Page 1


6KVGNHQVQ 0T   TÜRKEI 'Abd al-Majîd Khan, 1255-1277 H. (1839-1861).  500 Kurush 1255 H., 18, Qustantînîya. 36,03 g.

(D-/¤NEGT2GTG


AUKTION 199 THE SULTAN COLLECTION An Old Private Collection of Ottoman Coins, Part 1 Münzen des Ottomanischen Reiches, Teil 1 ZEIT

Dienstag, 13. Dezember 2011 13.30 Uhr - 18.00 Uhr Nr. 1 bis Nr. 908

ORT

Steigenberger Hotel Remarque Osnabrück, Natruper-Tor-Wall 1

AUKTIONS-TELEFON

+49 (0)541 60 96 633

AUKTIONS-FAX

+49 (0)541 60 96 634 in Zusammenarbeit mit:

NUMISART Roland Michel 18, place du Manoir CH - 1223 Cologny - Genève Schweiz Telefon +41 (0)22 73 67 593 Fax +41 (0)22 73 50 210 numisart@bluewin.ch www.numisart.ch

Auktionen 199-200, Dezember 2011 13. DEZEMBER 2011

Auktion 199 The Sultan Collection An Old Private Collection of Ottoman Coins, Part 1 Münzen des Ottomanischen Reiches, Teil 1

14. DEZEMBER 2011

Auktion 200 Sammlung Vogel, Hamburg Teil 1: Deutsche Goldmünzen - Komplette Sammlung Reichsgoldmünzen Papiergeld


Sehr geehrte Münzfreunde/Dear Coin Collectors, Ich wünsche Ihnen viel Freude mit unseren neuen Auktionskatalogen und hoffe, Sie finden einige schöne Stücke für Ihre Sammlung. Als Europas führendes Auktionshaus für Münzen, Medaillen und Orden hat sich unser Dienstleistungsspektrum für Sie als unsere Kunden stetig verbessert und erweitert. Einen kleinen Überblick über unsere Angebote finden Sie hier. I wish you a lot of pleasure with our new auction catalogues and I hope you will find a few additonal items for your collection. As Europe´s leading auction company for coins, medals and decorations our range of services for our customers has been steadily improving and expanding. Following is a short overview of our offers. Mit herzlichen Grüßen/With warm regards

Friti z Ru Frit Fr Rudo dolflff K do Kün ünke ün ker ke ker

AUKTIONEN/AUCTIONS Besuchen Sie unsere international bedeutenden Auktionen, die Ihnen viermal jährlich zahlreiche Raritäten bieten. Profitieren Sie als Bieter oder Einlieferer von unserer Erfahrung und Kompetenz. Visit our internationally recognized auctions which take place four times a year and offer many rarities. Benefit from our experience and competence while being a bidder or consigner. GOLDHANDEL/GOLD COIN TRADING Wir bieten Ihnen ein ständiges Angebot sowie den Ankauf von Anlagemünzen aus Deutschland, Europa und aller Welt zu fairen tagesaktuellen Preisen. We are constantly offering as well as purchasing a vast range of German, European and World bullion coins. We buy and sell gold assets at a fair, daily updated market price. ONLINE-SHOP Wir bieten Ihnen in unserem Online-Shop auf www.kuenker.de ein täglich aktualisiertes Münz-Angebot von der Antike bis zur Neuzeit. Kaufen Sie hier unkompliziert zum Festpreis und ohne Risiko. We offer you an exclusive daily updated selection of coins from ancient to modern times. You can order at www.kuenker.com without hassle or risk. eLIVE AUCTION Mit unseren eLive Auctions können Sie über das Internet an regelmäßigen Auktionen mit einem virtuellen Auktionator teilnehmen. Sie können Vorgebote bequem online abgeben und abschließend die Auktion live am Bildschirm für sich entscheiden. With our eLive Auctions, we offer you an opportunity to participate in regular auctions live over the Internet. You can submit preliminary bids online, and up to the last moment of the sale you can win auctions live on your computer screen. ORDEN UND EHRENZEICHEN/ORDERS AND DECORATIONS Einmal im Jahr findet unsere besondere Ordensauktion statt, die sich ganz den dekorativen Ehrenzeichen widmet. Profitieren Sie als Bieter oder Einlieferer von unserer Erfahrung und Kompetenz im Bereich Phaleristik. Once a year there is a special auction dedicated to medals and decorations. Benefit from our experience in the field of phaleristik becoming our bidder or consigner.

TEL +49 (0)541 96 20 20, FAX +49 (0)541 96 20 222, SERVICE@KUENKER.DE, WWW.KUENKER.DE

3


Besichtigung/On View Das Auktionsgut kann nach Vereinbarung besichtigt werden. Auction lots may be viewed by appointment only.

Online-Katalog/Online Catalogue

KUENKER.DE

Betrachten Sie unsere Auktionskataloge im Internet! Unter www.kuenker.de und www.sixbid.com haben Sie die Möglichkeit, Abbildungen zu vergrößern, Ihre Gebote direkt abzugeben und die Ergebnisse der Auktionen abzurufen. Please browse our auction catalogues at www.kuenker.com or at www.sixbid.com! You will have the possibility to zoom all images, to place your bids and to view all auction results online.

Künker-Service Wir sind mittlerweile mit neun eigenen Standorten in Deutschland und Europa vertreten. So können wir Ihnen unseren beliebten Künker-Service auch in Ihrer Nähe anbieten. Unsere Leistungen vor Ort: • Persönliche Beratung und Betreuung in Ihrer Nähe. • Sie können Ihre Münzen direkt einliefern oder verkaufen, ersteigerte Münzen abholen und sich nach Vereinbarung Einlieferungen auszahlen lassen. • Sie können sich von unserem Kooperationspartner auf den Künker-Auktionen vertreten lassen. We are now represented with nine locations in Germany and Europe so that we can also provide you the best service in your vicinity. Our local services: • You always have a point of contact nearby. • You can directly consign or sell your coins, collect purchases and receive by appointment payment for consignments. • You can have our cooperation partner represent you at our auctions.

OSNABRÜCK Fritz Rudolf Künker GmbH & Co. KG Gutenbergstraße 23, 49076 Osnabrück Tel. +49 (0)541 96 20 20, E-Mail: service@kuenker.de Haupptstsit Ha sititzz in Osnabbrüückk

4

USt-IdNr./VAT-No: DE256270181

TEL +49 (0)541 96 20 20, FAX +49 (0)541 96 20 222, SERVICE@KUENKER.DE, WWW.KUENKER.DE


Standorte/Locations

Drr. H D Huubert rt R Ruß uß

Fraannk Ri Fr Rich chharrds dsen en en

MÜNCHEN Künker Numismatik AG Löwengrube 12, 80333 München Dr. Hubert Ruß Tel. +49 (0)89 242 198 38, service@kuenker-numismatik.de Fritz Rudolf Künker GmbH & Co. KG Maximiliansplatz 12a, 80333 München Frank Richardsen Tel. +49 (0)89 242 16 990, frank.richardsen@kuenker.de BERLIN Fritz Rudolf Künker GmbH & Co. KG Poststraße 22, 10178 Berlin-Mitte Wollankstraße 117, 13187 Berlin-Pankow Michael Otto Tel. +49 (0)30 247 248 91, michael.otto@kuenker.de

M ch Mi chae aell Ot Otto tttoo

Rolaand nd Trraam mppe

HAMBURG Künker Hamburg, c/o Roland Trampe Roland Trampe Tel. +49 (0)541 96 20 20, roland.trampe@kuenker.de KONSTANZ Künker Konstanz, c/o Michael Autengruber Schulthaißstraße 10, 78462 Konstanz Michael Autengruber Tel. +49 (0)7531 28 44 69, michael.autengruber@kuenker.de

Michaeel Autengruubeer

Petr Kov Pe ovaljo jov

ZNOJMO Künker Znojmo, c/o Petr Kovaljov 17. Listopadu 18, 66902 Znojmo, Tschechische Republik Petr Kovaljov Tel. +42 (0)603 81 10 31, petr.kovaljov@kuenker.de ZÜRICH Künker Zürich, c/o Hess-Divo AG Löwenstraße 55, 8001 Zürich, Schweiz Ulf Künker Tel. +41 (0)44 225 40 90, zuerich@kuenker.de

Allekse Alek ekkseseyy O Onncchhuukkovv

MOSKAU Künker Moskau, c/o Russian Coin Co. Ltd. 2/21 Makarenko St., 123001 Moskau, Russland Aleksey Onchukov Tel. +7 (495) 589 56 10, aleksey.onchukov@kuenker.de

TEL +49 (0)541 96 20 20, FAX +49 (0)541 96 20 222, SERVICE@KUENKER.DE, WWW.KUENKER.DE

5


Was ist für Ihre schriftliche Auktionsteilnahme besonders wichtig?

DEUTSCH

• Bitte senden Sie uns Ihre Aufträge möglichst frühzeitig zu. Wenn uns Ihr Auftrag erst kurz vor der Auktion erreicht, können sich bei der Bearbeitung Fehler einschleichen. Das beiliegende Formular erleichtert Ihnen die Abgabe eines schriftlichen Gebots. Gerne nehmen wir Ihre Gebote per Post, Fax oder Email entgegen. • Wenn Sie noch nicht bei uns gekauft haben, bitten wir Sie, uns als Referenz eine Münzhandlung anzugeben, mit der Sie bereits in Geschäftsverbindung stehen. • Wir gewährleisten die Echtheit aller verkauften Objekte auch über die gesetzliche Frist hinaus.

Sie möchten telefonisch an der Auktion teilnehmen? Die telefonische Teilnahme an der Auktion ist bei uns selbstverständlich möglich. Wir rufen Sie während der Auktion gerne an und helfen Ihnen, die gewünschten Stücke zu ersteigern. Aus organisatorischen Gründen bitten wir Sie, die folgenden Punkte zu beachten:

Ulrich Künker Leiter Kundenbetreuung

• Telefonisches Bieten ist nur bei Losen mit einer Taxe von mind. € 500,– möglich. • Bitte teilen Sie uns mindestens 48 Stunden vor der Auktion mit, zu welchen Stücken Sie angerufen werden möchten. • Bitte achten Sie darauf, dass Sie erreichbar sind, wenn Ihre Stücke versteigert werden. Der Zeitplan in diesem Katalog hilft Ihnen dabei, den Zeitpunkt der Versteigerung abzuschätzen. • Für den Fall, dass wir Sie nicht erreichen können, bieten wir in Ihrem Namen bis zur Höhe Ihres schriftlichen Gebotes, mindestens aber bis zur Höhe des Schätzpreises. • Bitte beachten Sie, dass telefonisches Bieten eine unsichere Variante der Auktionsteilnahme sein kann. Wir können keine Garantie für das Zustandekommen der telefonischen Verbindung übernehmen. Wenn Sie sicher gehen wollen, besuchen Sie bitte unsere Auktion persönlich oder geben Sie uns ein schriftliches Gebot.

Was passiert nach der Auktion? Barbara Westmeyer deutschsprachige Kundenbetreuung

Telefon: +49 (0)541 96 20 20 Fax: +49 (0)541 96 20 222 Gebührenfrei: 0800 58 36 537 E-Mail: service@kuenker.de Internet: www.kuenker.de Montag – Donnerstag 8.30 – 17.00 Uhr Freitag 8.00 – 15.30 Uhr

6

• Der Versand der Auktionsware startet sofort nach Beendigung der Auktion und dauert in der Regel 8 Tage. • Alle Kunden, die an unserer Auktion schriftlich teilgenommen haben, erhalten innerhalb von 2 Wochen nach der Auktion unsere Ergebnisliste gratis. • Alle Ergebnisse sind spätestens einen Tag nach Auktionsende auf unserer Internetseite verfügbar.

Sie möchten Ihre Münzen in unsere Auktion einliefern? Sollten Sie sich zum Verkauf Ihrer Münzen entschlossen haben, kommen Sie zu uns. Seit 1985 beweisen wir mit derzeit 4 Auktionsterminen und ca. 15 Katalogen pro Jahr unsere Kompetenz und Zuverlässigkeit. Wichtige Informationen für Sie im Überblick: • Ihre Münzen werden von unseren Experten nach neuestem numismatischem Standard bestimmt und in hochwertigen Farbkatalogen präsentiert. • Wir verfügen mit mehr als 10.000 Kunden über eine der besten Kundendateien weltweit. Im Durchschnitt verkaufen wir mehr als 95 % der Stücke einer Auktion, nicht selten erzielen wir dabei Rekordzuschläge. Für nicht verkaufte Objekte werden keine Gebühren erhoben. • Ab der Übergabe an uns sind Ihre Münzen mit dem doppelten Schätzwert versichert. Unsere Kundenbetreuung bespricht gerne mit Ihnen wie Ihre Stücke sicher zu uns gelangen können. • Ihre Einlieferung wird Ihnen sofort nach der Übernahme quittiert. Spätestens 5 Wochen vor der Auktion erhalten Sie eine Auflistung Ihrer Stücke inkl. Katalognummern und Schätzpreisen. • Unmittelbar nach der Auktion erhalten Sie die Ergebnisliste und können dann alle erzielten Preise feststellen. Den Auktionserlös erhalten Sie innerhalb von 45 Tagen nach der Auktion.

TEL +49 (0)541 96 20 20, FAX +49 (0)541 96 20 222, SERVICE@KUENKER.DE, WWW.KUENKER.DE


Important facts for a written participation in the auction • Please send us your instructions as early as possible. The likelihood of errors occurring increases if we receive your instructions only shortly before the auction. The enclosed form should make it simple for you to submit a written bid, you may send your bids by mail, fax or e-mail. • If you are a new customer who has not yet purchased from us, we do request references. Please name a coin dealer with whom you have already done business. • The genuineness of all objects sold is warranted beyond the statutory length of time.

ENGLISH

Do you wish to participate by telephone? You are welcome to participate in our auction by telephone. We are glad to call you during the auction and to assist you in bidding for your items. Please take notice of the following conditions: • Telephone bidding is accepted exclusively on lot numbers with estimates at 500 Euro or above. • Please inform us at least 48 hours in advance if you wish to register for telephone bidding, even for single lots. We do need 48 hours to schedule all incoming requests. • Please be available, when your lots will be sold. The time schedule in the catalogue will help you to estimate the approximate time when your items are going to be sold. • Should you not be available by phone, we will bid on your behalf up to your submitted written limit or at least up to the estimate of the lot for which you requested to be called. • Please be aware that telephone bidding is a risky way of participation in our auction. We do not assume liability should the telephone line be interrupted or not be achieved. We advise you to attend the auction in person or to send written bids.

Nadine Zuber English, Deutsch

What occurs after the auction? • The shipment of all auction goods starts immediately after the completion of the entire auction week and it usually takes 8 days to be completed. • All auction results are available on our website one day after the end of the auction week. • All clients who submitted bids for the auction will automatically receive the list of auction results free of charge within two weeks after the end of auction.

Do you wish to consign your coins to our auction? Should you decide to sell your coins, we are ready to assist you. Since 1985 we have earned our bona fides in conducting over 4 auctions and in publishing 15 catalogues per year. In the following you will find the most important information on consigning: • We guarantee the professional handling of your consignment following the latest numismatic level of expertise including its presentation in colour catalogues of outstanding quality. • We possess one of the best customer lists worldwide. On average we sell more than 95 % of all items in our auction, and it is not unusual for us to achieve record hammer prices for lots submitted. Unsold items incur no fees. • Once the coins are consigned they are covered by our insurance at double the estimate. Upon consultation with our customer service we try to advise you on the safest way of shipping for your coins. • Your delivery will be confirmed in writing immediately on receipt. At least five weeks before the auction, you will receive an exact list of your objects with the relevant catalogue numbers and descriptions. • Within a week of the end of auction, you will receive a list of auction results in order to see what prices were reached for each individual lot. As a consignor, you will receive the auction proceeds within 45 days after the end of auction.

Marion Künker English, Deutsch

Phone: +49 (0)541 96 20 20 Fax: +49 (0)541 96 20 222 E-Mail: service@kuenker.de Website: www.kuenker.com Monday –Thursday 8.30 AM – 5 PM Friday 8 AM – 3.30 PM

TEL +49 (0)541 96 20 20, FAX +49 (0)541 96 20 222, SERVICE@KUENKER.DE, WWW.KUENKER.DE

7


Votre participation par écrit – Les points essentiels

FRANCAIS

• Veuillez nous faire parvenir vos ordres le plus tôt possible. Si vos ordres nous parviennent juste avant la vente aux enchères, des erreurs risquent d’être commises lors de leur traitement. Le formulaire ci-joint vous aidera à rédiger facilement votre offre. Vous pouvez nous envoyer vos ordres par la poste, par fax ou par e-mail. • Si vous n’avez encore fait aucune acquisition chez nous, nous vous prions de nous indiquer une ou deux références d’autres maisons numismatiques où vous avez déjà acheté. • L’authenticité des pièces vendues est garantie même au-delà des délais légaux.

Vous voulez participer par téléphone? La participation par téléphone est bien sûr possible. Nous vous appelons volontiers pour vous aider à acquérir les pièces voulues. Pour des raisons d´organisation veuillez noter les points suivants:

Alexandra Elflein, M. A. Français, Deutsch, English, Italiano

• La participation par téléphone est possible seulement pour les lots estimé à plus de 500 Euros chacun. • Veuillez nous informer au moins 48 heures avant la vente de la liste des pièces pour lesquelles vous voudriez être appelé. • Veuillez prendre soin d´être joignable quand vos pièces seront mises en vente. L’ordre de vente dans ce catalogue vous aidera à estimer l´heure de la vente. • Dans le cas où nous ne parviendrions pas à vous joindre, nous enchérirons pour vous jusqu’au montant que vous nous indiquez par écrit, égal ou supérieur au prix d’estimation. • La participation par téléphone présente des risques, et nous déclinons toute responsabilité dans le cas où la communication téléphonique serait interrompue, ou bien ne pourrait être établie.

Ce qui se passe après la vente Kmar Chachoua Français, Deutsch, English, Arabic

Tél. +49 (0)541 96 20 20 Facs. +49 (0)541 96 20 222 E-Mail: service@kuenker.de Site: www.kuenker.de Lundi à Jeudi de 8h30 à 17h00 Vendredi de 8h00 à 15h30

8

• L´expédition des biens va commencer immédiatement après la fin de la vente complète, et prend généralement 8 jours. • Tous les clients qui ont participé à l’une de nos ventes aux enchères recevront gratuitement une liste de résultats dans les deux semaines qui suivent. • Les résultats seront disponibles sur notre site internet, au plus tard un jour après la fin de la vente.

Vous voulez confier vos monnaies pour nos ventes aux enchères? Contactez nous si vous envisagez de vendre vos pièces. Notre compétence et fiabilité est prouvée depuis 1985 par actuellement 4 ventes aux enchères et environ 15 catalogues par an. Le plus important pour vous est que: • Vos pièces seront décrites par notre équipe d’experts selon les standards numismatiques les plus récents, et elles seront présentées dans des catalogues de haute qualité en couleurs. • Nous avons un des meilleurs fichiers-clientèle du monde avec plus de 10.000 clients. Nous vendons en moyenne plus de 95% de la vente aux enchères, et obtenons souvent des prix records. Les monnaies invendues n’encourent aucun frais. • Notre service clientèle est disponible pour vous conseiller pour l’envoi de vos pièces, et dès leur réception vos pièces seront assurées pour le double de la valeur d´estimation. • Vous recevrez une liste détaillée des pièces fournies au moment de la prise en charge puis, au plus tard cinq semaines avant la vente aux enchères, vous recevrez leur liste exacte avec les numéros de catalogue correspondants. • Immédiatement après la vente aux enchères, vous recevrez la liste des résultats et pourrez prendre connaissance des prix obtenus. Vous recevrez le produit de la vente dans les 45 jours après les enchères.

TEL +49 (0)541 96 20 20, FAX +49 (0)541 96 20 222, SERVICE@KUENKER.DE, WWW.KUENKER.DE


I punti piú importanti per la Sua partecipazione per iscritto • La preghiamo di farci pervenire i Suoi ordini al piú presto possibile. Se i Suoi ordini ci arrivano poco prima dell´inizio dell´asta possono verificarsi errori. Il formulario allegato Le faciliterá l´invio dei Suoi ordini per iscritto. Ci puó far pervenire i Suoi ordini per posta, per fax o per email. • Se non ha mai acquistato presso di noi, La preghiamo di volerci indicare a titolo di referenza il nome di uno o due commercianti numismatici presso i quali è giá cliente. • L’autenticità di tutti gli oggetti venduti viene garantita anche oltre i termini previsti dalla legge.

ITALIANO

Desidera partecipare telefonicamente alla nostra asta? La partecipazione telefonica è naturalmente da noi possibile. La chiameremo durante l´asta e La assisteremo volentieri per ottenere l´aggiudicazione dei pezzi desiderati. Per motivi di organizzazione La preghiamo di voler tenere conto dei seguenti punti: • La partecipazione telefonica è possibile solo per lotti stimati con almeno 500,– € l´uno. • La preghiamo di volerci comunicare almeno 48 ore prima dell´inizio dell´asta per quali pezzi desidera essere chiamato. • La preghiamo di aver cura di essere raggiungibile telefonicamente al momento in cui vengono messi all´asta i pezzi che Le interessano. Lo schema orario in catalogo La aiuterá a stimare a che ora verranno messi all´asta i pezzi che Le interessano. • Nel caso in cui non riuscissimo a contattarLa telefonicamente, provvederemo ad offrire a Suo nome fine all´importo massimo indicatoci per iscritto, in ogni caso offriremo a Suo nome come minimo il prezzo di stima. • La partecipazione telefonica è un modo incerto di partecipare alle aste. Non assumiamo nessuna responsabilità se per esempio la linea telefonica è occupata o interrotta o se Lei non sará raggiungibile per altri motivi.

Sonia Russo, M. A. Italiano, Deutsch, English, Español

Cosa succede dopo l´asta? • La spedizione del materiale d´asta comincia subito dopo la fine dell´intera asta e termina normalmente entro 8 giorni. • Tutti i clienti che hanno partecipato all´asta ricevono entro 2 settimane dopo l´asta la lista dei prezzi di realizzo. • I prezzi di realizzo sono visionabili sul nostro sito internet al piú tardi un giorno dopo la fine dell´intera asta.

Vuole consegnarci le Sue monete per una nostra asta? Ci contatti se ha deciso di vendere le Sue monete. Dal 1985 la nostra competenza ed affidabilità è dimostrata da attualmente 4 aste e circa 15 cataloghi all´anno. Quali sono i punti di maggior importanza per Lei:

Cristina Welzel Italiano, Deutsch, English, Français

Tel.: +49 (0)541 96 20 20 Fax: +49 (0)541 96 20 222 E-Mail: service@kuenker.de Internet: www.kuenker.de Lunedì a giovedì dalle 8.30 alle 17.00 Venerdì dalle 8.00 alle 15.30

• Le Sue monete vengono valutate dal nostro staff di esperti secondo i piú attuali standard numismatici e vengono presentati in cataloghi di alto valore a colori. • Con piú di 10.000 clienti disponiamo di una delle migliori banca dati clienti del mondo. In media vendiamo oltre il 95% del materiale d´asta realizzando spesso prezzi da record. Per i pezzi invenduti non ci sono nessune spese da pagare. • Dal momento della consegna le Sue monete sono assicurate per il doppio del valore di stima. Il nostro servizio clientela Le consiglierá volentieri come farci avere le Sue monete nel modo piú sicuro. • La Sua consegna Le verrá immediatamente quietanzata al momento della resa dei pezzi. Al piú tardi 5 settimane prima dell´asta riceverá una lista dettagliata dei Suoi pezzi con i numeri di catalogo ed i prezzi di stima. • Subito dopo l´asta riceverá la lista con i risultati d´asta dalla quale potrá subito controllare i prezzi realizzati. Riceverá l´importo di realizzo entro 45 giorni dopo la fine dell´asta.

TEL +49 (0)541 96 20 20, FAX +49 (0)541 96 20 222, SERVICE@KUENKER.DE, WWW.KUENKER.DE

9


Что особенно важно при заочном участии на аукционе?

RUSSKIJ

• Тщательно изучите наш каталог и запишите те лоты, которые Вас заинтересовали. Заполните приложенный формуляр и отправьте нам его заранее по почте, факсу или электронной почте. Мы обращаем внимание на то, что если Ваши ставки придут перед самым началом аукциона либо во время аукциона, то существует вероятность допуска ошибки в процессе обработки заказа. • Если Вы впервые принимаете участие в нашем аукционе, то мы рекомендуем Вам указать Ваш референц – аукционные дома, с которыми Вы уже сотрудничали. Или свяжитесь с нами по телефону +49(0)541 9620268. • Подлинность купленных на нашем аукционе лотов гарантируется нами на протяжении неограниченного времени.

Вы хотели бы принять участие на аукционе по телефону? У нас, конечно, есть возможность организовать Ваше телефонное участие на торгах, но мы бы хотели обратить внимание на следующие пункты: Anastasija Koepsell Russkij, Deutsch

• Участие в телефонных торгах возможно только для лотов со стартовой ценой свыше 500 евро. • Для участия в торгах по телефону просим Вас связаться с нами не позднее 48 часов до начала аукциона. • Мы хотим подчеркнуть, что телефонное участие на аукционе – не самый безопасный способ: в случае плохой связи, недоступности клиента во время торгов либо других технических проблем мы не несем ответственности.

Что происходит после окончания аукциона?

Dzmitry Nikulin Russkij, Deutsch, English

Телефон: +49 (0)541 96 20 20 Факс: +49 (0)541 96 20 222 E-Mail: service@kuenker.de интернет: www.kuenker.de понедельник – четверг 8.30 – 17.00 пятница 8 – 15.30

10

• Результаты аукционов доступны на нашем сайте на следующий день после окончания торгов. • Вы можете лично забрать приобретенные лоты. По окончании торгов мы готовим все необходимые документы на вывоз из Евросоюза. • Почтовые отправки в Россию ( Беларусь, Украину ) осуществляются по предварительной договоренности. Для связи с нами звоните по телефону +49 (0)541 9620268.

Вы хотели бы выставить Ваши предметы на аукцион? Более 160-ти успешно проведенных аукционов, тысячи участников, 4 аукциона в год - эти и другие преимущества, которые говорят в пользу выставления Ваших коллекций на аукцион Кюнкер: • Ваши монеты будут оценены нашими экспертами по самым новым нумизматическим стандартам и представлены в высококачественном цветном каталоге. • Более 10000 клиентов со всего мира оказывают нам свое доверие. В среднем мы продаем более 95% всех выставляемых предметов, при этом зачастую достигая рекордных сумм. • Все Ваши предметы, после передачи их нам, хранятся у нас до начала аукциона застрахованными. Не позднее 5-ти недель до начала аукциона Вы получите по почте подробное описание Ваших лотов с указаннами номерами в каталоге, а также их оценочной стоимостью. • Результаты аукционов также будут высланы Вам по почте после окончания торгов. В течение 45 дней после аукциона Вам будет выплачено Ваше вознаграждение.

TEL +49 (0)541 96 20 20, FAX +49 (0)541 96 20 222, SERVICE@KUENKER.DE, WWW.KUENKER.DE


INHALT AUKTION 199 Nr.

Seite

THE SULTAN COLLECTION

1

-

908

19

-

161

'Abd al-Majîd Khan, 1255-1277 H. (1839-1861)

1

-

204

19

-

48

1

-

23

21

-

23

1

-

13

21

-

22

14 24

-

23 204

22 23

-

23 48

24

-

59

23

-

27

60

-

93

27

-

32

94

-

105

33

-

34

106

-

108

34

109

35

Münzen vor der Münzreform von 1845 Goldprägungen der Münzstätte Qustantînîya Silberprägungen der Münzstätte Qustantînîya

Münzen nach der Münzreform von 1845 Goldprägungen der Münzstätte Qustantînîya Silberprägungen der Münzstätte Qustantînîya Kupferprägungen der Münzstätte Qustantînîya Goldene Städtebesuchsprägungen der Münzstätte Edirne Eine Kupfermünze der Münzstätte Baghdad Goldprägungen der Münzstätte Misr (Kairo) Silberprägungen der Münzstätte Misr (Kairo) Kupfermünzen der Münzstätte Misr (Kairo) Goldprägungen der Münzstätte Tûnis Silberprägungen der Münzstätte Tûnis Kupferprägungen der Münzstätte Tûnis Algerien. Aufstand des 'Abd al-Qâdir gegen die Franzosen 'Abd al-'Azîz Khan, 1277-1293 H. (1861-1876) Goldprägungen der Münzstätte Qustantînîya

110

-

139

35

-

38

140

-

163

38

-

42

164 170 177 196

-

169 176 195 202

42 43 44 47

-

43 44 47 48

203

-

204

205

-

382

49

-

75

205

-

236

50

-

54

237

-

256 257

54

-

56 57

48

Silberprägungen der Münzstätte Qustantînîya

Eine silberne Schmuckmünze Kupferprägungen der Münzstätte Qustantînîya Prägungen auf den Städtebesuch in Brûsa (Bursa) Goldprägungen der Münzstätte Misr (Kairo) Silberprägungen der Münzstätte Misr (Kairo) Eine Nickelprobe zu 80 Para Kupferprägungen der Münzstätte Misr (Kairo)

258

57

259

-

264

57

-

58

265

-

299

58

-

63

300

-

333 334

63

-

67 67

335

-

343

67

-

69

11


Nr. Goldprägungen der Münzstätte Tûnis Silberprägungen der Münzstätte Tûnis Kupferprägungen der Münzstätte Tûnis Goldprägungen der Münzstätte Kâshghar Silberprägungen der Münzstätte Kâshghar Eine Kupfermünze der Münzstätte Kûcha Murâd V., 1293 H. (1876) Goldprägungen der Münzstätte Qustantînîya Silberprägungen der Münzstätte Qustantînîya Goldprägungen der Münzstätte Misr (Kairo) Eine Silberprägung der Münzstätte Misr (Kairo) Eine Silberprägung der Münzstätte Tûnis 'Abd al-Hamîd Khan II., 1293–1327 H. (1876 - 1909) Goldprägungen der Münzstätte Qustantînîya Ziynet-Prägungen der Münzstätte Qustantînîya Silberprägungen der Münzstätte Qustantînîya Kupferprägungen der Münzstätte Qustantînîya Goldprägungen der Münzstätte Misr (Kairo) Silberprägungen der Münzstätte Misr (Kairo) Billonprägungen der Münzstätte Misr (Kairo) Goldprägungen der Münzstätte Tûnis Silberprägungen der Münzstätte Tûnis Muhammad V., genannt Rashad, 1327–1336 H. (1909-1918) Goldprägungen der Münzstätte Qustantînîya Ziynet-Prägungen der Münzstätte Qustantînîya Silberprägungen der Münzstätte Qustantînîya Billonprägungen der Münzstätte Qustantînîya Prägungen auf den Städtebesuch in Brûsa (Bursa) Prägungen auf den Städtebesuch in Edirne Prägungen auf den Städtebesuch in Qûsuwa (Kosovo)

12

Seite

344 354 370 375 377

-

353 369 374 376 381 382

69 71

-

71 73 74 74 75 75

383

-

393

76

-

78

383

-

385

77

386

-

389

77

390

-

391

78

392 393

78 78

394

-

656

79

-

115

394

-

513

80

-

95

514

-

551

95

-

102

552

-

594

102

-

107

595

-

596

597

-

612

107

-

110

613

-

633

110

-

112

634 640 645

-

639 644 656

113 114

-

113 114 115

657

-

778

116

-

135

657

-

698

117

-

123

699

-

732

123

-

127

733

-

744

128

-

129

745

-

747

129

748 752

-

751 757

130 131

758

-

762

132

107


Nr. Prägungen auf den Städtebesuch in Manâstir Prägungen auf den Städtebesuch in Selânîk (Saloniki) Silberprägungen der Münzstätte Misr (Kairo) Billonprägungen der Münzstätte Misr (Kairo) Muhammad VI., Wahîd ad-din, 1336–1341 H. (1918-1922) Goldprägungen der Münzstätte Qustantînîya Ziynet-Prägungen der Münzstätte Qustantînîya Silberprägungen der Münzstätte Qustantînîya Eine Billonprägung der Münzstätte Qustantînîya

Seite

763

-

767

133

768

-

772

134

773

-

776

135

777

-

778

135

779

-

805

136

-

142

779

-

789

137

-

138

790

-

796

139

-

140

797

-

804

141

-

142

805

142

Fehlprägungen

806

-

817

143

-

144

Gegenstempel auf Ottomanischen Kupfermünzen

818

-

907

145

-

161

Eine Sammlung von Token und Jetons

908

161

13


VORWORT

6*'57.6#0%1..'%6+10 

#01.&24+8#6'%1..'%6+101(1661/#0%1+052#46 /ª0<'0&'51661/#0+5%*'04'+%*'56'+.  

 8QTYQTV\WT5COONWPI





&KGJKGT\WT8GTUVGKIGTWPIMQOOGPFG5COONWPIQUOCPKUEJGT/ÒP\GPMCPPQJPGªDGTVTGKDWPICNUFKGWOHCUUGPFUVGIGIGP Y·TVKI GZKUVKGTGPFG 5COONWPI KJTGT #TV DG\GKEJPGV YGTFGP 5KG KUV FCU 'TIGDPKU XQP ÒDGT FTGK­KI ,CJTGP JKPICDGXQNNGT 5COOGNV·VKIMGKVVKGHGP8GTUV·PFPKUUGUFGT/CVGTKGUQYKGGKPGU0GV\YGTMUXQPDGHTGWPFGVGP*·PFNGTPWPF5COONGTPFKGOKV *KPYGKUGP&KUMWUUKQPGPWPFIWVGP&KGPUVGPFGP#WHDCWFKGUGTGKP\KICTVKIGP5COONWPIHÌTFGTVGP#NNGPXQTCPKUVJKGTFGTKO ,CJTXGTUVQTDGPG0GUVQTFGTQUOCPKUEJGP0WOKUOCVKM-GPPGVJ/CE-GP\KG\WPGPPGP&KGUGTJCVCWEJPKEJVYGPKIG DGFGWVGPFGWPFDKUFCJKPWPDGMCPPVG·NVGTG/ÒP\GPFGTXQTNKGIGPFGP5COONWPIKP#WHU·V\GPKPVÒTMKUEJGPCOGTKMCPKUEJGP WPFDTKVKUEJGP<GKVUEJTKHVGPXGTÌHHGPVNKEJV &KG#PH·PIGFGT5COONWPINCIGPKPGKPGT)TWRRGYGPKICVVTCMVKXGTFQEJUVGVUKP'JTGPIGJCNVGPGTQUOCPKUEJGT/ÒP\GPFGU  ,CJTJWPFGTVU YGNEJG UKEJ KP FGT (COKNKG FGU 5COONGTU XGTGTDV JCVVGP #NU 'PFG FGT GT ,CJTG FCU #WMVKQPUJCWU 5QVJGD[ U DGICPP TGIGNO·­KI #WMVKQPGP OKV KUNCOKUEJGP /ÒP\GP \W XGTCPUVCNVGP GTYCEJVG FCU RGTUÌPNKEJG +PVGTGUUG FGU 5COONGTUWPFXQPPWPCPGTYCTDGTFWTEJFKG(KTOC5RKPM UTGIGNO·­KIGKPKIG)QNFUVÒEMGFGT1UOCPGP/·EJVKIGP5EJWD 

DGMCOFCU+PVGTGUUGCNUGT\W$GIKPPFGU,CJTGUFKG)GNGIGPJGKVDGMCOWPFYCJTPCJO6GKNGGKPGTDGFGWVGPFGP·NVGTGP 5COONWPI OKV YGKVIGJGPF XQNNUV·PFKIGP ,CJTICPIU WPF /ÒP\\GKEJGPTGKJGP XQP -NGKPOÒP\GP KP ÒDGTFWTEJUEJPKVVNKEJGP 'TJCNVWPIGP\WKPMQTRQTKGTGP)GIGP'PFGFGTGT,CJTG\·JNVGFGT$GUVCPFOKVFCOCNUGVYCUÒDGT5VÒEMGPDGTGKVU\W FGPITQ­GP5COONWPIGPQUOCPKUEJGT/ÒP\GP&QEJFCUYCTPWTFGT#PURQTPFWTEJFCUHQNIGPFG,CJT\GJPVPQEJOCNUGKPG 8GTFQRRGNWPIFGT<CJNDGKSWCNKVCVKXGT8GTXKGNHCEJWPI\WGTTGKEJGP 

#PGKPGO2WPMVITÌ­VGT8QNNUV·PFKIMGKVCPIGNCPIVCPFGOYGKVGTG'TI·P\WPIGP\WGKPGOUGNVGPGP'TGKIPKUYGTFGPJCVUKEJ FGT5COONGTPWPGPVUEJNQUUGPFKGUGP5EJCV\WPVGT&QMWOGPVCVKQPGKPGUFGVCKNNKGTVGP-CVCNQIGUYKGFGTCPFGTGP5COONGTP\WT 8GTHÒIWPI\WUVGNNGP'THQNIVFCOKVXKGNGPFGTITQ­GP5COONGTFGU,CJTJWPFGTVUFKGOGJTCNUGKPG5COONWPICWHDCWVGP  1UPCDTÒEM6ÒDKPIGP1MVQDGT  &T.WV\+NKUEJ 

14


VORWORT



#POGTMWPIGP\WT$GUEJTGKDWPIWPF-CVCNQIKUKGTWPI 

'UOCIXGTYWPFGTNKEJGTUEJGKPGPYGPPFKG0COGPFGTQUOCPKUEJGP5WNVCPGJKGTPKEJVKPFGT(QTOYKGFGTIGIGDGPYGTFGP YKGUKGNCVGKPUEJTKHVNKEJKPFGTOQFGTPGP6ÒTMGKIGUEJTKGDGPYGTFGP#DGTUQYKGYKTJGWVGFKG0COGPD[\CPVKPKUEJGT-CKUGT PKEJV KP KJTGT ITKGEJKUEJGP (QTO YKGFGTIGDGP YGKN FCU .CVGKPKUEJG FKG 5RTCEJG FGU 4ÌOKUEJGP 4GKEJGU YCT UQ KUV GU UKPPXQNNGKPG6TCPUMTKRVKQPFGTCTCDKUEJGP0COGP\WDGPWV\GP&KGUIGUEJCJPKEJVPWTYGKN#TCDKUEJWPF2GTUKUEJKPFGP GTUVGP,CJTJWPFGTVGPFGU$GUVGJGPUFGUQUOCPKUEJGP5VCCVGUFKG8GTYCNVWPIUURTCEJGPYCTGPUQPFGTPCWEJYGKNFCUKO ,CJTJWPFGTVJKP\WMQOOGPFG1UOCPKUEJ6ÒTMKUEJGPKEJVPWTCTCDKUEJIGUEJTKGDGPYWTFGUQPFGTPCWEJGKPGPGTJGDNKEJGP6GKN FGUCTCDKUEJGPWPFRGTUKUEJGP9QTVUEJCV\GUKPMQTRQTKGTVG'TUVFKG4GVWTMKUKGTWPIFGT5RTCEJGKPFGPGTDKUGT,CJTGP FGU,CJTJWPFGTVUMCRRVGFKGUG8GTDKPFWPIOKVFGTCTCDKUEJGP5RTCEJGWPFUWEJVGOKV'THQNIKPDGYW­VGT#DMGJTXQPFGT 6TCFKVKQP FGU 1UOCPKUEJGP 4GKEJGU FKG CNU WPVÒTMKUEJ IGDTCPFOCTMVGP 5RTCEJGNGOGPVG \W GNKOKPKGTGP &KG 5RTCEJG FGT QUOCPKUEJGP /ÒP\CWHUEJTKHVGP DNKGD CWEJ FWTEJ FCU  ,CJTJWPFGTV JKPFWTEJ DKU \WO 'PFG FGU 4GKEJGU HÒT FKG 'FGNOGVCNNRT·IWPIXQNNUV·PFKIWPFHÒTFKG-NGKPOÒP\GPYGKVGUVIGJGPFCTCDKUEJWPFPKEJVQUOCPKUEJVÒTMKUEJ5EJNKG­NKEJYCT FCU1UOCPKUEJG4GKEJXQP$GIKPPCPPKEJVPWTGKP4GKEJFGT6ÒTMGPUQPFGTPGKPWPKXGTUCNGTKUNCOKUEJGT5VCCVOKVVÒTMKUEJGT QFGTVWTMKUKGTVGT'NKVG&KGUOCICNU$GITÒPFWPIFCHÒTTGKEJGPFC­FKGªDGTPCJOGFGUOQFGTPGP6ÒTMGK6ÒTMKUEJGPHÒTFKG QUOCPKUEJG0WOKUOCVKMPKEJVCF·SWCVUGKPMCPP#WEJFKGJGWVKIGPVÒTMKUEJGP*KUVQTKMGTWPF0WOKUOCVKMGTDGPWV\GPMGKPG TGKP VÒTMGKVÒTMKUEJG 0COGPUHQTOGP HÒT JKUVQTKUEJG 2GTUÌPNKEJMGKVGP XQT FGT LWPIVÒTMKUEJGP 4GXQNWVKQP UQPFGTP INGKEJGP FKGUG\WOKPFGUVOQFGTCVCPJKUVQTKUEJG5EJTGKDYGKUGPCP 

'KPKIG DGUQPFGTG *KPYGKUG UKPF DGK FGT -CVCNQIKUKGTWPI QUOCPKUEJGT /ÒP\GP \W FGP 'TJCNVWPIUITCFGP FGT /ÒP\GP CPIGDTCEJV*KGTKUVXQTCNNGP&KPIGPFGT*KPYGKUFCTCWHXQPPÌVGPFC­GUKO1UOCPKUEJGP4GKEJFGU,CJTJWPFGTVUMGKPG /ÒP\UCOONGTUEJCHVHÒT\GKVIGPÌUUKUEJG/ÒP\GPICD&KGYGPKIGP#WUPCJOGPFKGUGT4GIGN \$+UO³ ÄN)J³NKD JCDGPKJTG 5COONWPIGP KP ÌHHGPVNKEJG 5COONWPIGP ÒDGTHÒJTV CNUQ PKEJV KP GKPGP TG\[MNKGTGPFGP 5COONGTOCTMV 5RKV\GPGTJCNVWPIGP CDUQNWV WP\KTMWNKGTVGT QUOCPKUEJGT /ÒP\GP MQPPVGP UKEJ KP GTUVGT .KPKG KP GWTQR·KUEJGP WPF COGTKMCPKUEJGP )GPGTCNUCOONWPIGPYKGFGHKPFGP+PFGT4GIGNYWTFGCNNGTFKPIUJKGTPKEJVXGTUWEJVXQNNUV·PFKIG&CVGPTGKJGP\WUCOOGP\W VTCIGP+PFGP)GDKGVGPFGU1UOCPKUEJGP4GKEJGUUGNDGTGTHÒNNVGPFKGUGKVIGRT·IVGP/ÒP\GPCDGTCWEJÒDGTFCU'PFG

FGU 4GKEJGU JKPCWU FKG YGEJUGNPFGP (WPMVKQPGP FGU 7ONCWHU WPF FGT 6JGUCWTKGTWPI YCU KJPGP KP CNNGT 4GIGN FGWVNKEJ CP\WUGJGP KUV 7PUGT 5COONGT PWV\VG OKV -QPUGSWGP\WPFKPGTUVCWPNKEJGO7OHCPIFKG/ÌINKEJMGKVGPFGUCOGTKMCPKUEJGP DTKVKUEJGP WPF OKVVGNGWTQR·KUEJGP /CTMVGU FKG JKGT KP CNVGP 5COONWPIGP MQPUGTXKGTVGP DGUQPFGTU IWVGP 5VÒEMG \WUCOOGP\WHÒJTGP/ÌINKEJMGKVGPFKGKPPGTJCNDFGT6ÒTMGKMCWOIGIGDGPYCTGP#DGTOKV3WCNKV·VUGTYCTVWPIGPYKGUKG HÒT OKVVGNGWTQR·KUEJG WPF COGTKMCPKUEJG /ÒP\GP FGU  ,CJTJWPFGTVU IGNVGP MÌPPGP KUV MGKPG 5COONWPI QUOCPKUEJGT /ÒP\GP CPP·JGTPF \W XGTXQNNUV·PFKIGP &CU NKGIV FCTKP DGITÒPFGV FC­ FCU )GNFYGUGP KUNCOKUEJGT 5VCCVGP OKPFGUVGPU UGKV #WHICDG FGT )GYKEJVPQTOKGTWPIGP KO  ,CJTJWPFGTV GKPG 4GXGTUKDKNKV·V XQP /ÒP\GP KO <CJNWPIUXGTMGJT WPF KP FGT 5EJOWEMXGTYGPFWPI MGPPV &CU JGK­V IGNQEJVG WPF IIH UQICT IGJGPMGNVG /ÒP\GP MQPPVGP KO <CJNWPIUXGTMGJT YKGFGTXGTYGPFGV YGTFGP Y·JTGPF FKG .QEJWPI GVYC KP &GWVUEJNCPF XQP YGKVGTGT <CJNWPIUXGTYGPFWPI CWUUEJNQ­ 'KPG (QNIG FKGUGU 7OICPIU OKV /ÒP\GP YCT FC­ FGO <CJNWPIUXGTMGJT \WT <WMWPHVUUKEJGTWPI GPV\QIGPG /ÒP\GP \$ CWU $TCWVIGNF\CJNWPIGP  PKEJV \YCPIUN·WHKI CNU 5EJCV\ XGTITCDGP UQPFGTP GDGPUQ CNU 5EJOWEM IG\GKIV YGTFGP MQPPVGP 4GKJGP CWHIGP·JVGT /ÒP\GP CWU )QNF YKG CWU 5KNDGT DGITÒPFGVGP GVYC DGK RCN·UVKPGPUKUEJGP $·WGTKPPGP FGP UQ\KCNGP 5VCVWU FGT 6T·IGTKP &CU QUOCPKUEJG /ÒP\YGUGP GPVYKEMGNVG CWU FKGUGO )TWPF FKG UQIGPCPPVGP <K[PGV/ÒP\GP CWEJ CNU FGNWZG /ÒP\GPDG\GKEJPGV FKGDGKOKPKOCNNGKEJVGTGO/ÒP\HW­GKPGUQTIH·NVKIG2T·IWPICWHDGUQPFGTUDTGKVGOFÒPPGP5EJTÌVNKPI OKVFGMQTCVKXGP<KGTGNGOGPVGPKPFGT)GUVCNVWPI\GKIGP&KGUG/ÒP\GPYGKUGP\WO6GKNFWTEJGKPGPMNGKPGP-TGKUCOQDGTGP $KNFTCPFUEJQPKPFGT2T·IWPIFKG\WT.QEJWPIXQTIGUGJGPG5VGNNGCWU6TQV\FKGUGTRTKO·TGP6JGUCWTKGTWPIUCWHICDGMQPPVGP FKGUG /ÒP\GP CDGT UGMWPF·T GDGPUQ KO <CJNWPIUXGTMGJT WONCWHGP 1JPG GPVURTGEJGPFG .QEJWPI *GPMGN QFGT \WOKPFGUV GKPGT *GPMGNURWT MQOOGP FGTCTVKIG /ÒP\GP MCWO XQT WPF OCP MÌPPVG CWEJ UCIGP dass solche ungelochten Stücke nicht bestimmungsgemäß XGTYGPFGVYQTFGPUKPF \$KP/ÒP\UCOONWPIGPHTGOFGT-WNVWTGP +POCPEJGP(·NNGPKUVFCU(GJNGP UQNEJGT/GTMOCNGCWEJFGTGTUVG*KPYGKUCWH7PGEJVJGKVQFGTCWHFKG4GRTQFWMVKQPKPPCEJQUOCPKUEJGT<GKV'KP5COONGT OKV 8GTUV·PFPKU HÒT FKG IGNFIGUEJKEJVNKEJGP (WPMVKQPGP UGKPGT 1DLGMVG MCPP FCTKP MGKPGP GTPUVJCHVGP /CPIGN UGJGP WPF UQ UKPFCWEJFKGDGFGWVGPFGP5COONWPIGPFGT+UVCPDWNGT/ÒP\UV·VVGQFGTFGT;CRK-TGFK$CPMXQNNXQPIGNQEJVGP/ÒP\GPYCU GKPGP OKV FGP 8QTCWUUGV\WPIGP PKEJV XGTVTCWVGP $GQDCEJVGT GTUVCWPGP OCI &QEJ PGDGP FGP <K[PGV/ÒP\GP YWTFGP CWEJ IGYÌJPNKEJG5KNDGTWPF)QNFOÒP\GPQHVCNU5EJOWEMXGTYGPFGV 

&KG5KNDGTWPF)QNFUEJOKGFGXGTUVCPFGPUKEJFCDGKGTUVCWPNKEJIWVFCTCWHOKVYGPKI.QVGKPGUKEJGTG¤UGCP\WDTKPIGPYKG CWEJFKGUGYKGFGTWO\WGPVHGTPGPUQFC­OCPIGNGIGPVNKEJKO<YGKHGNFCTÒDGTDNGKDGPMCPPQDGKPG/ÒP\GGKPOCNIGJGPMGNV YCTQFGTPKEJV5GKVOKVVNGTYGKNGFTGK,CJT\GJPVGPJCVFCU8GTNCPIGPKPVGTPCVKQPCNGT5COONGTQUOCPKUEJG/ÒP\GPKPOÌINKEJUV RGTHGMVGT 'TJCNVWPI \W GTJCNVGP \WT #PYGPFWPI XQP \YGK 6GEJPKMGP IGHÒJTV FKG YGPKIGT CNU FKG DKU FCJKP IGÒDVG JCPFYGTMNKEJG2GTHGMVKQP\WDGITÒ­GPUKPF&KGGTUVGFKGUGT6GEJPKMGPKUVFKGGTPGWVG4·PFGNWPIÒDGTGKPG*GPMGNURWTFKG DKUYGKNGPNGKEJVQHVCDGTPWTUGJTUEJYGTGTMGPPDCTKUV5KGKUVIGNGIGPVNKEJDGK)QNFYKGDGK5KNDGTOÒP\GP\WDGQDCEJVGP &KG \YGKVG UEJ·FNKEJG 5GIPWPI FKGUGT #TV KUV FKG 8GTYGPFWPI HGKPGT 5CPFUVTCJNVGEJPKMGP WO QDGTHN·EJNKEJG $GCTDGKVWPIGP WPUKEJVDCT \W OCEJGP &KG 6GEJPKM YKTF KP FGT VTCFKVKQPGNNGP #WHICDG XQP )QNFUEJOKGFG \WT 'PVHGTPWPI XQP )TCXWTGP GKPIGUGV\V&CDGKYGTFGPDGK/ÒP\GPXQPVÒTMKUEJGP)QNFUEJOKGFGPQHHGPDCTGTJCDGPG$GTGKEJGFGT2T·IWPICDIGFGEMV&GT YGKVGTIGJGPFG8GTNWUVXQP1TKIKPCNQDGTHN·EJGKUVCDGTKPLGFGO(CNNUEJ·FNKEJ 

15


VORWORT 

+PVTQFWEVKQPVQVJG%QNNGEVKQP 

6JKUEQNNGEVKQPQH1VVQOCPEQKPUUEJGFWNGFHQTCWEVKQPUJQTVN[KUYKVJQWVGZCIIGTCVKQPQPGQHVJGOQUVEQORNGVGEQNNGEVKQPU QHKVUV[RG +V KU VJG TGUWNV QH QXGT VJKTV[ [GCTU QH FGFKECVGF EQNNGEVKPI C FGGR WPFGTUVCPFKPI QH VJG OCVGTKCN CU YGNN CU C PGVYQTM QH HTKGPFU FGCNGTUCPFEQNNGEVQTUYJQCNNEQPVTKDWVGFYKVJVKRUFKUEWUUKQPCPFCUUQTVGFJGNRQPVJKUWPKSWGEQNNGEVKQP9G OGPVKQPJGTGGURGEKCNN[VJCV0GUVQTQH1VVQOCPPWOKUOCVKEU-GPPGVJ/CEMGP\KGYJQFKGFKPCPFwho published many of the more important CPF RTGXKQWUN[ WPMPQYP QNFGT EQKPU QH VJKU EQNNGEVKQP CU GUUC[U KP KP 6WTMKUJ #OGTKECP CPF $TKVKUJ

LQWTPCNU  6JG EQNNGEVKQP DGICP CU C ITQWR QH PQV XGT[ CVVTCEVKXG DWV EJGTKUJGF 1VVQOCP EQKPU QH VJG   EGPVWT[ YJKEJ JCF DGGP VJ

inherited within the collector's family 6JG RGTUQPCN KPVGTGUV QH VJG EQNNGEVQT YCU CYCMGPGF KP VJG yU YJGP 5QVJGD[ʼnU UVCTVGF TGIWNCT CWEVKQPU QH +UNCOKE EQKPU CPF JG VJWU CESWKTGF IQNF 1VVQOCP pieces through Spink's QP C TGIWNCT DCUKU 6JKU KPVGTGUVIQVCJWIGDQQUVYJGPKPGCTN[JGUGK\GFVJGQRRQTVWPKV[VQKPEQTRQTCVGRCTVUQHCPKORQTVCPVQNFGTEQNNGEVKQPQH C XKTVWCNN[ EQORNGVG XKPVCIG OKPVOCTM

series of minor coins

KP CP CDQXG CXGTCIG UVCVG QH RTGUGTXCVKQP $[ VJG GPF QH VJG

yU VJG EQNNGEVKQP JCF KPETGCUGF VQ UQOGVJKPI QXGT  KVGOU CPF YCU CNTGCF[ QPG QH VJG ITGCV EQNNGEVKQPU QH 1VVQOCP EQKPU *QYGXGT VJKU YCU RWTGN[ CP KPEGPVKXG VQ FQWDNG VJG EQNNGEVKQP QXGT VJG PGZV FGECFG CV VJG UCOG VKOG OWNVKRN[KPI VJG SWCNKV[OCPKHQNF  *CXKPI CTTKXGF CV C RQKPV YJGTG HWTVJGT CFFKVKQPU JCF DGEQOG C TCTG GXGPV VJG EQNNGEVQT FGEKFGF VQ RTQRQUG VJKU VTGCUWTG VQ QVJGTEQNNGEVQTUVJTQWIJCFGVCKNGFECVCNQIWG*GVJWUHQNNQYUVJGGZCORNGQHVJGITGCVEQNNGEVQTUQHVJG EGPVWT[ VJ

  1UPCDTÒEM6ÒDKPIGP1EVQDGT  &T.WV\+NKUEJ    

0QVGUQPVJG&GUETKRVKQPCPF%CVCNQIKPI



+VOC[UGGOUVTCPIGKHVJGPCOGUQH1VVQOCPUWNVCPUCTGPQVUJQYPKPVJG.CVKPUETKRVCUHQWPFKPOQFGTPFC[6WTMG[$WVCU VQFC[YGFQPQVYTKVGVJGPCOGUQH$[\CPVKPGGORGTQTUKP)TGGMUETKRV DGECWUG.CVKPYCUVJGNCPIWCIGQH4QOCPGORGTQTU  KV OCMGU UGPUG VQ WUG C VTCPUETKRVKQP QH #TCDKE PCOGU 6JKU KU PQV QPN[ DGECWUG #TCDKE CPF 2GTUKCP YGTG VJG CFOKPKUVTCVKXG VJ

NCPIWCIGUKPVJGHKTUVEGPVWT[QHVJG1VVQOCPUVCVGDWVCNUQDGECWUGVJG1VVQOCP6WTMEQOKPIKPVQWUGKPVJG EGPVWT[YCU PQV QPN[ #TCDKE KP HQTO DWV CNUQ GODQFKGF C EQPUKFGTCDNG COQWPV QH #TCDKE CPF 2GTUKCP XQECDWNCT[ 6JG ŋTGVWTMKUJKPIŌ QH VJG NCPIWCIG DGVYGGP VJG yU CPF VJG yU EWV VJKU EQPPGEVKQP YKVJ VJG #TCDKE NCPIWCIG CPF UQWIJV YKVJ UWEEGUU VQ FGNKDGTCVGN[ GNKOKPCVG PQP6WTMKUJ GNGOGPVU HTQO VJG VTCFKVKQPU QH 1VVQOCP VKOGU 6JG NCPIWCIG QH 1VVQOCP  KPUETKRVKQPU QP VJ

CNNRTGEKQWUOGVCNUVCORKPIUCPFVQCNCTIGGZVGPVQPUOCNNEQKPUTGOCKPGF#TCDKECPFPQV1VVQOCP6WTMVJTQWIJQWVVJG  EGPVWT[ WR VQ VJG GPF QH VJG 1VVQOCP GORKTG #HVGT CNN VJG VJG 1VVQOCP GORKTG YCU HTQO VJG DGIKPPKPI PQV LWUV C 6WTMKUJ GORKTGDWVCWPKXGTUCN+UNCOKEUVCVGYKVJC6WTMKUJGNKVG6JKUYQWNFCRRGCTVQDGCXCNKFTGCUQPYJ[VJGCFQRVKQPQHOQFGTP 6WTMKUJKUPQVTGCNN[CFGSWCVGHQTVJGRWTRQUGUQH1VVQOCPPWOKUOCVKEU6QFC[ʼnU6WTMKUJJKUVQTKCPUCPFPWOKUOCVKUVUCNUQFQ PQVWUGRWTG6WTMKUJPCOGUHQTJKUVQTKECNRGTUQPUDWVOQFGTCVGN[CFCRVVJGOVQJKUVQTKECNUETKRV   5QOG URGEKHKE PQVGU CTG TGSWKTGF TGICTFKPI VJG ECVCNQIWKPI QH 1VVQOCP EQKPU CPF VJGKT UVCVG QH RTGUGTXCVKQPEQPFKVKQP *GTG VJ

QPG UJQWNF PQVG VJCV VJGTG YCU PQ TGCN EQKP EQNNGEVQT HTCVGTPKV[ HQT EQPVGORQTCT[ EQKPU QH VJG   EGPVWT[ 1VVQOCP GORKTG 6JG HGY GZEGRVKQPU VQ VJKU TWNG JCF RCUUGF VJGKT EQNNGEVKQPU KPVQ VJG RWDNKE FQOCKP CPF PQV KPVQ C TGE[ENGF EQNNGEVQT OCTMGV 6QRSWCNKV[OKPV1VVQOCPEQKPUYGTGQPN[

to be found in American and European general collectionsDWVKPYJKEJCUCTWNG

PQ CVVGORV JCF DGGP OCFG VQ QDVCKP C EQORNGVG UGTKGU +P VJG VGTTKVQTKGU QH VJG 1VVQOCP GORKTG KVUGNH VJG EQKPU OKPVGF CHVGT  UGTXGF VJG FWCN HWPEVKQP QH EKTEWNCVKQP CPF TGVGPVKQP CU ECP QHVGP DG ENGCTN[ GXKFGPEGF ŋ6JG 5WNVCP %QNNGEVKQPŌ WUGF

to incorporate the best preserved examples  RQUUKDKNKVKGUVJCVYGTGLWUVPQVCXCKNCDNGKPUKFG6WTMG[*QYGXGTVJGGZRGEVCVKQPU EQPUKUVGPVN[ CPF KP EQPUKFGTCDNG CORNKVWFG VJG RQUUKDKNKVKGU QH VJG #OGTKECP $TKVKUJ CPF EGPVTCN 'WTQRGCP OCTMGVU

