Page 1


6KVGNHQVQ 0T  

21.'0-¤0+)4'+%* DKU  /KNKV·TKUEJGT1TFGPFGU*GT\QIVWOU9CTUEJCW /GFCKNNG8KTVWVK/KNKVCTK /QFGNN)QNFGPG/GFCKNNG OKV¤UG Z 42OOI 




AUKTION 192 Russische Münzen und Medaillen Orden und Ehrenzeichen mit interessanten Serien aus europäischem Privatbesitz ZEIT

Donnerstag, 23. Juni 2011 14.00 Uhr - 18.30 Uhr Freitag, 24. Juni 2011 09.30 Uhr - 13.00 Uhr 14.00 Uhr - 16.00 Uhr

ORT

Steigenberger Hotel Remarque Osnabrück, Natruper-Tor-Wall 1

AUKTIONS-TELEFON

+49 (0)541 60 96 633

AUKTIONS-FAX

+49 (0)541 60 96 634

Auktionen 188-192, Juni 2011 20. JUNI 2011

Auktion 188 Münzen und Medaillen aus Mittelalter und Neuzeit Bedeutende Sammlung Osnabrück

21. JUNI 2011

Auktion 189 Die Sachsensammlung Gerhart Rother

21./22. JUNI 2011

Auktion 190 Französische Münzen Eine bedeutende Sammlung aus Privatbesitz

22./23. JUNI 2011

Auktion 191 Geprägtes Gold aus drei Jahrtausenden Deutsche Münzen ab 1871

23./24. JUNI 2011

Auktion 192 Russische Münzen und Medaillen Orden und Ehrenzeichen mit interessanten Serien aus europäischem Privatbesitz


1971 bis 2011 – 40 Jahre Künker Als im Juni 1971 die Münzenhandlung Fritz Rudolf Künker als Ein-Mann-Firma in Schapdetten bei Münster gegründet wurde, konnte niemand ahnen, welche Entwicklung das Unter nehmen in der numismatischen Welt nehmen würde. Als junger Unternehmer, gerade erst 22 Jahre alt, hatte ich von kaufmännischen Fragen keine rechten Vorstellungen und studierte zunächst weiter in Münster Geschichte und Numismatik bei Peter Berghaus, dessen große Persönlichkeit mich ebenso begeisterte wie das unerschöpfliche akademische Wissen dieses herausragenden Numismatikers. Peter Berghaus hat schon damals immer wieder betont, dass die Numismatik vielleicht die einzige Disziplin ist, in der sich WissenFritiittz Ru Fr Ruddoolff Küünnke Rud ker schaftler, engagierte Laien mit beachtlichen Publikationen und der Münzhandel auf vielschichtige Weise befruchten können und oft auch miteinander befreundet sind. Ich bin fest überzeugt, dass dieser Ansatz auch heute richtig ist und der Numismatik auch in Zukunft wichtige Impulse geben kann. Im September 1971 brachte mein junges Unternehmen die Lagerliste Nummer 1 heraus: ohne Bilder und von mir auf einer Reiseschreibmaschine während der Sommerferien in Tossens am Jadebusen getippt. 1972 trat mein jüngerer Bruder Horst-Rüdiger Künker (betriebsintern K2 genannt) als Mitarbeiter ein. Inzwischen leitet er als Geschäftsführer mit großem Erfolg und unternehmerischer Umsicht die Goldhandelsabteilung des Unternehmens Künker. Die Münzenhandlung Künker zog im April 1973 nach Osnabrück um und mietete bis 1985 Geschäftsräume in der Heger Straße 13. Vermieter war der Osnabrücker Unternehmer Hermann Löffler, einer unserer ersten Kunden überhaupt und, wie viele andere Kunden auch, mit unserem Haus über Jahrzehnte treu verbunden. In Osnabrück entwickelte sich ein guter Kontakt zu den »Münzbolden«, ein kleiner Sammlerkreis, gegründet von dem bekannten Numismatiker Dr. Karl Kennepohl. Dieser Kreis traf sich einmal im Monat auf privater Ebene. Mitglied war auch der renommierte Rechtsanwalt und Notar Alfons Buller, der nicht nur ein Förderer des jungen Unternehmens wurde, sondern auch für mich ein väterlicher Freund. Es war der Wunsch der Familie Buller, dass die Münzhandlung in der früheren Kanzlei in der Gutenbergstraße 23 ein neues und größeres Domizil erhalten sollte. Der

2

Umzug erfolgte dann im Juli 1985, gleichzeitig war dies der Einstieg der Firma Künker in das Auktionsgeschäft. Einige Mitarbeiter hatten diesen Geschäftszweig dringend empfohlen, weil sowohl Käufer als auch Verkäufer den Weg über Auktionen bevorzugen. Eine gute und richtige Einschätzung, wie sich bald herausstellte. Eine erfolgreiche Entwicklung von Münzauktionen setzt engagierte Mitarbeiter voraus. Gisela Thomas war für die Betreuung der Kunden ein Glücksfall, ebenso wie die im eigenen Haus ausgebildeten Numismatiker Oliver Köpp, Alexandra Spreu, Jens-Ulrich Thormann und Manuela Weiß, die sich bei der Auf bauarbeit der Auktionsabteilung besondere Verdienste erworben haben. Heute beschäftigt das Unternehmen Künker 40 Mitarbeiter. Die beiden tragenden Säulen stellen die Münzauktionen und der Goldhandel dar. Der alles entscheidende Faktor für eine Münzhandlung ist die Akzeptanz durch die Kunden. Bei uns sind es vor allem private Sammler, die Freude an ihren Objekten haben und von ihrem Lieferanten Tugenden wie Zuverlässigkeit und Ehrlichkeit erwarten. Eine hohe Fachkompetenz und die Bereitschaft, auf die spezifischen Belange und Wünsche eines Kunden einzugehen, sind ebenso wichtig wie Kulanz und Glaubwürdigkeit. Auch für das größer gewordene Unternehmen Künker ist es nach wie vor eine Verpflichtung, jeden Kunden so individuell wie möglich zu bedienen. Das Team der Kundenbetreuung nimmt unsere Kunden als unsere wichtigsten Partner sehr ernst und wünscht sich, dass Sie als Kunde auch dann mit uns sprechen, wenn uns ein Fehler unterläuft. Damit das möglichst selten der Fall ist, sorgen Arne Kirsch und Oliver Köpp für die Qualitätssicherung aller Objekte. Der Treue unserer Kunden und dem Engagement aller Mitarbeiter ist es zu verdanken, dass die Geschichte des Hauses Künker eine Erfolgsgeschichte geworden ist. Die Umwandlung der Einzelfirma in eine Kommanditgesellschaft hat die notwendige Regelung der Nachfolge erleichtert. Inzwischen stehen mir mit meinem Sohn Ulrich Künker und Dr. Andreas Kaiser zwei tüchtige Partner zur Seite, die schon unternehmerische Verantwortung übernommen haben und die zusammen mit allen Mitarbeitern auch in Zukunft dafür sorgen werden, dass das Haus Künker ein zuverlässiger und seriöser Partner für unsere Kunden bleibt. Osnabrück, im Mai 2011 Fritz Rudolf Künker

TEL +49 (0)541 96 20 20, FAX +49 (0)541 96 20 222, SERVICE@KUENKER.DE, WWW.KUENKER.DE


1971 to 2011 – 40th Anniversary of Künker Back in June 1971 when Fritz Rudolf Künker founded his one-man gold and silver coin enterprise in Schapdetten, near Münster, nobody could possibly have imagined how the business would develop in the numismatic world. As a 22-year-old entrepreneur I did not have a lot of knowledge of things commercial and thus continued my studies of history and numismatics in Münster under Peter Berghaus. Both the great personality and the inexhaustible academic knowledge of this outstanding numismatist were a source of inspiration. Even back then Peter Berghaus emphasised that numismatics was the only discipline in which both scientists and dedicated laypersons with remarkable publications could cross pollinate the coin trade and even create friendships, and I am fully convinced that this approach will continue to provide fundamental impulses for the future. In September 1971 my fledgling business issued its very first stock list, without pictures and typed during my summer vacation on a portable typewriter in Tossens near Jadebusen. In 1972 my younger brother Horst-Rüdiger Künker (known internally as K2) joined the business. With his great business acumen he is now the successful manager of the gold trading department. The company moved to Osnabrück in April 1973, renting office space in Heger Strasse 13 until 1985. The landlord was the Osnabrück businessman Hermann Löffler, one of our first clients, and along with many other customers, has remained faithful to us through all these years. A good contact developed in Osnabrück with the »Münzbolden«, a small group of collectors founded by the well-known numismatist Dr. Karl Kennepohl who used to meet once a month on a private basis. One of the members was the well-known lawyer and notary Alfons Buller, who was not only a patron but also a fatherly friend. It was the wish of the Buller family that the coin business should move into a new and larger home in the former chancellery in Gutenbergstraße 23. The move took place in July 1985 and at the same time served as the entry into the auctioneering business.

development of coin auctions requires dedicated employees. Gisela Thomas was a godsend for the support of the customers as well as Oliver Köpp, Alexandra Spreu, Jens-Ulrich Thormann and Manuela Weiß, all of whom were trained as numismatists in-house. Today, Künker employs 40 people and the two principle branches are the auction area and the gold trade. The all-important factor in the coin business is its acceptance by the customers. Private collectors who take great pleasure in their objects expect both honesty and reliability from their suppliers. A high level of expertise and the willingness to respond to the specific concerns and wishes of the customers is just as important as fair dealing and credibility. It is still a duty to treat each customer individually even for a mature enterprise like Künker. The customer service team considers our clients as our most important partner and desires that a customer will still talk with us, even if an error has occurred. To ensure that that seldom happens, Arne Kirsch and Oliver Köpp are responsible for the quality assurance of all objects. It is thanks to the trust of our customers and the dedication of our staff that the story of the house of Künker has been such a successful one. The change of corporate form to a limited partnership has enabled us to deal with the question of the succession. I now have two competent partners by my side in my son Ulrich Künker and Dr. Andreas Kaiser, both of whom have taken on management responsibilities and who in future, together with our staff, will ensure that the house of Künker remains a reliable and respected partner for our clients. Osnabrück, May 2011

Fritz Rudolf Künker

This area of activity was highly recommended by several of our employees because both buyers and sellers preferred this and it turned out to be a wise and correct decision. The successful

TEL +49 (0)541 96 20 20, FAX +49 (0)541 96 20 222, SERVICE@KUENKER.DE, WWW.KUENKER.DE

3


1971 по 2011 – 40 лет Кюнкер Когда в июне 1971 года в городке Шапдетен была основана маленькая фирма по торговле монетами, никто не мог и предположить, какое ведущее место она займет на нумизматическом рынке. Будучи молодым предпринимателем, которому едва исполнилось 22 года и который был так далек от вопросов экономики, я продолжал учебу в университете Мюнстера на факультете истории нумизматики под руководством гоcподина Петера Бергхауз, чья личность меня покорила так же, как и богатейший опыт и глубокие знания в этой науке. Петер Бергхауз уже тогда утверждал, что нумизматика – это, пожалуй, единственная дисциплина, которая смогла объединить науку и торговлю монетами таким образом, что они стали друг другу полезными. И я убежден, что именно это объединение и будет давать новые импульсы для развития нумизматики в будущем. В сентябре 1971 года вышел первый номер печатного каталога N 1 по фиксированным ценам. Он был без фотографий и отпечатан мною на машинке во время летнего отпуска на Северном море. В 1972 мой брат Хорст Рудигер ( K2 ) cтал первым сотрудником фирмы. В настоящее время он успешно руководит отделом по торговле золотом. В апреле 1973 года фирма Кюнкер переезжает на Хегерштрассе 13, в Оснабрюк и арендует там офис до 1985 года. Арендодатель офиса – предприниматель Германн Лефлер - стал одним из наших первых клиентов и остался верен нам долгое время. В Оснабрюке фирма сразу наладила хороший контакт с клубом «Друзья Нумизматики», основанный доктором Карлом Кенненполем. Встречи в этом клубе проводились раз в месяц. Одним из членов этого клуба был известный в те времена адвокат и нотариус Альфонс Буллер, который относился ко мне по-отцовски. Желанием семьи Буллер стало новое место фирмы Кюнкер – Гуттенбергштрассе 23 – бывшее адвокатское бюро. Переезд состоялся в июле 1985 года и стал одновременно началом проведения аукционов. Некоторые сотрудники были сторонниками этого нововведения, т. к. как продавец, так и очень многие покупатели предпочитали приобретать предметы именно таким образом. Как показала прак-

4

тика – это был хороший и правильно сделанный ход. Успешное развитие аукционов предполагало слаженную работу всех сотрудников. Важным координатором в работе с клиентами была долгое время Гизела Томас. Вместе с ней огромный вклад в развитие аукционов внесли сотрудники, получившие образование на фирме: Оливер Кепп, Александра Шпрой, Енс Улрих Торманн и Мануэлла Вайс. Сегодня фирма Кюнкер насчитывает более 40 человек, и ее основными направлениями считаются аукционы и торговля золотом. Самый важный и решающий фактор в нумизматическом бизнесе – это признание клиентов. Наши клиенты – это, в первую очередь, коллекционеры, которые ожидают от нас надежность и честность. Высокий профессионализм и компетентность являются важными факторами в работе с ними. Несмотря на все растущую фирму, основным приоритетом является индивидуальный подход к каждому из покупателей. Ведь именно покупатель и есть наш самый важный партнер. Мы также стремимся, чтобы наш клиент вновь и вновь обращался к нам, несмотря на иногда допускаемые ошибки. Чтобы их избежать, Арне Кирш и Оливер Кепп проверяют на подлинность все выставляемые на аукцион предметы. Благодаря верности наших клиентов и профессионализму сотрудников фирмы история Аукционного Дома Кюнкер стала историей успеха. Реконструкция одной маленькой фирмы в Акционерное Общество облегчила мне передачу дальнейших полномочий. Теперь у меня появилось два надежных продолжателя – мой сын Улрих Кюнкер и Андреас Кайзер, которые перенимают не только всю ответственность, но готовы и в будущем вместе со всеми сотрудниками фирмы оставаться серьезным и надежным партнером для наших клиентов. Оснабрюк, май 2011 года

Фриц Рудольф Кюнкер

TEL +49 (0)541 96 20 20, FAX +49 (0)541 96 20 222, SERVICE@KUENKER.DE, WWW.KUENKER.DE


Fritz Rudolf Künker GmbH & Co. KG Die Fritz Rudolf Künker GmbH & Co. KG ist Europas führendes Auktions- und Handelshaus für Münzen, Medaillen und Orden sowie ein seriöser Partner im Bereich Goldhandel. Unser Dienstleistungsspektrum für Sie als unsere Kunden hat sich in den Jahren kontinuierlich verbessert und erweitert. Einen kleinen Überblick über unsere Angebote finden Sie hier. Fritz Rudolf Künker GmbH & Co. KG is Europe’s leading auction and trading company for coins, medals and decorations as well as your serious partner in gold trading. Our range of services for our customers has been steadily improving and expanding over the years. Following is a short overview of our offers. AUKTIONEN/AUCTIONS Besuchen Sie unsere international bedeutenden Auktionen, die Ihnen viermal jährlich zahlreiche Raritäten bieten. Profitieren Sie als Bieter oder Einlieferer von unserer Erfahrung und Kompetenz. Visit our internationally recognized auctions which take place four times a year and offer many rarities. Benefit from our experience and competence while being a bidder or consigner. GOLDHANDEL/GOLD COIN TRADING Wir bieten Ihnen ein ständiges Angebot sowie den Ankauf von Anlagemünzen aus Deutschland, Europa und aller Welt zu fairen tagesaktuellen Preisen. We are constantly offering as well as purchasing a vast range of German, European and World bullion coins. We buy and sell gold assets at a fair, daily updated market price. ONLINE-SHOP Wir bieten Ihnen in unserem Online-Shop auf www.kuenker.de ein täglich aktualisiertes Münz-Angebot von der Antike bis zur Neuzeit. Kaufen Sie hier unkompliziert zum Festpreis und ohne Risiko. We offer you an exclusive daily updated selection of coins from ancient to modern times. You can order at www.kuenker.com without hassle or risk. eAUCTIONS Unsere eAuctions finden monatlich auf unserer Homepage www.kuenker.de statt und bieten Ihnen eine besondere Auswahl von Münzen von der Antike bis zur Neuzeit. Das Besondere hierbei: das reduzierte Aufgeld von nur 10 %. Our eAuctions take place monthly at www.kuenker.com with special selection of coins from ancient to modern times. Take advantage of our reduced buyer’s fee of only 10 %. ORDEN UND EHRENZEICHEN/ORDERS AND DECORATIONS Einmal im Jahr findet unsere besondere Ordensauktion statt, die sich ganz den dekorativen Ehrenzeichen widmet. Profitieren Sie als Bieter oder Einlieferer von unserer Erfahrung und Kompetenz im Bereich Phaleristik. Once a year there is a special auction dedicated to medals and decorations. Benefit from our experience in the field of phaleristik becoming our bidder or consigner.

TEL +49 (0)541 96 20 20, FAX +49 (0)541 96 20 222, SERVICE@KUENKER.DE, WWW.KUENKER.DE

5


Besichtigung/On View Das Auktionsgut kann nach Vereinbarung besichtigt werden. Auction lots may be viewed by appointment only.

Online-Katalog/Online Catalogue

KUENKER.DE

Betrachten Sie unsere Auktionskataloge im Internet! Unter www.kuenker.de und www.sixbid.com haben Sie die Möglichkeit, Abbildungen zu vergrößern, Ihre Gebote direkt abzugeben und die Ergebnisse der Auktionen abzurufen. Please browse our auction catalogues at www.kuenker. com or at www.sixbid.com! You will have the possibility to zoom all images, to place your bids and to view all auction results online.

Künker-Service Wir sind mittlerweile mit neun eigenen Standorten in Deutschland und Europa vertreten. So können wir Ihnen unseren beliebten Künker-Service auch in Ihrer Nähe anbieten. Unsere Leistungen vor Ort: • Persönliche Beratung und Betreuung in Ihrer Nähe. • Sie können Ihre Münzen direkt einliefern oder verkaufen, ersteigerte Münzen abholen und sich nach Vereinbarung Einlieferungen auszahlen lassen. • Sie können sich von unserem Kooperationspartner auf den Künker-Auktionen vertreten lassen. We are now represented with nine locations in Germany and Europe so that we can also provide you the best service in your vicinity. Our local services: • You always have a point of contact nearby. • You can directly consign or sell your coins, collect purchases and receive by appointment payment for consignments. • You can have our cooperation partner represent you at our auctions. OSNABRÜCK Fritz Rudolf Künker GmbH & Co. KG Gutenbergstraße 23, 49076 Osnabrück Tel. +49 (0)541 96 20 20, E-Mail: service@kuenker.de Haupptstsititz inn Osnab Ha abrü brüückk

6

USt-IdNr./VAT-No: DE256270181

TEL +49 (0)541 96 20 20, FAX +49 (0)541 96 20 222, SERVICE@KUENKER.DE, WWW.KUENKER.DE


Standorte/Locations MÜNCHEN Künker Numismatik AG Löwengrube 12, 80333 München Dr. Hubert Ruß Tel. +49 (0)89 242 198 38, service@kuenker-numismatik.de

Drrr. Hu D Hube bert r Rußß

Frank Fr ank Ri an Rich chhar ards rdssen en

Fritz Rudolf Künker GmbH & Co. KG Maximiliansplatz 12a, 80333 München Frank Richardsen Tel. +49 (0)89 242 16 990, frank.richardsen@kuenker.de BERLIN Fritz Rudolf Künker GmbH & Co. KG Poststraße 22, 10178 Berlin-Mitte Wollankstraße 117, 13187 Berlin-Pankow Michael Otto Tel. +49 (0)30 247 248 91, michael.otto@kuenker.de HAMBURG Künker Hamburg, c/o Roland Trampe

Micchhae Mi ael Ot Otto to

Rola Ro land la nndd Tra ram mppe

Roland Trampe Tel. +49 (0)541 96 20 20, roland.trampe@kuenker.de KONSTANZ Künker Konstanz, c/o Michael Autengruber Schulthaißstraße 10, 78462 Konstanz Michael Autengruber Tel. +49 (0)7531 28 44 69, michael.autengruber@kuenker.de ZNOJMO Künker Znojmo, c/o Petr Kovaljov 17. Listopadu 18, 66902 Znojmo, Tschechische Republik

Michaeel Autetngruube berr

Petr Kov Pe ovaalljo jov jov

Petr Kovaljov Tel. +42 (0)603 81 10 31, petr.kovaljov@kuenker.de ZÜRICH Künker Zürich, c/o Hess-Divo AG Löwenstraße 55, 8001 Zürich, Schweiz Ulf Künker Tel. +41 (0)44 225 40 90, zuerich@kuenker.de MOSKAU Künker Moskau, c/o Russian Coin Co. Ltd. 2/21 Makarenko St., 123001 Moskau, Russland

Alek Al lek ekses y O Onncchhuukkov ov

Aleksey Onchukov Tel. +7 (495) 589 56 10, aleksey.onchukov@kuenker.de

TEL +49 (0)541 96 20 20, FAX +49 (0)541 96 20 222, SERVICE@KUENKER.DE, WWW.KUENKER.DE

7


G ld Go ldhand ndelel Nicole Aßßm muuss, A Allexxis Caw wad adia iass,s, K Kar arin ar in Rieege g r, H Horst-Rüddigger er Kün ü kkeer,r Eikke Mül Müüllller M ller er

Kund Ku nden ennbe b tr treu euuun ungg o en ob en:: Anas Annassttaasija sisijjaa Koe o psel pselll,l, Maarrio ion K Küünk nker er,, Km marr C Cha hach chou oouua, a, Alleexa xanddrraa Elflflein i , So Soniia R Ruuss ussso uunnte ntet n: Ulrl icich Kü Künkker er, Na Nadi adi dinne ne Zub uber beerr, Crriisstitina n W na Weleellze z l,l, Bar arba baara ra Wesestm sttm meyyer e , Ju Julil a Fi F nsster teter ((M Mar arke rketitiinngg) g)

8

TEL +49 (0)541 96 20 20, FAX +49 (0)541 96 20 222, SERVICE@KUENKER.DE, WWW.KUENKER.DE


Nuumi N umiissm mat atiikk oobbenn: Dr Dr. Se Sebast Seba baasts iaan St Steeiinnbbac achh,, Dzmiti ryy Nik ikul ullin in, Ar Arne ne Kirrscs h, Marku arkuus He ar Heinne (Hau (H Haust auus ecchhnnik) ikk) uunnteen: Conra onnraadd--Ag Agiillol olf Bl olf B aassch chke kkee, JeJens ns-U -Ulrlicch Thorrma -Ulr mannn, Pe Petra trra W Weeddeekä k mp mper e er

Fiina nannzzen e JJuutttta Os O in ing,g, Ger erttrruudd Lem emme men-Ka Kaalk lkerr, Bea lker Beat Be atete Liint ntke ker

Numiissm Nu matik atikk at Olliivver e K Köp ö p,p, Steepphhan öp a ie Gri rieg eger er,, H er Haann annes nnese Prraaggeer nn

Numi Nu mism sm mat atik i EEvva We Webe ber,r, Mannueela l Weiiß, Dr.r And ndr dreas rreeas a K Kai aisseser,r, Alexa leexa xand xand ndra ra SSpr prreuu

Veerw V rwalltung tung tu ng Tanja Ta njja Brrea e rley rlley ey,, Ol Olav av Meennne new wiisiscsch,h Brriiggiitttte LLüüxm xmannn, xman n, Weerrne n r La Lamp amp mprreech cht

TEL +49 (0)541 96 20 20, FAX +49 (0)541 96 20 222, SERVICE@KUENKER.DE, WWW.KUENKER.DE

9


Chronik 1971 – 2011 JUNI 1971

Gründung der Münzenhandlung Fritz Rudolf Künker mit Firmensitz in Schapdetten im Münsterland

SEPTEMBER 1971

Erste Lagerliste

SEPTEMBER 1972

Einstellung des ersten Mitarbeiters Horst-Rüdiger Künker

APRIL 1973 FEBRUAR 1985

JULI 1985

Umzug in die Heger Straße 13, Osnabrück Erste Auktion im Hotel Ibis, Osnabrück (Deutsche Münzen und Medaillen)

Umzug in die Gutenbergstraße 23, Osnabrück

MÄRZ 1987

Auktion 7: Sammlung Egon Beckenbauer (Proben von deutschen Reichsmünzen)

MÄRZ/OKTOBER 1989

Auktion 13, 14 u. 16: Sammlung Grönegreß Teil I – III (Westfälische Münzen aus einer bedeutenden Privatsammlung)

JANUAR 1990 SEPTEMBER 1999 MÄRZ 2000 JUNI 2002 MÄRZ 2003 JUNI 2005

10

Auktion 15: Sammlung Dr. med. Georg Stalling (Norddeutschland) Auktion 50: 100 Numismatische Kostbarkeiten Erste Auktion im Steigenberger Hotel Remarque, Osnabrück Auktion 76: Münzen und Medaillen von Danzig und Polen aus altem Danziger Familienbesitz Auktion 81 u. 82: Sammlung Fritzotto Bauss (Brandenburg-Preußen) und Haussammlung der Hypovereinsbank München (Bayern) Auktion 100: Numismatische Kostbarkeiten aus drei Jahrtausenden

TEL +49 (0)541 96 20 20, FAX +49 (0)541 96 20 222, SERVICE@KUENKER.DE, WWW.KUENKER.DE


JUNI 2005 FEBRUAR 2006 MÄRZ 2006 JUNI 2006 SEPTEMBER 2006 OKTOBER 2006

Erste Auktion für Orden und Ehrenzeichen Erste Auktion in Berlin im Rahmen der World Money Fair Auktion 108: Bayern und das Haus Wittelsbach Auktion 112: Die Bibliothek des Numismatikers Prof. Dr. Peter Berghaus Auktion 116: Die Sammlung Georg Baums (Belagerung, Krieg und Frieden auf Münzen und Medaillen) Erweiterung der Räumlichkeiten auf die Lürmannstraße 44

FEBRUAR 2007

Auktion 120: Die Sammlung Hans-Wilhelm Wiebe (Brandenburg-Preußen im Spiegel der Medaillenkunst)

MÄRZ/OKTOBER 2007

Auktion 121, 130 u. 137: The De Wit Collection of Medieval Coins Part I – III (1000 Years of European Coinage)

Spitzenstücke der russischen Geldgeschichte

AUKTION 164 28. Januar 2010 in Berlin

JANUAR 2008 OKTOBER 2008 JANUAR 2009 MÄRZ 2009 JANUAR 2010 JUNI 2010 SEPTEMBER 2010 DEZEMBER 2010

Umwandlung von Einzelfirma in Kommanditgesellschaft Auktion 135: Die Schlesiensammlung Klaus Propp (Silesia in Nummis) Auktion 145: Sammlung der Freiherren Bonde Teil II (Schwedische Medaillen) Sohn Ulrich Künker wird Mitgesellschafter Auktion 150: Russland – Eine bedeutende Münzen- und Medaillensammlung Auktion 164: Spitzenstücke der russischen Geldgeschichte Übernahme der numismatischen Abteilung des Bankhauses Hauck & Auf häuser und Gründung der Künker Numismatik AG Auktion 176: Sammlung Siegfried Schierhorn (Hamburg und SchleswigHolstein) Dr. Andreas Kaiser wird Mitgesellschafter

MÄRZ 2011

Auktion 184: Die Talersammlung Dr. Heinz Pielsticker Auktion 185: Die Sammlung Julius Hagander (Schweden und seine Besitzungen)

JUNI 2011

40 Jahre Künker – 40 Mitarbeiter, acht internationale Standorte und Repräsentanzen: Osnabrück (Hauptsitz), Berlin, München, Hamburg, Konstanz, Zürich, Znojmo und Moskau

TEL +49 (0)541 96 20 20, FAX +49 (0)541 96 20 222, SERVICE@KUENKER.DE, WWW.KUENKER.DE

11


Was ist für Ihre schriftliche Auktionsteilnahme besonders wichtig?

DEUTSCH

• Bitte senden Sie uns Ihre Aufträge möglichst frühzeitig zu. Wenn uns Ihr Auftrag erst kurz vor der Auktion erreicht, können sich bei der Bearbeitung Fehler einschleichen. Das beiliegende Formular erleichtert Ihnen die Abgabe eines schriftlichen Gebots. Gerne nehmen wir Ihre Gebote per Post, Fax oder Email entgegen. • Wenn Sie noch nicht bei uns gekauft haben, bitten wir Sie, uns als Referenz eine Münzhandlung anzugeben, mit der Sie bereits in Geschäftsverbindung stehen. • Wir gewährleisten die Echtheit aller verkauften Objekte auch über die gesetzliche Frist hinaus.

Sie möchten telefonisch an der Auktion teilnehmen? Die telefonische Teilnahme an der Auktion ist bei uns selbstverständlich möglich. Wir rufen Sie während der Auktion gerne an und helfen Ihnen, die gewünschten Stücke zu ersteigern. Aus organisatorischen Gründen bitten wir Sie, die folgenden Punkte zu beachten:

Ulrich Künker Leiter Kundenbetreuung

• Telefonisches Bieten ist nur bei Losen mit einer Taxe von mind. € 500,– möglich. • Bitte teilen Sie uns mindestens 48 Stunden vor der Auktion mit, zu welchen Stücken Sie angerufen werden möchten. • Bitte achten Sie darauf, dass Sie erreichbar sind, wenn Ihre Stücke versteigert werden. Der Zeitplan in diesem Katalog hilft Ihnen dabei, den Zeitpunkt der Versteigerung abzuschätzen. • Für den Fall, dass wir Sie nicht erreichen können, bieten wir in Ihrem Namen bis zur Höhe Ihres schriftlichen Gebotes, mindestens aber bis zur Höhe des Schätzpreises. • Bitte beachten Sie, dass telefonisches Bieten eine unsichere Variante der Auktionsteilnahme sein kann. Wir können keine Garantie für das Zustandekommen der telefonischen Verbindung übernehmen. Wenn Sie sicher gehen wollen, besuchen Sie bitte unsere Auktion persönlich oder geben Sie uns ein schriftliches Gebot.

Was passiert nach der Auktion? Barbara Westmeyer deutschsprachige Kundenbetreuung

Telefon: +49 (0)541 96 20 20 Fax: +49 (0)541 96 20 222 Gebührenfrei: 0800 58 36 537 E-Mail: service@kuenker.de Internet: www.kuenker.de Montag – Donnerstag 8.30 – 17.00 Uhr Freitag 8.00 – 15.30 Uhr

12

• Der Versand der Auktionsware startet sofort nach Beendigung der Auktion und dauert in der Regel 8 Tage. • Alle Kunden, die an unserer Auktion schriftlich teilgenommen haben, erhalten innerhalb von 2 Wochen nach der Auktion unsere Ergebnisliste gratis. • Alle Ergebnisse sind spätestens einen Tag nach Auktionsende auf unserer Internetseite verfügbar.

Sie möchten Ihre Münzen in unsere Auktion einliefern? Sollten Sie sich zum Verkauf Ihrer Münzen entschlossen haben, kommen Sie zu uns. Seit 1985 beweisen wir mit derzeit 4 Auktionsterminen und ca. 15 Katalogen pro Jahr unsere Kompetenz und Zuverlässigkeit. Wichtige Informationen für Sie im Überblick: • Ihre Münzen werden von unseren Experten nach neuestem numismatischem Standard bestimmt und in hochwertigen Farbkatalogen präsentiert. • Wir verfügen mit mehr als 10.000 Kunden über eine der besten Kundendateien weltweit. Im Durchschnitt verkaufen wir mehr als 95 % der Stücke einer Auktion, nicht selten erzielen wir dabei Rekordzuschläge. Für nicht verkaufte Objekte werden keine Gebühren erhoben. • Ab der Übergabe an uns sind Ihre Münzen mit dem doppelten Schätzwert versichert. Unsere Kundenbetreuung bespricht gerne mit Ihnen wie Ihre Stücke sicher zu uns gelangen können. • Ihre Einlieferung wird Ihnen sofort nach der Übernahme quittiert. Spätestens 5 Wochen vor der Auktion erhalten Sie eine Auflistung Ihrer Stücke inkl. Katalognummern und Schätzpreisen. • Unmittelbar nach der Auktion erhalten Sie die Ergebnisliste und können dann alle erzielten Preise feststellen. Den Auktionserlös erhalten Sie innerhalb von 45 Tagen nach der Auktion.

TEL +49 (0)541 96 20 20, FAX +49 (0)541 96 20 222, SERVICE@KUENKER.DE, WWW.KUENKER.DE


Important facts for a written participation in the auction • Please send us your instructions as early as possible. The likelihood of errors occurring increases if we receive your instructions only shortly before the auction. The enclosed form should make it simple for you to submit a written bid, you may send your bids by mail, fax or e-mail. • If you are a new customer who has not yet purchased from us, we do request references. Please name a coin dealer with whom you have already done business. • The genuineness of all objects sold is warranted beyond the statutory length of time.

ENGLISH

Do you wish to participate by telephone? You are welcome to participate in our auction by telephone. We are glad to call you during the auction and to assist you in bidding for your items. Please take notice of the following conditions: • Telephone bidding is accepted exclusively on lot numbers with estimates at 500 Euro or above. • Please inform us at least 48 hours in advance if you wish to register for telephone bidding, even for single lots. We do need 48 hours to schedule all incoming requests. • Please be available, when your lots will be sold. The time schedule in the catalogue will help you to estimate the approximate time when your items are going to be sold. • Should you not be available by phone, we will bid on your behalf up to your submitted written limit or at least up to the estimate of the lot for which you requested to be called. • Please be aware that telephone bidding is a risky way of participation in our auction. We do not assume liability should the telephone line be interrupted or not be achieved. We advise you to attend the auction in person or to send written bids.

Nadine Zuber English, Deutsch

What occurs after the auction? • The shipment of all auction goods starts immediately after the completion of the entire auction week and it usually takes 8 days to be completed. • All auction results are available on our website one day after the end of the auction week. • All clients who submitted bids for the auction will automatically receive the list of auction results free of charge within two weeks after the end of auction.

Do you wish to consign your coins to our auction? Should you decide to sell your coins, we are ready to assist you. Since 1985 we have earned our bona fides in conducting over 4 auctions and in publishing 15 catalogues per year. In the following you will find the most important information on consigning: • We guarantee the professional handling of your consignment following the latest numismatic level of expertise including its presentation in colour catalogues of outstanding quality. • We possess one of the best customer lists worldwide. On average we sell more than 95 % of all items in our auction, and it is not unusual for us to achieve record hammer prices for lots submitted. Unsold items incur no fees. • Once the coins are consigned they are covered by our insurance at double the estimate. Upon consultation with our customer service we try to advise you on the safest way of shipping for your coins. • Your delivery will be confirmed in writing immediately on receipt. At least five weeks before the auction, you will receive an exact list of your objects with the relevant catalogue numbers and descriptions. • Within a week of the end of auction, you will receive a list of auction results in order to see what prices were reached for each individual lot. As a consignor, you will receive the auction proceeds within 45 days after the end of auction.

Marion Künker English, Deutsch

Phone: +49 (0)541 96 20 20 Fax: +49 (0)541 96 20 222 E-Mail: service@kuenker.de Website: www.kuenker.com Monday –Thursday 8.30 AM – 5 PM Friday 8 AM – 3.30 PM

TEL +49 (0)541 96 20 20, FAX +49 (0)541 96 20 222, SERVICE@KUENKER.DE, WWW.KUENKER.DE

13


Votre participation par écrit – Les points essentiels

FRANCAIS

• Veuillez nous faire parvenir vos ordres le plus tôt possible. Si vos ordres nous parviennent juste avant la vente aux enchères, des erreurs risquent d’être commises lors de leur traitement. Le formulaire ci-joint vous aidera à rédiger facilement votre offre. Vous pouvez nous envoyer vos ordres par la poste, par fax ou par e-mail. • Si vous n’avez encore fait aucune acquisition chez nous, nous vous prions de nous indiquer une ou deux références d’autres maisons numismatiques où vous avez déjà acheté. • L’authenticité des pièces vendues est garantie même au-delà des délais légaux.

Vous voulez participer par téléphone? La participation par téléphone est bien sûr possible. Nous vous appelons volontiers pour vous aider à acquérir les pièces voulues. Pour des raisons d´organisation veuillez noter les points suivants:

Alexandra Elflein, M. A. Français, Deutsch, English, Italiano

• La participation par téléphone est possible seulement pour les lots estimé à plus de 500 Euros chacun. • Veuillez nous informer au moins 48 heures avant la vente de la liste des pièces pour lesquelles vous voudriez être appelé. • Veuillez prendre soin d´être joignable quand vos pièces seront mises en vente. L’ordre de vente dans ce catalogue vous aidera à estimer l´heure de la vente. • Dans le cas où nous ne parviendrions pas à vous joindre, nous enchérirons pour vous jusqu’au montant que vous nous indiquez par écrit, égal ou supérieur au prix d’estimation. • La participation par téléphone présente des risques, et nous déclinons toute responsabilité dans le cas où la communication téléphonique serait interrompue, ou bien ne pourrait être établie.

Ce qui se passe après la vente Kmar Chachoua Français, Deutsch, English, Arabic

Tél. +49 (0)541 96 20 20 Facs. +49 (0)541 96 20 222 E-Mail: service@kuenker.de Site: www.kuenker.de Lundi à Jeudi de 8h30 à 17h00 Vendredi de 8h00 à 15h30

14

• L´expédition des biens va commencer immédiatement après la fin de la vente complète, et prend généralement 8 jours. • Tous les clients qui ont participé à l’une de nos ventes aux enchères recevront gratuitement une liste de résultats dans les deux semaines qui suivent. • Les résultats seront disponibles sur notre site internet, au plus tard un jour après la fin de la vente.

Vous voulez confier vos monnaies pour nos ventes aux enchères? Contactez nous si vous envisagez de vendre vos pièces. Notre compétence et fiabilité est prouvée depuis 1985 par actuellement 4 ventes aux enchères et environ 15 catalogues par an. Le plus important pour vous est que: • Vos pièces seront décrites par notre équipe d’experts selon les standards numismatiques les plus récents, et elles seront présentées dans des catalogues de haute qualité en couleurs. • Nous avons un des meilleurs fichiers-clientèle du monde avec plus de 10.000 clients. Nous vendons en moyenne plus de 95% de la vente aux enchères, et obtenons souvent des prix records. Les monnaies invendues n’encourent aucun frais. • Notre service clientèle est disponible pour vous conseiller pour l’envoi de vos pièces, et dès leur réception vos pièces seront assurées pour le double de la valeur d´estimation. • Vous recevrez une liste détaillée des pièces fournies au moment de la prise en charge puis, au plus tard cinq semaines avant la vente aux enchères, vous recevrez leur liste exacte avec les numéros de catalogue correspondants. • Immédiatement après la vente aux enchères, vous recevrez la liste des résultats et pourrez prendre connaissance des prix obtenus. Vous recevrez le produit de la vente dans les 45 jours après les enchères.

TEL +49 (0)541 96 20 20, FAX +49 (0)541 96 20 222, SERVICE@KUENKER.DE, WWW.KUENKER.DE


I punti piú importanti per la Sua partecipazione per iscritto • La preghiamo di farci pervenire i Suoi ordini al piú presto possibile. Se i Suoi ordini ci arrivano poco prima dell´inizio dell´asta possono verificarsi errori. Il formulario allegato Le faciliterá l´invio dei Suoi ordini per iscritto. Ci puó far pervenire i Suoi ordini per posta, per fax o per email. • Se non ha mai acquistato presso di noi, La preghiamo di volerci indicare a titolo di referenza il nome di uno o due commercianti numismatici presso i quali è giá cliente. • L’autenticità di tutti gli oggetti venduti viene garantita anche oltre i termini previsti dalla legge.

ITALIANO

Desidera partecipare telefonicamente alla nostra asta? La partecipazione telefonica è naturalmente da noi possibile. La chiameremo durante l´asta e La assisteremo volentieri per ottenere l´aggiudicazione dei pezzi desiderati. Per motivi di organizzazione La preghiamo di voler tenere conto dei seguenti punti: • La partecipazione telefonica è possibile solo per lotti stimati con almeno 500,– € l´uno. • La preghiamo di volerci comunicare almeno 48 ore prima dell´inizio dell´asta per quali pezzi desidera essere chiamato. • La preghiamo di aver cura di essere raggiungibile telefonicamente al momento in cui vengono messi all´asta i pezzi che Le interessano. Lo schema orario in catalogo La aiuterá a stimare a che ora verranno messi all´asta i pezzi che Le interessano. • Nel caso in cui non riuscissimo a contattarLa telefonicamente, provvederemo ad offrire a Suo nome fine all´importo massimo indicatoci per iscritto, in ogni caso offriremo a Suo nome come minimo il prezzo di stima. • La partecipazione telefonica è un modo incerto di partecipare alle aste. Non assumiamo nessuna responsabilità se per esempio la linea telefonica è occupata o interrotta o se Lei non sará raggiungibile per altri motivi.

Sonia Russo, M. A. Italiano, Deutsch, English, Español

Cosa succede dopo l´asta? • La spedizione del materiale d´asta comincia subito dopo la fine dell´intera asta e termina normalmente entro 8 giorni. • Tutti i clienti che hanno partecipato all´asta ricevono entro 2 settimane dopo l´asta la lista dei prezzi di realizzo. • I prezzi di realizzo sono visionabili sul nostro sito internet al piú tardi un giorno dopo la fine dell´intera asta.

Vuole consegnarci le Sue monete per una nostra asta? Ci contatti se ha deciso di vendere le Sue monete. Dal 1985 la nostra competenza ed affidabilità è dimostrata da attualmente 4 aste e circa 15 cataloghi all´anno. Quali sono i punti di maggior importanza per Lei:

Cristina Welzel Italiano, Deutsch, English, Français

Tel.: +49 (0)541 96 20 20 Fax: +49 (0)541 96 20 222 E-Mail: service@kuenker.de Internet: www.kuenker.de Lunedì a giovedì dalle 8.30 alle 17.00 Venerdì dalle 8.00 alle 15.30

• Le Sue monete vengono valutate dal nostro staff di esperti secondo i piú attuali standard numismatici e vengono presentati in cataloghi di alto valore a colori. • Con piú di 10.000 clienti disponiamo di una delle migliori banca dati clienti del mondo. In media vendiamo oltre il 95% del materiale d´asta realizzando spesso prezzi da record. Per i pezzi invenduti non ci sono nessune spese da pagare. • Dal momento della consegna le Sue monete sono assicurate per il doppio del valore di stima. Il nostro servizio clientela Le consiglierá volentieri come farci avere le Sue monete nel modo piú sicuro. • La Sua consegna Le verrá immediatamente quietanzata al momento della resa dei pezzi. Al piú tardi 5 settimane prima dell´asta riceverá una lista dettagliata dei Suoi pezzi con i numeri di catalogo ed i prezzi di stima. • Subito dopo l´asta riceverá la lista con i risultati d´asta dalla quale potrá subito controllare i prezzi realizzati. Riceverá l´importo di realizzo entro 45 giorni dopo la fine dell´asta.

TEL +49 (0)541 96 20 20, FAX +49 (0)541 96 20 222, SERVICE@KUENKER.DE, WWW.KUENKER.DE

15


Что особенно важно при заочном участии на аукционе?

RUSSKIJ

• Тщательно изучите наш каталог и запишите те лоты, которые Вас заинтересовали. Заполните приложенный формуляр и отправьте нам его заранее по почте, факсу или электронной почте. Мы обращаем внимание на то, что если Ваши ставки придут перед самым началом аукциона либо во время аукциона, то существует вероятность допуска ошибки в процессе обработки заказа. • Если Вы впервые принимаете участие в нашем аукционе, то мы рекомендуем Вам указать Ваш референц – аукционные дома, с которыми Вы уже сотрудничали. Или свяжитесь с нами по телефону +49(0)541 9620268. • Подлинность купленных на нашем аукционе лотов гарантируется нами на протяжении неограниченного времени.

Вы хотели бы принять участие на аукционе по телефону? У нас, конечно, есть возможность организовать Ваше телефонное участие на торгах, но мы бы хотели обратить внимание на следующие пункты: Anastasija Koepsell Russkij, Deutsch

• Участие в телефонных торгах возможно только для лотов со стартовой ценой свыше 500 евро. • Для участия в торгах по телефону просим Вас связаться с нами не позднее 48 часов до начала аукциона. • Мы хотим подчеркнуть, что телефонное участие на аукционе – не самый безопасный способ: в случае плохой связи, недоступности клиента во время торгов либо других технических проблем мы не несем ответственности.

Что происходит после окончания аукциона?

Dzmitry Nikulin Russkij, Deutsch, English

Телефон: +49 (0)541 96 20 20 Факс: +49 (0)541 96 20 222 E-Mail: service@kuenker.de интернет: www.kuenker.de понедельник – четверг 8.30 – 17.00 пятница 8 – 15.30

16

• Результаты аукционов доступны на нашем сайте на следующий день после окончания торгов. • Вы можете лично забрать приобретенные лоты. По окончании торгов мы готовим все необходимые документы на вывоз из Евросоюза. • Почтовые отправки в Россию ( Беларусь, Украину ) осуществляются по предварительной договоренности. Для связи с нами звоните по телефону +49 (0)541 9620268.

Вы хотели бы выставить Ваши предметы на аукцион? Более 160-ти успешно проведенных аукционов, тысячи участников, 4 аукциона в год - эти и другие преимущества, которые говорят в пользу выставления Ваших коллекций на аукцион Кюнкер: • Ваши монеты будут оценены нашими экспертами по самым новым нумизматическим стандартам и представлены в высококачественном цветном каталоге. • Более 10000 клиентов со всего мира оказывают нам свое доверие. В среднем мы продаем более 95% всех выставляемых предметов, при этом зачастую достигая рекордных сумм. • Все Ваши предметы, после передачи их нам, хранятся у нас до начала аукциона застрахованными. Не позднее 5-ти недель до начала аукциона Вы получите по почте подробное описание Ваших лотов с указаннами номерами в каталоге, а также их оценочной стоимостью. • Результаты аукционов также будут высланы Вам по почте после окончания торгов. В течение 45 дней после аукциона Вам будет выплачено Ваше вознаграждение.

TEL +49 (0)541 96 20 20, FAX +49 (0)541 96 20 222, SERVICE@KUENKER.DE, WWW.KUENKER.DE


Zeitplan/Timetable Auktion 188 Münzen und Medaillen aus Mittelalter und Neuzeit Bedeutende Sammlung Osnabrück

Montag, 20. Juni 2011 10.00 Uhr - 13.00 Uhr Nr. 1 bis Nr. 574 Europa, Übersee, Sammlung Meyer-Coloniensis 14.00 Uhr - 18.00 Uhr Nr. 575 bis Nr. 1307 Habsburgische Erblande, Altdeutschland

Auktion 189 Die Sachsensammlung Gerhart Rother

Dienstag, 21. Juni 2011 09.30 Uhr - 13.00 Uhr Nr. 1501 bis Nr. 2244 Sachsen: Markgrafschaft Meißen, Landesherrschaft Oberlausitz, Askanier als Herzöge von Sachsen, Kurfürstentum Sachsen: Friedrich I. - Friedrich August II. 14.00 Uhr - 16.00 Uhr Nr. 2245 bis Nr. 2615 Kurfürstentum und Königreich Sachsen: Friedrich Christian - Friedrich August III., sächsische Städte, Freistaat Sachsen, Miscellanea, BRD, sächsische Orden und Auszeichnungen

Auktion 190 Französische Münzen Eine bedeutende Sammlung aus Privatbesitz

16.00 Uhr - 19.00 Uhr Nr. 3001 bis Nr. 3594 Karolinger, Königreich Frankreich: Kapetinger, Haus Valois, Haus Valois-Orléans, Haus ValoisAngoulême, Bourbonen, Erste Republik, Restauration der Bourbonen

Mittwoch, 22. Juni 2011 09.30 Uhr - 13.00 Uhr Nr. 3595 bis Nr. 4486 Haus Orléans (Bürgerkönigtum) - 5. Republik, Feodales, Elsaß, Lothringen, Kolonien

Auktion 191 Geprägtes Gold aus drei Jahrtausenden

14.00 Uhr - 18.00 Uhr Nr. 5001 bis Nr. 5771

Donnerstag, 23. Juni 2011 Deutsche Münzen ab 1871 Auktion 192 Russische Münzen und Medaillen Orden und Ehrenzeichen mit interessanten Serien aus Privatbesitz

09.30 Uhr - 13.00 Uhr Nr. 6001 bis Nr. 6853 14.00 Uhr - 18.30 Uhr Nr. 7001 bis Nr. 7727

Freitag, 24. Juni 2011 09.30 Uhr - 13.00 Uhr Nr. 8001 bis Nr. 8699 Deutsche Staaten, Heiliges Römisches Reich Deutscher Nation, Deutsches Reich, Weimarer Republik, Drittes Reich, DDR, BRD, Phaleristische Literatur, Europa: Belgien - Portugal 14.00 Uhr - 16.00 Uhr Nr. 8700 bis Nr. 9077 Europa: Rumänien - Kirchenstaat, Übersee

17


INHALT AUKTION 192 Nr. RUSSISCHE MÜNZEN UND MEDAILLEN

7001

-

7727

24

-

130

Kaiserreich

7001

-

7610

24

-

115

Großfürst Wasili III. Wasiliewitsch, 1425-1462 Eine Denga des Großfürsten Wasili III. Wasiliewitsch Zar Wladislaw Sigismundowitsch von Polen, 1610-1613 Eine Goldkopeke des Zaren Wladislaw Sigmundowitsch Zar Peter I., der Große, 1682-1725 Zwei Goldmünzen des Zaren Peter I. Silbermünzen des Moskauer Münzhofes Kadashevsky Silbermünzen des Roten Münzhofes in Moskau Ein Sonnenrubel der Münzstätte St. Petersburg Kupfermünzen des Zaren Peter I. Medaillen des Zaren Peter I.

7001

24

7001

24

7002

24

7002

24

7003 7003

-

7044 7004

24

-

32 24

7005

-

7022

24

-

27

7023

-

7033

28

-

29

7035 7040

-

7034 7039 7044

29 31

-

29 30 32

7045

-

7052

32

-

33

7045

-

7048

32

-

33

7049

-

7052

7053

-

7063

7053

-

7055

7056

-

7062

34

-

35

7064

-

7063 7087

36

-

35 40

7064

-

7079

36 -

38

7080 7085

-

7084 7086 7087

38 39

39 40 40

Zar Ivan III., 1740-1741 Ein Grivennik des Roten Münzhofes in Moskau Ein 1/2 Rubel der Münzstätte St. Petersburg

7088

-

7089

40

7088

40

7089

40

Zarin Elisabeth, 1741-1761 Goldmünzen des Roten Münzhofes in Moskau Ein goldener Doppelrubel der Münzstätte St. Petersburg Silbermünzen des Roten Münzhofes in Moskau Silbermünzen der Münzstätte St. Petersburg

7090

-

7148

40

-

48

7090

-

7100

40

-

41

Zarin Katharina I., 1725-1727 Silbermünzen des Roten Münzhofes in Moskau Silbermünzen der Münzstätte St. Petersburg Zar Peter II., 1727-1730 Silbermünzen des Roten Münzhofes in Moskau Silbermünzen des Moskauer Münzhofes Kadashevsky Eine Kupferkopeke des Moskauer Münzhofes Kadashevsky Zarin Anna, 1730-1740 Silbermünzen des Moskauer Münzhofes Kadashevsky Silbermünzen des Roten Münzhofes in Moskau Zwei Rubel der Münzstätte St. Petersburg Ein Silberjeton der Zarin Anna

18

Seite

33 34

-

35 34

-

7101

41

7102

-

7120

42

-

44

7121

-

7140

44

-

47


Nr. Kupfermünzen der Zarin Elisabeth Prägungen für Livland und Estland Prägungen für Ostpreußen Zar Peter III., 1762 Ein 10 Rubel-Stück aus der Münzstätte St. Petersburg Silbermünzen des Roten Münzhofes in Moskau Silbermünzen der Münzstätte St. Petersburg Kupfermünzen des Zaren Peter III. Zarin Katharina II., 1762-1796 Goldmünzen der Zarin Katharina II. Silbermünzen des Roten Münzhofes in Moskau Silbermünzen der Münzstätte St. Petersburg Kupfermünzen der Zarin Katharina II. Kupferprägungen für Sibirien Eine Kupferprägung für Moldawien und Walachei Medaillen der Zarin Katharina II. Zar Paul I., 1796-1801 Ein 5 Rubel-Stück der Münzstätte St. Petersburg Silbermünzen der Münzstätte St. Petersburg Kupfermünzen des Zaren Paul I. Medaillen des Zaren Paul I. Zar Alexander I., 1801-1825 Ein 10 Rubel-Stück des Zaren Alexander I. aus der Münzstätte St. Petersburg Silbermünzen der Münzstätte St. Petersburg Kupfermünzen Münzstätte Ekaterinburg Prägungen für Georgien Eine Goldprägung für Polen Medaillen des Zaren Alexander I. Zar Nikolaus I., 1825-1855 Goldmünzen des Zaren Nikolaus I. Platinmünzen des Zaren Nikolaus I. Silbermünzen der Münzstätte St. Petersburg Silbermünzen der Münzstätte Warschau Kupfermünzen des Zaren Nikolaus I. Gedenkmünzen des Zaren Nikolaus I. Eine Kupferprobe der Münzstätte St Petersburg Prägungen für Polen Medaillen des Zaren Nikolaus I. Zar Alexander II., 1855-1881 Goldmünzen des Zaren Alexander II. Silbermünzen des Zaren Alexander II. Prägungen für Polen

Seite

7141 7145 7147 -

7144 7146 7148

47

-

48 48 48

7149

7156

49

-

51

-

7149

49

7150

-

7151

49

-

50

7152 7155

-

7154 7156

7157 7157

-

7217 7163

51 51

-

60 52

7164

-

7168

52

-

53

7169 7198 7208

-

7197 7207 7213

53 57

-

57 58 59

7215

-

7214 7217

7218

-

7238

50 51

60 60 61

-

7218

64 61

7219 7234 7236

-

7233 7235 7238

61

-

63 63 64

7239

-

7294

64

-

72

7239 7240 7274 7285

-

64

7288

-

7273 7284 7286 7287 7294

65 69

-

71

-

68 70 70 70 72

7295 7295 7304

-

7425 7303 7314

72 72 73

-

89 73 75

7315 7378 7380 7390

-

7377 7379 7389 7394

75

-

82 83

-

82 82 83 84

7396 7416

-

7395 7415 7425

85 87

-

84 87 89

7426 7426 7441 7470

-

7490 7440 7469 7471

90 90 92

-

98 91 94 94 19


Nr. Kupfermünzen des Zaren Alexander II. Gedenkmünzen des Zaren Alexander II. Eine Probeprägung der Münzstätte Brüssel Prägungen für Finnland Medaillen des Zaren Alexander II.

7472 7479

-

7482 7484

-

7478 7480 7481 7483 7490

Zar Alexander III., 1881-1894 Goldmünzen des Zaren Alexander III. Silbermünzen des Zaren Alexander III. Kupfermünzen des Zaren Alexander III. Gedenkmünzen des Zaren Alexander III. Prägungen für Finnland Feingewichtsbarren der Münzstätte St. Petersburg Medaillen des Zaren Alexander III.

7491 7491 7505 7528 7531 7534

-

7545 7504 7527 7530 7533 7536

7537 7539

-

7538 7545

Zar Nikolaus II., 1894-1917 Goldmünzen des Zaren Nikolaus II. Silbermünzen des Zaren Nikolaus II. Kupfermünzen des Zaren Nikolaus II. Ein 37 1/2 Rubel-Stück des Zaren Nikolaus II. aus der Münzstätte St. Petersburg Gedenkmünzen des Zaren Nikolaus II. Prägungen für Finnland Medaillen des Zaren Nikolaus II.

7546 7546 7560 7581

-

7610 7559 7580 7586

7588 7600 7605

-

7587 7599 7604 7610

Sowjetunion, 1917-1991

7611

-

Russische Republik seit 1992

7668

Lots und Sammlungen russischer Münzen und Medaillen ORDEN UND EHRENZEICHEN Deutsche Staaten Anhalt Baden Bayern Braunschweig Frankfurt Fürstenberg Hannover Freie Hansestädte Hessen Hohenzollern Lippe, Schaumburg-Lippe Mecklenburg-Schwerin Oldenburg Preußen Reuß Sachsen, sächsische Herzogtümer Schleswig-Holstein Waldeck und Pyrmont Württemberg Würzburg Heiliges Römisches Reich Deutscher Nation (bis 1806) 20

Seite 95 95 96 96 98

96

-

98 98 100

-

104

-

106 106 107

-

112

-

114

-

111 113 114 115

7667

116

-

123

-

7707

123

-

128

7708

-

7727

8001 8001

-

8002 8026 8063 8070

-

8075

-

8080

-

8102 8105 8108 8137 8213 8218 8254 8257 8259

-

9077 8281 8001 8025 8062 8069 8073 8074 8078 8079 8099 8101 8104 8107 8136 8212 8217 8253 8256 8258 8280 8281 8282

105 100 102 103 103 103 103 105 115 107 110 110

129 131 131

-

131 136 141 142

-

143

-

147

-

149 154

-

164

-

172

-

344 177 131 136 141 142 143 143 143 143 147 147 148 148 154 164 164 171 171 171 177 177 178


Nr.

Seite

Deutsches Reich 1871-1918

8283

-

8288

Weimarer Republik 1919-1933 Drittes Reich 1933-1945

8289 8302

-

8301 8320

Deutsche Demokratische Republik, 1949-1990

8321

-

8323

8324 8324

-

8332

-

178 178 181

-

180 183 183

Bundesrepublik Deutschland seit 1949 Verdienstorden Mecklenburg-Vorpommern Niedersachsen Nordrhein-Westfalen Rheinland-Pfalz Sachsen Unbekannte Orden und Ehrenzeichen Miniaturen Ordenschnallen Miniaturenschnallen und -kettchen Konvolute Phaleristische Literatur

8337

-

8340 8398 8415 8421

-

8423 8330 8331 8333 8334 8335 8336 8338 8339 8397 8414 8420 8423

184 184

-

187 200 203

-

204 185 186 186 186 186 186 186 187 200 203 204 204

Erster Weltkrieg Konvolute-International

8424 8428

-

8427 8433

205 205

Miniaturen-International

8434

-

8436

206

Unbekannte Auszeichnungen Belgien

8438

-

8437 8460

-

206 210

211

-

210 212

207

Bosnien und Herzegowina Bulgarien

8462

-

8461 8470

Dänemark Estland

8471 8480

-

8479 8481

213

-

214 214

Finnland

8482

-

8497

215

-

217

Frankreich Erstes Kaiserreich (1804-1814/1815) Königreich (Zweite Restauration 1815-1830) Zweites Kaiserreich (1852-1870) Dritte Republik (1870-1940) Vierte Republik (1946-1958) Fünfte Republik (seit 1958) Dritte bis Fünfte Republik (seit 1870)

8498

-

8561 8498

218

-

229 218

8499 8509 8513 8531 8534 8537

-

8508 8512 8530 8533 8536 8561

218

-

221

-

225

-

219 220 224 224 225 229

8562

-

8563

-

8564 8562 8564

Griechenland Zweites Königreich (1863-1924) Drittes Königreich (1935-1973)

230 230 230

Vereinigtes Königreich von Großbritannien und Nordirland

8565

-

8586

Internationale und Gesellschaftsorden

8587

-

8589

235

8591

-

8590 8593

235 236

8594 8594 8600

-

8623 8599 8617

8618 8620

-

8619 8623

Irland Island Italien Herzogtum Modena (bis 1861) Königreich (1841-1946) Königliche Familie der Herzöge von Savoyen (seit 1946) Republik (seit 1946)

231

237 237 239

244

-

234

-

245 238 243

-

243 245 21


Nr. Lettland

8624

-

8627

Luxemburg Souveräner Malteser Ritterorden

8628 8639

-

8638 8650

245 246 248

-

247 251

Monaco

8651

251

Montenegro

8652

251 252

Niederlande

8653

-

8657

Norwegen

8658

-

8667

253

-

254

Österreich Kaiserreich (1804-1918) Königreich Böhmen innerhalb des Kaiserreichs Erste Republik (1918-1934) und Ständestaat (1934-1938)

8668 8668

-

8682 8680

255 255

-

257 257

Polen Portugal Königreich (bis 1910) Republik (seit 1910)

8683 8689 8689 8698

-

8688 8699 8697 8699

258 261 261

-

261 264 263 264

Rumänien Königreich (1881-1947) Sozialistische Republik (1965-1989)

8700 8700

-

8714 8713 8714

265 265

-

267 267 267

Russland Zarentum (bis 1917) Provisorische russische Regierung (1917-1918) Russischer Bürgerkrieg (1918-1922) Georgische Legion Exil Sowjetunion Russisch-Orthodoxes Patriarchat von Moskau

8715 8715

-

8806 8794

268 268

-

280 278

8798 8802

-

8795 8796 8797 8801 8803

-

279 279 279 279 280

8804

-

8806

San Marino Schweden

8807 8812

-

8811 8873

8875

-

8874 8882

8875

-

8878

8879

-

8882

8883

-

8903

296

-

303

8883 8885

-

8884 8898

297

-

296 301

8899

-

8902 8903

301

-

Schweiz Serbien und Jugoslawien Fürstentum und Königreich (1817/1867-1918) Jugoslawien, Föderalistische Volksrepublik (1945-1963) Spanien Drittes Königreich, Regierung Isabellas II. (1833/1843-1868) Fünftes Königreich (1874-1931) Spanischer Staat Regierung von Francisco Franco (1936-1975) Sechstes Königreich (seit 1975)

22

Seite

8681

257

8682

257

Tschechoslowakei Ukraine

8905

-

8904 8906

Ungarn Königreich (1922-1944) Volksrepublik (1949-1989)

8907 8907 8909

-

8910 8908 8910

279

280 280 282

-

281 293

293

-

293 295

293

-

294 295

303

-

302 303 303 304 304 304 304


Nr. Kirchenstaat, heiliger Stuhl und Vatikan Ägypten Königreich (1923-1953) Republik (seit 1953)

8911 8983 8983 8985

-

Äquatorial-Guinea Äthiopien

8988

-

Afghanistan Bénin (-Dahomey) Brasilien Kaiserreich (1822-1889) Föderative Republik (seit 1891)

8994 8994 8999

-

Burundi

Seite 8982 8986 8984 8986

305 319

-

318 320 319 320

8987

320

8991

321

8992 8993

322 322

9002 8998 9002

323 323 324

-

9003

325 324 325 325

Chile Elfenbeinküste

9004 9007

-

9006 9011

325 326

-

326 327

Indien

9012

-

9013

327 328 330

Irak Japan

9015

-

9014 9024

Jordanien Kambodscha

9025 9027

-

9026 9028

331 331

Kolumbien Kongo

9029

-

9030 9031

332 332

Korea Kuba

9032 9033

332 333

Laos Libanon

333 334

Nepal Niger

9035

-

9037

334

9038 9041

-

9040 9042

334 334

-

9043 9055

335 338

9044

Syrien Thailand

-

9034 9036

Manchukuo Marokko Mongolei

328

333

335

-

-

9056 9057

-

Tschad

9060

339 339

-

340

9061

340 341 342

Türkei Tunesien

9062 9068

-

9067 9070

Venezuela

9071

-

9072

342

-

343

Vereinigte Staaten von Amerika (U. S. A.)

9073

-

9077

343

-

344

Ein Stichwortverzeichnis finden Sie am Ende des Auktionskataloges 188.

23


WASILI III. WASILIEWITSCH

4755+5%*'/ª0<'070&/'&#+..'0

1,5:1

7001

1,5:1

)4155(ª4569#5+.++++9#5+.+'9+65%* 'KPG&GPICFGU)TQ­HÒTUVGP9CUKNK+++9CUKNKGYKVUEJ 

&GPICQ,/QUMCWI8CTKCPVGOKVCTCDKUEJGT5EJTKHVCWHFGT4ÒEMUGKVG(ÒTUVTGKVGVTKPFGT 4GEJVGPGKPGP(CNMGP5EJTKHV5RCUUMK&CUTWUUKUEJG/ÒP\U[UVGO5#DDXCT  4*ÒDUEJG2CVKPCUGJTUEJÌP



7002 2:1

2:1

<#49.#&+5.#95+)+5/70&19+65%*81021.'0 'KPG)QNFMQRGMGFGU<CTGP9NCFKUNCY5KIKUOWPFQYKVUEJ 

-QRGMGKP)QNFQ,/QUMCW+P752NCUVKMJQNFGTFGT2%)5OKVFGT$GYGTVWPI#7(D-CKO -QRKEMK 4  )1.&8QPITQ­GT5GNVGPJGKV5GJTUEJÌP



7003

2:1

2:1

<#42'6'4+&'4)4155' <YGK)QNFOÒP\GPFGU<CTGP2GVGT+ 

4WDGN/QUMCW4QVGT/ÒP\JQHI)GJCTPKUEJVGU$TWUVDKNFTOKV.QTDGGTMTCP\WPFWO IGNGIVGO/CPVGN5V#PFTGCUUVGJVXXFCU-TGW\JKPVGTUKEJJCNVGPF$KVMKP 4 &KCMQX(D )1.&445GJTUEJÌPpXQT\ÒINKEJ



7004

2:1



24

2:1

4WDGN/QUMCW4QVGT/ÒP\JQHI)GJCTPKUEJVGU$TWUVDKNFTOKV.QTDGGTMTCP\WPFWO IGNGIVGO /CPVGN QJPG 2CNO\YGKI CWH FGT $TWUV5V #PFTGCU UVGJV X X FCU -TGW\ JKPVGT UKEJ JCN   VGPF$KVMKPXCT 4 &KCMQX(D  )1.&44-N5EJTÌVNKPIUHGJNGTHCUVXQT\ÒINKEJGU'ZGORNCT 


PETER I.

7005

7006

7007

5KNDGTOÒP\GPFGU/QUMCWGT/ÒP\JQHGU-CFCUJGXUM[ 

4WDGN M[TKNNKUEJ /QUMCW/ÒP\JQH-CFCUJGXUM[I$KVMKP 4 &CX&KCMQX 45GJTUEJÌP





4WDGN M[TKNNKUEJ /QUMCW/ÒP\JQH-CFCUJGXUM[I$KVMKP 4 &CX&KCMQX 49KP\5EJTÌVNKPIUHGJNGTCO4CPFUGJTUEJÌP





4WDGN  M[TKNNKUEJ  /QUMCW /ÒP\JQH -CFCUJGXUM[  I $KVMKP  4  &CX    &KCMQXXCT 8QPITQ­GT5GNVGPJGKV5EJÌPpUGJTUEJÌP



7008

7009

7010



4WDGN M[TKNNKUEJ /QUMCW/ÒP\JQH-CFCUJGXUM[I$KVMKP 4 &CX&KCMQX -N5EJTÌVNKPIUHGJNGTCO4CPFUGJTUEJÌPpXQT\ÒINKEJ



4WDGN  M[TKNNKUEJ  /QUMCW /ÒP\JQH -CFCUJGXUM[  I $KVMKP  &CX  &KCMQX    5GJTUEJÌP 



4WDGN  M[TKNNKUEJ  /QUMCW/ÒP\JQH-CFCUJGXUM[I$KVMKP&CX&KCMQX 5GJTUEJÌP 



25


PETER I.

7011

7012

7013



4WDGN  M[TKNNKUEJ  /QUMCW/ÒP\JQH-CFCUJGXUM[I$KVMKP&CX&KCMQX 5GJTUEJÌP 



4WDGN M[TKNNKUEJ /QUMCW/ÒP\JQH-CFCUJGXUM[I$KVMKPXCT&CX&KCMQX *ÒDUEJG2CVKPCUGJTUEJÌPpXQT\ÒINKEJ



4WDGN M[TKNNKUEJ /QUMCW/ÒP\JQH-CFCUJGXUM[I$KVMKP&CX&KCMQX  -N<CKPGPFG5EJTÌVNKPIUHGJNGTHCUVUGJTUEJÌP

7014

7015



7016



4WDGN  M[TKNNKUEJ  /QUMCW /ÒP\JQH -CFCUJGXUM[  I $KVMKP  XCT &CX    &KCMQXXCT 5EJÌPpUGJTUEJÌP



4WDGN M[TKNNKUEJ /QUMCW/ÒP\JQH-CFCUJGXUM[I$KVMKP 4 &CX&KCMQX 4#VVTCMVKXGUUGJTUEJÌPGU'ZGORNCT



4WDGN/QUMCW/ÒP\JQH-CFCUJGXUM[I$KVMKP 4 &CX&KCMQX  44(GKPG2CVKPCHCUVUGJTUEJÌP

26



  


PETER I.

