Page 1


6KVGNHQVQ 0T  

RUSSLAND, KAISERREICH Peter II., 1727-1730. Rubel 1727, St. Petersburg. Probe mit geriffeltem Rand; 28,74 g. Bitkin 225 (R4, dieses Exemplar).


AUKTION 198 Russische Münzen und Medaillen Chinesische Münzen

ZEIT

Freitag, 30. September 2011 09.30 Uhr - 13.00 Uhr 14.00 Uhr - 15.00 Uhr 15.00 Uhr - 18.00 Uhr

ORT

Steigenberger Hotel Remarque Osnabrück, Natruper-Tor-Wall 1

AUKTIONS-TELEFON

+49 (0)541 60 96 633

AUKTIONS-FAX

+49 (0)541 60 96 634

Auktionen 193-198, September 2011 26. SEPTEMBER 2011 26./27. SEPTEMBER 2011

Auktion 193 Münzen aus der Welt der Antike Auktion 194 Münzen und Medaillen aus Mittelalter und Neuzeit

28. SEPTEMBER 2011

Auktion 195 Münzen des österreichischen Kaisers Franz Josef I. (1848-1916) Eine bedeutende Spezialsammlung

28. SEPTEMBER 2011

Auktion 196 Schweden und seine Besitzungen Die Sammlung Julius Hagander, Teil 2

28./29. SEPTEMBER 2011

30. SEPTEMBER 2011

Auktion 197 Geprägtes Gold aus Mittelalter und Neuzeit Deutsche Münzen ab 1871 Auktion 198 Russische Münzen und Medaillen Chinesische Münzen


Zeitplan/Timetable Auktion 193 Münzen und Medaillen aus der Welt der Antike

Auktion 194 Münzen und Medaillen aus Mittelalter und Neuzeit

Montag, 26. September 2011 10.00 Uhr - 13.00 Uhr Nr. 1 bis Nr. 651 Kelten, Griechen, Römer: Römische Republik, Imperatoren, Kaiserzeit: Augustus - Nerva 14.00 Uhr - 16.30 Uhr Nr. 652 bis Nr. 1235 Kaiserzeit: Traianus - Basilicus, Lots Römer, Völkerwanderung, Byzanz, Kreuzfahrer, Orientalen 16.30 Uhr - 18.00 Uhr Nr. 2001 bis Nr. 2377 Europa: Albanien - Italien

Dienstag, 27. September 2011 09.30 Uhr - 13.00 Uhr Nr. 2378 bis Nr. 3071 Europa: Kroatien - Zypern, Übersee, RDR, Deutschland: Aachen - Brandenburg-Preußen 14.00 Uhr - 18.00 Uhr Nr. 3072 bis Nr. 3843 Deutschland: Braunschweig - Würzburg, Spezialsammlungen, Medaillen, Notmünzen, Münzteller, Lots

Auktion 195

Mittwoch, 28. September 2011

Münzen des österreichischen Kaisers Franz Josef I. (1848-1916)

09.30 Uhr - 13.00 Uhr Nr. 4001 bis Nr. 4795

Auktion 196

14.00 Uhr - 16.00 Uhr Nr. 5001 bis Nr. 5219

Schweden und seine Besitzungen Die Sammlung Julius Hagander, Teil 2

Auktion 197 Geprägtes Gold aus Mittelalter und Neuzeit

16.00 Uhr - 18.30 Uhr Nr. 5501 bis Nr. 6049 Europa: Albanien - Italien

Donnerstag, 29. September 2011 09.30 Uhr - 13.00 Uhr Nr. 6050 bis Nr. 6771 Europa: Jugoslawien - Zypern, Übersee 14.00 Uhr - 15.30 Uhr Nr. 6772 bis Nr. 7084 RDR, Deutschland, Medaillen, Lots

Deutsche Münzen ab 1871

Auktion 198

Freitag, 30. September 2011

Russische Münzen und Medaillen

09.30 Uhr - 13.00 Uhr Nr. 8001 bis Nr. 8503 Dmitry Iwanowitsch - Alexander III.

Chinesische Münzen

2

15.30 Uhr - 19.00 Uhr Nr. 7085 bis Nr. 7954

14.00 Uhr - 15.00 Uhr Nr. 8504 bis Nr. 8648 Nikolaus II., Sowjetunion, Russische Republik, Lots, Spitzbergen, Tannu Tuva, Papiergeld, Münzschmuck 15.00 Uhr - 18.00 Uhr Nr. 9001 bis Nr. 9619


Sehr geehrte Münzfreunde/Dear Coin Collectors, Ich wünsche Ihnen viel Freude mit unseren neuen Auktionskatalogen und hoffe, Sie finden einige schöne Stücke für Ihre Sammlung. Als Europas führendes Auktionshaus für Münzen, Medaillen und Orden hat sich unser Dienstleistungsspektrum für Sie als unsere Kunden stetig verbessert und erweitert. Einen kleinen Überblick über unsere Angebote finden Sie hier. I wish you a lot of pleasure with our new auction catalogues and I hope you will find a few additonal items for your collection. As Europe´s leading auction company for coins, medals and decorations our range of services for our customers has been steadily improving and expanding. Following is a short overview of our offers. Mit herzlichen Grüßen/With warm regards

Friti z Ru Frit Fr Rudo dolflff Kün do ünke ker ke er

AUKTIONEN/AUCTIONS Besuchen Sie unsere international bedeutenden Auktionen, die Ihnen viermal jährlich zahlreiche Raritäten bieten. Profitieren Sie als Bieter oder Einlieferer von unserer Erfahrung und Kompetenz. Visit our internationally recognized auctions which take place four times a year and offer many rarities. Benefit from our experience and competence while being a bidder or consigner. GOLDHANDEL/GOLD COIN TRADING Wir bieten Ihnen ein ständiges Angebot sowie den Ankauf von Anlagemünzen aus Deutschland, Europa und aller Welt zu fairen tagesaktuellen Preisen. We are constantly offering as well as purchasing a vast range of German, European and World bullion coins. We buy and sell gold assets at a fair, daily updated market price. ONLINE-SHOP Wir bieten Ihnen in unserem Online-Shop auf www.kuenker.de ein täglich aktualisiertes Münz-Angebot von der Antike bis zur Neuzeit. Kaufen Sie hier unkompliziert zum Festpreis und ohne Risiko. We offer you an exclusive daily updated selection of coins from ancient to modern times. You can order at www.kuenker.com without hassle or risk. eAUCTIONS Unsere eAuctions finden monatlich auf unserer Homepage www.kuenker.de statt und bieten Ihnen eine besondere Auswahl von Münzen von der Antike bis zur Neuzeit. Das Besondere hierbei: das reduzierte Aufgeld von nur 10 %. Our eAuctions take place monthly at www.kuenker.com with a special selection of coins from ancient to modern times. Take advantage of our reduced buyer’s fee of only 10 %. ORDEN UND EHRENZEICHEN/ORDERS AND DECORATIONS Einmal im Jahr findet unsere besondere Ordensauktion statt, die sich ganz den dekorativen Ehrenzeichen widmet. Profitieren Sie als Bieter oder Einlieferer von unserer Erfahrung und Kompetenz im Bereich Phaleristik. Once a year there is a special auction dedicated to medals and decorations. Benefit from our experience in the field of phaleristik becoming our bidder or consigner.

TEL +49 (0)541 96 20 20, FAX +49 (0)541 96 20 222, SERVICE@KUENKER.DE, WWW.KUENKER.DE

3


Besichtigung/On View Das Auktionsgut kann nach Vereinbarung besichtigt werden. Auction lots may be viewed by appointment only.

Online-Katalog/Online Catalogue

KUENKER.DE

Betrachten Sie unsere Auktionskataloge im Internet! Unter www.kuenker.de und www.sixbid.com haben Sie die Möglichkeit, Abbildungen zu vergrößern, Ihre Gebote direkt abzugeben und die Ergebnisse der Auktionen abzurufen. Please browse our auction catalogues at www.kuenker.com or at www.sixbid.com! You will have the possibility to zoom all images, to place your bids and to view all auction results online.

Künker-Service Wir sind mittlerweile mit neun eigenen Standorten in Deutschland und Europa vertreten. So können wir Ihnen unseren beliebten Künker-Service auch in Ihrer Nähe anbieten. Unsere Leistungen vor Ort: • Persönliche Beratung und Betreuung in Ihrer Nähe. • Sie können Ihre Münzen direkt einliefern oder verkaufen, ersteigerte Münzen abholen und sich nach Vereinbarung Einlieferungen auszahlen lassen. • Sie können sich von unserem Kooperationspartner auf den Künker-Auktionen vertreten lassen. We are now represented with nine locations in Germany and Europe so that we can also provide you the best service in your vicinity. Our local services: • You always have a point of contact nearby. • You can directly consign or sell your coins, collect purchases and receive by appointment payment for consignments. • You can have our cooperation partner represent you at our auctions.

OSNABRÜCK Fritz Rudolf Künker GmbH & Co. KG Gutenbergstraße 23, 49076 Osnabrück Tel. +49 (0)541 96 20 20, E-Mail: service@kuenker.de Hauupptstsitititz Ha itz in in Osn s ab abrü brü rückk rück

4

USt-IdNr./VAT-No: DE256270181

TEL +49 (0)541 96 20 20, FAX +49 (0)541 96 20 222, SERVICE@KUENKER.DE, WWW.KUENKER.DE


Standorte/Locations MÜNCHEN Künker Numismatik AG Löwengrube 12, 80333 München Dr. Hubert Ruß Tel. +49 (0)89 242 198 38, service@kuenker-numismatik.de

Drrr. Hu D Hube bert r Rußß

Frank Fr ank Ri an Rich chhar ards rdssen en

Fritz Rudolf Künker GmbH & Co. KG Maximiliansplatz 12a, 80333 München Frank Richardsen Tel. +49 (0)89 242 16 990, frank.richardsen@kuenker.de BERLIN Fritz Rudolf Künker GmbH & Co. KG Poststraße 22, 10178 Berlin-Mitte Wollankstraße 117, 13187 Berlin-Pankow Michael Otto Tel. +49 (0)30 247 248 91, michael.otto@kuenker.de HAMBURG Künker Hamburg, c/o Roland Trampe

Micchhae Mi ael Ot Otto to

Rola Ro l nndd Tra la ram ram mppe

Roland Trampe Tel. +49 (0)541 96 20 20, roland.trampe@kuenker.de KONSTANZ Künker Konstanz, c/o Michael Autengruber Schulthaißstraße 10, 78462 Konstanz Michael Autengruber Tel. +49 (0)7531 28 44 69, michael.autengruber@kuenker.de ZNOJMO Künker Znojmo, c/o Petr Kovaljov 17. Listopadu 18, 66902 Znojmo, Tschechische Republik

Michaeel Autetngruube berr

Petr Kov Pe ovaalljo jov jov

Petr Kovaljov Tel. +42 (0)603 81 10 31, petr.kovaljov@kuenker.de ZÜRICH Künker Zürich, c/o Hess-Divo AG Löwenstraße 55, 8001 Zürich, Schweiz Ulf Künker Tel. +41 (0)44 225 40 90, zuerich@kuenker.de MOSKAU Künker Moskau, c/o Russian Coin Co. Ltd. 2/21 Makarenko St., 123001 Moskau, Russland

Alek Al lek ekses y O Onncchhuukkov ov

Aleksey Onchukov Tel. +7 (495) 589 56 10, aleksey.onchukov@kuenker.de

TEL +49 (0)541 96 20 20, FAX +49 (0)541 96 20 222, SERVICE@KUENKER.DE, WWW.KUENKER.DE

5


Was ist für Ihre schriftliche Auktionsteilnahme besonders wichtig?

DEUTSCH

• Bitte senden Sie uns Ihre Aufträge möglichst frühzeitig zu. Wenn uns Ihr Auftrag erst kurz vor der Auktion erreicht, können sich bei der Bearbeitung Fehler einschleichen. Das beiliegende Formular erleichtert Ihnen die Abgabe eines schriftlichen Gebots. Gerne nehmen wir Ihre Gebote per Post, Fax oder Email entgegen. • Wenn Sie noch nicht bei uns gekauft haben, bitten wir Sie, uns als Referenz eine Münzhandlung anzugeben, mit der Sie bereits in Geschäftsverbindung stehen. • Wir gewährleisten die Echtheit aller verkauften Objekte auch über die gesetzliche Frist hinaus.

Sie möchten telefonisch an der Auktion teilnehmen? Die telefonische Teilnahme an der Auktion ist bei uns selbstverständlich möglich. Wir rufen Sie während der Auktion gerne an und helfen Ihnen, die gewünschten Stücke zu ersteigern. Aus organisatorischen Gründen bitten wir Sie, die folgenden Punkte zu beachten:

Ulrich Künker Leiter Kundenbetreuung

• Telefonisches Bieten ist nur bei Losen mit einer Taxe von mind. € 500,– möglich. • Bitte teilen Sie uns mindestens 48 Stunden vor der Auktion mit, zu welchen Stücken Sie angerufen werden möchten. • Bitte achten Sie darauf, dass Sie erreichbar sind, wenn Ihre Stücke versteigert werden. Der Zeitplan in diesem Katalog hilft Ihnen dabei, den Zeitpunkt der Versteigerung abzuschätzen. • Für den Fall, dass wir Sie nicht erreichen können, bieten wir in Ihrem Namen bis zur Höhe Ihres schriftlichen Gebotes, mindestens aber bis zur Höhe des Schätzpreises. • Bitte beachten Sie, dass telefonisches Bieten eine unsichere Variante der Auktionsteilnahme sein kann. Wir können keine Garantie für das Zustandekommen der telefonischen Verbindung übernehmen. Wenn Sie sicher gehen wollen, besuchen Sie bitte unsere Auktion persönlich oder geben Sie uns ein schriftliches Gebot.

Was passiert nach der Auktion? Barbara Westmeyer deutschsprachige Kundenbetreuung

Telefon: +49 (0)541 96 20 20 Fax: +49 (0)541 96 20 222 Gebührenfrei: 0800 58 36 537 E-Mail: service@kuenker.de Internet: www.kuenker.de Montag – Donnerstag 8.30 – 17.00 Uhr Freitag 8.00 – 15.30 Uhr

6

• Der Versand der Auktionsware startet sofort nach Beendigung der Auktion und dauert in der Regel 8 Tage. • Alle Kunden, die an unserer Auktion schriftlich teilgenommen haben, erhalten innerhalb von 2 Wochen nach der Auktion unsere Ergebnisliste gratis. • Alle Ergebnisse sind spätestens einen Tag nach Auktionsende auf unserer Internetseite verfügbar.

Sie möchten Ihre Münzen in unsere Auktion einliefern? Sollten Sie sich zum Verkauf Ihrer Münzen entschlossen haben, kommen Sie zu uns. Seit 1985 beweisen wir mit derzeit 4 Auktionsterminen und ca. 15 Katalogen pro Jahr unsere Kompetenz und Zuverlässigkeit. Wichtige Informationen für Sie im Überblick: • Ihre Münzen werden von unseren Experten nach neuestem numismatischem Standard bestimmt und in hochwertigen Farbkatalogen präsentiert. • Wir verfügen mit mehr als 10.000 Kunden über eine der besten Kundendateien weltweit. Im Durchschnitt verkaufen wir mehr als 95 % der Stücke einer Auktion, nicht selten erzielen wir dabei Rekordzuschläge. Für nicht verkaufte Objekte werden keine Gebühren erhoben. • Ab der Übergabe an uns sind Ihre Münzen mit dem doppelten Schätzwert versichert. Unsere Kundenbetreuung bespricht gerne mit Ihnen wie Ihre Stücke sicher zu uns gelangen können. • Ihre Einlieferung wird Ihnen sofort nach der Übernahme quittiert. Spätestens 5 Wochen vor der Auktion erhalten Sie eine Auflistung Ihrer Stücke inkl. Katalognummern und Schätzpreisen. • Unmittelbar nach der Auktion erhalten Sie die Ergebnisliste und können dann alle erzielten Preise feststellen. Den Auktionserlös erhalten Sie innerhalb von 45 Tagen nach der Auktion.

TEL +49 (0)541 96 20 20, FAX +49 (0)541 96 20 222, SERVICE@KUENKER.DE, WWW.KUENKER.DE


Important facts for a written participation in the auction • Please send us your instructions as early as possible. The likelihood of errors occurring increases if we receive your instructions only shortly before the auction. The enclosed form should make it simple for you to submit a written bid, you may send your bids by mail, fax or e-mail. • If you are a new customer who has not yet purchased from us, we do request references. Please name a coin dealer with whom you have already done business. • The genuineness of all objects sold is warranted beyond the statutory length of time.

ENGLISH

Do you wish to participate by telephone? You are welcome to participate in our auction by telephone. We are glad to call you during the auction and to assist you in bidding for your items. Please take notice of the following conditions: • Telephone bidding is accepted exclusively on lot numbers with estimates at 500 Euro or above. • Please inform us at least 48 hours in advance if you wish to register for telephone bidding, even for single lots. We do need 48 hours to schedule all incoming requests. • Please be available, when your lots will be sold. The time schedule in the catalogue will help you to estimate the approximate time when your items are going to be sold. • Should you not be available by phone, we will bid on your behalf up to your submitted written limit or at least up to the estimate of the lot for which you requested to be called. • Please be aware that telephone bidding is a risky way of participation in our auction. We do not assume liability should the telephone line be interrupted or not be achieved. We advise you to attend the auction in person or to send written bids.

Nadine Zuber English, Deutsch

What occurs after the auction? • The shipment of all auction goods starts immediately after the completion of the entire auction week and it usually takes 8 days to be completed. • All auction results are available on our website one day after the end of the auction week. • All clients who submitted bids for the auction will automatically receive the list of auction results free of charge within two weeks after the end of auction.

Do you wish to consign your coins to our auction? Should you decide to sell your coins, we are ready to assist you. Since 1985 we have earned our bona fides in conducting over 4 auctions and in publishing 15 catalogues per year. In the following you will find the most important information on consigning: • We guarantee the professional handling of your consignment following the latest numismatic level of expertise including its presentation in colour catalogues of outstanding quality. • We possess one of the best customer lists worldwide. On average we sell more than 95 % of all items in our auction, and it is not unusual for us to achieve record hammer prices for lots submitted. Unsold items incur no fees. • Once the coins are consigned they are covered by our insurance at double the estimate. Upon consultation with our customer service we try to advise you on the safest way of shipping for your coins. • Your delivery will be confirmed in writing immediately on receipt. At least five weeks before the auction, you will receive an exact list of your objects with the relevant catalogue numbers and descriptions. • Within a week of the end of auction, you will receive a list of auction results in order to see what prices were reached for each individual lot. As a consignor, you will receive the auction proceeds within 45 days after the end of auction.

Marion Künker English, Deutsch

Phone: +49 (0)541 96 20 20 Fax: +49 (0)541 96 20 222 E-Mail: service@kuenker.de Website: www.kuenker.com Monday –Thursday 8.30 AM – 5 PM Friday 8 AM – 3.30 PM

TEL +49 (0)541 96 20 20, FAX +49 (0)541 96 20 222, SERVICE@KUENKER.DE, WWW.KUENKER.DE

7


Votre participation par écrit – Les points essentiels

FRANCAIS

• Veuillez nous faire parvenir vos ordres le plus tôt possible. Si vos ordres nous parviennent juste avant la vente aux enchères, des erreurs risquent d’être commises lors de leur traitement. Le formulaire ci-joint vous aidera à rédiger facilement votre offre. Vous pouvez nous envoyer vos ordres par la poste, par fax ou par e-mail. • Si vous n’avez encore fait aucune acquisition chez nous, nous vous prions de nous indiquer une ou deux références d’autres maisons numismatiques où vous avez déjà acheté. • L’authenticité des pièces vendues est garantie même au-delà des délais légaux.

Vous voulez participer par téléphone? La participation par téléphone est bien sûr possible. Nous vous appelons volontiers pour vous aider à acquérir les pièces voulues. Pour des raisons d´organisation veuillez noter les points suivants:

Alexandra Elflein, M. A. Français, Deutsch, English, Italiano

• La participation par téléphone est possible seulement pour les lots estimé à plus de 500 Euros chacun. • Veuillez nous informer au moins 48 heures avant la vente de la liste des pièces pour lesquelles vous voudriez être appelé. • Veuillez prendre soin d´être joignable quand vos pièces seront mises en vente. L’ordre de vente dans ce catalogue vous aidera à estimer l´heure de la vente. • Dans le cas où nous ne parviendrions pas à vous joindre, nous enchérirons pour vous jusqu’au montant que vous nous indiquez par écrit, égal ou supérieur au prix d’estimation. • La participation par téléphone présente des risques, et nous déclinons toute responsabilité dans le cas où la communication téléphonique serait interrompue, ou bien ne pourrait être établie.

Ce qui se passe après la vente Kmar Chachoua Français, Deutsch, English, Arabic

Tél. +49 (0)541 96 20 20 Facs. +49 (0)541 96 20 222 E-Mail: service@kuenker.de Site: www.kuenker.de Lundi à Jeudi de 8h30 à 17h00 Vendredi de 8h00 à 15h30

8

• L´expédition des biens va commencer immédiatement après la fin de la vente complète, et prend généralement 8 jours. • Tous les clients qui ont participé à l’une de nos ventes aux enchères recevront gratuitement une liste de résultats dans les deux semaines qui suivent. • Les résultats seront disponibles sur notre site internet, au plus tard un jour après la fin de la vente.

Vous voulez confier vos monnaies pour nos ventes aux enchères? Contactez nous si vous envisagez de vendre vos pièces. Notre compétence et fiabilité est prouvée depuis 1985 par actuellement 4 ventes aux enchères et environ 15 catalogues par an. Le plus important pour vous est que: • Vos pièces seront décrites par notre équipe d’experts selon les standards numismatiques les plus récents, et elles seront présentées dans des catalogues de haute qualité en couleurs. • Nous avons un des meilleurs fichiers-clientèle du monde avec plus de 10.000 clients. Nous vendons en moyenne plus de 95% de la vente aux enchères, et obtenons souvent des prix records. Les monnaies invendues n’encourent aucun frais. • Notre service clientèle est disponible pour vous conseiller pour l’envoi de vos pièces, et dès leur réception vos pièces seront assurées pour le double de la valeur d´estimation. • Vous recevrez une liste détaillée des pièces fournies au moment de la prise en charge puis, au plus tard cinq semaines avant la vente aux enchères, vous recevrez leur liste exacte avec les numéros de catalogue correspondants. • Immédiatement après la vente aux enchères, vous recevrez la liste des résultats et pourrez prendre connaissance des prix obtenus. Vous recevrez le produit de la vente dans les 45 jours après les enchères.

TEL +49 (0)541 96 20 20, FAX +49 (0)541 96 20 222, SERVICE@KUENKER.DE, WWW.KUENKER.DE


I punti piú importanti per la Sua partecipazione per iscritto • La preghiamo di farci pervenire i Suoi ordini al piú presto possibile. Se i Suoi ordini ci arrivano poco prima dell´inizio dell´asta possono verificarsi errori. Il formulario allegato Le faciliterá l´invio dei Suoi ordini per iscritto. Ci puó far pervenire i Suoi ordini per posta, per fax o per email. • Se non ha mai acquistato presso di noi, La preghiamo di volerci indicare a titolo di referenza il nome di uno o due commercianti numismatici presso i quali è giá cliente. • L’autenticità di tutti gli oggetti venduti viene garantita anche oltre i termini previsti dalla legge.

ITALIANO

Desidera partecipare telefonicamente alla nostra asta? La partecipazione telefonica è naturalmente da noi possibile. La chiameremo durante l´asta e La assisteremo volentieri per ottenere l´aggiudicazione dei pezzi desiderati. Per motivi di organizzazione La preghiamo di voler tenere conto dei seguenti punti: • La partecipazione telefonica è possibile solo per lotti stimati con almeno 500,– € l´uno. • La preghiamo di volerci comunicare almeno 48 ore prima dell´inizio dell´asta per quali pezzi desidera essere chiamato. • La preghiamo di aver cura di essere raggiungibile telefonicamente al momento in cui vengono messi all´asta i pezzi che Le interessano. Lo schema orario in catalogo La aiuterá a stimare a che ora verranno messi all´asta i pezzi che Le interessano. • Nel caso in cui non riuscissimo a contattarLa telefonicamente, provvederemo ad offrire a Suo nome fine all´importo massimo indicatoci per iscritto, in ogni caso offriremo a Suo nome come minimo il prezzo di stima. • La partecipazione telefonica è un modo incerto di partecipare alle aste. Non assumiamo nessuna responsabilità se per esempio la linea telefonica è occupata o interrotta o se Lei non sará raggiungibile per altri motivi.

Sonia Russo, M. A. Italiano, Deutsch, English, Español

Cosa succede dopo l´asta? • La spedizione del materiale d´asta comincia subito dopo la fine dell´intera asta e termina normalmente entro 8 giorni. • Tutti i clienti che hanno partecipato all´asta ricevono entro 2 settimane dopo l´asta la lista dei prezzi di realizzo. • I prezzi di realizzo sono visionabili sul nostro sito internet al piú tardi un giorno dopo la fine dell´intera asta.

Vuole consegnarci le Sue monete per una nostra asta? Ci contatti se ha deciso di vendere le Sue monete. Dal 1985 la nostra competenza ed affidabilità è dimostrata da attualmente 4 aste e circa 15 cataloghi all´anno. Quali sono i punti di maggior importanza per Lei:

Cristina Welzel Italiano, Deutsch, English, Français

Tel.: +49 (0)541 96 20 20 Fax: +49 (0)541 96 20 222 E-Mail: service@kuenker.de Internet: www.kuenker.de Lunedì a giovedì dalle 8.30 alle 17.00 Venerdì dalle 8.00 alle 15.30

• Le Sue monete vengono valutate dal nostro staff di esperti secondo i piú attuali standard numismatici e vengono presentati in cataloghi di alto valore a colori. • Con piú di 10.000 clienti disponiamo di una delle migliori banca dati clienti del mondo. In media vendiamo oltre il 95% del materiale d´asta realizzando spesso prezzi da record. Per i pezzi invenduti non ci sono nessune spese da pagare. • Dal momento della consegna le Sue monete sono assicurate per il doppio del valore di stima. Il nostro servizio clientela Le consiglierá volentieri come farci avere le Sue monete nel modo piú sicuro. • La Sua consegna Le verrá immediatamente quietanzata al momento della resa dei pezzi. Al piú tardi 5 settimane prima dell´asta riceverá una lista dettagliata dei Suoi pezzi con i numeri di catalogo ed i prezzi di stima. • Subito dopo l´asta riceverá la lista con i risultati d´asta dalla quale potrá subito controllare i prezzi realizzati. Riceverá l´importo di realizzo entro 45 giorni dopo la fine dell´asta.

9


Что особенно важно при заочном участии на аукционе?

RUSSKIJ

• Тщательно изучите наш каталог и запишите те лоты, которые Вас заинтересовали. Заполните приложенный формуляр и отправьте нам его заранее по почте, факсу или электронной почте. Мы обращаем внимание на то, что если Ваши ставки придут перед самым началом аукциона либо во время аукциона, то существует вероятность допуска ошибки в процессе обработки заказа. • Если Вы впервые принимаете участие в нашем аукционе, то мы рекомендуем Вам указать Ваш референц – аукционные дома, с которыми Вы уже сотрудничали. Или свяжитесь с нами по телефону +49(0)541 9620268. • Подлинность купленных на нашем аукционе лотов гарантируется нами на протяжении неограниченного времени.

Вы хотели бы принять участие на аукционе по телефону? У нас, конечно, есть возможность организовать Ваше телефонное участие на торгах, но мы бы хотели обратить внимание на следующие пункты: Anastasija Koepsell Russkij, Deutsch

• Участие в телефонных торгах возможно только для лотов со стартовой ценой свыше 500 евро. • Для участия в торгах по телефону просим Вас связаться с нами не позднее 48 часов до начала аукциона. • Мы хотим подчеркнуть, что телефонное участие на аукционе – не самый безопасный способ: в случае плохой связи, недоступности клиента во время торгов либо других технических проблем мы не несем ответственности.

Что происходит после окончания аукциона?

Dzmitry Nikulin Russkij, Deutsch, English

Телефон: +49 (0)541 96 20 20 Факс: +49 (0)541 96 20 222 E-Mail: service@kuenker.de интернет: www.kuenker.de понедельник – четверг 8.30 – 17.00 пятница 8 – 15.30

10

• Результаты аукционов доступны на нашем сайте на следующий день после окончания торгов. • Вы можете лично забрать приобретенные лоты. По окончании торгов мы готовим все необходимые документы на вывоз из Евросоюза. • Почтовые отправки в Россию ( Беларусь, Украину ) осуществляются по предварительной договоренности. Для связи с нами звоните по телефону +49 (0)541 9620268.

Вы хотели бы выставить Ваши предметы на аукцион? Более 160-ти успешно проведенных аукционов, тысячи участников, 4 аукциона в год - эти и другие преимущества, которые говорят в пользу выставления Ваших коллекций на аукцион Кюнкер: • Ваши монеты будут оценены нашими экспертами по самым новым нумизматическим стандартам и представлены в высококачественном цветном каталоге. • Более 10000 клиентов со всего мира оказывают нам свое доверие. В среднем мы продаем более 95% всех выставляемых предметов, при этом зачастую достигая рекордных сумм. • Все Ваши предметы, после передачи их нам, хранятся у нас до начала аукциона застрахованными. Не позднее 5-ти недель до начала аукциона Вы получите по почте подробное описание Ваших лотов с указаннами номерами в каталоге, а также их оценочной стоимостью. • Результаты аукционов также будут высланы Вам по почте после окончания торгов. В течение 45 дней после аукциона Вам будет выплачено Ваше вознаграждение.

TEL +49 (0)541 96 20 20, FAX +49 (0)541 96 20 222, SERVICE@KUENKER.DE, WWW.KUENKER.DE


INHALT AUKTION 198 Nr.

Seite

RUSSISCHE MÜNZEN UND MEDAILLEN

8001

-

8648

15

-

115

Kaiserreich

8001

-

8579

15

-

105

Zar Dmitry Iwanowitsch, 1605-1606 Eine rubelförmige Silbermedaille auf den Zaren Dmitry Iwanowitsch Zar Alexei Michailowitsch, 1645-1676 Ein russischer Gegenstempel von 1655 (Jefimok) auf einem österreichischen Taler Zar Peter I., der Große, 1682-1725 Silbermünzen des Moskauer Münzhofes Kadashevsky Silbermünzen des Roten Münzhofes in Moskau Vier Sonnenrubel der Münzstätte St. Petersburg Eine Kupferprägung des Moskauer Münzhofes Naberezhny Kupferprägungen des Moskauer Münzhofes Kadashevsky Eine Prägung für die Ukraine Medaillen des Zaren Peter I. Zarin Katharina I., 1725-1727 Ein Novodel in Gold des Roten Münzhofes in Moskau Silbermünzen des Roten Münzhofes in Moskau Silbermünzen der Münzstätte St. Petersburg Eine Kupferprägung einer schwedischen Münzstätte

8001

15

8001

15

8002

15

8002

15

8003

-

8074

15

-

29

8003

-

8027

15

-

20

8028

-

8052

21

-

24

8053

-

8056

25

8057

25

8058

-

25

-

-

8062 8063 8074

27

-

26 26 29

8064 8075

-

8088

30

-

32

8075

30

8076

-

8084

30

-

31

8085

-

8087

31

-

32

8088

32

Zar Peter II., 1727-1730 Silbermünzen des Roten Münzhofes in Moskau Silbermünzen des Moskauer Münzhofes Kadashevsky Silbermünzen der Münzstätte St. Petersburg Ein Probe-Rubel der Münzstätte St. Petersburg

8089

-

8101

32

-

35

8089

-

8091

8092

-

8097

8098

-

8100

34

8101

35

Zarin Anna, 1730-1740 Silbermünzen des Moskauer Münzhofes Kadashevsky Silbermünzen des Roten Münzhofes in Moskau

8102

-

8126

36

-

40

8102

-

8116

36

-

38

8117

-

8120

38

-

39

32 33

-

34

11


Nr. Silbermünzen der Münzstätte St. Petersburg Zwei Silberjetons der Zarin Anna

8121 8125

-

8124 8126

8127

-

8133

40

-

42

8127

-

8129

40

-

41

8130

-

8133

41

-

42

8134

-

8156

42

-

46

8134

-

8136

8137

-

8149

8150 8152 8155

-

8151 8154 8156

Zar Peter III., 1762 Ein halber Rubel des Roten Münzhofes in Moskau Silbermünzen der Münzstätte St. Petersburg Zwei Kupferprägungen des Zaren Peter III.

8157

-

8164

Zarin Katharina II., 1762-1796 Goldmünzen der Münzstätte St. Petersburg Ein Rubel des Roten Münzhofes in Moskau Silbermünzen der Münzstätte St. Petersburg Kupferprägungen des Roten Münzhofes in Moskau Kupferprägungen der Münzstätte St. Petersburg Kupferprägungen der Münzstätte Ekaterinburg Eine Kupferprägung der Münzstätte Feodosia (Krim) Kupferprägungen der Münzstätte Anninskoye Kupferprägungen für Sibirien aus der Münzstätte Suzun (Kolyvan) Kupferprägungen für Moldawien und die Walachei aus der Münzstätte Sadogura Medaillen der Zarin Katharina II.

Zar Ivan III., 1740-1741 Silbermünzen des Roten Münzhofes in Moskau Silbermünzen der Münzstätte St. Petersburg Zarin Elisabeth, 1741-1761 Silbermünzen des Roten Münzhofes in Moskau Silbermünzen der Münzstätte St. Petersburg Zwei Kupferprägungen des Roten Münzhofes in Moskau Prägungen für Ostpreußen Zwei Medaillen der Zarin Elisabeth

Zar Paul I., 1796-1801 Silbermünzen der Münzstätte St. Petersburg Kupferprägungen des Zaren Paul I. Medaillen des Zaren Paul I.

12

Seite 39 40

42 43

-

45

45

-

45 46 46

46

-

48

8157

46

8158

-

8162

47

-

48

8163

-

8164

8165 8165

-

8231 8173 8174

48 48

-

59 50 50

8175

-

8196

50

-

53

8197

-

8198

53

8199

-

8200

54

8201

-

8206

48

54

-

55

8207

55 55

8208

-

8212

8213

-

8222

8223 8225

-

8224 8231

8232

-

8244

8232 8236 8241

-

8235 8240 8244

56

-

57

58

-

57 59

60

-

61

-

60 61 61

60


Nr. Zar Alexander I., 1801-1825 Zwei Goldmünzen des Zaren Alexander I. Silbermünzen der Münzstätte St. Petersburg Kupferprägungen des Zaren Alexander I. Eine Prägung für Georgien Prägungen für Polen Medaillen des Zaren Alexander I.

Seite

8245

-

8286

8245

-

8246

8247

-

8261

8262

-

8267 8275

-

8265 8266 8274 8286

8287

-

8287 8301 8305 8342 8351 8358

62

-

69 62

-

63

64 66

-

64 64 66 69

8393

69

-

80

-

8300 8304

69

-

70 71

-

8341 8350 8357 8363

71 75 76

-

75 76 77 77

8366 8382

-

78

-

8385

-

8364 8365 8381 8383 8384 8393

81

-

78 78 80 80 80 83

8394 8394

-

8459 8412

84 84

-

91 85

8413 8433 8442

-

8432 8441 8444

85

-

87 87 88

8446 8451

-

8445 8450 8459

Zar Alexander III., 1881-1894 Goldmünzen des Zaren Alexander III. Silbermünzen des Zaren Alexander III. Gedenkmünzen des Zaren Alexander III. Prägungen für Finnland Ein Feingewichtsbarren der Münzstätte St. Petersburg Medaillen des Zaren Alexander III.

8460 8460 8471 8490 8494

-

8503 8470 8489 8493 8495

8497

-

8496 8503

Zar Nikolaus II., 1894-1917 Goldmünzen des Zaren Nikolaus II. Silbermünzen des Zaren Nikolaus II. Kupfermünzen des Zaren Nikolaus II.

8504 8504 8529 8554

-

8579 8528 8553 8555

Zar Nikolaus I., 1825-1855 Goldmünzen der Münzstätte St. Petersburg Platinmünzen des Zaren Nikolaus I. Silbermünzen der Münzstätte St. Petersburg Silbermünzen der Münzstätte Warschau Kupfermünzen des Zaren Nikolaus I. Gedenkmünzen des Zaren Nikolaus I. Eine Kupferprobe der Münzstätte St Petersburg Eine Prägung für Georgien Prägungen für Polen Zwei Messing-Passiergewichte Eine französische Kupferprobe Medaillen des Zaren Nikolaus I. Zar Alexander II., 1855-1881 Goldmünzen des Zaren Alexander II. Silbermünzen der Münzstätte St. Petersburg Kupfermünzen des Zaren Alexander II. Gedenkmünzen des Zaren Alexander II. Ein Novodel einer Probemünze des Zaren Alexander II. Prägungen für Finnland Medaillen des Zaren Alexander II.

62

89

-

92

-

93

-

96

-

98 98 99

-

88 88 91 97 92 95 95 95 95 97 105 99 102 102

13


Nr. Gedenkmünzen des Zaren Nikolaus II. Prägungen für Finnland Medaillen des Zaren Nikolaus II.

Seite

8556 8568

-

8567 8574

102 103

-

103 104

8575

-

8579

104

-

105

Sowjetunion, 1917-1991

8580

-

8587

Russische Republik seit 1992

8588

-

8591

Lots und Sammlungen russischer Münzen und Medaillen

8592

-

8603

107

Spitzbergen

8604

107

Tannu Tuva

8605

107

Banknoten und Notgeldscheine des nördlichen Ostpreußens

8606

-

Münzschmuck CHINESISCHE MÜNZEN

8647

106

108

-

-

8648 9001

-

Eine Banknote der Ming Dynastie Das erste Papiergeld der Welt

9619

107

115 115

116

-

9001

212 116

Die Münzen des Kaiserreichs und der Republik China

9002

-

9296

117

-

159

Sycee-Barren und Gewichte

9297

-

9312

159

-

162

Ein bedeutender Orden der Quing-Dynastie

9313

163

Die Münzen der Volksrepublik China

9314

-

9572

Münzen aus Hong Kong

9573

-

9574

209

Münzen aus Taiwan

9575

-

9580

210

Lots chinesischer Münzen

9581

-

9619

Ein Stichwortverzeichnis finden Sie am Ende des Auktionskataloges 194.

14

106

164

211

-

-

209

212


PETER I.

4755+5%*'/ª0<'070&/'&#+..'0

8001

<#4&/+64;+9#019+65%* 'KPGTWDGNHÌTOKIG5KNDGTOGFCKNNGCWHFGP<CTGP&OKVT[+YCPQYKVUEJ 

4WDGNHÌTOKIG5KNDGTOGFCKNNGQ,WPUKIPKGTV$TWUVDKNFTOKVWOIGNGIVGO/CPVGNOKVFGT4GEJVGPFCU <GRVGT UEJWNVGTPF)GMTÌPVGT &QRRGNCFNGT CWH FGT $TWUV 5V )GQTIUUEJKNF QDGP -TQPG 0QXQFGN   OOI-CKO5 45VGORGNHGJNGTXQT\ÒINKEJ 

8002

<#4#.':'+/+%*#+.19+65%* 'KPTWUUKUEJGT)GIGPUVGORGNXQP ,GHKOQM CWHGKPGOÌUVGTTGKEJKUEJGP6CNGT 

,GHKOQM  ÒDGTRT·IV CWH GKPGO 4GKEJUVCNGT  FGU 4ÌOKUEJ&GWVUEJGP4GKEJGU 'T\JGT\QI .GQ   RQNF 8  FGT /ÒP\UV·VVG *CNN  I /KV \YGK)GIGPUVGORGNPCWHFGT4ÒEMUGKVG 5V )GQTIKO-CORHOKVFGO&TCEJGP ,CJTGU\CJN&CXp \W /6p \W 8QINJp

\W  $GNCIUGJTUEJÌP

,GHKOQM 2NWTCN ,GHKOMK  YCT FGT CWU FGT RQNPKUEJGP 5RTCEJG ,QCEJKOKM  CDIGNGKVGVG TWUUKUEJG #WUFTWEM HÒT   6CNGT &GT 0COG UVCOOV XQP FGP )WNFGPITQUEJGP FKG FKG )TCHGP XQP 5EJNKEM KP FGT DÌJOKUEJGP $GTIUVCFV   5V ,QCEJKOUVCN JGTIGUVGNNV JCVVGP /CP XGTYGPFGVG KP FGP DGKFGP UNCYKUEJGP 5RTCEJGP CNUQ FGP GTUVGP 6GKN FGT   WTURTÒPINKEJGP 0QOKPCNDG\GKEJPWPI ,QCEJKOUVCNGT Y·JTGPF KO &GWVUEJGP WPF 'PINKUEJGP 6CNGT &QNNCT    FGT \YGKVG 6GKN IGY·JNV YWTFG +O ,CJT  YWTFGP KP 4W­NCPF XGTUEJKGFGPG XQT CNNGO FGWVUEJG WPF   PKGFGTN·PFKUEJG6CNGTOKVGKPGO)GIGPUVGORGNXGTUGJGP&KGUG5VÒEMGYWTFGP,GHKOQMURTK\PCMQO IG\GKEJPGVGT ,GHKOQM  QFGT GKPHCEJ MWT\ ,GHKOQM IGPCPPV &KG IGIGPIGUVGORGNVGP 6CNGT MQPPVGP UKEJ LGFQEJ PKEJV KO   <CJNWPIUXGTMGJT FWTEJUGV\GP WPF YWTFGP  HÒT WPIÒNVKI GTMN·TV &C FKG OGKUVGP 5VÒEMG YQJN GKPIGUEJOQN\GP   YWTFGPUKPF,GHKOMKJGWVGTGEJVUGNVGPWPF\·JNGP\WFGPDGIGJTVGUVGP/ÒP\GP4W­NCPFU



8003

<#42'6'4+&'4)4155' 5KNDGTOÒP\GPFGU/QUMCWGT/ÒP\JQHGU-CFCUJGXUM[ 

4WDGN  M[TKNNKUEJ  /QUMCW /ÒP\JQH -CFCUJGXUM[  I )GJCTPKUEJVGU $TWUVDKNF T )G   MTÌPVGT&QRRGNCFNGTOKV<GRVGTWPF4GKEJUCRHGNKPFGP(·PIGPQDGP-TQPG$KVMKP 4 &CX &KCMQX 4*ÒDUEJGFWPMNG2CVKPCUGJTCVVTCMVKXGUUGJTUEJÌPGU'ZGORNCT  15


PETER I.

8004



4WDGN  M[TKNNKUEJ  /QUMCW /ÒP\JQH -CFCUJGXUM[  I )GJCTPKUEJVGU $TWUVDKNF T)G   MTÌPVGT&QRRGNCFNGTOKV<GRVGTWPF4GKEJUCRHGNKPFGP(·PIGPWPVGP\WFGP5GKVGPFGT5EJYCP\HGFGTP FCU IGVGKNVG /ÒP\UV·VVGP\GKEJGP QDGP -TQPG 8CTKCPVG OKV URKGIGNXGTMGJTVGT NGV\VGT <KHHGT FGT M[TKNNK   UEJGP,CJTGU\CJN$KVMKP 4 &CX&KCMQX  8QPITQ­GT5GNVGPJGKV(GKPG2CVKPCUGJTUEJÌPpXQT\ÒINKEJ 

8005

8005

1,5:1



4WDGN M[TKNNKUEJ /QUMCW/ÒP\JQH-CFCUJGXUM[I)GJCTPKUEJVGU$TWUVDKNFTOKV.QT DGGTMTCP\ WPF WOIGNGIVGO /CPVGN CO #TOCDUEJPKVV FKG 5KIPCVWT *)GMTÌPVGT &QRRGNCFNGT OKV   <GRVGTWPF4GKEJUCRHGNKPFGP(·PIGPQDGP-TQPG$KVMKP&CX&KCMQX  445GJTUEJÌP 

8006

8006

1,5:1



16

4WDGN/QUMCW/ÒP\JQH-CFCUJGXUM[I)GJCTPKUEJVGU$TWUVDKNFTOKV.QTDGGTMTCP\WPF WOIGNGIVGO /CPVGN)GMTÌPVGT &QRRGNCFNGT OKV <GRVGT WPF 4GKEJUCRHGN KP FGP (·PIGP WPVGP \W FGP   5GKVGPFGT5EJYCP\HGFGTPFKGIGVGKNVG,CJTGU\CJNQDGP-TQPG$KVMKP 4 &CX&KCMQX  8QPITQ­GT5GNVGPJGKV5GJTCVVTCMVKXGU'ZGORNCTOKVJGTTNKEJGT2CVKPCUGJTUEJÌPpXQT\ÒINKEJ 


PETER I.

8007

8008



4WDGN M[TKNNKUEJ /QUMCW/ÒP\JQH-CFCUJGXUM[I)GJCTPKUEJVGU$TWUVDKNFTOKV.QT DGGTMTCP\ WPF WOIGNGIVGO /CPVGN)GMTÌPVGT &QRRGNCFNGT OKV <GRVGTWPF4GKEJUCRHGNKPFGP(·PIGP QDGP-TQPG$KVMKP 4 &CX&KCMQX 4.GKEJVG2T·IGUEJY·EJGCO4CPFXQT\ÒINKEJ 



4WDGN  M[TKNNKUEJ  /QUMCW/ÒP\JQH-CFCUJGXUM[I$KVMKP&CX&KCMQX 5GJTUEJÌP 

8009

8009 1,5:1



4WDGN M[TKNNKUEJ /QUMCW/ÒP\JQH-CFCUJGXUM[I)GJCTPKUEJVGU$TWUVDKNFTOKV.QT DGGTMTCP\ WPF WOIGNGIVGO /CPVGN CO #TOCDUEJPKVV FKG 5KIPCVWT 1 -)GMTÌPVGT &QRRGNCFNGT OKV   <GRVGTWPF4GKEJUCRHGNKPFGP(·PIGPQDGP-TQPG$KVMKPp&CX\W&KCMQXp  7PGFKGTVG2QTVT·VXCTKCPVG8QPCNNGTITÌ­VGT5GNVGPJGKV9KP\5EJTÌVNKPIUHGJNGTHCUVXQT\ÒINKEJ  /KV'ZRGTVKUGXQP+IQT5EJKT[CMQX5VCCVNKEJGU*KUVQTKUEJGU/WUGWO/QUMCW

8011

8010

8010



4WDGN M[TKNNKUEJ /QUMCW/ÒP\JQH-CFCUJGXUM[I$KVMKP 4 &CX&KCMQX 4#VVTCMVKXGU'ZGORNCTOKVHGKPGT2CVKPCUGJTUEJÌPpXQT\ÒINKEJ





4WDGN M[TKNNKUEJ /QUMCW/ÒP\JQH-CFCUJGXUM[I$KVMKP 4 &CX&KCMQX 4(GKPG2CVKPCMN5EJTÌVNKPIUHGJNGTUGJTUEJÌP

 17


PETER I.

8012

8013

8014



4WDGN M[TKNNKUEJ /QUMCW/ÒP\JQH-CFCUJGXUM[I$KVMKP 4 &CX&KCMQX 44CPFWPF(GNFGTDGCTDGKVGVHCUVUGJTUEJÌP



4WDGN  M[TKNNKUEJ  /QUMCW/ÒP\JQH-CFCUJGXUM[I$KVMKP&CX&KCMQX 5GJTUEJÌPpXQT\ÒINKEJ 



4WDGN M[TKNNKUEJ /QUMCW/ÒP\JQH-CFCUJGXUM[I$KVMKP 4 &CX&KCMQX 4.GKEJVDGTKGDGPUGJTUEJÌP

8015

8016





8017



4WDGN M[TKNNKUEJ /QUMCW/ÒP\JQH-CFCUJGXUM[+P752NCUVKMJQNFGTFGT0)%OKVFGT$GYGT VWPI#7$KVMKP&CX&KCMQX 2TCEJVXQNNG2CVKPCHCUVXQT\ÒINKEJ





4WDGN M[TKNNKUEJ /QUMCW/ÒP\JQH-CFCUJGXUM[I$KVMKPXCT&CX&KCMQX *ÒDUEJG2CVKPCMN-TCV\GTKO(GNFFGT8QTFGTUGKVGUGJTUEJÌPpXQT\ÒINKEJ





4WDGN/QUMCW/ÒP\JQH-CFCUJGXUM[I$KVMKP 4 &CX&KCMQX  4(CUVUGJTUEJÌP

18




PETER I.

8018

1,5:1



1,5:1

4WDGN 2QNVKPC  M[TKNNKUEJ /QUMCW/ÒP\JQH-CFCUJGXUM[I)GJCTPKUEJVGU$TWUVDKNF T OKV .QTDGGTMTCP\ WPF WOIGNGIVGO /CPVGN CO #TOCDUEJPKVV ) URKGIGNXGTMGJTV )GMTÌPVGT   &QRRGNCFNGTOKV<GRVGTWPF4GKEJUCRHGNKPFGP(·PIGPQDGP-TQPG$KVMKP 4 &KCMQX  8QPITÌ­VGT5GNVGPJGKV*ÒDUEJG2CVKPCYKP\-TCV\GTUGJTUEJÌP 

8019

1,5:1



1,5:1

4WDGN 2QNVKPC  M[TKNNKUEJ /QUMCW/ÒP\JQH-CFCUJGXUM[I)GJCTPKUEJVGU$TWUVDKNF T OKV .QTDGGTMTCP\ WPF WOIGNGIVGO /CPVGN)GMTÌPVGT &QRRGNCFNGT OKV <GRVGT WPF 4GKEJUCRHGN KP   FGP(·PIGPQDGP-TQPG$KVMKP 4 &KCMQX  8QPITÌ­VGT5GNVGPJGKV(GKPG2CVKPCYKP\)TCHHKVKMN2T·IGUEJY·EJGUGJTUEJÌP 

8020

8021



4WDGN 2QNVKPC  M[TKNNKUEJ /QUMCW/ÒP\JQH-CFCUJGXUM[I$KVMKP 4 &KCMQX 4(CUUWPIUURWTGPUGJTUEJÌP





4WDGN 2QNVKPC  M[TKNNKUEJ /QUMCW/ÒP\JQH-CFCUJGXUM[I$KVMKP 4 &KCMQX 4*ÒDUEJG2CVKPCUGJTUEJÌP

 19


PETER I.

8022

1,5:1

1,5:1



 4WDGN 2QNVKPC   M[TKNNKUEJ  /QUMCW /ÒP\JQH -CFCUJGXUM[  I $KVMKP  4    &KCMQXXCT 8QPITQ­GT5GNVGPJGKV-N5VGORGNHGJNGTMN5EJTÌVNKPIUHGJNGTUGJTUEJÌP 

8024

8023



 4WDGN 2QNVKPC   M[TKNNKUEJ  /QUMCW /ÒP\JQH -CFCUJGXUM[  I $KVMKP  4    &KCMQX 5GJTUGNVGPDGUQPFGTUKPFKGUGT'TJCNVWPI #VVTCMVKXGU'ZGORNCTOKVJÒDUEJGT2CVKPCMN5EJTÌVNKPIUHGJNGTHCUVXQT\ÒINKEJ 



4WDGN 2QNVKPC  M[TKNNKUEJ /QUMCW/ÒP\JQH-CFCUJGXUM[I$KVMKP 4 &KCMQX 44#VVTCMVKXGU'ZGORNCTOKVJÒDUEJGT2CVKPCMN5EJTÌVNKPIUHGJNGTUGJTUEJÌP 'ZGORNCTFGT5COONWPI#PVQPKP2TQMQR6GKN#WMVKQP#WTGC0WOKUOCVKMC2TCI0T

8025

8026



8027



4WDGN 2QNVKPC  M[TKNNKUEJ /QUMCW/ÒP\JQH-CFCUJGXUM[I$KVMKPXCT&KCMQX XCT 4*GPMGNURWTUGJTUEJÌP





 4WDGN 2QNVKPC   M[TKNNKUEJ  /QUMCW /ÒP\JQH -CFCUJGXUM[  I $KVMKP    &KCMQXXCT 5GJTUEJÌP





 4WDGN 2QNWRQNVKPPKM   M[TKNNKUEJ  /QUMCW /ÒP\JQH -CFCUJGXUM[  I $KVMKP  4    &KCMQX 445GJTUEJÌP



20


PETER I.

8028

8028 1,5:1

5KNDGTOÒP\GPFGU4QVGP/ÒP\JQHGUKP/QUMCW 

4WDGN  M[TKNNKUEJ  /QUMCW 4QVGT /ÒP\JQH  I )GJCTPKUEJVGU $TWUVDKNF T)GMTÌPVGT   &QRRGNCFNGTOKV<GRVGTWPF4GKEJUCRHGNKPFGP(·PIGPQDGP-TQPG$KVMKP 4 &CX&KCMQX 44*ÒDUEJG2CVKPCMN<CKPGPFGUGJTUEJÌPpXQT\ÒINKEJ 

8029



4WDGN/QUMCW4QVGT/ÒP\JQHI$KVMKP 4 &CX&KCMQX  44(GKPG2CVKPCMN5EJTÌVNKPIUHGJNGTUGJTUEJÌP

8030

8031



8032



4WDGN/QUMCW4QVGT/ÒP\JQHI$KVMKP 4 &CX&KCMQX  445VCTMG5EJTÌVNKPIUHGJNGTMN-TCV\GTUGJTUEJÌP





4WDGN/QUMCW4QVGT/ÒP\JQHI8CTKCPVGQJPG#PFTGCUMTGW\$KVMKP 4 &CX &KCMQX 44(GKPG2CVKPCUGJTUEJÌP





4WDGN/QUMCW4QVGT/ÒP\JQHI$KVMKPHHXCT&CX&KCMQXHHXCT  *GPMGNURWTHCUVUGJTUEJÌP

 21


PETER I.

8033

8034

8035



4WDGN/QUMCW4QVGT/ÒP\JQHI$KVMKP&CX&KCMQX  5GNVGPKPFKGUGT'TJCNVWPI*GTTNKEJG2CVKPCHCUVXQT\ÒINKEJ





4WDGN/QUMCW4QVGT/ÒP\JQHI$KVMKP&CX&KCMQX  9KP\5EJTÌVNKPIUHGJNGTKO(GNFFGT4ÒEMUGKVGUGJTUEJÌP





4WDGN/QUMCW4QVGT/ÒP\JQHI$KVMKP&CX&KCMQX  &WPMNG2CVKPC*GPMGNURWT(GNFGTHGKPIGIGN·VVGVUGJTUEJÌP



8036

8037

8038



4WDGN/QUMCW4QVGT/ÒP\JQHI$KVMKP&CX&KCMQX

5EJÌPpUGJTUEJÌP





4WDGN/QUMCW4QVGT/ÒP\JQHI$KVMKPXCT&CX&KCMQXXCT  $GTKGDGPUGJTUEJÌP





4WDGN/QUMCW4QVGT/ÒP\JQHI$KVMKPXCT&CX&KCMQXXCT 5GJTUEJÌP



22


PETER I.

8039

8041

8040



4WDGN/QUMCW4QVGT/ÒP\JQHI$KVMKP&CX&KCMQXXCT

5GJTUEJÌP





4WDGN/QUMCW4QVGT/ÒP\JQHI$KVMKP 4 &CX&KCMQX

45GJTUEJÌP





4WDGN/QUMCW4QVGT/ÒP\JQHI$KVMKPXCT&CX&KCMQXXCT  5GNVGPKPFKGUGT'TJCNVWPI-N<CKPGPFGXQT\ÒINKEJ



8042

8044

8043



4WDGN/QUMCW4QVGT/ÒP\JQHI$KVMKPXCT&CX&KCMQXXCT

 5GJTUEJÌP





4WDGN/QUMCW4QVGT/ÒP\JQHI$KVMKP&CX&KCMQX  *ÒDUEJG2CVKPCUGJTUEJÌPpXQT\ÒINKEJ





4WDGN 2QNVKPC  M[TKNNKUEJ /QUMCW4QVGT/ÒP\JQHI$KVMKP 4 &KCMQX  45EJTÌVNKPIUTK­IGUVQRHVGU.QEJUGJTUEJÌP

 23


PETER I.

8045

8046



4WDGN 2QNVKPC  M[TKNNKUEJ /QUMCW4QVGT/ÒP\JQHI$KVMKP 4 &KCMQX  45GJTUEJÌP





4WDGN 2QNVKPC  M[TKNNKUEJ /QUMCW4QVGT/ÒP\JQHI$KVMKP 4 &KCMQX  45GJTUEJÌP



8048

8047



 4WDGN 2QNVKPC   /QUMCW 4QVGT /ÒP\JQH +P 752NCUVKMJQNFGT FGT 0)% OKV FGT $GYGTVWPI   :($KVMKPXCT 4 &KCMQXXCT 5GJTUEJÌP 



4WDGN 2QNVKPC /QUMCW4QVGT/ÒP\JQHI$KVMKPXCT 4 &KCMQXXCT  44-N&TWEMUVGNNG4CPFDGCTDGKVGVUGJTUEJÌP

8049



8050



4WDGN 2QNVKPC /QUMCW4QVGT/ÒP\JQHI$KVMKP 4 &KCMQX  4*ÒDUEJG2CVKPCUGJTUEJÌPpXQT\ÒINKEJ





4WDGN 2QNVKPC /QUMCW4QVGT/ÒP\JQHI$KVMKP 4 &KCMQX



1,5:1



24

1,5:1

-QRGMGP #NV[P  M[TKNNKUEJ /QUMCW4QVGT/ÒP\JQHI$KVMKPHHXCT&KCMQX 5GJTUEJÌP

1,5:1



8051

45GJTUEJÌP

8052



1,5:1

-QRGMGP #NV[P  M[TKNNKUEJ /QUMCW4QVGT/ÒP\JQHI$KVMKPHHXCT&KCMQX HHXCT 5GNVGPKPFKGUGT'TJCNVWPI5GJTUEJÌPpXQT\ÒINKEJ




PETER I.