QPSWCNKV[CUHQWPFKP EGPVWT[EGPVTCN'WTQRGCPQT#OGTKECPEQKPUCTGQPN[TGOQVGN[NKMGN[VQDGHQWPFKPCP[EQNNGEVKQP QH 1VVQOCP RKGEGU 6JG TGCUQP HQT VJKU NKGU KP VJG OQPGVCT[ U[UVGO QH +UNCOKE UVCVGU CHVGT VJG CDCPFQPOGPV QH YGKIJV VJ

piercedEQKPUCPF RGTJCRU GXGP mounted coins EQWNF DG TGWUGF CU XCNKF EWTTGPE[ YJGTGCU C pierced coin KP )GTOCP[ YQWNF JCXG DGGP HQTDKFFGPHQTWUG#EQPUGSWGPEGQHVTGCVKPIEQKPUKPVJKUYC[YCUVJCVEQKPUYKVJFTCYPHTQOEKTEWNCVKQPHQTVJGRWTRQUGQH UCHGIWCTFKPIVJGHWVWTG HQTGZCORNGHTQOFQYTKGU FKFPQVPGEGUUCTKN[DGEQOGDWTKGFVTGCUWTGDWVEQWNFCNUQDGFKURNC[GFKP VJG HQTO QH  LGYGNNGT[ 4QYU QH UVKVEJGF IQNF QT UKNXGT EQKPU HQT GZCORNG YGTG C UVCVWU U[ODQN QH VJG UQEKCN UVCPFKPI QH 2CNGUVKPKCPRGCUCPVYQOGP6JG1VVQOCPEQKPCIGFGXGNQRGFHQTVJKUTGCUQPVJGUQECNNGF<K[PGVEQKPU CNUQMPQYPCUFGNWZG

regulation KP VJG   EGPVWT[ VJG TGXGTUKDKNKV[ QH EQKPU WUGF KP RC[OGPV CPF KP LGYGNNGT[6JCVOGCPVVJCV VJ

16


VORWORT

  EQKPU  YJKEJ QP C OKPKOCNN[ NKIJVGT DNCPM UJQY C ECTGHWN GODQUUKPI QP CP GURGEKCNN[ DTQCF RNCPEJGV YKVJ FGEQTCVKXG CFQTPOGPVU 6JGUG EQKPU CNUQ RCTVKCNN[ FKURNC[ C UOCNN EKTENG CV VJGKT WRRGT GFIG VQ FGPQVG VJG CTGC YJGTG C JQNG EQWNF DG UVCORGF +P URKVG QH VJGKT RTKOCT[QDLGEVKXGQHTGVGPVKQPVJGUGEQKPUEQWNFUVKNNDGMGRVKPEKTEWNCVKQP%QKPUQHVJKUV[RGCTG UGNFQOVQDGHQWPFYKVJQWVRWPEJGFJQNGUNWIUQTVTCEGUQHNWIU and one could also argue that such coins without holes were not used as originally KPVGPFGF HQTGZCORNGEQKPEQNNGEVKQPUQHHQTGKIPEWNVWTGU +PUQOGECUGUVJGCDUGPEGQHUWEJHGCVWTGU KUCHKTUVKPFKECVKQPQHCHCMGQTCTGRTQFWEVKQPKPCRQUV1VVQOCPVKOG*QYGXGTCEQNNGEVQTYKVJCHGGNKPI for the monetary

YQWNFPQVUGGCP[UGTKQWUFGHKEKGPE[KPVJKUCPFVJGKORQTVCPVEQNNGEVKQPUQHVJG+UVCPDWNOKPVCUYGNNCU VJG;CRK-TGFK$CPMCTGHWNNQHJQNGFEQKPUCUVQPKUJKPIVQVJGWPKPKVKCVGFQDUGTXGTRGTJCRU*QYGXGTCRCTVHTQOVJG<K[PGV EQKPUOQTGQTFKPCT[IQNFCPFUKNXGTEQKPUYGTGCNUQQHVGPVQDGHQWPFKPLGYGNNGT[  6JGIQNFCPFUKNXGTUOKVJUMPGYXGT[YGNNJQYVQCVVCEJCUGEWTGOQWPVYKVJXGT[NKVVNGUQNFGTCUKPFGGFVJG[CNUQMPGYJQY VQTGOQXGQPGUQVJCVCVVKOGUKVYCUFKHHKEWNVVQTGEQIPKUGVJCVQPGJCFGXGTGZKUVGF1XGTVJGNCUVVJKTV[[GCTUVJGFGOCPFUQH KPVGTPCVKQPCNEQNNGEVQTUQH1VVQOCPEQKPUKPCURGTHGEVEQPFKVKQPCURQUUKDNGJCUNGFVQVJGWUGQHVYQVGEJPKSWGUYJKEJCTGVQ DG ITGGVGF YKVJ NGUU GPVJWUKCUO VJCP VJG RTGXKQWU JCPFOCFG RGTHGEVKQP 6JG HKTUV QHVJGUGVGEJPKSWGUKUTGGFKPIQXGTVJG VTCEGUQHCRTGXKQWUNWIYJKEJKUQEECUKQPCNN[GCU[DWVQHVGPFKHHKEWNVVQFGVGEV+VECPDGHQWPFPQYCPFCICKPYKVJIQNFCPF UKNXGTEQKPU6JGUGEQPFFGVTKOGPVCNOGVJQFQHVJKUUQTVKUVJGWUGQHCHKPGUCPFDNCUVKPIVGEJPKSWGVQOCMGUWTHCEGRTQEGUUKPI KPXKUKDNG6JGVGEJPKSWGKUWUGFKPVJGVTCFKVKQPCNIQNFUOKVJĹ&#x2030;UVCUMQHTGOQXKPIGPITCXKPIU+PVJKUYC[VJGTCKUGFCTGCUQP EQKPUHTQO6WTMKUJIQNFUOKVJUCTGEQXGTGFQXGT+PCP[ECUGVJKUNQUUQHUWTHCEGOCVGTKCNKUFGVTKOGPVCN history of his objects



 

Koleksiyon ile ilgili Ă&#x2013;nsĂśz : MĂźzayedede yer alacak OsmanlÄą sikkeleri koleksiyonu tĂźrĂźnĂźn gĂźnĂźmĂźzdeki en kapsamlÄą koleksiyonlarÄąndandÄąr. 30 yÄąlÄą aĹ&#x;kÄąn bir sĂźrede bĂźyĂźk bir gayretle bir araya getirilen bu koleksiyon gerçek bir uzmanlÄąk çalÄąĹ&#x;masÄąnÄąn ve samimi dostluk iliĹ&#x;kileri içinde bulunan tĂźccarlarÄąn ve koleksiyonerlerin desteÄ&#x;i, yorumlarÄą, Ăśneri ve yardÄąmlarÄą neticesinde tamamlanabilmiĹ&#x;tir. Bu vesileyle de Ăśzellikle OsmanlÄą NĂźmismatiÄ&#x;inin rahmetli duayeni SayÄąn Kenneth MacKenzieâ&#x20AC;&#x2122;yi anmak gerekir. MacKenzie bu koleksiyona ait olan ve camiada daha Ăśnce bilinmeyen parçalar ile ilgili TĂźrk, Amerikan ve Ä°ngiliz dergilerinde çok sayÄąda makale yayÄąnlamÄąĹ&#x;tÄąr. Koleksiyonerin ailesinden kalan ve nesilden nesle geçen, çok dikkat çekici olmasalar da her zaman bĂźyĂźk bir saygÄąyla saklanan 19. YĂźzyÄąl OsmanlÄą sikkeleri bu nadide koleksiyonun ilk parçalarÄą olmuĹ&#x;tur. 70li yÄąllarÄąn sonunda Sothebyâ&#x20AC;&#x2122;s MĂźzayede Eviâ&#x20AC;&#x2122;nde Ä°slam DĂźnyasÄą Sikkeleri mĂźzayedeleri yapÄąlmaya baĹ&#x;landÄąÄ&#x;Äąndan sonra koleksiyonerin de ilgisi bu konuya karĹ&#x;Äą artmÄąĹ&#x;tÄąr ve Spinkâ&#x20AC;&#x2122;s Ĺ&#x;irketi aracÄąlÄąÄ&#x;Äąyla OsmanlÄą dĂśnemi altÄąn paralar satÄąnalmaya baĹ&#x;lamÄąĹ&#x;tÄąr. 1990 senesinin ilk aylarÄąnda çok daha eski ve neredeyse eksiksiz yÄąllÄąk sikkeler ve sikke serilerini alma fÄąrsatÄą bulduÄ&#x;unda, ilgisi ve merakÄą daha da artmÄąĹ&#x;tÄąr. 90lÄą yÄąllarÄąn sonunda ise koleksiyondaki parça sayÄąsÄą 3000i aĹ&#x;mÄąĹ&#x;tÄą ve artÄąk camiadaki bĂźyĂźk OsmanlÄą Sikkeleri koleksiyonlarÄąndan sayÄąlÄąyordu. Ancak bu sadece bir baĹ&#x;langĹçtÄą ve takip eden yÄąllar boyunca çok daha kÄąymetli parçalarÄąn da dahil edilmesiyle bu sayÄą ikiye katlanmÄąĹ&#x;tÄąr. ArtÄąk neredeyse eksiÄ&#x;i kalmayan bu koleksiyona yeni parçalar katmak pek mĂźmkĂźn olmadÄąÄ&#x;Äąndan koleksiyoner bu hazineyi detaylÄą bir katalog ile belgeleyerek diÄ&#x;er koleksiyonlara dahil etmeye karar vermiĹ&#x;tir. Bu kararÄąyla, birden fazla koleksiyon oluĹ&#x;turan 19. YĂźzyÄąlÄąn bĂźyĂźk koleksiyonerlerinin izinden gitmiĹ&#x;tir.

1UPCDTĂ&#x2019;EM6Ă&#x2019;DKPIGP'MKO  &T.WV\+NKUEJ

AçĹklamalar ve KataloglaĹ&#x;tÄąrma ile Ä°lgili Bilgiler : GĂźnĂźmĂźz modern TĂźrkiyeâ&#x20AC;&#x2122;sinde Latin harfleriyle yazÄąlan OsmanlÄą PadiĹ&#x;ahlarÄąnÄąn isimlerinin burada aynÄą Ĺ&#x;ekilde kullanÄąlmamÄąĹ&#x; olmasÄą belki biraz tuhaf gibi gelecektir. NasÄąl gĂźnĂźmĂźzde Bizans dĂśnemi Ä°mparatorlarÄąnÄąn isimleri yunanca harflerle deÄ&#x;il de Roma ImparatorluÄ&#x;uâ&#x20AC;&#x2122;nun kullandÄąÄ&#x;Äą resmi dili olan Latince harflerle yazÄąlÄąyorsa, Arapça isimlerinin de transkripsiyonu kullanÄąlmaktadÄąr. Arapça ve Farsça OsmanlÄą Ä°mparatorluÄ&#x;uâ&#x20AC;&#x2122;nun ilk yĂźzyÄąllarÄąnda resmi idari dili olmuĹ&#x;tur ve 15. YĂźzyÄąl itibariyle kullanÄąlmaya baĹ&#x;lanan OsmanlÄąca-TĂźrkçesi de Arapça harflerle yazÄąlmaktaydÄą ve çok sayÄąda Arapça ve Farsça 17


VORWORT

kelimeler içermekteydi. 1930-1960 yılları arasında Türkiye’de yürütülen dili “yeniden Türkçeleştirme” çalışmaları neticesinde Arapça’dan uzaklaşılmış ve Türkçe olmayan dil unsurları bilinçli şekilde terk edilmiştir. Osmanlı döneminde 19. Yüzyıl boyunca ve Osmanlı İmparatorluğu’nun sona ermesine kadar kıymetli metallerin damgalanmasında ve madeni paralardaki yazı ve damgalarda Osmanlıca-Türkçesi değil, Arapça kullanılmıştır. Zira Osmanlı İmparatorluğu kuruluşundan beri sadece Türklerin İmparatorluğu değil, Türklerin ve türkleştirilen bir elitin yönettiği evrensel bir Müslüman devletiydi. Belki bu bilgi Osmanlı Nümismatiği’nde modern Türkiye-Türkçesi’nin neden kullanılmadığını açıklayabilmektedir. Günümüz Türk tarihçileri ve Nümismatik uzmanları da aynı şekilde tarih boyunca yaşamış önemli kişilerin isimlerini sadece salt Türkiye Türkçe’siyle yazılmış şekilleriyle kullanmamakta ve isimleri tarihi yazı şekillerine uygun bir şekilde adapte etmektedirler. Osmanlı sikkelerinin katalog çalışmaları ile ilgili bazı açıklamalar yapmak gerekmektedir. 19. Yüzyılda Osmanlı İmparatorluğu’nda kullanılan paraların koleksiyonunu yapma geleneği olmasa da, bu adete uymayan bazı istisnai kişiler (örneğin Ismâ'îl Ghâlib) koleksiyonlarını Nümismatiğin kapalı camiasında tutmak yerine umuma açık koleksiyonlara devretmiştir. Hiç tedavüle çıkmayan nadide Osmanlı sikkeleri Avrupa ve Amerika’daki genel koleksiyonlarda korunabilmiştir. Bu koleksiyonların çoğu zaten eksiksiz bir seri oluşturmayı amaçlamamaktaydı. Osmanlı İmparatorluğu sınırları içinde 1845 yılından itibaren darp edilen sikkelerin uzun yıllar ve hatta İmparatorluğun sona ermesinden sonra bile tedavülde kaldığı ve biriktirildiği sikkelerin görünümlerinden kolayca anlaşılabilmektedir. “Sultan” koleksiyonu, Türkiye içinde böyle bir imkanı bulamadığı için eski koleksiyonlar içinde çok iyi korunan ve çok özel parçaları bir araya taşıyan Amerika, İngiltere ve Orta Avrupa Nümismatik piyasasının imkanlarından faydalanmıştır. Ancak 19. Yüzyıl Orta Avrupalı ve Amerikalı paralarından beklenen kalitede bir Osmanlı Sikkeleri Koleksiyonu yapmak elbette mümkün olmayacaktır. Bunun nedeni ise İslam Devletinde paralar yaklaşık 9. Yüzyıldan itibaren dönüştürülerek tekrar tedavüle alınması veya takı ve ziynet eşyası olarak kullanılmasıydı. Başka bir değişle delinen ve hatta kulp takılan sikkeler bile para olarak kullanılabilmekteydi. Buna karşılık örneğin Almanya’da delinen paralar artık geçersiz sayılıp kullanılamamaktaydı. Bu adetten dolayı aslında tasarruf etmek üzere piyasadan çekilen paralar (örneğin mehir olarak verilmek üzere) ziynet ve süs eşyası olarak kullanılırdı. Filistinli köylü kadınlar örneğin boyunlarına astıkları altın veya gümüş sikkeler ile toplumdaki yerlerini göstermekteydiler. Paranın bu şekilde kullanılmasından dolayı Osmanlı döneminde ziynet altınlar (veya de-luxe-para olarak da anıldığı görülmektedir) hazırlanmaya başlanmıştır. Bu altınların ayarı biraz daha düşük olup çok geniş ve ince olan pulun üzeri dekoratif figürler ile bezenmekteydi. Bu sikkelerin bazılarında ise ileride açılacak deliğin yeri bile resmin üst kısmında belirtilmiştir. Öncelikle tasarruf amacıyla çıkarılan bu sikkeler yine de ödemelerde rahatlıkla kullanılabilmekteydi. Delinmeyen, kulpu olmayan veya en azından kulp izi olmayan ziynet altınlarına pek rastlanılmamaktadır ve asıl amaçlarına uygun kullanılmadıklarını söylemek mümkün (örneğin yabancı kültürlerdeki sikke koleksiyonlarında). Bazı durumlarda bu ziynet eşya özelliklerini oluşturan izlerin bulunmaması parçaların sahte olduğunu veya Osmanlı döneminden sonra yapılan reprodüksiyonlar olduklarını düşündürmektedir. Sahip olduğu objelerinin tarih içindeki yeri, önemi ve kullanım özelliklerini bilen bir koleksiyoner, sikkelerin ufak kusurlarından rahatsızlık duymaz. Aynı şekilde İstanbul Darphane Müzesi ve Yapı Kredi Bankası Osmanlı Madeni Para Koleksiyonunda sayısız delinmiş sikkeler bulunmaktadır. Ve sadece sikkelerin tarihi boyunca nasıl kullanıldığını bilmeyen kişiler bu duruma şaşırabilmektedir. Özel amaçla hazırlanan ziynet sikkelerinin dışında da yine sıradan gümüş ve altın paralar da süs ve takı olarak kullanılmıştır. Altın işleme ustaları her zaman sikkelere biraz lehimle sağlam bir kulp takmayı iyi bilmişlerdir ve aynı şekilde neredeyse iz kalmaksızın da bu kulpları tekrar çıkarabilmişlerdir. Hünerli çalışmaları sonucunda çoğu kez iz kalmadığı için sikkenin bir zaman kulplu mu yoksa kulpsuz mu olduğu bile anlaşılamamaktadır. Üç yüz yıldan beri uluslararası koleksiyonerlerin en mükemmel şekilde korunmuş Osmanlı sikkelerine sahip olma arzusu iki yeni çalışma tekniğinin gelişmesine neden olmuştur. İlk teknik sikkenin hafif, hatta bazen gözle görülmeyecek kadar belirsiz olan kulp izinin bulunduğu kenarın tekrar işlenmesi olmuştur. Kenar tırtıklarının tekrar düzeltildiği hem altın hem de gümüş sikkelerde görülebilmektedir. İkinci teknik olan ince kum püskürtme tekniği ile sikkenin yüzeyindeki kusurlar giderilmektedir. Aslında bu yöntem Türk altın işleme ustaları gravürleri silmek için kullanılmaktadır ve ustalar işlem sırasında sikkenin kabarık kısımlarını kapatarak çalışırlar. Ancak sikkenin orijinal yüzeyinden daha fazla kaybetmesi her halükarda zararlıdır.

18


'ABD AL-MAJÎD KHAN

/#,œ&-*#0 6ª4-'+6ª4-+5%*#$&ª./'%+&1&'4#$&ª./'%+6*#0  4#$œʼn++&*©.*+,,#* ,7.+,70+

#$&#.



/CJOÑF++GTUEJGKPVFGO/ÒP\UCOONGTKO)GIGPUCV\\WUGKPGOYGKVTGKEJGPFG4GHQTOGPFWTEJHÒJTGPFGP5QJP #DFCN /CLÄFCNUFGT5WNVCPWPVGTFGOFCU1UOCPKUEJG4GKEJKO)GNFYGUGPGKPGPUEJGKPDCTWPCWHJCNVUCOGP#DUVWT\\WDGUVGJGP JCV6CVU·EJNKEJYCTGTCDGTGKPGDGPUQTGCNKUVKUEJGTYKGTGHQTOHTGWFKIGT*GTTUEJGTFGTUGKPGOCO#RTKNIGDQTGPGP 5QJPYKGCWEJFGUUGPPCEJHQNIGPFGP$TÒFGTPGKPGRTQHWPFGWPFXKGNUGKVKIG#WUDKNFWPIPCEJOKVVGNGWTQR·KUEJGP5VCPFCTFU GTOÌINKEJVG#NUCO,WNKFGT5WNVCP/CJOÑF++UVCTDHKGN #DFCN/CLÄFFKG4QNNG\WFKGXQPUGKPGO8CVGTKPFKG 9GIG IGNGKVGVGP 4GHQTOGP WO\WUGV\GP 5KG DGVTCHGP FCU $ÒTIGTTGEJV FCU )GNFYGUGP WPF FKG 5VCCVUHKPCP\GP FKG *GGTGUUVTWMVWT9KUUGPUEJCHVWPF'T\KGJWPI+O#NNIGOGKPGPYWTFGFGTHTCP\ÌUKUEJG5VCCVCNU/QFGNNIGPQOOGPYKGCWEJ FKG'T\KGJWPIFGUHNKG­GPF(TCP\ÌUKUEJURTGEJGPFGP5WNVCPUFWTEJHTCP\ÌUKUEJG.GJTGTXQTIGRT·IVYCT 



&KG4GHQTOYGNNGFKGWPVGTFGO$GITKHH6CP\KOCV 8GTQTFPWPIGP KPFKG)GUEJKEJVGGKPIGICPIGPKUVDGICPPYGPKIG/QPCVG PCEJ4GIKGTWPIUCPVTKVVOKVGKPGTDÒTIGTHTGWPFNKEJGP4GHQTOFGT5VGWGTPWPFFGT9GJTRHNKEJV'KPYGKVGTGTGKPUEJPGKFGPFGT 5EJTKVV YCT  FKG #WHNÌUWPI FGU /KNNGVU[UVGOU FWTEJ FCU FKG QTVJQFQZGP CTOGPKUEJGP WPF LÒFKUEJGP 7PVGTVCPGP FGU 1UOCPKUEJGP4GKEJGUKPYGKVIGJGPFUGNDUV·PFKIG)TWRRKGTWPIGPOKVGKIGPGP4GEJVUWPF5VGWGTQTFPWPIGPGKPIGVGKNVYCTGP &CU<KGNYCTPCEJGWTQR·KUEJGP8QTDKNFGTPGKPGQUOCPKUEJG0CVKQP\WGPVYKEMGNP&QEJÒDGTFKGMWT\HTKUVKIG(TGWFGCP $ÒTIGTTGEJVGPJKPCWUUKGJV\WTÒEMUEJCWGPFFKG$KNCP\FGUUKEJPWPGPVYKEMGNPFGP0CVKQPCNKUOWUPKEJVCPFGTUCNUKOÒDTKIGP 'WTQRCCWU&GPPFGT8GTNWUVFGU/KPFGTJGKVGPUEJWV\GUHÒJTVG\W<WURKV\WPIGPFGU8GTJ·NVPKUUGUFGTGKP\GNPGP)TWRRGPWPF \WT 8GTFT·PIWPI FGT PKEJVVÒTMKUEJGP /KPFGTJGKVGP CO 'PFG FGU 1UOCPKUEJGP 4GKEJGU #WEJ GKP CPFGTGT 6GKN FGTUGNDGP 8GTQTFPWPI MCO CWU FGT YKTVUEJCHVUNKDGTCNGP 8GTWTVGKNWPI RTQVGMVKQPKUVKUEJGT <ÌNNG FKG HÒT FCU 'WTQRC FGT /KVVG FGU  ,CJTJWPFGTVUUQEJCTCMVGTKUVKUEJYCT&CU1UOCPKUEJG4GKEJÌHHPGVGUGKPG/·TMVGHÒTGWTQR·KUEJG+PFWUVTKGRTQFWMVGOKVFGP ÒDNKEJGP(QNIGPHÒTFKGGKPJGKOKUEJG9KTVUEJCHV 

$GKUGKPGO4GIKGTWPIUCPVTKVVHCPFFGTLWPIG5WNVCPGKPGRTGM·TG.CIGXQTFCFGTRTCMVKUEJWPCDJ·PIKIG·I[RVKUEJG8K\GMÌPKI /WJCOOCF #NÄUGKVOKVOKNKV·TKUEJGP/KVVGNPXGTUWEJVG5[TKGPWPF/GUQRQVCOKGPUGKPGT*GTTUEJCHVGKP\WXGTNGKDGP 'KPGQHHGPG5EJNCEJVDGK0K\KR8KN³[GV)C\KCPVGRPWTGKPG9QEJGXQTFGO4GIKGTWPIUCPVTKVVYCTHÒTFKGQUOCPKUEJG5GKVG XGTNQTGPYQTFGP&KGQUOCPKUEJG(NQVVGYWTFGXQPKJTGO#FOKTCNFGPI[RVGTPÒDGTIGDGP+PFKGUGT5KVWCVKQPICDFGTLWPIG 5WNVCPLGFGP9KFGTUVCPFIGIGPFKGHTCP\ÌUKUEJGP$GUGV\GT#NIGTKGPUCWH&C(TCPMTGKEJ\WFGOKO$ÒPFPKUOKVI[RVGPYCT 19


'ABD AL-MAJÎD KHAN

MQPPVG #DFCN/CLKF KP 8GTDKPFWPI OKV )TQ­DTKVCPPKGP ¤UVGTTGKEJ 2TGW­GP WPF 4WUUNCPF KO .QPFQPGT 8GTVTCI XQO  ,WNK  GKPG .ÌUWPI UWEJGP FKG KP GTUVGT .KPKG FC\W FKGPVG FKG YGKVGTG 'ZRCPUKQP (TCPMTGKEJU \W XGTJKPFGTP &CFWTEJ GTJKGNV FCU 4GKEJ UGKPG (NQVVG WPF 5[TKGP \WTÒEM OWUUVG UKEJ CDGT KP I[RVGP OKV GKPGT PQOKPGNNGP 1DGTJQJGKV ÒDGT FKG PWPOGJTGTDNKEJG*GTTUEJCHVDGIPÒIGPWPFXGTNQT#NIGTKGPCP(TCPMTGKEJ

&KG HTCPMQRJKNG )TWPFJCNVWPI FGU QUOCPKUEJGP 5WNVCPU YWTFG XQP 0CRQNGQP +++ DGPWV\V WO (TCPMTGKEJ GKPG 5EJKTOJGTTUEJCHV ÒDGT FKG JGKNKIGP 5V·VVGP 2CN·UVKPCU \W IGYKPPGP YCU YKGFGTWO \W FKRNQOCVKUEJGP -QPHNKMVGP OKV FGO 4WUUKUEJGP 4GKEJ HÒJTVG FCU CWU FGO QUOCPKUEJTWUUKUEJGP (TKGFGPUEJNWUU XQP -ÒEÒM -C[PCTEG XQP  GKPG TWUUKUEJG 5EJKTOJGTTUEJCHVÒDGTFKGQTVJQFQZGP-KTEJGPKO1UOCPKUEJGP4GKEJDGCPURTWEJGPMQPPVG&KGDTKVKUEJG&KRNQOCVKGJGK\VG FGP -QPHNKMV YGKVGT CP UQ FCUU OKV FGO  DGIKPPGPFGP -TKOMTKGI FCU 1UOCPKUEJG 4GKEJ KP GKPGP TWKPÌUGP 5VGNNXGTVTGVGTMTKGI WO FKG TWUUKUEJDTKVKUEJGP +PVGTGUUGP KP <GPVTCNCUKGP CP DTKVKUEJGT 5GKVG IGTKGV +PHQNIG FGT )GNFTGHQTO MQPPVGP FKG -TKGIUCWUICDGP YGFGT KO 4CJOGP FGU 5VCCVUJCWUJCNVU GTDTCEJV PQEJ FWTEJ FKG #DYGTVWPI FGT QUOCPKUEJGP 9·JTWPI CWUIGINKEJGP YGTFGP 5VCCVUUEJWNFGP KO #WUNCPF UEJKGPGP FKG .ÌUWPI \W UGKP FKG LGFQEJ GKPG FCWGTJCHVG 5EJY·EJWPIFGTKPPGTGP5KVWCVKQPFGU4GKEJGUDTCEJVGPWPFFGP'THQNIFGT4GHQTODGOÒJWPIGPGKPUEJT·PMVGP2QUKVKXYWTFG CWHVÒTMKUEJGT5GKVGDGYGTVGVFCUUFCU1UOCPKUEJG4GKEJKPFKGUGO-TKGICNUINGKEJTCPIKIGT#MVGWTWPVGTFGPGWTQR·KUEJGP /·EJVGPYCJTIGPQOOGPYQTFGPYCT #DFCN/CLKFUVCTDCO,WPK &CUCNVG1UOCPKUEJG4GKEJJCVVGDKUKPFKG<GKV #DFWN/CLÄFUJKPGKPGKPG5KNDGTY·JTWPICWHFGO#SEGDCUKGTGPF.ÌJPG 2TGKUGWPF5VGWGTPYWTFGPKP#SEGHGUVIGNGIV)QNFYCT\YCTKO/CTMVWPFKPFGT5EJCV\DKNFWPIKP(QTOXGPG\KCPKUEJGT <GEEJKPGPWPFKJTGTQUOCPKUEJGT'PVURTGEJWPIGPTGKEJNKEJXQTJCPFGPWPFYWTFGLGPCEJ/CTMVNCIGKP#SEGVCTKHKGTVJCVVG CDGT PKEJV FKG 9·JTWPIUHWPMVKQP FGU 5KNDGTU 5Q YCT GU UGKV FGP XGTNWUVTGKEJGP -TKGIGP OKV 4WUUNCPF KO UR·VGTGP  ,CJTJWPFGTV OÌINKEJ FKG 5VCCVUXGTUEJWNFWPI FWTEJ /ÒP\XGTUEJNGEJVGTWPIGP FGU 5KNDGTU CWH\WHCPIGP &QEJ FKG MWT\HTKUVKIGP)GYKPPGHHGMVGFWTEJ5EJWNFGPTGFWMVKQPWPF/ÒP\IGYKPPYWTFGPXKGNHCEJPCEJHQNIGPFFWTEJ8GTOKPFGTWPIFGU 5VGWGTGTVTCIU TGNCVKXKGTV *CPFYGTMGT OKV HGUVIGNGIVGP 2TGKUGP .QJPCDJ·PIKIG WPF UVCCVNKEJG 5QNFGORH·PIGT OWUUVGP FKG 4GEJPWPIDG\CJNGP5EJNKOOGTPQEJYCTFGT8GTVTCWGPUXGTNWUVXQP8QNMWPF(KPCP\YGNVKPFKG9·JTWPIPCEJFGOFKGUGT XQP FGT CTOGPKUEJGP /ÒP\OGKUVGTHCOKNKG &Ò\QINW XGTYCNVGVG /GEJCPKUOWU \YGK )GPGTCVKQPGP NCPI FGP 5VCCV XQT FGO <WUCOOGPDTWEJ DGYCJTV JCVVG #DF CN/CLÄF YCT PKEJV YGPKIGT CNU FKG $GXÌNMGTWPI FGU 4GKEJGU WPF FKG GWTQR·KUEJG )TQ­HKPCP\ ÒDGT\GWIV FCUU GKPG #PINGKEJWPI CP FKG /ÒP\U[UVGOG 'WTQRCU OKV GKPGO $KOGVCNNKUOWU \WT .ÌUWPI FGT YKTVUEJCHVNKEJGP2TQDNGOGFGU4GKEJGUDGKVTCIGPYÒTFG 5QYWTFGPPGWG)QNFWPF5KNDGTOÒP\GPGKPIGHÒJTVYGNEJGDKU\WO'PFGFGU4GKEJGU$GUVCPFJCDGPUQNNVGP 





&KG*CWRVY·JTWPIUOÒP\GKP)QNFYCTHQTVCPFCUCNU.KTCDG\GKEJPGVG-WTWUJUVÒEMYGNEJGUCD  KO9GTV \YKUEJGPFGOHTCP\ÌUKUEJGP(TCPEUWPFFGODTKVKUEJGP2HWPFCPIGUKGFGNVYCT#WUIGRT·IVYWTFGPCWEJWPF -WTWUJ5VÒEMG CD ,CJT  WPF WPVGT FGP 0CEJHQNIGTP KO 5WNVCPCV CWEJ \WPGJOGPF  -WTWUJ5VÒEMG -GTPUVÒEM FGT 5KNDGTY·JTWPIYCTFGT/CLÄFK[G4K[CN\W-WTWUJPGDGPFGO6GKNUVÒEMG\WWPF-WTWUJCDIGOÒP\V YWTFGP 

<WINGKEJYWTFGPUGKV5VCCVUUEJWNFGPUEJGKPG MCKOG KP7ONCWHIGDTCEJVYGNEJGL·JTNKEJWO\WXGT\KPUGPYCTGP WPFFKGCDCWEJXQPFGT$GXÌNMGTWPIKP+UVCPDWNCM\GRVKGTVYWTFGPHQNIVGPWPXGT\KPUVG)GNFUEJGKPGFKGCDGTPCEJ GKPKIGT<GKVKPHNCVKQP·TCDIGYGTVGVYWTFGP &CU)QNFWPF5KNDGTIGNFYCTWPFDNKGDRQRWN·TCWEJYGPPUEJQPYGPKIG,CJTGPCEJFGT'KPHÒJTWPIFGTGEJVG$KOGVCNNKUOWU FWTEJFKG#WUDGWVGPGWGT5KNDGTXQTMQOOGPWPOÌINKEJYWTFGYCUDGFGWVGVGFCUU\WP·EJUVFKG.KTC\WT.GKVY·JTWPIYWTFG YQIGIGP FGT /CLÄFK[G GPVYGFGT ÒDGTDGYGTVGV QFGT OCTMVCDJ·PIKI VCTKHKGTV YWTFG ,GFGPHCNNU YWTFGP RTKXCVG 5KNDGTGKPNKGHGTWPIGPKPFKG/ÒP\UV·VVGPKEJVOGJTCM\GRVKGTVWPFPWTPQEJ)QNFMQPPVG\WT5EJGKFWPIWPF8GTOÒP\WPIFWTEJ )GNFYGEJUNGTWPF$CPMGPGKPIGNKGHGTVYGTFGP&KGNGV\VGPIGTKPIJCNVKIGP5KNDGTOÒP\GP/CJOÑFU++YWTFGPPKEJVCW­GT-WTU 

IGUGV\VUQPFGTPDNKGDGPPGDGPFGOPGWGP)GNFDKU\WO+9GNVMTKGIKO7ONCWH(ÒTFKGPGWGP)QNFWPF5KNDGTOÒP\GPFKG VGEJPKUEJ HTCP\ÌUKUEJGP QFGT GPINKUEJGP 5VCPFCTFU GPVURTCEJGP YWTFG GKPG PGWG OKV &CORHMTCHV DGVTKGDGPG /ÒP\UV·VVG

&CTRJ³PGK ŒOKTG OKVGPINKUEJGP/CUEJKPGPWPVGTJCNDFGU6QRMCRKRCNCUVGTTKEJVGV&GOCTOGPKUEJGP/ÒP\UV·VVGPFKTGMVQT &Ò\QINW#IQR%GNGDKYWTFGÒDGTYKGIGPFGPINKUEJGUWPFVGKNUHTCP\ÌUKUEJGUVGEJPKUEJGU2GTUQPCN\WIGQTFPGV 

&KGJKGTXQTNKGIGPFG5COONWPI\GKIVKPFGT8KGN\CJNDGUQPFGTUIWVGTJCNVGPGT5VÒEMGOKVYGNEJJQJGT2T·\KUKQPFKG)GYKEJVG FGT'FGNOGVCNNOÒP\GPWPDGUVGEJNKEJLWUVKGTVYWTFGP 

&KG PGWG PKEJV CDYGTVDCTG 9·JTWPI UVGNNVG WPDGUVTKVVGP GKPG 'TNGKEJVGTWPI HÒT FGP KPVGTPCVKQPCNGP *CPFGN YKG CWEJ HÒT UVCCVNKEJG -TGFKVG CWH FGO KPVGTPCVKQPCNGP -CRKVCNOCTMV FCT 2COWM JCV UKEJGT \W 4GEJV CWH FKG PCEJHQNIGPFG MCWUCNG 8GTMGVVWPIJKPIGYKGUGPFCUU\WP·EJUVFGTUQNEJGTOC­GPGTNGKEJVGTVG*CPFGNRTKO·T4QJUVQHHGCWUFGT6ÒTMGKCWUHÒJTVGWO /CPWHCMVWTYCTGP GKP\WHÒJTGP YCU KP FGT $KNCP\ PKEJV \WIWPUVGP FGU 4GKEJGU WPF UGKPGT $GXÌNMGTWPI CWUHKGN )NGKEJG 'PVYKEMNWPIGP KO /ÒP\ WPF )GNFYGUGP HÒJTVGP FKG WPVGT QUOCPKUEJGT 1DGTJQJGKV UVGJGPFGP $C[U XQP 6WPKU WPF FKG -JGFKXGP XQP I[RVGP CWU +P CNNGP FTGK (·NNGP HÒJTVG FGT 9GI XQP FGT UVCDKNGP 9·JTWPI KP FKG ªDGTUEJWNFWPI CNNGT FTGK 5VCCVUJCWUJCNVG FWTEJ GZVGTPG -TGFKVG YCU  FKG 'KPTKEJVWPI GKPGT KPVGTPCVKQPCNGP 5VCCVUUEJWNFGPXGTYCNVWPI FGU 1UOCPKUEJGP 4GKEJGU PCEJ UKEJ \QI KO UGNDGP ,CJT KP 6WPGUKGP FKG $GUGV\WPI FWTEJ (TCPMTGKEJ  KP I[RVGP FKG $GUGV\WPIFWTEJ)TQ­DTKVCPPKGPHQNIGPNKG­  

20


'ABD AL-MAJÎD KHAN

/ÒP\GPXQTFGT/ÒP\TGHQTOXQP

2

1

3

)QNFRT·IWPIGPFGT/ÒP\UV·VVG3WUVCPVÄPÄ[C 

/COFÑJÄ[G#NVKP ;KTOKNKM *3WUVCPVÄPÄ[CI(D-/¤NEGT2GTG )1.&8QT\ÒINKEJ





/COFÑJÄ[G#NVKP ;KTOKNKM *3WUVCPVÄPÄ[CI(D-/¤NEGT2GTG )1.&5GNVGPGT,CJTICPI8QT\ÒINKEJ



/COFÑJÄ[G#NVKP ;KTOKNKM *3WUVCPVÄPÄ[CI(D-/¤NEGT2GTG )1.&ªDGTFWTEJUEJPKVVNKEJIWVCWUIGRT·IV-N-TCV\GT5VGORGNINCP\



'ZGORNCTFGT#WMVKQP5RKPM5QP<ÒTKEJ0T



4

1,5:1

1,5:1



/COFÑJÄ[G#NVKP ;KTOKNKM *3WUVCPVÄPÄ[CI(D-/¤NEGT2GTG )1.&2TCEJVGZGORNCT5VGORGNINCP\

6

7

5



8

5



/COFÑJÄ[G#NVKP ;KTOKNKM *3WUVCPVÄPÄ[CI(D-/¤NEGT2GTG )1.&8QT\ÒINKEJ





/COFÑJÄ[G#NVKP 1PNWM *3WUVCPVÄPÄ[CI(D-/¤NEGT2GTG )1.&5VGORGNINCP\





/COFÑJÄ[G#NVKP 1PNWM *3WUVCPVÄPÄ[CI(D-/¤NEGT2GTG )1.&8QT\ÒINKEJ





/COFÑJÄ[G#NVKP 1PNWM *3WUVCPVÄPÄ[CI(D-/¤NEGT2GTG )1.&8QT\ÒINKEJ



'ZGORNCTFGT#WMVKQP5RKPM5QP<ÒTKEJ0T

21


'ABD AL-MAJÎD KHAN

9



ex 10

ex 11

/COFÑJÄ[G#NVKP %G[TGM *3WUVCPVÄPÄ[CI(D-/¤NEGT2GTG )1.&5VGORGNINCP\



'ZGORNCTFGT#WMVKQP5RKPM5QP<ÒTKEJ0T



/COFÑJÄ[G#NVKP %G[TGM *WPF3WUVCPVÄPÄ[CWPFI(D-/¤NEGT WPF2GTG 5VÒEM)1.&&CUGTUVGGVYCUIGYGNNVXQT\ÒINKEJ





/COFÑJÄ[G#NVKP %G[TGM *WPF3WUVCPVÄPÄ[C,GI(D-/¤NEGT WPF2GTG 5VÒEM)1.&8QT\ÒINKEJWPF5VGORGNINCP\



13

12



<GTKOCJDÑD*3WUVCPVÄPÄ[CI-/¤NEGT2GTG  )1.&4*GPMGNURWTUGJTUEJÌP





<GTKOCJDÑD*3WUVCPVÄPÄ[CI-/¤NEGT2GTG  )1.&448QT\ÒINKEJp5VGORGNINCP\



+PVGTGUUCPVGªDGTUEJPGKFWPIFGTVTCFKVKQPGNNGP2T·IWPIFGT6CXUCPVCU/ÒP\UV·VVGWPFFGTPGWGP4GHQTORT·IWPIGPKP FGT6QRMCRK/ÒP\UV·VVGKP+UVCPDWNKO,CJTYGNEJGPWTHÒT2CTCRT·IWPIKP$KNNQPWPFFKGUGNVGPGPJCNDGP<GTK OCJDÑDDGNGIVKUV

ex 15

14

16

5KNDGTRT·IWPIGPFGT/ÒP\UV·VVG3WUVCPVÄPÄ[C 

-WTWUJ #NVKNKM *3WUVCPVÄPÄ[CI-/¤NEGT2GTG  -N(NGEMXQT\ÒINKEJ





-WTWUJ*WPF DGKFGOKVITQ­GT$NWOGPGDGPFGT6WIJTC 3WUVCPVÄPÄ[CWPFI -/¤NEGTWPF2GTG 5VÒEM5GJTUEJÌPWPFXQT\ÒINKEJ





-WTWUJ* OKVMNGKPGT$NWOGPGDGPFGT6WIJTC 3WUVCPVÄPÄ[CI-/¤NEGT 2GTG 8QT\ÒINKEJp5VGORGNINCP\



ex 17



22

-WTWUJ* 8CTKCPVGPOKVMNGKPGTWPFITQ­GT,CJTGU\CJN WPF3WUVCPVÄPÄ[C WPFI-/¤NEGTp2GTG  5VÒEM&CUGTUVGXQT\ÒINKEJFKGCPFGTGPWP\KTMWNKGTVOKVXQNNGO5VGORGNINCP\




'ABD AL-MAJÎD KHAN

ex 19

ex 18



 2CTC  *     WPF  3WUVCPVÄPÄ[C     WPFI-/¤NEGT p2GTG 5VÒEM5GJTUEJÌPWPFXQT\ÒINKEJ





 2CTC  *      8CTKCPVGP  WPF  3WUVCPVÄPÄ[C      WPF   I-/¤NEGTp2GTG 5VÒEM#NNGXQT\ÒINKEJp5VGORGNINCP\



ex 21

ex 20



2CTC* 5VGORGNXCTKCPVGP 3WUVCPVÄPÄ[C UKE  WPFI-/¤NEGT2GTG  5VÒEM6GKNUUEJYCEJWPFUEJNGEJVCWUIGRT·IVFQEJCNNGXQT\ÒINKEJp5VGORGNINCP\



0GDGPFGP8CTKCVKQPGPFGT5VGORGNKUVXQTCNNGOFKGCW­GTQTFGPVNKEJG5EJYCPMWPIFGT)GYKEJVGFKGUGT/ÒP\GPKO #WUICDG\WUVCPFXQO'KPHCEJGPDKU\WO&TGKHCEJGPDGOGTMGPUYGTV+O)GIGPUCV\\WFKGUGTGVYCUUQTINQUGPCNOCTEQ 2T·IWPIUVGJVFKGRGKPNKEJIGPCWG,WUVKGTWPICNNGT'FGNOGVCNNOÒP\GPPCEJFGT/ÒP\TGHQTOKO4GIKGTWPIULCJT



2CTC  *   5VGORGNXCTKCPVGP  3WUVCPVÄPÄ[C           WPFI-/¤NEGT2GTG  5VÒEM6GKNUUEJYCEJWPFUEJNGEJVCWUIGRT·IVFQEJCNNGXQT\ÒINKEJp5VGORGNINCP\

ex 23

ex 22







2CTC* 5VGORGNXCTKCPVGP WPF 5VGORGNXCTKCPVGP 3WUVCPVÄPÄ[C  ,CJT WPFI-/¤NEGTWPF 2GTG 5VÒEM6GKNUUEJYCEJWPFUEJNGEJVCWUIGRT·IVFQEJCNNGXQT\ÒINKEJp5VGORGNINCP\



2CTC  *  WPF   8CTKCPVGP GKPG OKV WPUKEJGTGT ,CJTGU\CJN  3WUVCPVÄPÄ[C   WPF   I-/¤NEGTWPF2GTG  5VÒEM5GNVGPG,CJTI·PIG&CUGTUVGOKV-PKEMURWTCNNGUEJYCEJCWUIGRT·IVWPFXQT\ÒINKEJ



/ÒP\GPPCEJFGT/ÒP\TGHQTOXQP

24

1,5:1

1,5:1

)QNFRT·IWPIGPFGT/ÒP\UV·VVG3WUVCPVÄPÄ[C 

-WTWUJ*3WUVCPVÄPÄ[CI(D-/¤NEGT2GTG  )1.&5GJTUGNVGPDGUQPFGTUKPFKGUGT'TJCNVWPI2TCEJVGZGORNCT5VGORGNINCP\

 23


'ABD AL-MAJÎD KHAN

25

26



-WTWUJ*3WUVCPVÄPÄ[CI(D-/¤NEGT2GTG  )1.&4-N4CPFUEJN·IGCO#XGTUTCPFXQT\ÒINKEJp5VGORGNINCP\





-WTWUJ*3WUVCPVÄPÄ[CI(D-/¤NEGT2GTG  )1.&8QPITQ­GT5GNVGPJGKV*GPMGNURWTUEJCTHIGTGKPKIVUGJTUEJÌP



27

1,5:1



1,5:1

-WTWUJ*3WUVCPVÄPÄ[CI(D-/¤NEGT UKETKEJVKIPCEJFGT5[ UVGOCVKM¤NEGTUY·TG 2GTG )1.&5GNVGPKPFKGUGT'TJCNVWPI8QT\ÒINKEJp5VGORGNINCP\



'TUVG2T·IWPIFGTITWPFNGIGPFGP/ÒP\TGHQTOXQP&KG5KNDGTOÒP\GPWPFCPFGTG0QOKPCNGKP)QNFHQNIVGPGTUV CDFGO4GIKGTWPIULCJT

28

29



-WTWUJ*3WUVCPVÄPÄ[CI(D-/¤NEGT2GTG  )1.&5GJTUEJÌP





-WTWUJ*3WUVCPVÄPÄ[CI(D-/¤NEGT2GTG  )1.&5GJTUEJÌP



30

31



-WTWUJ*3WUVCPVÄPÄ[CI(D-/¤NEGT2GTG  )1.&8QT\ÒINKEJ





-WTWUJ*3WUVCPVÄPÄ[CI(D-/¤NEGT2GTG  )1.&5GJTUEJÌP



32

33



-WTWUJ*3WUVCPVÄPÄ[CI(D-/¤NEGT2GTG  )1.&5GJTUEJÌP





-WTWUJ*3WUVCPVÄPÄ[CI(D-/¤NEGT2GTG  )1.&5EJÌPpUGJTUEJÌP



24


'ABD AL-MAJÎD KHAN

34

35

36



-WTWUJ*3WUVCPVÄPÄ[CI(D-/¤NEGT2GTG  )1.&5GJTUEJÌP





-WTWUJ*3WUVCPVÄPÄ[CI(D-/¤NEGT2GTG  )1.&5GJTUEJÌP





-WTWUJ*3WUVCPVÄPÄ[CI(D-/¤NEGT2GTG  )1.&5GJTUEJÌPpXQT\ÒINKEJ



37

38

39



-WTWUJ*3WUVCPVÄPÄ[CI(D-/¤NEGT2GTG  )1.&5GJTUEJÌP





-WTWUJ*3WUVCPVÄPÄ[CI(D-/¤NEGT2GTG  )1.&8QT\ÒINKEJ





-WTWUJ*3WUVCPVÄPÄ[CI(D-/¤NEGT2GTG  )1.&5GJTUEJÌP



40

1,5:1



1,5:1

-WTWUJ*3WUVCPVÄPÄ[CI(D-/¤NEGT2GTG  )1.&8QT\ÒINKEJ



/GTMYÒTFKIG5VGORGNXGT·PFGTWPIKO$GTGKEJFGU4GIKGTWPIULCJTGUXGTOWVNKEJGKP5VGORGNWOUEJPKVVCWU,CJT

25


'ABD AL-MAJÎD KHAN

41

42

43



-WTWUJ*3WUVCPVÄPÄ[CI(D-/¤NEGT2GTG  )1.&5GJTUEJÌP





-WTWUJ*3WUVCPVÄPÄ[CI(D-/¤NEGT2GTG  )1.&5GJTUEJÌP





-WTWUJ*3WUVCPVÄPÄ[CI(D-/¤NEGT2GTG  )1.&-N4CPFHGJNGTUGJTUEJÌP



44

45



-WTWUJ*3WUVCPVÄPÄ[CI(D-/¤NEGT2GTG  )1.&5GJTUEJÌP





-WTWUJ*3WUVCPVÄPÄ[CI(D-/¤NEGT2GTG  )1.&5GJTUEJÌPpXQT\ÒINKEJ



46

47

48

49



-WTWUJ*3WUVCPVÄPÄ[CI(D-/¤NEGT2GTG  )1.&5GJTUEJÌP





-WTWUJ*3WUVCPVÄPÄ[CI(D-/¤NEGT2GTG  )1.&8QT\ÒINKEJp5VGORGNINCP\





-WTWUJ*3WUVCPVÄPÄ[CI(D-/¤NEGT2GTG  )1.&5GJTUEJÌP





-WTWUJ*3WUVCPVÄPÄ[CI(D-/¤NEGT2GTG  )1.&/KP4CPFUEJNCI5VGORGNINCP\



50

51



-WTWUJ*3WUVCPVÄPÄ[CI(D-/¤NEGT2GTG  )1.&*GPMGNURWTUGJTUEJÌP





-WTWUJ*3WUVCPVÄPÄ[CI(D-/¤NEGT2GTG  )1.&5GJTUEJÌP



26


'ABD AL-MAJÎD KHAN

52

53



-WTWUJ*3WUVCPVÄPÄ[CI(D-/¤NEGT2GTG  )1.&5GNVGPGT,CJTICPI8QT\ÒINKEJ





-WTWUJ*3WUVCPVÄPÄ[CI(D-/¤NEGT2GTG  )1.&5GNVGPGT,CJTICPI(CUV5VGORGNINCP\



54

1,5:1

1,5:1



-WTWUJ*3WUVCPVÄPÄ[CI(D-/¤NEGT2GTG  )1.&8QPITÌ­VGT5GNVGPJGKV9KP\MN4CPFHGJNGTUGJTUEJÌP



'ZGORNCTFGT#WMVKQP(TKV\4WFQNH-ÒPMGT1UPCDTÒEM0T

55

56

57

58

ex 59



-WTWUJ*3WUVCPVÄPÄ[CI(D-/¤NEGT2GTG  )1.&5EJÌPpUGJTUEJÌP





-WTWUJ*3WUVCPVÄPÄ[CI(D-/¤NEGT2GTG  )1.&5GJTUEJÌP





-WTWUJ*3WUVCPVÄPÄ[CI(D-/¤NEGT2GTG  )1.&5VGORGNINCP\





-WTWUJ*3WUVCPVÄPÄ[CI(D-/¤NEGT2GTG  )1.&8QT\ÒINKEJp5VGORGNINCP\





-WTWUJ*WPF3WUVCPVÄPÄ[CWPFI(D-/¤NEGTWPF 2GTG 5VÒEM)1.&5GJTUEJÌP



60

5KNDGTRT·IWPIGPFGT/ÒP\UV·VVG3WUVCPVÄPÄ[C 

-WTWUJ /CLÄFÄ[C4K[³N *3WUVCPVÄPÄ[C/KVMNGKPGT4QUGPGDGPFGT6WIJTCI-/ ¤NEGT2GTG 5EJÌPG2CVKPCWP\KTMWNKGTV

 27


'ABD AL-MAJÎD KHAN

61

ex 62

ex 63



-WTWUJ /CLÄFÄ[C4K[³N *3WUVCPVÄPÄ[C/KVITQ­GT4QUGPGDGPFGT6WIJTCI-/ ¤NEGT2GTG 8QT\ÒINKEJp5VGORGNINCP\





-WTWUJ /CLÄFÄ[C4K[³N *3WUVCPVÄPÄ[C<YGK8CTKCPVGPFGT4QUGPGDGPFGT6WIJTC WPFI-/¤NEGT2GTG 5VÒEM5GJTUEJÌP





 -WTWUJ /CLÄFÄ[C 4K[³N   *  WPF   8CTKCPVGP 3WUVCPVÄPÄ[CWPFI -/¤NEGTWPF2GTG 5VÒEM5GJTUEJÌP



ex 64

ex 65

ex 66



-WTWUJ /CLÄFÄ[C4K[³N *WPF3WUVCPVÄPÄ[CWPFI-/ ¤NEGTp2GTG 5VÒEM5GJTUEJÌPWPFDGUUGT





 -WTWUJ /CLÄFÄ[C 4K[³N   *   WPF  3WUVCPVÄPÄ[C #NNG OKV MNGKPGT 4GXGTUCWHUEJTKHV   WPFI-/¤NEGTp2GTG 5VÒEM5GJTUEJÌPDKUWP\KTMWNKGTV





 -WTWUJ /CLÄFÄ[C 4K[³N   *   WPF  3WUVCPVÄPÄ[C #NNG OKV ITQ­GT 4GXGTUCWHUEJTKHV   WPFI-/¤NEGTp2GTG  5VÒEM&CUGTUVG5VÒEMHCUVUGJTUEJÌPFKGCPFGTGPXQT\ÒINKEJ



28


'ABD AL-MAJÎD KHAN

ex 67

68

ex 69



 -WTWUJ /CLÄFÄ[C 4K[³N   *  WPF  3WUVCPVÄPÄ[C #NNG OKV ITQ­GT 4GXGTUCWHUEJTKHV   WPFI-/¤NEGTWPF2GTG 5VÒEM5GJTUEJÌPWPFUEJÌP





-WTWUJ /CLÄFÄ[C4K[³N *3WUVCPVÄPÄ[C#NNGOKVITQ­GT4GXGTUCWHUEJTKHVI-/ ¤NEGT2GTG 5GJTUGNVGPGT,CJTICPI5GJTUEJÌP





-WTWUJ /CLÄFÄ[C4K[³N *WPF3WUVCPVÄPÄ[C$GKFGOKVITQ­GT4GXGTUCWHUEJTKHV WPFI-/¤NEGTWPF2GTG 5VÒEM5GJTUEJÌP



71

70

70



-WTWUJ /CLÄFÄ[C4K[³N *3WUVCPVÄPÄ[C/KVITQ­GT4GXGTUCWHUEJTKHVI-/ ¤NEGT2GTG 5GNVGPGT,CJTICPI5GJTUEJÌPpXQT\ÒINKEJ





 -WTWUJ JCNDGT /CLÄFÄ[C 4K[³N   *  3WUVCPVÄPÄ[C /KV MNGKPGT 4GXGTUCWHUEJTKHV  I  -/¤NEGT2GTG 8QT\ÒINKEJp5VGORGNINCP\



72 1,5:1



1,5:1

-WTWUJ JCNDGT/CLÄFÄ[C4K[³N *3WUVCPVÄPÄ[C/KVMNGKPGT4GXGTUCWHUEJTKHVI-/ ¤NEGT2GTG  8QPITQ­GT5GNVGPJGKVPWT5VÒEMIGRT·IV8QT\ÒINKEJp5VGORGNINCP\

 29


'ABD AL-MAJÎD KHAN

73



 -WTWUJ JCNDGT /CLÄFÄ[C 4K[³N   *  KP 2T·UGPVCVKQPUUCV\ OKV ICP\GO /CLÄFÄ[C 4K[³N WPF   -WTWUJFGUUGNDGP,CJTGU3WUVCPVÄPÄ[C/KVMNGKPGT4GXGTUCWHUEJTKHVWPFI-/ WPF¤NEGTFCU-WTWUJFGO#WVQTWPDGMCPPVWPF2GTGWPF  5VÒEM8QPCNNGTITÌ­VGT5GNVGPJGKV7P\KTMWNKGTVFGTICP\G/CLÄFÄ[CXQPRQNKGTVGP5VGORGNP  'TYQTDGPXQP5RKPM5QP.QPFQP/CK