7017

7018

7019



4WDGN 2QNVKPC  M[TKNNKUEJ /QUMCW/ÒP\JQH-CFCUJGXUM[I$KVMKP 4 &KCMQX 4*ÒDUEJG2CVKPCUGJTUEJÌP





4WDGN 2QNVKPC  M[TKNNKUEJ /QUMCW/ÒP\JQH-CFCUJGXUM[I$KVMKP 4 &KCMQX 4ªDGTRT·IWPIUURWTGPUGJTUEJÌP





4WDGN 2QNVKPC  M[TKNNKUEJ /QUMCW/ÒP\JQH-CFCUJGXUM[I$KVMKP 4 &KCMQXXCT 445EJÌPpUGJTUEJÌP



7020

7021

7021



 4WDGN 2QNVKPC   M[TKNNKUEJ  /QUMCW /ÒP\JQH -CFCUJGXUM[  I $KVMKP  4 FQTV   HCNUEJG8QTFGTUGKVGPCDDKNFWPI &KCMQX 445GJTUEJÌP 



4WDGN 2QNVKPC  M[TKNNKUEJ /QUMCW/ÒP\JQH-CFCUJGXUM[I$KVMKP 4 &KCMQX 49KP\5EJTÌVNKPIUHGJNGTUGJTUEJÌP



7022 1,5:1



1,5:1

 -QRGMGP )TKXGPPKM   M[TKNNKUEJ  /QUMCW /ÒP\JQH -CFCUJGXUM[ 0QXQFGN  I   $KVMKP* 4 &KCMQX50 8QPITQ­GT5GNVGPJGKV2TCEJVXQNNG2CVKPCXQT\ÒINKEJ  27


PETER I.

7023

5KNDGTOÒP\GPFGU4QVGP/ÒP\JQHGUKP/QUMCW 

4WDGN/QUMCW4QVGT/ÒP\JQHI$KVMKP&CX&KCMQX  *ÒDUEJG2CVKPCHCUVUGJTUEJÌP



7024

7024 1,5:1



4WDGN/QUMCW4QVGT/ÒP\JQH0QXQFGNI$KVMKP*&CX&KCMQX50 44/KPLWUVKGTVXQT\ÒINKEJ

7025

7026



7027



4WDGN/QUMCW4QVGT/ÒP\JQHI$KVMKP&CX&KCMQXXCT  'VYCU$GNCIMN5EJTÌVNKPIUHGJNGTHCUVXQT\ÒINKEJ





4WDGN/QUMCW4QVGT/ÒP\JQHI$KVMKP 4 &CX&KCMQX  -N-TCV\GTUGJTUEJÌP





4WDGN/QUMCW4QVGT/ÒP\JQHI$KVMKP 4 &CX&KCMQX  4*GTTNKEJG2CVKPCHCUVUGJTUEJÌP



28


PETER I.

7028

7029

7030



4WDGN 2QNVKPC /QUMCW4QVGT/ÒP\JQHI$KVMKP 4 &KCMQX  45GJTUEJÌPpXQT\ÒINKEJ





4WDGN 2QNVKPC /QUMCW4QVGT/ÒP\JQHI$KVMKPXCT 4 &KCMQXHH  45EJÌPpUGJTUEJÌP





4WDGN 2QNVKPC /QUMCW4QVGT/ÒP\JQHI$KVMKP 4 &KCMQX  45GJTCVVTCMVKXGU'ZGORNCTOKVJÒDUEJGT2CVKPCUGJTUEJÌP



7032 7033

7031



-QRGMGP #NV[P  M[TKNNKUEJ /QUMCW4QVGT/ÒP\JQHI$KVMKP 4 &KCMQX  45GJTUEJÌP





-QRGMGP #NV[P  M[TKNNKUEJ /QUMCW4QVGT/ÒP\JQHI$KVMKP 4 &KCMQX  49KP\5EJTÌVNKPIHGJNGTUGJTUEJÌP





-QRGMGP #NV[P  M[TKNNKUEJ /QUMCW4QVGT/ÒP\JQHI$KVMKP&KCMQX  45GJTUEJÌP



7035

7034

7034

'KP5QPPGPTWDGNFGT/ÒP\UV·VVG5V2GVGTUDWTI 



4WDGN5V2GVGTUDWTI5QPPGPTWDGNI$KVMKP 4 &CX&KCMQX  45GJTUEJÌP

-WRHGTOÒP\GPFGU<CTGP2GVGT+

-W2QNWUEJMC M[TKNNKUEJ /QUMCW/ÒP\JQH0CDGTG\JP[I$KVMKPHH

5GJTUEJÌP

  29


PETER I.

7036

1,5:1

1,5:1



-W-QRGMG/QUMCW/ÒP\JQH-CFCUJGXUM[I5KEJVDCTÒDGTRT·IVCWHGKPGT-QRGMG $KVMKPXCT&KCMQXHHXCT W­GTUVUGNVGPDGUQPFGTUKPFKGUGT'TJCNVWPI2TCEJVGZGORNCT 8QT\ÒINKEJp5VGORGNINCP\ 

7037

1,5:1



1,5:1

-W-QRGMG  /QUMCW /ÒP\JQH -CFCUJGXUM[  I 5KEJVDCT ÒDGTRT·IV CWH GKPGT -W-QRGMG   $KVMKP&KCMQX 8QPITQ­GT5GNVGPJGKV5EJTÌVNKPIUTK­MN<CKPGPFGUGJTUEJÌP 

7038



-W2QNWUEJMC/QUMCW/ÒP\JQH-CFCUJGXUM[IWPFI$KVMKPHH 5VÒEM5GJTUEJÌP



7039

1,5:1



30

1,5:1

-W-QRGMG $CTVMQRGMG  M[TKNNKUEJ /QUMCW/ÒP\JQH-CFCUJGXUM[I/KV)GIGPUVGORGN CWHFGT4ÒEMUGKVG)GMTÌPVGT&QRRGNCFNGT$KVMKP 4 &KCMQXp  5GJTUGNVGPDGUQPFGTUKPFKGUGT'TJCNVWPI1TKIKPCNRT·IWPIHCUVXQT\ÒINKEJ




PETER I.

7040

/GFCKNNGPFGU<CTGP2GVGT+ 

1XCNG<KPPOGFCKNNGOKV5KIPCVWT+ÛP UR·VGTG2T·IWPIFGU,CJTJWPFGTVU CWHFKG'TDCWWPI WPF FKG $GHGUVKIWPI FGU *CHGPU XQP 6CICPTQI FWTEJ-CRKV·P/CVYG[5KOQPVQHH)GJCTPKUEJVGU$TWUV DKNF T OKV .QTDGGTMTCP\ WPF WOIGNGIVGO /CPVGN6QRQITCRJKUEJGT 2NCP FGU *CHGP ÒDGT FGO QHHGPGP   /GGTZOOI&KCMQX FQTVKP5KNDGT  8QT\ÒINKEJ



7042

7041



7041

$TQP\GOGFCKNNG  XQP 6 +YCPQHH WPF OKV 5KIPCVWT / - XGTOWVNKEJ UR·VGTG 2T·IWPI FGU    ,CJTJWPFGTVU CWHFKG'TQDGTWPIXQP4KICCO,WNK)GJCTPKUEJVGU$TWUVDKNFTOKV.QTDGGTMTCP\WPF WOIGNGIVGO /CPVGN#PUKEJV FGT 5VCFV 4KIC FKG XQP TWUUKUEJGP /ÌTUGTP WPF -CPQPGP DGUEJQUUGP   YKTFOOI&KCMQX 8QT\ÒINKEJp5VGORGNINCP\



9GKNFKG5EJYGFGPDGTGKVUKO*GTDUVFKG'TQDGTWPI4KICUFWTEJFKGTWUUKUEJG#TOGGDGHÒTEJVGVGPVTQOOGNVGP UKGXQPFGPYGPKIGPKP.KXNCPFÒDTKIIGDNKGDGPGP5QNFCVGP/CPPKP4KIC\WUCOOGP#O0QXGODGT YCT FKG 5VCFV XQP TWUUKUEJGP 5QNFCVGP WO\KPIGNV WPF <CT 2GVGT DGICPP CO  0QXGODGT  RGTUÌPNKEJ FGP   $GUEJW­ OKV FGO #DHGWGTP XQP FTGK $QODGP FGPGP W C FKG 2GVGTUMKTEJG \WO 1RHGT HKGN &KG )CTPKUQP JKGNV   FGPPQEJ VCRHGT FGP 9KPVGT WPF (TÒJNKPI  FWTEJ #O  ,WPK  XGTYCPFGNVGP FKG 4WUUGP 4KIC FWTEJ FGP   $GUEJW­ OKV  $QODGP KP GKP 6TÒOOGTHGNF &GPPQEJ YGKIGTVG UKEJ FGT UEJYGFKUEJG )GPGTCNIQWXGTPGWT 0KNU   5VTQODGTIFKG5VCFVCWH\WIGDGP0CEJFGO$GUEJW­OKV$TCPFDQODGPICD5VTQODGTIUEJNKG­NKEJCO,WNK CWHWPFFWTHVGOKVFGPÒDTKIIGDNKGDGPGP5QNFCVGPCD\KGJGP  &KGCWHFGT4ÒEMUGKVGFGTXQTNKGIGPFGP/GFCKNNGUKEJVDCTG5KIPCVWT/-YWTFGXQP%#1UUDCJTWPF/KMJCKN &KCMQXFGO/GFCKNNGWT/KEJCGN-WVUEJMKP\WIGUEJTKGDGPFGTXQPDKUKP5V2GVGTUDWTICTDGKVGVG&KGU KUV LGFQEJ WPOÌINKEJ FC UKEJ KP FGT 5COONWPI FGT (TGKJGTTGP $QPFG FKG YKT KO *GTDUV  XGTUVGKIGTVGP   /GFCKNNGPOKVFGT5KIPCVWT/-DGHCPFGPFKGDGTGKVUGTYQTDGPYWTFGP



5KNDGTOGFCKNNG  XQP 6 +YCPQHH XGTOWVNKEJ UR·VGTG 2T·IWPI WO   CWH FKG -CRKVWNCVKQP XQP   4GXCN JGWVG 6CNNKPP 'UVNCPF  CO  5GRVGODGT )GJCTPKUEJVGU $TWUVDKNF T OKV .QTDGGTMTCP\ WPF   WOIGNGIVGO /CPVGN#PUKEJV XQP 4GXCN CWU FGT 8QIGNRGTURGMVKXG FCTÒDGT UEJYGDV GKP )GPKWU OKV   5EJYGTVWPF5VCFVMTQPGOOI&KCMQX 4 XCT  449KP\-TCV\GTUGJTUEJÌPpXQT\ÒINKEJXQT\ÒINKEJ  31


KATHARINA I.

7043



5KNDGTOGFCKNNGWPUKIPKGTVCWHFKG8GTO·JNWPIUGKPGU5QJPGU<CTGYKVUEJ#NGZGL2GVTQYKVUEJOKV %JCTNQVVG%JTKUVKPG5QRJKG6QEJVGT.WFYKI4WFQNHUXQP$TCWPUEJYGKI9QNHGPDÒVVGN$GKFGT$TWUVDKNFGT PGDGPGKPCPFGTT(GWGTCNVCTFGTOKVFGP9CRRGPUEJKNFGPXQP4W­NCPFWPF$TCWPUEJYGKIIGUEJOÒEMV KUV FCTÒDGT \YGK KPGKPCPFGTITGKHGPFG *·PFG  OOI$TQEMOCPP&KCMQX 4  44(GKPG2CVKPCMN4CPFHGJNGT5VGORGNHGJNGTCO4CPFXQT\ÒINKEJ 

7044



$TQP\GOGFCKNNGXQP6+YCPQHH UR·VGTG2T·IWPIFGU,CJTJWPFGTVU CWHFKG9KGFGTJGTUVGNNWPI FGTÌHHGPVNKEJGP1TFPWPICO&G\GODGT)GJCTPKUEJVGU$TWUVDKNFTOKV.QTDGGTMTCP\WPFWOIGNGI VGO /CPVGN(GNUGP FCTCWH -TQPG QDGP UVTCJNGPFG 5QPPG  OO  I &KCMQX    8QT\ÒINKEJ



7046

7045

7045

<#4+0-#6*#4+0#+   32

5KNDGTOÒP\GPFGU4QVGP/ÒP\JQHGUKP/QUMCW

4WDGN/QUMCW4QVGT/ÒP\JQHI$KVMKP&CX&KCMQX

(CUVUGJTUEJÌP



4WDGN/QUMCW4QVGT/ÒP\JQHI$KVMKP&CX&KCMQX  #VVTCMVKXGU'ZGORNCTOKVJÒDUEJGT2CVKPCUGJTUEJÌP




KATHARINA I.

7047

7048

7049



4WDGN/QUMCW4QVGT/ÒP\JQHI$KVMKP&CX&KCMQX  4#VVTCMVKXGU'ZGORNCTOKVJÒDUEJGT2CVKPCHCUVXQT\ÒINKEJ





4WDGN/QUMCW4QVGT/ÒP\JQHI$KVMKP&CX&KCMQX7\FGPKMQX  -N-TCV\GTGVYCURQTÌUGT5EJTÌVNKPIUGJTUEJÌP



'ZGORNCTFGT#WMVKQP2GWU0CEJH(TCPMHWTV0T

5KNDGTOÒP\GPFGT/ÒP\UV·VVG5V2GVGTUDWTI 

4WDGN5V2GVGTUDWTII$KVMKPXCT&CX&KCMQXXCT  9KP\5EJTÌVNKPIUHGJNGTCO4CPFUGJTUEJÌP

7051

  

7050

4WDGN5V2GVGTUDWTII$KVMKP&CX&KCMQX 4WDGN 2QNVKPC 5V2GVGTUDWTII$KVMKP 4 &KCMQX 4WDGN 2QNVKPC 5V2GVGTUDWTII$KVMKP 4 &KCMQX



7052

5GJTUEJÌP 4(CUVUGJTUEJÌP 45GJTUEJÌP

   33


PETER II.

7053

7054

7055

<#42'6'4++ 5KNDGTOÒP\GPFGU4QVGP/ÒP\JQHGUKP/QUMCW 

2GVGT++4WDGN/QUMCW4QVGT/ÒP\JQHI$KVMKP&CX&KCMQX (CUVUGJTUEJÌP





4WDGN/QUMCW4QVGT/ÒP\JQHI$KVMKP 4 XCT&CX&KCMQX  4(CUVUGJTUEJÌP





4WDGN/QUMCW4QVGT/ÒP\JQHI$KVMKP&CX&KCMQX



7056

7057

5GJTUEJÌP

7058

5KNDGTOÒP\GPFGU/QUMCWGT/ÒP\JQHGU-CFCUJGXUM[ 

4WDGN/QUMCW/ÒP\JQH-CFCUJGXUM[I$KVMKP&CX&KCMQX  -N<CKPGPFGYKP\-TCV\GTUGJTUEJÌP





4WDGN/QUMCW/ÒP\JQH-CFCUJGXUM[I$KVMKP&CX&KCMQX  (GKPG2CVKPCUGJTUEJÌP





4WDGN/QUMCW/ÒP\JQH-CFCUJGXUM[I$KVMKP&CX&KCMQX  9KP\5EJTÌVNKPIUHGJNGTUGJTUEJÌP



34


PETER II.

7059



4WDGN/QUMCW/ÒP\JQH-CFCUJGXUM[I$KVMKP&CX&KCMQX  &WPMNG2CVKPCXQT\ÒINKEJ

7060



7062

7061



4WDGN/QUMCW/ÒP\JQH-CFCUJGXUM[I$KVMKP&CX&KCMQXXCT  *GTTNKEJG2CVKPCUGJTCVVTCMVKXGUXQT\ÒINKEJGU'ZGORNCT





4WDGN/QUMCW/ÒP\JQH-CFCUJGXUM[I$KVMKP&CX&KCMQX  -N5EJTÌVNKPIUHGJNGTUGJTUEJÌP





4WDGN/QUMCW/ÒP\JQH-CFCUJGXUM[I$KVMKP&CX&KCMQX  *ÒDUEJG2CVKPCYKP\5EJTÌVNKPIUHGJNGTUGJTUEJÌP



7063

1,5:1

1,5:1

'KPG-WRHGTMQRGMGFGU/QUMCWGT/ÒP\JQHGU-CFCUJGXUM[ 

-W-QRGMG/QUMCW/ÒP\JQH-CFCUJGXUM[I$KVMKPHHXCT&KCMQXHHXCT  5GNVGPKPFKGUGT'TJCNVWPI8QT\ÒINKEJ

 35


ANNA

7064

<#4+0#00# 5KNDGTOÒP\GPFGU/QUMCWGT/ÒP\JQHGU-CFCUJGXUM[ 

4WDGN/QUMCW/ÒP\JQH-CFCUJGXUM[I$KVMKP 4 XCT&CX&KCMQXXCT  4*ÒDUEJG2CVKPCUGJTUEJÌPpXQT\ÒINKEJ

ex 7065



7066



7067

4WDGN  /QUMCW /ÒP\JQH -CFCUJGXUM[  I $KVMKP  4  &CX  &KCMQX  XCT   &C\W0KMQNCWU+4WDGN 2QNVKPC 9CTUEJCW$KVMKP  5VÒEM(CUVUGJTUEJÌPWPFUGJTUEJÌP





4WDGN/QUMCW/ÒP\JQH-CFCUJGXUM[I$KVMKP&CX&KCMQX  *ÒDUEJG2CVKPCUGJTUEJÌP





4WDGN/QUMCW/ÒP\JQH-CFCUJGXUM[I$KVMKPXCT&CX&KCMQXXCT  5GJTUEJÌP



7068

 36

4WDGN/QUMCW/ÒP\JQH-CFCUJGXUM[I$KVMKPXCT&CX&KCMQX  5EJTÌVNKPIUHGJNGTUGJTUEJÌP




ANNA

7069

7070

7071



4WDGN/QUMCW/ÒP\JQH-CFCUJGXUM[I$KVMKPXCT&CX&KCMQX  -N5EJTÌVNKPIUHGJNGTHCUVXQT\ÒINKEJ





4WDGN/QUMCW/ÒP\JQH-CFCUJGXUM[I$KVMKPXCT&CX&KCMQXXCT  -N-TCV\GTUGJTUEJÌP





4WDGN/QUMCW/ÒP\JQH-CFCUJGXUM[I$KVMKPXCT&CX&KCMQX

7072

7073

 5GJTUEJÌP



7074



4WDGN/QUMCW/ÒP\JQH-CFCUJGXUM[I$KVMKP 4 &CX&KCMQX  44(GKPG2CVKPCYKP\-TCV\GTUGJTUEJÌP





4WDGN/QUMCW/ÒP\JQH-CFCUJGXUM[I$KVMKPXCT&CX&KCMQX  (GKPG2CVKPCMN5EJTÌVNKPIUHGJNGTUGJTUEJÌP





4WDGN/QUMCW/ÒP\JQH-CFCUJGXUM[I$KVMKP 4 &CX&KCMQXXCT  449KP\5EJTÌVNKPIUHGJNGTUGJTUEJÌPpXQT\ÒINKEJ

 37


ANNA

7076

7075

7077



4WDGN/QUMCW/ÒP\JQH-CFCUJGXUM[I$KVMKPXCT&CX&KCMQXXCT  9KP\-TCV\GTXQT\ÒINKEJ





4WDGN 2QNVKPC /QUMCW/ÒP\JQH-CFCUJGXUM[I$KVMKPXCT&KCMQXXCT  5GJTUEJÌP





4WDGN 2QNVKPC /QUMCW/ÒP\JQH-CFCUJGXUM[I$KVMKP&KCMQX  5GJTCVVTCMVKXGU'ZGORNCTOKVJÒDUEJGT2CVKPCUGJTUEJÌP



7078

7080

7079



4WDGN 2QNVKPC /QUMCW/ÒP\JQH-CFCUJGXUM[I$KVMKP&KCMQX  *ÒDUEJG2CVKPCHCUVUGJTUEJÌPUGJTUEJÌP





4WDGN 2QNVKPC /QUMCW/ÒP\JQH-CFCUJGXUM[I$KVMKP&KCMQX  -N2TQDKGTURWTHCUVUGJTUEJÌP



5KNDGTOÒP\GPFGU4QVGP/ÒP\JQHGUKP/QUMCW  38

4WDGN/QUMCW4QVGT/ÒP\JQHI$KVMKP&CX&KCMQXXCT  #VVTCMVKXGU'ZGORNCTOKVJGTTNKEJGT2CVKPCMN5EJTÌVNKPIUHGJNGTUGJTUEJÌPpXQT\ÒINKEJ




ANNA

7081

7082

7083



4WDGN/QUMCW4QVGT/ÒP\JQHI$KVMKPNGKEJVXCT&CX&KCMQXNGKEJVXCT /KPDGTKGDGPUGJTUEJÌP





4WDGN/QUMCW4QVGT/ÒP\JQHI$KVMKPXCT&CX&KCMQXXCT  -N2T·IGUEJY·EJGXQT\ÒINKEJ





4WDGN/QUMCW4QVGT/ÒP\JQHI$KVMKPXCT&CX&KCMQX  *ÒDUEJG2CVKPCUGJTUEJÌP



7084



4WDGN 2QNWRQNVKPPKM /QUMCW4QVGT/ÒP\JQHI$KVMKP 4 &KCMQX  44(CUVUGJTUEJÌP

7085



7085 1,5:1

<YGK4WDGNFGT/ÒP\UV·VVG5V2GVGTUDWTI 

4WDGN5V2GVGTUDWTII$KVMKP 4 &CX&KCMQX  5GNVGPDGUQPFGTUKPFKGUGT'TJCNVWPI-N4CPFHGJNGTXQT\ÒINKEJ

 39


IVAN III.

7087

7086

7086



4WDGN5V2GVGTUDWTII$KVMKP&CX&KCMQX

5GJTUEJÌP



5KNDGTLGVQP  WPUKIPKGTV CWH FGP (TKGFGP OKV FGT 6ÒTMGK )GMTÌPVGU $TWUVDKNF T OKV WOIGNGIVGO   /CPVGN#FNGT OKV .QTDGGTMTCP\ KO 5EJPCDGN CWH #TOCVWTGP  OO  I $KVMKP  &KCMQX    4  4*ÒDUEJG2CVKPCUGJTUEJÌP



'KP5KNDGTLGVQPFGT<CTKP#PPC 

7088

7089

7089

<#4+8#0+++ 'KP)TKXGPPKMFGU4QVGP/ÒP\JQHGUKP/QUMCW 

-QRGMGP )TKXGPPKM /QUMCW4QVGT/ÒP\JQHI$KVMKP 4 &KCMQX  449KP\5EJTÌVNKPIUHGJNGTUEJÌPpUGJTUEJÌP



'KP4WDGNFGT/ÒP\UV·VVG5V2GVGTUDWTI 

4WDGN 2QNVKPC 5V2GVGTUDWTII$KVMKP 4 &KCMQX

44(CUVUGJTUEJÌP



4WDGN/QUMCW4QVGT/ÒP\JQHI$KVMKP 4 XCT&KCMQX 4 (D  )1.&5GNVGPDGUQPFGTUKPFKGUGT'TJCNVWPI8QT\ÒINKEJGU'ZGORNCT



1,5:1

7090

1,5:1

<#4+0'.+5#$'6* )QNFOÒP\GPFGU4QVGP/ÒP\JQHGUKP/QUMCW 

7091

7092



4WDGN/QUMCW4QVGT/ÒP\JQHI$KVMKP 4 &KCMQX 4 (D  )1.&5GJTUEJÌPpXQT\ÒINKEJ





4WDGN/QUMCW4QVGT/ÒP\JQHI$KVMKP 4 &KCMQX 4 (D  )1.&49KP\5EJTÌVNKPIUHGJNGTUGJTUEJÌP



40


ELISABETH

7093

7094

7095

7096



4WDGN/QUMCW4QVGT/ÒP\JQHI$KVMKP 4 &KCMQX 4 (D  )1.&5GJTUEJÌPpXQT\ÒINKEJ





4WDGN/QUMCW4QVGT/ÒP\JQHI$KVMKP 4 &KCMQX 4 (D  )1.&5GJTUEJÌPpXQT\ÒINKEJ





4WDGN/QUMCW4QVGT/ÒP\JQHI$KVMKP 4 &KCMQX 4 (D  )1.&#VVTCMVKXGU'ZGORNCTUGJTUEJÌPpXQT\ÒINKEJ





4WDGN/QUMCW4QVGT/ÒP\JQHI$KVMKP 4 &KCMQX 4 (D  )1.&5GJTUEJÌPpXQT\ÒINKEJ



7097

7098

7100

7099



4WDGN/QUMCW4QVGT/ÒP\JQHI$KVMKP 4 &KCMQX 4 (D  )1.&(CUVXQT\ÒINKEJ





4WDGN/QUMCW4QVGT/ÒP\JQHI$KVMKP 4 &KCMQX 4 (D  )1.&5EJTÌVNKPIUHGJNGTHCUVXQT\ÒINKEJ





4WDGN/QUMCW4QVGT/ÒP\JQH+P752NCUVKMJQNFGTFGT2%)5OKVFGT$GYGTVWPI:($KVMKP  4 &KCMQX 4 (D )1.&5GJTUEJÌP





 4WDGN 2QNVKPC  /QUMCW4QVGT/ÒP\JQHI$KVMKP 4 &KCMQX 4 (D )1.&5GJTUEJÌP



7101

1,5:1

1,5:1

'KPIQNFGPGT&QRRGNTWDGNFGT/ÒP\UV·VVG5V2GVGTUDWTI 

4WDGN5V2GVGTUDWTII$KVMKP 4 &KCMQX 4 (D  )1.&5GNVGPDGUQPFGTUKPFKGUGT'TJCNVWPI8QT\ÒINKEJ

 41


ELISABETH

7102

7103

7104

5KNDGTOÒP\GPFGU4QVGP/ÒP\JQHGUKP/QUMCW 

4WDGN/QUMCW4QVGT/ÒP\JQHI$KVMKPHHXCT&CX&KCMQX

5GJTUEJÌP





4WDGN/QUMCW4QVGT/ÒP\JQHI$KVMKP&CX&KCMQXXCT  9KP\5EJTÌVNKPIUHGJNGTUGJTUEJÌP





4WDGN/QUMCW4QVGT/ÒP\JQHI$KVMKP 4 &CX&KCMQX

7105

7106

 45GJTUEJÌP



7107



4WDGN/QUMCW4QVGT/ÒP\JQHI$KVMKP&CX&KCMQX  *ÒDUEJG2CVKPCMN5EJTÌVNKPIUHGJNGTCVVTCMVKXGUHCUVXQT\ÒINKEJGU'ZGORNCT





4WDGN/QUMCW4QVGT/ÒP\JQHI$KVMKP&CX&KCMQX  -N-TCV\GTKO(GNFFGT4ÒEMUGKVGUGJTUEJÌP





4WDGN/QUMCW4QVGT/ÒP\JQHI$KVMKP&CX&KCMQX



42

5GJTUEJÌP


ELISABETH

7108

7110

7109



4WDGN/QUMCW4QVGT/ÒP\JQHI$KVMKP&CX&KCMQX 4   *ÒDUEJG2CVKPCUGJTUEJÌPpXQT\ÒINKEJ





4WDGN/QUMCW4QVGT/ÒP\JQHI$KVMKP&CX&KCMQX

5GJTUEJÌP





4WDGN/QUMCW4QVGT/ÒP\JQHI$KVMKP&CX&KCMQX  *ÒDUEJG2CVKPCMN5EJTÌVNKPIUHGJNGTUGJTUEJÌP



7111



4WDGN 2QNVKPC /QUMCW4QVGT/ÒP\JQHI$KVMKP 4 &KCMQX  4*ÒDUEJG2CVKPCUGJTUEJÌP

7112

7113

7114



7115



4WDGN 2QNWRQNVKPPKM /QUMCW4QVGT/ÒP\JQHI$KVMKP 4 &KCMQX  45GJTUEJÌPpXQT\ÒINKEJ





 4WDGN 2QNWRQNVKPPKM   ,CJTGU\CJN KO 5VGORGN CWU  IG·PFGTV  /QUMCW 4QVGT /ÒP\JQH   I$KVMKP&KCMQX 5GJTUEJÌP





4WDGN 2QNWRQNVKPPKM /QUMCW4QVGT/ÒP\JQHI$KVMKP&KCMQX  *ÒDUEJG2CVKPCUGJTUEJÌPpXQT\ÒINKEJ





4WDGN 2QNWRQNVKPPKM /QUMCW4QVGT/ÒP\JQHI$KVMKP&KCMQX  *ÒDUEJG2CVKPCUGJTUEJÌP

 43


ELISABETH

7117 7116

7118



-QRGMGP )TKXGPPKM /QUMCW4QVGT/ÒP\JQHI$KVMKP&KCMQX  5GJTUEJÌPpXQT\ÒINKEJ





-QRGMGP )TKXGPPKM /QUMCW4QVGT/ÒP\JQHI$KVMKP&KCMQX  -N-TCV\GTUGJTUEJÌP





-QRGMGP )TKXGPPKM /QUMCW4QVGT/ÒP\JQHI$KVMKP&KCMQX

8QT\ÒINKEJ





-QRGMGP )TKXGPPKM /QUMCW4QVGT/ÒP\JQHI$KVMKP&KCMQX  5GJTUEJÌPpXQT\ÒINKEJ





-QRGMGP )TKXGPPKM /QUMCW4QVGT/ÒP\JQHI$KVMKP&KCMQX 5GJTUEJÌP



7119

7121

7120

7122

7123

5KNDGTOÒP\GPFGT/ÒP\UV·VVG5V2GVGTUDWTI 

4WDGN5V2GVGTUDWTII$KVMKPXCT&CX&KCMQXXCT  *ÒDUEJG2CVKPCNGKEJVGªDGTRT·IWPIUURWTGPXQT\ÒINKEJ





4WDGN5V2GVGTUDWTII$KVMKPNGKEJVXCT&CX&KCMQX

5GJTUEJÌP





4WDGN5V2GVGTUDWTII$KVMKP&CX&KCMQX  *ÒDUEJG2CVKPCUGJTUEJÌPUGJTUEJÌPpXQT\ÒINKEJ



44


ELISABETH

7124

7125

7126



4WDGN5V2GVGTUDWTII$KVMKP&CX&KCMQX

(GKPG2CVKPCUGJTUEJÌP





4WDGN5V2GVGTUDWTII$KVMKP&CX&KCMQX

*ÒDUEJG2CVKPCUGJTUEJÌP





4WDGN5V2GVGTUDWTII$KVMKP&CX&KCMQX  -N5EJTÌVNKPIUHGJNGTUGJTUEJÌP



7127

7128

7129



4WDGN5V2GVGTUDWTII$KVMKP&CX&KCMQX

5GJTUEJÌP





4WDGN5V2GVGTUDWTII$KVMKP&CX&KCMQX  -N-TCV\GTUGJTUEJÌPXQT\ÒINKEJ





4WDGN5V2GVGTUDWTI5QIGPCPPVGT5EQVV4WDGNI$KVMKP&CX&KCMQX  *GTTNKEJG2CVKPCUGJTUEJÌPpXQT\ÒINKEJ

 45


ELISABETH

7130



7130

1,5:1

4WDGN 5V2GVGTUDWTI5QIGPCPPVGT5EQVV4WDGNI$KVMKP&CX&KCMQX 5GJTUGNVGPKPFKGUGT'TJCNVWPI2TCEJVGZGORNCT*GTTNKEJG2CVKPCHCUV5VGORGNINCP\ 

7131

7132

7133



4WDGN 5V2GVGTUDWTI5QIGPCPPVGT5EQVV4WDGNI$KVMKP&CX&KCMQX *ÒDUEJG2CVKPCUGJTUEJÌP





4WDGN 5V2GVGTUDWTI5QIGPCPPVGT5EQVV4WDGNI$KVMKP&CX&KCMQX 9KP\-TCV\GTUGJTUEJÌP





4WDGN  5V 2GVGTUDWTI 5QIGPCPPVGT 5EQVV4WDGN  I $KVMKP  4  &CX    &KCMQX 4  4(GNFGTRQNKGTVUGJTUEJÌP



7134

 46

4WDGN5V2GVGTUDWTII$KVMKP&CX&KCMQX 4 

5GJTUEJÌPpXQT\ÒINKEJ




ELISABETH

7136

7137

7135



4WDGN5V2GVGTUDWTII$KVMKP&CX&KCMQX

8QT\ÒINKEJ





4WDGN 2QNVKPC 5V2GVGTUDWTII$KVMKP 4 &KCMQX  44-N5EJTÌVNKPIUHGJNGTCO4CPFHCUVUGJTUEJÌP





4WDGN 2QNVKPC 5V2GVGTUDWTII$KVMKP 4 &KCMQX 4 

7138

 44(CUVUGJTUEJÌP



7140

7139



-QRGMGP5V2GVGTUDWTII$KVMKP&KCMQX

 9KP\5EJTÌVNKPIUTK­HCUVXQT\ÒINKEJ



 

-QRGMGP5V2GVGTUDWTII$KVMKP&KCMQX -QRGMGP5V2GVGTUDWTII$KVMKP

5GJTUEJÌP (CUVXQT\ÒINKEJ

 

7142

7141

 

-WRHGTOÒP\GPFGT<CTKP'NKUCDGVJ

-W-QRGMGP'MCVGTKPDWTII$KVMKP&KCMQX -W-QRGMGP'MCVGTKPDWTII$KVMKP&KCMQX

7141

-N5VGORGNHGJNGTUGJTUEJÌP 5GJTUEJÌPpXQT\ÒINKEJ

  47


ELISABETH

7143

7144

7144



&GPIC'MCVGTKPDWTI0QXQFGNI$KVMKP* 4 

448QT\ÒINKEJ



-W-QRGMG  5V 2GVGTUDWTI  I 5KEJVDCT ÒDGTRT·IV CWH GKPGO -W -QRGMGP5VÒEM XQP   2GVGT++QFGT-CVJCTKPC+$KVMKP 4 &KCMQX 4ªDGTRT·IWPIUURWTGPUGJTUEJÌP

 

7145

2T·IWPIGPHÒT.KXNCPFWPF'UVNCPF 

.KXQPCKUG 4WDGN \W  -QRGMGP   /QUMCW 4QVGT /ÒP\JQH IGRT·IV HÒT .KXNCPF WPF 'UVNCPF   I$KVMKP 4 &CX&KCMQX 4  44(GKPG2CVKPCHCUVUGJTUEJÌP   DGVGKNKIVG UKEJ <CTKP 'NKUCDGVJ CP GKPGT IGUCOVGWTQR·KUEJGP -QCNKVKQP IGIGP (TKGFTKEJ ++ XQP 2TGW­GP 5KG   UEJKEMVG 6TWRRGP KP FKG DCNVKUEJGP 2TQXKP\GP FGTGP JGTTUEJGPFG 1DGTUEJKEJV ITÌ­VGPVGKNU FGWVUEJ YCT /KV FGO   XQTNKGIGPFGP.KXQPCKUGYQNNVG'NKUCDGVJFKGKPFGP2TQXKP\GPI·PIKIGP/ÒP\GPGTUGV\GP

7146



7147

7148

-QRGMGP/QUMCW4QVGT/ÒP\JQHIGRT·IVHÒT.KXNCPFWPF'UVNCPFI$KVMKP&KCMQX  4  5GJTUEJÌP



2T·IWPIGPHÒT1UVRTGW­GP 

6CNGT-ÌPKIUDGTIIGRT·IVHÒT1UVRTGW­GPWPVGTTWUUKUEJGT$GUCV\WPII$KVMKP 4  &KCMQX1NFD *ÒDUEJG2CVKPCUGJTUEJÌPpXQT\ÒINKEJ





)TÌUEJGT/QUMCW4QVGT/ÒP\JQHIGRT·IVHÒT1UVRTGW­GPWPVGTTWUUKUEJGT$GUCV\WPII $KVMKP 4 &KCMQX 4 1NF 5GJTUEJÌPpXQT\ÒINKEJ



48


PETER III.

2:1

7149

<#42'6'4+++ 'KP4WDGN5VÒEMFGU<CTGP2GVGT+++CWUFGT/ÒP\UV·VVG5V2GVGTUDWTI 

 4WDGN  5V 2GVGTUDWTI )GJCTPKUEJVGU $TWUVDKNF T OKV WOIGNGIVGO /CPVGN8KGT IGMTÌPVG   9CRRGPKPU-TGW\IGUVGNNVKPFGT/KVVG#FNGTUEJKNFKPFGP9KPMGNPFKGIGVGKNVG,CJTGU\CJN +P 752NCUVKMJQNFGT FGT 2%)5 OKV FGT $GYGTVWPI :(  $KVMKP  4  &KCMQX  4  (D    )1.&44#VVTCMVKXGU'ZGORNCTUGJTUEJÌPpXQT\ÒINKEJ  2GVGT +++ -CTN 2GVGT 7NTKEJ XQP *QNUVGKP)QVVQTR  YCT 'PMGN FGU <CTGP 2GVGT + FGU )TQ­GP WPF YWTFG KO #NVGTXQP,CJTGPXQPUGKPGT6CPVGFGT<CTKP'NKUCDGVJ\WO6JTQPHQNIGTDGUVKOOV+O,CJTYWTFGGTOKV UGKPGT %QWUKPG FGT 2TKP\GUUKP 5QRJKG #WIWUVG XQP #PJCNV<GTDUV XGTJGKTCVGV 9·JTGPF 2GVGT GKPG INÒJGPFG   8GTGJTWPIHÒTFGPRTGW­KUEJGP-ÌPKI(TKGFTKEJ++GORHCPFJGIVGUGKPG)GOCJNKPFKGUR·VGTG<CTKP-CVJCTKPCFKG )TQ­G GKPG VKGHG #DPGKIWPI IGIGP 2TGW­GP #NU <CTKP 'NKUCDGVJ  UVCTD YCT FGT #WUUVKGI CWU FGO   5KGDGPL·JTKIGP -TKGI FWTEJ FGP 5QPFGTHTKGFGPUXGTVTCI XQP 5V 2GVGTUDWTI OKV 2TGW­GP FKG GTUVG #OVUJCPFNWPI   2GVGTU++++PPGPRQNKVKUEJUEJT·PMVG2GVGTFKG2TKXKNGIKGPFGU#FGNUUVCTMGKPWPFDGICPPOKVFGT/QFGTPKUKGTWPIFGU 5VCCVUYGUGPUPCEJRTGW­KUEJGO8QTDKNF&GT<CT\QIUKEJPKEJVPWTFKG(GKPFUEJCHVFGUTWUUKUEJGP#FGNUUQPFGTP CWEJUGKPGTGKIGPGP(TCW\WOKVFGTGTGKPGWPINÒEMNKEJG'JGHÒJTVG&KG5KVWCVKQPGUMCNKGTVGWPFCO,WNK YWTFG -CVJCTKPC \WT <CTKP CWUIGTWHGP WPF 2GVGT HÒT VQV GTMN·TV &GT <CT YCTLGFQEJICTPKEJVVQVWPFYWTFGXQP FKGUGP )GUEJGJPKUUGP XQNNMQOOGP ÒDGTTCUEJV 9GKN GT \ÌIGTVG IGNCPI GU FGP #WHUV·PFKUEJGP KJP   IGHCPIGP\WPGJOGP WPF \WT #DFCPMWPI \W \YKPIGP 2GVGT YWTFG KP FCU .CPFJCWU 4QRUEJ DGK 5V 2GVGTUDWTI   IGDTCEJVWPFFQTVCO,WNKWPVGTDKUJGWVGWPIGMN·TVGP7OUV·PFGPGTOQTFGV5GKPG)GOCJNKPTGIKGTVGHCUV ,CJTGNCPIFCUTWUUKUEJG4GKEJ

7150

5KNDGTOÒP\GPFGU4QVGP/ÒP\JQHGUKP/QUMCW 

4WDGN/QUMCW4QVGT/ÒP\JQHI$KVMKP 4 &CX&KCMQX  4.GKEJVG(CUUWPIUURWTGPUGJTUEJÌP

 49


PETER III.

7151



4WDGN 2QNVKPC /QUMCW4QVGT/ÒP\JQHI$KVMKP 4 &KCMQX 4   45GJTUEJÌP



7152

1,5:1

1,5:1

5KNDGTOÒP\GPFGT/ÒP\UV·VVG5V2GVGTUDWTI 

4WDGN5V2GVGTUDWTII$KVMKP&CX&KCMQX 4   5GNVGPDGUQPFGTUKPFKGUGT'TJCNVWPI*GTTNKEJG2CVKPCXQT\ÒINKEJ



7154

7153

7153



4WDGN5V2GVGTUDWTII$KVMKP&CX&KCMQX 4 

(CUVUGJTUEJÌP





4WDGN 2QNVKPC 5V2GVGTUDWTII$KVMKP 4 &KCMQX 4   49KP\5EJTÌVNKPIUHGJNGTUGJTUEJÌP



50


KATHARINA II.

7155

7156

-WRHGTOÒP\GPFGU<CTGP2GVGT+++ 

-W-QRGMGPWPDGUVKOOVG/ÒP\UV·VVGI$KVMKP&KCMQX  4-N4CPFHGJNGTHCUVUGJTUEJÌP





-W -QRGMGP  WPDGUVKOOVG /ÒP\UV·VVG  I ªDGTRT·IV CWH GKPGO -QRGMGP5VÒEM XQP   'NKUCDGVJ$KVMKP&KCMQX 4ªDGTRT·IWPIUURWTGPHCUVUGJTUEJÌP



7157

<#4+0-#6*#4+0#++ )QNFOÒP\GPFGT<CTKP-CVJCTKPC++ 

4WDGN5V2GVGTUDWTII$KVMKP 4 &KCMQX 4 (DC  )1.&(CUUWPIUURWTGP*KV\GURWTGPUEJÌP



7158 1,5:1

1,5:1



4WDGN5V2GVGTUDWTII$KVMKP 4 &KCMQX 4 (DC  )1.&4#VVTCMVKXGUHCUVXQT\ÒINKEJGU'ZGORNCT

7159

1,5:1





1,5:1

4WDGN5V2GVGTUDWTI+P752NCUVKMJQNFGTFGT2%)5OKVFGT$GYGTVWPI8($KVMKP 4  &KCMQX 4 (DD )1.&445GJTUEJÌP

1,5:1

7160





1,5:1

4WDGN5V2GVGTUDWTII$KVMKP 4 &KCMQX(D  )1.&4/KPLWUVKGTVUGJTUEJÌPpXQT\ÒINKEJ

 51


KATHARINA II.

1,5:1



7161

1,5:1

4WDGN5V2GVGTUDWTII$KVMKP 4 &KCMQX(D  )1.&4/KPLWUVKGTVUGJTUEJÌPpXQT\ÒINKEJ



7162

1,5:1



1,5:1

4WDGN 2QNVKPC 5V2GVGTUDWTII$KVMKP 4 &KCMQX(D  )1.&(CUVXQT\ÒINKEJ



7163

1,5:1



1,5:1

4WDGN 2QNVKPC 5V2GVGTUDWTII$KVMKP 4 &KCMQX(D  )1.&-N-TCV\GTUGJTUEJÌP

7164

7165



7166

5KNDGTOÒP\GPFGU4QVGP/ÒP\JQHGUKP/QUMCW 

4WDGN/QUMCW4QVGT/ÒP\JQHI$KVMKP&CX&KCMQX  5GJTUEJÌPpXQT\ÒINKEJ





4WDGN/QUMCW4QVGT/ÒP\JQHI$KVMKP&CX&KCMQX  9KP\5EJTÌVNKPIUHGJNGTXQT\ÒINKEJ





4WDGN/QUMCW4QVGT/ÒP\JQHI$KVMKP&CX&KCMQX



52

5GJTUEJÌP


KATHARINA II.

7168 7167

7167



4WDGN 2QNVKPC /QUMCW4QVGT/ÒP\JQHI$KVMKP 4 &KCMQX 4   4-N5EJTÌVNKPIUHGJNGTHCUVUGJTUEJÌP





4WDGN 2QNWRQNVKPPKM /QUMCW4QVGT/ÒP\JQHI$KVMKP&KCMQX  #VVTCMVKXGUHCUVXQT\ÒINKEJGU'ZGORNCT



7169

  

7170

7171

5KNDGTOÒP\GPFGT/ÒP\UV·VVG5V2GVGTUDWTI

4WDGN5V2GVGTUDWTII$KVMKP&CX&KCMQX 5GJTUEJÌP 4WDGN5V2GVGTUDWTII$KVMKP&CX&KCMQX *GTTNKEJG2CVKPCUGJTUEJÌP 4WDGN5V2GVGTUDWTII$KVMKP&CX&KCMQX 5GJTUEJÌPpXQT\ÒINKEJ

  

7173

7172

7172



4WDGN5V2GVGTUDWTII$KVMKP&CX&KCMQX  *ÒDUEJG2CVKPCOKP-QTTQUKQPUURWTGPUGJTUEJÌPpXQT\ÒINKEJ





4WDGN5V2GVGTUDWTII$KVMKP&CX&KCMQX



5GJTUEJÌPpXQT\ÒINKEJ

53


KATHARINA II.

7176

7175

7174



4WDGN5V2GVGTUDWTII$KVMKP&CX&KCMQX

5GJTUEJÌP





4WDGN5V2GVGTUDWTII$KVMKP&CX&KCMQX

(CUVXQT\ÒINKEJ





4WDGN5V2GVGTUDWTII$KVMKP&CX&KCMQX  *ÒDUEJG2CVKPCUGJTUEJÌPpXQT\ÒINKEJ



7177

7178



4WDGN5V2GVGTUDWTII$KVMKP&CX&KCMQX

5GJTUEJÌP





4WDGN5V2GVGTUDWTII$KVMKP&CX&KCMQX

(CUVXQT\ÒINKEJXQT\ÒINKEJ



7179

1,5:1

 54

1,5:1

4WDGN5V2GVGTUDWTII$KVMKP&CX&KCMQX  2TCEJVGZGORNCT(CUV5VGORGNINCP\




KATHARINA II.

7180

7181

7182



4WDGN5V2GVGTUDWTII$KVMKP&CX&KCMQX

5GJTUEJÌP





4WDGN5V2GVGTUDWTII$KVMKP&CX&KCMQX  9KP\5EJTÌVNKPIUHGJNGTHCUVXQT\ÒINKEJ





4WDGN5V2GVGTUDWTII$KVMKP&CX&KCMQX  (GKPG2CVKPCMN5EJTÌVNKPIUHGJNGTCO4CPFUGJTUEJÌPpXQT\ÒINKEJ



7183



4WDGN5V2GVGTUDWTII$KVMKP&CX&KCMQX 4 

7184

7185

5GJTUEJÌP



7186



4WDGN5V2GVGTUDWTII$KVMKP 4 &CX&KCMQX 4   4*ÒDUEJG2CVKPCUGJTUEJÌP



 

4WDGN5V2GVGTUDWTII$KVMKP&CX&KCMQX 4  5GJTUEJÌP 4WDGN5V2GVGTUDWTII$KVMKP&CX&KCMQX (GKPG2CVKPCUGJTUEJÌP

  55


KATHARINA II.

7188

7187

7189



4WDGN5V2GVGTUDWTII$KVMKP&CX&KCMQX 4   5GNVGPGT,CJTICPI5GJTUEJÌPpXQT\ÒINKEJ



4WDGN5V2GVGTUDWTII$KVMKP&CX&KCMQX 4 

 45GJTUEJÌPpXQT\ÒINKEJ





4WDGN5V2GVGTUDWTII$KVMKP&CX&KCMQX 4 

 45GJTUEJÌPpXQT\ÒINKEJ





7191

7190



4WDGN 2QNVKPC 5V2GVGTUDWTII$KVMKP&KCMQX 4 

45GJTUEJÌP





4WDGN 2QNVKPC 5V2GVGTUDWTII$KVMKP&KCMQX 4 

45GJTUEJÌP



7193

7192

7192



4WDGN 2QNVKPC 5V2GVGTUDWTI$KVMKP 4 &KCMQX 4 

445GJTUEJÌP





-QRGMGP5V2GVGTUDWTII$KVMKP&KCMQX  #VVTCMVKXGUXQT\ÒINKEJGU'ZGORNCTOKVHGKPGT2CVKPC





-QRGMGP5V2GVGTUDWTIIWPFI$KVMKP&KCMQX  5VÒEM(CUVUGJTUEJÌP



56


KATHARINA II.

7197 7196

7195



-QRGMGP5V2GVGTUDWTII$KVMKP&KCMQX  *ÒDUEJG2CVKPCUGJTUEJÌPUGJTUEJÌPpXQT\ÒINKEJ



-QRGMGP5V2GVGTUDWTII$KVMKP&KCMQX

5GJTUEJÌPUGJTUEJÌPpXQT\ÒINKEJ





-QRGMGP )TKXGPPKM 5V2GVGTUDWTII$KVMKP&KCMQX  -N5EJTÌVNKPIUHGJNGTXQT\ÒINKEJ



7198

7199



7200

-WRHGTOÒP\GPFGT<CTKP-CVJCTKPC++ 

-W-QRGMGP/QUMCW4QVGT/ÒP\JQHI$KVMKP&KCMQX  .GKEJVGªDGTRT·IWPIUURWTGPUGJTUEJÌP





-W-QRGMGP'MCVGTKPDWTII$KVMKP&KCMQX

5GJTUEJÌPpXQT\ÒINKEJ





-W-QRGMGP'MCVGTKPDWTII$KVMKP&KCMQX

8QT\ÒINKEJ



8QT\ÒINKEJ



7201



-W-QRGMGP'MCVGTKPDWTII$KVMKP&KCMQX

57


KATHARINA II.

7202

7203

7204



-W-QRGMGP5W\WP -QN[XCP I$KVMKP&KCMQX  -N5VGORGNHGJNGTHCUVXQT\ÒINKEJ





-W-QRGMGP5W\WP -QN[XCP I$KVMKP&KCMQX  -N5EJTÌVNKPIUHGJNGTXQT\ÒINKEJp5VGORGNINCP\





-W-QRGMGP5W\WP -QN[XCP I$KVMKP&KCMQX



7205

7206

8QT\ÒINKEJ

7207



-W-QRGMGP5W\WP -QN[XCP I$KVMKP 4 &KCMQX  4-N5EJTÌVNKPIUHGJNGTXQT\ÒINKEJ





-W-QRGMGP#PPKPUMQ[GI$KVMKP&KCMQX  5GNVGPKPFKGUGT'TJCNVWPI(CUV5VGORGNINCP\





-W-QRGMGP#PPKPUMQ[GI$KVMKP&KCMQX

58

5GJTUEJÌPpXQT\ÒINKEJ




KATHARINA II.

7210

7208

7209

-WRHGTRT·IWPIGPHÒT5KDKTKGP 

-W-QRGMGP5W\WP -QN[XCP HÒT5KDKTKGPI$KVMKP&KCMQX  -N5VGORGNHGJNGTXQT\ÒINKEJ





-W-QRGMGP5W\WP -QN[XCP HÒT5KDKTKGPI$KVMKP 4 &KCMQX  49KP\5EJTÌVNKPIUHGJNGTHCUVXQT\ÒINKEJ





-W-QRGMGP5W\WP -QN[XCP HÒT5KDKTKGPI$KVMKP&KCMQX

8QT\ÒINKEJ





-W-QRGMGP5W\WP -QN[XCP HÒT5KDKTKGPI$KVMKP&KCMQX 5GJTUEJÌP





-W-QRGMGP5W\WP -QN[XCP HÒT5KDKTKGPI$KVMKP&KCMQX 5GJTUEJÌP



7212

7211

7213

1,5:1



1,5:1

-W2QNWUEJMC  5W\WP -QN[XCP  HÒT 5KDKTKGP 0QXQFGN  I $KVMKP *  4  &KCMQX 0    4  448QT\ÒINKEJp5VGORGNINCP\

 59


KATHARINA II.

7214

'KPG-WRHGTRT·IWPIHÒT/QNFCYKGPWPFFKG9CNCEJGK 

-W2CTC  &GPICU   5CFQIWTC IGRT·IV Y·JTGPF FGT TWUUKUEJGP $GUGV\WPI /QNFCYKGPU WPF FGT   9CNCEJGKY·JTGPFFGUVÒTMKUEJTWUUKUEJGP-TKGIGUJGTIGUVGNNVCWU-CPQPGPDTQP\GI$KVMKP

4 $TCWUG/CPUHGNF6HXCT&KCMQX 4  445EJÌPpUGJTUEJÌP



9·JTGPF FGU TWUUKUEJVÒTMKUEJGP -TKGIGU  XGTFT·PIVGP FKG TWUUKUEJGP 5VTGKVMT·HVG FKG 6ÒTMGP CWU FGO   OQNFCYKUEJGP )GDKGV WPF FGT 9CNCEJGK (ÒT FKG PWP GTHQTFGTNKEJG /ÒP\RT·IWPI XGTYGPFGVG OCP FCU /GVCNN   GTDGWVGVGTVÒTMKUEJGT)GUEJÒV\G

7215



/GFCKNNGPFGT<CTKP-CVJCTKPC++

$TQP\GOGFCKNNGXQP6+YCPQHH XGTOWVNKEJUR·VGTG2T·IWPIFGU,CJTJWPFGTVU CWHFKG)TWPF UVGKPNGIWPIFGT5V+UCCMU-CVJGFTCNGKP5V2GVGTUDWTI)GMTÌPVGU$TWUVDKNFTOKVWOIGNGIVGO/CPVGN WPF#PFTGCUQTFGP#PUKEJVFGT-CVJGFTCNGOOI&KCMQX FQTVKP5KNDGT   5GJTUEJÌP



7217

7216

7216



5KNDGTOGFCKNNGXQP5,WFKPWPF2+$QDTQXUEJKMQXCWHFGP(TKGFGPXQP8·T·N· 5ÒFQUVHKPPNCPF  \YKUEJGP 5EJYGFGP WPF 4W­NCPF CO  #WIWUV PCEJ ITGIQTKCPKUEJGO -CNGPFGT CO  #WIWUV  )G   MTÌPVGU $TWUVDKNF T OKV .QTDGGTMTCP\ WPF WOIGNGIVGO /CPVGN1NKXGP\YGKI KP .QTDGGTMTCP\ KO   #DUEJPKVVFTGK<GKNGP5EJTKHVOOI&KCMQX 4   8QPITQ­GT5GNVGPJGKV8QT\ÒINKEJ 



5KNDGTLGVQPWPUKIPKGTVCWHFGP(TKGFGPOKVFGT6ÒTMGK)GMTÌPVGU/QPQITCOOWOJGT.QTDGGT MTCP\8KGT<GKNGP5EJTKHVOOI$KVMKP 4 &KCMQX 4   *GTTNKEJG2CVKPCXQT\ÒINKEJ

60




PAUL I.

7218 1,5:1

1,5:1

<#42#7.+ 'KP4WDGN5VÒEMFGT/ÒP\UV·VVG5V2GVGTUDWTI 

4WDGN5V2GVGTUDWTII8KGTIGMTÌPVG/QPQITCOOGKPU-TGW\IGUVGNNVKPFGP9KPMGNPLG GKPG8GT\KGTVG6CHGNOKVXKGT<GKNGP5EJTKHV$KVMKP 4 (D  )1.&445GJTUEJÌPpXQT\ÒINKEJ



7219

1,5:1

1,5:1

5KNDGTOÒP\GPFGT/ÒP\UV·VVG5V2GVGTUDWTI 

4WDGN5V2GVGTUDWTII)GMTÌPVGT&QRRGNCFNGTOKV<GRVGTWPF4GKEJUCRHGNKPFGP(·PIGP CWH FGT $TWUV 5V )GQTIUUEJKNF WOJGT FKG -GVVG FGU #PFTGCUQTFGPU QDGP -TQPG8GT\KGTVG 6CHGN OKV   XKGT<GKNGP5EJTKHV$KVMKP 4 &CX  44#VVTCMVKXGUHCUVXQT\ÒINKEJGU'ZGORNCTOKVHGKPGT6ÌPWPI 

7220 7221

7221



4WDGN 2QNWRQNVKPPKM 5V2GVGTUDWTI$KVMKP 4 

45GJTUEJÌP





4WDGN5V2GVGTUDWTII$KVMKP&CX  (GKPG2CVKPCCVVTCMVKXGUHCUVXQT\ÒINKEJGU'ZGORNCT



'ZGORNCTFGT#WMVKQP6JG0GY;QTM5CNG8+++0GY;QTM0T

61


PAUL I.

7222

7224

7223



4WDGN5V2GVGTUDWTII$KVMKP&CX

#VVTCMVKXGUHCUVXQT\ÒINKEJGU'ZGORNCT





4WDGN5V2GVGTUDWTII$KVMKP&CX

 #VVTCMVKXGU'ZGORNCTUGJTUEJÌPpXQT\ÒINKEJ





4WDGN5V2GVGTUDWTII$KVMKP&CX

5GJTUEJÌP



 5EJTÌVNKPIUHGJNGTKO4CPFDGTGKEJXQT\ÒINKEJ



7225



4WDGN5V2GVGTUDWTII$KVMKP&CX

7226

7227

7228

 

4WDGN5V2GVGTUDWTII$KVMKP 4 &CX 4WDGN5V2GVGTUDWTII$KVMKP&CX



4WDGN5V2GVGTUDWTII$KVMKP&CX

62

48QT\ÒINKEJ 8QT\ÒINKEJ

 

 -N5EJTÌVNKPIUHGJNGTUGJTUEJÌPpXQT\ÒINKEJ




PAUL I.

7229

1,5:1



1,5:1

4WDGN 2QNVKPC 5V2GVGTUDWTII$KVMKP  5GJTUGNVGPKPFKGUGT'TJCNVWPI*GTTNKEJG2CVKPCYKP\5EJTÌVNKPIUHGJNGTHCUV5VGORGNINCP\

7230

7232

7231



7233



4WDGN 2QNWRQNVKPPKM 5V2GVGTUDWTII$KVMKP 4 

45GJTUEJÌP





4WDGN 2QNWRQNVKPPKM 5V2GVGTUDWTII$KVMKP 4 

4-N-TCV\GTUGJTUEJÌP





4WDGN 2QNWRQNVKPPKM 5V2GVGTUDWTII$KVMKP 4 

45GJTUEJÌP





-QRGMGP5V2GVGTUDWTII$KVMKP

(GKPG2CVKPCUGJTUEJÌP



7234 1,5:1

1,5:1

-WRHGTOÒP\GPFGU<CTGP2CWN+ 

-W-QRGMG'MCVGTKPDWTII$KVMKP

1,5:1



7235

-W2QNWUEJMC5W\WP -QN[XCP 0QXQFGNI$KVMKP*

2TCEJVGZGORNCT5VGORGNINCP\



1,5:1

448QT\ÒINKEJ

 63


ALEXANDER I.

7236

/GFCKNNGPFGU<CTGP2CWN+ 

5KNDGTOGFCKNNGQ,  XQP%.GDGTGEJVCWHUGKPG-TÌPWPIKP/QUMCW7PKHQTOKGTVGU$TWUVDKNFT OKVWOIGNGIVGO/CPVGN-TGW\OOI&KCMQX 4   44*ÒDUEJG2CVKPCXQT\ÒINKEJ



7238

7237





7237

5KNDGTOGFCKNNGQ,  XQP%/GKUPGTCWHUGKPG-TÌPWPIKP/QUMCW7PKHQTOKGTVGU$TWUVDKNFT OKVWOIGNGIVGO/CPVGN-TGW\OOI$KVMKP/ 4 &KCMQX 4   49KP\4CPFHGJNGTMN-TCV\GTUGJTUEJÌP



5KNDGTOGFCKNNG Q ,   WPUKIPKGTV 2T·OKG FGT -CKUGTNKEJGP #MCFGOKG FGT 9KUUGPUEJCHVGP   )GMTÌPVGU/QPQITCOO$WEJCWH5QEMGNFCTCWH'WNGCWH)NQDWUXQTFGO)NQDWU%CFWEGWU5EJNÒU UGNWPF.GKGTOOI&KCMQX 4  44(GKPG2CVKPCYKP\-TCV\GTXQT\ÒINKEJ



7239

1,5:1

1,5:1

<#4#.':#0&'4+ 'KP4WDGN5VÒEMFGU<CTGP#NGZCPFGT+CWUFGT/ÒP\UV·VVG5V2GVGTUDWTI  64

4WDGN5V2GVGTUDWTII$KVMKP 4 (D5EJN

)1.&445GJTUEJÌP




ALEXANDER I.

7241

7240

5KNDGTOÒP\GPFGT/ÒP\UV·VVG5V2GVGTUDWTI 

4WDGN5V2GVGTUDWTII$KVMKP&CX

8QT\ÒINKEJ





4WDGN5V2GVGTUDWTII$KVMKP&CX  (GKPG2CVKPCOKP5EJTÌVNKPIUHGJNGTXQT\ÒINKEJ



7243

7242



4WDGN5V2GVGTUDWTII$KVMKP&CX  *ÒDUEJG2CVKPCCVVTCMVKXGUUGJTUEJÌPGU'ZGORNCT





4WDGN5V2GVGTUDWTII$KVMKP&CX  *ÒDUEJG2CVKPCYKP\5EJTÌVNKPIUHGJNGTHCUVXQT\ÒINKEJ



7246

7245

7244



4WDGN 2QNVKPC 5V2GVGTUDWTII$KVMKP 4 

4-TCV\GTUGJTUEJÌP





4WDGN 2QNVKPC 5V2GVGTUDWTII$KVMKP 4 

 49KP\5EJTÌVNKPIUHGJNGTUGJTUEJÌP





-QRGMGP5V2GVGTUDWTII$KVMKP 4 

49KP\-TCV\GTUGJTUEJÌP



7247



4WDGN5V2GVGTUDWTII$KVMKP 4 &CX



4WDGN5V2GVGTUDWTII$KVMKP&CX

7248

45GJTUEJÌP



5GJTUEJÌP

 65


ALEXANDER I.

7249

7250



4WDGN5V2GVGTUDWTII$KVMKP&CX #VVTCMVKXGU'ZGORNCTUGJTUEJÌPpXQT\ÒINKEJ





4WDGN5V2GVGTUDWTII$KVMKP&CX



7251

*ÒDUEJG2CVKPCUGJTUEJÌP

7252



4WDGN5V2GVGTUDWTII$KVMKP&CX

(CUVXQT\ÒINKEJ





4WDGN5V2GVGTUDWTII$KVMKP&CX

*ÒDUEJG2CVKPCUGJTUEJÌP



7253

1,5:1



1,5:1

4WDGN 2QNVKPC 5V2GVGTUDWTII)GMTÌPVGT&QRRGNCFNGTOKV<GRVGTWPF4GKEJUCRHGNKP FGP (·PIGP CWH FGT $TWUV 5V )GQTIUUEJKNF WOJGT FKG -GVVG FGU #PFTGCUQTFGPU QDGP -TQPG8KGT   <GKNGP5EJTKHVFCTWPVGT/ÒP\UV·VVGPCPICDGQDGP-TQPGWOJGT.QTDGGTWPF'KEJGP\YGKI$KVMKP 4  8QPITQ­GT5GNVGPJGKV2TCEJVGZGORNCTXQPRQNKGTVGP5VGORGNP -N5EJTÌVNKPIUHGJNGTHCUV5VGORGNINCP\ 

7254 1,5:1

 66

1,5:1

4WDGN 2QNWRQNVKPPKM 5V2GVGTUDWTII$KVMKP 4   5GJTUGNVGPKPFKGUGT'TJCNVWPI#VVTCMVKXGUHCUVXQT\ÒINKEJGU'ZGORNCT




ALEXANDER I.

7255 7256

7256



-QRGMGP5V2GVGTUDWTII$KVMKP 4 



4WDGN5V2GVGTUDWTII$KVMKP&CX

7257

7258

4(CUVUGJTUEJÌP



9KP\-TCV\GTXQT\ÒINKEJ



7259



4WDGN5V2GVGTUDWTII$KVMKP&CX

 9KP\5EJTÌVNKPIUHGJNGTCO4CPFXQT\ÒINKEJ





4WDGN5V2GVGTUDWTII$KVMKP&CX

2TCEJVXQNNG2CVKPCXQT\ÒINKEJ





4WDGN5V2GVGTUDWTII$KVMKP&CX

*ÒDUEJG2CVKPCHCUVXQT\ÒINKEJ



7260

7261

7262



4WDGN5V2GVGTUDWTII$KVMKP 4 &CX#PO  44-N5EJTÌVNKPIUHGJNGTCO4CPFOKPLWUVKGTVUGJTUEJÌP





4WDGN5V2GVGTUDWTII$KVMKP&CX

.GKEJVG2T·IGUEJY·EJGXQT\ÒINKEJ





4WDGN5V2GVGTUDWTII$KVMKP&CX

5GJTUEJÌP

 67


ALEXANDER I.

7264

7263

7265



4WDGN5V2GVGTUDWTII$KVMKP&CX

*ÒDUEJG2CVKPCXQT\ÒINKEJ





4WDGN 2QNVKPC 5V2GVGTUDWTII$KVMKP  5GNVGPKPFKGUGT'TJCNVWPI(CUV5VGORGNINCP\





4WDGN 2QNVKPC 5V2GVGTUDWTII$KVMKP  #VVTCMVKXGU'ZGORNCTOKVJGTTNKEJGT2CVKPCXQT\ÒINKEJ



7266

7267

7268

7269



-QRGMGP5V2GVGTUDWTII$KVMKP

8QT\ÒINKEJ





-QRGMGP5V2GVGTUDWTII$KVMKP

*ÒDUEJG2CVKPCUGJTUEJÌPpXQT\ÒINKEJ





-QRGMGP5V2GVGTUDWTII$KVMKP

*ÒDUEJG2CVKPCXQT\ÒINKEJ





-QRGMGP5V2GVGTUDWTII$KVMKP

5GNVGPKPFKGUGT'TJCNVWPI8QT\ÒINKEJ



7270

7271

7272

7273



-QRGMGP5V2GVGTUDWTII$KVMKP

9KP\5EJTÌVNKPIUHGJNGTUGJTUEJÌP





-QRGMGP5V2GVGTUDWTII$KVMKP

8QT\ÒINKEJp5VGORGNINCP\





-QRGMGP5V2GVGTUDWTII$KVMKP

5GJTUEJÌP





-QRGMGP5V2GVGTUDWTII$KVMKP

5GJTUEJÌP



68


ALEXANDER I.

7274

7275

7276

-WRHGTOÒP\GPFGT/ÒP\UV·VVG'MCVGTKPDWTI 

-W-QRGMGP'MCVGTKPDWTII$KVMKP

5GJTUEJÌP





-W-QRGMGP'MCVGTKPDWTII$KVMKP

(CUVXQT\ÒINKEJ





-W-QRGMGP'MCVGTKPDWTII$KVMKP  5GNVGPGTNGV\VGT,CJTICPI'VYCUTCWJGT5EJTÌVNKPINGKEJVLWUVKGTVHCUVXQT\ÒINKEJ



7278

7277

7279



-W-QRGMGP'MCVGTKPDWTII$KVMKP

5GNVGPGTNGV\VGT,CJTICPI5GJTUEJÌP





-W-QRGMGP'MCVGTKPDWTI+P752NCUVKMJQNFGTFGT0)%OKVFGT$GYGTVWPI/5$0$KVMKP  2TCEJVGZGORNCT8QT\ÒINKEJp5VGORGNINCP\





-W-QRGMGP'MCVGTKPDWTI+P752NCUVKMJQNFGTFGT0)%OKVFGT$GYGTVWPI/5$0$KVMKP  2TCEJVGZGORNCT8QT\ÒINKEJp5VGORGNINCP\

 69


ALEXANDER I.

7281

7280



-W-QRGMGP'MCVGTKPDWTI+P752NCUVKMJQNFGTFGT0)%OKVFGT$GYGTVWPI/5$0$KVMKP 8QT\ÒINKEJp5VGORGNINCP\





-W-QRGMG'MCVGTKPDWTII$KVMKP



8QT\ÒINKEJ

7282

1,5:1

1,5:1



-W-QRGMG'MCVGTKPDWTI+P752NCUVKMJQNFGTFGT0)%OKVFGT$GYGTVWPI/54$$KVMKP 2TCEJVGZGORNCT-N<CKPGPFGHCUV5VGORGNINCP\

7283

7284



-W&GPIC'MCVGTKPDWTII$KVMKP  5GNVGPKPFKGUGT'TJCNVWPI9KP\5EJTÌVNKPIUHGJNGTCO4CPFXQT\ÒINKEJp5VGORGNINCP\



-W&GPIC'MCVGTKPDWTII$KVMKP

5GJTUEJÌPpXQT\ÒINKEJ

7285

 

 

7286

2T·IWPIGPHÒT)GQTIKGP

#DC\K -QRGMGP 6KHNKUHÒT)GQTIKGPI$KVMKP #DC\K -QRGMGP 6KHNKUHÒT)GQTIKGPI$KVMKP

1,5:1



7287

5GJTUEJÌPpXQT\ÒINKEJ 5GJTUEJÌP

 

1,5:1

'KPG)QNFRT·IWPIHÒT2QNGP  70

<NQV[EJ9CTUEJCWHÒT2QNGPI$KVMKP 4 (D FQTVWPVGT2QNGP 5EJN FQTV WPVGT2QNGP  )1.&5GNVGPDGUQPFGTUKPFKGUGT'TJCNVWPI5GJTCVVTCMVKXGUXQT\ÒINKEJGU'ZGORNCT




ALEXANDER I.