8053

8KGT5QPPGPTWDGNFGT/ÒP\UV·VVG5V2GVGTUDWTI 

4WDGN5V2GVGTUDWTI5QPPGPTWDGNI$KVMKP 4 &CX&KCMQX  445GJTUEJÌP

8054



8056

8055



4WDGN5V2GVGTUDWTI5QPPGPTWDGNI$KVMKP 4 &CX&KCMQX  45GJTUEJÌP





4WDGN5V2GVGTUDWTI5QPPGPTWDGNI$KVMKP 4 &CX&KCMQX  45GJTUEJÌP





4WDGN5V2GVGTUDWTI5QPPGPTWDGNI$KVMKP 4 &CX&KCMQX  4-N5EJTÌVNKPIUHGJNGTMN-TCV\GTUGJTUEJÌP



8057

8058

'KPG-WRHGTRT·IWPIFGU/QUMCWGT/ÒP\JQHGU0CDGTG\JP[ 

-W-QRGMGP/QUMCW/ÒP\JQH0CDGTG\JP[I$KVMKP&KCMQXHHXCT

 5GJTUEJÌP



-W-QRGMG M[TKNNKUEJ /QUMCW/ÒP\JQH-CFCUJGXUM[I$KVMKPHH&KCMQXHH  5GJTUEJÌP



-WRHGTRT·IWPIGPFGU/QUMCWGT/ÒP\JQHGU-CFCUJGXUM[ 

25


PETER I.

8059 1,5:1



1,5:1

-W-QRGMG  M[TKNNKUEJ  /QUMCW /ÒP\JQH -CFCUJGXUM[  I $KVMKP  4  &KCMQX    8QPITQ­GT5GNVGPJGKV5GJTUEJÌP 

8060 1,5:1



1,5:1

-W-QRGMG/QUMCW/ÒP\JQH-CFCUJGXUM[I$KVMKPXCT&KCMQXXCT  8QPITQ­GT5GNVGPJGKV-N<CKPGPFGUGJTUEJÌPpXQT\ÒINKEJ



8061 1,5:1



1,5:1

-W&GPIC M[TKNNKUEJ /QUMCW/ÒP\JQH-CFCUJGXUM[I$KVMKP 4 &KCMQX  8QPITQ­GT5GNVGPJGKV5GJTUEJÌP



8062 1,5:1



1,5:1

-W-QRGMG $CTVMQRGMG  M[TKNNKUEJ /QUMCW/ÒP\JQH-CFCUJGXUM[I/KV)GIGPUVGORGN CWHFGT4ÒEMUGKVG)GMTÌPVGT&QRRGNCFNGT$KVMKP 4 &KCMQXp  441TKIKPCNRT·IWPIUGJTUEJÌPpXQT\ÒINKEJ

1,5:1

8063



1,5:1

'KPG2T·IWPIHÒTFKG7MTCKPG  26

%JGMJ5GXUMHÒTFKG7MTCKPGI)GOGKPUEJCHVURT·IWPIOKV+XCP8WPF2TKP\GUUKP5QRJKC &KCMQXHH5GXGTKP 8QPITQ­GT5GNVGPJGKV5GJTUEJÌPpXQT\ÒINKEJ




PETER I.

8064

/GFCKNNGPFGU<CTGP2GVGT+ 

$TQP\GOGFCKNNG  XQP 6 +YCPQHH UR·VGTG 2T·IWPI FGU  ,CJTJWPFGTVU  CWH FKG 'TQDGTWPI XQP   5EJNÒUUGNDWTI UEJYGFKUEJ0ÌVGDQTI CO1MVQDGT)GJCTPKUEJVGU$TWUVDKNFTOKV.QTDGGTMTCP\WPF WOIGNGIVGO /CPVGN0GRVWP OKV &TGK\CEM WPF 5EJNÒUUGN NCIGTV PCEJ T KO *KPVGTITWPF FKG CWH GKPGT   +PUGN KP FGT 0GYC IGNGIGPG DTGPPGPFG (GUVWPI 5EJNÒUUGNDWTI WPVGT $GUEJW­ FGT KO 8QTFGTITWPF CWH   GKPGO 7HGTUVTGKHGP DGHKPFNKEJGP TWUUKUEJGP /ÌTUGT WPF -CPQPGPDCVVGTKGP CWH FGO 9CUUGT \CJNTGKEJG   $QQVGOOI&KCMQX 8QT\ÒINKEJ

8065







8066



8067

$TQP\GOGFCKNNG  XQP 6+YCPQHH UR·VGTG2T·IWPIWO CWHFKG'TQDGTWPIFGT(GUVWPI0[ GPUMCPUCO/CK)GJCTPKUEJVGU$TWUVDKNFTOKV.QTDGGTMTCP\WPFWOIGNGIVGO/CPVGN#PUKEJVFGT (GUVWPICWUFGT8QIGNRGTURGMVKXGKO8QTFGTITWPFNGJPVGKPTÌOKUEJGT-TKGIGTKPCPVKMGT4ÒUVWPIOKV .CP\GWPF(GUVWPIUUEJNÒUUGNPCEJNCPGKPGTCDIGDTQEJGPGP/CWGTOOI&KCMQX 8QT\ÒINKEJ



$TQP\GOGFCKNNG  XQP 6 +YCPQHH UR·VGTG 2T·IWPI WO   CWH FKG 'KPPCJOG XQP &QTRCV CO    ,WNK )GJCTPKUEJVGU $TWUVDKNF T OKV .QTDGGTMTCP\ WPF WOIGNGIVGO /CPVGN#PUKEJV FGT DG   UEJQUUGPGP (GUVWPI CWU FGT 8QIGNRGTURGMVKXG KO 8QTFGTITWPF ÒDGTTGKEJV FKG MPKGPFG 5VCFVIÌVVKP FGO   XQTKJTUVGJGPFGP<CTGPFKG5VCFVMTQPGOOI&KCMQX (CUVXQT\ÒINKEJ



$TQP\GOGFCKNNGXQP6+YCPQHH UR·VGTG2T·IWPIFGUHTÒJGP,CJTJWPFGTVU CWHFKG'KPPCJOG XQP 0CTXC CO  #WIWUV )GJCTPKUEJVGU $TWUVDKNF T OKV .QTDGGTMTCP\ WPF WOIGNGIVGO /CPVGN   #PUKEJVXQP0CTXCWPF+YCPIQTQFOKVFGO(NW­0CTXCCWUFGT8QIGNRGTURGMVKXGCWEJFKGTWUUKUEJGP $GHGUVKIWPIUCPNCIGPUKPFGTMGPPDCTOOI&KCMQX 448QT\ÒINKEJ

 27


PETER I.

8068







8069

8070

$TQP\GOGFCKNNG  XQP 6 +YCPQHH UR·VGTG 2T·IWPI WO   CWH FKG TWUUKUEJGP 'TQDGTWPIGP KO   ,CJT)GJCTPKUEJVGU$TWUVDKNFTOKV.QTDGGTMTCP\WPFWOIGNGIVGO/CPVGN*GTMWNGUOKV.ÌYGP HGNN MPKGV X X WPF J·NV )NQDWU OKV FGT .CPFMCTVG XQP .KXNCPF CWH UGKPGP 5EJWNVGTP KP FGT FKG   1TVG 0CTXC 4GXCN &QTRCV 2GTPCW 4KIC WPF #TGPUDWTI GKPIG\GKEJPGV UKPF  OO  I   &KCMQX 8QT\ÒINKEJ



$TQP\GOGFCKNNGXQP6+YCPQHH UR·VGTG2T·IWPIFGU,CJTJWPFGTVU CWHFKGTWUUKUEJGP'TQDG TWPIGP KO ,CJT  )GJCTPKUEJVGU $TWUVDKNF T OKV .QTDGGTMTCP\ WPF WOIGNGIVGO /CPVGN*GTMWNGU   OKV.ÌYGPHGNNMPKGVXXWPFJ·NV)NQDWUOKVFGT.CPFMCTVGXQP.KXNCPFCWHUGKPGP5EJWNVGTPKPFGTFKG 1TVG 0CTXC 4GXCN &QTRCV 2GTPCW 4KIC WPF #TGPUDWTI GKPIG\GKEJPGV UKPF  OO  I   &KCMQX 8QT\ÒINKEJ



5KNDGTOGFCKNNGWPUKIPKGTVCWHFKG8GTO·JNWPIUGKPGU5QJPGU<CTGYKVUEJ#NGZGL2GVTQYKVUEJOKV %JCTNQVVG %JTKUVKPG 5QRJKG 6QEJVGT .WFYKI 4WFQNHU XQP $TCWPUEJYGKI9QNHGPDÒVVGN $GKFGT $TWUVDKN   FGT PGDGPGKPCPFGT T(GWGTCNVCT FGT OKV FGP 9CRRGPUEJKNFGP XQP 4W­NCPF WPF $TCWPUEJYGKI   IGUEJOÒEMV KUV FCTÒDGT \YGK KPGKPCPFGTITGKHGPFG *·PFG  OO  I $TQEMOCPP    &KCMQX 4  44(GKPG2CVKPC5VGORGNHGJNGTCO4CPFGVYCUDGTKGDGPUGJTUEJÌP



8071



)QNFOGFCKNNG  XQP +-QPUVCPVKPQX UR·VGTG2T·IWPI CWHFKG5EJNCEJVDGK5VQTM[TQWPFFKG'KP PCJOG XQP 8CUC CO  (GDTWCT )GJCTPKUEJVGU $TWUVDKNF T OKV .QTDGGTMTCP\ WPF WOIGNGIVGO   /CPVGN5KGIGUIÌVVKPOKV.QTDGGTMTCP\WPFFGTUEJYGFKUEJGP(CJPGUEJYGDVÒDGTFGO5EJNCEJVHGNFDGK 5VQTM[TQOKVFGO\WIGHTQTGPGP(NW­-[TQNXWPFFGO&QTH0CRQOOI&KCMQX

4  )1.&8QPITÌ­VGT5GNVGPJGKV8QT\ÒINKEJ  0CEJ FGO 4ÒEM\WI XQP 2·NM·PG JCVVG FGT UEJYGFKUEJG )GPGTCNOCLQT %CTN )WUVCX #TOHGNV OKV UGKPGP GTUEJÌRHVGP   5QNFCVGPUGKP9KPVGTSWCTVKGTDGKFGTYGUVHKPPKUEJGP5VCFV8CUCCWHIGUEJNCIGP#NUGTXQPFGO8QTOCTUEJTWUUKUEJGT 6TWRRGP GTHWJT NKG­ GT DGK FGO KP FGT )GOGKPFG 5VQTM[TQ IGNGIGPGP &QTH 0CRQ CO (NW­ -[TQ NX GKP .CIGT   GTTKEJVGP WO UKEJ FQTV FGP TWUUKUEJGP 6TWRRGP GPVIGIGP\WUVGNNGP #O  (GDTWCT  MCO GU \WT 5EJNCEJV   <WP·EJUVMQPPVGPUKEJFKG5EJYGFGPFKG0CEJUEJWDÒDGTFGP\WIGHTQTGPGP-[TQNXGTJKGNVGPVCRHGTJCNVGPPCEJ FTGK 5VWPFGP WPF GKPGO 8GTNWUV XQP OGJT CNU  /CPP OW­VG UKEJ #TOHGNV OKV FGO 4GUV UGKPGT 6TWRRGP   \WTÒEM\KGJGP &KG 4WUUGP XGTHQNIVGP FKG 5EJYGFGP PKEJV UQPFGTP DGUGV\VGP 8CUC FKG YKEJVKIUVG 5VCFV FGT   YGUVHKPPKUEJGP.CPFUEJCHV¤UVGTDQVVGP

28


PETER I.

8072



5KNDGTOGFCKNNGWPUKIPKGTV XGTOWVNKEJUR·VGTG2T·IWPIFGU,CJTJWPFGTVU CWHFGP(TKGFGPXQP 0[UVCF\YKUEJGP5EJYGFGPWPF4W­NCPFXQO#WIWUV&KG#TEJG0QCJCWH5GGFCTÒDGTHNKGIVGKPG 6CWDGNOKV¤N\YGKIKO5EJPCDGNKO*KPVGTITWPFXGTDKPFGVGKP4GIGPDQIGPFKG5V·FVG5V2GVGTUDWTI WPF5VQEMJQNO<GKNGP5EJTKHVOOI&KCMQX 4   44*ÒDUEJG2CVKPCHCUVXQT\ÒINKEJ



&KG5EJTKHVKO#DUEJPKVVFGT8QTFGTUGKVGGPVJ·NVKTTVÒONKEJFKG,CJTGU\CJNCPUVCVVCNU%JTQPQITCOO  0CEJFGO FKG 4WUUGP KP FGP 5QOOGTOQPCVGP FGT ,CJTG  WPF  OGJTGTG UEJYGFKUEJG 5V·FVG  

WC0QTTMÌRKPIWPF7OG¹ \GTUVÌTVJCVVGPOW­VG5EJYGFGPUEJNKG­NKEJCO5GRVGODGTKPFGP(TKGFGP XQP0[UVCF HKPPKUEJ7WUKMCWRWPMKIGNGIGPKP9GUVHKPPNCPFECMOPQTFYGUVNKEJXQP6WTMW’DQ GKPYKNNKIGP &GT(TKGFGYCTGKPITQ­GT6TKWORJFGUTWUUKUEJGP<CTGP2GVGT+5EJYGFGPOW­VG'UVNCPF.KXNCPFOKVFGP+PUGNP ¤UGN WPF &CIÌ +PIGTOCPNCPF FCU )GDKGV \YKUEJGP 5V 2GVGTUDWTI WPF 0CTXC  UQYKG -CTGNKGP OKV 8KDQTI CP   4W­NCPFCDVTGVGPWPFGTJKGNVNGFKINKEJFCUXQP2GVGT+GTQDGTVG(KPPNCPF\WTÒEM

8073

8073 1,5:1



5KNDGTOGFCKNNG  WPUKIPKGTV CWH FGP (TKGFGP XQP 0[UVCF \YKUEJGP 5EJYGFGP WPF 4W­NCPF XQO   #WIWUV&KG#TEJG0QCJCWH5GGFCTÒDGTHNKGIVGKPG6CWDGNOKV¤N\YGKIKO5EJPCDGNKO*KPVGT ITWPFXGTDKPFGVGKP4GIGPDQIGPFKG5V·FVG5V2GVGTUDWTIWPF5VQEMJQNO<GKNGP5EJTKHV4CPFOKV $NWOGPWPF&TGKDN·VVGTPOOI&KCMQXXCT 4   8QPITÌ­VGT5GNVGPJGKV*ÒDUEJG2CVKPCXQT\ÒINKEJ 

8074



5KNDGTLGVQPWPUKIPKGTVCWHFKG-TÌPWPIUGKPGT)GOCJNKP-CVJCTKPC8KGT<GKNGP5EJTKHVQDGP -TQPG#NVCTOKV-TÌPWPIUKPUKIPKGPOOI&KCMQX 4  45GJTUEJÌP

 29


KATHARINA I.

8075

2:1

2:1

<#4+0-#6*#4+0#+ 'KP0QXQFGNKP)QNFFGU4QVGP/ÒP\JQHGUKP/QUMCW 

 4WDGN  /QUMCW 4QVGT /ÒP\JQH 0QXQFGN  I )GMTÌPVGU $TWUVDKNF N OKV WOIGNGIVGO   /CPVGN5V #PFTGCU UVGJV X X OKV *GKNKIGPUEJGKP FCU -TGW\ JKPVGT UKEJ JCNVGPF $KVMKP * 4    &KCMQX50(D )1.&8QPITQ­GT5GNVGPJGKV5VGORGNINCP\ 

8076

5KNDGTOÒP\GPFGU4QVGP/ÒP\JQHGUKP/QUMCW 

4WDGN/QUMCW4QVGT/ÒP\JQHI$KVMKP&CX&KCMQX  *ÒDUEJG2CVKPCUGJTUEJÌP

8077

8078



8079



4WDGN/QUMCW4QVGT/ÒP\JQHI$KVMKPXCT&CX&KCMQXXCT  -N5EJTÌVNKPIUHGJNGTHCUVUGJTUEJÌP





4WDGN/QUMCW4QVGT/ÒP\JQHI$KVMKP&CX&KCMQX

4(CUVUGJTUEJÌP





4WDGN/QUMCW4QVGT/ÒP\JQHI$KVMKPXCT&CX&KCMQXXCT  .GKEJVG2T·IGUEJY·EJGCO4CPFUGJTUEJÌP



30


KATHARINA I.

8080

8081

8082



4WDGN/QUMCW4QVGT/ÒP\JQHI$KVMKP&CX&KCMQX  48QTFGTUGKVGÒDGTCTDGKVGVUQPUVUGJTUEJÌPpXQT\ÒINKEJ





4WDGN/QUMCW4QVGT/ÒP\JQHI$KVMKP&CX&KCMQX

45GJTUEJÌP





4WDGN/QUMCW4QVGT/ÒP\JQHI$KVMKP&CX&KCMQX  4#VVTCMVKXGUUGJTUEJÌPGU'ZGORNCT



8083

8085

8084



4WDGN 2QNVKPC /QUMCW4QVGT/ÒP\JQHI$KVMKP 4 &KCMQX  449KP\5EJTÌVNKPIUHGJNGTUGJTUEJÌP



4WDGN 2QNVKPC /QUMCW4QVGT/ÒP\JQHI$KVMKP 4 &KCMQX

 4(CUVUGJTUEJÌP

 

5KNDGTOÒP\GPFGT/ÒP\UV·VVG5V2GVGTUDWTI 

4WDGN  5V 2GVGTUDWTI 5QIGPCPPVGT 6TCWGTTWDGN  I $KVMKP  4 &CX&KCMQX 44'VYCURQTÌUGT5EJTÌVNKPIHCUVUGJTUEJÌP  31


PETER II.

8086

8088

8087



4WDGN5V2GVGTUDWTII$KVMKPXCT&CX&KCMQXXCT  /KPDGTKGDGPHCUVUGJTUEJÌP





4WDGN5V2GVGTUDWTII$KVMKP&CX&KCMQX

4$TQUEJKGTURWTGPUEJÌP



-W-QRGMGPUEJYGFKUEJG/ÒP\UV·VVGI$KVMKPXCT 4 &KCMQXXCT  4'VYCU$GNCIUGJTUEJÌP



'KPG-WRHGTRT·IWPIGKPGTUEJYGFKUEJGP/ÒP\UV·VVG 

8089

8091

8090

<#42'6'4++ 5KNDGTOÒP\GPFGU4QVGP/ÒP\JQHGUKP/QUMCW 

4WDGN/QUMCW4QVGT/ÒP\JQHI$KVMKP&CX&KCMQX

5GJTUEJÌP





4WDGN/QUMCW4QVGT/ÒP\JQHI$KVMKPXCT&CX&KCMQXXCT 5GJTUEJÌP





4WDGN 2QNVKPC /QUMCW4QVGT/ÒP\JQHI$KVMKP 4 &KCMQX  4-N5EJTÌVNKPIUHGJNGTUEJÌPUEJÌPpUGJTUEJÌP



32


PETER II.

8092

8093

8094

5KNDGTOÒP\GPFGU/QUMCWGT/ÒP\JQHGU-CFCUJGXUM[ 

4WDGN/QUMCW/ÒP\JQH-CFCUJGXUM[I$KVMKP&CX&KCMQX  -N5EJTÌVNKPIUHGJNGTUGJTUEJÌP





4WDGN/QUMCW/ÒP\JQH-CFCUJGXUM[I$KVMKP&CX&KCMQX  5GJTUEJÌPpXQT\ÒINKEJ





4WDGN/QUMCW/ÒP\JQH-CFCUJGXUM[I$KVMKP&CX&KCMQX  -N<CKPGPFGUGJTUEJÌP



8095

1,5:1



1,5:1

4WDGN/QUMCW/ÒP\JQH-CFCUJGXUM[I$KVMKP&CX&KCMQX  5GNVGPKPFKGUGT'TJCNVWPI9KP\5EJTÌVNKPIUHGJNGTXQT\ÒINKEJ

 33


PETER II.

8097

8096

8096



4WDGN/QUMCW/ÒP\JQH-CFCUJGXUM[I$KVMKP&CX&KCMQXXCT  #VVTCMVKXGUUGJTUEJÌPGU'ZGORNCT





4WDGN/QUMCW/ÒP\JQH-CFCUJGXUM[I$KVMKPXCT&CX&KCMQXXCT  *ÒDUEJG2CVKPCHCUVXQT\ÒINKEJ



8099

8098

8100

5KNDGTOÒP\GPFGT/ÒP\UV·VVG5V2GVGTUDWTI 

4WDGN5V2GVGTUDWTII$KVMKP&CX&KCMQX  4-N<CPIGPLWUVKGTURWTGPUQPUVCVVTCMVKXGUXQT\ÒINKEJGU'ZGORNCTOKVJÒDUEJGT2CVKPC





4WDGN 2QNVKPC 5V2GVGTUDWTII$KVMKP 4 &KCMQX  44#VVTCMVKXGU'ZGORNCTOKVHGKPGT2CVKPCUGJTUEJÌP





4WDGN 2QNVKPC 5V2GVGTUDWTII$KVMKP 4 &KCMQX  44-N-TCV\GTHCUVUGJTUEJÌP



34


PETER II.

2:1

8101

8101

'KP2TQDG4WDGNFGT/ÒP\UV·VVG5V2GVGTUDWTI 

4WDGN 5V2GVGTUDWTI2TQDGOKVIGTKHHGNVGO4CPFI)GJCTPKUEJVGU$TWUVDKNFTOKV.QT DGGTMTCP\ WPF WOIGNGIVGO /CPVGN8KGT IGMTÌPVG /QPQITCOOG KPU -TGW\ IGUVGNNV KP FGT /KVVG FKG   IGVGKNVG,CJTGU\CJN$KVMKP 4FKGUGU'ZGORNCT   8QPCNNGTITÌ­VGT5GNVGPJGKV-CDKPGVVUVÒEM2TCEJVXQNNG2CVKPCHCUV5VGORGNINCP\  /KV'ZRGTVKUGXQP+IQT5EJKT[CMQX5VCCVNKEJGU*KUVQTKUEJGU/WUGWO/QUMCW

35


ANNA

8102

8103

8104

<#4+0#00# 5KNDGTOÒP\GPFGU/QUMCWGT/ÒP\JQHGU-CFCUJGXUM[ 

4WDGN/QUMCW/ÒP\JQH-CFCUJGXUM[I$KVMKP&CX&KCMQX  9KP\-TCV\GTUGJTUEJÌPpXQT\ÒINKEJ





4WDGN/QUMCW/ÒP\JQH-CFCUJGXUM[I$KVMKP&CX&KCMQX  *ÒDUEJG2CVKPCUGJTUEJÌP





4WDGN/QUMCW/ÒP\JQH-CFCUJGXUM[I$KVMKPXCT&CX&KCMQXXCT  5GNVGPKPFKGUGT'TJCNVWPI#VVTCMVKXGU'ZGORNCTOKVJÒDUEJGT2CVKPCXQT\ÒINKEJ



8105

8106

8107



4WDGN/QUMCW/ÒP\JQH-CFCUJGXUM[I+PVGTGUUCPVG8GTRT·IWPI$KVMKP&CX &KCMQX *ÒDUEJG2CVKPCUGJTUEJÌP



4WDGN/QUMCW/ÒP\JQH-CFCUJGXUM[I$KVMKPXCT&CX&KCMQXXCT  #VVTCMVKXGU'ZGORNCTHCUVXQT\ÒINKEJ



4WDGN  /QUMCW /ÒP\JQH -CFCUJGXUM[  I 2QTVT·VXCTKCPVG QJPG 0CEMGPJCCTG $KVMKP p  

\WHH &CX&KCMQX  445GJTCVVTCMVKXGUHCUVXQT\ÒINKEJGU'ZGORNCTOKVJÒDUEJGT2CVKPC 

36

 


ANNA

8108



8109

8110

4WDGN/QUMCW/ÒP\JQH-CFCUJGXUM[I$KVMKPXCT&CX&KCMQXXCT  *ÒDUEJG2CVKPCUGJTUEJÌPpXQT\ÒINKEJ



'ZGORNCTFGT5COONWPI#PVQPKP2TQMQR6GKN#WMVKQP#WTGC0WOKUOCVKMC2TCI0T



4WDGN  /QUMCW /ÒP\JQH -CFCUJGXUM[ +P 752NCUVKMJQNFGT FGT 0)% OKV FGT $GYGTVWPI #7   &'6#+.5$KVMKPNGKEJVXCT&CX&KCMQXNGKEJVXCT *ÒDUEJG2CVKPCHCUVXQT\ÒINKEJ





4WDGN/QUMCW/ÒP\JQH-CFCUJGXUM[I$KVMKP 4 &CX&KCMQXXCT  -N5EJTÌVNKPIUHGJNGTCO4CPFUGJTUEJÌP



8111

8112

8113



4WDGN/QUMCW/ÒP\JQH-CFCUJGXUM[I$KVMKP&CX&KCMQX  4-N5EJTÌVNKPIUHGJNGTCO4CPFUGJTUEJÌP





4WDGN/QUMCW/ÒP\JQH-CFCUJGXUM[I$KVMKP 4 &CX&KCMQXXCT  44#VVTCMVKXGUHCUVXQT\ÒINKEJGU'ZGORNCT





4WDGN/QUMCW/ÒP\JQH-CFCUJGXUM[I$KVMKP&CX&KCMQX

5GJTUEJÌP

 37


ANNA

8115

8114

8116



4WDGN/QUMCW/ÒP\JQH-CFCUJGXUM[I$KVMKP&CX&KCMQX  #VVTCMVKXGUUGJTUEJÌPGU'ZGORNCT



4WDGN 2QNVKPC /QUMCW/ÒP\JQH-CFCUJGXUM[I$KVMKP&KCMQX

 5GJTUEJÌP





4WDGN 2QNVKPC /QUMCW/ÒP\JQH-CFCUJGXUM[I$KVMKP&KCMQX  #VVTCMVKXGUUGJTUEJÌPGU'ZGORNCT



8117

8118



8119

5KNDGTOÒP\GPFGU4QVGP/ÒP\JQHGUKP/QUMCW 

4WDGN/QUMCW4QVGT/ÒP\JQH+P752NCUVKMJQNFGTFGT0)%OKVFGT$GYGTVWPI#7&'6#+.5 $KVMKP&CX&KCMQX (GKPG2CVKPCHCUVXQT\ÒINKEJ





4WDGN/QUMCW4QVGT/ÒP\JQHI$KVMKP&CX&KCMQX  -N5EJTÌVNKPIUHGJNGTHCUVUGJTUEJÌP





4WDGN  /QUMCW 4QVGT /ÒP\JQH  I $KVMKP  4 FQTV HCNUEJGT ,CJTICPI CPIGIGDGP    &CX&KCMQXXCT 45GJTUEJÌP



38


ANNA

8120

8121



8121

4WDGN 2QNWRQNVKPPKM /QUMCW4QVGT/ÒP\JQHI$KVMKP 4 &KCMQX  44,WUVKGTVHCUVUGJTUEJÌP



5KNDGTOÒP\GPFGT/ÒP\UV·VVG5V2GVGTUDWTI 

4WDGN5V2GVGTUDWTII$KVMKP 4 &CX&KCMQX  4#VVTCMVKXGUHCUVXQT\ÒINKEJGU'ZGORNCTOKVJÒDUEJGT2CVKPC



8122

1,5:1



1,5:1

4WDGN5V2GVGTUDWTII$KVMKP 4 &CX&KCMQX  5GNVGPDGUQPFGTUKPFKGUGT'TJCNVWPI2TCEJVGZGORNCT *ÒDUEJG2CVKPCXQT\ÒINKEJp5VGORGNINCP\



8124 8123

8123



4WDGN5V2GVGTUDWTII$KVMKP&CX&KCMQXXCT

 (GKPG2CVKPCUGJTUEJÌP





4WDGN 2QNVKPC 5V2GVGTUDWTII$KVMKP 4 &KCMQX

4(CUVUGJTUEJÌP

 39


IVAN III.

8125

8126

<YGK5KNDGTLGVQPUFGT<CTKP#PPC 

5KNDGTLGVQPWPUKIPKGTVCWHKJTG-TÌPWPIKP/QUMCW-TQPGQDGPCWU9QNMGPMQOOGPFG5VTCJNGP 5KGDGP<GKNGP5EJTKHVOOI$KVMKP 4 &KCMQX 4   4&WPMNG2CVKPCUGJTUEJÌPpXQT\ÒINKEJ





5KNDGTLGVQP  WPUKIPKGTV CWH KJTGP 6QF )GMTÌPVGU $TWUVDKNF T OKV WOIGNGIVGO /CPVGN   #EJV<GKNGP5EJTKHVOOI$KVMKP&KCMQX 4   4(GKPG6ÌPWPIUGJTUEJÌPpXQT\ÒINKEJ



8127

8127 1,5:1

<#4+8#0+++ 5KNDGTOÒP\GPFGU4QVGP/ÒP\JQHGUKP/QUMCW 

4WDGN  /QUMCW 4QVGT /ÒP\JQH  I /QUMCWGT 6[R $TWUVDKNF T OKV .QTDGGTMTCP\ WOIG   NGIVGO /CPVGN WPF #PFTGCUQTFGP)GMTÌPVGT &QRRGNCFNGT OKV <GRVGT WPF 4GKEJUCRHGN KP FGP (·PIGP   CWH FGT $TWUV 5V )GQTIUUEJKNF WOJGT FKG -GVVG FGU #PFTGCUQTFGPU QDGP -TQPG $KVMKP  4    &CX&KCMQX 8QPITQ­GT5GNVGPJGKV*ÒDUEJG2CVKPCMN5EJTÌVNKPIUHGJNGTUGJTUEJÌP 

8128

8128 1,5:1



40

4WDGN /QUMCW4QVGT/ÒP\JQHI2GVGTUDWTIGT6[R$TWUVDKNFTOKV.QTDGGTMTCP\WO IGNGIVGO /CPVGN WPF #PFTGCUQTFGP)GMTÌPVGT &QRRGNCFNGT OKV <GRVGT WPF 4GKEJUCRHGN KP FGP (·P   IGP CWH FGT $TWUV 5V )GQTIUUEJKNF WOJGT FKG -GVVG FGU #PFTGCUQTFGPU QDGP -TQPG $KVMKP  4    &CX&KCMQX 44&WPMNG2CVKPCUGJTUEJÌPXQT\ÒINKEJ 


IVAN III.

1,5:1



8129

1,5:1

-QRGMGP )TKXGPPKM /QUMCW4QVGT/ÒP\JQHI$KVMKP 4 &KCMQX  44-TCV\GTKO(GNFFGT8QTFGTUGKVGUGJTUEJÌP



8130

8130 1,5:1

5KNDGTOÒP\GPFGT/ÒP\UV·VVG5V2GVGTUDWTI 

4WDGN5V2GVGTUDWTII$TWUVDKNFTOKV.QTDGGTMTCP\WOIGNGIVGO/CPVGNWPF#PFTGCU QTFGP)GMTÌPVGT &QRRGNCFNGT OKV <GRVGT WPF 4GKEJUCRHGN KP FGP (·PIGP CWH FGT $TWUV 5V )GQTIU   UEJKNFWOJGTFKG-GVVGFGU#PFTGCUQTFGPUQDGP-TQPG$KVMKP 4 &CX&KCMQX  4#VVTCMVKXGU'ZGORNCTOKVJÒDUEJGT2CVKPCUGJTUEJÌPUGJTUEJÌPpXQT\ÒINKEJ 

8132

8131

8131



4WDGN5V2GVGTUDWTII$KVMKP 4 &CX&KCMQX  4-TCV\GTMN5EJTÌVNKPIUHGJNGTUGJTUEJÌP



4WDGN5V2GVGTUDWTII$TWUVDKNFTOKV.QTDGGTMTCP\WOIGNGIVGO/CPVGNWPF#PFTGCU QTFGP)GMTÌPVGT &QRRGNCFNGT OKV <GRVGT WPF 4GKEJUCRHGN KP FGP (·PIGP CWH FGT $TWUV 5V )GQTIU   UEJKNFWOJGTFKG-GVVGFGU#PFTGCUQTFGPUQDGP-TQPG$KVMKP 4 &CX&KCMQX  5GNVGPDGUQPFGTUKPFKGUGT'TJCNVWPI #VVTCMVKXGU'ZGORNCTOKVJÒDUEJGT2CVKPCUGJTUEJÌP 



41


ELISABETH

8133

1,5:1



1,5:1

 4WDGN 2QNVKPC   5V 2GVGTUDWTI  I $TWUVDKNF T OKV .QTDGGTMTCP\ WPF WOIGNGIVGO   /CPVGN)GMTÌPVGT &QRRGNCFNGT OKV <GRVGT WPF 4GKEJUCRHGN KP FGP (·PIGP CWH FGT $TWUV 5V )GQTIU   UEJKNFWOJGTFKG-GVVGFGU#PFTGCUQTFGPUQDGP-TQPG$KVMKP 4 &KCMQX  5GJTUGNVGPDGUQPFGTUKPFKGUGT'TJCNVWPI#VVTCMVKXGU'ZGORNCTOKVHGKPGT2CVKPCXQT\ÒINKEJ 

8134

8136

8135

<#4+0'.+5#$'6* 5KNDGTOÒP\GPFGU4QVGP/ÒP\JQHGUKP/QUMCW 

4WDGN/QUMCW4QVGT/ÒP\JQHI$KVMKP&CX&KCMQX  *ÒDUEJG2CVKPCUGJTUEJÌPpXQT\ÒINKEJ





4WDGN/QUMCW4QVGT/ÒP\JQHI$KVMKP&CX&KCMQX

5GJTUEJÌP





4WDGN 2QNVKPC /QUMCW4QVGT/ÒP\JQHI$KVMKP 4 &KCMQX  44-N5EJTÌVNKPIUHGJNGTHCUVUGJTUEJÌP



42


ELISABETH

8137

8138

8139

5KNDGTOÒP\GPFGT/ÒP\UV·VVG5V2GVGTUDWTI 

4WDGN5V2GVGTUDWTII$KVMKPNGKEJVXCT&CX&KCMQXNGKEJVXCT  5GNVGPKPFKGUGT'TJCNVWPI9KP\5EJTÌVNKPIUHGJNGTXQT\ÒINKEJp5VGORGNINCP\





4WDGN  5V 2GVGTUDWTI +P 752NCUVKMJQNFGT FGT 0)% OKV FGT $GYGTVWPI #7 &'6#+.5 $KVMKP   &CX&KCMQX -N5EJTÌVNKPIUHGJNGTXQT\ÒINKEJ





4WDGN5V2GVGTUDWTII$KVMKP&CX&KCMQX  *ÒDUEJG2CVKPCYKP\5EJTÌVNKPIUHGJNGTCO4CPFHCUVXQT\ÒINKEJ



8140

8141

8142



4WDGN5V2GVGTUDWTII$KVMKP&CX&KCMQX

$GTKGDGPUGJTUEJÌP





4WDGN5V2GVGTUDWTII$KVMKP&CX&KCMQX

 -TCV\GTUGJTUEJÌPpXQT\ÒINKEJ





4WDGN 5V2GVGTUDWTI5QIGPCPPVGT5EQVV4WDGNI$KVMKP&CX&KCMQX (GKPG2CVKPCHCUVXQT\ÒINKEJ

 43


ELISABETH

8143



4WDGN5V2GVGTUDWTI5QIGPCPPVGT5EQVV4WDGNI$KVMKP&CX&KCMQX  *ÒDUEJG2CVKPCYKP\-TCV\GTUGJTUEJÌPpXQT\ÒINKEJ



8144

1,5:1

1,5:1



4WDGN  5V 2GVGTUDWTI  I 2QTVT·V XQP , &CUUKGT )GMTÌPVGU $TWUVDKNF T OKV WOIGNGIVGO   /CPVGN)GMTÌPVGT &QRRGNCFNGT OKV <GRVGT WPF 4GKEJUCRHGN KP FGP (·PIGP CWH FGT $TWUV 5V )GQTIU   UEJKNF WOJGT FKG -GVVG FGU #PFTGCUQTFGPU WPVGP \W FGP 5GKVGP FGT 5EJYCP\HGFGTP FCU IGVGKNVG   /ÒP\UV·VVGP\GKEJGPQDGP-TQPG$KVMKP 4 &CX&KCMQX 4   44(GKPG2CVKPCUGJTUEJÌPpXQT\ÒINKEJ 

8145

8146

8146



4WDGN5V2GVGTUDWTII$KVMKP 4 &CX&KCMQX  4*GTTNKEJG2CVKPCYKP\-TCV\GTCVVTCMVKXGUXQT\ÒINKEJGU'ZGORNCT





4WDGN5V2GVGTUDWTII$KVMKP 4 &CX&KCMQX  4(GKPG2CVKPCMN5EJTÌVNKPIUHGJNGTUGJTUEJÌP



44


ELISABETH

8149

8148

8147



4WDGN 2QNVKPC 5V2GVGTUDWTII$KVMKP 4 &KCMQX

445EJÌP



4WDGN 2QNVKPC 5V2GVGTUDWTI+P752NCUVKMJQNFGTFGT0)%OKVFGT$GYGTVWPI#7&'6#+.5 $KVMKP 4 &KCMQX 4  449KP\5EJTÌVNKPIUHGJNGTUGJTUEJÌPpXQT\ÒINKEJ



-QRGMGP5V2GVGTUDWTII$KVMKP&KCMQX

 

8QT\ÒINKEJ



8151

8150

<YGK-WRHGTRT·IWPIGPFGU4QVGP/ÒP\JQHGUKP/QUMCW 

-W-QRGMGP/QUMCW4QVGT/ÒP\JQHI$KVMKP&KCMQX

5GJTUEJÌP





-W-QRGMGP/QUMCW4QVGT/ÒP\JQHI$KVMKP&KCMQX

5GJTUEJÌP



8152

1,5:1

1,5:1

2T·IWPIGPHÒT1UVRTGW­GP 

)TQUEJGP-ÌPKIUDGTIIGRT·IVHÒT1UVRTGW­GPWPVGTTWUUKUEJGT$GUCV\WPII$KVMKP

4 &KCMQX 4 1NFE 5GJTUGNVGPKPFKGUGT'TJCNVWPI8QT\ÒINKEJ

8153 1,5:1





1,5:1

6CNGT-ÌPKIUDGTIIGRT·IVHÒT1UVRTGW­GPWPVGTTWUUKUEJGT$GUCV\WPI+P752NCUVKMJQNFGTFGT 0)%OKVFGT$GYGTVWPI/5$KVMKP 4 &KCMQX1NFD  W­GTUVUGNVGPKPFKGUGT'TJCNVWPI2TCEJVGZGORNCT(CUV5VGORGNINCP\

 45


PETER III.

8154

8155



8155

)TÌUEJGT-ÌPKIUDGTIIGRT·IVHÒT1UVRTGW­GPWPVGTTWUUKUEJGT$GUCV\WPII$KVMKP 4  &KCMQX1NFC -N2T·IGUEJY·EJGUGJTUEJÌPpXQT\ÒINKEJ



<YGK/GFCKNNGPFGT<CTKP'NKUCDGVJ 

$TQP\GOGFCKNNGXQP5,WFKPWPF8-NKOQXCWHKJTG-TÌPWPI)GMTÌPVGU$TWUVDKNFTOKVWO IGNGIVGO /CPVGN&KG <CTKP UVGJV X X OKV <GRVGT KP FGT 4GEJVGP QDGP GKP'PIGNOKV5EJKNFKP9QN MGPFGTGKPG-TQPGÒDGTKJT*CWRVJ·NVTPGDGPKJTMPKGPFG4WUUKCOKV#FNGTUEJKNFOOI &KCMQX 5GJTUEJÌP



8156



6TCIDCTG TWDGNHÌTOKIG 5KNDGTOGFCKNNG  XQP 6 +YCPQHH CWH FGP 5KGI ÒDGT FKG 2TGW­GP KP FGT   5EJNCEJV DGK -WPGTUFQTH CO  #WIWUV )GMTÌPVGU $TWUVDKNF T OKV WOIGNGIVGO /CPVGN-TKGIGT KP   CPVKMGT 4ÒUVWPI UVGJV PCEJ T CWH 5EJNCEJVHGNF FGP NKPMGP (W­ CWH GKPG 3WGNNWTPG IGUVGNNV KP DGKFGP   *·PFGPJ·NVGTGKPGP5RGGTWOJGT-TKGIUVTQRJ·GPWPF)GHCNNGPGOOI$KVMKP/ 4  &KCMQX 4  44'PVHGTPVG6TCIGÌUGUGJTUEJÌP 

8157

1,5:1

1,5:1

<#42'6'4+++ 'KPJCNDGT4WDGNFGU4QVGP/ÒP\JQHGUKP/QUMCW 

46

4WDGN 2QNVKPC /QUMCW4QVGT/ÒP\JQH/KV4CPFUEJTKHVI)GJCTPKUEJVGU$TWUVDKNFT OKV WOIGNGIVGO /CPVGN)GMTÌPVGT &QRRGNCFNGT OKV <GRVGT WPF 4GKEJUCRHGN KP FGP (·PIGP CWH FGT   $TWUV5V)GQTIUUEJKNFWOJGTFKG-GVVGFGU#PFTGCUQTFGPUQDGP-TQPG$KVMKP 4 &KCMQX 4  442TCEJVGZGORNCT*GTTNKEJG2CVKPCXQT\ÒINKEJp5VGORGNINCP\ 


PETER III.

8158

1,5:1

1,5:1

5KNDGTOÒP\GPFGT/ÒP\UV·VVG5V2GVGTUDWTI 

4WDGN  5V 2GVGTUDWTI  I )GJCTPKUEJVGU $TWUVDKNF T OKV WOIGNGIVGO /CPVGN)GMTÌPVGT   &QRRGNCFNGTOKV<GRVGTWPF4GKEJUCRHGNKPFGP(·PIGPCWHFGT$TWUV5V)GQTIUUEJKNFWOJGTFKG-GVVG FGU#PFTGCUQTFGPUQDGP-TQPG$KVMKP&CX&KCMQX 4   5GNVGPKPFKGUGT'TJCNVWPI8QT\ÒINKEJp5VGORGNINCP\ 

8159



8159

1,5:1

4WDGN5V2GVGTUDWTII$KVMKP&CX&KCMQX 4   4(GKPG2CVKPCYKP\5EJTÌVNKPIUHGJNGTCO4CPFXQT\ÒINKEJ

8160



8161



4WDGN5V2GVGTUDWTII$KVMKP&CX&KCMQX 4   4*ÒDUEJG2CVKPCUGJTUEJÌPpXQT\ÒINKEJ



4WDGN5V2GVGTUDWTII$KVMKP&CX&KCMQX 4 

45EJÌPpUGJTUEJÌP

  47


KATHARINA II.

8162



8163

8164

4WDGN 2QNVKPC 5V2GVGTUDWTII$KVMKP 4 &KCMQX 4   4(GKPG2CVKPCHCUVXQT\ÒINKEJ



<YGK-WRHGTRT·IWPIGPFGU<CTGP2GVGT+++ 

-W-QRGMGPWPDGUVKOOVG/ÒP\UV·VVGIªDGTRT·IVCWHGKPGO-W-QRGMGP5VÒEMXQP 'NKUCDGVJ$KVMKPHH&KCMQXHH 5GJTUEJÌP



-W-QRGMGWPDGUVKOOVG/ÒP\UV·VVGI$KVMKP 4 &KCMQX 4   8QPITQ­GT5GNVGPJGKVªDGTRT·IWPIUURWTGPUEJÌPpUGJTUEJÌP

8165

1,5:1

 

8165

<#4+0-#6*#4+0#++ )QNFOÒP\GPFGT/ÒP\UV·VVG5V2GVGTUDWTI 

4WDGN5V2GVGTUDWTII)GMTÌPVGU$TWUVDKNFTOKVWOIGNGIVGO/CPVGN8KGTIGMTÌPVG 9CRRGPKPU-TGW\IGUVGNNVKPFGT/KVVG#FNGTUEJKNFKPFGP9KPMGNPFKGIGVGKNVG,CJTGU\CJN $KVMKP 4 &KCMQX 4 (DC )1.&4#VVTCMVKXGU'ZGORNCTUGJTUEJÌPpXQT\ÒINKEJ



8166

1,5:1



48

1,5:1

4WDGN5V2GVGTUDWTII)GMTÌPVGU$TWUVDKNFTOKVWOIGNGIVGO/CPVGN8KGTIGMTÌPVG 9CRRGP KPU -TGW\ IGUVGNNV KP FGT /KVVG #FNGTUEJKNF KP FGP 9KPMGNP FKG IGVGKNVG ,CJTGU\CJN   $KVMKPNGKEJVXCT 4 &KCMQXNGKEJVXCT(DC  )1.&45GJTCVVTCMVKXGUXQT\ÒINKEJGU'ZGORNCT 


KATHARINA II.

8167

1,5:1

1,5:1



4WDGN5V2GVGTUDWTII)GMTÌPVGU$TWUVDKNFTOKVWOIGNGIVGO/CPVGN8KGTIGMTÌPVG 9CRRGP KPU -TGW\ IGUVGNNV KP FGT /KVVG #FNGTUEJKNF KP FGP 9KPMGNP FKG IGVGKNVG ,CJTGU\CJN   $KVMKP 4 &KCMQX 4 (DC )1.&45GJTUEJÌPpXQT\ÒINKEJ 

8168 1,5:1

1,5:1



 4WDGN  5V 2GVGTUDWTI  I )GMTÌPVGU $TWUVDKNF T OKV WOIGNGIVGO /CPVGN8KGT IGMTÌPVG   9CRRGPKPU-TGW\IGUVGNNVKPFGT/KVVG#FNGTUEJKNFKPFGP9KPMGNPFKGIGVGKNVG,CJTGU\CJN $KVMKP 4 &KCMQX 4 (DC )1.&4#VVTCMVKXGUXQT\ÒINKEJGU'ZGORNCT 

8169 1,5:1



4WDGN5V2GVGTUDWTII$KVMKP 4 &KCMQX 4 (DC

1,5:1

 )1.&45GJTUEJÌP



8170 1,5:1



1,5:1

 4WDGN  5V 2GVGTUDWTI  I )GMTÌPVGU $TWUVDKNF T OKV WOIGNGIVGO /CPVGN8KGT IGMTÌPVG   9CRRGP KPU -TGW\ IGUVGNNV KP FGT /KVVG #FNGTUEJKNF KP FGP 9KPMGNP FKG IGVGKNVG ,CJTGU\CJN   $KVMKP 4 &KCMQX 4 (DD  )1.&45GJTCVVTCMVKXGUXQT\ÒINKEJGU'ZGORNCT  49


KATHARINA II.

8172

8173

8171



4WDGN5V2GVGTUDWTII$KVMKP 4 &KCMQX 4 (DD  )1.&445GJTUEJÌP





4WDGN 2QNVKPC 5V2GVGTUDWTII$KVMKP 4 &KCMQX(D  )1.&5EJTÌVNKPIUHGJNGTXQT\ÒINKEJ





4WDGN 2QNVKPC 5V2GVGTUDWTII$KVMKP 4 &KCMQX(D  )1.&-N5EJTÌVNKPIUHGJNGTCO4CPFXQT\ÒINKEJ



8175

8174

8176

'KP4WDGNFGU4QVGP/ÒP\JQHGUKP/QUMCW 

4WDGN/QUMCW4QVGT/ÒP\JQHI$KVMKP 4 &CX&KCMQX 4   5GNVGPGT,CJTICPI-N-TCV\GTUGJTUEJÌP



5KNDGTOÒP\GPFGT/ÒP\UV·VVG5V2GVGTUDWTI 

4WDGN5V2GVGTUDWTII$KVMKP&CX&KCMQX  .GKEJVG1DGTHN·EJGPMQTTQUKQPXQT\ÒINKEJ





4WDGN5V2GVGTUDWTII$KVMKP&CX&KCMQX  5GNVGPKPFKGUGT'TJCNVWPI*ÒDUEJG2CVKPCYKP\5VGORGNHGJNGTXQT\ÒINKEJp5VGORGNINCP\



8177

8178



4WDGN5V2GVGTUDWTII$KVMKP&CX&KCMQX  (GKPG2CVKPCMN2T·IGUEJY·EJGUGJTUEJÌPpXQT\ÒINKEJ





4WDGN5V2GVGTUDWTII$KVMKP&CX&KCMQX



50

5GJTUEJÌP


KATHARINA II.

8179

8180



4WDGN5V2GVGTUDWTII$KVMKP&CX&KCMQX

5GJTUEJÌP





4WDGN5V2GVGTUDWTII$KVMKP&CX&KCMQX  *ÒDUEJG2CVKPCUGJTUEJÌPpXQT\ÒINKEJ



8181

8182

8183



4WDGN5V2GVGTUDWTII$KVMKP&CX&KCMQX  -N5EJTÌVNKPIUHGJNGTCO4CPFHCUVXQT\ÒINKEJ





4WDGN5V2GVGTUDWTII$KVMKP&CX&KCMQX  5GNVGPKPFKGUGT'TJCNVWPI2TCEJVGZGORNCT(CUV5VGORGNINCP\





4WDGN5V2GVGTUDWTII$KVMKP&CX&KCMQX  -N5EJTÌVNKPIUHGJNGTCO4CPFUGJTUEJÌPpXQT\ÒINKEJ



8184

1,5:1



1,5:1

4WDGN5V2GVGTUDWTII$KVMKP&CX&KCMQX  2TCEJVGZGORNCT(CUV5VGORGNINCP\

 51


KATHARINA II.

8185

8186

8187



4WDGN5V2GVGTUDWTII$KVMKP&CX&KCMQX

5GJTUEJÌP





4WDGN5V2GVGTUDWTII$KVMKP&CX&KCMQX

8QT\ÒINKEJp5VGORGNINCP\





4WDGN5V2GVGTUDWTII$KVMKP&CX&KCMQX

9KP\-TCV\GTXQT\ÒINKEJ



8189

8188



4WDGN5V2GVGTUDWTII$KVMKP&CX&KCMQX  5GJTUEJÌPUGJTUEJÌPpXQT\ÒINKEJ





4WDGN5V2GVGTUDWTII$KVMKP&CX&KCMQX



8QT\ÒINKEJ

8190

1,5:1

 52

1,5:1

4WDGN5V2GVGTUDWTII$KVMKP&CX&KCMQX  (GKPG2CVKPCXQT\ÒINKEJp5VGORGNINCP\




KATHARINA II.

8191

8192



4WDGN5V2GVGTUDWTII$KVMKP&CX&KCMQX  *ÒDUEJG2CVKPCYKP\4CPFHGJNGTXQT\ÒINKEJ



4WDGN5V2GVGTUDWTII$KVMKP&CX&KCMQX 4 

8193



(CUVXQT\ÒINKEJ



4(CUVUGJTUEJÌP



8194



4WDGN 2QNVKPC 5V2GVGTUDWTII$KVMKP&KCMQX 4 



 4WDGN 2QNVKPC   5V 2GVGTUDWTI +P 752NCUVKMJQNFGT FGT 0)% OKV FGT $GYGTVWPI #7    $KVMKP 4 &KCMQX 4   5GNVGPDGUQPFGTUKPFKGUGT'TJCNVWPI*GTTNKEJG2CVKPCYKP\5EJTÌVNKPIUHGJNGTXQT\ÒINKEJ 

8196

8196

8195



 4WDGN 2QNVKPC   5V 2GVGTUDWTI +P 752NCUVKMJQNFGT FGT 0)% OKV FGT $GYGTVWPI #7    $KVMKP 4 &KCMQX 4  4(GKNURWTCO4CPFHCUVXQT\ÒINKEJ 



-QRGMGP )TKXGPPKM 5V2GVGTUDWTII$KVMKP&KCMQX

'ZGORNCTFGT5COONWPI#PVQPKP2TQMQR6GKN#WMVKQP#WTGC0WOKUOCVKMC2TCI0T

8QT\ÒINKEJ



8198

8197

8197

-WRHGTRT·IWPIGPFGU4QVGP/ÒP\JQHGUKP/QUMCW 

-W -QRGMGP  /QUMCW 4QVGT /ÒP\JQH  I ªDGTRT·IV CWH GKPGO -W -QRGMGP5VÒEM   XQP2GVGT+++$KVMKP&KCMQX 4-N2T·IGUEJY·EJGXQT\ÒINKEJ





-W-QRGMGP/QUMCW4QVGT/ÒP\JQHI$KVMKP&KCMQX  9KP\ªDGTRT·IWPIUURWTGPHCUVXQT\ÒINKEJ

 53


KATHARINA II.

8199

8200

8199

-WRHGTRT·IWPIGPFGT/ÒP\UV·VVG5V2GVGTUDWTI 

-W-QRGMGP5V2GVGTUDWTII5KEJVDCTÒDGTRT·IVCWHGKPGO-W-QRGMGP5VÒEM XQP2GVGT+++$KVMKP&KCMQX 5GJTUEJÌP



-W-QRGMG  5V 2GVGTUDWTI  I  5KEJVDCT ÒDGTRT·IV CWH GKPGO -W -QRGMGP5VÒEM    XQP2GVGT+++$KVMKP 4 &KCMQX 4  8QPITQ­GT5GNVGPJGKV(CUVUGJTUEJÌP 

8201

8202



8203

-WRHGTRT·IWPIGPFGT/ÒP\UV·VVG'MCVGTKPDWTI 

-W-QRGMGP'MCVGTKPDWTII$KVMKP&KCMQX

*ÒDUEJG2CVKPCXQT\ÒINKEJ





-W-QRGMGP'MCVGTKPDWTII$KVMKP\W&KCMQX\W  5GNVGPDGUQPFGTUKPFKGUGT'TJCNVWPI(CUV5VGORGNINCP\





-W-QRGMGP'MCVGTKPDWTII$KVMKP&KCMQX  9KP\5VGORGNHGJNGTHCUV5VGORGNINCP\



8205 8204

8204



-W-QRGMGP'MCVGTKPDWTII$KVMKP 4 &KCMQX  5GNVGPGT,CJTICPI8QT\ÒINKEJ





-W-QRGMGP'MCVGTKPDWTII$KVMKP&KCMQX  5GNVGPKPFKGUGT'TJCNVWPI5GJTUEJÌPpXQT\ÒINKEJ



54


KATHARINA II.

8207

8206



8206

-W-QRGMG'MCVGTKPDWTII$KVMKP&KCMQX

5GJTUEJÌP



'KPG-WRHGTRT·IWPIFGT/ÒP\UV·VVG(GQFQUKC -TKO  

-W -QRGMGP  (GQFQUKC -TKO   I $KVMKP  4  &KCMQX p \W  FQTV OKV 4KHHGN   TCPF  8QPITQ­GT5GNVGPJGKV(CUVUGJTUEJÌP 

8209

8208

8210

-WRHGTRT·IWPIGPFGT/ÒP\UV·VVG#PPKPUMQ[G 

-W-QRGMGP#PPKPUMQ[GI$KVMKP&KCMQX

8QT\ÒINKEJ





-W-QRGMGP#PPKPUMQ[GI$KVMKP&KCMQX

8QT\ÒINKEJp5VGORGNINCP\





-W-QRGMGP#PPKPUMQ[GI$KVMKP&KCMQX

8QT\ÒINKEJ



8QT\ÒINKEJp5VGORGNINCP\



45GJTUEJÌP



8212 8211



-W-QRGMGP#PPKPUMQ[GI$KVMKP&KCMQX



-W-QRGMGP#PPKPUMQ[GI$KVMKP 4 &KCMQX 4 

8211

55


KATHARINA II.

8213

8214

8215

-WRHGTRT·IWPIGPHÒT5KDKTKGPCWUFGT/ÒP\UV·VVG5W\WP -QN[XCP  

-W-QRGMGP5W\WP -QN[XCP HÒT5KDKTKGPI$KVMKP 4 &KCMQX 4   445GJTUEJÌPpXQT\ÒINKEJ





-W-QRGMGP5W\WP -QN[XCP HÒT5KDKTKGP+P752NCUVKMJQNFGTFGT0)%OKVFGT$GYGTVWPI #7$0$KVMKP&KCMQX -N5VGORGNHGJNGTHCUVXQT\ÒINKEJ





-W-QRGMGP5W\WP -QN[XCP HÒT5KDKTKGP+P752NCUVKMJQNFGTFGT0)%OKVFGT$GYGTVWPI #7$0$KVMKP&KCMQX 8QT\ÒINKEJ



8216

8217

8218

 

-W-QRGMGP5W\WP -QN[XCP HÒT5KDKTKGPI$KVMKP&KCMQX -W-QRGMGP5W\WP -QN[XCP HÒT5KDKTKGPI$KVMKP&KCMQX

8QT\ÒINKEJ 8QT\ÒINKEJ

 



-W-QRGMGP5W\WP -QN[XCP HÒT5KDKTKGPI$KVMKP 4 &KCMQX  48QT\ÒINKEJ



56


KATHARINA II.