74

1,5:1



1,5:1

-WTWUJ JCNDGT/CLÄFÄ[C4K[³N *3WUVCPVÄPÄ[C/KVMNGKPGT4GXGTUCWHUEJTKHVI-/ ¤NEGTXIN MCPPVGFCU,CJTPQEJPKEJV 2GTG  8QPITÌ­VGT5GNVGPJGKV(GKPUVGT5VGORGNINCP\



ex 75



-WTWUJ 8KGTVGN/CLÄFÄ[C4K[³N * 8CTKCPVGP WPF3WUVCPVÄPÄ[C WPFI-/¤NEGTp2GTG  5VÒEM5GJTUEJÌPWPFXQT\ÒINKEJ



76

 30

-WTWUJ 8KGTVGN/CLÄFÄ[C4K[³N * KO5VGORGNCWUIG·PFGTV 3WUVCPVÄPÄ[CI-/ ¤NEGT2GTG 5GJTUGNVGPKPFKGUGT'TJCNVWPI2QNKGTVG2NCVVG




'ABD AL-MAJÎD KHAN

ex 77



-WTWUJ 8KGTVGN/CLÄFÄ[C4K[³N *WPF3WUVCPVÄPÄ[C WPFI-/¤NEGTp2GTG  5VÒEM5GJTUEJÌPDKU5VGORGNINCP\



78

1,5:1



1,5:1

-WTWUJ 8KGTVGN/CLÄFÄ[C4K[³N *3WUVCPVÄPÄ[CI-/¤NEGT2GTG 5GJTUGNVGPKPFKGUGT'TJCNVWPI2QNKGTVG2NCVVG



ex 81

ex 80

ex 79

ex 79



-WTWUJ 8KGTVGN/CLÄFÄ[C4K[³N *WPF3WUVCPVÄPÄ[CWPFI-/¤NEGT WPF2GTG 5VÒEM45GJTUEJÌPWPFXQT\ÒINKEJ





-WTWUJ*WPF3WUVCPVÄPÄ[CWPFI-/¤NEGT p2GTG 5VÒEM5GJTUEJÌPWPFXQT\ÒINKEJ





-WTWUJ*WPF3WUVCPVÄPÄ[CWPFI-/ ¤NEGTp2GTG 5VÒEM,CJTGWPFUGNVGP5GJTUEJÌPDKUWP\KTMWNKGTV



82

1,5:1



1,5:1

-WTWUJ*3WUVCPVÄPÄ[CI-/¤NEGT2GTG  5GJTUGNVGPGT,CJTICPI8QT\ÒINKEJ

 31


'ABD AL-MAJÎD KHAN

1,5:1

83

1,5:1



-WTWUJ*3WUVCPVÄPÄ[CI-/¤NEGT2GTG  5GJTUGNVGPGT,CJTICPI5GJTUEJÌPpXQT\ÒINKEJ



'PVH·NNV



1,5:1



85

1,5:1

-WTWUJ*3WUVCPVÄPÄ[CI-/¤NEGT2GTG

448QT\ÒINKEJ

&CU DGK ¤NEGT WPF KO -/-CVCNQI CNU UGJT UGNVGP IGHÒJTVG  4GIKGTWPIULCJT #DF CN/CLÄFU CWH FGO GKPHCEJGP   -WTWUJUEJGKPVUGKPG'ZKUVGP\GKPGO5VGORGNHGJNGTGKPGUFGT5VGORGNFGU4GIKGTWPIULCJTGU\WXGTFCPMGP&CHÒT FKG#WHUEJTKHVGPFGTMNGKPUVGP5KNDGTPQOKPCNG2WP\GPWPF)GUGPMGXGTYGPFGVYWTFGPWPFFKG5EJTKHVPKEJVHTGKJ·PFKI ITCXKGTVYWTFGGTICDUKEJCWUFGT$GUEJ·FKIWPIGKPGU)GUGPMUKOQDGTGP$GTGKEJUFGTCTCDKUEJGP<CJNFKG(QTOFGT <CJN6CVU·EJNKEJFÒTHVGFKG2T·IWPIFGUTGHQTOKGTVGPGKPHCEJGP-WTWUJUQYKGFKGFGTFQRRGNVGP-WTWUJGTUVKO 4GIKGTWPIULCJTDGIQPPGPYQTFGPUGKP&KGUGNDGDGUEJ·FKIVG2WP\GYWTFGCWEJHÒT5VGORGNFGTUKNDGTPGP2CTC 5VÒEMGXGTYGPFGVFGTGP2T·IWPIGTUVKO4GIKGTWPIULCJTDGICPP

ex 86







88

ex 87

-WTWUJ*WPF3WUVCPVÄPÄ[C WPFI-/¤NEGTp2GTG  5VÒEM/GKUVXQT\ÒINKEJQFGTDGUUGTYGPKIGUGJTUEJÌP





-WTWUJ*WPF3WUVCPVÄPÄ[CWPFI-/¤NEGTp2GTG  5VÒEM7P\KTMWNKGTV





-WTWUJ*3WUVCPVÄPÄ[CI-/¤NEGT2GTG  5GNVGPGT,CJTICPI*GPMGNURWTUGJTUEJÌP



ex 91

90

ex 89



-WTWUJ  *      WPF  3WUVCPVÄPÄ[C      WPF  I   -/¤NEGTp2GTG 5VÒEM5GJTUEJÌPDKUWP\KTMWNKGTV





*CNDGT -WTWUJ  2CTC   *  VCVU·EJNKEJ   3WUVCPVÄPÄ[C  I -/  ¤NEGT    2GTG 5GNVGPGT,CJTICPI8QT\ÒINKEJ



*CNDGT-WTWUJ 2CTC *WPF3WUVCPVÄPÄ[C WPFI-/¤NEGTp2GTG  5VÒEM<WO6GKNUGNVGP5GJTUEJÌPWPFXQT\ÒINKEJ



*CNDGT-WTWUJ 2CTC *WPF3WUVCPVÄPÄ[C WPFI-/¤NEGTp2GTG 5VÒEM5GJTUEJÌPWPFXQT\ÒINKEJ



<WFKGUGODGTGKVUXQP+DTCJKO6Ì\GPKO-CVCNQIXQP0WTK2GTGCNU,CJTIGNGUGPGP&CVWOCWH2CTC5VÒEMGPJCVVG UEJQP%ÒPG[V¤NEGTFCTCWHJKPIGYKGUGPFCUUJKGTGKP2WP\GPHGJNGTHÒTXQTNKGIGPOWUUVG&CUUFKGUGNDG2WP\GCWEJ HÒT-WTWUJUVGORGNDGPWV\VYWTFG UQ0T KUVFCIGIGPPGW





1,5:1

 32

93

1,5:1

*CNDGT-WTWUJ 2CTC *3WUVCPVÄPÄ[CI-/¤NEGT2GTG  5GJTUGNVGPGT,CJTICPI*GPMGNURWTUGJTUEJÌP




'ABD AL-MAJÎD KHAN

94

ex 95

96

-WRHGTRT·IWPIGPFGT/ÒP\UV·VVG3WUVCPVÄPÄ[C 

2CTC*3WUVCPVÄPÄ[CI-/¤NEGT2GTG  W­GTUVUGNVGPKPFKGUGT'TJCNVWPI-N(NGEMRQNKGTVG2NCVVG



'ZGORNCTFGT5COONWPI&T8KMVQT5EJKOMC#WMVKQP&T$WUUQ2GWU0CEJH(TCPMHWTV/CKP0T



2CTC*WPF3WUVCPVÄPÄ[CWPFI-/ ¤NEGTp2GTG 5VÒEM5GJTUEJÌPWPFXQT\ÒINKEJ



2CTC*3WUVCPVÄPÄ[CI-/¤NEGT2GTG  5GJTUGNVGPGT,CJTICPI4CPFUEJN·IG8QTFGTUGKVGGVYCUMQTTQFKGTVUGJTUEJÌP

ex 97





 

98

 2CTC  *  WPF  CWH FKEMGP 5EJTÌVNKPIGP   WPF  CWH FÒPPGP 5EJTÌVNKPIGP 3W   UVCPVÄPÄ[CWPFI-/WPF¤NEGTp2GTG 5VÒEM&CUGTUVGXQT\ÒINKEJUQPUVUGJTUEJÌP



2CTC*CWHFKEMGO5EJTÌVNKPI3WUVCPVÄPÄ[CI-/¤NEGT2GTG  4/KVFGPHÒTFKGUG#WUICDGV[RKUEJGPMN5EJTÌVNKPIUHGJNGTP WPFMN5VGORGNCWUDTÒEJGPCO4CPFUQPUVXQT\ÒINKEJ



99

ex 100



 2CTC  * !  CWH DTGKVGO FÒPPGP 5EJTÌVNKPI 3WUVCPVÄPÄ[C 4GXGTUKPEWUWO  I -/ \W   ¤NEGT\W2GTG\W 4+PVGTGUUCPVG(GJNRT·IWPI7P\KTMWNKGTV





2CTC*WPFCWHOKVVNGTGP5EJTÌVNKPIGPWPFCWHFÒPPGP5EJTÌVNKPIGP3W UVCPVÄPÄ[CWPFI-/WPF¤NEGTp2GTG 5VÒEM&CUGTUVG5VGORGNINCP\FKGCPFGTGPUGJTUEJÌP

 33


'ABD AL-MAJÎD KHAN

102

ex 101





2CTC*WPFCWHFKEMGP5EJTÌVNKPIGP3WUVCPVÄPÄ[C WPFI-/¤NEGTp2GTG  5VÒEM<WO6GKNUGNVGPG,CJTI·PIG5GJTUEJÌPDKUWP\KTMWNKGTV



2CTC*CWHUEJYGTGO5EJTÌVNKPI3WUVCPVÄPÄ[CI-/¤NEGT2GTG 5GJTUGNVGPKPFKGUGT'TJCNVWPI/KVFGPHÒTFKGUG#WUICDGV[RKUEJGPMN5EJTÌVNKPIUHGJNGTP 2T·IWPIOKVRQNKGTVGP5VGORGNPXQT\ÒINKEJp5VGORGNINCP\



ex 104

ex 105 ex 103







2CTC* OKVVNGTG5EJTÌVNKPIG  FÒPPG5EJTÌVNKPIG 3WUVCPVÄPÄ[C WPFI-/WPF¤NEGTp2GTG  5VÒEM,CJTGWPFWP\KTMWNKGTVUQPUVUGJTUEJÌP



2CTC  *      Z    8CT   WPF CWHUEJYGTGP5EJTÌVNKPIGP3WUVCPVÄPÄ[C WPFI-/¤NEGTp2GTG 5VÒEM5GJTUEJÌPWPFXQT\ÒINKEJ



2CTC*CWHOKVVNGTGP5EJTÌVNKPIGPWPFCWHFÒPPGP5EJTÌVNKPIGP3WUVCPVÄPÄ[C WPFI-/WPF¤NEGTp2GTG  5VÒEM,CJTUGJTUGNVGPGT,CJTICPI/GKUVXQT\ÒINKEJ



106

1,5:1

1,5:1

)QNFGPG5V·FVGDGUWEJURT·IWPIGPFGT/ÒP\UV·VVG'FKTPG 

-WTWUJ*'FKTPGI(D-/¤NEGT2GTGp  )1.&448QT\ÒINKEJp5VGORGNINCP\ 'ZGORNCTFGT#WMVKQP5RKPM<ÒTKEJ0T

107



108



-WTWUJ*'FKTPGI(D-/¤NEGT2GTGp  )1.&445GJTUEJÌPpXQT\ÒINKEJ





-WTWUJ*'FKTPGI(D-/¤NEGT2GTGp )1.&445GJTUEJÌP



34


'ABD AL-MAJÎD KHAN

109

'KPG-WRHGTOÒP\GFGT/ÒP\UV·VVG$CIJFCF 

2CTC*$CIJFCFI-/¤NEGT2GTGp  449KGKOOGTXQPOKPFGTGT'TJCNVWPIUEJÌP



'ZGORNCTFGT5COONWPI&T8KMVQT5EJKOMC#WMVKQP&T$WUUQ2GWU0CEJH(TCPMHWTV/CKPCWU.QV0T

110

1,5:1

1,5:1

)QNFRT·IWPIGPFGT/ÒP\UV·VVG/KUT -CKTQ  

-WTWUJ*/KUT -CKTQ I(D-/¤NEGT2GTG  )1.&48QT\ÒINKEJp5VGORGNINCP\ 'ZGORNCTFGT#WMVKQP.GW<ÒTKEJ0T

111



112



-WTWUJ*/KUT -CKTQ I(D-/¤NEGT2GTG  )1.&45GJTUEJÌP





-WTWUJ*/KUT -CKTQ I(D-/¤NEGT2GTG  )1.&5GJTUEJÌP



113

114



-WTWUJ*/KUT -CKTQ I(D-/¤NEGT2GTG  )1.&8QT\ÒINKEJ





-WTWUJ*/KUT -CKTQ I(D-/¤NEGT2GTG  )1.&5GJTUEJÌP



115



116

-WTWUJ*/KUT -CKTQ I(D-/¤NEGT2GTG  )1.&8QT\ÒINKEJ



-WTWUJ*/KUT -CKTQ I(D-/¤NEGT2GTG  )1.&5GJTUEJÌP



'ZGORNCTFGT#WMVKQP.GW<ÒTKEJ0T



'ZGORNCTFGT#WMVKQP.GW<ÒTKEJ0T

35


'ABD AL-MAJÎD KHAN

118

117

119



-WTWUJ*/KUT -CKTQ I(D-/¤NEGT2GTG  )1.&8QT\ÒINKEJ





-WTWUJ*/KUT -CKTQ I(D-/¤NEGT2GTG  )1.&48QT\ÒINKEJ





-WTWUJ*/KUT -CKTQ I(D-/¤NEGT2GTG  )1.&4(CUVXQT\ÒINKEJ



120



121

-WTWUJ*/KUT -CKTQ I(D-/¤NEGT2GTG  )1.&(CUVXQT\ÒINKEJ



-WTWUJ*/KUT -CKTQ I(D-/¤NEGT2GTG  )1.&(CUVXQT\ÒINKEJ



'ZGORNCTFGT#WMVKQP.GW<ÒTKEJ0T



123

122



-WTWUJ*/KUT -CKTQ I(D-/¤NEGT2GTG  )1.&5GJTUEJÌP



-WTWUJ*/KUT -CKTQ I(D-/¤NEGT2GTG  )1.&5GJTUEJÌP



'ZGORNCTFGT#WMVKQP.GW<ÒTKEJ0T



'ZGORNCTFGT5COONWPI&T8KMVQT5EJKOMC#WMVKQP&T$WUUQ2GWU0CEJH(TCPMHWTV/CKP0T

124

125

126



-WTWUJ*/KUT -CKTQ I(D-/¤NEGT2GTG  )1.&5GJTUEJÌP





-WTWUJ*/KUT -CKTQ I(D-/¤NEGT2GTG  )1.&5GJTUEJÌP





-WTWUJ*/KUT -CKTQ I(D-/¤NEGT2GTG  )1.&-N4CPFHGJNGTUGJTUEJÌP



36


'ABD AL-MAJÎD KHAN

1,5:1



127

1,5:1

-WTWUJ*/KUT -CKTQ I(D-/¤NEGT2GTG  )1.&8QPITQ­GT5GNVGPJGKVPWT5VÒEMIGRT·IV8QT\ÒINKEJ

128

129



130



-WTWUJ*/KUT -CKTQ I(D-/¤NEGT2GTG  )1.&44CPFUEJNCIUGJTUEJÌP





-WTWUJ*/KUT -CKTQ I(D-/¤NEGT2GTG  )1.&44CPFUEJN·IGUGJTUEJÌP





-WTWUJ*/KUT -CKTQ I(D-/¤NEGT2GTG  )1.&5EJÌPpUGJTUEJÌP



1,5:1



131

 -WTWUJ */KUT -CKTQ I(D-/QJPGFKGUGU,CJT¤NEGTp2GTG )1.&8QPITÌ­VGT5GNVGPJGKV5GJTUEJÌP 

132 1,5:1



1,5:1

-WTWUJ*/KUT -CKTQ I(D-/QJPGFKGUGU,CJT¤NEGTp2GTG  )1.&,CJTICPIWPGFKGTVWPFXQPITÌ­VGT5GNVGPJGKV .GKEJVG(CUUWPIUURWTUGJTUEJÌPpXQT\ÒINKEJ

1,5:1



1,5:1

133



1,5:1

-WTWUJ*/KUT -CKTQ I(D-/¤NEGT2GTG  )1.&5GNVGPDGUQPFGTUKPFKGUGT'TJCNVWPI(CUV5VGORGNINCP\

 37


'ABD AL-MAJÎD KHAN

134

1,5:1

1,5:1



-WTWUJ*/KUT -CKTQ I(D-/¤NEGT2GTG  )1.&8QPITQ­GT5GNVGPJGKV5GJTUEJÌP

ex 135

ex 136

137

ex 138



ex 139



-WTWUJ*WPF/KUT -CKTQ WPFI(D-/¤NEGTp 2GTG 5VÒEM)1.&5GJTUEJÌP





-WTWUJ*WPF/KUT -CKTQ WPFI(D-/¤NEGTWPF2GTG 5VÒEM)1.&8QT\ÒINKEJ





-WTWUJ*/KUT -CKTQ I(D-/¤NEGT2GTG  )1.&8QT\ÒINKEJ





-WTWUJ*WPF/KUT -CKTQ WPFI(D-/¤NEGTWPF 2GTG 5VÒEM)1.&8QT\ÒINKEJWPF5VGORGNINCP\





-WTWUJ*WPF/KUT -CKTQ WPFI(D-/¤NEGT WPF2GTG 5VÒEM)1.&(CUV5VGORGNINCP\



140

141

141

5KNDGTRT·IWPIGPFGT/ÒP\UV·VVG/KUT -CKTQ  

-WTWUJ*/KUT -CKTQ I-/¤NEGT2GTGp



-WTWUJ*XGTOWVNKEJ/KUT -CKTQ I-/¤NEGT2GTGp

38

445EJÌPpUGJTUEJÌP  445GJTUEJÌP

 


'ABD AL-MAJÎD KHAN

142

1,5:1

1,5:1



-WTWUJ*/KUT -CKTQ I-/FKGUGU,CJTPKEJV¤NEGTp2GTGp  8GTOWVNKEJ7PKMWO5GJTUEJÌP 'TYQTDGPXQP5RKPM,WNK







&CU 9KGFGTCWHNGDGP FGT 6CNCTKRT·IWPI H·NNV UKEJGT KP FCU ,CJT  WPF KUV PKEJV GKPGT HGJNGTJCHVGP &CVKGTWPI   \W\WQTFPGPFC\YGKVGEJPKUEJG/GTMOCNGTKEJVKIFGTOKVVNGTGP4GIKGTWPIU\GKV#DFCN/CLÄFUGPVURTGEJGPWPFPKEJV FGPHTÒJGP,CJTGPFGT4CPFUVCDKUVPKEJVOGJTMQTFGNCTVKIUQPFGTPGKPG2WPMVTGKJGOKV8GTDKPFWPIGP\WO·W­GTGP 4CPF WPF FKG 4·PFGNWPI DGUVGJV CWU FGP OKVFGO4GIKGTWPIULCJTKP-CKTQGKPIGHÒJTVGPXQO4CPFJGTIGUGJGP TGEJVYKPMNKIGP4KNNGPPKEJVOGJTCWU5EJT·ITKNNGPYKGKPFGPGTUVGP,CJTGP5QXGTJ·NVGUUKEJCWEJOKVFGOWPVGP UVGJGPFGP-WTWUJXQO4GIKGTWPIULCJT

143 1,5:1



1,5:1

-WTWUJ*/KUT -CKTQ I-/¤NEGT2GTGp

448QT\ÒINKEJ



448QT\ÒINKEJ



144 1,5:1



-WTWUJ*/KUT -CKTQ I-/¤NEGT2GTGp

1,5:1

39


'ABD AL-MAJÎD KHAN

145 1,5:1



1,5:1

-WTWUJ*/KUT -CKTQ I-/¤NEGT2GTGp

 445GJTUEJÌPpXQT\ÒINKEJ



146 1,5:1



1,5:1

-WTWUJ*/KUT -CKTQ I-/¤NEGT2GTGp  44.GKEJVG5EJÒTHURWTGPCO#XGTUTCPF \GKVIGP5VTKEJRTQDGFGU5KNDGTU XQT\ÒINKEJ



'ZGORNCTFGT5COONWPI6WTCVJ2CTV++#WMVKQP5RKPM.QPFQP0T

147



147

1,5:1

-WTWUJ*/KUT -CKTQ I-/¤NEGT2GTGp

445GJTUEJÌP



'ZGORNCTFGT#WMVKQP5RKPM.QPFQP0T

148 1,5:1



-WTWUJ*/KUT -CKTQ I-/¤NEGT2GTGp  5GJTUGNVGPDGUQPFGTUKPFKGUGT'TJCNVWPI8QT\ÒINKEJ 'ZGORNCTFGT#WMVKQP$CNFYKP.QPFQP0T

40

1,5:1




'ABD AL-MAJÎD KHAN

149

1,5:1

1,5:1



 -WTWUJ  *  /KUT -CKTQ  I-/¤NEGTXIN MGPPVFKGUGU,CJTPKEJV  2GTGp 8QPITÌ­VGT5GNVGPJGKV-TCV\GTKO#XGTUUGJTUEJÌP  'ZGORNCTFGT#WMVKQP$CNFYKP.QPFQP0T

150



151

-WTWUJ*/KUT -CKTQ I-/¤NEGT2GTGp

152

445EJÌP





-WTWUJ*/KUT -CKTQ I-/¤NEGT2GTGp  8QPITQ­GT5GNVGPJGKV8QT\ÒINKEJ





-WTWUJ*/KUT -CKTQ I-/¤NEGT2GTGp  8QPITQ­GT5GNVGPJGKV5EJÌPpUGJTUEJÌP



'ZGORNCTFGT#WMVKQP*GTKVCIG5GRVGODGT0T

'ZGORNCTFGT#WMVKQP*GTKVCIG5GRVGODGT0T

ex 153

ex 154

ex 155



-KTUJ  *     WPF  /KUT -CKTQ      WPF  I -/  ¤NEGT   p2GTG 5VÒEM&CUGTUVGXGTIQNFGVWPF*GPMGNURWTUQPUVUGJTUEJÌPDKUWP\KTMWNKGTV





-KTUJ*WPF/KUT -CKTQ WPFI-/¤NEGT p2GTG  5VÒEM/GKUVUGNVGPG,CJTI·PIG&CUNGV\VGIGNQEJVDGUEJPKVVGPUGJTUEJÌPWPFXQT\ÒINKEJ



-KTUJ*WPF/KUT -CKTQ WPFI-/ ¤NEGTp2GTG  5VÒEM5GNVGPG,CJTI·PIG&CUGTUVGIGNQEJVUGJTUEJÌPWPFXQT\ÒINKEJ





41


'ABD AL-MAJÎD KHAN

ex 156

ex 157

ex 158

ex 159

ex 160



2CTC*WPF/KUT -CKTQ WPFI-/¤NEGT p2GTG 5VÒEM/GKUVUGJTUEJÌP





2CTC*WPF/KUT -CKTQ WPFI-/¤NEGT p2GTG 5VÒEM5GJTUEJÌPWPFXQT\ÒINKEJ





 2CTC  *    WPF  /KUT -CKTQ     WPF  I -/  ¤NEGT   pWPF2GTG 5VÒEM5GNVGPG,CJTI·PIG4CPFHGJNGTOGKUVUGJTUEJÌP





2CTC*WPF/KUT -CKTQ WPFI-/¤NEGT WPF2GTG  5VÒEMªDGTYKGIGPFUGNVGPG,CJTI·PIG5GJTUEJÌPWPFXQT\ÒINKEJ



 2CTC  *    WPF/KUT -CKTQ WPFI-/¤NEGT p2GTG 5VÒEM5GJTUEJÌPFCUNGV\VGXQT\ÒINKEJ





ex 162 ex 161

ex 163



 2CTC  *      /KUT -CKTQ      WPF  I -/  ¤NEGT   p2GTG 5VÒEM5GJTUEJÌPFCUNGV\VGXQT\ÒINKEJ





2CTC*WPF/KUT -CKTQ WPFI-/¤NEGT p2GTG  5VÒEM6GKNUUGNVGPG,CJTI·PIG&CUUGNVGPG,CJTIGNQEJVUQPUVUGJTUEJÌPWPFXQT\ÒINKEJ



 2CTC  *    WPF  /KUT -CKTQ     WPF  I -/  ¤NEGT   p2GTG  5VÒEM5GNVGPG,CJTI·PIGKPÒDGTFWTEJUEJPKVVNKEJGP'TJCNVWPIGP5GJTUEJÌPWPFXQT\ÒINKEJ





ex 165

164

164

-WRHGTOÒP\GPFGT/ÒP\UV·VVG/KUT -CKTQ  

2CTC*WPF/KUT -CKTQ WPFI-/¤NEGTWPF2GTG 5VÒEM5GJTUEJÌPpXQT\ÒINKEJ





2CTC*WPF/KUT -CKTQ WPFI-/ ¤NEGTp2GTG 5VÒEM5GJTUEJÌPWPFXQT\ÒINKEJ



42


'ABD AL-MAJÎD KHAN

167

169

168

ex 166



ex 166

2CTC*OKV6WIJTCCWH.QVWU\YGKIGP 8CT QUOCPKUEJGT4GKEJUV[R /KUT -CKTQ          WPF  I -/  WPF  ¤NEGT   pp2GTG 5VÒEM/GKUVUGJTUEJÌP



$GKGKPGTFGTDGKFGP5VGORGNXCTKCPVGPFGU,CJTGU·JPGNVFCU4GIKGTWPIULCJTUGJTUVCTMFGT,CJTGU\CJNCWHITWPF GKPGU MNGKPGP WPUEJGKPDCTGP 5VGORGNDTWEJU KP FGT <KHHGT  &KGUGU ,CJT  KUV PCEJ ¤NEGT PWT KP FGT 5COONWPI   .CEJOCPPPCEJIGYKGUGPFGT-/-CVCNQIIKDVFC\WCPTGRQTVGFPQVEQPHKTOGF5QMCPPXGTOWVGVYGTFGPFC­FCU ,CJT  PWT FKGUGO GKP\GNPGP 5VGORGN UGKPG UEJGKPDCTG 'ZKUVGP\ XGTFCPMV WPF FCOKV FKG 'KPHÒJTWPI FGU   -QPUVCPVKPQRNGT-WRHGTOÒP\V[RUKPFGT/ÒP\UV·VVG-CKTQPCEJGTUVGP'ZRGTKOGPVGPKO,CJTGTUVKPFCU,CJTWPF PKEJVFCVKGTV



2CTC*/KUT -CKTQ I-/¤NEGT2GTGp  4'VYCUWPTGIGNO·­KIGT5EJTÌVNKPIUGJTUEJÌP





2CTC*/KUT -CKTQ I-/¤NEGT2GTGp

48QT\ÒINKEJ





2CTC*/KUT -CKTQ I-/¤NEGT2GTGp

45GJTUEJÌP



170

1,5:1

1,5:1

)QNFRT·IWPIGPFGT/ÒP\UV·VVG6ÑPKU 

4K[CN*6ÑPKU/KV/WJCOOCF$C[ * OKV(CJPGÒDGTFGO0COGPFGU$C[ I(GPKPC5GEQPFV[RG(D-/¤NEGT2GTGp )1.&48QT\ÒINKEJ 

171



1,5:1

171

4K[CN*6ÑPKU/KV/WJCOOCF$C[ * I(GPKPC(D-/ ¤NEGT2GTGp )1.&44CPFUEJNCIMN*GPMGNURWTXQT\ÒINKEJp5VGORGNINCP\

 43


'ABD AL-MAJÎD KHAN

172

1,5:1

1,5:1



4K[CN*6ÑPKU/KV/WJCOOCFCU5³FKS$C[ * I(GPKPC(D -/¤NEGT2GTGp )1.&48QT\ÒINKEJ 

173

175

176

174



 4K[CN  * 6ÑPKU /KV /WJCOOCF $C[  *   I (GPKPC  (D  -/ ¤NEGT2GTGp )1.&4-N4CPFHGJNGTXQT\ÒINKEJp5VGORGNINCP\





 4K[CN  * 6ÑPKU /KV /WJCOOCF $C[  *   I (GPKPC  (D  -/ ¤NEGT2GTGp )1.&5GJTUEJÌP





4K[CN*6ÑPKU/KV/WJCOOCFCU5³FKS$C[ * I(GPKPC(D-/ ¤NEGT2GTGp )1.&448QT\ÒINKEJ





4K[CN*6ÑPKU/KV/WJCOOCF$C[ * I(GPKPCUGEQPFV[RG(D -/¤NEGT2GTGp )1.&45VGORGNINCP\



177

1,5:1

177

5KNDGTRT·IWPIGPFGT/ÒP\UV·VVG6ÑPKU  44

4K[CN*6ÑPKUI(GPKPC-/¤NEGT2GTGp  44-N4CPFHGJNGTXQT\ÒINKEJ




'ABD AL-MAJÎD KHAN

ex 178

179

180



4K[CNWPF*6ÑPKUWPFI(GPKPCWPF-/¤NEGTWPF 2GTGp 5VÒEM5GJTUEJÌPWPFXQT\ÒINKEJ





4K[CN*6ÑPKUI(GPKPC-/¤NEGT2GTGp

8QT\ÒINKEJ





4K[CN*6ÑPKUI(GPKPC-/¤NEGT2GTGp  5GJTUGNVGPGT,CJTICPI8QT\ÒINKEJp5VGORGNINCP\



181

182

183



4K[CN*6ÑPKUI(GPKPC-/¤NEGT2GTGp  5GJTUGNVGPGT,CJTICPI9KP\4CPFHGJNGTXQT\ÒINKEJ





4K[CN*6ÑPKUI(GPKPC-/¤NEGT2GTGp  -N2TÒHURWTCO4CPF8QT\ÒINKEJ





 4K[CN  * 6ÑPKU /KV /WJCOOCF $C[  *   I (GPKPC  -/  ¤NEGT   2GTGp 448QT\ÒINKEJ



184



 4K[CN  * 6ÑPKU /KV /WJCOOCF $C[  *   I (GPKPC  -/  ¤NEGT   2GTGp 44-N(NGEMGP5VGORGNINCP\

 45


'ABD AL-MAJÎD KHAN

186

185



 4K[CN  * 6ÑPKU /KV /WJCOOCF $C[  *   I (GPKPC  -/  ¤NEGT   2GTGp 48QT\ÒINKEJ





4K[CN*6ÑPKUI(GPKPC-/¤NEGT2GTGp

5VGORGNINCP\



5GJTUEJÌP



187

189

188



4K[CN*6ÑPKUI(GPKPC-/¤NEGT2GTGp



 4K[CN  * 6ÑPKU /KV /WJCOOCF $C[  *   I (GPKPC-/¤NEGT 2GTGp 4#XGTUKPFGT/KVVGHNCWUGJTUEJÌP





4K[CN*6ÑPKUI(GPKPC-/¤NEGTXIN2GTGp  4$GKFGTUGKVUNGKEJVG-TCV\GTUGJTUEJÌP



190

1,5:1



1,5:1

4K[CN*6ÑPKU/KV/WJCOOCF$C[ * I(GPKPC5GEQPFV[RG-/ ¤NEGT2GTGp 48QT\ÒINKEJp5VGORGNINCP\

191



192



4K[CN -JCTTWDC *6ÑPKU/KV/WJCOOCF$C[ * I(GPKPC-/ ¤NEGT2GTGp 5GJTUEJÌPpXQT\ÒINKEJ





4K[CN -JCTTWDC *6ÑPKU/KV/WJCOOCF$C[ * I(GPKPC-/ ¤NEGT2GTGp 5VGORGNINCP\



46


'ABD AL-MAJÎD KHAN

193

1,5:1



4K[CN -JCTTÑDC *6ÑPKUI(GPKPC-/¤NEGT2GTGp  445GJTUEJÌP

ex 194





1,5:1



ex 195

4K[CN -JCTTÑDC   WPF*6ÑPKU/KV/WJCOOCF$C[ *  WPFI(GPKPCWPF-/¤NEGTWPF2GTGp  5VÒEM8QT\ÒINKEJWPF5VGORGNINCP\



4K[CN -JCTTWDC WPF*6ÑPKU/KV/WJCOOCF$C[ *  WPFI(GPKPC-/¤NEGTp2GTGp 5VÒEM5GJTUEJÌPWPFXQT\ÒINKEJ



ex 198 196

ex 197

ex 200

-WRHGTRT·IWPIGPFGT/ÒP\UV·VVG6ÑPKU 

0CUTÄ -JCTTWDC *6ÑPKU/KV/WJCOOCF$C[ * I(GPKPC-/ ¤NEGT2GTGp 5GJTUGNVGPKPFKGUGT'TJCNVWPI(CUV5VGORGNINCP\





0CUTÄ -JCTTWDC WPF* ZFCXQPZOKV)GIGPUVGORGNCWHFGO#XGTUZOKV )GIGPUVGORGNCWHFGO4GXGTU 6ÑPKU/KV/WJCOOCF$C[ *  WPFI(GPKPCWPF-/WPF¤NEGTWPFC2GTGp  5VÒEM5GJTUEJÌP



0³UKTÄ -JCTTWDC WPF*6ÑPKU*OKV/WJCOOCF $C[ * WPFI(GPKPC WPF-/WPF¤NEGTWPF2GTG  5VÒEM/GKUVUGJTUEJÌP*5VGORGNINCP\



0³UKTÄ -JCTTWDC   WPF*CNNGOKVFGP9GTVJCNDKGTGPFGP)GIGPUVGORGNPDGK LGGKPOCNCWH#XGTUWPF4GXGTU6ÑPKU*OKV/WJCOOCF$C[ * WPF I(GPKPCWPF-/WPF¤NEGTCWPFC2GTG  5VÒEM5GJTUEJÌPWPFXQT\ÒINKEJ



 0³UKTÄ -JCTTWDC     WPF  * 6ÑPKU  * OKV /WJCOOCF $C[  

* WPFI(GPKPCWPF-/WPF¤NEGT WPF2GTGp 5VÒEMPWTUEJÌPFKGCPFGTGPUGJTUEJÌP



&KG)GIGPUVGORGNWPIYGNEJGKPFGT/ÒP\UV·VVG\W6ÑPKUCWUIGHÒJTVYWTFGUGV\VGPCEJ'FKMVXQO&JWNJKLLC *#WIWUVFKGPQEJ\W#PHCPIFGU,CJTGUKPITQ­GP/GPIGPCWUIGIGDGPGPUEJYGTGP-WRHGTOÒP\GP FGTGP2T·IWPIKO#RTKNGKPIGUVGNNVYQTFGPYCTCWHFGPJCNDGP9GTV(GPKPCJCVFKGUGU8QTIGJGPKP$G\WIIGUGV\V\W FGP FKXGTUGP GTJCNVGPGP 2TQVGUVPQVGP GWTQR·KUEJGT *·PFNGT KP 6WPKU ÒDGT FCU ÒDGTJCPF PGJOGPFG -WRHGT   +O2TKP\KRHQNIVFCU8GTHCJTGPCDGTUR·VOKVVGNCNVGTNKEJGPQFGTHTÒJPGW\GKVNKEJGP/ÒP\XGTTWHWPIGPYKGUKGUQYQJNCWU FGO1UOCPKUEJGP4GKEJWPFDGUQPFGTUCWUFGO/CONWMGPUWNVCPCVCNUGKPG#TVFGT7OUCV\UVGWGTIWVFQMWOGPVKGTV UKPF







47


'ABD AL-MAJÎD KHAN

ex 202

ex 201





ex 201

0³UKTÄWPF(CNUQFGT0³UKTÄWPF*6ÑPKUWPF I(GPKPCWPF-/WPF¤NEGTp2GTGp  5VÒEM5GJTUEJÌP



-JCTTWDCWPF* ZZOKVFKEMGTZOKVFÒPPGT5EJTKHV 6ÑPKUOKV/WJCOOCF $C[ * OKV/WJCOOCFCU5³FKS * WPFI(GPKPC  WPF  -/   WPF  ¤NEGT   ! $GUEJTGKDWPI PKEJV GKPFGWVKI  WPF   2GTGp 5VÒEM5GJTUEJÌP



203 1,5:1

1,5:1

#NIGTKGP#WHUVCPFFGU #DFCN3³FKTIGIGPFKG(TCP\QUGP 

4K[³N $ÑLÑ  * 6³SCFCOV #X NCTCDDWP³  CHTCIJ CNC[P³  UCDTCP YC VWYÑHWP³  OWUNKOÄPCP  

Q*GTTGTHÒNNGWPUOKV)GFWNFWPFNCUUGWPUCNU/WUNKOGUVGTDGP3WT ³P8++ 4GX/ÒP\UV·VVGWPF &CVWO5NI(QPTQDGTV*GKPTKEJ0ÒV\GN-ÌPKINKEJG/WUGGP\W$GTNKP-CVCNQIFGT1TKGPVCNKUEJGP /ÒP\GP ++&KG/ÒP\GPFGTOWUNKOKUEJGP&[PCUVKGGP5RCPKGPUWPFFGUYGUVNKEJGP0QTFCHTKMC $GTNKP  50TI-/¤NEGTp2GTGp 8QPITÌ­VGT5GNVGPJGKV5GJTUEJÌP  0CEJ FGT HTCP\ÌUKUEJGP +PVGTXGPVKQP  KP #NIGTKGP WPF FGT 'TQDGTWPI FGT *CWRVUVCFV #NIKGTU  OKV FGO   4ÒEM\WI FGT QUOCPKUEJGP 8GTYCNVWPI KP FCU UVCTM DGHGUVKIVG %QPUVCPVKPG \GTHKGN FCU .CPF KP GKPGP $ÒTIGTMTKGI   &GT*GTTUEJGT/CTQMMQUWPVGTUVÒV\VGFCDGKFGP/CTCDWVXQP/CUECTCKO+PPGTPFGU.CPFGU/WJK[CFFKPFGTCP UGKPGO 1TV GKP /CUUCMGT WPVGT FGT VÒTMKUEJGP )CTPKUQP CPTKEJVGVG &KG #WHUV·PFKUEJGP KP /CUECTC TKEJVGVGP UKEJ   UQYQJNIGIGPFKGQUOCPKUEJG*GTTUEJCHVCNUCWEJIGIGPFKG(TCP\QUGP0QEJXQTFGOXÌNNKIGP4ÒEM\WIFGT6ÒTMGP DGKO4GIKGTWPIUCPVTKVV #DFCN/CLÄFUDGICPPGPFKG#WHUV·PFKUEJGPOKVGKIGPGT/ÒP\RT·IWPIWPVGTKJTGO(ÒJTGT #DFCN3³FKTFGTPCEJFGO6QFFGU8CVGTU/WJK[CFFÄPKPFGT(ÒJTWPIIGHQNIVYCT  

+O,WNKPWV\VGPFKG(TCP\QUGPGKPGHÒTUKGIÒPUVKIG-TKGIUUKVWCVKQPWPFÒDGTNKG­GPKJOXGTVTCINKEJFKG8GTYCNVWPI XQP 1TCP WO UGNDGT IGIGP FKG 1UOCPKUEJG #TOGG KP %QPUVCPVKPG HTGKG *CPF \W JCDGP +P FKGUGT <GKV UEJGKPV FKG   'KPTKEJVWPIFGT/ÒP\UV·VVGXQP6CSCFCOV\WHCNNGP  

&KGXQPFGOJGTXQTTCIGPFGP1TICPKUCVQTKPOKVVGNCNVGTNKEJGTKUNCOKUEJGT6TCFKVKQPCPQP[OIGRT·IVGP/ÒP\GP\GKIGP KPKJTGT#WUYCJNXQPRTQITCOOCVKUEJGP3WT CP\KVCVGPYKGKPCM\GRVCDGNGKPGPKEJVOWUNKOKUEJG*GTTUEJCHVYCT5GKPG #DYGPFWPIXQO1UOCPKUEJGP4GKEJUEJGKPVJKGTCWUUEJNKG­NKEJCWUFGOWP\WTGKEJGPFGP5EJWV\XQTPKEJVKUNCOKUEJGT *GTTUEJCHV FWTEJ FKG 6ÒTMGP DGITÒPFGV +P VGEJPKUEJGT *KPUKEJV YCTGP FKG /ÒP\GP FGT /ÒP\UV·VVG KP 6CSCFCOV   HQTVUEJTKVVNKEJWPF\GKIVGPUGNDUVDGKMNGKPGP0QOKPCNGPGKPG4·PFGNWPI  

&GP #TOGGP #DF CN3CFKTU IGNCPI GU GKP ,CJT\GJPV NCPI FGP VGEJPKUEJ ÒDGTNGIGPGP 9CHHGP FGT (TCP\QUGP \W   YKFGTUVGJGP YCU KJTGO (ÒJTGT UEJQP Y·JTGPF FGU -CORHGU #PGTMGPPWPI WPF $GYWPFGTWPI CWEJ KP 'WTQRC   GKPDTCEJVG0CEJFGT0KGFGTNCIGWPF)GHCPIGPUEJCHVKP(TCPMTGKEJDKUYWTFGGTKPU'ZKNKPFCUQUOCPKUEJG $WTUCGPVNCUUGPWPFNGDVGUR·VGTKP&COCUMWU$GTÒJOVUKPFFKG'KPNCFWPIGPUGKPGU$GYWPFGTGTU0CRQNGQP+++FGTKJP \WO 4KVVGT FGT 'JTGPNGIKQP UEJNWI PKEJV ICP\ WPGKIGPPÒV\KI WO KJP \WT #WUUÌJPWPI OKV FGP #NIGTKGTP   RTQRCICPFKUVKUEJ\WDGPWV\GP #DFCN3³FKTUVCTDJQEJDGVCIVCO/CKKP&COCUMWU5GKPG5ÌJPGUVCPFGP VGKNUKPHTCP\ÌUKUEJGOVGKNUKPQUOCPKUEJGO&KGPUV

ex 204



48

-JCTTWDCWPF*6³SCFCOV#XCPPCFFÄP KPFCNN³JCNKUN³O FKGYCJTG4GNKIKQPDGK #NNCJKUVFGT+UNCO 4GX/ÒP\UV·VVGWPF&CVWOWPFI-/¤NEGTp2GTGp  5VÒEM45GJTUEJÌP




'ABD AL-'AZÎZ KHAN

#$&#. #<œ<-*#0 6ª4-'+6ª4-+5%*#$&ª.#<+<*#0  &*©+*+,,#,7/Œ&Œ++* ,70+/#+)'5614$'0,70+

&GT CO  (GDTWCT  IGDQTGPG $TWFGT #DF CN/CLÄFU XGTFCPMVG FGT CWHIGMN·TVGP JWOCPKUVKUEJGP   *CNVWPIUGKPGU8CVGTUWPF$TWFGTUFCUUGTFGPKOCNVGP1UOCPKUEJGP4GKEJÒDNKEJGP$TWFGTOQTFDGKO )GPGTCVKQPGPYGEJUGNPKEJVICDFQEJOCPXGTYGKIGTVGKJOFKGIGFKGIGPG'T\KGJWPIWPF#WUDKNFWPIFGT QUOCPKUEJGP-TQPRTKP\GP'TUVCPFFGP4GHQTOKFGGPUGKPGU8CVGTUWPF$TWFGTUPCJGCDGTKPFGT7OUGV \WPIUVCPFGP5VTWMVWTRTQDNGOGÒRRKIG*QHJCNVWPIWPFOCPIGNPFGªDGTUKEJVINGKEJ\GKVKIKO9GIG7P IGYÌJPNKEJYCTGPFKGYGKVGP4GKUGPFKG #DFCN #\Ä\OGJTHCEJWPVGTPCJOUQPCEJ(TCPMTGKEJ \WO$GUWEJFGT9GNVCWUUVGNNWPI'TXGTUWEJVGUQGKPGRGTUÌPNKEJG4QNNGWPVGTFGP*GTTUEJGTP'WTQRCU GKP\WPGJOGP  5EJQPKO#RTKNTGKUVGFGT5WNVCPPCEJI[RVGPWOFKG#OVUGKPUGV\WPIXQP+UOC KN2CUEJCFGO 5QJPFGUXGTUVQTDGPGP/WJCOOCF5C ÄF2CUEJCUGNDGTXQT\WPGJOGP&KGUGGTUVG4GKUGGKPGUQUOCPKUEJGP 5WNVCPUUGKVFGT'TQDGTWPIFWTEJ5GNKO+FKGPVGPKEJV\WNGV\VCNU<GKEJGPFCHÒTFCUUFGT*GTTUEJCHVUCP URTWEJFGT1UOCPGPCWHFCUKOOGTUV·TMGTWPVGTDTKVKUEJGPWPFHTCP\ÌUKUEJGP'KPHNWUUIGTCVGPFGI[RVGP UGJTNGDGPFKIYCT&KGKPVGPUKXKGTVGPFKRNQOCVKUEJGP-QPVCMVGHÒJTVGPCDGTCWEJ\WGKPGT0GWCWUJCPFNWPI FGTNCPIGIGURCPPVGP$G\KGJWPI\YKUEJGPI[RVGPWPFFGT*QJGP2HQTVG/KVGKPGOGTUVGP(KTO³P GTNCWDVGFGT5WNVCPCPP·JGTPFGKPG8GTFQRRNWPIFGU·I[RVKUEJGP*GGTGUFGOGKPGGPVURTGEJGPFG'TJÌ JWPI FGU ·I[RVKUEJGP L·JTNKEJGP 6TKDWVU CWH  2HWPF GPVURTCEJ +O HQNIGPFGP ,CJT KP FGO FCU   ·I[RVKUEJG *GGT9CHHGPJKNHGDGKGKPGO#WHUVCPFFGT)TKGEJGPCWH-TGVCNGKUVGPMQPPVGGTJKGNV+UOC KN 2CUJCYGKVGTG<WIGUV·PFPKUUGXQO5WNVCPP·ONKEJFKG'TDNKEJMGKVUGKPGU#OVGUKPFKTGMVGTO·PPNKEJGT .KPKGWPFGKPGPGKP\KICTVKIGP6KVGNFWTEJFGPUKEJFGT2CUJCXQPI[RVGPXQPFGP2TQXKP\IQWXGTPGWTGP CPFGTGT8KN³[GVGWPVGTUEJKGFFWTEJFKG8GTOKVVNWPICTOGPKUEJGT7PVGTJ·PFNGTYWTFGCWUFGTJKUVQTKUEJGP 6TKEMMKUVGFGTXQTKUNCOKUEJG\GPVTCNCUKCVKUEJG6KVGN-JGFKXGJGTXQTIG\CWDGTV&KGUGT8QTICPIKO)GKUVG FGU*KUVQTKUOWUGPVURTCEJGKPGTHCUVVCWUGPF,CJTG\WXQTXQPFGP #DD³UKFGPMCNKHGPXQNN\QIGPGP#WHYGT VWPI HÒT KJTG CNU +MJUJÄFG XQP I[RVGP WPF #HUJÄP XQP #TOGPKGP DG\GKEJPGVGP WPF GKIGPG &[PCUVKGP   DGITÒPFGPFGP)QWXGTPGWTG  49


'ABD AL-'AZÎZ KHAN *KUVQTKUOWUWPFDGIKPPGPFGT0CVKQPCNKUOWUDGGKPHNWUUVGPFGP)CPIFGT)GUEJKEJVGWPVGT #DFCN #\Ä\ CWEJKPCPFGTGTWPGTYCTVGVGT4KEJVWPI&GT$NKEMCWHPCVKQPCNG)GUEJKEJVGDTCEJVGCWEJGKP+PVGTGUUGCP VÒTMKUEJGT)GUEJKEJVGKP<GPVTCNCUKGPCWEJYGPPFKG#PH·PIGFGT#PGTMGPPWPIQUOCPKUEJGT*QJGKV FWTEJFGPIGIGPFKGEJKPGUKUEJG*GTTUEJCHVKP-³UJIJCTGTHQNITGKEJGP;C SÑD$G[GJGTOKVFGT#PGTMGP PWPI FGT -CNKHCVUKFGG WPF FGP VTCPUMQPVKPGPVCNGP 8GTDKPFWPIGP FGT 0CSUJDCPFÄ5ÑHÄDTWFGTUEJCHV GPV   URTCPIGP&KGQUOCPKUEJG*GTTUEJCHVKP<GPVTCNCUKGPDNKGDGKPGTGNCVKXMWT\G'RKUQFGYGKNFCU1UOCPK UEJG4GKEJCWEJDGKDTKVKUEJGT7PVGTUVÒV\WPIYGPKIUR·VGTPKEJVOGJT\WCMVKXGP*KNHUNGKUVWPIGPKPFGT .CIGYCTWPFFKG%JKPGUGP-³UJIJCTYKGFGTDGUGV\GPMQPPVGP&QEJFGT2CPVWTCPKUOWUPCJOFC OCNUUGKPGP#PHCPIFKG+FGGFCUUFKGVÒTMKUEJG)GUEJKEJVG-WNVWTWPF5RTCEJGKJTG9WT\GNPKP6WTMGUVCP JCDGYQJKPKPHQNIGFGUUGPKPVGPUKXG$G\KGJWPIGPHQTVDGUVGJGPOÒUUGP  7OGTUEJKGPGUUQCNUJCDGFCU1UOCPKUEJG4GKEJUGKPGP2NCV\WPVGTFGP/·EJVGP'WTQRCUIGHWPFGP +P FKGUGT 5KVWCVKQP DGCDUKEJVKIVG FGT 5WNVCP PWPOGJT FKG 'TDHQNIGTGIGNWPI YGNEJG GKPG 0CEJHQNIG HÒT   UGKPGP0GHHGP/WT³FXQTUCJCWHUGKPGPGKIGPGP5QJP +\\CFFÄPWO\WNGKVGPYQTKPGTXQP4WUUNCPFWPVGT UVÒV\VYWTFG  #WHFGT'DGPGFGT(KPCP\RQNKVKMICDGUGDGPHCNNUGKPGP-QPHNKMV\YKUEJGPTWUUKUEJGPWPFDTKVKUEJHTCP\ÌUK UEJGP+PVGTGUUGPNKG­FGT5WNVCPOKVTWUUKUEJGO2NC\GVGTMN·TGPFCUUGKP5VCCVUDCPMTQVV\WO#WUUGV \GPFGUUVCCVNKEJGP5EJWNFGPFKGPUVGU\YKPIGYCUGKPUGKVKIFKG'PIN·PFGTWPF(TCP\QUGPDGNCUVGVGKPPGT JCND FGU 4GKEJGU CDGT \W OCUUKXGP 'TUEJÒVVGTWPIGP HÒJTVG WPF GTUV PCEJ NCPIGP 8GTJCPFNWPIGP    IGTGIGNVYWTFG&KGYGUVNKEJQTKGPVKGTVGP4GHQTOMT·HVGQTICPKUKGTVGPFCTCWHJKPGKPGPCO/CK CWUDTGEJGPFGP#WHUVCPFKP-QPUVCPVKPQRGNFGTFGP5WNVCPCO/CK\WT#DFCPMWPI\YCPI#O,WPK UQNNUKEJ #DFCN #\Ä\UGNDGTIGVÌVGVJCDGPLGFQEJYWTFGHÒPH,CJTGUR·VGTPCEJFGT'PVOCEJVWPIFGT (ÒJTGTFGT4GHQTOKUVGPFKGUGPFGT2TQ\GUUYGIGPFGT'TOQTFWPIFGU5WNVCPUIGOCEJV  

205

1,5:1

1,5:1

)QNFRT·IWPIGPFGT/ÒP\UV·VVG3WUVCPVÄPÄ[C 

-WTWUJ*,CJT3WUVCPVÄPÄ[CI(D-/¤NEGT2GTG  )1.&5GJTUGNVGPPWT'ZGORNCTGIGRT·IV5GJTUEJÌP

206



206

-WTWUJ*,CJT3WUVCPVÄPÄ[CI(D-/¤NEGT2GTG  )1.&8QPITQ­GT5GNVGPJGKVPWT'ZGORNCTGIGRT·IV8QT\ÒINKEJ 'ZGORNCTCWUFGT.KUVG$CNFYKP.QPFQP0T

50

1,5:1






'ABD AL-'AZÎZ KHAN

208

207

209



-WTWUJ*,CJT3WUVCPVÄPÄ[CI(D-/¤NEGT2GTG  )1.&8QT\ÒINKEJ





-WTWUJ*3WUVCPVÄPÄ[CI(D-/¤NEGT2GTG  )1.&5GJTUEJÌP8QT\ÒINKEJ





-WTWUJ*3WUVCPVÄPÄ[CI(D-/¤NEGT2GTG  )1.&5GJTUEJÌP8QT\ÒINKEJ



210

211

212



-WTWUJ*3WUVCPVÄPÄ[CI(D-/¤NEGT2GTG  )1.&(CUVXQT\ÒINKEJ





-WTWUJ*3WUVCPVÄPÄ[CI(D-/¤NEGT2GTG  )1.&8QT\ÒINKEJ





-WTWUJ*3WUVCPVÄPÄ[CI(D-/¤NEGT2GTG  )1.&8QT\ÒINKEJ



'ZGORNCTFGT#WMVKQP7$5$CUGN0T

213



-WTWUJ*3WUVCPVÄPÄ[CI(D-/¤NEGT2GTG  )1.&5GJTUEJÌP



'ZGORNCTFGT#WMVKQP7$5<ÒTKEJ0T

51


'ABD AL-'AZÎZ KHAN

214

215



-WTWUJ*3WUVCPVÄPÄ[CI(D-/¤NEGT2GTG  )1.&8QT\ÒINKEJ





-WTWUJ*3WUVCPVÄPÄ[CI(D-/¤NEGT2GTG  )1.&5GJTUEJÌP



216

217

218

219



-WTWUJ*3WUVCPVÄPÄ[CI(D-/¤NEGT2GTG  )1.&5GJTUEJÌP





-WTWUJ*3WUVCPVÄPÄ[CI(D-/¤NEGT2GTG  )1.&5GJTUEJÌP





-WTWUJ*3WUVCPVÄPÄ[CI(D-/¤NEGT2GTG  )1.&5GJTUEJÌP





-WTWUJ*3WUVCPVÄPÄ[CI(D-/¤NEGT2GTG  )1.&8QT\ÒINKEJ



220

221

222

223



-WTWUJ*3WUVCPVÄPÄ[CI(D-/¤NEGT2GTG  )1.&5GJTUEJÌP





-WTWUJ*3WUVCPVÄPÄ[CI(D-/¤NEGT2GTG  )1.&5GJTUEJÌPpXQT\ÒINKEJ





-WTWUJ*3WUVCPVÄPÄ[CI(D-/¤NEGT2GTG  )1.&5GJTUEJÌPpXQT\ÒINKEJ





-WTWUJ*3WUVCPVÄPÄ[CI(D-/¤NEGT2GTG  )1.&8QT\ÒINKEJ



52


'ABD AL-'AZÎZ KHAN

224

226

225



-WTWUJ*3WUVCPVÄPÄ[CI(D-/¤NEGT2GTG  )1.&8QT\ÒINKEJ





-WTWUJ*3WUVCPVÄPÄ[CI(D-/¤NEGT2GTG  )1.&5GJTUEJÌP





-WTWUJ*3WUVCPVÄPÄ[CI(D-/¤NEGT2GTG  )1.&5GJTUEJÌPpXQT\ÒINKEJ



228

227



-WTWUJ*3WUVCPVÄPÄ[CI(D-/¤NEGT2GTG  )1.&8QT\ÒINKEJ





-WTWUJ*3WUVCPVÄPÄ[CI(D-/¤NEGT2GTG  )1.&5GJTUEJÌP



229

1,5:1

1,5:1



-WTWUJ*3WUVCPVÄPÄ[CI(D-/¤NEGT2GTG  )1.&5GJTUGNVGPDGUQPFGTUKPFKGUGT'TJCNVWPI9KP\4CPFHGJNGTXQT\ÒINKEJ

230



231



-WTWUJ*3WUVCPVÄPÄ[CI(D-/¤NEGT2GTG  )1.&445GJTUEJÌPMCWOUKEJVDCTG$TQUEJKGTURWTCWH4GX





-WTWUJ*3WUVCPVÄPÄ[CI(D-/¤NEGT2GTG  )1.&45GJTUEJÌP

 53


'ABD AL-'AZÎZ KHAN

ex 233

ex 234

ex 235

232

236



-WTWUJ*3WUVCPVÄPÄ[CI(D-/¤NEGT2GTG  )1.&45EJTÌVNKPIUHGJNGTCO4CPF .COKPKGTWPI 5GJTUEJÌPpXQT\ÒINKEJ





-WTWUJ*WPF3WUVCPVÄPÄ[CWPFI(D-/¤NEGT 2GTG 5VÒEM)1.&5GJTUEJÌP





-WTWUJ*WPF3WUVCPVÄPÄ[CWPFI(D-/¤NEGT 2GTG 5VÒEM)1.&5GJTUEJÌPUGJTUEJÌPOKV*GPMGNURWTWPF5VGORGNINCP\





-WTWUJ*WPF3WUVCPVÄPÄ[CWPFI(D-/¤NEGT 2GTG  5VÒEM)1.&5GJTUEJÌPWPFXQT\ÒINKEJFCUNGV\VGOKVMNGKPGP4CPFHGJNGTP



-WTWUJ*3WUVCPVÄPÄ[CI(D-/¤NEGT2GTG  )1.&5GJTUGNVGPGT,CJTICPI5GJTUEJÌPpXQT\ÒINKEJ





ex 237

5KNDGTRT·IWPIGPFGT/ÒP\UV·VVG3WUVCPVÄPÄ[C 

-WTWUJ*WPF3WUVCPVÄPÄ[CWPFI-/¤NEGTp 2GTG 5VÒEM5GJTUEJÌPWPFXQT\ÒINKEJ

238

ex 239



ex 240



-WTWUJ*3WUVCPVÄPÄ[CI-/¤NEGT2GTG  5GNVGPGT,CJTICPI5GJTUEJÌP





-WTWUJ*WPF3WUVCPVÄPÄ[CWPFI-/¤NEGTp 2GTG 5VÒEM5GJTUEJÌPWPFXQT\ÒINKEJ





-WTWUJ*WPF3WUVCPVÄPÄ[CWPFI-/¤NEGTp 2GTG 5VÒEM5GJTUEJÌPWPFXQT\ÒINKEJ



54


'ABD AL-'AZÎZ KHAN

ex 241

ex 242



-WTWUJ*WPF3WUVCPVÄPÄ[CWPFI-/¤NEGTp 2GTG 5VÒEM5GJTUEJÌPWPFXQT\ÒINKEJ





-WTWUJ* 8CTKCPVGPOKVFKEMGTGTWPFFÒPPGTGT,CJTGU\CJN WPF3WUVCPVÄPÄ[C WPFI-/¤NEGTWPF2GTG 5VÒEM5GJTUEJÌPWPFXQT\ÒINKEJ



243



243

1,5:1

-WTWUJ*3WUVCPVÄPÄ[CI-/¤NEGT2GTG

445GJTUEJÌP



244

1,5:1



1,5:1

-WTWUJ*3WUVCPVÄPÄ[CI-/¤NEGT2GTG  8QPITQ­GT5GNVGPJGKV5GJTUEJÌP

245



ex 246



-WTWUJ*3WUVCPVÄPÄ[CI-/¤NEGT2GTG  5GJTUGNVGPGT,CJTICPI5GJTUEJÌP





-WTWUJ*WPF3WUVCPVÄPÄ[CWPFI -/¤NEGTp2GTG 5VÒEM5GJTUEJÌPWPFXQT\ÒINKEJ

 55


'ABD AL-'AZÎZ KHAN

ex 247



-WTWUJ*WPF3WUVCPVÄPÄ[CWPF I-/¤NEGTp2GTG  5VÒEM,CJTOKV*GPMGNURWTUQPUVOGKUVUGJTUEJÌP

248

249



251

250



-WTWUJ*3WUVCPVÄPÄ[CI-/¤NEGT2GTG  5GJTUGNVGPGT,CJTICPI5GJTUEJÌPpXQT\ÒINKEJ





-WTWUJ*3WUVCPVÄPÄ[CI-/¤NEGT2GTG  W­GTUVUGNVGPGT,CJTICPI)TQDIGNQEJVUGJTUEJÌP





-WTWUJ*3WUVCPVÄPÄ[CI-/¤NEGT2GTG  5GJTUGNVGPGT,CJTICPI5GJTUEJÌP





-WTWUJ*3WUVCPVÄPÄ[CI-/¤NEGT2GTG  5GJTUGNVGPGT,CJTICPI5GJTUEJÌP



253

ex 252

ex 254

1,5:1

1,5:1



-WTWUJ  *     WPF  3WUVCPVÄPÄ[C     WPF  I -/  ¤NEGT   p2GTG 5VÒEM,CJTUGJTUEJÌPFKGCPFGTGPXQT\ÒINKEJp5VGORGNINCP\





-WTWUJ*3WUVCPVÄPÄ[CI-/¤NEGT2GTG  5GNVGPGT,CJTICPI8QT\ÒINKEJ





2CTC*WPF3WUVCPVÄPÄ[CWPFI-/¤NEGTp2GTG 5VÒEM8QT\ÒINKEJ



255 ex 256

1,5:1

1,5:1

ex 256



2CTC*3WUVCPVÄPÄ[CI-/¤NEGT2GTG  5GNVGPGT,CJTICPI5GJTUEJÌP





2CTC*WPF3WUVCPVÄPÄ[CWPFI-/¤NEGTp2GTG 5VÒEM,CJTUGJTUEJÌPFKGCPFGTGP5VGORGNINCP\



56


'ABD AL-'AZÎZ KHAN

257

ex 258

ex 258

'KPGUKNDGTPG5EJOWEMOÒP\G 

5EJOWEMOÒP\G XQO 6[R FGT  -WTWUJ FGU /CJOÑF ++  * HKMVKXGU ,CJT  /C FKP 0WJ³U   I-/p¤NEGT52GTG 9KGKOOGTIGNQEJVUGJTUEJÌP



&KG OGTMYÒTFKIGP 2T·IWPIGP OKV FGT /C FKP 0WJ³U JCDGP FGP 5COONGTP QUOCPKUEJGT /ÒP\GP NCPIG <GKV4·VUGN CWHIGIGDGP&CUNCIXQTCNNGOFCTCPYGKNGU\YCTXKGNG1TVUPCOGPOKV/C FKP $GTIYGTM ICDGKP/C FKP0WJ³U