7288

7289

/GFCKNNGPFGU<CTGP#NGZCPFGT+ 



$TQP\GOGFCKNNG  XQP % .GDGTGEJV CWH FKG .KGDG \WO 8CVGTNCPF XGTNKGJGP CP 2CTVKUCPGP FGT   /QUMCWGT 2TQXKP\GP $ÒUVG T(ÒPH <GKNGP 5EJTKHV WOJGT 'KEJGPMTCP\  OO  I &KCMQX    4  -N4CPFHGJNGTXQT\ÒINKEJ



/GUUKPILGVQP  9GTMUVCVV .CWGT 0ÒTPDGTI CWH FKG 5EJNCEJV DGK *CPCW &GT <CT UQYKG (TKGFTKEJ   9KNJGNO+++XQP2TGW­GPWPF-CKUGT(TCP\+XQP¤UVGTTGKEJUVGJGPPGDGPGKPCPFGTWPFTGKEJGPUKEJFKG *·PFG&CTUVGNNWPI FGT 8GTVTGKDWPI FGT PCRQNGQPKUEJGP 6TWRRGP XQT *CPCW  OO  I   &KCMQX -N5EJTÌVNKPIUHGJNGTCO4CPFUGJTUEJÌP



7291

7290

7290





<KPP5VGEMOGFCKNNG  XQP , 6 5VGVVPGT CWH FKG $GHTGKWPIUMTKGIG WPF FKG 5KGIGFGT8GTDÒPFGVGP 6GORGN OKV UKGDGP 5·WNGP CP FGPGP FKG 9CRRGPUEJKNFG FGT 8GTDÒPFGVGP DGHGUVKIV UKPF&KG FTGK )ÌV   VKPPGPFGT)GTGEJVKIMGKVFGT9GKUJGKVWPFFGT'KPKIMGKVUVGJGPPGDGPGKPCPFGTXXOOI +PJCNV  OKVGKPCPFGT XGTDWPFGPG FQRRGNUGKVKIG MQNQTKGTVG -WRHGTUVKEJG OKV &CTUVGNNWPIGP XQP   5EJNCEJVU\GPGP WPF $GUEJTGKDWPIGP FKG FGP <GKVTCWO XQO  /CK  DKU \WO  &G\GODGT   WOHCUUGPKPFGP&GEMGNKPPGPUGKVGPDGHKPFGPUKEJ\YGKGKPIGMNGDVGMQNQTKGTVG5EJTKHVDN·VVGT0GWP <GKNGP 5EJTKHV KP ITÒPGO .QTDGGTMTCP\<GJP <GKNGP 5EJTKHV KP ITÒPGO .QTDGGTMTCP\ &KCMQX p   2TG­NGT 8QT\ÒINKEJ



/GUUKPILGVQP Q ,   WPUKIPKGTV CWH FGP (TKGFGP XQP 2CTKU 7PKHQTOKGTVGU $TWUVDKNF N<YGK   IGMTGW\VG (ÒNNJÌTPGT FC\YKUEJGP 1NKXGP\YGKI  OO  I &KCMQX p 2CZ KP 0WOOKU p   5NI,WNKWU 5GJTUEJÌPpXQT\ÒINKEJ



7292



5KNDGTOGFCKNNGXQP(5VWEMJCTFVCWHFCU$ÒPFPKU\YKUEJGP4W­NCPF¤UVGTTGKEJWPF2TGW­GPKO -CORHIGIGP(TCPMTGKEJ&TGKMNGGDNCVVHÌTOKICPIGQTFPGVG/GFCKNNQPUOKVFGP$TWUVDKNFGTPXQP#NGZ CPFGT + XQP 4W­NCPF (TKGFTKEJ 9KNJGNO +++ XQP 2TGW­GP WPF (TCP\ + XQP ¤UVGTTGKEJ FC\YKUEJGP   2CNO 'KEJGP WPF .QTDGGT\YGKI<GJP <GKNGP 5EJTKHV  OO  I &KCMQX  4    /CTKGPD5NI/QPVGPWQXQ  445GJTCVVTCMVKXGUXQT\ÒINKEJGU'ZGORNCTOKVJGTTNKEJGT6ÌPWPI

 71


NIKOLAUS I.

7293



$TQP\GOGFCKNNGXQP*($TCPFVCWHFKG)TWPFUVGKPNGIWPIFGU5KGIGUFGPMOCNUCWHFGO-TGW\ DGTIKP$GTNKPIGOGKPUCOOKV-ÌPKI(TKGFTKEJ9KNJGNO+++XQP2TGW­GP\WT'TKPPGTWPICPFKG5KGIG ÒDGT 0CRQN¾QP + &KG $ÒUVGP XQP #NGZCPFGT + XQP 4W­NCPF WPF (TKGFTKEJ 9KNJGNO +++ XQP 2TGW­GP   PGDGPGKPCPFGT N WOJGT .QTDGGTMTCP\#PUKEJV FGU 5KGIGUFGPMOCNU WOJGT FKG ,CJTGU\CJNGP        UQYKG GKP FTGK\GKNKIGT 5EJTKHVMTGKU  OO  I &KCMQX  4  .GJPGTV    /CTKGPD 8QT\ÒINKEJp5VGORGNINCP\



7294



5KNDGTOGFCKNNG  XQP # -NGRKMQY CWH UGKPGP 6QF $ÒUVG T OKV .QTDGGTMTCP\WOJGT5EJNCPIGP TKPI5VTCJNGPFGU)QVVGUCWIGOOI&KCMQX 4   449KP\4CPFHGJNGTXQT\ÒINKEJ 

7295

7296

1,5:1

1,5:1

<#40+-1.#75+ )QNFOÒP\GPFGU<CTGP0KMQNCWU+ 

4WDGN5V2GVGTUDWTII$KVMKP(D5EJN



4WDGN5V2GVGTUDWTII$KVMKP(D5EJN

72

 )1.&4-N4CPFHGJNGTUGJTUEJÌP )1.&(CUVXQT\ÒINKEJ

 


NIKOLAUS I.

7297

7298



4WDGN5V2GVGTUDWTII$KVMKP(D5EJN  )1.&-N5VGORGNHGJNGTXQT\ÒINKEJp5VGORGNINCP\





4WDGN5V2GVGTUDWTII$KVMKP(D5EJN



)1.&5GJTUEJÌPpXQT\ÒINKEJ

7299 1,5:1



1,5:1

 4WDGN  5V 2GVGTUDWTI +P 752NCUVKMJQNFGT FGT 0)% OKV FGT $GYGTVWPI /5  $KVMKP    (D5EJN )1.&(CUV5VGORGNINCP\ 

7300

7301

7302

7303



4WDGN5V2GVGTUDWTII$KVMKP(D5EJN

)1.&(CUVXQT\ÒINKEJ





4WDGN5V2GVGTUDWTII$KVMKP(D5EJN

)1.&8QT\ÒINKEJ





4WDGN5V2GVGTUDWTII$KVMKP(D5EJN

)1.&9KP\-TCV\GTXQT\ÒINKEJ





4WDGN5V2GVGTUDWTII$KVMKP(D5EJN  )1.&-TCV\GTXQT\ÒINKEJp5VGORGNINCP\



7304 Pt

1,5:1

1,5:1

2NCVKPOÒP\GPFGU<CTGP0KMQNCWU+ 

4WDGN2NCVKP5V2GVGTUDWTII$KVMKP 4 (D5EJN  2.#6+0445GJTUEJÌP5GJTUEJÌPpXQT\ÒINKEJ

 73


NIKOLAUS I.

7305 Pt

7306 Pt

7307 Pt



4WDGN2NCVKP5V2GVGTUDWTII$KVMKP 4 (D5EJN  2.#6+08QT\ÒINKEJp5VGORGNINCP\





4WDGN2NCVKP5V2GVGTUDWTII$KVMKP 4 (D5EJN  2.#6+05GJTUGNVGPKPFKGUGT'TJCNVWPI8QT\ÒINKEJp5VGORGNINCP\





4WDGN2NCVKP5V2GVGTUDWTI+P752NCUVKMJQNFGTFGT2%)5OKVFGT$GYGTVWPI#7$KVMKP

4 (D5EJN 2.#6+05GJTUEJÌPpXQT\ÒINKEJ



7308 Pt

2:1



2:1

4WDGN2NCVKP5V2GVGTUDWTII$KVMKP 4 (D5EJN  2.#6+05GJTUGNVGPKPFKGUGT'TJCNVWPI2TCEJVGZGORNCT(CUV5VGORGNINCP\



/KV'ZRGTVKUGXQP+IQT5EJKT[CMQX5VCCVNKEJGU*KUVQTKUEJGU/WUGWO/QUMCW

7309 Pt

7310 Pt

7311 Pt



4WDGN2NCVKP5V2GVGTUDWTI+P752NCUVKMJQNFGTFGT0)%OKVFGT$GYGTVWPI8($KVMKP

4 (D5EJN 2.#6+05GJTUEJÌP





4WDGN2NCVKP5V2GVGTUDWTI+P752NCUVKMJQNFGTFGT2%)5OKVFGT$GYGTVWPI8($KVMKP

4 (D5EJN 2.#6+05GNVGPGT,CJTICPI5GJTUEJÌP





4WDGN2NCVKP5V2GVGTUDWTII$KVMKP 4 (D5EJN

74

 2.#6+048QT\ÒINKEJ




NIKOLAUS I.

7312 Pt

7313 Pt

7314 Pt



4WDGN2NCVKP5V2GVGTUDWTI+P752NCUVKMJQNFGTFGT0)%OKVFGT$GYGTVWPI8($KVMKP

4 (D5EJN 2.#6+05GJTUEJÌP





4WDGN2NCVKP5V2GVGTUDWTII$KVMKP 4 (D5EJN

2.#6+05GJTUEJÌP





4WDGN2NCVKP5V2GVGTUDWTII$KVMKP 4 (D5EJN  2.#6+049KP\4CPFHGJNGTUGJTUEJÌP



7316

7315

7315

5KNDGTOÒP\GPFGT/ÒP\UV·VVG5V2GVGTUDWTI 

4WDGN5V2GVGTUDWTII$KVMKP 4 &CX FQTVWPVGT#NGZCPFGT+   44(CUVUGJTUEJÌP





-QRGMGP5V2GVGTUDWTII$KVMKP 4 



7317

7318

48QT\ÒINKEJ

7319



4WDGN5V2GVGTUDWTII$KVMKP&CX

(CUVXQT\ÒINKEJ





4WDGN5V2GVGTUDWTII$KVMKP&CX

 2TCEJVXQNNG2CVKPCXQT\ÒINKEJp5VGORGNINCP\





4WDGN5V2GVGTUDWTII$KVMKP&CX

8QT\ÒINKEJ

 75


NIKOLAUS I.

7322

7321

7320

7320



4WDGN5V2GVGTUDWTII$KVMKP&CX

5GJTUEJÌPpXQT\ÒINKEJ





-QRGMGP5V2GVGTUDWTII$KVMKP

-QTTQFKGTVXQT\ÒINKEJ





-QRGMGP5V2GVGTUDWTII$KVMKP

5GJTUEJÌP



5GNVGPKPFKGUGT'TJCNVWPI8QT\ÒINKEJ



7323 1,5:1



1,5:1

-QRGMGP5V2GVGTUDWTII$KVMKP

7324

1,5:1



1,5:1

-QRGMGP5V2GVGTUDWTII$KVMKP  5GNVGPKPFKGUGT'TJCNVWPI8QT\ÒINKEJp5VGORGNINCP\

7325

7326

7327



-QRGMGP5V2GVGTUDWTII$KVMKP 4 



7328



7329

45GJTUEJÌP



-QRGMGP5V2GVGTUDWTII$KVMKP

8QT\ÒINKEJ





-QRGMGP5V2GVGTUDWTII$KVMKP

5GJTUEJÌP





-QRGMGP5V2GVGTUDWTII$KVMKP

8QT\ÒINKEJ





-QRGMGP5V2GVGTUDWTII$KVMKP

5GNVGPGT,CJTICPI(GKPG2CVKPCXQT\ÒINKEJ



76


NIKOLAUS I.

7330



4WDGN5V2GVGTUDWTII$KVMKP&CX

(CUVXQT\ÒINKEJ



7331

1,5:1

1,5:1



4WDGN  5V 2GVGTUDWTI /KV /ÒP\UV·VVGPCPICDG CÏB" CPUVCVV CÏÁ" +P 752NCUVKMJQNFGT FGT   0)%OKVFGT$GYGTVWPI/5$KVMKP 4 &CX  8QPITQ­GT5GNVGPJGKV8QT\ÒINKEJp5VGORGNINCP\ 

7332

7333

7334



4WDGN5V2GVGTUDWTII$KVMKP&CX

8QT\ÒINKEJ





4WDGN5V2GVGTUDWTI+P752NCUVKMJQNFGTFGT0)%OKVFGT$GYGTVWPI/5$KVMKP&CX *ÒDUEJG2CVKPCYKP\5VGORGNHGJNGTHCUV5VGORGNINCP\





4WDGN5V2GVGTUDWTI+P752NCUVKMJQNFGTFGT0)%OKVFGT$GYGTVWPI/5$KVMKP&CX 5GNVGPKPFKGUGT'TJCNVWPI(CUV5VGORGNINCP\

 77


NIKOLAUS I.

7335

7336

7337



4WDGN5V2GVGTUDWTII$KVMKP&CX

8QT\ÒINKEJ





4WDGN5V2GVGTUDWTII$KVMKP 4 &CX  5GNVGPDGUQPFGTUKPFKGUGT'TJCNVWPI(CUVXQT\ÒINKEJ





4WDGN  5V 2GVGTUDWTI +P 752NCUVKMJQNFGT FGT 0)% OKV FGT $GYGTVWPI /5  $KVMKP    &CX *ÒDUEJG2CVKPCXQT\ÒINKEJp5VGORGNINCP\



7338



4WDGN5V2GVGTUDWTII$KVMKP&CX

7339

   78

7340

4WDGN5V2GVGTUDWTII$KVMKP&CX 4WDGN5V2GVGTUDWTII$KVMKP&CX 4WDGN5V2GVGTUDWTII$KVMKP&CX

8QT\ÒINKEJp5VGORGNINCP\



7341

8QT\ÒINKEJ *ÒDUEJG2CVKPCUGJTUEJÌP 8QT\ÒINKEJ

  


NIKOLAUS I.

7342

7343

7344



4WDGN5V2GVGTUDWTII$KVMKP&CX

(CUVXQT\ÒINKEJ





4WDGN5V2GVGTUDWTII$KVMKP&CX

8QT\ÒINKEJp5VGORGNINCP\





4WDGN5V2GVGTUDWTII$KVMKP&CX

(GKPG2CVKPCHCUVXQT\ÒINKEJ



2TCEJVXQNNG2CVKPCHCUV5VGORGNINCP\



7345



4WDGN5V2GVGTUDWTII$KVMKP&CX

7346

7347

7348



4WDGN5V2GVGTUDWTII$KVMKP&CX  -N4CPFHGJNGTXQT\ÒINKEJCWURQNKGTVGT2NCVVG





4WDGN5V2GVGTUDWTII$KVMKP&CX  2TCEJVXQNNG2CVKPCYKP\4CPFHGJNGTXQT\ÒINKEJp5VGORGNINCP\





4WDGN5V2GVGTUDWTII$KVMKP&CX



5GJTUEJÌPpXQT\ÒINKEJ

79


NIKOLAUS I.

7349

1,5:1



1,5:1

 4WDGN 2QNVKPC   5V 2GVGTUDWTI  I $KVMKP  FQTV HCNUEJGU /Ã&#x2019;P\\GKEJGP CPIGIGDGP    2TCEJVGZGORNCT(CUV5VGORGNINCP\

7350

7352

7351



7353



 4WDGN 2QNVKPC   5V 2GVGTUDWTI  I $KVMKP  FQTV HCNUEJGU /Ã&#x2019;P\\GKEJGP CPIGIGDGP    8QT\Ã&#x2019;INKEJ





 4WDGN 2QNVKPC   5V 2GVGTUDWTI  I $KVMKP  FQTV HCNUEJGU /Ã&#x2019;P\\GKEJGP CPIGIGDGP    (GKPG2CVKPCXQT\Ã&#x2019;INKEJ





4WDGN 2QNVKPC 5V2GVGTUDWTII$KVMKP

9KP\4CPFHGJNGTXQT\Ã&#x2019;INKEJ





4WDGN 2QNVKPC 5V2GVGTUDWTII$KVMKP  9KP\4CPFHGJNGTXQT\Ã&#x2019;INKEJp5VGORGNINCP\



7355 7354

7356



-QRGMGP5V2GVGTUDWTII$KVMKP

5GNVGPKPFKGUGT'TJCNVWPI8QT\Ã&#x2019;INKEJ





-QRGMGP5V2GVGTUDWTII$KVMKP  5GNVGPKPFKGUGT'TJCNVWPI(GKPG2CVKPCXQT\Ã&#x2019;INKEJ





-QRGMGP5V2GVGTUDWTII$KVMKP



80

9KP\5VGORGNHGJNGTXQT\Ã&#x2019;INKEJ


NIKOLAUS I.

7357 1,5:1



1,5:1

-QRGMGP5V2GVGTUDWTII$KVMKP  5GNVGPKPFKGUGT'TJCNVWPI8QT\ÒINKEJp5VGORGNINCP\

7359

7358

7360



-QRGMGP5V2GVGTUDWTII$KVMKP



-QRGMGP5V2GVGTUDWTII$KVMKP 4 

 



7361

9KP\-TCV\GTXQT\ÒINKEJ



4(GKPG2CVKPCUGJTUEJÌPpXQT\ÒINKEJ



-QRGMGP5V2GVGTUDWTII$KVMKP

9KP\4CPFHGJNGTXQT\ÒINKEJ



-QRGMGP5V2GVGTUDWTII$KVMKP

*ÒDUEJG2CVKPCXQT\ÒINKEJp5VGORGNINCP\



7362

7363

7362



-QRGMGP5V2GVGTUDWTII$KVMKP

*ÒDUEJG2CVKPCHCUVXQT\ÒINKEJ





-QRGMGP5V2GVGTUDWTII$KVMKP

9KP\-TCV\GTRQNKGTVG2NCVVG



7364

7365

7367

7368

7369



-QRGMGP5V2GVGTUDWTII$KVMKP

5GJTUEJÌP





-QRGMGP5V2GVGTUDWTII$KVMKP

-N5VGORGNHGJNGTXQT\ÒINKEJ





-QRGMGP5V2GVGTUDWTII$KVMKP

*ÒDUEJG2CVKPCUGJTUEJÌP





-QRGMGP5V2GVGTUDWTII$KVMKP

2TCEJVGZGORNCT5VGORGNINCP\





-QRGMGP5V2GVGTUDWTII$KVMKP 2TCEJVGZGORNCT'TUVCDUEJNCI(CUV5VGORGNINCP\





-QRGMGP5V2GVGTUDWTII$KVMKP

8QT\ÒINKEJ

 81


NIKOLAUS I.

7370

7372

7375

7376

7377



-QRGMGP5V2GVGTUDWTII$KVMKP

(CUV5VGORGNINCP\





-QRGMGP5V2GVGTUDWTII$KVMKP

8QT\ÒINKEJ





-QRGMGP5V2GVGTUDWTII$KVMKP

2QNKGTVG2NCVVG





-QRGMGP5V2GVGTUDWTII$KVMKP

8QT\ÒINKEJ





-QRGMGP5V2GVGTUDWTI$KVMKP  5VÒEM*ÒDUEJG2CVKPCXQT\ÒINKEJp5VGORGNINCP\





-QRGMGP5V2GVGTUDWTII$KVMKP

2QNKGTVG2NCVVG





-QRGMGP5V2GVGTUDWTII$KVMKP

2QNKGTVG2NCVVG





-QRGMGP5V2GVGTUDWTII$KVMKP

9KP\-TCV\GTXQT\ÒINKEJ



7379

7378

7378

5KNDGTOÒP\GPFGT/ÒP\UV·VVG9CTUEJCW 

4WDGN9CTUEJCWI$KVMKP&CX



4WDGN 2QNVKPC 9CTUEJCWI$KVMKP 4 

7380

7382

7383

5GJTUEJÌP



445GJTUEJÌP



7384

-WRHGTOÒP\GPFGU<CTGP0KMQNCWU+ 

-W-QRGMG'MCVGTKPDWTI+P752NCUVKMJQNFGTFGT0)%OKVFGT$GYGTVWPI/54$$KVMKP 2TCEJVGZGORNCT(CUV5VGORGNINCP\





-W -QRGMGP  'MCVGTKPDWTI  I &C\W -W -QRGMGP  'MCVGTKPDWTI  I   $KVMKP 5VÒEM5GJTUEJÌPpXQT\ÒINKEJ





-W-QRGMG'MCVGTKPDWTII$KVMKP 4 

448QT\ÒINKEJ





-W-QRGMG'MCVGTKPDWTII&KEMCDUEJNCI 2K¾HQTV $KVMKP\W

448QT\ÒINKEJ





-W-QRGMG'MCVGTKPDWTI+P752NCUVKMJQNFGTFGT0)%OKVFGT$GYGTVWPI/5$0$KVMKP 8QT\ÒINKEJp5VGORGNINCP\

82




NIKOLAUS I.

7385

7386

7385



-W&GPG\JMC'MCVGTKPDWTII$KVMKP



-W2QNWUEJMC'MCVGTKPDWTII&KEMCDUEJNCI 2K¾HQTV $KVMKP\W



-W2QNWUEJMC  'MCVGTKPDWTI  I &C\W #NGZCPFGT ++  -W2QNWUEJMC    'MCVGTKPDWTII$KVMKP 5VÒEM8QT\ÒINKEJ

7388

7389



-W-QRGMGP9CTUEJCWHÒT2QNGPI$KVMKP 4 



-W-QRGMG9CTUEJCWI$KVMKP 4 

8QT\ÒINKEJp5VGORGNINCP\ 48QT\ÒINKEJ

  

7388

445GJTUEJÌP



48QT\ÒINKEJ



7390

1,5:1

1,5:1

)GFGPMOÒP\GPFGU<CTGP0KMQNCWU+ 

4WDGN5V2GVGTUDWTI&GPMOCNHÒT#NGZCPFGT+I$KVMKP 4 &CX  5GNVGPKPFKGUGT'TJCNVWPI2TCEJVGZGORNCT*GTTNKEJG2CVKPCHCUV5VGORGNINCP\



/KV'ZRGTVKUGXQP+IQT5EJKT[CMQX5VCCVNKEJGU*KUVQTKUEJGU/WUGWO/QUMCW

7391



4WDGN5V2GVGTUDWTI&GPMOCNHÒT#NGZCPFGT+I$KVMKP 4 &CX  *ÒDUEJG2CVKPCYKP\-TCV\GTHCUVXQT\ÒINKEJ

 83


NIKOLAUS I.

7393

7392



4WDGN  5V 2GVGTUDWTI CWH FKG 'KPYGKJWPI FGU $QTQFKPQ&GPMOCNU  I $KVMKP  4    &CX 45GJTUEJÌP





4WDGN5V2GVGTUDWTICWHFKG'KPYGKJWPIFGU$QTQFKPQ&GPMOCNUI$KVMKP 4 &CX 45GJTUEJÌP



7394

1,5:1



1,5:1

4WDGN  5V 2GVGTUDWTI XQP * )WDG CWH FKG 8GTO·JNWPI UGKPGU 5QJPGU )TQ­HÒTUV #NGZCPFGT   0KMQNCLGYKVUEJUR·VGT<CT#NGZCPFGT++OKV/CTKCXQP*GUUGP&CTOUVCFV6QEJVGT.WFYKIU++I $KVMKP 4 &CX# 44-N4CPFHGJNGTHCUVXQT\ÒINKEJ 

7395

1,5:1

1,5:1

'KPG-WRHGTRTQDGFGT/ÒP\UV·VVG5V2GVGTUDWTI  84

-W-QRGMGP5V2GVGTUDWTI0QXQFGNFGT2TQDGI$KVMKP* 4   44(CUV5VGORGNINCP\




NIKOLAUS I.

7397

7396

2T·IWPIGPHÒT2QNGP 

<NQV[EJ9CTUEJCWHÒT2QNGPI$KVMKP



<NQVG9CTUEJCWHÒT2QNGPI$KVMKP

7398

(GKPG2CVKPCUGJTUEJÌPpXQT\ÒINKEJ



5GJTUEJÌP



7399

7400



4WDGN <NQV[EJ 5V2GVGTUDWTIHÒT2QNGPI$KVMKP&CX

5GJTUEJÌP





4WDGN <NQV[EJ 5V2GVGTUDWTIHÒT2QNGPI$KVMKP&CX  (CUVUGJTUEJÌP



4WDGN <NQV[EJ 5V2GVGTUDWTIHÒT2QNGPI$KVMKP&CX  (GKPG2CVKPCUGJTUEJÌP



'ZGORNCTFGT5COONWPI#PVQPKP2TQMQR6GKN#WMVKQP#WTGC0WOKUOCVKMC2TCI0T



7401

7402



4WDGN <NQV[EJ 5V2GVGTUDWTIHÒT2QNGPI$KVMKP&CX

5GJTUEJÌP





4WDGN <NQV[EJ 5V2GVGTUDWTIHÒT2QNGPI$KVMKP&CX  *ÒDUEJG2CVKPCXQT\ÒINKEJ

 85


NIKOLAUS I.

7403 7404

 

7404

-QRGMGP <NQV[ 5V2GVGTUDWTIHÒT2QNGPI$KVMKP 4WDGN <NQV[EJ 9CTUEJCWHÒT2QNGPI$KVMKP&CX

7405

7406

5GJTUEJÌP 5GJTUEJÌP

 

7407



4WDGN <NQV[EJ 9CTUEJCWHÒT2QNGPI$KVMKP&CX  *ÒDUEJG2CVKPCUGJTUEJÌP





4WDGN <NQV[EJ 9CTUEJCWHÒT2QNGPI$KVMKP

(CUVXQT\ÒINKEJ





4WDGN <NQV[EJ 9CTUEJCWHÒT2QNGPI$KVMKP  (GKPG2CVKPCOKP4CPFHGJNGTUGJTUEJÌP



7408

    86

7409

7410

-QRGMGP <NQVG 9CTUEJCWHÒT2QNGPI$KVMKP -QRGMGP <NQVG 9CTUEJCWHÒT2QNGPI$KVMKP -QRGMGP <NQVG 9CTUEJCWHÒT2QNGPI$KVMKP -QRGMGP )TQU\[ 9CTUEJCWHÒT2QNGPI$KVMKP 4 

7411

5GJTUEJÌP 5GJTUEJÌP 5GJTUEJÌPpXQT\ÒINKEJ 45GJTUEJÌP

   


NIKOLAUS I.

7412

7413

7414

7415



-QRGMGP )TQU\[ 9CTUEJCWHÒT2QNGPI$KVMKP FQTVHCNUEJDGUEJTKGDGP   5GJTUEJÌP





-QRGMGP )TQU\[ 9CTUEJCWHÒT2QNGPI$KVMKP

5GJTUEJÌP





-QRGMGP )TQU\[ 9CTUEJCWHÒT2QNGPI$KVMKP  5GJTUGNVGPKPFKGUGT'TJCNVWPI2TCEJVXQNNG2CVKPCXQT\ÒINKEJp5VGORGNINCP\





-QRGMGP )TQU\[ 9CTUEJCWHÒT2QNGPI$KVMKP  -N-TCV\GTUGJTUEJÌPpXQT\ÒINKEJ



7417

7416

7418

/GFCKNNGPFGU<CTGP0KMQNCWU+ 





6TCIDCTG QXCNG 5KNDGTOGFCKNNG Q , WPUKIPKGTV 'JTGP\GKEJGP FGU )TQ­JGT\QIVWOU 5CEJUGP9GKOCT   'KUGPCEJ HÒT(TCWGP#DVGKNWPI$TWUVDKNFUGKPGT5EJYGUVGT)TQ­JGT\QIKP/CTKC2CYNQYPCTOKV &KCFGO)GMTÌPVGU/QPQITCOOZOOI1'-0KOOGTIWV  44*GTTNKEJG2CVKPCXQT\ÒINKEJp5VGORGNINCP\



5KNDGTOGFCKNNG  WPUKIPKGTV JGTCWUIGIGDGP XQP FGT 5VCFV 9CTUEJCW \WT 'TKPPGTWPI CP FGP 6QF   #NGZCPFGTU+$ÒUVG#NGZCPFGTU+TOKV.QTDGGTMTCP\FCTÒDGT5VGTP8KGT<GKNGP5EJTKHVWPF,CJTGU \CJNWOJGT.QTDGGTMTCP\OOI&KCMQX 4 *%\  42TCEJVXQNNG2CVKPCXQT\ÒINKEJ



5KNDGTOGFCKNNG  WPUKIPKGTV JGTCWUIGIGDGP XQP FGT 5VCFV 9CTUEJCW \WT 'TKPPGTWPI CP FGP 6QF   #NGZCPFGTU+$ÒUVG#NGZCPFGTU+TOKV.QTDGGTMTCP\FCTÒDGT5VGTP8KGT<GKNGP5EJTKHVWPF,CJTGU \CJNWOJGT.QTDGGTMTCP\OOI&KCMQX 4 *%\  42TCEJVXQNNG2CVKPCXQT\ÒINKEJ

 87


NIKOLAUS I.

7419







7420

7421

5KNDGTOGFCKNNG  WPUKIPKGTV JGTCWUIGIGDGP XQP FGT 5VCFV 9CTUEJCW \WT 'TKPPGTWPI CP FGP 6QF   #NGZCPFGTU+$ÒUVG#NGZCPFGTU+TOKV.QTDGGTMTCP\FCTÒDGT5VGTP8KGT<GKNGP5EJTKHVWPF,CJTGU \CJNWOJGT.QTDGGTMTCP\OOI&KCMQX 4 *%\ 48QT\ÒINKEJ



5KNDGTOGFCKNNG  XQP 8 #NGZGGX WPF ) 5CDWTQX CWH UGKPG -TÌPWPI KP /QUMCW CO  #WIWUV   $ÒUVG T-TQPG NKGIV CWH GKPGT 5·WNG CP FGT GKPG 6CHGN CPIGDTCEJV KUV LGFQEJ HGJNV FKG TWUUKUEJG +P   UEJTKHV &CU)GUGV\ QDGPUVTCJNGPFGU)QVVGUCWIGOOI&KCMQX 4   449KP\4CPFHGJNGTUGJTUEJÌPpXQT\ÒINKEJ



5KNDGTOGFCKNNGXQP*)WDGCWHFKG-TKGIUGTMN·TWPICPFKG6ÒTMGKCO#RTKN$ÒUVGT&KG RGTUQPKHK\KGTVG4GNKIKQPÒDGTTGKEJVFGO<CTGPGKP5EJYGTVWPFGKP-TGW\\YKUEJGPKJPGPCWHFGO$Q FGPGKP*GNOOOI&KCMQX 4   4*GTTNKEJG2CVKPCXQT\ÒINKEJp5VGORGNINCP\



7422



88

$TQP\GOGFCKNNGXQP*)WDGCWHFKG'KPYGKJWPIFGT5OQNP[-CVJGFTCNGKP5V2GVGTUDWTI%JTK UVWUUKV\VXXOKVFTGK-KPFGTP#PUKEJVFGT-CVJGFTCNGOOI&KCMQX 4   48QT\ÒINKEJ




NIKOLAUS I.

7423



5KNDGTOGFCKNNGWPUKIPKGTVCWHFKG'TTKEJVWPIFGU&GPMOCNUHÒTFKGKPFGT5EJNCEJVCO#WIWUV DGK-WNO $ÌJOGP IGHCNNGPGPTWUUKUEJGP5QNFCVGP#PUKEJVFGU&GPMOCNU5KGDGP<GKNGP5EJTKHV OOI&KCMQX 4 5NI/QPVGPWQXQ 9KP\4CPFHGJNGTXQT\ÒINKEJ &KG 5EJNCEJV HCPFCOWPF#WIWUVUVCVV#WHFGTXQTNKGIGPFGP/GFCKNNGYWTFGFCJGTFWTEJ'KPTKV\GP GKPGTTÌOKUEJGP+FKGTÌOKUEJG<CJN:::KP+:::XGT·PFGTV



7424



5KNDGTOGFCKNNGXQP27VMKPCWHFGPGTUVGP5RCVGPUVKEJ\WO$CWFGT%JTKUV'TNÌUGT-CVJGFTCNGKP /QUMCW5VTCJNGPFGU)QVVGUCWIG#PUKEJVFGT-KTEJGOOI&KCMQX 4   8QPITQ­GT5GNVGPJGKV*ÒDUEJG2CVKPCMN4CPFHGJNGTXQT\ÒINKEJ



7425



5KNDGTOGFCKNNGXQP,$4QVJCWHFKG$GVGKNKIWPI4W­NCPFUCPFGT4ÒEMICDG5[TKGPUCPFKG6ÒT MGK4KVVGTUVGJVXXWPFÒDGTUVGNNVFCURGTUQPKHK\KGTVG5[TKGPCPFKGRGTUQPKHK\KGTVG)QNFGPG2HQTVGKO *KPVGTITWPF FKG (CJPGP FGT XKGT DGVGKNKIVGP GWTQR·KUEJGP /·EJVG 4W­NCPF 2TGW­GP ¤UVGTTGKEJ WPF   )TQ­DTKVCPPKGP-TCP\ DGUVGJGPF CWU .QTDGGT WPF 'KEJGP\YGKIGP FCTCWH NKGIGP FKG XKGT IGMTÌPVGP   9CRRGPFGTDGVGKNKIVGP/·EJVGOOI&KCMQXp5NI/QPVGPWQXQ  44(CUV5VGORGNINCP\ 

0CEJ FGO 'PFG FGT TC 0CRQNGQP XGTUWEJVG FGT 2CUEJC XQP I[RVGP UKEJ PGDGP FGO 1UOCPKUEJGP 4GKEJ CNU   MQPMWTTKGTGPFG/CEJVKOÌUVNKEJGP/KVVGNOGGTTCWO\WGVCDNKGTGPIGNCPIKJOFKG'TQDGTWPI5[TKGPUWPFDKU  GTTCPI GT YGKVGTG OKNKV·TKUEJG 'THQNIG ÒDGT FKG 6ÒTMGP 7O FGP HTCP\ÌUKUEJGP 'KPHNW­ KP FGT .GXCPVG   \WTÒEM\WFT·PIGP XGTDCPFGP UKEJ 4W­NCPF ¤UVGTTGKEJ7PICTP )TQ­DTKVCPPKGP WPF 2TGW­GP \WT 3WCFTWRGNCNNKCP\   WPF GKNVGP FGO 5WNVCP \W *KNHG /KV FGT XGTGKPKIVGP ÌUVGTTGKEJKUEJGP (NQVVG WPF OKV *KNHG GKPGU 8QNMUCWHUVCPFU   MQPPVG FGT 2CUEJC XGTVTKGDGP WPF 5[TKGP FCU FCOCNU CWEJ FGP .KDCPQP WOHC­VG YKGFGTFGO1UOCPKUEJGP4GKEJ GKPXGTNGKDVYGTFGP

89


ALEXANDER II.

7426

7427

<#4#.':#0&'4++ )QNFOÃ&#x2019;P\GPFGU<CTGP#NGZCPFGT++ 

4WDGN5V2GVGTUDWTII$KVMKP(D5EJN  )1.&5GNVGPGT,CJTICPI8QT\Ã&#x2019;INKEJ





4WDGN5V2GVGTUDWTII$KVMKP(D5EJN  )1.&5GNVGPGT,CJTICPI8QT\Ã&#x2019;INKEJ



7428

1,5:1

1,5:1



4WDGN5V2GVGTUDWTII$KVMKP(D5EJN  )1.&5GNVGPKPFKGUGT'TJCNVWPI8QT\Ã&#x2019;INKEJp5VGORGNINCP\



7429

1,5:1



1,5:1

4WDGN5V2GVGTUDWTII$KVMKP(D5EJN  )1.&2TCEJVGZGORNCT5VGORGNINCP\

7430



7431



4WDGN5V2GVGTUDWTII$KVMKP(D5EJN  )1.&#VVTCMVKXGUXQT\Ã&#x2019;INKEJGU'ZGORNCT





4WDGN5V2GVGTUDWTII$KVMKP(D5EJN  )1.&-N&TWEMUVGNNGHCUVXQT\Ã&#x2019;INKEJ



90


ALEXANDER II.

7432 1,5:1



1,5:1

4WDGN5V2GVGTUDWTII(GKPIQNF$KVMKP 4 (D5EJN  )1.&44#VVTCMVKXGUXQT\Ã&#x2019;INKEJGU'ZGORNCTOKVJÃ&#x2019;DUEJGT2CVKPC

7433

7435

7434



7436



4WDGN5V2GVGTUDWTII$KVMKP(D5EJN

)1.&8QT\Ã&#x2019;INKEJ





4WDGN5V2GVGTUDWTII$KVMKP(D5EJN  )1.&5GNVGPGT,CJTICPI8QT\Ã&#x2019;INKEJ





4WDGN5V2GVGTUDWTII$KVMKP(D5EJN

)1.&(CUVXQT\Ã&#x2019;INKEJ





4WDGN5V2GVGTUDWTII$KVMKP(D5EJN

)1.&8QT\Ã&#x2019;INKEJ



7439 7438

7437



4WDGN5V2GVGTUDWTII$KVMKP(D5EJN

)1.&8QT\Ã&#x2019;INKEJ





4WDGN5V2GVGTUDWTII$KVMKP(D5EJN  )1.&9KP\4CPFHGJNGTXQT\Ã&#x2019;INKEJ





4WDGN5V2GVGTUDWTII$KVMKP 4 (D5EJN  )1.&49KP\4CPFHGJNGTXQT\Ã&#x2019;INKEJ



7440 1,5:1



1,5:1

4WDGN5V2GVGTUDWTII$KVMKP(D5EJN  )1.&5GNVGPKPFKGUGT'TJCNVWPI8QT\Ã&#x2019;INKEJCWURQNKGTVGT2NCVVG

 91


ALEXANDER II.

7441

7442

1,5:1

5KNDGTOÒP\GPFGU<CTGP#NGZCPFGT++ 

4WDGN5V2GVGTUDWTII$KVMKP&CX FQTVWPVGT0KMQNCWU+   2TCEJVGZGORNCT*GTTNKEJG2CVKPCXQT\ÒINKEJp5VGORGNINCP\





4WDGN5V2GVGTUDWTII$KVMKP 4 &CX FQTVWPVGT0KMQNCWU+   5GNVGPDGUQPFGTUKPFKGUGT'TJCNVWPI'TUVCDUEJNCIXQT\ÒINKEJp5VGORGNINCP\



7443

7444

7445



4WDGN 2QNVKPC 5V2GVGTUDWTII$KVMKP  2TCEJVGZGORNCT*GTTNKEJG2CVKPCHCUV5VGORGNINCP\



 

4WDGN 2QNVKPC 5V2GVGTUDWTII$KVMKP 4WDGN 2QNVKPC 5V2GVGTUDWTII$KVMKP

*ÒDUEJG2CVKPCXQT\ÒINKEJ 8QT\ÒINKEJp5VGORGNINCP\

 



-QRGMGP5V2GVGTUDWTIIWPFI$KVMKP  5VÒEM(CUVXQT\ÒINKEJWPFXQT\ÒINKEJ





-QRGMGP5V2GVGTUDWTIIWPFI$KVMKP  5VÒEM4CPFHGJNGTUGJTUEJÌPpXQT\ÒINKEJWPFXQT\ÒINKEJ



7449

   92

7448

-QRGMGP5V2GVGTUDWTII$KVMKP -QRGMGP5V2GVGTUDWTII$KVMKP -QRGMGP5V2GVGTUDWTII$KVMKP 4 

7450

(GKPG2CVKPCXQT\ÒINKEJp5VGORGNINCP\ 8QT\ÒINKEJ 45GJTUEJÌPpXQT\ÒINKEJ

  


ALEXANDER II.

7451

7452

7453



4WDGN5V2GVGTUDWTII$KVMKP 4 &CX  5GNVGPGT,CJTICPI-TCV\GTKO(GNFFGT8QTFGTUGKVGUGJTUEJÌP



4WDGN5V2GVGTUDWTII$KVMKP&CX

5GNVGPGT,CJTICPI8QT\ÒINKEJ





4WDGN5V2GVGTUDWTII$KVMKP&CX

5GJTUEJÌPpXQT\ÒINKEJ



7454



7455



4WDGN5V2GVGTUDWTII$KVMKP&CX

9KP\5VGORGNHGJNGTCO4CPFXQT\ÒINKEJ





4WDGN5V2GVGTUDWTII$KVMKP&CX

8QT\ÒINKEJ



7456

7457

7458

7459



4WDGN 2QNVKPC 5V2GVGTUDWTII$KVMKP 4 

 4(GKPG2CVKPCUGJTUEJÌPpXQT\ÒINKEJ





-QRGMGP5V2GVGTUDWTII$KVMKP 4 

48QT\ÒINKEJ





-QRGMGP5V2GVGTUDWTI+P752NCUVKMJQNFGTFGT0)%OKVFGT$GYGTVWPI/5$KVMKP 4  5GNVGPDGUQPFGTUKPFKGUGT'TJCNVWPI(CUV5VGORGNINCP\



-QRGMGP5V2GVGTUDWTIIWPFI$KVMKP  5VÒEM-N4CPFHGJNGTXQT\ÒINKEJWPFXQT\ÒINKEJ

  93


ALEXANDER II.

7460

1,5:1



1,5:1

-QRGMGP5V2GVGTUDWTII$KVMKP 4   4*GTTNKEJG2CVKPCXQT\ÒINKEJp5VGORGNINCP\CWURQNKGTVGT2NCVVG

7462

7461



7463



-QRGMGP5V2GVGTUDWTII$KVMKP



-QRGMGP5V2GVGTUDWTII$KVMKP

(CUVXQT\ÒINKEJ





-QRGMGP5V2GVGTUDWTII$KVMKP

(CUV5VGORGNINCP\





-QRGMGP5V2GVGTUDWTII$KVMKP

8QT\ÒINKEJ



-QRGMGP5V2GVGTUDWTII$KVMKP  5GNVGPDGUQPFGTUKPFKGUGT'TJCNVWPI2TCEJVGZGORNCT5VGORGNINCP\



7465

1,5:1



7466

8QT\ÒINKEJ

7467



1,5:1

7468

7469



-QRGMGP5V2GVGTUDWTII$KVMKP

2TCEJVGZGORNCT5VGORGNINCP\





-QRGMGP5V2GVGTUDWTII$KVMKP

2TCEJVGZGORNCT5VGORGNINCP\





-QRGMGP5V2GVGTUDWTII$KVMKP

2TCEJVGZGORNCT5VGORGNINCP\





-QRGMGP5V2GVGTUDWTII$KVMKP

8QT\ÒINKEJp5VGORGNINCP\



7470

7471

7470

2T·IWPIGPHÒT2QNGP 

-QRGMGP9CTUEJCWHÒT2QNGPI$KVMKP 4 

44*ÒDUEJG2CVKPCUGJTUEJÌP





-QRGMGP9CTUEJCWHÒT2QNGPI$KVMKP 4   44*ÒDUEJG2CVKPCYKP\-TCV\GTUGJTUEJÌP



94


ALEXANDER II.

7473

7472

-WRHGTOÒP\GPFGU<CTGP#NGZCPFGT++ 

-W-QRGMGP'MCVGTKPDWTII$KVMKP



-W-QRGMGP9CTUEJCWI$KVMKP

7474

(GKPG5VGORGNHGJNGTXQT\ÒINKEJ



5GJTUEJÌP



7475



-W-QRGMG9CTUEJCWI$KVMKP

#VVTCMVKXGUXQT\ÒINKEJGU'ZGORNCTOKVHGKPGT2CVKPC





-W-QRGMG9CTUEJCWI$KVMKP

5GJTUEJÌP



-W&GPG\JMC9CTUEJCWI$KVMKP  5GNVGPKPFKGUGT'TJCNVWPI2TCEJVGZGORNCT(CUV5VGORGNINCP\



7476

1,5:1



1,5:1

7477

7478



-W&GPG\JMC9CTUEJCWI$KVMKP



-W-QRGMG5V2GVGTUDWTII$KVMKP 4 

7479

7477

9KP\&TWEMUVGNNGUGJTUEJÌP



45GJTUEJÌPpXQT\ÒINKEJ



7480

)GFGPMOÒP\GPFGU<CTGP#NGZCPFGT++ 

4WDGN5V2GVGTUDWTI&GPMOCNHÒT0KMQNCWU+I$KVMKP&CX  5GJTUEJÌPpXQT\ÒINKEJ





4WDGN5V2GVGTUDWTI&GPMOCNHÒT0KMQNCWU+I$KVMKP&CX  -N-TCV\GTUGJTUEJÌP

 95


ALEXANDER II.

7481

1,5:1

1,5:1

'KPG2TQDGRT·IWPIFGT/ÒP\UV·VVG$TÒUUGN 

 -QRGMGP  '/ $TÒUUGN 0QXQFGN FGT 2TQDG KP -WRHGT0KEMGN<KPP  I -GJTRT·IWPI OKV   INCVVGO4CPF$KVMKP* 4  8QPITQ­GT5GNVGPJGKV2TCEJVGZGORNCT5VGORGNINCP\ 

7483

7482

2T·IWPIGPHÒT(KPPNCPF 

/CTMMCC*GNUKPMKHÒT(KPPNCPFI$KVMKP(D FQTVWPVGT(KPPNCPF 5EJN FQTV WPVGT(KPPNCPF  )1.&8QT\ÒINKEJp5VGORGNINCP\





/CTMMCC*GNUKPMKHÒT(KPPNCPFI$KVMKP 4 (D FQTVWPVGT(KPPNCPF 5EJN

FQTVWPVGT(KPPNCPF  )1.&48QT\ÒINKEJ



7484

/GFCKNNGPFGU<CTGP#NGZCPFGT++ 

5KNDGTLGVQP  WPUKIPKGTV CWH UGKPG -TÌPWPI KP /QUMCW )GMTÌPVGU /QPQITCOO<YGK <GKNGP   5EJTKHVQDGP-TQPGWPVGP,CJTGU\CJNOOI&KCMQX  2TCEJVXQNNG2CVKPCXQT\ÒINKEJp5VGORGNINCP\



7485



96

5KNDGTOGFCKNNGQ,XQP2/GUEJGT[CMQX2T·OKGFGT/·FEJGPUEJWNGHÒTIWVGU$GPGJOGPWPFUEJWNK UEJGP (QTVUEJTKVV $TWUVDKNF FGT <CTKP /CTKC #NGZCPFTQYPC T/KPGTXC OKV .QTDGGTMTCP\ KP FGT   4GEJVGPWPF¤NNCORGKPFGTGTJQDGPGP.KPMGPUVGJVXXWOIGDGPXQP#VVTKDWVGPFGT9KUUGPUEJCHVGP FKGCWHFGO$QFGPNKGIGPOOI&KCMQX 4  *ÒDUEJG2CVKPCXQT\ÒINKEJ




ALEXANDER II.

7486



<KPPOGFCKNNGXQP0-Q\KPWPF8#NGZGGXCWHFKG'KPYGKJWPIFGT5V+UCCMU-CVJGFTCNGKP5V 2GVGTUDWTI/GFCKNNQPFCTKPFCUIGJCTPKUEJVG$TWUVDKNF2GVGTU+TOKV.QTDGGTMTCP\WPFWOIGNGIVGO /CPVGN WOJGT HÒPH YGKVGTG /GFCKNNQPU OKV FGP $TWUVDKNFGTP D\Y $ÒUVGP XQP -CVJCTKPC ++ 2CWN +   #NGZCPFGT + 0KMQNCWU + WPF #NGZCPFGT ++ FC\YKUEJGP .QTDGGT WPF 'KEJGP\YGKIG#PUKEJV FGT   -CVJGFTCNGOOI&KCMQX 8QT\ÒINKEJ

7487



1,5:1



7487

5KNDGTOGFCKNNG Q , WO   WPUKIPKGTV IGHGTVKIV \W 'JTGP FGU <CTGP $TWUVDKNF HCUV X X<GRVGT   \YKUEJGP\YGKJTGPOOI&KCMQX 4  2TCEJVGZGORNCT(CUV5VGORGNINCP\



7488



$TQP\GOGFCKNNQPXQP/-WEJMKPWPF80KMQPQXCWHFCUL·JTKIG$GUVGJGPFGT/KEJCKNQYUMK #TVKNNGTKGCMCFGOKG WPF UEJWNG KP 5V 2GVGTUDWTI $ÒUVG T7PKHQTOKGTVGU $TWUVDKNF FGU 'TDCWGTU   )TQ­HÒTUV /KEJCGN 2CYNQYKVUEJ N FCTÒDGT UVTCJNGPFGU /GFCKNNQP OKV FGO IGMTÌPVGP /QPQITCOO   UGKPGU$TWFGTUFGU<CTGP#NGZCPFGTU+OOI&KCMQX 8QT\ÒINKEJ

 97


ALEXANDER III.

7489



5KNDGTOGFCKNNQP Q , WPUKIPKGTV 2TGKUOGFCKNNG HÒT 2HGTFG\WEJV )GMTÌPVGU /QPQITCOO)GMTÌPVGT   &QRRGNCFNGTOKV<GRVGTWPF4GKEJUCRHGNKPFGP(·PIGPCWHFGT$TWUV5V)GQTIUUEJKNFWOJGT1TFGPU MGVVGCWHFGP(NÒIGNPLGXKGTYGKVGTGMNGKPGTG9CRRGPUEJKNFG/KVFTGKTWUUKUEJGP4CPFRWP\GP#FNGT #%WPFOOI&KCMQXp XIN   8QPITQ­GT5GNVGPJGKV-N4CPFHGJNGTMN-TCV\GTUGJTUEJÌP 

7490



$TQP\GOGFCKNNGXQP8#NGZGGXCWHFGP)GDWTVUVCIXQP#NGZCPFGT+$ÒUVGTOKV.QTDGGT MTCP\(ÒPH<GKNGP5EJTKHVWOJGT8GT\KGTWPIGPOOI&KCMQX  8QT\ÒINKEJ



7491 1,5:1

1,5:1

<#4#.':#0&'4+++ )QNFOÒP\GPFGU<CTGP#NGZCPFGT+++  98

#NGZCPFGT+++4WDGN5V2GVGTUDWTII$KVMKP(D5EJN  )1.&5GNVGPGT,CJTICPI8QT\ÒINKEJp5VGORGNINCP\




ALEXANDER III.

7492 1,5:1



1,5:1

4WDGN5V2GVGTUDWTII$KVMKP(D5EJN  )1.&5GNVGPGT,CJTICPI9KP\4CPFHGJNGTXQT\ÒINKEJ



7493

2:1



2:1

4WDGN5V2GVGTUDWTI+P752NCUVKMJQNFGTFGT2%)5OKVFGT$GYGTVWPI/5$KVMKP 4  (D5EJN )1.&5GJTUGNVGPDGUQPFGTUKPFKGUGT'TJCNVWPI2TCEJVGZGORNCT 8QT\ÒINKEJp5VGORGNINCP\ 

7494

2:1



2:1

 4WDGN  5V 2GVGTUDWTI  I $ÒUVG T)GMTÌPVGT &QRRGNCFNGT OKV <GRVGT WPF 4GKEJUCRHGN   KPFGP(·PIGPQDGP-TQPGFCTWPVGT0QOKPCNCPICDGWPF,CJTGU\CJN$KVMKP 4 (D5EJN )1.&48QT\ÒINKEJ 

7495 1,5:1



1,5:1

4WDGN5V2GVGTUDWTII$KVMKP(D5EJN  )1.&440WT'ZGORNCTGIGRT·IV*ÒDUEJG2CVKPCUGJTUEJÌPpXQT\ÒINKEJXQT\ÒINKEJ

 99


ALEXANDER III.

7496

7497

7499

7498



4WDGN5V2GVGTUDWTII$KVMKP(D5EJN  )1.&9KP\4CPFHGJNGTXQT\ÒINKEJ



 

4WDGN5V2GVGTUDWTII$KVMKP(D5EJN 4WDGN5V2GVGTUDWTII$KVMKP(D5EJN

)1.&(CUVXQT\ÒINKEJ )1.&5GJTUEJÌPpXQT\ÒINKEJ

 



4WDGN5V2GVGTUDWTII$KVMKP(D5EJN  )1.&9KP\4CPFHGJNGT8QT\ÒINKEJ



7500

7501



4WDGN5V2GVGTUDWTII$KVMKP(D5EJN

)1.&5GJTUEJÌPpXQT\ÒINKEJ





4WDGN5V2GVGTUDWTII$KVMKP(D5EJN  )1.&-N4CPFHGJNGTUGJTUEJÌPpXQT\ÒINKEJ



7502

7503

7504



4WDGN5V2GVGTUDWTII$KVMKP(D5EJN  )1.&-N4CPFHGJNGTHCUVXQT\ÒINKEJ



 

4WDGN5V2GVGTUDWTII$KVMKP(D5EJN 4WDGN5V2GVGTUDWTII$KVMKP(D5EJN

 

)1.&5GJTUEJÌPpXQT\ÒINKEJ )1.&(CUVXQT\ÒINKEJ

7506

7505

  100

5KNDGTOÒP\GPFGU<CTGP#NGZCPFGT+++

4WDGN5V2GVGTUDWTII$KVMKP&CX FQTVWPVGT#NGZCPFGT++ 

7505

8QT\ÒINKEJ



-QRGMGP5V2GVGTUDWTII$KVMKP 4   440WT'ZGORNCTGIGRT·IV8QT\ÒINKEJ




ALEXANDER III.

7507

7508



4WDGN  5V 2GVGTUDWTI +P 752NCUVKMJQNFGT FGT 0)% OKV FGT $GYGTVWPI /5  $KVMKP    &CX 8QT\ÒINKEJ





4WDGN5V2GVGTUDWTII$KVMKP&CX



-N4CPFHGJNGTUGJTUEJÌP

7509

7510



4WDGN5V2GVGTUDWTII$KVMKP&CX

-N4CPFHGJNGTUGJTUEJÌP





4WDGN5V2GVGTUDWTII$KVMKP&CX

5GJTUEJÌPpXQT\ÒINKEJ



7511

7512



4WDGN5V2GVGTUDWTII$KVMKP&CX

8QT\ÒINKEJXQT\ÒINKEJp5VGORGNINCP\





4WDGN5V2GVGTUDWTII$KVMKP&CX

5GJTUEJÌP



7513

7514

7515

7516



-QRGMGP5V2GVGTUDWTII$KVMKP 4 

4*ÒDUEJG2CVKPCXQT\ÒINKEJ





-QRGMGP5V2GVGTUDWTII$KVMKP 4 

4*ÒDUEJG2CVKPCXQT\ÒINKEJ





-QRGMGP5V2GVGTUDWTII$KVMKP 4   40WT'ZGORNCTGIGRT·IV*ÒDUEJG2CVKPCUGJTUEJÌPpXQT\ÒINKEJXQT\ÒINKEJ





-QRGMGP5V2GVGTUDWTII$KVMKP



8QT\ÒINKEJp5VGORGNINCP\

101


ALEXANDER III.

7517

7518



-QRGMGP5V2GVGTUDWTII$KVMKP

8QT\ÒINKEJ





-QRGMGP5V2GVGTUDWTII$KVMKP

5GJTUEJÌPpXQT\ÒINKEJ



7519

1,5:1



1,5:1

-QRGMGP5V2GVGTUDWTII$KVMKP 4   5GNVGPDGUQPFGTUKPFKGUGT'TJCNVWPI2TCEJVGZGORNCT*GTTNKEJG2CVKPCHCUV5VGORGNINCP\

7520

7521



7522



-QRGMGP5V2GVGTUDWTII$KVMKP

2TCEJVXQNNG2CVKPCHCUV5VGORGNINCP\





-QRGMGP5V2GVGTUDWTII$KVMKP  2TCEJVGZGORNCT*GTTNKEJG2CVKPCHCUV5VGORGNINCP\





-QRGMGP5V2GVGTUDWTII$KVMKP



(CUVXQT\ÒINKEJ

7526 7523

7524



-QRGMGP5V2GVGTUDWTII$KVMKP

*ÒDUEJG2CVKPC5VGORGNINCP\





-QRGMGP5V2GVGTUDWTII$KVMKP

(GKPG2CVKPCXQT\ÒINKEJ





-QRGMGP5V2GVGTUDWTIIWPFI$KVMKP

 5VÒEM(CUV5VGORGNINCP\





-QRGMGP5V2GVGTUDWTII$KVMKP

8QT\ÒINKEJp5VGORGNINCP\





-QRGMGP5V2GVGTUDWTII$KVMKP

9KP\-TCV\GTUGJTUEJÌPpXQT\ÒINKEJ



102


ALEXANDER III.

7529

  

-WRHGTOÒP\GPFGU<CTGP#NGZCPFGT+++

-W-QRGMG5V2GVGTUDWTII$KVMKP -W-QRGMG5V2GVGTUDWTII$KVMKP 4  -W-QRGMG5V2GVGTUDWTII$KVMKP

7531



7530

7528

(CUV5VGORGNINCP\ 445GJTUEJÌPpXQT\ÒINKEJ 8QT\ÒINKEJp5VGORGNINCP\

  

7533

7532

)GFGPMOÒP\GPFGU<CTGP#NGZCPFGT+++

4WDGN5V2GVGTUDWTICWHUGKPG-TÌPWPII$KVMKP&CX

(CUVXQT\ÒINKEJ





4WDGN5V2GVGTUDWTICWHUGKPG-TÌPWPII$KVMKP&CX  9KP\4CPFHGJNGTHCUVXQT\ÒINKEJ





4WDGN5V2GVGTUDWTICWHUGKPG-TÌPWPII$KVMKP&CX



7534

7535

5GJTUEJÌPpXQT\ÒINKEJ

7536

2T·IWPIGPHÒT(KPPNCPF 

/CTMMCC*GNUKPMKHÒT(KPPNCPFI$KVMKP 4 (D FQTVWPVGT(KPPNCPF 5EJN

FQTVWPVGT(KPPNCPF  )1.&48QT\ÒINKEJ





/CTMMCC*GNUKPMKHÒT(KPPNCPFI$KVMKP(D FQTVWPVGT(KPPNCPF 5EJN FQTV WPVGT(KPPNCPF  )1.&8QT\ÒINKEJ





/CTMMCC*GNUKPMKHÒT(KPPNCPFI$KVMKP(D FQTVWPVGT(KPPNCPF 5EJN FQTV WPVGT(KPPNCPF  )1.&8QT\ÒINKEJ



7538

 

7537

(GKPIGYKEJVUDCTTGPFGT/ÒP\UV·VVG5V2GVGTUDWTI

<QNQVPKMUQ,5V2GVGTUDWTII$KVMKP 4  <QNQVPKMQ,5V2GVGTUDWTII$KVMKP

7538

-N4CPFHGJNGTUGJTUEJÌP 5GJTUEJÌPpXQT\ÒINKEJ

  103


ALEXANDER III.

7539

/GFCKNNGPFGU<CTGP#NGZCPFGT+++ 

6TCIDCTG UKNDGTPG 8GTFKGPUVOGFCKNNG Q , XQP # )TKNKEJGU $ÒUVG T5EJPWTMTGKU WOJGT 5EJTKHV KP   XKGTHCEJGO.KPKGPMTGKUOOI&KCMQX FQTVQJPG6TCIGÌUG4   8QPITQ­GT5GNVGPJGKVªDGTCTDGKVGVUGJTUEJÌP



7540

7541





7541

)QNFOGFCKNNGQ,WPUKIPKGTVXQP/5MWFPQX2T·OKGFGT/·FEJGPUEJWNGHÒTFGPGTHQNITGKEJGP#D UEJNW­ $TWUVDKNFFGT<CTKP/CTKC(GQFQTQYPCT5GEJU<GKNGP5EJTKHVCWH5VTCJNGPWOJGT-TCP\CWU 9GKPTGDGPOOI&KCMQX 4  )1.&4CPFHGJNGTXQT\ÒINKEJ 5KNDGTOGFCKNNG Q , WPUKIPKGTV 2T·OKG FGT /·FEJGPUEJWNG HÒT FGP GTHQNITGKEJGP #DUEJNW­ $TWUVDKNF   FGT <CTKP /CTKC (GQFQTQYPC T OKV WOIGNGIVGO /CPVGN5GEJU <GKNGP 5EJTKHV XQT 5QPPGPUVTCJNGP   WOJGT(TÒEJVGMTCP\OOI&KCMQX# 4   8QPITQ­GT5GNVGPJGKV+O'VWKXQT\ÒINKEJp5VGORGNINCP\





7542

 104

5KNDGTOGFCKNNG Q , WPUKIPKGTV 2T·OKG FGT /·FEJGPUEJWNG HÒT FGP GTHQNITGKEJGP #DUEJNW­ $TWUVDKNF   FGT <CTKP /CTKC (GQFQTQYPC T OKV WOIGNGIVGO /CPVGN5GEJU <GKNGP 5EJTKHV XQT 5QPPGPUVTCJNGP   WOJGT(TÒEJVGMTCP\OOI&KCMQX# 4  445GJTUEJÌPpXQT\ÒINKEJ




ALEXANDER III.

7543



$TQP\GOGFCKNNG  XQP # )TKNKEJGU LT WPF # )TKNKEJGU UT CWH FKG ,CJTHGKGT FGT TWUUKUEJGP   #TVKNNGTKG$ÒUVGNWOJGT.QTDGGTMTCP\5GEJU<GKNGP\WO6GKNIGDQIGPG5EJTKHVWOJGT'KEJGPD\Y .QTDGGT\YGKIFCTCWH\CJNTGKEJG-CPQPGPOOI&KCMQX 4   9KP\4CPFHGJNGTXQT\ÒINKEJ



7545

7544

7544



$TQP\GOGFCKNNGXQP#)TKNKEJGUCWHFKG'KPYGKJWPIFGU&GPMOCNUHÒT#NGZCPFGT++KP*GNUKPMK $ÒUVG#NGZCPFGTU++T#PUKEJVFGU&GPMOCNUOOI&KCMQX 5VGORGNINCP\



5KNDGTOGFCKNNGQ,XQP58C\JGPKPWPF#)TKNKEJGU2T·OKGFGU)CTVGPDCWXGTGKPUKP4KIC9GKDNK EJG $ÒUVG X X OKV &KCFGO FGP -QRH PCEJ N IGYCPFV)GMTÌPVGU 5VCFVYCRRGP XQP 4KIC WOJGT   (TÒEJVGMTCP\OOI&KCMQX\W 4FQTVCPFGTGT&WTEJOGUUGT   8QPITÌ­VGT5GNVGPJGKV(GKPG2CVKPCHCUVXQT\ÒINKEJ 



105


NIKOLAUS II.

7546 1,5:1

1,5:1

<#40+-1.#75++ )QNFOÒP\GPFGU<CTGP0KMQNCWU++ 

0KMQNCWU++4WDGN5V2GVGTUDWTII$KVMKP 4 (D5EJN  )1.&(CUVXQT\ÒINKEJ

7547

7548



7549



4WDGN5V2GVGTUDWTII$KVMKP 4 (D5EJN

 )1.&5GJTUEJÌPpXQT\ÒINKEJ





4WDGN5V2GVGTUDWTII$KVMKPXCT(D5EJN  )1.&8QT\ÒINKEJp5VGORGNINCP\





4WDGN5V2GVGTUDWTII$KVMKPXCT(D5EJN



1,5:1



7550

1,5:1

4WDGN5V2GVGTUDWTI+P752NCUVKMJQNFGTFGT0)%OKVFGT$GYGTVWPI/5$KVMKP(D 5EJN )1.&(CUV5VGORGNINCP\

7551



4WDGN5V2GVGTUDWTII$KVMKP 4 (D5EJN



4WDGN5V2GVGTUDWTII$KVMKP(D5EJN

106

)1.&(CUVXQT\ÒINKEJ



7552

)1.&48QT\ÒINKEJ



)1.&8QT\ÒINKEJ




NIKOLAUS II.

7554

7553

7555



4WDGN5V2GVGTUDWTII$KVMKP(D5EJN



7556

)1.&8QT\ÒINKEJ



4WDGN5V2GVGTUDWTII$KVMKP(D5EJN

 )1.&5GJTUEJÌPpXQT\ÒINKEJ





4WDGN5V2GVGTUDWTII$KVMKP(D5EJN

 )1.&5GJTUEJÌPpXQT\ÒINKEJ





4WDGN5V2GVGTUDWTII$KVMKP(D5EJN

 )1.&5GJTUEJÌPpXQT\ÒINKEJ



7558

7557

7559



4WDGN5V2GVGTUDWTII$KVMKP(D5EJN



4WDGN5V2GVGTUDWTI+P752NCUVKMJQNFGTFGT#0#OKVFGT$GYGTVWPI/5$KVMKP(D 5EJN )1.&8QT\ÒINKEJp5VGORGNINCP\





4WDGN5V2GVGTUDWTI+P752NCUVKMJQNFGTFGT0)%OKVFGT$GYGTVWPI/5$KVMKP(D 5EJN )1.&8QT\ÒINKEJp5VGORGNINCP\



7560

)1.&(CUV5VGORGNINCP\



7561

5KNDGTOÒP\GPFGU<CTGP0KMQNCWU++ 

4WDGN5V2GVGTUDWTII$KVMKP&CX  5GNVGPKPFKGUGT'TJCNVWPI*GTTNKEJG2CVKPCOKP4CPFHGJNGTHCUV5VGORGNINCP\





4WDGN5V2GVGTUDWTII$KVMKP&CX



7562

8QT\ÒINKEJp5VGORGNINCP\

7563



4WDGN5V2GVGTUDWTII$KVMKP&CX

2TCEJVXQNNG2CVKPCXQT\ÒINKEJp5VGORGNINCP\





4WDGN5V2GVGTUDWTII$KVMKP&CX

-N4CPFHGJNGTUGJTUEJÌP

 107


NIKOLAUS II.

7564

1,5:1



1,5:1

4WDGN5V2GVGTUDWTII$KVMKP 4 &CXp \W   5GJTUGNVGPKPFKGUGT'TJCNVWPI2TCEJVGZGORNCT/KP4CPFHGJNGT5VGORGNINCP\

7565



7566



4WDGN5V2GVGTUDWTII$KVMKP 4 &CXp \W   4*GTTNKEJG2CVKPCMN-TCV\GTXQT\Ã&#x2019;INKEJ





4WDGN5V2GVGTUDWTII$KVMKP&CX



*Ã&#x2019;DUEJG2CVKPCXQT\Ã&#x2019;INKEJ

7567

1,5:1

 108

1,5:1

4WDGN5V2GVGTUDWTII$KVMKP 4 &CX  5GNVGPDGUQPFGTUKPFKGUGT'TJCNVWPI2QNKGTVG2NCVVG




NIKOLAUS II.

7568

7569

7570

 

4WDGN5V2GVGTUDWTII$KVMKP 4 &CX 4WDGN5V2GVGTUDWTII$KVMKP 4 &CX

48QT\Ã&#x2019;INKEJ $GUUGTGT,CJTICPI8QT\Ã&#x2019;INKEJ



-QRGMGP5V2GVGTUDWTI+P752NCUVKMJQNFGTFGT0)%OKVFGT$GYGTVWPI/5$KVMKP (CUV5VGORGNINCP\

  

7571

1,5:1



1,5:1

-QRGMGP5V2GVGTUDWTII$KVMKP  5GJTUGNVGPKPFKGUGT'TJCNVWPI2TCEJVGZGORNCT*GTTNKEJG2CVKPCRQNKGTVG2NCVVG

7572

 



7573

-QRGMGP5V2GVGTUDWTII$KVMKP 9KP\&TWEMUVGNNGXQT\Ã&#x2019;INKEJ -QRGMGP5V2GVGTUDWTII$KVMKP 4  4*GTTNKEJG2CVKPCYKP\-TCV\GTXQT\Ã&#x2019;INKEJ

 

7574 1,5:1



-QRGMGP5V2GVGTUDWTII$KVMKP 4 

1,5:1

448QT\Ã&#x2019;INKEJp5VGORGNINCP\

 109


NIKOLAUS II.