8219

8220

8220



-W-QRGMGP5W\WP -QN[XCP HÒT5KDKTKGPI$KVMKP 4 &KCMQX 4   445GJTUEJÌPpXQT\ÒINKEJ





-W-QRGMGP5W\WP -QN[XCP HÒT5KDKTKGPI$KVMKP&KCMQX  5GNVGPKPFKGUGT'TJCNVWPI8QT\ÒINKEJp5VGORGNINCP\



8222

8221

8221



-W-QRGMGP5W\WP -QN[XCP HÒT5KDKTKGPI$KVMKP&KCMQX  5GNVGPKPFKGUGT'TJCNVWPI8QT\ÒINKEJp5VGORGNINCP\



-W-QRGMGP5W\WP -QN[XCP HÒT5KDKTKGP+P752NCUVKMJQNFGTFGT0)%OKVFGT$GYGTVWPI #7$0$KVMKP&KCMQX 8QT\ÒINKEJ

8223

 

8224

-WRHGTRT·IWPIGPHÒT/QNFCYKGPWPFFKG9CNCEJGKCWUFGT/ÒP\UV·VVG5CFQIWTC 

-W2CTC  &GPICU   5CFQIWTC IGRT·IV Y·JTGPF FGT TWUUKUEJGP $GUGV\WPI /QNFCYKGPU WPF FGT   9CNCEJGKY·JTGPFFGUVÒTMKUEJTWUUKUEJGP-TKGIGUJGTIGUVGNNVCWU-CPQPGPDTQP\GI$KVMKP

4 $TCWUG/CPUHGNF6HXCT FQTVCPFGTGT,CJTICPI &KCMQX 4  44(CUVUGJTUEJÌP



-W2CTC  &GPICU   5CFQIWTC IGRT·IV Y·JTGPF FGT TWUUKUEJGP $GUGV\WPI /QNFCYKGPU WPF FGT   9CNCEJGK Y·JTGPF FGU VÒTMKUEJTWUUKUEJGP -TKGIGU JGTIGUVGNNV CWU -CPQPGPDTQP\G  I $KVMKP   $TCWUG/CPUHGNF6H&KCMQX -N<CKPGPFGUGJTUEJÌP



9·JTGPF FGU TWUUKUEJVÒTMKUEJGP -TKGIGU  XGTFT·PIVGP FKG TWUUKUEJGP 5VTGKVMT·HVG FKG 6ÒTMGP CWU FGO   OQNFCYKUEJGP )GDKGV WPF FGT 9CNCEJGK (ÒT FKG PWP GTHQTFGTNKEJG /ÒP\RT·IWPI XGTYGPFGVG OCP FCU /GVCNN   GTDGWVGVGTVÒTMKUEJGT)GUEJÒV\G



57


KATHARINA II.

8225

/GFCKNNGPFGT<CTKP-CVJCTKPC++ 

$TQP\GOGFCKNNGXQP,$(KNKRRQWPF8$CTCPQXCWHKJTG6JTQPDGUVGKIWPICO,WPK)GJCT PKUEJVGU $TWUVDKNF -CVJCTKPCU CNU RGTUQPKHK\KGTVG /KPGTXC N OKV (GFGTJGNO WPF WOIGNGIVGO /CPVGN   -CVJCTKPCUKV\VPCEJTWPFGORH·PIVXQP4WUUKCWPF5V)GQTIGKP-KUUGPCWHFGOFKG-TÌPWPIUKPUK IPKGP NKGIGP QDGP UEJYGDV FKG RGTUQPKHK\KGTVG 8QTUGJWPI KP 9QNMGP  OO  I &KCMQX    4  5GJTUEJÌPpXQT\ÒINKEJ



8226



5KNDGTOGFCKNNG Q , WO   UR·VGTG 2T·IWPI XQP 0 -Q\KP 2T·OKG FGT .KDGTCNGP ¤MQPQOKUEJGP   )GUGNNUEJCHV XGTNKGJGP HÒT 8GTFKGPUVG WO FKG .CPFYKTVUEJCHV )GMTÌPVGU $TWUVDKNF T OKV WOIGNGIVGO   /CPVGN%GTGU UKV\V X X CWH)GVTGKFGICTDGPXQTGKPGO2CNODCWOKPFGTGTJQDGP4GEJVGP-TCP\KO NKPMGP#TO%CFWEGWUKO*KPVGTITWPFNGKPRHNÒIGPFGT$CWGTOOI&KCMQX 4  4*GTTNKEJG2CVKPCYKP\4CPFHGJNGTXQT\ÒINKEJ



8227



58

5KNDGTOGFCKNNGXQP6+YCPQHH XGTOWVNKEJUR·VGTG2T·IWPIFGU,CJTJWPFGTVU CWHFGP(TKGFGP OKV FGT 6ÒTMGK )GMTÌPVGU $TWUVDKNF T OKV WOIGNGIVGO /CPVGN WPF 1TFGPUDCPF/KPGTXC UVGJV X X   OKV/GTMWTUVCDWPF5RGGTCP/GGTGUWHGTWPFFGWVGVCWHGKP5EJKHHCWH5GGT6TQRJ·GKO*KPVGTITWPF T 5EJNCEJVHGNF  OO  I &KCMQX  XCT 4 5KIPCVWT GKP\GKNKI WPF QJPG ,CJTGUCP   ICDG  44*ÒDUEJG2CVKPCXQT\ÒINKEJ 


KATHARINA II.

8228

8229



8229

5KNDGTLGVQP  WPUKIPKGTV CWH FKG 'TTKEJVWPI FGT 4GKVGTUVCVWG 2GVGTU + CWH FGO 5V 2GVGTUDWTIGT   &GMCDTKUVGPRNCV\ CO  #WIWUV $ÒUVG N OKV .QTDGGTMTCP\#PUKEJV FGT 4GKVGTUVCVWG CWHGKPGO(GNUGP OOI$KVMKP 4 &KCMQX *ÒDUEJG2CVKPCYKP\4CPFHGJNGTUGJTUEJÌP



 ,CJTG PCEJ UGKPGT 6JTQPDGUVGKIWPI NKG­ <CTKP -CVJCTKPC ++ HÒT <CT 2GVGT + FGP )TQ­GP CWH FGO   5V 2GVGTUDWTIGT &GMCDTKUVGPRNCV\GKP6QPPGPUEJYGTGU&GPMOCNCWHGKPGO(GNUDNQEMGTTKEJVGPHÒTFCUFGT HTCP\ÌUKUEJG $KNFJCWGT 'VKGPPG/CWTKEG (CNEQPGV \YÌNH ,CJTGDGPÌVKIVG&CU/QPWOGPV\GKIVFGP<CTGP\W2HGTF FCU OKV FGP *KPVGTJWHGP GKPG 5EJNCPIG FKG (GKPFG FGU <CTGP KPUDGUQPFGTG 5EJYGFGP  \GTVTKVV *GWVG \·JNV FCU   &GPMOCN FCU #NGZCPFGT 2WUEJMKP CNU 'JGTPGT 4GKVGT FWTEJ FCU ÒDGTHNWVGVG 5V 2GVGTUDWTI TGKVGP NKG­ \W FGP   DGFGWVGPFGP5GJGPUYÒTFKIMGKVGPFGT5VCFV



5KNDGTOGFCKNNGXQP5,WFKPCWHFGP(TKGFGPXQP8·T·N· 5ÒFQUVHKPPNCPF \YKUEJGP5EJYGFGPWPF 4W­NCPF CO  #WIWUV PCEJ ITGIQTKCPKUEJGO -CNGPFGT CO  #WIWUV  )GMTÌPVGU $TWUVDKNF T OKV   .QTDGGTMTCP\ WPF WOIGNGIVGO /CPVGN1NKXGP\YGKI KP .QTDGGTMTCP\  OO  I &KCMQX p  

\WXCT4  44-N4CPFHGJNGTUGJTUEJÌPpXQT\ÒINKEJ

8230



8231



'KPUGKVKIGU QXCNGU 'NHGPDGKPOGFCKNNQP Q ,  ,CJTJWPFGTV  )GMTÌPVGU $TWUVDKNFTOKVWOIGNGIVGO /CPVGNZOOI 448QT\ÒINKEJ





'KPUGKVKIG'NHGPDGKPOGFCKNNGQ,WPUKIPKGTVCWHFGPTWUUKUEJGP(GNFOCTUEJCNN#NGZCPFGT8CUKNKGYKVUEJ 5WXQTQX$TWUVDKNFFGU(GNFOCTUEJCNNUJCNDN&KGECOOITQ­G/GFCKNNGKUVKPGKPGOFWPMGNDTCWP IGDGK\VGP*QN\TCJOGPOKV¤UGGKPIGNCUUGP+PUIGUCOVOOI&KCMQXp 8QT\ÒINKEJ



)GPGTCN #NGZCPFGT 8CUKNKGYKVUEJ 5WXQTQX   IKNV CNU GKPGT FGT DGFGWVGPFUVGP 5VTCVGIGP FGT TWUUKUEJGP   /KNKV·TIGUEJKEJVG 9·JTGPF FGU 5KGDGPL·JTKIGP -TKGIGU   PCJO GT CNU 4GIKOGPVUEJGH CP XGTUEJKGFGPGP   5EJNCEJVGP VGKN WPF YWTFG Y·JTGPF FGU )GHGEJVUDGK5VGVVKP 1MVQDGT XGTYWPFGV0CEJ'KPU·V\GPIGIGP FKG RQNPKUEJG -QPHÌFGTCVKQP   WPF KO 4WUUKUEJ6ÒTMKUEJGP -TKGI   ÒDGTPCJO GT FCU   -QOOCPFQ ÒDGT FKG 6TWRRGP CWH FGT -TKO 1DYQJN GT GTHQNITGKEJG 1RGTCVKQPGP FWTEJHÒJTVG WPF KO 4WUUKUEJ   6ÒTMKUEJGP-TKGI  OGJTHCEJUEJYGTXGTYWPFGVYWTFGHKGNGTDGK4GKEJUHÒTUV)TKIQTK#NGZCPFTQYKVUEJ 2QVLQOMKPGKPGO8GTVTCWVGPFGT<CTKP-CVJCTKPCFGT)TQ­GPKP7PIPCFGWPFYWTFGCWHGKPGPGJGTWPDGFGWVGPFGP #W­GPRQUVGP XGTUGV\V 5GKPGP NGV\VGP 'KPUCV\ JCVVG 5WXQTQX Y·JTGPF FGU <YGKVGP -QCNKVKQPUMTKGIGU     IGIGP FCU TGXQNWVKQP·TG (TCPMTGKEJ CNU 1DGTDGHGJNUJCDGT FGU TWUUKUEJÌUVGTTGKEJKUEJGP -QPVKPIGPVU 1DYQJN   OKNKV·TKUEJGTHQNITGKEJYCTFGT-TKGIHÒTFKGTWUUKUEJG#TOGGXGTNWUVTGKEJWPF5WXQTQXHKGNGTPGWVDGKO<CTGPKP 7PIPCFG YGKN GT Y·JTGPF FGU (GNF\WIGU CFOKPKUVTCVKXG &KGPUVXQTUEJTKHVGP PKEJV GKPIGJCNVGP JCVVG 5Q DNKGD UGKP   6QFCO/CKXQO<CTGPJQHYGKVGUVIGJGPFWPDGCEJVGVYQJKPIGIGPUKEJFCUGKPHCEJG8QNMKPITQ­GT<CJN \WT$GGTFKIWPIKO#NGZCPFGT0GYUMK-NQUVGTXGTUCOOGNVG

59


PAUL I.

8232

8233

<#42#7.+  

5KNDGTOÒP\GPFGT/ÒP\UV·VVG5V2GVGTUDWTI

4WDGN5V2GVGTUDWTII$KVMKP&CX 4WDGN5V2GVGTUDWTII$KVMKP&CX

8234

 

 

8235

-QRGMGP5V2GVGTUDWTII$KVMKP 4  -QRGMGP5V2GVGTUDWTII$KVMKP 4 

8236

-N5EJTÌVNKPIUHGJNGTUGJTUEJÌP 8QT\ÒINKEJ

8237

44'VYCUIGYGNNVUGJTUEJÌP 45GJTUEJÌP

 

8238

-WRHGTRT·IWPIGPFGU<CTGP2CWN+ 

-W-QRGMGP'MCVGTKPDWTI5V2GVGTUDWTI/QUMCW 4QVGT/ÒP\JQH QFGT0K\JPK0QXIQ TQFIªDGTRT·IVKO,CJTKO#WHVTCIXQP<CT2CWN+$KVMKP&KCMQX FQTVWPVGT -CVJCTKPC++  5GJTUEJÌP



-W-QRGMGP'MCVGTKPDWTI5V2GVGTUDWTI/QUMCW 4QVGT/ÒP\JQH QFGT0K\JPK0QXIQ TQFIªDGTRT·IVKO,CJTKO#WHVTCIXQP<CT2CWN+$KVMKP 4 &KCMQX 4FQTV WPVGT-CVJCTKPC++  8QPITQ­GT5GNVGPJGKV9KP\4CPFHGJNGTUGJTUEJÌP



-W-QRGMGP'MCVGTKPDWTIIªDGTRT·IVKO,CJTKO#WHVTCIXQP<CT2CWN+ $KVMKP 4 &KCMQX 4FQTVWPVGT-CVJCTKPC++  44ªDGTRT·IWPIUURWTGPUGJTUEJÌP



-CVJCTKPC ++ DGUEJNQ­ KP KJTGO NGV\VGP 4GIKGTWPIULCJT  GKPG IGYCNVKIG /ÒP\TGHQTO &KG -WRHGTOÒP\GP \W    -QRGMGP YWTFGP WO   CDIGYGTVGV KPFGO UKG OKV PGWGP 5VGORGNP OKV FGO 9GTV  -QRGMGP WPF FGT   ,CJTGU\CJN  ÒDGTRT·IV YWTFGP 0CEJ FGO 6QF -CVJCTKPCU CO  0QXGODGT  UVQRRVG <CT 2CWN + FKGUG   #MVKQP WPXGT\ÒINKEJ WPF NKG­ FKG ÒDGTRT·IVGP /ÒP\GP KO ,CJT  YKGFGTWO OKV FGP CNVGP 5VGORGNP WPF FGT   WTURTÒPINKEJGP,CJTGU\CJNÒDGTRT·IGP



 60


PAUL I.

8240

8239

8239





-W-QRGMGP#PPKPUMQ[GIªDGTRT·IVKO,CJTKO#WHVTCIXQP<CT2CWN+ $KVMKP 4 &KCMQX 4FQTVWPVGT-CVJCTKPC++   8QPITQ­GT5GNVGPJGKVDGUQPFGTUKPFKGUGT'TJCNVWPI ªDGTRT·IWPIUURWTGPCVVTCMVKXGUXQT\ÒINKEJGU'ZGORNCT  -W-QRGMGPWPDGUVKOOVG/ÒP\UV·VVGI$KVMKP 4  5GJTUEJÌP 

8241

8242

/GFCKNNGPFGU<CTGP2CWN+ 



5KNDGTOGFCKNNGQ,  XQP%.GDGTGEJVCWHUGKPG-TÌPWPIKP/QUMCW7PKHQTOKGTVGU$TWUVDKNFT OKVWOIGNGIVGO/CPVGN-TGW\OOI&KCMQX 4   4-TCV\GTKO(GNFFGT4ÒEMUGKVGHCUVXQT\ÒINKEJ



5KNDGTOGFCKNNGQ,  XQP%/GKUPGTCWHUGKPG-TÌPWPIKP/QUMCW7PKHQTOKGTVGU$TWUVDKNFT OKVWOIGNGIVGO/CPVGN-TGW\OOI$KVMKP/ 4 &KCMQX 4   4*ÒDUEJG2CVKPCMN$GCTDGKVWPIUUVGNNGKO(GNFFGT8QTFGTUGKVG YKP\-TCV\GTUGJTUEJÌPpXQT\ÒINKEJ



8243





8244

5KNDGTOGFCKNNGQ,  XQP%/GKUPGTCWHUGKPG-TÌPWPIKP/QUMCW7PKHQTOKGTVGU$TWUVDKNFT OKVWOIGNGIVGO/CPVGN-TGW\OOI$KVMKP/ 4 &KCMQX 4   4-N-TCV\GTDGTKGDGPUGJTUEJÌPpXQT\ÒINKEJ



5KNDGTOGFCKNNG  XQP ) )WKNNGOCTF WPF ( 5VWEMJCTFV CWH FKG ,CJTJWPFGTVYGPFG &TGK MNGGDNCVV   HÌTOKI CPIGQTFPGVG /GFCKNNQPU OKV FGP $TWUVDKNFGTP XQP -CVJCTKPC++XQP4W­NCPF(TKGFTKEJ++XQP 2TGW­GP WPF ,QUGRJ ++XQP¤UVGTTGKEJ)GPKWUUVGJVPCEJTWPFGPV\ÒPFGVOKVGKPGT(CEMGNGKP(GWGT CWH GKPGO #NVCT KO #DUEJPKVV FTGK <GKNGP 5EJTKHV WPF ,CJTGU\CJN  OO  I &KCMQX   

4 5VTQVJQVVGp 4*ÒDUEJG2CVKPCXQT\ÒINKEJ

 61


ALEXANDER I.

8245

8246

<#4#.':#0&'4+ <YGK)QNFOÒP\GPFGU<CTGP#NGZCPFGT+ 

4WDGN5V2GVGTUDWTII$KVMKP(D5EJN  )1.&9KP\-TCV\GTHCUVXQT\ÒINKEJ





4WDGN5V2GVGTUDWTII$KVMKP(D5EJN )1.&-N4CPFHGJNGTUGJTUEJÌP



8248

8247

5KNDGTOÒP\GPFGT/ÒP\UV·VVG5V2GVGTUDWTI 

4WDGN5V2GVGTUDWTII$KVMKP&CX

8QT\ÒINKEJ





4WDGN5V2GVGTUDWTII$KVMKP&CX  4#VVTCMVKXGU'ZGORNCTOKVJÒDUEJGT2CVKPCHCUVXQT\ÒINKEJ



8249

1,5:1



1,5:1

 4WDGN 2QNWRQNVKPPKM   5V 2GVGTUDWTI +P 752NCUVKMJQNFGT FGT 2%)5 OKV FGT $GYGTVWPI   /5$KVMKP 4   5GNVGPDGUQPFGTKPFKGUGT'TJCNVWPI*ÒDUEJG2CVKPCXQT\ÒINKEJp5VGORGNINCP\ 

8250

8251



4WDGN5V2GVGTUDWTII$KVMKP 4 &CX

45GJTUEJÌPpXQT\ÒINKEJ





4WDGN5V2GVGTUDWTII$KVMKP&CX  (GKPG6ÌPWPIYKP\5EJTÌVNKPIUHGJNGTCO4CPFXQT\ÒINKEJ



62


ALEXANDER I.

8253

8254

8252

8252



4WDGN5V2GVGTUDWTII$KVMKP&CX  5GJTUGNVGPKPFKGUGT'TJCNVWPI*GTTNKEJG2CVKPCXQT\ÒINKEJ



-QRGMGP5V2GVGTUDWTII$KVMKP 4 

49KP\4CPFHGJNGTUGJTUEJÌP





-QRGMGP5V2GVGTUDWTII$KVMKP 4 

 4.GKEJVIGYGNNVYKP\-TCV\GTHCUVUGJTUEJÌP



8255



8256



4WDGN5V2GVGTUDWTII$KVMKPXCT 4 &CX  5GNVGPDGUQPFGTUKPFKGUGT'TJCNVWPI8QT\ÒINKEJp5VGORGNINCP\



4WDGN5V2GVGTUDWTII$KVMKP&CX

8257



8QT\ÒINKEJ



8258



4WDGN5V2GVGTUDWTII$KVMKP&CX

(CUVXQT\ÒINKEJ





4WDGN5V2GVGTUDWTII$KVMKP&CX

5GJTUEJÌPpXQT\ÒINKEJ



8261

8259

8260



4WDGN 2QNVKPC 5V2GVGTUDWTII$KVMKP 4   8QPITQ­GT5GNVGPJGKV(CUVUGJTUEJÌP



-QRGMGP5V2GVGTUDWTII$KVMKP



-QRGMGP5V2GVGTUDWTII$KVMKP 4 



8QT\ÒINKEJ



44-N5EJTÌVNKPIUHGJNGTXQT\ÒINKEJ

 63


ALEXANDER I.

8262

8264

8263

-WRHGTRT·IWPIGPFGU<CTGP#NGZCPFGT+   

-W-QRGMGP'MCVGTKPDWTII$KVMKP -W-QRGMGP'MCVGTKPDWTII$KVMKP 4  -W-QRGMGP5W\WP -QN[XCP I$KVMKP

8QT\ÒINKEJ 4-N4CPFHGJNGTUGJTUEJÌP 45GJTUEJÌPpXQT\ÒINKEJ

  

8266

8265

8265



-W-QRGMGP5W\WP -QN[XCP I$KVMKP 4   5GNVGPDGUQPFGTUKPFKGUGT'TJCNVWPI8QT\ÒINKEJ



#DC\K -QRGMGP 6KHNKUHÒT)GQTIKGPI$KVMKP



'KPG2T·IWPIHÒT)GQTIKGP 8QT\ÒINKEJ



8267

1,5:1

1,5:1

2T·IWPIGPHÒT2QNGP  64

<NQV[EJ9CTUEJCWHÒT2QNGPI$KVMKP 4 (D FQTVWPVGT2QNGP 5EJN FQTV WPVGT2QNGP  )1.&45GJTUEJÌPpXQT\ÒINKEJXQT\ÒINKEJ




ALEXANDER I.

8268 1,5:1



<NQV[EJ9CTUEJCWHÒT2QNGPI$KVMKP 4 (D FQTVWPVGT2QNGP 5EJN FQTV WPVGT2QNGP  )1.&440WT'ZGORNCTGIGRT·IV5GJTUEJÌP

1,5:1



8269

8270

8272



1,5:1

<NQV[EJ9CTUEJCWHÒT2QNGPI$KVMKP 4 (D FQTVWPVGT2QNGP 5EJN FQTV WPVGT2QNGP  )1.&45GJTUEJÌPpXQT\ÒINKEJ

8271



1,5:1

<NQV[EJ9CTUEJCWHÒT2QNGPI$KVMKP 4 (D FQTVWPVGT2QNGP 5EJN FQTV WPVGT2QNGP  )1.&4-N-TCV\GTCWHFGT4ÒEMUGKVGUGJTUEJÌP

1,5:1



1,5:1



8273



<NQV[EJ9CTUEJCWHÒT2QNGPI$KVMKP 4 &CX FQTVWPVGT2QNGP   40WT'ZGORNCTGIGRT·IV-N4CPFHGJNGTHCUVXQT\ÒINKEJ





<NQV[EJ9CTUEJCWHÒT2QNGPI$KVMKP 4 &CX FQTVWPVGT2QNGP   440WT'ZGORNCTGIGRT·IV*ÒDUEJG2CVKPCUGJTUEJÌPpXQT\ÒINKEJXQT\ÒINKEJ





<NQV[EJ9CTUEJCWHÒT2QNGPI$KVMKP 4 &CX FQTVWPVGT2QNGP   440WT'ZGORNCTGIGRT·IV-N4CPFHGJNGTUGJTUEJÌP

 65


ALEXANDER I.

8274 1,5:1

1,5:1



<NQVG9CTUEJCWHÒT2QNGPI$KVMKP

9KP\5EJTÌVNKPIUHGJNGTXQT\ÒINKEJ



8275

8276

8276

/GFCKNNGPFGU<CTGP#NGZCPFGT+ 

$TQP\GOGFCKNNG  XQP $ #PFTKGW WPF , 2 &TQ\ CWH FGP (TKGFGP XQP 6KNUKV \YKUEJGP 4W­NCPF   2TGW­GP WPF (TCPMTGKEJ &KG $TWUVDKNFGT 0CRQN¾QPU + #NGZCPFGTU + WPF (TKGFTKEJ 9KNJGNOU +++   PGDGPGKPCPFGT T&GT (NW­IQVV 0KGOGP NCIGTV PCEJ N FGP NKPMGP #TO CWH GKPGP CWUUVTÌOGPFGP   9CUUGTMTWIIGNGJPVKPFGT4GEJVGPJ·NVGTFCU/QFGNNFGU<GNVGUKPFGOFKGFTGK4GIGPVGP\WUCOOGP MCOGPN¤NDCWOOOI&KCMQX 4  8QT\ÒINKEJp5VGORGNINCP\





$TQP\GOGFCKNNG  XQP # #DTCOUQP CWH FKG <WUCOOGPMWPHV XQP #NGZCPFGT + WPF 0CRQN¾QP +   CPN·­NKEJFGU(TKGFGPUXQP6KNUKV\YKUEJGP4W­NCPF2TGW­GPWPF(TCPMTGKEJ$ÒUVGP#NGZCPFGTU+WPF 0CRQN¾QPU + GKPCPFGT IGIGPÒDGT<YGK UGEJUUVTCJNKIG 5VGTPG  OO  I &KCMQX    *QHHOCPP2CZKP0WOOKU FQTVKP5KNDGT  48QT\ÒINKEJp5VGORGNINCP\



8277



66

5KNDGTOGFCKNNG  XQP , .CPI CWH FCU $ÒPFPKU \YKUEJGP 4W­NCPF 2TGW­GP WPF ¤UVGTTGKEJ KO   -CORHIGIGP(TCPMTGKEJ&KGDGNQTDGGTVGP$ÒUVGPXQP(TCP\+XQP¤UVGTTGKEJ#NGZCPFGT+XQP4W­ NCPFWPF(TKGFTKEJ9KNJGNO+++XQP2TGW­GPPGDGPGKPCPFGTT<GJP<GKNGP5EJTKHVOO I&KCMQX 4 /CTKGPD5NI/QPVGPWQXQ 42CVKPCXQT\ÒINKEJ




ALEXANDER I.

8278

8279



8279

5KNDGTOGFCKNNG XQP&(QFGT(9.QQUCWHFCU$ÒPFPKU\YKUEJGP4W­NCPFWPF2TGW­GPKO -CORH IGIGP (TCPMTGKEJ &KG WPKHQTOKGTVGP $TWUVDKNFGT XQP #NGZCPFGT + WPF (TKGFTKEJ 9KNJGNO +++   XQP 2TGW­GP GKPCPFGT IGIGPÒDGT&GPMUVGKP OKV FGP 9CRRGPUEJKNFGP XQP 4W­NCPF WPF 2TGW­GP FKG   XQP GKPGT 'KEJGPIKTNCPFG WOTCPMV YGTFGP \W FGP 5GKVGP 9CHHGP  OO  I   &KCMQX 4 5QOOGT# 44*ÒDUEJG2CVKPCXQT\ÒINKEJ



0CEJ 0CRQNGQPU IGUEJGKVGTVGO (GNF\WI IGIGP 4W­NCPF WPF FGT XQP )GPGTCN ;QTEM GKIGPO·EJVKI TCVKHK\KGTVGP   -QPXGPVKQP XQP 6CWTQIIGP UEJNQUUGP #NGZCPFGT + WPF (TKGFTKEJ 9KNJGNO +++ KP -CNKUEJ GKP $ÒPFPKU IGIGP   0CRQNGQP FGO FGT DGTÒJOVG #WHTWH FGU RTGW­KUEJGP -ÌPKIU #P OGKP 8QNM HQNIVG &KG $GHTGKWPIUMTKGIG   DGICPPGP



$TQP\GOGFCKNNGQ, WO OKV5KIPCVWT+/CWHFGP)GPGTCNFGTTWUUKUEJGP#TOGGWPF#VCOCP FGT &QPMQUCMGP )TCH /CVYGL +YCPQYKVUEJ 2NCVQY 7PKHQTOKGTVGU $TWUVDKNF FGU )GPGTCNU N8KGT   <GKNGP5EJTKHVOOI$TCOUGP&KCMQXp5NI,WNKWU  2TCEJVGZGORNCT(CUV5VGORGNINCP\



)TCH/CVYGL+YCPQYKVUEJ2NCVQYYWTFGCO#WIWUV PCEJITGIQTKCPKUEJGO-CNGPFGTCO#WIWUV  CO &QP <WHNW­ FGU #UQYUEJGP /GGTGU  IGDQTGP 2NCVQY FGT CWU GKPHCEJGP 8GTJ·NVPKUUGP UVCOOVG VTCV  KP   FCU -QUCMGPJGGT GKP WPF M·ORHVG  IGIGP FKG 6ÒTMGP 'T \GKEJPGVG UKEJ KO 4WUUKUEJ¤UVGTTGKEJKUEJGP   6ÒTMGPMTKGI ņ DGKFGT'KPPCJOGXQP1VUEJCMQYXQT#MMGTOCPWPF$GPFGTCWU(ÒTUGKPGP /WV DGK FGT 'TUVÒTOWPI +UOCLKNU KO ,CJT  YWTFG GT OKV FGO )GQTIUQTFGP FGMQTKGTV YWTFGGTXQP<CT #NGZCPFGT + \WO )GPGTCNNGWVPCPV WPF #VCOCP FGT &QPMQUCMGP  GTPCPPV 2NCVQY M·ORHVG FCPP KP FGP   0CRQNGQPKUEJGP-TKGIGP\WP·EJUVDKUIGIGPFKG(TCP\QUGP+OCPUEJNKG­GPFGP(GNF\WIIGIGPFKG6ÒTMGK PCJOGTFKG5VCFV*KTUQYCWPFJCVVGITQ­GP#PVGKNCPFGP5KGIGPDGK4CUUGYCVWPF-CNKRGVTK+O(GNF\WIXQP  DGHGJNKIVG GT PCEJ FGT <GTUVÌTWPI /QUMCWU  &QPMQUCMGPTGIKOGPVGT  ,·IGTTGIKOGPVGT WPF  TGKVGPFG   $CVVGTKGPFKGUVGVUFKG8QTJWVWPFFKG0CEJJWVFGT4WUUGPDKNFGVGPWPFXGTHQNIVGFGPCD\KGJGPFGP(GKPFOKVUGKPGP -QUCMGPFKGOGJTCNU)GHCPIGPGWPF-CPQPGPGKPDTCEJVGP9·JTGPFFGT(GNF\ÒIGGTYCTD UKEJ 2NCVQY OKV UGKPGP -QUCMGP KP 'WTQRC ITQ­G 2QRWNCTKV·V 0CEJ ªDGTUEJTGKVWPI FGT )TGP\G DGHTGKVG GT FKG   RTGW­KUEJGP5V·FVG/CTKGPYGTFGT/CTKGPDWTI&KTUEJCWWPF'NDKPIUEJNWI)GPGTCN.GH½DXTGCO/CKDGK #NVGPDWTIWPFXGTHQNIVGPCEJFGT5EJNCEJVDGK.GKR\KIFGP(GKPFDKUCPFGP4JGKP+P(TCPMTGKEJUGNDUVUKGIVGGTDGK .CQP PCJO 0GOQWTU KO 5VWTOCPITKHH DGUGV\VG #TEKU WPF 8GTUCKNNGU WPF TÒEMVG UEJNKG­NKEJ OKV FGP #NNKKGTVGP KP   2CTKUGKP#O1MVQDGTYWTFG2NCVQYKPFGP)TCHGPUVCPFGTJQDGP'TUVCTD,CPWCTCO&QPWPF YWTFGKP0QYQVUEJGTMCUUMDGITCDGPYQOCPKJOGKP&GPMOCNGTTKEJVGVG

8280



6TCIDCTG 5KNDGTOGFCKNNG  WPUKIPKGTV 4WUUKUEJG /KNKV·TXGTFKGPUVOGFCKNNG CWH FKG 'KPPCJOG XQP   2CTKU $ÒUVG T OKV .QTDGGTMTCP\ FCTÒDGT UVTCJNGPFGU )QVVGUCWIG(ÒPH <GKNGP 5EJTKHV WOJGT .QT   DGGTMTCP\OOI&KCMQX 4FQTVQJPG¤UG 5NI,WNKWU 445GJTUEJÌP

 67


ALEXANDER I.

8281



5KNDGTOGFCKNNGXQP(5VWEMJCTFVCWHFCU$ÒPFPKU\YKUEJGP4W­NCPF2TGW­GPWPF¤UVGTTGKEJKO -CORHIGIGP(TCPMTGKEJ&TGKMNGGDNCVVHÌTOKICPIGQTFPGVG/GFCKNNQPUOKVFGP$TWUVDKNFGTPXQP#NGZ CPFGT + XQP 4W­NCPF (TKGFTKEJ 9KNJGNO +++ XQP 2TGW­GP WPF (TCP\ + XQP ¤UVGTTGKEJ FC\YKUEJGP   2CNO 'KEJGP D\Y .QTDGGT\YGKI<GJP <GKNGP 5EJTKHV  OO  I &KCMQX  4    /CTKGPD5NI/QPVGPWQXQ 44(GKPG2CVKPCYKP\4CPFHGJNGTUGJTUEJÌPpXQT\ÒINKEJ

8282







68

8284



8283

$TQP\GOGFCKNNGXQP$#PFTKGWCWHFGP$GUWEJFGU<CTGPKP2CTKU$ÒUVGTOKV.QTDGGTMTCP\ 8KMVQTKCUKV\VPCEJNXQTGKPGO.QTDGGTDCWOWPFUEJTGKDVCWHGKPG6CHGNOOI&KCMQX 5NI,WNKWU 8QT\ÒINKEJ



$TQP\GOGFCKNNGXQP$#PFTKGWCWHFGP$GUWEJFGU<CTGPKP2CTKU$ÒUVGTOKV.QTDGGTMTCP\ 8KMVQTKCUKV\VPCEJNXQTGKPGO.QTDGGTDCWOWPFUEJTGKDVCWHGKPG6CHGNOOI&KCMQX 5NI,WNKWU 8QT\ÒINKEJ



$TQP\GOGFCKNNG  WPUKIPKGTV 9GTMUVCVV ' 6JQOCUQP CWH FKG <WUCOOGPMWPHV FGT XKGT CNNKKGTVGP   /QPCTEJGPKP'PINCPF&KGDGNQTDGGTVGP$ÒUVGPXQP)GQTIG+++XQP)TQ­DTKVCPPKGP(TKGFTKEJ9KNJGNO +++ XQP 2TGW­GP (TCP\ + XQP ¤UVGTTGKEJ WPF #NGZCPFGT + XQP 4W­NCPF PGDGPGKPCPFGT T9GKDNKEJG   )GUVCNVUVGJVHCUVXXOKV1NKXGP\YGKIWPF(ÒNNJQTPOOI&KCMQX 4 /CTKGPD 448QT\ÒINKEJp5VGORGNINCP\




NIKOLAUS I.

8285



$TQP\GOGFCKNNGXQP*($TCPFVCWHFKG)TWPFUVGKPNGIWPIFGU5KGIGUFGPMOCNUCWHFGO-TGW\ DGTIKP$GTNKPIGOGKPUCOOKV-ÌPKI(TKGFTKEJ9KNJGNO+++XQP2TGW­GP\WT'TKPPGTWPICPFKG5KGIG ÒDGT 0CRQN¾QP + &KG $ÒUVGP XQP #NGZCPFGT + WPF (TKGFTKEJ 9KNJGNO +++ PGDGPGKPCPFGT N WOJGT   .QTDGGTMTCP\#PUKEJV FGU 5KGIGUFGPMOCNU WOJGT FKG ,CJTGU\CJNGP      UQYKG GKP   FTGK\GKNKIGT 5EJTKHVMTGKU  OO  I &KCMQX  4  .GJPGTV  /CTKGPD    2TCEJVGZGORNCT5VGORGNINCP\



8286



*QN\FQUG Q ,  ,CJTJWPFGTV  OKV GKPIGNCUUGPGO $TQP\GMNKUEJGG &WTEJOGUUGT EC  OO  GKPGT   /GFCKNNG XQP'/QTGNOKVFGOWPKHQTOKGTVGP$TWUVDKNFFGU<CTGPT&WTEJOGUUGTOO*ÌJG OO/KV¤UG 5GJTUEJÌP

8287



8288

<#40+-1.#75+ )QNFOÒP\GPFGT/ÒP\UV·VVG5V2GVGTUDWTI 

4WDGN5V2GVGTUDWTII$KVMKP(D5EJN  )1.&45EJÌPpUGJTUEJÌPUGJTUEJÌP



 4WDGN  5V 2GVGTUDWTI +P 752NCUVKMJQNFGT FGT 0)% OKV FGT $GYGTVWPI#7$KVMKP(D 5EJN )1.&-N5VGORGNHGJNGTHCUVXQT\ÒINKEJ 



69


NIKOLAUS I.

8289

8290

8291

8292



4WDGN5V2GVGTUDWTII$KVMKP(D5EJN

)1.&5GJTUEJÌPpXQT\ÒINKEJ





4WDGN5V2GVGTUDWTII$KVMKP(D5EJN  )1.&5GJTUGNVGPGT,CJTICPI5EJTÌVNKPIUHGJNGT-TCV\GTUGJTUEJÌPpXQT\ÒINKEJ





4WDGN5V2GVGTUDWTI+P752NCUVKMJQNFGTOKVFGT$GYGTVWPI/5$KVMKP(D5EJN )1.&(CUV5VGORGNINCP\





 4WDGN  5V 2GVGTUDWTI +P 752NCUVKMJQNFGT FGT 0)% OKV FGT $GYGTVWPI /5  $KVMKP    (D5EJN )1.&9KP\5VGORGNHGJNGTXQT\ÒINKEJp5VGORGNINCP\

8293



8294



4WDGN5V2GVGTUDWTII$KVMKP(D5EJN  )1.&9KP\4CPFHGJNGTXQT\ÒINKEJp5VGORGNINCP\





4WDGN5V2GVGTUDWTII$KVMKP(D5EJN



8295

)1.&(CUVXQT\ÒINKEJ

8296



4WDGN5V2GVGTUDWTII$KVMKP(D5EJN

)1.&(CUVXQT\ÒINKEJ





4WDGN5V2GVGTUDWTII$KVMKP(D5EJN  )1.&9KP\4CPFHGJNGTXQT\ÒINKEJ



8297

8298

8299

8300



4WDGN5V2GVGTUDWTII$KVMKP 4 (D5EJN  )1.&-N4CPFHGJNGTHCUVXQT\ÒINKEJ



 

4WDGN5V2GVGTUDWTII$KVMKP(D5EJN 4WDGN5V2GVGTUDWTII$KVMKP(D5EJN

)1.&8QT\ÒINKEJ )1.&8QT\ÒINKEJ

 



4WDGN5V2GVGTUDWTII$KVMKP(D5EJN  )1.&#VVTCMVKXGU'ZGORNCTXQT\ÒINKEJp5VGORGNINCP\



70


NIKOLAUS I.

8301 Pt

8302 Pt

8303 Pt

8304 Pt

2NCVKPOÒP\GPFGU<CTGP0KMQNCWU+ 

4WDGN2NCVKP5V2GVGTUDWTII$KVMKP 4 (D5EJN  2.#6+09KP\4CPFHGJNGTYKP\-TCV\GTUGJTUEJÌP





4WDGN2NCVKP5V2GVGTUDWTII$KVMKP 4 (D5EJN 2.#6+05GJTUEJÌP





4WDGN2NCVKP5V2GVGTUDWTII$KVMKP 4 (D5EJN

2.#6+05GJTUEJÌP





4WDGN2NCVKP5V2GVGTUDWTII$KVMKP 4 (D5EJN  2.#6+05GJTUEJÌPpXQT\ÒINKEJ



8305

8305 1,5:1

5KNDGTOÒP\GPFGT/ÒP\UV·VVG5V2GVGTUDWTI 

-QRGMGP5V2GVGTUDWTII$KVMKP 4   5GNVGPDGUQPFGTUKPFKGUGT'TJCNVWPI(CUV5VGORGNINCP\

8306

8307



8308



4WDGN5V2GVGTUDWTII$KVMKP&CX

2TCEJVGZGORNCT(CUV5VGORGNINCP\





4WDGN5V2GVGTUDWTII$KVMKP&CX

8QT\ÒINKEJp5VGORGNINCP\





4WDGN5V2GVGTUDWTII$KVMKP&CX

(GKPG2CVKPCXQT\ÒINKEJ

 71


NIKOLAUS I.

8309

8310



4WDGN5V2GVGTUDWTII$KVMKP&CX 2TCEJVXQNNG2CVKPCXQT\ÒINKEJp5VGORGNINCP\





4WDGN5V2GVGTUDWTII$KVMKP&CX

8QT\ÒINKEJ





4WDGN5V2GVGTUDWTII$KVMKP&CX  5GNVGPKPFKGUGT'TJCNVWPI2TCEJVGZGORNCT2TCEJVXQNNG2CVKPCHCUV5VGORGNINCP\





4WDGN5V2GVGTUDWTII$KVMKP&CX

8311

8312

8QT\ÒINKEJ

8314

8313

8313



4WDGN5V2GVGTUDWTII/KVQHHGPGTKPFGT4ÒEMUGKVGPKPUEJTKHV$KVMKP 4 &CX 4(GKPG2CVKPCHCUVXQT\ÒINKEJ



4WDGN 2QNVKPC 5V2GVGTUDWTII$KVMKP

8315

8316



2TCEJVXQNNG2CVKPCXQT\ÒINKEJ

8317

 

8318



-QRGMGP5V2GVGTUDWTI+P752NCUVKMJQNFGTFGT0)%OKVFGT$GYGTVWPI/5$KVMKP *ÒDUEJG2CVKPCXQT\ÒINKEJp5VGORGNINCP\





-QRGMGP5V2GVGTUDWTII$KVMKP

*ÒDUEJG2CVKPCXQT\ÒINKEJ





-QRGMGP5V2GVGTUDWTII$KVMKP

5GJTUEJÌPpXQT\ÒINKEJ





-QRGMGP5V2GVGTUDWTII$KVMKP

*ÒDUEJG2CVKPCMN4CPFXGTRT·IWPIXQT\ÒINKEJ



72


NIKOLAUS I.

8320

8319

8321



-QRGMGP5V2GVGTUDWTII$KVMKP 4 

45GJTUEJÌP





-QRGMGP5V2GVGTUDWTII$KVMKP  5GNVGPKPFKGUGT'TJCNVWPI2TCEJVGZGORNCT(CUV5VGORGNINCP\





-QRGMGP5V2GVGTUDWTII$KVMKP  5GNVGPGT,CJTICPI5GNVGPKPFKGUGT'TJCNVWPI2TCEJVGZGORNCT *ÒDUEJG2CVKPC5VGORGNINCP\



8323

8322



4WDGN5V2GVGTUDWTII$KVMKP&CX



4WDGN5V2GVGTUDWTI+P752NCUVKMJQNFGTFGT2%)5OKVFGT$GOGTMWPI)GPWKPG$KVMKP &CX 9KP\4CPFHGJNGTUGJTUEJÌPpXQT\ÒINKEJ

8324

 

8325



4WDGN5V2GVGTUDWTII$KVMKP 4 &CX



4WDGN5V2GVGTUDWTII$KVMKP&CX

8326

9KP\-TCV\GTHCUVXQT\ÒINKEJ

8327

 44(GKPG2CVKPCUGJTUEJÌPpXQT\ÒINKEJ



8QT\ÒINKEJ



8328



4WDGN5V2GVGTUDWTII$KVMKP 4 &CX  5GNVGPGT,CJTICPI5GJTUEJÌPpXQT\ÒINKEJ



4WDGN5V2GVGTUDWTI+P752NCUVKMJQNFGTFGT0)%OKVFGT$GYGTVWPI/5$KVMKP 4  &CX 2TCEJVGZGORNCT*GTTNKEJG2CVKPCHCUV5VGORGNINCP\ 



4WDGN5V2GVGTUDWTII$KVMKP&CX

8QT\ÒINKEJ



 73


NIKOLAUS I.

8330

8329



4WDGN5V2GVGTUDWTII$KVMKP&CX

8QT\ÒINKEJ





4WDGN5V2GVGTUDWTII$KVMKP 4 &CX  4*ÒDUEJG2CVKPCUGJTUEJÌPpXQT\ÒINKEJ



8331

8332



4WDGN5V2GVGTUDWTII$KVMKP&CX

/KPDGTKGDGPXQT\ÒINKEJ





4WDGN5V2GVGTUDWTII$KVMKP&CX  *ÒDUEJG2CVKPCMN4CPFHGJNGTHCUVXQT\ÒINKEJ



8334

8333

 

4WDGN5V2GVGTUDWTII$KVMKP&CX 4WDGN5V2GVGTUDWTII$KVMKP&CX

(GKPG2CVKPCHCUVXQT\ÒINKEJ (CUVXQT\ÒINKEJ



4WDGN5V2GVGTUDWTII$KVMKP&CX&C\W#NGZCPFGT+4WDGN5V2GVGTU DWTII$KVMKP&CX 5VÒEM5GJTUEJÌPpXQT\ÒINKEJWPFUGJTUEJÌP

8337

8336

  

8336



4WDGN5V2GVGTUDWTII$KVMKP&CX

8QT\ÒINKEJ





4WDGN 2QNVKPC 5V2GVGTUDWTII$KVMKP  5GNVGPKPFKGUGT'TJCNVWPI8QT\ÒINKEJp5VGORGNINCP\



8338

8339



4WDGN 2QNVKPC 5V2GVGTUDWTII$KVMKP



 4WDGN 2QNVKPC   5V 2GVGTUDWTI +P 752NCUVKMJQNFGT FGT 0)% OKV FGT $GYGTVWPI /5    $KVMKP *ÒDUEJG2CVKPCXQT\ÒINKEJ

74

*GTTNKEJG2CVKPCXQT\ÒINKEJ

 


NIKOLAUS I.

8340

8341

8342

  

8342

-QRGMGP5V2GVGTUDWTII$KVMKP -QRGMGP5V2GVGTUDWTII$KVMKP

(GKPG2CVKPCXQT\ÒINKEJp5VGORGNINCP\ 8QT\ÒINKEJ

 

5GJTUEJÌPpXQT\ÒINKEJ



5KNDGTOÒP\GPFGT/ÒP\UV·VVG9CTUEJCW

4WDGN9CTUEJCWI$KVMKP&CX

8344

8343



4WDGN9CTUEJCWI$KVMKP&CX



4WDGN9CTUEJCW+P752NCUVKMJQNFGTFGT2%)5OKVFGT$GYGTVWPI/5$KVMKP&CX 5GNVGPKPFKGUGT'TJCNVWPI*ÒDUEJG2CVKPCXQT\ÒINKEJ

8345

8347

4(GKPG2CVKPCXQT\ÒINKEJ

8348

 

8346

 

4WDGN9CTUEJCWI$KVMKP&CX 4WDGN9CTUEJCWI$KVMKP&CX

(CUVXQT\ÒINKEJ 8QT\ÒINKEJ

 



4WDGN 2QNVKPC 9CTUEJCW+P752NCUVKMJQNFGTFGT2%)5OKVFGT$GYGTVWPI/5 $KVMKP 5GNVGPDGUQPFGTUKPFKGUGT'TJCNVWPI*GTTNKEJG2CVKPCXQT\ÒINKEJp5VGORGNINCP\





4WDGN 2QNVKPC 9CTUEJCWI$KVMKP  5GNVGPDGUQPFGTUKPFKGUGT'TJCNVWPI*GTTNKEJG2CVKPCXQT\ÒINKEJGU'ZGORNCTCWURQNKGTVGT2NCVVG

 75


NIKOLAUS I.

8349 1,5:1



-QRGMGP9CTUEJCWI$KVMKP 4 

1,5:1



8353

-WRHGTOÃ&#x2019;P\GPFGU<CTGP0KMQNCWU+

-W-QRGMGP'MCVGTKPDWTII$KVMKP -W-QRGMGP'MCVGTKPDWTII$KVMKP -W-QRGMGP'MCVGTKPDWTII$KVMKP

76

-W-QRGMGP'MCVGTKPDWTII$KVMKP -W-QRGMGP'MCVGTKPDWTII$KVMKP



1,5:1

448QT\Ã&#x2019;INKEJ

8354

 

44*Ã&#x2019;DUEJG2CVKPCXQT\Ã&#x2019;INKEJ

-QRGMGP9CTUEJCWI$KVMKP 4

8351

  

8350

1,5:1



8352

9KP\5VGORGNHGJNGTHCUVXQT\Ã&#x2019;INKEJ 8QT\Ã&#x2019;INKEJp5VGORGNINCP\ 8QT\Ã&#x2019;INKEJp5VGORGNINCP\

  

8355

(CUVXQT\Ã&#x2019;INKEJ 8QT\Ã&#x2019;INKEJ

 


NIKOLAUS I.

8357 8356



-W-QRGMGP5W\WP -QN[XCP I$KVMKP 4 



-W-QRGMGP9CTUEJCWI$KVMKP 4 

8358

8356

 445EJTÌVNKPIUHGJNGTHCUVUGJTUEJÌP



44-N4CPFHGJNGTHCUVUGJTUEJÌP



8359

)GFGPMOÒP\GPFGU<CTGP0KMQNCWU+ 

4WDGN5V2GVGTUDWTI&GPMOCNHÒT#NGZCPFGT+I$KVMKP 4 &CX  *ÒDUEJG2CVKPCHCUVXQT\ÒINKEJ





4WDGN5V2GVGTUDWTI&GPMOCNHÒT#NGZCPFGT+I$KVMKP 4 &CX  -N-TCV\GTHCUVXQT\ÒINKEJ



8360

8361



4WDGN5V2GVGTUDWTICWHFKG'KPYGKJWPIFGU$QTQFKPQ&GPMOCNUI$KVMKP 4 &CX 45GJTCVVTCMVKXGU'ZGORNCTOKVJÒDUEJGT2CVKPCXQT\ÒINKEJ





4WDGN5V2GVGTUDWTICWHFKG'KPYGKJWPIFGU$QTQFKPQ&GPMOCNUI$KVMKP 4 &CX 4/KPDGTKGDGPYKP\4CPFHGJNGTXQT\ÒINKEJ



8362

8363



4WDGN5V2GVGTUDWTICWHFKG'KPYGKJWPIFGU$QTQFKPQ&GPMOCNUI$KVMKP 4 &CX 4.GKEJVDGTKGDGPHCUVXQT\ÒINKEJ



4WDGN  5V 2GVGTUDWTI XQP * )WDG CWH FKG 8GTO·JNWPI UGKPGU 5QJPGU )TQ­HÒTUV #NGZCPFGT   0KMQNCLGYKVUEJ UR·VGT <CT #NGZCPFGT ++ OKV /CTKC XQP *GUUGP&CTOUVCFV 6QEJVGT .WFYKIU ++   I$KVMKP 4 &CX# 44-TCV\GTYKP\4CPFHGJNGTUGJTUEJÌP 



77


NIKOLAUS I.

8364

1,5:1

1,5:1

'KPG-WRHGTRTQDGFGT/ÒP\UV·VVG5V2GVGTUDWTI 

-W-QRGMGP5V2GVGTUDWTI2TQDGI$KVMKP 4 

1,5:1

8365

448QT\ÒINKEJp5VGORGNINCP\



1,5:1

'KPG2T·IWPIHÒT)GQTIKGP 

#DC\K -QRGMGP 6KHNKUHÒT)GQTIKGPI$KVMKP 4 

45GJTUEJÌP



8366

2:1

2:1

2T·IWPIGPHÒT2QNGP 

 <NQV[EJ  9CTUEJCW HÒT 2QNGP  I $KVMKP  4  (D  FQTV WPVGT 2QNGP    5EJN FQTVWPVGT2QNGP   )1.&440WT'ZGORNCTGIGRT·IV9KP\4CPFHGJNGTXQT\ÒINKEJ 

8367

2:1

 78

2:1

 <NQV[EJ  9CTUEJCW HÒT 2QNGP  I $KVMKP  4  (D  FQTV WPVGT 2QNGP    5EJN FQTVWPVGT2QNGP  )1.&440WT'ZGORNCTGIGRT·IV5GJTUEJÌPpXQT\ÒINKEJ 


NIKOLAUS I.

8369

8368



<NQVG9CTUEJCWHÒT2QNGPI$KVMKP

(CUVUGJTUEJÌP





<NQV[9CTUEJCWHÒT2QNGPI$KVMKP

5GJTUEJÌPpXQT\ÒINKEJ



8370

1,5:1



1,5:1

 4WDGN  <NQV[EJ   5V 2GVGTUDWTI HÒT 2QNGP  I $KVMKP  4  (D  FQTV WPVGT   2QNGP 5EJN FQTVWPVGT2QNGP  )1.&45GJTUEJÌPpXQT\ÒINKEJ 

8371 1,5:1



1,5:1

 4WDGN  <NQV[EJ   5V 2GVGTUDWTI HÒT 2QNGP  I $KVMKP  4  (D  FQTV WPVGT   2QNGP 5EJN FQTVWPVGT2QNGP  )1.&45GJTUEJÌPpXQT\ÒINKEJ 

8374

8372

8373

8375

8373



4WDGN <NQV[EJ 5V2GVGTUDWTIHÒT2QNGPI$KVMKP&CX  *GTTNKEJG2CVKPCXQT\ÒINKEJ





-QRGMGP <NQV[ 5V2GVGTUDWTIHÒT2QNGPI$KVMKP

8QT\ÒINKEJ





4WDGN <NQV[EJ 9CTUEJCWHÒT2QNGPI$KVMKP 4 &CX  49KP\5EJTÌVNKPIUHGJNGTCO4CPFUGJTUEJÌP





4WDGN <NQV[EJ 9CTUEJCWHÒT2QNGPI$KVMKP&CX



5GJTUEJÌP

79


NIKOLAUS I.

8378

8376

8377



-QRGMGP <NQV[ 9CTUEJCWHÒT2QNGPI$KVMKP  5GNVGPKPFKGUGT'TJCNVWPI*ÒDUEJG2CVKPCHCUV5VGORGNINCP\



 

)TQU\[9CTUEJCWHÒT2QNGPI$KVMKP )TQU\[9CTUEJCWHÒT2QNGPI$KVMKP

 

8379

8QT\ÒINKEJp5VGORGNINCP\ 8QT\ÒINKEJp5VGORGNINCP\

8380

8381

8381



-QRGMGP )TQU\[ 9CTUEJCWHÒT2QNGPI$KVMKP FQTVHCNUEJDGUEJTKGDGP   2TCEJVGZGORNCT*GTTNKEJG2CVKPCHCUV5VGORGNINCP\





-QRGMGP )TQU\[ 9CTUEJCWHÒT2QNGPI$KVMKP FQTVHCNUEJDGUEJTKGDGP   *ÒDUEJG2CVKPCUGJTUEJÌP





 4WDGN 2QNVKPC   9CTUEJCW HÒT 2QNGP 2TQDG KP -WRHGT OKV INCVVGO 4CPF  I -TQPG   <YGK(ÒNNJÌTPGTÒDGT&QRRGNCFNGT$KVMKP 4  44-N-TCV\GTUGJTUEJÌPpXQT\ÒINKEJ



8383

8382

<YGK/GUUKPI2CUUKGTIGYKEJVG 



2QNPKUEJGU /GUUKPI2CUUKGTIGYKEJV Q ,   HÒT GKPGP +ORGTKCN /GUUKPI  I )GMTÌPVGT   &QRRGNCFNGT OKV <GRVGT WPF 4GKEJUCRHGN KP FGP (·PIGP CWH FGT $TWUV5V)GQTIUUEJKNFCWHIGMTÌPVGO 9CRRGPOCPVGN QDGP -TQPG8KGT <GKNGP 5EJTKHV WOJGT GDGPHCNNU 5EJTKHV $KVMKP  4  6GYGU    KP.6GYGU&KGUVCCVNKEJGP)QNFOÒP\IGYKEJVG/C­WPF)GYKEJV<GKVUEJTKHVHÒT/GVTQNQIKG0T 5GRVGODGT 445GJTUEJÌPpXQT\ÒINKEJ



2QNPKUEJGU2CUUKGTIGYKEJVQ,  HÒTGKPGP+ORGTKCN/GUUKPII)GMTÌPVGT&QRRGNCFNGT OKV<GRVGTWPF4GKEJUCRHGNKPFGP(·PIGPCWHFGT$TWUV5V)GQTIUUEJKNFCWHIGMTÌPVGO9CRRGPOCP VGNQDGP-TQPG(ÒPH<GKNGP5EJTKHVWOJGTGDGPHCNNU5EJTKHV$KVMKP 4 6GYGUKP.6GYGU &KG UVCCVNKEJGP )QNFOÒP\IGYKEJVG /C­ WPF )GYKEJV <GKVUEJTKHV HÒT /GVTQNQIKG 0T  5GRVGODGT    445GJTUEJÌP 

8384

'KPGHTCP\ÌUKUEJG-WRHGTRTQDG  80

4WDGN2CTKU(TCP\ÌUKUEJG2TQDGKP-WRHGTFGT(KTOC6QPPGNKGTI$KVMKP 4   44(CUUWPIUURWTGPUGJTUEJÌP




NIKOLAUS I.