KPFKGUGO5KPPG-WRHGTDGTIYGTM CDGTPKEJVFCTWPVGTYCT¤NEGTYKGUUKGYGIGPFGUWPOÌINKEJGP4GIKGTWPIU LCJTGUCNUTGIWN·TG/ÒP\GP\WTÒEM'KPGTKEJVKIG'KPQTFPWPICNU5EJOWEMOÒP\GPRTKXCVGT(CDTKMCVKQPGTNCWDVFGT 8GTINGKEJ OKV FGO 8QTMQOOGP HKMVKXGT /ÒP\UV·VVGPPCOGP CWH ·I[RVKUEJGP 5EJOWEMOÒP\GP FGU UR·VGP  ,CJT   JWPFGTVUOKVFGP0COGPFGT6QWTKUOWUQTVGCN7SUWT .WZQT WPF#DW5ÄTQFGTFGU-CKTKPGT)QNFUEJOKGFGUWSUCU 5³IJC&CFKG5EJOWEMOÒP\GPOKV/C FKP0WJ³UXQTCNNGOKPRCN·UVKPGPUKUEJGO5EJOWEM\WHKPFGPUKPFFCTHFGT /ÒP\UV·VVGPPCOG GJGT CTCDKUEJ CNU QUOCPKUEJVÒTMKUEJCWHIGHCUUVYGTFGPWPFFCJGTFCU9QTV/C FKPCNU/GVCNN XGTUVCPFGPYGTFGP&KG#WHUEJTKHVIKDVCNUQGKPGP*KPYGKUCWHFCUWPGFNG/GVCNNFGTCWU-WRHGTPKEMGNIGHGTVKIVGP 5VÒEMG9QFGT(CDTKMCVKQPUQTVNCII[RVGP2CN·UVKPCQFGTCWEJ'WTQRCMQOOGPKPHTCIGKUVDKUJGWVGWPIGMN·TV

-WRHGTRT·IWPIGPFGT/ÒP\UV·VVG3WUVCPVÄPÄ[C 

  WPF  2CTC  * ,CJT  CWH FGP 4GIKGTWPIUCPVTKVV    WPF  2CTC     3WUVCPVÄPÄ[C       WPF  I -/ p p ¤NEGT   p2GTGp 5VÒEM&KGp2CTCp5VÒEMGUGJTUEJÌPFGT4GUVXQT\ÒINKEJ



259 1,5:1

1,5:1

2T·IWPIGPCWHFGP5V·FVGDGUWEJKP$TÑUC $WTUC  

-WTWUJ*$TÑUC $WTUC #WHFGP$GUWEJKP$WTUCI(D-/¤NEGT 2GTG )1.&5GJTUGNVGPPWT'ZGORNCTGIGRT·IV5GJTUEJÌP

1,5:1



260



1,5:1

-WTWUJ*$TÑUC $WTUC #WHFGP$GUWEJKP$WTUCI(D-/¤NEGT 2GTG )1.&8QPCNNGTITÌ­VGT5GNVGPJGKVPWT'ZGORNCTGIGRT·IV 5GJTUEJÌPpXQT\ÒINKEJ

 57


'ABD AL-'AZÎZ KHAN

1,5:1



261

1,5:1

-WTWUJ*$TÑUC $WTUC #WHFGP$GUWEJKP$WTUCI(D-/¤NEGT 2GTG )1.&5GJTUGNVGPPWT'ZGORNCTGIGRT·IV 5VCTMG$TQUEJKGTWPIUURWTQDGPWPFWPVGPKO4GXGTUUGJTUEJÌP



263

262

262



-WTWUJ*$TÑUC $WTUC #WHFGP$GUWEJKP$WTUCI-/¤NEGT2GTG 44'VYCUDGTKGDGPUGJTUEJÌPpXQT\ÒINKEJ





-WTWUJ*$TÑUC $WTUC #WHFGP$GUWEJKP$WTUCI-/¤NEGT2GTG 445GJTUEJÌPpXQT\ÒINKEJ



264 1,5:1



1,5:1

-WTWUJ*$TÑUC $WTUC #WHFGP$GUWEJKP$WTUCI-/¤NEGT2GTG 8QPITQ­GT5GNVGPJGKV(CUV5VGORGNINCP\



265

1,5:1

1,5:1

)QNFRT·IWPIGPFGT/ÒP\UV·VVG/KUT -CKTQ  

-WTWUJ*/KUT -CKTQ I(D-/¤NEGT2GTGp  )1.&8QPITÌ­VGT5GNVGPJGKVPWT'ZGORNCTGIGRT·IV9KP\4CPFHGJNGTXQT\ÒINKEJ 'ZGORNCTFGT#WMVKQP7$5<ÒTKEJ0T

58




'ABD AL-'AZÎZ KHAN

266

1,5:1

1,5:1



-WTWUJ*/KUT -CKTQ I(D-/¤NEGT2GTGp  )1.&8QPITÌ­VGT5GNVGPJGKVPWT'ZGORNCTGIGRT·IV5VGORGNINCP\



'ZGORNCTFGT5COONWPI-ÌPKI(CTQWMXQPI[RVGP#WMVKQP5QVJGD[ %Q-CKTQ

267

1,5:1



1,5:1

-WTWUJ*/KUT -CKTQ I(D-/¤NEGT2GTGp  )1.&8QPITÌ­VGT5GNVGPJGKVPWT'ZGORNCTGIGRT·IV5VGORGNINCP\



'ZGORNCTFGT5COONWPI-ÌPKI(CTQWMXQPI[RVGP#WMVKQP5QVJGD[ %Q-CKTQ

268



-WTWUJ*/KUT -CKTQ I(D-/¤NEGT2GTG  )1.&5GJTUEJÌPpXQT\ÒINKEJ

 59


'ABD AL-'AZÎZ KHAN

269

1,5:1



1,5:1

-WTWUJ*/KUT -CKTQ 2T·IWPIFGT/\UV2CTKUQJPG$NWOGPGDGPFGT6WIJTCI (DC-/¤NEGT2GTGp )1.&5GNVGPDGUQPFGTUKPFKGUGT'TJCNVWPI 8QT\ÒINKEJ

271

270



272



-WTWUJ*/KUT -CKTQ I(D-/¤NEGT2GTG  )1.&8QT\ÒINKEJ





-WTWUJ*/KUT -CKTQ I(D-/¤NEGT2GTG  )1.&8QT\ÒINKEJ





-WTWUJ*/KUT -CKTQ I(D-/¤NEGT2GTG  )1.&8QT\ÒINKEJ



273

274

275

276



-WTWUJ*/KUT -CKTQ I(D-/¤NEGT2GTG  )1.&5GJTUEJÌP





-WTWUJ*/KUT -CKTQ I(D-/¤NEGT2GTG  )1.&5VGORGNINCP\





-WTWUJ*/KUT -CKTQ I(D-/¤NEGT2GTG  )1.&(CUVXQT\ÒINKEJ





-WTWUJ*/KUT -CKTQ I(D-/¤NEGT2GTG  )1.&-N4CPFHGJNGTUGJTUEJÌPpXQT\ÒINKEJ



60


'ABD AL-'AZÎZ KHAN

278

277



-WTWUJ*/KUT -CKTQ I(D-/¤NEGT2GTG  )1.&(CUVXQT\ÒINKEJ





-WTWUJ*/KUT -CKTQ I(D-/¤NEGT2GTG  )1.&(CUVXQT\ÒINKEJ



279 1,5:1



1,5:1

-WTWUJ*/KUT -CKTQ I(D-/¤NEGT2GTG  )1.&5GNVGPGT,CJTICPI8QT\ÒINKEJ



282 280

281



-WTWUJ*/KUT -CKTQ I(D-/¤NEGT2GTG  )1.&8QT\ÒINKEJ





-WTWUJ*/KUT -CKTQ I(D-/¤NEGT2GTG  )1.&5GNVGPGT,CJTICPI5VGORGNINCP\





 -WTWUJ  *  /KUT -CKTQ   I (D  -/  ¤NEGT  2GTG    )1.&4/KVFGPHÒTFKG/ÒP\UV·VVG-CKTQV[RKUEJGP7PTGIGNO·­KIMGKVGPFGT5EJTÌVNKPIUQDGTHN·EJG 8QT\ÒINKEJ



283

284

285

286



 -WTWUJ  *  /KUT -CKTQ   I (D  -/  ¤NEGT &CVWO PKEJV GTHCUUV   XIN2GTG )1.&44)GJGPMGNVOKV¤UGUGJTUEJÌP





-WTWUJ*/KUT -CKTQ I(D-/¤NEGT2GTG  )1.&45GJTUEJÌP





-WTWUJ*/KUT -CKTQ I(D-/¤NEGT2GTG  )1.&45VGORGNINCP\





-WTWUJ*/KUT -CKTQ I(D-/¤NEGT2GTG  )1.&45GJTUEJÌP

 61


'ABD AL-'AZÎZ KHAN

ex 287

ex 288

289

290

291



-WTWUJ*WPF/KUT -CKTQ WPFI(D-/¤NEGTWPF 2GTG 5VÒEM)1.&$GKFGOKVMN*GPMGNURWTUGJTUEJÌPWPFXQT\ÒINKEJ





-WTWUJ*WPF/KUT -CKTQ WPFI(D-/¤NEGTWPF 2GTG 5VÒEM)1.&&CU\YGKVGOKVGPVHGTPVGT.ÌVURWTUGJTUEJÌP





-WTWUJ*/KUT -CKTQ I(D-/¤NEGT2GTG  )1.&-CWOUKEJVDCTG(CUUWPIUURWTGP8QT\ÒINKEJ





-WTWUJ*/KUT -CKTQ I(D-/¤NEGT2GTG  )1.&(CUV5VGORGNINCP\





-WTWUJ*/KUT -CKTQ I(D-/¤NEGT2GTG  )1.&5VGORGNINCP\



#X5VGORGNKFGPVKUEJOKVFGOXQTKIGP5VÒEMXQO4GIKGTWPIULCJT

292

1,5:1



1,5:1

-WTWUJ*/KUT -CKTQ I(D-/¤NEGT2GTG  )1.&5VGORGNINCP\



9GKVGTJKPFGTUGNDG#XGTUUVGORGNXQO4GIKGTWPIULCJTLGFQEJOKVCWUIGRT·IVGP*CCTTKUUGP

293

ex 294

ex 295

ex 296

ex 297



-WTWUJ*/KUT -CKTQ I(D-/¤NEGT2GTGp  )1.&5VGORGNINCP\





-WTWUJ*WPF/KUT -CKTQ WPFI(D-/¤NEGTWPF 2GTGp 5VÒEM)1.&&CUGTUVGOKVNGKEJVGP(CUUWPIUURWTGPXQT\ÒINKEJWPF5VGORGNINCP\





 -WTWUJ  *  KO 5VGORGN IG·PFGTV CWU   WPF  /KUT -CKTQ   WPF  I (D    -/¤NEGT2GTG 5VÒEM)1.&5VGORGNINCP\





-WTWUJ*WPF/KUT -CKTQ WPFI%CIWPF(D-/ ¤NEGTWPF2GTG 5VÒEM)1.&8QT\ÒINKEJWPF5VGORGNINCP\





-WTWUJ*WPF/KUT -CKTQ WPFI%CIWPF(D-/ ¤NEGTWPF2GTG 5VÒEM)1.&5VGORGNINCP\



62


'ABD AL-'AZÎZ KHAN

ex 299

298



 -WTWUJ  *  /KUT -CKTQ   I %CI # (D  -/  ¤NEGT p XIN    2GTG )1.&5GNVGPGT,CJTICPI5GJTUEJÌP





-WTWUJ*/KUT -CKTQ WPFI%CIWPF(D -/¤NEGTWPF2GTG 5VÒEM)1.&5VGORGNINCP\



300

302

301

5KNDGTRT·IWPIGPFGT/ÒP\UV·VVG/KUT -CKTQ  

-WTWUJ*/KUT -CKTQ I-/¤NEGT2GTGp

445GJTUEJÌP





-WTWUJ*/KUT -CKTQ I-/¤NEGT2GTGp  8QPITQ­GT5GNVGPJGKV5GJTUEJÌP





-WTWUJ*/KUT -CKTQ I-/¤NEGT2GTGp

303

305

445GJTUEJÌP



304



 -WTWUJ  *  /KUT IGRT·IV KP 2CTKU 1JPG $NWOG PGDGP FGT 6WIJTC  I -/    ¤NEGT2GTG 45GJTUEJÌP





 -WTWUJ  *  /KUT IGRT·IV KP 2CTKU 1JPG $NWOG PGDGP FGT 6WIJTC  I -/    ¤NEGT2GTG 45GJTUEJÌP





 -WTWUJ  *  /KUT -CKTQ  /KV $NWOG PGDGP FGT 6WIJTC  I -/  ¤NEGT    2GTG 448QT\ÒINKEJ

 63


'ABD AL-'AZÎZ KHAN

306

307

308



 -WTWUJ  *  /KUT -CKTQ  /KV $NWOG PGDGP FGT 6WIJTC  I -/  ¤NEGT    2GTG 45GJTUEJÌP





 -WTWUJ  *  /KUT -CKTQ  IGRT·IV KP 2CTKU 1JPG $NWOG PGDGP FGT 6WIJTC  I   -/¤NEGT2GTGp 48QT\ÒINKEJp5VGORGNINCP\





 -WTWUJ  *  /KUT IGRT·IV KP 2CTKU 1JPG $NWOG PGDGP FGT 6WIJTC  I -/    ¤NEGT2GTGp 45GJTUEJÌP



309



310

 -WTWUJ  *  URKGIGNXGTMGJTVG   /KUT IGRT·IV KP 2CTKU 1JPG $NWOG PGDGP FGT 6WIJTC   I-/¤NEGTC2GTGp  445VTKEJRTÒHURWTCO4CPFCWHIGUEJTKGDGPG6WUEJGPWOOGTUGJTUEJÌP



&KG OKV 6WUEJG CWHIGUEJTKGDGPG <CJN  DG\KGJV UKEJ QHHGPDCT CWH GKPG 9KGIWPI FGU 5VÒEMU YGNEJG KO   <WUCOOGPJCPIOKVFGT5KNDGTRTÒHWPICWHGKPGO2TQDKGTUVGKPUVGJGPMCPPYGNEJG\WGKPGT5EJÒTHUVGNNGCO·W­GTGP 4CPFHÒJTVG



 -WTWUJ  *  /KUT -CKTQ  /KV $NWOG PGDGP FGT 6WIJTC  I -/  ¤NEGT    2GTG 445GJTUEJÌP

311

312



313



 -WTWUJ  *  /KUT -CKTQ  /KV $NWOG PGDGP FGT 6WIJTC  I -/  ¤NEGT    2GTG 445GJTUEJÌP





 -WTWUJ  *  /KUT -CKTQ  /KV $NWOG PGDGP FGT 6WIJTC  I -/  ¤NEGT    2GTG 445GJTUEJÌP





 -WTWUJ  *  /KUT -CKTQ  /KV $NWOG PGDGPFGT6WIJTCI-/C¤NEGT 2GTG 445GJTUEJÌP



64


'ABD AL-'AZÎZ KHAN

314

315



 -WTWUJ  *  /KUT -CKTQ  /KV $NWOG PGDGPFGT6WIJTCI-/C¤NEGT 2GTG 445GJTUEJÌP





 -WTWUJ  *  /KUT -CKTQ  /KV $NWOG PGDGPFGT6WIJTCI-/C¤NEGT 2GTG 445GJTUEJÌP



316

1,5:1



1,5:1

-WTWUJ*/KUT -CKTQ /KV$NWOGPGDGPFGT6WIJTCI-/C¤NEGTXIN MGPPVFKGUGU,CJTPKEJV2GTG ,CJTICPIXQPITÌ­VGT5GNVGPJGKV5GJTUEJÌP

1,5:1



1,5:1

-WTWUJ*/KUTIGRT·IVKP2CTKU1JPG$NWOGPGDGPFGT6WIJTCI-/ ¤NEGT2GTG 448QT\ÒINKEJp5VGORGNINCP\

318



317

319





320

-WTWUJ*/KUT -CKTQ /KV$NWOGPGDGPFGT6WIJTCI-/¤NEGT 2GTGp 48QT\ÒINKEJ



'ZGORNCTFGT5COONWPI6WTCVJ2CTV++5RKPM.QPFQP0T



-WTWUJ*/KUT -CKTQ /KV$NWOGPGDGPFGT6WIJTCI-/¤NEGT 2GTGp 48QT\ÒINKEJ





-WTWUJ*/KUT -CKTQ /KV$NWOGPGDGPFGT6WIJTCI-/C¤NEGT 2GTGp 45EJÌPG2CVKPC(CUV5VGORGNINCP\



'ZGORNCTFGT5COONWPI6WTCVJ2CTV++5RKPM.QPFQP0T

65


'ABD AL-'AZÎZ KHAN

322

321



  -WTWUJ  *  /KUT -CKTQ  /KV $NWOG PGDGP FGT 6WIJTC  I -/ C ¤NEGT   2GTGp 445GJTUEJÌP





-WTWUJ*/KUT -CKTQ /KV$NWOGPGDGPFGT6WIJTCI-/C¤NEGT 2GTGp 445GJTUEJÌP



'ZGORNCTFGT5COONWPI6WTCVJ2CTV++5RKPM.QPFQP0T

323

1,5:1



1,5:1

-WTWUJ*/KUT -CKTQ /KV$NWOGPGDGPFGT6WIJTCI-/C¤NEGT 2GTGp 8QPITQ­GT5GNVGPJGKV8QT\ÒINKEJ

ex 324

ex 325

ex 326



ex 327



-WTWUJ 3KTUJ   *    WPF  /KUT -CKTQ     WPF  I -/  ¤NEGT   p2GTG 5VÒEM4&CUGTUVG5VÒEMIGNQEJVUGJTUEJÌPWPFXQT\ÒINKEJ





-WTWUJ 3KTUJ *WPF/KUT -CKTQ WPFI-/ ¤NEGTp2GTG 5VÒEM5GJTUEJÌPWPFXQT\ÒINKEJ





-WTWUJ 3KTUJ *WPF/KUT -CKTQ &C\WGKPGDTGKVTCPFKIG5EJOWEMK OKVCVKQPOKV,CJTWPFI-/C¤NEGTp 2GTG 5VÒEM5GJTUEJÌPWPFXQT\ÒINKEJFKG5EJOWEMKOKVCVKQPIGNQEJV



2CTC 3KTUJ *WPF/KUT -CKTQ WPFI-/¤NEGTWPF 2GTG 5VÒEM45GJTUEJÌP





ex 328

ex 329



2CTC 3KTUJ *WPF/KUT -CKTQ WPF I-/¤NEGTp2GTG 5VÒEM4/GKUVXQT\ÒINKEJ,CJTUGJTUEJÌP





2CTC 3KTUJ *WPF/KUT -CKTQ WPF I-/C¤NEGTp2GTG  5VÒEM&CUNGV\VG,CJTUGNVGP5GJTUEJÌPpWP\KTMWNKGTV



66


'ABD AL-'AZÎZ KHAN

ex 330



ex 331

ex 332

ex 333

2CTC*WPF/KUT -CKTQ WPFI-/¤NEGTp 2GTG 5VÒEM#NNGUGNVGP5GJTUEJÌPWPFXQT\ÒINKEJ



&CU,CJT \YGKHGNNQUGEJV QJPG4·PFGNWPI



2CTC*WPF/KUT -CKTQ WPFI-/¤NEGTp 2GTG 5VÒEM,CJTWP\KTMWNKGTVFKGCPFGTGPUGJTUEJÌP





 2CTC  *    WPF  /KUT -CKTQ     WPF  I -/ C ¤NEGT   p2GTG 5VÒEM5GJTUEJÌPWPFXQT\ÒINKEJ





2CTC*WPF/KUT -CKTQ WPFI-/C¤NEGTp2GTG  5VÒEM$GKFG,CJTI·PIGUGNVGP7P\KTMWNKGTVWPFUGJTUEJÌP



334 Ni

1,5:1

1,5:1

'KPG0KEMGNRTQDG\W2CTC 

 2CTC2TQDG KP 0KEMGN 2KGFHQTV  *  /KUT IGRT·IV KP 2CTKU 1JPG $NWOG PGDGP FGT   6WIJTCI%CI5NI(QPTQDGTV-/XIN2¤NEGT52GTG#POGTMWPI  8QPITÌ­VGT5GNVGPJGKV'KPFTWEMUVGNNGGKPGU\YGKVGP'ZGORNCTUUQPUV5VGORGNINCP\ 

335

335 1,5:1

-WRHGTRT·IWPIGPFGT/ÒP\UV·VVG/KUT -CKTQ  

2CTC*/KUT -CKTQ /KV$NWOGPGDGPFGT6WIJTCI-/¤NEGT2GTGp 8QPITÌ­VGT5GNVGPJGKV/KVFGPÒDNKEJGPMNGKPGP5EJTÌVNKPIUHGJNGTPXQT\ÒINKEJ

 67


'ABD AL-'AZÎZ KHAN

ex 337

336

338



2CTC*/KUTIGRT·IVKP2CTKUQFGT$TÒUUGN1JPG$NWOGPGDGPFGT6WIJTCI -/¤NEGT2GTG 5GJTUEJÌPpXQT\ÒINKEJ





2CTC*WPF/KUTIGRT·IVKP2CTKUQFGT$TÒUUGN1JPG$NWOGPGDGPFGT 6WIJTCWPFI-/¤NEGTpp 2GTG 5VÒEM/GKUVUGJTUEJÌPFCUNGV\VGXQT\ÒINKEJ



&KG'ZKUVGP\GWTQR·KUEJGT2CTC2T·IWPIGPFGU4GIKGTWPIULCTGUFKGDGK¤NEGTWPVGT$GTWHWPICWHGKPGP#WHUCV\ .CEJOCPUWPFFCPCEJCWEJKO-/-CVCNQICWHIGHÒJTVYGTFGPKUVUGJTHTCINKEJWPFFÒTHVGCWHGKPGT8GTYGEJUNWPI OKVFGPV[RGPINGKEJGP-CKTKPGT)GRT·IGPDCUKGTGP



 2CTC  *  /KUT -CKTQ  1JPG $NWOG PGDGP FGT 6WIJTC  I -/  ¤NEGT    2GTGp 44/KVFGPÒDNKEJGP7PTGIGNO·­KIMGKVGPFGU5EJTÌVNKPIUUEJÌPG2CVKPCUGJTUEJÌP



339

1,5:1



1,5:1

2CTC*8CTKCPVGOKVCPFGTGT<GKEJPWPIFGT6WIJTC UV·TMGTGT-PKEMKPFGPNCWHGPFGP5VTK EJGP /KUT -CKTQ 1JPG$NWOGPGDGPFGT6WIJTCI-/¤NEGT2GTGp  5GJTUGNVGPDGUQPFGTUKPFKGUGT'TJCNVWPI /KVFGTÒDNKEJGP)TQDJGKVFGT1DGTHN·EJGXQT\ÒINKEJ OKVNGKEJVGO5VGORGNINCP\ &KG2T·IWPIGPFGT/ÒP\UV·VVG-CKTQNCUUGPUKEJXQPFGPINGKEJ\GKVKIGP2T·IWPIGPCWU2CTKUWPF$TÒUUGNCWEJFCPP YGPPFKGUQPUVHÒT-CKTQEJCTCMVGTKUVKUEJG$NWOGPGDGPFGT6WIJTCHGJNVWPVGTUEJGKFGPFCFKG#WHUEJTKHVGPWPFFKG 6WIJTCKP-CKTQKPVTCFKVKQPGNNGT9GKUGFKTGMVXQP*CPFKPFKG5VGORGNIGUEJPKVVGPYWTFGYQIGIGPFKGGWTQR·KUEJGP /ÒP\UV·VVGPKO·I[RVKUEJGP#WHVTCIFGP5VGORGNUEJPKVVFWTEJ)GUGPMGGTUGV\VGP&GT7PVGTUEJKGFYKTFKOOGTFCPP FGWVNKEJ YGPP KP FGT -TÒOOWPI GKPGT .KPKG FGT )TCXKGTUVKEJGN UEJTKVVYGKUG DGYGIV YWTFG YCU DGK XGTITÌ­GTVGT   $GVTCEJVWPI CNU MNGKPG <CEMGP CO 4CPF FGT -QPVWT KP 'TUEJGKPWPI VTKVV &CIGIGP YGKUGP FKG OKV )GUGPMGP   JGTIGUVGNNVGP #WHUEJTKHVGP INCVVG -QPVWTGP CWH &CPGDGP UEJGKPV CWEJ FGT 2TQ\GUU FGT 5EJTÌVNKPIUJGTUVGNNWPI   KPUDGUQPFGTG DGKO -WRHGT CWH FGO 5VCPF GWTQR·KUEJGT 6GEJPQNQIKG FGT <GKV WO  XGTDNKGDGP \W UGKP CNU FKG   -CKTKPGT/ÒP\UV·VVGWPVGT/WJCOOCF #NÄVGEJPKUEJTGHQTOKGTVYQTFGPYCT&GUJCND\GKIGPCWEJRGTHGMVGTJCNVGPG /ÒP\GPGKPGTCWJG1DGTHN·EJG

68




'ABD AL-'AZÎZ KHAN

341

ex 340



2CTC*WPF/KUT -CKTQ /KV$NWOGPGDGPFGT6WIJTCWPFI-/ ¤NEGTp2GTGp 5VÒEM#NNGUGNVGP5GJTUEJÌP





2CTC*/KUT -CKTQ /KV$NWOGPGDGPFGT6WIJTCI-/¤NEGT2GTGp 445GJTUEJÌP



342

ex 343



2CTC*/KUT -CKTQ /KV$NWOGPGDGPFGT6WIJTCI-/¤NEGT2GTGp 445GJTUEJÌP





2CTC*WPFFC\W2CTC*/KUTIGRT·IVKP2CTKUQFGT$TÒUUGN 1JPG $NWOG PGDGP FGT 6WIJTC       WPF  I -/  WPF    ¤NEGTpWPF2GTG#POGTMWPI  5VÒEM,CJTGWPFUGJTUEJÌPWPF2CTCXQT\ÒINKEJWPF5VGORGNINCP\



344

1,5:1

1,5:1

)QNFRT·IWPIGPFGT/ÒP\UV·VVG6ÑPKU 

4K[CN*6ÑPKU/KVFGO&G[XQP6ÑPKU/WJCOOCFCU5³FKSI(D(GPKPC -/¤NEGT2GTGp )1.&448QT\ÒINKEJ  'ZGORNCTFGT#WMVKQP(TKV\4WFQNH-ÒPMGT1UPCDTÒEM0T

345



4K[CN*6ÑPKU/KVFGO&G[XQP6ÑPKU/WJCOOCFCU5³FKSI(D(GPKPC -/¤NEGT2GTGp )1.&44(CUVXQT\ÒINKEJ  69


'ABD AL-'AZÎZ KHAN

346



WPF4K[CN*6ÑPKU 2CTKU /KVFGO&G[XQP6ÑPKU/WJCOOCFCU5³FKS WPFI(D(GPKPC-/25   ¤NEGT2GTGp  )1.&5VÒEM8QPCNNGTITÌ­VGT5GNVGPJGKVPWTQFGT5·V\GDGMCPPV2QNKGTVG2NCVVG 'ZGORNCTGCWUFGT#WMVKQP7$5$CUGN0T







&KG 2T·IWPIGP OKV FGT ,CJTGU\CJN  * YWTFGP PCEJ GKPGO 8GTVTCI \YKUEJGP FGT /ÒP\UV·VVG 6ÑPKU WPF FGO   *CWU 'OKNG 'TNCPIGT KP FGT /ÒP\UV·VVG 2CTKU CWUIGHÒJTV U (GPKPC 5  &KG 5VGORGN YCTGP XQP 4CNRJ   *GCVQP+++KP$KTOKPIJCOIGUEJPKVVGPYQTFGP

347

1,5:1

1,5:1



4K[CN*6ÑPKU/KVFGO&G[XQP6ÑPKU/WJCOOCFCU5³FKSI(D(GPKPC -/¤NEGT2GTGp )1.&44(CUV5VGORGNINCP\ 

348

349



4K[CN*6ÑPKU/KVFGO&G[XQP6ÑPKU/WJCOOCFCU5³FKSI(D(GPKPC-/ ¤NEGT2GTGp )1.&8QT\ÒINKEJ





4K[CN*6ÑPKU/KVFGO&G[XQP6ÑPKU/WJCOOCFCU5³FKSI(D(GPKPC-/ ¤NEGT2GTGp )1.&5VGORGNINCP\



70


'ABD AL-'AZÎZ KHAN

350

351

350



 4K[CN  * 6ÑPKU 2CTKU  /KV FGO &G[ XQP 6ÑPKU /WJCOOCF CU5³FKS  I (D    (GPKPC-/¤NEGT2GTGp )1.&5GJTUEJÌP





 4K[CN  * 6ÑPKU 2CTKU  /KV FGO &G[ XQP 6ÑPKU /WJCOOCF CU5³FKS  I (D    (GPKPC-/¤NEGT2GTGp )1.&5GJTUEJÌP



ex 352

353 2:1



 4K[CN   WPF  * 6ÑPKU /KV FGO &G[ XQP 6ÑPKU /WJCOOCF CU5³FKS ,G  I   %CIWPF(D(GPKPCWPF-/¤NEGTWPF2GTGp 5VÒEM)1.&(CUVUGJTUEJÌPWPFUGJTUEJÌP





4K[CN*6ÑPKU/KVFGO&G[XQP6ÑPKU/WJCOOCFCU5³FKS)GIGPUVGORGN5VGTP\WT9GTVTG FWMVKQPKO#XGTUI%CI(D(GPKPC#PO-/¤NEGTC2GTGp  )1.&45GJTUEJÌP



354

355

356

5KNDGTRT·IWPIGPFGT/ÒP\UV·VVG6ÑPKU 

 4K[CN  * 6ÑPKU /KV /WJCOOCF CU5³FKS $C[  *  QJPG )GIGPUVGORGN XQP   *I(GPKPC-/¤NEGT2GTG 45GJTUEJÌP





4K[CN*6ÑPKU/KV/WJCOOCFCU5³FKS$C[ * OKVYGTVTGFW\KGTGPFGO)GIGP UVGORGN5VGTPXQP*I(GPKPC-/¤NEGT2GTG 5GJTUEJÌP





4K[CN*6ÑPKU/KV/WJCOOCFCU5³FKS$C[ * OKVYGTVTGFW\KGTGPFGO)GIGP UVGORGN5VGTPXQP*I(GPKPC-/¤NEGT2GTG 5GJTUEJÌP



ex 357



4K[CNWPF*6ÑPKU/KV/WJCOOCFCU5³FKS$C[ * QJPG)GIGPUVGORGNXQP *WPFI(GPKPCWPF-/¤NEGTWPF2GTG  5VÒEM$GKFGQJPG)GIGPUVGORGNUGNVGP*GPMGNURWTUEJÌPWPFMNGKPG(GKNURWTUGJTUEJÌP

 71


'ABD AL-'AZÎZ KHAN

358





359

4K[CN*6ÑPKU/KV/WJCOOCFCU5³FKS$C[ * OKVYGTVTGFW\KGTGPFGO)GIGP UVGORGNQJPG<GKEJPWPIXQP*I(GPKPC-/¤NEGT2GTG  8QT\ÒINKEJ



4K[CN*6ÑPKU/KV/WJCOOCFCU5³FKS$C[ * OKVYGTVTGFW\KGTGPFGO)GIGP UVGORGN5VGTPXQP*I(GPKPC-/¤NEGT2GTG 5GJTUEJÌP



360

1,5:1

1,5:1



4K[CN*6ÑPKUIGRT·IVKP2CTKU1JPG0COGPFGU/WJCOOCFCU5³FKS$C[ *  I(GPKPC-/¤NEGT2GTGp 8QPITQ­GT5GNVGPJGKV2QNKGTVG2NCVVG



<WFKGUGO/ÒP\V[RFGTFWTEJFKG(QTVNCUUWPIFGU0COGPUFGU$C[XQP6WPKUGKPG'TMN·TWPIKO<WUCOOGPJCPIFGT RQNKVKUEJGP)GUEJKEJVGXGTNCPIVICDGUWPVGTUEJKGFNKEJG6JGQTKGP&CFKGYGPKIGPDGMCPPVGP5VÒEMGUVGVUXQPDGUVGT 'TJCNVWPI YCTGP DGUVCPFGP CWEJ WPVGTUEJKGFNKEJG #WHHCUUWPIGP QD GU UKEJ WO 2TQDGOÒP\GP QFGT WO TGIWN·TG   /ÒP\GPJCPFGNVG(ÒTNGV\VGTG#PPCJOGURTCEJFKGXQP(CTTWIKCFG%CPFKCCWHIG\GKEJPGVGOÒPFNKEJGªDGTNKGHGTWPI XQPCNVGP/ÒP\UV·VVGPCTDGKVGTPFCUUFKG5VGORGNKP2CTKUIGUEJPKVVGPYQTFGPUGKGPY·JTGPFFKG2T·IWPIFCPPKP 6WPKU CWUIGHÒJTV YQTFGP Y·TG  MQOOGPVKGTVG * *QIQP FKGUG 2T·IWPI CNU RTQQUOCPKUEJG 5EJOGKEJGNGKFGT HTCP\ÌUKUEJGP4GIKGTWPICPIGUKEJVUCPVKDG[NKMCNGP9KFGTUVCPFGUKP6WPGUKGP&WTEJUGKPGGKPIGJGPFGP#TEJKXUVWFKGP MQPPVG(GPKPCMN·TGPFCUUFKG/ÒP\UV·VVG2CTKUKO#WHVTCIFGUOKVFGT(KPCP\XGTYCNVWPIFGU$C[UMQQRGTKGTGPFGP $CPMJCWUGU'TNCPIGTGKPG/KNNKQPFKGUGT/ÒP\GPJCVVGRT·IGPNCUUGP&KGUGYWTFGPCWEJPCEJ6WPKUIGNKGHGTVCDGT YGIGPFGUHGJNGPFGP$C[PCOGPU\WTÒEMIGYKGUGPWPFYKGFGTGKPIGUEJOQN\GP0WTFKGYGPKIGP5COONGTCPHGTVKIWPIGP GPVIKPIGPFKGUGO.QU (GPKPC5 

361





72

ex 362

4K[CN*6ÑPKU/KV0COGPFGU/WJCOOCFCU5³FKS$C[ * QJPG)GIGPUVGORGN (GPKPCI-/C¤NEGT2GTG  42T·IGDGFKPIVG7PTGIGNO·­KIMGKVGPCO4CPFXQT\ÒINKEJ



4K[CNWPF*6ÑPKU/KV0COGPFGU/WJCOOCFCU5³FKS$C[ * OKVFGP 9GTV TGFW\KGTGPFGP )GIGPUVGORGN 5VGTP XQP  *  * LG GKPOCN CWH #X WPF CWH 4X   WPFI(GPKPCWPF-/¤NEGTWPF2GTG  5VÒEM5GJTUEJÌP




'ABD AL-'AZÎZ KHAN

364

363

363



4K[CN*6ÑPKU/KV0COGPFGU/WJCOOCFCU5³FKS$C[ * QJPG)GIGPUVGORGN I(GPKPC-/C¤NEGT2GTG 8QT\ÒINKEJ





4K[CN  * 6ÑPKU /KV 0COGP FGU/WJCOOCFCU5³FKS$C[ * QJPG)GIGPUVGORGN I(GPKPC-/C¤NEGT2GTG 5GNVGPGT,CJTICPI'VYCU$GNCI8QT\ÒINKEJ



ex 365





366

4K[CNWPF*6ÑPKU/KV0COGPFGU/WJCOOCFCU5³FKS$C[ * QJPG)GIGP UVGORGNWPFI(GPKPCWPF-/C¤NEGTWPF2GTG  5VÒEM&CU\YGKVGOKV*GPMGNURWTDGKFGUGJTUEJÌP



4K[CN  * 6ÑPKU /KV 0COGP FGU/WJCOOCFCU5³FKS$C[ * QJPG)GIGPUVGORGN I(GPKPC-/C¤NEGT2GTG (CUVXQT\ÒINKEJ



367

1,5:1



1,5:1

 4K[CN  -JCTTWDC   * 6ÑPKU /KV 0COGP FGU /WJCOOCF CU5³FKS $C[  *    I(GPKPC #PO -/¤NEGT2GTG 445VGORGNINCP\



ex 369

368 1,5:1



 4K[CN  -JCTTWDC   * 6ÑPKU /KV 0COGP FGU /WJCOOCF CU5³FKS $C[  *    I(GPKPC-/¤NEGT2GTG 45VGORGNINCP\





 4K[CN  -JCTTWDC   WPF  * 6ÑPKU /KV 0COGP FGU /WJCOOCF CU5³FKS $C[  

* WPFI(GPKPCWPF-/C¤NEGTWPF2GTG  5VÒEM5GJTUEJÌP

 73


'ABD AL-'AZÎZ KHAN

370

-WRHGTRT·IWPIGPFGT/ÒP\UV·VVG6WPKU 



5CV\XQPWPF-JCTTWDC*6ÑPKUIGRT·IVKP$KTOKPIJCO *GCVQPOKPV /KV 0COGPFGU/WJCOOCFCU5³FKS$C[ * WPFI(GPKPC WPF-/pWPFp¤NEGTp2GTGp  5VÒEM5GNVGPKPFKGUGT'TJCNVWPI2QNKGTVG2NCVVGDTCWPG6ÌPWPI



5CV\XQPWPF-JCTTWDC*6ÑPKUIGRT·IVKP$KTOKPIJCO *GCVQPOKPV /KV 0COGPFGU/WJCOOCFCU5³FKS$C[ * WPFI(GPKPC WPF-/pWPFp¤NEGTp2GTGp  5VÒEM5GJTUEJÌP



ex 372



373

-JCTTÑDC* 8CTKCPVGPKPFGT5EJTGKDWPIFGT<KHHGT 6ÑPKU/KV0COGPFGU/WJCOOCFCU 5³FKS$C[ * WPFI(GPKPC-/CNU-JCTTÑDCDG\GKEJPGV¤NEGT CNU-JCTTÑDCDG\GKEJPGV2GTGp 5VÒEM5VGORGNINCP\WPFUGJTUEJÌP





 -JCTTWDC  * 6ÑPKU /KV 0COGP FGU /WJCOOCF CU5³FKS $C[  *   I   (GPKPC-/¤NEGT2GTG 8QT\ÒINKEJ





5CV\ XQP   WPF  -JCTTÑDC  * 6ÑPKU /KV 0COGP FGU /WJCOOCF CU5³FKS $C[  

* WPFI(GPKPCWPF-/p¤NEGTWPF 2GTGp 5VÒEM5GJTUEJÌPWPFXQT\ÒINKEJ



375

376

)QNFRT·IWPIGPFGT/ÒP\UV·VVG-³UJIJCT 

6KNNC  * &CVWO CWH DGKFGP 5GKVGP  -³UJIJCT  I -/  4GX UVGORGNINGKEJ    ¤NEGT5Q0T*8CT2GTGp )1.&445GJTUEJÌP





6KNNC  * &CVWO CWH DGKFGP 5GKVGP  -³UJIJCT  I -/  4GX UVGORGNINGKEJ    ¤NEGT5Q0T*8CTFGT2CV\KGTWPIFGU&CVWOU2GTG )1.&448QT\ÒINKEJ



'ZGORNCTCWU.KUVG5VGRJGP#NDWO5CPVC4QUC0T

74


'ABD AL-'AZÎZ KHAN

377

378

379

5KNDGTRT·IWPIGPFGT/ÒP\UV·VVG-³UJIJCT 





6GPIC  * DGKFGTUGKVU  -³UJIJCT #X #DF  CN C\Ä\  MJ³P XQP WPVGP PCEJ QDGP   4GXFCTD-³UJIJCTNCVKHXQPWPVGPPCEJQDGPI-/p¤NEGT$2GTG  5GJTUEJÌP



6GPIC  * DGKFGTUGKVU  -³UJIJCT #X MJ³P  #DF  CN C\Ä\  MJ³P XQP QDGP PCEJ WPVGP   4GXFCTD-³NCVÄHUJIJCTXQPWPVGPPCEJQDGPI-/p¤NEGT#2GTG  5GJTUEJÌP



6GPIC*-³UJIJCT7PVGTIGYKEJVKIG0CEJCJOWPIXQPITQDGO5VKN#XMJ³P #DFCN C\Ä\ MJ³PXQPQDGPPCEJWPVGP4XFCTD-³NCVÄHUJIJCTXQPWPVGPPCEJQDGPI-/p¤NEGT #8CT2GTG 5GJTUEJÌP



381

380





6GPIC  * DGKFGTUGKVU  -³UJIJCT #X #DF  CN C\Ä\  MJ³P XQP WPVGP PCEJ QDGP   4GXFCTD-³UJIJCTNCVKHXQPWPVGPPCEJQDGPI-/p¤NEGT$2GTG  5GJTUEJÌP



6GPIC  * PWT KO 4GX  -³UJIJCT #X #DF  CN C\Ä\  MJ³P XQP WPVGP PCEJ QDGP   4GXFCTD-³UJIJCTNCVKHXQPWPVGPPCEJQDGPI-/p¤NEGT$2GTG  5GJTUEJÌP



382

'KPG-WRHGTOÒP\GFGT/ÒP\UV·VVG-ÑEJC 

7PDGMCPPVGU0QOKPCN* PWTKO4GX -ÑEJC#XKPFQRRGNVGO-TGKUCUUWNV³P #DFCN C\Ä\ MJ³P7OUEJTKHVUCPCVCMJCOUVJCO³PÄPOKPDC FJKLTCVTKU³N³4GXKPFQRRGNVGO-TGKUFCTDOC FÄPCV-ÑEJC7OUEJTKHV0COGPFGTFTGKFGTGTUVGPTGEJVIGNGKVGVGP-CNKHGP WPVGT9GINCUUWPIXQP #NK  I-/p¤NEGTp2GTGp 45EJÌP



&KGUGOGTMYÒTFKIGP$TQP\GOÒP\GPFGTGP0QOKPCNYQJNGJGTFGOEJKPGUKUEJGPQFGT%CUJUVÒEMGPGPVURTCEJ CNUFGPCWU-JQSCPFWPFFGOYGUVNKEJGP6WTMGUVCPGPVNGJPVGP0QOKPCNGPFKGKP-CUJIJCTÒDNKEJYCTGPUKPFGTUVUGKV YGPKI OGJT CNU GKPGO ,CJT\GJPV DGMCPPV 5KG IGDGP PQEJ GKPKIG 4·VUGN CWH &C\W IGJÌTV FKG 5EJTGKDWPI FGU   /ÒP\UV·VVGPPCOGPUOKVJCCO'PFGCPUVGNNGFGUÒDNKEJGPCNKH&KG8GTMÒT\WPIFGT,CJTGU\CJNCWHFKGDGKFGPNGV\VGP 5VGNNGP YCT KP <KHHGTP PKEJV WPÒDNKEJ KP FGT CTCDKUEJ CWUIGUEJTKGDGPGP (QTO KUV FCU (GJNGP XQP *WPFGTVGT WPF   6CWUGPFGTCDGTUGNVUCOWPFMQTTGURQPFKGTVOÌINKEJGTYGKUGOKVFGTJKUVQTKUKGTGPFGPMWHKUEJGP5EJTKHV  

)TWPFNCIGHÒT;C SÑD$GI\WT#PGTMGPPWPIFGU1UOCPKUEJGP5WNVCPUYCTFKG9KGFGTDGNGDWPIFGU-CNKHCVUWPFFKGU OCIFGP4ÒEMITKHHCWHFKGHTÒJGKUNCOKUEJG5EJTKHVGDGPUQGTMN·TGPYKGFKGOGTMYÒTFKIG0GPPWPIXQPPWTFTGKFGT XKGTTGEJVIGNGKVGVGP-CNKHGP&CU2T·IGLCJTGPVURTKEJVFGO,CJTFGTGTUVGP)GUCPFUEJCHVFGU;C SÑD$GICPFKG*QJG 2HQTVG&KG#WHUEJTKHVGPFÒTHVGPQJPG#DURTCEJGOKVFGTQUOCPKUEJGP4GIKGTWPIHGUVIGNGIVYQTFGPUGKP

75


MURÂD V.

/74Œ&8 ,7/Œ&Œ++5*#ʼn$Œ0* /#+#7)756)'5614$'0#7)756

&WTEJFKG#DUGV\WPIFGU5WNVCPU #DFCN #\Ä\HKGNFCU5WNVCPCVFGOCO5GRVGODGTIGDQTGPGP ·NVGUVGP5QJP/WT³FUGKPGU$TWFGTU #DFCN/CLÄF\WFGTCO/CKKPVJTQPKUKGTVYWTFG9KGUGKP 8CVGTJCVVGGTGKPGHTCP\ÌUKUEJIGRT·IVG'T\KGJWPIIGPQUUGPWPFXGTHÒIVGÒDGTIWVG#TCDKUEJMGPPVPKUUG 'TJCVVGFKGXQPUGKPGO1PMGNDGCDUKEJVKIVG0CEJHQNIGTGIGNWPIFKGKJPCWUUEJNQUUPKEJVCPGTMCPPVWPF YCTFCJGTXQPUGKPGO1PMGNKUQNKGTVWPFITCWUCODGJCPFGNVYQTFGP&QEJFKG4QNNGFGU5WNVCPUGKPGUKP VKGHGT-TKUGOKV5VCCVUDCPMTQVVWPFOKNKV·TKUEJGP0KGFGTNCIGPUVGEMGPFGP4GKEJGUWPFFKG0CEJTKEJVXQO /QTFQFGT5GNDUVOQTFUGKPGU1PMGNUKO%KTCICP2CNCUVNKG­GPFGPPGWGP*GTTUEJGTKPVKGHG&GRTGUUKQP XGTHCNNGP 9KGFGTJQNVG 0GTXGP\WUCOOGPDTÒEJG OCEJVGP KJO FKG 9CJTPGJOWPI FGT 4GIKGTWPI WP   OÌINKEJ5QYWTFGGTFWTEJGTFWTEJFGP5VCCVUTCVWPVGTFGO2T·UKFGPVGP/KFJCV2CUEJCHCNNGPIGNCUUGP WPF FGT 5JC[MJ CN+UNCO UGV\VG KJP CO  #WIWUV  \WIWPUVGP UGKPGU P·EJUVHQNIGPFGP $TWFGTU CD   /CP DTCEJVG /WTCF CNU 5VCCVUIGHCPIGPGP KP FGP %KTCICP2CNCUV WPF GT HKGN GKPGT #TV FGT EQPFGOPCVKQ   OGOQTKG CPJGKO Y·JTGPF INGKEJ\GKVKI )GTÒEJVG ÒDGT UGKPG CPIGDNKEJ HTGKOCWTGTKUEJGP 8GTDKPFWPIGP   IGUVTGWVYWTFGP'TUVCTDCO#WIWUV  

76


MURÂD V.

383

1,5:1

1,5:1

)QNFRT·IWPIGPFGT/ÒP\UV·VVG3WUVCPVÄPÄ[C 

-WTWUJ*3WUVCPVÄPÄ[CI(D-/¤NEGT2GTG  )1.&8QT\ÒINKEJ



385

384



-WTWUJ*3WUVCPVÄPÄ[CI(D-/¤NEGT2GTG  )1.&5GJTUEJÌP





-WTWUJ*3WUVCPVÄPÄ[CI(D-/¤NEGT2GTG  )1.&5GJTUEJÌP



386



5KNDGTRT·IWPIGPFGT/ÒP\UV·VVG3WUVCPVÄPÄ[C

-WTWUJ*3WUVCPVÄPÄ[CI-/¤NEGT2GTG

45GJTUEJÌP



388

387



-WTWUJ*3WUVCPVÄPÄ[CI-/¤NEGT2GTG

445GJTUEJÌP





-WTWUJ*3WUVCPVÄPÄ[CI-/¤NEGT2GTG  445GKVNKEJUEJYCEJCWUIGRT·IV4CPFUEJN·IGUGJTUEJÌP



1,5:1



389

1,5:1

-WTWUJ*3WUVCPVÄPÄ[CI-/¤NEGT2GTG  44-N-TCV\GTCO4GXGTUTCPFXQT\ÒINKEJp5VGORGNINCP\

 77


MURÂD V.

390

1,5:1

1,5:1

)QNFRT·IWPIGPFGT/ÒP\UV·VVG/KUT -CKTQ  

-WTWUJ*/KUT -CKTQ I%CI(D-/¤NEGT2GTGp  )1.&44(CUVXQT\ÒINKEJ 'ZGORNCTFGT#WMVKQP$CNFYKP U1MVQDGT0T

1,5:1



391

1,5:1

-WTWUJ*/KUT -CKTQ I%CI(DC-/¤NEGT2GTGp  )1.&445GJTUEJÌP

'ZGORNCTFGT5COONWPI6WTCVJ2CTV++5RKPM.QPFQP0T

1,5:1

392





1,5:1

'KPG5KNDGTRT·IWPIFGT/ÒP\UV·VVG/KUT -CKTQ  

-WTWUJ*/KUT -CKTQ I-/¤NEGT2GTGp

445GJTUEJÌP



393

1,5:1

1,5:1

'KPG5KNDGTRT·IWPIFGT/ÒP\UV·VVG6ÑPKU 

 4K[CN  * 6ÑPKU /KV 0COGP FGU /WJCOOCF CU5³FKS  I (GPKPC  -/  ¤NEGT   2GTGp 8QPCNNGTITÌ­VGT5GNVGPJGKV-N4CPFUEJNCIXQT\ÒINKEJ  ¤NEGTWPF(GPKPCYCTPWTFCU'ZGORNCTCWUFGT5COONWPI)GQTIGU*WUPKDGMCPPVFCUOKVFGPXQTNKGIGPFGPQHHGPDCT PKEJVKFGPVKUEJKUV9GKVGTG'ZGORNCTGUEJGKPGPPKEJVDGMCPPV\WUGKP

78


'ABD AL-HAMÎD KHAN II.

#$&#.*#/œ&-*#0++ 6ª4-'+6ª4-+5%*#$&ª.*#/+6*#0  5*#ʼn$Œ04#$œ++* #7)756#24+.)'5614$'0('$47#4

&GTCO5GRVGODGTIGDQTGPG #DFCN*COÄF-JCPXGTFCPMVGUGKPG'KPUGV\WPI\YCTFGT4GHQTO RCTVGKWPVGT/KFJCV2CUEJCFQEJUQNNVGGTDCNFICP\GKIGPG9GIGIGJGP/KFJCVMQPPVG\YCTPQEJ FGO1UOCPKUEJGP4GKEJGKPGMQPUVKVWVKQPGNNG8GTHCUUWPIIGDGPFKGCDGTFGO9KNNGPFGU5WNVCPUWPVGTIG QTFPGVYCTWPFCWEJDCNFXQPFGOCWVQMTCVKUEJFGPMGPFGP5WNVCPCW­GT-TCHVIGUGV\VYWTFGY·JTGPFFGT )TQ­YGUKTCDIGUGV\VYWTFG&CUFWTEJFGP5WNVCPUYGEJUGNIGRTGNNVG4WUUNCPFDGICPPPQEJGKPGP XGTJGGTGPFGP-TKGIFGT\WP·EJUV\WO8GTNWUVHCUVCNNGTDCNMCPKUEJGP)GDKGVGFGU4GKEJGUGKPUEJNKG­NKEJ XQP'FKTPGHÒJTVG&CFKGUGKPGGORHKPFNKEJG5VÌTWPIKO)NGKEJIGYKEJVFGTGWTQR·KUEJGP/·EJVGPCEJ UKEJ\QIYWTFG4WUUNCPFKO$GTNKPGT(TKGFGPFC\WIGDTCEJVITQ­G$GTGKEJG\WTÒEM\WIGDGP  #DFCN*COÄFGTDVGGKPGPHKPCP\KGNN\GTTÒVVGVGP5VCCVUJCWUJCNV&CU/QTCVQTKWOFGTUVCCVNKEJGP<KPU\CJ NWPIGPXQPYWTFGFWTEJFKGKPVGTPCVKQPCNG5EJWNFGPXGTYCNVWPIÒDGTPQOOGPFGTGUIGNCPIFKG 8GTUEJWNFWPIDKUIGIGP'PFGFGU,CJTJWPFGTVUYGKVIGJGPFCD\WVTCIGP)NGKEJ\GKVKIIKPIGPFKG5VCCVUHK PCP\GPXQPFGT)QNFCWHFKG5KNDGTY·JTWPI\WTÒEMYCU\WTªDGTDGYGTVWPIFGU5KNDGTUHÒJTVGWPFTGIGN JCHV \WO #DHNWUU FGU )QNFGU J·VVG HÒJTGP OÒUUGP+PFKGUGO<WUCOOGPJCPIGTUEJGKPVFKG'KPHÒJTWPI URG\KGNNGT )QNFOÒP\GP HÒT FKG RTKXCVG 6JGUCWTKGTWPI KP 5EJOWEMHQTO \K[PGV GKPGGDGPUQDGOGTMGPU YGTVGYKGQHHGPDCTCWEJYKTMUCOG)GIGPOC­PCJOG  8QPDGUQPFGTGT$GFGWVWPIHÒTFKG0WOKUOCVKMKUVFGT)TQ­YGUKT \WXQTQUOCPKUEJGT$QVUEJCHVGT KP$GTNKP +DT³JÄO'FJGO2CUEJCFGUUGP5QJP*COFÄ$G[\WOYKTMWPIUO·EJVKIGP)TÒPFWPIUFK TGMVQT FGU /Ò\G[K *WO³[ÑP JGWVG #TEJ·QNQIKUEJGU /WUGWO +UVCPDWN  GTPCPPV YWTFG Y·JTGPF FKG   5ÌJPG+UO³ ÄN)J³NKD$G[WPF*CNÄN'FJGOCNU$GITÒPFGTFGTURG\KGNNGPQUOCPKUEJGP0WOKUOCVKMIGNVGP MÌPPGP&KGUKUVU[ORVQOCVKUEJHÒTFGP#WUDCWFGU$KNFWPIUYGUGPUWPVGT #DFCN*COÄF++FGT\YCTFKG MTKVKMNQUGªDGTPCJOGYGUVNKEJGT/QFGNNGUGKPGT8QTI·PIGTCDDTCEJCDGTFGPPQEJGTJGDNKEJG5EJTKVVG\WT YGKVGTGP'PVYKEMNWPIFGU5VCCVGUOCEJVG&KGUGUQCPFGTUIGCTVGVG2QNKVKMITÒPFGVGCWHÒDGTMQOOGPGP 9GTVGPCWHFGO+UNCOKPFGPªDGTNGIWPIGPFGU·I[RVKUEJGP/QFGTPKUVGP,COCNCFFKPCN#HIJCPKFGTFKG 4ÒEMUV·PFKIMGKVIGIGPÒDGTFGTYGUVNKEJGP9GNVVJGOCVKUKGTVGCWHFGO1UOCPKUOWUFGTFGOFCOCNUKP 'WTQRCXGTDTGKVGVGP0CVKQPCNKUOWUGPVIGIGPUVCPFWPFFGTFKGPKEJVVÒTMKUEJGP/KPFGTJGKVGPFGU1UOCPK UEJGP4GKEJGUUEJÒV\VGXGTDWPFGPOKVFGT9KGFGTDGNGDWPIFGT-CNKHCVUKFGGFKGKJOGKPGHÒJTGPFG4QNNG KPFGTIGUCOVGP9GNVFGUUWPPKVKUEJGP+UNCOU\WUEJTKGD  79


'ABD AL-HAMÎD KHAN II. 'UKUVUGNDUVPCEJJWPFGTV,CJTGPPKEJVGKPHCEJFKGUVCCVUO·PPKUEJGP.GKUVWPIGP #DFCN*COÄF-JCPUWPF UGKPGT9GUKTGTKEJVKI\WDGYGTVGPFGPPFKGRQNKVKUEJG'TKPPGTWPIKUVIGRT·IVXQOUR·VGTGP'THQNIUGKPGT UEJ·THUVGP9KFGTUCEJGTFKGUKEJUGKVKO\WP·EJUVMQPURKTCVKXGP$ÒPFPKUFGT,WPIVÒTMGP\WUCOOGP HCPFGP&KG,WPIVÒTMGPYCTGPIGGKPVKPFGT(QTFGTWPIPCEJFGT9KGFGTGKPUGV\WPIFGTCWUIGUGV\VGP 8GTHCUUWPICPUQPUVGPCDGTYKGGUUEJGKPVJGVGTQIGPXQP0CVKQPCNKUVGPYKG6CNCCV2CUEJC2CPVWTMKUVGP YKG 'PXGT 2CUEJC WPF 5CGMWNCTKUVGP YKG -GOCN 2CUEJC \WUCOOGPIGYÒTHGNV 5Q KUVGUPKEJVNGKEJVFKG GVJPKUEJGP-CVCUVTQRJGPCWHFGO$CNMCPWPFKP#PCVQNKGPYKGCWEJFKGVGTTKVQTKCNG&GUKPVGITCVKQPFKGCWH FKG#DUGV\WPI #DFCN*COÄFU++HQNIVGCWUFGPTGEJVHGTVKIGPFGP2GTURGMVKXGPXQP,WPIVÒTMGPPCEJHQNIGTP QFGTXQP0WV\PKG­GTPFGTVGTTKVQTKCNGP&GUKPVGITCVKQPUKPPXQNN\WGTMN·TGP5QYKTFCWUFGOUKEJGTNKEJ CWVQMTCVKUEJGP 5WNVCP GKP 5ÒPFGPDQEM FGO XKGNGTNGK PCEJHQNIGPFG 2TQDNGOG KP FKG 5EJWJG IGUEJQDGP   YGTFGPMÌPPGP#WUFGWVUEJGT2GTURGMVKXGKUVFKG#PP·JGTWPIFGTQUOCPKUEJGP2QNKVKMCP&GWVUEJNCPFKP FKGUGP,CJT\GJPVGPKPVGPUKXGTFGPPLG\WXQTIGYGUGP&GTIGUEJNQUUGPG(TGWPFUEJCHVU*CPFGNUWPF 5EJKHHHCJTVUXGTVTCIYWTFG\WT)TWPFNCIGFGU$CIFCFDCJPDCWU&GT$GUWEJFGU-CKUGTU9KNJGNO++DGKO 5WNVCPKO4CJOGPUGKPGT2CN·UVKPCTGKUGYWTFGOKVITQ­GO)GRT·PIG\GNGDTKGTVWPFPQEJJGWVG\GWIV FKG(CUUCFGFGUPCEJWOC[[CFKUEJGP9ÒUVGPUEJNQUUGU/UEJCVVCFKGCNU)GUEJGPMFGU5WNVCPUCPFGP -CKUGTPCEJ$GTNKPMCOXQPFGTKORGTKCNGP(TGWPFUEJCHV  &KGLWPIVÒTMKUEJGP(GKPFGFGT#NNGKPJGTTUEJCHVFGU5WNVCPUIGYCPPGPFKG/GJTJGKVWPVGTFGP1HHK\KG TGPFGT)CTPKUQPXQP5CNQPKMKWPFUKGMQPPVGPFKG9KGFGTGKPUGV\WPIFGT8GTHCUUWPIXQPFWTEJ FGP5WNVCPFWTEJUGV\GPWPFKJPGPIGPGJOG(ÒJTWPIURQUKVKQPGPDGUGV\GP&KGUGKPPGTGP#WUGKPCPFGTUGV \WPIGPYWTFGPCDGTXQPFGP0CEJDCTP\W#PPGZKQPGPDGPWV\VUQGTMN·TVG)TKGEJGPNCPFFGP#PUEJNWUU XQP-TGVC$WNICTKGPOCEJVGUKEJWPCDJ·PIKI¤UVGTTGKEJ7PICTPCPPGMVKGTVG$QUPKGPWPF*GT\GIQYKPC &KGUG)GDKGVUXGTNWUVGWPVGTLWPIVÒTMKUEJGT*GTTUEJCHVXGTCPNCUUVGP #DFCN*COKF++GTPGWVUGKPG#NNGKP JGTTUEJCHVFWTEJ\WUGV\GPFQEJFKG4GCMVKQPFGT,WPIVÒTMGPCWU5CNQPKMKGTHQNIVGUQHQTV&GT5WNVCPYWTFG CO#RTKNXGTJCHVGVWPFCDIGUGV\VWPFKPFGT0·JGXQP5CNQPKMKKPVGTPKGTV  

394

)QNFRT·IWPIGPFGT/ÒP\UV·VVG3WUVCPVÄPÄ[C 

-WTWUJ*3WUVCPVÄPÄ[C/KV$NWOGPGDGPFGT6WIJTCI(D-/¤NEGT 2GTG )1.&45EJÌPpUGJTUEJÌP



395

1,5:1

 80

1,5:1

-WTWUJ*3WUVCPVÄPÄ[C/KV$NWOGPGDGPFGT6WIJTCI(D-/¤NEGT 2GTG )1.&5GNVGPDGUQPFGTUKPFKGUGT'TJCNVWPI8QT\ÒINKEJ




'ABD AL-HAMÎD KHAN II.