7576

7577

7578

7575

7579



-QRGMGP5V2GVGTUDWTI+P752NCUVKMJQNFGTFGT0)%OKVFGT$GYGTVWPI/5$KVMKP 4  45VGORGNINCP\



   

-QRGMGP5V2GVGTUDWTII$KVMKP\W -QRGMGP5V2GVGTUDWTII$KVMKP -QRGMGP5V2GVGTUDWTII$KVMKP -QRGMGP5V2GVGTUDWTII$KVMKP

2QNKGTVG2NCVVGOKPDGTÃ&#x2019;JTV 5VGORGNINCP\ 8QT\Ã&#x2019;INKEJ 8QT\Ã&#x2019;INKEJ

   

*Ã&#x2019;DUEJG2CVKPCXQT\Ã&#x2019;INKEJ



7580



-QRGMGP2CTKUI$KVMKP

7582

7583

7581

7581

-WRHGTOÃ&#x2019;P\GPFGU<CTGP0KMQNCWU++ 

-W -QRGMGP  5V 2GVGTUDWTI +P 752NCUVKMJQNFGT FGT 0)% OKV FGT $GYGTVWPI /5  4$   $KVMKP 2TCEJVGZGORNCT(CUV5VGORGNINCP\





-W -QRGMGP  5V 2GVGTUDWTI +P 752NCUVKMJQNFGT FGT 0)% OKV FGT $GYGTVWPI /5  4$   $KVMKP 8QT\Ã&#x2019;INKEJp5VGORGNINCP\





-W-QRGMG5V2GVGTUDWTI+P752NCUVKMJQNFGTFGT0)%OKVFGT$GYGTVWPI/54$$KVMKP 5VGORGNINCP\



7584

   110

7585

7586

-W-QRGMG5V2GVGTUDWTII$KVMKP 4  48QT\Ã&#x2019;INKEJ -W-QRGMG5V2GVGTUDWTII$KVMKP 2TCEJVGZGORNCT(GKPG2CVKPC5VGORGNINCP\ -W-QRGMG5V2GVGTUDWTII$KVMKP (CUV5VGORGNINCP\

  


NIKOLAUS II.

2:1

7587

'KP4WDGN5VÒEMFGU<CTGP0KMQNCWU++CWUFGT/ÒP\UV·VVG5V2GVGTUDWTI 

4WDGN (TCPMGP 5V2GVGTUDWTII-QRHT)GMTÌPVGT&QRRGNCFGTOKV<GRVGT WPF4GKEJUCRHGNKPFGP(·PIGPCWHFGT$TWUV5V)GQTIUUEJKNFWOJGTFKG-GVVGFGU#PFTGCUQTFGPUCWH FGP(NÒIGNPLGXKGTYGKVGTG9CRRGPUEJKNFGQDGP-TQPG$KVMKP 4 (D5EJN  )1.&8QPITQ­GT5GNVGPJGKV0WT'ZGORNCTGIGRT·IV 9KP\4CPFHGJNGTXQT\ÒINKEJp5VGORGNINCP\  0KMQNCWU++#NGZCPFTQYKVUEJHÒJTVG\WP·EJUVFCUCWVQMTCVKUEJG4GIKOGPVUGKPGU8CVGTU#NGZCPFGT+++HQTVDKUKJP FKGY·JTGPFFGUTWUUKUEJLCRCPKUEJGP-TKGIGUCWUIGDTQEJGPG4GXQNWVKQP\WGKPUEJPGKFGPFGP4GHQTOGP\YCPI 'T IGY·JTVG UGKPGO 8QNM YGUGPVNKEJG )TWPFTGEJVG FCU CNNIGOGKPG 9CJNTGEJV WPF TKGH GKPG IGUGV\IGDGPFG   8QNMUXGTVTGVWPI &WOC KPU.GDGP#W­GPRQNKVKUEJUVTGDVGGTPCEJFGT'TJCNVWPIFGUTWUUKUEJGP'KPHNWUUGUCWHFGO $CNMCP\ÌIGTVGPKEJVXQTFGO'KPVTKVVKPFGP'TUVGP9GNVMTKGIWPFÒDGTPCJORGTUÌPNKEJFGP1DGTDGHGJN0CEJFGO #WUDTWEJFGT4GXQNWVKQPFCPMVGFGTNGV\VGTWUUKUEJG<CTCO/·T\CWH&TWEMFGT)GPGTCNKV·VCD'TYWTFG \WUCOOGPOKVUGKPGT)GOCJNKP#NGZCPFTCXQP*GUUGPFGO6JTQPHQNIGTWPFFGPXKGT6ÌEJVGTPKO,WNKKPFGT UKDKTKUEJGP8GTDCPPWPIGTOQTFGV  &CUJKGT\WT8GTUVGKIGTWPIIGNCPIGPFG4WDGN5VÒEMFCUKPPWT'ZGORNCTGPIGRT·IVYWTFG\·JNV\WFGP DGMCPPVGUVGP WPF DGIGJTVGUVGP TWUUKUEJGP /ÒP\GP &KG /ÒP\G KUV OKV  I 4CWJIGYKEJV WPF  I   (GKPIGYKEJVPCEJFGO5VCPFCTFFGTUQIGPCPPVGP.CVGKPKUEJGP/ÒP\WPKQPCWUIGDTCEJV&KGUG9·JTWPIUWPKQPOKV FGO HTCP\ÌUKUEJGP (TCPMGP CNU )TWPFNCIG YCT CWH +PKVKCVKXG 0CRQNGQPU +++  XQP (TCPMTGKEJ $GNIKGP +VCNKGP   WPFFGT5EJYGK\ $GKVTKVV)TKGEJGPNCPFU DGUEJNQUUGPYQTFGP&KG-WTCPVOÒP\GPFKGUGT&QRRGNY·JTWPIFCU IQNFGPG(TCPMGP5VÒEMWPFFCUUKNDGTPG(TCPMGP5VÒEMYCTGPKPCNNGP5VCCVGPIÒNVKI&CUITÌ­VG0QOKPCNFGT /ÒP\WPKQPYCTFCU(TCPMGP5VÒEMFCUPWTKP(TCPMTGKEJKPITÌ­GTGP/GPIGPIGRT·IVYWTFG0KMQNCWU++NKG­  GDGPHCNNU GKPG UQNEJG TGRT·UGPVCVKXG )QNFOÒP\G \W  (TCPMGP D\Y   4WDGN RT·IGP FKG CP JQJG   9ÒTFGPVT·IGTXGTVGKNVYWTFG9KTHTGWGPWPU+JPGPFKGUGDGTÒJOVG4CTKV·VFGTTWUUKUEJGP/ÒP\IGUEJKEJVGCPDKGVGP \WMÌPPGPFKGCWEJFKG8GTDKPFWPIGP4W­NCPFUOKVFGT(TCP\ÌUKUEJGP4GRWDNKMFQMWOGPVKGTV

111


NIKOLAUS II.

7588

1,5:1

1,5:1

)GFGPMOÒP\GPFGU<CTGP0KMQNCWU++ 

4WDGN5V2GVGTUDWTICWHUGKPG-TÌPWPII$KVMKP&CX  -CDKPGVVUVÒEM*GTTNKEJG2CVKPCHGKPUVGT5VGORGNINCP\

7589



7589

1,5:1

4WDGN5V2GVGTUDWTICWHUGKPG-TÌPWPII$KVMKP&CX  2TCEJVXQNNG2CVKPC'TUVCDUEJNCI5VGORGNINCP\

7590

7591



7592



4WDGN5V2GVGTUDWTICWHUGKPG-TÌPWPII$KVMKP&CX  2TCEJVXQNNG2CVKPCYKP\5EJTÌVNKPIUHGJNGTHCUV5VGORGNINCP\

 

4WDGN5V2GVGTUDWTICWHUGKPG-TÌPWPII$KVMKP&CX 4WDGN5V2GVGTUDWTICWHUGKPG-TÌPWPII$KVMKP&CX

112



8QT\ÒINKEJ (CUVXQT\ÒINKEJ

  


NIKOLAUS II.

7593

7594



4WDGN5V2GVGTUDWTI&GPMOCNHÒT#NGZCPFGT++I$KVMKP 4 &CX

 48QT\ÒINKEJ





4WDGN5V2GVGTUDWTI&GPMOCNHÒT#NGZCPFGT++I$KVMKP 4 &CX  4-N4CPFHGJNGTUGJTUEJÌPpXQT\ÒINKEJ



7595

7595

1,5:1



4WDGN  5V 2GVGTUDWTI CWH FKG ,CJTHGKGT FGU 5KGIGU ÒDGT 0CRQN¾QP  I $KVMKP    &CX 8QT\ÒINKEJp5VGORGNINCP\ 

7596

7597



4WDGN  5V 2GVGTUDWTI CWH FKG ,CJTHGKGT FGU 5KGIGU ÒDGT 0CRQN¾QP  I $KVMKP    &CX 8QT\ÒINKEJ





4WDGN  5V 2GVGTUDWTI CWH FKG ,CJTHGKGT FGU 5KGIGU ÒDGT 0CRQN¾QP  I $KVMKP    &CX (GKPG2CVKPCXQT\ÒINKEJ



7598

7599



4WDGN  5V 2GVGTUDWTI CWH FKG ,CJTHGKGT FGU 5KGIGU ÒDGT 0CRQN¾QP  I $KVMKP    &CX 2TCEJVXQNNG2CVKPCXQT\ÒINKEJ





4WDGN5V2GVGTUDWTICWHFKG,CJTHGKGTFGT4QOCPQX&[PCUVKGI$KVMKP&CX (CUV5VGORGNINCP\

 113


NIKOLAUS II.

7600

7601

2T·IWPIGPHÒT(KPPNCPF 

/CTMMCC*GNUKPMKHÒT(KPPNCPFI$KVMKP(D FQTVWPVGT(KPPNCPF 5EJN FQTV WPVGT(KPPNCPF  )1.&8QT\ÒINKEJ





/CTMMCC*GNUKPMKHÒT(KPPNCPFI$KVMKP(D FQTVWPVGT(KPPNCPF 5EJN FQTV WPVGT(KPPNCPF  )1.&8QT\ÒINKEJ



7603

7602



/CTMMCC*GNUKPMKHÒT(KPPNCPFI$KVMKP(D FQTVWPVGT(KPPNCPF 5EJN FQTV WPVGT(KPPNCPF  )1.&8QT\ÒINKEJp5VGORGNINCP\





/CTMMCC*GNUKPMKHÒT(KPPNCPFI$KVMKP(D FQTVWPVGT(KPPNCPF 5EJN FQTV WPVGT(KPPNCPF  )1.&(CUV5VGORGNINCP\



7604



-W2GPPK·*GNUKPMKHÒT(KPPNCPFI$KVMKP 4 

445GJTUEJÌP



7606

7605

7605

/GFCKNNGPFGU<CTGP0KMQNCWU++ 



114

6TCIDCTG UKNDGTPG 8GTFKGPUVOGFCKNNG Q , WO   WPUKIPKGTV XQP # 8CU[WVKPUM[ WPF -NGPQX   (NGK­RT·OKG HÒT -CWHNGWVG #TDGKVGT $CWGTP 7PVGTQHHK\KGTG WPF -KTEJGPRHNGIGT FKG FGT 4GIKGTWPI   &KGPUVG GTDTCEJV JCVVGP -QRH N5EJTKHV PGDGP XGTUEJNWPIGPGP .QTDGGT 2CNO WPF 'KEJGP\YGKIGP   OOI&KCMQX 4  448QT\ÒINKEJ



6TCIDCTG IQNFGPG 8GTFKGPUVOGFCKNNG Q ,   WPUKIPKGTV XQP # 8CU[WVKPUM[ (NGK­RT·OKG HÒT   -CWHNGWVG #TDGKVGT $CWGTP 7PVGTQHHK\KGTG WPF -KTEJGPRHNGIGT FKG FGT 4GIKGTWPI &KGPUVG GTDTCEJV   JCVVGP-QRHN5EJTKHVPGDGPXGTUEJNWPIGPGP.QTDGGT2CNOWPF'KEJGP\YGKIGPOOI &C\W<YGKIGHNQEJVGPGXGT\KGTVGWPFHCTDKIG5VQHHFGMQTCVKQPGP&KCMQX 4   )1.&48QT\ÒINKEJ 


NIKOLAUS II.

7607







7608

7609

5KNDGTOGFCKNNGQ, WOITCXKGTV WPUKIPKGTVXQP#8CU[WVKPUM[2T·OKGFGU(KPCP\OKPK UVGTKWOU XGTNKGJGP HÒT (NGK­ WPF 5QTIHCNV -QRH N5KGDGP <GKNGP 5EJTKHV WOJGT 'KEJGPMTCP\ /KV   4CPFITCXWTFCTKPGPVJCNVGPFKG,CJTGU\CJNOOI&KCMQX 4   449KP\4CPFHGJNGTMN(NGEMGPUGJTUEJÌPpXQT\ÒINKEJ



5KNDGTOGFCKNNGQ,WPUKIPKGTV2T·OKGHÒT8GTFKGPUVGKPFGT.CPFYKTVUEJCHV&KG-ÌRHGXQP#NGZCPFGT+++ WPF 0KMQNCWU ++ PGDGPGKPCPFGT N5GEJU <GKNGP 5EJTKHV WOJGT -TCP\ CWU $NWOGP (TÒEJVGP WPF   )GVTGKFGOOI&KCMQX 4  *GTTNKEJG2CVKPCXQT\ÒINKEJ



5KNDGTOGFCKNNGQ,WPUKIPKGTV2T·OKGHÒT8GTFKGPUVGKPFGT.CPFYKTVUEJCHV&KG-ÌRHGXQP#NGZCPFGT+++ WPF 0KMQNCWU ++ PGDGPGKPCPFGT N5GEJU <GKNGP 5EJTKHV WOJGT -TCP\ CWU $NWOGP (TÒEJVGP WPF   )GVTGKFGOOI&KCMQX 4  8QT\ÒINKEJ



7610



$TQP\GOGFCKNNG  XQP , % %JCRNCKP CWH FGP $GUWEJ FGU <CTGPRCCTGU KP (TCPMTGKEJ $TWUVDKNFGT   FGU <CTGP WPF UGKPGT )GOCJNKP #NGZCPFTC (GQFQTQYPC PGDGPGKPCPFGT T5KGDGP <GKNGP 5EJTKHV QDGP   FKG 9CRRGP XQP 4W­NCPF WPF (TCPMTGKEJ WPVGP $NÒVGP\YGKI  OO  I &KCMQX   

4  +P1TKIKPCNGVWK8QT\ÒINKEJ

 115


SOWJETUNION

7611

ex 7612

ex 7612

519,'670+10 

-QRGMGPI;GQ



-W -QRGMGP  OKV INCVVGO 4CPF  I -W -QRGMGP  OKV INCVVGO 4CPF  I   ;GQ 5VÒEM8QT\ÒINKEJp5VGORGNINCP\WPFUGJTUEJÌP

*ÒDUEJG2CVKPCXQT\ÒINKEJp5VGORGNINCP\

 

7613 1,5:1



1,5:1

-QRGMGP2TQDGKP$TQP\G#NWOKPKWOI(GFQTKP  44*GTTNKEJG2CVKPCHCUV5VGORGNINCP\



7614 1,5:1



1,5:1

-QRGMGP2TQDGKP0GWUKNDGTI7UJCMQX(GFQTKP 2 

44(CUV5VGORGNINCP\



7615 1,5:1



1,5:1

-QRGMGP2TQDGKP0GWUKNDGTI7UJCMQX(GFQTKP 2   44(GKPG2CVKPCHCUV5VGORGNINCP\



7616 1,5:1

 116

1,5:1

-QRGMGP2TQDGKP/GUUKPII7UJCMQX(GFQTKP 2   44(GKPG2CVKPCXQT\ÒINKEJp5VGORGNINCP\




SOWJETUNION

7617 1,5:1



1,5:1

-QRGMGP2TQDGKP5VCJNI7UJCMQX(GFQTKP 2   44'VYCURQTÌUGT5EJTÌVNKPI5VGORGNINCP\



7618 1,5:1



-QRGMGP2TQDGKP/GUUKPII7UJCMQX(GFQTKP 2 

1,5:1



7620

-QRGMGP2TQDGKP/GUUKPII7UJCMQX(GFQTKP 2 

1,5:1



7619

44(CUV5VGORGNINCP\

7621



1,5:1

-QRGMGP2TQDGKP/GUUKPII7UJCMQX(GFQTKP 2   442TCEJVXQNNG2CVKPCHCUV5VGORGNINCP\

1,5:1



1,5:1



1,5:1

44(CUV5VGORGNINCP\



1,5:1

-QRGMGP2TQDGKP#NWOKPKWO/CIPGUKWOI7UJCMQX(GFQTKP 2   445VGORGNINCP\

 117


SOWJETUNION

7622 1,5:1



1,5:1

-QRGMGP2TQDGKP#NWOKPKWOI7UJCMQX(GFQTKP 2 

44(CUV5VGORGNINCP\



7623 1,5:1



1,5:1

-QRGMGP2TQDGKP#NWOKPKWO/CPICP!I7UJCMQX(GFQTKP 2   44(CUV5VGORGNINCP\



7624 1,5:1



1,5:1

-QRGMGP2TQDGKP#NWOKPKWO/CIPGUKWOI7UJCMQX(GFQTKP 2   44(CUV5VGORGNINCP\

7625

7626 Pt

7627



7628 Pt



4WDGN 6UEJGTYQPG\ /QUMCWI(GKPIQNF(D5EJN



 4WDGN 2NCVKP  .GPKPITCF 1N[ORKCFG KP /QUMCW   1N[ORKC'ODNGO CWH .QTDGGTMTCP\   IHGKP(D5EJN 2.#6+05VGORGNINCP\





 4WDGN  /QUMCW 1N[ORKCFG KP /QUMCW   'TFDCNN 2CNO\YGKI WPF 1N[ORKC'ODNGO   I(GKPIQNF(D5EJN )1.&5VGORGNINCP\





4WDGN2NCVKP.GPKPITCF1N[ORKCFGKP/QUMCW&KUMWUYGTHGTIHGKP(D 5EJN 2.#6+05VGORGNINCP\



118

)1.&5VGORGNINCP\




SOWJETUNION

7629

7630



 4WDGN  .GPKPITCF 1N[ORKCFG KP /QUMCW  .GPKPUVCFKQPKP/QUMCWI(GKPIQNF (D5EJN )1.&2QNKGTVG2NCVVG





 4WDGN  .GPKPITCF 1N[ORKCFG KP /QUMCW   4WFGTUVCFKQP KP -T[NCVUMQLG  I (GKP   IQNF(D5EJN )1.&2QNKGTVG2NCVVG



7631 Pt

7632 Pt



4WDGN2NCVKP.GPKPITCF1N[ORKCFGKP/QUMCW#PVKMG4KPIM·ORHGTIHGKP(D 5EJN 2.#6+05VGORGNINCP\





4WDGN2NCVKP.GPKPITCF1N[ORKCFGKP/QUMCW#NVQN[ORKUEJGU9CIGPTGPPGPI HGKP(D5EJN 2.#6+05VGORGNINCP\



7633

7634



4WDGN.GPKPITCF1N[ORKCFGKP/QUMCW4CFUVCFKQPKP-T[NCVUMQLGI(GKPIQNF (D5EJN )1.&5VGORGNINCP\





 4WDGN  /QUMCW 1N[ORKCFG KP /QUMCW   &TWUEJDC5RQTVJCNNG KP .WUEJPKMK  I   (GKPIQNF(D5EJN )1.&5VGORGNINCP\



7635 Pt

7636

7637 Pt



 4WDGN 2NCVKP  .GPKPITCF1N[ORKCFGKP/QUMCW.·WHGTFGT#PVKMGIHGKP(D 5EJN 2.#6+05VGORGNINCP\





4WDGN/QUMCW1N[ORKCFGKP/QUMCW1N[ORKUEJG(CEMGNI(GKPIQNF(D 5EJN )1.&5VGORGNINCP\





4WDGN2NCVKP.GPKPITCF'RQUFGU)TQ­HÃ&#x2019;TUVGP+IQTIHGKP(D5EJN  2.#6+02QNKGTVG2NCVVG

 119


SOWJETUNION

7639

7640

7638

7638



4WDGN/QUMCW<NCVPKM)QNFOÃ&#x2019;P\G8NCFKOKTUI(GKPIQNF(D5EJN  )1.&2QNKGTVG2NCVVG





4WDGN/QUMCW5QRJKGP-CVJGFTCNGKP0QYIQTQFI(GKPIQNF(D5EJN  )1.&2QNKGTVG2NCVVG





4WDGN/QUMCW5QRJKGP-CVJGFTCNGKP0QYIQTQFI(GKPIQNF(D5EJN  )1.&2QNKGTVG2NCVVG



7642 Pt

7643 Pt

7641 Pd

7641



 4WDGN  .GPKPITCF 5VCPFDKNF 8NCFKOKTU FGU )TQ­JGT\QIU XQP -KGY  I HGKP (D    5EJN 2#..#&+7/2QNKGTVG2NCVVG





 4WDGN 2NCVKP  .GPKPITCF -CORH IGIGP FKG 6CTVCTGP CO (NW­ 7ITC   I HGKP   (D5EJN 2.#6+02QNKGTVG2NCVVG





 4WDGN 2NCVKP  .GPKPITCF -CORH IGIGP FKG 6CTVCTGP CO (NW­ 7ITC   I HGKP   (D5EJN 2.#6+02QNKGTVG2NCVVG



7645

7644

7645



4WDGN/QUMCW5KGIGNXQP+XCP+++XQPI(GKPIQNF(D5EJN  )1.&2QNKGTVG2NCVVG





 4WDGN  /QUMCW /CTK·*KOOGNHCJTVU-CVJGFTCNG FGU -TGON KP /QUMCW  I (GKPIQNF   (D5EJN )1.&2QNKGTVG2NCVVG



120


SOWJETUNION

7646 Pd

7647 Pd



4WDGN.GPKPITCF+XCP+++IHGKP(D5EJN

2#..#&+7/2QNKGTVG2NCVVG





4WDGN.GPKPITCF4WUUKUEJGU$CNNGVVIHGKP(D$5EJN  2#..#&+7/5VGORGNINCP\



7649 Pt

7648 Pt



4WDGN2NCVKP.GPKPITCF5EJNCEJVDGK2QNVCYCIHGKP(D5EJN  2.#6+02QNKGTVG2NCVVG





4WDGN2NCVKP.GPKPITCF5GIGNUEJKHH5V)CXTKKNWPVGT/KMJCKN5RKTKFQPQXKE)XQ\FGXI HGKP(D5EJN 2.#6+02QNKGTVG2NCVVG



7651

7650

7650



 4WDGN  /QUMCW 4GKVGTUVCPFDKNF 2GVGTU FGU )TQ­GP KP 5V 2GVGTUDWTI  I (GKPIQNF (D   5EJN )1.&2QNKGTVG2NCVVG





4WDGN/QUMCW-KTEJGXQOJGKNKIGP'T\GPIGN)CDTKGNKP/QUMCWI(GKPIQNF(D 5EJN )1.&2QNKGTVG2NCVVG



7652 Pd

7653 Pd



4WDGN.GPKPITCF2CMGVDQQV5V2GVGTWPF2QTVT·VXQP-CRKV·P8KVWU,QPCUGP$GTKPII HGKP(D5EJN 2#..#&+7/2QNKGTVG2NCVVG





4WDGN.GPKPITCF2CMGVDQQV5V2CXGNWPVGT-CRKV·P#NGMUGL+XCPQXKE%KTKMQXIHGKP (D5EJN 2#..#&+7/2QNKGTVG2NCVVG

 121


SOWJETUNION

7654 Pd

7655 Pd



4WDGN.GPKPITCF2GVGTFGT)TQ­GIHGKP(DC5EJN  2#..#&+7/2QNKGTVG2NCVVG





4WDGN.GPKPITCF4WUUKUEJGU$CNNGVVIHGKP(D$5EJN  2#..#&+7/5VGORGNINCP\



7657 Pt

7656 Pd



4WDGN.GPKPITCF4WUUKUEJGU$CNNGVVIHGKP(D$5EJNp  2#..#&+7/5VGORGNINCP\





 4WDGN 2NCVKP  .GPKPITCF $KUEJQH +PPQ\GP\ 8GPKCOKPQX  I HGKP (D  5EJN    2.#6+02QNKGTVG2NCVVG



7658 Pt

7659 Pt

7660 Pt



 4WDGN 2NCVKP  .GPKPITCF $KUEJQH +PPQ\GP\ 8GPKCOKPQX  I HGKP (D  5EJN    2.#6+02QNKGTVG2NCVVG





4WDGN2NCVKP.GPKPITCF2QTVT·VUXQP<CT#NGZCPFGT+WPF-CKUGT0CRQN¾QP+IHGKP (D5EJN 2.#6+02QNKGTVG2NCVVG





4WDGN2NCVKP.GPKPITCF2QTVT·VUXQP<CT#NGZCPFGT+WPF-CKUGT0CRQN¾QP+IHGKP (D5EJN 2.#6+02QNKGTVG2NCVVG



7662

7661

7662



4WDGN/QUMCW.GX0KMQNCGXKE)TCH6QNUVQL .GQ6QNUVQL I(GKPIQNF(D 5EJN )1.&2QNKGTVG2NCVVG





4WDGN/QUMCW5V+UCCM-CVJGFTCNGKP5V2GVGTUDWTIGTDCWVI(GKPIQNF(D 5EJN )1.&2QNKGTVG2NCVVG



122


RUSSISCHE REPUBLIK

7663 Pd

7664 Pd



 4WDGN  .GPKPITCF 5GIGNUEJKHH 'NKUCDGVJ KO *CHGP FGT &TGK/GVTQRQNKVGP$WEJV FGT +PUGN   -QFKCMIHGKP(D5EJN 2#..#&+7/2QNKGTVG2NCVVG





 4WDGN  .GPKPITCF 5GIGNUEJKHH 0KEQNCL 2QTVT·V XQP #NGMUCPFT # $CTCPQX )TÃ&#x2019;PFGT FGT   *CWRVUVCFV0QXQ#TEJCPIGN UMCWHFGT+PUGN5KVMCIHGKP(D5EJN  2#..#&+7/2QNKGTVG2NCVVG



7665 Pd

ex 7666

ex 7667 Pd



4WDGN.GPKPITCF#DUEJCHHWPIFGT.GKDGKIGPUEJCHVKP4W­NCPFFWTEJ<CT#NGZCPFGT++ CNVGT<GKVTGEJPWPIIHGKP(D5EJN 2#..#&+7/2QNKGTVG2NCVVG



/Ã&#x2019;P\UCV\  DGUVGJGPF CWU   WPF  4WDGN CNNG /Ã&#x2019;P\UV·VVG .GPKPITCF 4WUUKUEJGU $CNNGVV   +PUIGUCOVI(GKPIQNF(D$$$5EJN\W\W\W  5VÃ&#x2019;EM)1.&2QNKGTVG2NCVVG 



/Ã&#x2019;P\UCV\  DGUVGJGPF CWU   WPF  4WDGN CNNG /Ã&#x2019;P\UV·VVG .GPKPITCF 4WUUKUEJGU $CNNGVV   +PUIGUCOVIHGKP(D$$$5EJN 5VÃ&#x2019;EM2#..#&+7/5VGORGNINCP\

7668 Pt





7669

4755+5%*'4'27$.+-5'+6 

4GRWDNKMUGKV4WDGN2NCVKP5V2GVGTUDWTI5GGUEJNCEJVXQP%GUOGIGIGPFKG6Ã&#x2019;TMGP IHGKP(D5EJN 2.#6+00WTOCZKOCN'ZGORNCTGIGRT·IV2QNKGTVG2NCVVG





4WDGN/QUMCW/KMJCKN.QOQPQUQX 7PKXGTUCNIGNGJTVGT I(GKPIQNF(D 5EJN )1.&2QNKGTVG2NCVVG

 123


RUSSISCHE REPUBLIK

7670

7671 Pd

7671 Pd



4WDGN/QUMCW.CPFUKV\2CUMQX 2CUEJMQY KP/QUMCWI(GKPIQNF(D5EJN )1.&2QNKGTVG2NCVVG





4WDGN5V2GVGTUDWTI<CTKP-CVJCTKPC++PCEJGKPGO)GO·NFGXQP&.GXKVUM[IHGKP (D5EJN 2#..#&+7/2QNKGTVG2NCVVG



7672 Pt

7673 Pt



4WDGN2NCVKP5V2GVGTUDWTI+IQT(5VTCYLPUMKLIHGKP(D5EJN 2.#6+00WTOCZKOCN'ZGORNCTGIGRT·IV2QNKGTVG2NCVVG





4WDGN2NCVKP5V2GVGTUDWTI024WOLCPVUGX 0CF[G\FJCWPF0GYC I HGKP(D5EJN 2.#6+00WTOCZ'ZGORNCTGIGRT·IV2QNKGTVG2NCVVG



7674

7675



4WDGN/QUMCW5EJÃ&#x2019;V\GWPUGTG7OYGNV.KGIGPFGT$·TI(GKPIQNF(D5EJN )1.&40WT'ZGORNCTGIGRT·IV2QNKGTVG2NCVVG





4WDGN/QUMCW2QTVT·VXQP2LQVT+6UEJCKMQYUM[5\GPGCWUFGO5EJYCPGPUGG I(GKPIQNF(D5EJN )1.&2QNKGTVG2NCVVG



7676

7677 Pd

7677 Pd



 4WDGN  /QUMCW 2QTVT·V XQP 5GTIGL 9 4CEJOCPKPQX  /WUG OKV -TCP\  I   (GKPIQNF(D5EJN )1.&2QNKGTVG2NCVVG





 4WDGN  5V 2GVGTUDWTI 9GNVWOUGINWPI XQP , ( .KULCPUMKL WPF , ( -TWUGPUVGTP5EJCNWRRG 0CFG\FCIHGKP(D5EJN  2#..#&+7/0WT'ZGORNCTGIGRT·IV2QNKGTVG2NCVVG



124


RUSSISCHE REPUBLIK

7678 Pd

7679 Pd



 4WDGN  5V 2GVGTUDWTI 9GNVWOUGINWPI XQP , ( .KULCPUMKL WPF , ( -TWUGPUVGTP5EJCNWRRG 0GYCIHGKP(Dp5EJN 2#..#&+7/0WT'ZGORNCTGIGRT·IV2QNKGTVG2NCVVG





4WDGN5V2GVGTUDWTI2QTVT·VXQP/QFGUV2/WUUQTIUMKLIHGKP(D5EJN 2#..#&+7/2QNKGTVG2NCVVG



7680 Pt

ex 7681



/Ã&#x2019;P\UCV\  5V 2GVGTUDWTI DGUVGJGPF CWU   WPF  4WDGN 4WUUKUEJGU $CNNGVV +PUIGUCOV   IHGKP(D$$$5EJN  2.#6+04,GYGKNUPWT'ZGORNCTGIGRT·IV2QNKGTVG2NCVVG 



/Ã&#x2019;P\UCV\/QUMCWDGUVGJGPFCWUWPF4WDGN4WUUKUEJGU$CNNGVV+PUIGUCOVI (GKPIQNF(D$C$C$C$C5EJN 5VÃ&#x2019;EM)1.&2QNKGTVG2NCVVG

ex 7682 Pd

7683 Pt



7683 Pt



/Ã&#x2019;P\UCV\5V2GVGTUDWTIDGUVGJGPFCWUWPF4WDGN4WUUKUEJGU$CNNGVV+PUIGUCOVI HGKP(D$$$5EJN 5VÃ&#x2019;EM2#..#&+7/5VGORGNINCP\





 4WDGN 2NCVKP  5V 2GVGTUDWTI 'TUVG TWUUKUEJG 'ZRGFKVKQP KP FKG #PVCTMVKU  5EJKHHG   WPF2KPIWKPGIHGKP(D5EJN 2.#6+02QNKGTVG2NCVVG



7684 Pt

7685



4WDGN2NCVKP5V2GVGTUDWTI&GT&·OQPXQP/KMJCKN#9TWDGNIHGKP (D5EJN 2.#6+00WTOCZKOCN'ZGORNCTGIGRT·IV2QNKGTVG2NCVVG





4WDGN/QUMCW5EJÃ&#x2019;V\GWPUGTG7OYGNV.KGIGPFGT<QDGNI(GKPIQNF(D5EJN )1.&40WT'ZGORNCTGIGRT·IV2QNKGTVG2NCVVG

 125


RUSSISCHE REPUBLIK

7686

7687



 4WDGN  /QUMCW 9CUUKN[ -CPFKPUM[   I (GKPIQNF (D  5EJN    )1.&2QNKGTVG2NCVVG





4WDGN/QUMCW2QTVT·VFGT%0GNKFQYCXQP&KOKVTK)TKIQTLGUKVUEJ.GYKV\M[I (GKPIQNF(D5EJN )1.&2QNKGTVG2NCVVG



7688 Pd





7689 Pd

 4WDGN  5V 2GVGTUDWTI 'TUVG TWUUKUEJG 'ZRGFKVKQP KP FKG #PVCTMVKU  5EJCNWRRG   /KTP[WPF2QTVT·VXQP-CRKV·P/.CUCTGYIHGKP(D5EJN  2#..#&+7/2QNKGTVG2NCVVG



 4WDGN  5V 2GVGTUDWTI 'TUVG TWUUKUEJG 'ZRGFKVKQP KP FKG #PVCTMVKU  5EJCNWRRG   8QUVQMWPF2QTVT·VXQP'ZRGFKVKQPUNGKVGT)(TGKJGTTXQP$GNNKPIUJCWUGPIHGKP(D5EJN 2#..#&+7/2QNKGTVG2NCVVG



7690 Pd

ex 7691



4WDGN5V2GVGTUDWTI+MQPG&KG&TGKHCNVKIMGKVXQP#PFTGL4WDNGYWOI HGKP(D5EJN 2#..#&+7/2QNKGTVG2NCVVG





/Ã&#x2019;P\UCV\/QUMCWDGUVGJGPFCWUWPF4WDGN4WUUKUEJGU$CNNGVV+PUIGUCOVI (GKPIQNF(D$$$$5EJN FQTVHCNUEJDGUEJTKGDGP   5VÃ&#x2019;EM)1.&2QNKGTVG2NCVVG



7692 Pt

7693



4WDGN2NCVKP5V2GVGTUDWTI5EJNCEJVCO(NW­0GYCIHGKP(D5EJN 2.#6+0/CZKOCN'ZGORNCTGIGRT·IV2QNKGTVG2NCVVG





4WDGN/QUMCW#NGZCPFGT0GYUMK1TFGPI(GKPIQNF(D5EJN  )1.&2QNKGTVG2NCVVG



126


RUSSISCHE REPUBLIK

7694

7695 1:1,5

7695 1:1,5



 4WDGN  /QUMCW 'KUDTGEJGT -TCUUKP  4GVVWPI FGT 0QDKNG0QTFRQN'ZRGFKVKQP   I   (GKPIQNF(D5EJNp;GQ )1.&2QNKGTVG2NCVVG



 4WDGN  /QUMCW 6KGTYGNV  $·TGPOWVVGT OKV FTGK ,WPIGP  I (GKPUKNDGT ;GQ    2QNKGTVG2NCVVG 

7696



7697



 4WDGN  /QUMCW 'ZRGFKVKQP XQP ( 0CPUGP   I (GKPIQNF (D  5EJN p   ;GQ )1.&2QNKGTVG2NCVVG





4WDGN/QUMCW'TNÌUGTMKTEJGCPFGT0GYCI(GKPIQNF(D5EJN  )1.&2QNKGTVG2NCVVG



7699 Pd

7698 Pd

ex 7700 Pt



4WDGN5V2GVGTUDWTI(ÒTUV#NGZCPFGT0GYUMKIHGKP(D5EJN  2#..#&+7/2QNKGTVG2NCVVG





4WDGN/QUMCW4WUUKUEJGU$CNNGVVIHGKP(D$5EJN  2#..#&+7/2QNKGTVG2NCVVG





/ÒP\UCV\5V2GVGTUDWTIDGUVGJGPFCWUWPF4WDGN4WUUKUEJGU$CNNGVV&QTPTÌUEJGP +PUIGUCOVIHGKP(D$$$5EJN  5VÒEM2.#6+0,GYGKNUPWT'ZGORNCTGIGRT·IV2QNKGTVG2NCVVG

 127


RUSSISCHE REPUBLIK

ex 7701

7702



/ÒP\UCV\  /QUMCW DGUVGJGPF CWU    WPF  4WDGN 4WUUKUEJGU $CNNGVV  &QTPTÌUEJGP   +PUIGUCOVI(GKPIQNF(D$$$$5EJN  5VÒEM)1.&2QNKGTVG2NCVVG 



4WDGN/QUMCW#OWT6KIGTI(GKPIQNF(D  )1.&40WT'ZGORNCTGIGRT·IV2QNKGTVG2NCVVG

7703



ex 7704



 4WDGN  /QUMCW #OWT 6KIGT  I (GKPIQNF +P 752NCUVKMJQNFGT FGT 0)% OKV FGT $G   YGTVWPI2(7.64#%#/'1(D )1.&40WT'ZGORNCTGIGRT·IV2QNKGTVG2NCVVG 



/ÒP\UCV\/QUMCWD\Y5V2GVGTUDWTIDGUVGJGPFCWUWPF4WDGN4WUUKUEJGU$CNNGVV 0W­MPCEMGT+PUIGUCOVI(GKPIQNF(D$$$$ 5VÒEM)1.&2QNKGTVG2NCVVG



7705 1:1,3



4WDGN5V2GVGTUDWTI5GIGNUEJWNUEJKHH-TWUGPUVGTPI(GKPUKNDGT;GQ  40WT'ZGORNCTGIGRT·IV+P1TKIKPCNUEJCVWNNG2QNKGTVG2NCVVG

ex 7706



ex 7707



/ÒP\UCV\  /QUMCW D\Y 5V 2GVGTUDWTI DGUVGJGPF CWU    WPF  4WDGN 4WUUKUEJGU   $CNNGVV5EJYCPGPUGG+PUIGUCOVI(GKPIQNF(D$$$$  5VÒEM)1.&2QNKGTVG2NCVVG 



/ÒP\UCV\  /QUMCW D\Y 5V 2GVGTUDWTI DGUVGJGPF CWU    WPF  4WDGN 4WUUKUEJGU   $CNNGVV4CKOQPFC+PUIGUCOVI(GKPIQNF(D$$$$ 5VÒEM)1.&2QNKGTVG2NCVVG 

128


LOTS UND SAMMLUNGEN

.16570&5#//.70)'04755+5%*'4/ª0<'070&/'&#+..'0 

2CWN +  -W&GPIC   -W-QRGMG  #NNG /ÒP\UV·VVG 'MCVGTKPDWTI $KVMKP    4  5VÒEM5GJTUEJÌPpXQT\ÒINKEJ





0KMQNCWU+-W-QRGMGP'/ $KVMKP -W-QRGMGP'/ $KVMKP  -W-QRGMGP+IJQTUM Z$KVMKP  5VÒEM5GJTUEJÌPpXQT\ÒINKEJ





-QRGMGP Z CNNG/ÒP\UV·VVG5V2GVGTUDWTI$KVMKP Z   5VÒEM*GPMGNURWT Z UGJTUEJÌP



#NGZCPFGT++-W-QRGMG $KVMKP -QRGMGP $KVMKP  $KVMKP  -QRGMGP $KVMKP -QRGMGP $KVMKP -W-QRGMG $KVMKP   5VÒEM9KP\4CPFHGJNGT Z XQT\ÒINKEJWPFDGUUGT



0KMQNCWU ++   4WDGN    4WDGN   &C\W 5QYLGVWPKQP    4WDGN 6UEJGTYQPG\  Z +PUIGUCOVI(GKPIQNF(D Z  Z  5VÒEM)1.&/GKUVXQT\ÒINKEJ 



-QRGMGP Z$KVMKP  Z$KVMKP -QRGMGP $KVMKP -W-QRGMGP  $KVMKP  5VÒEM8QT\ÒINKEJp5VGORGNINCP\



4WDGN Z +PUIGUCOVI(GKPIQNF(D  5VÒEM)1.&/GKUVXQT\ÒINKEJ





4WDGN Z +PUIGUCOVI(GKPIQNF(D  5VÒEM)1.&/GKUVUGJTUEJÌP





5QYLGVWPKQP  5RKV\DGTIGP 4WUUKUEJGU /KPGPWPVGTPGJOGP #TMVKMWIQN    WPF    -QRGMGP  CNNG /ÒP\UV·VVG .GPKPITCF XQT\ÒINKEJ  6QMGP \W    WPF  4WDGN    5GTKG\W-QRGMGP Z 4WDGNKP0KEMGN#NWOKPKWOWPF-WRHGT  4WDGN   5VÒEM XGTUEJKGFGPG /QVKXG WPF /GVCNNG   4WDGN   5VÒEM XGTUEJKGFGPG   /QVKXGWPF/GVCNNG  5VÒEM5VGORGNINCP\WPFRQNKGTVG2NCVVG  -NGKPG 5COONWPI XQP TWUUKUEJGP -WTUOÒP\U·V\GP FGT ,CJTG       ,CJTG   4GXQNWVKQP               *QEJKPVGTGUUCPVGU1DLGMVDKVVGWPDGFKPIVDGUKEJVKIGP  +PUIGUCOV/ÒP\U·V\G5VGORGNINCP\D\YRQNKGTVG2NCVVG 



 





#NNIGOGKP-NGKPGU-QPXQNWVXQPTWUUKUEJGP5KNDGTOÒP\GPFGU,CJTJWPFGTVUXQO-QRGMGP5VÒEM DKU\WO4WDGN+PVGTGUUCPVGU.QVDKVVGDGUKEJVKIGP 5VÒEM/GKUVUGJTUEJÌP





-W-QRGMGP ªDGTRT·IWPIUURWTGP -W-QRGMGP-W-QRGMGP -W&GPIC 5VÒEM5GJTUEJÌPWPFDGUUGT





.QVXQP&GPIKFGU,CJTJWPFGTVUWCXQP2UMQY+PVGTGUUCPVGU.QVDKVVGDGUKEJVKIGP  5VÒEM5GJTUEJÌP





-NGKPG 5COONWPI XQP TWUUKUEJGP 5KNDGTMQRGMGP FGU  ,CJTJWPFGTVU XQO )TKXGPPKM  DKU \W    -QRGMGP  W C  -QRGMGP  )TKXGPPKM   -QRGMGP   -QRGMGP    -QRGMGP+PVGTGUUCPVGU.QVDKVVGDGUKEJVKIGP 5VÒEM5GJTUEJÌPpXQT\ÒINKEJ





-NGKPG 5COONWPI XQP TWUUKUEJGP -WRHGTOÒP\GP FGU  ,CJTJWPFGTVU XQP FGT 2QNWUEJMC DKU\WO  -QRGMGP5VÒEM FCTWPVGT CWEJ \CJNTGKEJG JÒDUEJG 'TJCNVWPIGP *QEJKPVGTGUUCPVGU 1DLGMV DKVVG   DGUKEJVKIGP 5VÒEM(CUVUGJTUEJÌPpHCUV5VGORGNINCP\





-NGKPG 5COONWPI XQP TWUUKUEJGP /ÒP\GP WPF /GFCKNNGP FGU  ,CJTJWPFGTVU W C 4WDGN             Z          GVE*QEJKPVGTGUUCPVGU1DLGMVDKVVGDGUKEJVKIGP  5VÒEM'KPKIGOKV(GJNGTPOGKUVUGJTUEJÌP 



7OHCPITGKEJG 5COONWPI XQP TWUUKUEJGP 5KNDGT WPF -WRHGT0KEMGN)GFGPMOÒP\GP \WO 6JGOC    ,CJTG4W­NCPFXQP&KG5COONWPIUGV\VUKEJCWUWPF4WDGNUVÒEMGPCWHFGPGP5\G PGP2GTUQPGPWPFYKEJVKIG'TGKIPKUUGFGTTWUUKUEJGP)GUEJKEJVGCDIGDKNFGVUKPF\WUCOOGP&GU9GK VGTGPGPVJCNVGPUKPFGKPKIGTWUUKUEJG-WTUOÒP\GP 4WDGN FGTGT,CJTG+PVGTGU UCPVGU.QVDKVVGDGUKEJVKIGP 5VÒEM+P\YGKQTKIKPCNGP/ÒP\DQZGP8QT\ÒINKEJpRQNKGTVG2NCVVG -CVJCTKPC++-W2CTC &GPICU 5CFQIWTCIGRT·IVY·JTGPFFGTTWUUKUEJGP$GUGV \WPI/QNFCYKGPUWPFFGT9CNCEJGKY·JTGPFFGUVÒTMKUEJTWUUKUEJGP-TKGIGUJGTIGUVGNNVCWU-CPQPGP DTQP\G 0KMQNCWU +   4WDGN 2QNVKPC   5V 2GVGTUDWTI  4WDGN 2QNVKPC     9CTUEJCW-QRGMGPDGKFG/ÒP\UV·VVG5V2GVGTUDWTI#NGZCPFGT++4WDGN 5V2GVGTUDWTI-QRGMGP5V2GVGTUDWTI&C\WFTGKWPGFNG/GFCKNNGP  5VÒEM-QTTQFKGTV Z UGJTUEJÌPpXQT\ÒINKEJ +PVGTGUUCPVG 5COONWPI <KPP5WKVGPOGFCKNNGP XQP + $ )CUU 5 ,WFKP D\Y 6 +YCPQHH CWH FKG TWUUK   UEJGP )TQ­HÒTUVGP 4WTKM Z 5GTKGPPWOOGT   1NGI Z 5GTKGPPWOOGTP    +IQT Z 5GTKGP   PWOOGT   WPF 5YLCVQUNCY + Z 5GTKGPPWOOGTP   #WH FGP 8QTFGTUGKVGP KUV FCU IGJCTPKUEJVG   $TWUVDKNFFGULGYGKNKIGP*GTTUEJGTUTFCTIGUVGNNVFKG4ÒEMUGKVGP\GKIGPDGFGWVGPFG'TGKIPKUUGCWUFGTGP 4GIKGTWPIU\GKVGPECOOI&KCMQX 5VÒEM5GJTUEJÌP -NGKPG5COONWPIXQPFKXGTUGPTWUUKUEJGP/GFCKNNGPWPF,GVQPUFGU,CJTJWPFGTVUWC-TÌ PWPIULGVQP XQP 'NKUCDGVJ &KCMQX   VTCIDCTG UKNDGTPG 8GTFKGPUVOGFCKNNG CWH FGP 6QF FGU <CTGP   #MGZCPFGT+++ &KCMQX +PVGTGUUCPVGU.QVDKVVGDGUKEJVKIGP 5VÒEM5GJTUEJÌPpXQT\ÒINKEJ











  129


14&'070&'*4'0<'+%*'0

5GJTIGGJTVG5COONGTXGTGJTVG-WPFGP    8QT+JPGPNKGIVOKVFGO-CVCNQIFGT#WMVKQP\WOUGEJUVGP/CNGKPDGFGWVGPFGU#PIGDQVFGT(KTOC -ÒPMGT XQP 1TFGP WPF 'JTGP\GKEJGP 'U HTGWV OKEJ FC­ YKT +JPGP JGWVG YKGFGT ÒDGT  1TFGP   'JTGP WPF #D\GKEJGP /KPKCVWTGP 1TFGPU WPF /KPKCVWTGPUEJPCNNGP UQYKG 8GTNGKJWPIUWTMWPFGP KP   ÒDGT  RTGKUYGTV VCZKGTVGP #WMVKQPUNQUGP CPDKGVGP MÌPPGP &KG 5VÒEMG MQOOGP \WO ITÌ­VGP 6GKN   CWU \YGK 5COONWPIGP GKPGT CWU *GUUGP UVCOOGPFGP CNVGP &GWVUEJNCPF5COONWPI UQYKG GKPGT   HTCP\ÌUKUEJGP'WTQRC5COONWPIOKVGKPKIGP'ZGORNCTGPCWUªDGTUGG   <WP·EJUVIGNCPIGPOGJTCNU.QUGOKV1TFGP'JTGPWPF#D\GKEJGPFGTFGWVUEJGP$WPFGUUVCCVGPDKU  XQTCNNGOCWU$CFGP$C[GTPCNNGPFTGK*GUUGP1NFGPDWTI2TGW­GP5CEJUGP5CEJUGP9GKOCT FGP 5·EJUKUEJGP *GT\QIVÒOGTP WPF 9ÒTVVGODGTI  \WO #WHTWH IGHQNIV XQP  .QUGP OKV   #WU\GKEJPWPIGP FGU &GWVUEJGP 4GKEJGU  .QUGP OKV #WU\GKEJPWPIGP FGU UQIGPCPPVGP ō&TKVVGP   4GKEJGUŋ WPF  .QUGP OKV #WU\GKEJPWPIGP FGT $WPFGUTGRWDNKM &GWVUEJNCPF &GP #DUEJNW­ FGU   FGWVUEJGP $GTGKEJGU DKNFGP  .QUG OKV ITQ­GP 1TFGPUUEJPCNNGP /KPKCVWTGPUEJPCNNGP WPF MGVVEJGP   (GNFUEJPCNNGPUQYKGGKPKIGFGTKOOGTUGJTDGNKGDVGPFGWVUEJGP-QPXQNWVG   &GT GWTQR·KUEJG 6GKN OKV ÒDGT  .QUGP DGKPJCNVGV W C FKG 5EJYGTRWPMVG $GNIKGP $WNICTKGP      (KPPNCPF (TCPMTGKEJ )TQ­DTKVCPPKGP +VCNKGP .WZGODWTI 5QWXGT·PGT /CNVGUGT 4KVVGTQTFGP 2QNGP   ¤UVGTTGKEJ2QTVWICN4WO·PKGP4W­NCPF5MCPFKPCXKGP5RCPKGPWPF8CVKMCP*GKNKIGT5VWJN   +O $GTGKEJ ªDGTUGG OKV ÒDGT  .QUGP NKGIGP FKG 5EJYGTRWPMVG DGK $TCUKNKGP ,CRCP 2GTUKGP FGT   6ÒTMGKWPFFGP8GTGKPKIVGP5VCCVGPXQP#OGTKMC   &GT -CVCNQI YWTFG YKGFGT WPVGT YKUUGPUEJCHVNKEJGP )GUKEJVURWPMVGP GTUVGNNV YKG FKG \CJNTGKEJGP   #POGTMWPIGP WPVGTJCND FGT GKIGPVNKEJGP $GUEJTGKDWPI FGU LGYGKNKIGP .QVU DGNGIGP +P FKGUGO   <WUCOOGPJCPI FCPMG KEJ DGUQPFGTU *GTTP 2TQH &T &T ) #PFTGCU 6COOCPP $CUGN  CWH FGUUGP    WOHCPITGKEJG8QTCTDGKVGPKEJYKGFGTQHV\WTÒEMITGKHGPMQPPVG   #O 8QTCDGPF XQT FGT #WMVKQP YKTF FGT -CVCNQICWVQT KP GKPGO $KNF8QTVTCI OKV FGO 6KVGN   ō#WU\GKEJPWPIGP KO 5RCPPWPIUHGNF \YKUEJGP 1TKIKPCN WPF (·NUEJWPI ņ 'KPG DGITKHHNKEJG #DITGP\WPI   \WT0WOKUOCVKMŋITWPFU·V\NKEJKPGKPKIG#URGMVGFGU5COOGNPUXQP1TFGPWPF'JTGP\GKEJGPGKPHÒJTGP DGUQPFGTU CWEJ KO *KPDNKEM CWH )GOGKPUCOMGKVGP WPF 7PVGTUEJKGFG \WT 0WOKUOCVKM &GT 8QTVTCI   TKEJVGVUKEJUQOKVPKEJVPWTCPFKG5COONGTXQP1TFGPWPF'JTGP\GKEJGPUQPFGTPCWEJWPFIGTCFGCP 0WOKUOCVKMGT5COONGTYKG*·PFNGTWPFCPCNNGITWPFU·V\NKEJCPFKGUGO6JGOC+PVGTGUUKGTVGP   +EJYÒPUEJG+JPGPUGJTIGGJTVGT5COONGTWPF-WPFGXKGN(TGWFGDGKO5VWFKWOFKGUGU-CVCNQIGUWPF KEJYÒTFGOKEJUGJTHTGWGPYGPPGKPKIGFGTJKGTCPIGDQVGPGP1DLGMVGCWEJ+JT+PVGTGUUGHKPFGPYÒTFGP   /KEJCGN#WVGPITWDGT 



130

#DDKNFWPIGPUKPFUQHGTPPKEJVCPFGTUCPIGIGDGPCWH…)TÌ­GXGTMNGKPGTV 'TJCNVWPIUCPICDGPWPF.KVGTCVWTXGT\GKEJPKUCO'PFGFGU-CVCNQIGU +HPQVQVJGTYKUGUVCVGFKOCIGUCTGTGFWEGFVQ…QHVJGQTKIKPCNUK\G#PGZRNCPCVKQPEQPEGTPKPIVJG VGTOUQHEQPFKVKQPCPFCDKDNKQITCRJ[CTGCXCKNCDNGCVVJGGPFQHVJGECVCNQIWG


DEUTSCHE STAATEN

8001 (1:1)

&'765%*'56##6'0 #0*#.6*'4<1)67/   

'TKPPGTWPIU\GKEJGP FGT *GT\QIKP9KVYG (TGFGTKMG \W #PJCNV$GTPDWTI 5KNDGT XGTIQNFGV   QJPG$CPF$9-1'-5 4++



.CWV 5EJCTHGPDGTI KP 5$ 5   JCV *GT\QIKP9KVYG (TGFGTKMG \W #PJCNV$GTPDWTI OKV )GPGJOKIWPI *GT\QI   (TKGFTKEJU +  'KPPGTWPIU\GKEJGP XGTNKGJGP FCXQP  CP #PIGJÌTKIG FGU JGT\QINKEJGP *CWUGU WPF CP YGKVGTG   HÒTUVNKEJG2GTUQPGP

8002 (1:1)

$#&'0 /#4-)4#(5%*#(6 $+5   -74(ª456'067/   70&   )4155*'4<1)67/   

)TQ­JGT\QINKEJGT 1TFGP XQO <·JTKPIGT .ÌYGP $TWUVUVGTP \WO )TQ­MTGW\ #PHGTVKIWPI FGT (KTOC   <WDGTKP-CTNUTWJG5KNDGT#WHNCIGPVGKNYGKUG)QNFGOCKNNKGTVMCWOUKEJVDCTG#DRNCV\WPIGPXQPITÒ PGT 'OCKNNG KP FTGK FGT $N·VVEJGP CWH FGO 4GXGTU *GTUVGNNGTDG\GKEJPWPI <7$'4 CP 0CFGN $9-   )-XCT1'- 4+p  -NGPCWHÒJTVKP)- 5++ CWUFC­,QUGRJ<WDGT CDCNU*QHLWYGNKGTDG\GKEJPGV WPFUGKP5QJP%CTNUGKV  IGOGKPUCO FKG (KTOC <WDGT WPF %Q HÒJTVGP %CTN <WDGT YKTF  NGV\OCNKI KO -CTNUTWJGT #FTG­DWEJ   IGPCPPV ,QUGRJ KUV /KVVG FGT GT ,CJTG XGTUVQTDGP &KG 8GTCTDGKVWPI FKGUGU $TWUVUVGTPU N·­V CWH GKPG HTÒJG   #PHGTVKIWPI UEJNKG­GP UQ FC­ XQP GKPGO *GTUVGNNWPIU\GKVTCWO WO  CWUIGICPIGP YGTFGP MCPP +P FGP   ,CJTGP\YKUEJGPDKUUKPFNCWV8QNNG KP8.5 )TQ­MTGW\GXGTNKGJGPYQTFGP

131


DEUTSCHE STAATEN

8003





8004

8005

)TQ­JGT\QINKEJGT 1TFGP XQO <·JTKPIGT .ÌYGP 4KVVGTMTGW\ D\Y UGKV   4KVVGTMTGW\  -NCUUG   OKV 'KEJGPNCWD 5KNDGT XGTIQNFGV /GFCKNNQPU )QNF GOCKNNKGTV 'OCKNNGOCNGTGK )NCUHNW­ 'KEJGPNCWD   5KNDGT JQJN IGHGTVKIV WPF XGTDÌFGV XGTIQNFGVOKV$CPFKOQTKIKPCNGPIQNFGPDGFTWEMVGP8GTNGKJWPIU GVWKOKVQTKIKPCNGOªDGTMCTVQPOKVIGFTWEMVGT$G\GKEJPWPI$9-)-1'- ++



)TQ­JGT\QINKEJGT 1TFGP XQO <·JTKPIGT .ÌYGP 4KVVGTMTGW\  -NCUUG OKV 'KEJGPNCWD UGKV      6[R #WUHÒJTWPI FGT (KTOC %CTN (TKGFTKEJ <KOOGTOCPP KP 2HQT\JGKO    5KNDGT   /GFCKNNQPU)QNFGOCKNNKGTVHGKPUVG'OCKNNGOCNGTGK)NCUUVGKPG'KEJGPNCWD5KNDGTXGTIQNFGVHGUVOKVFGT ¤UGXGTDWPFGPCOCNVGP1TKIKPCNDCPFOKV6TCIGURCPIGUEJYGFKUEJGT#TV$9-1'- ++



5GJTUEJÌPIGHGTVKIVGUOGJTVGKNKIGU'KEJGPNCWDXQPXQT.CWV8QNNG KP8.5 YWTFGGVYCCDFGO,CJT FCU'KEJGPNCWDKPXGTIQNFGVGO5KNDGTXGTNKGJGPKP8GTDKPFWPIOKVGEJVIQNFGPGP/GFCKNNQPUDKU



)TQ­JGT\QINKEJGT 1TFGP XQO <·JTKPIGT .ÌYGP 4KVVGTMTGW\  -NCUUG UGKV    6[R  

#WUHÒJTWPI FGT (KTOC %CTN (TKGFTKEJ <KOOGTOCPP KP 2HQT\JGKO    5KNDGT /GFCKNNQPU   )QNFGOCKNNKGTVHGKPUVG'OCKNNGOCNGTGK)NCUUVGKPGCOCNVGP1TKIKPCNDCPF$9-1'- ++

8006





8007

8GTFKGPUVOGFCKNNGHÒT8QTIGUGV\VGWPFMNGKPGTG8GTFKGPUVGD\Y%KXKNXGTFKGPUVOGFCKNNG   D\Y )TQ­JGT\QINKEJG 8GTFKGPUVOGFCKNNG    /QFGNN OKV FGO 2QTVTCKV )TQ­   JGT\QI .GQRQNFU    5KNDGTPG 8GTFKGPUVOGFCKNNG #WUHÒJTWPI OKV NCWV 8QNNG  8QTFGTUGKVGP   5VGORGN MÒT\GTG7OUEJTKHV WPF4ÒEMUGKVGPUVGORGN 2WPMVGFGUª\YKUEJGP4CPFWPF$WEJUVCDG  5KNDGTCWHFGO*CNUCDUEJPKVV5VGORGNUEJPGKFGTUKIPCVWT-#%*'.COCNVGP1TKIKPCNDCPF$9- 1'- ++



.CWV 8QNNG 8. 5   YWTFG FKGUG /GFCKNNG  OCN KP FGP ,CJTGP XQP  DKU  XGTNKGJGP 5EJQP WPVGT   /CTMITCH-CTN(TKGFTKEJ TGI UKPF8GTFKGPUVOGFCKNNGPQJPG8QTJCPFGPUGKPXQPFKGUDG\ÒINKEJGP5VCVW VGP XGTNKGJGP YQTFGP 7O FKG 9GPFG \WO  ,CJTJWPFGTV DKNFGVG UKEJ GKPG &TGKUVWHKIMGKV ITQ­G WPF MNGKPG IQN   FGPGUKNDGTPG FGT#WU\GKEJPWPIJGTCWU#D)TQ­JGT\QI-CTN TGI GTJKGNVGPFKG/GFCKNNGPLGYGKNUFCU 2QTVTCKVFGU*GTTUEJGTU'TUVCO5GRVGODGTGTNKG­)TQ­JGT\QI(TKGFTKEJ+FKG5VCVWVGPHÒTFKG8GTNGKJWPI FGT )TQ­JGT\QINKEJGP 8GTFKGPUV WPF 4GVVWPIUOGFCKNNGP FKG KO 4GIKGTWPIUDNCVV 0T .8+ XQP  5GKVG    XGTÌHHGPVNKEJVYWTFGP#DFGOINGKEJGP,CJTMQPPVGPFKG/GFCKNNGPHÒT-TKGIUXGTFKGPUVCWEJCO$CPFFGU/KNV·TK UEJGP %CTN (TKGFTKEJ8GTFKGPUV1TFGPU D\Y FGT /GFCKNNG XGTNKGJGP YGTFGP /KV FGT#DUEJCHHWPIFGT/QPCTEJKG KO0QXGODGTGPFGVGCWEJFKG8GTNGKJWPIFGT8GTFKGPUVOGFCKNNGP



 132

8GTFKGPUVOGFCKNNGHÒT8QTIGUGV\VGWPFMNGKPGTG8GTFKGPUVGD\Y%KXKNXGTFKGPUVOGFCKNNG   D\Y )TQ­JGT\QINKEJG 8GTFKGPUVOGFCKNNG    /QFGNN OKV FGO 2QTVTCKV )TQ­JGT\QI   .GQRQNFU    CNVG <YGKVCPHGTVKIWPI FGT 5KNDGTPGP 8GTFKGPUVOGFCKNNG 5KNDGTIW­ CWH FGO   *CNUCDUEJPKVV5VGORGNUEJPGKFGTUKIPCVWT-#%*'.KO4CPFRWP\KGTV%12;COUR·VGTGP$CPF +++ &KGUG-CVCNQIRQUKVKQPGPVH·NNV






DEUTSCHE STAATEN

8009 (1:1)



8GTFKGPUVOGFCKNNGHÒT8QTIGUGV\VGWPFMNGKPGTG8GTFKGPUVGD\Y%KXKNXGTFKGPUVOGFCKNNG   D\Y )TQ­JGT\QINKEJG 8GTFKGPUVOGFCKNNG    /QFGNN OKV FGO ·NVGTGP 2QTVTCKV )TQ­   JGT\QI (TKGFTKEJ +     #WUHÒJTWPI QJPG 5VGORGNUEJPGKFGTUKIPCVWT    )QNF   IMNGKPG4CPFFGNNGCOPGWGP$CPFKOQTKIKPCNGP8GTNGKJWPIUGVWKOKVIQNFHCTDGPGO/QPQITCOO ($9-1'- ++

8010



8011

8012

8GTFKGPUVOGFCKNNG HÒT 8QTIGUGV\VG WPF MNGKPGTG 8GTFKGPUVG D\Y %KXKNXGTFKGPUVOGFCKNNG  

 D\Y)TQ­JGT\QINKEJG8GTFKGPUVOGFCKNNG  /QFGNN OKVFGO·NVGTGP2QT VTCKV )TQ­JGT\QI (TKGFTKEJU +     #WUHÒJTWPI QJPG 5VGORGNUEJPGKFGTUKIPCVWT      5KNDGTCOPGWGP$CPF$9-1'- ++



8013



+PGKPGOJGTXQTTCIGPFGP'TJCNVWPIU\WUVCPF&KGUG/GFCKNNGIKNVCNUGKPGFGTCOUEJÌPUVGPIGUEJPKVVGPGP/GFCKNNGP FGT FGWVUEJGP 5VCCVGP .CWV 8QNNG 8. 5   YWTFG FKGUG /GFCKNNG  OCN KP FGP ,CJTGPXQPDKU XGTNKGJGPYQXQP8GTNGKJWPIGPCO$CPFFGU/KNV·TKUEJGP%CTN(TKGFTKEJ8GTFKGPUV1TFGPUD\YFGT/GFCKNNG GTHQNIVGP



.CPFYKTVUEJCHVUOGFCKNNG/QFGNN OKV2QTVTCKV)TQ­JGT\QI.GQRQNFU )TQ­G5KNDGTPG /GFCKNNG VTCIDCTG #WUHÒJTWPI OKV $CPF #WUICDG OKV 5VGORGNUEJPGKFGT\GKEJGP & &WTEJOGUUGT   OO5KNDGTCOCNVGP$CPF*5 44++



&KG ITWPFU·V\NKEJ PKEJV VTCIDCTG /GFCKNNG YWTFG UGKV FGT 4GIKGTWPIU\GKV )TQ­JGT\QI .WFYKIU   XQO   .CPFYKTVUEJCHVNKEJGP<GPVTCNXGTGKPKP$CFGPKPXKGT5VWHGP )TQ­GWPF-NGKPG)QNFGPGWPF)TQ­GWPF-NGKPG5KN DGTPG/GFCKNNG HÒTDGUQPFGTG.GKUVWPIGPCWHFGO)GDKGVGFGT.CPFYKTVUEJCHVXGTNKGJGP#NNGTFKPIUGTVGKNVG)TQ­ JGT\QI .GQRQNF NCWV *GUUGPVJCN WPF 5EJTGKDGT KP *5 5   CWH DGUQPFGTGP #PVTCI JKP XGTGKP\GNV FKG )GPGJOK   IWPIFKG/GFCKNNGCO$CPFFGT8GTFKGPUVOGFCKNNG\WVTCIGP7PVGT)TQ­JGT\QI(TKGFTKEJ+YWTFGUKGFWTEJ FKG/GFCKNNGHÒT.CPFYKTVUEJCHV)GYGTDGWPF*CPFGNGTUGV\V



'JTGP\GKEJGP HÒT #TDGKVGT WPF O·PPNKEJG &KGPUVDQVGP HÒT VTGWG 2HNKEJVGTHÒNNWPI  /QFGNN  

OKV 5 KP )415*'4<1)    $TQP\G CO CNVGP 1TKIKPCNDCPF KO UGNVGPGP QTKIKPCNGP   8GTNGKJWPIUGVWK$9-1'- ++



)GUVKHVGV XQP )TQ­JGT\QI (TKGFTKEJ + CO  0QXGODGT  XGTÌHHGPVNKEJV KO )GUGV\GU WPF 8GTQTFPWPIUDNCVV   0T ::+ XQP  5GKVG   7O FCU 'JTGP\GKEJGP \W GTJCNVGP OW­VG FGT $GNKGJGPG KP FGT 4GIGN OKPFGUVGPU    #TDGKVULCJTG IGTGEJPGV XQO  .GDGPULCJT CP  CWHYGKUGP 0CEJ FGT 4GIKGTWPIUÒDGTPCJOG XQP )TQ­JGT\QI   (TKGFTKEJ ++  YWTFG FCU $KNFPKU FGU 5VKHVGTU DGKDGJCNVGP  LGFQEJ FKG 7OUEJTKHV \YGK 5 KP )4155   *'4<1)  XGT·PFGTV  /QFGNN  8QP  DKU  UKPF NCWV 9KGPCPF WPF <GKV\ KP 9< 5   KPUIG   UCOV'JTGP\GKEJGPIGRT·IVYQTFGP#O/CKIGUVCVVGVG)TQ­JGT\QI(TKGFTKEJ++FKG*GTUVGNNWPIFGT /GFCKNNG CWU XGTMWRHGTVGO 'KUGP YQDGKFKGGTUVG5EJTGKDYGKUG )415*'4<1) YKGFGT\WXGTYGPFGPYCT  /QFGNN  0CEJ FGO 6JTQPXGT\KEJV(TKGFTKEJU++CO0QXGODGTYWTFGFKG8GTNGKJWPIFGU'JTGP\GKEJGPU GKPIGUVGNNV



'TKPPGTWPIU\GKEJGPHÒT)QNFGPGU'TKPPGTWPIU\GKEJGPOKV4KPI$TQP\G  XGTIQNFGVCO$CPF

QJPG/GVCNNH·FGP $9-1'- 44++



.CWV8QNNG KP8.5 UKPFPWT)QNFGPG'TKPPGTWPIU\GKEJGPOKV4KPIXGTNKGJGPYQTFGP&KGUGU'ZGORNCT WPVGTUEJGKFGVUKEJFGWVNKEJXQPFGPIGOGKPJKPDGMCPPVGP(·NUEJWPIGPOKVFGO5KNDGTUVGORGNCWHFGT4ÒEMUGKVG

133


DEUTSCHE STAATEN 

'JTGP\GKEJGP HÒT /KVINKGFGT FGT HTGKYKNNKIGP (GWGTYGJTGP 5RCPIG HÒT  &KGPUVLCJTG     $TQP\GXGTIQNFGVCWHIGNGIVCWH5EJPCNNGOKVQTKIKPCNGOCNVGO1TFGPUDCPFCPHNCEJGTWPFCDIGTWPFGVGT 0CFGN  6[R  &C\W 5RCPIG FGU (TGKUVCCVGU HÒT  &KGPUVLCJTG  /QFGNN   CP 0CFGN   $9-1'- 5VÒEM++



)TQ­JGT\QI(TKGFTKEJ+  UVKHVGVGFCU'JTGP\GKEJGPOKV.CPFGUJGTTNKEJGT8GTQTFPWPIXQO&G\GODGT  XGTÌHHGPVNKEJVKO)GUGV\GUWPF8GTQTFPWPIUDNCVV0T::8++5 HÒTL·JTKIG/KVINKGFUEJCHVKP GKPGTHTGKYKNNKIGP(GWGTYGJT/KV.CPFGUJGTTNKEJGT8GTQTFPWPIXQO#WIWUV XGTÌHHGPVNKEJVKO)GUGV\GU WPF8GTQTFPWPIUDNCVV0T:::+++5 YWTFGGKPG/GFCKNNGHÒTL·JTKIG/KVINKGFUEJCHVKPGKPGTHTGKYKN NKIGP (GWGTYGJT JKP\WIGHÒIV 0CEJ FGO 6JTQPXGT\KEJV )TQ­JGT\QI (TKGFTKEJU ++   CO  0QXGODGT   YWTFGFKG8GTNGKJWPIFGU'JTGP\GKEJGPUGKPIGUVGNNV

