэтому в нашем случае в интересах заочного участника 1 аукционатор начнет торги с € 1.900,– ( хотя оценочная стоимость составляет € 1.000,–). Если среди очных участников никто не даст более высокую ставку, то заочный участник 1 получит этот лот за € 1.900,–. Его лимит в € 2.900,– ни в коем случае не будет исчерпан.

Пример 4 (Оценочная стоимость: € 1.000,– ) У аукционатора имеется только 1 заочная ставка в размере € 1.200,–. Аукционатор начнет торги с € 800,–. Если среди очных участников никто не даст более высокую ставку, то заочный участник получит этот лот за € 800,–. Если же в зале очный участник согласен на более высокую ставку ( больше € 800,– ), то в этом случае аукционатор в интересах заочного участника имеет право тоговаться до € 1.200,–. Следовательно только при ставке, превышающей € 1.200,–, данный лот получит очный участник в зале. Пример 5 (Оценочная стоимость: € 1.000,– ) У аукционатора имеются 3 заочные ставки, каждая в размере € 975,–. Среди очных участников интереса к лоту не имеется. В этом случае чтобы избежать недоразумений, аукционатор имеет право ненамного повысить лимит и сделать ставку равной € 1.000,–. Данный лот за € 1.000,– получит тот заочный участник, чей письменный формуляр мы получили раньше всего.

Пример 3 (Оценочная стоимость: € 1.000,– ) У аукционатора имеется только 1 заочная ставка в размере € 850,–. Аукционатор начнет торги с € 800,–. Если среди очных участников никто не даст более высокую ставку, то заочный участник получит этот лот за € 800,–.

Как я могу получить приобретенные лоты? Вывоз приобретенных на аукционе предметов осуществляется одним из следующих способов по Вашему выбору: • Вы можете лично забрать Ваши лоты. По окончании торгов мы готовим все необходимые документы на вывоз из Германии. При вывозе за пределы Евросоюза, НДС Вам возвращается. • Почтовые отправки в Россию ( Беларусь, Украину ) приобретенных Вами лотов осуществляются по предварительной договоренности. Для связи с нами звоните нам по телефону +49 (0)541-96 20 268. С 1971 года имя Кюнкер является гарантией надежности и компетентности. Мы не станем изменять нашим принципам и в будущем. Спасибо Вам за Ваше доверие, которое является не только самым сильным стимулом в нашей работе, но и наилучшей ее оценкой. Я желаю Вам успехов на нашем аукционе!

Фриц-Рудольф Кюнкер

TEL +49 (0)541 96 20 20, FAX +49 (0)541 96 20 222, SERVICE@KUENKER.DE, WWW.KUENKER.DE


Versteigerungsbedingungen Die Versteigerung erfolgt im Auftrag und für Rechnung der Eigentümer unter Einhaltung der sich aus der Versteigerungsordnung (BGB1 I 1976, 1346) ergebenden und für Kommissionäre geltenden gesetzlichen Bestimmungen des BGB und HGB gegen Barzahlung des Kaufpreises in €-Währung. Durch Abgabe eines Gebotes werden die Versteigerungsbedingungen anerkannt, dies gilt auch für die schriftlichen Gebote. Der Zuschlagpreis ist Nettopreis im Sinne des Umsatzsteuergesetzes und bildet die Berechnungsgrundlage für das vom Käufer zu zahlende Aufgeld in Höhe von 15 %. Auf den daraus entstehenden Gesamtpreis (Zuschlag + Aufgeld) wird die jeweils gültige Umsatzsteuer erhoben, soweit dies gesetzlich vorgeschrieben ist. Ausländischen Käufern aus Ländern der europäischen Gemeinschaft wird die in Deutschland gültige Umsatzsteuer berechnet. Anderen ausländischen Käufern (aus Drittländern) wird, sofern die Münzen durch uns exportiert werden, ein Aufgeld von 15 % netto auf den Zuschlagpreis berechnet; sie erhalten die Lieferung nur gegen Zahlung des Kaufpreises in €-Währung, bankspesenfrei. Ausländischen Münzhändlern aus Ländern der europäischen Gemeinschaft wird bei Nachweis der Umsatzsteuer-Identifi kationsnummer (§ 27 a USTG) und der sonstigen Voraussetzungen gemäß § 4 Nr. 1 b USTG in Verbindung mit § 6 a USTG die Lieferung ohne Umsatzsteuer berechnet. Sofern nichts anderes vereinbart wird, ist die Zahlung der Auktionsrechnung bei anwesenden Käufern sofort, bei schriftlichen Bietern spätestens 20 Tage nach Erhalt fällig. Bei Zahlungsverzug werden Zinsen von 1 % pro Monat berechnet. Wird die Zahlung nicht sofort an den Versteigerer geleistet oder die Abnahme der zugeschlagenen Sache verweigert, so findet die Übergabe der Sache an den Ersteigerer nicht statt. Der Ersteigerer verliert vielmehr seine Rechte aus dem Zuschlag, und die Sache kann auf seine Kosten erneut versteigert werden. In diesem Fall haftet der Ersteigerer für den Ausfall, dagegen hat er auf den Mehrerlös keinen Anspruch. Der Zuschlag erfolgt nach dreimaligem Ausruf des höchsten Gebotes und verpflichtet zur Abnahme und Zahlung. Bei Meinungsverschiedenheiten über den Zuschlag wird die Nummer noch einmal ausgerufen. Der Versteigerer ist berechtigt, Nummern zu vereinigen oder zu trennen. Eine Vorausnahme von Nummern erfolgt nicht. Der Zutritt zur Versteigerung ist nur Interessenten gestattet, die einen Katalog besitzen. Die Mindeststeigerungsstufen für das Bietungsverfahren betragen: Gebote