396

398

399



-WTWUJ*3WUVCPVÄPÄ[C/KV$NWOGPGDGPFGT6WIJTCI(D-/¤NEGT 2GTG )1.&4*GPMGNURWTUGJTUEJÌP



'PH·NNV



 -WTWUJ  *  3WUVCPVÄPÄ[C CN)J³\Ä PGDGP FGT 6WIJTC  I (D  -/  ¤NEGT   2GTG )1.&44CPFGVYCUDGCTDGKVGV5GJTUEJÌP 



 -WTWUJ  *  3WUVCPVÄPÄ[C CN)J³\Ä PGDGP FGT 6WIJTC  I (D  -/  ¤NEGT   2GTG )1.&4-CWOUKEJVDCTG*GPMGNURWTUGJTUEJÌP 

 

400

401

402



 -WTWUJ  *  3WUVCPVÄPÄ[C CN)J³\Ä PGDGP FGT 6WIJTC  I (D  -/  ¤NEGT   2GTG )1.&4-CWOUKEJVDCTG*GPMGNURWTUGJTUEJÌP 



 -WTWUJ  *  3WUVCPVÄPÄ[C CN)J³\Ä PGDGP FGT 6WIJTC  I (D  -/  ¤NEGT   2GTG )1.&4*GPMGNURWTUEJÌPpUGJTUEJÌP 



 -WTWUJ  *  3WUVCPVÄPÄ[C CN)J³\Ä PGDGP FGT 6WIJTC  I (D  -/  ¤NEGT   2GTG )1.&4-CWOUKEJVDCTG*GPMGNURWTUGJTUEJÌP  81


'ABD AL-HAMÎD KHAN II.

403

1,5:1

1,5:1



 -WTWUJ  *  3WUVCPVÄPÄ[C CN)J³\Ä PGDGP FGT 6WIJTC  I (D  -/  ¤NEGT   2GTG )1.&5GNVGPKPFKGUGT'TJCNVWPI(CUV5VGORGNINCP\ 

404



 -WTWUJ  *  3WUVCPVÄPÄ[C CN)J³\Ä PGDGP FGT 6WIJTC  I (D  -/  ¤NEGT   2GTG )1.&45GJTUEJÌPpXQT\ÒINKEJ 

405

406

407



 -WTWUJ  *  3WUVCPVÄPÄ[C CN)J³\Ä PGDGP FGT 6WIJTC  I (D  -/  ¤NEGT   2GTG )1.&4-CWOUKEJVDCTG*GPMGNURWTUGJTUEJÌP 



 -WTWUJ  *  3WUVCPVÄPÄ[C CN)J³\Ä PGDGP FGT 6WIJTC  I (D  -/  ¤NEGT   2GTG )1.&4-CWOUKEJVDCTG*GPMGNURWT-TCV\GTUGJTUEJÌP 



 -WTWUJ  *  3WUVCPVÄPÄ[C CN)J³\Ä PGDGP FGT 6WIJTC  I (D  -/  ¤NEGT   2GTG )1.&4-CWOUKEJVDCTG*GPMGNURWTUGJTUEJÌP 

82


'ABD AL-HAMÎD KHAN II.

408

409

410



 -WTWUJ  *  3WUVCPVÄPÄ[C CN)J³\Ä PGDGP FGT 6WIJTC  I (D  -/  ¤NEGT   2GTG )1.&4-CWOUKEJVDCTG*GPMGNURWTUGJTUEJÌP 



 -WTWUJ  *  3WUVCPVÄPÄ[C CN)J³\Ä PGDGP FGT 6WIJTC  I (D  -/  ¤NEGT   2GTG )1.&4-CWOUKEJVDCTG*GPMGNURWTUGJTUEJÌP 



 -WTWUJ  *  3WUVCPVÄPÄ[C CN)J³\Ä PGDGP FGT 6WIJTC  I (D  -/  ¤NEGT   2GTG )1.&(CUVXQT\ÒINKEJ 

411

412

413



 -WTWUJ  *  3WUVCPVÄPÄ[C CN)J³\Ä PGDGP FGT 6WIJTC  I (D  -/  ¤NEGT   2GTG )1.&4*GPMGNURWTHCUVXQT\ÒINKEJ 



 -WTWUJ  *  3WUVCPVÄPÄ[C CN)J³\Ä PGDGP FGT 6WIJTC  I (D  -/  ¤NEGT   2GTG )1.&45GJTUEJÌP 



 -WTWUJ  *  3WUVCPVÄPÄ[C CN)J³\Ä PGDGP FGT 6WIJTC  I (D  -/  ¤NEGT   2GTG )1.&*GPMGNURWTUGJTUEJÌP  83


'ABD AL-HAMÎD KHAN II.

414

1,5:1



1,5:1

 -WTWUJ  *  3WUVCPVÄPÄ[C CN)J³\Ä PGDGP FGT 6WIJTC  I (D  -/  ¤NEGT   2GTG )1.&8QPRQNKGTVGP5VGORGNP5VGORGNINCP\ 

415

416

417



 -WTWUJ  *  3WUVCPVÄPÄ[C CN)J³\Ä PGDGP FGT 6WIJTC  I (D  -/  ¤NEGT   2GTG )1.&8QT\ÒINKEJ 



 -WTWUJ  *  3WUVCPVÄPÄ[C CN)J³\Ä PGDGP FGT 6WIJTC  I (D  -/  ¤NEGT   2GTG )1.&(CUV5VGORGNINCP\ 



 -WTWUJ  *  3WUVCPVÄPÄ[C CN)J³\Ä PGDGP FGT 6WIJTC  I (D  -/  ¤NEGT   2GTG )1.&(CUV5VGORGNINCP\ 

418

 84

 -WTWUJ  *  3WUVCPVÄPÄ[C CN)J³\Ä PGDGP FGT 6WIJTC  I (D  -/  ¤NEGT   2GTG *GPMGNURWTUGJTUEJÌP 


'ABD AL-HAMÎD KHAN II.

419



420

421

 -WTWUJ  *  3WUVCPVÄPÄ[C CN)J³\Ä PGDGP FGT 6WIJTC  I (D  -/  ¤NEGT   2GTG )1.&8QT\ÒINKEJ  'ZGORNCTFGT5COONWPI*WUPK5VGRJGP#NDWO5CPVC4QUC0T



 -WTWUJ  *  3WUVCPVÄPÄ[C CN)J³\Ä PGDGP FGT 6WIJTC  I (D  -/  ¤NEGT   2GTG )1.&-CWOUKEJVDCTG*GPMGNURWTUGJTUEJÌPpXQT\ÒINKEJ 



 -WTWUJ  *  3WUVCPVÄPÄ[C CN)J³\Ä PGDGP FGT 6WIJTC  I (D  -/  ¤NEGT   2GTG )1.&-CWOUKEJVDCTG*GPMGNURWTUGJTUEJÌP 

422

1,5:1



1,5:1

 -WTWUJ  *3WUVCPVÄPÄ[C/KV$NWOGPGDGPFGT6WIJTCI(D-/¤NEGT 2GTGp  )1.&8QPITÌ­VGT5GNVGPJGKVPWT'ZGORNCTGIGRT·IV<YGK*GPMGNURWTGPUGJTUEJÌP

423



424



 -WTWUJ  *  3WUVCPVÄPÄ[C CN)J³\Ä PGDGP FGT 6WIJTC  I (D  -/  ¤NEGT   2GTG )1.&4*GPMGNURWTUEJÌPpUGJTUEJÌP





 -WTWUJ  *  3WUVCPVÄPÄ[C CN)J³\Ä PGDGP FGT 6WIJTC  I (D  -/  ¤NEGT   2GTG )1.&4*GPMGNURWTUGJTUEJÌP

 85


'ABD AL-HAMÎD KHAN II.

425

426

428

427



 -WTWUJ  *  3WUVCPVÄPÄ[C CN)J³\Ä PGDGP FGT 6WIJTC  I (D  -/  ¤NEGT   2GTG )1.&4*GPMGNURWTUGJTUEJÌP





 -WTWUJ  *  3WUVCPVÄPÄ[C CN)J³\Ä PGDGP FGT 6WIJTC  I (D  -/  ¤NEGT   2GTG )1.&4*GPMGNURWTUGJTUEJÌP





 -WTWUJ  *  3WUVCPVÄPÄ[C CN)J³\Ä PGDGP FGT 6WIJTC  I (D  -/  ¤NEGT   2GTG )1.&4*GPMGNURWTUGJTUEJÌP





 -WTWUJ  *  3WUVCPVÄPÄ[C CN)J³\Ä PGDGP FGT 6WIJTC  I (D  -/  ¤NEGT   2GTG )1.&4-CWOUKEJVDCTG*GPMGNURWTUEJÌPpUGJTUEJÌP



429

430



 -WTWUJ  *  3WUVCPVÄPÄ[C CN)J³\Ä PGDGP FGT 6WIJTC  I (D  -/  ¤NEGT   2GTG )1.&4*GPMGNURWTUGJTUEJÌP





 -WTWUJ  *  3WUVCPVÄPÄ[C CN)J³\Ä PGDGP FGT 6WIJTC  I (D  -/  ¤NEGT   2GTG )1.&4-CWOUKEJVDCTG*GPMGNURWTUGJTUEJÌP



431

432

433

434



 -WTWUJ  *  3WUVCPVÄPÄ[C CN)J³\Ä PGDGP FGT 6WIJTC  I (D  -/  ¤NEGT   2GTG )1.&4-CWOUKEJVDCTG*GPMGNURWTUGJTUEJÌP





 -WTWUJ  *  3WUVCPVÄPÄ[C CN)J³\Ä PGDGP FGT 6WIJTC  I (D  -/  ¤NEGT   2GTG )1.&5GJTUGNVGPGT,CJTICPI*GPMGNURWTUGJTUEJÌP





 -WTWUJ  *  3WUVCPVÄPÄ[C CN)J³\Ä PGDGP FGT 6WIJTC  I (D  -/  ¤NEGT   2GTG )1.&*GPMGNURWTUGJTUEJÌPpXQT\ÒINKEJ





 -WTWUJ  *  3WUVCPVÄPÄ[C CN)J³\Ä PGDGP FGT 6WIJTC  I (D  -/  ¤NEGT   2GTG )1.&45GJTUEJÌP



86


'ABD AL-HAMÎD KHAN II.

435

1,5:1

1,5:1



 -WTWUJ  *  3WUVCPVÄPÄ[C CN)J³\Ä PGDGP FGT 6WIJTC  I (D  -/  ¤NEGT   2GTG )1.&5GJTUGNVGPDGUQPFGTUKPFKGUGT'TJCNVWPI2QNKGTVG2NCVVG 

436

437



 -WTWUJ  *  3WUVCPVÄPÄ[C CN)J³\Ä PGDGP FGT 6WIJTC  I (D  -/  ¤NEGT   2GTG )1.&-CWOUKEJVDCTG*GPMGNURWTUGJTUEJÌP





 -WTWUJ  *  3WUVCPVÄPÄ[C CN)J³\Ä PGDGP FGT 6WIJTC  I (D  -/  ¤NEGT   2GTG )1.&-CWOUKEJVDCTG*GPMGNURWTUGJTUEJÌP



439

438



 -WTWUJ  *  3WUVCPVÄPÄ[C CN)J³\Ä PGDGP FGT 6WIJTC  I (D  -/  ¤NEGT   2GTG )1.&-CWOUKEJVDCTG*GPMGNURWTUGJTUEJÌP





 -WTWUJ  *  3WUVCPVÄPÄ[C CN)J³\Ä PGDGP FGT 6WIJTC  I (D  -/  ¤NEGT   2GTG )1.&8QT\ÒINKEJ



440

1,5:1



1,5:1

-WTWUJ* CWUWOIGUEJPKVVGP 3WUVCPVÄPÄ[CCN)J³\ÄPGDGPFGT6WIJTCI(D -/¤NEGT2GTG )1.&8QT\ÒINKEJp5VGORGNINCP\ 'ZGORNCTFGT#WMVKQP(TKV\4WFQNH-ÒPMGT1UPCDTÒEM0T







5VGORGNINGKEJOKVFGOXQTKIGP5VÒEMPWTKO&CVWOWOIGUEJPKVVGP

87


'ABD AL-HAMÎD KHAN II.

441

442

443



 -WTWUJ  *  3WUVCPVÄPÄ[C CN)J³\Ä PGDGP FGT 6WIJTC  I (D  -/  ¤NEGT   2GTG )1.&*GPMGNURWTUGJTUEJÌP





 -WTWUJ  *  3WUVCPVÄPÄ[C CN)J³\Ä PGDGP FGT 6WIJTC  I (D  -/  ¤NEGT   2GTG )1.&8QT\ÒINKEJ





 -WTWUJ  *  3WUVCPVÄPÄ[C CN)J³\Ä PGDGP FGT 6WIJTC  I (D  -/  ¤NEGT   2GTG )1.&*GPMGNURWTUGJTUEJÌP



444

445

446



 -WTWUJ  *  3WUVCPVÄPÄ[C /KV $NWOG PGDGP FGT 6WIJTC I (D  -/  ¤NEGT   2GTG )1.&45GJTUEJÌP





 -WTWUJ  *  3WUVCPVÄPÄ[C /KV $NWOG PGDGP FGT 6WIJTC  I (D  -/  ¤NEGT   2GTG )1.&5GJTUEJÌP





 -WTWUJ  *  3WUVCPVÄPÄ[C /KV $NWOG PGDGP FGT 6WIJTC  I (D  -/  ¤NEGT   2GTG )1.&-N-TCV\GTHCUVXQT\ÒINKEJ



447

1,5:1

 88

1,5:1

 -WTWUJ  *  3WUVCPVÄPÄ[C /KV $NWOG PGDGP FGT 6WIJTC  I (D  -/  ¤NEGT   2GTG )1.&5GJTUGNVGPGT,CJTICPI5GJTUEJÌP




'ABD AL-HAMÎD KHAN II.

448

449

450

451



 -WTWUJ  *  3WUVCPVÄPÄ[C /KV $NWOG PGDGP FGT 6WIJTC  I (D  -/  ¤NEGT   2GTG )1.&8QT\ÒINKEJ





-WTWUJ*3WUVCPVÄPÄ[CCN)J³\ÄPGDGPFGT6WIJTCI(D-/¤NEGT 2GTG )1.&5GJTUEJÌP





-WTWUJ*3WUVCPVÄPÄ[CCN)J³\ÄPGDGPFGT6WIJTCI(D-/¤NEGT 2GTG )1.&8QT\ÒINKEJ





-WTWUJ*3WUVCPVÄPÄ[CCN)J³\ÄPGDGPFGT6WIJTCI(D-/¤NEGT 2GTG )1.&8QT\ÒINKEJ



452

453

454

455



-WTWUJ*3WUVCPVÄPÄ[CCN)J³\ÄPGDGPFGT6WIJTCI(D-/¤NEGT 2GTG )1.&5VGORGNINCP\





 -WTWUJ  *  3WUVCPVÄPÄ[C CN)J³\Ä PGDGP FGT 6WIJTC  I (D  -/  ¤NEGT   2GTG )1.&-N2TÒHURWTCO4CPFHCUVXQT\ÒINKEJ





 -WTWUJ  *  3WUVCPVÄPÄ[C CN)J³\Ä PGDGP FGT 6WIJTC  I (D  -/  ¤NEGT   2GTG )1.&5GNVGPGT,CJTICPI8QT\ÒINKEJ





 -WTWUJ  *  3WUVCPVÄPÄ[C CN)J³\Ä PGDGP FGT 6WIJTC  I (D  -/  ¤NEGT   2GTG )1.&45GJTUEJÌPpXQT\ÒINKEJ



456

457



 -WTWUJ  *  3WUVCPVÄPÄ[C CN)J³\Ä PGDGP FGT 6WIJTC  I (D  -/  ¤NEGT   2GTG )1.&5VGORGNINCP\





 -WTWUJ  *  3WUVCPVÄPÄ[C CN)J³\Ä PGDGP FGT 6WIJTC  I (D  -/  ¤NEGT   2GTG )1.&45GJTUEJÌPpXQT\ÒINKEJ

 89


'ABD AL-HAMÎD KHAN II.

459

458



 -WTWUJ  *  3WUVCPVÄPÄ[C CN)J³\Ä PGDGP FGT 6WIJTC  I (D  -/  ¤NEGT   2GTG )1.&5GJTUEJÌP





 -WTWUJ  *  3WUVCPVÄPÄ[C CN)J³\Ä PGDGP FGT 6WIJTC  I (D  -/  ¤NEGT   2GTG )1.&-N4CPFUEJNCIUGJTUEJÌPpXQT\ÒINKEJ



460

461

462

463



 -WTWUJ  *  3WUVCPVÄPÄ[C CN)J³\Ä PGDGP FGT 6WIJTC  I (D  -/  ¤NEGT   2GTG )1.&8QT\ÒINKEJ





 -WTWUJ  *  3WUVCPVÄPÄ[C CN)J³\Ä PGDGP FGT 6WIJTC  I (D  -/  ¤NEGT   2GTG )1.&5GJTUEJÌP





 -WTWUJ  *  3WUVCPVÄPÄ[C CN)J³\Ä PGDGP FGT 6WIJTC  I (D  -/  ¤NEGT   2GTG )1.&8QT\ÒINKEJ





 -WTWUJ  *  3WUVCPVÄPÄ[C CN)J³\Ä PGDGP FGT 6WIJTC  I (D  -/  ¤NEGT   2GTG )1.&8QT\ÒINKEJ



464

465

466

467



 -WTWUJ  *  3WUVCPVÄPÄ[C CN)J³\Ä PGDGP FGT 6WIJTC  I (D  -/  ¤NEGT   2GTG )1.&(CUVXQT\ÒINKEJ





 -WTWUJ  *  3WUVCPVÄPÄ[C CN)J³\Ä PGDGP FGT 6WIJTC  I (D  -/  ¤NEGT   2GTG )1.&-N4CPFUEJN·IGHCUVXQT\ÒINKEJ





 -WTWUJ  *  3WUVCPVÄPÄ[C CN)J³\Ä PGDGP FGT 6WIJTC  I (D  -/  ¤NEGT   2GTG )1.&/KP(CUUWPIUURWTUGJTUEJÌP





 -WTWUJ  *  3WUVCPVÄPÄ[C CN)J³\Ä PGDGP FGT 6WIJTC  I (D  -/  ¤NEGT   2GTG )1.&5GNVGPGT,CJTICPI8QT\ÒINKEJ



90


'ABD AL-HAMÎD KHAN II.

468

469

470



 -WTWUJ  *  3WUVCPVÄPÄ[C CN)J³\Ä PGDGP FGT 6WIJTC  I (D  -/  ¤NEGT   2GTG )1.&8QT\ÒINKEJ





 -WTWUJ  *  3WUVCPVÄPÄ[C CN)J³\Ä PGDGP FGT 6WIJTC  I (D  -/  ¤NEGT   2GTG )1.&8QT\ÒINKEJ





 -WTWUJ  *  3WUVCPVÄPÄ[C CN)J³\Ä PGDGP FGT 6WIJTC  I (D  -/  ¤NEGT   2GTG )1.&.GKEJVG4CPFHGJNGTXQT\ÒINKEJp5VGORGNINCP\



472

471



 -WTWUJ  *  3WUVCPVÄPÄ[C CN)J³\Ä PGDGP FGT 6WIJTC  I (D  -/  ¤NEGT   2GTG )1.&8QT\ÒINKEJ





 -WTWUJ  *  3WUVCPVÄPÄ[C CN)J³\Ä PGDGP FGT 6WIJTC  I (D  -/  ¤NEGT   2GTG )1.&8QT\ÒINKEJ



473

1,5:1



1,5:1

 -WTWUJ  *  3WUVCPVÄPÄ[C CN)J³\Ä PGDGP FGT 6WIJTC  I (D  -/  ¤NEGT   2GTG )1.&5VGORGNINCP\

474



475



 -WTWUJ  *  3WUVCPVÄPÄ[C CN)J³\Ä PGDGP FGT 6WIJTC  I (D  -/  ¤NEGT   2GTG )1.&8QT\ÒINKEJ





 -WTWUJ  *  3WUVCPVÄPÄ[C /KV $NWOG PGDGP FGT 6WIJTC  I (D  -/  ¤NEGT   2GTG )1.&4*GPMGNURWTUGJTUEJÌP

 91


'ABD AL-HAMÎD KHAN II.

476

477

479

478



-WTWUJ*3WUVCPVÄPÄ[CCN)J³\ÄPGDGPFGT6WIJTCI(D-/¤NEGT 2GTG )1.&45GJTUEJÌP





-WTWUJ*3WUVCPVÄPÄ[CCN)J³\ÄPGDGPFGT6WIJTCI(D-/¤NEGT 2GTG )1.&4(CUUWPIUURWTGPXQT\ÒINKEJ





-WTWUJ*3WUVCPVÄPÄ[CCN)J³\ÄPGDGPFGT6WIJTCI(D-/¤NEGT 2GTG )1.&48QT\ÒINKEJ





-WTWUJ*3WUVCPVÄPÄ[CCN)J³\ÄPGDGPFGT6WIJTCI(D-/¤NEGT 2GTG )1.&5GJTUEJÌPpXQT\ÒINKEJ



480

481

482



-WTWUJ*3WUVCPVÄPÄ[CCN)J³\ÄPGDGPFGT6WIJTCI(D-/¤NEGT 2GTG )1.&(CUVXQT\ÒINKEJ





-WTWUJ*3WUVCPVÄPÄ[CCN)J³\ÄPGDGPFGT6WIJTCI(D-/¤NEGT 2GTG )1.&5GJTUEJÌP





-WTWUJ*3WUVCPVÄPÄ[CCN)J³\ÄPGDGPFGT6WIJTCI(D-/¤NEGT 2GTG )1.&5GJTUEJÌPpXQT\ÒINKEJ



484

483



-WTWUJ*3WUVCPVÄPÄ[CCN)J³\ÄPGDGPFGT6WIJTCI(D-/¤NEGT 2GTG )1.&-N4CPFHGJNGTUGJTUEJÌP





-WTWUJ*3WUVCPVÄPÄ[CCN)J³\ÄPGDGPFGT6WIJTCI(D-/¤NEGT 2GTG )1.&-N5EJTÌVNKPIUHGJNGTCO4CPFXQT\ÒINKEJ



485



-WTWUJ*3WUVCPVÄPÄ[CCN)J³\ÄPGDGPFGT6WIJTCI(D-/¤NEGT 2GTG )1.&5EJYCEJG4·PFGNWPIXQT\ÒINKEJ &KG VGKNYGKUG CWUUGV\GPFG 4·PFGNWPI DGTWJV PKEJV CWH GPVHGTPVGT *GPMGNWPI QFGT FGTINGKEJGP UQPFGTP KUV GKPG   +ORGTHGMVKQPFGT/ÒP\UV·VVG&CUGTIKDVUKEJCWUFGOOKPKOCNITÌ­GTGP&WTEJOGUUGTFGU5VÒEMGUFCUFWTEJTKEJVKIG 4·PFGNWPI MNGKPGT IGYQTFGP Y·TG WPF FWTEJ $GUEJPGKFGP \WT 8GTFGEMWPI GKPGT *GPMGNURWT PQEJOCNU OKPKOCN   MNGKPGT

92




'ABD AL-HAMÎD KHAN II.

487

486



-WTWUJ*3WUVCPVÄPÄ[CCN)J³\ÄPGDGPFGT6WIJTCI(D-/¤NEGT 2GTG )1.&-N4CPFHGJNGTUGJTUEJÌP





-WTWUJ*3WUVCPVÄPÄ[CCN)J³\ÄPGDGPFGT6WIJTCI(D-/¤NEGT 2GTG )1.&5EJYCEJG4·PFGNWPIWPFOKP4CPFHGJNGTXQT\ÒINKEJ



488

1,5:1



1,5:1

-WTWUJ*3WUVCPVÄPÄ[CCN)J³\ÄPGDGPFGT6WIJTCI(D-/¤NEGT 2GTG )1.&5VGORGNINCP\

489

490

491



492



-WTWUJ*3WUVCPVÄPÄ[CCN)J³\ÄPGDGPFGT6WIJTCI(D-/¤NEGT 2GTG )1.&*GPMGNURWTUGJTUEJÌP





-WTWUJ*3WUVCPVÄPÄ[CCN)J³\ÄPGDGPFGT6WIJTCI(D-/¤NEGT 2GTG )1.&8QT\ÒINKEJp5VGORGNINCP\





-WTWUJ*3WUVCPVÄPÄ[CCN)J³\ÄPGDGPFGT6WIJTCI(D-/¤NEGT 2GTG )1.&5GJTUEJÌP





-WTWUJ*3WUVCPVÄPÄ[CCN)J³\ÄPGDGPFGT6WIJTCI(D-/¤NEGT 2GTG )1.&(CUV5VGORGNINCP\



494 493

495



-WTWUJ*3WUVCPVÄPÄ[CCN)J³\ÄPGDGPFGT6WIJTCI(D-/¤NEGT 2GTG )1.&(CUV5VGORGNINCP\





-WTWUJ*3WUVCPVÄPÄ[CCN)J³\ÄPGDGPFGT6WIJTCI(D-/¤NEGT 2GTG )1.&(CUV5VGORGNINCP\



'ZGORNCTFGT#WMVKQP5QVJGD[ U0GY;QTM0T



-WTWUJ*3WUVCPVÄPÄ[CCN)J³\ÄPGDGPFGT6WIJTCI(D-/¤NEGT 2GTG )1.&(CUVXQT\ÒINKEJ

 93


'ABD AL-HAMÎD KHAN II.

496



-WTWUJ*3WUVCPVÄPÄ[CCN)J³\ÄPGDGPFGT6WIJTCI(D-/¤NEGT 2GTG )1.&8QT\ÒINKEJ

498

497

499



500



 -WTWUJ  *  3WUVCPVÄPÄ[C /KV $NWOG PGDGP FGT 6WIJTC  I (D  -/  ¤NEGT   2GTG )1.&5GJTUEJÌP





 -WTWUJ  *  3WUVCPVÄPÄ[C /KV $NWOG PGDGP FGT 6WIJTC  I (D  -/  ¤NEGT   2GTG )1.&5GJTUEJÌPpXQT\ÒINKEJ





-WTWUJ*3WUVCPVÄPÄ[CCN)J³\ÄPGDGPFGT6WIJTCI(D-/¤NEGT 2GTG )1.&5GJTUEJÌP





-WTWUJ*3WUVCPVÄPÄ[CCN)J³\ÄPGDGPFGT6WIJTCI(D-/¤NEGT 2GTG )1.&8QT\ÒINKEJ



ex 502

501

ex 503

ex 504



-WTWUJ*3WUVCPVÄPÄ[CCN)J³\ÄPGDGPFGT6WIJTCI(D-/¤NEGT 2GTG )1.&5GJTUEJÌP





-WTWUJ*WPF3WUVCPVÄPÄ[CCN)J³\ÄPGDGPFGT6WIJTCWPFI(D-/ ¤NEGTWPF2GTG 5VÒEM)1.&8QT\ÒINKEJWPF5VGORGNINCP\





-WTWUJ*WPF3WUVCPVÄPÄ[CCN)J³\ÄPGDGPFGT6WIJTCWPFI(D-/ ¤NEGTWPF2GTG  5VÒEM)1.&&KGÒDNKEJGWPXQNNUV·PFKIG4·PFGNWPIUGJTUEJÌP



-WTWUJ*WPF3WUVCPVÄPÄ[CCN)J³\ÄPGDGPFGT6WIJTCWPFI(D-/ ¤NEGTWPF2GTG  5VÒEM)1.&+PFGT/KVVGLGYGKNUGVYCUHNCWXQT\ÒINKEJWPFUGJTUEJÌP





505

ex 506



-WTWUJ*3WUVCPVÄPÄ[CCN)J³\ÄPGDGPFGT6WIJTCI(D-/¤NEGT 2GTG )1.&5VGORGNINCP\





-WTWUJ*WPF3WUVCPVÄPÄ[CCN)J³\ÄPGDGPFGT6WIJTCWPFI(D-/ ¤NEGTWPF2GTG 5VÒEM)1.&&CUGTUVGOKV*GPMGNURWTUGJTUEJÌP



94


'ABD AL-HAMÎD KHAN II.

ex 507

ex 508

509

ex 510



-WTWUJ*WPF3WUVCPVÄPÄ[CCN)J³\ÄPGDGPFGT6WIJTCWPFI(D-/ ¤NEGTWPF2GTG 5VÒEM)1.&5GJTUEJÌPWPFXQT\ÒINKEJ





-WTWUJ*WPF3WUVCPVÄPÄ[CCN)J³\ÄPGDGPFGT6WIJTCWPFI(D-/ ¤NEGTWPF2GTG 5VÒEM)1.&5GJTUEJÌPWPFXQT\ÒINKEJ





-WTWUJ*WPF3WUVCPVÄPÄ[CCN)J³\ÄPGDGPFGT6WIJTCWPFI(D-/ ¤NEGTWPF2GTG )1.&5GJTUEJÌPWPFXQT\ÒINKEJ





-WTWUJ*WPF3WUVCPVÄPÄ[CCN)J³\ÄPGDGPFGT6WIJTCWPFI(D-/ ¤NEGTWPF2GTG 5VÒEM)1.&8QT\ÒINKEJp5VGORGNINCP\



513 ex 511

ex 512



-WTWUJ*WPF3WUVCPVÄPÄ[CCN)J³\ÄPGDGPFGT6WIJTCWPFI(D-/ ¤NEGTWPF2GTG 5VÒEM)1.&8QT\ÒINKEJp5VGORGNINCP\





-WTWUJ*WPF3WUVCPVÄPÄ[CCN)J³\ÄPGDGPFGT6WIJTCWPFI(D-/ ¤NEGTWPF2GTG 5VÒEM)1.&5VGORGNINCP\





-WTWUJ*3WUVCPVÄPÄ[CCN)J³\ÄPGDGPFGT6WIJTCI(D-/¤NEGT 2GTG )1.&5GNVGPGT,CJTICPI5VGORGNINCP\



514

<K[PGV2T·IWPIGPFGT/ÒP\UV·VVG3WUVCPVÄPÄ[C 

-WTWUJ*3WUVCPVÄPÄ[C<K[PGV2T·IWPIOKVDTGKVGOQTPCOGPVKGTVGP4CPFI%CI -/¤NEGT2GTG )1.&5VGORGNINCP\

 95


'ABD AL-HAMÎD KHAN II.

515



-WTWUJ*3WUVCPVÄPÄ[C<K[PGV2T·IWPIOKVDTGKVGOQTPCOGPVKGTVGP4CPFI%CI -/¤NEGT2GTG )1.&0CEJRT·IWPIHÒTFGP$C\CT8QT\ÒINKEJ



516



 -WTWUJ  *  3WUVCPVÄPÄ[C <K[PGV2T·IWPI OKV DTGKVGO QTPCOGPVKGTVGP 4CPF  I   -/¤NEGT2GTG )1.&)GJGPMGNVUGJTUEJÌPpXQT\ÒINKEJ 

517



-WTWUJ*3WUVCPVÄPÄ[C<K[PGV2T·IWPIOKVDTGKVGOQTPCOGPVKGTVGP4CPFI%CI -/¤NEGT2GTG )1.&8QT\ÒINKEJ



518



96

 -WTWUJ  *  3WUVCPVÄPÄ[C <K[PGV2T·IWPI OKV DTGKVGO QTPCOGPVKGTVGP 4CPF  I   -/¤NEGT2GTG  )1.&48GTOWVNKEJPCEJIGT·PFGNVÒDGTPKEJVOGJTUKEJVDCTG*GPMGNURWTHCUVUGJTUEJÌP 


'ABD AL-HAMÎD KHAN II.

519



 -WTWUJ  *  3WUVCPVÄPÄ[C <K[PGV2T·IWPI OKV DTGKVGO QTPCOGPVKGTVGP 4CPF  I   -/¤NEGT2GTG )1.&44(CUV5VGORGNINCP\ 

520

521

522



 -WTWUJ  *  3WUVCPVÄPÄ[C <K[PGV2T·IWPI OKV DTGKVGO QTPCOGPVKGTVGP 4CPF  I   -/¤NEGT2GTGp )1.&.GKEJVGT4CPFUEJNCIUGJTUEJÌP





 -WTWUJ  *  3WUVCPVÄPÄ[C <K[PGV2T·IWPI OKV DTGKVGO QTPCOGPVKGTVGP 4CPF  I   -/¤NEGT2GTGp )1.&*GPMGNURWTUGJTUEJÌP





 -WTWUJ  *  3WUVCPVÄPÄ[C <K[PGV2T·IWPI OKV DTGKVGO QTPCOGPVKGTVGP 4CPF  I   -/¤NEGT2GTGp )1.&8QT\ÒINKEJ



523



 -WTWUJ  *  3WUVCPVÄPÄ[C <K[PGV2T·IWPI OKV DTGKVGO QTPCOGPVKGTVGP 4CPF  I   -/¤NEGT2GTGp )1.&*GPMGNURWTUGJTUEJÌP

 97


'ABD AL-HAMÎD KHAN II.

524

525

526



 -WTWUJ  *  3WUVCPVÄPÄ[C <K[PGV2T·IWPI OKV DTGKVGO QTPCOGPVKGTVGP 4CPF  I   -/¤NEGT2GTGp )1.&-CWOUKEJVDCTG*GPMGNURWTUGJTUEJÌP





 -WTWUJ  *  3WUVCPVÄPÄ[C <K[PGV2T·IWPI OKV DTGKVGO QTPCOGPVKGTVGP 4CPF  I   -/¤NEGT2GTGp )1.&*GPMGNURWTUGJTUEJÌP





 -WTWUJ  *  3WUVCPVÄPÄ[C <K[PGV2T·IWPI OKV DTGKVGO QTPCOGPVKGTVGP 4CPF  I   -/¤NEGT2GTGp )1.&8QT\ÒINKEJp5VGORGNINCP\



527

528

529



 -WTWUJ  *  3WUVCPVÄPÄ[C <K[PGV2T·IWPI OKV DTGKVGO DGUEJTKHVGVGP 4CPF  I   -/¤NEGT2GTG )1.&*GPMGNURWTUGJTUEJÌP





 -WTWUJ  *  3WUVCPVÄPÄ[C <K[PGV2T·IWPI OKV DTGKVGO DGUEJTKHVGVGP 4CPF  I   -/¤NEGT2GTG )1.&4*GPMGNURWTIGUVQRHVGU.QEJUGJTUEJÌP





 -WTWUJ  *  3WUVCPVÄPÄ[C <K[PGV2T·IWPI OKV DTGKVGO DGUEJTKHVGVGP 4CPF  I   -/¤NEGT2GTG )1.&4*GPMGNURWTUGJTUEJÌP



98


'ABD AL-HAMÎD KHAN II.

530

531

532



 -WTWUJ  *  3WUVCPVÄPÄ[C <K[PGV2T·IWPI OKV DTGKVGO DGUEJTKHVGVGP 4CPF  I   -/¤NEGT2GTG )1.&4*GPMGNURWTXQT\ÒINKEJ





 -WTWUJ  *  3WUVCPVÄPÄ[C <K[PGV2T·IWPI OKV DTGKVGO DGUEJTKHVGVGP 4CPF  I   -/¤NEGT2GTG )1.&5GNVGPKPFKGUGT'TJCNVWPI8QT\ÒINKEJ





 -WTWUJ  *  3WUVCPVÄPÄ[C <K[PGV2T·IWPI OKV DTGKVGO DGUEJTKHVGVGP 4CPF  I   -/¤NEGT2GTG )1.&*GPMGNURWTUGJTUEJÌP



533

1,5:1



 -WTWUJ  *  3WUVCPVÄPÄ[C <K[PGV2T·IWPI OKV DTGKVGO DGUEJTKHVGVGP 4CPF  I   -/¤NEGT2GTG  )1.&5GJTUGNVGPDGUQPFGTUKPFKGUGT'TJCNVWPI(CUV5VGORGNINCP\

534



1,5:1

1,5:1



534

 -WTWUJ  *  3WUVCPVÄPÄ[C <K[PGV2T·IWPI OKV DTGKVGO DGUEJTKHVGVGP 4CPF  I   -/¤NEGT2GTGp  )1.&5GJTUGNVGPDGUQPFGTUKPFKGUGT'TJCNVWPI(CUV5VGORGNINCP\

 99


'ABD AL-HAMÎD KHAN II.

536

535



 -WTWUJ  *  3WUVCPVÄPÄ[C <K[PGV2T·IWPI OKV DTGKVGO DGUEJTKHVGVGP 4CPF  I   -/¤NEGT2GTGp )1.&4)GUVQRHVGU.QEJUGJTUEJÌP





 -WTWUJ  *  3WUVCPVÄPÄ[C <K[PGV2T·IWPI OKV DTGKVGO DGUEJTKHVGVGP 4CPF  I   -/¤NEGT2GTGp )1.&4)GUVQRHVGU.QEJUGJTUEJÌP



538

537



 -WTWUJ  *  3WUVCPVÄPÄ[C <K[PGV2T·IWPI OKV DTGKVGO DGUEJTKHVGVGP 4CPF  I   -/¤NEGT2GTGp )1.&4)GUVQRHVGU.QEJUGJTUEJÌPpXQT\ÒINKEJ





 -WTWUJ  *  3WUVCPVÄPÄ[C <K[PGV2T·IWPI OKV DTGKVGO DGUEJTKHVGVGP 4CPF  I   -/¤NEGT2GTGp )1.&4)GUVQRHVGU.QEJUGJTUEJÌPpXQT\ÒINKEJ



539

540



 -WTWUJ  *  3WUVCPVÄPÄ[C <K[PGV2T·IWPI OKV DTGKVGO DGUEJTKHVGVGP 4CPF  I   -/¤NEGT2GTGp )1.&4)GUVQRHVGU.QEJUGJTUEJÌP





 -WTWUJ  *  3WUVCPVÄPÄ[C <K[PGV2T·IWPI OKV DTGKVGO DGUEJTKHVGVGP 4CPF  I   -/¤NEGT2GTGp )1.&4-N*GPMGNURWTXQT\ÒINKEJ



541

1,5:1



100

1,5:1

 -WTWUJ  *  3WUVCPVÄPÄ[C <K[PGV2T·IWPI OKV DTGKVGO DGUEJTKHVGVGP 4CPF  I   -/¤NEGT2GTGp  )1.&5GJTUGNVGPKPFKGUGT'TJCNVWPI8QPRQNKGTVGP5VGORGNP5VGORGNINCP\




'ABD AL-HAMÎD KHAN II.

543

542



 -WTWUJ  *  3WUVCPVÄPÄ[C <K[PGV2T·IWPI OKV DTGKVGO DGUEJTKHVGVGP 4CPF  I   -/¤NEGT2GTGp )1.&4)GUVQRHVGU.QEJUGJTUEJÌP





 -WTWUJ  *  3WUVCPVÄPÄ[C <K[PGV2T·IWPI OKV DTGKVGO DGUEJTKHVGVGP 4CPF  I   -/¤NEGT2GTGp )1.&*GPMGNURWTUGJTUEJÌP



544 1,5:1



1,5:1

 -WTWUJ  *  3WUVCPVÄPÄ[C <K[PGV2T·IWPI OKV DTGKVGO DGUEJTKHVGVGP 4CPF  I   -/¤NEGT2GTGp )1.&5GNVGPKPFKGUGT'TJCNVWPI5VGORGNINCP\



546

ex 545



 -WTWUJ  *  WPF  3WUVCPVÄPÄ[C <K[PGV2T·IWPIGP OKV DTGKVGO DGUEJTKHVGVGP 4CPF    WPFI-/¤NEGTWPF2GTGp  5VÒEM)1.&,GYGKNUOKVIGUVQRHVGO.QEJUGJTUEJÌP





 -WTWUJ  *  WPF  3WUVCPVÄPÄ[C <K[PGV2T·IWPIGP OKV DTGKVGO DGUEJTKHVGVGP 4CPF    WPFI-/¤NEGTWPF2GTGp  )1.&&CUGTUVGOKV*GPMGNURWTFCU\YGKVGOKVIGUVQRHVGO.QEJUGJTUEJÌP



547 1,5:1



1,5:1

 -WTWUJ  *  3WUVCPVÄPÄ[C <K[PGV2T·IWPI OKV DTGKVGO DGUEJTKHVGVGP 4CPF  I   -/¤NEGT2GTGp )1.&5GNVGPKPFKGUGT'TJCNVWPI8QT\ÒINKEJp5VGORGNINCP\



548 1,5:1



1,5:1

 -WTWUJ  *  3WUVCPVÄPÄ[C <K[PGV2T·IWPI OKV DTGKVGO DGUEJTKHVGVGP 4CPF  I   -/¤NEGT2GTGp  )1.&5GNVGPKPFKGUGT'TJCNVWPI8QPRQNKGTVGP5VGORGNP5VGORGNINCP\

 101


'ABD AL-HAMÎD KHAN II.

550

ex 551

549



 -WTWUJ  *  3WUVCPVÄPÄ[C <K[PGV2T·IWPI OKV DTGKVGO DGUEJTKHVGVGP 4CPF  I   -/¤NEGT2GTGp )1.&4)GNQEJVHCUVXQT\ÒINKEJ





  -WTWUJ  *  3WUVCPVÄPÄ[C <K[PGV2T·IWPI OKV DTGKVGO XGT\KGTVGP 4CPF  I   -/¤NEGT2GTGp )1.&4)GUVQRHVGU.QEJUGJTUEJÌP





-WTWUJ*WPF3WUVCPVÄPÄ[C<K[PGV2T·IWPIOKVDTGKVGOXGT\KGTVGP4CPFWPF I(D-/¤NEGT2GTGp  5VÒEM)1.&4&CUGTUVGIGNQEJVFCU\YGKVGOKVIGUVQRHVGO.QEJUGJTUEJÌP



553

552

554

5KNDGTRT·IWPIGPFGT/ÒP\UV·VVG3WUVCPVÄPÄ[C 

 -WTWUJ  *  3WUVCPVÄPÄ[C /KV $NWOG PGDGP FGT 6WIJTC  I -/  ¤NEGT    2GTG -N5EJTÌVNKPIUHGJNGTCO4CPFHCUV5VGORGNINCP\





 -WTWUJ  *  3WUVCPVÄPÄ[C /KV $NWOG PGDGP FGT 6WIJTC  I -/  ¤NEGT    2GTG (CUV5VGORGNINCP\





 -WTWUJ  *  3WUVCPVÄPÄ[C /KV $NWOG PGDGP FGT 6WIJTC  I -/  ¤NEGT   2GTG 5GJTUEJÌPpXQT\ÒINKEJ



556

555

555



 -WTWUJ  *  3WUVCPVÄPÄ[C /KV $NWOG PGDGP FGT 6WIJTC  I -/  ¤NEGT    2GTG 5GJTUGNVGPGT,CJTICPI6WIJTCUEJYCEJCWUIGRT·IVUGJTUEJÌP





 -WTWUJ  *  3WUVCPVÄPÄ[C /KV $NWOG PGDGP FGT 6WIJTC  I -/  ¤NEGT    2GTG 5VGORGNINCP\



102


'ABD AL-HAMÎD KHAN II.

ex 557

558



-WTWUJ*WPF3WUVCPVÄPÄ[CCNIJ³\ÄPGDGPFGT6WIJTCWPFI-/ ¤NEGTWPF2GTG 5VÒEM&CUGTUVG5VÒEMUGNVGP5GJTUEJÌP





 -WTWUJ  *  3WUVCPVÄPÄ[C CNIJ³\Ä PGDGP FGT 6WIJTC  I -/  ¤NEGT    2GTG 45GJTUEJÌP



559

ex 560



 -WTWUJ  *  3WUVCPVÄPÄ[C CNIJ³\Ä PGDGP FGT 6WIJTC  I -/  ¤NEGT    2GTG 45GJTUEJÌP





-WTWUJ*WPF3WUVCPVÄPÄ[CCNIJ³\ÄPGDGPFGT6WIJTCWPFI-/ ¤NEGTWPF2GTG 5VÒEM5GJTUEJÌP



561

562

ex 563



 -WTWUJ  *  3WUVCPVÄPÄ[C /KV $NWOG PGDGP FGT 6WIJTC  I -/  ¤NEGT    2GTG 5GJTUGNVGPGT,CJTICPI5GJTUEJÌP





 -WTWUJ  *  3WUVCPVÄPÄ[C /KV $NWOG PGDGP FGT 6WIJTC  I -/  ¤NEGT    2GTG 5GJTUGNVGPGT,CJTICPI5GJTUEJÌP





-WTWUJ*WPF3WUVCPVÄPÄ[C/KV$NWOGPGDGPFGT6WIJTCWPFI-/¤NEGT WPF2GTG 5VÒEM47P\KTMWNKGTVWPFXQT\ÒINKEJ



ex 564





565

-WTWUJ*WPF3WUVCPVÄPÄ[CCNIJ³\ÄPGDGPFGT6WIJTC WPFI-/¤NEGTp2GTG  5VÒEM&KG,CJTGWPFUGJTUEJÌPFKGÒDTKIGPXQT\ÒINKEJWPF5VGORGNINCP\



 -WTWUJ  *  3WUVCPVÄPÄ[C CNIJ³\Ä PGDGP FGT 6WIJTC  I -/  ¤NEGT    2GTG 5GNVGPGT,CJTICPI5GJTUEJÌP

 103


'ABD AL-HAMÎD KHAN II.

567

ex 566



-WTWUJ*WPF3WUVCPVÄPÄ[CCNIJ³\ÄPGDGPFGT6WIJTCWPFI-/ ¤NEGTp2GTG  5VÒEM4,CJTOKV*GPMGNURWTWPFUGJTUEJÌPUGJTUEJÌPXQT\ÒINKEJ





 -WTWUJ  *  3WUVCPVÄPÄ[C CNIJ³\Ä PGDGP FGT 6WIJTC  I -/  ¤NEGT    2GTG 44*GPMGNURWTUGJTUEJÌP





 -WTWUJ  *  3WUVCPVÄPÄ[C CNIJ³\Ä PGDGP FGT 6WIJTC  I -/  ¤NEGT    2GTG 445GJTUEJÌP





 -WTWUJ  *     3WUVCPVÄPÄ[C CNIJ³\Ä PGDGP FGT 6WIJTC   WPF  I   -/¤NEGTWPF2GTG  5VÒEM'KP5VÒEMFGU,CJTGUUGJTUEJÌPFKG\YGKCPFGTGPXQT\ÒINKEJ



568

569

570

571



 -WTWUJ  *  3WUVCPVÄPÄ[C CNIJ³\Ä PGDGP FGT 6WIJTC  I -/  ¤NEGT    2GTG 5GJTUGNVGPGT,CJTICPI9KP\2TÒHURWTCO4CPFUGJTUEJÌP





 -WTWUJ  *  3WUVCPVÄPÄ[C CNIJ³\Ä PGDGP FGT 6WIJTC  I -/  ¤NEGT    2GTG 5GNVGPGT,CJTICPI5GJTUEJÌP



572

1,5:1

1,5:1



 -WTWUJ  *  3WUVCPVÄPÄ[C CNIJ³\Ä PGDGP FGT 6WIJTC  I -/  ¤NEGT    2GTG 5GJTUGNVGPGT,CJTICPI8QT\ÒINKEJ



 -WTWUJ  *  3WUVCPVÄPÄ[C CNIJ³\Ä PGDGP FGT 6WIJTC  I -/  ¤NEGT    2GTG 5GJTUGNVGPGT,CJTICPI*GPMGNURWTUGJTUEJÌP





-WTWUJ*WPF3WUVCPVÄPÄ[CCNIJ³\ÄPGDGPFGT6WIJTCWPF I-/¤NEGTp2GTG  5VÒEM,CJTWP\KTMWNKGTVFKGCPFGTGPFTGKXQT\ÒINKEJ



573

104



574


'ABD AL-HAMÎD KHAN II.

575

1,5:1



1,5:1

-WTWUJ*3WUVCPVÄPÄ[CCNIJ³\ÄPGDGPFGT6WIJTCI-/¤NEGT2GTG  5GJTUGNVGPGT,CJTICPI5GJTUEJÌP

1,5:1









578

-WTWUJ* 8CTKCPVGPOKVITQ­GOWPFOKVMNGKPGO4GIKGTWPIULCJT 3WUVCPVÄPÄ[CCN IJ³\ÄPGDGPFGT6WIJTCWPFI-/¤NEGTp2GTG  5VÒEM&CUGTUVGWP\KTMWNKGTVFKGCPFGTGPUGJTUEJÌPWPFXQT\ÒINKEJ



 -WTWUJ  *  3WUVCPVÄPÄ[C CNIJ³\Ä PGDGP FGT 6WIJTC  I -/  ¤NEGT    2GTG 5GJTUGNVGPGT,CJTICPI5GJTUEJÌP



ex 579



1,5:1

-WTWUJ*3WUVCPVÄPÄ[C/KV$NWOGPGDGPFGT6WIJTCI-/¤NEGT2GTGp 5GJTUGNVGPGT,CJTICPI5GJTUEJÌPpXQT\ÒINKEJ

ex 577



576



ex 580

-WTWUJ*WPF3WUVCPVÄPÄ[CCNIJ³\ÄPGDGPFGT6WIJTCWPFI-/ ¤NEGTp2GTG  5VÒEM&CU4GIKGTWPIULCJTUGNVGP8QT\ÒINKEJWP\KTMWNKGTVWPFUGJTUEJÌP



 -WTWUJ  *       5VÒEM  WPF  3WUVCPVÄPÄ[C CNIJ³\Ä PGDGP FGT 6WIJTC   WPFI-/¤NEGTp2GTG  5VÒEM&CU4GIKGTWPIULCJTUGNVGP &CUUGNVGPG,CJTUGJTUEJÌPFKGCPFGTGPXQT\ÒINKEJWPF5VGORGNINCP\



ex 581

ex 582



-WTWUJ*WPF3WUVCPVÄPÄ[CCNIJ³\ÄPGDGPFGT6WIJTCWPFI-/¤NEGT WPF2GTG 5VÒEM$GKFG,CJTI·PIGUGNVGP5VGORGNINCP\WPFUGJTUEJÌP





-WTWUJ*WPF3WUVCPVÄPÄ[CCNIJ³\ÄPGDGPFGT6WIJTC WPFI-/¤NEGTp2GTG  5VÒEM/GKUV5VGORGNINCP\GKPKIGXQT\ÒINKEJ

 105


'ABD AL-HAMÎD KHAN II.

583

1,5:1



1,5:1

-WTWUJ*3WUVCPVÄPÄ[CCNIJ³\ÄPGDGPFGT6WIJTCI-/¤NEGT2GTG  5GJTUGNVGPGT,CJTICPI5GJTUEJÌP

584

1,5:1



1,5:1



-WTWUJ*3WUVCPVÄPÄ[C/KV$NWOGPGDGPFGT6WIJTCI-/¤NEGT2GTGp 448QT\ÒINKEJ



-WTWUJ*3WUVCPVÄPÄ[C/KV$NWOGPGDGPFGT6WIJTCI-/¤NEGT2GTGp 44)GUVQRHVGU.QEJUGJTUEJÌP



585

586

1,5:1





1,5:1

-WTWUJ*3WUVCPVÄPÄ[C/KV$NWOGPGDGPFGT6WIJTCI-/¤NEGT2GTGp 445VGORGNINCP\

ex 587

ex 588



589



590

-WTWUJ*WPF3WUVCPVÄPÄ[CCNIJ³\ÄPGDGPFGT6WIJTC WPFI-/¤NEGTp2GTG  5VÒEM&CUUGNVGPGTG,CJTUGJTUEJÌPCPUQPUVGPXQT\ÒINKEJWPF5VGORGNINCP\



-WTWUJ*WPF3WUVCPVÄPÄ[CCNIJ³\ÄPGDGPFGT6WIJTC WPFI-/¤NEGTp2GTG  5VÒEM&KG,CJTGWPFUGJTUEJÌPCPUQPUVGPOGKUV5VGORGNINCP\





-WTWUJ*3WUVCPVÄPÄ[CCNIJ³\ÄPGDGPFGT6WIJTCI-/¤NEGT2GTG 5GNVGPGT,CJTICPI-N4CPFHGJNGTUGJTUEJÌP





2CTC -WTWUJ *3WUVCPVÄPÄ[C/KV$NWOGPGDGPFGT6WIJTCI-/¤NEGT 2GTG 5GJTUEJÌP





1,5:1

 106

591

1,5:1

2CTC -WTWUJ *3WUVCPVÄPÄ[C/KV$NWOGPGDGPFGT6WIJTCI-/¤NEGT 2GTG 5GJTUGNVGPGT,CJTICPI8QT\ÒINKEJ




'ABD AL-HAMÎD KHAN II.

592

ex 594

ex 593



 2CTC  -WTWUJ   *  3WUVCPVÄPÄ[C CNIJ³\Ä PGDGP FGT 6WIJTC  I -/  ¤NEGT   2GTG 5VGORGNINCP\





2CTC $KNNQP *WPF3WUVCPVÄPÄ[CCNIJ³\ÄPGDGPFGT6WIJTC WPFI-/¤NEGTp2GTG 5VÒEM5GJTUEJÌPDKU5VGORGNINCP\





2CTC $KNNQP *WPF3WUVCPVÄPÄ[CCNIJ³\ÄPGDGPFGT6WIJTC WPFI-/¤NEGTp2GTG  5VÒEM,CJTUGJTUEJÌPUQPUVXQT\ÒINKEJWPF5VGORGNINCP\



595

1,5:1

1,5:1

-WRHGTRT·IWPIGPFGT/ÒP\UV·VVG3WUVCPVÄPÄ[C 

2CTC -WRHGT *3WUVCPVÄPÄ[C/KV$NWOGPGDGPFGT6WIJTCI-/¤NEGT 2GTG 8QPITQ­GT5GNVGPJGKV8QT\ÒINKEJ



ex 596



 2CTC -WRHGT   *  WPF  3WUVCPVÄPÄ[C /KV $NWOG PGDGP FGT 6WIJTC  WPF  I   -/¤NEGTWPF2GTG 5VÒEM8QT\ÒINKEJWPF5VGORGNINCP\



597

1,5:1

1,5:1

)QNFRT·IWPIGPFGT/ÒP\UV·VVG/KUT -CKTQ  

-WTWUJ*/KUT -CKTQ /KV$NWOGPGDGPFGT6WIJTCI(D-/¤NEGT 2GTG )1.&8QPITQ­GT5GNVGPJGKV$TQUEJKGTURWTGPHCUVXQT\ÒINKEJ



'ZGORNCTFGT5COONWPI6WTCVJ2CTV++5RKPM.QPFQP0T

107


'ABD AL-HAMÎD KHAN II.

598

1,5:1



1,5:1

-WTWUJ*/KUT -CKTQ /KV$NWOGPGDGPFGT6WIJTCI(DC-/¤NEGT 2GTG )1.&8QPCNNGTITÌ­VGT5GNVGPJGKVPWTDKU'ZGORNCTGIGRT·IV 'VYCUDGTKGDGPXQT\ÒINKEJ



'ZGORNCTFGT5COONWPI-ÌPKI(CTQWMXQPI[RVGP#WMVKQP5QVJGD[ %Q-CKTQ0T

599

1,5:1



1,5:1

 -WTWUJ  *  /KUT -CKTQ  /KV$NWOGPGDGPFGT6WIJTCI(D-/¤NEGT 2GTGp )1.&448QT\ÒINKEJp5VGORGNINCP\



600

1,5:1



108

1,5:1

 -WTWUJ  *  /KUT -CKTQ  /KV$NWOGPGDGPFGT6WIJTCI(D-/¤NEGT 2GTGp )1.&448QT\ÒINKEJp5VGORGNINCP\




'ABD AL-HAMÎD KHAN II.