8015







8016

8017 8018

8019

&KGPUVCWU\GKEJPWPI HÒT -TCPMGPUEJYGUVGTP FGU $CFKUEJGP (TCWGPXGTGKPU -TGW\ HÒT :::8   &KGPUVLCJTG5KNDGTVGKNYGKUGXGTIQNFGV4GXGTUITCXWT/CTKC9KNN[+PITQUUGT<GKVVGKNYGKUG DGTKGDGPQJPG6TCIGDTQUEJGWPF-GVVG$9-1'- +++++



&KGPUVCWU\GKEJPWPIHÒT-TCPMGPUEJYGUVGTPFGU$CFKUEJGP(TCWGPXGTGKPU-TGW\HÒT:&KGPUVLCJTG 5KNDGT4GXGTUITCXWT'XC(KUEJGTVGKNYGKUGDGTKGDGPQJPG6TCIGDTQUEJGWPF-GVVG$9- 1'- ++



(GNFFKGPUV#WU\GKEJPWPI )GUEJÒV\DTQP\G CO QTKIKPCNGP \GKVIGPÌUUKUEJGP $CPF OKV \YGK $CPFURCP   IGPWPF NGV\VGTGQJPG2WPMV $TQP\G$9-1'-XCT ++



#PN·­NKEJFGU,CJTGUVCIGUFGU#WUOCTUEJGUFGTDCFKUEJGP.CPFYGJTIGIGP(TCPMTGKEJ KO,CJTG HCPFCO  (GDTWCT  KP 1HHGPDWTI GKP ITQ­GU (GUV UVCVV KP FGUUGP 8GTNCWH FKG #NNGTJÌEJUVG 'PVUEJNKG­WPI )TQ­JGT\QI   .GQRQNFU  ÒDGTFKG5VKHVWPIFGT(GNFFKGPUV#WU\GKEJPWPIXQO,CPWCTXGTMÒPFGVWPFFKGGTUVGP 8GTNGKJWPIGP XQTIGPQOOGP YWTFG )GO·­ h  FGT 8QTUEJTKHVGP ÒDGT FKG (GNFFKGPUV#WU\GKEJPWPI GTNCPIVG LGFGT   FCTCWH #PURTWEJ FGT DKUJGT KP FGO )TQ­JGT\QINKEJGP #TOGG%QTRU KP FGT .KPKG QFGT FGT .CPFYGJT IWV IGFKGPV   WPFGKPGO(GNF\WIVCFGNNQUDGKIGYQJPVQFGTGKPHTÒJGTGU8GTIGJGPFWTEJUR·VGTXQT\ÒINKEJG&KGPUVNGKUVWPIYKGFGT IWVIGOCEJV JCV &KG /GFCKNNGP YWTFGP OKV $CPFURCPIGP /GVCNNUEJNGKHG IGPCPPV XGTNKGJGPCWHFGPGPFKG,CJTGU \CJN GP FGTGPVURTGEJGPFGP(GNF\ÒIGCPIGDTCEJVYCTGP5QICDGU$CPFURCPIGPOKVFGP,CJTGU\CJNGP (ÒTFKGOKNKV·TKUEJGP #WUGKPFGTUGV\WPIGP FGT ,CJTG  YWTFG FKG (GNFFKGPUV#WU\GKEJPWPI GTPGWGTV WPF OKV GPVURTGEJGPFGP   $CPFURCPIGP XGTNKGJGP (ÒT FKG 6GKNPGJOGT CP FGP )GHGEJVGP DGK -CPFGTP)ÒPVGTUVJCN(TGKDWTIWPF5VCWHGPKO ,CJTGYWTFGFCU'JTGP\GKEJGPCNUDGUQPFGTG#WU\GKEJPWPIOKVTÒEMUGKVKIITCXKGTVGO)GHGEJVUQTVWPFCO$CPF FGT/KNKV·TKUEJGP-CTN(TKGFTKEJ8GTFKGPUVOGFCKNNGXGTNKGJGP#WEJHÒTFKG-TKGIGXQPWPFYWTFG FKG(GNFFKGPUV#WU\GKEJPWPILGYGKNUGTPGWGTVWPFOKVGPVURTGEJGPFGP$CPFURCPIGPXGTNKGJGP)GO·­#NNGTJÌEJUVGO $GHGJN)TQ­JGT\QI(TKGFTKEJ+  XQO#RTKNYWTFGFKG(GNFFKGPUV#WU\GKEJPWPIGTPGWGTVWPF U·OVNKEJGP1HHK\KGTGP-TKGIUDGCOVGPWPF/CPPUEJCHVGPYGNEJGKPFGP(GNF\ÒIGPWPFCPGKPGO )GHGEJV QFGT GKPGT $GNCIGTWPI 6JGKN IGPQOOGP JCDGP QFGT \W MTKGIGTKUEJGP <YGEMGP FGP 4JGKP ÒDGTUEJTKVVGP   JCDGPXGTNKGJGP#WHITWPFFGU'PFGUFGT/QPCTEJKGKO0QXGODGTMCOGUPKEJVOGJT\WGKPGT'TPGWG TWPIFGU(GNFFKGPUV'JTGP\GKEJGPUHÒTFGP'TUVGP9GNVMTKGIUQFC­FCU'JTGP\GKEJGP\WNGV\VXGTNKGJGPYQTFGP KUV XIN8QNNGKP8.5HH 



(GNFFKGPUV#WU\GKEJPWPI )GUEJÒV\DTQP\G CO QTKIKPCNGP \GKVIGPÌUUKUEJGP $CPF OKV $CPFURCPIG    NGV\VGTGOKV2WPMV $TQP\G$9-1'- ++





'TKPPGTWPIUMTGW\ HÒT  CWEJ 'TKPPGTWPIUMTGW\ HÒT HTGKYKNNKIG *KNHUV·VKIMGKV Y·JTGPF   FGU-TKGIGUIGPCPPV )QNFDTQP\GCOPGWGP$CPF$9-1'- ++



&CU 'JTGP\GKEJGP YWTFG CO  ,WPK  XQP )TQ­JGT\QI (TKGFTKEJ + IGUVKHVGV XGTÌHHGPVNKEJV KO)GUGV\GUWPF 8GTQTFPWPIUDNCVV 0T ::8 XQP  5GKVG  'UYWTFGCP(TCWGPWPF/·PPGTXGTNKGJGPFKGUKEJFGT2HNGIG FGT8GTYWPFGVGPWPF-TCPMGPFGT(ÒTUQTIGHÒTFKG6TWRRGPWPF7PVGTUVÒV\WPIFGT(COKNKGPFGT\WO-TKGIUFKGPUV IG\QIGPGP4GUGTXKUVGPWPF.CPFYGJTO·PPGTIGYKFOGVJCDGP

134


DEUTSCHE STAATEN

ex 8021 8020

ex 8022



&KGPUVCWU\GKEJPWPIUMTGW\HÒT1HHK\KGTG/QFGNN  -TGW\-NCUUGHÒT&KGPUVLCJTG $TQP\GXGTIQNFGV#WHNCIG5KNDGTCOCNVGP1TKIKPCNDCPF$9-1'- ++





&KGPUVCWU\GKEJPWPI HÒT 7PVGTQHHK\KGTG WPF 5QNFCVGP  /QFGNN   -QPXQNWV XQP \YGK   #WU\GKEJPWPIGPHÒT:++&KGPUVLCJTG'KUGPIGUEJY·T\VOKV5KNDGTTCJOGPGKPGOKVWPNGUGTNKEJGT*GT UVGNNGTDG\GKEJPWPI CWH FGT 4ÒEMUGKVG CP CNVGP 1TKIKPCND·PFGTP LGYGKNU QJPG 6TCIGURCPIG $9-    1'- 5VÒEM++



.CPFYGJT&KGPUVCWU\GKEJPWPI-QPXQNWVXQPFTGK'ZGORNCTGP /QFGNN  QJPG'KUGP TCJOGP CWHIGP·JV CWH $CPF HÒTFKGINCVVG1TFGPUUEJPCNNG /QFGNN  KPQHHK\KGNNG#WU HÒJTWPI HÒT FKG ITQ­G 1TFGPUUEJPCNNG $TQP\G XGTIQNFGV WPF GOCKNNKGTV CP MTCWUGT 'KPGT1TFGPU   UEJPCNNG    /QFGNN   /GFCKNNG $TQP\G XGTIQNFGV CO $CPF $9-   1'-    5VÒEM++





8023



'TKPPGTWPIU/GFCKNNG HÒT FKG FGO $CFKUEJGP /KNKV·TXGTGKPU8GTDCPF CPIGJÌTGPFGP 8GTGKPG  

5KNDGTPG  'TKPPGTWPIUOGFCKNNG HÒT  ,CJTG (QTOCV  Z  OO $TQP\G XGTUKNDGTV QJPG $CPF   $9-1'- ++



#O#WIWUVUVKHVGVG)TQ­JGT\QI(TKGFTKEJ+CWU#PNC­FGUL·JTKIGP,WDKN·WOUFGU5KGIGUXQPFKGUG (CJPGPOGFCKNNG 5KG YWTFG CP 8GTGKPG FGU /KNKV·TXGTGKPU8GTDCPFGU XGTNKGJGP FKG  ,CJTG WPF OGJT DGUVCPFGP   /KV'TNC­XQO1MVQDGTUVKHVGVG)TQ­JGT\QI(TKGFTKEJ++FKG)QNFGPG'TKPPGTWPIUOGFCKNNGOKV-TQPGFKG CP-TKGIGTXGTGKPGXGTNKGJGPYWTFGFKG,CJTGWPFN·PIGTDGUVCPFGP0CEJFGO6JTQPXGT\KEJV(TKGFTKEJU++CO 0QXGODGTYWTFGFKG8GTNGKJWPIFGU'JTGP\GKEJGPUGKPIGUVGNNV



7TMWPFGP 6GKN0CEJNC­ FGU /CLQTU -CTN 'OKN )WUVCX 9KGVJQNV\ KO  .CPFUVWTO+PHCPVGTKG$C   VCKNNQP.ÌTTCEJ :+8  2CVGPV\WO2QTVGRGG(·JPTKEJFCVKGTV$GTNKP#WIWUVOKVITQ­GO 2TG­5KGIGN   2CVGPV \WO 5GEQPFNKGWVGPCPV FCVKGTV $GTNKP  /·T\  OKV ITQ­GO 2TG­5KGIGN     2CVGPV \WO 1DGTNGWVPCPV FGT +PHCPVGTKG FCVKGTV $GTNKP  (GDTWCT  OKV ITQ­GO 2TG­5KGIGN     8GTNGKJWPIUWTMWPFG \WT <GPVGPCTOGFCKNNG OKV 1TKIKPCNWPVGTUEJTKHV FGU )GPGTCNU FGT +PHCPVGTKG XQP   $NWODGTI MQOOCPFKGTGPFGP )GPGTCNU FGU  #TOGG-QTRU   8QTN·WHKIG$GUKV\7TMWPFG\WO'KUGT PGP-TGW\++-NCUUGFCVKGTV,WNK7PVGTUEJTKHVGKPGU)GPGTCNNGWVPCPVU 8GTNGKJWPIUWTMWPFG\WO 4KVVGTMTGW\ GTUVGT -NCUUG OKV 5EJYGTVGTP FGU 1TFGPU XQO <·JTKPIGT .ÌYGP FCVKGTV -CTNUTWJG   #WIWUV 8GTNGKJWPIUWTMWPFG\WO'JTGPMTGW\HÒT(TQPVM·ORHGTFCVKGTV-QRGPJCIGP  CO  /·T\  OKV 1TKIKPCNWPVGTUEJTKHV FGU FGWVUEJGP )GUCPFVGP (TGKJGTTP XQP 4KEJVJQHGP   )TQ­G   6KUEJQTFPWPIGKPGU$CPMGVVUOKVFGO-CKUGTRCCTFGO-TQPRTKP\GPWPF\CJNTGKEJGPDGFGWVGPFGP\KXKNGP WPF OKNKV·TKUEJGP 2GTUÌPNKEJMGKVGP YQTCP CWEJ 9KGVJQNV\ VGKNIGPQOOGP JCV #NNG &QMWOGPVGIGHCNVGV 5VÒEM++

 135


DEUTSCHE STAATEN 

7TMWPFGPPCEJNC­ FGU 1DGTRQUVFKTGMVQTU .GQRQNF #NDGTV 8QIGN   $GTGEJVKIWPIUUEJGKP \WO GKP   L·JTKIHTGKYKNNKIGP &KGPUV OKV 'TI·P\WPIGP CWH FGT 4ÒEMUGKVG \CJNTGKEJGP 7PVGTUEJTKHVGP WPF 5VGO   RGNP NGKEJVGKPIGTKUUGP  5KIPCVWT\WO1DGTRQUVUGMTGV·TKP/CPPJGKOFCVKGTV$CFGPCO,WNK OKVITQ­GO2CRKGTUKGIGNWPF1TKIKPCNWPVGTUEJTKHV)TQ­JGT\QI(TKGFTKEJ+ 5KIPCVWT\WO2QUVKPURGM VQTKP(TGKDWTIFCVKGTV-CTNUTWJGCO#RTKNOKVITQ­GO2CRKGTUKGIGNWPF1TKIKPCNWPVGTUEJTKHV )TQ­JGT\QI (TKGFTKEJ +   5KIPCVWT \WO 8K\G2QUVFKTGMVQT KP /CPPJGKO FCVKGTV -CTNUTWJG CO    1MVQDGTOKVITQ­GO2CRKGTUKGIGNWPF1TKIKPCNWPVGTUEJTKHV)TQ­JGT\QI(TKGFTKEJ++  5KIPC VWT\WO2QUVFKTGMVQTKP#EJGTPFCVKGTV-CTNUTWJGCO&G\GODGTOKVITQ­GO2CRKGTUKGIGNWPF 1TKIKPCNWPVGTUEJTKHV )TQ­JGT\QI (TKGFTKEJ ++   $GUVCNNWPI CNU 1DGTRQUVFKTGMVQT FCVKGTV $GTNKP CO    ,WNK  OKV ITQ­GO 2T·IG4GKEJUUKGIGN WPF 1TKIKPCNWPVGTUEJTKHV FGU 4GKEJURT·UKFGPVGP (TKGFTKEJ   'DGTV#NNG&QMWOGPVGIGMPKEMVCDGTKPUGJTIWVGO<WUVCPF 5VÒEM++



8026

8027

$#;'40-74(ª456'067/ $+5 70&-¤0+)4'+%*   

-ÌPKINKEJ $C[GTKUEJGT *CWUTKVVGTQTFGP XQO JGKNKIGP *WDGTVWU )TQ­GT IGUVKEMVGT $TWUVUVGTP FGT   5WRTCYGUVG \WT )TQ­GP )CNCWPKHQTO FGT -ÌPKINKEJGP .GKDICTFG FGT *CTVUEJKGTG &WTEJOGUUGT  EO   5KNDGTWPF)QNFHCFGP XGTIQNFGVGU5KNDGT 5KNDGTDNGEJXGTIQNFGVTQVGT5COVOKP$GUEJ·FKIWPIGPCP FGP5RKV\GPGVYCUIGFWPMGNVCWHFGO4GXGTUXKGT$GHGUVKIWPIUJCMGPWPF'KIGPVÒOGT<GVVGN*#*0 ++p



-ÌPKINKEJ $C[GTKUEJGT *CWUTKVVGTQTFGP XQO JGKNKIGP *WDGTVWU )TQ­GT IGUVKEMVGT $TWUVUVGTP FGT   5WRTCYGUVG \WT )TQ­GP )CNCWPKHQTO FGT -ÌPKINKEJGP .GKDICTFG FGT *CTVUEJKGTG &WTEJOGUUGT  EO   5KNDGTWPF)QNFHCFGP XGTIQNFGVGU5KNDGT 5KNDGTDNGEJXGTIQNFGVTQVGT5COVOKP$GUEJ·FKIWPIGPCP FGP5RKV\GPGVYCUIGFWPMGNVCWHFGO4GXGTUXKGT$GHGUVKIWPIUJCMGPOKV+PXGPVCT\GVVGN.5VÒEM .75) ++p+++



5GJTHGKPIGCTDGKVGVGTWPF·W­GTUVFGMQTCVKXGT5VGTP



136


DEUTSCHE STAATEN

8028



-ÌPKINKEJ $C[GTKUEJGT *CWUTKVVGTQTFGP XQO JGKNKIGP *WDGTVWU )TQ­GT IGUVKEMVGT $TWUVUVGTP FGT   5WRTCYGUVG \WT )TQ­GP )CNCWPKHQTO FGT -ÌPKINKEJGP .GKDICTFG FGT *CTVUEJKGTG &WTEJOGUUGT  EO   5KNDGTWPF)QNFHCFGP XGTIQNFGVGU5KNDGT 5KNDGTDNGEJXGTIQNFGVTQVGT5COVOKP$GUEJ·FKIWPIGPCP FGP 5RKV\GP GVYCU IGFWPMGNV CWH FGO 4GXGTU XKGT $GHGUVKIWPIUJCMGP WPF 'KIGPVÒOGT<GVVGN   2(#44&4'5%*'4 ++p+++



8030 8029



8GTFKGPUVQTFGP XQO JGKNKIGP /KEJCGN  /QFGNN   -TGW\  -NCUUG OKV -TQPG   5KNDGTGOCKNNKGTVCOPGWGP$CPF$9-)-1'- ++



5EJÌPGU·NVGTGU'ZGORNCTOKVHGKPRQNKGTVGP-TQPGPMCPVGP&GTWTURTÒPINKEJXQP,QUGRJ%NGOGPUXQP$C[ GTP-WTHÒTUVWPF'T\DKUEJQHXQP-ÌNPIGUVKHVGVG/KEJCGNU1TFGPYWTFGWPFUEJNKG­NKEJPCEJWPF PCEJ KP FGP FTGKMNCUUKIGP )TQ­MTGW\ 4KVVGT 'JTGPTKVVGT  4KVVGT*CWU1TFGP XQO JGKNKIGP /KEJCGN WOIGHQTOV   &KGUGPYCPFGNVGUEJNKG­NKEJ-ÌPKI.WFYKI+CO,CPWCTKPFGPFTGKMNCUUKIGP )TQ­MTGW\-QOVWT4KVVGT  8GTFKGPUVQTFGP XQO JN /KEJCGN WO  YWTFGP CNU PGWG -NCUUG FKG )TQ­MQOVWTG GKPIGHÒJTV  YWTFG FGT   1TFGP PGW QTICPKUKGTV WPF WOHC­VG PWPOGJT )TQ­MTGW\    -NCUUG OKV WPF QJPG 5VGTP    -NCUUG OKV   -TQPG 8GTFKGPUVMTGW\WPF5KNDGTPG8GTFKGPUVOGFCKNNGMCOGPFKG$TQP\GPG8GTFKGPUVOGFCKNNGWPFFKG  -NCUUG QJPG -TQPG  WPF FCU 8GTFKGPUVMTGW\ OKV -TQPG JKP\W /KV FGT #DFCPMWPI-ÌPKI.WFYKIU+++KO0Q XGODGT  YWTFGP FKG 8GTNGKJWPIGP GKPIGUVGNNV XIN CWEJ 6TQUV .WFYKI &KG )GUEJKEJVG FGU 5V /KEJCGNU   1TFGPU KP $C[GTP WPF FGT 5V /KEJCGNU$TWFGTUEJCHV UGKV FGO ,CJTG  DKU CWH FKG )GIGPYCTV /ÒPEJGP WPF   .GKR\KI 



'T\DTWFGTUEJCHVFGUJGKNKIGP/KEJCGN\W$GTICO.CKOKP/ÒPEJGP)QNFGPG$TWFGTUEJCHVUOGFCKNNG 5KNDGTXGTIQNFGVOKV'OCKNNGTGUVGPQJPG$CPF +8



8QPGKPGOHTQOOGP$C[GTPXKGNIGVTCIGPG/GFCKNNG&KGXQP,QUGRJ%NGOGPU*GT\QIXQP$C[GTP-WTHÒTUV 'T\DKUEJQH XQP -ÌNP \WUCOOGPOKVFGO4KVVGTQTFGPXQOJGKNKIGP/KEJCGNIGUVKHVGVGWPFJGWVGPQEJGZKUVKGTGPFG 'T\DTWFGTUEJCHV FGU JGKNKIGP /KEJCGN \W $GTI CO .CKO KP /ÒPEJGP YCT FGO 4KVVGT*CWU1TFGP XQO JGKNKIGP   /KEJCGNWPFFGOFCTCWUJGTXQTIGICPIGPGP8GTFKGPUVQTFGPXQOJGKNKIGP/KEJCGN\WIGQTFPGVFGUUGP6TCFKVKQPUKG DKU KP FKG )GIGPYCTV HQTVHÒJTV XIN 6TQUV .WFYKI  &KG )GUEJKEJVG FGU 5V /KEJCGNU1TFGPU KP $C[GTP WPF FGT   5V/KEJCGNU$TWFGTUEJCHVUGKVFGO,CJTGDKUCWHFKG)GIGPYCTV/ÒPEJGPWPF.GKR\KIUQYKG$GPMGT 5KGIOWPF-KGV\KI1VVQWPFCPFGTG3WKUWV&GWU,CJTG'T\DTWFGTUEJCHV5V/KEJCGN$GTICO.CKO/ÒP EJGP/ÒPEJGP 

137


DEUTSCHE STAATEN

8032

8031



'T\DTWFGTUEJCHVFGUJGKNKIGP/KEJCGN\W$GTICO.CKOKP/ÒPEJGP)QNFGPG$TWFGTUEJCHVUOGFCKNNG 5KNDGTXGTIQNFGVKO$CPFTKPIRWP\KGTVQJPG$CPF +++





'T\DTWFGTUEJCHVFGUJGKNKIGP/KEJCGN\W$GTICO.CKOKP/ÒPEJGP5KNDGTPG$TWFGTUEJCHVUOGFCKNNG 5KNDGTCWHFGT4ÒEMUGKVGRWP\KGTVQJPG$CPF +++





'T\DTWFGTUEJCHVFGUJGKNKIGP/KEJCGN\W$GTICO.CKOKP/ÒPEJGP<YGKDTQP\GPG$TWFGTUEJCHVU OGFCKNNGPGKPGITÌ­GTGWPFGKPGMNGKPGTGKPXGTUEJKGFGPGP2T·IWPIGPFCXQPGKPGUGJTUVCTMIGVTCIGP QJPG$CPF 5VÒEM++



8034



8035

8036

8037

/KNKV·T8GTFKGPUVQTFGP -TGW\  -NCUUG OKV -TQPG WPF 5EJYGTVGTP    #WUHÒJTWPI  

  #PHGTVKIWPI FGT (KTOC *GOOGTNG KP /ÒPEJGP 5KNDGT /GFCKNNQPU )QNF GOCKNNKGTV CWH   FGO4GXGTUFGT#ITCHHG*GTUVGNNGTRWP\G)*FGT(KTOC*GOOGTNGWPFGT5KNDGTRWP\GCWHGKPGT 5EJYGTVURKV\G *GTUVGNNGTRWP\G )* WPF GT 5KNDGTRWP\G OKV UEJOCNGO MWT\GO $CPFUVÒEM KO   JGNNDNCWGPUKNDGTHCTDKIDGFTWEMVGP8GTNGKJWPIUGVWK$9-1'- +p++



&GT \WP·EJUV HÒPHMNCUUKIG 1TFGP OKV CHHKNKKGTVGO /KNKV·T8GTFKGPUVMTGW\ YWTFG XQP -ÌPKI .WFYKI ++ CO  ,WNK   IGUVKHVGV'TGTHWJTKO.CWHGUGKPGU$GUVGJGPUOGJTGTG8GT·PFGTWPIGPWPF'TYGKVGTWPIGP     WPF   #D  DGUVCPF GT CWU  -NCUUGP FKG OGKUV KP OGJTGTG )TCFG WPVGTVGKNV UKPF  

)TQ­MTGW\-NCUUG-NCUUGOKVWPFQJPG5VGTP1HHK\KGTUMTGW\4KVVGTWPF-NCUUGOKVWPFQJPG-TQPG  WPF FGO CHHKNKKGTVGP FTGKMNCUUKIGP /KNKV·T8GTFKGPUVMTGW\ OKV WPF QJPG -TQPG #D  MQPPVGP CNNG -NCUUGP OKV   5EJYGTVGTPWPFCDCWEJFKG-NCUUGWPFFCU)TQ­MTGW\CNU*ÌJGTUVWHWPIOKVFGT-TQPGXGTNKGJGPYGT FGP/KVFGO6JTQPXGT\KEJV-ÌPKI.WFYKIU+++KO0QXGODGTGTNQUEJCWEJFGT1TFGP







138

/KNKV·T8GTFKGPUVQTFGP -TGW\  -NCUUG OKV 5EJYGTVGTP    #WUHÒJTWPI     #PHGTVKIWPI FGT (KTOC 9GKUU  %Q 5KNDGT /GFCKNNQPU )QNF GOCKNNKGTV QDGTHN·EJNKEJGT 'OCKNNGEJKR   CWHFGT4ÒEMUGKVGFGUQDGTGP-TGW\CTOUCWHFGO4GXGTUFGT#ITCHHG*GTUVGNNGTRWP\G9%QFGT(KTOC 9GKUUWPFGT5KNDGTRWP\GCWHGKPGT5EJYGTVURKV\G*GTUVGNNGTRWP\G9%QWPFGT5KNDGTRWP\GCO $CPF KO DTCWPGP UKNDGTHCTDGP DGFTWEMVGP QTKIKPCNGP8GTNGKJWPIUGVWK$9-)-1'-  ++++p+++



/KNKV·T8GTFKGPUVQTFGP -TGW\  -NCUUG OKV 5EJYGTVGTP    #WUHÒJTWPI     #PHGTVKIWPI FGT (KTOC 9GKUU  %Q 5KNDGT /GFCKNNQPU )QNF GOCKNNKGTV GKPG -TGW\URKV\G NGKEJV IG   UVCWEJVWPFOKVOKP'OCKNNGCDRNCV\WPIGPCWHFGO4GXGTUFGT#ITCHHG*GTUVGNNGTRWP\G9%QFGT(KTOC 9GKUUWPFGT5KNDGTRWP\GCOUEJOCNGPMWT\GP$CPF$9-)-1'- ++



/KNKV·T8GTFKGPUVQTFGP -TGW\  -NCUUG OKV 5EJYGTVGTP    #WUHÒJTWPI 4CPF CWH FGO   4GXGTUFGUWPVGTGP-TGW\CTOGUGVYCUDTGKVGT #PHGTVKIWPIFGT(KTOC9GKUU%Q5KNDGT VGKNYGKUGXGTIQNFGVGOCKNNKGTVOKPQDGTHN·EJNKEJGT'OCKNNGEJKRCWHFGO#XGTUFGUWPVGTGP-TGW\CTOU CWHFGO4GXGTUFGT#ITCHHG*GTUVGNNGTRWP\G9%QFGT(KTOC9GKUUWPFGT5KNDGTRWP\GCOUEJOC NGPMWT\GP$CPF$9-)-1'- +p++




DEUTSCHE STAATEN

8042

8039 8038





/KNKV·T8GTFKGPUVMTGW\ FGU /KNKV·T8GTFKGPUVQTFGPU  /QFGNN   UR·VGTG <YGKVCPHGTVK   IWPI EQR[ FGU-TGW\GU-NCUUGOKV-TQPGWPF5EJYGTVGTP$TQP\GXGTIQNFGV8QTFGTUGKVGPOGFCKNNQP NCEMKGTVCO$CPFKO'VWKXQP.GUGTOKVJCPFUEJTKHVNKEJIG·PFGTVGT-NCUUGP\CJN ++



/KNKV·T8GTFKGPUVMTGW\ FGU /KNKV·T8GTFKGPUVQTFGPU  /QFGNN   -TGW\  -NCUUG OKV   5EJYGTVGTP $TQP\G XGTIQNFGV #XGTU WPF 4GXGTUOGFCKNNQPU )QNF   #XGTUOGFCKNNQP OGJTVGKNKI    GOCKNNKGTV OKP QDGTHN·EJNKEJGT %JKR KP FGT YGK­GP 'OCKNNG KO $CPFTKPI RWP\KGTV 9% QJPG $CPF   $9-)-'- 4++



'KPGUFGTYGPKIGPQTKIKPCNGP#PHGTVKIWPIGP







/KNKV·T8GTFKGPUVMTGW\ FGU /KNKV·T8GTFKGPUVQTFGPU  /QFGNN   -TGW\  -NCUUG OKV   5EJYGTVGTP $TQP\G XGTUKNDGTV #XGTUOGFCKNNQP GOCKNNKGTV OKV MWT\GO CNVGP $CPF $9-    )-1'- ++



/KNKV·T8GTFKGPUVMTGW\ FGU /KNKV·T8GTFKGPUVQTFGPU  /QFGNN   -QPXQNWV XQP XKGT 'Z   GORNCTGPZ-NCUUGOKV5EJYGTVGTP$TQP\GFCXQP\YGKXGTMWRHGTV\YGKCO$CPFZ-NCUUG OKV -TQPG WPF 5EJYGTVGTP $TQP\G XGTMWRHGTV \WUCOOGP CP ITQ­GT INCVVGT GT 1TFGPUUEJPCNNG OKV   'KUGTPGO -TGW\ #WUICDG  -TGW\ ++ -NCUUG <CTIG 5KNDGT KO $CPFTKPI RWP\KGTV -#$   #P0CFGN 5VÒEM++



<KXKNXGTFKGPUVOGFCKNNG/QFGNN OKV+PUEJTKHV%*74(ª456<72(#.<$#+'40  $TQP\GCDUEJNCIFGT/GFCKNNGWPIGJGPMGNV ++



5EJÌPGT$GNGIHÒTFKGKO1TKIKPCNPCJG\WPKEJVDGUEJCHHDCTG/GFCKNNG

8043 8044



8045

.GDGPUTGVVWPIUOGFCKNNG 5KNDGT OKV 5VGORGNUEJPGKFGTUKIPCVWT 1 5%*#4(( CO MWT\GP UR·VGTGP   $CPF$9-1'- +p++



*GTXQTTCIGPFGTJCNVGPGU'ZGORNCT



2TKP\TGIGPV.WKVRQNF/GFCKNNG  /GFCKNNGKP5KNDGT5KNDGTCO$CPF1'-

++



.CPFYKTVUEJCHVNKEJG ,WDKN·WOUOGFCKNNG   $TQP\GOGFCKNNG $TQP\G CO CNVGP $CPF $9-    1'- ++

  139


DEUTSCHE STAATEN

8046 (1:1)



/KNKV·T8GTFKGPUVOGFCKNNG D\Y CD   6CRHGTMGKVUOGFCKNNG  /QFGNN OKV 2QTVTCKV XQP -ÌPKI   /CZ + ,QUGRJ  CD    #WUHÒJTWPI MNGKPGTGT -QRH QJPG 5VGORGNUEJPGKFGTUKIPCVWT     EC  5KNDGTPG /GFCKNNG &WTEJOGUUGT  OO 5KNDGT  I QJPG $CPFTKPI WPF QJPG   $CPF$9-1'- 4++p+++



&GWVNKEJIGVTCIGPGULGFQEJ\YGKHGNUHTGKQTKIKPCNGU'ZGORNCT

8049 8047



8048

/KNKV·T8GTFKGPUVOGFCKNNG D\Y CD   6CRHGTMGKVUOGFCKNNG NVGTG 0CEJRT·IWPI MGKP )W­    HÒTFKGITQ­G1TFGPUUEJPCNNG5KNDGTQJPG5VGORGNUEJPGKFGTUKIPCVWTOKV&TCJVÌUGQJPG$CPF +p++



5GJTMNCTGWPFFGWVNKEJGWPFGKPFGWVKICNUUQNEJGGTMGPPDCTG2T·IWPI



8GTFKGPUVMTGW\HÒTHTGKYKNNKIG-TCPMGPRHNGIG  5KNDGTVGKNYGKUGGOCKNNKGTVQJPG$CPF$9- 1'- ++





8GVGTCPGP&GPM\GKEJGP HÒT FKG (GNF\ÒIG  $TQP\G XGTIQNFGV WPF VGKNYGKUG FWPMGNITÒP NCE   MKGTVQJPG$CPF$9-1'- ++



+PFKGUGT'TJCNVWPIPKEJVJ·WHKI\WHKPFGP

8053 (1:1) 8052 (1:1)

8054

8050



/KNKV·T&GPM\GKEJGP HÒT    -TGW\ HÒT 1HHK\KGTG WPF /CPPUEJCHVGP $TQP\G   XGTIQNFGVWPFVGKNYGKUGNCEMKGTVCOCNVGP1TKIKPCNDCPF$9-1'- ++





/KNKV·T&GPM\GKEJGP HÒT    -TGW\ HÒT 1HHK\KGTG WPF /CPPUEJCHVGP \YGK 'ZGORNCTG   GKPGUKP$TQP\GXGTIQNFGVWPFGKPGU$TQP\GQJPG$·PFGT$9-1'- 5VÒEM++





/KNKV·T&GPM\GKEJGP HÒT    /KPKCVWT FGU -TGW\GU HÒT 1HHK\KGTG WPF /CPPUEJCHVGP   $TQP\GXGTIQNFGVWPFVGKNYGKUGNCEMKGTVQJPG$·PFEJGP 4++



#NU/KPKCVWTPKEJVJ·WHKI



/KNKV·T&GPM\GKEJGP HÒT    /KPKCVWT FGU -TGW\GU HÒT 1HHK\KGTG WPF /CPPUEJCHVGP   $TQP\GVGKNYGKUGIGUEJY·T\VCOMWT\GPCNVGP$CPFUVÒEM ++



#NU/KPKCVWTPKEJVJ·WHKI

 140

/KNKV·T&GPM\GKEJGP HÒT    /GFCKNNG FGU /KNKV·T&GPM\GKEJGPU HÒT      HÒT/KNKV·TDGCOVG$TQP\GCOCNVGP1TKIKPCNDCPF$9-1'- 4++




DEUTSCHE STAATEN

8056

8055

8059

8058



&GPM\GKEJGP HÒT FCU ,CJT  #WUHÒJTWPI KP JGNNGT $TQP\G OKV 5VGORGNUEJPGKFGTUKIPCVWT   %81+)6QJPG$CPF$9-1'- ++





&GPM\GKEJGP HÒT FCU ,CJT  #WUHÒJTWPI KP IGFWPMGNVGT $TQP\G OKV 5VGORGNUEJPGKFGTUKIPCVWT   %81+)6COPGWGPPKEJVICP\MQTTGMVGP$CPF$9-1'- ++





&GPM\GKEJGP HÒT FCU ,CJT  #WUHÒJTWPI KP FWPMNGT $TQP\G OKV 5VGORGNUEJPGKFGTUKIPCVWT   %81+)6QJPG$CPFUV·TMGTIGVTCIGPGU'ZGORNCT$9-1'- ++p+++





/KNKV·TKUEJG ,WDKN·WOUOGFCKNNG OKV -TQPG /GFCKNNG OKV FGP ,CJTGU\CJNGP  WPF    XGTIQNFGVCOMWT\GP$CPF$9-1'- ++





$C[GTKUEJGU (NWI\GWIHÒJTGTCD\GKEJGP 5KNDGT JQJN IGRT·IV WPF XGTDÌFGV CWH FGT 4ÒEMUGKVG *GTUVGN   NGTDG\GKEJPWPI FGT (KTOC -CTN 2ÌNNCVJ KP 5EJTQDGPJCWUGP WPF 2WP\G 5+.$'4 CP 0CFGN   $9-1'- ++



8060 8063 8061



&KGPUVCWU\GKEJPWPI-TGW\-NCUUGHÒT&KGPUVLCJTG5KNDGTGOCKNNKGTV#DRNCV\WPIGPKPFGTITÒPGP 'OCKNNGXQP#XGTUWPF4GXGTU$9-1'- 4++p+++





)GFGPMCD\GKEJGP \WO L·JTKIGP ,WDKN·WO FGT -ÌPKIN 2TKX (GWGT5EJÒV\GP )GUGNNUEJCHV \W   #KEJCEJ $TQP\G XGTUKNDGTV CWH FGO 4GXGTU *GTUVGNNGTDG\GKEJPWPI FGT (KTOC2ÌNNCVJKP5EJTQDGPJCW UGPCP6TCIGURCPIG ++





-QPXQNWV XQP  DC[GTKUEJGP #WU\GKEJPWPIGP FGU -ÌPKITGKEJU WPF FGU (TGKUVCCVU W C FGT (GWGT   YGJT FGU 4QVGP -TGW\GU PKEJV VTCIDCT  FCTWPVGT /KNKV·T8GTFKGPUVMTGW\ OKV -TQPG WPF 5EJYGTVGTP   'JTGP\GKEJGPFGU.CPFGUXGTDCPFGUFGT$C[GTKUEJGP(GNFCTVKNNGTKG2TKP\#NHQPU'TKPPGTWPIU\GKEJGP   8GTUEJKGFGPG/GVCNNGVGKNUCP$·PFGTPVGKNUCP0CFGNPKPWPVGTUEJKGFNKEJGP'TJCNVWPIGP 5VÒEM++



$4#705%*9'+)*'4<1)67/ $+5  

*GT\QINKEJ $TCWPUEJYGKIKUEJGT 1TFGP *GKPTKEJ FGU .ÌYGP 4KVVGTMTGW\  -NCUUG     5KNDGT GOCKNNKGTV 'OCKNNGOCNGTGK FTGK #TOG FGU #XGTU TGUVCWTKGTV #DRNCV\WPIGP KP FGT TQVGP 'OCKNNG   FGT-TQPGCOUR·VGTGP$CPF$9-1'- +++

 141


DEUTSCHE STAATEN



8066

8065

8064

(GWGTYGJT'JTGP\GKEJGP 5EJPCNNG HÒT  &KGPUVLCJTG $TQP\G VGKNYGKUG XGTUKNDGTV VGKNYGKUG   XGTIQNFGVCWH$CPFUEJPCNNGOKV0CFGN&C\W5EJPCNNGFGU$TCWPUEJYGKIKUEJGP(GWGTYGJTXGTDCPFGUHÒT  &KGPUVLCJTG $TQP\G VGKNYGKUG XGTUKNDGTV VGKNYGKUG XGTIQNFGV $TQP\G VGKNYGKUG XGTUKNDGTV VGKNYGKUG   XGTIQNFGV$9-1'- ++





&KGPUV\GKEJGPHÒT*QHDGFKGPUVGVG-NCUUG5RCPIGHÒT&KGPUVLCJTG5KNDGTOKV0CFGN$9- 1'- 4++





9CVGTNQQ/GFCKNNG $TQP\G OKV 5VGORGNUEJPGKFGTUKIPCVWT % *·UGNGT OGJTGTG 4CPFMGTDGP OKV   4CPFKPUEJTKHV$'40*.1*&.+0$#6QJPG$CPFTKPIWPFQJPG$CPF$9-/; 1'- ++p+++



8068

8067



9CVGTNQQ/GFCKNNG$TQP\GOKV4GUVXGTIQNFWPIOKV5VGORGNUEJPGKFGTUKIPCVWT%*·UGNGTOKV6T·IGT PCOGPō'4056-1%*(#46ŋCWHFGO4CPFOKVXCTKCPVGTCNVCPIGNÌVGVGT¤UGCOUR·VGTGP$CPF $9-/;1'- ++p+++





9CVGTNQQ/GFCKNNG$TQP\GOKV5VGORGNUEJPGKFGTUKIPCVWT%*·UGNGTUVCTMIGVTCIGP%104*14&6 .+0$#6¤UGUR·VGTGTI·P\VQJPG$CPF$9-/;1'- +++





2CVGPV \WO 5GEQPF .KGWVGPCPV FGT +PHCPVGTKG *GTOCPP $CNVJCUCT (TCP\ /CTKC 5VWV\GT &CVKGTV   $TCWPUEJYGKI  0QXGODGT  OKV 1TKIKPCN7PVGTUEJTKHV *GT\QI 9KNJGNOU WPF 2CRKGT2T·IGUKGIGN   IGHCNVGV ++



8072 8070

8071 Rv.

(4#0-(746)'0'4#.)178'40'/'06   

'JTGPMTGW\ HÒT FKG 1HHK\KGTG FGT .KPKG  $TQP\G VGKNYGKUG IGUEJY·T\V QJPG $CPF $9-   1'- 4++





'JTGPMTGW\ HÒT FKG 1HHK\KGTG FGT .KPKG  $TQP\G VGKNYGKUG IGUEJY·T\V QJPG $CPF $9-   1'- 4++





-TKGIUFGPMOÒP\G HÒT 1HHK\KGTG WPF /CPPUEJCHVGP CWH FGO )GDKGVG FGT 5VCFV  5KNDGTPG   /GFCKNNGCOCNVGP$CPF$9-1'- ++

(4#0-(746(4'+'56#&6   <YGKHGNUHTGKIGRT·IVGU1TKIKPCNGZGORNCT

142




DEUTSCHE STAATEN

8073 (1:1)



8074 (1:1)

8075

-TGW\HÒT::8&KGPUVLCJTGFGT1HHK\KGTG/KPKCVWTZOO$TQP\GXGTIQNFGVQJPG$CPF 4++



(ª456'0$'4)(ª456.+%*'(#/+.' 

)QNFGPG'JTGPPCFGNFGUHÒTUVNKEJGP*CWUGU\W(ÒTUVGPDGTI)QNFVGKNYGKUGGOCKNNKGTVCWHFGT4ÒEM UGKVGRWP\KGTVōŋCP0CFGN ++



&KGUG 'JTGPPCFGNP YGTFGP XQO (ÒTUVGP CP XGTFKGPVG #PIGUVGNNVG FGU HÒTUVNKEJGP *CWUGU PCEJ NCPIGT &KGPUV\GKV   XGTNKGJGPWPFUKPFPCVWTIGO·­UGJTUGNVGP

*#0018'4-74(ª456'067/ $+5 70&-¤0+)4'+%*   

9CVGTNQQ/GFCKNNG#WUHÒJTWPIOKV5VGORGNUEJPGKFGT5KIPCVWT99;105KNDGTOKV4CPFKPUEJTKHV 51.&#62*+.+225%*1'0)4'0#&+'4$#6#+..108'4&'04KPIFWTEJ5EJNÒUUGNTKPIGT UGV\VCOUR·VGTGP$CPF$9-1'- ++p

8077

8076





9CVGTNQQ/GFCKNNG#WUHÒJTWPIOKV5VGORGNUEJPGKFGT5KIPCVWT99;105KNDGTOKV4CPFKPUEJTKHV 51.&#6 %*4+56+#0 ,#*4#0& .#0&9 $#6#+..10 *+.&'5*'+/ ¤UG HGJNV $9-    1'- ++





#NNIGOGKPGU'JTGP\GKEJGPHÒT/KNKV·TXGTFKGPUV5KNDGTPG/GFCKNNGOKV4CPFKPUEJTKHV'*.'45CO MWT\GP$CPF$9-1'- ++





.CPIGPUCN\C/GFCKNNG$TQP\GXGTIQNFGVOKV4CPFKPUEJTKHV9&+'64+%*5COCNVGPVTKCPIWNCTIGHCN VGVGP$CPF$9-1'- ++



8079

8080

(4'+'*#05'56&6')'/'+05#/ 

)GOGKPUCOG -TKGIUFGPMOÒP\G HÒT FKG *CPUGCVKUEJG .GIKQP  5KNDGTPG /GFCKNNG 5KNDGT   COUR·VGTGP$CPF$9-1'- ++



*'55'0 &#4/56#&6  70& $'+ 4*'+0 .#0&)4#(5%*#(6 $+5   70&   )4155*'4<1)67/   

)TQ­JGT\QINKEJGT*CWUWPF8GTFKGPUVQTFGPD\Y CD .WFGYKIU1TFGP/GFCKNNGFGU1TFGPU

CD D\Y CD 8GTFKGPUVOGFCKNNGFGU1TFGPU/QFGNN OKVFGO2QTVTCKVXQP)TQ­JGT\QI .WFYKI+++ 5KNDGTPG/GFCKNNG&'/8'4&+'056'  5KNDGTOKV5VGORGNUEJPGKFGTUK IPCVWT%81+)6CO$CPF$9-1'- 4+p++

 143


DEUTSCHE STAATEN

8081





)TQ­JGT\QINKEJ *GUUKUEJGT 8GTFKGPUV1TFGP 2JKNKRRU FGU )TQ­OÒVJKIGP D\Y )TQ­JGT\QINKEJ   *GUUKUEJGT 2JKNKRRU1TFGP CD    /QFGNN   4KVVGTMTGW\ + -NCUUG )QNF GOCKNNKGTV   FGT.ÌYGCWHFGT4ÒEMUGKVGQJPG$GUEJ·FKIWPIQJPG$CPF$9-1'- +



)TQ­JGT\QINKEJ *GUUKUEJGT 8GTFKGPUV1TFGP 2JKNKRRU FGU )TQ­OÒVJKIGP D\Y )TQ­JGT\QINKEJ   *GUUKUEJGT 2JKNKRRU1TFGP CD    /QFGNN   NGGTGU 'VWK \WO 4KVVGTMTGW\ + -NCUUG   TGEJVGEMKIG#WUHÒJTWPICWUFGT4GIKGTWPIU\GKVXQP)TQ­JGT\QI'TPUV.WFYKI TGIXQPDKU  UEJYCT\OKVIQNFHCTDGPGO9CRRGPCWHFTWEM ++



8083



)TQ­JGT\QINKEJ *GUUKUEJGT 8GTFKGPUV1TFGP 2JKNKRRU FGU )TQ­OÒVJKIGP D\Y )TQ­JGT\QINKEJ   *GUUKUEJGT2JKNKRRU1TFGP CD /QFGNN  4KVVGTMTGW\++-NCUUG5KNDGTGOCKNNKGTV $ÒUVG KO #XGTUOGFCKNNQP )QNF FGT .ÌYG CWH FGT 4ÒEMUGKVG QJPG $GUEJ·FKIWPI CP MTCWUGT   'KPGT1TFGPUUEJPCNNG$9-1'- ++



8086 (1:1)

8087 8084



8085 Rv.

)TQ­JGT\QINKEJ *GUUKUEJGT 8GTFKGPUV1TFGP 2JKNKRRU FGU )TQ­OÒVJKIGP D\Y )TQ­JGT\QINKEJ   *GUUKUEJGT2JKNKRRU1TFGP CD /QFGNN  5KNDGTPGU-TGW\OKV-TQPGWPF5EJYGT VGTP#WUHÒJTWPIOKV.7&18+%75+++CWHFGO4GXGTU/GFCKNNQPTKPI5KNDGTVGKNYGKUGGOCKN NKGTVOKV$CPFUVÒEMKOQTKIKPCNGPIQNFGPDGFTWEMVGP8GTNGKJWPIUGVWK$9-1'- 44++



)TQ­JGT\QINKEJ *GUUKUEJGT 8GTFKGPUV1TFGP 2JKNKRRU FGU )TQ­OÒVJKIGP D\Y )TQ­JGT\QINKEJ   *GUUKUEJGT2JKNKRRU1TFGP CD /QFGNN  5KNDGTPGU-TGW\#WUHÒJTWPIOKV .7&18+%75+++CWHFGO4GXGTU/GFCKNNQPTKPIZOO5KNDGTVGKNYGKUGGOCKNNKGTVQJPG $CPF$9-1'- ++





8GTFKGPUVOGFCKNNG )TQ­JGT\QI .WFYKIU +8 XGTNKGJGP XQP   /KPKCVWT FGT $TQP\GPGP   /GFCKNNG&WTEJOGUUGTOO$TQP\GXGTIQNFGVQJPG$·PFEJGP 4++





#NNIGOGKPGU 'JTGP\GKEJGP  /QFGNN OKV 2QTVTCKV XQP 'TPUV .WFYKI    /GFCKNNG   (ª4.#0),*4+)'64'7'&+'056'5KNDGTQJPG$CPF$9-1'- ++





144


DEUTSCHE STAATEN

8088 Rv.

8090

8089



#NNIGOGKPGU 'JTGP\GKEJGP  /QFGNN OKV 2QTVTCKV XQP 'TPUV .WFYKI    /GFCKNNG   (ª464'7'#4$'+65KNDGTCPMTCWUGT'KPGT$CPFUEJPCNNG$9-1'- ++





#NNIGOGKPGU 'JTGP\GKEJGP  /QFGNN OKV 2QTVTCKV XQP 'TPUV .WFYKI    /GFCKNNG   (ª46#2('4-'+65KNDGTQJPG$CPFKOQMVCIQPCNGPIQNFGPDGFTWEMVGP8GTNGKJWPIUGVWKOKVPKEJV ICP\RCUUGPFGT'KPNCIG &WTEJOGUUGTOO $9-1'- ++



-TKGIU'JTGP\GKEJGP KP 'KUGP 'KUGP IGUEJY·T\V OKV 4GUVXGTIQNFWPI CP 0CFGN $9-  1'-    ++p+++





8091 (1:1)



,WDKN·WOU'TKPPGTWPIU\GKEJGP HÃ&#x2019;T FKG #FLWVCPVWT   #D\GKEJGP KP $TQP\G   XGTIQNFGV   CP0CFGNFKGUGKP(QTOFGU-TCP\GUIGDQIGP$9-1'- 44+p++



.CWV*GUUGPVJCNWPF5EJTGKDGT KP*550T UKPFPWT'ZGORNCTGFKGUGU#D\GKEJGPUXGTNKGJGPYQTFGP

8092

8095



/KNKV·TFKGPUV'JTGP\GKEJGP-TGW\HÃ&#x2019;T&KGPUVLCJTGFGT7PVGTQHHK\KGTGWPF5QNFCVGP#WUHÃ&#x2019;JTWPI OKVCTCDKUEJGP<KHHGTP  5KNDGTQJPG$CPF$9-1'- ++





'TPGPPWPIU7TMWPFG \WO 2TQHGUUQT HÃ&#x2019;T FGP 1DGTNGJTGT ,QUGH (TCP\ CP FGT 1DGTTGCNUEJWNG \W   9QTOU&CVKGTV\W&CTOUVCFVCO5GRVGODGTOKV1TKIKPCNWPVGTUEJTKHV)TQ­JGT\QI'TPUV.WF YKIUWPF2TG­5KGIGN\YGKOCNIGHCNVGV ++



'TPGPPWPIU7TMWPFG \WO 1DGTNGJTGT HÃ&#x2019;T FGP .GJTCOVUCUUGUUQT ,QUGRJ (TCP\ CP FGT 1DGTTGCN   UEJWNG \W 9QTOU &CVKGTV \W &CTOUVCFV CO  1MVQDGT  OKV 1TKIKPCNWPVGTUEJTKHV )TQ­JGT\QI   'TPUV.WFYKIUWPF2TG­5KGIGN'KPTK­KO5KGIGNTÃ&#x2019;EMUGKVKIGU2CRKGTHGJNGPF\YGKOCNIGHCNVGV ++





*'55'0 *1/$74) .#0&)4#(5%*#(6 $+5  

(GNFFKGPUV\GKEJGP$TQP\GCP6TCIGUEJPCNNG$9-1'-

4++

 145


DEUTSCHE STAATEN

8096 (1:1)

*'55'0 -#55'.  .#0&)4#(5%*#(6 $+5  70&  $+5   70&   -74(ª456'067/   

*CWU1TFGPXQO)QNFGPGP.ÌYGP/QFGNN OGJTMNCUUKI $TWUVUVGTP\WO)TQ­MTGW\ 5KNDGT /GFCKNNQP )QNF 4GXGTU VGKNYGKUG XGTDÌFGV CP 0CFGN KO QMVCIQPCNGP 1TKIKPCNGVWK GKP 8GT   UEJNW­J·MEJGPHGJNGPFOKVGKPNKGIGPFGOJCPFUEJTKHVNKEJGP<GVVGNYQTCWHCWHFGP-WTHÒTUVNKEJGP)GPG TCNNGWVPCPV(TGKJGTTPX*C[PCW$G\WIIGPQOOGPYKTF$9-1'- 4++  W­GTUV SWCNKV·VUXQNNG #PHGTVKIWPI CWU FGO GTUVGP &TKVVGN FGU  ,CJTJWPFGTVU WPF KO 1TKIKPCNGVWK DGUQPFGTU   UGNVGP9KNJGNO%CTN(TGKJGTTXQP*C[PCW  GKPPCVÒTNKEJGT5QJPFGU-WTHÒTUVGP9KNJGNO+XQP*GUUGP

  WPF FGUUGP \YGKVGT /·VTGUUG 4QUC &QTQVJGC 4KVVGT   YCT )GPGTCNNGWVPCV WPF YWTFG    1DGTDGHGJNUJCDGT FGU MWTJGUUKUEJGP /KNKV·TU 5GKP 5QJP (TKGFTKEJ 9KNJGNO -CTN 'FWCTF XQP *C[PCW     UEJNWI GDGPHCNNU GKPG OKNKV·TKUEJG -CTTKGTG GKP WPF DTCEJVG GU DKU \WO MWTJGUUKUEJGP -TKGIUOKPKUVGT   WPF   )GPGTCNNGWVPCPV  )GPGTCNNGWVPCPV9KNJGNO%CTN(TGKJGTTXQP*C[PCWYWTFGCO,CPWCT)TQ­MTGW\FGU *CWU1TFGPU XQO )QNFGPGP .ÌYGP UGKP 5QJP (TKGFTKEJ 9KNJGNO %CTN YQJN GTUV PCEJ  #WH YGNEJGP FGT   DGKFGP IGPCPPVGP UKEJ FGT 6GZV FGU <GVVGNU DG\KGJV MQPPVG NGKFGT PKEJV HGUVIGUVGNNV YGTFGP 8QP  DKU    YWTFGP)TQ­MTGW\GFGU1TFGPUXGTNKGJGP

8097 (1:1)



*CWU1TFGPXQO)QNFGPGP.ÌYGP/QFGNN OGJTMNCUUKI 4KVVGTMTGW\)QNFGOCKNNKGTV CWHFGT4ÒEMUGKVGKO/QPQITCOOOGJTGTGMNGKPG NGKEJVTGUVCWTKGTDCTG 'OCKNNGCWUDTÒEJGQJPG$CPF KOQTKIKPCNGP8GTNGKJWPIUGVWK$9-1'- 4++++  &GT 7PVGTUEJKGF \YKUEJGP FGP XQNNMQOOGP INGKEJ CWUUGJGPF GTUEJGKPGPFGP 4KVVGTMTGW\GP FGU *CWU1TFGPU XQO   )QNFGPGP.ÌYGPXQPDKUWPFFGU9KNJGNO1TFGPUXQPDKUNKGIVKO2TKP\KRKPFGT&CTUVGNNWPI FGU .ÌYGP KO 8QTFGTUGKVGP/GFCKNNQP $GKO GTUVGTGP KUV FGT .ÌYG JGTCNFKUEJ UVGKIGPF FCTIGUVGNNV F J FKG GKPG   *KPVGTRHQVGKUVJÌJGTFCTIGUVGNNVCNUFKGCPFGTG*KPVGTRHQVGDGKOCPFGTGPGTUEJGKPVFGT.ÌYGJGTCNFKUEJUEJTGKVGPF FJDGKFG2HQVGPUKPFKPINGKEJGT*ÌJGFCTIGUVGNNV#NNGTFKPIUMQPPVGKP\YKUEJGPPCEJIGYKGUGPYGTFGPFC­CWEJ 4KVVGTMTGW\GFKGWTURTÒPINKEJHÒTFGP*CWU1TFGP8GTYGPFWPIHCPFGPUR·VGTCNU4KVVGTMTGW\GFGU9KNJGNO1TFGPU XGTNKGJGP YQTFGP UKPF8QP  DKU  UKPF KPUIGUCOV PWT  4KVVGTMTGW\G XGTNKGJGP YQTFGP YQXQP CDGT FKG   CNNGTOGKUVGPPCEJFGO6QFFGT$GNKGJGPGP\WTÒEMIGIGDGPYQTFGPUGKPFÒTHVGP

146


DEUTSCHE STAATEN

8098

8099

8100

8101

8102



-TKGIUFGPMOÒP\G/GFCKNNGHÒT-·ORHGTOKV4CPFRT·IWPICOCNVGP1TKIKPCNDCPF$9- 1'- ++





&KGPUVCWU\GKEJPWPIHÒT1HHK\KGTG-TGW\HÒT&KGPUVLCJTG5KNDGTXGTIQNFGVCOCNVGP1TKIKPCNDCPF $9-1'- ++



(ª456'06ª/'4 $+5   *1*'0<1..'40*'%*+0)'0 70& *1*'0   <1..'405+)/#4+0)'0 70& (ª456.+%*' (#/+.+' 810 *1*'0<1.   .'40 5+)/#4+0)'0  

(ÒTUVNKEJ*QJGP\QNNGTPUEJGU'JTGP\GKEJGP  D\Y(ÒTUVNKEJGT*CWUQTFGPXQP*QJGP\QN NGTP UGKV    /QFGNN OKV XQP GKPGT (ÒTUVGPMTQPG ÒDGTJÌJVGO GKPHCEJGP 9CRRGPUEJKNF  UGKV    'JTGPMTGW\-NCUUGUR·VG#PHGTVKIWPICWUFGT4GIKGTWPIU\GKVFGT(ÒTUVGP9KNJGNO TGI DKU   QFGT (TKGFTKEJ TGI  DKU   OKV GKPVGKNKIGP /GFCKNNQPU 5KNDGT VGKNYGKUG GOCKNNKGTV   MCWO UKEJVDCTG 4GRCTCVWTGP KP FGT UEJYCT\GP WPF DNCWGP 'OCKNNG CO QTKIKPCNGP $CPF $9-    1'- ++



5R·VGPKEJVJ·WHKIG#PHGTVKIWPICWUFGOGTUVGPQFGT\YGKVGP&TKVVGNFGU,CJTJWPFGTVUFKGWPVGT(ÒTUV9KNJGNO XQPDKUPWTOCNWPFWPVGT(ÒTUV(TKGFTKEJXQPDKUPWTOCNXGTNKGJGPYQTFGPKUV.CWV .KPMWPF)CWIIGN KP.0-5H KUVFCU'JTGPMTGW\-NCUUGXQPDKU WPVGT(ÒTUV%CTN#PVQPWPF (ÒTUV(TKGFTKEJ9KNJGNO%QPUVCPVKP OCNXQPDKU WPVGT(ÒTUV%CTN#PVQPCNNGKP OCNXQP DKU WPVGT(ÒTUV.GQRQNF OCNXQPDKU WPVGT(ÒTUV9KNJGNO OCNWPFXQPDKU

WPVGT(ÒTUV(TKGFTKEJ OCNCNUQXQPDKUKPUIGUCOVOCNXGTNKGJGPYQTFGP



(ÒTUVNKEJ*QJGP\QNNGTPUEJGU'JTGP\GKEJGP  D\Y(ÒTUVNKEJGT*CWUQTFGPXQP*QJGP\QN NGTP UGKV /QFGNN UGKV OO/KPKCVWTFGU-TGW\GU-NCUUGOKV5EJYGTVGTP$TQP\G XGTUKNDGTVVGKNYGKUGXGTIQNFGVCP4GXGTUPCFGN ++



#NU#PUVGEMOKPKCVWTUGNVGP\WHKPFGP

.+22'5%*'(ª456'06ª/'4)'/'+05#/ 

'JTGPMTGW\ FGU (ÒTUVNKEJ.KRRKUEJGP)GUCOVJCWUGU  D\Y(ÒTUVNKEJ.KRRKUEJGU'JTGP MTGW\   D\Y (ÒTUVNKEJ .KRRKUEJGT *CWUQTFGP    /QFGNN CWH FGT 4ÒEM   UGKVGFCU/QPQITCOO.# 'JTGPMTGW\-NCUUG#WUHÒJTWPI  #PHGTVKIWPI FGT (KTOC , )QFGV  5QJP KP $GTNKP   5KNDGT VGKNYGKUG ITCXKGTV VGKNYGKUG XGTIQNFGV WPF   GOCKNNKGTV MCWO UKEJVDCTG 'OCKNNGTGRCTCVWT KO XQTFGTUGKVKIGP /GFCKNNQPTKPI CO PGWGP $CPF $9-   1'-5-CC ++



#WHITWPFFGT#WUHÒJTWPIFGU$NÒVGP\GPVTWOU HÒPH\CEMKIGT5VGTPITCXKGTVVGKNYGKUGGOCKNNKGTV N·­VUKEJWP\YGKHGN JCHVFKG(KTOC,)QFGV5QJPKP$GTNKPCNU*GTUVGNNGTKFGPVKHK\KGTGPFKGFCU-TGW\CWEJGPVYQTHGPWPFNCWV5EJYCTM

KP5-5 CWEJPWTXQPDKUJGTIGUVGNNVJCV&CFCU-TGW\KPFKGUGT)GUVCNVWPIGTUV\WO'JTGP MTGW\-NCUUGYWTFGJCPFGNVGUUKEJJKGTDGK\YGKHGNNQUWOGKP'JTGPMTGW\FGT-NCUUGKPFGT#WUHÒJTWPIXQP DKUKPGKPGT*GTUVGNNWPIDKU.CWV5EJYCTM KP5-5 UKPFKP.KRRGXQO0QXGODGTDKU  #RTKN  PWT  'JTGPMTGW\G  -NCUUG XGTNKGJGP YQTFGP FKG UEJCWODWTINKRRKUEJGP 8GTNGKJWPIGP KO INGK   EJGP<GKVTCWOUKPFPKEJVIGPCWDGMCPPVFÒTHVGPCDGTPKEJVJÌJGTUQPFGTPGJGTPQEJIGTKPIGTIGYGUGPUGKP5QOKV FÒTHVGFKG)GUCOV\CJNFGTXQP)QFGVJGTIGUVGNNVGP'ZGORNCTGFGU'JTGPMTGW\GU-NCUUGKPFGTGTUVGP#WUHÒJTWPI DGKFGWVNKEJWPVGTIGNGIGPJCDGP  &CU 'JTGPMTGW\ YWTFG CO  1MVQDGT  XQP .GQRQNF +++ (ÒTUV \WT .KRRG   WPF #FQNRJ + )GQTI    (ÒTUV\W5EJCWODWTI.KRRG  CNUIGOGKPUCOGT*CWUQTFGPOKV5VGTPWPF%QTFQPHÒTDGKFG.CPFGUJGTTGP -NCUUGPWPFCHHKNKKGTVG\YGKUVWHKIG8GTFKGPUVOGFCKNNGIGUVKHVGV#O#RTKNGTHQNIVGFKG7ODGPGPPWPIFGT 8GTFKGPUVOGFCKNNG KP 'JTGP\GKEJGP 8QO  5GRVGODGT  DKU 0QXGODGTYWTFGFKG-NCUUGKP\YGK 5VWHGP OKVWPFQJPG-TQPG XGTNKGJGP#O0QXGODGTYWTFGPYGKVGTGPFGTWPIGPFGMTGVKGTVFKGDKUJGTKIG  -NCUUG OKV -TQPG YWTFG  -NCUUG PGW IGUVKHVGV YWTFG GKPG  -NCUUG OKV 'KEJGPNCWD FKG DKUJGTKIG  -NCUUG   QJPG -TQPG YWTFG  -NCUUG FKG DKUJGTKIG  -NCUUG YWTFG  WPF FKG DKUJGTKIG  YWTFG  #PUVGNNG FGT   'JTGP\GKEJGPYWTFGGKP\YGKUVWHKIGU8GTFKGPUVMTGW\GKPIGHÒJTV(ÒT#WU\GKEJPWPIKO-TKGIYWTFGPFKG 'JTGPMTGW\GOKV5EJYGTVGTP FWTEJFKG/KVVG XGTNKGJGP+PFGP,CJTGPWPFGTHQNIVGP8GTNGKJWPIGPFGT  WPF FGT  -NCUUG OKV 5EJYGTVGTP CO 4KPI #O  #RTKN  YWTFG FGT 1TFGP \YKUEJGP FGP DGKFGP   (ÒTUVGPVÒOGTPCWHIGVGKNV

147


DEUTSCHE STAATEN

8103 (1:1)

.+22' &'6/1.& (ª456'067/ $+5  

&GPMOÒP\G CP FGP GTUVTKVVGP 6JTQPCPURTWEJ  $TQP\G XGTIQNFGV CP 'KPGT$CPFUEJPCNNG OKV   PKEJV ICP\ MQTTGMVGO $CPF FGT DCFKUEJGP 4GIKGTWPIULWDKN·WOUOGFCKNNG   $9-    1'- 4+p++ .CWV5EJYCTM KP5-5 UKPFEC'ZGORNCTGKPFGT/GFCKNNGP/ÒP\G4KEJCTF&KNNGTKP&TGUFGPJGTIGUVGNNV YQTFGPYQXQP\YKUEJGPWPF5VÒEMXGTNKGJGPYWTFGP



8104 8105

5%*#7/$74).+22'(ª456'067/ $+5  

/KNKV·T8GTFKGPUVOGFCKNNG  /QFGNN   5KNDGTPG /GFCKNNG OKV )GPHGT -TGW\ 5KNDGT   CO$CPFOKV#WHNCIG5KNDGTVGKNYGKUGGOCKNNKGTV$9- ++



/'%-.'0$74)5%*9'4+0 *'4<1)67/ $+5   70& )4155*'4<1)   67/   

8GTFKGPUVOGFCKNNG#WUHÒJTWPIWPVGT(TKGFTKEJ(TCP\+8 UQXGTNKGJGPXQP 5KNDGTPG/G FCKNNG5KNDGTNGKEJVG4CPFFGNNGQJPG$CPF1'- ++

8106

8107



-TKGIUFGPMOÒP\GHÒT  $TQP\GCOCNVGP1TKIKPCNDCPF$9-



/GFCKNNG \WT 'TKPPGTWPI CP FKG (GKGTNKEJMGKVGP CWU #PNC­ FGU 'KPJWPFGTVL·JTKIGP $GUVGJGPU FGT   /GEMNGPDWTIKUEJGP#TVKNNGTKGKO,CJTG$TQP\GXGTUKNDGTVCOPGWGP$CPF75 ++

++

+O ,CJTG  GTTKEJVGVG (TKGFTKEJ (TCP\ + *GT\QI \W CD  )TQ­JGT\QI XQP  /GEMNGPDWTI5EJYGTKP FCU   *GT\QINKEJG CD)TQ­JGT\QINKEJG /GEMNGPDWTIKUEJG#TVKNNGTKGMQTRUCWUFGOFCU\WO+:#TOGGMQTRU IGJÌTGPFG WPF KP 5EJYGTKP UVCVKQPKGTVG )TQ­JGT\QINKEJ /GEMNGPDWTIKUEJG (GNFCTVKNNGTKG4GIKOGPV 0T  IGDKNFGV   YWTFG<WOL·JTKIGP,WDKN·WOFGU$GUVGJGPUFGT/GEMNGPDWTIKUEJGP#TVKNNGTKGUVKHVGVGFGT%JGHFGU4GIKOGPVU )TQ­JGT\QI(TKGFTKEJ(TCP\+8  FKGUG/GFCKNNG

148



 


DEUTSCHE STAATEN

8108

1.&'0$74)*'4<1)67/ $+5 70&)4155*'4<1)67/   

)TQ­JGT\QINKEJ 1NFGPDWTIGT *CWU WPF 8GTFKGPUVQTFGP FGU *GT\QIU 2GVGT (TKGFTKEJ .WFYKI   5R·VGTG #PHGTVKIWPI CWU FGP GT ,CJTGP  FGT 1TFGPUMQNNCPG FGU  6[RU DGUVGJGPF CWU   /QPQITCOO/GFCKNNQPGKPGO5EJNW­ FKGUGURWP\KGTV%12; WPFGKPGO*·PIGINKGFLGYGKNU 5KNDGTIW­ XGTIQNFGV VGKNYGKUG GOCKNNKGTV VGKNYGKUG OKV 'OCKNNGOCNGTGK OKV UR·VGTGT #PHGTVKIWPI CWU   FGPGT,CJTGP FGU-NGKPQFU)QNFJQJNIGHGTVKIVGOCKNNKGTVI'OCKNNGOCNGTGKKO6TCIGTKPI RWP\KGTV %12; WPF UR·VGTGT #PHGTVKIWPI CWU FGPGT,CJTGP FGU$TWUVUVGTPU5KNDGTVGKNYGKUG XGTIQNFGVWPFGOCKNNKGTVCP0CFGNFKGUGRWP\KGTV-0#7'4WPFCWHFGT7PVGTUGKVG%12;KOUGJT CWHYGPFKIIGCTDGKVGVGP OÌINKEJGTYGKUGQTKIKPCNGP OKVIQNFHCTDGPGO9CRRGPDGFTWEMVGP'VWK  5VÒEM++  5GJTUEJÌPGT'TUCV\HÒTGKPKO1TKIKPCNPWTUGJTUEJYGTDGUEJCHHDCTGU'PUGODNG