8385

/GFCKNNGPFGU<CTGP0KMQNCWU+ 

5KNDGTOGFCKNNG  WPUKIPKGTV JGTCWUIGIGDGP XQP FGT 5VCFV 9CTUEJCW \WT 'TKPPGTWPI CP FGP 6QF   #NGZCPFGTU+$ÒUVG#NGZCPFGTU+TOKV.QTDGGTMTCP\FCTÒDGT5VGTP8KGT<GKNGP5EJTKHVWPF,CJTGU \CJNWOJGT.QTDGGTMTCP\OOI&KCMQX 4 *%\ 4(CUVXQT\ÒINKEJ



8386 Pt 1,5:1

1,5:1



2NCVKPLGVQP  WPUKIPKGTV CWH UGKPG -TÌPWPI KP /QUMCW CO  #WIWUV )GMTÌPVGU /QPQITCOO   <YGK<GKNGP5EJTKHVQDGP-TQPGWPVGP,CJTGU\CJNOOI&KCMQX 4   2.#6+0449KP\4CPFHGJNGTXQT\ÒINKEJ 



5KNDGTLGVQP  WPUKIPKGTV CWH UGKPG -TÌPWPI KP /QUMCW )GMTÌPVGU /QPQITCOO<YGK <GKNGP   5EJTKHV QDGP -TQPG WPVGP ,CJTGU\CJN +P 752NCUVKMJQNFGT FGT 0)% OKV FGT$GYGTVWPI/'&#./5 &KCMQX 8QT\ÒINKEJp5VGORGNINCP\

8389



8389

8388



'KPUGKVKIGU 5KNDGTMNKUEJGG Q , XQP 8 #NGZGGX 8QTFGTUGKVG FGT 5KNDGTOGFCKNNG  CWH UGKPG   -TÌPWPI$ÒUVGTOOI&KCMQX\W 8QT\ÒINKEJ





5KNDGTOGFCKNNGQ, WO WPUKIPKGTV2T·OKGHÒTGTHQNITGKEJG5VWFKGP)GMTÌPVGT&QRRGNCFNGTOKV <GRVGT WPF 4GKEJUCRHGN KP FGP (·PIGP CWH FGT $TWUV 5V )GQTIUUEJKNF WOIGDGP XQP FGT -GVVG FGU   #PFTGCUQTFGPU CWH FGP (NÒIGNP LG FTGK YGKVGTG 9CRRGPUEJKNFG QDGP -TQPG/KPGTXC OKV .QTDGGT   MTCP\ KP FGT 4GEJVGP WPF ¤NNCORG KP FGT GTJQDGPGP .KPMGP UVGJV X X WOIGDGP XQP #VVTKDWVGP FGT   9KUUGPUEJCHVGPOOI&KCMQX #VVTCMVKXGU'ZGORNCTOKVHGKPGT2CVKPCXQT\ÒINKEJ

 81


NIKOLAUS I.

8390



<YGKTGEJVGEMKIGGKPUGKVKIG#NWOKPKWORNCMGVVGPXQP*)WDGCWHFKG'TÌHHPWPIFGU/QUMCWGT 6TKWORJDQIGPU KP 5V 2GVGTUDWTI #PUKEJV FGU 6TKWORJDQIGPU<GJP <GKNGP 5EJTKHV \W FGP 5GKVGP LG   GKPG6TQRJ·GZOOWPFZOOIWPFI&KCMQX  5VÒEM-N-TCV\GTXQT\ÒINKEJ



8391

1,5:1



82

1,5:1

5KNDGTOGFCKNNG  WPUKIPKGTV -ÒTCUUKGTVCNGT IGHGTVKIV CWH UGKP L·JTKIGU ,WDKN·WO CNU %JGH FGU   RTGW­KUEJGP-ÒTCUUKGT4GIKOGPVU)GMTÌPVGU/QPQITCOOÒDGT\YGK<GKNGP5EJTKHV&KG,CJTGU\CJNGP ºWOJGT.QTDGGTMTCP\OOI&KCMQX 4 /CTKGPD  44(CUVXQT\ÒINKEJ




NIKOLAUS I.

8392 1:1,5



<YGKGKPUGKVKIG$TQP\GMNKUEJGGUFGU5KNDGTOGFCKNNQPUQ,  XQP$2KUVTWEEKCWHFKG5EJNCEJVDGK 9CVGTNQQWPFFGPGPFIÒNVKIGP5KGIFGTCNNKKGTVGP6TWRRGPÒDGT0CRQNGQP+ &KGDGNQTDGGTVGP$ÒUVGP XQP)GQTIG+++XQP'PINCPF(TCP\+XQP¤UVGTTGKEJ#NGZCPFGT+XQP4W­NCPFWPF(TKGFTKEJ9KNJGNO +++PGDGPGKPCPFGTNOKVWOIGNGIVGP/·PVGNPWOJGT&CTUVGNNWPIGPCWUFGTCPVKMGP/[VJQNQIKG*GNKQU +TKUWPF<GRJ[TQU*GTCMNGU'TKPP[GP.WPCFKG2CT\GP6JGOKUWPF&KQUMWTGP &KG(GNFJGTTGP $NÒEJGT WPF 9GNNKPIVQP KP )GUVCNV CPVKMGT -TKGIGT TGKVGP N WPF DGUEJÒV\GP 8KMVQTKC QDGP )ÌVVGTXCVGT   <GWU KP 3WCFTKIC WOJGT -CORH FGT 6KVCPGP WPF )KICPVGP  OO WPF  OO  I   WPFI 5VÒEM8QT\ÒINKEJ



&CU9CVGTNQQ/GFCKNNQPKUV\YGKHGNNQUFCU/GKUVGTUVÒEMFGUCW­GTIGYÌJPNKEJDGICDVGPKVCNKGPKUEJGP/GFCKNNGWTUWPF )GOOGPUEJPGKFGTU $GPGFGVVQ 2KUVTWEEK FGT CNU 5VGORGNUEJPGKFGT CP FGT MÌPKINKEJGP /ÒP\G KP .QPFQP CTDGKVGVG   &KG #TDGKV CP FGP 5VGORGNP FKGUGU UEJQP KP UGKPGT )TÌ­G CDGT CWEJ KP FGT (ÒNNG FGT FCTIGUVGNNVGP (KIWTGP   GKP\KICTVKIGP5VÒEMGU\QIUKEJÒDGTOGJTCNU,CJTGJKP2KUVTWEEKDGICPPFCOKVKO#NVGTXQP,CJTGPWPF NKGHGTVG FKG /CVTK\GP GTUV  CP UGKPGP #WHVTCIIGDGT FKG 4Q[CN /KPV CD &GT #WHVTCI YCT FGO KVCNKGPKUEJGP   -ÒPUVNGT GTVGKNV YQTFGP WO KJO FGP 0CEJ\WI UGKPGT (COKNKG XQP 4QO PCEJ .QPFQP \W GTOÌINKEJGP 2KUVTWEEK   GTJKGNVHÒTFKGUG#TDGKV2HWPFYQXQPKJO2HWPFCNU8QTUEJW­IGY·JTVYWTFGP&KG4Q[CN/KPVJCVVG WTURTÒPINKEJ IGRNCPV FGP XKGT FCTIGUVGNNVGP #NNKKGTVGP LGYGKNU GKP 'ZGORNCT KP )QNF WPF FGP ÒDTKIGP CO 5KGI DGK   9CVGTNQQ DGVGKNKIVGP (ÒTUVGP LG GKP 'ZGORNCT KP 5KNDGT \W ÒDGTTGKEJGP,GFQEJXGT\KEJVGVGOCPCWHFKGVGWTG *GTUVGNNWPI XQP 5VGORGNP WPF DGIPÒIVG UKEJ OKV FGT #PHGTVKIWPI GKPGT IGTKPIGP #P\CJN XQP ICNXCPQRNCUVKUEJGP   #DFTÒEMGP

8393



5KNDGTOGFCKNNG  XQP # (CEKWU CWH FCU L·JTKIG 9KTMGP UGKPGT 5EJYGUVGT )TQ­JGT\QIKP /CTKC   2CYNQYPC KP 5CEJUGP9GKOCT'KUGPCEJ $ÒUVG /CTKC 2CYNQYPCU T5GEJU <GKNGP 5EJTKHV WOJGT   -TCP\ QDGP 5VGTP  OO  I &KCMQX  4  (TGFG  5NI /GTUGD  FQTV KP   $TQP\G  4*GTTNKEJG2CVKPCXQT\ÒINKEJ



/CTKC2CYNQYPCYWTFGCO(GDTWCTCNU6QEJVGTXQP2CWN+WPFUGKPGT)GOCJNKP5QRJKG&QTQVJGC#WIWUVG .WKUGXQP9ÒTVVGODGTIIGDQTGP5KGJGKTCVGVGCO#WIWUVFGP-TQPRTKP\GPWPFUR·VGTGP)TQ­JGT\QI-CTN (TKGFTKEJXQP5CEJUGP9GKOCT'KUGPCEJFGTKPFGT0CEJVXQO\WO,WNKXGTUVCTD

83


ALEXANDER II.

8394

8395

8396

8397

<#4#.':#0&'4++    

)QNFOÒP\GPFGU<CTGP#NGZCPFGT++

4WDGN5V2GVGTUDWTII$KVMKP(D5EJN 4WDGN5V2GVGTUDWTII$KVMKP(D5EJN 4WDGN5V2GVGTUDWTII$KVMKP(D5EJN 4WDGN5V2GVGTUDWTII$KVMKP(D5EJN

)1.&8QT\ÒINKEJ )1.&8QT\ÒINKEJ )1.&8QT\ÒINKEJp5VGORGNINCP\ )1.&8QT\ÒINKEJ

8398

 

8399

4WDGN5V2GVGTUDWTII$KVMKP(D5EJN 4WDGN5V2GVGTUDWTII$KVMKP(D5EJN

8400

 

)1.&8QT\ÒINKEJ )1.&-N(GKNURWTXQT\ÒINKEJ

 

8401

4WDGN5V2GVGTUDWTII$KVMKP(D5EJN 4WDGN5V2GVGTUDWTII$KVMKP(D5EJN

8402

   

8403

8404

)1.&5GJTUEJÌPpXQT\ÒINKEJ )1.&8QT\ÒINKEJ

 

8405



4WDGN5V2GVGTUDWTII$KVMKP(D5EJN



4WDGN5V2GVGTUDWTI+P752NCUVKMJQNFGTFGT0)%OKVFGT$GYGTVWPI/5$KVMKP(D 5EJN )1.&9KP\-TCV\GTXQT\ÒINKEJ



 

4WDGN5V2GVGTUDWTII$KVMKP(D5EJN 4WDGN5V2GVGTUDWTII$KVMKP(D5EJN

 

84

)1.&(CUVXQT\ÒINKEJ

)1.&(CUVXQT\ÒINKEJ )1.&5GJTUEJÌP




ALEXANDER II.

8406

8407



4WDGN5V2GVGTUDWTII$KVMKP(D5EJN  )1.&9KP\4CPFHGJNGTUGJTUEJÌP





4WDGN5V2GVGTUDWTII$KVMKP(D5EJN



8408

8409

8410

)1.&8QT\ÒINKEJ

8412

8411



4WDGN5V2GVGTUDWTII$KVMKP 4 (D5EJN

)1.&4(CUVXQT\ÒINKEJ





4WDGN5V2GVGTUDWTII$KVMKP 4 (D5EJN  )1.&49KP\4CPFHGJNGTXQT\ÒINKEJ





4WDGN5V2GVGTUDWTII$KVMKP(D5EJN

)1.&48QT\ÒINKEJ





4WDGN5V2GVGTUDWTII$KVMKP 4 (D5EJN  )1.&4-N4CPFHGJNGTXQT\ÒINKEJ





4WDGN5V2GVGTUDWTI+P752NCUVKMJQNFGTFGT2%)5OKVFGT$GYGTVWPI/5$KVMKP 4  (D5EJN )1.&5GNVGPGT,CJTICPI8QT\ÒINKEJp5VGORGNINCP\



8414

8415

8413

8413

5KNDGTOÒP\GPFGT/ÒP\UV·VVG5V2GVGTUDWTI 

4WDGN 2QNVKPC 5V2GVGTUDWTII$KVMKP

9KP\4CPFHGJNGTXQT\ÒINKEJ





-QRGMGP5V2GVGTUDWTII$KVMKP

(GKPG2CVKPCYKP\4CPFHGJNGTXQT\ÒINKEJ





-QRGMGP5V2GVGTUDWTII$KVMKP

*ÒDUEJG2CVKPCXQT\ÒINKEJ



8416



-QRGMGP5V2GVGTUDWTII$KVMKP



-QRGMGP5V2GVGTUDWTII$KVMKP 4 

1,5:1

8417

*ÒDUEJG2CVKPCXQT\ÒINKEJ



 4*ÒDUEJG2CVKPCYKP\4CPFHGJNGTXQT\ÒINKEJ

 85


ALEXANDER II.

8418

8420

8419



4WDGN5V2GVGTUDWTII$KVMKP&CX

5GNVGPGT,CJTICPI5GJTUEJÌP





4WDGN5V2GVGTUDWTII$KVMKP&CX *ÒDUEJG2CVKPCNGKEJVDGTKGDGPUGJTUEJÌP





4WDGN5V2GVGTUDWTI+P752NCUVKMJQNFGTFGT2%)5OKVFGT$GYGTVWPI/5$KVMKP&CX *ÒDUEJG2CVKPCXQT\ÒINKEJ



8422

8421



4WDGN 2QNVKPC 5V2GVGTUDWTII$KVMKP 4   5GNVGPGT,CJTICPI(GKPG2CVKPCXQT\ÒINKEJ





4WDGN 2QNVKPC 5V2GVGTUDWTII$KVMKP 4 

45GJTUEJÌP



8423

8424



4WDGN 2QNVKPC 5V2GVGTUDWTII$KVMKP

8QT\ÒINKEJ





4WDGN 2QNVKPC 5V2GVGTUDWTII$KVMKP

 9KP\4CPFHGJNGTUGJTUEJÌPpXQT\ÒINKEJ



8427 8425



-QRGMGP5V2GVGTUDWTII$KVMKP 4 



-QRGMGP5V2GVGTUDWTII$KVMKP



-QRGMGP5V2GVGTUDWTII$KVMKP

86

8426

48QT\ÒINKEJp5VGORGNINCP\



4*ÒDUEJG2CVKPCXQT\ÒINKEJp5VGORGNINCP\



(GKPG2CVKPCXQT\ÒINKEJ




ALEXANDER II.

8429

8430

8431

8428

8432

 

-QRGMGP5V2GVGTUDWTII$KVMKP -QRGMGP5V2GVGTUDWTII$KVMKP

8QT\Ã&#x2019;INKEJp5VGORGNINCP\ (CUV5VGORGNINCP\

 



-QRGMGP5V2GVGTUDWTII$KVMKP  5GNVGPDGUQPFGTUKPFKGUGT'TJCNVWPI(CUV5VGORGNINCP\



 

-QRGMGP5V2GVGTUDWTII$KVMKP -QRGMGP5V2GVGTUDWTII$KVMKP

 

(CUV5VGORGNINCP\ (CUV5VGORGNINCP\

8433

 

8434

-WRHGTOÃ&#x2019;P\GPFGU<CTGP#NGZCPFGT++

-W-QRGMGP'MCVGTKPDWTII$KVMKP -W-QRGMGP'MCVGTKPDWTII$KVMKP

-N5VGORGNHGJNGTXQT\Ã&#x2019;INKEJ 8QT\Ã&#x2019;INKEJp5VGORGNINCP\

 

8437 8436

8435

  

-W-QRGMG9CTUEJCWI$KVMKP -W&GPG\JMC9CTUEJCWI$KVMKP -W&GPG\JMC9CTUEJCWI$KVMKP

8438

8439

8QT\Ã&#x2019;INKEJ 8QT\Ã&#x2019;INKEJp5VGORGNINCP\ 8QT\Ã&#x2019;INKEJ

8440

  

8441



-W2QNWUEJMC9CTUEJCWI$KVMKP 4   5GNVGPDGUQPFGTUKPFKGUGT'TJCNVWPI(CUV5VGORGNINCP\



  

-W-QRGMG5V2GVGTUDWTII$KVMKP 4  -W-QRGMG5V2GVGTUDWTII$KVMKP 4  -W-QRGMG5V2GVGTUDWTII$KVMKP 4 

  

48QT\Ã&#x2019;INKEJ 48QT\Ã&#x2019;INKEJ 4(CUVXQT\Ã&#x2019;INKEJ

87


ALEXANDER II.

8442

8443

8444

)GFGPMOÒP\GPFGU<CTGP#NGZCPFGT++ 

4WDGN5V2GVGTUDWTI&GPMOCNHÒT0KMQNCWU+I$KVMKP&CX  #VVTCMVKXGUXQT\ÒINKEJGU'ZGORNCT





4WDGN5V2GVGTUDWTI&GPMOCNHÒT0KMQNCWU+I$KVMKP&CX

8QT\ÒINKEJ





4WDGN5V2GVGTUDWTI&GPMOCNHÒT0KMQNCWU+I$KVMKP&CX  (GKPG2CVKPCHCUVXQT\ÒINKEJ



8445

'KP0QXQFGNGKPGT2TQDGOÒP\GFGU<CTGP#NGZCPFGT++ 

-W -QRGMGP  '/ $TÒUUGN 0QXQFGN FGT 2TQDG KP -WRHGT0KEMGN<KPP  I -GJTRT·IWPI   OKVINCVVGO4CPF$KVMKP* 4   8QPITQ­GT5GNVGPJGKV#VVTCMVKXGU'ZGORNCTOKVHGKPGT2CVKPCHCUV5VGORGNINCP\ 

8446

8447

8448

8450

2T·IWPIGPHÒT(KPPNCPF 

 /CTMMCC  *GNUKPMK HÒT (KPPNCPF  I $KVMKP  4  (D  FQTV WPVGT (KPPNCPF    5EJN FQTVWPVGT(KPPNCPF  )1.&48QT\ÒINKEJ





 /CTMMCC  *GNUKPMK HÒT (KPPNCPF  I $KVMKP  (D  FQTV WPVGT (KPPNCPF    5EJN FQTVWPVGT(KPPNCPF  )1.&8QT\ÒINKEJ





 /CTMMCC  *GNUKPMK HÒT (KPPNCPF  I $KVMKP  (D  FQTV WPVGT (KPPNCPF    5EJN FQTVWPVGT(KPPNCPF  )1.&8QT\ÒINKEJ





 /CTMMCC  *GNUKPMK HÒT (KPPNCPF  I $KVMKP  (D  FQTV WPVGT (KPPNCPF    5EJN FQTVWPVGT(KPPNCPF  )1.&8QT\ÒINKEJ





 /CTMMCC  *GNUKPMK HÒT (KPPNCPF  I $KVMKP  4  (D  FQTV WPVGT (KPPNCPF    5EJN FQTVWPVGT(KPPNCPF  )1.&45GJTUEJÌPpXQT\ÒINKEJ



88


ALEXANDER II.

8451

/GFCKNNGPFGU<CTGP#NGZCPFGT++ 

6TCIDCTG 5KNDGTOGFCKNNG  WPUKIPKGTV CWH FKG 'KPPCJOG FGT 5VCFV 5GYCUVQRQN Y·JTGPF FGU -TKO   MTKGIGU\YKUEJGP4W­NCPFWPFFGO1UOCPKUEJGP4GKEJ)TQ­DTKVCPPKGP5CTFKPKGPWPF(TCPMTGKEJ&KG IGMTÌPVGP /QPQITCOOG XQP #NGZCPFGT ++ WPF 0KMQNCWU +8KGT <GKNGP 5EJTKHV QDGP UVTCJNGPFGU   )QVVGUCWIGOOI&KCMQX 5GJTUEJÌP



#WH )TWPF KJTGT OKNKV·TKUEJGP $GFGWVWPI YCT FKG DNÒJGPFG *CPFGNUUVCFV 5GYCUVQRQN KO -TKOMTKGI UEJYGT   WOM·ORHV 0CEJ FGT GNHOQPCVKIGP $GNCIGTWPI XQP 5GYCUVQRQN YCT UKG CO  5GRVGODGT  PWT PQEJ GKP   6TÒOOGTJCWHGPWPFIGNCPIVGFCTCWHJKPPKGOGJT\WOHTÒJGTGP9QJNUVCPF  5GYCUVQRQNKUVJGWVGFKGITÌ­VG5VCFVCWHFGTWMTCKPKUEJGP*CNDKPUGN-TKO5KGNKGIVCO5EJYCT\GP/GGTWPFKUV FWTEJGKPGP8GTVTCIOKV4WUUNCPFDKU\WO,CJTGCWEJ*GKOCVJCHGPFGT5EJYCT\OGGTHNQVVG

8452



)QNFOGFCKNNG  XQP 8 #NGZGGX WPF 4 )CPPGOCP CWH UGKPG -TÌPWPI $ÒUVG T)GMTÌPVGT &QR   RGNCFNGTOKV<GRVGTWPF4GKEJUCRHGNKPFGP(·PIGPCWHFGT$TWUV5V)GQTIUUEJKNFWOJGTFKG-GVVGFGU #PFTGCUQTFGPUCWHFGP(NÒIGNPLGXKGTYGKVGTG9CRRGPUEJKNFGQDGP-TQPGOOI&KC MQX 4  )1.&8QPITQ­GT5GNVGPJGKV8QT\ÒINKEJp5VGORGNINCP\ 

8453



5KNDGTOGFCKNNG  XQP 8 #NGZGGX WPF 4 )CPPGOCP CWH UGKPG -TÌPWPI $ÒUVG T)GMTÌPVGT   &QRRGNCFNGTOKV<GRVGTWPF4GKEJUCRHGNKPFGP(·PIGPCWHFGT$TWUV5V)GQTIUUEJKNFWOJGTFKG-GVVG FGU #PFTGCUQTFGPU CWH FGP (NÒIGNP LG XKGT YGKVGTG 9CRRGPUEJKNFG QDGP -TQPG  OO  I   &KCMQX 4  448QT\ÒINKEJ  89


ALEXANDER II.

8454



$TQP\GOGFCKNNG  XQP + %JWMOCUQX CWH FKG 'KPYGKJWPI FGU &GPMOCNU HÒT 0KMQNCWU + KP FGT   5V2GVGTUDWTIGT$ÌTUG#PUKEJVFGU&GPMOCNU#PUKEJVFGT$ÌTUGOOI&KCMQX 4  449KP\-TCV\GTXQT\ÒINKEJ



8455



)QNFOGFCKNNG Q ,   WPUKIPKGTV 2T·OKG FGT MCKUGTNKEJ TWUUKUEJGP )GUGNNUEJCHV HÒT )CTVGPDCW KP   5V2GVGTUDWTI9GKDNKEJG)GUVCNVUVGJVXXOKV(ÒNNJQTPWPF-TCP\WOIGDGPXQPNCPFYKTVUEJCHVNKEJGP )GT·VGP (TÒEJVGP WPF $NWOGP(ÒPH <GKNGP 5EJTKHV WOJGT GKP OKV (TÒEJVGP WPF $NWOGP IGUEJOÒEM   VGT-TCP\QDGP5VGTPOOI&KCMQXp XIN   )1.&8QPITQ­GT5GNVGPJGKV'VYCUDGTKGDGPMN4CPFXGTRT·IWPIUGJTUEJÌPpXQT\ÒINKEJ



8456



)QNFOGFCKNNG  XQP + %JWMOCUQX WPF 8 #NGZGGX CWH FGP 6QF UGKPGT /WVVGT #NGZCPFTC (GQFQ   TQYPC )GOCJNKP FGU <CTGP 0KMQNCWU + $TWUVDKNF FGT 8GTUVQTDGPGP OKV &KCFGO WPF 5EJNGKGT T'KP   'PIGNOKV-TGW\UEJYGDVÒDGTFGO)TCDFGT<CTKPFCTCWHGKPGMPKGPFGYGKDNKEJG)GUVCNVOKV-KPFWPF GKP MPKGPFGT )GPKWU FGT GKPG (CEMGN KP GKPGP 5EJNCPIGPTKPI FCU 5[ODQN FGT 'YKIMGKV J·NV QDGP   UVTCJNGPFGU)QVVGUCWIGOOI&KCMQX 4   )1.&8QPITÌ­VGT5GNVGPJGKV8QT\ÒINKEJ  &KG<CTKP#NGZCPFTC(GQFQTQYPCYWTFGCO,WNKKP$GTNKPCNU2TKP\GUUKP(TKGFGTKMG%JCTNQVVG9KNJGNOKPG XQP2TGW­GPIGDQTGP%JCTNQVVGYCTFCUFTKVVG-KPFWPFFKG·NVGUVG6QEJVGTXQP-ÌPKI(TKGFTKEJ9KNJGNO+++WPF -ÌPKIKP.WKUG#O,WNKYWTFGUKGCPKJTGO)GDWTVUVCIOKV0KMQNCWUFGOLÒPIGTGP$TWFGTFGU<CTGP #NGZCPFGT + WPF UR·VGTGP <CTGP 0KMQNCWU + XGTJGKTCVGV 1DYQJN FKG *QEJ\GKV CNU RQNKVKUEJG /C­PCJOG \WT   $GMT·HVKIWPI FGU TWUUKUEJRTGW­KUEJGP $ÒPFPKUUGU GKPIGH·FGNV YWTFG YCT FKG 'JG UGJT INÒEMNKEJ WPF DTCEJVG      -KPFGT JGTXQT %JCTNQVVG VTCV \WT TWUUKUEJQTVJQFQZGP -KTEJG ÒDGT WPF YWTFG CNU )TQ­HÒTUVKP #NGZCPFTC   (GQFQTQYPCIGPCPPV

90


ALEXANDER II.

8457



5KNDGTOGFCKNNG  WPUKIPKGTV 2T·OKG FGT )GUGNNUEJCHV HÒT ,CIFYGUGP KP /QUMCW $·T OKV5VQEMCP FGO GKP 5EJKNF OKV FGT ,CJTGU\CJN  J·PIV UVGJV X X \W FGP 5GKVGP 'KEJGP WPF .QTDGGT\YGKI   .GGTGU(GNFHÒT)TCXWTGP\WFGP5GKVGP.QTDGGTWPF'KEJGP\YGKIOOI&KCMQX 4  4+P1TKIKPCNGVWK2TCEJVXQNNG2CVKPCXQT\ÒINKEJp5VGORGNINCP\



8458

1,5:1



1,5:1

)QNFGPG 8GTFKGPUVOGFCKNNG  XQP 0 -Q\KP XGTNKGJGPCP/KVYKTMGPFGDGKO&GMTGV\WT$GHTGKWPI FGT .GKDGKIGPGP KP 2QNGP $GKFGT $ÒUVGP XQP 0KMQNCWU + WPF #NGZCPFGT ++ PGDGPGKPCPFGT N   5KGDGP<GKNGP5EJTKHVOOI&KCMQX 4   )1.&8QPITQ­GT5GNVGPJGKV0WT'ZGORNCTGIGRT·IV5GJTUEJÌP 

8459



$TQP\GOGFCKNNGXQP%9KGPGTCWHFKG2CPTWUUKUEJG)GYGTDGCWUUVGNNWPIKP5V2GVGTUDWTI<YGK )GPKGPJCNVGPGKP5EJTKHVDCPFOKV'KEJGPWPF.QTDGGT\YGKI\YKUEJGPKJPGP/GFCKNNQPOKVFTGK<GKNGP 5EJTKHV FCTWPVGT IGMTÌPVGT 9CRRGPUEJKNF WPVGP \YGK KPGKPCPFGTITGKHGPFG *·PFG9GKDNKEJG )GUVCNV   UKV\VPCEJNOKV.QTDGGTMTCP\KPFGTCWUIGUVTGEMVGP4GEJVGPWPF.QTDGGT\YGKIKONKPMGP#TOWOJGT #VVTKDWVGFGU)GYGTDGUOOI&KCMQX\W 9KP\4CPFHGJNGTXQT\ÒINKEJ

 91


ALEXANDER III.

8460 1,5:1

1,5:1

<#4#.':#0&'4+++ )QNFOÒP\GPFGU<CTGP#NGZCPFGT+++ 

4WDGN5V2GVGTUDWTII$KVMKP 4 (D5EJN

8461

 )1.&44(CUVXQT\ÒINKEJ



8462



4WDGN5V2GVGTUDWTII$KVMKP(D5EJN  )1.&40WT'ZGORNCTGIGRT·IV(CUVXQT\ÒINKEJ





4WDGN5V2GVGTUDWTII$KVMKP(D5EJN  )1.&40WT'ZGORNCTGIGRT·IV5GJTUEJÌP



8463

8464

8465

8467

 

4WDGN5V2GVGTUDWTII$KVMKP(D5EJN 4WDGN5V2GVGTUDWTII$KVMKP(D5EJN

)1.&8QT\ÒINKEJ )1.&5GJTUEJÌP

 



4WDGN5V2GVGTUDWTII$KVMKP(D5EJN  )1.&*GPMGNURWTUGJTUEJÌPpXQT\ÒINKEJ





 4WDGN  5V 2GVGTUDWTII&C\W0KMQNCWU++4WDGN5V2GVGTUDWTI I$KVMKP 4 (D5EJN 5VÒEM)1.&5GJTUEJÌPpXQT\ÒINKEJ





4WDGN5V2GVGTUDWTII$KVMKP(D5EJN



8468

8469

)1.&5GJTUEJÌPpXQT\ÒINKEJ

8470



4WDGN5V2GVGTUDWTII$KVMKP(D5EJN  )1.&5GNVGPGT,CJTICPI5GJTUEJÌPpXQT\ÒINKEJ





4WDGN5V2GVGTUDWTII$KVMKP(D5EJN  )1.&5GNVGPGT,CJTICPI8QT\ÒINKEJp5VGORGNINCP\





 4WDGN  5V 2GVGTUDWTI +P 752NCUVKMJQNFGT FGT 2%)5 OKV FGT $GYGTVWPI #7  $KVMKP    (D5EJN )1.&5GNVGPGT,CJTICPI(CUVXQT\ÒINKEJ



92


ALEXANDER III.

8472

8471

8471

5KNDGTOÃ&#x2019;P\GPFGU<CTGP#NGZCPFGT+++ 

4WDGN5V2GVGTUDWTII$KVMKP&CX FQTVWPVGT#NGZCPFGT++   4#VVTCMVKXGUXQT\Ã&#x2019;INKEJGU'ZGORNCT





4WDGN 2QNVKPC 5V2GVGTUDWTII$KVMKP 4   440WT'ZGORNCTGIGRT·IV8QT\Ã&#x2019;INKEJ



8473

1,5:1



1,5:1

4WDGN 2QNVKPC 5V2GVGTUDWTII$KVMKP 4   440WT'ZGORNCTGIGRT·IV8QT\Ã&#x2019;INKEJ



8474

1,5:1



1,5:1

4WDGN5V2GVGTUDWTII$KVMKP&CX  5GJTUGNVGPKPFKGUGT'TJCNVWPI2TCEJVGZGORNCT*GTTNKEJG2CVKPCOKPDGTÃ&#x2019;JTVRQNKGTVG2NCVVG

 93


ALEXANDER III.

8475

8477

8476

 

4WDGN5V2GVGTUDWTII$KVMKP&CX 4WDGN5V2GVGTUDWTII$KVMKP&CX

5GJTUEJÌP 8QT\ÒINKEJ

 



4WDGN5V2GVGTUDWTII$KVMKP&CX  /KPDGTKGDGPYKP\4CPFHGJNGTUGJTUEJÌPpXQT\ÒINKEJ



8478

   

8480

8479

-QRGMGP5V2GVGTUDWTII$KVMKP 4  -QRGMGP5V2GVGTUDWTII$KVMKP 4  -QRGMGP5V2GVGTUDWTII$KVMKP -QRGMGP5V2GVGTUDWTII$KVMKP

8481

4*ÒDUEJG2CVKPCXQT\ÒINKEJ 45GJTUEJÌP *ÒDUEJG2CVKPCXQT\ÒINKEJ 9KP\-TCV\GTXQT\ÒINKEJ

   

8484

8482

8483

 

-QRGMGP5V2GVGTUDWTII$KVMKP -QRGMGP5V2GVGTUDWTII$KVMKP



-QRGMGP5V2GVGTUDWTI+P752NCUVKMJQNFGTFGT0)%OKVFGT$GYGTVWPI#7$KVMKP 4  8QT\ÒINKEJ

94

9KP\4CPFHGJNGTXQT\ÒINKEJ 5GJTUEJÌPpXQT\ÒINKEJXQT\ÒINKEJ

  


ALEXANDER III.

8485 1,5:1



-QRGMGP5V2GVGTUDWTII$KVMKP 4   440WT'ZGORNCTGIGRT·IV*ÒDUEJG2CVKPCXQT\ÒINKEJp5VGORGNINCP\

8487

8486

   

1,5:1

8488

-QRGMGP5V2GVGTUDWTII$KVMKP 4  -QRGMGP5V2GVGTUDWTII$KVMKP -QRGMGP5V2GVGTUDWTII$KVMKP -QRGMGP5V2GVGTUDWTII$KVMKP 4 

8489

4(CUVXQT\ÒINKEJ *ÒDUEJG2CVKPCXQT\ÒINKEJ (CUVXQT\ÒINKEJ 45GJTUEJÌP

   

8491

8490

 



)GFGPMOÒP\GPFGU<CTGP#NGZCPFGT+++

4WDGN5V2GVGTUDWTICWHUGKPG-TÌPWPII$KVMKP&CX 4WDGN5V2GVGTUDWTICWHUGKPG-TÌPWPII$KVMKP&CX

8QT\ÒINKEJ 8QT\ÒINKEJ

 



4WDGN5V2GVGTUDWTICWHUGKPG-TÌPWPII$KVMKP&CX  *ÒDUEJG2CVKPCUGJTUEJÌPpXQT\ÒINKEJ





4WDGN5V2GVGTUDWTICWHUGKPG-TÌPWPII$KVMKP&CX  -N)TCXWTKO(GNFFGT8QTFGTUGKVGHCUVXQT\ÒINKEJ



8494

8496

8495

2T·IWPIGPHÒT(KPPNCPF 

 /CTMMCC  *GNUKPMK HÒT (KPPNCPF  I $KVMKP  4  (D  FQTV WPVGT (KPPNCPF    5EJN FQTVWPVGT(KPPNCPF  )1.&48QT\ÒINKEJp5VGORGNINCP\





 /CTMMCC  *GNUKPMK HÒT (KPPNCPF  I $KVMKP  (D  FQTV WPVGT (KPPNCPF    5EJN FQTVWPVGT(KPPNCPF  )1.&8QT\ÒINKEJp5VGORGNINCP\





<QNQVPKMQ,5V2GVGTUDWTII$KVMKP  5GNVGPKPFKGUGT'TJCNVWPI2TCEJVGZGORNCT(CUV5VGORGNINCP\

'KP(GKPIGYKEJVUDCTTGPFGT/ÒP\UV·VVG5V2GVGTUDWTI  95


ALEXANDER III.

8497

1,5:1

1,5:1

/GFCKNNGPFGU<CTGP#NGZCPFGT+++ 

6TCIDCTGIQNFGPG/KNKV·T8GTFKGPUVOGFCKNNGQ,XQP.5VGKPOCPXGTNKGJGPHÒT6CRHGTMGKV$ÒUVGT <YGK<GKNGP5EJTKHVFCTWPVGT#DUEJPKVVUNKPKGOOI&KCMQXp \W4   )1.&8QPITQ­GT5GNVGPJGKV5GJTUEJÌPpXQT\ÒINKEJ  &KG XQTNKGIGPFG /GFCKNNG YWTFG KO ,CJT  Y·JTGPF FGT 4GIKGTWPI XQP #NGZCPFGT + \WO GTUVGP /CN   CWUIGIGDGP 5KG YWTFG CP $GYQJPGT FGT )TGP\TGIKQP JCWRVU·EJNKEJ KO -CWMCUWU HÒT OKNKV·TKUEJG 8GTFKGPUVG   XGTNKGJGP7PVGT<CT#NGZCPFGT+++YWTFGPWTGKPGIGTKPIG5VÒEM\CJNJGTIGUVGNNV

8498



)QNFOGFCKNNG Q , XQP # )TKNKEJGU 2T·OKG FGT /·FEJGPUEJWNG HÒT FGP GTHQNITGKEJGP #DUEJNW­   $TWUVDKNF FGT <CTKP /CTKC (GQFQTQYPC T/KPGTXC OKV .QTDGGTMTCP\ KP FGT 4GEJVGP WPF ¤NNCORG KP   FGT GTJQDGPGP .KPMGP UVGJV X X WOIGDGP XQP #VVTKDWVGP FGT 9KUUGPUEJCHVGP FKG CWH FGO $QFGP   NKGIGPOOI&KCMQX 4  )1.&449KP\4CPFHGJNGTXQT\ÒINKEJ 

8499



96

$TQP\GOGFCKNNG  XQP 5 8C\JGPKP WPF / )CDG CWH FCU L·JTKIG #OVULWDKN·WO FGU 2TKP\GP   # / )QTEJCMQX CNU /KPKUVGT HÒT #WUNCPFUCPIGNGIGPJGKVGP $ÒUVG FGU 5VCCVUOCPPGU N&CVWOU   CPICDGOOI&KCMQX 8QT\ÒINKEJ




ALEXANDER III.

8500

8501

8501





6TCIDCTG 5KNDGTOGFCKNNG Q , WO   WPUKIPKGTV XQP # )TKNKEJGU XGTNKGJGP HÒT JGTXQTTCIGPFG   &KGPUVG KO 2QNK\GKYGUGP $ÒUVG T WOJGT .QTDGGTMTCP\8KGT <GKNGP 5EJTKHV WOJGT .QTDGGTMTCP\   OOI&KCMQX 4  5GJTUEJÌP



$TQP\GOGFCKNNGOKVFGP5KIPCVWTGP'9WPF*2CWHUGKPG-TÌPWPIKP/QUMCW&KG$ÒUVGP XQP #NGZCPFGT +++ WPF UGKPGT )GOCJNKP /CTKC (GQFQTQYPC PGDGPGKPCPFGT T ÒDGT XGTDWPFGPGP .QT   DGGT\YGKIGP QDGP UVTCJNGPFGU )QVVGUCWIG)GMTÌPVG YGKDNKEJG )GUVCNV VJTQPV X X OKV <GRVGT 5EJKNF   WPF4GKEJUCRHGNOOI&KCMQX 4  48QT\ÒINKEJ



8502

8503





8503

5KNDGTOGFCKNNGWPUKIPKGTV2TGKUOGFCKNNGFGTMCKUGTNKEJTWUUKUEJGP)GUGNNUEJCHVHÒTNCPFYKTVUEJCHV NKEJG)GHNÒIGN\WEJV'KP-KPFUKV\VPCEJNWPFJ·NVGKP-ÒMGPKPFGP*·PFGPXQTKJOUVGJVGKP-QTDOKV *WJPWPFGKPGOYGKVGTGP-ÒMGPUQYKGGKPGIGÌHHPGVG'KGTUEJCNGKO#DUEJPKVVHTGKGU(GNFHÒT)TCXWTGP /GFCKNNQP OKV FTGK <GKNGP 5EJTKHV QDGP \W FGP 5GKVGP UKV\GP \YGK -KPFGT OKV *WJP D\Y $WEJ   FCTWPVGT)KTNCPFGPWPF,CJTGU\CJNOOI&KCMQX  -N4CPFHGJNGTUGJTUEJÌPpXQT\ÒINKEJ



$TQP\GOGFCKNNGWPUKIPKGTVCWHUGKPGP$GUWEJKP$GTNKP7PKHQTOKGTVGU$TWUVDKNFTOKVWOIGNGI VGO /CPVGN7PKHQTOKGTVGU $TWUVDKNF 9KNJGNOU++XQP2TGW­GPNOKVWOIGNGIVGO/CPVGNOO I&KCMQX 4  44(CUV5VGORGNINCP\

 97


NIKOLAUS II.

8505

8504

8506

8507

<#40+-1.#75++ )QNFOÒP\GPFGU<CTGP0KMQNCWU++ 

4WDGN5V2GVGTUDWTII$KVMKPXCT(D5EJN  )1.&8QT\ÒINKEJp5VGORGNINCP\





4WDGN5V2GVGTUDWTI+P752NCUVKMJQNFGTFGT0)%OKVFGT$GYGTVWPI/5$KVMKPXCT (D5EJN )1.&8QT\ÒINKEJp5VGORGNINCP\





4WDGN5V2GVGTUDWTII$KVMKPXCT(D5EJN

)1.&8QT\ÒINKEJ





4WDGN5V2GVGTUDWTII$KVMKPXCT(D5EJN

)1.&8QT\ÒINKEJ



8511

8508



4WDGN5V2GVGTUDWTII$KVMKPXCT(D5EJN

)1.&(CUVXQT\ÒINKEJ





4WDGN5V2GVGTUDWTII$KVMKPXCT(D5EJN

)1.&(CUVXQT\ÒINKEJ





4WDGN5V2GVGTUDWTII$KVMKPXCT(D5EJN

)1.&5GJTUEJÌP





 4WDGN  5V 2GVGTUDWTI +P 752NCUVKMJQNFGT FGT 0)% OKV FGT $GYGTVWPI /5  $KVMKP    (D5EJN )1.&(CUV5VGORGNINCP\

8512

8513

8514



8515



4WDGN5V2GVGTUDWTII$KVMKP(D5EJN

)1.&8QT\ÒINKEJ





4WDGN5V2GVGTUDWTII$KVMKP(D5EJN

)1.&8QT\ÒINKEJ





4WDGN5V2GVGTUDWTII$KVMKP 4 (D5EJN

)1.&48QT\ÒINKEJ





4WDGN5V2GVGTUDWTII$KVMKP 4 (D5EJN  )1.&45GJTUEJÌPpXQT\ÒINKEJ



98


NIKOLAUS II.

8516

8517

8518



4WDGN5V2GVGTUDWTII$KVMKP(D5EJN

)1.&8QT\ÒINKEJ





4WDGN5V2GVGTUDWTII$KVMKP(D5EJN

)1.&8QT\ÒINKEJ





4WDGN5V2GVGTUDWTII$KVMKP(D5EJN )1.&5GJTUEJÌPpXQT\ÒINKEJ





4WDGN5V2GVGTUDWTII$KVMKP(D5EJN )1.&5GJTUEJÌPpXQT\ÒINKEJ





4WDGN5V2GVGTUDWTII$KVMKP(D5EJN )1.&5GJTUEJÌPpXQT\ÒINKEJ





4WDGN5V2GVGTUDWTII$KVMKP(D5EJN )1.&5GJTUEJÌPpXQT\ÒINKEJ





4WDGN5V2GVGTUDWTII$KVMKP(D5EJN



8523

8524

8525

8526

)1.&5GJTUEJÌP

8527

8528



4WDGN5V2GVGTUDWTII$KVMKP(D5EJN

)1.&8QT\ÒINKEJ





4WDGN5V2GVGTUDWTII$KVMKP(D5EJN

)1.&8QT\ÒINKEJp5VGORGNINCP\





 4WDGN  5V 2GVGTUDWTI +P 752NCUVKMJQNFGT FGT 0)% OKV FGT $GYGTVWPI /5  $KVMKP    (D5EJN )1.&2TCEJVGZGORNCT5VGORGNINCP\





4WDGN5V2GVGTUDWTII$KVMKP(D5EJN

)1.&8QT\ÒINKEJp5VGORGNINCP\





4WDGN5V2GVGTUDWTII$KVMKP 4 (D5EJN  )1.&5GNVGPGT,CJTICPI(CUV5VGORGNINCP\





4WDGN5V2GVGTUDWTII$KVMKP 4 (D5EJN  )1.&48QT\ÒINKEJp5VGORGNINCP\



8529

8530

8531

5KNDGTOÒP\GPFGU<CTGP0KMQNCWU++ 

4WDGN5V2GVGTUDWTII$KVMKP&CX

*GTTNKEJG2CVKPCXQT\ÒINKEJp5VGORGNINCP\





4WDGN5V2GVGTUDWTII$KVMKP&CX

2TCEJVGZGORNCT(CUV5VGORGNINCP\





4WDGN5V2GVGTUDWTII$KVMKP 4 &CX

5GNVGPGT,CJTICPI5GJTUEJÌP

 99


NIKOLAUS II.

8532

8533



4WDGN5V2GVGTUDWTII$KVMKP 4 &CX



4WDGN  5V 2GVGTUDWTI +P 752NCUVKMJQNFGT FGT 0)% OKV FGT $GYGTVWPI /5  )QQFOCP %QN   NGEVKQP$KVMKP 4 &CX 4-CDKPGVVUVÒEM2TCEJVXQNNG2CVKPC5VGORGNINCP\ 

8534

445GJTUEJÌP



8535



4WDGN5V2GVGTUDWTII$KVMKP&CX

8QT\ÒINKEJ





4WDGN5V2GVGTUDWTII$KVMKP&CX

8QT\ÒINKEJ



8536

8537



4WDGN5V2GVGTUDWTII$KVMKP 4 &CXp \W 

4(CUVXQT\ÒINKEJ





4WDGN5V2GVGTUDWTII$KVMKP 4 &CXp \W 

4-N4CPFHGJNGTXQT\ÒINKEJ



8538

8539



4WDGN5V2GVGTUDWTII$KVMKP&CX  #VVTCMVKXGUXQT\ÒINKEJGU'ZGORNCTOKVJÒDUEJGT2CVKPC





4WDGN5V2GVGTUDWTII$KVMKP 4 &CX  $GUUGTGT,CJTICPI(GKPG2CVKPCCVVTCMVKXGUXQT\ÒINKEJGU'ZGORNCT



8540



-QRGMGP5V2GVGTUDWTII$KVMKP



-QRGMGP5V2GVGTUDWTII$KVMKP

100

8541

2TCEJVGZGORNCT(CUV5VGORGNINCP\



(CUV5VGORGNINCP\




NIKOLAUS II.

8542

8544

8543

8545



-QRGMGP5V2GVGTUDWTII$KVMKP 4   44#VVTCMVKXGUXQT\ÒINKEJGU'ZGORNCTOKVJÒDUEJGT2CVKPC





-QRGMGP5V2GVGTUDWTII$KVMKP 4 

448QT\ÒINKEJ





-QRGMGP5V2GVGTUDWTII$KVMKP 4 

48QT\ÒINKEJ





-QRGMGP5V2GVGTUDWTII$KVMKP

2TCEJVGZGORNCT(CUV5VGORGNINCP\



8547

8546

8548

8549



-QRGMGP5V2GVGTUDWTII$KVMKP  *GTTNKEJG2CVKPCYKP\5EJTÌVNKPIUHGJNGTHCUV5VGORGNINCP\





-QRGMGP5V2GVGTUDWTII$KVMKP

*ÒDUEJG2CVKPCXQT\ÒINKEJp5VGORGNINCP\





-QRGMGP5V2GVGTUDWTII$KVMKP  2TCEJVGZGORNCTOKVHGKPGT2CVKPC(CUV5VGORGNINCP\





-QRGMGP5V2GVGTUDWTII$KVMKP

8QT\ÒINKEJ



4(CUVXQT\ÒINKEJ



44*ÒDUEJG2CVKPCXQT\ÒINKEJ



5GNVGPKPFKGUGT'TJCNVWPI(CUV5VGORGNINCP\



8552 8551

8550



-QRGMGP5V2GVGTUDWTII$KVMKP 4 



-QRGMGP5V2GVGTUDWTII$KVMKP 4 



-QRGMGP2CTKUI$KVMKP

101


NIKOLAUS II.

8555

8554

8553



4WDGN$TÒUUGNI$KVMKP&CX

8QT\ÒINKEJ



49KP\(NGEMGPXQT\ÒINKEJ



-WRHGTOÒP\GPFGU<CTGP0KMQNCWU++ 

-W-QRGMGP5V2GVGTUDWTII$KVMKP 4 



-W-QRGMG5V2GVGTUDWTI+P752NCUVKMJQNFGTFGT2%)5OKVFGT$GYGTVWPI244&$KVMKP 2QNKGTVG2NCVVG

8556

8557

8558



8559

)GFGPMOÒP\GPFGU<CTGP0KMQNCWU++ 

4WDGN  5V 2GVGTUDWTI CWH UGKPG -TÌPWPI +P 752NCUVKMJQNFGT FGT 2%)5 OKV FGT $GYGTVWPI   /5$KVMKP&CX 8QT\ÒINKEJ





4WDGN5V2GVGTUDWTICWHUGKPG-TÌPWPII$KVMKP&CX

8QT\ÒINKEJ





4WDGN5V2GVGTUDWTICWHUGKPG-TÌPWPII$KVMKP&CX  9KP\4CPFHGJNGTXQT\ÒINKEJ





4WDGN5V2GVGTUDWTICWHUGKPG-TÌPWPII$KVMKP&CX -N)TCHHKVKXQT\ÒINKEJ



8560

8561



4WDGN5V2GVGTUDWTI&GPMOCNHÒT#NGZCPFGT+++I$KVMKP 4 &CX  48QT\ÒINKEJ





4WDGN5V2GVGTUDWTI&GPMOCNHÒT#NGZCPFGT+++I$KVMKP 4 &CX  4*GTTNKEJG2CVKPCYKP\4CPFHGJNGTCVVTCMVKXGUXQT\ÒINKEJGU'ZGORNCT



102


NIKOLAUS II.

8563

8562

8564



4WDGN5V2GVGTUDWTICWHFKG,CJTHGKGTFGU5KGIGUÒDGT0CRQN¾QPI$KVMKP&CX /KP5EJTÌVNKPIUHGJNGTXQT\ÒINKEJp5VGORGNINCP\





4WDGN5V2GVGTUDWTICWHFKG,CJTHGKGTFGU5KGIGUÒDGT0CRQN¾QPI$KVMKP&CX #VVTCMVKXGUXQT\ÒINKEJGU'ZGORNCT





4WDGN5V2GVGTUDWTICWHFKG,CJTHGKGTFGU5KGIGUÒDGT0CRQN¾QPI$KVMKP&CX (CUVXQT\ÒINKEJ



8565

8566

8567



4WDGN5V2GVGTUDWTICWHFKG,CJTHGKGTFGT4QOCPQX&[PCUVKGI$KVMKP&CX 8QT\ÒINKEJp5VGORGNINCP\





4WDGN5V2GVGTUDWTICWHFKG,CJTHGKGTFGT4QOCPQX&[PCUVKGI$KVMKP&CX /KP4CPFHGJNGTXQT\ÒINKEJp5VGORGNINCP\





4WDGN5V2GVGTUDWTICWHFKG,CJTHGKGTFGT4QOCPQX&[PCUVKGI$KVMKP&CX 8QT\ÒINKEJ



8568

8569

2T·IWPIGPHÒT(KPPNCPF 

 /CTMMCC  *GNUKPMK HÒT (KPPNCPF  I $KVMKP  (D  FQTV WPVGT (KPPNCPF    5EJN FQTVWPVGT(KPPNCPF  )1.&8QT\ÒINKEJ





 /CTMMCC  *GNUKPMK HÒT (KPPNCPF  I $KVMKP  (D  FQTV WPVGT (KPPNCPF    5EJN FQTVWPVGT(KPPNCPF  )1.&8QT\ÒINKEJ

 103


NIKOLAUS II.

8570

8571

8572

8573



 /CTMMCC  *GNUKPMK HÃ&#x2019;T (KPPNCPF  I $KVMKP  (D  FQTV WPVGT (KPPNCPF    5EJN FQTVWPVGT(KPPNCPF  )1.&8QT\Ã&#x2019;INKEJp5VGORGNINCP\





 /CTMMCC  *GNUKPMK HÃ&#x2019;T (KPPNCPF  I $KVMKP  (D  FQTV WPVGT (KPPNCPF    5EJN FQTVWPVGT(KPPNCPF  )1.&8QT\Ã&#x2019;INKEJp5VGORGNINCP\





 /CTMMCC  *GNUKPMK HÃ&#x2019;T (KPPNCPF  I $KVMKP  (D  FQTV WPVGT (KPPNCPF    5EJN FQTVWPVGT(KPPNCPF  )1.&8QT\Ã&#x2019;INKEJp5VGORGNINCP\XQT\Ã&#x2019;INKEJ





 /CTMMCC  *GNUKPMK HÃ&#x2019;T (KPPNCPF  I $KVMKP  (D  FQTV WPVGT (KPPNCPF    5EJN FQTVWPVGT(KPPNCPF  )1.&8QT\Ã&#x2019;INKEJ



8574



8575

8574

/CTMMCC*GNUKPMKHÃ&#x2019;T(KPPNCPFI(GKPIQNF+P752NCUVKMJQNFGTFGT0)%OKVFGT$G YGTVWPI/5$KVMKP(D FQTVWPVGT(KPPNCPF 5EJN FQTVWPVGT(KPPNCPF   )1.&(CUV5VGORGNINCP\



/GFCKNNGPFGU<CTGP0KMQNCWU++ 

6TCIDCTG IQNFGPG 8GTFKGPUVOGFCKNNG Q ,   WPUKIPKGTV XQP # 8CU[WVKPUM[ (NGK­RT·OKG HÃ&#x2019;T   -CWHNGWVG #TDGKVGT $CWGTP 7PVGTQHHK\KGTG WPF -KTEJGPRHNGIGT FKG FGT 4GIKGTWPI &KGPUVG GTDTCEJV   JCVVGP -QRH N5EJTKHV PGDGP XGTUEJNWPIGPGP .QTDGGT 2CNO WPF 'KEJGP\YGKIGP  OO   I&KCMQX 4  )1.&4-N4CPFHGJNGTXQT\Ã&#x2019;INKEJ 

8576



104

$TQP\GOGFCKNNQPXQP#)TKNKEJGULTCWHFCUPGWGTTKEJVGVG&GPMOCN#NGZCPFGTU++GTDCWV -QRH#NGZCPFGTU++N#PUKEJVFGU&GPMOCNUOOI&KCMQX 4   8QT\Ã&#x2019;INKEJ




NIKOLAUS II.