601



-WTWUJ*/KUT $KTOKPIJCO /KV$NWOGPGDGPFGT6WIJTCKP'KPHCUUWPICWU.QVWUDNÒ VGPI(D-/¤NEGT2GTG )1.&5VGORGNINCP\

602

1,5:1



601

1,5:1

1,5:1

-WTWUJ*/KUT -CKTQ /KV$NWOGPGDGPFGT6WIJTCI(D-/#¤NEGT 2GTGp )1.&44*GPMGNURWTUGJTUEJÌP

604

603





606

605



 -WTWUJ  *  /KUT -CKTQ  CN)J³\Ä PGDGP FGT 6WIJTC  I (D C -/  ¤NEGT   2GTG )1.&8QT\ÒINKEJ





 -WTWUJ  *  /KUT -CKTQ  CN)J³\Ä PGDGP FGT 6WIJTC  I (D C -/  ¤NEGT   2GTG )1.&8QT\ÒINKEJ





 -WTWUJ  *  /KUT -CKTQ  /KV $NWOG PGDGP FGT 6WIJTC  I (D  -/  ¤NEGT   2GTGp )1.&448QT\ÒINKEJ





 -WTWUJ  *  /KUT -CKTQ  /KV $NWOG PGDGP FGT 6WIJTC  I (D  -/  ¤NEGT   2GTGp )1.&5VGORGNINCP\



607

608

609

1,5:1

1,5:1



 -WTWUJ  *  /KUT -CKTQ  /KV $NWOG PGDGP FGT 6WIJTC  I (D  -/  ¤NEGT   2GTGp )1.&45VGORGNINCP\





 -WTWUJ  *  /KUT -CKTQ  /KV $NWOG PGDGP FGT 6WIJTC  I (D  -/  ¤NEGT   2GTGp )1.&45VGORGNINCP\





 -WTWUJ  *  /KUT -CKTQ  /KV $NWOG PGDGP FGT 6WIJTC  I (D  -/  ¤NEGT   2GTGp )1.&8QT\ÒINKEJ



1,5:1



610

1,5:1

-WTWUJ*/KUT -CKTQ CN)J³\ÄPGDGPFGT6WIJTC/ÒP\UV·VVGPCPICDGKP.QVWU\YGKIGP I(DC-/#¤NEGTC2GTGp )1.&5GJTUGNVGPG8CTKCPVG8QT\ÒINKEJ

 109


'ABD AL-HAMÎD KHAN II.

ex 611

ex 612



-WTWUJ*WPF/KUT -CKTQ CN)J³\ÄPGDGPFGT6WIJTCWPFI(DC-/ ¤NEGTWPF2GTG 5VÒEM)1.&8QT\ÒINKEJ





-WTWUJ*WPF/KUT -CKTQ CN)J³\ÄPGDGPFGT6WIJTCWPFI(DC-/ ¤NEGTWPF2GTG 5VÒEM)1.&8QT\ÒINKEJ



ex 613

614

615

5KNDGTRT·IWPIGPFGT/ÒP\UV·VVG/KUT -CKTQ  

-WTWUJ*WPF/KUT -CKTQ IGRT·IVKP$TÒUUGN/\\9/KV$NWOGPGDGPFGT6WI JTCWPFI-/¤NEGTWPF2GTG  5VÒEM5GJTUEJÌP WPFDGTKGDGPUGJTUEJÌP





 -WTWUJ  *  /KUT -CKTQ  IGRT·IV KP $TÒUUGN /\\ 9 /KV $NWOG PGDGP FGT 6WIJTC   I-/¤NEGT2GTG  5GJTUGNVGPDGUQPFGTUKPFKGUGT'TJCNVWPI(CUV5VGORGNINCP\HGKPG6ÌPWPI 



 -WTWUJ  *  /KUT -CKTQ  IGRT·IV KP $TÒUUGN /\\ 9 /KV $NWOG PGDGP FGT 6WIJTC   I-/¤NEGT2GTG 5GNVGPDGUQPFGTUKPFKGUGT'TJCNVWPI(CUV5VGORGNINCP\



'ZGORNCTFGT#WMVKQP*GTKVCIG5GRVGODGT0T

ex 616



110

 -WTWUJ  *    WPF/KUT -CKTQ IGRT·IVKP$TÒUUGN/\\9/KV$NWOG PGDGPFGT6WIJTCWPFI-/¤NEGTp2GTG  5VÒEM5EJÌPWPFUGJTUEJÌP




'ABD AL-HAMÎD KHAN II.

ex 617



619

ex 618

-WTWUJ*WPF/KUT -CKTQ WPFIGRT·IVKP$TÒUUGN/\\9WPF KP $KTOKPIJCO / /KV $NWOG PGDGP FGT 6WIJTC    WPF  I -/  ¤NEGT   p2GTG 5VÒEM5GJTUEJÌP





-WTWUJ*WPF/KUT -CKTQ IGRT·IVKP$KTOKPIJCO/\\*/KV$NWOGPGDGP FGT6WIJTCWPFI-/¤NEGTp2GTG 5VÒEM5GJTUEJÌP





 -WTWUJ  *  /KUT -CKTQ  IGRT·IV KP $TÒUUGN /\\ 9 /KV $NWOG PGDGP FGT 6WIJTC   I-/¤NEGT2GTG 5VGORGNINCP\



ex 620





ex 621

ex 622

 -WTWUJ  *     WPF  /KUT -CKTQ  IGRT·IV KP $TÒUUGN /\\9/KV$NWOG PGDGPFGT6WIJTCWPFI-/¤NEGTp2GTG  5VÒEM,CJTXQT\ÒINKEJXQT\ÒINKEJp5VGORGNINCP\ UQPUVUGJTUEJÌPGKPKIGOKVMNGKPGP4CPFUEJN·IGP



 -WTWUJ  *     WPF   'Z  /KUT -CKTQ  IGRT·IV KP $TÒUUGN /\\ 9   /KV $NWOG PGDGP FGT 6WIJTC      WPF  I -/  ¤NEGT   p2GTG 5VÒEM$GKFG'ZGORNCTGFGU,CJTGUXQT\ÒINKEJUQPUVUGJTUEJÌP



'KPGUFGTDGKFGP'ZGORNCTGXQO,CJTVT·IVOKVHGKPGT(GFGTKPFGP5VGORGNINCP\IGMTCV\VGKP)TCHHKVQKPCOGTK MCPKUEJGT*CPFUEJTKHVFGUHTÒJGP,CJTJWPFGTVUOGJTHCEJ.WE[/QPTQG5QWVJ*CXGP7PKVGF5VCVGU



 -WTWUJ  *     WPF  /KUT -CKTQ  IGRT·IV KP $KTOKPIJCO /\\ *   /KV $NWOG PGDGP FGT 6WIJTC     WPF  I -/  ¤NEGT p   2GTG 5VÒEM,CJTOKV(GWGTXGTIQNFWPIUpWPF*GPMGNURWT ,CJT*GPMGNURWTUQPUVCNNGUGJTUEJÌP

 111


'ABD AL-HAMÎD KHAN II.

ex 623





ex 624

 -WTWUJ  *       WPF  /KUT -CKTQ  IGRT·IV KP $TÒUUGN /\\ 9   /KV$NWOGPGDGPFGT6WIJTCWPFI-/¤NEGTp 2GTG 5VÒEM5GJTUEJÌPWPFXQT\ÒINKEJ



-WTWUJ* 1TKIKPCN\GKVIGP(·NUEJWPIKP-WRHGTPKEMGN WPF/KUT -CKTQ  IGRT·IVKP$TÒUUGN/\\9/KV$NWOGPGDGPFGT6WIJTCWPFI-/ ¤NEGTp2GTG 5VÒEM5GJTUEJÌP



ex 626

ex 627

ex 625







-WTWUJ*WPF/KUT -CKTQ IGRT·IVKP$KTOKPIJCO/\\*/KV$NWOG PGDGPFGT6WIJTCWPFI-/¤NEGTp2GTG  5VÒEM5GJTUEJÌP



-WTWUJ* 9WPF* WPF/KUT -CKTQ IGRT·IVKP$TÒU UGN/\\9CD,CJTKP$KTOKPIJCO/\\*/KV$NWOGPGDGPFGT6WIJTC WPFI-/¤NEGTp2GTG  5VÒEM,CJTXQT\ÒINKEJ5VGORGNINCP\UQPUVUGJTUEJÌP



3KTUJ -WTWUJ *WPF/KUT -CKTQ /KV$NWOGPGDGPFGT6WIJTC WPFI-/¤NEGTp2GTG 5VÒEM5GJTUEJÌPWPFXQT\ÒINKEJ



ex 628







ex 625

ex 629

ex 630

3KTUJ -WTWUJ *WPF/KUT -CKTQ IGRT·IVKP$TÒUUGN/\\9/KV$NWOG PGDGPFGT6WIJTCWPFI-/¤NEGTp2GTG  5VÒEM,CJTUGJTUEJÌPCNNGCPFGTGPXQT\ÒINKEJp5VGORGNINCP\



3KTUJ -WTWUJ * 'ZGORNCTG /KUT -CKTQ IGRT·IVKP$KTOKPIJCO/\\*/KV $NWOGPGDGPFGT6WIJTCWPFI-/¤NEGTWPF2GTG  5VÒEM,CJTUGJTUEJÌP,CJT5VGORGNINCP\



 2CTC  *   WPF  /KUT -CKTQ  /KV $NWOG PGDGP FGT 6WIJTC   WPF  I   -/¤NEGTp2GTG 5VÒEM45GJTUEJÌPWPFXQT\ÒINKEJ



631

632

633



2CTC*/KUT -CKTQ /KV$NWOGPGDGPFGT6WIJTCI-/¤NEGT2GTGp 45GJTUEJÌP





2CTC*/KUT -CKTQ /KV$NWOGPGDGPFGT6WIJTCI-/¤NEGT2GTGp 44(CUVXQT\ÒINKEJ





2CTC*/KUT -CKTQ /KV$NWOGPGDGPFGT6WIJTCI-/¤NEGT2GTGp 45GJTUEJÌPpXQT\ÒINKEJ



112


'ABD AL-HAMÎD KHAN II.

ex 635

ex 634

$KNNQPRT·IWPIGPFGT/ÒP\UV·VVG/KUT -CKTQ  



3KTUJ -WTWUJ *WPF/KUT -CKTQ IGRT·IVKP$KTOKPIJCOPWT FCU NGV\VG OKV /\\ * /KV $NWOG PGDGP FGT 6WIJTC       WPF  I   -/¤NEGTp2GTG 5VÒEM,CJT5VGORGNINCP\UQPUVUGJTUEJÌP



3KTUJ *CNDGT-WTWUJ *WPF/KUT -CKTQ  IGRT·IV KP $KTOKPIJCO PWT FCU NGV\VG OKV /\\ * /KV $NWOG PGDGP FGT 6WIJTC      WPFI-/¤NEGTp2GTG  5VÒEM,CJT5VGORGNINCP\XQT\ÒINKEJUQPUVUGJTUEJÌP



ex 637

ex 636









ex 638

ex 639

3KTUJ*WPF/KUT -CKTQ IGRT·IVKP$KTOKPIJCO PWT,OKV/\\*/KV$NWOGPGDGPFGT6WIJTC WPFI-/¤NEGTpp2GTGp  5VÒEM,CJTGWPFXQT\ÒINKEJUQPUVUGJTUEJÌP



3KTUJ 2CTC *WPF /KUT -CKTQ IGRT·IVKP$KTOKPIJCOPWT,OKV/\\*/KV$NWOGPGDGPFGT6WIJTC WPFI -/¤NEGTp2GTGp  5VÒEM,CJTGWPFXQT\ÒINKEJQFGTDGUUGTUQPUVUGJTUEJÌP



3KTUJ*WPF/KUT -CKTQ IGRT·IVKP $KTOKPIJCOPWT,OKV/\\*/KV$NWOGPGDGPFGT6WIJTC WPFI-/¤NEGTp2GTG  5VÒEM,CJTGWPFXQT\ÒINKEJUQPUVUGJTUEJÌP



3KTUJ 2CTC *WPF/KUT -CKTQ IGRT·IVKP $KTOKPIJCO PWT ,  OKV /\\ * /KV $NWOG PGDGP FGT 6WIJTC        WPFI-/¤NEGTp2GTG  5VÒEM,CJTGWPFXQT\ÒINKEJUQPUVUGJTUEJÌP



640

641

)QNFRT·IWPIGPFGT/ÒP\UV·VVG6ÑPKU 

 4K[CN  * 6ÑPKU /KV 0COGP FGU /WJCOOCF CU5³FKS  I (D (GPKPC-/ ¤NEGT )1.&8QT\ÒINKEJ





 4K[CN  * 6ÑPKU /KV 0COGP FGU /WJCOOCF CU5³FKS  I (D (GPKPC-/ ¤NEGT )1.&.GKEJVG(CUUWPIUURWTGPHCUVXQT\ÒINKEJ

 113


'ABD AL-HAMÎD KHAN II.

642

643



 4K[CN  * 6ÑPKU /KV 0COGP FGU /WJCOOCF CU5CFKS  I (D (GPKPC-/ ¤NEGT )1.&5GJTUEJÌP





 4K[CN  * 6ÑPKU /KV 0COGP FGU /WJCOOCF CU5³FKS  I (D (GPKPC-/ ¤NEGT )1.&5GJTUEJÌP



644

1,5:1



1,5:1

4K[CN*6ÑPKU/KVCNNGKPKIGO0COGPFGU/WJCOOCFCU5³FKS$C[PCEJ'TTKEJVWPIFGUHTCP \ÌUKUEJGP2TQVGMVQTCVUI(GPKPC-/¤NEGTp )1.&45VGORGNINCP\

645

646



647

5KNDGTRT·IWPIGPFGT/ÒP\UV·VVG6ÑPKU 

4K[CN*6ÑPKU/KV/WJCOOCFCU5³FKS$C[XQP6ÑPKUI(GPKPC-/ ¤NEGT2GTGp 45GJTUEJÌPpXQT\ÒINKEJ





 4K[CN  * 6ÑPKU FGU #DF CN #\Ä\ OKV )GIGPUVGORGN 5VGTP XQP  * #&   /KV/WJCOOCFCU5³FKS$C[XQP6ÑPKUI(GPKPC-/¤NEGTXIN

*  5GJTUEJÌP



 4K[CN  * 6ÑPKU FGU #DF CN #\Ä\ OKV )GIGPUVGORGN 5VGTP XQP  * #&   /KV/WJCOOCFCU5³FKS$C[XQP6ÑPKUI(GPKPC-/¤NEGT  5GJTUEJÌPpXQT\ÒINKEJ





114


'ABD AL-HAMÎD KHAN II.

648



649

650

 4K[CN  * 6ÑPKU FGU #DF CN #\Ä\ OKV )GIGPUVGORGN 5VGTP XQP  * #&   /KV/WJCOOCFCU5³FKS$C[XQP6ÑPKUI(GPKPC-/¤NEGT  5GJTUEJÌP





 4K[CN  * 6ÑPKU OKV )GIGPUVGORGN 5VGTP XQP  * #& /KV /WJCOOCF CU5³FKS   $C[XQP6ÑPKUI(GPKPC-/-/¤NEGT 5GJTUEJÌP





4K[CN*6ÑPKUOKV)GIGPUVGORGN5VGTPXQP*#&/KV6KVGNCNIJ³\ÄHÒTFGP5WNVCP WPF/WJCOOCFCU5³FKS$C[XQP6ÑPKUI(GPKPCC-/¤NEGT  5GJTUEJÌP



651



4K[CN  * 6ÑPKU /KV 6KVGN CNIJ³\Ä HÒT FGP 5WNVCP WPF /WJCOOCF CU5³FKS $C[ XQP 6ÑPKU   I(GPKPC-/¤NEGT 45GJTUEJÌP

652

653



654



-JCTTWDC*6ÑPKU/KV6KVGNCNIJ³\ÄHÒTFGP5WNVCPWPF/WJCOOCFCU5³FKS$C[XQP6ÑPKU I(GPKPC-/¤NEGT 45GJTUEJÌP





-JCTTWDC 4K[CN *6ÑPKU/KV6KVGNCNIJ³\ÄHÒTFGP5WNVCPWPF/WJCOOCFCU5³FKS$C[ XQP6ÑPKUI(GPKPC-/¤NEGT 45GJTUEJÌP





-JCTTWDC 4K[CN *6ÑPKU/KV6KVGNCNIJ³\ÄHÒTFGP5WNVCPWPF/WJCOOCFCU5³FKS$C[ XQP6ÑPKUI(GPKPC-/¤NEGT 48QT\ÒINKEJ



655

656



-JCTTWDC 4K[CN *6ÑPKU/KV6KVGNCNIJ³\ÄHÒTFGP5WNVCPWPF/WJCOOCFCU5³FKS$C[ XQP6ÑPKUI(GPKPC-/¤NEGT 45GJTUEJÌP





-JCTTWDC 4K[CN *6ÑPKU/KV #NÄ$³[$C[XQP6ÑPKUI(GPKPC -/¤NEGTp 45VGORGNINCP\

 115


MUHAMMAD V.

/7*#//#&8)'0#0064#5*#& 6ª4-'+6ª4-+5%*/'*/'684'5#6  4#$œʼn++4#/#&Œ0* #24+.,7.+

0CEJFGT#DUGV\WPI #DFCN*COKFU++UGV\VGPFKG,WPIVÒTMGPFGUUGPCO0QXGODGTIGDQTGPGP $TWFGT/WJCOOCF8CNU0CEJHQNIGTFWTEJ&KGUGTJCVVGFKGNCPIG4GIKGTWPIU\GKV #DFCN*COKFUWPVGT *CWUCTTGUV\WDTKPIGPOÒUUGP'TICNVCNUDGNGUGPCDGTYGPKIYGNVIGYCPFV5GKPGGTUVG#WHICDGDGUVCPF FCTKPFKGXQPFGP,WPIVÒTMGPIGHQTFGTVG8GTHCUUWPIXQPYKGFGT\WT)GNVWPI\WDTKPIGP&GTGTUVGP (TGWFG HQNIVG DCNF FKG 'TPÒEJVGTWPI \WOCN FGO PWP FKG 1DGTJCPF IGYKPPGPFGP VÒTMKUEJG 0CVKQPCNKU   OWU FKG KPVGITCVKXG -TCHV IGIGPÒDGT /KPFGTJGKVGP CWH FGO $CNMCP HGJNVG YQ \WFGO UGRCTCVKUVKUEJG   $GUVTGDWPIGP XQP 5GTDKGP $WNICTKGP WPF )TKGEJGPNCPF WPVGTUVÒV\V YWTFGP &KG #PPCJOG FGT ,WPI   VÒTMGP FCUU FKG &WTEJUGV\WPI FGT 8GTHCUUWPI XQP FGP GWTQR·KUEJGP 0CEJDCTP CNU NGIKVKOKGTGPFGU   'NGOGPVYCJTIGPQOOGPYÒTFGGTYKGUUKEJCNUPCKX¤UVGTTGKEJCPPGMVKGTVG$QUPKGP*GT\GIQYKPC &TGK,CJTGUR·VGTPWV\VG+VCNKGPFKG5KVWCVKQPCWUWO6TKRQNKVCPKGP\WDGUGV\GP  /WJCOOCF 8 JCV \YCT PKG FKG /CEJVHÒNNG UGKPGU $TWFGTU WPF 8QTI·PIGTU IGJCDV CDGT GT \GKIVG GKP   GTJGDNKEJGURGTUÌPNKEJGU'PICIGOGPVKPFGOGTCO,WPKGKPG4GKUGKPFKG<GPVTGPFGTIGH·JTFGVGP )GDKGVG5CNQPKMKWPF-QUQXQCPVTCVWOFKGCNVGPFKG0CVKQPGPXGTGKPKIGPFGP9GTVGFGU1UOCPGPVWOU \WUV·TMGP8QPDGUQPFGTGOPWOKUOCVKUEJGP+PVGTGUUGKUVFKGUGRQNKVKUEJDGFGWVUCOG4GKUGYGKNFWTEJ 5QPFGTOÒP\GP KP FGPGP FKG YKEJVKIUVGP 4GKUG\KGNG 5GN³PÄM5CNQPKMK /CP³UVKT WPF -QUQXQ CNU   /ÒP\UV·VVGPCPUVGNNGXQP-QPUVCPVKPQRGNCPIGIGDGPYWTFGPWOFGPFGHCEVQPKEJVOGJTGZKUVKGTGPFGP 4GIKQPCNKUOWUFGU4GKEJGUPQEJGKPOCNYKGFGTGTUVGJGP\WNCUUGP6TQV\DGYGIGPFGT/QOGPVGGVYCFCU 6TGHHGPOKVQTVJQFQZGP0CEJMQOOGPLGPGU'XTGPQUFGTKO,CJTJWPFGTVGPVUEJGKFGPFOKVIGJQNHGP JCVVGFCU1UOCPKUEJG4GKEJCWH\WDCWGPWPFRTQRCICPFKUVKUEJGT$GOÒJWPIGPYKG(KNOCWHPCJOGPYCT FGO7PVGTPGJOGPMGKP'THQNIDGUEJKGFGP0CEJFGO+VCNKGPQJPGITQ­G)GIGPYGJTFGU1UOCPKUEJGP 4GKEJGU OKV 6TKRQNKVCPKGP WPF %[TGPCKEC FKG NGV\VGP PQTFCHTKMCPKUEJGP $GUKV\WPIGP GTQDGTVG WPF ITQ­G   6GKNGFGU;GOGPXGTNQTGPIGICPIGPYCTGPYGEJUGNVGFKG5VKOOWPIIGIGPFKG,WPIVÒTMGP\WIWPUVGPFGT NKDGTCNGP'PINCPFWPF(TCPMTGKEJ\WIGYCPFVGP(TGKJGKVUWPF'KPKIMGKVURCTVGK  116


MUHAMMAD V. 9GIGPFKGUGT8GTUEJKGDWPIFGT-T·HVGMCOFGP#WHUV·PFKUEJGPCWHFGO$CNMCPFWTEJTWUUKUEJG&KRNQ OCVKGGKP$ÒPFPKUCNNGTPKEJVQUOCPKUEJGP$CNMCPUVCCVGP\WT*KNHGFCUKO$CNMCPMTKGIITQ­G6GKNGFGT GWTQR·KUEJGP6ÒTMGKKPUGRCTCVGP5VCCVGPQFGT\WIWPUVGP)TKGEJGPNCPFUCDURCNVGPMQPPVG+O(QNIGLCJT ICDFKG7PGKPKIMGKVFGT$CNMCPUVCCVGPKO$CNMCPMTKGIFGO1UOCPKUEJGP4GKEJFKG)GNGIGPJGKVGKPKIG UGKPGTGWTQR·KUEJGP-GTPIGDKGVGYKGFKGCNVG*CWRVUVCFV'FKTPG\WTÒEM\WIGYKPPGP7PVGTFGUUGPJCVVGGKPG )TWRRG XQP PCVKQPCNKUVKUEJ WPF CPVKFGOQMTCVKUEJ IGUQPPGPGP ,WPIVÒTMGP OKV GPIGP $G\KGJWPIGP \WO   &GWVUEJGP4GKEJYKG'PXGTWPF6CNCV2CUEJCFKG*GTTUEJCHVCPUKEJIGTKUUGPWPFFKG8GTHCUUWPICW­GT -TCHVIGUGV\VWOGKPGPGWG8GTHCUUWPIXQT\WDGTGKVGPFKGCDGTYGIGPFGUDCNFCWUDTGEJGPFGP+9GNVMTKG IGU PWT KP 6GKNGP WOIGUGV\V YWTFG +OOGTJKP YCT FKG YGKVIGJGPFG'OCP\KRCVKQPFGT(TCWGPWPFKJTG $KNFWPIUEJCPEGP6GKNFGUWOIGUGV\VGP2TQITCOOU  &GT+9GNVMTKGIYWTFGXQPFGPLWPIVÒTMKUEJGP(ÒJTGTPFGU1UOCPGPUVCCVGUCNU/ÌINKEJMGKVXGTUVCPFGP FKGGTFTÒEMGPFGHTCP\ÌUKUEJGWPFDTKVKUEJG9KTVUEJCHVUOCEJVCD\WUEJÒVVGNP&GPPQEJIKPIGPUKGPKEJVOKV $GIGKUVGTWPIKPFGP-TKGIFGUUGPXKGNG(TQPVGPQHHGPUKEJVNKEJG2TQDNGOGDTKPIGPUQNNVGP&GT$GKVTCIFGU 5WNVCPUDNKGDIGOGKPUCOOKVFGO5JC[MJCN+UNCOCWHFKG'TMN·TWPIFGU,KJCFDGUEJT·PMV&GT0CVKQPC NKUOWU FGT LWPIVÒTMKUEJGP (ÒJTGT UVGNNVG FKG -TKGIHÒJTWPI KP TGKP CTCDKUEJGT 7OIGDWPI XQT WPNÌUDCTG   #WHICDGP WPF DTCEJVG FGP #TOGPKGTP KP #PCVQNKGP 8GTVTGKDWPI WPF 6QF &CU ÒDGTYKGIGPF VÒTMKUEJG   -GTPNCPFMQPPVGXQP$GUGV\WPIGPXGTUEJQPVDNGKDGPFQEJOKVFGPCPFGTGP/KVVGNO·EJVGPIGOGKPUCOIKPI FGT -TKGI OKV FGO 9CHHGPUVKNNUVCPF XQO  1MVQDGT  XGTNQTGP /WJCOOCF 8 GTNGDVG FCU 'PFG   PKEJVUQPFGTPUVCTDCO,WNK  

657

1,5:1

1,5:1

)QNFRT·IWPIGPFGT/ÒP\UV·VVG3WUVCPVÄPÄ[C 

-WTWUJ*3WUVCPVÄPÄ[C4CUJ³FPGDGPFGT6WIJTCI(D-/¤NEGT 2GTG )1.&8QT\ÒINKEJp5VGORGNINCP\



658



-WTWUJ*3WUVCPVÄPÄ[C4CUJ³FPGDGPFGT6WIJTCI(D-/¤NEGT 2GTG )1.&8QT\ÒINKEJ



659



-WTWUJ*3WUVCPVÄPÄ[C4CUJ³FPGDGPFGT6WIJTCI(D-/¤NEGT 2GTG )1.&*GPMGNURWTUGJTUEJÌP

 117


MUHAMMAD V.

660

1,5:1

1,5:1



 -WTWUJ  *  3WUVCPVÄPÄ[C CN)J³\Ä PGDGP FGT 6WIJTC  I (D  -/  ¤NEGT   2GTG )1.&8QPITÌ­VGT5GNVGPJGKVPWT'ZGORNCTGIGRT·IV 5VCTMDGTKGDGPWPFPCEJIGT·PFGNVUGJTUEJÌP 

661

1,5:1



1,5:1

 -WTWUJ  *  3WUVCPVÄPÄ[C CN)J³\Ä PGDGP FGT 6WIJTC  I (D  -/  ¤NEGT   2GTG )1.&8QPITQ­GT5GNVGPJGKVPWT'ZGORNCTGIGRT·IV -N$TQUEJKGTURWTGPUGJTUEJÌPpXQT\ÒINKEJ 

662

663



-WTWUJ*3WUVCPVÄPÄ[C4GUJ³FPGDGPFGT6WIJTCI(D-/¤NEGT 2GTG )1.&5VGORGNINCP\





-WTWUJ*3WUVCPVÄPÄ[C4GUJ³FPGDGPFGT6WIJTCI(D-/¤NEGT 2GTG )1.&-N*GPMGNURWTUGJTUEJÌP



118


MUHAMMAD V.

664

665



-WTWUJ*3WUVCPVÄPÄ[C4GUJ³FPGDGPFGT6WIJTCI(D-/¤NEGT 2GTG )1.&8QT\ÒINKEJ





 -WTWUJ  *  3WUVCPVÄPÄ[C 4GUJ³F PGDGP FGT 6WIJTC  I (D  -/  ¤NEGT p   2GTG )1.&48QT\ÒINKEJ



667

666



-WTWUJ*3WUVCPVÄPÄ[C4GUJ³FPGDGPFGT6WIJTCI(D-/¤NEGT 2GTG )1.&-N-TCV\GTUGJTUEJÌP





-WTWUJ*3WUVCPVÄPÄ[C4GUJ³FPGDGPFGT6WIJTCI(D-/¤NEGT 2GTG )1.&.GKEJVGTNCPIGT-TCV\GTHCUV5VGORGNINCP\



668

1,5:1



1,5:1

 -WTWUJ  *  3WUVCPVÄPÄ[C CN)J³\Ä PGDGP FGT 6WIJTC  I (D  -/  ¤NEGT   2GTG )1.&5GNVGPKPFKGUGT'TJCNVWPI8QPRQNKGTVGP5VGORGNP5VGORGNINCP\ 

669

1,5:1



1,5:1

 -WTWUJ  *  3WUVCPVÄPÄ[C CN)J³\Ä PGDGP FGT 6WIJTC  I (D  -/  ¤NEGT   2GTG )1.&8QPITQ­GT5GNVGPJGKVPWT'ZGORNCTGIGRT·IV -CWOUKEJVDCTG*GPMGNURWTPCEJXGTIQNFGVUGJTUEJÌP  119


MUHAMMAD V.

670

1,5:1



1,5:1

 -WTWUJ  *  3WUVCPVÄPÄ[C CN)J³\Ä PGDGP FGT 6WIJTC  I (D  -/  ¤NEGT   2GTG )1.&8QPITQ­GT5GNVGPJGKVPWT'ZGORNCTGIGRT·IV $TQUEJKGTURWTUGJTUEJÌP 

671

672

673



-WTWUJ*3WUVCPVÄPÄ[C4CUJ³FPGDGPFGT6WIJTCI(D-/¤NEGT 2GTG )1.&5GJTUEJÌP





-WTWUJ*3WUVCPVÄPÄ[C4CUJ³FPGDGPFGT6WIJTCI(D-/¤NEGT 2GTG )1.&8QT\ÒINKEJ





-WTWUJ*3WUVCPVÄPÄ[C4CUJ³FPGDGPFGT6WIJTCI(D-/¤NEGT 2GTG )1.&8QT\ÒINKEJ



674

675

676

677



-WTWUJ*3WUVCPVÄPÄ[C4CUJ³FPGDGPFGT6WIJTCI(D-/¤NEGT 2GTG )1.&8QT\ÒINKEJ





-WTWUJ*3WUVCPVÄPÄ[C4CUJ³FPGDGPFGT6WIJTCI(D-/¤NEGT 2GTG )1.&-CWOUKEJVDCTG*GPMGNURWTUGJTUEJÌP





-WTWUJ*3WUVCPVÄPÄ[C4CUJ³FPGDGPFGT6WIJTCI(D-/¤NEGT 2GTG )1.&8QT\ÒINKEJ





-WTWUJ*3WUVCPVÄPÄ[CCN)J³\ÄPGDGPFGT6WIJTCI(D-/¤NEGT 2GTG )1.&5GJTUEJÌPpXQT\ÒINKEJ



120


MUHAMMAD V.

678



680

679

-WTWUJ*3WUVCPVÄPÄ[CCN)J³\ÄPGDGPFGT6WIJTCI(D-/¤NEGT 2GTG )1.&5VGORGNINCP\



&GT4ÒEMUGKVGPUVGORGNYCTXQTFGT2T·IWPI\GTDTQEJGPWPFFCUCDIGDTQEJGPG&TKVVGNOKVNGKEJVGO8GTUCV\YKGFGT DGHGUVKIV&KGUGTHÒTGKPGOQFGTPG/ÒP\UV·VVGWPIGYÌJPNKEJG8QTICPIKNNWUVTKGTVFGPDGUQPFGTGP<GKVFTWEMDGKFGT #WURT·IWPIFGU)QNFGU\WT-TKGIUHKPCP\KGTWPIY·JTGPFFGUGTUVGP9GNVMTKGIU



-WTWUJ*3WUVCPVÄPÄ[CCN)J³\ÄPGDGPFGT6WIJTCI(D-/¤NEGT 2GTG )1.&8QT\ÒINKEJp5VGORGNINCP\





 -WTWUJ  *  3WUVCPVÄPÄ[C CN)J³\Ä PGDGP FGT 6WIJTC  I (D  -/  ¤NEGT   2GTG )1.&6GKNUCO4CPFGHNCWG2T·IWPIWPFVGEJPKUEJUEJNGEJVG4·PFGNWPI HCUV5VGORGNINCP\



681

1,5:1



1,5:1

-WTWUJ*3WUVCPVÄPÄ[C4CUJ³FPGDGPFGT6WIJTCI(D-/¤NEGT 2GTG )1.&5GJTUGNVGPGT,CJTICPI8QT\ÒINKEJ

682

683

684



685



-WTWUJ*3WUVCPVÄPÄ[C4CUJ³FPGDGPFGT6WIJTCI(D-/¤NEGT 2GTG )1.&8QT\ÒINKEJ





-WTWUJ*3WUVCPVÄPÄ[C4CUJ³FPGDGPFGT6WIJTCI(D-/¤NEGT 2GTG )1.&8QT\ÒINKEJ





-WTWUJ*3WUVCPVÄPÄ[C4CUJ³FPGDGPFGT6WIJTCI(D-/¤NEGT 2GTG )1.&-N2T·IGUEJY·EJG5VGORGNINCP\





-WTWUJ*3WUVCPVÄPÄ[C4CUJ³FPGDGPFGT6WIJTCI(D-/¤NEGT 2GTG )1.&-N2T·IGUEJY·EJG5VGORGNINCP\

 121


MUHAMMAD V.

686

688

687

689



-WTWUJ*3WUVCPVÄPÄ[C4CUJ³FPGDGPFGT6WIJTCI(D-/¤NEGT 2GTG )1.&5GJTUEJÌP





-WTWUJ*3WUVCPVÄPÄ[CCN)J³\ÄPGDGPFGT6WIJTCI(D-/¤NEGT 2GTG )1.&8QT\ÒINKEJ





-WTWUJ*3WUVCPVÄPÄ[CCN)J³\ÄPGDGPFGT6WIJTCI(D-/¤NEGT 2GTG )1.&(CUV5VGORGNINCP\





-WTWUJ*3WUVCPVÄPÄ[CCN)J³\ÄPGDGPFGT6WIJTCI(D-/¤NEGT 2GTG )1.&5VGORGNINCP\



690

1,5:1



1,5:1

 -WTWUJ  *  3WUVCPVÄPÄ[C CN)J³\Ä PGDGP FGT 6WIJTC  I (D  -/  ¤NEGT   2GTG )1.&8QPITQ­GT5GNVGPJGKV5VCTMG$TQUEJKGTURWTCWHFGT4ÒEMUGKVG PCEJIGT·PFGNVWPFXQTCNNGOCWHFGT4ÒEMUGKVGÒDGTCTDGKVGVUEJÌPpUGJTUEJÌP

692

691

693



694



-WTWUJ*3WUVCPVÄPÄ[C4CUJ³FPGDGPFGT6WIJTCI(D-/¤NEGT 2GTG )1.&(CUV5VGORGNINCP\





-WTWUJ*3WUVCPVÄPÄ[C4CUJ³FPGDGPFGT6WIJTCI(D-/¤NEGT 2GTG )1.&(CUV5VGORGNINCP\





-WTWUJ*3WUVCPVÄPÄ[C4CUJ³FPGDGPFGT6WIJTCI(D-/¤NEGT 2GTG )1.&8QT\ÒINKEJp5VGORGNINCP\





-WTWUJ*3WUVCPVÄPÄ[C4CUJ³FPGDGPFGT6WIJTCI(D-/¤NEGT 2GTG )1.&5VGORGNINCP\



695

696



-WTWUJ*3WUVCPVÄPÄ[C4CUJ³FPGDGPFGT6WIJTCI(D-/¤NEGT 2GTG )1.&-N4CPFHGJNGTXQT\ÒINKEJ





-WTWUJ*3WUVCPVÄPÄ[C4CUJ³FPGDGPFGT6WIJTCI(D-/¤NEGT 2GTG )1.&8QT\ÒINKEJ



122


MUHAMMAD V.

697

698



-WTWUJ*3WUVCPVÄPÄ[CCN)J³\ÄPGDGPFGT6WIJTCI(D-/¤NEGT 2GTG )1.&8QT\ÒINKEJ





-WTWUJ*3WUVCPVÄPÄ[CCN)J³\ÄPGDGPFGT6WIJTCI(D-/¤NEGT 2GTG )1.&4*GPMGNURWTPCEJIGT·PFGNVWPFDGTKGDGPUGJTUEJÌP



699

700

701

<K[PGV2T·IWPIGPFGT/ÒP\UV·VVG3WUVCPVÄPÄ[C 

-WTWUJ*3WUVCPVÄPÄ[C4CUJ³FPGDGPFGT6WIJTCI(D-/¤NEGT 2GTG )1.&4*GPMGNURWTUGJTUEJÌPpXQT\ÒINKEJ





-WTWUJ*3WUVCPVÄPÄ[C4CUJ³FPGDGPFGT6WIJTCI(D-/¤NEGT 2GTG )1.&*GPMGNURWTUGJTUEJÌPpXQT\ÒINKEJ





-WTWUJ*3WUVCPVÄPÄ[C4CUJ³FPGDGPFGT6WIJTCI(D-/¤NEGT 2GTG )1.&*GPMGNURWTXQT\ÒINKEJ



702



-WTWUJ*3WUVCPVÄPÄ[C4CUJ³FPGDGPFGT6WIJTCI(D-/¤NEGT 2GTG )1.&5GJTUGNVGPKPFKGUGT'TJCNVWPI5VGORGNINCP\



'ZGORNCTFGT5COONWPI&T8KMVQT5EJKOMC#WMVKQP&T$WUUQ2GWU0CEJH(TCPMHWTV/CKP0T 

<K[PGVOÒP\GPMQOOGPPCVWTIGO·­QJPG*GPMGN*GPMGNURWTQFGT.QEJWPIMCWOXQT9GPPFQEJUQGTYGKUGPUKEJ UQNEJG5VÒEMGOGKUVGPUCNULÒPIGTG$CUCTRT·IWPIGP&CUXQTNKGIGPFG5VÒEMFÒTHVGDCNFPCEJFGT2T·IWPIKPFKG*CPF FGUIGDQTGPGP5COONGTUIGMQOOGPUGKP

123


MUHAMMAD V.

703

704

705



-WTWUJ*3WUVCPVÄPÄ[C4CUJ³FPGDGPFGT6WIJTCI(D-/¤NEGT 2GTG )1.&-CWOUKEJVDCTG*GPMGNURWTXQT\ÒINKEJ



 -WTWUJ  *  3WUVCPVÄPÄ[C CN)J³\Ä PGDGP FGT 6WIJTC  I (D  -/  ¤NEGT   2GTGp  )1.&8QPITQ­GT5GNVGPJGKVPWT'ZGORNCTGIGRT·IV*GPMGNURWTRQNKGTVUGJTUEJÌP 



 -WTWUJ  *  3WUVCPVÄPÄ[C CN)J³\Ä PGDGP FGT 6WIJTC  I (D  -/  ¤NEGT   2GTGp  )1.&8QPITQ­GT5GNVGPJGKVPWT'ZGORNCTGIGRT·IV*GPMGNURWTRQNKGTVUGJTUEJÌP 



706



-WTWUJ*3WUVCPVÄPÄ[C4CUJ³FPGDGPFGT6WIJTCI(D-/¤NEGT 2GTG )1.&*GPMGNURWTUGJTUEJÌP



707

 124

-WTWUJ*3WUVCPVÄPÄ[C4CUJ³FPGDGPFGT6WIJTCI(D-/¤NEGT 2GTG )1.&*GPMGNURWTUGJTUEJÌP




MUHAMMAD V.

708

709

710



-WTWUJ*3WUVCPVÄPÄ[C4CUJ³FPGDGPFGT6WIJTCI(D-/¤NEGT 2GTG )1.&*GPMGNURWTUGJTUEJÌP





 -WTWUJ  *  3WUVCPVÄPÄ[C 4CUJ³F PGDGP FGT 6WIJTC  I (D  -/  ¤NEGT   2GTG5EJN )1.&5GNVGPKPFKGUGT'TJCNVWPI MGKPG*GPMGNURWT 8QT\ÒINKEJ



'ZGORNCTFGT#WMVKQP7$5$CUGN0T



-WTWUJ*3WUVCPVÄPÄ[CCN)J³\ÄPGDGPFGT6WIJTCI(D-/¤NEGT 2GTGp )1.&44*GPMGNURWTRQNKGTVUGJTUEJÌP

711

712



713



-WTWUJ*3WUVCPVÄPÄ[C4CUJ³FPGDGPFGT6WIJTCI(D-/¤NEGT 2GTG )1.&*GPMGNURWTRQNKGTVUGJTUEJÌP





-WTWUJ*3WUVCPVÄPÄ[C4CUJ³FPGDGPFGT6WIJTCI(D-/¤NEGT 2GTG )1.&*GPMGNURWTUGJTUEJÌP





-WTWUJ*3WUVCPVÄPÄ[C4CUJ³FPGDGPFGT6WIJTCI(D-/¤NEGT 2GTG )1.&*GPMGNURWTUGJTUEJÌP

 125


MUHAMMAD V.

715

714

716



-WTWUJ*3WUVCPVÄPÄ[C4CUJ³FPGDGPFGT6WIJTCI(D-/¤NEGT 2GTG )1.&*GPMGNURWTUEJCTHIGTGKPKIVUGJTUEJÌP





-WTWUJ*3WUVCPVÄPÄ[C4CUJ³FPGDGPFGT6WIJTCI(D-/¤NEGT 2GTG )1.&*GPMGNURWTUEJCTHIGTGKPKIVUGJTUEJÌP





-WTWUJ*3WUVCPVÄPÄ[C4CUJ³FPGDGPFGT6WIJTCI(D-/¤NEGT 2GTG )1.&*GPMGNURWTUEJCTHIGTGKPKIVUGJTUEJÌP



717



-WTWUJ*3WUVCPVÄPÄ[CCN)J³\ÄPGDGPFGT6WIJTCI(D-/¤NEGT 2GTGp )1.&44*GPMGNURWTUGJTUEJÌPpXQT\ÒINKEJ



'ZGORNCTFGT#WMVKQP5RKPM<ÒTKEJ0T

718

719



-WTWUJ*3WUVCPVÄPÄ[C4CUJ³FPGDGPFGT6WIJTCI(D-/¤NEGT 2GTGp )1.&5GNVGPDGUQPFGTUKPFKGUGT'TJCNVWPI MGKPG*GPMGNURWT (CUV5VGORGNINCP\





-WTWUJ*3WUVCPVÄPÄ[C4CUJ³FPGDGPFGT6WIJTCI(D-/¤NEGT 2GTGp )1.&*GPMGNURWTUGJTUEJÌPpXQT\ÒINKEJ



720

721



-WTWUJ*3WUVCPVÄPÄ[C4CUJ³FPGDGPFGT6WIJTCI(D-/¤NEGT 2GTGp )1.&)GUVQRHVGU.QEJUEJCTHIGTGKPIVUGJTUEJÌP





-WTWUJ*3WUVCPVÄPÄ[C4CUJ³FPGDGPFGT6WIJTCI(D-/¤NEGT 2GTGp )1.&*GPMGNURWTUEJCTHIGTGKPIVUGJTUEJÌPpXQT\ÒINKEJ



126


MUHAMMAD V.

723

722



-WTWUJ*3WUVCPVÄPÄ[C4CUJ³FPGDGPFGT6WIJTCI(D-/¤NEGT 2GTGp )1.&5GNVGPDGUQPFGTUKPFKGUGT'TJCNVWPI MGKPG*GPMGNURWT 5VGORGNINCP\





-WTWUJ*3WUVCPVÄPÄ[CCN)J³\ÄPGDGPFGT6WIJTCI(D-/¤NEGT 2GTGp )1.&44)GUVQRHVGU.QEJUEJCTHIGTGKPIVUGJTUEJÌP



724

726

725

727



-WTWUJ*3WUVCPVÄPÄ[C4CUJ³FPGDGPFGT6WIJTCI(D-/¤NEGT 2GTGp )1.&4)GUVQRHVGU.QEJUEJCTHIGTGKPIVUGJTUEJÌP





-WTWUJ*3WUVCPVÄPÄ[C4CUJ³FPGDGPFGT6WIJTCI(D-/¤NEGT 2GTGp )1.&4*GPMGNURWTUGJTUEJÌP





-WTWUJ*3WUVCPVÄPÄ[C4CUJ³FPGDGPFGT6WIJTCI(D-/¤NEGT 2GTGp )1.&*GPMGNURWTUGJTUEJÌP





-WTWUJ*3WUVCPVÄPÄ[C4CUJ³FPGDGPFGT6WIJTCI(D-/¤NEGT 2GTGp )1.&5GNVGPKPFKGUGT'TJCNVWPI8QT\ÒINKEJ



728

729

730

731

732



-WTWUJ*3WUVCPVÄPÄ[C4CUJ³FPGDGPFGT6WIJTCI(D-/¤NEGT 2GTGp )1.&4*GPMGNURWTUEJCTHIGTGKPKIVUGJTUEJÌP





-WTWUJ*3WUVCPVÄPÄ[CCN)J³\ÄPGDGPFGT6WIJTCI(D-/¤NEGT 2GTGp )1.&5GJTUGNVGPFQEJOÌINKEJGTYGKUG0CEJRT·IWPI )GNQEJVUGJTUEJÌP



&GTWPTGIGNO·­KIG5VGORGNUEJPKVVFGT6WIJTCN·­VFKG/ÌINKEJMGKVGKPGTUR·VGTGP$CUCTRT·IWPIGTPUVJCHVKP$GVTCEJV \KGJGP &CIGIGP GPVURTGEJGP FKG #DYGKEJWPIGP FGU 6[RU \W XQTJGTIGJGPFGP ,CJTGP CDIGUGJGP XQP FGO   MTKGIUDGFKPIVGP 'TUCV\ FGU $GKPCOGPU 4CUJ³F FWTEJ CN)J³\Ä YKGFKG8GTMNGKPGTWPIFGU4CPMGPMTCP\GUCPFGTGP GKPFGWVKI\GKVIGPÌUUKUEJGP2T·IWPIGPFGU,CJTGU



  -WTWUJ  *  3WUVCPVÄPÄ[C 4CUJ³F PGDGP FGT 6WIJTC  I (D  -/  ¤NEGT   2GTGp )1.&48QT\ÒINKEJ





  -WTWUJ  *  3WUVCPVÄPÄ[C 4CUJ³F PGDGP FGT 6WIJTC  I (D  -/  ¤NEGT   2GTGp )1.&4*GPMGNURWTUEJCTHIGTGKPIVHCUVXQT\ÒINKEJ





  -WTWUJ  *  3WUVCPVÄPÄ[C 4CUJ³F PGDGP FGT 6WIJTC  I (D  -/  ¤NEGT   2GTGp )1.&4-CWOUKEJVDCTG*GPMGNURWTXQT\ÒINKEJ

 127


MUHAMMAD V.

ex 733

5KNDGTRT·IWPIGPFGT/ÒP\UV·VVG3WUVCPVÄPÄ[C 

 -WTWUJ  *   WPF  3WUVCPVÄPÄ[C 4CUJ³F PGDGP FGT 6WIJTC  I -/  ¤NEGT   p2GTG 5VÒEM8QT\ÒINKEJWPF5VGORGNINCP\

ex 734



735



-WTWUJ*WPF3WUVCPVÄPÄ[C4CUJ³FPGDGPFGT6WIJTCWPFI-/¤NEGT WPF2GTG 5VÒEM4,CJTOKVMNGKPGO4CPFUEJNCIUGJTUEJÌPpXQT\ÒINKEJ





-WTWUJ*3WUVCPVÄPÄ[C4CUJ³FPGDGPFGT6WIJTCI-/¤NEGT2GTG  5GJTUGNVGPGT,CJTICPI-NGKPG*GPMGNURWTUGJTUEJÌP



ex 737

ex 736





 -WTWUJ  *    WPF  3WUVCPVÄPÄ[C 4CUJ³F PGDGP FGT 6WIJTC    WPF   I-/¤NEGTp2GTG  5VÒEM&CUUGNVGPGTG,CJTUGJTUEJÌP FKGFTGKCPFGTGP5VGORGNINCP\



-WTWUJ*WPF3WUVCPVÄPÄ[CCN)J³\ÄPGDGPFGT6WIJTCWPF I-/¤NEGTp2GTG  5VÒEM&CU,CJTUGNVGP8QT\ÒINKEJWPF5VGORGNINCP\



ex 738



ex 739

740

-WTWUJ*WPF3WUVCPVÄPÄ[C4CUJ³FPGDGPFGT6WIJTC WPFI-/¤NEGTp2GTG  5VÒEM&CUUGNVGPGTG,CJTXQT\ÒINKEJCNNGCPFGTGP5VGORGNINCP\





-WTWUJ*WPF3WUVCPVÄPÄ[CCN)J³\ÄPGDGPFGT6WIJTCWPFI-/¤NEGT p2GTG 5VÒEM5GJTUEJÌPWPFXQT\ÒINKEJ





 -WTWUJ*3WUVCPVÄPÄ[CCN)J³\ÄPGDGPFGT6WIJTCI-/¤NEGT2GTG  5GJTUGNVGPGT,CJTICPI*GPMGNURWTUGJTUEJÌP



128


MUHAMMAD V.



743

ex 742

ex 741

-WTWUJ*WPF3WUVCPVÄPÄ[C4CUJ³FPGDGPFGT6WIJTC WPFI-/¤NEGTp2GTG  5VÒEM&CUUGNVGPGTG,CJTXQT\ÒINKEJCNNGCPFGTGP5VGORGNINCP\





-WTWUJ*WPF3WUVCPVÄPÄ[CCN)J³\ÄPGDGPFGT6WIJTCWPFI-/¤NEGT p2GTG 5VÒEM45VGORGNINCP\





-WTWUJ*3WUVCPVÄPÄ[CCN)J³\ÄPGDGPFGT6WIJTCI-/¤NEGT2GTG  5GJTUGNVGPGT,CJTICPI5GJTUEJÌP



ex 744



-WTWUJ*WPFFC\W2CTC 0KEMGN *WPF3WUVCPVÄPÄ[C4GUJ³FPGDGPFGT 6WIJTCWPFI-/WPF¤NEGTp2GTGWPF  5VÒEM&KG5KNDGTOÒP\GPXQT\ÒINKEJWPF5VGORGNINCP\FKG0KEMGNUVÒEMGUGJTUEJÌP



ex 745

$KNNQPRT·IWPIGPFGT/ÒP\UV·VVG3WUVCPVÄPÄ[C 

2CTC*WPFFC\W2CTC*QJPG,CJTWPF3WUVCPVÄPÄ[C&KGGTUVGP DGKFGPOKVCN)J³\ÄFKGYGKVGTGPOKV4GUJ³FPGDGPFGT6WIJTC WPFI-/WPF¤NEGTppWPFC2GTGpWPF  5VÒEM2CTCQJPG4GIKGTWPIULCJTGKPVTCIUGNVGP5GJTUEJÌP



746

1,5:1



1,5:1

2CTC*3WUVCPVÄPÄ[C4GUJ³FPGDGPFGT6WIJTCI-/¤NEGTp2GTG  5GJTUGNVGPGT,CJTICPI-N4CPFUEJNCIUGJTUEJÌP



ex 747



2CTC* 5VÒEMOKV4GUJ³FWPFCN)J³\Ä 3WUVCPVÄPÄ[C&C\W2CTC *        5VÒEMG YKG XQTJGT  DKU ,CJT  OKV 4GUJ³F PGDGP FGT 6WIJTC FCPP   CN)J³\Ä               WPF   I-/WPF¤NEGTpp2GTGWPF  5VÒEM5GJTUEJÌPWPFXQT\ÒINKEJ

 129


MUHAMMAD V.

748

1,5:1

1,5:1

2T·IWPIGPCWHFGP5VCFVDGUWEJKP$TÃ&#x2018;UC $WTUC  2T·IWPIGPCWHFKG5V·FVGDGUWEJGYWTFGPKP3WUVCPVÃ&#x201E;PÃ&#x201E;[CIGRT·IV 

-WTWUJ*$TÃ&#x2018;UC $WTUC 4CUJ³FPGDGPFGT6WIJTCI(D-/¤NEGT 2GTG )1.&48QT\Ã&#x2019;INKEJ



749

1,5:1

1,5:1



-WTWUJ*$TÃ&#x2018;UC $WTUC 4CUJ³FPGDGPFGT6WIJTCI(D-/¤NEGT 2GTG )1.&448QPRQNKGTVGP5VGORGNP5VGORGNINCP\



750

1,5:1



1,5:1

-WTWUJ*$TÃ&#x2018;UC $WTUC 4CUJ³FPGDGPFGT6WIJTCI(D-/¤NEGT 2GTG )1.&8QPITQ­GT5GNVGPJGKV(CUV5VGORGNINCP\



751

 130

WPF-WTWUJ*$TÃ&#x2018;UC $WTUC 4CUJ³FPGDGPFGT6WIJTCWPFI-/p ¤NEGTp2GTGp 5VÃ&#x2019;EM(CUV5VGORGNINCP\WPFXQT\Ã&#x2019;INKEJ




MUHAMMAD V.

752

1,5:1

1,5:1

2T·IWPIGPCWHFGP5VCFVDGUWEJKP'FKTPG 2T·IWPIGPCWHFKG5V·FVGDGUWEJGYWTFGPKP3WUVCPVÄPÄ[CIGRT·IV 

 -WTWUJ  *  'FKTPG 4CUJ³F PGDGP FGT 6WIJTC  I (D  -/ ¤NEGT 2GTG )1.&442QNKGTVG2NCVVGDGTKGDGP 

755 753

754



 -WTWUJ  *  'FKTPG 4CUJ³F PGDGP FGT 6WIJTC  I (D C -/  ¤NEGT    2GTG )1.&48QT\ÒINKEJ





 -WTWUJ  *  'FKTPG 4CUJ³F PGDGP FGT 6WIJTC  I (D C -/  ¤NEGT    2GTG )1.&45GJTUEJÌP





 -WTWUJ  *  'FKTPG 4CUJ³F PGDGP FGT 6WIJTC  I (D C -/  ¤NEGT    2GTG )1.&44.GKEJVG-TCV\GTHCUV5VGORGNINCP\



756



-WTWUJ*'FKTPG4CUJ³FPGDGPFGT6WIJTCI-/¤NEGT2GTG 48QT\ÒINKEJ



757



WPF-WTWUJ*'FKTPG4CUJ³FPGDGPFGT6WIJTCWPFI-/WPF¤NEGT p2GTGWPF 5VÒEM5GJTUEJÌPpXQT\ÒINKEJ

 131


MUHAMMAD V.

758

1,5:1

1,5:1

2T·IWPIGPCWHFGP5VCFVDGUWEJKP3ÑUWYC -QUQXQ  2T·IWPIGPCWHFKG5V·FVGDGUWEJGYWTFGPKP3WUVCPVÄPÄ[CIGRT·IV 

-WTWUJ*3ÑUWYC -QUQXQ 4CUJ³FPGDGPFGT6WIJTCI(DC-/¤NEGT 2GTG  )1.&8QPITQ­GT5GNVGPJGKVPWT'ZGORNCTGIGRT·IV*GPMGNURWTUGJTUEJÌP



760

759



-WTWUJ*3ÑUWYC -QUQXQ 4CUJ³FPGDGPFGT6WIJTCI(DD-/¤NEGT 2GTG )1.&4/KP4CPFUEJNCIXQT\ÒINKEJ





-WTWUJ*3ÑUWYC -QUQXQ 4CUJ³FPGDGPFGT6WIJTCI(DD-/¤NEGT 2GTG )1.&45GJTUEJÌPpXQT\ÒINKEJ



761

761 1,5:1



-WTWUJ*3ÑUWYC -QUQXQ 4CUJ³FPGDGPFGT6WIJTCI-/¤NEGT 2GTG 48QT\ÒINKEJ



762

 132

 WPF  -WTWUJ  *  3ÑUWYC -QUQXQ  4CUJ³F PGDGP FGT 6WIJTC  WPF  I -/   p¤NEGTp2GTGp 5VÒEM8QT\ÒINKEJp5VGORGNINCP\WPF5VGORGNINCP\




MUHAMMAD V.

763

1,5:1

1,5:1

2T·IWPIGPCWHFGP5VCFVDGUWEJKP/CP³UVKT 2T·IWPIGPCWHFKG5V·FVGDGUWEJGYWTFGPKP3WUVCPVÃ&#x201E;PÃ&#x201E;[CIGRT·IV 

-WTWUJ*/CP³UVKT4CUJ³FPGDGPFGT6WIJTCI(DD-/¤NEGT 2GTG )1.&8QPITQ­GT5GNVGPJGKVPWT'ZGORNCTGIGRT·IV8QT\Ã&#x2019;INKEJ



764



-WTWUJ*/CP³UVKT4CUJ³FPGDGPFGT6WIJTCI(DE-/¤NEGT 2GTG )1.&48QT\Ã&#x2019;INKEJp5VGORGNINCP\

1,5:1



765



1,5:1

-WTWUJ*/CP³UVKT4CUJ³FPGDGPFGT6WIJTCI(DE-/¤NEGT 2GTG )1.&48QT\Ã&#x2019;INKEJp5VGORGNINCP\



766



-WTWUJ*/CP³UVKT4CUJ³FPGDGPFGT6WIJTCI-/¤NEGT2GTG 48QT\Ã&#x2019;INKEJp5VGORGNINCP\



767



WPF-WTWUJ*/CP³UVKT4CUJ³FPGDGPFGT6WIJTCWPFI-/WPF ¤NEGTp2GTGp 5VÃ&#x2019;EM47P\KTMWNKGTVWPFXQT\Ã&#x2019;INKEJp5VGORGNINCP\

 133


MUHAMMAD V.