8109



)TQ­JGT\QINKEJ 1NFGPDWTIGT *CWU WPF 8GTFKGPUVQTFGP FGU *GT\QIU 2GVGT (TKGFTKEJ .WFYKI   5R·VGTG#PHGTVKIWPI CWUFGPGT,CJTGP FGU)TQ­MTGW\GUOKVFGTIQNFGPGP-TQPGOKV5EJYGTVGTP WPF OKV .QTDGGT 5KNDGT XGTIQNFGV WPF GOCKNNKGTV 'OCKNNGOCNGTGK KO $CPFTKPI RWP\KGTV %12; CO   UR·VGTGP5EJWNVGTDCPF ++ 5GJT UEJÌPG 5COONGTCPHGTVKIWPI FKGUGU KO 1TKIKPCNPKEJVDGUEJCHHDCTGP'ZGORNCTU&CU1TKIKPCNYWTFGNCWV$G[ TGK­ KP$;15H PWTGKPGKP\KIGUOCNCPFGPRTGW­KUEJGP)GPGTCNHGNFOCTUEJCNN2CWNXQP$GPGEMGPFQTHHWPFXQP *KPFGPDWTIXGTNKGJGPWPF\YCTCO1MVQDGT



149


DEUTSCHE STAATEN

8112 8110







8111

)TQ­JGT\QINKEJ 1NFGPDWTIGT *CWU WPF 8GTFKGPUVQTFGP FGU *GT\QIU 2GVGT (TKGFTKEJ .WFYKI   5R·VGTG#PHGTVKIWPI CWUFGPGT,CJTGP GKPGU)TQ­MTGW\UCV\GUOKVFGTUKNDGTPGP-TQPGDGUVGJGPF CWU UR·VGTG #PHGTVKIWPI CWU FGP GT ,CJTGP  FGU -NGKPQFU 5KNDGT GOCKNNKGTV 'OCKNNGOCNGTGK KO   $CPFTKPI RWP\KGTV %12; QJPG5EJWNVGTDCPFWPFUR·VGTGT#PHGTVKIWPI CWUFGPGT,CJTGP FGU $TWUVUVGTPU 5KNDGT VGKNYGKUG GOCKNNKGTV CP 0CFGN FKGUG RWP\KGTV -0#7'4 WPF CWH FGT 7PVGTUGKVG   %12; 5VÒEM++



)TQ­JGT\QINKEJ 1NFGPDWTIGT *CWU WPF 8GTFKGPUVQTFGP FGU *GT\QIU 2GVGT (TKGFTKEJ .WFYKI   5R·VGTG #PHGTVKIWPI CWU FGP GT ,CJTGP  GKPGU )TQ­MTGW\UCV\GU OKV FGT UKNDGTPGP -TQPG WPF OKV   5EJYGTVGTPDGUVGJGPFCWUUR·VGTG#PHGTVKIWPI CWUFGPGT,CJTGP FGU-NGKPQFU5KNDGTGOCKNNKGTV OKP 'OCKNNGEJKR CWH GKPGO -TGW\CTO 'OCKNNGOCNGTGK KO $CPFTKPI RWP\KGTV %12; CO UR·VGTGP   5EJWNVGTDCPFWPFUR·VGTGT#PHGTVKIWPI CWUFGPGT,CJTGP FGU$TWUVUVGTPU5KNDGTVGKNYGKUGGOCKN NKGTVCP0CFGNFKGUGRWP\KGTV-0#7'4WPFCWHFGT7PVGTUGKVG%12; 5VÒEM++



)TQ­JGT\QINKEJ 1NFGPDWTIGT *CWU WPF 8GTFKGPUVQTFGP FGU *GT\QIU 2GVGT (TKGFTKEJ .WFYKI   5R·VGTG#PHGTVKIWPI CWUFGPGT,CJTGP FGU)TQ­MTGW\GUOKVFGTUKNDGTPGP-TQPGOKV5EJYGTVGTP WPFOKV.QTDGGT5KNDGTXGTIQNFGVWPFGOCKNNKGTV'OCKNNGOCNGTGKKO$CPFTKPIRWP\KGTV%12;QJPG 5EJWNVGTDCPF ++



5GJT UEJÌPG 5COONGTCPHGTVKIWPI FKGUGU KO 1TKIKPCNPKEJVDGUEJCHHDCTGP'ZGORNCTU&CU1TKIKPCNYWTFGNCWV$G[ TGK­ KP $;1 5 H  PWT GKP GKP\KIGU OCN XGTNKGJGP WPF \YCT CO  1MVQDGT  CP FGP RTGW­KUEJGP 'TUVGP   )GPGTCNSWCTVKGTOGKUVGT'TKEJ.WFGPFQTHH

150


DEUTSCHE STAATEN

8115

8113

8116









)TQ­JGT\QINKEJ 1NFGPDWTIGT *CWU WPF 8GTFKGPUVQTFGP FGU *GT\QIU 2GVGT (TKGFTKEJ .WFYKI   5R·VGTG #PHGTVKIWPI CWU FGP GT ,CJTGP  GKPGU )TQ­MTGW\UCV\GU OKV FGT UKNDGTPGP -TQPG WPF OKV   5EJYGTVGTPCO4KPIDGUVGJGPFCWUUR·VGTG#PHGTVKIWPI CWUFGPGT,CJTGP FGU-NGKPQFU5KNDGT GOCKNNKGTVOKP'OCKNNGEJKRCWHGKPGO-TGW\CTO'OCKNNGOCNGTGKKO$CPFTKPIRWP\KGTV%12;CO UR·VGTGP 5EJWNVGTDCPF WPF UR·VGTGT #PHGTVKIWPI CWU FGP GT ,CJTGP  FGU $TWUVUVGTPU 5KNDGT VGKN   YGKUGGOCKNNKGTVCP0CFGNFKGUGRWP\KGTV-0#7'4WPFCWHFGT7PVGTUGKVG%12; 5VÃ&#x2019;EM++



)TQ­JGT\QINKEJ 1NFGPDWTIGT *CWU WPF 8GTFKGPUVQTFGP FGU *GT\QIU 2GVGT (TKGFTKEJ .WFYKI   1TKIKPCNGUCNVGUMQPHGMVKQPKGTVGU5EJWNVGTDCPFHÃ&#x2019;TFCU)TQ­MTGW\-NGKPQF\WO'KPJ·PIGPQJPG-NGKPQF ++



)TQ­JGT\QINKEJ 1NFGPDWTIGT *CWU WPF 8GTFKGPUVQTFGP FGU *GT\QIU 2GVGT (TKGFTKEJ .WFYKI   5R·VGTG #PHGTVKIWPI CWU FGP GT ,CJTGP  GKPGU 1HHK\KGTUMTGW\GU 5KNDGT VGKNYGKUG XGTIQNFGV WPF   GOCKNNKGTVCP0CFGNFKGUGRWP\KGTV$-0#7'4WPF%12; ++



)TQ­JGT\QINKEJ 1NFGPDWTIGT *CWU WPF 8GTFKGPUVQTFGP FGU *GT\QIU 2GVGT (TKGFTKEJ .WFYKI   5R·VGTG #PHGTVKIWPI CWU FGP GT ,CJTGP  GKPGU 1HHK\KGTUMTGW\GU OKV 5EJYGTVGTP 5KNDGT VGKNYGKUG   XGTIQNFGVWPFGOCKNNKGTVCP0CFGNFKGUGRWP\KGTV$-0#7'4WPF%12; ++



8118 (1:1) 8117





)TQ­JGT\QINKEJ 1NFGPDWTIGT *CWU WPF 8GTFKGPUVQTFGP FGU *GT\QIU 2GVGT (TKGFTKEJ .WFYKI   5R·VGTG #PHGTVKIWPI CWU FGP GT ,CJTGP  GKPGU 1HHK\KGTUMTGW\GU OKV 5EJYGTVGTP Ã&#x2019;DGT FGO -TGW\   5KNDGTVGKNYGKUGXGTIQNFGVWPFGOCKNNKGTVCP0CFGNFKGUGRWP\KGTV$-0#7'4WPF%12; ++



)TQ­JGT\QINKEJ 1NFGPDWTIGT *CWU WPF 8GTFKGPUVQTFGP FGU *GT\QIU 2GVGT (TKGFTKEJ .WFYKI   4KVVGTMTGW\-NCUUG)QNFGOCKNNKGTVIHGKPUVG'OCKNNGOCNGTGKKO$CPFTKPIRWP\KGTV-0#7'4 OKVUR·VGTGO$CPFKOCNVGP1TKIKPCNGVWK$9-1'- +p++  .CWV$G[TGK­ KP$;15D\Y5H UKPFXQO4KVVGTMTGW\-NCUUGXQPDKU XQTDGJCNVNKEJHGJNGP FGT 7PVGTNCIGP HÃ&#x2019;T    WPF   PWT  4KVVGTMTGW\G-NCUUGJGTIGUVGNNVWPFDKUPCEJ XGTNKGJGPYQTFGP

151


DEUTSCHE STAATEN

8120

8119



)TQ­JGT\QINKEJ 1NFGPDWTIGT *CWU WPF 8GTFKGPUVQTFGP FGU *GT\QIU 2GVGT (TKGFTKEJ .WFYKI   4KVVGTMTGW\  -NCUUG OKV UR·VGTGP #PHGTVKIWPIGP FGT GT ,CJTG  5EJYGTVGTP FKGUG IGIQUUGP WPF   XGTNÌVGV )QNFGOCKNNKGTVIHGKPUVG'OCKNNGOCNGTGKOKVUR·VGTGO$CPFKOCNVGP1TKIKPCNGVWK ++



<YGKHGNUHTGKGU1TKIKPCN'ZGORNCTGKPGU4KVVGTMTGW\GU-NCUUGFCULGFQEJ\WOCPKRWNCVKXGP<YGEMGPKPFGPGT ,CJTGP OKV IGIQUUGPGP 5EJYGTVGTP CWHIGTÒUVGV YQTFGP KUV 1TKIKPCNG 5EJYGTVGT'ZGORNCTG UKPF XQP CNNGTITÌ­VGT   5GNVGPJGKVFCNCWV$G[TGK­ KP$;15D\Y5H XQPDKU XQTDGJCNVNKEJHGJNGPFGT7PVGTNCIGPHÒT WPF PWT4KVVGTMTGW\G-NCUUGJGTIGUVGNNVWPFDKUPCEJPWTXGTNKGJGPYQTFGPUKPF



)TQ­JGT\QINKEJ 1NFGPDWTIGT *CWU WPF 8GTFKGPUVQTFGP FGU *GT\QIU 2GVGT (TKGFTKEJ .WFYKI   5R·VGTG #PHGTVKIWPI CWU FGP GT ,CJTGP  GKPGU 4KVVGTMTGW\GU  -NCUUG OKV FGT UKNDGTPGP -TQPG   5KNDGT GOCKNNKGTV 'OCKNNGOCNGTGK KO $CPFTKPI RWP\KGTV %12; OKV PGWGO $CPF KO CNVGP GVYCU   DGUEJ·FKIVGP1TKIKPCNGVWK ++



8122 8121





)TQ­JGT\QINKEJ 1NFGPDWTIGT *CWU WPF 8GTFKGPUVQTFGP FGU *GT\QIU 2GVGT (TKGFTKEJ .WFYKI   5R·VGTG #PHGTVKIWPI CWU FGP GT ,CJTGP  GKPGT &GMQTCVKQP \WO -CRKVWNCT)TQ­MQOVWT 5KNDGT XGT   IQNFGVGOCKNNKGTV'OCKNNGOCNGTGKKO$CPFTKPIRWP\KGTV%12;CO$CPF ++



)TQ­JGT\QINKEJ 1NFGPDWTIGT *CWU WPF 8GTFKGPUVQTFGP FGU *GT\QIU 2GVGT (TKGFTKEJ .WFYKI   5R·VGTG#PHGTVKIWPI CWUFGPGT,CJTGP GKPGT&GMQTCVKQP\WO-CRKVWNCT-QOVWT5KNDGTXGTIQNFGV GOCKNNKGTV'OCKNNGOCNGTGKKO$CPFTKPIRWP\KGTV%12;CO$CPF ++



8123 (1:1)



)TQ­JGT\QINKEJ 1NFGPDWTIGT *CWU WPF 8GTFKGPUVQTFGP FGU *GT\QIU 2GVGT (TKGFTKEJ .WFYKI   &GMQTCVKQP GKPGU -CRKVWNCT4KVVGTU 5KNDGT #WHNCIGP VGKNYGKUG )QNF GOCKNNKGTV HGKPUVG 'OCKNNGOCNGTGK   CPCNVGTMTCWUGT'KPGT1TFGPUUEJPCNNG$9-1'- ++ <YGKHGNUHTGKGU\GKVIGPÌUUKUEJGU1TKIKPCNGZGORNCTXQPFGONCWV$G[TGK­ KP$;15 KPFGP,CJTGPDKU PWT'ZGORNCTGJGTIGUVGNNVYQTFGPUKPF

152




DEUTSCHE STAATEN

8127 8125

8124

8126



<KXKN8GTFKGPUVOGFCKNNG 5R·VGTG )W­#PHGTVKIWPI CWU FGP GT ,CJTGP  GKPGT )QNFGPGP /GFCKNNG   )QNFIKO4CPFRWP\KGTV%12;OKVPGWGO$CPFUVÃ&#x2019;EMKO'VWK ++





8GTFKGPUVOGFCKNNG HÃ&#x2019;T 4GVVWPI CWU )GHCJT  2T·IWPI   5KNDGT OKV 5VGORGNUEJPGKFGTUK   IPCVWT$4'*/'4(KO*CNUCDUEJPKVVKO4CPFRWP\KGTVCOMWT\GP$CPFUVÃ&#x2019;EM$9- 1'- +p++





4QVG -TGW\/GFCKNNG   5KNDGT XGTIQNFGV VGKNYGKUG GOCKNNKGTV CWH FGT 4Ã&#x2019;EMUGKVG RWP\KGTV    COCNVGP$CPF$9-1'- ++





/KNKV·TXGTFKGPUVOGFCKNNG HÃ&#x2019;T FGP (GNF\WI  5KNDGT QJPG $CPF OKV NCPIGO $CPFTKPI $9-    1'- ++



8129

8130

8128



'TKPPGTWPIUOGFCKNNG HÃ&#x2019;T FKG 8GVGTCPGP XQP  WPF    $TQP\G XGTIQNFGV CO MWT\GP   1TKIKPCN$CPFUVÃ&#x2019;EM$9-1'- ++





'TKPPGTWPIUOGFCKNNG5KNDGTICOPGWGP$CPF$9-1'-





8GTFKGPUVMTGW\ HÃ&#x2019;T #WHQRHGTWPI WPF 2HNKEJVVTGWG  $TQP\G XGTIQNFGV VGKNYGKUG GOCKNNKGTV   QJPG$CPF$9-1'- ++

8131

8132

8133

++



8134



(TKGFTKEJ#WIWUV-TGW\-TGW\-NCUUG$TQP\GNCEMKGTV.CEMKGTWPIVGKNYGKUGCDIGRNCV\VCP0CFGN $9-1'- ++p+++





(TKGFTKEJ#WIWUV-TGW\-TGW\-NCUUG'KUGPNCEMKGTVCWHFGO4GXGTUGKPKIG4QUVURWTGPCP0CFGN OKV\YGK5GKVGPJCMGP$9-1'- ++





&KGPUVCWU\GKEJPWPIFGT)GPFCTOGTKG  -NCUUG-TGW\HÃ&#x2019;T:8+++&KGPUVLCJTG-WRHGTCO $CPF$9-1'- ++





6TGWGMTGW\FGT1NFGPDWTIKUEJGP+PFWUVTKGWPF*CPFGNUMCOOGT6TGWGMTGW\-NCUUG5VGEMMTGW\ $TQP\GXGTIQNFGVWPFGOCKNNKGTVCP0CFGN ++

 153


DEUTSCHE STAATEN

8135 8137





/KPKCVWTGPMGVVEJGP OKV UGEJU #WU\GKEJPWPIUOKPKCVWTGP   1NFGPDWTI *CWU WPF 8GTFKGPUVQTFGP   XQP *GT\QI2GVGT(TKGFTKEJ.WFYKI1HHK\KGTUMTGW\ IGYÌNDVGKPUGKVKIGOCKNNKGTV  1NFGPDWTIFKVQ )QNFGPGU 8GTFKGPUVMTGW\   1NFGPDWTI 1HHK\KGTU&KGPUVCWU\GKEJPWPIUMTGW\ HÒT ::8 &KGPUVLCJTG    2TGW­GP-TQPGP1TFGP-TGW\-NCUUG)QNF $TGOGP*CPUGCVGPMTGW\ /GEMNGPDWTI)TGK HGPQTFGPCP\YGK0CFGNP ++



-QPXQNWVXQPECQNFGPDWTIKUEJGP'JTGPWPF#D\GKEJGP1TKIKPCNGWPF-QRKGPKPXGTUEJKGFGPGP /CVGTKCNKGP CWEJ 5KNDGT  CWEJ GOCKNNKGTV VGKNU CP $·PFGTP VGKNU CP 0CFGNP KP XGTUEJKGFGPGP   'TJCNVWPIGP 5VÒEM++++p+++



24'755'0-¤0+)4'+%*   

4QVGT#FNGT1TFGP/QFGNN OKV\KGIGNTQVGO#FNGT -TGW\-NCUUGOKV5EJYGTVGTP  #WUICDG OKV INCVVGP -TGW\CTOGP    5KNDGT 5EJYGTVGT )QNF IGRT·IV WPF IGUEJTCWDV   VGKNYGKUG GOCKNNKGTV HGKPG 'OCKNNGOCNGTGK QJPG *GTUVGNNGTOCTMKGTWPI CO UR·VGTGP $CPF $9-    1'- ++



7TURTÒPINKEJ  XQP 'TDRTKP\ )GQTI 9KNJGNO XQP $TCPFGPDWTI$C[TGWVJ CNU GKPMNCUUKIGT 1TFGPFGNC5KPEGTKV¾ IGUVKHVGVYWTFGGTPCEJªDGTPCJOGFGT/CTMITCHUEJCHVFWTEJ2TGW­GPÒDGTPQOOGPWPFKO(QNIGPFGPUWM\GU UKXG FWTEJ \CJNTGKEJG PFGTWPIGP 'TI·P\WPIGP WPF 'TYGKVGTWPIGP GTJGDNKEJ CWUIGDCWV 'T XGTHÒIVG CO 5EJNW­   ÒDGT UGEJU -NCUUGP -GVVG )TQ­MTGW\  DKU  -NCUUG  XQP FGPGP FKG\YGKVGKP\YGK5VWHGPWPVGTVGKNVYCTXQP FGPGP FKG +PUKIPKGP OKV \CJNTGKEJGP $GK\GKEJGP 5EJYGTVGT 5EJYGTVGT CO 4KPI $TKNNCPVGP -TQPG 'KEJGPNCWD   ,WDKN·WOU\CJN ,QJCPPKVGTMTGW\ 5EJYGTV WPF 5\GRVGT 'OCKNNGDCPF FGU -TQPGPQTFGPU -QODKPCVKQPGP OÌINKEJ    XGTNKGJGP YGTFGP MQPPVGP YCU \W GKPGT IGTCFG\W WPÒDGTUKEJVNKEJGP #TVGPXKGNHCNV HÒJTVG /KV FGO 'PFG FGT   /QPCTEJKGKUVCWEJFGT1TFGPWPVGTIGICPIGP

8141 (1:1) 8138









8139

8140

8142

4QVGT #FNGT1TFGP  /QFGNN OKV \KGIGNTQVGO #FNGT    -TGW\  -NCUUG  #WUICDG  

OKVIGMÌTPVGP-TGW\CTOGPUGKV 5KNDGTVGKNYGKUGGOCKNNKGTVHGKPG'OCKNNGOCNGTGKCWHFGO4CPF FGUWPVGTGP-TGW\CTOU4KV\OCTMG9CONCPIGPCNVGP1TKIKPCNDCPF$9-1'- ++



4QVGT #FNGT1TFGP  /QFGNN OKV \KGIGNTQVGO #FNGT    -TGW\  -NCUUG  #WUICDG  

OKVIGMÌTPVGP-TGW\CTOGPUGKV 5KNDGTVGKNYGKUGGOCKNNKGTVHGKPG'OCKNNGOCNGTGK/GFCKNNQPHGNF NGKEJV XGTFTGJV QJPG *GTUVGNNGTOCTMKGTWPI CO CNVGP 1TKIKPCNDCPF KO UEJYCT\GP OKV IQNFHCTDGPGO   /QPQITCOODGFTWEMVGP'VWK$9-1'- ++



4QVGT #FNGT1TFGP  /QFGNN OKV \KGIGNTQVGO #FNGT    -TGW\  -NCUUG  #WUICDG  

OKV IGMÌTPVGP -TGW\CTOGP  UGKV   5KNDGT VGKNYGKUG GOCKNNKGTV HGKPG 'OCKNNGOCNGTGK QJPG *GT   UVGNNGTOCTMKGTWPIIGFWPMGNVQJPG$CPFKOTQVGP'VWK$9-1'- ++



4QVGT#FNGT1TFGP/QFGNN OKV\KGIGNTQVGO#FNGT /KPKCVWTFGU-TGW\GU-NCUUG #WUICDG OKVIGMÌTPVGP-TGW\CTOGPUGKV 5KNDGT#XGTUOGFCKNNQP)QNF  VGKNYGKUGGOCKNNKGTV HGKPG'OCKNNGOCNGTGK4GXGTUOGFCKNNQPITCXKGTVCOCNVGP1TKIKPCND·PFEJGP 4++



5GNVGPG·W­GTUVSWCNKV·VUXQNNG,WYGNKGTU'KP\GNCPHGVKIWPICWUFGONGV\VGP8KGTVGNFGU,CJJWPFGTVU

 154

4QVG#FNGT/GFCKNNG/QFGNN  #WUHÒJTWPI OKVIGUEJNQUUGPGT-TQPG -TKGIUOGVCNN CO$CPF$9-1'- ++




DEUTSCHE STAATEN

8143 (1:1)



8144 (1:1)

-ÌPKINKEJGT-TQPGP1TFGP/QFGNN OKVITQ­GTRTGW­KUEJGT-ÌPKIUMTQPGUGKVEC $TWUVUVGTP \WT-NCUUG&WTEJOGUUGTOO5KNDGT/GFCKNNQP)QNFGOCKNNKGTVICP0CFGN$9- 1'- ++



8QP -ÌPKI 9KNJGNO +  CWU #PNC­ UGKPGT -TÌPWPI CO  1MVQDGT  IGUVKHVGV .CWV *ÒUMGP KP *2   5 GTHWJTFKG-TQPGKOXQTFGTUGKVKIGP/GFCKNNQPGKPGGTUVGPFGTWPI XQPGKPGTCNNIGOGKPGPJGTCNFKUEJGP -ÌPKIUMTQPGKPGKPGōMNGKPGŋRTGW­KUEJG-ÌPKIUMTQPG WPFECGKPG\YGKVG XQPFGTōMNGKPGPŋKPFKGōITQ­Gŋ RTGW­KUEJGP-ÌPKIUMTQPG'TXGTHÒIVGÒDGTXKGT-NCUUGPXQPFGPGPFKG\YGKVGKP\YGK5VWHGP OKVWPFQJPG$TWUV UVGTP WPVGTVGKNVYCT&KG+PUKIPKGPMQPPVGPOKV\CJNTGKEJGP$GK\GKEJGP 5EJYGTVGT5EJYGTVGTCO4KPI'KEJGPNCWD $TKNNCPVGP,WDKN·WOU\CJN)GPHGT-TGW\'OCKNNGDCPFFGU4QVGP#FNGT1TFGPU-QODKPCVKQPGPOÌINKEJ XGTNKGJGP YGTFGP YCU ·JPNKEJ YKG DGKO 4QVGP #FNGT1TFGP \W GKPGT ITQ­GP #TVGPXKGNHCNV HÒJTVG /KV FGO 'PFG FGT   /QPCTEJKGKO0QXGODGTKUVCWEJFKGUGT1TFGPWPVGTIGICPIGP



-ÌPKINKEJGT-TQPGP1TFGP/QFGNN OKVITQ­GTRTGW­KUEJGT-ÌPKIUMTQPGKO8QTFGTUGKVGPOGFCKNNQP UGKVEC -TGW\-NCUUG#PHGTVKIWPIFGT(KTOC)QFGVKP$GTNKP)QNFGOCKNNKGTVICWH FGO<[NKPFGT*GTUVGNNGTRWP\G)FGT(KTOC)QFGVCOPGWGP*CNUDCPFCDUEJPKVV$9-1'-  ++



'ZGORNCTGKPGUPKEJVJ·WHKI\WHKPFGPGPFGP*GTUVGNNGTU

8145

8146

8148



-ÌPKINKEJGT -TQPGP1TFGP  /QFGNN OKV ITQ­GT RTGW­KUEJGT -ÌPKIUMTQPG  UGKV EC   -TGW\   -NCUUG$TQP\GXGTIQNFGV/GFCKNNQP)QNFGOCKNNKGTVQJPG$CPF$9-1'- ++





-ÌPKINKEJGT -TQPGP1TFGP  /QFGNN OKV ITQ­GT RTGW­KUEJGT -ÌPKIUMTQPG  UGKV EC   -TGW\   -NCUUG$TQP\GXGTIQNFGV/GFCKNNQP)QNFGOCKNNKGTVQJPG$CPF$9-1'- ++





-TQPGP1TFGP/GFCKNNG  #WUHÒJTWPI -TQPG OKVIGRT·IV WPF CWUIGU·IV  CP 'KPGT$CPFUEJPCNNG   0CFGNHGJNV$9-1'- ++





-ÌPKINKEJGT *CWUQTFGP XQP *QJGP\QNNGTP 4KVVGTMTGW\ OKV 5EJYGTVGTP 5KNDGT XGTIQNFGV WPF   GOCKNNKGTVCWHFGO4CPFFGUWPVGTGP-TGW\CTOU2WP\G9WPF5KNDGTRWP\GCO$CPF$9- 1'- ++

 155


DEUTSCHE STAATEN

8149 8151







8152

8153

-ÌPKINKEJGT *CWUQTFGP XQP *QJGP\QNNGTP 4KVVGTMTGW\ OKV 5EJYGTVGTP 5KNDGT XGTIQNFGV WPF   GOCKNNKGTV-TQPGDGYGINKEJCWHFGO4CPFFGUWPVGTGP-TGW\CTOUGKPIGTKV\V59*CNDOQPF-TQPG   QJPG$CPF$9-1'- ++



-ÌPKINKEJGT *CWUQTFGP XQP *QJGP\QNNGTP 4KVVGTMTGW\ OKV 5EJYGTVGTP 5KNDGT XGTIQNFGV WPF   GOCKNNKGTVCWHFGO4CPFFGUWPVGTGP-TGW\CTOU5KNDGTRWP\G-TQPGWPF5EJYGTVGTHGJNGPOGJTGTG MNGKPG5EJ·FGPQJPG$CPF$9-1'- +8



$CNNG[ $TCPFGPDWTI FGU 4KVVGTNKEJGP 1TFGPU 5V ,QJCPPKU XQO 5RKVCN \W ,GTWUCNGO ,QJCPPKVGT   QTFGP  -TGW\ FGT 4GEJVUTKVVGT $TQP\G XGTIQNFGV WPF GOCKNNKGTV OKP #DURNKVVGTWPIGP KP \YGK   -TGW\URKV\GPGKPG-TGW\URKV\GNGKEJVIGUVCWEJVCONCPIGPIGVTCIGPGP*CNUDCPFKOQTKIKPCNGPUEJYCT \GP8GTNGKJWPIUGVWK1'- ++



)GVTCIGPG#PHGTVKIWPICWUFGO\YGKVGP8KGTVGNFGU,CJTJWPFGTVU



$CNNG[ $TCPFGPDWTI FGU 4KVVGTNKEJGP 1TFGPU 5V ,QJCPPKU XQO 5RKVCN \W ,GTWUCNGO ,QJCPPKVGT   QTFGP  -TGW\ FGT 'JTGPTKVVGT $TQP\G XGTIQNFGV WPF GOCKNNKGTV VGKNYGKUG NCEMKGTV CO IGVTCIGPGP   *CNUDCPFCWHFGP8GTUEJNW­MPÌRHGP*GTUVGNNGTDG\GKEJPWPIFGT(KTOC)QFGV5QJPKP$GTNKP1'-  ++



)GVTCIGPG#PHGTVKIWPICWUFGO\YGKVGP8KGTVGNFGU,CJTJWPFGTVU



$CNNG[ $TCPFGPDWTI FGU 4KVVGTNKEJGP 1TFGPU 5V ,QJCPPKU XQO 5RKVCN \W ,GTWUCNGO ,QJCPPKVGT   QTFGP -TGW\FGT'JTGPTKVVGT$TQP\GXGTIQNFGVWPFGOCKNNKGTVVGKNYGKUGNCEMKGTVCO*CNUDCPFCDUEJPKVV KOYGK­GP8GTNGKJWPIUGVWK1'- ++



)GVTCIGPG#PHGTVKIWPICWUFGO\YGKVGP8KGTVGNFGU,CJTJWPFGTVU

8155 8154



8156

$CNNG[ $TCPFGPDWTI FGU 4KVVGTNKEJGP 1TFGPU 5V ,QJCPPKU XQO 5RKVCN \W ,GTWUCNGO ,QJCPPKVGT   QTFGP  $TWUVMTGW\ FGT 1TFGPUTKVVGT 5KNDGT CWH FGT 4ÒEMUGKVG GT 5KNDGTOCTMG WPF *GTUVGNNGTRWP\G   *,9KO-NGGDNCVVCP3WGTPCFGN ++



5GJTSWCNKV·VUXQNNG#PHGTVKIWPI



#NNIGOGKPGU'JTGP\GKEJGP-TGW\FGU#NNIGOGKPGP'JTGP\GKEJGPU5KNDGT/GFCKNNQPU)QNFCOPKEJV ICP\MQTTGMVGP TÌVNKEJUVCVVIGND $CPF$9-1'- ++





#NNIGOGKPGU'JTGP\GKEJGP'JTGP\GKEJGP-NCUUG/QFGNN5KNDGTOKVQTKIKPCNGO$CPFKO8GT NGKJWPIUGVWKOKVPKEJVICP\RCUUGPFGT'KPNCIG GVYCUMNGKPGTGT&WTEJOGUUGT=ECOO?¤UGPCWUURC TWPI SWGTQXCN WPF ITÌ­GT =EC  OO? CNU PQTOCN  &GEMGNDKPFWPI GVYCU IGNQEMGTV KO ªDGTMCTVQP   OKV#WHFTWEM#NNIGOGKPGU'JTGP\GKEJGP ++



/ÌINKEJGTYGKUGJCPFGNVGUUKEJDGKFGO'VWKWOFCUGKPGTCPFGTGP#WU\GKEJPWPI

156


DEUTSCHE STAATEN

8160 8157

8159

8158



8GTFKGPUVMTGW\ -TGW\ KP )QNF $TQP\G XGTIQNFGV /GFCKNNQPU )QNF CO CNVGP 1TKIKPCNDCPF   $9-1'- ++





8GTFKGPUVMTGW\ -TGW\ KP )QNF $TQP\G XGTIQNFGV /GFCKNNQPU 5KNDGT 8GTIQNFWPI XGTICPIGP  QJPG   $CPF$9-1'- ++





8GTFKGPUVMTGW\ -TGW\ KP 5KNDGT 5KNDGT OKV UR·VGTGO $CPFCDUEJPKVV KO QTKIKPCNGP 8GTNGKJWPIUGVWK   $9-1'- ++



&CU8GTFKGPUVMTGW\KP5KNDGTKUVYGKVCWUUGNVGPGT\WHKPFGPCNUFCULGPKIGKP)QNF



8GTFKGPUV'JTGP\GKEJGP HÒT 4GVVWPI CWU )GHCJT  #WUHÒJTWPI   OKV +PUEJTKHV   ō-1'0+)ŋWPFUGEJU\CEMKIGO5VGTPEJGPÒDGTFGO-QRH 5KNDGTCOUR·VGTGP$CPF24- ++

8162



8163

8161



8GTFKGPUVMTGW\HÒT(TCWGPWPF,WPIHTCWGP  5KNDGTVGKNYGKUGITCXKGTVGOCKNNKGTVCPFGTQTKIK PCNGPCNVGP&COGPUEJNGKHG$9-1'- ++





/GFCKNNG &'/$'56'05%*ª6<'0&WTEJOGUUGTOOOKV5VGORGNUEJPGKFGTUKIPCVWT .'55'4GKPKIG-TCV\GTCOCNVGP$CPF ++p+++





'TKPPGTWPIUOGFCKNNG CP FGP 6QF -ÌPKI (TKGFTKEJ 9KNJGNOU +8 CO  ,CPWCT  $TQP\G   &WTEJOGUUGTOOIGJGPMGNVQJPG$CPF ++



8164 (1:1)



5QIGPCPPVG 2T·OKGPOGFCKNNG -ÌPKI 9KNJGNOUWPF-ÌPKIKP#WIWUVCUXQP2TGW­GP#WUHÒJTWPI )QNFGPG/GFCKNNG  &WTEJOGUUGTOO)QNFIOKV5VGORGNUEJPGKFGT5KIPCVWT).115CWH FGO4GXGTU9KFOWPIUITCXWT<74'4+00'470)#09+.*)4#(85%*.+'(('0*#726/ +/GP)#4&'4')+/'06<7(755UVCTMIGVTCIGPQJPG$CPF 4444++p+++



'UJCPFGNVUKEJJKGTDGKWP\YGKHGNJCHVWOGKPIGRT·IVGU1TKIKPCNGZGORNCTFCUXKGNIGVTCIGPYQTFGPKUV*ÒUMGPHÒJTV

KP *2 5  0T   GKPG #WUHÒJTWPI KP )QNF PKEJV CWH #WHITWPF FGT 9KFOWPIUKPUEJTKHV FÒTHVG GU UKEJ   JKGTDGKWOGKP7PKMCVJCPFGNP*CWRVOCPP9KNJGNOXQP5EJNKGHHGPYCTGKP/KVINKGFFGTRQOOGTUEJGP#FGNUHCOKNKG FGT)TCHGPXQP5EJNKGHHGPFGTCWEJFGTRTGW­KUEJG)GPGTCNHGNFOCTUEJCNNWPF%JGHFGU)GPGTCNUVCDGU#NHTGF)TCH XQP5EJNKGHHGP  #WVQTFGUUQIGPCPPVGP5EJNKGHHGP2NCPGUIGJÌTVG

157


DEUTSCHE STAATEN

8165 (1:1)

8167 Rv.

8166

8168 Rv.



/KNKV·T'JTGP\GKEJGP /KPKCVWT FGU /KNKV·T'JTGP\GKEJGPU  -NCUUG  Z  OO 5KNDGT QJPG   $·PFEJGP 4++





/KNKV·T'JTGP\GKEJGP 'JTGP\GKEJGP  -NCUUG 5KNDGT OKV FÒPPGO $CPFTKPI CO CNV IGUEJNQUUGPGP   $CPFHÒT0KEJVM·ORHGT$9-1'- ++





-TKGIUFGPMOÒP\G   #WUICDG OKV IGTCFNKPKIGP -TGW\CTOGPFGP )GUEJÒV\DTQP\G OKV 4CPFRT·   IWPICOCNVGP1TKIKPCNDCPF$9-1'- ++



-TKGIUFGPMOÒP\G  HÒT 0KEJVM·ORHGT 5QIGPCPPVG 'KUGTPG 2HNCWOG #WUICDG HÒT   'KUGPIGUEJY·T\VQJPG$CPF$9-1'- ++



8QPFGT*G[FGPKOOVFKGUG'KPQTFPWPI #WUICDGOKVTWPFGP-TGW\CTOGPFGPWPF#WUICDGOKVIGTCFNKPKIGP -TGW\CTOGPFGP  CWHITWPF FGU 7OUVCPFGU XQT FC­ GU XQP FGP GTUVGTGP MGKPG #WUICDG HÒT  IKDV UKG CNUQ XQT   JGTIGUVGNNVYQTFGPUGKPOÒ­VGP XIN*G[FG*GKMQXQPFGT&KGRTGW­KUEJGP-TKGIUFGPMOÒP\GP+P+0(1 ,I0T/ÒPEJGP5HH 



8170 8171

8169 Rv.



-TKGIUFGPMOÒP\GHÒT0KEJVM·ORHGT5QIGPCPPVG'KUGTPG2HNCWOG#WUICDGHÒT'KUGP FÒPPGU'ZGORNCT5EJY·T\WPIPCJG\WXQNNUV·PFKIXGTICPIGPQJPG$CPF$9-1'- ++





5QIGPCPPVGU $GTNKPGT 'KUGP \WT 'TKPPGTWPI CP FGP UKGITGKEJGP #WUICPI FGT 8ÌNMGTUEJNCEJV DGK   .GKR\KIXQODKU1MVQDGT'KUGPOKV5KNDGTDGUEJN·IGP ++





'TKPPGTWPIUOGFCKNNGCWHFKG#NNKCP\XQPUKGITGKEJG4WUUGP¤UVGTTGKEJGTP2TGW­GPWPF5EJYGFGP 5KNDGTQJPG$CPF ++





'TKPPGTWPIUOGFCKNNGCWHFKGUKGITGKEJG#NNKCP\XQP4WUUGP¤UVGTTGKEJGTP2TGW­GPWPF5EJYGFGP 5KNDGTQJPG$CPF ++p+++



ex 8173 8174



ex 8175

-QPXQNWV XQP PGWP UQIGPCPPVGP 5KGIGURHGPPKIGP XQP &CPKGN (TKGFTKEJ .QQU   $GHTGKWPI $GTNKP    )TQ­IÌTUEJGP .ÒDPKV\$GN\KI %WNO  8ÌNMGTUEJNCEJV.GKR\KI

Z  .ÒDGEM 'THWTV 'KP\WIKP2CTKU,GYGKNU5KNDGTDGKHÒPH5VÒEM¤UGCDIG DTQEJGPKPWPVGTUEJKGFNKEJGT'TJCNVWPI.11##  5VÒEM++++p+++++++8





0GWEJ³VGNGT'TKPPGTWPIUOGFCKNNG  5KNDGTCOCNVGP1TKIKPCNDCPF$9-XCT1'-  ++





&ÒRRGNGT5VWTOMTGW\ WPF #NUGP-TGW\  -QPXQNWV XQP LGYGKNU \YGK 'ZGORNCTGP FCXQP FTGK   XGTNKGJGPG'ZGORNCTGXQO&ÒRRGNGT5VWTOMTGW\GKPG5RCPIGPRT·IWPI CPXGTUEJKGFGPGP$·PFGTPKP QTFGPVNKEJGP'TJCNVWPIGP$9-1'- 5VÒEM++



158


DEUTSCHE STAATEN

ex 8176 Rv.

ex 8177 Rv.

8178







-TKGIU&GPMOÒP\G  -QPXQNWV XQP FTGK XGTUEJKGFGPGP 'ZGORNCTGP   2TGW­KUEJG #WUICDG HÒT   -·ORHGTOKV4CPFRT·IWPI 2TGW­KUEJG#WUICDGHÒT0KEJVM·ORHGT ¤UVGTTGKEJKUEJG#WUICDGQJPG 4CPFRT·IWPI,GYGKNUCP$·PFGTPKPQTFGPVNKEJGP'TJCNVWPIGP$9-$9-1'-  5VÒEM++



'TKPPGTWPIUMTGW\-QORNGVVGT5CV\CNNGTXKGT-TGW\G XGTNKGJGPG'ZGORNCTG  -¤0+))46<  &'4/#+0#4/'' 64'7'0-4+')'40 2(.+%*664'7'+/ -4+')'  HÒT 0KEJVM·ORHGT #P $·PFGTP KP QTFGPVNKEJGP 'TJCNVWPIGP $9-    1'- 5VÒEM++



-TKGIUFGPMOÒP\G  /GFCKNNG HÒT -·ORHGT )GUEJÒV\DTQP\G OKV 4CPFRT·IWPI GKPGT INCVVGT   'KPGT1TFGPUUEJPCNNGOKVUGEJUCWHIGNGIVGP)GHGEJVUURCPIGP$'#7)'0%;%4#8#0614.—#05 2#4+5 01+55'8+..' )4#8'.166'5624+8#6 WPF 8+108+..'/#45 .# 6174   #P0CFGN$9-FTUSN1'- ++



8179 8181 ex 8180









8182

-TKGIUFGPMOÒP\G)NCVVG'KPGT1TFGPUUEJPCNNG QJPG/GFCKNNG OKVFTGKCWHIGNGIVGP)GHGEJVU URCPIGP.'/#0514.—#05WPF/'6<#P0CFGN$9-OTQ1'-  ++



-TKGIUFGPMOÒP\G)NCVVG'KPGT1TFGPUUEJPCNNG OKV\YGKDGKNKGIGPFGP/GFCKNNGP'KPJ·PIJC MGPCDIGDTQEJGP OKVFTGKCWHIGNGIVGP)GHGEJVUURCPIGP2#4+55'&#0WPF$'#7/1060CFGN CDIGDTQEJGP$9-UWG1'- 5VÒEM++



-TKGIUFGPMOÒP\G  .GGTGU $CPF QJPG /GFCKNNG  OKV XKGT CWHIGNGIVGP )GHGEJVUURCPIGP   01+55'8+..'%1.1/$';017+..;/'6<WPF5637'06+0$9-SLQ V1'- ++



-TKGIUFGPMOÒP\G  /GFCKNNG HÒT -·ORHGT )GUEJÒV\DTQP\G OKV 4CPFRT·IWPI GKPGT INCVVGT   'KPGT1TFGPUUEJPCNNG OKV XKGT CWHIGNGIVGP )GHGEJVUURCPIGP 2#4+5 5'&#0 9¤46* WPF   9'+55'0$74)#P0CFGN$9-UWCDCC1'- ++

 159


DEUTSCHE STAATEN

8183 8184







8185

8186

-TKGIUFGPMOÒP\G  /GFCKNNG HÒT -·ORHGT )GUEJÒV\DTQP\G OKV 4CPFRT·IWPI GKPGT INCVVGT   <YGKGT1TFGPUUEJPCNNG OKV $CPF HÒT FKG <GPVGPCTOGFCKNNG FKG /GFCKNNG HGJNV  OKV XKGT CWHIGNGIVGP   )GHGEJVUURCPIGP2#4+55'&#09¤46*WPF9'+55'0$74)#P0CFGN$9-U WCC1'- ++



-TKGIUFGPMOÒP\G/KPKCVWTFGT/GFCKNNGHÒT-·ORHGTCP$CPFTCJGOKV$·PFEJGPOKVUGEJU )GHGEJVUURCPIGP .' /#05 $'#7)'0%;)4#8#06 14.—#05.1+)0;21724; 2#4+5WPF/'6< ++



-TGW\ HÒT 8GTFKGPUVG WO FCU /KNKV·T$TKGHVCWDGPYGUGP 'KUGP CO GTI·P\VGP $CPFTKPI CO $CPF   $9-*2 4++



.CWV*ÒUMGP KP*25 YWTFGPXQPFGOCO&G\GODGTFWTEJFCU-IN2TGW­KUEJG-TKGIUOKPKUVG TKWOIGUVKHVGVGP8GTFKGPUVMTGW\5VÒEMJGTIGUVGNNVYQXQPXGTNKGJGPYQTFGPUKPF



5EJKG­2T·OKGPOGFCKNNG  /QFGNN OKV FGO 2QTVTCKV 9KNJGNOU ++    /GFCKNNG \W     /CTM&WTEJOGUUGTOO5KNDGTOKV5VGORGNUEJPGKFGTUKIPCVWT'9'+)#0&5%CP¤UGOKV $CPF*ª52 ++



)GUVKHVGVOKV%CDKPGVU1TFTG-ÌPKI(TKGFTKEJ9KNJGNO+++  KPFTGK5VWHGP&CU/QFGNNOKVFGO 2QTVTCKV9KNJGNOU++KPUGEJU5VWHGPYWTFGGKPIGHÒJTV

8187



8188

8189

8190

/GFCKNNG \WT 'TKPPGTWPI CP FKG (GKGTNKEJMGKVGP CWU #PNC­ FGU 'KPJWPFGTVL·JTKIGP $GUVGJGPU   FGU  4JGKPKUEJGP +PHCPVGTKG4GIKOGPVU XQP .ÒV\QY 0T  $TQP\G XGTUKNDGTV CO PGWGP $CPF   75 ++



+O,CJTGGTTKEJVGVG-ÌPKI(TKGFTKEJ9KNJGNO+++XQP2TGW­GP  KP*CPCWFCU6JÒTKPIKUEJG7NCPGP 4GIKOGPV0TCWUFGO-CXCNNGTKGVGKNFGUNGIGPF·TGPCWHIGUVGNNVGP(TGKMQTRU.ÒV\QYFGURTGW­KUEJGP/CLQTU

UR·VGT)GPGTCNOCLQT .WFYKI#FQNH9KNJGNO(TGKJGTTPXQP.ÒV\QY  FGTCNU1DGTUVNGWVPCPVCWEJGTUVGT -QOOCPFGWTFGUPGWGP4GIKOGPVUYWTFG'UIGJÌTVGUR·VGTFGO:8+++#TOGGMQTRUCP$KU\WUGKPGO6QF YCT-ÌPKI%JTKUVKCP+:XQP&·PGOCTM  %JGHFGU4GIKOGPVUYGUJCNDGUUGKP/QPQITCOOHÒJTVG<WO GKPJWPFGTUVGP ,CJTGUVCI FGT #WHUVGNNWPI FGU (TGKMQTRU .ÒV\QY KO ,CJTG  YWTFG FKGUG /GFCKNNG IGUVKHVGV   &KG8QTFGTUGKVGFGT/GFCKNNGKUVKFGPVKUEJOKVFGTKOINGKEJGP,CJTIGUVKHVGVGP,WDKN·WOUOGFCKNNGFGU4JGKPKUEJGP +PHCPVGTKG4GIKOGPVUXQP.ÒV\QY0TFCUCWUFGO+PHCPVGTKGVGKNFGUGJGOCNKIGP(TGKMQTRU.ÒV\QYIGDKNFGV YQTFGPKUV







160

5EJKG­2T·OKGPOGFCKNNG  /QFGNN OKV FGO 2QTVTCKV 9KNJGNOU ++    /GFCKNNG \W     /CTM &WTEJOGUUGT  OO 5KNDGT OKV 5VGORGNUEJPGKFGTUKIPCVWT ' 9'+)#0& 5% CP ¤UG OKV   $CPF*ª52 ++



&KGPUV#WU\GKEJPWPIU-TGW\ HÒTCMVKXG1HHK\KGTG #WUHÒJTWPI OKVITÌDGTIGMÌTPVGP-TGW\CTOGP EC XCTKCPVGT6[RQJPG2WPMVJKPVGT::8&WTEJOGUUGTOO$TQP\GXGTIQNFGVCO $CPF$9-1'- ++



&KGPUV#WU\GKEJPWPIU-TGW\ HÒTCMVKXG1HHK\KGTG #WUHÒJTWPI OKVITÌDGTIGMÌTPVGP-TGW\CTOGP EC   XCTKCPVGT 6[R OKV DTGKVGP RQNKGTVGP 4·PFGTP FGT -TGW\CTOG $TQP\G XGTIQNFGV CO   $CPF$9-1'- ++




DEUTSCHE STAATEN 

-QPXQNWV XQP  RTGW­KUEJGP \KXKNGP WPF OKNKV·TKUEJGP #WU\GKEJPWPIGP &CTWPVGT -TQPGP1TFGP  /GFCKNNG#NNIGOGKPGU'JTGP\GKEJGP-NCUUG Z #NNIGOGKPGU'JTGP\GKEJGPKP$TQP\G/KNKV·T'JTGP \GKEJGP  -NCUUG -TKGIGT8GTFKGPUVOGFCKNNG +P XGTUEJKGFGPGP /GVCNNGP HÒPH KP 5KNDGT  KP   WPVGTUEJKGFNKEJGP'TJCNVWPIGPVGKNUCP$·PFGTPGKPGCP'KPGT$CPFUEJPCNNG 5VÒEM+++8



8192



#OVUMGVVG FGT 5VCFVXGTQTFPGVGP XQP 2QVUFCO /KV JQJN IGHGTVKIVGO #OVU\GKEJGP OKV 7OUEJTKHV   56#&68'414&0'6' <7 2165&#/  /&%%%8+++ 5KNDGT CWH FGO 4GXGTU OKV +PUEJTKHV   (4+'&4+%* 9+.*'./ +++  -1'0+) 810 24'755'0  )47'0&'4  &'4  56#'&6'   14&070)OKV4CPFRT·IWPI.$';'4*#75CP-GVVG5KNDGT ++



8GTINGKEJG JKGT\W /CNEJQY )KUGNC WPF *GTOCPP  &KG #OVU\GKEJGP 2QVUFCO /&%%%8+++ +P $GKVT·IG \WT   $TCPFGPDWTIKUEJ2TGWUUKUEJGP0WOKUOCVKM0WOKUOCVKUEJGU*GHV$GTNKP5HH

8193

24'755'0-¤0+)4'+%*'+5'40'5-4'7< 

'KUGTPGU -TGW\ #WUICDG  -TGW\  -NCUUG #PHGTVKIWPIUUGTKG XQP  DKU  'KUGP IG   UEJY·T\V5KNDGT\CTIG¤UGCNVTGRCTKGTVQJPG$CPF$9-XCT1'-XCT ++p+++



'UJCPFGNVUKEJJKGTDGKWOGKP'ZGORNCTFGTDGK*G[FG KP*(#50T% DGUEJTKGDGPGP5GTKGFGTGP#PHGTVK IWPI KP FGP ,CJTGP  DKU  HÒT PQEJ CPUVGJGPFG 8GTNGKJWPIGP PQVYGPFKI IGYQTFGP YCT CWHITWPF FGU XQP   -ÌPKI (TKGFTKEJ 9KNJGNO +++   OKV &CVWO XQO  &G\GODGT  CWUIGDGPGP #NNGTJÌEJUVGP 'TNC­   CPFKG)GPGTCN1TFGPU%QOOKUUKQPFKGPCEJ&KGPUVLCJTGPKPFGT#TOGGUQHQTVGKPVTGVGPFG8GTGTDWPIFGU'KUGT PGP -TGW\GU DGVTGHHGPF D\Y CWHITWPF UGKPGU OKV &CVWO XQO  &G\GODGT  CWUIGIGDGPGP #NNGTJÌEJUVGP   'TNC­ CP FKG #TOGG ÒDGT FKG 8GTNGKJWPI FGU 'KUGTPGP -TGW\GU CP CNNG PQEJ XQTJCPFGPGP 'TDDGTGEJVKIVGP DGKFG   CDIGFTWEMVKP50'-7TMWPFGP50TWPF0T   &CU 'KUGTPG -TGW\ YWTFG CWH RGTUÌPNKEJG +PKVKCVKXG CO  /·T\  XQP -ÌPKI (TKGFTKEJ 9KNJGNO +++ KP FTGK   -NCUUGP 'KUGTPGU -TGW\  -NCUUG 'KUGTPGU -TGW\  -NCUUG )TQ­MTGW\ FGU 'KUGTPGP -TGW\GU  CNU -TKGIU  'JTGP\GKEJGP KO DGUVGJGPFGP 8GTVGKFKIWPIUHCNN  HÒT     8GTFKGPUV YGNEJGU KP FGO LGV\V CWUDTGEJGPFGP -TKGIG   GPVYGFGT KO YKTMNKEJGP -CORH OKV FGO (GKPFG QFGT CW­GTFGO KO (GNFG QFGT FCJGKO LGFQEJ KP $G\KGJWPI CWH   FKGUGPITQ­GP-CORHWO(TGKJGKVWPF5GNDUVUV·PFKIMGKVGTYQTDGPYKTF 5VKHVWPIUWTMWPFG 'UUQNNVGPCEJFGO CWUFTÒEMNKEJGP9KNNGPFGU-ÌPKIUKPFGTWPF-NCUUGQJPG#PUGJGPXQP2GTUQPWPF*GTMWPHVCPLGFGP/CPP XGTNKGJGP YGTFGP FGT UKEJ FGUUGP CNU YÒTFKI GTYKGU +P FGT (QNIG\GKV YWTFG FCU 'KUGTPG -TGW\ \WO 5[ODQN FGT   $GHTGKWPIUMTKGIG WPF GTTGKEJVG GKP JQJGU #PUGJGP XIN CWEJ W X C 5EJPGKFGT .QWKU &KG 2TGW­KUEJGP 1TFGP   'JTGP\GKEJGP WPF #WU\GKEJPWPIGP  &CU $WEJ XQO 'KUGTPGP -TGW\G $GTNKP   *ÒVVG 9GTPGT 1VVQ &KG   )GUEJKEJVG FGU 'KUGTPGP -TGW\GU WPF UGKPG $GFGWVWPI HÒT FCU RTGW­KUEJG WPF FGWVUEJG #WU\GKEJPWPIUYGUGP XQP   DKU\WT)GIGPYCTV$QPP0KOOGTIWV,ÌTI *I &CU'KUGTPG-TGW\.ÒFGPUEJGKF )GK­NGT *CTCNF &CU 'KUGTPG -TGW\ XQP  DKU JGWVG 0QTFGTUVGFV   $QYGP 8 ' 6JG 2TWUUKCP CPF   )GTOCP+TQP%TQUU#WHNCIGQJPG1TVWPFQJPG,CJT2TGXKVGTC5VGRJGP6JQOCU6JG+TQP6KOG#*KUVQT[ QH6JG+TQP%TQUU#WHNCIG 

161


DEUTSCHE STAATEN

ex 8194



8196

8195

8197

'KUGTPGU -TGW\ #WUICDG  -TGW\  -NCUUG XGTNKGJGPGU 'ZGORNCT 'KUGP IGUEJY·T\V PKEJVNCE MKGTV <CTIG5KNDGTCO$CPFHÒT-·ORHGTOKVCWHIGNGIVGT'KEJGPNCWDURCPIG OKV\YGK5RNKPVGP  $9-1'- 5VÒEM++



'KUGTPGU -TGW\ #WUICDG  -TGW\  -NCUUG XGTNKGJGPGU 'ZGORNCT 'KUGP IGUEJY·T\V PKEJVNCE MKGTV <CTIG5KNDGTCO$CPFHÒT-·ORHGTOKVCWHIGNGIVGT'KEJGPNCWDURCPIG OKV\YGK5RNKPVGP  $9-1'- ++





'KUGTPGU-TGW\#WUICDG4GFWMVKQPGKPGU-TGW\GU-NCUUGUQIGPCPPVG2TKP\GPITÌ­GZ OO'KUGPIGUEJY·T\V PKEJVNCEMKGTV <CTIG5KNDGTQJPG$CPF ++





'KUGTPGU -TGW\ #WUICDG  -TGW\  -NCUUG XGTNKGJGPGU 'ZGORNCT 'KUGP IGUEJY·T\V PKEJV   NCEMKGTV <CTIG5KNDGTCO$CPFHÒT-·ORHGTOKVCWHIGNGIVGT'KEJGPNCWDURCPIG OKV\YGK5RNKPVGP  WPF 9KGFGTJQNWPIUURCPIG  5KNDGT VGKNYGKUG GOCKNNKGTV CWH FGT 4ÒEMUGKVG *GTUVGNNGTDG\GKEJPWPI   ,1* 9#)0'4  51*0  $'4.+0 OKV \YGK 5RNKPVGP  $9-    1'-      44++



+P(QNIGFGT-TKGIUGTMN·TWPI(TCPMTGKEJUCP2TGW­GPCO,WNKGTPGWGTVG-ÌPKI9KNJGNO+XQP2TGW­GPFCU 'KUGTPG-TGW\YGPKIG6CIGUR·VGTTÒEMFCVKGTVCWHFGP6CIFGT-TKGIUGTMN·TWPI



8199

8200 8198



'KUGTPGU -TGW\ #WUICDG  -TGW\  -NCUUG XGTNKGJGPGU 'ZGORNCT 'KUGP IGUEJY·T\V PKEJV   NCEMKGTV  <CTIG 5KNDGT CO $CPF HÒT 0KEJVM·ORHGT OKV CWHIGNGIVGT 'KEJGPNCWDURCPIG  OKV \YGK   5RNKPVGP  WPF 9KGFGTJQNWPIUURCPIG  5KNDGT VGKNYGKUG GOCKNNKGTV CWH FGT 4ÒEMUGKVG *GTUVGNNGTDG   \GKEJPWPI ,1* 9#)0'4  51*0  $'4.+0 OKV \YGK 5RNKPVGP  $9-    1'-    44++





'KUGTPGU-TGW\#WUICDG-TGW\+-NCUUGHNCEJG#WUHÒJTWPI'KUGPIGUEJY·T\V<CTIG5KNDGT CWH FGO 4GXGTU *GTUVGNNGTRWP\G -1 FGU -ÌPKINKEJGP /ÒP\COVU KP $GTNKP CP 0CFGN KO QTKIKPCNGP   DQTFGCWZTQVGPOKV'KUGTPGO-TGW\DGMNGDVGP8GTNGKJWPIUGVWK$9-1'- ++



#O#WIWUVGTMN·TVGFCU&GWVUEJG4GKEJ4W­NCPFFGP-TKGIWPFCOFGU/QPCVU(TCPMTGKEJ&CTCWHJKP GTPGWGTVG-CKUGT9KNJGNO++CNU-ÌPKIXQP2TGW­GPCO#WIWUVFCU'KUGTPG-TGW\+PFGPHQNIGPFGP,CJTGP GPVYKEMGNVGUKEJFCU'KUGTPG-TGW\FGHCEVQ CWUFTÒEMNKEJPKEJVFGLWTG \WGKPGTIGOGKPUCOGP-TKGIUCWU\GKEJPWPI FGT5VCCVGPFGU&GWVUEJGP4GKEJGUYKGYQJNFKG8GTNGKJWPIUKPKVKCVKXGIGPGTGNNDGK2TGW­GPXGTDNKGD



162

'KUGTPGU-TGW\#WUICDG-TGW\+-NCUUGHNCEJG#WUHÒJTWPI'KUGPIGUEJY·T\V<CTIG5KNDGT CWH FGO 4GXGTU *GTUVGNNGTRWP\G -1 FGU -ÌPKINKEJGP /ÒP\COVU KP $GTNKP CP 0CFGN KO QTKIKPCNGP   UEJYCT\GP OKV IQNFHCTDGPGO 'KUGTPGO -TGW\ DGFTWEMVGP 8GTNGKJWPIUGVWK 8GTUEJNW­ FGHGMV OKV DG   UEJ·FKIVGPDTCWPGPªDGTMCTVQPOKV#WHUEJTKHV$9-1'- ++




DEUTSCHE STAATEN

8201

8204

8202

8205

8203



'KUGTPGU-TGW\#WUICDG-TGW\+-NCUUGHNCEJG#WUHÒJTWPI'KUGPIGUEJY·T\V<CTIG5KNDGT CP0CFGNFKGUGOKV5KNDGTRWP\G$9-1'- ++





'KUGTPGU-TGW\#WUICDG-TGW\+-NCUUGHNCEJG#WUHÒJTWPI'KUGPIGUEJY·T\V<CTIG5KNDGT CWHFGT4ÒEMUGKVG*GTUVGNNGTRWP\G-1FGU-ÌPKINKEJGP/ÒP\COVGUKP$GTNKPCP0CFGNKOQTKIKPCNGP UEJYCT\GPUKNDGTHCTDGPDGFTWEMVGP8GTNGKJWPIUGVWK$9-1'- ++



'KUGTPGU -TGW\ #WUICDG  -TGW\ + -NCUUG HNCEJG #WUHÒJTWPI #WUHÒJTWPI OKV DGUQPFGTGO   0CFGNU[UVGO 'KUGPMGTP IGUEJY·T\V <CTIG 5KNDGT OKV DGUQPFGTGO 0CFGNU[UVGO $9-    1'- ++



'KUGTPGU -TGW\ #WUICDG -TGW\+-NCUUGIGYÌNDVG#WUHÒJTWPI'KUGPIGUEJY·T\V<CTIG5KN DGT QJPG 2WP\KGTWPI QFGT $G\GKEJPWPI CP 0CFGN KO OÌINKEJGTYGKUG PKEJV \WIGJÌTKIGP UEJYCT\GP   UKNDGTPDGFTWEMVGP'VWKFGT(KTOC,)QFGVW5QJPKP$GTNKP$9-1'- ++



'KUGTPGU -TGW\ #WUICDG -TGW\+-NCUUGIGYÌNDVG#WUHÒJTWPI'KUGPIGUEJY·T\V<CTIG5KN DGTCWHFGO4GXGTU5KNDGTRWP\GOKV5EJTCWDG OÌINKEJGTYGKUGHCEJO·PPKUEJCNVTGRCTKGTV WPF 5EJTCWDUEJGKDGXKGNIGVTCIGP$9-1'- ++









8206

8207

8208

ex 8210



'KUGTPGU-TGW\#WUICDG-TGW\+-NCUUGIGYÌNDVG#WUHÒJTWPI'KUGPIGUEJY·T\V<CTIGXGT UKNDGTVOKVMNGKPGT5EJTCWDUEJGKDGXKGNIGVTCIGP$9-1'- ++p





'KUGTPGU -TGW\ #WUICDG  -TGW\ + -NCUUG IGYÌNDVG #WUHÒJTWPI <GPVTWO PKEJV OCIPGVKUEJ   <CTIGXGTUKNDGTVOKVITQ­GT5EJTCWDUEJGKDG$9-1'- ++





'KUGTPGU -TGW\ #WUICDG-TGW\+-NCUUGIGYÌNDVG#WUHÒJTWPI'KUGPMGTPIGUEJY·T\V<CTIG XGTUKNDGTVOKV\YGK5EJTCWDGP)GIGPRNCVVGWPF(GNFWPKHQTOVWEJWPF\YGK/WVVGTPFCXQPGKPGGTPGW GTV$9-1'- ++



'KUGTPGU -TGW\ #WUICDG  -QPXQNWV XQP UGEJU -TGW\GP ++ -NCUUG LGYGKNU OKV 'KUGPMGTP IG   UEJY·T\V<CTIG5KNDGT IGRTÒHV \YGKRWP\KGTVGKPGUTGRCTKGTVGKPGUCO$QIGPDCPF&C\WGKPGITQ­G 'KPGT(GNFUEJPCNNGOKV'-#WHNCIGCP0CFGN$9-1'- 5VÒEM+++++



'KUGTPGU -TGW\ #WUICDG  -QPXQNWV XQP FTGK XGTUEJKGFGPGP DTKVKUEJGP 2TQRCICPFCHGTVKIWPIGP   FGU'-++FCXQPGKPGUOKV$CPF 5VÒEM++







&KGUG5VÒEMGYWTFGPXQPFGP$TKVGPCPIGHGTVKIVWPF\W&GOQTCNKUKGTWPIUWPF2TQRCICPFC\YGEMGPOKV(NWI\GWIGP ÒDGTFGPFGWVUEJGP5VGNNWPIGPKP(TCPMTGKEJCDIGYQTHGP

163


DEUTSCHE STAATEN

8213 (1:1)

8212 (1:1) ex 8211

8214



'KUGTPGU-TGW\-QPXQNWVXQPCEJV/KPKCVWTGPFGU'-++-NCUUGWPFVGKNUCP5EJNGKHEJGP VGKNUCP0CFGNP+PWPVGTUEJKGFNKEJGP'TJCNVWPIGP 5VÒEM++





'KUGTPGU-TGW\#WUICDG2CVTKQVKUEJG&COGPDTQUEJG-NGKPGU'KUGTPGU-TGW\$TQP\GGOCKN NKGTVWOIGDGPXQP5KOKNK$TKNNCPVGPCP0CFGN ++



4'755(ª456'06ª/'4)'/'+05#/ 



(ÒTUVNKEJ4GW­KUEJGU'JTGPMTGW\/KPKCVWTFGU-TGW\-NCUUGOKV-TQPGWPF5EJYGTVGTP#WUHÒJ TWPI OKV 5VTCJNGP \YKUEJGP FGP -TGW\CTOGP    XGTUKNDGTV VGKNYGKUG XGTIQNFGV VGKNYGKUG   GOCKNNKGTVQJPG$·PFEJGP ++



(ÒTUVNKEJ4GW­KUEJGU'JTGPMTGW\-TGW\-NCUUGOKV5EJYGTVGTP#WUHÒJTWPI OKV5VTCJNGP\YK UEJGP FGP -TGW\CTOGP    5KNDGT VGKNYGKUG XGTIQNFGV GOCKNNKGTV CO $CPF $9-    1'- ++



8216 8217

8218 8215



(ÒTUVNKEJ 4GW­KUEJGU 'JTGPMTGW\ )QNFGPG 8GTFKGPUVOGFCKNNG OKV 5EJYGTVGTP 5KNDGT XGTIQNFGV   COCNVIGP·JVGP$QIGPDCPF$9-1'- ++



4'755.6'4'.+0+'(ª456'067/ )4'+<$+5  

#PGTMGPPWPIUOGFCKNNGFGU.CPFWPF(QTUVYKTVUEJCHVNKEJGP8GTGKPU\W<GWNGPTQFC#PGTMGPPWPIU OGFCKNNGHÒT6TGWG&KGPUV&WTEJOGUUGTOO$TQP\GXGTUKNDGTVQJPG$CPF 4++





<KXKN'JTGPMTGW\D\Y CD 8GTFKGPUVMTGW\-TGW\-NCUUGD\Y)QNFGPGU-TGW\5KNDGTXGT IQNFGV/GFCKNNQPU)QNFGOCKNNKGTVCP&TGKGEM$CPFUEJPCNNGOKV0CFGNKOQTKIKPCNGP8GTNGKJWPIUGVWK $9-XCT1'- 4++



5#%*5'0-74(ª456'067/ $+5 70&-¤0+)4'+%*     9GKVGTGU·EJUKUEJG1TFGPWPF'JTGP\GKEJGPHKPFGP5KGKPWPUGTGT#WMVKQP-CV0T 

4KVVGTNKEJGT /KNKVCKT1TFGP 5CPEVK *GPTKEK   D\Y %JWTHÒTUVNKEJG5·EJUKUEJGT /KNKV·T1TFGP   5CPEVK *GPTKEK   D\Y -WTHÒTUVNKEJ   D\Y -ÌPKINKEJ UGKV   5·EJUKUEJGT   /KNKV·T5V*GKPTKEJU1TFGP/QFGNN UGKV 4KVVGTMTGW\#WUHÒJTWPI  #PHGTVKIWPI FGT (KTOC ) # 5EJCTHHGPDGTI KP &TGUFGP 5KNDGT XGTIQNFGV GOCKNNKGTV OGJTGTG %JKRU KP FGT DNCWGP   'OCKNNG FGT /GFCKNNQPTKPIG HGKPG 'OCKNNGOCNGTGK CO QTKIKPCNGP CNVGP &TGKGEMUDCPF $9-    1'- ++p

.CWV 9GDGT #TPQNF WPF -GKN N·­V UKEJ FGU 'ZGORNCT CWHITWPF FGT 'OCKNNGOCNGTGK XIN 9$   FGO *GTUVGNNGT   5EJCTHHGPDGTI KP &TGUFGP \WQTFPGP +JPGP \WHQNIG 9$ 5   UKPF KO GTUVGP 9GNVMTKGI  4KVVGTMTGW\G KP   5KNDGTXGTIQNFGVXGTNKGJGPYQTFGP

 164

&KGUG-CVCNQIRQUKVKQPGPVH·NNV






DEUTSCHE STAATEN

8220



-ÌPKINKEJ 5·EJUKUEJGT <KXKN8GTFKGPUVQTFGP   D\Y -ÌPKINKEJ 5·EJUKUEJGT 8GTFKGPUV   1TFGP  /QFGNN OKVIGOCNVGP/GFCKNNQPU #WUHÒJTWPI /GFCKNNQPTKPI WPF HGNF CWU GKPGO 5VÒEM    4KVVGTMTGW\  -NCUUG OKV 5EJYGTVGTP 5KNDGT XGTIQNFGV WPF   GOCKNNKGTVKO8QTFGTUGKVGPOGFCKNNQPMCWOUKEJVDCTGT'OCKNNGMTCV\GTCWHFGT4ÒEMUGKVGMCWOUKEJVDCTG 'OCKNNGTGRCTCVWTCWHFGOWPVGTGP-TGW\CTOCOUR·VGTGP$CPF 4++



'Z#WMVKQPXQP#PFTGCU6JKGUKP-KTEJJGKOWPVGT6GEMCO&G\GODGT 0T 5GJTUEJÌPGU'ZGO RNCTCWUFGT\YGKVGP*·NHVGFGU'TUVGP9GNVMTKGIGUXQPFGONCWV9GDGT#TPQNFWPF-GKN KP9$5 XQP DKUPWT5VÒEMXGTNKGJGPYWTFGPFKGNCWV4QVJ KP5#5 CNNGCWHFGP'TUVGP9GNVMTKGIGPVHKGNGP  4KVVGTMTGW\G-NCUUGOKV5EJYGTVGTPWPF5EJYGTVGT\WDGTGKVUXGTNKGJGPGP4KVVGTMTGW\GP-NCUUG 

8221 (1:1)