Mindeststeigerungsstufe

Schriftliche Aufträge werden von uns ohne Auftragsprovision gewissenhaft ausgeführt. Aufträge von uns unbekannten Sammlern können nur ausgeführt werden, wenn ein Depot hinterlegt wird oder Referenzen benannt werden. Schriftliche Gebote können nur bis 24 Stunden vor Auktionsbeginn verbindlich berücksichtigt werden. Im Bedarfsfall ist der Auktionator berechtigt, die Limits um 3 – 5 % zu überschreiten. Bei mehreren gleichhohen Geboten erhält das zuerst eingegangene den Zuschlag. Unlimitierte Aufträge haben keinen Anspruch auf unbedingte Ausführung. Telefonisches Bieten ist nur in Ausnahmefällen möglich. Telefonische Bieter müssen sich mindestens einen Werktag vor der Auktion voranmelden. Der Versand geht zu Lasten und auf Risiko des Ersteigerers bzw. Empfängers. Das Auktionsgut bleibt bis zur vollständigen Bezahlung aller Forderungen aus Anlass der Versteigerung Eigentum des Verkäufers. Ist der Käufer Vollkaufmann, so ist Osnabrück als Gerichtsstand vereinbart. Für das Mahnverfahren gilt die Zuständigkeit des Amtsgerichts Osnabrück auch in allen anderen Fällen als vereinbart. Ansonsten ist es Osnabrück nur, wenn nur die Firma Fritz Rudolf Künker GmbH & Co. KG ihren allgemeinen Gerichtsstand in der BRD hat, oder wenn alle Ansprüche im Wege des Mahnverfahrens geltend gemacht werden, oder wenn die im Klageweg in Anspruch zu nehmende Vertragspartei nach Vertragsabschluss ihren gewöhnlichen Aufenthaltsort aus dem Geltungsbereich der BRD verlegt hat, oder ihr Wohnsitz oder gewöhnlicher Aufenthaltsort zum Zeitpunkt der Klage nicht bekannt ist. Die Beschreibung im Katalog ist gewissenhaft durchgeführt. Sie begründet jedoch keine Rechts- oder Sachmängelhaftung gemäß §§ 434, 459 ff BGB. Die Angabe der Erhaltung ist streng nach den im deutschen Münzhandel üblichen Erhaltungseinstufungen vorgenommen und gilt als persönliche Beurteilung. Bei der Auktion anwesende Käufer kaufen grundsätzlich „wie besehen“. Da durch Vorbesichtigung Gelegenheit gegeben ist, sich vom Erhaltungszustand des Versteigerungsgutes zu überzeugen, können nach erfolgtem Zuschlag Reklamationen nur bei irrtümlich übersehener Henkel- oder Fassungsspur oder gestopftem Loch berücksichtigt werden. Bei Losen mit mehreren Stücken sind die Stückzahlen nur Circa-Angaben, irrtümliche Zuschreibungen sind im Einzelfall nicht ausgeschlossen. Diese Lose sind nach erfolgtem Zuschlag von jeder Reklamation ausgeschlossen. Der Versteigerer kann bei eventuellen Meinungsverschiedenheiten bzw. Beanstandungen einen vereidigten Sachverständigen seiner Wahl (die Kosten trägt der unterliegende Teil) beauftragen. Eventuelle Beanstandungen können nur innerhalb von 8 Tagen nach der Auktion bzw. nach Erhalt der ersteigerten Stücke berücksichtigt werden. Die Echtheit der Stücke wird bis zur Höhe des Kaufpreises garantiert. Die beigedruckten Preise sind Schätzpreise, die unter- oder überschritten werden können. Aufträge, die unter 80 % des Schätzpreises liegen, können nicht bearbeitet werden.