768

1,5:1

1,5:1

2T·IWPIGPCWHFGP5VCFVDGUWEJKP5GN³PÄM 5CNQPKMK  2T·IWPIGPCWHFKG5V·FVGDGUWEJGYWTFGPKP3WUVCPVÄPÄ[CIGRT·IV 

-WTWUJ*5GN³PÄM 5CNQPKMK 4CUJ³FPGDGPFGT6WIJTCI(DE-/¤NEGT 2GTG  )1.&8QPITQ­GT5GNVGPJGKVPWT'ZGORNCTGIGRT·IV8QPRQNKGTVGP5VGORGNPXQT\ÒINKEJ



770

769

769



-WTWUJ*5GN³PÄM 5CNQPKMK 4CUJ³FPGDGPFGT6WIJTCI(DF-/¤NEGT 2GTG )1.&44-N4CPFUEJN·IGXQT\ÒINKEJ





-WTWUJ*5GN³PÄM 5CNQPKMK 4CUJ³FPGDGPFGT6WIJTCI(DF-/¤NEGT 2GTG )1.&448QT\ÒINKEJp5VGORGNINCP\



771



-WTWUJ*5GN³PÄM4CUJ³FPGDGPFGT6WIJTCI-/¤NEGT2GTG 4'VYCUDGTKGDGPXQT\ÒINKEJ



772

 134

WPF-WTWUJ*5GN³PÄM4CUJ³FPGDGPFGT6WIJTCWPFI-/p¤NEGT p2GTGp 5VÒEM48QT\ÒINKEJp5VGORGNINCP\WPFUGJTUEJÌP




MUHAMMAD V.

ex 773

5KNDGTRT·IWPIGPFGT/ÒP\UV·VVG/KUT -CKTQ  

 -WTWUJ  *    WPF  /KUT -CKTQ  IGRT·IV KP $KTOKPIJCO /KV $NWOG PGDGP FGT   6WIJTCWPFI-/¤NEGTp2GTG 5VÒEM5GJTUEJÌP

ex 775

ex 774



ex 774



 -WTWUJ  *    WPF  /KUT -CKTQ  IGRT·IV KP $KTOKPIJCO /KV $NWOG PGDGP FGT   6WIJTCWPFI-/¤NEGTp2GTG 5VÒEM5GJTUEJÌP





-WTWUJ*WPF/KUT -CKTQ IGRT·IVKP$KTOKPIJCO/KV$NWOGPGDGPFGT6WIJTC WPFI-/¤NEGTp2GTG  5VÒEM,CJTXQT\ÒINKEJFKGCPFGTGPUGJTUEJÌP



ex 776



-WTWUJ*WPFUQYKG3KTUJ -WTWUJ *WPF/KUT -CKTQ IGRT·IVKP$KT OKPIJCO /KV $NWOG PGDGP FGT 6WIJTC    WPF  I -/  WPF  ¤NEGT   pp2GTGp  5VÒEM&CUGTUVG5VÒEMXQT\ÒINKEJ5VGORGNINCP\FKGCPFGTGPUGJTUEJÌP

ex 777



ex 778

$KNNQPRT·IWPIGPFGT/ÒP\UV·VVG/KUT -CKTQ  



3KTUJWPF3KTUJLGYGKNUFGT,CJTG*WPF/KUT -CKTQ IGRT·IVKP $KTOKPIJCO/KV$NWOGPGDGPFGT6WIJTC     WPF  I -/   WPF  ¤NEGT p p   pp2GTGp  5VÒEM/GKUVUGJTUEJÌPGKPKIGFGTMNGKPGTGP5VÒEMGXQT\ÒINKEJ



WPF3KTUJLGYGKNUFGT,CJTG*WPF/KUT -CKTQ IGRT·IVKP$KTOKPIJCO /KV$NWOGPGDGPFGT6WIJTCWPFI-/¤NEGT pp2GTG 5VÒEM5GJTUEJÌPWPFXQT\ÒINKEJ

 135


MUHAMMAD VI.

/7*#//#&8+9#*œ&#&&+0 6ª4-'+6ª4-+5%*/'*/'&8#*&'66+0  4#/#&Œ0ņ4#$œʼn+* ,7.+018'/$'4

/WJCOOCF8+GDGPHCNNUGKP5QJPFGU #DFCN/CLÄFHKGNFKG4QNNG\WFCUFKMVKGTVG4GUWNVCVFGU+9GNV MTKGIU\WGZGMWVKGTGP  &GHCEVQYCTUGKP*GTTUEJCHVUDGTGKEJCWHFKG5VCFV+UVCPDWNWPF7OIGDWPITGFW\KGTV'TNÌUVGGTPGWVFCU 2CTNCOGPVCWH  &CFCULWPIVÒTMKUEJG-TKGIUMCDKPGVV 'PXGT6CNCVWPF%GOCN2CUEJC KO,WNKKP#DYGUGPJGKV\WO 6QFGXGTWTVGKNVYWTFGWPFCWEJFKG5KGIGTO·EJVGMGKP+PVGTGUUGFCTCPJCVVGPFGP5WNVCPCNU8GTVTCIURCTV PGT\WXGTNKGTGPMQPPVGFKGUGTKPUGKPGO5VCFVUVCCVCNU&KMVCVQTKO5VKNGUGKPGU$TWFGTU #DFCN*COÄF CWHVTGVGP7OFCUKP#PCTEJKGDGHKPFNKEJG#PCVQNKGP\WDGHTKGFGPGTPCPPVGGTFGP)GPGTCN/WUVCHC-GOCN 2CUEJC\WO*GGTGUKPURGMVGWT&GTNÌUVGUGKPG4GQTICPKUCVKQPUCWHICDGPDTCXQWTÌUYCPFVGUKEJXQO5WN VCPCDWPFQTICPKUKGTVGKO*GTDUVKP5KXCUWPF#PMCTCGKPGUGNDUV·PFKIG6ÒTMGK&GT5WNVCPWPFUGKP 5JC[MJCN+UNCOXGTUWEJVGPPQEJOKVGKPGT-CNKHCVUCTOGGWPFOKV(CVYCUIGIGPFKG4GDGNNGPXQT\WIGJGP &CGTCDGTKO#WIWUVFGP(TKGFGPXQP5½XTGU\WWPVGT\GKEJPGPJCVVGYGNEJGTXQP-GOCN2CUEJC PKEJVCPGTMCPPVYWTFGXGTNQTFGT5WNVCPYGKVGTCP7PVGTUVÒV\WPI&KG-GOCNKUVGPYCPFVGPUKEJPWPCDGT PKEJVIGIGPFGPOKNKV·TKUEJDGFGWVWPIUNQUGP5WNVCPUQPFGTPPCEJ1UVGPIGIGP#TOGPKGPWPFKO9GUVGP IGIGPFKG)TKGEJGPDGKFGUOKVOKNKV·TKUEJGO'THQNIYCUFKG5KGIGTO·EJVG\YCPIOKVFGP-GOCNKUVGPPGW \WXGTJCPFGNP0CEJYGKVGTGP5KGIGPÒDGTFKG)TKGEJGPICDGUKO1MVQDGTFCPPGKPGPCO5WNVCP XQTDGKIGHÒJTVGPPGWGP(TKGFGPUXGTVTCI\YKUEJGPFGP-GOCNKUVGPWPFFGT'PVGPVGFGU9GNVMTKGIGUFGT VGTTKVQTKCNGP<WIGUV·PFPKUUGHÒTFKGVÒTMKUEJGP0CVKQPCNKUVGPDTCEJVG&GTGP6TWRRGP\QIGPFCTCWHQJPG 9KFGTUVCPFKP-QPUVCPVKPQKRGNGKPWPFUGV\VGPFGP5WNVCPCD  /WJCOOCF8+JCVVGXQP$GIKPPUGKPGU5WNVCPCVUCPCNU-TQPRTKP\GP #DFCN/CLÄF++FGP5QJPUGKPGU 1PMGNU #DFCN #\Ä\\WCM\GRVKGTGP&KGUGTYWTFGKO<WIGFGT#DUGV\WPI/WJCOOCFUWPFFGT#DUEJCH HWPIFGU5WNVCPCVUFWTEJFKGPGWG0CVKQPCNXGTUCOONWPIFGT4GRWDNKMKP#PMCTCKO0QXGODGT\WO -CNKHGPGTPCPPVYGNEJGUGTCDGTMCWOCWUHÒNNVG#O/·T\YWTFG #DFCN/CLÄF++FWTEJ$G UEJNWUUFGT0CVKQPCNXGTUCOONWPICDIGUGV\VWPFKPU'ZKNKPFCUHTCP\ÌUKUEJG6GTTKVGVIGUEJKEJMV'TUVCTD CO#WIWUVKP2CTKU&KGQUOCPKUEJG/ÒP\IGUEJKEJVGGPFGVLGFQEJOKV/WJCOOCF8+   136


MUHAMMAD VI.

779

1,5:1

1,5:1

)QNFRT·IWPIGPFGT/Ã&#x2019;P\UV·VVG3WUVCPVÃ&#x201E;PÃ&#x201E;[C 

-WTWUJ*3WUVCPVÃ&#x201E;PÃ&#x201E;[CI(D-/¤NEGT2GTG  )1.&*GPMGNURWTRQNKGTVXQT\Ã&#x2019;INKEJ



780



-WTWUJ*3WUVCPVÃ&#x201E;PÃ&#x201E;[CI(D-/¤NEGT2GTG  )1.&*GPMGNURWTUEJCTHIGTGKPKIVXQT\Ã&#x2019;INKEJ



781

1,5:1



1,5:1

-WTWUJ*3WUVCPVÃ&#x201E;PÃ&#x201E;[CI(D-/¤NEGT2GTG  )1.&448QT\Ã&#x2019;INKEJ

 137


MUHAMMAD VI.

782

1,5:1



1,5:1

-WTWUJ*3WUVCPVÄPÄ[CI(D-/¤NEGT2GTG  )1.&8QPITÌ­VGT5GNVGPJGKVPWT5VÒEMIGRT·IV*GPMGNURWTUGJTUEJÌP

783



784



-WTWUJ*3WUVCPVÄPÄ[CI(D-/¤NEGT2GTG  )1.&8QT\ÒINKEJ





-WTWUJ*3WUVCPVÄPÄ[CI(D-/¤NEGT2GTG  )1.&8QT\ÒINKEJ



785



-WTWUJ*3WUVCPVÄPÄ[CI(D-/¤NEGT2GTG  )1.&*GPMGNURWT!WP\KTMWNKGTV

786

787

788



789



-WTWUJ*3WUVCPVÄPÄ[CI(D-/¤NEGT2GTG  )1.&7P\KTMWNKGTV





-WTWUJ*3WUVCPVÄPÄ[CI(D-/¤NEGT2GTG  )1.&7P\KTMWNKGTV





-WTWUJ*3WUVCPVÄPÄ[CI(D-/¤NEGT2GTG  )1.&48QT\ÒINKEJp5VGORGNINCP\





-WTWUJ*3WUVCPVÄPÄ[CI(D-/¤NEGT2GTG  )1.&48QT\ÒINKEJp5VGORGNINCP\



&KGNGV\VG2T·IWPIFGU1UOCPKUEJGP4GKEJGU

138


MUHAMMAD VI.

790

791

791

<K[PGV2T·IWPIGPFGT/ÒP\UV·VVG3WUVCPVÄPÄ[C 

-WTWUJ*3WUVCPVÄPÄ[CI(D-/¤NEGT2GTG  )1.&5GJTUGNVGPGT,CJTICPI*GPMGNURWTUEJCTHIGTGKPIVUGJTUEJÌP





-WTWUJ*3WUVCPVÄPÄ[CI(D-/¤NEGT2GTG  )1.&4-CWOUKEJVDCTG*GPMGNURWTXQT\ÒINKEJ



'ZGORNCTFGT#WMVKQP5RKPM<ÒTKEJ0T

793

792



792

-WTWUJ*3WUVCPVÄPÄ[CI(D-/¤NEGT2GTG  )1.&4*GPMGNURWTUGJTUEJÌPpXQT\ÒINKEJ



'ZGORNCTFGT#WMVKQP)GTJCTF*KTUEJ0CEJH/ÒPEJGP0T



-WTWUJ*3WUVCPVÄPÄ[CI(D-/¤NEGT2GTG  )1.&4*GPMGNURWTUGJTUEJÌP

 139


MUHAMMAD VI.

794

1,5:1



1,5:1

-WTWUJ*3WUVCPVÃ&#x201E;PÃ&#x201E;[CI(D-/¤NEGT2GTG  )1.&5GJTUGNVGPKPFKGUGT'TJCNVWPI QJPG*GPMGNURWT 8QT\Ã&#x2019;INKEJ



795

1,5:1



1,5:1

-WTWUJ*3WUVCPVÃ&#x201E;PÃ&#x201E;[CI(D-/¤NEGT2GTGp  )1.&-CWOUKEJVDCTG*GPMGNURWTXQT\Ã&#x2019;INKEJ

796 1,5:1

 140



1,5:1

-WTWUJ*3WUVCPVÃ&#x201E;PÃ&#x201E;[CI(D-/¤NEGT2GTGp  )1.&*GPMGNURWTHCUVXQT\Ã&#x2019;INKEJ




MUHAMMAD VI.

797

5KNDGTRT·IWPIGPFGT/ÒP\UV·VVG3WUVCPVÄPÄ[C 

-WTWUJUWDCGTCV*3WUVCPVÄPÄ[CI-/¤NEGT2GTG

 5GJTUEJÌP



&KG/ÒP\GYGKUVYGFGTKPUVKNKUVKUEJGTPQEJKPVGEJPKUEJGT*KPUKEJV#WHH·NNKIMGKVGPCWHFCIGIGPUEJGKPVUVGNNGPYGKUG CPFGP-CPVGPGKPGMWRHTKIG8GTH·TDWPIWPFFGT4CPFFGT4ÒEMUGKVG\GKIVDGKJCWHGVYCEO.·PIGGKPGOCUUKXG 2NCVVKGTWPIQJPGJKGT'KPDNKEMKPFCU+PPGTG\WIGDGP&KGVGEJPKUEJG2GTHGMVKQPXQP5VGORGNUEJPKVVWPF2T·IWPI OCEJV YCJTUEJGKPNKEJ FCUU FKGUG /ÒP\G KP GKPGT UVCCVNKEJGP /ÒP\UV·VVG GPVUVCPFGP KUV YCJTUEJGKPNKEJ KP   -QPUVCPVKPQRGN &KG RTGM·TG 9KTVUEJCHVUNCIG FGU 1UOCPKUEJGP 4GKEJGU CO 'PFG FGU + 9GNVMTKGIGU YÒTFG GDGPUQ   GKPGP RNCWUKDNGP *KPVGTITWPF HÒT FKGUGP 5ÒPFGPHCNN FCTUVGNNGP YKG GKP /KUUDTCWEJ FGU /ÒP\YGUGPU FWTEJ   -TKGIUIGIPGTKPDGUGV\VGP)GDKGVGP 5[TKGP +TCS FGU0CJGP1UVGPU

798

1,5:1

1,5:1



-WTWUJ*3WUVCPVÄPÄ[CI-/¤NEGT2GTG  5GJTUGNVGPGT,CJTICPI8QT\ÒINKEJ



799

1,5:1



1,5:1

-WTWUJ*3WUVCPVÄPÄ[CI-/¤NEGT2GTG  5GJTUGNVGPGT,CJTICPI8QT\ÒINKEJ5VGORGNINCP\

 141


MUHAMMAD VI.

800

1,5:1



1,5:1

-WTWUJ*3WUVCPVÃ&#x201E;PÃ&#x201E;[CI-/¤NEGT2GTG  8QPITQ­GT5GNVGPJGKVPWT5VÃ&#x2019;EMIGRT·IV8QT\Ã&#x2019;INKEJ



801 1,5:1



1,5:1

-WTWUJ*3WUVCPVÃ&#x201E;PÃ&#x201E;[CI-/¤NEGT2GTG

445VGORGNINCP\



802 1,5:1

1,5:1



-WTWUJ*3WUVCPVÃ&#x201E;PÃ&#x201E;[CI-/¤NEGT2GTG

445VGORGNINCP\





-WTWUJ*3WUVCPVÃ&#x201E;PÃ&#x201E;[CI-/¤NEGT2GTG  48QT\Ã&#x2019;INKEJp5VGORGNINCP\





-WTWUJ*3WUVCPVÃ&#x201E;PÃ&#x201E;[CI-/¤NEGT2GTG

45VGORGNINCP\



5VGORGNINCP\



803

804

805

'KPG$KNNQPRT·IWPIFGT/Ã&#x2019;P\UV·VVG3WUVCPVÃ&#x201E;PÃ&#x201E;[C  142

2CTC*3WUVCPVÃ&#x201E;PÃ&#x201E;[CI-/¤NEGT2GTG


FEHLPRÄGUNGEN

('*.24)70)'0

806



#DF CN/CLÄF  * #& *CNDGT -WTWUJ  2CTC   *  3WUVCPVÄPÄ[C   &G\GPVTKGTV #DFWN #\K\*#&-WTWUJ 2KCUVTG 3WUVCPVÄPÄ[C'VYCU FG\GPVTKGTVWPFI-/WPF¤NEGT 5VÒEM5GJTUEJÌP



807



*CNDGT -WTWUJ  2CTC   * 3WUVCPVÄPÄ[C +PMWUG 2T·IWPI FGT 4ÒEMUGKVG #DF CN*COÄF    ++*#&-WTWUJ3WUVCPVKPK[C+PMWUG2T·IWPIFGT4ÒEMUGKVGWPF I¤NEGT 5VÒEM5GJTUEJÌP 

808



2CTC* 'Z WPF2CTC3WUVCPVÄPÄ[C&G\GPVTKGTV WPFI-/¤NEGT  5VÒEM5GJTUEJÌPWPFXQT\ÒINKEJ



809



2CTC*WPF 'Z 3WUVCPVÄPÄ[C&G\GPVTKGTVWPFI-/¤NEGT  5VÒEM5GJTUEJÌP

810



1,5:1



810

#DFCN #\Ä\*#&-WTWUJ*3WUVCPVÄPÄ[C0CEJGTUVGT2T·IWPI DGKIGÌHHPGVGO4KPIPQEJOCNUFG\GPVTKGTVIGRT·IVI-/¤NEGT2GTG  )1.&5GJTUEJÌPpXQT\ÒINKEJ

 143


FEHLPRÄGUNGEN

811

812



#DF CN*COÄF ++ * #&  -WTWUJ  * 3WUVCPVÄPÄ[C +PMWUG 2T·IWPI   FGT4ÒEMUGKVGI-/QFGT¤NEGTp2GTGQFGT  )1.&8QT\ÒINKEJ





/WJCOOCF 8 4GUJ³F  * #&  -WTWUJ  *  3WUVCPVÄPÄ[C   1JPG4KPINGKEJVFG\GPVTKGTVIGRT·IVQJPG4·PFGNWPII-/¤NEGT2GTG  )1.&5GJTUEJÌPpXQT\ÒINKEJ



813 1,5:1

1,5:1



-WTWUJ*3WUVCPVÄPÄ[C1JPG4KPIFG\GPVTKGTVIGRT·IVFCJGTGVYCUITÌ­GTGT&WTEJOGUUGT QJPG4·PFGNWPII-/¤NEGT2GTG )1.&(CUV5VGORGNINCP\

814



814 2:1



 -WTWUJ  *  3WUVCPVÄPÄ[C CNIJ³\Ä PGDGP FGT 6WIJTC &KG GTUVG 5VGNNG FGU 4GIKGTWPIU   CPVTKVVULCJTGUFWTEJ8GTWPTGKPKIWPIFGU5VGORGNUXGTYKUEJVI-/¤NEGT2GTG )1.&8QT\ÒINKEJ



815





 -WTWUJ  *  3WUVCPVÄPÄ[C <YKVVGTRT·IWPI OKV FGT 4ÒEMUGKVG XQP /WJCOOCF 8+   *#&-WTWUJ3WUVCPVÄPÄ[CI-/#X4X  5VGORGNHGJNGTUGJTUEJÌP 'PH·NNV





ex 817

 144

 2CTC  *   'Z    WPF   3WUVCPVÄPÄ[C &G\GPVTKGTV    WPF   I-/ 5VÒEM8QT\ÒINKEJWPFUGJTUEJÌP ZIGNQEJV




GEGENSTEMPEL

)')'056'/2'.#7(1661/#0+5%*'0-72('4/ª0<'0

818



;WPFC #NKDG[ #FCUK   2CTC  *  WPF  FGU #DF CN/CLKF 3WUVCPVÄPÄ[C   $TGKVGT NKPFGPDNCVVHÌTOKIGT )GIGPUVGORGN OKV CTCDKUEJGT #WHUEJTKHV [ÑPFC  DGNGFK[GUK    

FKG ,CJTGU\CJN MCWO GTMGPPDCT   WPF  I 9KNUMK %QWPVGTOCTMU # p 5    9KNUMK0GY6CDNG5 5VÒEM5EJÌPWPFUGJTUEJÌP



ex 819



2CTC * ,CJTPKEJVGTMGPPDCTFGU #DFCN/CLÄFWPF 'Z FGU #DFCN #\Ä\ 3WUVCPVÄPÄ[C$TGKVGTNKPFGPDNCVVHÌTOKIGT)GIGPUVGORGNOKVCTCDKUEJGT#WHUEJTKHV[ÑPFCDGNGFK[GUK  FKG,CJTGU\CJNMCWOGTMGPPDCT WPFI9KNUMK%QWPVGTOCTMU#p5 9KNUMK0GY6CDNG5 5VÒEM&CUGTUVGIGTKPIGTJCNVGPOKV)GIGPUVGORGNUEJÌP FKGCPFGTGPUEJÌPWPFUGJTUEJÌP)GIGPUVGORGNUGJTUEJÌP



820



&KMKNK 8KNC[GV #[FKP $GTICOC MC\   2CTC   FGU #DFCN #\Ä\3WUVCPVÄPÄ[C+OTWPFGP )GIGPUVGORGNCTCDKUEJG#WHUEJTKHV&ÄMKNÄDGNGFK[GUKI9KNUMK%QWPVGTOCTMU#p5 9KNUMK0GY6CDNG5  5GJTUGNVGPGU0QOKPCNHÒTFKGUGP5VGORGN/ÒP\GGVYCUITÒPURCPHNGEMKI KPCMVKX  )GIGPUVGORGNUGJTUEJÌP

 145


GEGENSTEMPEL

ex 821



5JCMJOÑU !   2CTC    WPF  FGU #DF CN/CLÄF   FGU #DF CN #\Ä\ 3W   UVCPVÄPÄ[C +O TWPFGP )GIGPUVGORGN KP (NGEJVDCPF CTCDKUEJG #WHUEJTKHV 5JCMJOÑU !      WPFI9KNUMK%QWPVGTOCTMU#p59KNUMK0GY6CDNG5  5VÒEM44/ÒP\GPUEJÌPWPFUGJTUEJÌP)GIGPUVGORGNOGKUVUGJTUEJÌP



&KG5COONWPI6JQOCUGPVJ·NVOKV'ZGORNCTGPFGPITÌ­VGP$GUVCPFFGTUGNVGPGPWPFT·VUGNJCHVGP-WRHGTOÒP\GP FKGOKVFGOXQP9KNUMK5JCMJOÑU ! IGNGUGPGP)GIGPUVGORGNXGTUGJGPUKPFXQPFGPGP9KNUMKKPUIGUCOVCEJV 5VÒEMGMCPPVG&KG.GUWPIKUVKPUQHGTPWPUKEJGTCNUFKGJKGTPWPOGJTXQTNKGIGPFGP5VÒEMGFGWVNKEJOCEJGPFCUUUKEJ WPVGTFGOGTUVGP$WEJUVCDGPUJÄPPQEJOCNU\YGK2WPMVGGTUEJGKPGPYGNEJG9KNUMKKP#0GY6CDNGCWEJIGRWPMVGV YKGFGTIGIGDGP JCV 5Q KUV CPIGUKEJVU FGT WPIGMN·TVGP +FGPVKHKMCVKQP CWEJ FKG .GUWPI FGU 9QTVCPHCPIU WPUKEJGT   'XGPVWGNNY·TGJKGTCNU#NVGTPCVKXG\WGKPGOCWHQUCWUNCWVGPFGPITKGEJKUEJGP1TVUPCOGPCPGKPGPGVYCUHGJNGTJCHV YKGFGTIGIGDGPGP2GTUQPGPPCOGP5JC[MJOÑU JGWVGOGKUV5JGJOWUIGUEJTKGDGP \WFGPMGP&CUXÌNNKIG(GJNGPXQP /KVUVGORNGTP PGDGP 5JCMJOÑU YGKUV YQJN CWH GKPG *GTMWPHV CW­GTJCND FGT I·KU YKG CWEJ FKG XKGTHCEJ   PCEJYGKUDCTG$GPWV\WPI·I[RVKUEJGT-WRHGTUVÒEMGWPFFKG5VGORGNWPICWHFKGXQTCNNGOKPFGT.GXCPVGXGTDTGKVGVGP 2CTC5VÒEMGKPUÒFNKEJG4KEJVWPI\WFGWVGPUEJGKPGP

ex 822



2CTCFGU #DFCN/CLÄFWPF 'ZGKPOCNOKVFQRRGNVGOEO FGU #DFCN #\Ä\ 3WUVCPVÄPÄ[C +O TWPFGP )GIGPUVGORGN KP (NGEJVDCPF CTCDKUEJG #WHUEJTKHV 5JCMJOÑU !    WPFI9KNUMK%QWPVGTOCTMU#p59KNUMK0GY6CDNG5  5VÒEM44'KP5VÒEMIGNQEJV/ÒP\GPUEJÌPWPFUGJTUEJÌP)GIGPUVGORGNOGKUVUGJTUEJÌP



ex 823



2CTCWPFFGU #DFCN/CLÄF3WUVCPVÄPÄ[C+OTWPFGP)GIGPUVGORGNKP(NGEJVDCPF CTCDKUEJG #WHUEJTKHV 5JCMJOÑU !    WPF  I 9KNUMK %QWPVGTOCTMU # p 5    9KNUMK0GY6CDNG5 5VÒEM44/ÒP\GPUEJÌPWPFUGJTUEJÌP)GIGPUVGORGNOGKUVUGJTUEJÌP



824



146

2CTCWPFFGU #DFCN #\Ä\3WUVCPVÄPÄ[CWPFCWU/KUT+OTWPFGP)GIGPUVGORGNKP (NGEJVDCPFCTCDKUEJG#WHUEJTKHV5JCMJOÑU ! WPFI9KNUMK%QWPVGTOCTMU#p5 9KNUMK0GY6CDNG5 5VÒEM445GJTUEJÌP




GEGENSTEMPEL

ex 825



 2CTC   FGU #DF CN #\Ä\ 3WUVCPVÄPÄ[C WPF   WPF  CWU /KUT FGU #DF CN/CLKF   +O TWPFGP )GIGPUVGORGN KP (NGEJVDCPF CTCDKUEJG #WHUEJTKHV 5JCMJOÑU !    WPF  I   9KNUMK%QWPVGTOCTMU#p59KNUMK0GY6CDNG5  5VÒEM44&CUGTUVGIGNQEJVUGJTUEJÌP

ex 827

826









ex 828

$C[TCOKE $G\KTM$KIC 2CTC ! FGU #DFCN/CLÄF3WUVCPVÄPÄ[C+OTWPFGP)GIGPUVGORGN CTCDKUEJG#WHUEJTKHV$C[T³OÄE$GNGFK[G  /KVUVGORNGT/CPVCOCFQU.GUDQUOKVGKPIGUEJNCIGPGO ΤΞΧUQYKG-CNNQPK.GUDQUOKV- ΛUQYKGCO4CPFGGKPIGUEJNCIGPGUFQRRGNVGUΠI9KNUMK %QWPVGTOCTMU#pC)DWPF)p9KNUMK0GY6CDNG5WPF 445GJTUEJÌP



2CTCWPFFGU #DFCN/CLÄF3WUVCPVÄPÄ[C+OTWPFGP)GIGPUVGORGNCTCDKUEJG#WH UEJTKHV $C[T³OÄE $GNGFK[G     WPF  I 9KNUMK%QWPVGTOCTMU#pC9KNUMK 0GY6CDNG5 5VÒEM45EJÌPWPFHCUVUGJTUEJÌP)GIGPUVGORGNUGJTUEJÌP



2CTCFGU #DFCN #\Ä\UQYKG,CJTPKEJVGTMGPPDCTFGU #DFCN/CLÄF3WUVCPVÄPÄ[C+O TWPFGP)GIGPUVGORGNCTCDKUEJG#WHUEJTKHV$C[T³OÄE$GNGFK[G  CWHFGO\YGKVGP5VÒEM/KVUVGORNGT Θ+KO-TGKU WPDGMCPPVG*GTMWPHV WPFI9KNUMK%QWPVGTOCTMU#pC)p9KNUMK 0GY6CDNG5 5VÒEM4&CUGTUVG5VÒEM/ÒP\GWPF)GIGPUVGORGNUGJTUEJÌP FCU\YGKVG/ÒP\GIGTKPI)GIGPUVGORGNUEJÌP



ex 829





ex 830

$QIC\*KUCT 5CPLCM )GNKDQNW   2CTC     WPF WPFGWVNKEJGU ,CJT FGU #DF CN/CLÄF   3WUVCPVÄPÄ[C+OTWPFGP)GIGPUVGORGNCTCDKUEJGT$WEJUVCDGD³ ÒDGT&CVWO   #&  WPFI9KNUMK%QWPVGTOCTMU#pCWPFD9KNUMK0GY6CDNG5  5VÒEM/ÒP\GPIGTKPIDKUUGJTUEJÌP )GIGPUVGORGNOGKUVUGJTUEJÌPFKG\YGKVG/ÒP\GIGTKPI)GIGPUVGORGNUEJÌP



2CTCWPF 'Z FGU #DFCN #\Ä\3WUVCPVÄPÄ[C+OTWPFGP)GIGPUVGORGNCTCDKUEJGT$WEJ UVCDG D³  ÒDGT &CVWO    #&     WPF  I 9KNUMK %QWPVGTOCTMU #   pCWPFD9KNUMK0GY6CDNG5 5VÒEM/ÒP\GPUEJÌPWPFUGJTUEJÌP )GIGPUVGORGNOGKUVUGJTUEJÌPFKG\YGKVG/ÒP\GIGTKPI)GIGPUVGORGNUEJÌP

 147


GEGENSTEMPEL

ex 831







832

2CTCWPFPKEJVNGUDCTFGU #DFCN/CLÄF3WUVCPVÄPÄ[C+OTWPFGP)GIGPUVGORGNCTCDKUEJGT $WEJUVCDGD³ ÒDGT&CVWO   #& WPFI9KNUMK%QWPVGTOCTMU#pCWPFD 9KNUMK0GY6CDNG5 5VÒEM4/ÒP\GUEJÌP)GIGPUVGORGNUEJÌPpUGJTUEJÌP FKG\YGKVG/ÒP\GIGTKPI)GIGPUVGORGNUEJÌP



2CTCFGU #DFCN #\Ä\3WUVCPVÄPÄ[C+OTWPFGP)GIGPUVGORGNITQDGTCTCDKUEJGT$WEJUVCDG D³  ÒDGT &CVWO    #&   I 9KNUMK %QWPVGTOCTMU # p 9KNUMK 0GY 6CDNG   5 4/ÒP\GPUEJÌP)GIGPUVGORGNUGJTUEJÌP



(KPFKMNK -Ì[Ò 5CPLCM )GNKDQNW   2CTC   FGU #DF CN/CLÄF 3WUVCPVÄPÄ[C +O 4GEJVGEM   #0 HÒT *CIKQU 0KMQNCQU FCTWPVGT KP MNGKPGTGO 4GEJVGEM   I 60& *CVKTC 5C[UK  5 9KNUMK%QWPVGTOCTMU)pC9KNUMK0GY6CDNG5QJPGIGPCWGTG<WUEJTGKDWPI  4/ÒP\GPUEJÌP)GIGPUVGORGNUGJTUEJÌP



834







148

835

'TGPMÌ[ 5CPLCM$KIC 2CTC!FGU #DFCN/CLÄF3WUVCPVÄPÄ[C+P)TÌ­GFGTICP\GP/ÒP\G   # Γ HÒT *CIKQU )GQTIKQU  I 9KNUMK %QWPVGTOCTMU ) p 9KNUMK 0GY 6CDNG 5    44)GNQEJV/ÒP\GFWTEJªDGTRT·IWPIPWTKPIGTKPIGP5RWTGPGTMGPPDCT)GIGPUVGORGNUGJTUEJÌP



2CTCFGU #DFCN #\Ä\/KUT -CKTQ +P)TÌ­GFGTICP\GP/ÒP\G #ΓHÒT*CIKQU)GQT IKQUI9KNUMK%QWPVGTOCTMU)p9KNUMK0GY6CDNG5  44/ÒP\GFWTEJªDGTRT·IWPIPWTKPIGTKPIGP5RWTGPGTMGPPDCT)GIGPUVGORGNUGJTUEJÌP



836



833

ex 837

7PDGMCPPVG CTCDKUEJG )GIGPUVGORGN  2CTC   FGU #DF CN #\Ä\ 3WUVCPVÄPÄ[C   +PVTQRHGPHÌTOKIGT(CUUWPICTCD/QPQITCOOCWUFGP$WEJUVCDGPD³PÑPF³NM³H C[PFCTKPFKG ,CJTGU\CJN  I9KNUMK%QWPVGTOCTMU#+p9KNUMK0GY6CDNG5  4/ÒP\GUEJÌP)GIGPUVGORGNUGJTUEJÌP



2CTCFGU #DFCN/CLÄFWPFFGU #DFCN #\Ä\3WUVCPVÄPÄ[C+PTWPFGT(CUUWPICTCD FTGKHCEJGT$WEJUVCDGF³NFKG(CUUWPIQDGPWPFWPVGPFWTEJLG\YGK'KPMGTDWPIGPCWUIG\CEMVWPF I9KNUMK%QWPVGTOCTMU#+p9KNUMK0GY6CDNG5  5VÒEM4/ÒP\GPUEJÌPWPFUGJTUEJÌP)GIGPUVGORGNUGJTUEJÌP




GEGENSTEMPEL

838

839



839

2CTCFGU #DFCN/CLÄF3WUVCPVÄPÄ[C+PQXCNGT(CUUWPICTCDOWS³DKN 'PVURTGEJWPI-QO RGPUCVKQP CO#XGTUTCPFKPFGT/KVVGFGU4GXGTUGKPUVGTPHÌTOKIGT5VGORGNI9KNUMK%QWPVGT OCTMU#p9KNUMK0GY6CDNG5 44/ÒP\GWPF)GIGPUVGORGNUGJTUEJÌP



&KG XQP 9KNUMK WPF 2WKP XGTVTGVGPG .GUWPI OCS³O 1TV #OV  YKTF FWTEJ FKG MNCTGP 5VGORGN FGU XQTNKGIGPFGP   'ZGORNCTUMQTTKIKGTVYGNEJGXGTFGWVNKEJGPFCUUCPUVGNNGFGUOÄOCO'PFG\YGK$WEJUVCDGP\WNGUGPUKPF#W­GTFGO UEJGKPGPGJGT\YGKCNUGKPFKCMTKVKUEJGT2WPMVWPVGTFGOXQTNGV\VGP$WEJUVCDGP\WUVGJGPUQFCUUCWEJGKPGUKPPHTGKG .GUWPIOCS³ KNOCS³[KN\WGTY·IGPKUV



.GUDQU#MTCUK2CTCFGU #DFCN #\Ä\3WUVCPVÄPÄ[C+PTWPFGT(CUUWPI#ΠHÒT*CIKC2C TCUMGXKUQYKGGKP\YGKVGTPKEJVKFGPVKHK\KGTVGTITKGEJKUEJGT)GIGPUVGORGNI9KNUMK%QWPVGTOCTMU )p9KNUMK0GY6CDNG5 4/ÒP\GUEJÌP)GIGPUVGORGNUGJTUEJÌP

ex 840







ex 841



ex 842

.GUDQU8CUKNKMC2CTC!FGU #DFCN/CLÄFWPFWPF2CTCFGU #DFCN #\Ä\3WUVCPVÄPÄ[C+PQXCNGT(CUUWPI$#ΣUQYKGCWHFGPDGKFGP2CTC5VÒEMGPGKP\YGKVGT)GIGP UVGORGNΠHÒT2NQOCTK.GUDQUWPFI9KNUMK%QWPVGTOCTMU)p9KNUMK0GY 6CDNG5 5VÒEM&KGGTUVGPDGKFGP/ÒP\GPUEJÌP)GIGPUVGORGNUEJÌPpUGJTUEJÌP 2CTCUGJTUEJÌPOKVUEJYCEJGO)GIGPUVGORGN



.GUDQU8CVQWUC2CTCWPFFGU #DFCN/CLÄF3WUVCPVÄPÄ[C#WHFGOGTUVGP5VÒEM\YGK )GIGPUVGORGN C  KO 4GEJVGEM $6Σ WPF D  KO 3WCFTCV $ CWH FGO \YGKVGP PWT )GIGPUVGORGN D   WPFI9KNUMK%QWPVGTOCTMU)ppCWPFpD9KNUMK0GY6CDNG5  5VÒEM4/ÒP\GPUEJÌP)GIGPUVGORGNUEJÌPWPFUGJTUEJÌP



.GUDQU8TKUUC2CTCWPF:FGU #DFCN/CLÄF3WUVCPVÄPÄ[C,GYGKNU\YGK)GIGPUVGORGNC  KO4GEJVGEM$2WPFD <ΠHÒT<QQFQEJQU2GIGFGT-KTEJGPIGOGKPFGXQP8TKUUCWPFI 9KNUMK%QWPVGTOCTMU)pWPFp9KNUMK0GY6CDNG5WPF  5VÒEM/ÒP\GPUGJTUEJÌPWPFUEJÌP)GIGPUVGORGNUGJTUEJÌP

 149


GEGENSTEMPEL

ex 843







ex 845

844

.GUDQU'TGUQU2CTCFGU #DFCN/CLÄFWPFFGU #DFCN #\K\3WUVCPVÄPÄ[C+O 3WCFTCV '2Σ/ HÒT 6CTKHKGTWPI \W  /CLKFK[G4K[CN WPF KO 4GEJVGEM #TCD *GTGUG  HÒT    *  WPF  I 9KNUMK %QWPVGTOCTMU ) pC WPF # pC WPF pD 9KNUMK 0GY   6CDNG5WPFH  5VÒEM/ÒP\GPUGJTUEJÌPWPFUEJÌPOKVUVCTMGP4CPFHGJNGTP)GIGPUVGORGNUGJTUEJÌP  2CTC   FGU #DF CN/CLÄF 3WUVCPVÄPÄ[C +O 3WCFTCV '2Σ/ HÒT 6CTKHKGTWPI \W   /CLKFK[G4K[CNWPFKO4GEJVGEM#TCD*GTGUG  HÒT*WPF\WU·V\NKEJGT)GIGPUVGORGN- Λ XQP-CNNQPKI9KNUMK%QWPVGTOCTMU)pC)pDWPF#pC9KNUMK0GY6CDNG5 WPF /ÒP\GUEJÌP)GIGPUVGORGNUGJTUEJÌP 2CTCFGU #DFCN/CLÄFWPF!FGU #DFCN #\Ä\3WUVCPVÄPÄ[C+O3WCFTCV'2Σ/ HÒT 6CTKHKGTWPI \W  /CLKFK[G4K[CN WPF KO 4GEJVGEM #TCD *GTGUG   HÒT  * WPF \WU·V\   NKEJGT )GIGPUVGORGN #* KO 1XCN WPDGUVKOOV .GUDQU  CWH FGT \YGKVGP /ÒP\G  WPF    I 9KNUMK %QWPVGTOCTMU ) pC ) p WPF # pC WPF D 9KNUMK 0GY 6CDNG 5     WPF 5VÒEM/ÒP\GPUEJÌP)GIGPUVGORGNUGJTUEJÌP







846

ex 847





150

ex 847

.GUDQU#IKCUQU QFGT#UQOCVQU 2CTC:FGU #DFCN/CLÄF3WUVCPVÄPÄ[C1JPG'KPHCUUWPI # 6ÒDGT<KGTNGKUVGXGTOWVNKEJHÒT*CIKCU6TKCUFGT-KTEJGXQP#IKCUQUFC\WFKGTGIGNO·­KIFKGUGP 5VGORGN DGINGKVGPFGP /CTMGP -TGW\ WPF GKP Θ·JPNKEJGU 5[ODQN  I 9KNUMK %QWPVGTOCTMU   )pC)pWPF#pCWPFD9KNUMK0GY6CDNG5WPF  /ÒP\GUEJÌP)GIGPUVGORGNUGJTUEJÌP .GUDQU -CNNQPK  2CTC   FGU #DF CN/CLÄF WPF   FGU #DF CN #\Ä\ 3WUVCPVÄPÄ[C   +O 4GEJVGEM - Λ CWH FGO \YGKVGP 5VÒEM OKV )GIGPUVGORGN KO CWUIG\CEMVGP 4WPF CTCD /GMVGD  

5EJWNG  FGT OGJTHCEJ KP -QODKPCVKQP OKV )GIGPUVGORGNP XQP -CNNQPK PCEJIGYKGUGP KUV  WPF   I9KNUMK%QWPVGTOCTMU)pDWPF#p9KNUMK0GY6CDNG5WPF  5VÒEM/ÒP\GPUEJÌPWPFUGJTUEJÌP)GIGPUVGORGNUGJTUEJÌP






GEGENSTEMPEL

ex 848







ex 849

850

.GUDQU -NKQ  2CTC  ! WPF ! FGU #DF CN/CLÄF 3WUVCPVÄPÄ[C 1JPG 'KPHCUUWPI -Λ   WPFI9KNUMK%QWPVGTOCTMU)p9KNUMK0GY6CDNG5  5VÒEM&CU\YGKVG5VÒEMGVYCUUEJÒUUGNHÌTOKIIGUEJNCIGP /ÒP\GPIGTKPIGTJCNVGP)GIGPUVGORGNUGJTUEJÌP



.GUDQU -QWTPGNC  2CTC   WPF  FGU #DF CN #\Ä\ 3WUVCPVÄPÄ[C +P UEJNÒUUGNNQEJHÌTOKIGT   'KPHCUUWPI #+- HÒT FKG *CIKQU ,QJCPPGU-KTEJG KP -QWTPGNC UQYKG CNU /KVUVGORNGT Π16   HÒT2QVCOQUWPFMNGKPGT6WIJTCUVGORGNWPFI9KNUMK%QWPVGTOCTMU)p)pCWPFF WPF#6p9KNUMK0GY6CDNG5H  5VÒEM/ÒP\GPUEJÌPWPFIWVGUUGJTUEJÌP)GIGPUVGORGNUGJTUEJÌP



.GUDQU .KUXQTK  2CTC   FGU #DF CN/CLÄF 3WUVCPVÄPÄ[C +O 4WPF Λ$2 HÒT .KUDQTKQP   I9KNUMK%QWPVGTOCTMU)p9KNUMK0GY6CDNG5  4/ÒP\GUEJÌP)GIGPUVGORGNUGJTUEJÌP



ex 852

ex 851





ex 851

.GUDQU/CPVCOCFQU2CTC 'Z WPFFGU #DFCN/CLÄF3WUVCPVÄPÄ[C+O4GEJVGEM 6Ξ:HÒT6CZKCTEJGU 'T\GPIGN CNU-KTEJGPRCVTQPXQP/CPVCOCFQUWPFI9KNUMK %QWPVGTOCTMU)p9KNUMK0GY6CDNG5  5VÒEM/ÒP\GPUEJÌPWPFUGJTUEJÌP)GIGPUVGORGNUEJÌPWPFUGJTUEJÌP



 2CTC   FGU #DF CN/CLÄF WPF  2CTC   FGU #DF CN #\Ä\ 3WUVCPVÄPÄ[C   +O 4GEJVGEM 6Ξ: HÒT 6CZKCTEJGU 'T\GPIGN  CNU -KTEJGPRCVTQP XQP /CPVCOCFQU FCU GTUVG5VÒEMOKV GKPGOYGKVGTGPCTCDKUEJGP)GIGPUVGORGNXQP;WPFCWPFGKPGTYGKVGTGPRTKOKVKXGKPIGUEJNCIGPGP/CTMG #Π#  WPF  I 9KNUMK %QWPVGTOCTMU )p WPF )p # p 9KNUMK 0GY 6CDNG   5 5VÒEM/ÒP\GPUEJÌPWPFUGJTUEJÌP)GIGPUVGORGNUEJÌPWPFUGJTUEJÌP

 151


GEGENSTEMPEL

853







854

ex 855

.GUDQU/GICNQJQTK2CTCFGU #DFCN #\Ä\3WUVCPVÄPÄ[C+O1XCNOKV'TYGKVGTWPIPCEJ WPVGP/:HÒT/GICNQ%JQTKI9KNUMK%QWPVGTOCTMU)p8CT9KNUMK0GY6CDNG5 4/ÒP\GWPF)GIGPUVGORGNUGJTUEJÌP



.GUDQU /GUQVQRQU  2CTC   FGU #DF CN/CLÄF 3WUVCPVÄPÄ[C +O 4WPF CTCD   /GUG6QRW ! I9KNUMK%QWPVGTOCTMU#p9KNUMK0GY6CDNG5  5GJTUGNVGPDGUQPFGTUKPFKGUGT'TJCNVWPI/ÒP\GWPF)GIGPUVGORGNUGJTUEJÌP



2CTCWPNGUDCTGU,CJTFGU #DFCN/CLÄFWPF2CTCFGU #DFCN #\Ä\3WUVCPVÄPÄ[C #WHFGOGTUVGP5VÒEMKO4WPFCTCD/ÄUG6QRW  UQYKGGKPITKGEJKUEJGT)GIGPUVGORGNFGUUGNDGP 1TVUOKV:/KPXGT\KGTVGO4GEJVGEMCWHFGO\YGKVGP5VÒEMPWTFKGUGTITKGEJKUEJG)GIGPUVGORGN WPFI9KNUMK%QWPVGTOCTMU#pWPF)p9KNUMK0GY6CDNG5  5VÒEM42CTCIGYGNNVOKV4CPFTKUU/ÒP\GPUQPUVUEJÌPFKG)GIGPUVGORGNUEJÌPWPFUGJTUEJÌP



856

ex 857



.GUDQU /[VKNGPG /KFKNNK   2CTC   FGU #DF CN #\Ä\ 3WUVCPVÄPÄ[C +P NKPFGPDNCVVHÌTOKIGT   'KPHCUUWPICTCD/KFKNNK$GNGFK[GUK  UQYKGGKPITQ­GTTWPFGT6WIJTCUVGORGNGDGPHCNNUCWU.GUDQU I9KNUMK%QWPVGTOCTMU#pWPF#6p9KNUMK0GY6CDNG5  44/ÒP\GWPF)GIGPUVGORGNUGJTUEJÌP





.GUDQU 2CRCFQU  2CTC    WPFGKPWPNGUDCTGU,CJTFGU #DFCN/CLÄF3WUVCPVÄPÄ[C +PTWPFGTGT'KPHCUUWPICTCD2³R³UNÄUQYKGGKPGMNGKPGSWCFTCVKUEJG-QPVTQNNOCTMGCWHFGO'KPGTFGT ,CJTGU\CJN FKG PWT KP 2CRRCFQU XQTMQOOV WPF CWH FGO 5VÒEM FGU  4GIKGTWPIULCJTGU HGJNV   WPFI9KNUMK%QWPVGTOCTMU#pWPF)5p9KNUMK0GY6CDNG5 5VÒEM4'KP5VÒEMOKVCNVIGUVQRHVGO.QEJ/ÒP\GPIGTKPIGTJCNVGPDKUUGJTUEJÌP )GIGPUVGORGNUGJTUEJÌP



152


GEGENSTEMPEL

ex 858



.GUDQU2GVTC2CTCFGU #DFCN/CLÄFWPF2CTCFGU #DFCN #\Ä\3WUVCPVÄPÄ[C +O4GEJVGEM Π62FGTCDYGKEJGPFG)GIGPUVGORGNCWH2CTCQJPG-TGW\DGKFGCWHFKG4ÒEMUGKVG IGUEJNCIGPWPFI9KNUMK%QWPVGTOCTMU)pWPF8CTKCPVG9KNUMK0GY6CDNG5 5VÒEM4/ÒP\GPWPF)GIGPUVGORGNUGJTUEJÌP

ex 859







860



ex 861

.GUDQU2QNKEJPKVQU2CTCFGU #DFCN #\Ä\WPF2CTCFGU #DFCN/CLÄF3W UVCPVÄPÄ[C+PXGT\KGTVGO4GEJVGEMΠ+:HÒT2QNKEJPKVQUFCPGDGPCWHFGO2CTC5VÒEMGKPITQ­GTTWPFGT )GIGPUVGORGNOKV6WIJTCCWH2CTCGKPMNGKPGT)GIGPUVGORGNOKV6WIJTCWPFPQEJGKP5VGORGNXQP 2QVCOQUCWHFGT4ÒEMUGKVGFGT/ÒP\GWPFI9KNUMK%QWPVGTOCTMU)pp#6p WPF#6p9KNUMK0GY6CDNG5 5VÒEM4/ÒP\GPUEJÌP)GIGPUVGORGNUGJTUEJÌP



.GUDQU 2KIK  2CTC   FGU #DF CN/CLÄF 3WUVCPVÄPÄ[C 1JPG 'KPHCUUWPI /QPQITCOO FGU   ITKGEJ 1TVUPCOGPU WPF -QPVTQNNOCTMG  I 9KNUMK %QWPVGTOCTMU ) p ) 5p   9KNUMK0GY6CDNG5 45EJÌP



.GUDQU5KITK2CTCWPFWPMNCTFGU #DFCN #\Ä\2CTCWPFFGU #DFCN/CLÄF 3WUVCPVÄPÄ[C +O 4WPF Σ CWH FGO \YGKVGP WPF FTKVVGP 5VÒEM XGTUEJKGFGPG UEJYGT GTMGPPDCTG /KV   UVGORNGTWPFI9KNUMK%QWPVGTOCTMU)pWPFp)p!9KNUMK 0GY6CDNG5 5VÒEM4&CU\YGKVG5VÒEMIGTKPIUQPUVUEJÌPpUGJTUEJÌP



862



.GUDQU 5MCNQJQTK  2CTC   FGU #DF CN #\Ä\ 3WUVCPVÄPÄ[C +O CWUIG\CEMVGP *QEJQXCN   Σ:#Γ HÒT 5MCNQ -JQTK *CIKQU )GQTIKQU   I 9KNUMK %QWPVGTOCTMU )    9KNUMK0GY6CDNG5 5GJTUEJÌP

 153


GEGENSTEMPEL

ex 863



.GUDQU6GNQPKC #PVKUUC 2CTCFGU #DFCN/CLÄFFGU #DFCN #\Ä\3W UVCPVÄPÄ[C +P IG\CEMVGT TGEJVGEMKIGT 'KPHCUUWPI 6'Λ    WPF  I   9KNUMK%QWPVGTOCTMU)p9KNUMK0GY6CDNG5  5VÒEM/ÒP\GPUEJÌPWPFUGJTUEJÌP)GIGPUVGORGNUGJTUEJÌP

ex 864









154

865

 2CTC  WPFGWVNKEJGU ,CJT FGU #DF CN/CLÄF    'Z  FGU #DF CN #\Ä\ 3WUVCPVÄPÄ[C   +PIG\CEMVGTTGEJVGEMKIGT'KPHCUUWPI6'ΛWPFI9KNUMK%QWPVGTOCTMU)p 9KNUMK0GY6CDNG5 5VÒEM/ÒP\GPUEJÌPWPFUGJTUEJÌP)GIGPUVGORGNUGJTUEJÌP



.GUDQU2JVGTQWPVC2CTCFGU #DFCN #\Ä\3WUVCPVÄPÄ[C1JPG'KPHCUUWPIΦ62WPFMNGKPGTGT 5VGORGNOKVFGPUGNDGP$WEJUVCDGPWPVGTGKPGO-TGW\FCTWPVGT&CVWOI9KNUMK%QWPVGT OCTMU)pWPFp9KNUMK0GY6CDNG5  44/ÒP\GUEJCTHIGTGKPKIVWPFUEJÌP)GIGPUVGORGNUGJTUEJÌP



ex 867





866

ex 868

 2CTC   FGU #DF CN/CLÄF 3WUVCPVÄPÄ[C +P 3WCFTCV   Φ62   I   9KNUMK%QWPVGTOCTMU)p FKGUGU'ZGORNCT! 9KNUMK0GY6CDNG5  8QPCNNGTITÌ­VGT5GNVGPJGKV5GJTUEJÌP



.GUDQU 2QVCOQU $G\KTM 2NQOCTK   2CTC   WPF  FGU #DF CN/CLÄF 3WUVCPVÄPÄ[C   +P FTGKUGKVKIGT 'KPHCUUWPI Π16 \WU·V\NKEJ CO #XGTUTCPF MNGKPGT KPMWUGT 6WIJTCUVGORGN  WPF   I9KNUMK%QWPVGTOCTMU)p#6p9KNUMK0GY6CDNG5 5VÒEM5GJTUEJÌP



 2CTC WPFWPNGUDCTFGU #DFCN/CLÄFFGU #DFCN #\Ä\3WUVCPVÄPÄ[C+PQXCNGT 'KPHCUUWPI ΠΠ FCU \YGKVG 5VÒEM OKV \YGK YGKVGTGP WPDGUVKOOVGP )GIGPUVGORGNP    WPFI9KNUMK%QWPVGTOCTMU)pC)p)p#6p9KNUMK0GY6CDNG5  5VÒEM5EJÌPWPFUGJTUEJÌP




GEGENSTEMPEL

ex 869









ex 871

ex 870

ex 872

 2CTC  ,CJT WPNGUDCT FGU #DF CN/CLÄF    'Z  FGU #DF CN #\Ä\ 3WUVCPVÄPÄ[C   +PFTGKUGKVKIGT'KPHCUUWPIΠ16\WU·V\NKEJCO#XGTUTCPFC MNGKPGTKPMWUGT6WIJTCUVGORGNWPFD ΔΠCNU 5VGORGNFGUNVGUVGPTCVGUXQP2NQOCTKWPFI9KNUMK%QWPVGTOCTMU)p)p #6p9KNUMK0GY6CDNG5  5VÒEM5EJÌPWPFUGJTUEJÌPFCU\YGKVG5VÒEMDGK/ÒP\GWPF)GIGPUVGORGNÒDGTFWTEJUEJPKVVNKEJ



 2CTC  ,CJT WPNGUDCT FGU #DF CN/CLÄF    'Z  FGU #DF CN #\Ä\ 3WUVCPVÄPÄ[C   #WHFGOGTUVGP)GIGPUVGORGNΠΠCWHFGO\YGKVGPWPFFTKVVGP)GIGPUVGORGNKPFTGKUGKVKIGT'KPHCU UWPIΠ16WPF\WU·V\NKEJCO#XGTUTCPFMNGKPGTKPMWUGT6WIJTCUVGORGNWPFI9KNUMK %QWPVGTOCTMU)p)p#6p9KNUMK0GY6CDNG5 5VÒEM5EJÌP



2CTCWPFWPNGUDCTGU,CJTFGU #DFCN/CLÄF3WUVCPVÄPÄ[C)GIGPUVGORGNKPFTGKUGKVKIGT'KP HCUUWPI Π16 WPF \WU·V\NKEJ CO #XGTUTCPF MNGKPGT KPMWUGT 6WIJTCUVGORGN  WPF  I 9KNUMK   %QWPVGTOCTMU)p#6p9KNUMK0GY6CDNG5 5VÒEM5GJTUEJÌP



 2CTC   WPF FGU #DFCN/CLÄFFGU #DFCN #\Ä\3WUVCPVÄPÄ[C#O#XGTUTCPF ITQ­GT KPMWUGT 6WIJTCUVGORGN   WPF  I 9KNUMK %QWPVGTOCTMU # 6p   9KNUMK0GY6CDNG5 5VÒEM5GJTUEJÌP



ex 873



 2CTC      FGU #DF CN/CLÄF   FGU #DF CN #\Ä\ 3WUVCPVÄPÄ[C   # O  # X G T U T C P F  I T Q ­ G T  K P M W U G T  6 W I J T CUVGORGN     WPF  I   9KNUMK%QWPVGTOCTMU#6p9KNUMK0GY6CDNG5 5VÒEM5GJTUEJÌP

ex 874







ex 875

2CTCFGU #DFCN/CLÄFWPF2CTCWPFFGU #DFCN #\Ä\3WUVCPVÄPÄ[C #O #XGTUTCPF ITQ­GT KPMWUGT 6WIJTCUVGORGN    WPF  I 9KNUMK %QWPVGTOCTMU   #6p9KNUMK0GY6CDNG5 5VÒEM5EJÌPWPFUGJTUEJÌP



 2CTC   WPF Z PKEJV GTMGPPDCT FGU #DF CN/CLÄF WPF  2CTC   FGU #DF CN #\Ä\   3WUVCPVÄPÄ[C #O #XGTUTCPF MNGKPGT KPMWUGT 6WIJTCUVGORGN    WPF  I   9KNUMK%QWPVGTOCTMU#6p9KNUMK0GY6CDNG5 5VÒEM/GKUVUEJÌP

 155


GEGENSTEMPEL

876







ex 877

ex 878

.GUDQU 2NQOCTK2KNOCT  2CTCFGU #DFCN/CLÄF3WUVCPVÄPÄ[C+OKVCVKXGT)GIGPUVGORGN PCEJ 8QTDKNF FGT 5VGORGN OKV CTCD 2ÄNO³T $GNGFK[GUK   I 9KNUMK %QWPVGTOCTMU # p   9KNUMK0GY6CDNG5 445GJTUEJÌP



2CTCWPFPKEJVNGUDCTFGU #DFCN/CLÄF3WUVCPVÄPÄ[C)GIGPUVGORGNKP$NCVVHQTO CTCD2ÄNO³T$GNGFK[GUKDGKO\YGKVGPDKUXKGTVGP5VÒEM\WUCOOGPOKVITKGEJ)GIGPUVGORGNPXQP 2QVCOQU   WPFI9KNUMK%QWPVGTOCTMU#p)pCWPFp 9KNUMK0GY6CDNG5 5VÒEM/GKUVUEJÌP



2CTCWPFFGU #DFCN/CLÄF3WUVCPVÄPÄ[C)GIGPUVGORGNKP$NCVVHQTOCTCD2ÄNO³T$GNG FK[GUKDGKOGTUVGP5VÒEM\WUCOOGPOKVITKGEJ)GIGPUVGORGNXQP2QVCOQUFCU\YGKVG5VÒEM OKV FGP ÒDNKEJGP -QPVTQNNUVGORGNP XQP 2NQOCTK Π WPF Λ IGIGPÒDGTNKGIGPF WPF ΔΠ    WPF  I 9KNUMK %QWPVGTOCTMU # p ) pE ) p )p WPF ) p 9KNUMK 0GY   6CDNG5 5VÒEM5GJTUEJÌP



879

ex 880





156

ex 880

2CTCWPNGUDCTGU,CJTFGU #DFCN/CLÄF3WUVCPVÄPÄ[C)GIGPUVGORGNKP$NCVVHQTOCTCD2ÄNO³T $GNGFK[GUK  \WUCOOGP OKV ITKGEJ )GIGPUVGORGN XQP 2NQOCTK   I 9KNUMK   %QWPVGTOCTMU#p)p9KNUMK0GY6CDNG5 5GJTUEJÌP



2CTCWPFWPNGUDCTFGU #DFCN/CLÄF 'Z FGU #DFCN #\Ä\3WUVCPVÄPÄ[C)GIGP UVGORGNKP$NCVVHQTOCTCD2ÄNO³T$GNGFK[GUKOKVFGPÒDNKEJGP-QPVTQNNUVGORGNPXQP2NQOCTKΠWPF ΛIGIGPÒDGTNKGIGPFWPFΔΠWPFI9KNUMK%QWPVGTOCTMU#pCWPFE )p)pWPF)p9KNUMK0GY6CDNG5  5VÒEM&CUGTUVG5VÒEMIGNQEJV/ÒP\GPIGTKPIGTJCNVGPWPFUEJÌP )GIGPUVGORGNUEJÌPWPFUGJTUEJÌP