8577



6TCIDCTG 5KNDGTOGFCKNNG Q , XQP % ,CJP 2TGKUOGFCKNNG FGT HKPPKUEJGP )GUGNNUEJCHV HÒT .CPFYKTV    UEJCHV-QRHN)GMTÌPVGUHKPPKUEJGU9CRRGPÒDGT\YGKIGMTGW\VGP'KEJGP\YGKIGPOOI &KCMQX 4FQTVOKVWPXQNNUV·PFKIGT5KIPCVWTCWHFGT8QTFGTUGKVG   4*ÒDUEJG2CVKPCUGJTUEJÌPpXQT\ÒINKEJ



8578



5KNDGTRNCMGVVG  XQP ( %QUVGCWHFKGGTUVGKPVGTPCVKQPCNG#WUUVGNNWPIMÒPUVNGTKUEJGT(QVQITCHKGKP /QUMCW9GKDNKEJG)GUVCNVUKV\VPCEJTOKV-CVCNQIWPF.QTDGGT\YGKIFCTWPVGTHÒPH<GKNGP5EJTKHVWPF FKG/GFCKNNGWTUUKIPCVWT8KGT<GKNGP5EJTKHVZOOI&KCMQXp 8QT\ÒINKEJ



8579



$TQP\GOGFCKNNG  XQP # )TKNKEJGU LT CWH FKG 'KPYGKJWPI FGU &GPMOCNU HÒT #NGZCPFGT +++   $ÒUVG#NGZCPFGTU+++N#PUKEJVFGU&GPMOCNUOOI&KCMQX  -N4CPFHGJNGTMN-TCV\GTUGJTUEJÌPpXQT\ÒINKEJ

 105


RUSSISCHE REPUBLIK

8580 8581

8581

519,'670+10 

-QRGMGPQ,2TKXCVRT·IWPIKP#NWOKPKWOJGTCWUIGIGDGPCP/KVCTDGKVGTGKPGT-QHHGTHCDTKMI (GFQTKP 4  49KP\4CPFHGJNGTUGJTUEJÌPpXQT\ÒINKEJ



4WDGN.GPKPITCF+P752NCUVKMJQNFGTFGT00%OKVFGT$GYGTVWPI/5&CX  *ÒDUEJG2CVKPCXQT\ÒINKEJ

8582

 

ex 8584

8583

 

4WDGN 6UEJGTYQPG\ .GPKPITCFI(GKPIQNF(D5EJN 4WDGN 6UEJGTYQPG\ .GPKPITCFI(GKPIQNF(D5EJN

)1.&8QT\ÒINKEJ )1.&8QT\ÒINKEJ

 



4WDGN 6UEJGTYQPG\ /QUMCWI(GKPIQNF(DC5EJN  5VÒEM)1.&8QT\ÒINKEJp5VGORGNINCP\



8586

8587

ex 8585 Pt

ex 8585 Pt



 4WDGN 2NCVKP  .GPKPITCF 1N[ORKCFG KP /QUMCW   1N[ORKC'ODNGO CWH .QTDGGTMTCP\   &C\W  4WDGN 2NCVKP GDGPHCNNU CWH FKG 1N[ORKCFG KP /QUMCW   &KUMWUYGTHGT +PUIGUCOV   IHGKP(D5EJN 5VÒEM2.#6+05VGORGNINCP\ 



 4WDGN  /QUMCW /CTK·*KOOGNHCJTVU-CVJGFTCNG FGU -TGON KP /QUMCW  I (GKPIQNF (D   5EJN )1.&2QNKGTVG2NCVVG





4WDGN/QUMCW4WUUKUEJGU$CNNGVVI(GKPIQNF(Dp5EJN



)1.&5VGORGNINCP\

8588 8589

8589

4755+5%*'4'27$.+-5'+6 

4WDGN5V2GVGTUDWTI$CKMCNVWPPGNI(GKPIQNF(D5EJN  )1.&2QNKGTVG2NCVVG





4WDGN5V2GVGTUDWTI5EJÒV\VWPUGTG7OYGNV.WEJUI(GKPIQNF(D  )1.&2QNKGTVG2NCVVG



106


TANNU TUVA

8591

8590



4WDGN/QUMCW5EJÒV\VWPUGTG7OYGNV#OWT6KIGTI(GKPIQNF(D  )1.&2QNKGTVG2NCVVG





4WDGN/QUMCW,CJTGUVCIFGU5KGIGUKO<YGKVGP9GNVMTKGII(GKPIQNF;GQp  )1.&2QNKGTVG2NCVVG



.16570&5#//.70)'0 4755+5%*'4/ª0<'070&/'&#+..'0 

2GVGT+FGT)TQ­G+PVGTGUUCPVG5COONWPIXQP<KPPOGFCKNNGPWPF$TQP\GOGFCKNNGP XQP <CT 2GVGT + &KCMQX       XCT   $TQP\G       $TQP\G &C\W<KPPOGFCKNNGXQP'NKUCDGVJ &KCMQX *QEJKPVGTGUUCPVGU 1DLGMVDKVVGWPDGFKPIVDGUKEJVKIGP 5VÒEM(CUVUGJTUEJÌPpHCUV5VGORGNINCP\ 



-CVJCTKPC ++  -W -QRGMGP  5V 2GVGTUDWTI ªDGTRT·IWPIUURWTGP  WPF FKXGTUG   -W -QRGMGP5VÒEMG FGT /ÒP\UV·VVG 'MCVGTKPDWTI XQP          $KVMKP 5VÒEM/GKUVXQT\ÒINKEJ





0KMQNCWU +  4WDGN  9CTUEJCW  9CTUEJCW  5V 2GVGTUDWTI &C\W   #NGZCPFGT++4WDGN5V2GVGTUDWTI 5VÒEM8QT\ÒINKEJ





#NGZCPFGT+++4WDGN Z 5V2GVGTUDWTI$KVMKP(D Z  5EJN Z  5VÒEM)1.&5GJTUEJÌPpXQT\ÒINKEJ 



0KMQNCWU ++   4WDGN   4WDGN    4WDGN  #NNG /ÒP\UV·VVG   5V2GVGTUDWTI$KVMKPXCT(D5EJN  5VÒEM)1.&5GJTUEJÌPWPFDGUUGT





4GRWDNKMUGKV4WDGN Z -QRGMGP Z  Z   5VÒEM5GJTUEJÌPpXQT\ÒINKEJ





#NNIGOGKP 4WDGN  $KVMKP    $KVMKP    $KVMKP    $KVMKP     

$KVMKP #NNGKP752NCUVKMJQNFGTPFGT2%)5OKVFGT$GOGTMWPI)GPWKPG  5VÒEM(CUVUGJTUEJÌPpXQT\ÒINKEJ





-QRGMGP $KVMKP  $KVMKP -QRGMGP $KVMKP CNNGKP752NCUVKMJQNFGTP FGT 2%)5 OKV FGT $GOGTMWPI )GPWKPG -W -QRGMGP  $KVMKP   -W -QRGMGP   

$KVMKP   DGKFG KP 752NCUVKMJQNFGTP FGT 2%)5 OKV FGT $GYGTVWPI /5  $0 -W -QRGMGP  

$KVMKP KP752NCUVKMJQNFGTFGT2%)5OKVFGT$GYGTVWPI/54$  5VÒEM5GJTUEJÌPp5VGORGNINCP\





-NGKPG 5COONWPI TWUUKUEJGT /ÒP\GP FGU  ,CJTJWPFGTVU XQP FGT 6TQRHMQRGMG DKU \WO 4WDGN    W C  -QRGMGP   )TQU\[  4WDGN  ,CJTHGKGT FGT 4QOCPQX&[PCUVKG    2QNVKPPKM5GJTKPVGTGUUCPVGU1DLGMVDKVVGDGUKEJVKIGP 5VÒEM(CUVUGJTUEJÌPpXQT\ÒINKEJ





&KXGTUG-WRHGTOÒP\GPFGU,CJTJWPFGTVUXQPFGT-QRGMGDKU\W-QRGMGPFCTWPVGTCWEJ DGUUGTG,CJTI·PIGWPF6[RGP+PVGTGUUCPVGU.QVDKVVGDGUKEJVKIGP 5VÒEM5GJTUEJÌPpXQT\ÒINKEJ





&KXGTUG /ÒP\GP FGU  ,CJTJWPFGTVU XQP  -QRGMGP DKU \WO 4WDGN W C 4WDGN         Z     Z    GVE *QEJKPVGTGUUCPVGU .QV DKVVG   DGUKEJVKIGP 5VÒEM5GJTUEJÌPpXQT\ÒINKEJ 



-NGKPG5COONWPIXQP/ÒP\GPFGU,CJTJWPFGTVUXQPFGT-W-QRGMGDKU\WO4WDGNFCTWPVGT DGUUGTG6[RGPWPF,CJTI·PIG*QEJKPVGTGUUCPVGU1DLGMVDKVVGDGUKEJVKIGP  5VÒEM'KPKIGOKVMN(GJNGTPUEJÌPpXQT\ÒINKEJ

ex 8604

8605



ex 8604

52+6<$'4)'0 

-QJNGOKPGPIGUGNNUEJCHV#TMVKMWIQN-QRGMGP.GPKPITCF(GFQTKP  5VÒEM5GJTUEJÌPpXQT\ÒINKEJ



6#007678# 

4GRWDNKM-QRGLGM-/

8QT\ÒINKEJ

 107


PAPIERGELD

ex 8607

8606

$#0-016'070&016)'.&5%*'+0'&'5 0¤4&.+%*'015624'755'05

#NNG#DDKNFWPIGPKO/C­UVCD 

-ÌPKIUDGTI -ÌPKIUDGTIGT 2TKXCVDCPM  6JCNGT %QWTCPV  1EVQDGT  5GT  0Q    2KEM4KZGP#-GNNGTD-CTRKPUMK+++C4LCD 8QPITÌ­VGT5GNVGPJGKV+8



&CTMGJOGP JGWVG 1UGTUM  -TGKUCWUUEJW­ -QPXQNWV   WPF  /CTM OKV WPF QJPG 2T·IG  UVGORGN 0QXGODGT-GNNGT-CTRKPUMKDFGH/GJHCEJIGNQEJV\WT'PVYGTVWPI  5EJGKPG+p+++





ex 8608

ex 8609



&QOPCW JGWVG &QOPQX  /CIKUVTCV -QPXQNWV    2HGPPKI WPF  /CTM  #WIWUV    <YGKXGTUEJKGFGPG9CUUGT\GKEJGP4LCD 5EJGKPG+





)WODKPPGP JGWVG)WUUGY -ÌPKINKEJG4GIKGTWPIU*CWRVMCUUG-QPXQNWVZ/CTM0Q XGODGT  #NNG OKV JCPFUEJTKHVNKEJGO 8GTOGTM 7PIÒNVKI DGK  /CTM CNU 8CTKCPVGP  -GNNGT   -CTRKPUMKDD 5EJGKPG+p++



108


PAPIERGELD

ex 8611 ex 8610





)WODKPPGP JGWVG )WUUGY  -TGKUCWUUEJW­ -QPXQNWV  2HGPPKI  ,CPWCT    WPF   /CTM0QXGODGT&KGGT5EJGKPGOKV5VGORGN7PIÃ&#x2019;NVKI-GNNGTCD-CT RKPUMKCCC4LCD 5EJGKPG+++



)WODKPPGP JGWVG )WUUGY  -TGKUCWUUEJWUU WPF /CIKUVTCV -QPXQNWV  2HGPPKI )QNF     &QNNCT -0  WPF UVGNNKI   2HGPPKI )QNF   &QNNCT  -0 8CTKCPVGP   /CTM )QNF     &QNNCT  -0  8CTKCPVGP  CNNG XQO  0QXGODGT  -GNNGT  -CTRKPUMK  CJ 4LCD    5EJGKPG++p+++



ex 8612



*G[FGMTWI JGWVG 5KNWV¾ .KVCWGP )GOGKPFGXQTUVCPF-QPXQNWV2HGPPKIÂ&#x201E;/CTM#WIWUV   2HGPPKI Â&#x201E; /CTM  /CK   2HGPPKI  /CK   -0  8CTKCPVGP  5WFGTOCPP    5GTKG  2HGPPKI  8CTKCPVGP   2HGPPKI  8CTKCPVGP   2HGPPKI  8CTKCPVGP FCDGK QJPG -0     /CTM  8CTKCPVGP FCDGK QJPG -0  )TCD/GJN  -GNNGT  CE -CTRKPUMK  C D   CDCD 5EJGKPG+ Z WPF+++



ex 8613 ex 8614



*G[FGMTWI JGWVG 5KNWV¾ .KVCWGP  -QPXQNWV    2HGPPKI Q & +P FGT .KVGTCVWT PKEJV PCEJ   YGKUDCTG#WUICDG2HGPPKIÂ&#x201E;/CTM 5EJGKPG+





+PUVGTDWTI JGWVG 6UEJGTPLCEJQYUM  +PUVGTDWTIGT #MVKGPURKPPGTGK -QPXQNWV Â&#x201E; /CTM      Â&#x201E; /CTM    +PUVGTDWTIGT 5RKPPGTGK WPF 9GDGTGK  /CTM  5GRVGODGT  -CTVQP  

FTWEMHTKUEJ -GNNGTDG-CTRKPUMKDH 5EJGKPG+WPF+++ Z



+PUVGTDWTI JGWVG 6UEJGTPLCEJQYUM  /CIKUVTCV -QPXQNWV  2HGPPKI  /CTM QJPG -0   GPVYGTVGV   /CTM OKV UVGNNKIGT -0  -CTRKPUMK   /CTM OKV JCPFUEJTKHVNKEJGT 0QVK\ /WUVGT    /CTM QJPG -0 QJPG 0QVK\ #NNG 5EJGKPG XQO  1MVQDGT   /CTM  1MVQDGT   

-08CTKCPVGP /CTMªDGTFTWEMCWH/CTMXQO1MVQDGT&C\W5V·FVKUEJG 5RCTMCUUG   2HGPPKI    /CTM Q &   OKV -QPVQCPICDG WPF -0  2HGPPKI    WPF  /CTM DNCPMQ )TCD/GJN  -GNNGT   C D  C -CTRKPUMK  E   /C/CCCI4LCD 5EJGKPG+p+8





109


PAPIERGELD

ex 8617

ex 8616





+PUVGTDWTI JGWVG 6UEJGTPLCEJQYUM  /CIKUVTCV -QPXQNWV  /CTM  1MVQDGT  1JPG   'PVYGTVWPI FTWEMHTKUEJ /CTM1MVQDGTOKVWPIÒNVKI FGTQDGTG4CPFDGUEJPKVVGP  -GNNGTD-CTRKPUMKC/ 5EJGKPG+WPF+++



-COUVKICNN DGK 2KNNCW JGWVG $CNVKLUM  1HHK\KGTIGHCPIGPGPNCIGT $NCPMGPDWTI -QPXQNWV OKV #WH   FTWEM 1HHK\KGT)GHCPIGPGP.CIGT -COUVKICNN  /CTM Q &  8CTKCPVGP   /CTM Q &  8CTK   CPVGP   /CTM Q &  XGTUEJKGFGPG 9CUUGT\GKEJGP   /CTM Q &  8CTKCPVGP  -TKGIU   IGHCPIGPGPNCIGT $NCPMGPDWTI OKV #WHFTWEM 1HHK\KGT)GHCPIGPGP.CIGT -COUVKICNN   /CTM Q &   -GNNGTDH-CTRKPUMKCEEFCCD 5EJGKPG+ Z ++WPF+++



ex 8618

ex 8619



-CWMGJOGP JGWVG,CUPQLG .CPFIGOGKPFG-QPXQNWV„/CTM#RTKN 5VGORGNXCTKCPVGP  -GNNGT-CTRKPUMKCD4LCD 5EJGKPG+





-ÌPKIUDGTI/CIKUVTCV-QPXQNWV2HGPPKI#RTKN 8CTKCPVGP\YGKFCXQPOKVTQVGO#WH FTWEM /WUVGT OKV 2GTHQTCVKQP WPIÒNVKI WPF /WUVGT OKV 2GTHQTCVKQP WPIÒNVKI   /CTM    1MVQDGT   8CTKCPVGP OKV UEJYCT\GO #WHFTWEM /WUVGT OKV 2GTHQTCVKQP WPIÒNVKI WPF   WPGPVYGTVGV   /CTM  1MVQDGT  WPGPVYGTVGV WPF OKV 2GTHQTCVKQP WPIÒNVKI   /CTM   1MVQDGT  WPGPVYGTVGV WPF OKV 2GTHQTCVKQP WPIÒNVKI   /CTM  5GRVGODGT   

9CUUGT\GKEJGPXCTKCPVGP /CTM/CTM5GRVGODGT-GNNGTCECE -CTRKPUMK4LCD  5EJGKPG+p+++



ex 8620



110

-ÌPKIUDGTI/CIKUVTCV-QPXQNWV/CTMªDGTFTWEMCWH/CTM/CTMªDGTFTWEM CWH  /CTM  /KNNKQP ªDGTFTWEM CWH  /CTM 4GKJG # WPF $  CNNG OKV CNVGO &CVWO    5GRVGODGT   /KNNKQP /CTM  -0  8CTKCPVGP   /KNNKQPGP /CTM  -0  8CTKCPVGP    #WIWUV/KNNKQPGP/CTMªDGTFTWEMCWH/CTMXQO5GRVGODGT 4ÒEMUGKVGJKP VGTNGIV     Z   /KNNKQPGP /CTM  5GRVGODGT   /KNNKCTFG /CTM  1MVQDGT     /KNNKCTFGP /CTM  1MVQDGT    /KNNKCTFGP /CTM  $KNNKQP /CTM  1MVQDGT   -GNNGTCR-CTRKPUMK4LCDHH 5EJGKPG+p8




PAPIERGELD

ex 8621





-ÌPKIUDGTI 4GKEJUDCJPFKTGMVKQP -QPXQNWV  /CTM  #WIWUV  -0   WPF   UVGNNKI   /KNNKQP /CTM  #WIWUV  -0  WPF UVGNNKI OKV 5VGTP   /KNNKQPGP /CTM    #WIWUV   /KNNKCTFGP /CTM ªDGTFTWEM CWH  /KNNKQPGP /CTM  #WIWUV      /KNNKCTFGP /CTM  1MVQDGT   -GNNGT  CF 4KZGP  -CTRKPUMK    4LCD 5EJGKPG+++p+8



-ÌPKIUDGTI4GKEJUDCJPFKTGMVKQP$KNNKQP/CTM0QXGODGT9\5VTGKHGPWPF9GNNGPD·PFGT -GNNGTG4KZGP-CTRKPUMKF +



ex 8623







8622

ex 8625

-ÌPKIUDGTI -ÌPKINKEJG 4GIKGTWPIU  *CWRVMCUUG -QPXQNWV    /CTM  1MVQDGT    2CRKGTJGNNDTCWPITCWJGNNITCWITÒPJGNNQNKXITCW/CTM1MVQDGT2CRKGTJGNNITCWTQV -GNNGTCD-CTRKPUMKCECDF 5EJGKPG+p+++



-ÌPKIUDGTI )KTQ  8GTDCPF HÒT 1UV WPF 9GUVRTGW­GP -QPXQNWV  /KNNKCTFGP /CTM ªDGTFTWEM   CWH  /CTM  /KNNKCTFGP /CTM ªDGTFTWEM CWH  /KNNKQP /CTM  /KNNKCTFGP /CTM ªDGT   FTWEM CWH   /KNNKQPGP /CTM  /KNNKCTFGP /CTM ªDGTFTWEM CWH  /KNNKQPGP /CTM CNNG XQO    #WIWUV/KNNKCTFGP/CTM1MVQDGT$KNNKQP/CTM0QXGODGT-GNNGT DF-CTRKPUMK 5EJGKPG+p+++



-ÌPKIUDGTI2TQXKP\KCNXGTDCPF1UVRTGW­GP-QPXQNWV2HGPPKI&G\GODGT 8CTKCPVGP QJPG #WUICDG #WUICDG + ++ +++  5VÒEM OKV #WHFTWEM#WHUEJTKHV 0WT HÒT 5COONGT\YGEMG   XGTUEJKGFGPG 9CUUGT\GKEJGP   /CTM  &G\GODGT   8CTKCPVGP Z OKV 0WT HÒT 5COONGT   \YGEMG   /CTM  &G\GODGT   8CTKCPVGP Z OKV 0WT HÒT 5COONGT\YGEMG      /CTM  1MVQDGT   /CTM ªDGTFTWEM CWH  /CTM 4GKJG # $   /KNNKQP /CTM   ªDGTFTWEMCWH/CTM 4GKJG#$ /KNNKQPGP/CTMªDGTFTWEMCWH/CTMXQO&G\GODGT  8CTKCPVGP -GNNGTCJCG-CTRKPUMKCJCFDECC CDCDCH 5EJGKPG+p+++

 111


PAPIERGELD

ex 8628 ex 8626







-ÌPKIUDGTI 2TQXKP\KCNXGTDCPF 1UVRTGW­GP -QPXQNWV  /KNNKQPGP /CTM  #WIWUV     /KNNKQPGP /CTM  #WIWUV   8CTKCPVGP    /KNNKQPGP /CTM  5GRVGODGT   

 /KQ KP  8CTKCPVGP   /KNNKQPGP /CTM  1MVQDGT   8CTKCPVGP   /KNNKCTFG /CTM    1MVQDGT   /KNNKCTFGP /CTM  1MVQDGT   /KNNKCTFGP /CTM  1MVQDGT     /KNNKCTFGP /CTM  1MVQDGT   8CTKCPVGP  -GNNGT IR-CTRKPUMK CFCFCCF 5EJGKPG/GKUV+++



-ÌPKIUDGTI 2TQXKP\KCNXGTDCPF 1UVRTGW­GP -QPXQNWV  /KNNKCTFGP /CTM  1MVQDGT   

8CTKCPVGP /KNNKCTFGP/CTM1MVQDGT 8CTKCPVGP /KNNKCTFGP/CTM1MVQDGT   8CTKCPVGP \YGK FCXQP QJPG FGP ITCWXKQNGVVGP &TWEM  -GNNGT  S T U -CTRKPUMK   CDCJDEF( 5EJGKPG/GKUV+++



-ÌPKIUDGTI 2TQXKP\KCNXGTDCPF 1UVRTGW­GP  $KNNKQPGP /CTM  0QXGODGT  -0 UVGNNKI   OKV 5VGTP -GNNGT  T H·NUEJNKEJ UVCVV V  -CTRKPUMK 8CTKCPVGHGJNV .KPMUWPVGPGKPGMNGKPG (GJNUVGNNG 44+++p+84ÒEMUGKVG)TCHHKVQ



ex 8629 ex 8631



-ÌPKIUDGTI2TQXKP\KCNXGTDCPF1UVRTGW­GP-QPXQNWV2HGPPKI)QNF&QNNCT 5GTKG#$   /CTM )QNF   &QNNCT 5GTKG # $   /CTM )QNF    &QNNCT  8CTKCPVGP    CNNG  0QXGODGT   2HGPPKI )QNF   &QNNCT  /CTM )QNF   &QNNCT    0QXGODGT  -GNNGT  C D -CTRKPUMK  CE  C D  D E  D  C   4LCD 5EJGKPG+p+++





-ÌPKIUDGTI /CTMGPJCWU FGU 1UVGPU 'NWMC )OD* -QPXQNWV  Z  2HGPPKI  /CK  DKU   &G\GODGT&C\W9CPFGTCWUUVGNNWPI1UVRTGW­GP1UVDCPMHÒT*CPFGNWPF)GYGTDG&GRQUK VGP-CUUG *WHGP 5VCFVVGKN XQP -ÌPKIUDGTI   /CTM  )TCD/GJN    -CTRKPUMK    5EJGKPG+





.CDKCW 5VCFVIGOGKPFG -QPXQNWV  2HGPPKI Q &   -TGKU  2HGPPKI Q &   -0    8CTKCPVGPGPVYGTVGVWPFWPGPVYGTVGV5VÒEM/CTMQ&  GPVYGTVGV/CTMQ&

 GPVYGTVGV-GNNGT-CTRKPUMKECDCCE4LCD  5EJGKPG+p+++



112


PAPIERGELD

8637

ex 8635

ex 8632



8634

/GOGN JGWVG -NCKRGFC .KVCWGP  *CPFGNUMCOOGT FGU /GOGNIGDKGVU -QPXQNWV Â&#x201E;          9CUUGT\GKEJGP8CTKCPVGP    /CTM  (GDTWCT  &C\W /GOGN 5VCFV   Â&#x201E; /CTM Q &    8CTKCPVGP FGT &TWEMTCJOGP  WPF  OO NCPI  &C\W GKP ITCWGT -CTVQP    Z  OO OKV FGO FTGK\GKNKIGP #WHFTWEM4GKEJU$CJP-COGTCFUEJCHVYGTM/GOGN-GNNGT )TCD/GJN-CTRKPUMKCDCCCCC C4LCD PKEJVMQORNGVV  5EJGKPG+p+++



/GOGN JGWVG-NCKRGFC.KVCWGP 'TKEJ5VGRJCPK)TÃ&#x2019;PG#RQVJGMG-QPXQNWV2HGPPKI Q&9GTVJCPFIGUEJTKGDGP(KTOGPPCOGIGUVGORGNV+PFGT.KVGTCVWTPKEJVPCEJYGKUDCT2CRKGT\6 DTÃ&#x2019;EJKI 5EJGKPG+p+++





2CPGXGĻKU .KVCWGP &CTDKPKPMK#VUVQXW6CT[DC #TDGKVGTFGRWVKGTVGPTCV -QRGMGPQ&   4LCD 5GJTUGNVGP+





2KNNMCNNGP JGWVG&QDTQXQNUM /CIKUVTCV-QPXQNWV2HGPPKI WPGPVYGTVGV /CTM 8CTKCPVGP   /CTM  /CTM  7PVGTUEJTKHVUXCTKCPVGP   1MVQDGT  $KU CWHFGPGTY·JPVGPCNNGGPVYGTVGV -GNNGT++-CTRKPUMKDGE4LCD 5EJGKPG+ Z ++WPF+++



2KNNMCNNGP JGWVG &QDTQXQNUM  8QTUEJWUU  8GTGKP -QPXQNWV   /CTM Q &   QJPG FKG   DGKFGP7PVGTUEJTKHVGPFGT#WUIGDGT/CTMQ&  OKVFGPDGKFGP7PVGTUEJTKHVGP2HGPPKI  ,WPK 5VGORGN WPF2HGPPKI/CK 5VGORGN &KGGT5EJGKPGGPVYGTVGV-GNNGT CD-CTRKPUMKCEGD4LCDDG 5EJGKPG+p+++



2TGWUUKUEJ'[NCW/CIKUVTCV2HGPPKI5GRVGODGTWPGPVYGTVGV-GNNGT-CTRKPUMK 4LCD +8









ex 8638



ex 8640

4CIPKV JGWVG 0GOCP  /CIKUVTCV -QPXQNWV Â&#x201E;   /CTM Q &   /WUVGTUEJGKPG QJPG -0   Â&#x201E; /CTM  8CTKCPVGP GKPG  FCXQP WPGPVYGTVGV   /CTM  8CTKCPVGP   /CTM  8CTKCPVGP    /CTMQ&  8GTUEJKGFGPG7PVGTUEJTKHVGP-0WPF5VGORGNXCTKCPVGP$KUCWHFGPIGPCPPVGP 5EJGKP UKPF CNNG TÃ&#x2019;EMUGKVKI OKV FGO 8GTOGTM 'PVYGTVGV XGTUGJGP Â&#x201E; /CTM  (GDTWCT   

 8CTKCPVGP  Â&#x201E; /CTM  &G\GODGT  -GNNGT  CI  C D -CTRKPUMK   E F   CD4LCD 5EJGKPG+p+8





4CWUEJGP1UVUGGDCF-QPXQNWV/CTM/CK)TCD/GJNWPF-CTRKPUMK 4LCD 5EJGKPG+ Z WPF++





4W­ JGWVG4WUP¾.KVCWGP )GOGKPFG-QPXQNWV2HGPPKI/CK 8CTKCPVGP 2HGPPKI ,WNK 8CTKCPVGPFCXQPQJPG7PVGTUEJTKHV -GNNGTCD-CTRKPUMKCECD F4LCD 5EJGKPG+p+++

 113


PAPIERGELD

ex 8641

ex 8642





5RNKVVGT -TU 6KNUKV )GOGKPFG -QPXQNWV  2HGPPKI Q &  2HGPPKI OKV IGUVGORGNVGO &CVWO    5GRV  DGKFG 5EJGKPG GPVYGTVGV FWTEJ 2GTHQTCVKQP   /CTM Q &   -GNNGT  C D   -CTRKPUMKCDFC 5EJGKPG+ Z p+++



5VCNNWRÌPGP JGWVG0GUVGTQX -TGKUCWUUEJW­-QPXQNWV/KNNKQP 8CTKCPVGP /KNNKQ PGP/CTM 8CTKCPVGP #WIWUV-GNNGTC-CTRKPUMKCCDCD  5EJGKPG+++p+8



ex 8644

ex 8643



5VCNNWRÌPGP JGWVG 0GUVGTQX  -TGKUCWUUEJW­ -QPXQNWV   )QNFRHGPPKI  )QNFOCTM  0Q   XGODGT-GNNGT-CTRKPUMKCE4LCD 5EJGKPG++p+++





6KNUKV JGWVG 5QXLGUM  /CIKUVTCV -QPXQNWV „  /CTM Q &   „ /CTM  5GRVGODGT   

&CVWO JKP\WIGUVGORGNV  WPGPVYGTVGV  /CTM  'PVYGTVWPIUXCTKCPVGP   /CTM  7PVGTUEJTKHVU   XCTKCPVGP /CTM/CTM 7PVGTUEJTKHVUXCTKCPVGP 5GRVGODGT#NNGDKUCWHFGPIGPCPPVGP GPVYGTVGV-GNNGTCI-CTRKPUMKCDCDECD 5EJGKPG+++



ex 8645



114

6KNUKV JGWVG5QXLGUM /CIKUVTCV-QPXQNWV„/CTM&G\GODGT 8CTKCPVGPFCXQPGPV YGTVGV   2HGPPKI  #RTKN   8CTKCPVGP  FCXQP GPVYGTVGV   2HGPPKI  (GDTWCT    /CTM 8CTKCPVGP /CTM 8CTKCPVGP /CTM/CTM 8CTKCPVGP 1MVQDGTDKU (GDTWCT/CTM 8CTKCPVGP /CTM 8CTKCPVGP 1MVQDGTDKU#RTKN&KG 5EJGKPGDKU/CTMCNNGGPVYGTVGVFWTEJ2GTHQTCVKQP2HGPPKI/CTM0QXGODGT -GNNGT  CG  CE )TCD/GJN  -CTRKPUMK     CF HJ   CF4LCD 5EJGKPG+p+++




PAPIERGELD 

6KNUKV JGWVG 5QXLGUM  /CIKUVTCV -QPXQNWV  /CTM  /CTM  8CTKCPVGP   /KNNKQP   /CTM  8CTKCPVGP   /KNNKQPGP  /CTM  8CTKCPVGP   #WIWUV     /KNNKCTFGP /CTM   1MVQDGT„)QNFOCTM0QXGODGT-GNNGTCDC-CTRKPUMKCDF CFCDEDD4LCDC 5EJGKPG+p+++



ex 8647



<KPVGP JGWVG-QTPGYQ /CIKUVTCV-QPXQNWV2HGPPKI#WIWUV QFGT#WI  8CTKCPVGP  /CTM#WI 8CTKCPVGP 0CEJ*CPFUEJTKHVXGTXKGNH·NVKIVG5EJGKPG8CTKCPVGPKPFGT5EJTKHV KPFGT&CVWOUCPICDG5VGORGNHCTDGDNCWQFGTXKQNGVV-GNNGTCE-CTRKPUMK  5EJGKPG+p++



8648

4755+5%*'4/ª0<5%*/7%- 

5KNDGTPG*CNUMGVVGOKVHQNIGPFGPHÒPH/ÒP\GP2GVGT+4WDGN 2QNVKPC WPF-CVJCTKPC++ 4WDGN 5V2GVGTUDWTI 2CWN+4WDGN 5V2GVGTUDWTI 0KGFGTNCPFG7VTGEJV5KNDGTFWMCV 5EJÌPpUGJTUEJÌP

 115


%*+0'5+5%*'/ª0<'0

9001

'+0'$#0-016'&'4/+0)&;0#56+' &#5'456'2#2+'4)'.&&'49'.6  116

*QPI 9W  /KPI &[PCUVKG   $CPMPQVG KO 9GTV XQP  -WCP  -·UEJ    Q,2KEM## &KGGTUVG$CPMPQVGFGT9GNV-N.QEJWPFGKPKIGFÃ&#x2019;PPG5VGNNGPUQPUV+++p+8 


WEN ZONG

9002

&+'/ª0<'0&'5-#+5'44'+%*570&&'44'27$.+-%*+0# 

9GP<QPI-·UEJ2GMKPI (KPCP\OKPKUVGTKWO (&*CTVKNN  -N.QEJUQPUVUGJTUEJÌP

9003

9004



9005



-·UEJ2GMKPI #TDGKVUOKPKUVGTKWO (&*CTVKNN

5GJTUEJÌP





-·UEJ*WPCP 2TQXKP\ 2T·IWPICWHFKEMGO5EJTÌVNKPII(&*CTVKNN  5EJÌPpUGJTUEJÌP





-·UEJ*WRGJ 2TQXKP\ /ÒP\UV·VVG9WEJCPI(&*CTVKNN



8QT\ÒINKEJ

117


WEN ZONG

9006



-·UEJ,KCPIUW 2TQXKP\ (&XIN*CTVKNN

5GJTUEJÌP



<CRQPKGTVUGJTUEJÌP



9007



-·UEJ,KCPIUW 2TQXKP\ (&*CTVKNN

9008

   118

9009

-·UEJ2GMKPI #TDGKVUOKPKUVGTKWO (&*CTVKNN -·UEJ2GMKPI (KPCP\OKPKUVGTKWO (&*CTVKNN -·UEJ5\GEJWCP 2TQXKP\ (&*CTVKNN

9010

5GJTUEJÌP 5GJTUEJÌP 5GJTUEJÌP

  


WEN ZONG

9011

  

9012

-·UEJ5\GEJWCP 2TQXKP\ (&*CTVKNN -·UEJ*WPCP 2TQXKP\ (&*CTVKNN -·UEJ,KCPIZK 2TQXKP\ /ÒP\UV·VVG0CPEJCPI(&*CTVKNN

9013

5GJTUEJÌP 5GJTUEJÌPpXQT\ÒINKEJ 5GJTUEJÌP

  

8QT\ÒINKEJ



-·UEJ2GMKPI #TDGKVUOKPKUVGTKWO (&\W*CTVKNN\W  5VÒEM#NVGFGMQTCVKXG8GT\KGTWPIGPKO(GNFUGJTUEJÌPpXQT\ÒINKEJ



9014



-·UEJ2GMKPI #TDGKVUOKPKUVGTKWO (&*CTVKNN

ex 9015



119


ALLGEMEINE PRÄGUNGEN

ex 9017 9016

9016



#NNIGOGKPG2T·IWPIGP&QNNCTQ,  6KGPVUKP&CX-CPP./  <YGK-QPVGTOCTMGP %JQROCTMU CWHFGT8QTFGTUGKVGUQPUVHCUVXQT\ÒINKEJ



 %GPVU Q ,   6KGPVUKP &C\W 2TQXKP\ *WRGJ  %GPVU Q ,   -CPP     ./ 5VÒEM5GJTUEJÌPWPFUGJTUEJÌPpXQT\ÒINKEJ

 

9018

9019

9019



-W%CUJ6KGPVUKP;GQ

5GNVGPKPFKGUGT'TJCNVWPI*ÒDUEJG2CVKPCXQT\ÒINKEJ



&QNNCT,CJT  6KGPVUKP+P752NCUVKMJQNFGTFGT2%)5OKVFGT$GYGTVWPI/5&CX -CPP./ 8QT\ÒINKEJp5VGORGNINCP\ 

9020

 

&QNNCT,CJT  6KGPVUKP&CX-CPP./ &QNNCT,CJT  6KGPVUKP&CX-CPP./

9022

  120

&QNNCT,CJT  6KGPVUKP&CX-CPP./ &QNNCT,CJT  6KGPVUKP&CX-CPP./



9021

*ÒDUEJG2CVKPCXQT\ÒINKEJ 8QT\ÒINKEJ

 

9023

(CUVXQT\ÒINKEJ (CUVXQT\ÒINKEJ

 


PROVINZ CHEKIANG

9025

9024



&QNNCT,CJT  6KGPVUKP&CX-CPP./

5GJTUEJÌPpXQT\ÒINKEJ





&QNNCT,CJT  6KGPVUKP&CX-CPP./

#VVTCMVKXGUUGJTUEJÌPGU'ZGORNCT



9026

9027



&QNNCT,CJT  6KGPVUKP&CX-CPP./  <YGKMN-QPVGTOCTMGP %JQROCTMU KO(GNFFGT8QTFGTUGKVGUGJTUEJÌP





&QNNCT,CJT  6KGPVUKP&CX-CPP./



9028

9030

9KP\4CPFHGJNGTUGJTUEJÌP

ex 9032

9031



&QNNCT,CJT  6KGPVUKP&CX-CPP./  /GJTGTGMN-QPVGTOCTMGP %JQROCTMU MN4CPFHGJNGTUGJTUEJÌP





&QNNCT,CJT  6KGPVUKP&C\W&QNNCTWPF&QNNCT./  5VÒEM5GJTUEJÌP





%GPVU,CJT  6KGPVUKP-CPP./





2TQXKP\#PJYGK&QNNCT,CJT  &CX-CPP./



2TQXKP\%JGMKCPI%GPVU-CPP./

*ÒDUEJG2CVKPCHCUVXQT\ÒINKEJ 45GJTUEJÌP



5VÒEM8QT\ÒINKEJp5VGORGNINCP\

 121


PROVINZ FENGTIEN

9033



1,5:1

9033

2TQXKP\(GPIVKGP (WPIVKGP &QNNCT,CJT  &CX-CPP./  #VVTCMVKXGUXQT\ÒINKEJGU'ZGORNCT

9034

9035



9036



&QNNCT,CJT  &CX-CPP./

*ÒDUEJG2CVKPCHCUVXQT\ÒINKEJXQT\ÒINKEJ





&QNNCT,CJT  &CX-CPP./

-N4CPFHGJNGTHCUVXQT\ÒINKEJ





&QNNCT,CJT  &CX-CPP./

5GJTUEJÌPpXQT\ÒINKEJ



9038

9037



&QNNCT,CJT  &CX-CPP./



%GPVU-CPP./

122

9038

5VCTMÒDGTCTDGKVGVUEJÌPpUGJTUEJÌP



5GJTUEJÌPpXQT\ÒINKEJ




PROVINZ FOOKIEN

9040

9041

9039

9039



-W%CUJQ,  ;GQ

49KP\4CPFHGJNGTUGJTUEJÌPpXQT\ÒINKEJ





%GPVU,CJT  /#0%*74+#02418+0%'5-CPP./

5GJTUEJÌP





%GPVUQ,  /#0%*74+#02418+0%'5-CPP./  5GJTUEJÌPpXQT\ÒINKEJ



9042 1,5:1



1,5:1

%GPVUQ,  /#0%*74+#02418+'0%'5-CPP./

9043

ex 9044

9045



%GPVUQ,  /#0%*74+#02418+0%'5-CPPp./



2TQXKP\(QQMKGP%GPVU&C\W%GPVU./



(CUV5VGORGNINCP\

9046



9047

8QT\ÒINKEJ



5VÒEM8QT\ÒINKEJ



%GPVU-CPPp./

8QT\ÒINKEJ





%GPVU-CPPp./

-N-TCV\GTXQT\ÒINKEJ





%GPVU-CPP FQTV ./

8QT\ÒINKEJp5VGORGNINCP\



9048

9049

9050



%GPVUQ,  -CPP./

8QT\ÒINKEJp5VGORGNINCP\





%GPVUQ,  -CPP./

8QT\ÒINKEJp5VGORGNINCP\





%GPVUQ,  -CPP./

8QT\ÒINKEJ

 123


PROVINZ HUPEH

9051 1,5:1



1,5:1

2TQXKP\ *WPCP  6CGN Q ,   &TGK\GKNKIG +PUEJTKHV *W 0CP )WCP 3KCP ,Ò <CQ  1HHK\KGNNG   /ÒP\UV·VVG XQP *WPCP <YGK\GKNKIG +PUEJTKHV 5JGP 2KP <W ;KP ;K .KCPI  'PVURTKEJV FGO )GYKEJV   XQP6CGN &WTEJOGUUGTOO&KEMGOO)GYKEJVI-CPPC./  5GJTUEJÌPpXQT\ÒINKEJ

9052



9052 1,5:1



2TQXKP\*WRGJ&QNNCTQ,  &CX-CPP./  5GNVGPKPFKGUGT'TJCNVWPI*GTTNKEJG2CVKPCXQT\ÒINKEJ

9053

   124

9054

&QNNCTQ,  &CX-CPP./ &QNNCTQ,  &CX-CPP./ &QNNCTQ,  &CX-CPP./



9055

5GJTUEJÌPpXQT\ÒINKEJ 5GJTUEJÌPpXQT\ÒINKEJ 5GJTUEJÌP

  


PROVINZ HUPEH

9056

9057



&QNNCTQ,  &CX-CPP./

5GJTUEJÌP





&QNNCTQ,  &CX-CPP./  <YGK-QPVGTOCTMGP %JQROCTMU CWHFGT8QTFGTUGKVGHCUVUGJTUEJÌP



9058

1,5:1

1,5:1



%GPVUQ,  -CPP FQTV ./  9KP\4CPFHGJNGTUQPUVCVVTCMVKXGUXQT\ÒINKEJGU'ZGORNCTOKVHGKPGT6ÌPWPI

9060

 

ex 9059

9060

%GPVUQ,  &C\W%GPVUQ,  -CPP./  5VÒEM<YGKMNGKPG-QPVGTOCTMGP %JQROCTMU CWHFGT8QTFGTUGKVGFGUp%GPVUp5VÒEMU UGJTUEJÌPWPFXQT\ÒINKEJ %GPVUQ,  -CPP./

9061

8QT\ÒINKEJ

9062



 

9061



%GPVUQ,  -CPP./



-W%CUJQ,  2*18+0%'CPUVGNNGXQP2418+0%'KPFGT7OUEJTKHV;GQC 5GNVGPG8CTKCPVGKPÒDGTFWTEJUEJPKVVNKEJGT'TJCNVWPI8QT\ÒINKEJ

8QT\ÒINKEJ

  125


PROVINZ HUPEH

9064

 

-W%CUJ;GQL -W%CUJQ,  -/

9063

9064

5GNVGPKPFKGUGT'TJCNVWPI8QT\ÒINKEJp5VGORGNINCP\ -N5VGORGNHGJNGTUEJÌPG2CVKPCXQT\ÒINKEJ

 

9065

1,5:1

1,5:1



&QNNCTQ,  &CX-CPP./

9066

   126

9067

&QNNCTQ,  &CX-CPP./ &QNNCTQ,  &CX-CPP./ &QNNCTQ,  &CX-CPP./

8QT\ÒINKEJp5VGORGNINCP\



9068

8QT\ÒINKEJ 5GJTUEJÌP -N-TCV\GTUGJTUEJÌP

  


PROVINZ KIANGNAN

9069

1,5:1



2TQXKP\-KCPIPCP&QNNCTQ,  &CX-CPP./  /GJTGTG-QPVGTOCTMGP %JQROCTMU IGRWV\VUGJTUEJÌP

9070

 

%GPVU-CPP./ &QNNCT&CX-CPP./

(CUVXQT\ÒINKEJ 48QT\ÒINKEJ

ex 9074

%GPVU-CPP./ %GPVU-CPP./ %GPVU./



9070

9071

9072

  

1,5:1

 

9073

8QT\ÒINKEJ (CUVXQT\ÒINKEJ 5VÒEM8QT\ÒINKEJ

  

-N-TCV\GTXQT\ÒINKEJ



9075



&QNNCT&CX-CPP./

127


PROVINZ KIANGSU

9076

9077



&QNNCT&CX-CPP./

*ÒDUEJG6ÌPWPIHCUVXQT\ÒINKEJ





&QNNCT&CX-CPP./  -TCV\GTTGUVCWTKGTVG-QTTQUKQPUURWTGPUQPUVHCUVXQT\ÒINKEJ



9079

9078

 

&QNNCT&CX-CPP./ &QNNCT&CX-CPP./

9081

9080

  

8QT\ÒINKEJ 5GJTUEJÌPpXQT\ÒINKEJ

&QNNCT&CX-CPP./ &QNNCT&CX-CPP./ &QNNCT&CX-CPP./

9084

9082

-N)TCHHKVQCWHFGT4ÒEMUGKVGUGJTUEJÌP -N%JQROCTMUUGJTUEJÌP (CUVUGJTUEJÌP

9083

 

  

9084



2TQXKP\ -KCPIUW -W %CUJ Q ,   '+8' CPUVGNNG XQP (+8' KP FGT 7OUEJTKHV FGT 4ÒEMUGKVG   ;GQ -N4CPFFGNNGHCUVXQT\ÒINKEJ





-W%CUJQ,  ;GQCXCT



128

*ÒDUEJG2CVKPCXQT\ÒINKEJ


PROVINZ KIRIN

9085

9086

9087



2TQXKP\-KTKP&QNNCTQ,  &CX-CPP./  8QT\ÒINKEJGU'ZGORNCTOKVCVVTCMVKXGT2CVKPC

 

&QNNCTQ,  &CX-CPP./ &QNNCTQ,  &CX-CPP./

5GJTUEJÌP -N4CPFHGJNGTUGJTUEJÌP

%GPVUQ,  -CPP./ %GPVUQ,  -CPP./

9090

 

9089

9088

 



*ÒDUEJG2CVKPCUGJTUEJÌP 5GJTUEJÌP

9091

 

9092



%GPVUQ,  -CPP./

5GJTUEJÌP





&QNNCT&CX-CPP./  &TGK-QPVGTOCTMGP %JQROCTMU CWH8QTFGTpWPF4ÒEMUGKVGHCUVUGJTUEJÌP





%GPVU-CPP./



4ÒEMUGKVGNGKEJVFG\GPVTKGTVUGJTUEJÌP

129


PROVINZ KWANGTUNG

9093

9095

9094



%GPVU-CPP./

(CUVUGJTUEJÌP





%GPVU-CPP./

5GJTUEJÌP





%GPVU-CPPHH./

(CUVXQT\ÒINKEJ



9097

9096



&QNNCT&CX-CPP./

&WPMNG6ÌPWPIXQT\ÒINKEJ





&QNNCT&CX-CPP./

5GJTUEJÌP



9099

9098



%GPVU-CPP./



&QNNCT&CX-CPP./

5GJTUEJÌP



-N4CPFHGJNGTUGJTUEJÌPpXQT\ÒINKEJ



9100

1,5:1

 130

2TQXKP\-YCPIVWPI&QNNCTQ,  &CX-CPP./

1,5:1

8QT\ÒINKEJp5VGORGNINCP\




PROVINZ KWANGTUNG

9101



1,5:1

&QNNCTQ,  &CX-CPP./

9102

9101

-N-TCV\GTXQT\ÒINKEJ

9103



9104



&QNNCTQ,  &CX-CPPC./  *ÒDUEJG2CVKPC\YGK-QPVGTOCTMGP %JQROCTMU XQT\ÒINKEJ



&QNNCTQ,  &CX-CPPC./  -N-TCV\GTWPF-QPVGTOCTMGP %JQROCTMU HCUVXQT\ÒINKEJXQT\ÒINKEJ





&QNNCTQ,  &CX-CPP./



5GJTUEJÌP



9105

1,5:1



1,5:1

%GPVUQ,  -CPP FQTV ./  5GJTUGNVGPKPFKGUGT'TJCNVWPI2TCEJVGZGORNCTXQPRQNKGTVGP5VGORGNPHCUV5VGORGNINCP\ 2TQQHNKMG

 131


PROVINZ KWANGTUNG

9106

ex 9107



%GPVU-CPP./

5GJTUEJÌP





%GPVU&C\W%GPVU-CPP FQTVLGYGKNU ./  5VÒEM-N4CPFHGJNGT Z UGJTUEJÌP



9109

9108



%GPVUQ,  -CPP./

8QT\ÒINKEJp5VGORGNINCP\





%GPVUQ,  &C\W%GPVUQ,  -CPP FQTV ./  5VÒEM8QT\ÒINKEJp5VGORGNINCP\



ex 9111

ex 9110

9112



%GPVUQ,  &C\W%GPVUQ,  -CPP FQTV ./  5VÒEM(CUVXQT\ÒINKEJWPFXQT\ÒINKEJ



 %GPVU Q ,  &C\W%GPVUWPF%GPVUQ,  -CPP FQTV ./  5VÒEM5GJTUEJÌPpXQT\ÒINKEJ



%GPVU-CPP./

 

8QT\ÒINKEJ



9114

9113



-W%CUJQ,  ;GQ

8QT\ÒINKEJ





-W%CUJQ,  ;GQ

*ÒDUEJG2CVKPCXQT\ÒINKEJ



ex 9115

9116

9116



-W%CUJQ,  &C\W%GPVUWPF%GPVU-/./ 5VÒEM8QT\ÒINKEJ





&QNNCT&CX-CPP./



132

5GJTUEJÌP


PROVINZ PEI-YANG

9117

9118



&QNNCT&CX-CPP./

5GJTUEJÌP





&QNNCT&CX-CPP./

5GJTUEJÌP



9119

9120

9120



%GPVU,CJT  -CPP./

5GNVGPGT,CJTICPI8QT\ÒINKEJp5VGORGNINCP\





2TQXKP\-YGKEJQY&QNNCT,CJT  #WVQFQNNCT&CX-CPP./  45GJTUEJÌPGU'ZGORNCT



&KGUGT#WVQFQNNCTYWTFG\WT'TKPPGTWPICPFKG'TÌHHPWPIFGTGTUVGP#WVQUVTC­GKPFGT2TQXKP\-YGKEJQYIGRT·IV

9121

1,5:1



1,5:1

2TQXKP\2GK;CPI&QNNCT,CJT  &CX-CPP./  44-N4CPFHGJNGTUGJTUEJÌPpXQT\ÒINKEJ



&KGCNVG$G\GKEJPWPIHÒTFKG2TQXKP\2GK;CPINCWVGV%JKJNKJGWVGYKTFUKG*QRGKIGPCPPV+PFGT.KVGTCVWTHKPFGV OCPFKG/ÒP\DGUEJTGKDWPIGP\WO6GKNWPVGTFGTCNVGPQFGTFGTJGWVKIGP$G\GKEJPWPIFGT2TQXKP\

133


PROVINZ PEI-YANG

9123

9122

 

&QNNCT,CJT  &CX-CPP./ &QNNCT,CJT  &CX-CPP./

9124

 

%GPVU,CJT  -CPP./ %GPVU,CJT  -CPP./

9126

  

9125

4(GKPG6ÌPWPIXQT\ÒINKEJ 5GJTUEJÌP

9124

5GJTUEJÌP #VVTCMVKXGUUGJTUEJÌPGU'ZGORNCT

9127

&QNNCT,CJT  &CX-CPP./ &QNNCT,CJT  &CX-CPP./ &QNNCT,CJT  &CX-CPP./

 

 

9128

-TCV\GTHCUVUGJTUEJÌP -N-TCV\GTUGJTUEJÌPpXQT\ÒINKEJ 5GJTUEJÌP

  

&QNNCT,CJT  &CX-CPP./  5GNVGPGT,CJTICPI-N4CPFHGJNGTUGJTUEJÌP



9129

 134


PROVINZ PEI-YANG

9130

1,5:1



1,5:1

&QNNCT,CJT  &CX-CPP./  5GJTUGNVGPKPFKGUGT'TJCNVWPI(CUV5VGORGNINCP\

9132

9131

  

&QNNCT,CJT  &CX-CPP./ &QNNCT,CJT  &CX-CPP./ &QNNCT,CJT  &CX-CPP./

9134

 

&QNNCT,CJT  &CX-CPP./ &QNNCT,CJT  &CX-CPP./



9133

8QT\Ã&#x2019;INKEJXQT\Ã&#x2019;INKEJ 9KP\4CPFHGJNGTXQT\Ã&#x2019;INKEJ 8QT\Ã&#x2019;INKEJ

  

9135

8QT\Ã&#x2019;INKEJ 8QT\Ã&#x2019;INKEJ

  135


PROVINZ PEI-YANG

9136

  

&QNNCT,CJT  &CX-CPP./ &QNNCT,CJT  &CX-CPP./ &QNNCT,CJT  &CX-CPP./

9139

  

9137

9140

&QNNCT,CJT  &CX-CPP./ &QNNCT,CJT  &CX-CPP./ &QNNCT,CJT  &CX-CPP./

9138

(CUVXQT\ÒINKEJ 5GJTUEJÌPpXQT\ÒINKEJ 5GJTUEJÌP

  

9141

#VVTCMVKXGUUGJTUEJÌPGU'ZGORNCT 5GJTUEJÌP (CUVUGJTUEJÌP

  

(CUVUGJTUEJÌP 5VÒEM5GJTUEJÌP

 

9142

  136

&QNNCT,CJT  &CX-CPP./ &QNNCT,CJT  &CX-CPP./


PROVINZ SIN KIANG

9144 9145

9145



&QNNCT,CJT  &CX#PO-CPPXCT./XCT  5GNVGPG8CTKCPVGQHHGPG9QNMG5GJTUEJÌPpXQT\ÒINKEJ





%GPVUQ,  )GPGTCN6CPI%JK;CQ-CPP FQTV ./  -N4CPFHGJNGTUGJTUEJÌP



9147 9146

9148



2TQXKP\5KP-KCPI %JKPGUKUEJ6WTMGUVCP /CEG 6GPIC  #* *QVCP-/p 445GJTUEJÌP





/CEG #* -CPP./

45GJTUEJÌP





/CEG #* -CPP./

5GJTUEJÌP



9149

9150

9151

9152



/CEG #* -CPP./

5GJTUEJÌP





6CGNQ,  &CX-CPP./

8QT\ÒINKEJ





6CGNQ,  &CX-CPP./

8QT\ÒINKEJ





/CEGQ,  -CPP FQTV ./

5GJTUEJÌP

 137


PROVINZ SIN KIANG

9153

9154



/CEGQ,  -CPP FQTV ./

8QT\ÒINKEJ





/CEGQ,  -CPP FQTV ./

5GJTUEJÌP



5GJTUEJÌP



5VÒEM5EJÌPpUGJTUEJÌP



4(CUVXQT\ÒINKEJ



9155

9157



/CEGQ,  -CPP FQTV ./



/CEGQ,  -CPP Z  Z ./ Z  Z 



/CEGQ,  -CPP FQTV ./

9158

1,5:1

1,5:1



/CEGQ,  -CPP FQTV ./

9159

9160

5GNVGPKPFKGUGT'TJCNVWPI(CUVXQT\ÒINKEJ

9161



9162



/CEG #* -CPP./

44(CUVUGJTUEJÌP





/CEG #* -CPP./

5EJÌPpUGJTUEJÌP





/CEG,CJT  -CPP./

8QT\ÒINKEJ





/CEG,CJT  -CPP./

5GJTUEJÌP



138


PROVINZ SIN KIANG

9163

9164

9165



&QNNCT,CJT  &CX-CPP./

5GJTUEJÌP





&QNNCT,CJT  &CX-CPP./

(CUVUGJTUEJÌPUGJTUEJÌP





&QNNCT,CJT  &CX-CPP./

2T·IGUEJY·EJGCO4CPFUGJTUEJÌP



9166

9167

9168



&QNNCT,CJT  &CX-CPP./  5EJYCEJCWUIGRT·IVMN4CPFHGJNGTHCUVUGJTUEJÌP





&QNNCT,CJT  &CX-CPP./

-N-QTTQUKQPUUVGNNGPUQPUVUGJTUEJÌP





&QNNCT,CJT  &CX-CPP./  5GNVGPGT,CJTICPI-N2T·IGUEJY·EJGUGJTUEJÌP

 139


PROVINZ SIN KIANG

9169



9170

&QNNCT,CJT  &CXp-CPP./;GQ

9171

-N4CPFHGJNGTUGJTUEJÌP



'UJCPFGNVUKEJJKGTDGKWOFKGNGV\VG2T·IWPIFGTEJKPGUKUEJGP4GRWDNKMCWHFGO(GUVNCPFXQTFGT/CEJVÒDGTPCJOG FWTEJFKGMQOOWPKUVKUEJG2CTVGK&KG/ÒP\GPFGT2TQXKP\\GKIGPUQYQJNGKPGEJKPGUKUEJGCNUCWEJGKPGCTCDKUEJG .GIGPFG



&QNNCT,CJT  &CXp-CPP./;GQ

5GJTUEJÌP





&QNNCT,CJT  &CXp-CPP./;GQ  5EJTÌVNKPIUHGJNGTMN-TCV\GTUGJTUEJÌP



9172

9173

9174



&QNNCT,CJT  &CXp-CPP./;GQ

5GJTUEJÌP





&QNNCT,CJT  &CXp-CPP./;GQ

5EJTÌVNKPIUHGJNGTUGJTUEJÌP





&QNNCT,CJT  &CXp-CPP./;GQ

5GJTUEJÌP



140


PROVINZ SZE-CHUEN

ex 9175



.165 /ÒP\UV·VVG -CUJICT  /CEG  ./    /CEG  ./    /CEG   

./    /CEG  ./    /CEG  ./   /CEG  ./      /CEG  ./    /CEG  ./   /CEG  ./    /CEG   

./   Z  /CEG  ./    /CEG  ./   +PVGTGUUCPVGU .QV   DKVVGDGUKEJVKIGP 5VÒEM/GKUVUGJTUEJÌP

9177

ex 9176







ex 9176

/ÒP\UV·VVG 6KJYC  /CEG  ./    /CEG  ./    /CEG  ./     /CEG ./ /CEG ./ /CEG ./ +PVGTGUUCPVGU.QVDKVVG DGUKEJVKIGP 5VÒEM/GKUVUGJTUEJÌP



2TQXKP\5\G%JWGP&QNNCTQ,  &CXp-CPP./



9178

9179

5GJTUEJÌP

9180



&QNNCTQ,  &CXp-CPP./

5GJTUEJÌP





&QNNCTQ,  &CXp-CPP./

5GJTUEJÌP





&QNNCTQ,  &CXp-CPP./#  5GNVGPG8CTKCPVGOKVITQ­GO&TCEJGPMQRH5GJTUEJÌP

 141


PROVINZ TIBET

9181

9182

9182



%GPVU-CPPp./



&QNNCT,CJT  &CX-CPP./

9183

9184

5GJTUEJÌPpXQT\ÒINKEJ



(CUVXQT\ÒINKEJ



9185



&QNNCT,CJT  &CX-CPP./

(CUVXQT\ÒINKEJ





&QNNCT,CJT  &CX-CPP./

(CUVXQT\ÒINKEJ





&QNNCT,CJT  &CX-CPP./

(CUVXQT\ÒINKEJ





&QNNCT,CJT  &CX-CPP./

5VÒEM/GKUVUGJTUEJÌP



2TQXKP\6CKYCP&QNNCTQ,  1NF/CP&QNNCT&CX-CPP./XCT  /KV\CJNTGKEJGP-QPVGTOCTMGP %JQROCTMU HGKPG6ÌPWPIUGJTUEJÌP



9187



'UJCPFGNVUKEJJKGTDGKWOFKGGTUVG2T·IWPIGKPGUEJKPGUKUEJGP5KNDGT&QNNCTU'TGPVUVCPFKO4GIKGTWPIULCJT FGU-CKUGTU6CQ-YCPI  WOFKG6TWRRGP\WDG\CJNGPFKGFGP#WHUVCPFXQP%JCPI9GPCWHFGT+PUGN (QTOQUC PKGFGTUEJNCIGP UQNNVGP #WH FGT 8QTFGTUGKVG KUV FGT )QVV FGT .CPINGDKIMGKV UQIGP 1NF /CP  CDIGDKNFGV   &KG 4ÒEMUGKVG \GKIV GKP 1RHGTIGH·­ CWH FTGK $GKPGP WOIGDGP XQP XKGT OCPFUEJWTKUEJGP 5EJTKHV\GKEJGP +JTG   $GFGWVWPI KUV (QTOQUC QDGP WPF WPVGP  -[CJK NKPMU YQOÌINKEJ FGT 0COG FGT 5VCFV -CIK  WPF *QQ TGEJVU   5VCCVUUEJCV\  /CPFUEJWTKUEJ YCT FKG 5RTCEJG CO *QH FGT 3KPI&[PCUVKG FKG XQP  DKU  ÒDGT %JKPC   JGTTUEJVG

 142

2TQXKP\ 6KDGV -NGKPG 5COONWPI XQP MWRHGTPGP  5VÒEM  WPF UKNDGTPGP  5VÒEM  /ÒP\GP FGU   ,CJTJWPFGTVUCWU6KDGV+PVGTGUUCPVGU.QVDKVVGDGUKEJVKIGP 5VÒEM/GKUVUGJTUEJÌP




PROVINZ YUN-NAN

9189

9190

9191

 

2TQXKP\;WPPCP&QNNCT&CX-CPP./ (CUVXQT\ÒINKEJ &QNNCT&CX-CPP./ *ÒDUEJG6ÌPWPIUGJTUEJÌPpXQT\ÒINKEJ

 



&QNNCT&CX-CPP./



9192

5GJTUEJÌP

9194



&QNNCT&CX-CPP./



%GPVU Z ./ Z 



&QNNCTQ,  -CPP./



&QNNCTQ,  &CX-CPP./

9195

5GJTUEJÌP



5VÒEM5GJTUEJÌPpXQT\ÒINKEJ



*ÒDUEJG2CVKPCHCUVXQT\ÒINKEJXQT\ÒINKEJ



9KP\4CPFHGJNGTHCUVXQT\ÒINKEJ



*ÒDUEJG2CVKPCHCUVXQT\ÒINKEJ



9196



%GPVUQ,  -CPP./

143


PROVINZ YUN-NAN

9197



&QNNCTQ,  &CX FQTV -CPP FQTV ./

5GJTUEJÌPpXQT\ÒINKEJ



9198 1,5:1

1,5:1



 ;WCP Q ,   )GPGTCN 6CPI %JK ;CQ +P 752NCUVKMJQNFGT FGT 2%)5 OKV FGT $GYGTVWPI   /5I(GKPIQNF(D-CPP./ )1.&8QT\ÒINKEJp5VGORGNINCP\ 