bis zu

€ 100,–

€ 5,–

bis zu

€ 200,–

€ 10,–

bis zu

€ 500,–

€ 20,–

bis zu

€ 1.000,–

€ 50,–

bis zu

€ 2.000,–

€ 100,–

Soweit nicht anders vermerkt, gelten im übrigen die allgemeinen Versteigerungsbestimmungen und – auch im Verhältnis zu ausländischen Kunden – gilt Deutsches Recht.

bis zu

€ 5.000,–

€ 200,–

Die Ergebnisliste erscheint sofort nach der Auktion.

bis zu

€ 10.000,–

€ 500,–

bis zu

€ 20.000,–

€ 1.000,–

bis zu

€ 50.000,–

€ 2.000,–

bis zu

€ 100.000,–

€ 5.000,–

ab

€ 100.000,–

€ 10.000,–

Ausländische Kunden kaufen nach den Devisen-, Zoll- und Steuerbestimmungen ihres Landes. Versandformalitäten werden vom Versteigerer erledigt.

Die Versteigerer:

Fritz Rudolf Künker Dr. Andreas Kaiser Arne Kirsch Oliver Köpp

TEL +49 (0)541 96 20 20, FAX +49 (0)541 96 20 222, SERVICE@KUENKER.DE, WWW.KUENKER.DE


Terms and Conditions of Auction The auction is conducted on behalf and for the account of the appropriate proprietors of the goods and is subject to the federal Auction Regulation (Versteigerungsordnung, BGB1 I 1976, 1346) published in the Federal Law Gazette Vol. I, 1976, 1346 and the relevant provisions for factors in accordance with the German Civil Code (BGB) and Commercial Code (HGB). Payment of the hammer-price has to be made in cash and in Euro. The submission of an offer implies the express acknowledgement of these Terms and Conditions of Auction; the same applies to the submission of an offer in writing. The hammer-price is exclusive of applicable German VAT according to the prevailing VAT-legislation and represents the basis for calculating the surcharge of 15 percent payable by the purchaser. The total price so calculated (hammer-price plus surcharge) is subject to the VAT (value added tax = Mehrwertsteuer), which is payable additionally. Purchasers from abroad will be charged a surcharge of 15 percent net on the hammerprice, provided the export of the coins is undertaken by the auctioneer. Buyers in European Community (EEC) countries (other than Germany) will be charged value added tax at the rates prevailing in Germany. Dealers from EEC countries (other than Germany) will receive goods free of tax upon presentation of their VAT ID number, and upon fulfillment of the other conditions set forth in Paragraph 4, Nr. 1 b, and Paragraph 6 a of the German Turnover Tax Law Buyers from other countries are not charged value added tax. Delivery will be made against payment in Euro with no bank charges to the auctioneer. Unless mutually agreed otherwise, payment of the auction bill from purchasers present at the auction is due immediately. From purchasers who have submitted a bid in writing, payment is due within 20 days after receipt of the goods. Defaulted payments shall bear an interest charge of 1 % per month in the amount in default. Should payment to the auctioneer not be made immediately or should the acceptance of the awarded item be refused, such item shall not be handed over to the purchaser. Instead the purchaser shall forfeit all right and title in and to such item from the award and the item may again be put to auction at this buyer’s cost. In this event the buyer shall be liable for any shortfall, while he shall have no right or claim towards any excess proceeds. An item will be knocked down after the highest bid has been called three times. The award shall be a binding commitment and liability on the part of the bidder to take acceptance and delivery of the item or items so awarded. In the event of any dispute with regard to the award the lot will be put up again for bidding. The auctioneer reserves the right to combine or to separate lots. Lots will not be called out of sequence. Access to the auction will only be permitted to interested persons who are in possession of the catalogue.