GEGENSTEMPEL

ex 881



ex 883

ex 882

2CTCWPF:FGU #DFCN/CLÄFWPF2CTCFGU #DFCN #\Ä\3WUVCPVÄPÄ[C)GIGP UVGORGNKP$NCVVHQTOCTCD2ÄNO³T$GNGFK[GUK  WPFΔΠHÒTFGPNVGUVGPTCVXQP2NQOCTK\WU·V\NKEJ CWHFGOGTUVGP5VÒEM5VGORGNXQP2QVCOQUWPFMNGKPGTKPMWUGT6WIJTCUVGORGNWPFCWHFGO\YGKVGPFGT )GIGPUVGORGNXQP;WPFC*WPFI9KNUMK%QWPVGTOCTMU#pC)p )p#6p#p9KNUMK0GY6CDNG5  5VÒEM&CUFTKVVG5VÒEMIGNQEJV/ÒP\GPOGKUVUEJÌP)GIGPUVGORGNUEJÌPWPFUGJTUEJÌP





2CTCWPFFGU #DFCN/CLÄF3WUVCPVÄPÄ[C)GIGPUVGORGNKP$NCVVHQTOCTCD2ÄNO³T $GNGFK[GUK  OKVFGPÒDNKEJGP-QPVTQNNUVGORGNPXQP2NQOCTKΠWPFΛIGIGPÒDGTNKGIGPFWPFΔΠ WPFI9KNUMK%QWPVGTOCTMU#pCWPFF)p)pWPF)p 9KNUMK0GY6CDNG5  5VÒEM/ÒP\GPUEJÌPWPFUGJTUEJÌP)GIGPUVGORGNUGJTUEJÌPWPFKOOGTMNCT





2CTCFGU #DFCN/CLÄFWPF2CTCFGU #DFCN #\Ä\3WUVCPVÄPÄ[C)GIGPUVGORGN KP $NCVVHQTO CTCD 2ÄNO³T $GNGFK[GUK   WPF FGO -QPVTQNNUVGORGN ΔΠ WPFI9KNUMK %QWPVGTOCTMU#pDWPFE)p9KNUMK0GY6CDNG5H  5VÒEM/ÒP\GPUEJÌPWPFUGJTUEJÌP)GIGPUVGORGNUGJTUEJÌP



885

884





884

 2CTC   WPF  2CTC   FGU #DF CN/CLÄF  2CTC  FGU #DFCN #\Ä\3W UVCPVÄPÄ[CC ; ! D ITQ­GT6WIJTCUVGORGNE PWT-QPVTQNNOCTMGPXQP2NQOCTKCWHFGPDGKFGP5GKVGP PKEJV IGPCW IGIGPÒDGTNKGIGPF   WPF  I 9KNUMK %QWPVGTOCTMU ) )p   )pC/p#6p9KNUMK0GY6CDNG  /ÒP\GPUGJTUEJÌP)GIGPUVGORGNXQT\ÒINKEJ



.GUDQU -NCRCFQU  2CTC   FGU #DF CN #\Ä\ 3WUVCPVÄPÄ[C )GIGPUVGORGN KO 4WPF CTCD   3N³R³F³WPFKO4GXITKGEJ5VGORGNKO4WPF-Λ#Π#I9KNUMK%QWPVGTOCTMU#p9KNUMK 0GY6CDNG#p)p5  8QPITQ­GT5GNVGPJGKV/ÒP\GPUEJÌP)GIGPUVGORGNUGJTUEJÌP



9KNUMKXGT\GKEJPGVMGKPGKP-NCRCFQUIGIGPIGUVGORGNVGP2CTCWPFCWEJCWH2CTCUKPFFKG5VGORGNCWUFKGUGO &QTHUGJTUGNVGP

157


GEGENSTEMPEL

887

886





.GUDQU -CVQ *QTKQ  2CTC  ,CJT WPNGUDCT FGU #DF CN/CLÄF 3WUVCPVÄPÄ[C )GIGPUVGORGN KO   1XCN-:##HÒTFKG#PFTGCU-KTEJGKP-CVQ*QTKQFKGUGT5VGORGNÒDGTGKPGPMNGKPGP6WIJTC5VGORGN IGRT·IVI9KNUMK%QWPVGTOCTMU)p9KNUMK0GY6CDNG5  4/ÒP\GKO#XGTUCDIGUEJNKHHGP)GIGPUVGORGNUGJTUEJÌP



.GOPQU4QOCPQW2CTC,CJTWPNGUDCTFGU #DFCN/CLÄF3WUVCPVÄPÄ[C)GIGPUVGORGNKPWPDG UVKOOVGT 'KPHCUUWPI #Γ- HÒT FKG -QPUVCPVKPU-KTEJG  I 9KNUMK %QWPVGTOCTMU ) p 9KNUMK   0GY6CDNG5 4/ÒP\GUEJÌP)GIGPUVGORGNUGJTUEJÌP



ex 888



6JCUQU4CJQPK 8WTICTQ 2CTCWPFWPNGUDCTGU,CJTFGU #DFCN/CLÄF3WUVCPVÄPÄ[C)G IGPUVGORGNFGT-KTEJGPIGOGKPFGFGTJN,WPIHTCWKO4WPFGKP-TGW\KPFGP9KPMGNPITKGEJ'$-Θ D\Y4GKJGPHQNIGQDGPWPFWPVGPXGTVCWUEJVWPFI9KNUMK%QWPVGTOCTMU)pWPF) p9KNUMK0GY6CDNG5WPF 5VÒEM45GJTUEJÌP

889







158

890



891

2CTCFGU #DFCN #\Ä\/KUT -CKTQ )GIGPUVGORGNFGT-KTEJGPIGOGKPFGFGTJN,WPIHTCWKO 4WPF GKP -TGW\ KP FGP 9KPMGNP ITKGEJ '$  -Θ  I 9KNUMK %QWPVGTOCTMU ) p   9KNUMK0GY6CDNG5 44#WHFGO#XIGTKPIGKPCMVKXG)TÒPURCPHNGEMGP UGJTUEJÌP)GIGPUVGORGNPWT\WTQDGTGP*·NHVGCWUIGRT·IV



6JCUQU2CPCIKC2CTCFGU #DFCN #\Ä\3WUVCPVÄPÄ[C)GIGPUVGORGNFGT-KTEJGPIGOGKPFG FGTJN,WPIHTCWKO#EJVGEMΚΘ/ΠΝΣI9KNUMK%QWPVGTOCTMU)p9KNUMK0GY6CDNG 5 44/ÒP\GWPF)GIGPUVGORGNUGJTUEJÌP



2CTC,CJTPKEJVNGUDCTFGU #DFCN/CLÄF3WUVCPVÄPÄ[C)GIGPUVGORGNFGT-KTEJGPIGOGKPFGFGT JN,WPIHTCWKO4GEJVGEM\WU·V\NKEJ)GIGPUVGORGNFGT)GQTIUWPF#RQUVGNMKTEJGPKP-C\CXKVK2TKPQUCWH 6JCUQUI9KNUMK%QWPVGTOCTMU)p)pWPF)p9KNUMK0GY6CDNG5 4)TÒPURCPHNGEMGPCO4CPF KPCMVKX /ÒP\GUEJÌP)GIGPUVGORGNUGJTUEJÌP FQEJWPXQNNUV·PFKICWUIGRT·IV




GEGENSTEMPEL

892



6JCUQU2QVCOKC2CTCFGU #DFCN #\Ä\3WUVCPVÄPÄ[C&QRRGNVGKPIGUEJNCIGPGT)GIGPUVGO RGN FGT -KTEJGPIGOGKPFG FGT JN ,WPIHTCW Π':Π FGU &QTHGU 2QVCOKC KO 4GEJVGEM  I 9KNUMK   %QWPVGTOCTMU)p9KNUMK0GY6CDNG5  4/ÒP\GIGNQEJVUGJTUEJÌP)GIGPUVGORGNUGJTUEJÌPFQEJWPXQNNUV·PFKICWUIGRT·IV

893

894



895



6JCUQU6JGQNQIQU2CTCFGU #DFCN #\Ä\3WUVCPVÄPÄ[C)GIGPUVGORGNFGT-KTEJGPIGOGKPFG FGU JN &GOGVTKQU KO 4WPF # Δ  I 9KNUMK %QWPVGTOCTMU ) p 9KNUMK 0GY 6CDNG 5    4/ÒP\GIGTKPIGTJCNVGP)GIGPUVGORGNUGJTUEJÌP





6JCUQU -C\CXKVK  2CTC  WPNGUDCTGU ,CJT FGU #DF CN/CLÄF 3WUVCPVÄPÄ[C )GIGPUVGORGN FGT   #RQUVGN-KTEJG KO 4WPF -##   I 9KNUMK %QWPVGTOCTMU ) pC 9KNUMK 0GY 6CDNG   5 /ÒP\GIGTKPIGTJCNVGP)GIGPUVGORGNUEJÌP



6JCUQU-CNNKTCJK2CTCFGU #DFCN #\Ä\3WUVCPVÄPÄ[C)GIGPUVGORGNFGT&GOGVTKQU-KTEJG -CNNKTCJKKO4GEJVGEM-# ΔFCPGDGP/KVUVGORNGTFKG&GOGVTKQU-KTEJGKP6JGQNQIQU6JCUQU I9KNUMK%QWPVGTOCTMU)pWPF)p9KNUMK0GY6CDNG5  4/ÒP\GUEJÌP)GIGPUVGORGNUGJTUEJÌP





896

ex 897

ex 897



/C\GFQPKGP0KITKVC2CTCFGU #DFCN/CLÄF3WUVCPVÄPÄ[C+O4WPF0Σ HÒT0KITKVCKO 5CPLCM5GTTG\I9KNUMK%QWPVGTOCTMU)p9KNUMK0GY6CDNG5  44/ÒP\GWPF)GIGPUVGORGNUGJTUEJÌP





7PDGUVKOOVGITKGEJKUEJG5VGORGN2CTCWPF2CTCFGU #DFCN/CLÄF2CTC WPF2CTCFGU #DFCN #\Ä\3WUVCPVÄPÄ[C)TQ­GU#KP-QPVWTWPF I9KNUMK%QWPVGTOCTMU)p9KNUMK0GY6CDNG5  5VÒEM/ÒP\GPUEJÌPWPFUGJTUEJÌP)GIGPUVGORGNOGKUVUGJTUEJÌP

 159


GEGENSTEMPEL

ex 898



2CTCWPFWPF2CTCFGU #DFCN/CLÄF2CTCFGU #DFFCN #\Ä\ 3WUVCPVÄPÄ[C)TQ­GU#KP-QPVWTDGKOGTUVGP5VÒEMWPVGTUEJKGFNKEJG8GTUKQPGPCWH#XGTUWPF4GXGTU WPFI9KNUMK%QWPVGTOCTMU)p)p)p9KNUMK0GY6CDNG5H 5VÒEM&CUFTKVVG5VÒEMKO#XGTUCDIGUEJNKHHGPUQPUVUGJTUEJÌP)GIGPUVGORGNUGJTUEJÌP

ex 900





ex 900

 2CTC   WPF  2CTC   FGU #DF CN/CLÄF  2CTC   FGU #DF CN #\Ä Ä\ 3W   UVCPVÄPÄ[CC # /GKPGT/KEJCGNUMKTEJGD ΔΠWPDGMCPPVCDGTPKEJV2NQOCTK.GUDQUE  #: WPFI9KNUMK%QWPVGTOCTMU)p)p)p9KNUMK0GY6CDNG5  5VÒEM/ÒP\GPUEJÌP)GIGPUVGORGNUGJTUEJÌP



 2CTC   WPF  2CTC   FGU #DF CN/CLÄF 3WUVCPVÄPÄ[C C  QJPG 'KPHCUUWPI Π   D ΠΓ WPFI9KNUMK%QWPVGTOCTMU)p)p9KNUMK0GY6CDNG5  5VÒEM/ÒP\GPIGTKPIWPFUGJTUEJÌP)GIGPUVGORGNUEJÌP



ex 901



ex 899



ex 902

ex 903

2CTC!WPF2CTCFGU #DFCN/CLÄFWPF2CTCFGU #DFCN #\Ä\ 3WUVCPVÄPK[C +P DTGKVGT 5EJKNFHQTO 2 /    WPF  I 9KNUMK %QWPVGTOCTMU )   p9KNUMK0GY6CDNG5  5VÒEM/ÒP\GPUEJÌPWPFUGJTUEJÌP)GIGPUVGORGNUEJÌPWPFUGJTUEJÌP





2CTCWPF2CTC XGTUEJKGFGPG WPFFGU #DFCN/CLÄF3WUVCPVÄPK[CC Π! D  : 0 ITQD GKPIGUEJNCIGP E  WPFGWVNKEJG ITQDG 'KPUEJN·IGO F  # 1TPCOGPV *      WPFI9KNUMK%QWPVGTOCTMUWC)p FKGUGU'Z! 9KNUMK0GY6CDNG5  5VÒEM/ÒP\GPUEJÌP)GIGPUVGORGNUEJÌPWPFUGJTUEJÌP





2CTCWPF2CTC!FGU #DFCN/CLÄF3WUVCPVÄPK[CUQYKG2CTC/KUTC 

XGTOWVNKEJOQFGTPG5VGORGN *CNDOQPFKO-TCP\WPF22D UEJTCHHKGTVGT5VGTPE WPFGWVNKEJGITQDG 'KPUEJN·IGXKGNNGKEJVCTCDKO1XCN!WPFI9KNUMK%QWPVGTOCTMUp9KNUMK0GY 6CDNGp 5VÒEM/ÒP\GPUEJÌPWPFUGJTUEJÌP)GIGPUVGORGNUEJÌPWPFUGJTUEJÌP



160


TOKEN UND JETONS

ex 904





ex 905

 2CTC   WPF  2CTC  WPMNCT  2CTC   FGU #DF CN/CLÄF 3WUVCPVÄPK[C UQYKG   2CTC 'Z 2CTCFGU #DFCN #\Ä\WPF2CTCFGU#DFWN*COKF++&K XGTUG -TGW\ WPF UVGORGN        WPF  I 9KNUMK   %QWPVGTOCTMU)%p)%p)%p)5p)0p9KNUMK0GY6CDNGHH  5VÒEM/ÒP\GPIGTKPIDKUUGJTUEJÌP)GIGPUVGORGNOGKUVUGJTUEJÌP



 2CTC    2CTC    2CTC FGU #DFCN/CLÄF/CLÄF3WUVCPVÄPK[CWPF  'Z 2CTCFGU#DFWN#\K\&KXGTUG1TPCOGPVUVGORGNGKP5VÒEMOKV*CNDOQPFOKV5VGTPWPF )GIGPUVGORGN       WPF  I 9KNUMK %QWPVGTOCTMU ) 5p   )5p)5p)5p9KNUMK0GY6CDNGHH 5VÒEM/GKUVUGJTUEJÌP



907 906

906





#VJ[TC $Ò[ÒM %GMOGEG 8KNC[GV +UVCPDWN   2CTC   FGU #DF CN #\Ä\ 3WUVCPVÄPÄ[C &GT   CTCD1TVUPCOGKO4GEJVGEMI9KNUMK%QWPVGTOCTMU#p9KNUMK0GY6CDNG5  4/ÒP\GUGJTUEJÌP)GIGPUVGORGNXQT\ÒINKEJ  2CTC   FGU #DF CN #\Ä\ 3WUVCPVÄPÄ[C )GIGPUVGORGN KP WPDGUVKOOVGT 'KPHCUUWPI #  MN    6JGVC HÒT#VJWTCUI9KNUMK%QWPVGTOCTMU)p9KNUMK0GY6CDNG5  4/ÒP\GUGJTUEJÌP)GIGPUVGORGNPWTJCNDGKPIGUEJNCIGP





ex 908

'KPG5COONWPIXQP6QMGPWPF,GVQPU 

5COONWPIXQP6QMGPFGUQUOCPKUEJGP4GKEJGUXQTYKGIGPFCWU#NIGTKGPWPFIGIGPIGUVGORGNVG,GVQPU  WPFI 5VÒEM5GJTUEJÌPWPFDGUUGT

 161


LITERATURVERZEICHNIS #TVWM+#/ $/% +0%'1ø7..#4+ KP  %CI (D (GPKPC FʼnJKUVQKTG -/ ¤NEGT     2COWM 2GTG 5NI(QPTQDGTV (QPTQDGTV UEJGP 9KNUMK 9KNUMK0GY6CDNG ;CRÁ-TGFK %QKPU 

 #TVWM+WPF%+UVCPDWN#TMGQNQLK/Ò\GNGTKVGĤJKTFGMK+UN³OÄUKMMGNGTMCVCNQùW$F+++UVCPDWN  %CVCNQIWGQH1TKGPVCN%QKPUKPVJG$TKVKUJ/WUGWO.QPFQPHH  Ă0%'1ø7..#4+5CDCJCVVKP5WNVCP#DFÒNOGEKF*CP&ÌPGOKPKP;GPK$WNWPCPĂMK-WTWĤNWM2CTCUÁ  $ÒNVGP  •#ø.#4105QP2CFKĤCJ\COCPÁPFCDCUÁNCPDÒVÒP1UOCPNÁOCFGPKRCTCNCTÁ Ă\OKT   (TKGFDGTI4)QNF%QKPUQHVJG9QTNF#WHNCIG75#  (GPKPC#.GUOQPPCKGUFGNCT¾IGPEGFG6WPKUUQWUNGU* WUC[PKFGU¾VWFGUFGPWOKUOCVKSWGGV   OQP¾VCKTG  6WPKU  -TCWUG%./KUJNGT%5VCPFCTF%CVCNQIWGQH9QTNF%QKPU#MVWGNNG#WHNCIG  ¤NEGT%5WNVCP#DFÒNOGEKFFGXTK1UOCPNÁOCFGPÄRCTCNCTÁ+UVCPDWN  &GTU5WNVCP#DFÒNC\K\*CPFGXTK1UOCPNÁOCFGPÄRCTCNCTÁ+UVCPDWN  &GTU5WNVCP/WTCF8XG5WNVCP#DFÒNJCOKF++FÌPGOK1UOCPNÁOCFGPKRCTCNCTÁ+UVCPDWN  &GTU5WNVCP/GJOGF4GĤCFXG5WNVCP/GJOGF8CJFGVVKP&ÌPGOK1UOCPNÁOCFGPKRCTCNCTÁ+UVCPDWN  2COWMģ#/QPGVCT[*KUVQT[QHVJG1VVQOCP'ORKTG%CODTKFIG 2GTG0 WPF6Ì\GP+ 1UOCPNÁ/CFGPK2CTCNCTÁ+UVCPDWN  8GT\GKEJPKUFGT/ÒP\GPWPF&GPMOÒP\GPFGT'TFVJGKNG#WUVTCNKGP#UKGP#HTKMCFGT,WNGU   5COONWPI#WMVKQP#9G[N$GTNKP  9KNUMK*%QWPVGTOCTMUQP1VVQOCP%QKPU)ÒVGTUNQJ  &GTU#0GY6CDNGQH%QWPVGTOCTMU/CKP\ ģGPVÒTMģWPF¤\RCNCDÁ[ÁMNCT5 *TUI 2QYGTQH)QNF)QNFU UKE QH2QYGT;CRÁ-TGFK)QNF  %QNNGEVKQP+UVCPDWNQ,  

BILDNACHWEIS

/GVKP'TÒTGVGP1UOCPNÁOCFCN[CNCTÁXGPKĤCPNCTÁ$GNIGNGTNGVCTKJK 1VVQOCP/GFCNUCPF1TFGTU&QEWOGPVGF*KUVQT[ 6JG &GUVKPCVKQP/CPCIGOGPV%QORCP[ĂUVCPDWN  /G[GTU-QPXGTUCVKQPU.GZKMQP(ÒPHVG#WHNCIG$CPF.GKR\KIWPF9KGP

162


eLive Auction NEU Mit unseren eLive Auctions bieten wir Ihnen die Möglichkeit, direkt und unkompliziert über das Internet an regelmäßigen Auktionen mit einem virtuellen Auktionator live teilzunehmen.

NEW With our eLive Auctions, we offer you a direct and easy opportunity to participate in regular auctions live over the Internet.

Bequem von zuhause oder unterwegs können Sie Vorgebote abgeben und abschließend – ganz wie in einer echten Auktion im Bieterwettstreit mit anderen – den Ausgang der Auktionen live am Bildschirm für sich entscheiden.

From the convenience of your own home or when travelling, you can submit preliminary bids, and up to the last moment of the sale – as in a real auction, vying with other bidders – you can win auctions live on your computer screen.

Weitere Informationen erhalten Sie unter https://live.kuenker.de/hilfe

Additional information is available at https://live.kuenker.de/hilfe

eLive Auction ab November 2011 auf https://live.kuenker.de


Leitfaden zur erfolgreichen schriftlichen Auktionsteilnahme • • • • •

Studieren Sie den Katalog sorgfältig und notieren Sie alle Lose, die interessant für Sie sind. Legen Sie für jedes Los Ihr persönliches Limit fest, das Sie maximal zu zahlen bereit sind. Füllen Sie das beiliegende Formular aus (siehe unten) und tragen Sie für jedes Los Ihr Höchstgebot ein. Schicken Sie uns Ihren Auftrag frühzeitig. Bei gleich hohen Geboten erhält das zuerst eingegangene Gebot den Zuschlag. Sie haben interessante Lose für insgesamt € 10.000,– gefunden, möchten jedoch nur € 2.000,– ausgeben. Kein Problem: Sie geben als Gesamtlimit (ohne Aufgeld) € 2.000,– an. • Wenn Sie Fragen haben: Die MitarbeiterInnen unserer Kundenbetreuung sind für Sie da: Telefon 0800 583 65 37 (gebührenfrei). • Wenn Sie telefonisch an unseren Auktionen teilnehmen möchten, ist das ab einer Schätzung von € 500,– pro Los möglich. Bitte teilen Sie uns diesen Wunsch mindestens einen Werktag vor Beginn der Versteigerung schriftlich mit.

Musterauftrag für schriftliche Gebote Name, Adresse, Telefon Ihre vollständige Anschrift ist wichtig, damit wir Ihren Auktionsauftrag annehmen und bearbeiten können. Ihre Telefonnummer brauchen wir, um Sie bei Rückfragen zu Ihren Geboten schnell erreichen zu können.

Ihre Kundennummer Die Angabe Ihrer Kundennummer unterstützt uns bei der Bearbeitung Ihres Auktionsauftrages. Viele Vorarbeiten für die Auktion werden dadurch einfacher und es werden Fehler vermieden.

Losnummern und Gebote Listen Sie alle Lose, für die Sie sich interessieren, mit ihrer Katalognummer auf und legen Sie für sich selbst fest, wie viel Sie bereit sind, für jedes einzelne Los zu bieten.

Ihr Limit pro Einzellos An dieser Stelle geben Sie an, was Sie für jedes einzelne Stück maximal bereit sind auszugeben.

„Oder“-Gebote Wenn Sie sich für mehrere Münzen interessieren, aber nur ein Stück davon erwerben wollen, können Sie Ihre Gebote einfach mit einem „Oder“ verbinden. Wichtig: bei den „Oder“Geboten können Sie nicht auf frühere Katalognummern zurückgreifen (z. B. 2890 oder 1558), da die Nr. 1558 dann bereits versteigert ist. Unterschreiben Sie Ihren Auktionsauftrag ... ... nachdem Sie Ihre Angaben noch einmal überprüft haben. Ihre Unterschrift ist wichtig, denn damit bestätigen Sie uns, dass sie tatsächlich teilnehmen wollen.

Überschreitung Ihrer Limits pro Einzellos In der Praxis zeigt sich, dass oft mehrere Bieter mit ihren Geboten dicht beieinander liegen. Deshalb empfiehlt es sich, an dieser Stelle einer geringfügigen Überschreitung Ihrer Gebote zuzustimmen. Dadurch erhöhen sich Ihre Chancen, im Wettbewerb mit anderen den Zuschlag zu erhalten.

Begrenzung Ihres Gesamtlimits Hier können sie die Gesamtsumme Ihrer Gebote begrenzen und festlegen, was Sie insgesamt maximal bereit sind auszugeben. Aufgeld und Mehrwertsteuer kommen später noch hinzu.

TEL +49 (0)541 96 20 20, FAX +49 (0)541 96 20 222, SERVICE@KUENKER.DE, WWW.KUENKER.DE


Wie entsteht der Preis einer Auktion? Der im Auktionskatalog angegebene Preis ist ein Schätzpreis, der durch unsere Experten festgelegt wurde. Das Mindestgebot liegt bei 80 % dieses Wertes. Die Zuschlagpreise sind oft deutlich höher als die Schätzpreise. Als Auktionshaus müssen wir bereits vor der Auktion alle schriftlichen Gebote koordinieren. Folgende Beispiele sind im Bietverfahren möglich: Beispiel 1 (Schätzpreis: € 1.000,–) Es liegt kein schriftlicher Auftrag vor: Der Auktionator ruft das Los in der Auktion mit € 800,– aus. Wenn im Saal nur ein Bieter darauf ein Gebot abgibt, erhält der Saalbieter den Zuschlag für € 800,–.

Beispiel 3 (Schätzpreis: € 1.000,–) Es liegt dem Auktionator nur ein schriftliches Gebot von € 850,– vor: Das Los wird in der Auktion mit € 800,– ausgerufen. Falls kein Bieter im Saal ein Gegenangebot abgibt, erhält der schriftliche Bieter den Zuschlag bei € 800,–.

Beispiel 2 (Schätzpreis: € 1.000,–) Es liegen dem Auktionator drei schriftliche Gebote vor:

Beispiel 4 (Schätzpreis: € 1.000,–) Es liegt dem Auktionator nur ein schriftliches Gebot von € 1.200,– vor: Der Auktionator ruft das Los mit € 800,– aus. Gibt es im Saal keinen Gegenbieter, erhält der schriftliche Bieter den Zuschlag bei € 800,–. Falls es im Saal Gegenbieter gibt, bietet der Auktionator für seinen schriftlichen Bieter bis maximal € 1.200,– und erteilt einem Gegenbieter im Saal erst bei mehr als € 1.200,– den Zuschlag.

Bieter 1: Limit € 2.900,– Bieter 2: Limit € 1.800,– Bieter 3: Limit € 800,– Nach der Versteigerungsordnung muss der Auktionator im Interesse von Bieter 1 und 2 angemessen überbieten (um ca. 5 bis 10 %). Der Ausrufpreis in der Auktion beträgt daher im Interesse von Bieter 1 € 1.900,– (obwohl die Schätzung € 1.000,– beträgt). Falls keine höheren Gebote aus dem Saal erfolgen, erhält Bieter 1 den Zuschlag für € 1.900,–. Das Höchstangebot von € 2.900,– musste nicht ausgeschöpft werden.

Beispiel 5 (Schätzpreis: € 1.000,–) Es liegen drei Gebote von je € 975,– vor: Um Missverständnisse zu vermeiden, überzieht der Auktionator das zuerst eingegangene Gebot geringfügig und erteilt den Zuschlag bei € 1.000,–.

Antworten auf Fragen, die uns oft gestellt werden • Zuschlagpreis/Aufgeld: Wir berechnen als Auktionshaus ein Aufgeld von 15 % auf den Zuschlagpreis, dazu kommt die gesetzliche Mehrwertsteuer. Beispiel 1

Zuschlagpreis Aufgeld 15 % Versandkosten, z. B. * MwSt. 7 % Rechnungs-Betrag

€ € € € €

100,00 15,00 5,90 8,46 129,36

Beispiel 2

Zuschlagpreis Aufgeld 15 % Versandkosten, z. B. * MwSt. 7 % Rechnungs-Betrag

€ 1.000,00 € 150,00 € 5,90 € 80,91 € 1.236,81

• Mehrwertsteuer: üblicherweise in Deutschland 7 %, seit dem 01.01.2000 sind viele Goldmünzen, die nach 1800 geprägt wurden, steuerfrei. Bei Fragen zu der MwSt.-Berechnung rufen Sie uns an, gebührenfrei unter: 0800 583 65 37. • Rücklosverkauf: Alle Lose, die in der Auktion nicht verkauft wurden, können Sie innerhalb von vier Wochen nach der Versteigerung zu 80 % des Schätzpreises (zzgl. Aufgeld und Mehrwertsteuer) erwerben. Achtung: Viele Rücklose sind schnell vergriffen. • Unser Spezialservice: Alle Bieter erhalten gratis die Ergebnisliste innerhalb von zwei Wochen nach der Auktion. Im Internet können Sie die Ergebnisliste der Auktion sofort nach der Auktion unter www.kuenker.de einsehen. * Die Kosten für Versand und Versicherung werden nach Aufwand berechnet.

Besuchen Sie uns doch einmal persönlich auf der Auktion! • Wir freuen uns sehr, wenn Sie persönlich nach Osnabrück kommen möchten. Das Flair einer Auktion und die Stimmung im Auktionssaal sind ein besonderes Erlebnis für Sie als Sammler. Osnabrück ist außerdem immer eine Reise wert und die persönliche Betreuung durch unsere Mitarbeiter wissen immer mehr Kunden zu schätzen. • Bitte rufen Sie uns rechtzeitig an, damit wir Ihnen Tipps für die Anreise geben und Ihnen ein Hotelzimmer reservieren können. Sie erreichen uns gebührenfrei unter: 0800 583 65 37. • Als erfolgreicher Bieter können Sie Ihre neu erworbenen Stücke gleich persönlich mit nach Hause nehmen. Als guter Kunde unseres Hauses haben Sie 20 Tage Zahlungsziel nach der Auktion.

TEL +49 (0)541 96 20 20, FAX +49 (0)541 96 20 222, SERVICE@KUENKER.DE, WWW.KUENKER.DE


Важная информация об участии на аукционе • Наши аукционные правила и условия Вы можете найти в конце каталога. • Мы просим Вас присылать Ваши ставки заранее. В противном случае вероятность ошибки при обработке заказа, присланного перед самым аукционом, возрастает. • Приложенный образец заполнения письменного заказа поможет Вам при отправлении Ваших письменных ставок. Ставки можно отправить как по почте, так и по факсу : +49 (0)541–96 20 222 круглосуточно. • Успешные заказы будут обрабатываться в порядке их поступления к нам. Все участники, которым не удалось что-либо купить на аукционе, будут также проинформированы после аукциона. • Если Вы впервые принимаете участие в нашем аукционе, то мы рекомендуем Вам сообщить нам Ваш референц – аукционные дома, с которыми Вы уже сотрудничали. Или свяжитесь с нами по телефону. • Мы гарантируем подлинность всех предметов, проданных на нашем аукционе, в течении неограниченного времени. • Все участники нашего аукциона получают в течении 2-ух недель результаты торгов бесплатно. • У Вас есть вопросы по определенной монете? Вы хотели бы лично принять участие в аукционе? У Вас возникли другие вопросы? Звоните нам по телефону +49 (0)541-96 20 268, и мы будем рады Вам помочь.

Мое заочное участие на аукционе • • • •

Тщательно изучите наш каталог и запишите те лоты, которые Вас заинтересовали. Определите для Себя ту максимальную сумму, которую Вы готовы заплатить за каждый лот. Заполните приложенный формуляр. Отправьте нам Ваш заказ заранее. При 2-ух и более равных ставок на один и тот же лот преимущество получает ставка, пришедшая к нам первой ( ранее других ). • Если стоимость выбранных Вами лотов составляет например 10.000 евро, а Вы могли бы потратить только 2.000 евро, то в этом случае укажите Ваш общий лимит в размере 2.000 евро. • Если у Вас возникли вопросы по заполнению формуляра, звоните нам по телефону +49 (0)541-96 20 268. Наши сотрудники будут рады Вам помочь.

Мое личное участие в Оснабрюке • Мы будем рады Вашему личному присутствию в Оснабрюке. Атмосфера, которая стоит во время аукционных торгов в зале, особенная и непередаваемая. • Для получения более подробной информации по Вашей поездке в Оснабрюк, в частности, бронирования номеров в гостинице, мы просим Вас заранее связаться с нами по телефону: +49 (0)541-96 20 268. • Приобретенные на аукционе лоты Вы можете лично забрать после окончания торгов. Наши постоянные клиенты осуществляют оплату в течение 20 дней после получения счета. Участвующие в аукционе впервые осуществляют 100%-ую предоплату.

Участие по интернету Все каталоги доступны для просмотра на нашем сайте в интернете по адресу www.kuenker.de. На сайте Вы можете выбрать интересующие Вас лоты и отправить Ваши ставки на нашу электронную почту service@kuenker.de. Если у Вас возникнут дополнительные вопросы, мы просим Вас связаться с нами по телефону +49 (0)5 41-96 20 268.

Участие по телефону Для участия в торгах по телефону просим Вас связаться с нами не позднее 48 часов до начала аукциона. Условием проведения телефонных торгов является письменное подтверждение ставки, равной как минимум стартовой цене. Участие в телефонных торгах возможно только для лотов со стартовой ценой свыше 500 евро. Для получения дополнительной информации и регистрации на аукционе звоните Анастасии Кепселль до аукциона по телефону +49 (0)5 41-96 20 268 и во время аукциона по телефону, указанному на первой странице каталога.

TEL +49 (0)541 96 20 20, FAX +49 (0)541 96 20 222, SERVICE@KUENKER.DE, WWW.KUENKER.DE


Как образовывается цена на аукционе? • Все лоты в нашем каталоге были предварительно оценены нашими экпертами. Минимальная ставка составляет 80 % от оценочной стоимости лота. Конечные цены зачастую намного превышают оценочные. • Ваши письменные ( заочные ) ставки должны быть обязательно обработаны нашими сотрудниками до начала аукциона. Рассмотрим несколько возможных примеров: Пример 1 ( Оценочная стоимость: € 1.000,– ) Заочных ставок нет. Аукционатор начинает торги с € 800,–. Если в зале только один человек, желающий приобрести этот лот, то соответственно он получит его за € 800,–. Пример 2 ( Оценочная стоимость: € 1.000,– ) У аукционатора имеются 3 заочные ставки: Заочный участник 1 : Лимит € 2.900,– Заочный участник 2 : Лимит € 1.800,– Заочный участник 3 : Лимит € 800,– По правилам аукциона аукционатор в интересах заочного участника 1 и 2 должен повышать ставку равномерно ( приблизительно на 5 – 10 % ). Поэтому в нашем случае в интересах заочного участника 1 аукционатор начнет торги с € 1.900,– ( хотя оценочная стоимость составляет € 1.000,–). Если среди очных участников никто не даст более высокую ставку, то заочный участник 1 получит этот лот за € 1.900,–. Его лимит в € 2.900,– ни в коем случае не будет исчерпан.

Пример 4 (Оценочная стоимость: € 1.000,– ) У аукционатора имеется только 1 заочная ставка в размере € 1.200,–. Аукционатор начнет торги с € 800,–. Если среди очных участников никто не даст более высокую ставку, то заочный участник получит этот лот за € 800,–. Если же в зале очный участник согласен на более высокую ставку ( больше € 800,– ), то в этом случае аукционатор в интересах заочного участника имеет право тоговаться до € 1.200,–. Следовательно только при ставке, превышающей € 1.200,–, данный лот получит очный участник в зале. Пример 5 (Оценочная стоимость: € 1.000,– ) У аукционатора имеются 3 заочные ставки, каждая в размере € 975,–. Среди очных участников интереса к лоту не имеется. В этом случае чтобы избежать недоразумений, аукционатор имеет право ненамного повысить лимит и сделать ставку равной € 1.000,–. Данный лот за € 1.000,– получит тот заочный участник, чей письменный формуляр мы получили раньше всего.

Пример 3 (Оценочная стоимость: € 1.000,– ) У аукционатора имеется только 1 заочная ставка в размере € 850,–. Аукционатор начнет торги с € 800,–. Если среди очных участников никто не даст более высокую ставку, то заочный участник получит этот лот за € 800,–.

Как я могу получить приобретенные лоты? Вывоз приобретенных на аукционе предметов осуществляется одним из следующих способов по Вашему выбору: • Вы можете лично забрать Ваши лоты. По окончании торгов мы готовим все необходимые документы на вывоз из Германии. При вывозе за пределы Евросоюза, НДС Вам возвращается. • Почтовые отправки в Россию ( Беларусь, Украину ) приобретенных Вами лотов осуществляются по предварительной договоренности. Для связи с нами звоните нам по телефону +49 (0)541-96 20 268. С 1971 года имя Кюнкер является гарантией надежности и компетентности. Мы не станем изменять нашим принципам и в будущем. Спасибо Вам за Ваше доверие, которое является не только самым сильным стимулом в нашей работе, но и наилучшей ее оценкой. Я желаю Вам успехов на нашем аукционе!

Фриц-Рудольф Кюнкер

TEL +49 (0)541 96 20 20, FAX +49 (0)541 96 20 222, SERVICE@KUENKER.DE, WWW.KUENKER.DE


Versteigerungsbedingungen Die Versteigerung erfolgt im Auftrag und für Rechnung der Eigentümer unter Einhaltung der sich aus der Versteigerungsordnung (BGB1 I 1976, 1346) ergebenden und für Kommissionäre geltenden gesetzlichen Bestimmungen des BGB und HGB gegen Barzahlung des Kaufpreises in €-Währung. Durch Abgabe eines Gebotes werden die Versteigerungsbedingungen anerkannt, dies gilt auch für die schriftlichen Gebote. Der Zuschlagpreis ist Nettopreis im Sinne des Umsatzsteuergesetzes und bildet die Berechnungsgrundlage für das vom Käufer zu zahlende Aufgeld in Höhe von 15 %. Auf den daraus entstehenden Gesamtpreis (Zuschlag + Aufgeld) wird die jeweils gültige Umsatzsteuer erhoben, soweit dies gesetzlich vorgeschrieben ist. Ausländischen Käufern aus Ländern der europäischen Gemeinschaft wird die in Deutschland gültige Umsatzsteuer berechnet. Anderen ausländischen Käufern (aus Drittländern) wird, sofern die Münzen durch uns exportiert werden, ein Aufgeld von 15 % netto auf den Zuschlagpreis berechnet; sie erhalten die Lieferung nur gegen Zahlung des Kaufpreises in €-Währung, bankspesenfrei. Ausländischen Münzhändlern aus Ländern der europäischen Gemeinschaft wird bei Nachweis der Umsatzsteuer-Identifi kationsnummer (§ 27 a USTG) und der sonstigen Voraussetzungen gemäß § 4 Nr. 1 b USTG in Verbindung mit § 6 a USTG die Lieferung ohne Umsatzsteuer berechnet. Sofern nichts anderes vereinbart wird, ist die Zahlung der Auktionsrechnung bei anwesenden Käufern sofort, bei schriftlichen Bietern spätestens 20 Tage nach Erhalt fällig. Bei Zahlungsverzug werden Zinsen von 1 % pro Monat berechnet. Wird die Zahlung nicht sofort an den Versteigerer geleistet oder die Abnahme der zugeschlagenen Sache verweigert, so findet die Übergabe der Sache an den Ersteigerer nicht statt. Der Ersteigerer verliert vielmehr seine Rechte aus dem Zuschlag, und die Sache kann auf seine Kosten erneut versteigert werden. In diesem Fall haftet der Ersteigerer für den Ausfall, dagegen hat er auf den Mehrerlös keinen Anspruch. Der Zuschlag erfolgt nach dreimaligem Ausruf des höchsten Gebotes und verpflichtet zur Abnahme und Zahlung. Bei Meinungsverschiedenheiten über den Zuschlag wird die Nummer noch einmal ausgerufen. Der Versteigerer ist berechtigt, Nummern zu vereinigen oder zu trennen. Eine Vorausnahme von Nummern erfolgt nicht. Der Zutritt zur Versteigerung ist nur Interessenten gestattet, die einen Katalog besitzen. Die Mindeststeigerungsstufen für das Bietungsverfahren betragen: Gebote

Mindeststeigerungsstufe

Schriftliche Aufträge werden von uns ohne Auftragsprovision gewissenhaft ausgeführt. Aufträge von uns unbekannten Sammlern können nur ausgeführt werden, wenn ein Depot hinterlegt wird oder Referenzen benannt werden. Schriftliche Gebote können nur bis 24 Stunden vor Auktionsbeginn verbindlich berücksichtigt werden. Im Bedarfsfall ist der Auktionator berechtigt, die Limits um 3 – 5 % zu überschreiten. Bei mehreren gleichhohen Geboten erhält das zuerst eingegangene den Zuschlag. Unlimitierte Aufträge haben keinen Anspruch auf unbedingte Ausführung. Telefonisches Bieten ist nur in Ausnahmefällen möglich. Telefonische Bieter müssen sich mindestens einen Werktag vor der Auktion voranmelden. Der Versand geht zu Lasten und auf Risiko des Ersteigerers bzw. Empfängers. Das Auktionsgut bleibt bis zur vollständigen Bezahlung aller Forderungen aus Anlass der Versteigerung Eigentum des Verkäufers. Ist der Käufer Vollkaufmann, so ist Osnabrück als Gerichtsstand vereinbart. Für das Mahnverfahren gilt die Zuständigkeit des Amtsgerichts Osnabrück auch in allen anderen Fällen als vereinbart. Ansonsten ist es Osnabrück nur, wenn nur die Firma Fritz Rudolf Künker GmbH & Co. KG ihren allgemeinen Gerichtsstand in der BRD hat, oder wenn alle Ansprüche im Wege des Mahnverfahrens geltend gemacht werden, oder wenn die im Klageweg in Anspruch zu nehmende Vertragspartei nach Vertragsabschluss ihren gewöhnlichen Aufenthaltsort aus dem Geltungsbereich der BRD verlegt hat, oder ihr Wohnsitz oder gewöhnlicher Aufenthaltsort zum Zeitpunkt der Klage nicht bekannt ist. Die Beschreibung im Katalog ist gewissenhaft durchgeführt. Sie begründet jedoch keine Rechts- oder Sachmängelhaftung gemäß §§ 434, 459 ff BGB. Die Angabe der Erhaltung ist streng nach den im deutschen Münzhandel üblichen Erhaltungseinstufungen vorgenommen und gilt als persönliche Beurteilung. Bei der Auktion anwesende Käufer kaufen grundsätzlich „wie besehen“. Da durch Vorbesichtigung Gelegenheit gegeben ist, sich vom Erhaltungszustand des Versteigerungsgutes zu überzeugen, können nach erfolgtem Zuschlag Reklamationen nur bei irrtümlich übersehener Henkel- oder Fassungsspur oder gestopftem Loch berücksichtigt werden. Bei Losen mit mehreren Stücken sind die Stückzahlen nur Circa-Angaben, irrtümliche Zuschreibungen sind im Einzelfall nicht ausgeschlossen. Diese Lose sind nach erfolgtem Zuschlag von jeder Reklamation ausgeschlossen. Der Versteigerer kann bei eventuellen Meinungsverschiedenheiten bzw. Beanstandungen einen vereidigten Sachverständigen seiner Wahl (die Kosten trägt der unterliegende Teil) beauftragen. Eventuelle Beanstandungen können nur innerhalb von 8 Tagen nach der Auktion bzw. nach Erhalt der ersteigerten Stücke berücksichtigt werden. Die Echtheit der Stücke wird bis zur Höhe des Kaufpreises garantiert. Die beigedruckten Preise sind Schätzpreise, die unter- oder überschritten werden können. Aufträge, die unter 80 % des Schätzpreises liegen, können nicht bearbeitet werden.

bis zu

€ 100,–

€ 5,–

bis zu

€ 200,–

€ 10,–

bis zu

€ 500,–

€ 20,–

bis zu

€ 1.000,–

€ 50,–

bis zu

€ 2.000,–

€ 100,–

Soweit nicht anders vermerkt, gelten im übrigen die allgemeinen Versteigerungsbestimmungen und – auch im Verhältnis zu ausländischen Kunden – gilt Deutsches Recht.

bis zu

€ 5.000,–

€ 200,–

Die Ergebnisliste erscheint sofort nach der Auktion.

bis zu

€ 10.000,–

€ 500,–

bis zu

€ 20.000,–

€ 1.000,–

bis zu

€ 50.000,–

€ 2.000,–

bis zu

€ 100.000,–

€ 5.000,–

ab

€ 100.000,–

€ 10.000,–

Ausländische Kunden kaufen nach den Devisen-, Zoll- und Steuerbestimmungen ihres Landes. Versandformalitäten werden vom Versteigerer erledigt.

Die Versteigerer:

Fritz Rudolf Künker Dr. Andreas Kaiser Arne Kirsch Oliver Köpp

TEL +49 (0)541 96 20 20, FAX +49 (0)541 96 20 222, SERVICE@KUENKER.DE, WWW.KUENKER.DE


Terms and Conditions of Auction The auction is conducted on behalf and for the account of the appropriate proprietors of the goods and is subject to the federal Auction Regulation (Versteigerungsordnung, BGB1 I 1976, 1346) published in the Federal Law Gazette Vol. I, 1976, 1346 and the relevant provisions for factors in accordance with the German Civil Code (BGB) and Commercial Code (HGB). Payment of the hammer-price has to be made in cash and in Euro. The submission of an offer implies the express acknowledgement of these Terms and Conditions of Auction; the same applies to the submission of an offer in writing. The hammer-price is exclusive of applicable German VAT according to the prevailing VAT-legislation and represents the basis for calculating the surcharge of 15 percent payable by the purchaser. The total price so calculated (hammer-price plus surcharge) is subject to the VAT (value added tax = Mehrwertsteuer), which is payable additionally. Purchasers from abroad will be charged a surcharge of 15 percent net on the hammerprice, provided the export of the coins is undertaken by the auctioneer. Buyers in European Community (EEC) countries (other than Germany) will be charged value added tax at the rates prevailing in Germany. Dealers from EEC countries (other than Germany) will receive goods free of tax upon presentation of their VAT ID number, and upon fulfillment of the other conditions set forth in Paragraph 4, Nr. 1 b, and Paragraph 6 a of the German Turnover Tax Law Buyers from other countries are not charged value added tax. Delivery will be made against payment in Euro with no bank charges to the auctioneer. Unless mutually agreed otherwise, payment of the auction bill from purchasers present at the auction is due immediately. From purchasers who have submitted a bid in writing, payment is due within 20 days after receipt of the goods. Defaulted payments shall bear an interest charge of 1 % per month in the amount in default. Should payment to the auctioneer not be made immediately or should the acceptance of the awarded item be refused, such item shall not be handed over to the purchaser. Instead the purchaser shall forfeit all right and title in and to such item from the award and the item may again be put to auction at this buyer’s cost. In this event the buyer shall be liable for any shortfall, while he shall have no right or claim towards any excess proceeds. An item will be knocked down after the highest bid has been called three times. The award shall be a binding commitment and liability on the part of the bidder to take acceptance and delivery of the item or items so awarded. In the event of any dispute with regard to the award the lot will be put up again for bidding. The auctioneer reserves the right to combine or to separate lots. Lots will not be called out of sequence. Access to the auction will only be permitted to interested persons who are in possession of the catalogue.

lot, the bid first received by the auctioneer shall be given the award. Unlimited bids shall not oblige the auctioneer to consider, accept or carry out such order. Telephone bidding is generally an option for lots of substantial value only. The registration is required at the latest a day before auction. Shipment (by mail or otherwise) of the goods shall be for the sole cost and risk of the purchaser or recipient, respectively. The auctioned goods remain the sole and exclusive property of the vendor until full payment and settlement of any and all dues and claims in connection with the auction. In the event the purchaser is a merchant (in the sense of the German commercial laws) Osnabrück shall be the agreed and exclusive place of jurisdiction. The competence of the District Court (Amtsgericht) of Osnabrück is agreed in respect of summary proceedings for the collection of defaulted payments (Mahnverfahren) as well as in any and all other cases. Should the purchaser not be a merchant Osnabrück shall be the place of jurisdiction with the District Court of Osnabrück’s competence, if only the auctioneer has his ordinary legal domicile in the Federal Republic of Germany or if claims are made by way of summary proceedings of collection (Mahnverfahren) or if the defendant has moved his ordinary legal domicile outside the jurisdiction of the Federal Republic of Germany or if the legal domicile of the defendant is unknown to the auctioneer at the time of filing a suit. To the exclusion of any other legislation German law, as in force at the time, shall be applied for the settlement of any and all legal or judicial matters. The specifications and descriptions in the catalogue have been prepared diligently and in good faith, however, do not constitute the acceptance by the auctioneer of any warranty or liability in respect of defect in material or title. The state of preservation of items is strictly assessed in accordance with the grades accepted by the German coin trade and only represents an individual and personal assessment. Purchasers present at the auction acquire items strictly on the basis of “as is where is” and “as inspected”. In view of the opportunity of prior inspection to ascertain the state and condition of the auction lots, complaints and objections made after the sale will only be considered, if by obvious error or mistake loop or traces or mountings, traces of trimmings or settings, or the plugging of a hole (eyelet) have remained unnoticed. If and when auctioned in lots, the quantities of individual pieces given, only represent an approximate figure. An error in the allocation of individual pieces to a certain lot cannot be excluded. Such lots are, therefore, excluded from any complaints or objections after the lot is knocked down. In the event of disputes or complaints as to the quality of an item the auctioneer may call upon a generally sworn expert of the trade, which the auctioneer may choose at his sole discretion, for assessment and the rendering of a decision as to the justification of such dispute or complaint. The costs of such expert shall be borne by the party loosing the dispute according to the expert’s decision. Complaints or objections, if justified, will only be considered if made and received by the auctioneer within 8 days after the auction or after receiving the lots, respectively.

The minimum rates of increase for the bidding procedure are: offers up to up to up to up to up to up to up to up to up to up to above

€ 100.– € 200.– € 500.– € 1,000.– € 2,000.– € 5,000.– € 10,000.– € 20,000.– € 50,000.– € 100,000.– € 100,000.–

minimum increase rate € 5.– € 10.– € 20.– € 50.– € 100.– € 200.– € 500.– € 1,000.– € 2,000.– € 5,000.– € 10,000.–

Orders submitted in writing will be carried out diligently and without charge of an extra commission. Orders from collectors unknown to the auctioneer can only be accepted and carried out if a deposit or references to the satisfaction on the auctioneer are given. To be bindingly accepted, written bids need to be received at least 24 hours before auction. If necessary, the auctioneer is allowed to increase the bids by 3 – 5 %. Should several bids be obtained in writing bidding the same price or prices for a given

The authenticity of the coins is warranted up to the total purchase price. The prices set out in the catalogue are estimates only, which may be exceeded or undercut. Orders for less than 80 per cent of the estimated price cannot be accepted. Purchasers from abroad will have to observe all applicable laws and regulations in respect of foreign exchange, customs duties and taxation of their country. The auctioneer will only discharge such formalities, which have to be observed, in the Federal Republic of Germany in connection with the export of the purchased item(s). Unless stipulated otherwise herein, the general rules regulations for auctions applicable in Germany shall govern any transaction in respect of the auction; German Law shall also be applicable in relation to purchasers from abroad. Only the German text has legal force. The prices realized will be published in the form of a list immediately after the auction. The auctioneers:

Fritz Rudolf Künker Dr. Andreas Kaiser Arne Kirsch Oliver Köpp

TEL +49 (0)541 96 20 20, FAX +49 (0)541 96 20 222, SERVICE@KUENKER.DE, WWW.KUENKER.DE


Numismatische Ausdrücke/Numismatic Terms/Expressions Numismatiques/ Termini di Numismatica/Нумизматические Термины DEUTSCH

ENGLISH

FRANCAIS

ITALIANO

RUSSKIJ

Abschlag Am Rand Berieben Blei Dezentriert Doppelschlag Einfassung Einseitig Emailliert Erhaltung Etwas Exemplar Fassungsspuren Fehlprägung

struck at the rim/border slightly polished lead uncentered double struck frame uniface enamelled condition/preservation slightly specimen, copy trace of mounting mis-strike

frappe en tranche frotté plomb décentré double frappe encadrement uniface émaillé conservation un peu exemplaire traces de monture défaut de frappe

coniazione al bordo trattato piombo non centrato ribattitura cornice uniface smaltato conservazione un poco esemplare tracce di montatura difetto di coniazione

Feld(er) Fundexemplar Gedenkmünze Geglättet Gelocht Geprägt Gewellt Goldpatina Henkelspur Hübsch Jahrh. = Jahrhundert Kl. = klein Korrosionsspuren Kratzer Kupfer Legierung Leicht(e) l. = links Min. = minimal Nachahmung Prachtexemplar Prägeschwäche Randdelle Randfehler Randschrift r. = rechts Rückseite

field(s) specimen from a hoard commemorative coin tooled holed minted bent golden patina mount mark attractive century small traces of corrosion scratch(es) copper alloy slightly left minimal imitation attractive, perfect piece weakly struck edge nick edge faults lettered edge to right reverse

champ exemplaire de trouvaille monnaie commémorative retouché troué frappé ondulé patine dorée trace de monture joli siècle petit traces de corrosion rayure cuivre alliage légèrement gauche minime imitation pièce magnifique de frappe faible défaut sur la tranche erreur sur la tranche tranche inscrite droite revers

campo da tesoretto moneta commemorativa liscio bucato coniato ondolato patina d´oro tracce di appicagnolo carino secolo piccolo segni di corrosione graffio(i) rame lega leggero sinistra minimamente contraffazione esemplare magnifico conio stanco ammaccatura al bordo errore nel bordo inscrizione sul bordo destra rovescio

оттиск на гурте потертая свинец ассиметричный двойной чекан кайма односторонняя эмалированная сохранность слегка экземпляр следы обработки ошибка в процессе чеканки поле экземпляр памятная монета отглаженная проколатая отчеканенная волнистая золотая патина следы от ушка красивая столетие маленький следы коррозии царапина медь сплав легкий слева минимальный имитация превосходный экземпляр издержкн при чеканкe вмятина на гурте ошибка на гурте гуртовая надпись справа реверс

TEL +49 (0)541 96 20 20, FAX +49 (0)541 96 20 222, SERVICE@KUENKER.DE, WWW.KUENKER.DE


DEUTSCH

ENGLISH

FRANCAIS

ITALIANO

RUSSKIJ

Schriftspuren

traces of inscription

traces de légende

tracce di leggenda

Schrötling Schrötlingsfehler Schwach ausgeprägt Selten in dieser Erhaltung

flan flan defect weakly struck rare in this condition

flan flan défectueux de frappe faible rare en cet état

tondello errore di tondello conio stanco conservazione rara

Seltener Jahrgang Stempel Stempelfehler Überdurchschnittlich erhalten Überprägt Unediert Unikum Vergoldet Von allergrößter Seltenheit Vorderseite Winz.= winzig Zain Zierrand Zinn ziseliert

rare year die(s) mistake in the die extraordinary condition

année rare coin erreur de frappe conservation extraordinaire

overstruck unpublished unique specimen gilt extremely rare averse tiny flan ornamental border tin chased

surfrappé inédit unique doré de toute rareté en face petit flan tranche ornée étain ciselé

annata rara conio errore di conio conservazione estraordinaria ribattuto inedito pezzo unico dorato di estrema raritá diritto veramente piccolo tondello taglio ornato stagno cesellato

следы предыдущей надписи заготовка брак заготовки слабо отчеканeна редкая в такой сохранности редкий год штамп ошибка штампа сохранность выше среднего перечекан неопубликованная монета уникальная позолоченная наиредчайшая аверс незначительный заготовка декоративный гурт цинк гравированный

Erhaltungsgrade/Grading Terms/Degrès de Conservation/Gradi di Conservazione/ Шкала сохранности DEUTSCH

ENGLISH

FRANCAIS

ITALIANO

RUSSKIJ

Polierte Platte Stempelglanz Vorzüglich Sehr schön Schön Gering erhalten

Proof Uncirculated Extremely fine Very fine Fine Very good

Flan bruni Fleur de coin Superbe Très beau Beau Très bien conservé

Fondo specchio Fior di conio Splendido Bellissimo Molto Bello Bello

полированная превосходная отличная очень хорошая хорошая удовлетворительная

Seltenheitsgrade/Rarity Terms/Degrés de Rareté/Grado di Raritá/ Шкала редкости DEUTSCH

ENGLISH

FRANCAIS

ITALIANO

RUSSKIJ

R = Selten RR = Sehr selten Von großer Seltenheit Von größter Seltenheit Von allergrößter Seltenheit Uneditiert

R = Rare RR = Very rare Very rare Extremely rare Extremely rare Unpublished

Rare Très rare De grande rareté Extrêmement rare De la plus extrême rareté Inédit

raro molto raro di grande raritá di grandissima raritá di estrema raritá inedito

редкая очень редкая большой редкости наибольшей редкости наиредчайшая ранее не описанная

TEL +49 (0)541 96 20 20, FAX +49 (0)541 96 20 222, SERVICE@KUENKER.DE, WWW.KUENKER.DE


IMPRESSUM NUMISMATISCHE BEARBEITUNG FOTOS LAYOUT DRUCK

Dr. Lutz Ilisch, Alexandra Spreu, Dr. Sebastian Steinbach, Jens Ulrich Thormann M. A., Eva Weber, Manuela Weiß Lübke & Wiedemann, Stuttgart danner pc - gesteuerte systeme waiblingen meister print und media, Kassel, Oktober 2011 Jeglicher Nachdruck, auch auszugsweise, bedarf der Genehmigung des Auktionshauses

ZAHLUNGEN AUS DEM INLAND Deutsche Bank Osnabrück Commerzbank Osnabrück Sparkasse Osnabrück Volksbank eG Bad Laer-Borgloh-Hilter-Melle Bankhaus Lampe KG, Bielefeld Postbank Hannover HypoVereinsbank München WestLB Dortmund Paypal

(BLZ 265 700 90) Konto-Nummer 0 177 006 (BLZ 265 800 70) Konto-Nummer 780 520 200 (BLZ 265 501 05) Konto-Nummer 247 320 (BLZ 265 624 90) Konto-Nummer 1 200 222 400 (BLZ 480 201 51) Konto-Nummer 174 076 (BLZ 250 100 30) Konto-Nummer 2900 60-308 (BLZ 700 202 70) Konto-Nummer 24 17 952 (BLZ 440 500 00) Konto-Nummer 1128 842 paypal@kuenker.de,

Service charge: 3,5 %

ZAHLUNGEN AUS DEM AUSLAND FOREIGN PAYMENTS Deutsche Bank Osnabrück Sparkasse Osnabrück Postbank Hannover Credit Suisse Credit Cards Paypal

IBAN: DE11 2657 0090 0017 7006 00 Swift-Code: DEUTDE3B265 IBAN: DE50 2655 0105 0000 2473 20 Swift-Code: NOLADE22XXX IBAN: DE73 2501 0030 0290 0603 08 Swift-Code: PBNKDEFF IBAN: CH43 0483 5177 3509 0200 0 Swift-Code: CRESCHZZ80A We do accept VISA and MASTERCARD, Service charge: 4,5 % paypal@kuenker.de, Service charge: 3,5 %

ZAHLUNGEN INNERHALB RUSSLANDS PAYMENTS WITHIN RUSSIA Deutsche Bank Moskau

ʽʽʽΗʪ̸̨̜̖ʥ̡̦̌Η

172

ИНН 7728717332; КПП 772801001 Получатель: ЗАО "Кюнкер" счет №: 40702810500000000825; БИК: 044525101 корсчет №: 30101810100000000101

Auktion 199  

The Sultan Collection. An old private collection of Ottoman Coins, Part 1

Read more
Read more
Similar to
Popular now
Just for you