-ÌPKINKEJ5·EJUKUEJGT#NDTGEJVUQTFGP/QFGNN OKVFGO2QTVTCKVXQP*GT\QI#NDTGEJV +++FGO$GJGT\VGP #WUHÒJTWPI #WUHÒJTWPIKP)QNF -NGKPQF\WO)TQ­MTGW\)QNF GOCKNNKGTVIQJPG5EJWNVGTDCPF$9-1'- +p++



)GUVKHVGV CO  &G\GODGT  XQP -ÌPKI (TKGFTKEJ #WIWUV ++ CNU \WP·EJUV HÒPHMNCUUKIGT )TQ­MTGW\ -QOVWT    WPF  -NCUUG 4KVVGT WPF -NGKPMTGW\  CNNIGOGKPGT 8GTFKGPUVQTFGP  /QFGNN  #NU DGUQPFGTGT )PCFGPGTYGKU   MQPPVGFCU)TQ­MTGW\ōOKV$TKNNCPVGPŋXGTNKGJGPYGTFGP#DYWTFGFCU-NGKPMTGW\CNU'JTGPMTGW\DG\GKEJPGV YWTFGGKPGCHHKNKKGTVG\YGKUVWHKIG )QNFWPF5KNDGT /GFCKNNGIGUVKHVGVWPFYWTFGPHÒTCNNGHÒPH-NCUUGP FKG 5EJYGTVGT IGUVKHVGV 8QP  CP DKU   YCT FKG 8GTNGKJWPI CNNGT -NCUUGP CWEJ OKV 5EJYGTVGTP CO 4KPI  

FKTGMVÒDGTFGO-TGW\CPIGDTCEJV OÌINKEJYWTFGOKVFGO'TNC­PGWGT1TFGPUUVCVWVGPFCUDKUJGTKIG2QTVTCKV -WTHÒTUV ,QJCPP ōFGU $GUV·PFKIGPŋ FWTEJ FCU 2QTVTCKV *GT\QI #NDTGEJVU +++ ōFGU $GJGT\VGPŋ CWH FGO 8QTFGTUGK   VGPOGFCKNNQP  /QFGNN  #WUHÒJTWPI  GTUGV\V DGUEJNQUUGP   &WTEJ FKG PGWGP 5VCVWVGP YWTFG CWEJ FKG   4KVVGTMNCUUGKPWPF-NCUUGCWHIGVGKNVFCU'JTGPMTGW\WPFFKG/GFCKNNGPCDIGUEJCHHVUQYKGFCU#NDTGEJVUMTGW\ CNU FGO 1TFGP CHHKNKKGTVGU 'JTGP\GKEJGP GKPIGHÒJTV  GTHQNIVG FKG 'KPHÒJTWPI GKPGU )QNFGPGP $TWUVUVGTPU \WO   )TQ­MTGW\ OKV GKPGO DGUQPFGTGP 5EJWNVGTDCPF CNU ÒDGT FGO PQTOCNGP )TQ­MTGW\ CPIGUKGFGNVG 5QPFGTUVWHG    GTHQNIVG FKG 5VKHVWPI FGU \YKUEJGP FGO -QOVWT  -NCUUG WPF FGO 4KVVGT  -NCUUG CPIGUKGFGNVGP 1HHK\KGTMTGW\GU   #D  MQPPVG FGT IQNFGPG $TWUVUVGTP \WO )TQ­MTGW\ CWEJ QJPG FCU DGUQPFGTG 5EJWNVGTDCPF XGTNKGJGP YGTFGP   GTHQNIVFKG'KPHÒJTWPIFGU4KVVGTMTGW\GU-NCUUGOKVFGT-TQPGGTJKGNVFGTIQNFGPG$TWUVUVGTPOKVFGO DGUQPFGTGP5EJWNVGTDCPFGKPGUKNDGTPG-TQPG5GKVFKGUGO,CJTGTHQNIVGFKG*GTUVGNNWPIFGT+PUKIPKGPKPXGTIQNFGVGO 5KNDGT /QFGNN#WUHÒJTWPI 0CEJFGTNGV\VGPYGUGPVNKEJGPPFGTWPIWOHC­VGFGT1TFGPKPUIGUCOV )TCFG=)TQ­MTGW\OKVIQNFGPGO5VGTPWPFUKNDGTPGT-TQPG)TQ­MTGW\OKVIQNFGPGO5VGTP)TQ­MTGW\OKV$TKNNCP VGP)TQ­MTGW\-QOVWTWPF-NCUUG1HHK\KGT4KVVGTMTGW\-NCUUGOKV-TQPG4KVVGTMTGW\WPF-NCUUG? WPFFCUCHHKNKKGTVG#NDTGEJVUMTGW\#DYCTGPFKG/GFCKNNQPHGNFGTFGT+PUKIPKGPGKPVGKNKICWUIGHÒJTV /QFGNN #WUHÒJTWPI /KVFGO6JTQPXGT\KEJV-ÌPKI(TKGFTKEJ#WIWUVU+++KO0QXGODGTGTNQUEJCWEJFGT1TFGP

165


DEUTSCHE STAATEN

8222 8223









8224

-ÌPKINKEJ5·EJUKUEJGT#NDTGEJVUQTFGP/QFGNN OKVFGO2QTVTCKVXQP*GT\QI#NDTGEJV +++FGO$GJGT\VGP #WUHÒJTWPI #WUHÒJTWPIKP)QNF 4KVVGTMTGW\-NCUUG#WUHÒJTWPI OKVINCVVGP-TGW\CTOT·PFGTP)QNFGOCKNNKGTVICOCNVGP$CPF$9-1'- +p++



-ÌPKINKEJ5·EJUKUEJGT#NDTGEJVUQTFGP/QFGNN OKVFGO2QTVTCKVXQP*GT\QI#NDTGEJV +++ FGO $GJGT\VGP   #WUHÒJTWPI   #WUHÒJTWPI KP 5KNDGT XGTIQNFGV OKV GKPVGKNKIGP   /GFCKNNQPHGNFGTP 4KVVGTMTGW\-NCUUGOKV5EJYGTVGTP5KNDGTXGTIQNFGVWPFGOCKNNKGTVMCWOUKEJVDCTG 'OCKNNGEJKR CWH 8QTFGT WPF 4ÒEMUGKVG FGT TGEJVGP QDGTGP -TGW\CTOURKV\G CO CNVGP &TGKGEMUDCPF   $9-1'- ++



-ÌPKINKEJ5·EJUKUEJGT#NDTGEJVUQTFGP/QFGNN OKVFGO2QTVTCKVXQP*GT\QI#NDTGEJV +++ FGO $GJGT\VGP   #WUHÒJTWPI   #WUHÒJTWPI KP 5KNDGT XGTIQNFGV OKV GKPVGKNKIGP   /GFCKNNQPHGNFGTP  4KVVGTMTGW\  -NCUUG OKV 5EJYGTVGTP #WUHÒJTWPI OKV GKPUGKVKI IGRT·IVGP 5EJYGT   VGTP5KNDGTVGKNYGKUGXGTIQNFGVWPFGOCKNNKGTVCWHFGO4CPFFGUWPVGTGP-TGW\CTOU5KNDGTRWP\G5CO QTKIKPCNGPCNVGP$CPF$9-1'- ++



-ÌPKINKEJ5·EJUKUEJGT#NDTGEJVUQTFGP/QFGNN OKVFGO2QTVTCKVXQP*GT\QI#NDTGEJV +++FGO$GJGT\VGP /KPKCVWTFGU4KVVGTMTGW\GU-NCUUGOKV5EJYGTVGTP5KNDGTVGKNYGKUGXGTIQNFGVWPF GOCKNNKGTV ++



8226

8227

8228

8229



-ÌPKINKEJ5·EJUKUEJGT#NDTGEJVUQTFGP#NDTGEJVUMTGW\OKV5EJYGTVGTP#WUHÒJTWPI KPGKPGO5VÒEM IGRT·IV 5KNDGT5EJYGTVGTDGKFUGKVKIIGRT·IVQJPG$CPF$9-1'- ++



#NNIGOGKPGU 'JTGP\GKEJGP D\Y 'JTGPMTGW\ <YGK #WUICDGP   'JTGPMTGW\ QJPG 5EJYGTVGT      'JTGPMTGW\ OKV 5EJYGTVGTP $TQP\G XGTIQNFGV LGYGKNU CP UEJOCNGP $·PFGTP $9-     1'- ++





'JTGP\GKEJGP FGU #NDGTV8GTGKPU UQIGPCPPVGT %CTQNC1TFGP HÒT 8GTFKGPUVG  -TGW\  -NCUUG   XGTIQNFGVWPFGOCKNNKGTVCOUR·VGTGP$CPF)$ ++





&KGPUV#WU\GKEJPWPIU-TGW\ HÒT 1HHK\KGTG HÒT  CMVKXG &KGPUVLCJTG   #WUHÒJTWPI OKV INCVVGP   -TGW\CTOHN·EJGP WPF KP GKPGO 5VÒEM IGRT·IV  $TQP\G XGTIQNFGV QJPG $CPF $9-  1'-    ++



#O#RTKNXGTHÒIVG-ÌPKI#NDGTV  FKG5VKHVWPIFGT&KGPUV#WU\GKEJPWPIGP&KG5VCVWVGPHÒTFKG -ÌPKINKEJ 5·EJUKUEJGP &KGPUV#WU\GKEJPWPIGP WPF FCOKV CWEJ HÒT FCU &KGPUV#WU\GKEJPWPIU-TGW\ HÒT 1HHK\KGTG   YWTFGP\YGK6CIGUR·VGTCO#RTKNGTNCUUGP/KV8GTQTFPWPI-ÌPKI(TKGFTKEJ#WIWUVU+++  XQO #WIWUVMQPPVGFCU'JTGP\GKEJGPCWEJCP$GCOVGWPF2GTUQPGPFGU5QNFCVGPUVCPFGUXGTNKGJGPYGTFGP8GTNGK JWPIGPYWTFGPY·JTGPFFGUICP\GPGTUVGP9GNVMTKGIGUDKUXQTIGPQOOGP XIN,0KOOGTIWVKP0/5 

166




DEUTSCHE STAATEN

8230



8231

/KNKV·T4KEJVRT·OKGPOGFCKNNG HÒT FKG #TVKNNGTKG   /QFGNN OKV FGO 2QTVTCKV -ÌPKI (TKGFTKEJ   #WIWUV +++    )TQ­G 4KEJVRT·OKG  -NCUUG 5KNDGT &WTEJOGUUGT  OO )GYKEJV   ICOUR·VGTGP$CPF)$ ++



.CWV$&UKPFXQPFKGUGT/GFCKNNGPWTIGRT·IVYQTFGP'ZGORNCTOKVUEJÌPGTCNVGT2CVKPC



/KNKV·T4KEJVRT·OKGPOGFCKNNG HÒT FKG #TVKNNGTKG   /QFGNN OKV FGO 2QTVTCKV -ÌPKI (TKGFTKEJ   #WIWUV+++ -NGKPG4KEJVRT·OKG-NCUUG5KNDGT&WTEJOGUUGTOO)GYKEJVI COUR·VGTGP$CPF)$ ++



.CWV$&UKPFXQPFKGUGT/GFCKNNGPWTIGRT·IVYQTFGP'ZGORNCTOKVUEJÌPGTCNVGT2CVKPC

8232 (1:1)

8233

5#%*5'0 9'+/#4'+5'0#%*$+5 *'4<1)67/ $+5 70&)4155 *'4<1)67/   

)TQ­JGT\QINKEJ 5·EJUKUEJGT *CWUQTFGP FGT 9CEJUCOMGKV QFGT XQO 9GK­GP (CNMGP 4KVVGTMTGW\   D\Y CD   4KVVGTMTGW\  -NCUUG )QNF VGKNYGKUG HGKPUV \KUGNKGTV GOCKNNKGTV  I OGJTGTG $G   UEJ·FKIWPIGPKPFGTITÒPGPTQVGPWPFYGK­GP'OCKNNGGKPG-TGW\URKV\GGVYCUIGUVCWEJV#WHNCIGPWPF #ITCHHGNGKEJVDGYGIDCTQJPG$CPF$9-1'- 4+++  6TQV\ FGT FGWVNKEJGP 'KPUEJT·PMWPIGP UGNVGPGU 'ZGORNCT FCU CWHITWPF FGT JQJGP #PHGTVKIWPIUSWCNKV·V YQJN KO   NGV\VGP&TKVVGNFGU,CJTJWPFGTVUJGTIGUVGNNVYQTFGPKUV0CEJ#WUMWPHVFGU'KPNKGHGTGTUUVCOOVFKGUGU'ZGORNCT CWUFGO0CEJNC­XQP#NGZCPFGT(TGKJGTTXQP)NGKEJGPIGP4W­YWTO  GKPGO7TGPMGN(TKGFTKEJXQP 5EJKNNGTU WPF YCT OWVOC­NKEJ CP UGKPGP 8CVGT .WFYKI (TGKJGTT XQP )NGKEJGP IGP XQP 4W­YWTO     GKPGOKORTGUUKQPKUVKUEJGP.CPFUEJCHVUOCNGTXGTNKGJGPYQTFGP  )GUVKHVGV CO  #WIWUV  FWTEJ *GT\QI 'TPUV #WIWUV XQP 5CEJUGP9GKOCT YWTFG GTCO1MVQDGTCNU FTGKMNCUUKIGTCNNIGOGKPGT8GTFKGPUVQTFGPGTPGWGTVWPFGTHQNIVGP'TYGKVGTWPIGPYWTFGFCU )TQ­MTGW\CWHIGVGKNVKP+PUKIPKGPHÒT8GTFKGPUVGWOFCUITQ­JGT\QINKEJG*CWUWPFUQNEJGHÒTCNNIGOGKPG8GTFKGPUVG 9GKVGTG8GT·PFGTWPIGPGTHQNIVGPWPF



8GTFKGPUVOGFCKNNG  /QFGNN OKV FGO ·NVGTGP 2QTVTCKV XQP )TQ­JGT\QI %CTN #NGZCPFGT WPF &'/   8'4&+'056 5KNDGTPG8GTFKGPUVOGFCKNNG5KNDGTCWHFGT8QTFGTUGKVGOKV5VGORGNUEJPGK FGT\GKEJGP*'.(4+%*6(COUR·VGTGPLGFQEJ·NVGTGP$CPFKP1TKIKPCNDTGKVG OO $9- 1'- ++



)TQ­JGT\QI%CTN(TKGFTKEJ  UVKHVGVGFKGFTGKMNCUUKIG/GFCKNNGHÒT8GTFKGPUVGCNNGT#TV)TQ­JGT\QI %CTN#NGZCPFGT  GTUGV\VGFCU2QTVTCKVFWTEJUGKPGKIGPGU.CWV8GTHÒIWPI)TQ­JGT\QI%CTN#NGZ CPFGTUXQO#WIWUVYWTFGFCUDKUJGTKIGLWIGPFNKEJG2QTVTCKVFWTEJGKPGPGWGU·NVGTGU2QTVTCKVGTUGV\V/KV 8GTQTFPWPIXQO,WPKYWTFGFKG8GTFKGPUVOGFCKNNGXQP)TQ­JGT\QI9KNJGNO'TPUV  CWHIGJQ DGPWPFFWTEJGKP#NNIGOGKPGU'JTGP\GKEJGPGTUGV\V

167


DEUTSCHE STAATEN

8234

8235 8238

8236 8237



#NNIGOGKPGU'JTGP\GKEJGP/QFGNN &'/8'4&+'056' 'JTGP\GKEJGPKP)QNF5KNDGTXGTIQN FGV OKV 5VGORGNUEJPGKFGTUKIPCVWT KO 4CPF RWP\KGTV 5+.$'4  XQTFGTUGKVKI OKV UVCTMGT 2CVKPC   CO$CPF$9-1'- ++



/KV8GTQTFPWPIXQO,WPKUVKHVGVG)TQ­JGT\QI9KNJGNO'TPUV  WPVGT#WHJGDWPIFGTDKUFCJKP XGTNKGJGPGP 8GTFKGPUVOGFCKNNG FCU #NNIGOGKPG 'JTGP\GKEJGP KP)QNF5KNDGTWPF$TQP\G\WT#PGTMGPPWPICWUIG \GKEJPGVGT8GTFKGPUVGKPUDGUQPFGTGNCPIL·JTKIGTXQTDKNFNKEJGT2HNKEJVGTHÒNNWPIWPFVTGWGT#TDGKVUQYKG\WT8GTNGK JWPI CNU <GKEJGP 7PUGTGT 9QJNIGPGKIVJGKV 'U MQPPVG KP XGTUEJKGFGPGP #WUHÒJTWPIGP F J OKV XGTUEJKGFGPGP   4ÒEMUGKVGP+PUEJTKHVGPXGTNKGJGPYGTFGP&'/8'4&+'056'(ª464'7'&+'056'(ª464'7' #4$'+6WPF HÒTPKEJVUCEJUGPYGKOCTKUEJG5VCCVUCPIGJÌTKIG OKVFGO5VKHVGTOQPQITCOO9'YQDGKFKGGTUVIG PCPPVG #WUHÒJTWPI \WT #PGTMGPPWPI FGU 8GTJCNVGPU XQT FGO (GKPFG OKV GKPGT 5EJYGTVGTURCPIG XGTNKGJGP YGTFGP   MQPPVG1JPGGKPGPDGUQPFGTGP5VKHVWPIUGTNC­YWTFGGU\W$GIKPPFGU'TUVGP9GNVMTKGIGUUQYGKVGUHÒT8GTFKGPUVG XGTNKGJGPYWTFGFKGOKVFKGUGO-TKGI\WUCOOGPJKPIGPOKVFGT4ÒEMUGKVGP+PUEJTKHV&'/8'4&+'056' XGTNKGJGP+PJCDGTGKPGTPKGFGTGP-NCUUGFGU'JTGP\GKEJGPUJCVVGPFKGUGUDGK8GTNGKJWPIGKPGTJÌJGTGP-NCUUGPKEJV \WTÒEM\WIGDGP 8GTUEJKGFGPG -NCUUGP MQPPVGP PGDGPGKPCPFGT IGVTCIGP YGTFGP &CU #NNIGOGKPG 'JTGP\GKEJGP KUV   DKUECXGTNKGJGPYQTFGP XIN-NGG,ÒTIGPKP-*-5HHWPF5HH 





#NNIGOGKPGU'JTGP\GKEJGP/QFGNN &'/8'4&+'056' 'JTGP\GKEJGPKP 5KNDGT OKV 5EJYGTVGTP 5KNDGT KO 4CPF RWP\KGTV 5+.$'4 WPF  CO $CPF OKV 5EJYGTVGT  $CPFURCPIG$9-1'- ++



,WDKN·WOUOGFCKNNG \WT 'TKPPGTWPI CP FKG )QNFGPG *QEJ\GKV  )QNFGPG /GFCKNNG 5KNDGT XGT   IQNFGVQJPG$CPFTKPIWPFQJPG$CPF$9-1'- ++



0CEJ #WUMWPHV FGU 'KPNKGHGTGTU CWU FGO 0CEJNC­ XQP #NGZCPFGT (TGKJGTT XQP )NGKEJGP IGP 4W­YWTO  

 GKPGO7TGPMGN(TKGFTKEJXQP5EJKNNGTU  



-TKGIGTXGTGKPU'JTGPMTGW\  $TQP\GCO$CPF$9-1'-

++



5KIPKGTVGU 2QTVTCKVRJQVQ XQP )TQ­JGT\QI %CTN #NGZCPFGT 5KEJVDCT  Z  OO +P 7PKHQTO   OKV )TQ­MTGW\ FGU *CWUQTFGPU XQO 9GK­GP (CNMGP -NGKPQF FGU 5RCPKUEJGP 1TFGPU XQO )QNFGPGP   8NKGU CO *CNU WPF ITQ­GT 1TFGPUUEJPCNNG 5KIPKGTV %CTN #NGZCPFGT  9GKOCT KOCNVGPGVYCU DGUVQ­GPGPIQNFDGFTWEMVGP.GFGT$KNFGTTCJOGPZOO ++ 0CEJ #WUMWPHV FGU 'KPNKGHGTGTU CWU FGO 0CEJNC­ XQP #NGZCPFGT (TGKJGTT XQP )NGKEJGP IGP 4W­YWTO  

 GKPGO7TGPMGN(TKGFTKEJXQP5EJKNNGTU    %CTN#NGZCPFGTIGDQTGPKP9GKOCTTGIKGTVGXQPDKU\WUGKPGO6QFCNU)TQ­JGT\QIXQP5CEJUGP 9GKOCT'KUGPCEJ5EJQPMWT\PCEJFGUUGP6JTQPDGUVGKIWPIKUVGTXQP-ÌPKI#NHQPU:++  \WO 4KVVGTFGU5RCPKUEJGP1TFGPUXQO)QNFGPGP8NKGUGTPCPPVYQTFGP

168






DEUTSCHE STAATEN

8239 (1:1) 8240 (1:1)

8241 (1:1)

5%*5+5%*'*'4<1)6ª/'4)'/'+05#/ 

*GT\QINKEJ5CEJUGP'TPGUVKPKUEJGT*CWUQTFGP/QFGNN  #WUICDGHÒT5CEJUGP%QDWTI WPF)QVJC OKV'CWHFGOQDGTGP-TGW\CTO 4KVVGTMTGW\OKV.QTDGGTMTCP\ZOO)QNF VGKNYGKUGHGKPUV\KUGNKGTVGOCKNNKGTVIFCU'KPFKG'OCKNNGGKPIGNGIVMNGKPGT'OCKNNGEJKRCWHFGT 8QTFGTUGKVG FGU QDGTGP -TGW\CTOU CO CNVGP QTKIKPCNGP VGKNYGKUG CWUIGDNGKEJVGP 5GKFGPDCPF $9-   1'-XCT 44++p  'UJCPFGNVUKEJJKGTDGKGKPFGWVKIWOGKP'ZGORNCTFCUWOQFGTFCXQTGPVUVCPFGPKUV#NNGTFKPIUKUVFKGUGT6[R YGFGTDGK*CPU KP*# PQEJDGK0KOOGTIWV KP0/ FQMWOGPVKGTV5QOKVMÌPPVGGUUKEJGXGPVWGNNWOGKP4KVVGT MTGW\FGTCNNGTGTUVGP#PHGTVKIWPIUUGTKGXQPQFGTYGIGPFGUGVYCUCPFGTGP-TQPGPV[RWUWOGKPGCWUN·PFKUEJG

LGFQEJPKEJVHTCP\ÌUKUEJGQFGTDTKVKUEJG(GTVKIWPIFCPKEJVRWP\KGTV JCPFGNP  )GUVKHVGVCO&G\GODGTCNUIGOGKPUCOGT\WP·EJUVXKGTMNCUUKIGT*CWUQTFGP OKVCHHKNKKGTVGO8GTFKGPUVMTGW\ WPF 8GTFKGPUVOGFCKNNG  XQP (TKGFTKEJ *GT\QI XQP 5CEJUGP#NVGPDWTI 'TPUV *GT\QI XQP 5CEJUGP%QDWTI WPF   )QVJC WPF $GTPJCTF 'TKEJ (TGWPF *GT\QI XQP 5CEJUGP/GKPKPIGP KP #PNGJPWPI CP FGP  XQP *GT\QI   (TKGFTKEJ XQP 5CEJUGP%QDWTI IGUVKHVGVGP 1TFGP FGT &GWVUEJGP 4GFNKEJMGKV (ÒT 8GTFKGPUVG KO -TKGI GTHQNIVG FKG   8GTNGKJWPI OKV IGMTGW\VGP 5EJYGTVGTP  GTHQNIVG GKPG 8GTGKPJGKVNKEJWPI FGT +PUKIPKGP W C FWTEJ FKG   'PVHGTPWPIFGT/QPQITCOOGFGTXGTNGKJGPFGP*GT\ÌIGCWHFGOQDGTGP-TGW\CTOFKG7PVGTVGKNWPIFGT4KVVGTKP WPF-NCUUGWPFFKG5VKHVWPIFGT)QNFGPGP8GTFKGPUVOGFCKNNGUQYKGFGT1TFGPUMGVVG /QFGNN YWTFGPFKG +PUKIPKGPOKV,CJTGU\CJNGP ōŋōŋōŋōŋōŋIGUVKHVGV WPFFKG$CPFURCPIGPOKVWPF QJPG5EJYGTVGTHÒTFKG)QNFGPGPWPF5KNDGTPGP8GTFKGPUVOGFCKNNGPXGTUGJGP$KU\WO'PFGFGT/QPCTEJKGICDGU +PUKIPKGP OKV 5EJYGTVGTP KP \YGK #WUHÒJTWPIGP OKV ōTÌOKUEJGPŋ IGTCFGP  WPF OKV ōHTCP\ÌUKUEJGPŋ  

IGUEJYWPIGPGP 2CTKGTUVCPIGPFGT5EJYGTVGT+P#$UVGJVJKGT\WCWH5ō$KU\WOJGWVKIGP6CIKUVFKG7TUCEJG HÒTFKG7TUCEJGPFGT5EJYGTVGTUVÒEMGOKVIGTCFGP2CTKGTUVCPIGPQFGTIGUEJYWPIGPGP2CTKGTUVCPIGPPKEJVGKPFGWVKI IGMN·TV <WO 6GKN YKTF FKG /GKPWPI XGTVTGVGP FCUU IGUEJYWPIGPG 2CTKGTUVCPIGP #NVGPDWTIGT 8GTNGKJWPIGP WPF   IGTCFG2CTKGTUVCPIGP)QVJCGTD\Y/GKPKPIGT8GTNGKJWPIGPUKPF&KGUN·UUVUKEJYGFGTFWTEJ#MVGPPQEJ.KVGTCVWT DGNGIGP QDYQJN DKUJGT CWHIGVCWEJVG \YGKHGNUHTGKG #NVGPDWTI 5VÒEMG FGU 5'*1 KOOGT OKV IGUEJYWPIGPGP   2CTKGTUVCPIGPXGTUGJGPYCTGP&KGUIKNVHÒTCNNG5VWHGPXQO8GTFKGPUVMTGW\OKV5EJYGTVGTPDKU\WO)TQ­MTGW\OKV 5EJYGTVGTPŋ#WEJPCEJFGO'PFGFGT/QPCTEJKGXGTNKGJ*GT\QI%CTN'FWCTFXQP5CEJUGP%QDWTIWPF)QVJCFGP 1TFGP DKU  YGKVGT +P FKGUGO ,CJT UVKHVGVG GT PQEJ FKG 5EJYGTVGT CO 4KPI \W CNNGP -NCUUGP /KV   4GKEJUXGTQTFPWPIXQO0QXGODGTYWTFGPFKG8GTNGKJWPIGPHÒTCDIGUEJNQUUGPGTMN·TV&KG8GTNGKJWPIGPKP 5CEJUGP#NVGPDWTI WPF 5CEJUGP/GKPKPIGP YCTGP UEJQP OKV FGO 'PFG FGT /QPCTEJKG KP FKGUGP 5VCCVGP KO ,CJTG   GKPIGUVGNNVYQTFGP





*GT\QINKEJ5CEJUGP'TPGUVKPKUEJGT*CWUQTFGP/QFGNN  -QOVWTMTGW\5KNDGTXGTIQNFGV WPF GOCKNNKGTV CWH FGT 4ÒEMUGKVG FTGK MNGKPG 'OCKNNGTGRCTCVWTGP KP FGP -TGW\CTOURKV\GP CO *CNU   DCPFCDUEJPKVV$9-1'- ++p



*GT\QINKEJ 5CEJUGP'TPGUVKPKUEJGT *CWUQTFGP  /QFGNN   4KVVGTMTGW\  -NCUUG OKV   5EJYGTVGTP HÒT 8GTFKGPUVG KO -TKGI OKV .QTDGGTMTCP\  OWVOC­NKEJG #NVGPDWTIKUEJG #WUHÒJTWPI  

OKV HTCP\ÌUKUEJGP  IGUEJYWPIGPGP  2CTKGTUVCPIGP  5KNDGT /GFCKNNQPU )QNF OGJTVGKNKI GOCKNNKGTV   QJPG$CPF$9-1'- +p++



.CWV#$ 5 UKPF#NVGPDWTIGT8GTNGKJWPIGPFGU4KVVGTMTGW\GU++-NCUUGOKV5EJYGTVGTPPCEJYGKUDCT

169


DEUTSCHE STAATEN

8243

8242



8244

*GT\QINKEJ5CEJUGP'TPGUVKPKUEJGT*CWUQTFGP5KNDGTPGU8GTFKGPUVMTGW\#WUHÒJTWPI   #XGTUWPF4GXGTUUGKVGP/GFCKNNQPUOGJTVGKNKI5KNDGTQJPG$CPF$9-1'- ++



5#%*5'0#.6'0$74)*'4<1)67/   



*GT\QINKEJ 5CEJUGP'TPGUVKPKUEJGT *CWUQTFGP 8GTFKGPUVOGFCKNNG HÒT 5CEJUGP#NVGPDWTI  /QFGNN    #WUHÒJTWPI OKV DGKFUGKVKIGO $CEMGPDCTV    5KNDGTPG /GFCKNNG 5KNDGT OKV 5VGORGN   UEJPGKFGTUKIPCVWT*'.(4+%*6(OKP4CPFFGNNGPQJPG$CPF$9-1'- ++p



*GT\QINKEJ 5CEJUGP'TPGUVKPKUEJGT *CWUQTFGP 8GTFKGPUVOGFCKNNG #WUICDG HÒT 5CEJUGP#NVGPDWTI    /QFGNN OKV 2QTVTCKV *GT\QI 'TPUVU ++    #WUHÒJTWPI OKV 5VGORGNUEJPGKFGTUKIPCVWT   12'%*KO*CNUCDUEJPKVVWPFQJPG*GTUVGNNGTUKIPCVWT)QNFGPG8GTFKGPUVOGFCKNNG6[ROKV2WP\KG TWPI5+.$'4KO4CPF5KNDGTXGTIQNFGVCOPGWGP$CPF$9-1'- ++



8245





8246

8247

*GT\QI'TPUV/GFCKNNG/QFGNN OKVFGO2QTVTCKV*GT\QI'TPUV+ 5KNDGTPG/GFCKNNG 5KNDGTOKV5VGORGNUEJPGKFGTUKIPCVWT/*#5'416*COPGWGPPKEJVICP\MQTTGMVGP$CPF$9- 1'- ++



*GT\QI'TPUV/GFCKNNG/QFGNN OKV2QTVTCKV*GT\QI'TPUVU++ 5KNDGTCWHFGT8QTFGT UGKVG5VGORGNUEJPGKFGT\GKEJGP/*HÒT/*CUGTQVJCOUR·VGTGP$CPF1'- ++



#$PGPPV8GTNGKJWPIGPFKGUGT/GFCKNNG

5#%*5'0%1$74)70&)16*#*'4<1)67/   

*GT\QINKEJ 5CEJUGP'TPGUVKPKUEJGT *CWUQTFGP 8GTFKGPUVOGFCKNNG #WUICDG HÒT 5CEJUGP%QDWTI WPF   )QVJC  /QFGNN OKV FGO 2QTVTCKV XQP *GT\QI 'TPUV     #WUHÒJTWPI QJPG   5VGORGNUEJPGKFGTUKIPCVWT 5KNDGTPG8GTFKGPUVOGFCKNNG#PHGTVKIWPIHÒTFKGITQ­G1TFGPU UEJPCNNGOKVCPIGNÌVGVGT¤UG5KNDGTIW­KO4CPFRWP\KGTVCOUR·VGTGP$CPF ++



+PVGTGUUCPVG\GKVIGPÌUUKUEJG8CTKCPVGFKGUGTUGNVGPGP/GFCKNNGFKGDGK0/WPVGTFGT0TCDIGDKNFGVKUV

8248 (1:1)

8249 (1:1)



*GT\QI 'TPUV/GFCKNNG /KPKCVWT \WT 5KNDGTPGP /GFCKNNG &WTEJOGUUGT  OO 5KNDGT QJPG $·PF   EJGP 4++





/GFCKNNG HÒT -WPUV WPF 9KUUGPUEJCHV  /QFGNN OKV FGO 2QTVTCKV *GT\QI 'TPUVU +      /KPKCVWTFGT5KNDGTPGP/GFCKNNG5KNDGTQJPG$·PFEJGP ++



170


DEUTSCHE STAATEN

8250

8253

8252

5#%*5'0%1$74)70&)16*#*'4<1).+%*'(#/+.+' 5'+6  

/GFCKNNG\WT'TKPPGTWPICPFKGªDGTPCJOGFGT4GIKGTWPI*GT\QI%CTN'FWCTFU5KNDGTCO&TGK GEMUDCPF  1'- ++ &KG/GFCKNNGYWTFG\WOL·JTKIGP4GIKGTWPIULWDKN·WOFGU*GT\QIUCO,WNKIGUVKHVGV



5#%*5'0/'+0+0)'0*'4<1)67/   





*GT\QINKEJ5CEJUGP'TPGUVKPKUEJGT*CWUQTFGP8GTFKGPUVOGFCKNNGHÒT5CEJUGP/GKPKPIGP/QFGNN  #WUHÒJTWPI *'4<1) 810      5KNDGTPG /GFCKNNG 5KNDGT OKV 5VGORGNUEJPGKFGT   UKIPCVWT*'.(4+%*6(4CPFRWP\GPVGKNYGKUGCWUIGUEJNKHHGP¤UGGPVHGTPV$9-1'- +++



1TFGP HÒT (TCWGP WPF ,WPIHTCWGPKPFGT-TKGIUHÒTUQTIG-TKGIUOGVCNNDTQP\KGTVCPFGTQTKIKPCNGP &COGPUEJNGKHG\WUCOOGPOKVMNGKPGT$CPFUEJPCNNG1'- ++



8105#%*5'0/'+0+0)'0*'4<1).+%*'(#/+.+' 5'+6  *GT\QI)GQTI/GFCKNNG  $TQP\GCO$CPF

+p++

&KG/GFCKNNGYWTFGKO,CJTGXQPFGTXGTYKVYGVGP*GT\QIKP-NCTC/CTKCXQP5CEJUGP/GKPKPIGP   \WT'TKPPGTWPICPKJTGP)CVVGP)GQTI+++*GT\QIXQP5CEJUGP/GKPKPIGP KPTWUUKUEJGT-TKGIUIGHCPIGP UEJCHV CWU#PNC­FGTIGOGKPUCOGP&KCOCPVGPGP*QEJ\GKVKO,CJTGIGUVKHVGVWPFXGTNKGJGP

8254 8257



8258

5%*.'59+)*1.56'+0*'4<1)6ª/'4 $+5  

'TKPPGTWPIUMTGW\CPFKGUEJNGUYKIJQNUVGKPKUEJG#TOGG'KUGPIGUEJY·T\VCPUR·VGTGTHNCEJGT'KPGT 1TFGPUUEJPCNNGOKVPGWGP$·PFGTP1'- ++





'TKPPGTWPIUMTGW\CPFKGUEJNGUYKIJQNUVGKPKUEJG#TOGG'KUGPIGUEJY·T\VQJPG$CPF1'- ++





'TKPPGTWPIUMTGW\CPFKGUEJNGUYKIJQNUVGKPKUEJG#TOGG'KUGPIGUEJY·T\VQJPG$CPF1'- ++



9#.&'%-70&2;4/1068'4'+0+)6'5 5'+6 (ª456'067/ $+5  

8GTFKGPUVMTGW\8GTFKGPUVMTGW\-NCUUG5KNDGTVGKNYGKUGXGTIQNFGVWPFGOCKNNKGTVCOUR·VGTGP$CPF 1'- ++



8GTFKGPUVMTGW\ 5KNDGTPG 8GTFKGPUVOGFCKNNG  #WUHÒJTWPI OKV ITÌ­GTGO (ÒTUVGPJWV      /GFCKNNGOKV5EJYGTVGTP5KNDGTCO-TKGIUDCPF1'- ++



.CWV'HNGT KP'(95 UKPFXQPDKUKPUIGUCOV'ZGORNCTGXGTNKGJGPYQTFGPYQXQP5VÒEM PCEJFGO6QFFGT$GNKGJGPGP\WTÒEMIGIGDGPYQTFGPUKPF



171


DEUTSCHE STAATEN

8259 (min. verkleinert)

9ª466'/$'4)*'4<1)67/ $+5 -74(ª456'067/   70&-¤0+)4'+%*   

*GT\QINKEJ 9ÒTVVGODGTIKUEJGT 4KVVGTQTFGP XQP FGT ,CIF #WHPCJOG WPF 8GTNGKJWPIUWTMWPFG   HÒTFGPJGT\QINKEJYÒTVVGODGTIKUEJGP-COOGTJGTTP.WFYKI'TPUV)TCHXQP9KVVIGPUVGKPFCVKGTV.WF YKIUDWTICO0QXGODGTOKV1TKIKPCNWPVGTUEJTKHVXQP*GT\QI'DGTJCTF.WFYKIXQP9ÒTVVGO DGTI FGO 5VKHVGT FGU 1TFGPU 2GTICOGPV CEJV 5GKVGP <WUCOOGPIGDWPFGP OKVFGP \YGKVGP 5VCVWVGP FGU1TFGPUFCVKGTV5GKVGPWPFFTGK-WRHGTUVKEJGPOKVFGP#DDKNFWPIGPFGT+PUKIPKGP2CRKGT HQTOCV LGYGKNU  Z  EO \WUCOOGP KO IGNDUCOVGPGP QTKIKPCNGP $WEJGKPDCPF KO (QTOCV    Z  EO OKV FGP QTKIKPCNGP UGKFGPGP 8GTUEJNW­D·PFGTP WPF OKV -QTFGN CPJ·PIGPFGT 5KGIGNMCRUGN  

YQJN 'DGPJQN\  OKV GKPGO &WTEJOGUUGT XQP  OO FCTKP FCU WPDGUEJ·FKIV ITQ­G 1TFGPUUKGIGN KP   TQVGO 5KGIGNNCEM OKV GKPGO &WTEJOGUUGT XQP EC  OO <WUCOOGP KP GKPGO RCUUGPFGP OQFGTPGP   5EJWV\DGJ·NVGT #PIGDQVGP OKV GKPGT 2JQVQMQRKG FGU #WHUCV\GU XQP #NDGTV 4CHH &GT JGT\QINKEJYÒTV   VGODGTIKUEJG4KVVGTQTFGPXQPFGT,CIF#WU1TFGPWPF'JTGP\GKEJGP*GHVXQO#RTKN5 DKU 444++  $GFGWVGPFG XQNNUV·PFKIG 1TFGPUWTMWPFG OKV DGKIGDWPFGPGP 1TFGPUUVCVWVGP CWU FGO GTUVGP &TKVVGN FGU  ,CJT   JWPFGTVUXQPCNNGTITÌ­VGT5GNVGPJGKVWPFKPJGTXQTTCIGPFGT'TJCNVWPI'KPPCJG\WKFGPVKUEJGU'ZGORNCTKO$GUKV\ FGU*CWRVUVCCVUCTEJKXU5VWVVICTVKUVDGK4CHHCDIGDKNFGV'KPG-TÌPWPIHÒTLGFG9ÒTVVGODGTI5COONWPI  &GT JGT\QINKEJ 9ÒTVVGODGTIKUEJGT 4KVVGTQTFGP XQP FGT ,CIF YWTFG  XQP *GT\QI 'DGTJCTF .WFYKI XQP   9ÒTVVGODGTI  FGTFCU*GT\QIVWOUGKVTGIKGTVGIGUVKHVGV.CWV4CHHNGKVGVGGTFCU4GEJVJKGT\WXQP FGT9ÒTFGFGU,·IGT/GKUVGTUFGU*GKNKIGP4ÌOKUEJGP4GKEJGUCDFKGFWTEJFKG'TDUEJCHVFGT)TCHUEJCHV7TCEJCP FCU *CWU 9ÒTVVGODGTI IGMQOOGP YCT &KG GTUVGP 5VCVWVGP GTUEJKGPGP \YKUEJGP  WPF  FKG JKGT   CPIGDQVGPGP \YGKVGP5VCVWVGP&KG<CJNFGT1TFGPUTKVVGT CW­GTFGPHÒTUVNKEJGP2GTUÌPNKEJMGKVGP YCT\WP·EJUV CWH  DGITGP\V UR·VGT CWH  9GKVGTG 1TFGPUUVCVWVGP GTUEJKGPGP   WPF  /KV MÌPKINKEJGO &GMTGV   XQO  /·T\ QTFPGVG-ÌPKI(TKGFTKEJ+XQP9ÒTVVGODGTI  FKG4GQTICPKUCVKQPFGU1TFGPUWPVGT FGO PGWGP 0COGP -ÌPKINKEJGT *QJGT 1TFGP FGU IQNFGPGP #FNGTU CP YQOKV FGT 4KVVGTQTFGP FGT ,CIF HCMVKUEJ   CWHIGJQDGPYWTFG

172


DEUTSCHE STAATEN

8260 (1:1)

8261 (1:1)



8261 (1:1)

1TFGP FGT -ÌPKINKEJGP 9ÒTVVGODGTIKUEJGP -TQPG 4KVVGTMTGW\ -NCUUG  CD4KV VGTMTGW\ #PHGTVKIWPI FGU *QHLWYGNKGTU 'FWCTF (QGJT CWU FGP ,CJTGP  DKU  )QNF GOCKNNKGTV   ICOCNVGP1TKIKPCNDCPF ++  -NGKP WPF 4CHH PGPPGP KP 5/- 5    8GTNGKJWPIGP FGU 4KVVGTMTGW\GU  -NCUUG D\Y 4KVVGTMTGW\GU   \YKUEJGPWPF#WHITWPFXQP/GJTHCEJXGTNGKJWPIGPXQPPCEJFGO6QFGXQP$GNKGJGPGPCPFKG1TFGPU MCP\NGK \WTÒEMIGIGDGPGP 'ZGORNCTGP NKGIV FKG VCVU·EJNKEJG *GTUVGNNWPIU\CJNFGWVNKEJWPVGTGKPVCWUGPF'ZGORNCTGP 'KPGNCWV-NGKPWPF4CHH KP5/-5 CO1MVQDGTKO#WHVTCIFGU9ÒTVVGODGTIKUEJGP5VCCVOKPKUVG TKWOU GTUVGNNVG ōªDGTUKEJV ÒDGT FKG \WT <GKV CWUIGIGDGPGP YÒTVVGODGTIKUEJGP 1TFGPU\GKEJGP YGNEJG UVCVWCTKUEJ   YKGFGTCD\WNKGHGTPUKPFŋPGPPVGKPG<CJNXQP4KVVGTMTGW\GPFKGPCEJFGO#DNGDGPFGT$GNKGJGPGPPQEJ\WTÒEM IGIGDGPYGTFGPOÒUUGP  'FWCTF(QGJTNKGHGTVGNCWV8QNNOGT 8QNNOGT/CVVJKCU&GT-ÌPKINKEJYÒTVVGODGTIKUEJG*QHLWYGNKGT'FWCTF(QGJT +P 1' XQO (GDTWCT  5 HH  UGKV  YÒTVVGODGTIKUEJG 1TFGP WPF 'JTGP\GKEJGP YWTFG  \WO   *QHLWYGNKGT GTPCPPV WPF NKGHGTVG DKU  CNU GT PCEJ WPF PCEJ XQO -ÌPKINKEJGP /ÒP\COV CNU .KGHGTCPVGP   CDIGNÌUVYWTFG  /KV-ÌPKINKEJGO&GMTGVXQO5GRVGODGTXGTGKPKIVG-ÌPKI9KNJGNO+XQP9ÒTVVGODGTI  FGP -ÌPKINKEJGP *QJGP 1TFGP FGU IQNFGPGP #FNGTU WPF FGP -ÌPKINKEJGP <KXKNXGTFKGPUVQTFGP \WO PGWGP FTGKMNCUUKIGP  

)TQ­MTGW\-QOVWTWPF4KVVGT 1TFGPFGT-ÌPKINKEJGP9ÒTVVGODGTIKUEJGP-TQPG&KG5VCVWVGPFGUPGWGP1TFGPU YWTFGP KO ō-ÌPKINKEJ9ÒTVVGODGTIKUEJGP 5VCCVU WPF 4GIKGTWPIUDNCVV XQO  5GRVGODGT  0T ŋ   XGTÌHHGPVNKEJVHÒJTVG-ÌPKI-CTN  HÒT/KVINKGFGTFGTMÌPKINKEJGPWPFCPFGTGTUQWXGT·PGT(COKNKGP GKPGP DGUQPFGTGP $TWUVUVGTP WPF GKP DGUQPFGTGU 5EJWNVGTDCPF UQYKG HÒT FCU 4KVVGTMTGW\ CNU *ÌJGTUVWHWPI GKPG   -TQPG GKP +O <WUCOOGPJCPI OKV FGO &GWVUEJ(TCP\ÌUKUEJGP -TKGI  YWTFGHÒTCNNG-NCUUGPFKG /ÌINKEJMGKV FGT 8GTNGKJWPI OKV 5EJYGTVGTP GKPIGHÒJTV WPF FKG 4KVVGTMNCUUG KP  WPF  -NCUUG CWHIGVGKNV YQDGK   DGKO 4KVVGTMTGW\  -NCUUG FKG WONCWHGPFGP .ÌYGP KP 9GIHCNN MCOGP  YWTFGP FKG ō4KVVGTMTGW\G  -NCUUGŋ  

OKVQFGTQJPG-TQPG KPō'JTGPTKVVGTMTGW\Gŋ OKVQFGTQJPG-TQPG WODGPCPPV&KG-QOVWTMNCUUGYWTFGKP \YGK -NCUUGP OKV WPF QJPG 5VGTP  CWHIGVGKNV 7O  FÒTHVG PCEJ -NGKP WPF 4CHH KP 5/- 5   FKG   #WUTKEJVWPI FGT .ÌYGP PKEJV OGJT ōWONCWHGPFŋ UQPFGTP FKG DGKFGP QDGTGP PCEJ QDGP WPF FKG   DGKFGP WPVGTGP PCEJ WPVGP IGTKEJVGV  IG·PFGTV YQTFGP UGKP +O <WUCOOGPJCPI OKV FGT 0GWHCUUWPI FGT 5VCVWGP   GTHQNIVG  FKG 5VKHVWPI FGU WPVGTJCND FGT -QOVWTMNCUUG CPIGUKGFGNVGP 'JTGPMTGW\GU CNU5VGEMMTGW\ YQDGKFCU DKUJGTKIGō'JTGPTKVVGTMTGW\ŋKPō4KVVGTMTGW\OKVFGP.ÌYGPŋWODGPCPPVYWTFGFCUDKUJGTKIG'JTGPTKVVGTMTGW\OKV -TQPGIGTKGVKP9GIHCNN/KVFGO6JTQPXGT\KEJV-ÌPKI9KNJGNOU++XQP9ÒTVVGODGTI  CO0QXGO DGTYWTFGFGT1TFGPFGT9ÒTVVGODGTIKUEJGP-TQPG\WGKPGODKUJGWVGDGUVGJGPFGPGKPMNCUUKIGP GJGOCNKIGU )TQ­MTGW\HÒT/KVINKGFGTFGTMÌPKINKEJGP(COKNKG *CWUQTFGPFGTPWPOGJTKIGP(COKNKGFGT*GT\ÌIGXQP9ÒTVVGO DGTI



1TFGP FGT -ÌPKINKEJGP 9ÒTVVGODGTIKUEJGP -TQPG 4KVVGTMTGW\  -NCUUG OKV 5EJYGTVGTP     CD4KVVGTMTGW\OKV5EJYGTVGTP#PHGTVKIWPIFGU*QHLWYGNKGTU'FWCTF(QGJTCWUFGP,CJTGP DKU#WUHÒJTWPIOKVFWTEJ¤UGPDGHGUVKIVGP5EJYGTVGTP)QNFGOCKNNKGTVICOUEJOC NGPCNVGP1TKIKPCNDCPF1'- ++  -NGKP WPF 4CHH PGPPGP KP 5/- 5    8GTNGKJWPIGP FGU 4KVVGTMTGW\GU  -NCUUG OKV 5EJYGTVGTP D\Y   4KVVGTMTGW\GU OKV 5EJYGTVGTP \YKUEJGP  WPF  #WHITWPF XQP /GJTHCEJXGTNGKJWPIGP XQP PCEJ FGO 6QFG   XQP $GNKGJGPGP CP FKG 1TFGPUMCP\NGK \WTÒEMIGIGDGPGP 'ZGORNCTGP NKGIV FKGVCVU·EJNKEJG*GTUVGNNWPIU\CJNFGWVNKEJ WPVGT GKPVCWUGPF 'ZGORNCTGP 'KPG NCWV -NGKP WPF 4CHH KP 5/- 5   CO  1MVQDGT  KO #WHVTCI FGU   9ÒTVVGODGTIKUEJGP 5VCCVOKPKUVGTKWOU GTUVGNNVG ōªDGTUKEJV ÒDGT FKG \WT <GKV CWUIGIGDGPGP YÒTVVGODGTIKUEJGP 1T   FGPU\GKEJGPYGNEJGUVCVWCTKUEJYKGFGTCD\WNKGHGTPUKPFŋPGPPVGKPG<CJNXQP4KVVGTMTGW\GPOKV5EJYGTVGTPFKG PCEJFGO#DNGDGPFGT$GNKGJGPGPPQEJ\WTÒEMIGIGDGPYGTFGPOÒUUGP.CWV0KOOGTIWV KP0+5 UKPFXQP  DKU  KPUIGUCOV PWTEC  8GTNGKJWPIGPXQTIGPQOOGPYQTFGPWPFNCWV-NKGVOCPP KP-/65  XQP  DKU  PWT  8GTNGKJWPIGP YQXQP FKG OGKUVGP 'ZGORNCTG YQJN KP XGTIQNFGVGO 5KNDGT CWUIGHÒJTV   YCTGP 

173


DEUTSCHE STAATEN

8262 (1:1)



-ÌPKINKEJ9ÒTVVGODGTIKUEJGT (TKGFTKEJU1TFGP  /QFGNN OGJTMNCUUKI    4KVVGTMTGW\   D\Y CD 4KVVGTMTGW\-NCUUGGTUVGHNCEJGTG#WUHÒJTWPI#PHGTVKIWPIFGT(KTOC(TCP\5VGKPCO KP 5VWVVICTV )QNF GOCKNNKGTV  I OKP 'OCKNNGTGRCTCVWT KO 4GXGTUOGFCKNNQP CO CNVGP VGKNYGKUG   CWUIGDNGKEJVGP1TKIKPCNDCPF1'- ++



#PHGTVKIWPI FGT (KTOC 5VGKPCO CWU FGO FTKVVGP 8KGTVGN FGU   ,CJTJWPFGTVU .CWV -NGKP WPF 4CHH KP 5/-   5 NKGHGTVGFKG(KTOC(TCP\5VGKPCOXQPDKUCWEJFKG4KVVGTMTGW\GD\Y4KVVGTMTGW\G-NCUUGFGU (TKGFTKEJQTFGPU 'DGPHCNNU NCWV -NGKP WPF 4CHH KP 5/- 5   YWTFGP XQP  DKU  KPUIGUCOV    4KVVGTMTGW\GD\Y4KVVGTMTGW\G-NCUUGXGTNKGJGPYQXQPLGFQEJFKGCNNGTOGKUVGPPCEJ#DNGDGPFGT$GNKGJGPGPCP FKG1TFGPUMCP\NGK\WTÒEMIGIGDGPYQTFGPUGKPFÒTHVGP  &GT\WP·EJUVGKPMNCUUKIG1TFGPYWTFGCO,CPWCTXQP-ÌPKI9KNJGNO+XQP9ÒTVVGODGTI  KP 'TKPPGTWPI CP UGKPGP 8CVGT -ÌPKI (TKGFTKEJ +   IGUVKHVGV  YWTFG FGT 1TFGP CWH XKGT -NCUUGP   GTYGKVGTV /QFGNN )TQ­MTGW\-QOVWTWPF-NCUUGWPF4KVVGTGTHQNIVGFKG7PVGTVGKNWPIFGT4KVVGTKP GKPG GTUVG WPF GKPG \YGKVG -NCUUG <WFGO YWTFGP HÒT FKG -TGW\G CNNGT -NCUUGP FKG 5EJYGTVGT IGUVKHVGV    GTJKGNVGP CWEJ FKG 1TFGPUUVGTPG FKG 5EJYGTVGT &KG )QNFGPG 8GTFKGPUVOGFCKNNG YWTFG  IGUVKHVGV WPF FCU )TQ­MTGW\OKV-TQPG/KVFGT#DUEJCHHWPIFGT/QPCTEJKGKO0QXGODGTGTNQUEJCWEJFGT1TFGP

8263 (1:1)





8264 (1:1)

-ÌPKINKEJ9ÒTVVGODGTIKUEJGT (TKGFTKEJU1TFGP  /QFGNN OGJTMNCUUKI    4KVVGTMTGW\   D\Y CD   4KVVGTMTGW\  -NCUUG \YGKVGXQNWOKPÌUGTG#WUHÒJTWPI#PHGTVKIWPIFGU*QHLWYGNKGTU 'FWCTF(QGJTKP5VWVVICTV\YKUEJGPWPF)QNFGOCKNNKGTVMCWOUKEJVDCTG'OCKNNGMTCV\GTWPF QDGTHN·EJNKEJGT %JKR CWH #XGTU WPF 4GXGTU FGU QDGTGP -TGW\CTOU CO CNVGP VGKNYGKUG CWUIGDNGKEJVGP   1TKIKPCNDCPF1'- ++



-ÌPKINKEJ9ÒTVVGODGTIKUEJGT (TKGFTKEJU1TFGP  /QFGNN OGJTMNCUUKI    4KVVGTMTGW\   D\Y CD   4KVVGTMTGW\  -NCUUG \YGKVG XQNWOKPÌUGTG #WUHÒJTWPI #PHGTVKIWPI FGU -ÌPKINKEJGP   /ÒP\COVUKP5VWVVICTV\YKUEJGPWPF5KNDGTXGTIQNFGVWPFGOCKNNKGTVMCWOUKEJVDCTG'OCKN NGTGRCTCVWTKPGKPGT'EMGFGT4ÒEMUGKVGFGUQDGTGP-TGW\CTOUCONCPIGPCNVGPVGKNYGKUGCWUIGDNGKEJVGP 1TKIKPCNDCPF1'- ++p



.CWV-NGKPWPF4CHH KP5/-5 YWTFGPKPFGP,CJTGPDKUKPUIGUCOV4KVVGTMTGW\G-NCUUGKP 5KNDGTXGTIQNFGVXQPFGT5VWVVICTVGT/ÒP\GJGTIGUVGNNV&CGDGPHCNNUNCWV-NGKPWPF4CHH KP5/-5 FKGCO 1MVQDGTKO#WHVTCIFGU9ÒTVVGODGTIKUEJGP5VCCVOKPKUVGTKWOUGTUVGNNVGōªDGTUKEJVÒDGTFKG\WT<GKVCWU IGIGDGPGP YÒTVVGODGTIKUEJGP 1TFGPU\GKEJGP YGNEJG UVCVWCTKUEJ YKGFGT CD\WNKGHGTP UKPFŋ GKPG <CJN XQP    4KVVGTMTGW\GP-NCUUGPGPPVFKGPCEJFGO#DNGDGPFGT$GNKGJGPGPPQEJ\WTÒEMIGIGDGPYGTFGPOÒUUGPKUVFCXQP CWU\WIGJGP FC­ FKG 'ZGORNCTG KP 5KNDGT XGTIQNFGV JGWVG YGKVCWU UGNVGPGT \W HKPFGP UKPF CNU FKGLGPKIGP KP )QNF   &CU-ÌPKINKEJG/ÒP\COVKP5VWVVICTVNKGHGTVGXQPCPYÒTVVGODGTIKUEJG1TFGPUKPUKIPKGPWPFYCTXQP DKUFGTGPCNNGKPKIGTQHHK\KGNNGT.KGHGTCPV

174


DEUTSCHE STAATEN

8265



8266

-ÌPKINKEJ9ÒTVVGODGTIKUEJGT(TKGFTKEJU1TFGP/QFGNN OGJTMNCUUKI 4KVVGTMTGW\ -NCUUG OKV 5EJYGTVGTP   \YGKVG XQNWOKPÌUGTG #WUHÒJTWPI #PHGTVKIWPI FGU *QHLWYGNKGTU   'FWCTF (QGJT KP 5VWVVICTV \YKUEJGP  WPF  OKV UVCTT XGTNÌVGVGP 5EJYGTVGTP )QNF GOCKNNKGTV    I PCJG\W WPUKEJVDCTG 'OCKNNGTGRCTCVWTGP KP FGP 5RKV\GP FGU QDGTGP -TGW\CTOU CO QTKIKPCNGP   5RTWPITKPI OKV UR·VGTGP LGFQEJ CNVGP $CPFCDUEJPKVV KO QTKIKPCNGP IQNFGP DGFTWEMVGP 8GTNGKJWPIUGVWK   FGT(KTOC(QGJT1'- ++



-ÌPKINKEJ9ÒTVVGODGTIKUEJGT (TKGFTKEJU1TFGP  /QFGNN OGJTMNCUUKI    4KVVGTMTGW\   -NCUUGOKV5EJYGTVGTP\YGKVGXQNWOKPÌUGTG#WUHÒJTWPI#PHGTVKIWPIFGU-ÌPKINKEJGP/ÒP\COVUKP 5VWVVICTV\YKUEJGPWPF5KNDGTXGTIQNFGVWPFGOCKNNKGTVOKVMWT\GO1TKIKPCNDCPFKOQTKIKPC NGPIQNFGPDGFTWEMVGP8GTNGKJWPIUGVWK1'- ++



.CWV-NGKPWPF4CHH KP5/-5 YWTFGPKPFGP,CJTGPDKUKPUIGUCOV4KVVGTMTGW\G-NCUUG OKV5EJYGTVGTPKP)QNFXQO*QHLWYGNKGT'FWCTF(QGJTIGNKGHGTVYQXQP5VÒEMOKV5EJYGTVGTPXQP5VGKPCO OKV 5EJCTPKGTGP XGTUGJGPYCTGP(ÒTFGP<GKVTCWOXQPDKUPGPPGPUKG KP5/-5 8GTNGKJWP IGP FGU 4KVVGTMTGW\G  -NCUUG OKV 5EJYGTVGTP &C GDGPHCNNU NCWV -NGKP WPF 4CHH KP 5/- 5   FKG CO    1MVQDGTKO#WHVTCIFGU9ÒTVVGODGTIKUEJGP5VCCVOKPKUVGTKWOUGTUVGNNVGōªDGTUKEJVÒDGTFKG\WT<GKVCWUIGIG DGPGP YÒTVVGODGTIKUEJGP 1TFGPU\GKEJGP YGNEJG UVCVWCTKUEJ YKGFGT CD\WNKGHGTP UKPFŋ GKPG <CJN XQP  4KVVGT   MTGW\GP-NCUUGOKV5EJYGTVGTPPGPPV GKPUEJNKG­NKEJFGTJÌEJUVGPU'ZGORNCTGKP5KNDGTXGTIQNFGV FKGNCWV -NGKPWPF4CHH KP5/-5 \YKUEJGPWPFXQPFGT5VWVVICTVGT/ÒP\GJGTIGUVGNNVYWTFGP FKGPCEJ FGO#DNGDGPFGT$GNKGJGPGPPQEJ\WTÒEMIGIGDGPYGTFGPOÒUUGPKUVFCXQPCWU\WIGJGPFC­FKG'ZGORNCTGKPGEJV )QNFJGWVGYGKVCWUUGNVGPGT\WHKPFGPUKPFCNUFKGLGPKIGPKP5KNDGTXGTIQNFGV



.CWV-NGKPWPF4CHH KP5/-5 YWTFGPKPFGP,CJTGPDKUKPUIGUCOV4KVVGTMTGW\G-NCUUG KP5KNDGTXGTIQNFGVXQPFGT5VWVVICTVGT/ÒP\GJGTIGUVGNNV

8268 8267



8269

-ÌPKINKEJ9ÒTVVGODGTIKUEJGT (TKGFTKEJU1TFGP  /QFGNN OGJTMNCUUKI    4KVVGTMTGW\    -NCUUG OKV 5EJYGTVGTP #PHGTVKIWPI XQP 1VVQ9GPPDGTIKP5VWVVICTV  5KNDGT)QNF CWEJFKG 5EJYGTVGT GOCKNNKGTVQJPG$CPF1'- 4+p++



-ÌPKINKEJ9ÒTVVGODGTIKUEJGT (TKGFTKEJU1TFGP  /QFGNN OGJTMNCUUKI    4KVVGTMTGW\    -NCUUG OKV 5EJYGTVGTP #PHGTVKIWPI FGU -ÌPKINKEJGP /ÒP\COVU   5KNDGT VGKNYGKUG XGT   IQNFGVWPFGOCKNNKGTV$CPFTKPIGTI·P\VQJPG$CPF1'- ++



1NIC1TFGP#WUHÒJTWPIHÒT&COGP5KNDGT0COGPUEJKHHTG)QNFVGKNYGKUGGOCKNNKGTVCPFGTQTKIKPC NGPITQ­GPCNVGP&COGPUEJNGKHG1'- ++



'ZGORNCTGFKGUGU*GTUVGNNGTUUKPFUGNVGP.CWV4CHH KP5/-5 NKGHGTVG1VVQ9GPPDGTIKPUIGUCOVPWT 'ZGORNCTGFGU4KVVGTMTGW\GU-NCUUGOKV5EJYGTVGTPCNNGKO,CJTG&KG7PVGTUEJGKFWPIUOGTMOCNGUKPFKO INGKEJGP9GTMCWH5GTUKEJVNKEJ





&GT GKPMNCUUKIG 1TFGP YWTFG CO  ,WPK  XQP -ÌPKI -CTN   XQP 9ÒTVVGODGTI \W 'JTGP UGKPGT   )CVVKP-ÌPKIKP1NIC0KMQNCLGYPC4QOCPQYC  )TQ­HÒTUVKPXQP4W­NCPFWPF-ÌPKIKPXQP9ÒTVVGODGTI IGUVKHVGV 'T MQPPVG CP (TCWGP WPF /·PPGT HÒT DGUQPFGTG 8GTFKGPUVG WOFKGHTGKYKNNKIG2HNGIGWPF*KNHGKP-TKGI WPF(TKGFGPXGTNKGJGPYGTFGP/KVFGT5VKHVWPIFGU%JCTNQVVGPMTGW\GUCO,CPWCTYWTFGFKG8GTNGKJWPIFGU 1TFGPUGKPIGUVGNNV

175


DEUTSCHE STAATEN

8270

8272

8271

8273

8274



<KXKNXGTFKGPUVOGFCKNNG/QFGNN OKVFGO2QTVTCKV-ÌPKI-CTNU 5KNDGTPG8GTFKGPUVOG FCKNNG#WUHÒJTWPIOKV5VGORGNUEJPGKFGTUKIPCVWT%5%*0+6<52#*0QJPG$CPF1'- ++





5KNDGTPGU 8GTFKGPUVMTGW\   8GTFKGPUVMTGW\ QJPG 5EJYGTVGT  #PHGTVKIWPI FGT (KTOC 'FWCTF   (QGJTKP5VWVVICTV  #WUHÒJTWPIOKVUGRCTCVIGHGTVKIVGP/GFCKNNQPU5KNDGTCOCNVSWGTOQP VKGTVGP$CPFOKV5KEJGTJGKVUPCFGN1'- +p++





'TKPPGTWPIUOGFCKNNG\WOL·JTKIGP4GIKGTWPIULWDKN·WO-ÌPKI-CTNU)QNFGPG'TKPPGTWPIU OGFCKNNG$TQP\GXGTIQNFGVCO$CPF1'- ++





5KNDGTPG*QEJ\GKVUOGFCKNNG  5KNDGTQJPG$CPF1'-





,WDKN·WOU9KNJGNOUMTGW\DKUJGTCNU9KNJGNOUMTGW\HÒTUQPUVKIG8GTFKGPUVWOFKGÌHHGPVNKEJG 9QJNHCJTVDG\GKEJPGV 1JPG4ÒEMUGKVGPKPUEJTKHV $TQP\GCO$CPFKO1TKIKPCNGVWKFGU-ÌPKINKEJGP /ÒP\COVUKP5VWVVICTV1'-5/-1 ++

+P FKGUGT #WUHÒJTWPI YQJN XQP GKPGT &COG IGVTCIGP .CWV 4CHH KP 5/- 5   YWTFGP XQP  DKU    KPUIGUCOV  XQP 'FWCTF (QGJT IGNKGHGTVG 'ZGORNCTG XGTNKGJGP &KG 7PVGTUEJGKFWPIUOGTMOCNG UKPF KO INGKEJGP   9GTMCWH5GTUKEJVNKEJYQDGKFKG#PICDGPDG\ÒINKEJFGT/GFCKNNQPUHÒT'ZGORNCTGQJPGWPFOKV5EJYGTVGTP KFGPVKUEJUKPF

++



0GWG(QTUEJWPIUGTIGDPKUUGXQP#NDGTV4CHHWPF7NTKEJ-NGKP XGTÌHHGPVNKEJVKP5/-5H DGNGIGPGKPFGWVKI FC­ GU UKEJ DGK FKGUGO H·NUEJNKEJGTYGKUG DKUJGT UQ DG\GKEJPGVGP ō9KNJGNOUMTGW\ HÒT UQPUVKIG 8GTFKGPUVG WO FKG   ÌHHGPVNKEJG 9QJNHCJTVŋ KP 9KTMNKEJMGKV WO GKPG XQP -ÌPKI 9KNJGNO ++   CWU #PNC­ UGKPGU L·JTKIGP   4GIKGTWPIULWDKN·WOU KPKVKKGTVG #WUICDG JCPFGNV FKG OKV GKPGTPQTOCNGP8GTNGKJWPIUWTMWPFGQJPGDGUQPFGTGP*KP YGKUCWHFCU4GIKGTWPIULWDKN·WOLGFQEJOKVFGOIGFTWEMVGP8GTNGKJWPIUFCVWOXQO1MVQDGTCWUIGIGDGP YWTFGP .CWV 4CHH-NGKP YCTGP DKU \WO  1MVQDGT  OGJT CNU  #PVT·IG CWH 8GTNGKJWPI FGT   ō,WDKN·WOUCWUICDGŋGKPIGICPIGP

8276

8277

8278



9KNJGNOUMTGW\9KNJGNOUMTGW\OKV5EJYGTVGTP$TQP\GQJPG$CPF1'-

++





&KGPUV'JTGP\GKEJGP/QFGNN OKV/QPQITCOO9WPF4ÒEMUGKVGPOGFCKNNQP -TGW\ -NCUUGHÒT&KGPUVLCJTG$TQP\GXGTIQNFGVVGKNYGKUGGOCKNNKGTVCO$CPF ++





&KGPUV'JTGP\GKEJGP/QFGNN OKV/QPQITCOO9WPF4ÒEMUGKVGPOGFCKNNQP -TGW\  -NCUUG HÒT  &KGPUVLCJTG XCTKCPVG #WUHÒJTWPI OKV PCEJ WPVGP IGTKEJVGVGP 5EJYGTVGTP   CWH FGO   4GXGTUOGFCKNNQP5KNDGTVGKNYGKUGGOCKNNKGTVCO$CPF ++



+PVGTGUUCPVGKPGKPGO5VÒEMIGHGTVKIVG8CTKCPVG



176

&KGPUVCWU\GKEJPWPI HÒT 7PVGTQHHK\KGTG  /QFGNN OKV FGO /QPQITCOO -ÌPKI 9KNJGNOU ++      /KPKCVWTFGT-NCUUGHÒT&KGPUVLCJTG5KNDGTXGTIQNFGVWPFGOCKNNKGTVCP4GXGTUUEJNGKHGOKV 4GXGTUMPQRHFGT(KTOC/C[GT9KNJGNOKP5VWVVICTVKO1TKIKPCNGVWKFGT(KTOC 4++




DEUTSCHE STAATEN

8279



(CJPGPOGFCKNNGHÒT-TKGIGTXGTGKPG$TQP\GXGTUKNDGTV\YGKMNGKPG4CPFFGNNGPQJPG$CPF

++



)GUVKHVGVCO0QXGODGTFWTEJ-ÌPKI9KNJGNO++XQP9ÒTVVGODGTI  WPFDKUCPYÒTVVGO DGTIKUEJG-TKGIGTXGTGKPGXGTNKGJGPFKGKJTL·JTKIGU$GUVGJGPHGKGTVGP

8280



$TQUEJG WPVGT 8GTYGPFWPI GKPGT &KGPUVCWU\GKEJPWPI  -NCUUG /QFGNN  $TQP\G XGT   IQNFGV QJPG 'KUGPRN·VVEJGP OKV GKPGO XQP WTURTÒPINKEJ \YGK  <CJP OÌINKEJGTYGKUG GKPGU -KPFGU    CP0CFGN ++



'XGPVWGNNCWEJGKP,CIFUEJOWEM

8281 (1:1)

*1%*56+(6&'5(ª456$+567/59ª4<$74) $+5  

-·OOGTGT5EJNÒUUGN #WUHÒJTWPI OKV FGO 9CRRGP XQP #FCO (TKGFTKEJ )TCH XQP 5GKPUJGKO      (ÒTUVDKUEJQH XQP 9ÒT\DWTI XQP  DKU   WPF $CODGTI $TQP\G XGTIQNFGV 8GTIQNFWPI   GVYCUDGTKGDGP 44++