lot, the bid first received by the auctioneer shall be given the award. Unlimited bids shall not oblige the auctioneer to consider, accept or carry out such order. Telephone bidding is generally an option for lots of substantial value only. The registration is required at the latest a day before auction. Shipment (by mail or otherwise) of the goods shall be for the sole cost and risk of the purchaser or recipient, respectively. The auctioned goods remain the sole and exclusive property of the vendor until full payment and settlement of any and all dues and claims in connection with the auction. In the event the purchaser is a merchant (in the sense of the German commercial laws) Osnabrück shall be the agreed and exclusive place of jurisdiction. The competence of the District Court (Amtsgericht) of Osnabrück is agreed in respect of summary proceedings for the collection of defaulted payments (Mahnverfahren) as well as in any and all other cases. Should the purchaser not be a merchant Osnabrück shall be the place of jurisdiction with the District Court of Osnabrück’s competence, if only the auctioneer has his ordinary legal domicile in the Federal Republic of Germany or if claims are made by way of summary proceedings of collection (Mahnverfahren) or if the defendant has moved his ordinary legal domicile outside the jurisdiction of the Federal Republic of Germany or if the legal domicile of the defendant is unknown to the auctioneer at the time of filing a suit. To the exclusion of any other legislation German law, as in force at the time, shall be applied for the settlement of any and all legal or judicial matters. The specifications and descriptions in the catalogue have been prepared diligently and in good faith, however, do not constitute the acceptance by the auctioneer of any warranty or liability in respect of defect in material or title. The state of preservation of items is strictly assessed in accordance with the grades accepted by the German coin trade and only represents an individual and personal assessment. Purchasers present at the auction acquire items strictly on the basis of “as is where is” and “as inspected”. In view of the opportunity of prior inspection to ascertain the state and condition of the auction lots, complaints and objections made after the sale will only be considered, if by obvious error or mistake loop or traces or mountings, traces of trimmings or settings, or the plugging of a hole (eyelet) have remained unnoticed. If and when auctioned in lots, the quantities of individual pieces given, only represent an approximate figure. An error in the allocation of individual pieces to a certain lot cannot be excluded. Such lots are, therefore, excluded from any complaints or objections after the lot is knocked down. In the event of disputes or complaints as to the quality of an item the auctioneer may call upon a generally sworn expert of the trade, which the auctioneer may choose at his sole discretion, for assessment and the rendering of a decision as to the justification of such dispute or complaint. The costs of such expert shall be borne by the party loosing the dispute according to the expert’s decision. Complaints or objections, if justified, will only be considered if made and received by the auctioneer within 8 days after the auction or after receiving the lots, respectively.

The minimum rates of increase for the bidding procedure are: offers up to up to up to up to up to up to up to up to up to up to above

€ 100.– € 200.– € 500.– € 1,000.– € 2,000.– € 5,000.– € 10,000.– € 20,000.– € 50,000.– € 100,000.– € 100,000.–

minimum increase rate € 5.– € 10.– € 20.– € 50.– € 100.– € 200.– € 500.– € 1,000.– € 2,000.– € 5,000.– € 10,000.–

Orders submitted in writing will be carried out diligently and without charge of an extra commission. Orders from collectors unknown to the auctioneer can only be accepted and carried out if a deposit or references to the satisfaction on the auctioneer are given. To be bindingly accepted, written bids need to be received at least 24 hours before auction. If necessary, the auctioneer is allowed to increase the bids by 3 – 5 %. Should several bids be obtained in writing bidding the same price or prices for a given

The authenticity of the coins is warranted up to the total purchase price. The prices set out in the catalogue are estimates only, which may be exceeded or undercut. Orders for less than 80 per cent of the estimated price cannot be accepted. Purchasers from abroad will have to observe all applicable laws and regulations in respect of foreign exchange, customs duties and taxation of their country. The auctioneer will only discharge such formalities, which have to be observed, in the Federal Republic of Germany in connection with the export of the purchased item(s). Unless stipulated otherwise herein, the general rules regulations for auctions applicable in Germany shall govern any transaction in respect of the auction; German Law shall also be applicable in relation to purchasers from abroad. Only the German text has legal force. The prices realized will be published in the form of a list immediately after the auction. The auctioneers:

Fritz Rudolf Künker Dr. Andreas Kaiser Arne Kirsch Oliver Köpp

TEL +49 (0)541 96 20 20, FAX +49 (0)541 96 20 222, SERVICE@KUENKER.DE, WWW.KUENKER.DE


Numismatische Ausdrücke/Numismatic Terms/Expressions Numismatiques/ Termini di Numismatica/Нумизматические Термины DEUTSCH

ENGLISH

FRANCAIS

ITALIANO

RUSSKIJ

Abschlag Am Rand Berieben Blei Dezentriert Doppelschlag Einfassung Einseitig Emailliert Erhaltung Etwas Exemplar Fassungsspuren Fehlprägung

struck at the rim/border slightly polished lead uncentered double struck frame uniface enamelled condition/preservation slightly specimen, copy trace of mounting mis-strike

frappe en tranche frotté plomb décentré double frappe encadrement uniface émaillé conservation un peu exemplaire traces de monture défaut de frappe

coniazione al bordo trattato piombo non centrato ribattitura cornice uniface smaltato conservazione un poco esemplare tracce di montatura difetto di coniazione

Feld(er) Fundexemplar Gedenkmünze Geglättet Gelocht Geprägt Gewellt Goldpatina Henkelspur Hübsch Jahrh. = Jahrhundert Kl. = klein Korrosionsspuren Kratzer Kupfer Legierung Leicht(e) l. = links Min. = minimal Nachahmung Prachtexemplar Prägeschwäche Randdelle Randfehler Randschrift r. = rechts Rückseite

field(s) specimen from a hoard commemorative coin tooled holed minted bent golden patina mount mark attractive century small traces of corrosion scratch(es) copper alloy slightly left minimal imitation attractive, perfect piece weakly struck edge nick edge faults lettered edge to right reverse

champ exemplaire de trouvaille monnaie commémorative retouché troué frappé ondulé patine dorée trace de monture joli siècle petit traces de corrosion rayure cuivre alliage légèrement gauche minime imitation pièce magnifique de frappe faible défaut sur la tranche erreur sur la tranche tranche inscrite droite revers

campo da tesoretto moneta commemorativa liscio bucato coniato ondolato patina d´oro tracce di appicagnolo carino secolo piccolo segni di corrosione graffio(i) rame lega leggero sinistra minimamente contraffazione esemplare magnifico conio stanco ammaccatura al bordo errore nel bordo inscrizione sul bordo destra rovescio

оттиск на гурте потертая свинец ассиметричный двойной чекан кайма односторонняя эмалированная сохранность слегка экземпляр следы обработки ошибка в процессе чеканки поле экземпляр памятная монета отглаженная проколатая отчеканенная волнистая золотая патина следы от ушка красивая столетие маленький следы коррозии царапина медь сплав легкий слева минимальный имитация превосходный экземпляр издержкн при чеканкe вмятина на гурте ошибка на гурте гуртовая надпись справа реверс

TEL +49 (0)541 96 20 20, FAX +49 (0)541 96 20 222, SERVICE@KUENKER.DE, WWW.KUENKER.DE


DEUTSCH

ENGLISH

FRANCAIS

ITALIANO

RUSSKIJ

Schriftspuren

traces of inscription

traces de légende

tracce di leggenda

Schrötling Schrötlingsfehler Schwach ausgeprägt Selten in dieser Erhaltung

flan flan defect weakly struck rare in this condition

flan flan défectueux de frappe faible rare en cet état

tondello errore di tondello conio stanco conservazione rara

Seltener Jahrgang Stempel Stempelfehler Überdurchschnittlich erhalten Überprägt Unediert Unikum Vergoldet Von allergrößter Seltenheit Vorderseite Winz.= winzig Zain Zierrand Zinn ziseliert

rare year die(s) mistake in the die extraordinary condition

année rare coin erreur de frappe conservation extraordinaire

overstruck unpublished unique specimen gilt extremely rare averse tiny flan ornamental border tin chased

surfrappé inédit unique doré de toute rareté en face petit flan tranche ornée étain ciselé

annata rara conio errore di conio conservazione estraordinaria ribattuto inedito pezzo unico dorato di estrema raritá diritto veramente piccolo tondello taglio ornato stagno cesellato

следы предыдущей надписи заготовка брак заготовки слабо отчеканeна редкая в такой сохранности редкий год штамп ошибка штампа сохранность выше среднего перечекан неопубликованная монета уникальная позолоченная наиредчайшая аверс незначительный заготовка декоративный гурт цинк гравированный