9199 1,5:1



1,5:1

 ;WCP Q ,   )GPGTCN 6CPI %JK ;CQ +P 752NCUVKMJQNFGT FGT 2%)5 OKV FGT $GYGTVWPI   /5I(GKPIQNF(D-CPP./ )1.&8QT\ÒINKEJp5VGORGNINCP\ 

9200 1,5:1



1,5:1

 ;WCP Q ,   )GPGTCN 6CPI %JK ;CQ +P 752NCUVKMJQNFGT FGT 2%)5 OKV FGT $GYGTVWPI   /5I(GKPIQNF(D-CPP./ )1.&8QT\ÒINKEJ 

9201

1,5:1

 144

1,5:1

 ;WCP Q ,   )GPGTCN 6CPI %JK ;CQ +P 752NCUVKMJQNFGT FGT 2%)5 OKV FGT $GYGTVWPI   /5I(GKPIQNF(D-CPP./ )1.&8QT\ÒINKEJ 


PROVINZ YUN-NAN

9202 1,5:1

1,5:1



 ;WCP Q ,   )GPGTCN 6CPI %JK ;CQ +P 752NCUVKMJQNFGT FGT 2%)5 OKV FGT $GYGTVWPI   /5I(GKPIQNF(D-CPP./ )1.&8QT\ÒINKEJ 

9203 1,5:1

1,5:1



 ;WCP Q ,   )GPGTCN 6CPI %JK ;CQ +P 752NCUVKMJQNFGT FGT 2%)5 OKV FGT $GYGTVWPI   #7I(GKPIQNF(D-CPP./ )1.&8QT\ÒINKEJ 

9204 1,5:1

1,5:1



;WCPQ,  )GPGTCN6CPI%JK;CQI(GKPIQNF(D-CPP./  )1.&45GJTUEJÌPpXQT\ÒINKEJ



9205

1,5:1



1,5:1

;WCPQ,  )GPGTCN6CPI%JK;CQI(GKPIQNF(D-CPP./  )1.&48QT\ÒINKEJ



9206

1,5:1



1,5:1

;WCPQ,  )GPGTCN6CPI%JK;CQI(GKPIQNF(D-CPP./  )1.&48QT\ÒINKEJ

 145


REPUBLIK

9207

9208

9209



.KCPI 6CGN  Q ,   )GRT·IV HÒT FKG EJKPGUKUEJGP 6TWRRGP CP FGT )TGP\G ;WPPCP$WTOC   &CX-CPP./ -N-TCV\GTXQT\ÒINKEJ





.KCPI 6CGN  Q ,   )GRT·IV HÒT FKG EJKPGUKUEJGP 6TWRRGP CP FGT )TGP\G ;WPPCP$WTOC   &CX-CPP./ 9KP\4CPFHGJNGTHCUVXQT\ÒINKEJ





.KCPI 6CGN  Q ,   )GRT·IV HÒT FKG EJKPGUKUEJGP 6TWRRGP CP FGT )TGP\G ;WPPCP$WTOC   &CX-CPP./ 5GJTUEJÌPpXQT\ÒINKEJ



9210



.KCPI 6CGN  Q ,   )GRT·IV HÒT FKG EJKPGUKUEJGP 6TWRRGP CP FGT )TGP\G ;WPPCP$WTOC   &CX-CPP./ 5GJTUEJÌPXQT\ÒINKEJ





.16  &QNNCT  ./    &QNNCT  ./   Z  &QNNCT  ./     &QNNCT ./  5VÒEM5GJTUEJÌPpHCUVXQT\ÒINKEJ



9212



1,5:1

4GRWDNKM&QNNCTQ,  CWHFKG9CJNXQP.K;WCP*WPI\WO8K\GRT·UKFGPVGP&CX-CPP ./ 5GJTUGNVGPKPFKGUGT'TJCNVWPI2TCEJVGZGORNCT(GKPG6ÌPWPIHCUV5VGORGNINCP\ 'ZGORNCTFGT5NI,QJP9)CTTGV6GKN#WMVKQP0(#$CPM.GW<ÒTKEJ0T

146

9212




REPUBLIK

9213

9214

9215



 &QNNCT Q ,   CWH FKG 9CJN XQP .K ;WCP *WPI \WO 8K\GRT·UKFGPVGP &CX  -CPP    ./ 8QT\ÒINKEJ 



 &QNNCT Q ,   CWH FKG 9CJN XQP .K ;WCP *WPI \WO 8K\GRT·UKFGPVGP &CX  -CPP    ./ (CUVXQT\ÒINKEJ 



 &QNNCT Q ,   CWH FKG 9CJN XQP .K ;WCP *WPI \WO 8K\GRT·UKFGPVGP &CX  -CPP    ./ 9KP\4CPFHGJNGTHCUVXQT\ÒINKEJ 

9216

9217

9218



 &QNNCT Q ,   CWH FKG 9CJN XQP .K ;WCP *WPI \WO 8K\GRT·UKFGPVGP &CX  -CPP    ./ (CUVUGJTUEJÌPUGJTUEJÌP



&QNNCTQ,  5WP;CV5GP&CX-CPP./



&QNNCTQ,  CWHFKG)TÒPFWPIFGT4GRWDNKM5WP;CV5GP&CX#PO-CPP ./ 5GNVGPG8CTKCPVGOKVHÒPHUVTCJNKIGO5VGTP5GJTUEJÌPpXQT\ÒINKEJ 

(GKPG2CVKPCUGJTUEJÌP

 

147


REPUBLIK

9219

9220

9221

9221



%GPVU-CPP./

8QT\ÒINKEJp5VGORGNINCP\





%GPVU-CPP./

8QT\ÒINKEJ





%CUJQ,  /GUUKPI)GPGTCN6CPI%JK;CQ-/

5GJTUEJÌP



9222

1,5:1



1,5:1

 &QNNCT Q ,   CWH FKG 8GTGKPKIWPI XQP 0QTF WPF 5ÒFEJKPC WPF FKG 9CJN XQP ;WCP5JKJ-CK \WO2T·UKFGPVGP&CX-CPP./  5GJTUGNVGPKPFKGUGT'TJCNVWPI2TCEJVGZGORNCTOKVJGTTNKEJGT6ÌPWPI5VGORGNINCP\



'TYQTDGPXQP$CNFYKP.QPFQP

9223

9224



 &QNNCT Q ,   CWH FKG 8GTGKPKIWPI XQP 0QTF WPF 5ÒFEJKPC WPF FKG 9CJN XQP ;WCP5JKJ-CK \WO2T·UKFGPVGP&CX-CPP./ *GTTNKEJG2CVKPCYKP\-TCV\GTXQT\ÒINKEJ





 &QNNCT Q ,   CWH FKG 8GTGKPKIWPI XQP 0QTF WPF 5ÒFEJKPC WPF FKG 9CJN XQP ;WCP5JKJ-CK \WO2T·UKFGPVGP&CX-CPP./ (CUVXQT\ÒINKEJ



148


REPUBLIK

9225

9225

1,5:1



&QNNCT,CJT  2TQXKP\-CPUW;WCP5JKJ-CK&CX-CPP./

9227

9226

 445GJTUEJÌP



9228



 &QNNCT ,CJT    ;WCP 5JKJ-CK +P 752NCUVKMJQNFGT FGT 0)% OKV FGT $GYGTVWPI /5    &CX-CPP./ (CUV5VGORGNINCP\ 



 &QNNCT ,CJT    ;WCP 5JKJ-CK +P 752NCUVKMJQNFGT FGT 0)% OKV FGT $GYGTVWPI /5    &CX-CPP./ 8QT\ÒINKEJp5VGORGNINCP\





 &QNNCT ,CJT    ;WCP 5JKJ-CK +P 752NCUVKMJQNFGT FGT 0)% OKV FGT $GYGTVWPI /5    &CX-CPP./ 8QT\ÒINKEJ



9229

9230



 &QNNCT ,CJT    ;WCP 5JKJ-CK +P 752NCUVKMJQNFGT FGT 0)% OKV FGT $GYGTVWPI /5    &CX-CPP./ 8QT\ÒINKEJ





 &QNNCT ,CJT    ;WCP 5JKJ-CK +P 752NCUVKMJQNFGT FGT 0)% OKV FGT $GYGTVWPI /5    &CX-CPP./ 8QT\ÒINKEJ

 149


REPUBLIK

9231

  

&QNNCT,CJT  ;WCP5JKJ-CK&CX-CPP./ &QNNCT,CJT  ;WCP5JKJ-CK&CX-CPP./ &QNNCT,CJT  ;WCP5JKJ-CK&CX-CPP./

9234

  

9232

9235

&QNNCT,CJT  ;WCP5JKJ-CK&CX-CPP./ &QNNCT,CJT  ;WCP5JKJ-CK&CX-CPP./ &QNNCT,CJT  ;WCP5JKJ-CK&CX-CPP./

9233

(CUV5VGORGNINCP\ 8QT\Ã&#x2019;INKEJp5VGORGNINCP\ 8QT\Ã&#x2019;INKEJ

  

9236

8QT\Ã&#x2019;INKEJ 8QT\Ã&#x2019;INKEJ 8QT\Ã&#x2019;INKEJ

  

&QNNCT,CJT  ;WCP5JKJ-CK&CX-CPP./  8CTKCPVGOKVIGUEJNQUUGPGO5EJTKHV\GKEJGPCWHFGT4Ã&#x2019;EMUGKVG8QT\Ã&#x2019;INKEJ



9237

 150


REPUBLIK

9240

9238

9239



&QNNCT,CJT  ;WCP5JKJ-CK&CX-CPP./  8CTKCPVGOKVIGUEJNQUUGPGO5EJTKHV\GKEJGPCWHFGT4ÒEMUGKVG8QT\ÒINKEJ





&QNNCT,CJT  ;WCP5JKJ-CK&CX#PO-CPP./  8CTKCPVGOKV1KO-TCP\#VVTCMVKXGUUGJTUEJÌPGU'ZGORNCT





%GPVU,CJT  ;WCP5JKJ-CK-CPP./

9241

 *ÒDUEJG6ÌPWPIXQT\ÒINKEJp5VGORGNINCP\



9242



%GPVU,CJT  ;WCP5JKJ-CK+P752NCUVKMJQNFGTFGT0)%OKVFGT$GYGTVWPI#7-CPP ./ *ÒDUEJG2CVKPCXQT\ÒINKEJ



%GPVU,CJT  ;WCP5JKJ-CK-CPP./

4CPFHGJNGTUGJTUEJÌP

 

9245 9243

9244



%GPVU,CJT  -CPP./

2T·IGUEJY·EJGCO4CPFUQPUVXQT\ÒINKEJ





%GPVU,CJT  -CPP./

(CUVXQT\ÒINKEJ





%GPVU,CJT  -CPP./

8QT\ÒINKEJ

 151


REPUBLIK

9246

1,5:1



1,5:1

 &QNNCTU ,CJT     I 7PKHQTOKGTVGU $TWUVDKNF FGU )GPGTCNU ;WCP 5JKJ-CK N)GHNÃ&#x2019;IGNVGT   &TCEJGN(D-CPP./;GQC )1.&448QT\Ã&#x2019;INKEJ  &KGEJKPGUKUEJG.GIGPFGFGT4Ã&#x2019;EMUGKVGDGFGWVGVÃ&#x2019;DGTUGV\VQDGP-CKUGTTGKEJ%JKPCWPVGP$GIKPPFGU*WPI*UKGP 4GIKOGU  ;WCP &QNNCT  &KG 9KGFGTJGTUVGNNWPI FGT EJKPGUKUEJGP /QPCTEJKG FWTEJ FGP /KNKV·THÃ&#x2019;JTGT WPF   2QNKVKMGT;WCP5JKJ-CKY·JTVGPWTGKPRCCT/QPCVGXQO&G\GODGTDKU/·T\;WCP5JKJ-CK VTCV WPVGT FGO &TWEM FGU /KNKV·TU WPF FGT 4GXQNWVKQP·TG \WTÃ&#x2019;EM WPF UVCTD CO  ,WPK  CP GKPGO   0KGTGPXGTUCIGP

9247

1,5:1



1,5:1

 &QNNCT Q ,   CWH FGP $GIKPP FGT *WPI *UKGP2GTKQFG ;WCP 5JKJ-CK &CX  -CPP    ./ 9KP\4CPFHGJNGTXQT\Ã&#x2019;INKEJ 

9248

1,5:1

 152

1,5:1

;WCP,CJT  2T·UKFGPV;WCP5JKJ-CK(GKPIQNF(D-CPP./  )1.&8QT\Ã&#x2019;INKEJ




REPUBLIK

9250

9249

9251



%GPVUQ,  )GPGTCN6CPI%JK;CQ-CPP FQTV ./  9KP\-TCV\GTXQT\Ã&#x2019;INKEJ





&QNNCT,CJT  ;WCP5JKJ-CK&CX-CPP./  *Ã&#x2019;DUEJG2CVKPCHCUV5VGORGNINCP\





&QNNCT,CJT  ;WCP5JKJ-CK&CX-CPP./



9252

9253

8QT\Ã&#x2019;INKEJp5VGORGNINCP\

9254



&QNNCT,CJT  ;WCP5JKJ-CK&CX-CPP./

8QT\Ã&#x2019;INKEJ





&QNNCT,CJT  ;WCP5JKJ-CK&CX-CPP./

9KP\-TCV\GTXQT\Ã&#x2019;INKEJ





&QNNCT,CJT  ;WCP5JKJ-CK+P752NCUVKMJQNFGTFGT0)%OKVFGT$GYGTVWPI/5&CX -CPP./ 8QT\Ã&#x2019;INKEJ

 153


REPUBLIK

9255

9256



&QNNCT,CJT  ;WCP5JKJ-CK&CX-CPP./



&QNNCTQ,  CWHFGP#OVUCPVTKVVXQP2T·UKFGPV*UW5JKJ%JCPI&CX-CPP./ )GRWV\VUGJTUEJÌP

9257

5GJTUEJÌP

 

9258



 &QNNCT ,CJT    ;WCP 5JKJ-CK +P 752NCUVKMJQNFGT FGT 0)% OKV FGT $GYGTVWPI /5    &CX-CPP./ (CUV5VGORGNINCP\





&QNNCT,CJT  ;WCP5JKJ-CK&CX-CPP./  *ÒDUEJG6ÌPWPIXQT\ÒINKEJp5VGORGNINCP\



9261 9259

9260



%GPVU,CJT  -CPP./

8QT\ÒINKEJ





%GPVU,CJT  -CPP./

(CUVXQT\ÒINKEJ





%GPVU,CJT  -CPP./

5GJTUEJÌPpXQT\ÒINKEJ



9262

9263



 &QNNCT Q ,   CWH FKG )TÒPFWPI FGT 4GRWDNKM  5WP ;CV5GP +P 752NCUVKMJQNFGT FGT   0)%OKVFGT$GYGTVWPI/5&CX-CPP./ 8QT\ÒINKEJp5VGORGNINCP\





&QNNCTQ,  CWHFKG)TÒPFWPIFGT4GRWDNKM5WP;CV5GP&CX-CPP./ 8QT\ÒINKEJp5VGORGNINCP\



154


REPUBLIK

9264

9265

9266



&QNNCTQ,  CWHFKG)TÒPFWPIFGT4GRWDNKM5WP;CV5GP&CX-CPP./ 8QT\ÒINKEJp5VGORGNINCP\





&QNNCTQ,  CWHFKG)TÒPFWPIFGT4GRWDNKM5WP;CV5GP&CX-CPP./ *ÒDUEJG2CVKPCXQT\ÒINKEJ





&QNNCTQ,  CWHFKG)TÒPFWPIFGT4GRWDNKM5WP;CV5GP&CX-CPP./ 5GJTUEJÌP



9269 9267



&QNNCTQ,  CWHFKG)TÒPFWPIFGT4GRWDNKM5WP;CV5GP&CX-CPP./ 5GJTUEJÌP





&QNNCTQ,  CWHFKG)TÒPFWPIFGT4GRWDNKM5WP;CV5GP#NNGKP752NCUVKMJQNFGTFGT 0)%OKVFGP$GYGTVWPIGP#7 Z /5 Z WPF/5 Z &CX-CPP./  5VÒEM8QT\ÒINKEJ





%GPVU,CJT  ./

8QT\ÒINKEJp5VGORGNINCP\



9270

9270 1,5:1



&QNNCT,CJT  5WP;CV5GP8CTKCPVGOKV)·PUGPÒDGT&UEJWPMG&CX-CPP./ 5GNVGPKPFKGUGT'TJCNVWPI*ÒDUEJG2CVKPCYKP\-TCV\GTXQT\ÒINKEJp5VGORGNINCP\

 155


REPUBLIK

9271

9272

9273



&QNNCT,CJT  5WP;CV5GP8CTKCPVGOKV)·PUGPÒDGT&UEJWPMG&CX-CPP./ 9KP\4CPFHGJNGTUGJTUEJÌP



&QNNCT,CJT  5WP;CV5GP&CX-/-CPP./  8QT\ÒINKEJp5VGORGNINCP\





&QNNCT,CJT  5WP;CV5GP&CX-/-CPP./  8QT\ÒINKEJp5VGORGNINCP\



9274

9276



9277



&QNNCT,CJT  5WP;CV5GP&CX-/-CPP./



&QNNCT,CJT  5WP;CV5GP&C\W&QNNCT ./ &CX-/-CPP ./ 5VÒEM8QT\ÒINKEJWPFUGJTUEJÌP





 &QNNCT ,CJT    5WP ;CV5GP +P 752NCUVKMJQNFGTFGT0)%OKVFGT$GYGTVWPI/5&CX -/-CPP./ 8QT\ÒINKEJp5VGORGNINCP\





&QNNCT,CJT  5WP;CV5GP&CX-/-CPP./  8QT\ÒINKEJp5VGORGNINCP\



156

8QT\ÒINKEJ




REPUBLIK

9278

9279



&QNNCT,CJT  5WP;CV5GP&CX-/-CPP./  8QT\ÒINKEJp5VGORGNINCP\





&QNNCT,CJT  5WP;CV5GP&CX-/-CPP./  8QT\ÒINKEJp5VGORGNINCP\



9280

9282

9281



&QNNCT,CJT  5WP;CV5GP&CX-/-CPP./  -N-TCV\GTXQT\ÒINKEJ





 &QNNCT ,CJT    5WP ;CV5GP +P 752NCUVKMJQNFGT FGT 0)% OKV FGT $GYGTVWPI /5    &CX-/-CPP./ 8QT\ÒINKEJ





&QNNCT,CJT  5WP;CV5GP&CX-/-CPP./

8QT\ÒINKEJ



9283

9284



&QNNCT,CJT  5WP;CV5GP&CX-/-CPP./

8QT\ÒINKEJ





&QNNCT,CJT  5WP;CV5GP&CX-/-CPP./

5GJTUEJÌP

 157


FANTASIEPRÄGUNGEN

9285



&QNNCT,CJT  5WP;CV5GP&CX-/-CPP./

5GJTUEJÌP





&QNNCT,CJT  5WP;CV5GP&CX-/-CPP./  5VÒEM5GJTUEJÌP





&QNNCT,CJT  5WP;CV5GP&CX-/-CPP./  5VÒEM5GJTUEJÌPWPFXQT\ÒINKEJ





 &QNNCT ,CJT    5WP ;CV5GP #NNG KP 752NCUVKMJQNFGT FGT 0)% OKV FGP $GYGTVWPIGP   #7 Z #7 Z UQYKG#7&'6#+.54'8%14415+10 Z WPF#7&'6#+.5574(#%' *#+4.+0'5 Z &CX-/-CPP./ 5VÒEM5GJTUEJÌPpXQT\ÒINKEJ



&QNNCT,CJT  5WP;CV5GP&CX-/-CPP./  5VÒEM(CUVXQT\ÒINKEJWPFXQT\ÒINKEJ





9291

9290

 

-W%GPV,CJT  -/

,CRCPKUEJG$GUGV\WPI%JKCQ,CJT  /GPI%JKCPI;GQ

(CUV5VGORGNINCP\

&KG +PPGTG /QPIQNGK KUV JGWVG GKP #WVQPQOGU )GDKGV KP FGT 8QNMUTGRWDNKM %JKPC &GT 1UVGP FGT 4GIKQP  

FKGGJGOCNKIG2TQXKP\%JCJCT YWTFGXQPFGP,CRCPGTPGTQDGTVFKGFGP/CTKQPGVVGPUVCCV/GPI%JKCPI OKVFGT*CWRVUVCFV-CNICP <JCPILKCMQW GTTKEJVGVGP#NUGKP\KIGU<CJNWPIUOKVVGNKPFGPGTQDGTVGP)GDKGVGPUQNNVGP FKG/ÒP\GPWPF$CPMPQVGPFGTCO0QXGODGTGKPIGTKEJVGVGP/GPI%JKCPI$CPMIGNVGP

1,5:1



8GTRT·IWPIGVYCUFG\GPVTKGTVHCUVXQT\ÒINKEJ

9292



1,5:1

(CPVCUKGRT·IWPIGP )QNFOGFCKNNG Q , 7PKHQTOKGTVGU $TWUVDKNF FGU )GPGTCNU (GPI -WQEJCPI X X    &TGK FWTEJ GKP $CPF \WUCOOGPIGJCNVGPG (CJPGP QDGP UKGDGP 5VGTPG  I  OO -CPP $    )1.&8QT\ÒINKEJ

9293





9294



&QNNCTQ, PCEJ $TWUVDKNFFGU-CKUGTU6CQMYCPI  XX&TCEJGPXXI OO-CPP$ 4*ÒDUEJG2CVKPCXQT\ÒINKEJ





6CGNQ, WO 2TQXKP\-YCPIVWPI-CPP$XCT FQTV+PUEJTKHV%GPVU   *ÒDUEJG2CVKPCXQT\ÒINKEJ



158


SYCEE-BARREN UND GEWICHTE

9295

9296

9296



 &QNNCT Q , PCEJ   $TWUVDKNF FGU -CKUGTU ;WCP 5JKJMCK   X X&TCEJGP X X   IOO-CPP$ 44*ÒDUEJG6ÌPWPIXQT\ÒINKEJ



 &QNNCT ,CJT    $TWUVDKNF FGU )QWXGTPGWTU .K %JKPNKP JCNDN<YGK IGMTGW\VG (NCIIGP ÒDGT   JTGPMTCP\QDGPHÒPH\CEMKIGT5VGTPIOO-CPP$ #VVTCMVKXG2CVKPCXQT\ÒINKEJ 



9297

9297

1,5:1

5;%''$#44'070&)'9+%*6' 

)QNFDCTTGP \W  6CGN WO  0QTFEJKPC 8QTFGTUGKVG  2WP\GP CW­GP 5JCPI 5JCPI %JK ,KP  

5GJT IWVGU (GKPIQNF  /KVVG ,KP <JGP 1TVUPCOG  %JWP *G (KTOC  *GTUVGNNGT  4ÒEMUGKVG  2WP\G   5QYLGVUVGTPOKV*COOGTWPF5KEJGNI )1.&48QT\ÒINKEJ 

9298



1,5:1

9298

)QNFDCTTGP \W6CGNEC0QTFEJKPC8QTFGTUGKVG2WP\GPZCW­GP%JK,KP (GKPIQNF  /KVVG6KCP,KP 1TVUPCOGECMOXQP2GMKPIGPVHGTPV ;QPI:KCPI *GTUVGNNGT(KTOC 4ÒEMUGKVG 2WP\G,K )NÒEM I )1.&48QT\ÒINKEJ 

9299 1,5:1



1,5:1

)QNFDCTTGP \W  6CGN Q , 5ÒFEJKPC #WHUEJTKHV 8QTFGTUGKVG QDGP /CECQ *QPIMQPI /KVVG %JWP   <JGPI <W ,KP (GKPIQNF  )CTCPVKGCPICDG  WPVGP %JQY 5CPI 5CPI JGWVG PQEJ GZKUVKGTGPFGT )QNF   UEJOWEMJGTUVGNNGT KP *QPIMQPI  #WHUEJTKHV 4ÒEMUGKVG %*19 5#0) 5#0) %1 .6&  5K /C ;K   .KCPI QHHK\KGNNGU)GYKEJVXQP6CGN I )1.&8QT\ÒINKEJ  159


SYCEE-BARREN UND GEWICHTE

9300



)QNFDCTTGP\W6CGN,CJT  I

)1.&8QT\Ã&#x2019;INKEJ



)QNFDCPF\W6CGNQ,*QPIMQPI(KTOC9KPI5MKPI.QQPII  )1.&8QT\Ã&#x2019;INKEJp5VGORGNINCP\



9301



9302 9302



1,5:1

)QNFDCTTGP\W6CGN ;WCP$CQ Q, OQFGTP 5Ã&#x2019;FEJKPC8QTFGTUGKVG2WP\GP (GKPIGJCNVU CPICDG  WPF 5JQW .CPIGU .GDGP  &KGUG $CTTGP YGTFGP QHV CNU )GDWTVUVCIUIGUEJGPMG XGTYGPFGV   I./ )1.&8QT\Ã&#x2019;INKEJ 

9303

9303





160

1,5:1

)QNFDCTTGP \W 6CGNWO5Ã&#x2019;FEJKPC8QTFGTUGKVG2WP\G:K )NÃ&#x2019;EMYÃ&#x2019;PUEJG\WT*QEJ \GKV   2WP\GP CWH FGO 4CPF ,KP .KCQ /CVGTKCN )QNF  5JK ,KCPI 1TVUPCOG  2TQXKP\ ,KCPI :K    I )1.&8QT\Ã&#x2019;INKEJ



)QNFDCTTGP\W6CGNQ, OQFGTP 5Ã&#x2019;FEJKPC8QTFGTUGKVG2WP\GPZ2WP\G (GKPIGJCNVU CPICDG  Z 5JQW .CPIGU .GDGP   MNGKPG 2WP\GP KO 4CPF Z .K )GYKPP QFGT 4GKEJVWO    &KGUG$CTTGPYGTFGPQHVCNU)GDWTVUVCIUIGUEJGPMGXGTYGPFGVI )1.&8QT\Ã&#x2019;INKEJ 

9305



9304

9304

1,5:1

9305 1,5:1

)QNFDCTTGP \W  6CGN ;WCP $CQ  Q , OQFGTP  5Ã&#x2019;FEJKPC 8QTFGTUGKVG  2WP\GP   

(GKPIGJCNVUCPICDG  WPF 5JQW .CPIGU .GDGP  &KGUG $CTTGP YGTFGP QHV CNU )GDWTVUVCIUIGUEJGPMG   XGTYGPFGVI )1.&8QT\Ã&#x2019;INKEJ




SYCEE-BARREN UND GEWICHTE

9306



)QNFDCTTGP Q , 8KGVPCO -KO 6JCPJ )QNFRNCVVG  /KV 1TVU WPF (GKPIGJCNVUCPICDGP KP NCVGKPKUEJGP   $WEJUVCDGPWPFEJKPGUKUEJGP5EJTKHV\GKEJGP5CKIQP*QPIMQPI*CPQK2PQORGPJWPF142741DGP WPFWPVGPLG\YGK-TGKUGFCTKP66I )1.&8QT\ÒINKEJ



9307 1:1,5



5KNDGTDCTTGP\W6CGN'PFG#PHCPI,CJTJWPFGTV2TQXKP\5JCPVWPI2WP\GPLGYGKNU;QPI %JGPI,K *GTUVGNNGT <W;KP (GKPUKNDGT I 4'VYCUMQTTQFKGTVUGJTUEJÌP



9308



5KNDGTDCTTGP \W  6CGN  -CKUGT )WCPI :W  2TQXKP\ #PJYGK  2WP\GP CW­GP #P *WK   5JGP 2TQXKP\ /KVVG)WCPI:W 0COGFGU-CKUGTU I 5GJTUEJÌP

 161


SYCEE-BARREN UND GEWICHTE

9309



4WPFGT 5KNDGTDCTTGP \W  6CGN  ,CJTJWPFGTV 3KPI &[PCUVKG  2TQXKP\ 5\GEJWGP  2WP\GP   LGYGKNU;QPI%JCPI 1TVUPCOG I 5GJTUEJÌP



9310



5CVVGNHÌTOKIGT 5KNDGTDCTTGP \W  6CGN WO  4GRWDNKM  2TQXKP\ ;WPPCP  2WP\GP  

CW­GPWPFOKVVKI /KPI)WQ0KCP<CKQ *GTUVGNNWPIU\GKVTCWO4GRWDNKMOCZ\YKUEJGP  *WK *CQ 9GP ;KP )CTCPVKG D\Y (GKPIGJCNVUCPICDG   MNGKPG 2WP\GP QDGP )WCP )QPI 5JG -CP  

COVNKEJGT 2TÒHUVGORGN   MNGKPG 2WP\G QDGP (W :KP 9GEJUGNOCTMG  RTKXCVGT 5VGORGN  GXGPVWGNN   *GTUVGNNGTOCTMG I 8QT\ÒINKEJ



9311



5CVVGNHÌTOKIGT 5KNDGTDCTTGP \W  6CGN EC  4GRWDNKM  2TQXKP\ ;WPPCP  2WP\GP  

CW­GPWPFOKVVKI 6QPI(W5JGPI*CQ *GTUVGNNGT6QP(W5JGPI *WK*CQ9GP;KP )CTCPVKGD\Y (GKPIGJCNVUCPICDG   MNGKPG 2WP\GP QDGP )WCP )QPI )W 5JG -CP 3K COVNKEJG 2TÒHUVGORGN    I -N4CPFCDDTWEJUGJTUEJÌP



ex 9312

 162

.168GTUEJKGFGPG5KNDGTDCTTGPOKV5VGORGNP OGKUVYCJTUEJGKPNKEJPKEJV\GKVIGPÌUUKUEJG2WP\GP   5VÒEM7PVGTUEJKGFNKEJGTJCNVGPOGKUVUGJTUEJÌP




ORDEN DER QING-DYNASTIE

9313

'+0$'&'76'0&'414&'0&'43+0)&;0#56+' 

-CKUGTNKEJGT 1TFGP XQO &QRRGNVGP &TCEJGP  /QFGNN EC  DKU   $TWUVUVGTP  -NCUUG   )TCF&WTEJOGUUGTOO5KNDGT/GFCKNNQP5KNDGTXGTIQNFGVWPFGOCKNNKGTVOKVDNCWGO)NCUEC DQEJQP KO <GPVTWO CWH FGO 4GXGTU WPF CWH FGT 0CFGN TWUUKUEJG /GKUVGTOCTMG /Á WPF   5V 2GVGTUDWTIGT 5KNDGTRWP\G  <QNQVPKMK XQP  DKU  CP 0CFGN KO QTKIKPCNGP TQVGP OKP   DGUEJ·FKIVGP WPF PKEJV OGJT RGTHGMV UEJNKG­GPFGP OKV IQNFHCTDGPGT HTCP\ÌUKUEJGT $G\GKEJPWPI DG   FTWEMVGP 8GTNGKJWPIUGVWK XQP # # ÒÐÅÉÄÅÍÚ =6TGKFGP? KP 5V 2GVGTUDWTI .+ 5  1#0   5H6#50T81.2'5H 44+p++  &KGUGT $TWUVUVGTP FGT CNNGKPG QJPG YGKVGTG +PUKIPKGP YKG *CNU QFGT $TWUVFGMQTCVKQPXGTNKGJGPWPFCWHFGTNKPMGP WPVGTGP $TWUVUGKVG IGVTCIGP YWTFG UVCOOV CWU FGO 0CEJNC­ FGU FGWVUEJGP -QPVGTCFOKTCNU /CZ $CEJGO  

  FGT KJP \YKUEJGP 'PFG 0QXGODGT  WPF 'PFG 0QXGODGT  CNU -QTXGVVGPMCRKV·PGTJCNVGPJCV &CU \YKUEJGP  WPF  CWHIGPQOOGPG $KNF \GKIV $CEJGO KP FGT 7PKHQTO GKPGU -CRKV·PU \WT 5GG OKV   CPIGNGIVGP1TFGPYQTWPVGTCWHFGTNKPMGP$TWUVUGKVGCWEJFKGUGT$TWUVUVGTPUEJYCEJ\WGTMGPPGPKUV  +P5V2GVGTUDWTIJGTIGUVGNNVGT5VGTPMQTRWUOKVCWHIGNGIVGOEJKPGUKUEJIGHGTVKIVGO/GFCKNNQP&CKP4W­NCPF PGWG2WP\KGTWPIGPGKPIGHÒJTVYWTFGPMCPPFKG*GTUVGNNWPIU\GKVFKGUGU5VGTPUCWHFGP<GKVTCWOXQPDKU GKPIGITGP\V YGTFGP YCU CWEJ OKV FGO OÌINKEJGP 8GTNGKJWPIU\GKVTCWO ÒDGTGKPUVKOOV &KGUG DGUQPFGTG -NCUUG   FKG ÒDGT FGT PQTOCNGP *CNUFGMQTCVKQP FGT  -NCUUG  )TCF UVCPF VCWEJVG \WGTUV Y·JTGPF FGT FKRNQOCVKUEJGP   9GNVTGKUG .K *WPIEJCPIU FGU UVCTMGP /CPPGU CO EJKPGUKUEJGP *QH  CWH 5KG YWTFG PWT UGJT YGPKI   XGTNKGJGP .CWV FGP RTGW­KUEJGP 6TCIG)GPGJOKIWPIGP  KP CNNGP -NCUUGP  YWTFGP .K Y·JTGPF UGKPGU   #WHGPVJCNVGUKP$GTNKP*CNUFGMQTCVKQPGPCDGTPWTFTGK$TWUVUVGTPGFKGUGT-NCUUGXGTNKGJGP&KGUGT5VGTPKUVUQOKV UGJT UGNVGP XIN CWEJ 9GJNKUEJ *GKP\ 'KP YGPKI DGMCPPVGT EJKPGUKUEJGT 5VGTP KP ,QWTPCN 'WTQR¾GP FW   EQNNGEVKQPGWTF QTFTGUGVF¾EQTCVKQPU  0T   /CZ $CEJGO FKGPVG KP FGT MCKUGTNKEJGP /CTKPG XQP  DKU  W C XQP  DKU  CNU-QOOCPFCPVFGU 5GIGNUEJWNUEJKHHGU 5/5 5VGKP $GK UGKPGO #DUEJKGF XQP FGT /CTKPG KO ,CJT  KP FGP 4CPI GKPGU   -QPVGTCFOKTCNU\&GTJQDGPYWTFGGT&KTGMVQTFGT/CTKPG5EJWNGKP*GKFGNDGTI9KGCWHFGO$KNFGTUKEJVNKEJ YCT $CEJGO 6T·IGT \CJNTGKEJGT KP WPF CWUN·PFKUEJGT 1TFGP WPF 'JTGP\GKEJGP 'T XGTUVCTD Y·JTGPF FGU 'TUVGP   9GNVMTKGIGUKO#RTKNKO#NVGTXQP,CJTGPKP*GKFGNDGTI  &KG5VCVWVGPFGU1TFGPUXQO&QRRGNVGP&TCEJGPOKV+NNWUVTCVKQPGPKPXQNNGT)TÌ­GYWTFGPCWH%JKPGUKUEJWPFXQP 6J&WRW[KP2CTKUCWEJCWH(TCP\ÌUKUEJKP(QTOGKPGU8QTUEJNCIUFGU6UQPINK;COGP $ÒTQFGU2TGOKGTOKPKUVGTU  CPFKG-CKUGTKP4GIGPVKPCO(GDTWCTIGFTWEMVFKGFKGUGCOINGKEJGP6CIIGPGJOKIVG /QFGNN $KU YCTFGT1TFGPCWUUEJNKG­NKEJHÒT#WUN·PFGTDGUVKOOV'TJCVVG-NCUUGPXQPFGPGPFKGFTGKGTUVGPLGKP)TCFG WPVGTVGKNV YCTGP &KG -NCUUGP WPF )TCF$G\GKEJPWPI KUV KP /CP<GKEJGP CWH FGP +PUKIPKGP UKGJG ,COGU 2GVGTUQP   KP6JG/GFCN%QNNGEVQTPQRHH &KGHTÒJGP+PUKIPKGPYWTFGPKP%JKPCJGTIGUVGNNVCDGTGUYWTFGKO 9GUVGPMTKVKUKGTVFC­UKGPWTCO*CNU QDUEJQPCPUEJÌPIGUVKEMVGP$·PFGTP QJPG5VGTP\WVTCIGPUGKGPFKG)TÌ­G XQP-WJINQEMGPJ·VVGPWPF\WYGPKIINCP\XQNNUGKGP&KGUHÒJTVG\WGKPKIGPPFGTWPIGP5EJ·TRGPYWTFGPUEJQP HÒTFKG\YGKJÌEJUVGP-NCUUGPGKPIGHÒJTVWPFIGO·­GKPGU&GMTGVUXQPUQNNVGPUKGKP)QNFIGHGTVKIVWPF XQP$TWUVUVGTPGPDGINGKVGVUGKP /QFGNN /ÌINKEJGTYGKUGYWTFGGKPITQ­GT6GKNFKGUGT$TWUVUVGTPGKO#WHVTCIFGT MCKUGTNKEJGP4GIKGTWPIKP4W­NCPFXQP/KMJCKN$QIFCPQXIGHGTVKIV  &KG8CTKCVKQPUDTGKVGFGT+PUKIPKGPFGUWPF/QFGNNUYWTFGUVCTMGTYGKVGTVFWTEJFGP7OUVCPFFC­8K\GMÌPKIG )QWXGTPGWTG )GPGT·NG WPF CPFGTG JQJG $GCOVG FCU 8QTUEJNCIUTGEJV HÒT FKG 'ORH·PIGT FGT   WPF  -NCUUG  

WPF GXGPVWGNN CWEJ FGT  -NCUUG  JCVVGP LGFQEJ FKG -QUVGP HÒT FKG *GTUVGNNWPI FGT +PUKIPKGP FCPP CWEJ VTCIGP   OW­VGP &KGU YWTFG XQT CNNGO XQP .K *WPIEJCPI FC\W DGPWV\V +PUKIPKGP XQP TGFW\KGTVGT )TÌ­G WPF   WPIGYÌJPNKEJGT <GKEJPWPI GKP\WHÒJTGP #NU  $TWUVUVGTPG GKPIGHÒJTV YWTFGP UKPF FGTGP 5VGTPEQTRK QHV KP   'WTQRC DGUVGNNV WPF JGTIGUVGNNV \$ XQP *CNNG[ -T¾VN[ .GOCKVTG 9QNHGTU CPF )QFGV  WPF OKV GKPGO UVCTM   TGFW\KGTVGP1TFGPU\GKEJGPEJKPGUKUEJGT#PHGTVKIWPIDGNGIVYQTFGP  6TQV\ FGU FG\GPVTCNKUKGTVGP 8QTUEJNCIUTGEJVU YWTFGP CNNG 8GTNGKJWPIGP KP GKPGO \GPVTCNGP 4GIKUVGT KP 2GMKPI OKV   GKPGT HÒT CNNG -NCUUGP FWTEJNCWHGPFGP 0WOOGT XGTUGJGP FKG CWH FGP 8GTNGKJWPIUFKRNQOGP YKGFGTJQNV YWTFG   &CTCWUKUVGTUKEJVNKEJFC­KPCNNGP-NCUUGPMCWO+PUKIPKGPXQOWPF/QFGNNKPFGT<GKVXQPDKU\WO #WUDTWEJFGTUQIGP$QZGTTGDGNNKQP KO,CJT \WT8GTNGKJWPIMCOGP&KGXGTYKTTGPFG8KGNIGUVCNVKIMGKVFGT +PUKIPKGP HÒJTVG UEJNKG­NKEJ  \W GKPGO PGWGP GKPJGKVNKEJGP PGWGP   /QFGNN FGUUGP +PUKIPKGP KP %JKPC   JGTIGUVGNNVYWTFGP&KGUGUWPFNGV\VG/QFGNNYWTFGDKU'PFGXGTNKGJGPCNUGUFWTEJGKPXQNNMQOOGPPGW IGUVCNVGVGU CDGT CWHITWPF FGU DCNFKIGP 'PFG FGU -CKUGTTGKEJGU   PWT UGJT MWT\NGDKIGU 1TFGPUU[UVGO GTUGV\V   YWTFG

163


VOLKSREPUBLIK CHINA

&+'/ª0<'0&'481.-54'27$.+-%*+0#

9314

164


VOLKSREPUBLIK CHINA

ex 9314



8QNMUTGRWDNKM 70+%'(5GTKG ,CJT FGU -KPFGU   -QORNGVVGT 5CV\ CNNGT CNU 2KGFHQTV   IGRT·IVGP5KNDGTCWUICDGPKO1TKIKPCNGVWKFGT(KTOC%CTVKGTOKVFGOFC\WIGJÌTKIGP<GTVKHKMCVHÒT FKG IGUCOVG 5GTKG 'PVJCNVGP UKPF HQNIGPFG .·PFGT %C[OCP +UNCPFU  &QNNCTU   'ZGORNCTG   -/ 2   2CRWC 0GW )WKPGC  -KPC   'ZGORNCTG -/ 2   2JKNKRRKPGP  2KUQ   

-/2 /CNGFKXGP4WHK[CC 'ZGORNCTG-/2 %JKPC;WCP  'ZGORNCTG-/2 &QOKPKMCPKUEJG4GRWDNKM2GUQU 'ZGORNCTG-/2 <CO DKC-YCEJC 'ZGORNCTG-/2 5WFCP2QWPFU #*'ZGORNCTG -/2 ,GOGP4K[CNU #*'ZGORNCTG-/2 VJKQRKGP$KTT

'''ZGORNCTG-/2 0GRCN4WRGG 85'ZGORNCTG-/2  .GUQVJQ/CNQVK 'ZGORNCTG-/2 I[RVGP2QWPFU #*'ZGO RNCTG -/ 2   /QPIQNGK  6WITKM   'ZGORNCTG -/ 2   5G[EJGNNGP   4WRGGU 'ZGORNCTG-/2 ,COCKMC&QNNCTU -/2 8GTGKPKIVG#TCDK UEJG 'OKTCVG  &KTJCOU  #*   'ZGORNCTG -/ 2   $QNKXKGP  2GUQU   

'ZGORNCTG-/2 6JCKNCPF$CJV $''ZGORNCTG-/2 6WPGUKGP  &KPCTU   'ZGORNCTG -/ 2   ,QTFCPKGP  &KPCTU  #*   'ZGORNCTG   -/2 +PFKGP4WRGGU -/2 7PICTP(QTKPV 'ZGORNCTG-/ 2 $WNICTKGP.GXC 'ZGORNCTG-/2 /CNVC2QWPFU 'ZGORNCTG -/ 2   6ÒTMGK  .KTC   'ZGORNCTG -/ 2   5CNQOQPGP  &QNNCTU     'ZGORNCTG-/2 %CKEQUKPUGNP%TQYPU 'ZGORNCTG-/2   5VÒEM+PFKGUGT8QNNUV·PFKIMGKVUGJTUGNVGPCO/CTMVCPIGDQVGP 2QNKGTVG2NCVVG $QNKXKGPZOKPDGTÒJTV  +P FGT 0QTOCNXGTUKQP WOHC­V FKG 5GTKG  'ZGORNCTG &CU JKGT HGJNGPFG 5VÒEM XQP %QUVC 4KEC YWTFG PKEJV CNU   2KGFHQTVIGRT·IV&KG-CUUGVVGGPVJ·NV.CIGPHÒTLG/ÒP\GPWOHC­VCNUQ(·EJGT'UKUVCP\WPGJOGPFC­FKG *GTUVGNNWPIFGT-CUUGVVGPDGTGKVUXQTFGP#WUICDGPCNNGT.·PFGTGTHQNIVG/CWTKVKWUWPF/GZKMQJCVVGPLGYGKNUGKPG 5KNDGTCWUICDG IGRNCPV FKGUG FCPP LGFQEJ PKEJV XGTYKTMNKEJV 'U HGJNGP CNUQ PKEJV  /ÒP\GP 8KGNOGJT KUV FCXQP   CWU\WIGJGP FC­ OGJT 'ZGORNCTG IGRNCPV YCTGP CNU NGV\VGPFNKEJ CWUIGRT·IV YQTFGP UKPF &KG 2T·IG\CJNGP FGT   GKP\GNPGP#WUICDGPUEJYCPMGPUVCTM\YKUEJGP5VÒEM VJKQRKGP WPF5VÒEM 5WFCP (ÒTGKPKIG#WUICDGP NKGIGPMGKPG2T·IG\CJNGPXQT

165


VOLKSREPUBLIK CHINA

9316

9315

9317



;WCP70+PVGTPCVKQPCNGU,CJTFGU-KPFGUI(GKPIQNF(D-/  )1.&/KV1TKIKPCN\GTVKHKMCV2QNKGTVG2NCVVG





;WCP70+PVGTPCVKQPCNGU,CJTFGU-KPFGUI(GKPIQNF(D-/  )1.&2QNKGTVG2NCVVG





;WCP70+PVGTPCVKQPCNGU,CJTFGU-KPFGUI(GKPIQNF(D-/  )1.&2QNKGTVG2NCVVG



9318



 ;WCP   ,CJTG 8QNMUTGRWDNKM %JKPC +PUIGUCOV  I (GKPIQNF (D       -/ 5VÃ&#x2019;EM)1.&+P1TKIKPCNGVWKOKV1TKIKPCN\GTVKHKMCV2QNKGTVG2NCVVG 

9320

9319



;WCP70+PVGTPCVKQPCNGU,CJTFGU-KPFGU-/

2QNKGTVG2NCVVGOKPDGTÃ&#x2019;JTV





;WCP70+PVGTPCVKQPCNGU,CJTFGU-KPFGU-/

2QNKGTVG2NCVVGOKPDGTÃ&#x2019;JTV



9321

9322

9323



 ;WCP  ::++ 1N[ORKUEJG 5QOOGTURKGNG  KP /QUMCW $QIGPUEJÃ&#x2019;V\GP  I (GKPIQNF   (D-/ )1.&2QNKGTVG2NCVVG





;WCP:8+++1N[ORKUEJG9KPVGTURKGNGKP.CMG2NCEKF#DHCJTVUN·WHGTI(GKPIQNF(D -/ )1.&2QNKGTVG2NCVVG





;WCP:8+++1N[ORKUEJG9KPVGTURKGNGKP.CMG2NCEKF#DHCJTVUN·WHGTI(GKPIQNF(D -/ )1.&2QNKGTVG2NCVVGNGKEJVDGTÃ&#x2019;JTVWPFYKP\4CPFHGJNGT



166


VOLKSREPUBLIK CHINA

9324



9325

7P\G2CPFC#WUICDGLCJTI(GKPIQNF(D$-/:/$#  )1.&1TKIKPCNXGTUEJYGK­V5VGORGNINCP\



$GKFGOXQTNKGIGPFGP5VÃ&#x2019;EMJCPFGNVGUUKEJWOFKGGTUVG#WUICDGFGTDGNKGDVGP)QNF2CPFCU&KGUG/Ã&#x2019;P\GYWTFG PQEJQJPG#PICDGFGU0QOKPCNUIGRT·IV



7P\G2CPFC#WUICDGLCJTI(GKPIQNF(Dp-/:/$#  )1.&-N-TCV\GTWPF4CPFHGJNGTXQT\Ã&#x2019;INKEJ



9327

9326

9328



7P\G2CPFC#WUICDGLCJTI(GKPIQNF(Dp-/:/$#  )1.&-N-WRHGTCWUUEJNCICWHFGT4Ã&#x2019;EMUGKVGHCUV5VGORGNINCP\





7P\G2CPFC#WUICDGLCJTI(GKPIQNF(Dp-/:/$  )1.&1TKIKPCNXGTUEJYGK­V5VGORGNINCP\





;WCP2CPFCI(GKPIQNF(D$-/

)1.&5VGORGNINCP\



ex 9330

9329



;WCP2CPFC#WUICDGLCJTKP5KNDGT-/  0WT'ZGORNCTGIGRT·IV2QNKGTVG2NCVVG





;WCP/CTEQ2QNQ&C\W,KCQ/CTEQ2QNQ-/

5VÃ&#x2019;EM2QNKGTVG2NCVVG





;WCP/CTEQ2QNQ&C\W;WCP/CTEQ2QNQ-/

5VÃ&#x2019;EM2QNKGTVG2NCVVG



9332



/Ã&#x2019;P\UGV  DGUVGJGPF CWU     WPF  ;WCP 2CPFC +PUIGUCOV  I (GKPIQNF   (D$$$$$-/  5VÃ&#x2019;EM)1.&1TKIKPCNXGTUEJYGK­V5VGORGNINCP\  167


VOLKSREPUBLIK CHINA

9334

9335

9333

9333



;WCP2CPFCI(GKPIQNF(D$-/  )1.&-N-WRHGTCWUUEJNCI5VGORGNINCP\



 ;WCP  )TQ­G 2GTUÌPNKEJMGKVGP FGT EJKPGUKUEJGP )GUEJKEJVG -CKUGT 3KP 5JK *WCPI   I(GKPIQNF(D-/ )1.&+P1TKIKPCNGVWKOKV1TKIKPCN\GTVKHKMCV2QNKGTVG2NCVVG





 ;WCP  )TQ­G 2GTUÌPNKEJMGKVGP FGT EJKPGUKUEJGP )GUEJKEJVG -CKUGT 3KP 5JK *WCPI   I(GKPIQNF(D-/ )1.&2QNKGTVG2NCVVG





9337

9336



;WCP2CPFC-/

0WT'ZGORNCTGIGRT·IV2QNKGTVG2NCVVG





;WCPQ,  70+PVGTPCVKQPCNGU,CJT\GJPVHÒT(TCWGP-/  0WT'ZGORNCTGIGRT·IV2QNKGTVG2NCVVG



9338

9339



;WCPQ,  70+PVGTPCVKQPCNGU,CJT\GJPVHÒT(TCWGP-/  0WT'ZGORNCTGIGRT·IV2QNKGTVG2NCVVG





;WCPQ,  70+PVGTPCVKQPCNGU,CJT\GJPVHÒT(TCWGP-/  0WT'ZGORNCTGIGRT·IV2QNKGTVG2NCVVGOKPDGTÒJTV



9340



 ;WCP  )TQ­G 2GTUÌPNKEJMGKVGP FGT EJKPGUKUEJGP )GUEJKEJVG  -QORNGVVG  5GTKG 6GTTCMQVVCCT   OGG-/ 5VÒEM+P1TKIKPCNGVWKOKV1TKIKPCN\GTVKHKMCV2QNKGTVG2NCVVG





 ;WCP  )TQ­G 2GTUÌPNKEJMGKVGP FGT EJKPGUKUEJGP )GUEJKEJVG  -QORNGVVG  5GTKG 6GTTCMQVVCCT   OGG-/ 5VÒEM+P1TKIKPCNGVWKQJPG1TKIKPCN\GTVKHKMCV2QNKGTVG2NCVVG



168


VOLKSREPUBLIK CHINA

9342



/ÒP\UGV  DGUVGJGPF CWU     WPF  ;WCP 2CPFC +PUIGUCOV  I (GKPIQNF   (D$$$$$-/  5VÒEM)1.&1TKIKPCNXGTUEJYGK­V5VGORGNINCP\ 

9343

9344



;WCP2CPFCI(GKPIQNF(D$-/

)1.&5VGORGNINCP\





;WCP2CPFCI(GKPIQNF(D$-/

)1.&-N4CPFHGJNGT5VGORGNINCP\



9345

9346



 ;WCP  )TQ­G 2GTUÌPNKEJMGKVGP FGT EJKPGUKUEJGP )GUEJKEJVG -QPHW\KWU -QPI <K   I   (GKPIQNF(D-/ )1.&+P1TKIKPCNGVWKOKV1TKIKPCN\GTVKHKMCV2QNKGTVG2NCVVG





 ;WCP  )TQ­G 2GTUÌPNKEJMGKVGP FGT EJKPGUKUEJGP )GUEJKEJVG -QPHW\KWU -QPI <K   I   (GKPIQNF(D-/ )1.&+P1TKIKPCNGVWKOKV1TKIKPCN\GTVKHKMCV2QNKGTVG2NCVVG



9347

9348

9349



;WCP2CPFC-/  0WT'ZGORNCTGIGRT·IV/KV1TKIKPCN\GTVKHKMCV2QNKGTVG2NCVVG





;WCP2CPFC-/





 ;WCP  )TQ­G 2GTUÌPNKEJMGKVGP FGT EJKPGUKUEJGP )GUEJKEJVG  -QORNGVVG  5GTKG -/     5VÒEM+P1TKIKPCNGVWKOKV1TKIKPCN\GTVKHKMCV2QNKGTVG2NCVVG

0WT'ZGORNCTGIGRT·IV2QNKGTVG2NCVVG

 169


VOLKSREPUBLIK CHINA

9350



 ;WCP  2CPFC +P 752NCUVKMJQNFGT FGT 0)% OKV FGT $GYGTVWPI 2(  7.64# %#/'1   I(GKPIQNF(D$-/  )1.&0WT'ZGORNCTGIGRT·IV2QNKGTVG2NCVVGOKPDGTÒJTV 

9351



/ÒP\UGVDGUVGJGPFCWUWPF;WCP2CPFC/KV/ÒP\UV·VVGP\GKEJGP2+PUIGUCOV I(GKPIQNF(D$$$$$-/  5VÒEM)1.&0WT'ZGORNCTGIGRT·IV +P1TKIKPCNGVWKOKV1TKIKPCN\GTVKHKMCV2QNKGTVG2NCVVG



9352



/ÒP\UGV  DGUVGJGPF CWU     WPF  ;WCP 2CPFC +PUIGUCOV  I (GKPIQNF   (D$$$$$-/  5VÒEM)1.&1TKIKPCNXGTUEJYGK­V5VGORGNINCP\ 

9354

9353

9354



;WCP2CPFCI(GKPIQNF(D$-/  )1.&1TKIKPCNXGTUEJYGK­V5VGORGNINCP\



 ;WCP  )TQ­G 2GTUÌPNKEJMGKVGP FGT EJKPGUKUEJGP )GUEJKEJVG -CKUGT .KW $CPI  I   (GKPIQNF(D-/ )1.&+P1TKIKPCNGVWKOKV1TKIKPCN\GTVKHKMCV2QNKGTVG2NCVVG

170

 


VOLKSREPUBLIK CHINA

9355

9356



 ;WCP  )TQ­G 2GTUÌPNKEJMGKVGP FGT EJKPGUKUEJGP )GUEJKEJVG -CKUGT .KW $CPI  I   (GKPIQNF(D-/ )1.&/KV/&/p<GTVKHKMCVQJPG1TKIKPCNGVWK2QNKGTVG2NCVVG





 ;WCP  )TQ­G 2GTUÌPNKEJMGKVGP FGT EJKPGUKUEJGP )GUEJKEJVG -CKUGT .KW $CPI  I   (GKPIQNF(D-/ )1.&2QNKGTVG2NCVVG



9357

9359



 ;WCP  )TQ­G 2GTUÌPNKEJMGKVGP FGT EJKPGUKUEJGP )GUEJKEJVG  -QORNGVVG  5GTKG -/     5VÒEM+P1TKIKPCNGVWKOKV1TKIKPCN\GTVKHKMCV2QNKGTVG2NCVVG





 ;WCP  )TQ­G 2GTUÌPNKEJMGKVGP FGT EJKPGUKUEJGP )GUEJKEJVG  -QORNGVVG  5GTKG -/     5VÒEM+P1TKIKPCNGVWKOKV1TKIKPCN\GTVKHKMCV2QNKGTVG2NCVVG





;WCP,CJTG9QTNF9KNFNKHG(WPF2CPFC-/

2QNKGTVG2NCVVG



9360 9360



/ÒP\UGVDGUVGJGPFCWUWPF;WCP2CPFC/KV/ÒP\UV·VVGP\GKEJGP2+PUIGUCOV I(GKPIQNF(D$$$$$-/  5VÒEM)1.&0WT'ZGORNCTGIGRT·IV +P1TKIKPCNGVWKOKV1TKIKPCN\GTVKHKMCV2QNKGTVG2NCVVG



9361 9361



/ÒP\UGVDGUVGJGPFCWUWPF;WCP2CPFC/KV/ÒP\UV·VVGP\GKEJGP2+PUIGUCOV I(GKPIQNF(D$$$$$-/  5VÒEM)1.&0WT'ZGORNCTGIGRT·IV2QNKGTVG2NCVVG

 171


VOLKSREPUBLIK CHINA

9362



/ÒP\UGVDGUVGJGPFCWUWPF;WCP2CPFC/KV/ÒP\UV·VVGP\GKEJGP5KP4CWVG 5JCPIJCK+PUIGUCOVI(GKPIQNF(D$$$$$-/  5VÒEM)1.&1TKIKPCNXGTUEJYGK­V5VGORGNINCP\ 

9364

9363

9363



 ;WCP  2CPFC /KV /ÒP\UV·VVGP\GKEJGP 5 KP 4CWVG 5JCPIJCK  I (GKPIQNF (D $    -/ )1.&8QT\ÒINKEJp5VGORGNINCP\ 



;WCP2CPFC/KV/ÒP\UV·VVGP\GKEJGP;KP4CWVG5JGP[CPII(GKPIQNF(D$-/ )1.&1TKIKPCNXGTUEJYGK­V5VGORGNINCP\

9365



9366

9367



 ;WCP  )TQ­G 2GTUÌPNKEJMGKVGP FGT EJKPGUKUEJGP )GUEJKEJVG -CKUGT .K 5JK /KP  I   (GKPIQNF(D-/ )1.&+P1TKIKPCNGVWKOKV1TKIKPCN\GTVKHKMCV2QNKGTVG2NCVVG