Erhaltungsgrade/Grading Terms/Degrès de Conservation/Gradi di Conservazione/ Шкала сохранности DEUTSCH

ENGLISH

FRANCAIS

ITALIANO

RUSSKIJ

Polierte Platte Stempelglanz Vorzüglich Sehr schön Schön Gering erhalten

Proof Uncirculated Extremely fine Very fine Fine Very good

Flan bruni Fleur de coin Superbe Très beau Beau Très bien conservé

Fondo specchio Fior di conio Splendido Bellissimo Molto Bello Bello

полированная превосходная отличная очень хорошая хорошая удовлетворительная

Seltenheitsgrade/Rarity Terms/Degrés de Rareté/Grado di Raritá/ Шкала редкости DEUTSCH

ENGLISH

FRANCAIS

ITALIANO

RUSSKIJ

R = Selten RR = Sehr selten Von großer Seltenheit Von größter Seltenheit Von allergrößter Seltenheit Uneditiert

R = Rare RR = Very rare Very rare Extremely rare Extremely rare Unpublished

Rare Très rare De grande rareté Extrêmement rare De la plus extrême rareté Inédit

raro molto raro di grande raritá di grandissima raritá di estrema raritá inedito

редкая очень редкая большой редкости наибольшей редкости наиредчайшая ранее не описанная

TEL +49 (0)541 96 20 20, FAX +49 (0)541 96 20 222, SERVICE@KUENKER.DE, WWW.KUENKER.DE


IMPRESSUM NUMISMATISCHE BEARBEITUNG FOTOS LAYOUT DRUCK

Alexandra Spreu, Dr. Sebastian Steinbach, Jens Ulrich Thormann M. A., Eva Weber, Manuela Weiß Lübke & Wiedemann, Stuttgart danner pc - gesteuerte systeme waiblingen meister print und media, Kassel, Januar 2012 Jeglicher Nachdruck, auch auszugsweise, bedarf der Genehmigung des Auktionshauses

ZAHLUNGEN AUS DEM INLAND Deutsche Bank Osnabrück Commerzbank Osnabrück Sparkasse Osnabrück Volksbank eG Bad Laer-Borgloh-Hilter-Melle Bankhaus Lampe KG, Bielefeld Postbank Hannover HypoVereinsbank München WestLB Dortmund Oldenburgische Landesbank AG Oldenburg Paypal

(BLZ 265 700 90) Konto-Nummer 0 177 006 (BLZ 265 800 70) Konto-Nummer 780 520 200 (BLZ 265 501 05) Konto-Nummer 247 320 (BLZ 265 624 90) Konto-Nummer 1 200 222 400 (BLZ 480 201 51) Konto-Nummer 174 076 (BLZ 250 100 30) Konto-Nummer 2900 60-308 (BLZ 700 202 70) Konto-Nummer 24 17 952 (BLZ 440 500 00) Konto-Nummer 1128 842 (BLZ 280 200 50) Konto-Nummer 508 50338 00 paypal@kuenker.de, Service charge: 3,5 %

ZAHLUNGEN AUS DEM AUSLAND FOREIGN PAYMENTS Deutsche Bank Osnabrück Sparkasse Osnabrück Postbank Hannover Credit Suisse Credit Cards Paypal

IBAN: DE11 2657 0090 0017 7006 00 Swift-Code: DEUTDE3B265 IBAN: DE50 2655 0105 0000 2473 20 Swift-Code: NOLADE22XXX IBAN: DE73 2501 0030 0290 0603 08 Swift-Code: PBNKDEFF IBAN: CH43 0483 5177 3509 0200 0 Swift-Code: CRESCHZZ80A We do accept VISA and MASTERCARD, Service charge: 4,5 % paypal@kuenker.de, Service charge: 3,5 %

ZAHLUNGEN INNERHALB RUSSLANDS PAYMENTS WITHIN RUSSIA Deutsche Bank Moskau ʽʽʽΗʪ̸̨̜̖ʥ̡̦̌Η

ИНН 7728717332; КПП 772801001 Получатель: ЗАО "Кюнкер" счет №: 40702810500000000825; БИК: 044525101 корсчет №: 30101810100000000101

Auktion 209  

Russische Münzen und Medaillen, Deutsch Münzen ab 1871

Read more
Read more
Similar to
Popular now
Just for you