 ;WCP  )TQ­G 2GTUÌPNKEJMGKVGP FGT EJKPGUKUEJGP )GUEJKEJVG -CKUGT .K 5JK /KP  I   (GKPIQNF(D-/ )1.&2QNKGTVG2NCVVG





;WCP2CPFC-/

2QNKGTVG2NCVVG



;WCP)TQ­G2GTUÌPNKEJMGKVGPFGT9GNVMWNVWT-QORNGVVG5GTKG-/  5VÒEM+P1TKIKPCNGVWKOKV1TKIKPCN\GTVKHKMCV2QNKGTVG2NCVVG



9368

 172


VOLKSREPUBLIK CHINA

9369



/ÒP\UGVDGUVGJGPFCWUWPF;WCP2CPFC/KV/ÒP\UV·VVGP\GKEJGP2+PUIGUCOV I(GKPIQNF(D$$$$$-/  5VÒEM)1.&0WT'ZGORNCTGIGRT·IV +P1TKIKPCNGVWKOKV1TKIKPCN\GTVKHKMCV2QNKGTVG2NCVVG



9370



/ÒP\UGV  DGUVGJGPF CWU     WPF  ;WCP 2CPFC +PUIGUCOV  I (GKPIQNF   (D$$$$$-/  5VÒEM)1.&1TKIKPCNXGTUEJYGK­V5VGORGNINCP\ 

9371



9372

7P\G(GJNRT·IWPIKP)QNFOKVFGO5EJTKHV\WIQ\2V+PVGTPCVKQPCNG/ÒP\OGUUGKP$CUGN 2CPFCI(GKPIQNF(D\W$-/:/$ )1.&1TKIKPCNXGTUEJYGK­V2QNKGTVG2NCVVG  $GKFGOXQTNKGIGPFGP'ZGORNCTJCPFGNVGUUKEJWOGKPG(GJNRT·IWPICPN·UUNKEJFGT$CUGN+PVGTPCVKQPCN%QKP9GGM  &KG /ÒP\G YWTFG H·NUEJNKEJGTYGKUG OKV FGO #WHFTWEM 2V HÒT 2NCVKP CPUVGNNG XQP #W HÒT )QNF   CWUIGDTCEJV$GXQTFKG$GJÌTFGPKJTGP+TTVWODGOGTMVGPYCTGPDGTGKVU'ZGORNCTGKO7ONCWH0QEJUGNVGPGT UKPFFKGMQTTGMVIGRT·IVGP#75VÒEMGXQPFGPGPNGFKINKEJ'ZGORNCTGKO7ONCWHUGKPUQNNGP



7P\G+PVGTPCVKQPCNG/ÒP\OGUUGKP/ÒPEJGP2CPFCI(GKPIQNF(D$-/:/$ )1.&0WT5VÒEMIGRT·IV+P1TKIKPCNGVWKOKV/&/p<GTVKHKMCV2QNKGTVG2NCVVG

9373

9374



9375



 ;WCP  ::+8 1N[ORKUEJG 5QOOGTURKGNG  KP 5GQWN 5EJYGTVV·P\GTKP  I (GKPIQNF   (D-/ )1.&+P/&/p'VWK2QNKGTVG2NCVVG





 ;WCP  ::+8 1N[ORKUEJG 5QOOGTURKGNG  KP 5GQWN 5EJYGTVV·P\GTKP  I (GKPIQNF   (D-/ )1.&2QNKGTVG2NCVVG





 ;WCP  ::+8 1N[ORKUEJG 5QOOGTURKGNG  KP 5GQWN 5EJYGTVV·P\GTKP  I (GKPIQNF   (D-/ )1.&2QNKGTVG2NCVVG





 ;WCP  ::+8 1N[ORKUEJG 5QOOGTURKGNG KP5GQWN5EJYGTVV·P\GTKP+PUIGUCOVI (GKPIQNF(D-/ 5VÒEM)1.&2QNKGTVG2NCVVG

 173


VOLKSREPUBLIK CHINA

9378

9377



;WCP)TQ­G2GTUÌPNKEJMGKVGPFGTEJKPGUKUEJGP)GUEJKEJVG-CKUGT<JCQ-WCPI;KPI (GKPIQNF(D-/ )1.&+P1TKIKPCNGVWKOKV1TKIKPCN\GTVKHKMCV2QNKGTVG2NCVVG





;WCP)TQ­G2GTUÌPNKEJMGKVGPFGTEJKPGUKUEJGP)GUEJKEJVG-CKUGT<JCQ-WCPI;KPI (GKPIQNF(D-/ )1.&+P1TKIKPCNGVWK2QNKGTVG2NCVVG



9379



7P\GP+PVGTPCVKQPCNG/ÒP\OGUUGKP/ÒPEJGP2CPFC-/:/$  0WT5VÒEMIGRT·IV+P1TKIKPCNGVWKOKV1TKIKPCN\GTVKHKMCV2QNKGTVG2NCVVG



9380

 174

;WCP::+81N[ORKUEJG5QOOGTURKGNGKP5GQWN8QNNG[DCNNURKGNGTKPPGP-/  +O'VWKOKV1TKIKPCN\GTVKHKMCV2QNKGTVG2NCVVG




VOLKSREPUBLIK CHINA

9381



 ;WCP  ::+8 1N[ORKUEJG 5QOOGTURKGNG  KP 5GQWN 8QNNG[DCNNURKGNGTKPPGP -/    2QNKGTVG2NCVVG



9382



 ;WCP  ::+8 1N[ORKUEJG 5QOOGTURKGNG  KP 5GQWN 8QNNG[DCNNURKGNGTKPPGP -/    2QNKGTVG2NCVVG





 ;WCP  ::+8 1N[ORKUEJG 5QOOGTURKGNG  KP 5GQWN 8QNNG[DCNNURKGNGTKPPGP -/    2QNKGTVG2NCVVG





;WCP::+81N[ORKUEJG5QOOGTURKGNGKP5GQWN8QNNG[DCNNURKGNGTKPPGP-/  5VÃ&#x2019;EM2QNKGTVG2NCVVG



9385

9386



;WCP:81N[ORKUEJG9KPVGTURKGNGKP%CNICT[#DHCJTVUN·WHGT-/

 2QNKGTVG2NCVVG





;WCP:81N[ORKUEJG9KPVGTURKGNGKP%CNICT[#DHCJTVUN·WHGT-/  2QNKGTVG2NCVVGYKP\-TCV\GT





;WCP:81N[ORKUEJG9KPVGTURKGNGKP%CNICT[#DHCJTVUN·WHGT-/  5VÃ&#x2019;EM2QNKGTVG2NCVVG

 175


VOLKSREPUBLIK CHINA

9388



 ;WCP  )TQ­G 2GTUÌPNKEJMGKVGP FGT EJKPGUKUEJGP )GUEJKEJVG  -QORNGVVG  5GTKG -/   

FQTVHCNUEJG#DDKNFWPI  5VÒEM+P1TKIKPCNGVWKOKV1TKIKPCN\GTVKHKMCV2QNKGTVG2NCVVG



9389



/ÒP\UGVDGUVGJGPFCWUWPF;WCP2CPFC/KV/ÒP\UV·VVGP\GKEJGP2KP-TGKU +PUIGUCOVI(GKPIQNF(D$$$$$-/  5VÒEM)1.&0WT'ZGORNCTGIGRT·IV +P1TKIKPCNGVWKOKV1TKIKPCN\GTVKHKMCV2QNKGTVG2NCVVG 



/ÒP\UGVDGUVGJGPFCWUWPF;WCP2CPFC/KV/ÒP\UV·VVGP\GKEJGP2KP-TGKU +PUIGUCOVI(GKPIQNF(D$$$$$-/  5VÒEM)1.&0WT'ZGORNCTGIGRT·IV2QNKGTVG2NCVVG 

9391



/ÒP\UGV  DGUVGJGPF CWU     WPF  ;WCP 2CPFC +PUIGUCOV  I (GKPIQNF   (D$$$$$-/ 5VÒEM)1.&5VGORGNINCP\ 

9395

9392 9393 Pd

9392 9393 Pd



7P\G+PVGTPCVKQPCNG/ÒP\OGUUGKP/ÒPEJGP2CPFCI(GKPIQNF(Dp-/:/$ )1.&0WT'ZGORNCTGIGRT·IV2QNKGTVG2NCVVG



7P\G#OGTKECP0WOKUOCVKE#UUQEKCVKQP%QPXGPVKQPKP2KVVUDWTIJ2CPFCIHGKP(Dp -/p 2#..#&+7/40WT'ZGORNCTGIGRT·IV2QNKGTVG2NCVVGOKPDGTÒJTV 



 ;WCP  2CPFC &C\W  ;WCP  2CPFC +PUIGUCOV  I (GKPIQNF (D $  $    -/ 5VÒEM)1.&5VGORGNINCP\





;WCP)TQ­G2GTUÌPNKEJMGKVGPFGTEJKPGUKUEJGP)GUEJKEJVG&UEJKPIKU-JCP %JGP,K5K*CP  I(GKPIQNF(D-/ )1.&+P1TKIKPCNGVWKOKV1TKIKPCN\GTVKHKMCV2QNKGTVG2NCVVG



176




VOLKSREPUBLIK CHINA

9396

9397

9398



;WCP)TQ­G2GTUÌPNKEJMGKVGPFGTEJKPGUKUEJGP)GUEJKEJVG&UEJKPIKU-JCP %JGP,K5K*CP  I(GKPIQNF(D-/ )1.&+P1TKIKPCNGVWKOKV1TKIKPCN\GTVKHKMCV2QNKGTVG2NCVVG





7P\G/CKVTG[C$WFFJCI(GKPIQNF(Dp-/:/$

)1.&5VGORGNINCP\





;WCP,CJTFGT5EJNCPIGI(GKPIQNF(D$-/  )1.&1TKIKPCNXGTUEJYGK­VKP1TKIKPCNGVWKOKV1TKIKPCN\GTVKHKMCV2QNKGTVG2NCVVG



9399



;WCP2CPFC-/  0WT'ZGORNCTGIGRT·IV+P1TKIKPCNGVWKOKV1TKIKPCN\GTVKHKMCV2QNKGTVG2NCVVG



9400



;WCP2CPFC-/ 0WT'ZGORNCTGIGRT·IV +PNGKEJVDGUEJ·FKIVGO1TKIKPCNGVWKOKV1TKIKPCN\GTVKHKMCV2QNKGTVG2NCVVG



;WCP2CPFC-/

 0WT'ZGORNCTGIGRT·IV1TKIKPCNXGTUEJYGK­V2QNKGTVG2NCVVG

  177


VOLKSREPUBLIK CHINA

9402



;WCP2CPFC-/

+P1TKIKPCNGVWKOKV1TKIKPCN\GTVKHKMCV2QNKGTVG2NCVVG



9406

9403

9403



;WCP2CPFC-/

+P1TKIKPCNGVWKOKV1TKIKPCN\GTVKHKMCV2QNKGTVG2NCVVG





;WCP2CPFC-/

+P1TKIKPCNGVWKOKV1TKIKPCN\GTVKHKMCV2QNKGTVG2NCVVG





;WCP2CPFC-/

2QNKGTVG2NCVVG





7P\G+PVGTPCVKQPCNG/ÒP\OGUUGKP0GY;QTM2CPFC-/:/$  1TKIKPCNXGTUEJYGK­VKP1TKIKPCNGVWKOKV1TKIKPCN\GTVKHKMCV2QNKGTVG2NCVVG



9407

 178

 ;WCP  )TQ­G 2GTUÌPNKEJMGKVGP FGT EJKPGUKUEJGP )GUEJKEJVG  -QORNGVVG  5GTKG -/     5VÒEM+P1TKIKPCNGVWK2QNKGTVG2NCVVG




VOLKSREPUBLIK CHINA

9408

9408



/Ã&#x2019;P\UGVDGUVGJGPFCWUWPF;WCP2CPFC/KV/Ã&#x2019;P\UV·VVGP\GKEJGP2KP-TGKU +PUIGUCOVI(GKPIQNF(D$$$$$-/  5VÃ&#x2019;EM)1.&0WT'ZGORNCTGIGRT·IV +P1TKIKPCNGVWKOKV1TKIKPCN\GTVKHKMCV2QNKGTVG2NCVVG 

9409



/Ã&#x2019;P\UGVDGUVGJGPFCWUWPF;WCP2CPFC/KV/Ã&#x2019;P\UV·VVGP\GKEJGP2KP-TGKU +PUIGUCOVI(GKPIQNF(D$$$$$-/  5VÃ&#x2019;EM)1.&0WT'ZGORNCTGIGRT·IV +P1TKIKPCNGVWKOKV1TKIKPCN\GTVKHKMCV2QNKGTVG2NCVVG 

9410



/Ã&#x2019;P\UGVDGUVGJGPFCWUWPF;WCP2CPFC+PUIGUCOVI(GKPIQNF(D$ $$$$-/  5VÃ&#x2019;EM)1.&1TKIKPCNXGTUEJYGK­V5VGORGNINCP\



9411



 7P\G  +PVGTPCVKQPCNG /Ã&#x2019;P\OGUUG KP /Ã&#x2019;PEJGP 2CPFC  I (GKPIQNF (D p   -/:/$ )1.&0WT'ZGORNCTGIGRT·IV +P1TKIKPCNGVWKOKV1TKIKPCN\GTVKHKMCV2QNKGTVG2NCVVG



9412



 ;WCP  5GJGPUYÃ&#x2019;TFKIMGKVGP KP 6CKYCP  -QORNGVVG  5GTKG +PUIGUCOV  I (GKPIQNF (D   -/ 5VÃ&#x2019;EM)1.&40WT'ZGORNCTGIGRT·IV +P1TKIKPCNGVWKOKV1TKIKPCN\GTVKHKMCV2QNKGTVG2NCVVG  179


VOLKSREPUBLIK CHINA

9413

9414

9415



 ;WCP  )TQ­G 2GTUÌPNKEJMGKVGP FGT EJKPGUKUEJGP )GUEJKEJVG -CKUGT <JW ;WCP <JCPI   I(GKPIQNF(D-/ )1.&+P1TKIKPCNGVWKOKV1TKIKPCN\GTVKHKMCV2QNKGTVG2NCVVG





;WCP)TQ­G2GTUÌPNKEJMGKVGPFGT9GNVMWNVWT*WCPI&KI(GKPIQNF(D-/ )1.&+P1TKIKPCNGVWKOKV1TKIKPCN\GTVKHKMCV2QNKGTVG2NCVVG





;WCP)TQ­G2GTUÌPNKEJMGKVGPFGT9GNVMWNVWT*WCPI&KI(GKPIQNF(D-/ )1.&1TKIKPCNXGTUEJYGK­VOKV1TKIKPCN\GTVKHKMCV2QNKGTVG2NCVVG



9416

9417



 ;WCP  :8+ 1N[ORKUEJG 5QOOGTURKGNG  KP $CTEGNQPC $CUMGVDCNNURKGNGTKPPGP  I   (GKPIQNF(D-/ )1.&+P1TKIKPCNGVWKOKV1TKIKPCN\GTVKHKMCV2QNKGTVG2NCVVG





 ;WCP  :8+ 1N[ORKUEJG 5QOOGTURKGNG  KP $CTEGNQPC $CUMGVDCNNURKGNGTKPPGP  I   (GKPIQNF(D-/ )1.&2QNKGTVG2NCVVG





 ;WCP :8+1N[ORKUEJG5QOOGTURKGNGKP$CTEGNQPC$CUMGVDCNNURKGNGTKPPGP+PUIGUCOV I(GKPIQNF(D;GQ 5VÒEM)1.&2QNKGTVG2NCVVG





 ;WCP  :8+ 1N[ORKUEJG 5QOOGTURKGNG  KP $CTEGNQPC $CUMGVDCNNURKGNGTKPPGP   &C\W  ;WCP  :8+ 1N[ORKUEJG 9KPVGTURKGNG  KP #NDGTVXKNNG 'KUMWPUVNCWH  ;WCP    ::8+ 1N[ORKUEJG 5QOOGTURKGNG  KP #VNCPVC 6WTOURTKPIGT +PUIGUCOV  I (GKPIQNF   (D-/ 5VÒEM)1.&2QNKGTVG2NCVVG 

9420

 180

;WCP2CPFC-/  0WT'ZGORNCTGIGRT·IV+O1TKIKPCNGVWKOKV<GTVKHKMCV2QNKGTVG2NCVVG




VOLKSREPUBLIK CHINA

9421



;WCP2CPFC-/

0WT'ZGORNCTGIGRT·IV2QNKGTVG2NCVVG



0WT'ZGORNCTGIGRT·IV2QNKGTVG2NCVVGMN-TCV\GT



9422



;WCP2CPFC-/

9423



;WCP:8+1N[ORKUEJG9KPVGTURKGNGKP#NDGTVXKNNG'KUUEJPGNNN·WHGT-/  /KV1TKIKPCN\GTVKHKMCV2QNKGTVG2NCVVG

 181


VOLKSREPUBLIK CHINA

9424

  

;WCP:8+1N[ORKUEJG9KPVGTURKGNGKP#NDGTVXKNNG'KUUEJPGNNN·WHGT-/  2QNKGTVG2NCVVG ;WCP:8+1N[ORKUEJG9KPVGTURKGNGKP#NDGTVXKNNG'KUUEJPGNNN·WHGT-/  2QNKGTVG2NCVVG ;WCP:8+1N[ORKUEJG9KPVGTURKGNGKP#NDGTVXKNNG'KUUEJPGNNN·WHGT-/  5VÒEM2QNKGTVG2NCVVG

  

9427

9428

9428

 

;WCP&TCEJGWPF2JÌPKZ-/  0WT'ZGORNCTGIGRT·IV+P1TKIKPCNGVWKOKV1TKIKPCN\GTVKHKMCV2QNKGTVG2NCVVG ;WCP&TCEJGWPF2JÌPKZ-/  0WT'ZGORNCTGIGRT·IV2QNKGTVG2NCVVGYKP\-TCV\GT

 

9429



182

 ;WCP  #TEJ·QNQIKUEJG (WPFG FGT $TQP\G\GKV  -QORNGVVG  5GTKG -/     ## 5VÒEM0WT'ZGORNCTGIGRT·IV +P1TKIKPCNGVWKOKV1TKIKPCN\GTVKHKMCVGP2QNKGTVG2NCVVG




VOLKSREPUBLIK CHINA

9430



;WCP)TQ­G2GTUÌPNKEJMGKVGPFGT9GNVMWNVWT-QORNGVVG5GTKG-/ 5VÒEM/KV1TKIKPCN\GTVKHKMCVGP2QNKGTVG2NCVVG



9431



 ;WCP  )TQ­G 2GTUÌPNKEJMGKVGP FGT EJKPGUKUEJGP )GUEJKEJVG  -QORNGVVG  5GTKG -/     5VÒEM+P1TKIKPCNGVWKOKV1TKIKPCN\GTVKHKMCV2QNKGTVG2NCVVG



9432



/ÒP\UGV  DGUVGJGPF CWU     WPF  ;WCP 2CPFC +PUIGUCOV  I (GKPIQNF   (D$$$$$-/  5VÒEM)1.&1TKIKPCNXGTUEJYGK­V5VGORGNINCP\ 

9434 9433

9435



7P\G+PVGTPCVKQPCNG/ÒP\OGUUGKP/ÒPEJGP2CPFCI(GKPIQNF(Dp-/:/$ )1.&0WT'ZGORNCTGIGRT·IV2QNKGTVG2NCVVG





7P\G+PVGTPCVKQPCNG/ÒP\OGUUGKP/ÒPEJGP2CPFCI(GKPIQNF(Dp-/:/$ )1.&1TKIKPCNXGTUEJYGK­VKP1TKIKPCNGVWKOKV1TKIKPCN\GTVKHKMCV2QNKGTVG2NCVVG





7P\G+PVGTPCVKQPCNG/ÒP\OGUUGKP/ÒPEJGP2CPFCI(GKPIQNF(Dp-/:/$ )1.&+P1TKIKPCNGVWK2QNKGTVG2NCVVG

 183


VOLKSREPUBLIK CHINA

9436 9437



9438

;WCP2CPFCI(GKPIQNF(D$-/

)1.&5VGORGNINCP\





;WCP,CJTFGT<KGIGI(GKPIQNF(D$-/  )1.&1TKIKPCNXGTUEJYGK­VKP1TKIKPCNGVWKOKV1TKIKPCN\GTVKHKMCV2QNKGTVG2NCVVG





;WCP)TQ­G2GTUÌPNKEJMGKVGPFGTEJKPGUKUEJGP)GUEJKEJVG-CKUGT-CPI:KI(GKPIQNF (D-/ )1.&+P1TKIKPCNGVWKOKV1TKIKPCN\GTVKHKMCV2QNKGTVG2NCVVG



'UJCPFGNVUKEJJKGTDGKWOFKGMNGKPUVG2CPFC)QNFOÒP\G

9439

9440

9441

9442



;WCP)TQ­G2GTUÌPNKEJMGKVGPFGTEJKPGUKUEJGP)GUEJKEJVG-CKUGT-CPI:KI(GKPIQNF (D-/ )1.&+P1TKIKPCNGVWKOKV1TKIKPCN\GTVKHKMCV2QNKGTVG2NCVVG





 ;WCP  )TQ­G 2GTUÌPNKEJMGKVGP FGT 9GNVMWNVWT -CKUGT ;CP &K  I (GKPIQNF (D    -/ )1.&/KV1TKIKPCN\GTVKHKMCV2QNKGTVG2NCVVG





;WCP:8+1N[ORKUEJG9KPVGTURKGNGKP#NDGTVXKNNG'KUMWPUVNCWHI(GKPIQNF(D -/ )1.&/KV1TKIKPCN\GTVKHKMCV2QNKGTVG2NCVVG





 ;WCP  :8+ 1N[ORKUEJG 9KPVGTURKGNG  KP #NDGTVXKNNG 'KUMWPUVNCWH +PUIGUCOV  I   (GKPIQNF(D-/ 5VÒEM)1.&2QNKGTVG2NCVVG 

9443

 184

;WCP2CPFC-/

+P1TKIKPCNGVWKOKV1TKIKPCN\GTVKHKMCV2QNKGTVG2NCVVG




VOLKSREPUBLIK CHINA

9444

9446

9445



7P\G+PVGTPCVKQPCNG/Ã&#x2019;P\OGUUGKP/Ã&#x2019;PEJGP2CPFC-/p  +P1TKIKPCNGVWKOKV1TKIKPCN\GTVKHKMCV2QNKGTVG2NCVVG





7P\G+PVGTPCVKQPCNG/Ã&#x2019;P\OGUUGKP/Ã&#x2019;PEJGP2CPFC-/p  +P1TKIKPCNGVWKOKV1TKIKPCN\GTVKHKMCV2QNKGTVG2NCVVG





;WCP2CPFC/KV/Ã&#x2019;P\UV·VVGP\GKEJGP2KP-TGKU-/  0WT'ZGORNCTGIGRT·IV+P1TKIKPCNGVWKOKV1TKIKPCN\GTVKHKMCV2QNKGTVG2NCVVG





;WCP2CPFC/KV/Ã&#x2019;P\UV·VVGP\GKEJGP2KP-TGKU-/  0WT'ZGORNCTGIGRT·IV 1TKIKPCNXGTUEJYGK­VKP1TKIKPCNGVWKOKV1TKIKPCN\GTVKHKMCV2QNKGTVG2NCVVG





;WCP2CPFC/KV/Ã&#x2019;P\UV·VVGP\GKEJGP2KP-TGKU-/  0WT'ZGORNCTGIGRT·IV1TKIKPCNXGTUEJYGK­V2QNKGTVG2NCVVG



9452

9449

9449



;WCP::81N[ORKUEJG5QOOGTURKGNGKP$CTEGNQPC&TGK5RTKPVGTKPPGP-/  /KV/&/p<GTVKHKMCV2QNKGTVG2NCVVG





;WCP::81N[ORKUEJG5QOOGTURKGNGKP$CTEGNQPC&TGK5RTKPVGTKPPGP-/  2QNKGTVG2NCVVG





;WCP::81N[ORKUEJG5QOOGTURKGNGKP$CTEGNQPC&TGK5RTKPVGTKPPGP-/  5VÃ&#x2019;EM2QNKGTVG2NCVVG





 7P\G  +PVGTPCVKQPCNG /Ã&#x2019;P\OGUUG KP /Ã&#x2019;PEJGP 2CPFC  I (GKPIQNF (D p -/ p   )1.&+P1TKIKPCNGVWKOKV1TKIKPCN\GTVKHKMCV2QNKGTVG2NCVVG

 185


VOLKSREPUBLIK CHINA

9453

9454

9455



 ;WCP  $GFTQJVG 6KGTYGNV 6CMKP  $GTIUEJCH $WFQTECU VCZKEQNQT   I (GKPIQNF (D    -/ )1.&0WT'ZGORNCTGIGRT·IV2QNKGTVG2NCVVG



 ;WCP  )TQ­G 2GTUÌPNKEJMGKVGP FGT EJKPGUKUEJGP )GUEJKEJVG 9W <G 6KCP  I (GKPIQNF   (D-/ )1.&+P1TKIKPCNGVWKOKV1TKIKPCN\GTVKHKMCV2QNKGTVG2NCVVG 



;WCP)TQ­G2GTUÌPNKEJMGKVGPFGT9GNVMWNVWT&C;WI(GKPIQNF(D-/ )1.&+P1TKIKPCNGVWKOKV1TKIKPCN\GTVKHKMCV2QNKGTVG2NCVVG

9456





9457

9458

9458



;WCP)TQ­G2GTUÌPNKEJMGKVGPFGT9GNVMWNVWT&C;WI(GKPIQNF(D-/ )1.&/KV/&/p<GTVKHKMCVQJPG1TKIKPCNGVWK2QNKGTVG2NCVVG





 ;WCP  :8++ 1N[ORKUEJG 9KPVGTURKGNG  KP .KNNGJCOOGT 'KUMWPUVN·WHGT  I   (GKPIQNF(D-/ )1.&2QNKGTVG2NCVVG





7P\G+PVGTPCVKQPCNG/ÒP\OGUUGKP/ÒPEJGP2CPFC-/p  0WT'ZGORNCTGIGRT·IV1TKIKPCNXGTUEJYGK­VOKV1TKIKPCN\GTVKHKMCV2QNKGTVG2NCVVG



9459

 186

;WCP'THKPFWPIGPWPF'PVFGEMWPIGPFGU#NVGTVWOU-QORNGVVG5GTKG-/  5VÒEM2QNKGTVG2NCVVG




VOLKSREPUBLIK CHINA

9460

9461



 7P\G  +PVGTPCVKQPCNG /Ã&#x2019;P\OGUUG KP /Ã&#x2019;PEJGP 2CPFC  I (GKPIQNF (D p -/ p   )1.&0WT'ZGORNCTGIGRT·IV+P1TKIKPCNGVWKOKV1TKIKPCN\GTVKHKMCV2QNKGTVG2NCVVG





 7P\G  +PVGTPCVKQPCNG /Ã&#x2019;P\OGUUG KP /Ã&#x2019;PEJGP 2CPFC  I (GKPIQNF (D p -/ p   )1.&0WT'ZGORNCTGIGRT·IV2QNKGTVG2NCVVG



9462



 ;WCP  'THKPFWPIGP WPF 'PVFGEMWPIGP FGU #NVGTVWOU  -QORNGVVG  5GTKG $GKNCIG 4GEJGP   UEJKGDGT+PUIGUCOVI(GKPIQNF(D-/  5VÃ&#x2019;EM)1.&40WT'ZGORNCTGIGRT·IV +P1TKIKPCNGVWKQJPG1TKIKPCN\GTVKHKMCVG2QNKGTVG2NCVVG 

9463



 ;WCP  5GJGPUYÃ&#x2019;TFKIMGKVGP KP 6CKYCP  -QORNGVVG  5GTKG +PUIGUCOV  I (GKPIQNF (D   -/ 5VÃ&#x2019;EM)1.&440WT'ZGORNCTGIGRT·IV +P1TKIKPCNGVWKOKV1TKIKPCN\GTVKHKMCV2QNKGTVG2NCVVG 

9465

9464

9465



;WCP%JKPGUKUEJG/CNGTGK2HCWI(GKPIQNF(D-/  )1.&40WT'ZGORNCTGIGRT·IV2QNKGTVG2NCVVG





;WCP%JKPGUKUEJG/CNGTGK2HCWI(GKPIQNF(D-/  )1.&2QNKGTVG2NCVVGOKPDGTÃ&#x2019;JTV

 187


VOLKSREPUBLIK CHINA

1,5:1

9466 1,5:1



;WCP)TQ­G2GTUÌPNKEJMGKVGPFGTEJKPGUKUEJGP)GUEJKEJVG/CQ<G&QPII(GKPIQNF (D-/ )1.&+P1TKIKPCNGVWKOKV1TKIKPCN\GTVKHKMCV2QNKGTVG2NCVVG 



;WCP)TQ­G2GTUÌPNKEJMGKVGPFGTEJKPGUKUEJGP)GUEJKEJVG/CQ<G&QPII(GKPIQNF (D-/ )1.&+P1TKIKPCNGVWKOKV1TKIKPCN\GTVKHKMCV2QNKGTVG2NCVVG 

9467

9468



;WCP2CPFC-/  0WT'ZGORNCTGIGRT·IV+P1TKIKPCNGVWKOKV1TKIKPCN\GTVKHKMCV2QNKGTVG2NCVVG



9469

 188

;WCP$GFTQJVG6KGTYGNV$TCWPD·TOKV,WPIGO-/  0WT'ZGORNCTGIGRT·IV2QNKGTVG2NCVVG




VOLKSREPUBLIK CHINA

9470



;WCP,CJTGUVCIFGT4Ã&#x2019;EMMGJTXQP/CTEQ2QNQ-/p  0WT'ZGORNCTGIGRT·IV+P1TKIKPCNGVWKQJPG<GTVKHKMCV2QNKGTVG2NCVVG



9471



;WCP,CJTGUVCIFGT4Ã&#x2019;EMMGJTXQP/CTEQ2QNQ-/p  0WT'ZGORNCTGIGRT·IV1TKIKPCNXGTUEJYGK­V2QNKGTVG2NCVVG



9472



;WCP,CJTGUVCIFGT4Ã&#x2019;EMMGJTXQP/CTEQ2QNQ-/p  0WT'ZGORNCTGIGRT·IV2QNKGTVG2NCVVG

 189


VOLKSREPUBLIK CHINA

9473



;WCP/CQ<G&QPI-/

+P1TKIKPCNGVWKOKV1TKIKPCN\GTVKHKMCV2QNKGTVG2NCVVG



9474



;WCP'THKPFWPIGPWPF'PVFGEMWPIGPFGU#NVGTVWOU-QORNGVVG5GTKG-/  5VÃ&#x2019;EM+P1TKIKPCNGVWKOKV1TKIKPCN\GTVKHKMCVGP2QNKGTVG2NCVVG





;WCP'THKPFWPIGPWPF'PVFGEMWPIGPFGU#NVGTVWOU-QORNGVVG5GTKG-/  5VÃ&#x2019;EM2QNKGTVG2NCVVG



9476

1,5:1



1,5:1

;WCP2CPFCI(GKPIQNF(D$-/#  )1.&0WT'ZGORNCTGIGRT·IV2QNKGTVG2NCVVG

9477





190



9478

 ;WCP  2CPFC  I $KOGVCNN 4KPI CWU GT 5KNDGT -GTP CWU GT )GNDIQNF   I    (GKPIQNF(D$-/#  )1.&0WT'ZGORNCTGIGRT·IV/KV1TKIKPCN\GTVKHKMCV2QNKGTVG2NCVVG



 ;WCP  2CPFC  I $KOGVCNN 4KPI CWU GT 5KNDGT -GTP CWU GT )GNDIQNF   I   (GKPIQNF(D$-/#  )1.&0WT'ZGORNCTGIGRT·IV/KV1TKIKPCN\GTVKHKMCV2QNKGTVG2NCVVG




VOLKSREPUBLIK CHINA

9479



;WCP'THKPFWPIGPWPF'PVFGEMWPIGPFGU#NVGTVWOU-QORNGVVG5GTKG+PUIGUCOVI(GKP IQNF(D-/ 5VÒEM)1.&40WT'ZGORNCTGIGRT·IV +P1TKIKPCNGVWKOKV1TKIKPCN\GTVKHKMCVGP2QNKGTVG2NCVVG 

9481 9482

9480



;WCP)TQ­G2GTUÌPNKEJMGKVGPFGT9GNVMWNVWT<JQW9GP9CPII(GKPIQNF(D -/ )1.&+P1TKIKPCNGVWKOKV1TKIKPCN\GTVKHKMCV2QNKGTVG2NCVVG





;WCP'KPJQTPI(GKPIQNF(D$-/





;WCP&TCEJGWPF(GWGTXQIGNI$KOGVCNN 4KPICWUGT5KNDGT-GTPCWUGT)GND IQNF I(GKPIQNF(D$-/ )1.&0WT'ZGORNCTGIGRT·IV2QNKGTVG2NCVVG

)1.&2QNKGTVG2NCVVGOKPDGTÒJTV



9484

9483

9483



;WCP2CPFC/KV/ÒP\UV·VVGP\GKEJGP2KP-TGKU-/  0WT5VÒEMIGRT·IV2QNKGTVG2NCVVG





;WCP'KPJQTP/KV/ÒP\UV·VVGP\GKEJGP2KP-TGKU-/  0WT'ZGORNCTGIGRT·IV2QNKGTVG2NCVVG

 191


VOLKSREPUBLIK CHINA

9486

9485



;WCP'THKPFWPIGPWPF'PVFGEMWPIGPFGU#NVGTVWOU-QORNGVVG5GTKG-/  5VÃ&#x2019;EM2QNKGTVG2NCVVG



;WCP2CPFCI(GKPIQNF(D$-/  )1.&1TKIKPCNXGTUEJYGK­V5VGORGNINCP\

 

9487



;WCP'THKPFWPIGPWPF'PVFGEMWPIGPFGU#NVGTVWOU-QORNGVVG5GTKG+PUIGUCOVI(GKP IQNF(D-/ 5VÃ&#x2019;EM)1.&40WT'ZGORNCTGIGRT·IV +P1TKIKPCNGVWKOKV1TKIKPCN\GTVKHKMCVGP2QNKGTVG2NCVVG 

9488

 192

1,5:1

9488

;WCP%JKPGUKUEJG-WNVWT-CKUGT6CPI6CK<QPII(GKPIQNF(D-/  )1.&40WT'ZGORNCTGIGRT·IV/KV1TKIKPCN\GTVKHKMCVQJPG1TKIKPCNGVWK2QNKGTVG2NCVVG




VOLKSREPUBLIK CHINA

9489

9490



;WCP%JKPGUKUEJG-WNVWT-CKUGT6CPI6CK<QPII(GKPIQNF(D-/  )1.&40WT'ZGORNCTGIGRT·IV2QNKGTVG2NCVVG





;WCP%JKPGUKUEJG-WNVWT/GPI<KI(GKPIQNF(D-/  )1.&440WT'ZGORNCTGIGRT·IV2QNKGTVG2NCVVG



9492

9491



;WCP%JKPGUKUEJG-WNVWT.ÌYGPVCP\I(GKPIQNF(D-/  )1.&440WT'ZGORNCTGIGRT·IV2QNKGTVG2NCVVG





;WCP'KPJQTPI(GKPIQNF(D$-/  )1.&40WT'ZGORNCTGIGRT·IV1TKIKPCNXGTUEJYGK­V2QNKGTVG2NCVVG



9494

9493

9493



;WCP,CJTFGU5EJYGKPUI(GKPIQNF(D$-/  )1.&40WT'ZGORNCTGIGRT·IV2QNKGTVG2NCVVG



 ;WCP  ::8+ 1N[ORKUEJG 5QOOGTURKGNG  KP #VNCPVC 6WTOURTKPIGT  I (GKPIQNF   (D-/ )1.&2QNKGTVG2NCVVGNGKEJVDGTKGDGPWPFMN-TCV\GT

 

9495

9496

9496



;WCP2CIQFGFGT5GEJU*CTOQPKGPCO3KCPIVCPIKP*CPI\JQW&C\W;WCP.ÌYGP VCP\+PUIGUCOVI(GKPIQNF(D-/ 5VÒEM)1.&2QNKGTVG2NCVVG





;WCP2CPFC-/



0WT'ZGORNCTGIGRT·IV2QNKGTVG2NCVVG

193


VOLKSREPUBLIK CHINA

9497



;WCP::8+1N[ORKUEJG5QOOGTURKGNGKP#VNCPVC6KUEJVGPPKUURKGNGTKP-/  2QNKGTVG2NCVVG



9498



;WCP::8+1N[ORKUEJG5QOOGTURKGNGKP#VNCPVC6KUEJVGPPKUURKGNGTKP-/  2QNKGTVG2NCVVG



9499

 194

;WCP'THKPFWPIGPWPF'PVFGEMWPIGPFGU#NVGTVWOU-QORNGVVG5GTKG-/  5VÃ&#x2019;EM2QNKGTVG2NCVVG




VOLKSREPUBLIK CHINA

ex 9500



;WCP%JKPGUKUEJG-WNVWT-QORNGVVG5GTKG-/  5VÒEM/KV/&/p<GTVKHKMCVGP2QNKGTVG2NCVVG



ex 9501



;WCPWPF5GKFGPUVTC­G-QORNGVVGWPF5GTKG-/  5VÒEM2QNKGTVG2NCVVG



9502



/ÒP\UGV  DGUVGJGPF CWU   WPF  ;WCP 2CPFC  ,WDKN·WOUCWUICDG +PUIGUCOV  I   (GKPIQNF(D$$$-/ 5VÒEM)1.&0WT5·V\GCWUIGIGDGP 1TKIKPCNXGTUEJYGK­VOKVFGPFC\WIGJÌTKIGP1TKIKPCN\GTVKHKMCVGP5VGORGNINCP\ 

9503



;WCP'THKPFWPIGPWPF'PVFGEMWPIGPFGU#NVGTVWOU-QORNGVVG5GTKG+PUIGUCOVI (GKPIQNF(D-/  5VÒEM)1.&40WT'ZGORNCTGIGRT·IV /KV1TKIKPCN\GTVKHKMCVGPQJPG1TKIKPCNGVWKU2QNKGTVG2NCVVG  195


VOLKSREPUBLIK CHINA

9504

9505



;WCP'KPJQTPI(GKPIQNF(D$-/  )1.&40WT'ZGORNCTGIGRT·IV1TKIKPCNXGTUEJYGK­V2QNKGTVG2NCVVG





;WCP'KPJQTPI(GKPIQNF(D$-/  )1.&40WT'ZGORNCTGIGRT·IV1TKIKPCNXGTUEJYGK­V2QNKGTVG2NCVVG



9507

9506



;WCP'KPJQTPI(GKPIQNF(D$-/  )1.&40WT'ZGORNCTGIGRT·IV1TKIKPCNXGTUEJYGK­V2QNKGTVG2NCVVG





;WCP'KPJQTPI(GKPIQNF(D$-/  )1.&40WT'ZGORNCTGIGRT·IV1TKIKPCNXGTUEJYGK­V2QNKGTVG2NCVVG



9508 9509

9509



;WCP'KPJQTPI(GKPIQNF(D$-/  )1.&40WT'ZGORNCTGIGRT·IV1TKIKPCNXGTUEJYGK­V2QNKGTVG2NCVVG





;WCP'KPJQTP0WT5VÃ&#x2019;EMIGRT·IV&C\W;WCP'KPJQTP-/  5VÃ&#x2019;EM$GKFGQTKIKPCNXGTUEJYGK­V2QNKGTVG2NCVVGWPF5VGORGNINCP\



9510

 196

;WCP'THKPFWPIGPWPF'PVFGEMWPIGPFGU#NVGTVWOU-QORNGVVG5GTKG-/  5VÃ&#x2019;EM2QNKGTVG2NCVVG




VOLKSREPUBLIK CHINA

9511



/Ã&#x2019;P\UGVDGUVGJGPFCWUWPF;WCP2CPFC-NGKPG,CJTGU\CJN+PUIGUCOVI (GKPIQNF(D$$$$$-/  5VÃ&#x2019;EM)1.&5VGORGNINCP\



9513

9512

9512



;WCP2CPFC)TQ­G,CJTGU\CJNI(GKPIQNF(D$-/  )1.&(CUV5VGORGNINCP\





;WCP,CJTFGU1EJUGPI(GKPIQNF(D$-/  )1.&40WT'ZGORNCTGIGRT·IV2QNKGTVG2NCVVG



9514 9515



;WCP%JKPGUKUEJG/CNGT3K$CKUJKI(GKPIQNF(D-/  )1.&0WT'ZGORNCTGIGRT·IV1JPG-CRUGN2QNKGTVG2NCVVG





;WCP%JKPGUKUEJG-WNVWT-QORNGVVG5GTKG-/  5VÃ&#x2019;EM/KV/&/p<GTVKHKMCVGP2QNKGTVG2NCVVG

 197


VOLKSREPUBLIK CHINA

9516



;WCP2CNCUVOWUGWOKP2GMKPI-QORNGVVG5GTKG-/  5VÃ&#x2019;EM/KV/&/p<GTVKHKMCVGP2QNKGTVG2NCVVG



9518

ex 9517



;WCP&C\W;WCP%JKPGUKUEJG5GIGPU\GKEJGP2KGFHQTV-/22  5VÃ&#x2019;EM5VGORGNINCP\





;WCP,CJTFGU6KIGTUI(GKPIQNF(D$-/  )1.&40WT'ZGORNCTGIGRT·IV2QNKGTVG2NCVVG



9519 1:1,5



;WCP5GJGPUYÃ&#x2019;TFKIMGKVGPXQP*QPMQPI TGEJVGEMKIG$CTTGPOÃ&#x2019;P\GP -QORNGVVG5GTKG-/  5VÃ&#x2019;EM1TKIKPCNXGTUEJYGK­VKP1TKIKPCNGVWKOKV1TKIKPCN\GTVKHKMCV -CRUGNNGKEJVDGUEJ·FKIV2QNKGTVG2NCVVG



9520

 198

;WCP,CJTFGU6KIGTU (CTDOÃ&#x2019;P\G -/C

2QNKGTVG2NCVVG




VOLKSREPUBLIK CHINA

9521

9523

9522



;WCP2CPFC)TQ­G,CJTGU\CJNI(GKPIQNF(D$-/



;WCP,CJTFGU*CUGPI(GKPIQNF(D$-/  )1.&40WT'ZGORNCTGIGRT·IV 1TKIKPCNXGTUEJYGK­VKP1TKIKPCNGVWKOKV1TKIKPCN\GTVKHKMCV2QNKGTVG2NCVVG



 )1.&5VGORGNINCP\

;WCP,CJTFGU*CUGP-/  0WT'ZGORNCTGIGRT·IV1JPG-CRUGN2QNKGTVG2NCVVG



 

9524



;WCP,CJTG8QNMUTGRWDNKM%JKPC-QORNGVVG5GTKG-/  5VÃ&#x2019;EM/KV/&/p<GTVKHKMCVGP2QNKGTVG2NCVVG

9525



9526



;WCP,CJTFGU&TCEJGPI(GKPIQNF(D$-/

)1.&2QNKGTVG2NCVVG





;WCP,CJTFGU&TCEJGPI(GKPIQNF(D$-/  )1.&1TKIKPCNXGTUEJYGK­VOKV1TKIKPCN\GTVKHKMCV2QNKGTVG2NCVVG



9527



/Ã&#x2019;P\UGV  DGUVGJGPF CWU     WPF  ;WCP 2CPFC EQNQTKGTV  +PUIGUCOV  I   (GKPIQNF(D$$$$$-/  5VÃ&#x2019;EM)1.&2CPFC2TGOKWO5GV0WT5·V\GCWUIGIGDGP  +P*QN\MCUUGVVGOKV<GTVKHKMCV 2TKXCVG#WUICDGGKPGUFGWVUEJGP/Ã&#x2019;P\XGTUCPFJCWUGU 5VGORGNINCP\  199


VOLKSREPUBLIK CHINA

9528



/ÒP\UGV  DGUVGJGPF CWU     WPF  ;WCP 2CPFC EQNQTKGTV  +PUIGUCOV  I   (GKPIQNF(D$$$$$-/  5VÒEM)1.&2CPFC2TGOKWO5GV0WT5·V\GCWUIGIGDGP +P*QN\MCUUGVVGOKV<GTVKHKMCV 2TKXCVG#WUICDGGKPGUFGWVUEJGP/ÒP\XGTUCPFJCWUGU 5VGORGNINCP\ 

9531

9530

9529



;WCP2CPFCI(GKPIQNF(D$-/  )1.&1TKIKPCNXGTUEJYGK­V5VGORGNINCP\





;WCP2CPFCI(GKPIQNF(D$-/  )1.&1TKIKPCNXGTUEJYGK­V5VGORGNINCP\





;WCP,CJTFGT5EJNCPIG H·EJGTHÌTOKI I(GKPIQNF(D$-/  )1.&#WHNCIG'ZGORNCTG1JPG-CRUGN2QNKGTVG2NCVVG



9532

9533



;WCP,CJTFGT5EJNCPIG CEJVDQIKIGT9GNNGPUEJPKVV -/  0WT'ZGORNCTGIGRT·IV+P1TKIKPCNGVWKOKV1TKIKPCN\GTVKHKMCV2QNKGTVG2NCVVG





;WCP%JKPGUKUEJG*ÌJNGPOCNGTGK)TQVVGPXQP&WPJWCPI-/  +P1TKIKPCNGVWKOKV1TKIKPCN\GTVKHKMCV2QNKGTVG2NCVVG



9534

 200

;WCP2GMKPIQRGT-QORNGVVG5GTKG EQNQTKGTV -/  5VÒEM+P'VWKOKV<GTVKHKMCV2QNKGTVG2NCVVG




VOLKSREPUBLIK CHINA

9535

9537

9536



;WCP2CPFCI(GKPIQNF(D$-/  )1.&1TKIKPCNXGTUEJYGK­V5VGORGNINCP\





;WCP2CPFCI(GKPIQNF(D$-/  )1.&1TKIKPCNXGTUEJYGK­V5VGORGNINCP\





;WCP2CPFCI(GKPIQNF(D$-/



)1.&8QT\ÒINKEJp5VGORGNINCP\

ex 9539

9538



;WCP,CJTFGU2HGTFGU H·EJGTHÌTOKI -/  +P1TKIKPCNGVWKOKV1TKIKPCN\GTVKHKMCV2QNKGTVG2NCVVG





;WCP,CJTFGU2HGTFGU H·EJGTHÌTOKI &C\W;WCP99(2CPFC-/  5VÒEM2QNKGTVG2NCVVGWPFRQNKGTVG2NCVVGOKPDGTÒJTV



9540

9540



/ÒP\UGV  DGUVGJGPF CWU     WPF  ;WCP 2CPFC &C\W 5KNDGTOGFCKNNG  7P\G   ,CJTFGT<KGIG EQNQTKGTV .WPCT2TGOKWO5GV+PUIGUCOVI(GKPIQNF(D$$$ $$-/ 5VÒEM)1.&0WT5·V\GCWUIGIGDGP +P1TKIKPCNGVWKOKV1TKIKPCN\GTVKHKMCV5VGORGNINCP\ 

9542 Pt 9541

9541



;WCP2CPFCI(GKPIQNF(D$-/  )1.&1TKIKPCNXGTUEJYGK­V5VGORGNINCP\





;WCP2CPFCI(GKPRNCVKP(D$-/  2.#6+0+P1TKIKPCNGVWKOKV1TKIKPCN\GTVKHKMCV2QNKGTVG2NCVVG

 201


VOLKSREPUBLIK CHINA

9543



;WCP2CPFC-/  0WT'ZGORNCTGIGRT·IV+P1TKIKPCNGVWKOKV1TKIKPCN\GTVKHKMCV2QNKGTVG2NCVVG



9544



;WCP2CPFC-/

+P1TKIKPCNGVWKOKV1TKIKPCN\GTVKHKMCV2QNKGTVG2NCVVG



9545

 202

;WCP%JKPGUKUEJG5GIGPU\GKEJGP-KTUEJDCWO-/  +P1TKIKPCNGVWKOKV1TKIKPCN\GTVKHKMCV2QNKGTVG2NCVVG




VOLKSREPUBLIK CHINA

9546



;WCP,CJTFGT<KGIG H·EJGTHÌTOKI -/

/KV1TKIKPCN\GTVKHKMCV5VGORGNINCP\



9547

9547



/ÒP\UGV  DGUVGJGPF CWU     WPF  ;WCP 2CPFC &C\W 5KNDGTOGFCKNNG  7P\G    ,CJT FGU #HHGP EQNQTKGTV  .WPCT 2TGOKWO 5GV +PUIGUCOV  I (GKPIQNF (D $  $    $$$-/  5VÒEM)1.&0WT5·V\GCWUIGIGDGP +P1TKIKPCNGVWKOKV1TKIKPCN\GTVKHKMCV5VGORGNINCP\ 

9548



/ÒP\UGVDGUVGJGPFCWUWPF;WCP2CPFC+PUIGUCOVI(GKPIQNF(D $$$$$-/  5VÒEM)1.&5VÒEMNQUGKP-CRUGNUQPUVQTKIKPCNXGTUEJYGK­V5VGORGNINCP\ 

9549 Pd



;WCP2CPFCIHGKP(D$-/#  2#..#&+7/0WT'ZGORNCTGIGRT·IV2QNKGTVG2NCVVG



9550

9550



/ÒP\UGV  DGUVGJGPF CWU     WPF  ;WCP 2CPFC &C\W 5KNDGTOGFCKNNG  7P\G   ,CJTFGU*CJPU EQNQTKGTV .WPCT2TGOKWO5GV+PUIGUCOVI(GKPIQNF(D$$$ $$-/ 5VÒEM)1.&0WT5·V\GCWUIGIGDGP +P1TKIKPCNGVWKOKV1TKIKPCN\GTVKHKMCV5VGORGNINCP\  203


VOLKSREPUBLIK CHINA

9551



/Ã&#x2019;P\UGVDGUVGJGPFCWUWPF;WCP2CPFC+PUIGUCOVI(GKPIQNF(D $$$$$-/  5VÃ&#x2019;EM)1.&5VÃ&#x2019;EMNQUGKP-CRUGNUQPUVQTKIKPCNXGTUEJYGK­V5VGORGNINCP\ 

9552



;WCP,CJTFGU*CJPU CEJVDQIKIGT9GNNGPUEJPKVV -/  /KV1TKIKPCN\GTVKHKMCV2QNKGTVG2NCVVG



9553



204

;WCP2CPFCI(GKPIQNF(D$-/  )1.&0WT'ZGORNCTGIGRT·IV +PNGKEJVDGUEJ·FKIVGO1TKIKPCNGVWKOKV1TKIKPCN\GTVKHKMCV2QNKGTVG2NCVVG 


VOLKSREPUBLIK CHINA

9554



;WCP2CPFCI(GKPIQNF(D$-/  )1.&0WT'ZGORNCTGIGRT·IV +P1TKIKPCNGVWKOKV1TKIKPCN\GTVKHKMCV-CTVQPNGKEJVDGUEJ·FKIV2QNKGTVG2NCVVG



9555



/Ã&#x2019;P\UGV  DGUVGJGPF CWU     WPF  ;WCP 2CPFC &C\W 5KNDGTOGFCKNNG  7P\G   ,CJTFGU*WPFGU EQNQTKGTV .WPCT2TGOKWO5GV+PUIGUCOVI(GKPIQNF(D$$ $$$-/  5VÃ&#x2019;EM)1.&0WT5·V\GCWUIGIGDGP +PNGKEJVDGUEJ·FKIVGO1TKIKPCNGVWKOKV1TKIKPCN\GTVKHKMCV5VGORGNINCP\ 

9556



/Ã&#x2019;P\UGVDGUVGJGPFCWUWPF;WCP2CPFC+PUIGUCOVI(GKPIQNF(D $$$$$-/ 5VÃ&#x2019;EM)1.&2QNKGTVG2NCVVG 

9557



;WCP2CPFCI(GKPIQNF(D$-/

)1.&(CUV5VGORGNINCP\

 205


VOLKSREPUBLIK CHINA

9558



/Ã&#x2019;P\UGVDGUVGJGPFCWUWPF;WCP2CPFC+PUIGUCOVI(GKPIQNF(D $$$$$-/  5VÃ&#x2019;EM)1.&5VÃ&#x2019;EMNQUGKP-CRUGNUQPUVQTKIKPCNXGTUEJYGK­V5VGORGNINCP\ 

9559



;WCP2CPFC-/  0WT5VÃ&#x2019;EMIGRT·IV+P1TKIKPCNGVWKOKV1TKIKPCN\GTVKHKMCV2QNKGTVG2NCVVG



9560



/Ã&#x2019;P\UGVDGUVGJGPFCWUWPF;WCP2CPFCI(GKPIQNF-/  5VÃ&#x2019;EM)1.&1TKIKPCNXGTUEJYGK­V5VGORGNINCP\  ;WCPPKEJVKO-/XGT\GKEJPGV

206


VOLKSREPUBLIK CHINA

9561



 ;WCP  ::+: 1N[ORKUEJG 5QOOGTURKGNG  KP 2GMKPI 6CW\KGJGP WPF 5EJCVVGPDQZGP   -/ +P1TKIKPCNGVWKQJPG<GTVKHKMCVOKV/&/p7TMWPFG2QNKGTVG2NCVVG



9562



/Ã&#x2019;P\UGV  DGUVGJGPF CWU     WPF  ;WCP 2CPFC +PUIGUCOV  I (GKPIQNF   -/ 5VÃ&#x2019;EM)1.&1TKIKPCNXGTUEJYGK­V5VGORGNINCP\ 

&KG0QOKPCNGWPF;WCPUKPFKO-/PKEJVXGT\GKEJPGV

9563



/Ã&#x2019;P\UGV  DGUVGJGPF CWU    WPF  ;WCP 2CPFC .WPCT 2TGUVKIG 5GV $KOGVCNNRT·   IWPI+PUIGUCOVI(GKPIQNF 5VÃ&#x2019;EM)1.&0WT5·V\GCWUIGIGDGP +P*QN\MCUUGVVGOKV<GTVKHKMCV2QNKGTVG2NCVVG  207


VOLKSREPUBLIK CHINA

9564

 

9565

;WCP2CPFCI(GKPIQNF-/ ;WCP2CPFCI(GKPIQNF-/

9567

9566

)1.&1TKIKPCNXGTUEJYGK­V5VGORGNINCP\ )1.&1TKIKPCNXGTUEJYGK­V5VGORGNINCP\

 

9567



;WCP2CPFCI(GKPIQNF-/



 ;WCP  2CPFC /KV 2NCVKPCWHNCIG &C\W 75$TKGHOCTMG  %GPVU  OKV 5VGORGN ,#0     I(GKPIQNF(Dp-/p  )1.&0WT'ZGORNCTGIGRT·IV+O$NKUVGTXQP9CNNUVTGGV+PXGUVOGPV5VGORGNINCP\

)1.&1TKIKPCNXGTUEJYGK­V5VGORGNINCP\

 

9568



/ÒP\UGVDGUVGJGPFCWUWPF;WCP2CPFCI(GKPIQNF-/  5VÒEM)1.&1TKIKPCNXGTUEJYGK­V5VGORGNINCP\ 

9569



208

 ;WCP  ,CJT FGU 6KIGTU  -QORNGVVGT 5KNDGTUCV\ 2T·IWPIGP TWPF H·EJGTHÌTOKI CEJVDQIKIGT   9GNNGPUEJPKVVEQNQTKGTV -/  5VÒEM+P1TKIKPCNGVWKOKV1TKIKPCN\GTVKHKMCVGP2QNKGTVG2NCVVG




HONG-KONG

9570





9571

/ÒP\UGVDGUVGJGPFCWU;WCPWPFZ;WCP5JCPIJCK'ZRQ-QORNGVVG5GTKGI (GKPIQNF-/  5VÒEM)1.&+P1TKIKPCNGVWKOKV1TKIKPCN\GTVKHKMCV2QNKGTVG2NCVVG



/ÒP\UGVDGUVGJGPFCWU;WCPWPFZ;WCP5JCPIJCK'ZRQ-QORNGVVG5GTKGI (GKPIQNF-/  5VÒEM)1.&+P1TKIKPCNGVWKOKV1TKIKPCN\GTVKHKMCV2QNKGTVG2NCVVG



9572



;WCP2CPFCI(GKPIQNF

)1.&1TKIKPCNXGTUEJYGK­V5VGORGNINCP\



9574

9573

9573

/ª0<'0#75*10)-10) 

8KEVQTKC&QNNCT&CX-/

-N-TCV\GTHCUVXQT\ÒINKEJ



'NK\CDGVJ++&QNNCTU$GUWEJXQP-ÌPKIKP'NK\CDGVJ++I(GKPIQNF(D )1.&-N5EJTÌVNKPIUHGJNGTHCUV5VGORGNINCP\

  209


TAIWAN

9576

9575

/ª0<'0#756#+9#0 

4GRWDNKM;WCP,CJT  )GDWTVUVCIXQP&T5WP;CV5GPI(GKPIQNF(D -/./ )1.&+P1TKIKPCNGVWK8QT\Ã&#x2019;INKEJp5VGORGNINCP\





;WCP,CJT  )GDWTVUVCIXQP%JKCPI-CKUJGMI(GKPIQNF(D-/ ./ )1.&45VGORGNINCP\



9577

9578

9579



;WCP,CJT  )GDWTVUVCIXQP%JKCPI-CKUJGMI(GKPIQNF(D-/ ./ )1.&4(CUV5VGORGNINCP\





;WCP,CJT  )GDWTVUVCIXQP%JKCPI-CKUJGMI(GKPIQNF(D-/ ./ )1.&48QT\Ã&#x2019;INKEJp5VGORGNINCP\





)QNFOGFCKNNG  WPUKIPKGTV CWH FGP  )GDWTVUVCI XQP %JKCPI -CKUJGM $TWUVDKNF HCUV   XX9CRRGPXQP6CKYCPWOJGT$NWOGPMTCP\OOI./  )1.&5VGORGNINCP\ 

9580

9580 1,5:1



210

)QNFOGFCKNNG  WPUKIPKGTV CWH FGP  )GDWTVUVCI XQP %JKCPI -CKUJGM $TWUVDKNF HCUV X X   6CKYCPCWUFGT8QIGNRGTURGMVKXGOOI./  )1.&/KV<GTVKHKMCV'VYCU-WRHGTCWUUEJNCI2QNKGTVG2NCVVG 


LOTS CHINESISCHER MÜNZEN

.165%*+0'5+5%*'4/ª0<'0 

-NGKPG5COONWPIXQPOGKUVXGTUEJKGFGPGP/ÒP\V[RGPDGIKPPGPFOKVFGT6CPI&[PCUVKGDKU\WT4GRW DNKM'PVJCNVGPUKPFWC./WPF+PVGTGUUCPVGU1DLGMVDKVVGDGUKEJVKIGP 5VÒEM5GJTUEJÌPpHCUV5VGORGNINCP\





-NGKPG 5GTKG XGTUEJKGFGPGT &QNNCT/ÒP\GP 'PVJCNVGP UKPF ./   Z   Z      WPF Z +PVGTGUUCPVGU.QVDKVVGDGUKEJVKIGP 5VÒEM/GKUVUGJTUEJÌP





7OHCPITGKEJG5COONWPIXQP-·UEJ/ÒP\GPXGTUEJKGFGPGT&[PCUVKGPDGIKPPGPFOKVFGT3KP&[PCUVKG DKU \WO 'PFG FGU -CKUGTTGKEJU 3KPI&[PCUVKG  $GKIGIGDGP UKPF CWEJ GKPKIG #OWNGVVG UQYKG 5VÒEMG   PKEJVEJKPGUKUEJGT*GTMWPHV WC#PPCO *QEJKPVGTGUUCPVGU.QVDKVVGWPDGFKPIVDGUKEJVKIGP  5VÒEM7PVGTUEJKGFNKEJGTJCNVGPFGT)GUCOVGKPFTWEMKUVUGJTUEJÌP



5GTKGFKXGTUGTEJKPGUKUEJGT-NGKPOÒP\GPFGU-CKUGTTGKEJUUQYKGFGT4GRWDNKMWPF6CKYCPU&CDGKWC ./          WPF  +PVGTGUUCPVGU .QV DKVVG WPDGFKPIV   DGUKEJVKIGP 5VÒEM5GJTUEJÌPpXQT\ÒINKEJ





.QV XQP %JKPC&QNNCT DGUVGJGPF CWU Z (CVOCP Z &UEJWPMG5WP ;CV 5GP WPF Z /GOGPVQ &QNNCT   ./ Z WPF Z  5VÒEM/GKUVUGJTUEJÌP





5COONWPIXQP/ÒP\GPFGUWPF,CJTJWPFGTVUCWU%JKPC6KDGV6CKYCP/CECWWPF*QPMQPI &CTWPVGTZ(CV/CP&QNNCTZ&QNNCT;WPPCPWPF&QNNCT6CPI%JK;CQ+PVGTGUUCPVGU.QV DKVVGDGUKEJVKIGP 5VÒEM5GJTUEJÌPpRQNKGTVG2NCVVG





5GTKGXQP/ÒP\GPFGT2TQXKP\;WPPCPZ&QNNCTZ&QNNCTWPFZ%GPVU./ Z   Z  Z  Z $KVVGDGUKEJVKIGP 5VÒEM/GKUVUGJTUEJÌP





&KXGTUG /ÒP\GP XGTUEJKGFGPGT ,CJTJWPFGTVG WPF 'RQEJGP FCTWPVGT \YGK 5RCVGPOÒP\GP FKXGTUG   &QNNCTUVÒEMGGVE&C\W-·UEJOÒP\GPCWU8KGVPCOUQYKGGKPKIGLCRCPKUEJG/ÒP\GP+PVGTGUUCPVGU.QV DKVVGDGUKEJVKIGP 5VÒEM/GKUVUGJTUEJÌP



5GTKG 5KNXGT %TQYPU KP OQFGTP %JKPC \WO  ,CJTGUVCI FGT 2T·IWPI FGU &TCIQP &QNNCT   &QNNCT ,CJT    ;WCP 5JKJ -CK &CX  ./   &QNNCT  5WP ;CV 5GP &CX    ./   /GOGPVQ &QNNCT  5WP ;CV 5GP &CX  ./   2TQXKP\ 5\GEJWGP   &QNNCT &CX./ WPF2TQXKP\*W2GK&QNNCT &CX./ +PUGJT CVVTCMVKXGT*QN\DQZOKV'EJVJGKVU\GTVKHKMCVXQP*QEJKPVGTGUUCPVGU.QVDKVVGDGUKEJVKIGP  5VÒEM5GJTUEJÌP



-NGKPGU.QVEJKPGUKUEJGT/ÒP\GPDGUVGJGPFCWUZ/GOGPVQ&QNNCT ./ Z(CV/CP&QNNCT ;WCP 5JKJ -CK ./   Z  &QNNCT 6CPI %JK ;CQ ./   Z  &QNNCT ;WPPCP  

./ WPFZ&QNNCT;WPPCP ./ +PVGTGUUCPVGU.QVDKVVGDGUKEJVKIGP  5VÒEM/GKUVUGJTUEJÌP





-NGKPGU .QV EJKPGUKUEJGT /ÒP\GP DGUVGJGPF CWU Z 5\GEJWGP ./   Z 5WP ;CV 5GP  

./ Z;WCP5JKJ-CK ./ WPFZ;WPPCP ./  5VÒEM/GKUVUGJTUEJÌP





5GTKG XQP -NGKPOÒP\GP XGTUEJKGFGPGT 2TQXKP\GP KP -WRHGT WPF 5KNDGT +PVGTGUUCPVGU .QV DKVVG   DGUKEJVKIGP 5VÒEM/GKUVUGJTUEJÌP





#VVTCMVKXG 5COONWPI XQP 2QT\GNNCPOCTMGP WPF \GKEJGP CWU FGO 'PFG FGU  WPF FGO $GIKPP FGU   ,CJTJWPFGTVUOKVXGTUEJKGFGPGP/QVKXGP FCTWPVGTCWEJ6KGTOQVKXG WPF5EJTKHV\GKEJGP+PVGTGUUCP VGU.QVDKVVGDGUKEJVKIGP 5VÒEM5GJTUEJÌPpXQT\ÒINKEJ





.QV XGTUEJKGFGPGT EJKPGUKUEJGT /ÒP\GP GPVJCNVGP UKPF W C ./   WPF  UQYKG   &QNNCTQUVCUKCVKUEJGT*CPFGN )$ +PVGTGUUCPVGU.QVDKVVGDGUKEJVKIGP 5VÒEM/GKUVUGJTUEJÌP





-NGKPOÒP\GPXGTUEJKGFGPGT2TQXKP\GPWC././ Z ./ Z ./WPF ./ 5VÒEM/GKUVUGJTUEJÌP





5COONWPI OQFGTPGT EJKPGUKUEJGT 5KNDGTOÒP\GP CWU WPVGTUEJKGFNKEJGP 5GTKGP KP  $QZGP WPFXGTUEJKG FGPGP'VWKU*QEJKPVGTGUUCPVGU.QVDKVVGDGUKEJVKIGP  5VÒEM6GKNYGKUGKP1TKIKPCNGVWKU2QNKGTVG2NCVVG 



5COONWPI XQP  WPF ;WCP5KNDGTOÒP\GP OKV 5RQTVOQVKXGP XGTUEJKGFGPGT 1N[ORKCFGP WPF (W­   DCNNYGNVOGKUVGTUEJCHVGP+PVGTGUUCPVGU.QVDKVVGDGUKEJVKIGP 5VÒEM2QNKGTVG2NCVVG 



)TQ­G2GTUÌPNKEJMGKVGPFGTEJKPGUKUEJGP)GUEJKEJVG-QORNGVVG5GTKG    5VÒEM+PTQVGO'VWKOKV/&/p<GTVKHKMCVGP5VGORGNINCP\





'THKPFWPIGPWPF'PVFGEMWPIGPFGU#NVGTVWOU-QORNGVVG5GTKG    5VÒEM+PDNCWGO'VWKOKV/&/p<GTVKHKMCVGPHÒTLGFG/ÒP\G2QNKGTVG2NCVVG





)TQ­G2GTUÌPNKEJMGKVGPFGTEJKPGUKUEJGP)GUEJKEJVG-QORNGVVG  WPF5GTKG   5VÒEM+PDNCWGO'VWKOKV/&/p<GTVKHKMCVGPHÒTLGFG/ÒP\G2QNKGTVG2NCVVG 







211


LOTS CHINESISCHER MÜNZEN 

5COONWPI XQP    WPF ;WCP/ÒP\GP FGU <GKVTCWOU  OKV 5RQTVOQVKXGP  

1N[ORKCFGWPF(W­DCNNYGNVOGKUVGTUEJCHV FCXQPEQNQTKGTV+PVGTGUUCPVGU.QVDKVVGDGUKEJVKIGP  5VÒEM+PTQVGO'VWK2QNKGTVG2NCVVG 



-QORNGVVG 5GTKG XQP ;WCP/ÒP\GP 2CPFC LGYGKNU  7P\G (GKPUKNDGT  FGU <GKVTCWOU    +PVGTGUUCPVGU.QVDKVVGDGUKEJVKIGP 5VÒEM+PTQVGO'VWK5VGORGNINCP\ 



5GTKG EJKPGUKUEJGT 5KNDGTOÒP\GP  5VÒEM  WPF OGFCKNNGP  5VÒEM  FGU <GKVTCWOU  CWH   XGTUEJKGFGPG#PN·UUG+PVGTGUUCPVGU.QVDKVVGDGUKEJVKIGP 5VÒEM2QNKGTVG2NCVVG 



2CPFC5GTKGXQP7P\GP5VÒEMGP ;WCP FGT,CJTGZKP1TKIKPCNGVWKOKV1TKIKPCN\GTVK HKMCVZQTKIKPCNXGTUEJYGK­VZPCEJVT·INKEJEQNQTKGTV 5VÒEM5VGORGNINCP\



)TQ­G2GTUÌPNKEJMGKVGPFGTEJKPGUKUEJGP)GUEJKEJVG-QORNGVVG5GTKG    5VÒEM,GYGKNU5VÒEMKP1TKIKPCNGVWKU2QNKGTVG2NCVVG





)TQ­G 2GTUÌPNKEJMGKVGP FGT EJKPGUKUEJGP )GUEJKEJVG   -QORNGVVG 5GTKGP Z  5GTKG   Z   5GTKG  Z5GTKG  Z5GTKG  WPFZ5GTKG  +PVGTGUUCPVGU.QVDKVVG DGUKEJVKIGP 5VÒEM+P1TKIKPCNGVWKU2QNKGTVG2NCVVG





)TQ­G2GTUÌPNKEJMGKVGPFGTEJKPGUKUEJGP)GUEJKEJVG-QORNGVVG#WUICDG    5VÒEM2QNKGTVG2NCVVG





5GTKG EJKPGUKUEJGT 5KNDGTOÒP\GP \W  WPF ;WCP OKV XGTUEJKGFGPGP /QVKXGP VGKNYGKUG EQNQTKGTV    FCDGKCWEJZ7P\G2CPFC)QNFWPF;WCP;KPIWPF;CPIVGKNXGTIQNFGV+PVGTGUUCP VGU.QVDKVVGDGUKEJVKIGP 5VÒEM5VGORGNINCP\WPFRQNKGTVG2NCVVG



$GFTQJVG 6KGTYGNV Z  5GTKG  %JKPGUKUEJG (NWUUFGNRJKPG ,CRCPKUEJGT +DKU  Z  5GTKG   

5EJPGGNGQRCTF5EJYCT\UEJPCDGNUVÌTEJG WPFZ5GTKG 9KNFMCOGNG&CXKFUJKTUEJ   5VÒEM2QNKGTVG2NCVVG





2CPFC;WCP;WCP;WCP Z ;WCP;WCP;WCP +PUIGUCOVI(GKPIQNF 5VÒEM)1.&6GKNYGKUGQTKIKPCNXGTUEJYGK­V5VGORGNINCP\





2GTUÌPNKEJMGKVGPFGT9GNVIGUEJKEJVG-QORNGVVG    WPF5GTKG    5VÒEM,GYGKNUKP1TKIKPCNGVWKUVGKNYGKUGOKV1TKIKPCN\GTVKHKMCVGP2QNKGTVG2NCVVG





5GTKGXQP5KNDGTCPNCIGOÒP\GP2CPFCFGT,CJTGZ7P\GWPFZ7P\G&C\W;WCP 99( 5VÒEM/GKUV5VGORGNINCP\





-NGKPGU .QV EJKPGUKUEJGT 2CPFC/ÒP\GP GPVJCNVGP UKPF Z  ;WCP  2CPFC Z QTKIKPCNXGT   UEJYGK­V ;WCP 2CPFCKO1TKIKPCNGVWK ;WCP 99(2CPFC ;WCP 2CPFC  ;WCP 2CPFCEQNQTKGTV &C\W;WCP &TCEJGPDQQV   5VÒEM5VGORGNINCP\WPFRQNKGTVG2NCVVG



-NGKPGU .QV DGUVGJGPF CWU  ;WCP  Z /CTEQ 2QNQ   ;WCP  )GPGTCN ;WG (GK     ;WCP  5QPI ;KPI :KPI   ;WCP  &GT GTUVG -QORC­   ;WCP  &GT GTUVG 5GKUOQ   ITCRJ ;WCP $TQP\G\GKVCNVGT ;WCP -QZKPIC ;WCP &GHKPKVKQPFGT<CJN0WNN  ;WCP /Q\CTV ;WCP 'KPUVGKP ;WCP /CTM6YCKP #NNG5VÒEMGOKV/&/ <GTVKHKMCVGPOKV\WU·V\NKEJGP'TN·WVGTWPIGPWPFOGVTKUEJGP&CVGP 5VÒEM2QNKGTVG2NCVVG





-NGKPGU .QV XQP  WPF ;WCP/ÒP\GP FGU <GKVTCWOU  OKV XGTUEJKGFGPGP 5RQTVOQVKXGP   $KVVGDGUKEJVKIGP 5VÒEM2QNKGTVG2NCVVG





2CPFC5GTKGXQP7P\GP5VÒEMGP ;WCP FGT,CJTG





%JKPGUKUEJG 5KNDGTOÒP\GP XQO  DKU ;WCP5VÒEM FGU <GKVTCWOU  CWU XGTUEJKGFGPGP   5GTKGP&C\W,KCQ/CTEQ2QNQ+PVGTGUUCPVGU.QVDKVVGDGUKEJVKIGP 5VÒEM2QNKGTVG2NCVVG





%W0K WPF /GUUKPI/ÒP\GP FCTWPVGT Z  ;WCP  2CPFC 22  Z  ;WCP  (W­DCNN 22    Z;WCP5QOOGTQN[ORKCFG MQORNGVV22  5VÒEM8QT\ÒINKEJp2QNKGTVG2NCVVG





%W0K/ÒP\GP  5VÒEM  WPF /GFCKNNGP  5VÒEM  FGU <GKVTCWOU  &CTWPVGT  ;WCP    2CPFCWPFZ1N[ORKCFG 5VÒEM/GKUVRQNKGTVG2NCVVG







212

5VÒEM5VGORGNINCP\




Li Keran (1907 – 1989). Landschaft mit Wasserfall in einem felsigen Bergmassiv 79,7 x 48 cm. Verkauft für e 360.000,-

Auktionen 2011 21. Sept. Gemälde 15.–19. Jh. 30. Sept./1. Okt. Antiquarische Bücher, Graphik 18. Nov. Möbel, Porzellan, Silber, Schmuck 19. Nov. Gemälde, Zeichnungen, Skulpturen 15.–19. Jh. 1. Dez. Photographie 2. Dez. Zeitgenössische Kunst 3. Dez. Moderne Kunst 9./10. Dez. Asiatische Kunst Einlieferungen sind willkommen. Kataloge auf Anfrage und online

L E M PE RTZ Neumarkt 3 50667 Köln Poststraße 22 10178 Berlin St.-Anna-Platz 3 80538 München www.Lempertz.com

Tel. 02 21 ⁄ 92 57 29 - 0 Fax - 6 Tel. 030 ⁄ 27 87 60 8 - 0 Fax - 6 Tel. 089 ⁄ 98 10 77 67 Fax 21 01 96 95 info@Lempertz.com


Bei uns sind Sie goldrichtig!

• Über 35 Jahre Erfahrung im Gold- und Münzenhandel • Faire und objektive Bewertung Ihrer Goldmünzen • Barankauf von Goldmünzen zu tagesaktuellen Preisen • Große Auswahl interessanter Goldmünzen • Vertrauen Sie Europas führendem Auktionshaus für Münzen und Medaillen

Sie möchten Ihre Münzen veräußern? 0800 5836537 (gebührenfrei) Fritz Rudolf Künker GmbH & Co. KG Gutenbergstraße 23 · 49076 Osnabrück · Germany Tel. +49 (0)541 96 20 20 · Fax +49 (0)541 96 20 222 www.kuenker.de · service@kuenker.de Osnabrück · Berlin · München · Zürich · Moskau


Künker eAuctions

Künker eAuctions

Unsere eAuctions umfassen circa 250 Losnummern. In einem festgelegten Zeitraum von 14 Tagen haben Sie die Möglichkeit, online auf die für Sie interessanten Münzen und Medaillen zu bieten. Die einzelnen Losnummern laufen zeitlich versetzt aus. Selbstverständlich werden Sie über Ihren aktuellen Gebotsstatus laufend per Email informiert und können Ihre Gebote bei Bedarf bis zur letzten Sekunde erhöhen.

Our eAuctions contain 250 lots. During a fixed period of 14 days you have the opportunity to submit your bids online on your favourite coins and medals.

Weitere Informationen und die nächsten Termine zu den Künker eAuctions finden Sie unter:

You may find further information and the next dates of the Künker eAuctions here:

www.kuenker.de

www.kuenker.com

Each lot will expire at different times. Certainly you will be informed constantly by email about the current status of your bids so that you permanent have the possibility – if necessary – to raise your bids till the end of the eAuction.

Fritz Rudolf Künker GmbH & Co. KG Gutenbergstraße 23 · 49076 Osnabrück · Germany Tel. +49 (0)541 96 20 20 · Fax +49 (0)541 96 20 222 www.kuenker.de · service@kuenker.de Osnabrück · Berlin · München · Zürich


Leitfaden zur erfolgreichen schriftlichen Auktionsteilnahme • • • • •

Studieren Sie den Katalog sorgfältig und notieren Sie alle Lose, die interessant für Sie sind. Legen Sie für jedes Los Ihr persönliches Limit fest, das Sie maximal zu zahlen bereit sind. Füllen Sie das beiliegende Formular aus (siehe unten) und tragen Sie für jedes Los Ihr Höchstgebot ein. Schicken Sie uns Ihren Auftrag frühzeitig. Bei gleich hohen Geboten erhält das zuerst eingegangene Gebot den Zuschlag. Sie haben interessante Lose für insgesamt € 10.000,– gefunden, möchten jedoch nur € 2.000,– ausgeben. Kein Problem: Sie geben als Gesamtlimit (ohne Aufgeld) € 2.000,– an. • Wenn Sie Fragen haben: Die MitarbeiterInnen unserer Kundenbetreuung sind für Sie da: Telefon 0800 583 65 37 (gebührenfrei). • Wenn Sie telefonisch an unseren Auktionen teilnehmen möchten, ist das ab einer Schätzung von € 500,– pro Los möglich. Bitte teilen Sie uns diesen Wunsch mindestens einen Werktag vor Beginn der Versteigerung schriftlich mit.

Musterauftrag für schriftliche Gebote Name, Adresse, Telefon Ihre vollständige Anschrift ist wichtig, damit wir Ihren Auktionsauftrag annehmen und bearbeiten können. Ihre Telefonnummer brauchen wir, um Sie bei Rückfragen zu Ihren Geboten schnell erreichen zu können.

Ihre Kundennummer Die Angabe Ihrer Kundennummer unterstützt uns bei der Bearbeitung Ihres Auktionsauftrages. Viele Vorarbeiten für die Auktion werden dadurch einfacher und es werden Fehler vermieden.

Losnummern und Gebote Listen Sie alle Lose, für die Sie sich interessieren, mit ihrer Katalognummer auf und legen Sie für sich selbst fest, wie viel Sie bereit sind, für jedes einzelne Los zu bieten.

Ihr Limit pro Einzellos An dieser Stelle geben Sie an, was Sie für jedes einzelne Stück maximal bereit sind auszugeben.

„Oder“-Gebote Wenn Sie sich für mehrere Münzen interessieren, aber nur ein Stück davon erwerben wollen, können Sie Ihre Gebote einfach mit einem „Oder“ verbinden. Wichtig: bei den „Oder“Geboten können Sie nicht auf frühere Katalognummern zurückgreifen (z. B. 2890 oder 1558), da die Nr. 1558 dann bereits versteigert ist. Unterschreiben Sie Ihren Auktionsauftrag ... ... nachdem Sie Ihre Angaben noch einmal überprüft haben. Ihre Unterschrift ist wichtig, denn damit bestätigen Sie uns, dass sie tatsächlich teilnehmen wollen.

Überschreitung Ihrer Limits pro Einzellos In der Praxis zeigt sich, dass oft mehrere Bieter mit ihren Geboten dicht beieinander liegen. Deshalb empfiehlt es sich, an dieser Stelle einer geringfügigen Überschreitung Ihrer Gebote zuzustimmen. Dadurch erhöhen sich Ihre Chancen, im Wettbewerb mit anderen den Zuschlag zu erhalten.

Begrenzung Ihres Gesamtlimits Hier können sie die Gesamtsumme Ihrer Gebote begrenzen und festlegen, was Sie insgesamt maximal bereit sind auszugeben. Aufgeld und Mehrwertsteuer kommen später noch hinzu.

TEL +49 (0)541 96 20 20, FAX +49 (0)541 96 20 222, SERVICE@KUENKER.DE, WWW.KUENKER.DE


Wie entsteht der Preis einer Auktion? Der im Auktionskatalog angegebene Preis ist ein Schätzpreis, der durch unsere Experten festgelegt wurde. Das Mindestgebot liegt bei 80 % dieses Wertes. Die Zuschlagpreise sind oft deutlich höher als die Schätzpreise. Als Auktionshaus müssen wir bereits vor der Auktion alle schriftlichen Gebote koordinieren. Folgende Beispiele sind im Bietverfahren möglich: Beispiel 1 (Schätzpreis: € 1.000,–) Es liegt kein schriftlicher Auftrag vor: Der Auktionator ruft das Los in der Auktion mit € 800,– aus. Wenn im Saal nur ein Bieter darauf ein Gebot abgibt, erhält der Saalbieter den Zuschlag für € 800,–.

Beispiel 3 (Schätzpreis: € 1.000,–) Es liegt dem Auktionator nur ein schriftliches Gebot von € 850,– vor: Das Los wird in der Auktion mit € 800,– ausgerufen. Falls kein Bieter im Saal ein Gegenangebot abgibt, erhält der schriftliche Bieter den Zuschlag bei € 800,–.

Beispiel 2 (Schätzpreis: € 1.000,–) Es liegen dem Auktionator drei schriftliche Gebote vor:

Beispiel 4 (Schätzpreis: € 1.000,–) Es liegt dem Auktionator nur ein schriftliches Gebot von € 1.200,– vor: Der Auktionator ruft das Los mit € 800,– aus. Gibt es im Saal keinen Gegenbieter, erhält der schriftliche Bieter den Zuschlag bei € 800,–. Falls es im Saal Gegenbieter gibt, bietet der Auktionator für seinen schriftlichen Bieter bis maximal € 1.200,– und erteilt einem Gegenbieter im Saal erst bei mehr als € 1.200,– den Zuschlag.

Bieter 1: Limit € 2.900,– Bieter 2: Limit € 1.800,– Bieter 3: Limit € 800,– Nach der Versteigerungsordnung muss der Auktionator im Interesse von Bieter 1 und 2 angemessen überbieten (um ca. 5 bis 10 %). Der Ausrufpreis in der Auktion beträgt daher im Interesse von Bieter 1 € 1.900,– (obwohl die Schätzung € 1.000,– beträgt). Falls keine höheren Gebote aus dem Saal erfolgen, erhält Bieter 1 den Zuschlag für € 1.900,–. Das Höchstangebot von € 2.900,– musste nicht ausgeschöpft werden.

Beispiel 5 (Schätzpreis: € 1.000,–) Es liegen drei Gebote von je € 975,– vor: Um Missverständnisse zu vermeiden, überzieht der Auktionator das zuerst eingegangene Gebot geringfügig und erteilt den Zuschlag bei € 1.000,–.

Antworten auf Fragen, die uns oft gestellt werden • Zuschlagpreis/Aufgeld: Wir berechnen als Auktionshaus ein Aufgeld von 15 % auf den Zuschlagpreis, dazu kommt die gesetzliche Mehrwertsteuer. Beispiel 1

Zuschlagpreis Aufgeld 15 % Versandkosten, z. B. * MwSt. 7 % Rechnungs-Betrag

€ € € € €

100,00 15,00 5,90 8,46 129,36

Beispiel 2

Zuschlagpreis Aufgeld 15 % Versandkosten, z. B. * MwSt. 7 % Rechnungs-Betrag

€ 1.000,00 € 150,00 € 5,90 € 80,91 € 1.236,81

• Mehrwertsteuer: üblicherweise in Deutschland 7 %, seit dem 01.01.2000 sind viele Goldmünzen, die nach 1800 geprägt wurden, steuerfrei. Bei Fragen zu der MwSt.-Berechnung rufen Sie uns an, gebührenfrei unter: 0800 583 65 37. • Rücklosverkauf: Alle Lose, die in der Auktion nicht verkauft wurden, können Sie innerhalb von vier Wochen nach der Versteigerung zu 80 % des Schätzpreises (zzgl. Aufgeld und Mehrwertsteuer) erwerben. Achtung: Viele Rücklose sind schnell vergriffen. • Unser Spezialservice: Alle Bieter erhalten gratis die Ergebnisliste innerhalb von zwei Wochen nach der Auktion. Im Internet können Sie die Ergebnisliste der Auktion sofort nach der Auktion unter www.kuenker.de einsehen. * Die Kosten für Versand und Versicherung werden nach Aufwand berechnet.

Besuchen Sie uns doch einmal persönlich auf der Auktion! • Wir freuen uns sehr, wenn Sie persönlich nach Osnabrück kommen möchten. Das Flair einer Auktion und die Stimmung im Auktionssaal sind ein besonderes Erlebnis für Sie als Sammler. Osnabrück ist außerdem immer eine Reise wert und die persönliche Betreuung durch unsere Mitarbeiter wissen immer mehr Kunden zu schätzen. • Bitte rufen Sie uns rechtzeitig an, damit wir Ihnen Tipps für die Anreise geben und Ihnen ein Hotelzimmer reservieren können. Sie erreichen uns gebührenfrei unter: 0800 583 65 37. • Als erfolgreicher Bieter können Sie Ihre neu erworbenen Stücke gleich persönlich mit nach Hause nehmen. Als guter Kunde unseres Hauses haben Sie 20 Tage Zahlungsziel nach der Auktion.

TEL +49 (0)541 96 20 20, FAX +49 (0)541 96 20 222, SERVICE@KUENKER.DE, WWW.KUENKER.DE


Важная информация об участии на аукционе • Наши аукционные правила и условия Вы можете найти в конце каталога. • Мы просим Вас присылать Ваши ставки заранее. В противном случае вероятность ошибки при обработке заказа, присланного перед самым аукционом, возрастает. • Приложенный образец заполнения письменного заказа поможет Вам при отправлении Ваших письменных ставок. Ставки можно отправить как по почте, так и по факсу : +49 (0)541–96 20 222 круглосуточно. • Успешные заказы будут обрабатываться в порядке их поступления к нам. Все участники, которым не удалось что-либо купить на аукционе, будут также проинформированы после аукциона. • Если Вы впервые принимаете участие в нашем аукционе, то мы рекомендуем Вам сообщить нам Ваш референц – аукционные дома, с которыми Вы уже сотрудничали. Или свяжитесь с нами по телефону. • Мы гарантируем подлинность всех предметов, проданных на нашем аукционе, в течении неограниченного времени. • Все участники нашего аукциона получают в течении 2-ух недель результаты торгов бесплатно. • У Вас есть вопросы по определенной монете? Вы хотели бы лично принять участие в аукционе? У Вас возникли другие вопросы? Звоните нам по телефону +49 (0)541-96 20 268, и мы будем рады Вам помочь.

Мое заочное участие на аукционе • • • •

Тщательно изучите наш каталог и запишите те лоты, которые Вас заинтересовали. Определите для Себя ту максимальную сумму, которую Вы готовы заплатить за каждый лот. Заполните приложенный формуляр. Отправьте нам Ваш заказ заранее. При 2-ух и более равных ставок на один и тот же лот преимущество получает ставка, пришедшая к нам первой ( ранее других ). • Если стоимость выбранных Вами лотов составляет например 10.000 евро, а Вы могли бы потратить только 2.000 евро, то в этом случае укажите Ваш общий лимит в размере 2.000 евро. • Если у Вас возникли вопросы по заполнению формуляра, звоните нам по телефону +49 (0)541-96 20 268. Наши сотрудники будут рады Вам помочь.

Мое личное участие в Оснабрюке • Мы будем рады Вашему личному присутствию в Оснабрюке. Атмосфера, которая стоит во время аукционных торгов в зале, особенная и непередаваемая. • Для получения более подробной информации по Вашей поездке в Оснабрюк, в частности, бронирования номеров в гостинице, мы просим Вас заранее связаться с нами по телефону: +49 (0)541-96 20 268. • Приобретенные на аукционе лоты Вы можете лично забрать после окончания торгов. Наши постоянные клиенты осуществляют оплату в течение 20 дней после получения счета. Участвующие в аукционе впервые осуществляют 100%-ую предоплату.

Участие по интернету Все каталоги доступны для просмотра на нашем сайте в интернете по адресу www.kuenker.de. На сайте Вы можете выбрать интересующие Вас лоты и отправить Ваши ставки на нашу электронную почту service@kuenker.de. Если у Вас возникнут дополнительные вопросы, мы просим Вас связаться с нами по телефону +49 (0)5 41-96 20 268.

Участие по телефону Для участия в торгах по телефону просим Вас связаться с нами не позднее 48 часов до начала аукциона. Условием проведения телефонных торгов является письменное подтверждение ставки, равной как минимум стартовой цене. Участие в телефонных торгах возможно только для лотов со стартовой ценой свыше 500 евро. Для получения дополнительной информации и регистрации на аукционе звоните Анастасии Кепселль до аукциона по телефону +49 (0)5 41-96 20 268 и во время аукциона по телефону, указанному на первой странице каталога.

TEL +49 (0)541 96 20 20, FAX +49 (0)541 96 20 222, SERVICE@KUENKER.DE, WWW.KUENKER.DE


Как образовывается цена на аукционе? • Все лоты в нашем каталоге были предварительно оценены нашими экпертами. Минимальная ставка составляет 80 % от оценочной стоимости лота. Конечные цены зачастую намного превышают оценочные. • Ваши письменные ( заочные ) ставки должны быть обязательно обработаны нашими сотрудниками до начала аукциона. Рассмотрим несколько возможных примеров: Пример 1 ( Оценочная стоимость: € 1.000,– ) Заочных ставок нет. Аукционатор начинает торги с € 800,–. Если в зале только один человек, желающий приобрести этот лот, то соответственно он получит его за € 800,–. Пример 2 ( Оценочная стоимость: € 1.000,– ) У аукционатора имеются 3 заочные ставки: Заочный участник 1 : Лимит € 2.900,– Заочный участник 2 : Лимит € 1.800,– Заочный участник 3 : Лимит € 800,– По правилам аукциона аукционатор в интересах заочного участника 1 и 2 должен повышать ставку равномерно ( приблизительно на 5 – 10 % ). Поэтому в нашем случае в интересах заочного участника 1 аукционатор начнет торги с € 1.900,– ( хотя оценочная стоимость составляет € 1.000,–). Если среди очных участников никто не даст более высокую ставку, то заочный участник 1 получит этот лот за € 1.900,–. Его лимит в € 2.900,– ни в коем случае не будет исчерпан.

Пример 4 (Оценочная стоимость: € 1.000,– ) У аукционатора имеется только 1 заочная ставка в размере € 1.200,–. Аукционатор начнет торги с € 800,–. Если среди очных участников никто не даст более высокую ставку, то заочный участник получит этот лот за € 800,–. Если же в зале очный участник согласен на более высокую ставку ( больше € 800,– ), то в этом случае аукционатор в интересах заочного участника имеет право тоговаться до € 1.200,–. Следовательно только при ставке, превышающей € 1.200,–, данный лот получит очный участник в зале. Пример 5 (Оценочная стоимость: € 1.000,– ) У аукционатора имеются 3 заочные ставки, каждая в размере € 975,–. Среди очных участников интереса к лоту не имеется. В этом случае чтобы избежать недоразумений, аукционатор имеет право ненамного повысить лимит и сделать ставку равной € 1.000,–. Данный лот за € 1.000,– получит тот заочный участник, чей письменный формуляр мы получили раньше всего.

Пример 3 (Оценочная стоимость: € 1.000,– ) У аукционатора имеется только 1 заочная ставка в размере € 850,–. Аукционатор начнет торги с € 800,–. Если среди очных участников никто не даст более высокую ставку, то заочный участник получит этот лот за € 800,–.

Как я могу получить приобретенные лоты? Вывоз приобретенных на аукционе предметов осуществляется одним из следующих способов по Вашему выбору: • Вы можете лично забрать Ваши лоты. По окончании торгов мы готовим все необходимые документы на вывоз из Германии. При вывозе за пределы Евросоюза, НДС Вам возвращается. • Почтовые отправки в Россию ( Беларусь, Украину ) приобретенных Вами лотов осуществляются по предварительной договоренности. Для связи с нами звоните нам по телефону +49 (0)541-96 20 268. С 1971 года имя Кюнкер является гарантией надежности и компетентности. Мы не станем изменять нашим принципам и в будущем. Спасибо Вам за Ваше доверие, которое является не только самым сильным стимулом в нашей работе, но и наилучшей ее оценкой. Я желаю Вам успехов на нашем аукционе!

Фриц-Рудольф Кюнкер

TEL +49 (0)541 96 20 20, FAX +49 (0)541 96 20 222, SERVICE@KUENKER.DE, WWW.KUENKER.DE


Versteigerungsbedingungen Die Versteigerung erfolgt im Auftrag und für Rechnung der Eigentümer unter Einhaltung der sich aus der Versteigerungsordnung (BGB1 I 1976, 1346) ergebenden und für Kommissionäre geltenden gesetzlichen Bestimmungen des BGB und HGB gegen Barzahlung des Kaufpreises in €-Währung. Durch Abgabe eines Gebotes werden die Versteigerungsbedingungen anerkannt, dies gilt auch für die schriftlichen Gebote. Der Zuschlagpreis ist Nettopreis im Sinne des Umsatzsteuergesetzes und bildet die Berechnungsgrundlage für das vom Käufer zu zahlende Aufgeld in Höhe von 15 %. Auf den daraus entstehenden Gesamtpreis (Zuschlag + Aufgeld) wird die jeweils gültige Umsatzsteuer erhoben, soweit dies gesetzlich vorgeschrieben ist. Ausländischen Käufern aus Ländern der europäischen Gemeinschaft wird die in Deutschland gültige Umsatzsteuer berechnet. Anderen ausländischen Käufern (aus Drittländern) wird, sofern die Münzen durch uns exportiert werden, ein Aufgeld von 15 % netto auf den Zuschlagpreis berechnet; sie erhalten die Lieferung nur gegen Zahlung des Kaufpreises in €-Währung, bankspesenfrei. Ausländischen Münzhändlern aus Ländern der europäischen Gemeinschaft wird bei Nachweis der Umsatzsteuer-Identifi kationsnummer (§ 27 a USTG) und der sonstigen Voraussetzungen gemäß § 4 Nr. 1 b USTG in Verbindung mit § 6 a USTG die Lieferung ohne Umsatzsteuer berechnet. Sofern nichts anderes vereinbart wird, ist die Zahlung der Auktionsrechnung bei anwesenden Käufern sofort, bei schriftlichen Bietern spätestens 20 Tage nach Erhalt fällig. Bei Zahlungsverzug werden Zinsen von 1 % pro Monat berechnet. Wird die Zahlung nicht sofort an den Versteigerer geleistet oder die Abnahme der zugeschlagenen Sache verweigert, so findet die Übergabe der Sache an den Ersteigerer nicht statt. Der Ersteigerer verliert vielmehr seine Rechte aus dem Zuschlag, und die Sache kann auf seine Kosten erneut versteigert werden. In diesem Fall haftet der Ersteigerer für den Ausfall, dagegen hat er auf den Mehrerlös keinen Anspruch. Der Zuschlag erfolgt nach dreimaligem Ausruf des höchsten Gebotes und verpflichtet zur Abnahme und Zahlung. Bei Meinungsverschiedenheiten über den Zuschlag wird die Nummer noch einmal ausgerufen. Der Versteigerer ist berechtigt, Nummern zu vereinigen oder zu trennen. Eine Vorausnahme von Nummern erfolgt nicht. Der Zutritt zur Versteigerung ist nur Interessenten gestattet, die einen Katalog besitzen. Die Mindeststeigerungsstufen für das Bietungsverfahren betragen: Gebote

Mindeststeigerungsstufe

Schriftliche Aufträge werden von uns ohne Auftragsprovision gewissenhaft ausgeführt. Aufträge von uns unbekannten Sammlern können nur ausgeführt werden, wenn ein Depot hinterlegt wird oder Referenzen benannt werden. Schriftliche Gebote können nur bis 24 Stunden vor Auktionsbeginn verbindlich berücksichtigt werden. Im Bedarfsfall ist der Auktionator berechtigt, die Limits um 3 – 5 % zu überschreiten. Bei mehreren gleichhohen Geboten erhält das zuerst eingegangene den Zuschlag. Unlimitierte Aufträge haben keinen Anspruch auf unbedingte Ausführung. Telefonisches Bieten ist nur in Ausnahmefällen möglich. Telefonische Bieter müssen sich mindestens einen Werktag vor der Auktion voranmelden. Der Versand geht zu Lasten und auf Risiko des Ersteigerers bzw. Empfängers. Das Auktionsgut bleibt bis zur vollständigen Bezahlung aller Forderungen aus Anlass der Versteigerung Eigentum des Verkäufers. Ist der Käufer Vollkaufmann, so ist Osnabrück als Gerichtsstand vereinbart. Für das Mahnverfahren gilt die Zuständigkeit des Amtsgerichts Osnabrück auch in allen anderen Fällen als vereinbart. Ansonsten ist es Osnabrück nur, wenn nur die Firma Fritz Rudolf Künker GmbH & Co. KG ihren allgemeinen Gerichtsstand in der BRD hat, oder wenn alle Ansprüche im Wege des Mahnverfahrens geltend gemacht werden, oder wenn die im Klageweg in Anspruch zu nehmende Vertragspartei nach Vertragsabschluss ihren gewöhnlichen Aufenthaltsort aus dem Geltungsbereich der BRD verlegt hat, oder ihr Wohnsitz oder gewöhnlicher Aufenthaltsort zum Zeitpunkt der Klage nicht bekannt ist. Die Beschreibung im Katalog ist gewissenhaft durchgeführt. Sie begründet jedoch keine Rechts- oder Sachmängelhaftung gemäß §§ 434, 459 ff BGB. Die Angabe der Erhaltung ist streng nach den im deutschen Münzhandel üblichen Erhaltungseinstufungen vorgenommen und gilt als persönliche Beurteilung. Bei der Auktion anwesende Käufer kaufen grundsätzlich „wie besehen“. Da durch Vorbesichtigung Gelegenheit gegeben ist, sich vom Erhaltungszustand des Versteigerungsgutes zu überzeugen, können nach erfolgtem Zuschlag Reklamationen nur bei irrtümlich übersehener Henkel- oder Fassungsspur oder gestopftem Loch berücksichtigt werden. Bei Losen mit mehreren Stücken sind die Stückzahlen nur Circa-Angaben, irrtümliche Zuschreibungen sind im Einzelfall nicht ausgeschlossen. Diese Lose sind nach erfolgtem Zuschlag von jeder Reklamation ausgeschlossen. Der Versteigerer kann bei eventuellen Meinungsverschiedenheiten bzw. Beanstandungen einen vereidigten Sachverständigen seiner Wahl (die Kosten trägt der unterliegende Teil) beauftragen. Eventuelle Beanstandungen können nur innerhalb von 8 Tagen nach der Auktion bzw. nach Erhalt der ersteigerten Stücke berücksichtigt werden. Die Echtheit der Stücke wird bis zur Höhe des Kaufpreises garantiert. Die beigedruckten Preise sind Schätzpreise, die unter- oder überschritten werden können. Aufträge, die unter 80 % des Schätzpreises liegen, können nicht bearbeitet werden.

bis zu

€ 100,–

€ 5,–

bis zu

€ 200,–

€ 10,–

bis zu

€ 500,–

€ 20,–

bis zu

€ 1.000,–

€ 50,–

bis zu

€ 2.000,–

€ 100,–

Soweit nicht anders vermerkt, gelten im übrigen die allgemeinen Versteigerungsbestimmungen und – auch im Verhältnis zu ausländischen Kunden – gilt Deutsches Recht.

bis zu

€ 5.000,–

€ 200,–

Die Ergebnisliste erscheint sofort nach der Auktion.

bis zu

€ 10.000,–

€ 500,–

bis zu

€ 20.000,–

€ 1.000,–

bis zu

€ 50.000,–

€ 2.000,–

bis zu

€ 100.000,–

€ 5.000,–

ab

€ 100.000,–

€ 10.000,–

Ausländische Kunden kaufen nach den Devisen-, Zoll- und Steuerbestimmungen ihres Landes. Versandformalitäten werden vom Versteigerer erledigt.

Die Versteigerer:

Fritz Rudolf Künker Dr. Andreas Kaiser Arne Kirsch Oliver Köpp

TEL +49 (0)541 96 20 20, FAX +49 (0)541 96 20 222, SERVICE@KUENKER.DE, WWW.KUENKER.DE


Terms and Conditions of Auction The auction is conducted on behalf and for the account of the appropriate proprietors of the goods and is subject to the federal Auction Regulation (Versteigerungsordnung, BGB1 I 1976, 1346) published in the Federal Law Gazette Vol. I, 1976, 1346 and the relevant provisions for factors in accordance with the German Civil Code (BGB) and Commercial Code (HGB). Payment of the hammer-price has to be made in cash and in Euro. The submission of an offer implies the express acknowledgement of these Terms and Conditions of Auction; the same applies to the submission of an offer in writing. The hammer-price is exclusive of applicable German VAT according to the prevailing VAT-legislation and represents the basis for calculating the surcharge of 15 percent payable by the purchaser. The total price so calculated (hammer-price plus surcharge) is subject to the VAT (value added tax = Mehrwertsteuer), which is payable additionally. Purchasers from abroad will be charged a surcharge of 15 percent net on the hammerprice, provided the export of the coins is undertaken by the auctioneer. Buyers in European Community (EEC) countries (other than Germany) will be charged value added tax at the rates prevailing in Germany. Dealers from EEC countries (other than Germany) will receive goods free of tax upon presentation of their VAT ID number, and upon fulfillment of the other conditions set forth in Paragraph 4, Nr. 1 b, and Paragraph 6 a of the German Turnover Tax Law Buyers from other countries are not charged value added tax. Delivery will be made against payment in Euro with no bank charges to the auctioneer. Unless mutually agreed otherwise, payment of the auction bill from purchasers present at the auction is due immediately. From purchasers who have submitted a bid in writing, payment is due within 20 days after receipt of the goods. Defaulted payments shall bear an interest charge of 1 % per month in the amount in default. Should payment to the auctioneer not be made immediately or should the acceptance of the awarded item be refused, such item shall not be handed over to the purchaser. Instead the purchaser shall forfeit all right and title in and to such item from the award and the item may again be put to auction at this buyer’s cost. In this event the buyer shall be liable for any shortfall, while he shall have no right or claim towards any excess proceeds. An item will be knocked down after the highest bid has been called three times. The award shall be a binding commitment and liability on the part of the bidder to take acceptance and delivery of the item or items so awarded. In the event of any dispute with regard to the award the lot will be put up again for bidding. The auctioneer reserves the right to combine or to separate lots. Lots will not be called out of sequence. Access to the auction will only be permitted to interested persons who are in possession of the catalogue.

lot, the bid first received by the auctioneer shall be given the award. Unlimited bids shall not oblige the auctioneer to consider, accept or carry out such order. Telephone bidding is generally an option for lots of substantial value only. The registration is required at the latest a day before auction. Shipment (by mail or otherwise) of the goods shall be for the sole cost and risk of the purchaser or recipient, respectively. The auctioned goods remain the sole and exclusive property of the vendor until full payment and settlement of any and all dues and claims in connection with the auction. In the event the purchaser is a merchant (in the sense of the German commercial laws) Osnabrück shall be the agreed and exclusive place of jurisdiction. The competence of the District Court (Amtsgericht) of Osnabrück is agreed in respect of summary proceedings for the collection of defaulted payments (Mahnverfahren) as well as in any and all other cases. Should the purchaser not be a merchant Osnabrück shall be the place of jurisdiction with the District Court of Osnabrück’s competence, if only the auctioneer has his ordinary legal domicile in the Federal Republic of Germany or if claims are made by way of summary proceedings of collection (Mahnverfahren) or if the defendant has moved his ordinary legal domicile outside the jurisdiction of the Federal Republic of Germany or if the legal domicile of the defendant is unknown to the auctioneer at the time of filing a suit. To the exclusion of any other legislation German law, as in force at the time, shall be applied for the settlement of any and all legal or judicial matters. The specifications and descriptions in the catalogue have been prepared diligently and in good faith, however, do not constitute the acceptance by the auctioneer of any warranty or liability in respect of defect in material or title. The state of preservation of items is strictly assessed in accordance with the grades accepted by the German coin trade and only represents an individual and personal assessment. Purchasers present at the auction acquire items strictly on the basis of “as is where is” and “as inspected”. In view of the opportunity of prior inspection to ascertain the state and condition of the auction lots, complaints and objections made after the sale will only be considered, if by obvious error or mistake loop or traces or mountings, traces of trimmings or settings, or the plugging of a hole (eyelet) have remained unnoticed. If and when auctioned in lots, the quantities of individual pieces given, only represent an approximate figure. An error in the allocation of individual pieces to a certain lot cannot be excluded. Such lots are, therefore, excluded from any complaints or objections after the lot is knocked down. In the event of disputes or complaints as to the quality of an item the auctioneer may call upon a generally sworn expert of the trade, which the auctioneer may choose at his sole discretion, for assessment and the rendering of a decision as to the justification of such dispute or complaint. The costs of such expert shall be borne by the party loosing the dispute according to the expert’s decision. Complaints or objections, if justified, will only be considered if made and received by the auctioneer within 8 days after the auction or after receiving the lots, respectively.

The minimum rates of increase for the bidding procedure are: offers up to up to up to up to up to up to up to up to up to up to above

€ 100.– € 200.– € 500.– € 1,000.– € 2,000.– € 5,000.– € 10,000.– € 20,000.– € 50,000.– € 100,000.– € 100,000.–

minimum increase rate € 5.– € 10.– € 20.– € 50.– € 100.– € 200.– € 500.– € 1,000.– € 2,000.– € 5,000.– € 10,000.–

Orders submitted in writing will be carried out diligently and without charge of an extra commission. Orders from collectors unknown to the auctioneer can only be accepted and carried out if a deposit or references to the satisfaction on the auctioneer are given. To be bindingly accepted, written bids need to be received at least 24 hours before auction. If necessary, the auctioneer is allowed to increase the bids by 3 – 5 %. Should several bids be obtained in writing bidding the same price or prices for a given

The authenticity of the coins is warranted up to the total purchase price. The prices set out in the catalogue are estimates only, which may be exceeded or undercut. Orders for less than 80 per cent of the estimated price cannot be accepted. Purchasers from abroad will have to observe all applicable laws and regulations in respect of foreign exchange, customs duties and taxation of their country. The auctioneer will only discharge such formalities, which have to be observed, in the Federal Republic of Germany in connection with the export of the purchased item(s). Unless stipulated otherwise herein, the general rules regulations for auctions applicable in Germany shall govern any transaction in respect of the auction; German Law shall also be applicable in relation to purchasers from abroad. Only the German text has legal force. The prices realized will be published in the form of a list immediately after the auction. The auctioneers:

Fritz Rudolf Künker Dr. Andreas Kaiser Arne Kirsch Oliver Köpp

TEL +49 (0)541 96 20 20, FAX +49 (0)541 96 20 222, SERVICE@KUENKER.DE, WWW.KUENKER.DE


Numismatische Ausdrücke/Numismatic Terms/Expressions Numismatiques/ Termini di Numismatica/Нумизматические Термины DEUTSCH

ENGLISH

FRANCAIS

ITALIANO

RUSSKIJ

Abschlag Am Rand Berieben Blei Dezentriert Doppelschlag Einfassung Einseitig Emailliert Erhaltung Etwas Exemplar Fassungsspuren Fehlprägung

struck at the rim/border slightly polished lead uncentered double struck frame uniface enamelled condition/preservation slightly specimen, copy trace of mounting mis-strike

frappe en tranche frotté plomb décentré double frappe encadrement uniface émaillé conservation un peu exemplaire traces de monture défaut de frappe

coniazione al bordo trattato piombo non centrato ribattitura cornice uniface smaltato conservazione un poco esemplare tracce di montatura difetto di coniazione

Feld(er) Fundexemplar Gedenkmünze Geglättet Gelocht Geprägt Gewellt Goldpatina Henkelspur Hübsch Jahrh. = Jahrhundert Kl. = klein Korrosionsspuren Kratzer Kupfer Legierung Leicht(e) l. = links Min. = minimal Nachahmung Prachtexemplar Prägeschwäche Randdelle Randfehler Randschrift r. = rechts Rückseite

field(s) specimen from a hoard commemorative coin tooled holed minted bent golden patina mount mark attractive century small traces of corrosion scratch(es) copper alloy slightly left minimal imitation attractive, perfect piece weakly struck edge nick edge faults lettered edge to right reverse

champ exemplaire de trouvaille monnaie commémorative retouché troué frappé ondulé patine dorée trace de monture joli siècle petit traces de corrosion rayure cuivre alliage légèrement gauche minime imitation pièce magnifique de frappe faible défaut sur la tranche erreur sur la tranche tranche inscrite droite revers

campo da tesoretto moneta commemorativa liscio bucato coniato ondolato patina d´oro tracce di appicagnolo carino secolo piccolo segni di corrosione graffio(i) rame lega leggero sinistra minimamente contraffazione esemplare magnifico conio stanco ammaccatura al bordo errore nel bordo inscrizione sul bordo destra rovescio

оттиск на гурте потертая свинец ассиметричный двойной чекан кайма односторонняя эмалированная сохранность слегка экземпляр следы обработки ошибка в процессе чеканки поле экземпляр памятная монета отглаженная проколатая отчеканенная волнистая золотая патина следы от ушка красивая столетие маленький следы коррозии царапина медь сплав легкий слева минимальный имитация превосходный экземпляр издержкн при чеканкe вмятина на гурте ошибка на гурте гуртовая надпись справа реверс

TEL +49 (0)541 96 20 20, FAX +49 (0)541 96 20 222, SERVICE@KUENKER.DE, WWW.KUENKER.DE


DEUTSCH

ENGLISH

FRANCAIS

ITALIANO

RUSSKIJ

Schriftspuren

traces of inscription

traces de légende

tracce di leggenda

Schrötling Schrötlingsfehler Schwach ausgeprägt Selten in dieser Erhaltung

flan flan defect weakly struck rare in this condition

flan flan défectueux de frappe faible rare en cet état

tondello errore di tondello conio stanco conservazione rara

Seltener Jahrgang Stempel Stempelfehler Überdurchschnittlich erhalten Überprägt Unediert Unikum Vergoldet Von allergrößter Seltenheit Vorderseite Winz.= winzig Zain Zierrand Zinn ziseliert

rare year die(s) mistake in the die extraordinary condition

année rare coin erreur de frappe conservation extraordinaire

overstruck unpublished unique specimen gilt extremely rare averse tiny flan ornamental border tin chased

surfrappé inédit unique doré de toute rareté en face petit flan tranche ornée étain ciselé

annata rara conio errore di conio conservazione estraordinaria ribattuto inedito pezzo unico dorato di estrema raritá diritto veramente piccolo tondello taglio ornato stagno cesellato

следы предыдущей надписи заготовка брак заготовки слабо отчеканeна редкая в такой сохранности редкий год штамп ошибка штампа сохранность выше среднего перечекан неопубликованная монета уникальная позолоченная наиредчайшая аверс незначительный заготовка декоративный гурт цинк гравированный

Erhaltungsgrade/Grading Terms/Degrès de Conservation/Gradi di Conservazione/ Шкала сохранности DEUTSCH

ENGLISH

FRANCAIS

ITALIANO

RUSSKIJ

Polierte Platte Stempelglanz Vorzüglich Sehr schön Schön Gering erhalten

Proof Uncirculated Extremely fine Very fine Fine Very good

Flan bruni Fleur de coin Superbe Très beau Beau Très bien conservé

Fondo specchio Fior di conio Splendido Bellissimo Molto Bello Bello

полированная превосходная отличная очень хорошая хорошая удовлетворительная

Seltenheitsgrade/Rarity Terms/Degrés de Rareté/Grado di Raritá/ Шкала редкости DEUTSCH

ENGLISH

FRANCAIS

ITALIANO

RUSSKIJ

R = Selten RR = Sehr selten Von großer Seltenheit Von größter Seltenheit Von allergrößter Seltenheit Uneditiert

R = Rare RR = Very rare Very rare Extremely rare Extremely rare Unpublished

Rare Très rare De grande rareté Extrêmement rare De la plus extrême rareté Inédit

raro molto raro di grande raritá di grandissima raritá di estrema raritá inedito

редкая очень редкая большой редкости наибольшей редкости наиредчайшая ранее не описанная

TEL +49 (0)541 96 20 20, FAX +49 (0)541 96 20 222, SERVICE@KUENKER.DE, WWW.KUENKER.DE


IMPRESSUM NUMISMATISCHE BEARBEITUNG FOTOS LAYOUT DRUCK

Alexandra Spreu, Dr. Sebastian Steinbach, Jens Ulrich Thormann M. A., Eva Weber, Manuela Weiß Lübke & Wiedemann, Stuttgart danner pc - gesteuerte systeme waiblingen meister print und media, Kassel Jeglicher Nachdruck, auch auszugsweise, bedarf der Genehmigung des Auktionshauses

ZAHLUNGEN AUS DEM INLAND Deutsche Bank Osnabrück Commerzbank Osnabrück Sparkasse Osnabrück Volksbank eG Bad Laer-Borgloh-Hilter-Melle Bankhaus Lampe KG, Bielefeld Postbank Hannover HypoVereinsbank München WestLB Dortmund Paypal

(BLZ 265 700 90) Konto-Nummer 0 177 006 (BLZ 265 800 70) Konto-Nummer 780 520 200 (BLZ 265 501 05) Konto-Nummer 247 320 (BLZ 265 624 90) Konto-Nummer 1 200 222 400 (BLZ 480 201 51) Konto-Nummer 174 076 (BLZ 250 100 30) Konto-Nummer 2900 60-308 (BLZ 700 202 70) Konto-Nummer 24 17 952 (BLZ 440 500 00) Konto-Nummer 1128 842 paypal@kuenker.de, Service charge: 3,5 %

ZAHLUNGEN AUS DEM AUSLAND FOREIGN PAYMENTS Deutsche Bank Osnabrück Sparkasse Osnabrück Postbank Hannover Credit Suisse Credit Cards Paypal

IBAN: DE11 2657 0090 0017 7006 00 Swift-Code: DEUTDE3B265 IBAN: DE50 2655 0105 0000 2473 20 Swift-Code: NOLADE22XXX IBAN: DE73 2501 0030 0290 0603 08 Swift-Code: PBNKDEFF IBAN: CH43 0483 5177 3509 0200 0 Swift-Code: CRESCHZZ80A We do accept VISA and MASTERCARD, Service charge: 4,5 % paypal@kuenker.de, Service charge: 3,5 %

ZAHLUNGEN INNERHALB RUSSLANDS PAYMENTS WITHIN RUSSIA Deutsche Bank Moskau ʽʽʽΗʪ̸̨̜̖ʥ̡̦̌Η

ИНН 7728717332; КПП 772801001 Получатель: ЗАО "Кюнкер" счет №: 40702810500000000825; БИК: 044525101 корсчет №: 30101810100000000101

Profile for Fritz Rudolf Kuenker GmbH & Co. KG

Auktion 198  

Russische Münzen und Medaillen Chinesische Münzen

Auktion 198  

Russische Münzen und Medaillen Chinesische Münzen