<YGKHGNUHTGKGU1TKIKPCNGZGORNCTFKGUGUHTÒJGPWPFUGNVGPGP-·OOGTGT5EJNÒUUGNUCWUFGOFTKVVGP8KGTVGNFGU#EJV \GJPVGP ,CJTJWPFGTVU &KG )GUVCNVWPI FGT YÒT\DWTIKUEJGP 5EJNÒUUGN KUV DGTGKVU WPVGT (ÒTUVDKUEJQH (TKGFTKEJ %CTN   )TCH CD XQP5EJÌPDQTP$WEJJGKO  FGTXQPDKUTGIKGTVGGKPIGHÒJTVYQTFGPPWTFCU 9CRRGP YWTFG GPVURTGEJGPF CPIGRC­V XIN &WYG )GQTI  'T\M·OOGTGT -COOGTJGTTGP WPF KJTG 5EJNÒUUGN   1UPCDTÒEM5HH 

177


DEUTSCHES REICH 1871-1918

8282 (1:1)

*'+.+)'54¤/+5%*'54'+%*&'765%*'40#6+10 $+5  

#FNKIG )CPGTDUEJCHV #NVGP.KORWTI \W (TCPMHWTV CO /CKP &GMQTCVKQP FGT /KVINKGFGT  /QFGNN  

OKV TWFQNRJKPKUEJGT -CKUGTMTQPG CD    Z  OO )QNF GOCKNNKGTV OKP #DRNCV\WPIGP KO   XQTFGTWPFTÒEMUGKVKIGP/GFCKNNQPTKPICP$CPFUEJNGKHGOKV6TCIGMPQRH 44++p

&KG&GMQTCVKQPFKGUGT)GUEJNGEJVGTIGUGNNUEJCHVKUVXQPCNNGTITÌ­VGT5GNVGPJGKV5KGYWTFGNCWV2TQEJ±\MC KP2)#5 H  CO  /·T\  XQP (TCP\ ++ -CKUGT FGU *GKNKIGP 4ÌOKUEJGP 4GKEJGU &GWVUEJGT 0CVKQP IGUVKHVGV   &KGNGV\VGP5VCVWVGPFGT)GUGNNUEJCHVUVCOOGPXQP

ex 8283



8286

8285

&'765%*'54'+%* 

%JKPC&GPMOÒP\G  <YGK 'ZGORNCTG   #WUICDG HÒT -·ORHGT $TQP\G   #WUICDG HÒT   0KEJVM·ORHGT5VCJN,GYGKNUCP$·PFGTP1'- 5VÒEM++



%JKPC&GPMOÒP\G/GFCKNNGHÒT-·ORHGT$TQP\GQJPG$CPF1'-



%JKPC&GPMOÒP\G  /GFCKNNG HÒT -·ORHGT $TQP\G QJPG $CPFTKPI WPF QJPG $CPF   1'- ++





5ÒFYGUVCHTKMC&GPMOÒP\G )NCVVG 'KPGT1TFGPUUEJPCNNG QJPG FKG /GFCKNNG  OKV FTGK CWHIGNGIVGP   )GHGEJVUURCPIGP 07&74#5 -Š4#5$'4)' WPF )41550#/#.#0& #P 0CFGN 1'-    ++



8GTYWPFGVGPCD\GKEJGP-QPXQNWVXQPPGWP'ZGORNCTGPXGTUEJKGFGPG5VWHGPFCXQP\YGKFWTEJ DTQEJGPKPXGTUEJKGFGPGP/GVCNNGPOCIPGVKUEJWPFPKEJVOCIPGVKUEJKPWPVGTUEJKGFNKEJGP'TJCNVWPIGP 5VÒEM++++p++++++





++

 

8288

 178

#D\GKEJGPHÒT/KNKV·T(NWI\GWIHÒJTGT5KNDGTJQJNIGRT·IVWPFXGTDÌFGVCP0CFGNKODTCWPGP1TK IKPCNGVWK1'- ++




DEUTSCHES REICH 1919-1933

8289

8290

&'765%*'54'+%* 51)'0#006'9'+/#4'44'27$.+-  

$CNVGPMTGW\5VGEMMTGW\OGJTVGKNKIG(GTVKIWPI#WHNCIGXGTPKGVGVCP0CFGN1'-

++



#D\GKEJGPHÒT8GTFKGPUVGWOFKG-QNQPKGPUQIGPCPPVGT'NGRJCPVGPQTFGP5VGEMCD\GKEJGP-TKGIU OGVCNNCP0CFGN1'- ++

 

8291 (1:1)



-CORHYCIGP#D\GKEJGP *QJN IGRT·IV WPF XGTDÌFGV XGTUKNDGTV CP 0CFGN 0/  D   1'- ++ 

8292

8293

8294

(4'+-1425 

.WDNKPKV\-TGW\FGU5GNDUVUEJWV\$CVCKNNQPU.WDNKPKV\-TGW\-NCUUG$TQP\GXGTIQNFGVWPFGOCKN NKGTVCWHFGT4ÒEMUGKVG*GTUVGNNGTRWP\GCP0CFGN0/C 4++





.WDNKPKV\-TGW\FGU5GNDUVUEJWV\$CVCKNNQPU.WDNKPKV\-TGW\-NCUUG$TQP\GXGTUKNDGTVWPFGOCKN NKGTVCWHFGT4ÒEMUGKVG*GTUVGNNGTRWP\GQJPG$CPFTKPIWPFQJPG$CPF0/D 4++





#PPCDGTIMTGW\ FGU (TGKMQTRU 1DGTNCPF 5VGEMMTGW\ XGTUKNDGTV WPF GOCKNNKGTV OKV 3WGTPCFGN 0/   D1'- ++

 179


DEUTSCHES REICH 1919-1933

8295

8298

8297

8296

51.&#6'070&8'6'4#0'08'4$0&' 

-QNQPKCNCWU\GKEJPWPIFGU&GWVUEJGP-QNQPKCN-TKGIGT$WPFGUUQIGPCPPVGT.ÌYGPQTFGP-QNQPKCN CWU\GKEJPWPIKP5KNDGT5VGEMCD\GKEJGP$TQP\GXGTUKNDGTVCP0CFGN0/C ++





$WPFGU'JTGPMTGW\ FGU $CFKUEJGP -TKGIGT$WPFGU $WPFGU'JTGPMTGW\ + -NCUUG HÒT  ,CJTG XGT   IQNFGVWPFGOCKNNKGTVCWHFGT4ÒEMUGKVG*GTUVGNNGTDG\GKEJPWPIFGT(KTOC$*/C[GTKP2HQT\JGKOKP FGTQTKIKPCNGP8GTNGKJWPIUVÒVG0/E ++





'JTGPMTGW\ OKV 5EJYGTVGTP FGU 'JTGPDWPFGU 5·EJUKUEJGT 9GNVMTKGIUVGKNPGJOGT G 8 8GTIQNFGV   COCNVGP1TKIKPCNDCPF ++





(TQPVMTGW\FGU(TQPVMTKGIGTDWPFGUG88GTUKNDGTVVGKNYGKUGXGTIQNFGVWPFGOCKNNKGTVCWHFGT4ÒEM UGKVG*GTUVGNNGTDG\GKEJPWPIFGT(KTOC&GUEJNGT5QJPKP/ÒPEJGPCP0CFGN0/ ++



8300 8299

8301

$#;'40(4'+56##6 5'+6  

(GWGTYGJT'JTGPMTGW\ FGU .CPFGUHGWGTYGJTXGTDCPFGU $C[GTP 'JTGPMTGW\ HÒT  &KGPUVLCJTG   5KNDGTVGKNYGKUGXGTIQNFGVWPFGOCKNNKGTVCWHFGONKPMGP-TGW\CTORWP\KGTVCOQTKIKPCNGPCNVGP &TGKGEMUDCPF'(. ++



)GUVKHVGVCO5GRVGODGTFWTEJFGP.CPFGUHGWGTYGJTCWUUEJW­$C[GTPWPFDKUXGTNKGJGP

24'755'0(4'+56##670&4'27$.+-   

(GWGTYGJT'TKPPGTWPIUCD\GKEJGP HÒT 8GTFKGPUV 5KNDGT IGRT·IV  CWH FGT 4ÒEMUGKVG DG\GKEJPGV   24'75556##65/ª0<'WPF5+.$'4('+0CP$TQUEJKGTWPIOKV0CFGN1'- ++



<YGKHGNUHTGKIGRT·IVGU1TKIKPCNGZGORNCTCNUUQNEJGUPKEJVJ·WHKI\WHKPFGP<WFKGUGO'JTGP\GKEJGPWPFDGUQPFGTU \WT 2TQDNGOCVKM FGT )W­H·NUEJWPIGP UKGJG-NCGFMG$GTPF&CU(GWGTYGJT'TKPPGTWPIUCD\GKEJGPHÒT8GTFKGPUVG FGT 4GRWDNKM 2TGW­GP +P /KNKVCTKC  ,I  *GHV  5 HH  0CEJFGO OKV FGO )GUGV\ ÒDGT FCU (GWGT   NÌUEJYGUGPXQO&G\GODGTFCUUGNDGPGWIGTGIGNVYQTFGPYCTYWTFGFKGUGU'JTGP\GKEJGPOKV4WPFGTNCUU 0T ++ &  FGU RTGW­KUEJGP +PPGPOKPKUVGTKWOU XQO  &G\GODGT  IGUVKHVGV FKG 8GTNGKJWPIUTKEJVNKPKGP   YWTFGPKO/KPKUVGTKCNDNCVVHÒTFKG+PPGTG8GTYCNVWPI0T5HHXGTÌHHGPVNKEJV0CEJFGT5VKHVWPIFGU 4GKEJUHGWGTYGJTGJTGP\GKEJGPU FWTEJ FGP 4GKEJUOKPKUVGT FGU +PPGTP 9KNJGNO (TKEM   CO&G\GODGT YWTFGFKG8GTNGKJWPIFGURTGW­KUEJGP'JTGP\GKEJGPUGKPIGUVGNNV



(GWGTYGJT8GTFKGPUVMTGW\FGU$TCPFGPDWTIKUEJGP2TQXKP\KCNHGWGTYGJTXGTDCPFGU$TQP\GXGTIQNFGV WPFGOCKNNKGTVCOQTKIKPCNGPCNVGPVGKNYGKUGXGTH·TDVGP$CPF'( ++ &CUUGJTUGNVGPG'JTGP\GKEJGPYWTFGNCWV'HNGT KP'( Y·JTGPFFGU8GTDCPFUVCIUFGU$TCPFGPDWTIKUEJGP2TQXKP \KCNHGWGTYGJTXGTDCPFGUCO1MVQDGTIGUVKHVGVWPFPWTGVYC\YGK,CJTGNCPIDKUXGTNKGJGP

180




DEUTSCHES REICH 1933-1945

&'765%*'54'+%* 51)'0#006'5&4+66'54'+%*  5QNCPIG UKEJ -WPFG WPF 8GTM·WHGT PKEJV IGIGPVGKNKI ·W­GTP XGTUKEJGTP UKG FC­ UKG )GIGPUV·PFG WPF   $Ã&#x2019;EJGT CWU FGT <GKV FGU &GWVUEJGP4GKEJGUXQPDKUPWT\W<YGEMGPFGTUVCCVUDÃ&#x2019;TIGTNKEJGP #WHMN·TWPIFGT#DYGJTXGTHCUUWPIUYKFTKIGT$GUVTGDWPIGPFGT-WPUVQFGTFGT9KUUGPUEJCHVFGT(QT UEJWPI QFGT FGT .GJTG FGT $GTKEJVGTUVCVVWPI Ã&#x2019;DGT 8QTI·PIG FGU <GKVIGUEJGJGPU QFGT FGT )GUEJKEJVG   QFGT ·JPNKEJGP <YGEMGP GTYGTDGP &KGUG )GIGPUV·PFG WPF $Ã&#x2019;EJGT YGTFGP ITWPFU·V\NKEJ PWT WPVGT   FKGUGP8QTCWUUGV\WPIGPCPIGDQVGPWPFCDIGIGDGP  5QOKV UVGNNV FGT 'TYGTD XQP )GIGPUV·PFGP WPF $Ã&#x2019;EJGTP CWU FKGUGT <GKV WPVGT FGP QDGP CWHIGHÃ&#x2019;JTVGP   8QTCWUUGV\WPIGP IGO·­ FGT hh C #DU  D\Y  #DU  5V)$ MGKPGP 5VTCHVCVDGUVCPF KO 5KPPG FGU   h C #DU  5V)$ FCT 7PVGT FKGUGP 7OUV·PFGP KUV GU CNUQ ITWPFU·V\NKEJ GTNCWDV 1TFGP WPF   'JTGP\GKEJGPFKGKPh#DU)GUGV\Ã&#x2019;DGT6KVGN1TFGPWPF'JTGP\GKEJGPPKEJVCWHIGHÃ&#x2019;JTVUKPFUQYKG #D\GKEJGPOKVPCVKQPCNUQ\KCNKUVKUEJGP'ODNGOGP\WXGTMCWHGPWPF\WGTYGTDGPWPFFKGUGPVIGIGPFGP $GUVKOOWPIGPFGUh#DU)GUGV\Ã&#x2019;DGT6KVGN1TFGPWPF'JTGP\GKEJGP  &GUJCND JCV FGT $WPFGUOKPKUVGT FGT ,WUVK\ OKV 5EJTGKDGP  ++  XQO  FGO   UGKPGT\GKVKIGP 8QTUKV\GPFGP FGU $WPFGU FGWVUEJGT 1TFGPUUCOONGT G 8 CWUFTÃ&#x2019;EMNKEJ GTMN·TV FC­ FGT   'TYGTD XQP 1TFGP WPF 'JTGP\GKEJGP CWU FGT <GKV FGU UQIGPCPPVGP &TKVVGP 4GKEJGUFWTEJGTPUVJCHVG WPFQTICPKUKGTVG5COONGTOKVFGO<KGNFKGUGP)GIGPUVCPFKPGKPG5COONWPIGKP\WHÃ&#x2019;IGPMGKPGP5VTCH DGUVCPFKO5KPPGFGU)GUGV\VGUFCTUVGNNV 



1TFGPFGU'KUGTPGP-TGW\GU  'KUGTPGU-TGW\+-NCUUG'KUGPMGTPIGUEJY·T\V<CTIGXGTUKNDGTV QJPG *GTUVGNNGTRWP\GP CP 0CFGN FC\W 'KUGTPGU -TGW\ ++ -NCUUG 'KUGPMGTP IGUEJY·T\V <CTIG   XGTUKNDGTVCO$CPF 5VÃ&#x2019;EM++



1TFGP FGU 'KUGTPGP -TGW\GU   9KGFGTJQNWPIUURCPIG \WO 'KUGTPGP -TGW\   -NCUUG   \YGKVG#WUHÃ&#x2019;JTWPI$WPVOGVCNNXGTUKNDGTVQJPG*GTUVGNNGTRWP\GCPURKV\\WNCWHGPFGT0CFGN0CFGNJCMGP CWUTWPFGO&TCJV1'- ++



#WHITWPFFGTGZKUVKGTGPFGPITQ­GP(·NUEJWPIURTQDNGOCVKMMCPPHÃ&#x2019;TFKGUGU'ZGORNCTNGKFGTMGKPG)GY·JTHÃ&#x2019;T1TKIK PCNKV·V IGIGDGP YGTFGP &GT +PVGTGUUGPV YKTF CWUFTÃ&#x2019;EMNKEJ CWH FKG )GNGIGPJGKV \WT CWUHÃ&#x2019;JTNKEJGP 8QTDGUKEJVKIWPI   XQTFGT#WMVKQPCWHOGTMUCOIGOCEJV





1TFGP FGU 'KUGTPGP -TGW\GU  'KUGTPGU-TGW\#WUICDG-TGW\-NCUUG'KUGPMGTPIG UEJY·T\V <CTIG 5KNDGT CO $CPF OKV CWHIGNGIVGT  5RNKPVG  9KGFGTJQNWPIUURCPIG    #WUHÃ&#x2019;JTWPI1'- ++



8GTYWPFGVGPCD\GKEJGP UQIGPCPPVGU8GTYWPFGVGPCD\GKEJGPHÃ&#x2019;TFGWVUEJG(TGKYKNNKIGKP5RCPK UEJGP (TGKJGKVUMCORH   /QFGNN   #D\GKEJGP KP 5EJYCT\ /GUUKPI OKV 4GUVUEJY·T\WPI   CP0CFGN1'- ++p+++



.CWV0KGOCPP KP0/5 KUVFKGUGUWTURTÃ&#x2019;PINKEJHÃ&#x2019;TFKGFGWVUEJGP(TGKYKNNKIGPKO5RCPKUEJGP(TGKJGKVUMCORH IGUVKHVGVG8GTYWPFGVGPCD\GKEJGPVTQV\FGTOKVFGT0GWUVKHVWPIGTHQNIVGP8GT·PFGTWPIFGT)GUVCNVWPI /Q FGNN DKUYGKVKPFGP<YGKVGP9GNVMTKGIJKPGKPJGTIGUVGNNVWPFXGTNKGJGPYQTFGPYCUFKG'TMN·TWPIHÃ&#x2019;TFKGTGNCVKXG *·WHKIMGKV FKGUGU HÃ&#x2019;T FGP 'KPUCV\ KP 5RCPKGP KP 5EJYCT\ PWT  OCN XGTNKGJGPGP 'JTGP\GKEJGPU #WHITWPF FGT   GZKUVKGTGPFGPITQ­GP(·NUEJWPIURTQDNGOCVKMMCPPHÃ&#x2019;TFKGUGU'ZGORNCTNGKFGTMGKPG)GY·JTHÃ&#x2019;T1TKIKPCNKV·VIGIGDGP YGTFGP&GT+PVGTGUUGPVYKTFCWUFTÃ&#x2019;EMNKEJCWHFKG)GNGIGPJGKV\WTCWUHÃ&#x2019;JTNKEJGP8QTDGUKEJVKIWPIXQTFGT#WMVKQP CWHOGTMUCOIGOCEJV



8GTYWPFGVGPCD\GKEJGP UQIGPCPPVGU8GTYWPFGVGPCD\GKEJGPHÃ&#x2019;TFGWVUEJG(TGKYKNNKIGKP5RCPK UEJGP (TGKJGKVUMCORH   /QFGNN   #D\GKEJGP KP 5EJYCT\ /GUUKPI OKV 4GUVUEJY·T\WPI   CP0CFGN1'- +++



#WHITWPFFGTGZKUVKGTGPFGPITQ­GP(·NUEJWPIURTQDNGOCVKMMCPPHÃ&#x2019;TFKGUGU'ZGORNCTNGKFGTMGKPG)GY·JTHÃ&#x2019;T1TKIK PCNKV·V IGIGDGP YGTFGP &GT +PVGTGUUGPV YKTF CWUFTÃ&#x2019;EMNKEJ CWH FKG )GNGIGPJGKV \WT CWUHÃ&#x2019;JTNKEJGP 8QTDGUKEJVKIWPI   XQTFGT#WMVKQPCWHOGTMUCOIGOCEJV



5KGIGTOGFCKNNGFGT&GWVUEJGP9KPVGTMCORHURKGNGKP$TCWPNCIG5EJKGTMC0KEJVVTCIDCT&WTEJ OGUUGTOOXGTUKNDGTVOKV5VGORGNUEJPGKFGTUKIPCVWT%.¤%-.'4 4++





5COONWPI XQP EC  \KXKNGP WPF OKNKV·TKUEJGP 1TFGP 'JTGP\GKEJGP WPF #D\GKEJGP FGU   &GWVUEJGP4GKEJGU7CCWEJ-CORHCD\GKEJGPFGU*GGTGU FCTWPVGT0CJMCORHURCPIGPKP 5KNDGT WPF $TQP\G  FGT /CTKPG FCTWPVGT (NQVVGP-TKGIUCD\GKEJGP  WPF FGT .WHVYCHHG FCTWPVGT $GQD   CEJVGT WPF &QRRGNCD\GKEJGP 1TFGPXQO&GWVUEJGP#FNGT&GWVUEJGU1N[ORKC'JTGP\GKEJGP5VCJN JGNODWPF 'KPVTKVVUCD\GKEJGP FCTWPVGT OGJTGTG *CNUFGMQTCVKQPGP -QRKGP   WPF 1TKIKPCNG XGTUEJKG   FGPG/GVCNNGVGKNUGOCKNNKGTVVGKNUCP0CFGNPVGKNUCP$·PFGTPKPUGJTWPVGTUEJKGFNKEJGP'TJCNVWPIGP &C\WGKPKIG$CPFVGKNGGKPG#EJVGT(GNFUEJPCNNGWPFCEJV4GXGTUUEJNGKHEJGP 5VÃ&#x2019;EM++++p+++++++8



&KGUG5COONWPIUQNNVGWPDGFKPIVXQT#DICDGGKPGU)GDQVGUDGUKEJVKIVYGTFGP

181


DEUTSCHES REICH 1933-1945 

-QPXQNWVXQPUKGDGPXGTUEJKGFGPGP'JTGP\GKEJGPWPF#D\GKEJGP&CTWPVGT7$QQV-TKGIUCD\GKEJGP KP /GVCNN WPF IGUVKEMV 2CP\GTMCORHCD\GKEJGP ¤UVGTTGKEJ 5WFGVGPNCPF WPF /GOGNIGDKGV#PUEJNW­   OGFCKNNGP1TKIKPCNGWPF-QRKGP  XGTUEJKGFGPG/GVCNNGVGKNUXGTIQNFGVQFGTXGTUKNDGTVVGKNUCP$·PFGTP QFGTCP0CFGNPKPWPVGTUEJKGFNKEJGT'TJCNVWPIGKPGUKO'VWK&C\WGKP5VQHHCD\GKEJGP 5VÒEM++



&KGUGU-QPXQNWVUQNNVGWPDGFKPIVXQT#DICDGGKPGU)GDQVGUDGUKEJVKIVYGTFGP



-QPXQNWV XQP  #WU\GKEJPWPIGP XQTYKGIGPF FGU <YGKVGP 9GNVMTKGIU &CTWPVGT \YGK '- ++ GKPGU   $QFGPHWPF  UGEJU -TKGIUXGTFKGPUVMTGW\G ++ -NCUUG OKV WPF QJPG 5EJYGTVGT CEJV /GFCKNNGP 9KPVGT   UEJNCEJV KO 1UVGP  FTGK 8GTYWPFGVGPCD\GKEJGP KP XGTUEJKGFGPGP /GVCNNGP WPF KP WPVGTUEJKGF   NKEJGP'TJCNVWPIGPVGKNUOKV$·PFGTPWPFVGKNUCP0CFGNP 5VÒEM++++p++++8



&KGUGU-QPXQNWVUQNNVGWPDGFKPIVXQT#DICDGGKPGU)GDQVGUDGUKEJVKIVYGTFGP



-QPXQNWVXQP#WU\GKEJPWPIGPFGU&GWVUEJGP4GKEJGUXQPDKU1TKIKPCNGWPF-QRKGPKP WPVGTUEJKGFNKEJGP/GVCNNGPVGKNUCP$·PFGTPVGKNUCP0CFGNP\YGKKP'VWKUFC\W\YGK'-++WPF GKP 8GTYWPFGVGPCD\GKEJGP UQYKG 4GXGTUUEJNGKHEJGP -QRRGNUEJNQ­ GVE KP WPVGTUEJKGFNKEJGP 'TJCN   VWPIGP 5VÒEM++++p+++



&KGUGU-QPXQNWVUQNNVGWPDGFKPIVXQT#DICDGGKPGU)GDQVGUDGUKEJVKIVYGTFGP



-QPXQNWV XQP XKGT #WU\GKEJPWPIU-QRKGP FCTWPVGT FTGK KP JGTXQTTCIGPFGT #PHGTVKIWPIUSWCNKV·V   5RCPKGPMTGW\KP)QNFOKV$TKNNCPVGP 5KNDGT 'JTGP\GKEJGPHÒT&GWVUEJG8QNMURHNGIG CO*CNUDCPF CDUEJPKVV  WPF  5VWHG FKGUG FTGK KP JGTXQTTCIGPFGT #PHGTVKIWPIUSWCNKV·V  WPF 'JTGPUEJKNF HÒT   DGUQPFGTG.GKUVWPIGPKO.WHVICW0QTYGIGP 5VÒEM++



-QPXQNWV XQP EC  -NGKPCD\GKEJGP FGU &GWVUEJGP 4GKEJGU XQP  DKU  1TKIKPCNG WPF   -QRKGPKPXGTUEJKGFGPGP/GVCNNGPVGKNUGOCKNNKGTVOGKUVCP0CFGNPKPWPVGTUEJKGFNKEJGP'TJCNVWPIGP ++





'JTGPMTGW\ FGU 9GNVMTKGIGU -QPXQNWV XQP UKGDGP 8GTNGKJWPIUWTMWPFGP KP WPVGTUEJKGFNKEJGT 'TJCN   VWPI&C\WGKP5QNFDWEJWPFUGEJU(CTDFTWEMGXQP7PKHQTOGPFGU,CJTJWPFGTVU 5VÒEM+++++





-QPXQNWV XQP  IGUVKEMVGP 'JTGP\GKEJGP WPF 7PKHQTOGHHGMVGP 7 C &GWVUEJGU -TGW\ KP 5KNDGT   (NWI\GWIHÒJTGT#D\GKEJGPTOGNDCPF-WTNCPFWPF\YGK5EJÒV\GPUEJPÒTG-QRKGP  WPF1TKIKPCNGKP WPVGTUEJKGFNKEJGP'TJCNVWPIGP 5VÒEM++





&KGUGU-QPXQNWVUQNNVGWPDGFKPIVXQT#DICDGGKPGU)GDQVGUDGUKEJVKIVYGTFGP



5COONWPI XQP EC  8GTCPUVCNVWPIU#D\GKEJGP XQTYKGIGPF FGU &GWVUEJGP 4GKEJGU    8GTUEJKGFGPG /CVGTKCNKGP <KPM $NGEJ -WPUVUVQHH 2CRRG WPF 6QP  ITÌ­VGPVGKNU CP 0CFGNP KP WPVGT   UEJKGFNKEJGP'TJCNVWPIGP 5VÒEM++



&KGUG5COONWPIUQNNVGWPDGFKPIVXQT#DICDGGKPGU)GDQVGUDGUKEJVKIVYGTFGP



5COONWPI XQP ÒDGT  5COOGNDGNGIGP FGU 9KPVGTJKNHUYGTMGU WPF CPFGTGP -NGKPCD\GKEJGP \W   UCOOGP OKV CNVGO 5COOGNMCUVGP #WU FGP XGTUEJKGFGPUVGP /CVGTKCNKGP *QN\ -WPUVUVQHH 6GZVKNKGP   6QP 5VGKPIWV 2QT\GNNCP .GFGT 2CRRG 2CRKGT GVE  VGKNU DGOCNV QFGT NCEMKGTV KP UGJT WPVGTUEJKGF   NKEJGP'TJCNVWPIGP\WUCOOGPOKVCNVGOCEJV'VCIGP5COOGNMCUVGP 5VÒEM++



&KGUG5COONWPIUQNNVGWPDGFKPIVXQT#DICDGGKPGU)GDQVGUDGUKEJVKIVYGTFGP



-QPXQNWV XQP EC  -PÌRHGP 'HHGMVGP/GVCNNCWHNCIGP WPF -QMCTFGP ÒDGTYKGIGPF FGU &GWV   UEJGP4GKEJGU7CFGU5VCJNJGNOFGT#TOGG/CTKPGWPF.WHVYCHHGFGT*KVNGTLWIGPFKPXGTUEJKGFG PGP /CVGTKCNKGP /GVCNN .GFGT -WPUVUVQHH  KP WPVGTUEJKGFNKEJGP 'TJCNVWPIU\WUV·PFGP &C\W \YGK   (KPIGTTKPIGWPFXKGT2CVTQPGP 5VÒEM++++p++++++



&KGUGU-QPXQNWVUQNNVGWPDGFKPIVXQT#DICDGGKPGU)GDQVGUDGUKEJVKIVYGTFGP



$WEJ *Q[QU /CZ )TCH 2GFTQU [ 2CDNQU OKV 9KFOWPI XQP * )ÌTKPI (NKGIGP  'TNGDGP    -·ORHGPKP5RCPKGP/ÒPEJGP5GKVGPOKV\CJNTGKEJGPUY2JQVQUIGDWPFGPOKVQTKIKPCNGT JCPFUEJTKHVNKEJGT9KFOWPI(ÒTVTGWG&KGPUVGKP-TKGIU\GKVGP,WNHGUV)ÌTKPI ++ $WEJÒDGTFKG'TNGDPKUUGFGU1DGTNGWVPCPVU/CZ)TCH*Q[QUCNU(NKGIGTFGT.GIKQP%QPFQTKOURCPKUEJGP$ÒTIGT MTKGIXQPDKU*Q[QUYCT6T·IGTFGU5RCPKGPMTGW\GUKP)QNFOKV$TKNNCPVGP+PVGTGUUCPVCWEJJKPUKEJVNKEJ FGTJCPFUEJTKHVNKEJGP9KFOWPIFGUUR·VGTGP4GKEJUOCTUEJCNNU*GTOCPP)ÌTKPI

182




DDR (1949-1990)

ex 8320

&'765%*'54'+%* #75(ª*470)  

-QPXQNWV XQP CEJV GPVPC\KHK\KGTVGP QFGT GT 'JTGP\GKEJGP &CXQP GPVPC\KHK\KGTV 5RCPIG    \WO '- +  \YGK '- ++  GKP UEJYCT\GU 8GTYWPFGVGPCD\GKEJGP 8GTUEJKGFGPG /GVCNNG KP   WPVGTUEJKGFNKEJGP'TJCNVWPIGPVGKNYGKUGCP0CFGNPGKPGUCO$CPF 5VÒEM+++8



8321

&'765%*'&'/1-4#6+5%*'4'27$.+-   

8CVGTN·PFKUEJGT 8GTFKGPUVQTFGP )QNFUVWHG  #WUICDG $WPVOGVCNN &GMQTCVKQP OKV PKEJVNÌUDCTGT   8GTDKPFWPI\WT6TCIGURCPIG $WPVOGVCNNXGTIQNFGVWPFGOCKNNKGTVCP6TCIGURCPIGFKGUG CWH FGT 4ÒEMUGKVG XGTUEJTCWDV \WUCOOGP OKV +PVGTKOUURCPIG CWHFGT4ÒEMUGKVGXGTUEJTCWDVKOIGND YGK­GP'VWK$#E-&1 ++



+PFKGUGT#WUHÒJTWPIPKEJVJ·WHKI\WHKPFGPFCNCWV$CTVGNUQPWTEC\YGK,CJTGXGTNKGJGP

8322





ex 8323

0CVKQPCNRTGKUFGT&GWVUEJGP&GOQMTCVKUEJGP4GRWDNKM#WUICDG $WPVOGVCNN $WPV OGVCNN XGTIQNFGV CP 6TCIGURCPIG \WUCOOGP OKV +PVGTKOUURCPIG KO TQVGP 'VWK $# J   -&1 +p++



-NGKPG 5COONWPI XQP EC  1TFGP 'JTGP\GKEJGP WPF #D\GKEJGP 7PVGT XKGNGP CPFGTGP 8CVGT   N·PFKUEJGT8GTFKGPUVQTFGPKP5KNDGT XGTUKNDGTV WPF$TQP\G1TFGP$CPPGTFGT#TDGKV 5VWHGP #TVWT $GEMGT/GFCKNNG  5VWHGP  6JGQFQT 0GWDCWGT/GFCKNNG  5VWHGP  ,QJ *GKPTKEJ 2GUVCNQ\\K/GFCKNNG  

5VWHGP 'JTGP\GKEJGPFGT&GWVUEJGP8QNMURQNK\GK/GFCKNNGHÒTNCPIL·JTKIG2HNKEJVGTHÒNNWPI\WT5V·T MWPI FGT .CPFGUXGTVGKFKIWPI FGT &GWVUEJGP &GOQMTCVKUEJGP 4GRWDNKM  5VWHGP  /GFCKNNG HÒT VTGWG   &KGPUVG KP FGP -CORHVTWRRGP FGT #TDGKVGTMNCUUG  5VWHGP  2CDNQ 0GTWFC/GFCKNNG 8GTUEJKGFGPG   /GVCNNG VGKNU XGTIQNFGV QFGT XGTUKNDGTV VGKNU GOCKNNKGTV QFGT NCEMKGTV VGKNU CP 2GPVCIQPCN$CPFURCPIGP   6TCIGURCPIGPQFGT0CFGNVGKNUOKV+PVGTKOUURCPIGPVGKNUKP'VWKU-WPUVUVQHHQFGT2CRRUEJCEJVGNP&C\W GKPG\YGKTGKJKIG#EJVGT+PVGTKOUURCPIGCWU2CRKGTCP0CFGNUQYKG\YGK7TMWPFGP 5VÒEM++

 183


BUNDESREPUBLIK DEUTSCHLAND

8324 (1:1)

$70&'54'27$.+-&'765%*.#0& 5'+6  1TFGP WPF 'JTGP\GKEJGP FGT $WPFGUTGRWDNKM &GWVUEJNCPF WPF KJTGT $WPFGUN·PFGT GDGPUQ YKG FGTGP   /KPKCVWTGP$CPFUVGIG-PQRHNQEJUEJNGKHGPWPF$CPFUEJPCNNGPFÒTHGPIGO·­h#DU)GUGV\ÒDGT 6KVGN 1TFGP WPF 'JTGP\GKEJGP PWT CP $GTGEJVKIVG CDIGIGDGP YGTFGP #NU $GTGEJVKIVG IGNVGP JKGTDGK   PGDGP FGP $GNKGJGPGP CWEJ CNNG FKGLGPKIGP 2GTUQPGP FKG KO $GUKV\ GKPGT 5COOGNIGPGJOKIWPI UKPF   &KGUG5COOGNIGPGJOKIWPIGTVGKNVCWH#PHTCIGFKGLGYGKNU\WUV·PFKIG$GJÌTFG &KG<WUV·PFKIMGKVKUVKP FGPGKP\GNPGP$WPFGUN·PFGTPWPVGTUEJKGFNKEJIGTGIGNV &KG'TVGKNWPIGKPGTUQNEJGP)GPGJOKIWPIMCPP IGO·­FGU-QOOGPVCTU\WO)GUGV\VXQPFGT\WUV·PFKIGP$GJÌTFGPWTDGK8QTNKGIGPUEJYGTYKGIGPFGT )TÒPFGXGTYGKIGTVYGTFGP/KVGKPGO)GDQVCWH1TFGPWPF'JTGP\GKEJGPFGT$WPFGUTGRWDNKMWPFKJTGT $WPFGUN·PFGT XGTUKEJGTV FGT $KGVGTKOQTFPWPIUIGO·­GP$GUKV\GKPGTUQNEJGP5COOGNIGPGJOKIWPI\W UGKP 

8GTFKGPUVQTFGP FGT $WPFGUTGRWDNKM &GWVUEJNCPF 5GV FGU )TQ­MTGW\GU UGKV  #WUHÒJTWPI HÒT   *GTTGP #PHGTVKIWPI FGT (KTOC 5VGKPJCWGT  .ÒEM .ÒFGPUEJGKF DGUVGJGPF CWU -NGKPQF \WO )TQ­   MTGW\$TQP\GXGTIQNFGVWPFGOCKNNKGTVCOIGP·JVGP5EJWNVGTDCPFHÒT*GTTGPOKVGKPIGYQDGPGP DKUKP FKG GT ,CJTG  $WPFGUCFNGTP WPF $TWUVUVGTP 5KNDGT XGTIQNFGV WPF GOCKNNKGTV CP 0CFGN FKGUG OKV   *GTUVGNNGTRWP\G5V.FGT(KTOC5VGKPJCWGT.ÒEMWPF5KNDGTRWP\G\WUCOOGPOKV4GXGTUCD \GKEJGPOKV#WHNCIGFKGUGKOUGRCTCVGP5EJ·EJVGNEJGPKOQTKIKPCNGP8GTNGKJWPIUGVWKFGT(KTOC5VGKP JCWGT.ÒEMOKVIQNFHCTDGPGO$WPFGUCFNGT-&1 ++ &GT8GTFKGPUVQTFGPFGT$WPFGUTGRWDNKM&GWVUEJNCPF CWEJ$WPFGUXGTFKGPUVQTFGPIGPCPPV YWTFGXQP$WPFGURT·UK FGPV2TQH&T6JGQFQT*GWUU  OKV'TNC­XQO5GRVGODGT XGTÌHHGPVNKEJVKO$WPFGUIGUGV\DNCVV+ XQP5 CNU\WP·EJUVHÒPHUVWHKIGT )TQ­MTGW\)TQ­GU8GTFKGPUVMTGW\OKV5VGTP)TQ­GU8GTFKGPUVMTGW\ 8GTFKGPUVMTGW\WPF8GTFKGPUVMTGW\CO$CPF CNNIGOGKPGT8GTFKGPUVQTFGPIGUVKHVGV/KV'TNC­XQO,WPKÒDGT FKG'TI·P\WPIFGU5VCVWVUFGU8GTFKGPUVQTFGPUFGT$WPFGUTGRWDNKM&GWVUEJNCPFYWTFGFCU8GTFKGPUVMTGW\OKV5VGTP WPF5EJWNVGTDCPFIGUVKHVGVWPFFKG6TCIGYGKUGFGU)TQ­GP8GTFKGPUVMTGW\GUOKV5VGTP /QFGNN IG·PFGTV#O 5GRVGODGTGTHQNIVGHQTONQUFWTEJ8GTNGKJWPIFKG'KPHÒJTWPIFGU8GTFKGPUVMTGW\GUCO$CPFGHÒT#PIGUVGNNVG WPF#TDGKVGTFGTHTGKGP9KTVUEJCHVFKGGKPGOWPFFGOUGNDGP&KGPUVJGTTP#TDGKVIGDGTQFGT$GVTKGD,CJTGNCPIKP 6TGWGIGFKGPVJCDGP 8GTFKGPUVMTGW\HÒT#TDGKVULWDKNCTGņ/QFGNN /KV'TNC­XQO&G\GODGTÒDGTFKG 0GWHCUUWPIFGU5VCVWVUFGU8GTFKGPUVQTFGPUFGT$WPFGUTGRWDNKM&GWVUEJNCPFYWTFGPFKG5QPFGTUVWHGFGU)TQ­MTGW \GUWPFFKG8GTFKGPUVOGFCKNNGIGUVKHVGVFKG)TÌ­GFGT5QPFGTUVWHGFGU)TQ­MTGW\GUHÒT&COGPWPFFGU)TQ­MTGW\GU HÒT&COGPIG·PFGTV5EJWNVGTD·PFGTHÒT&COGPHÒTFKG5QPFGTUVWHGFGU)TQ­MTGW\GUHÒTFCU)TQ­MTGW\WPFHÒTFCU )TQ­G 8GTFKGPUVMTGW\ OKV 5VGTP WPF 5EJWNVGTDCPF GKPG UQIGPCPPVG ōITQ­GP &COGPUEJNGKHGŋ HÒT FCU )TQ­G 8GT   FKGPUVMTGW\OKV5VGTPWPFFCU)TQ­G8GTFKGPUVMTGW\WPFGKPGUQIGPCPPVGōMNGKPGP&COGPUEJNGKHGŋHÒTFCU$WPFGU XGTFKGPUVMTGW\ CO $CPFG GKPIGHÒJTV WPF FCU 8GTFKGPUVMTGW\ KP 8GTFKGPUVMTGW\  -NCUUG WODGPCPPV #O  /CK   GTHQNIVGHQTONQUFWTEJ8GTNGKJWPIFKG'KPHÒJTWPIFGT$CPFURCPIGōŋHÒTFCU8GTFKGPUVMTGW\HÒT#TDGKVULW DKNCTGWPFYWTFGHÒTFKGUG5VWHGHQTONQUFCU$CPFFGT$WPFGUXGTFKGPUVOGFCKNNGGKPIGHÒJTV/KV'TNC­XQO &G\GODGT  YWTFG W C FKG 8GTNGKJWPI FGU 8GTFKGPUVMTGW\GU HÒT #TDGKVULWDKNCTG GKPIGUVGNNV FCU UQOKV OKV   &CVWOXQO5GRVGODGTXGTNKGJGPYQTFGPYCT9QJNWOGTHQNIVGFKGHQTONQUGPFGTWPIFGT)TÌ­GFGU 8GTFKGPUVMTGW\GU  -NCUUG HÒT &COGP WPF FGU 8GTFKGPUVMTGW\GU CO $CPFG HÒT &COGP)GIGPY·TVKI XGTHÒIV FGT   $WPFGUXGTFKGPUVQTFGPÒDGTPGWP5VWHGP5QPFGTUVWHG\WO)TQ­MTGW\)TQ­MTGW\KPDGUQPFGTGT#WUHÒJTWPI)TQ­ MTGW\ )TQ­GU 8GTFKGPUVMTGW\ OKV 5VGTP WPF 5EJWNVGTDCPF )TQ­GU 8GTFKGPUVMTGW\ OKV 5VGTP )TQ­GU 8GTFKGPUV   MTGW\8GTFKGPUVMTGW\-NCUUG8GTFKGPUVMTGW\CO$CPFGWPF8GTFKGPUVOGFCKNNG<WT)GUEJKEJVGFGU1TFGPUWPF UGKPGT'PVYKEMNWPIXIN)GKIGT4QNH.KPFPGT,ÒTIGPWPF9ÌTPGT(TCPM,CJTG8GTFKGPUVQTFGPFGT$WPFGUTG RWDNKM&GWVUEJNCPF+P1TFGPWPF'JTGP\GKEJGP&CU/CIC\KPHÒT5COONGTWPF(QTUEJGT,CJTICPI*GHV #WIWUV5HH

184




BUNDESREPUBLIK DEUTSCHLAND

8326 8325







8GTFKGPUVQTFGP FGT $WPFGUTGRWDNKM &GWVUEJNCPF $TWUVUVGTP \WO )TQ­GP 8GTFKGPUVMTGW\ OKV 5VGTP  

UGKV #PHGTVKIWPIFGT(KTOC5VGKPJCWGT.ÒEM.ÒFGPUEJGKF\YKUEJGPECWPFEC 5KNDGTXGTIQNFGVVGKNYGKUGGOCKNNKGTVCWHFGT4ÒEMUGKVG\YGKHCEJIGPKGVGVCP0CFGNFKGUGOKV*GTUVGN NGTRWP\G 5V. WPF 5KNDGTRWP\G\WUCOOGPOKV-PQRHNQEJUEJNGKHGOKV#WHNCIGCP-PQRHKO QTKIKPCNGP8GTNGKJWPIUGVWKFGT(KTOC5VGKPJCWGT.ÒEMOKVIQNFHCTDGPGO$WPFGUCFNGT ++



8GTFKGPUVQTFGP FGT $WPFGUTGRWDNKM &GWVUEJNCPF )TQ­GU 8GTFKGPUVMTGW\ CWEJ )TQ­GU $WPFGUXGT   FKGPUVMTGW\ IGPCPPV #WUHÒJTWPI HÒT *GTTGP #PHGTVKIWPI FGT (KTOC % ' ,WPEMGT KP $GTNKP $TQP\G   XGTIQNFGV WPF GOCKNNKGTV CO IGP·JVGP *CNUDCPF OKV -NGOOUEJNKG­G \WUCOOGP OKV -PQRHNQEJUEJNGKHG   OKV #WHNCIG KO QTKIKPCNGP 8GTNGKJWPIUGVWK FGT (KTOC % ' ,WPEMGT KP $GTNKP OKV IQNFHCTDGPGO $WP   FGUCFNGT ++



8GTFKGPUVQTFGP FGT $WPFGUTGRWDNKM &GWVUEJNCPF 8GTFKGPUVMTGW\   D\Y 8GTFKGPUVMTGW\   +-NCUUG UGKV CWEJ$WPFGUXGTFKGPUVMTGW\-NCUUGIGPCPPVUGKV#WUHÒJTWPIPWTHÒT*GT TGP#PHGTVKIWPIFGT(KTOC5VGKPJCWGT.ÒEM.ÒFGPUEJGKF\YKUEJGPCWUFGPGT,CJTGP$TQP\G XGTIQNFGV WPF GOCKNNKGTV MNGKPGT 'OCKNNGUEJCFGP KP GKPGO -TGW\CTOGP 0CFGN \WUCOOGP OKV \YGK   -PQRHNQEJUEJNGKHGPOKV#WHNCIGPKOQTKIKPCNGP8GTNGKJWPIUGVWKFGT(KTOC5VGKPJCWGT.ÒEMOKVIQNF HCTDGPGO$WPFGUCFNGT\WUCOOGPOKVFGT8GTNGKJWPIUWTMWPFGHÒT&T+PI-CTN)ÒPVJGTFCVKGTV$QPP CO  #RTKN  OKV 2T·IGUKGIGN WPF 1TKIKPCNWPVGTUEJTKHV XQP $WPFGURT·UKFGPV 6JGQFQT *GWUU KP   IQNFGPDGFTWEMVGT2CRROCRRG-&1 ++p+++



ex 8328







8330

-QPXQNWV XQP EC  1TFGP 'JTGP WPF #D\GKEJGP UQYKG EC  5VQHHCD\GKEJGP &CTWPVGT )TQ­GU   $WPFGUXGTFKGPUVMTGW\ CO *CNUDCPF $WPFGUXGTFKGPUVMTGW\ CO $CPF $WPFGUYGJT'KPUCV\OGFCKNNGP   WUY KP XGTUEJKGFGPGP /GVCNNGP WPF KP WPVGTUEJKGFNKEJGP 'TJCNVWPIGP LGFQEJ XQTYKGIGPF <WUVCPF ++   VGKNUCP0CFGN 5VÒEM++++p+++



5COONWPI XQP EC  5VQHH'HHGMVGP FGT $WPFGUYGJT 8QTYKGIGPF FGU *GGTGU WPF FGT /CTKPG   1HHK\KGTU WPF /CPPUEJCHVUCWUHÒJTWPIGP UQYKG  /GVCNNCD\GKEJGP &WTEJYGIU KP QTFGPVNKEJGT 'TJCN   VWPIITÌ­VGPVGKNUU[UVGOCVKUEJKP-NCTUKEJVJÒNNGPIGQTFPGV 5VÒEM++



$C[GTKUEJGT 8GTFKGPUVQTFGP XGTNKGJGPG UR·VGTG #WUHÒJTWPIOKVINCVVGP-TGW\CTOT·PFGTP5KNDGTXGT IQNFGVWPFGOCKNNKGTVCO*CNUDCPF\WUCOOGPOKVMNGKPGTWPFITQ­GT4GXGTUTQUGVVGKOQTKIKPCNGP8GT NGKJWPIUGVWKFGT(KTOC)GDT*GOOGTNGKP/ÒPEJGP5. ++

 185


DEUTSCHLAND - UNBEKANNTE ORDEN

8334

8331

8335

8333

8332

/'%-.'0$74)81421//'40$70&'5.#0& 5'+6  

8GTFKGPUVQTFGPFGU.CPFGU/GEMNGPDWTI8QTRQOOGTP8GTIQNFGVWPFGOCKNNKGTVCOIGP·JVGP*CNU DCPF\WUCOOGPOKV4GXGTUPCFGNKO1TKIKPCNGVWK5. +p++



0+'&'45#%*5'0$70&'5.#0& 5'+6   

0KGFGTU·EJUKUEJGT8GTFKGPUVQTFGP)TQ­GU8GTFKGPUVMTGW\HÃ&#x2019;T*GTTGP#WUHÃ&#x2019;JTWPIOKVPKEJVGOCKN NKGTVGT4Ã&#x2019;EMUGKVGXGTUKNDGTVWPFGOCKNNKGTVCO*CNUDCPFCDUEJPKVV5.XCT ++ 4GVVWPIUOGFCKNNG5KNDGTKO4CPFRWP\KGTVCO$CPF5. ++

 

014&4*'+09'56(#.'0$70&'5.#0& 5'+6  



8GTFKGPUVQTFGP FGU .CPFGU 0QTFTJGKP9GUVHCNGP 8GTUKNDGTV WPF GOCKNNKGTV CP 0CFGN \WUCOOGP   OKV-PQRHNQEJCD\GKEJGPKOQTKIKPCNGP8GTNGKJWPIUGVWK5. ++

4*'+0.#0&2(#.<$70&'5.#0& 5'+6 

4GVVWPIUOGFCKNNG'TUVG#WUHÃ&#x2019;JTWPI DKU 5KNDGTCO$CPFKO1TKIKPCNGVWK5.

++





8337 8338

5#%*5'0(4'+56##6 5'+6  

8336

5·EJUKUEJG 8GTHCUUWPIUOGFCKNNG 0KEJV VTCIDCT 5KNDGT  I   &WTEJOGUUGT  OOKO4CPF RWP\KGTVWPF)KO1TKIKPCNGVWKQJPG4GXGTUOKPKCVWT5. ++



&'765%*.#0&70$'-#006'14&'070&'*4'0<'+%*'0 

7PDGMCPPVG#WU\GKEJPWPI$TQP\GXGTUKNDGTVOKVCWHIGNGIVGO(KUEJ $CTDG CPMTCWUGT'KPGT1TFGPU UEJPCNNG ++



$TWUVUVGTP GKPGU WPDGMCPPVGP YQJN FGWVUEJGP 1TFGPU 5KNDGT XGTIQNFGV WPF VGKNYGKUG GOCKNNKGTV   CP0CFGN ++



-WTKQU8KGNNGKEJVGKPG#WU\GKEJPWPIHÃ&#x2019;T5RQTVHKUEJGT

 186


DEUTSCHLAND - MINIATUREN

&'765%*.#0&/+0+#674'0 

-QPXQNWVXQPEC#WU\GKEJPWPIUOKPKCVWTGPWPF4GXGTUUEJNGKHEJGP7CCWU*CODWTI2TGW ­GP /GEMNGPDWTI5EJYGTKP FGO &GWVUEJGP 4GKEJ XQP  FCTWPVGT XKGT OKV 9KGFGTJQNWPIU   URCPIG \WO '- ++   WPF FGT $WPFGUTGRWDNKM &GWVUEJNCPF +P XGTUEJKGFGPGP /GVCNNGP KP WPVGT   UEJKGFNKEJGP'TJCNVWPIGPVGKNUCP0CFGNPOKV5RNKPVGPQFGTOKV¤UGP 5VÒEM++



8340

&'765%*.#0&14&'055%*0#..'0 

)TQ­G 1TFGPUUEJPCNNG OKV FTGK #WU\GKEJPWPIGP   *GUUGP-CUUGN -TKGIUFGPMOÒP\G    HÒT -·ORHGT   9GUVHCNGP   1TFGP FGT 9GUVH·NKUEJGP -TQPG 4KVVGTFGMQTCVKQP  -NCUUG   5KNDGT VGKNYGKUG GOCKNNKGTV OGJTGTG 'OCKNNGCWUDTÒEJG KP FGT -TQPG *GTUVGNNGTDG\GKEJPWPI FGT (KTOC   $KGPPCKU KP 2CTKU   'JTGPNGIKQP  /QFGNN  #WUHÒJTWPI OKV -TQPG    4KVVGTFGMQTC   VKQP 5KNDGT /GFCKNNQPU )QNF GOCKNNKGTV OGJTGTG OKP 'OCKNNGCDRNCV\WPIGP FKG -TQPG PKEJV ICP\   V[RKUEJ#P0CFGNKO·NVGTGPLGFQEJUR·VGTGP'VWKOKVRCUUGPFGT'KPNCIG 44++ 

$GFGWVGPFG WPF KP FKGUGT (QTO UGJT UGNVGPG HTÒJG WPF KP CNNGP 6GKNGP QTKIKPCNG \GKVIGPÌUUKUEJ IGHGTVKIVG 1TFGPU   UEJPCNNG GKPGU GJGOCNU KP MÌPKINKEJ YGUVH·NKUEJGP WPF UR·VGT KP MWTHÒTUVNKEJG JGUUKUEJGP &KGPUVGP UVGJGPFGP 1HHK   \KGTUFGTPCEJCWEJPQEJFKG4KVVGTFGMQTCVKQPFGT'JTGPNGIKQPGTJCNVGPJCV

8341 (1:2)



)TQ­GMTCWUG1TFGPUUEJPCNNGXQP&T*CPU-KEMVQPOKVXQPWTURTÒPINKEJ#WU\GKEJPWPIGP   2TGW­GP 'KUGTPGU -TGW\ #WUICDG  -TGW\ ++ -NCUUG 2TGW­GP-ÌPKINKEJGT-TQPGP1TFGP /QFGNN OKVITQ­GTRTGW­KUEJGT-ÌPKIUMTQPGKO#XGTUOGFCKNNQPUGKVEC -TGW\-NCUUGOKV 5EJYGTVGTP COYGK­GP$CPFOKVIGRT·IVGPWPFGKPIGUEJTCWDVGP5EJYGTVGTP *CODWTI*CPUGCVGP MTGW\ &GWVUEJGU4GKEJ5ÒFYGUVCHTKMC&GPMOÒP\GHÒT-·ORHGTOKV5VGORGNUEJPGKFGTUKIPCVWT 5%*7.6<OKV)GHGEJVUURCPIGP-#.#*#4+WPF)41550#/#.#0& &GWVUEJGU4GKEJ $CPF FGU 'JTGPMTGW\GU HÒT (TQPVM·ORHGT FCU 'JTGP\GKEJGP HGJNV    2TGW­GP &KGPUVCWU\GKEJPWPIU   MTGW\ HÒT &KGPUVLCJTGFGT1HHK\KGTG 2TGW­GP4QVG-TGW\/GFCKNNG-NCUUG$TQP\G ¤UVGT TGKEJ(TCP\,QUGRJQTFGP4KVVGTMTGW\$TQP\GXGTIQNFGVWPFGOCKNNKGTV 1UOCPKUEJGU4GKEJ.K[CMCV /GFCKNNGKP5KNDGT5KNDGTOKV5EJYGTVGT$CPFURCPIG 1UOCPKUEJGU4GKEJ5KNDGTPG/GFCKNNG XQO 4QVGP *CNDOQPF 5KNDGT   1UOCPKUEJGU 4GKEJ 1UOCPKG1TFGP &GMQTCVKQP  -NCUUG 5KNDGT   XGTIQNFGVWPFGOCKNNKGTV#P0CFGNOCPEJG$GHGUVKIWPIGPGVYCUNQUGKO)GUCOVGPGVYCUXGTUEJOWV\V &C\W /KPKCVWTCPUVGEMPCFGN OKV '-+ *CPUGCVGPMTGW\ WPF (TQPVM·ORHGTMTGW\ #PIGDQVGP OKV XKGT   7TMWPFGPFGU6T·IGTU 2CVGPV\WO1DGTCT\VFGT5EJWV\VTWRRGPKP5ÒFYGUVCHTKMCFCVKGTV*QJGP\QNNGTP CO,WNKOKVITQ­GO2T·IGUKGIGN 2CVGPV\WO5VCDUCT\VFGT5EJWV\VTWRRGKP5ÒFYGUVCHTKMC FCVKGTV$GTNKPCO,WPKOKV1TKIKPCNWPVGTUEJTKHV-CKUGT9KNJGNOU++ $GUVCNNWPI\WO4GIKG TWPIU/GFK\KPCNTCVKO8GTUQTIWPIUYGUGPFCVKGTV$GTNKPCO#WIWUVOKV1TKIKPCNWPVGTUEJTKHVGP XQP4GKEJURT·UKFGPV'DGTVWPF4GKEJUCTDGKVUOKPKUVGT&T$TCWPU 'PVNCUUWPIUWTMWPFGFCVKGTV$GTNKP CO,WPK1TKIKPCNWPVGTUEJTKHVGPXQP4GKEJURT·UKFGPVXQP*KPFGPDWTIWPFXQP4GKEJUCTDGKVUOK PKUVGT&T$TCWPU,GYGKNUFQRRGNVIGHCNVGV 5VÒEM4++  5GJTUEJÌPG1TFGPUUEJPCNNGGKPGU-QNQPKCNCT\VGUKP&GWVUEJ5ÒFYGUVCHTKMCOKVGKPGTUGNVGPGP8GTNGKJWPIFGU-TQ PGPQTFGPU-NCUUGOKV5EJYGTVGTPCOYGK­GP$CPFFGTY·JTGPFFGU'TUVGP9GNVMTKGIUYQJNCWHFGO6GTTKVQTKWO FGU1UOCPKUEJGP4GKEJGUKO'KPUCV\YCT

187


DEUTSCHLAND - ORDENSSCHNALLEN

8342 (1:2)



)TQ­GMTCWUG1TFGPUUEJPCNNGFGU-ÌPKINKEJ$C[GTKUEJGP*QHMQP\GTVOGKUVGTU$TWPQ#JPGTKPDC[G TKUEJGT#PQTFPWPIOKV#WU\GKEJPWPIGP $C[GTP8GTFKGPUVQTFGPXQOJGKNKIGP/KEJCGN-TGW\  -NCUUG   5KNDGT 'OCKNNG   $C[GTP -ÌPKI .WFYKI -TGW\     $C[GTP )QNFGPG   *QEJ\GKVU,WDKN·WOUOGFCKNNG   <KPM   $C[GTP )QNFGPG .WFYKIUOGFCKNNG HÒT 9KUUGPUEJCHVWPF -WPUV  5KNDGTXGTIQNFGV   $C[GTP2TKP\TGIGPV.WKVRQNF/GFCKNNGKP5KNDGTOKV-TQPG    2TGW­GP-ÌPKINKEJGT-TQPGPQTFGP/QFGNN EC -TGW\-NCUUG$TQP\GXGTIQNFGV /GFCKNNQPU )QNF 'OCKNNG   *GUUGP &CTOUVCFV  )TQ­JGT\QINKEJ *GUUKUEJGT 2JKNKRRU1TFGP CD    /QFGNN OKV$TWUVDKNFņ 4KVVGTMTGW\-NCUUG CD )QNF'OCKNNG #P JCNV*GT\QINKEJ#PJCNVKUEJGT*CWUQTFGP#NDTGEJVFGU$·TGP4KVVGT\GKEJGP-NCUUG5KNDGTXGTIQNFGV  #PJCNV8GTFKGPUVQTFGPHÒT9KUUGPUEJCHVWPF-WPUV/QFGNN QXCNOKV<CEMGPMTCP\ņ  $TQP\G XGTIQNFGV   /GEMNGPDWTI5EJYGTKP .CPFYGJT&KGPUVCWU\GKEJPWPI  /QFGNN /GFCKNNG ņ     -WRHGT4ÒEMUGKVKIGU#DFGEMVWEJ\GTUEJNKUUGPCP0CFGN 5VÒEM++  2T·EJVKIG KP CNNGP 6GKNGP QTKIKPCNG 1TFGPUUEJPCNNG KP JGTXQTTCIGPFGT 'TJCNVWPI &GT 8KQNKPXKTVWQUG $TWPQ #JPGT   YWTFG CO  #WIWUV  KP &TGUFGP IGDQTGP YQ GT 5EJWNG WPF -QPUGTXCVQTKWO DGUWEJVG 8QP  DKU    YKTMVGGTCNU-QP\GTVOGKUVGTKP(TCPMHWTVC/FCPPDKUKP-CTNUTWJG8QPFQTVYWTFGGTCNU)TQ­JGT\QINK EJGT*QHMQP\GTVOGKUVGTPCEJ5EJYGTKPDGTWHGPYQGTDKUXGTDNKGDHQNIVGGTGKPGO4WHCPFKG9KGPGT *QHQRGT DKU XQPYQGTCPFKG*QHQRGTPCEJ/ÒPEJGPIKPIYQGTUEJNKG­NKEJ\WO-IN$C[GTKUEJGP*QHMQP \GTVOGKUVGTGTPCPPVYWTFG#WEJPCEJFGO'PFGUGKPGTDGTWHNKEJGP6·VKIMGKVXGTDNKGDGTKP/ÒPEJGPWPFUVCTDFQTV CO,CPWCT

8343 (1:2)



)TQ­G MTCWUG 1TFGPUUEJPCNNG OKV HÒPH #WU\GKEJPWPIGP WPF \WIGJÌTKIGT(GNFUEJPCNNG 2TGW­GP 'KUGTPGU -TGW\ #WUICDG  -TGW\  -NCUUG   $C[GTP /KNKV·T8GTFKGPUVQTFGP -TGW\  -NCUUG   OKV 5EJYGTVGTP #WUHÒJTWPI OKV DTGKVGO 4CPF FGT 4ÒEMUGKVG FGU WPVGTGP -TGW\CTOU 5KNDGT   &GWV   UEJGU4GKEJ'JTGPMTGW\FGU9GNVMTKGIGUHÒT(TQPVM·ORHGT $CFGP.CPFYGJT&KGPUVCWU \GKEJPWPI  /QFGNN   /GFCKNNG   2TGW­GP <GPVGPCTOGFCKNNG   4ÒEMUGKVKIG #D   FGEMWPIGTPGWGTVCP0CFGN 5VÒEM++



8344 (1:2)



)TQ­GMTCWUG1TFGPUUEJPCNNGOWVOC­NKEJFGUDC[GTKUEJGP1HHK\KGTU*CPU8ÌNMXQODC[GTKUEJGP (GNFCTVKNNGTKG4GIKOGPV OKV UGEJU #WU\GKEJPWPIGP   2TGW­GP 'KUGTPGU -TGW\ #WUICDG    -TGW\  -NCUUG   $C[GTP /KNKV·T8GTFKGPUVQTFGP -TGW\  -NCUUG OKV 5EJYGTVGTP )QNF   &GWV   UEJGU 4GKEJ 'JTGPMTGW\ FGU 9GNVMTKGIGU  HÒT (TQPVM·ORHGT   $C[GTP /KNKV·T8GTFKGPUV   QTFGP-TGW\-NCUUG QJPG5EJYGTVGT 5KNDGT/GFCKNNQPU)QNF $C[GTP,WDKN·WOUOGFCKNNGHÒTFKG DC[GTKUEJG#TOGGKP$TQP\G /KNKV·T&KGPUVCWU\GKEJPWPIUMTGW\HÒT::+8,CJTG#P0CFGN  5VÒEM++  5GJTUEJÌPGDC[GTKUEJG1HHK\KGTUUEJPCNNGKPDGUVGT'TJCNVWPI

188


DEUTSCHLAND - ORDENSSCHNALLEN

8345 (1:2)



)TQ­G 1TFGPUUEJPCNNG GKPGU DC[TKUEJGP 7PVGTQHHK\KGTU OKV UKGDGP #WU\GKEJPWPIGP   $C[GTP   /KNKV·T8GTFKGPUVMTGW\ FGU /KNKV·T8GTFKGPUVQTFGPU  /QFGNN   /KNKV·T8GTFKGPUVMTGW\   -NCUUGOKV-TQPGWPF5EJYGTVGTPXGTUKNDGTVVGKNYGKUGGOCKNNKGTV 2TGW­GP'KUGTPGU-TGW\#WU ICDG  -TGW\  -NCUUG   $C[GTP 2TKP\TGIGPV .WKVRQNFOGFCKNNG KP $TQP\G   $C[GTP )QNFGPG   *QEJ\GKVU,WDKN·WOUOGFCKNNG   <KPM   9GKOCTGT 4GRWDNKM -TKGIUFGPMOÒP\G  FGU   4GKEJUMTKGIGTDWPFGU-[HHJ·WUGT $C[GTP&KGPUVCWU\GKEJPWPI/GFCKNNGHÒT+:&KGPUVLCJTG ¤UVGT TGKEJ )QNFGPGU8GTFKGPUVMTGW\OKVFGT-TQPG$TQP\GXGTIQNFGV4ÒEMUGKVKIG#DFGEMWPIGTPGWGTVCP 0CFGN 5VÒEM++



8346 (1:2)



)TQ­G INCVVG 1TFGPUUEJPCNNG OKV HÒPH CPJ·PIGPFGP #WU\GKEJPWPIGP   $C[GTP /KNKV·T8GTFKGPUV   OGFCKNNG D\Y CD   6CRHGTMGKVUOGFCKNNG  /QFGNN OKV 2QTVTCKV XQP -ÌPKI /CZ + ,QUGRJ  CD      #WUHÒJTWPI ITÌ­GTGT -QRH OKV 5VGORGNUEJPGKFGTUKIPCVWT ,4+'5 EC  5KN   DGTPG /GFCKNNG &WTEJOGUUGT  OO 5KNDGT  I OKV PGWGO $CPFTKPI    2TGW­GP 'KUGTPGU   -TGW\#WUICDG-TGW\++-NCUUG'KFGPMGTPIGUEJY·T\V<CTIG5KNDGT 2TGW­GP-TKGIUFGPM OÒP\G  HÒT -·ORHGT OKV 4CPFRT·IWPI WPF XKGT )GHGEJVUURCPIGP 2#4+5 $'#7)'0%;   )4#8#06 14.'#05 WPF $'#7/106   $C[GTP #TOGGFGPM\GKEJGP     <GPVGPCT   OGFCKNNG  QJPGTÒEMUGKVKIG#DFGEMWPIOKV\YGK*CMGP\WO'KPJ·PIGP 5VÒEM++

8347 (1:2)







8348 (1:2)

)TQ­G MTCWUG 1TFGPUUEJPCNNG OKV UGEJU #WU\GKEJPWPIGP   2TGW­GP 'KUGTPG -TGW\ #WUICDG    -TGW\-NCUUG'KUGPIGUEJY·T\V5KNDGT\CTIG *GUUGP &CTOUVCFV #NNIGOGKPGU'JTGP\GK EJGP  /QFGNN   /GFCKNNG (ÒT 6CRHGTMGKV 5KNDGT   &GWVUEJGU 4GKEJ 'JTGPMTGW\ FGU   9GNVMTKGIGUHÒT(TQPVM·ORHGTCWHFGO4GXGTU*GTUVGNNGTRWP\G,$ *GUUGP &CTO UVCFV  &KGPUVCWU\GKEJPWPI  /QFGNN    -NCUUG HÒT  &KGPUVLCJTG FGT 7PVGTQHHK\KGTG   -WRHGT *GUUGP &CTOUVCFV #NNIGOGKPGU'JTGP\GKEJGP/QFGNN  /GFCKNNG(ÒT8GT FKGPUV 5KNDGT 4GXGTU \GKIV PCEJ XQTP    2TGW­GP -TQPGP1TFGP/GFCKNNG  #WUHÒJTWPI UGRCTCV   IGHGTVKIVG-TQPG #WHFGO4GXGTU*GTUVGNNGT'VKMGVVFGT(KTOC8KëVQTUEJG-WPUVCPUVCNVKP9KGUDCFGP CP0CFGN 5VÒEM++ )TQ­G MTCWUG 1TFGPUUEJPCNNG OKV XKGT #WU\GKEJPWPIGP   2TGW­GP 'KUGTPG -TGW\ #WUICDG    -TGW\-NCUUG'KUGPIGUEJY·T\V5KNDGT\CTIG 9CNFGEM)QNFGPG8GTFKGPUVOGFCKNNGOKV5EJYGTVGTP FGU 8GTFKGPUVMTGW\GU 5KNDGT XGTIQNFGV 8GTIQNFWPI VGKNYGKUG XGTICPIGP  CO -TKGIUDCPF   2TGW­GP   .CPFYGJT&KGPUVCWU\GKEJPWPI  -NCUUG  /QFGNN   $TQP\G   9GKOCTGT 4GRWDNKM   -TKGIUFGPMOÒP\GFGU4GKEJUMTKGIGTDWPFGU-[HHJ·WUGT#P0CFGN0CFGNJCMGPCDIGDTQEJGP 5VÒEM++





.CWV 'HNGT '(95H KUVFKG)QNFGPG8GTFKGPUVOGFCKNNGOKV5EJYGTVGTPY·JTGPFFGU'TUVGP9GNVMTKGIUXQP DKUPWTOCNXGTNKGJGPYQTFGP

189


DEUTSCHLAND - ORDENSSCHNALLEN

8349 (1:2) 8351







)TQ­G INCVVG 1TFGPUUEJPCNNG OKV XKGT NQUG J·PIGPFGP WPF GKPGT HGUVGP #WU\GKEJPWPI   2TGW­GP   -TKGIUFGPMOÃ&#x2019;P\GHÃ&#x2019;T-·ORHGTOKV4CPFRT·IWPI#75'41$'46'/)'5%*7'6<OKV\YGK )GHGEJVUURCPIGP#0&'4.+5#+0'WPF564#55$74) $CFGP(GNFFKGPUV#WU\GKEJPWPI 2TGW­GP <GPVGPCTOGFCKNNG     $CFGP .CPFYGJT&KGPUVCWU\GKEJPWPI  /QFGNN 5EJPCNNG       $CFGP4GIKGTWPIULWDKN·WOUOGFCKNNG  $TQP\GPG/GFCKNNG1JPG4GXGTUUGKVKIG#DFGEMWPICP 0CFGN ++



)TQ­G INCVVG 1TFGPUUEJPCNNG OKV XKGT NQUG J·PIGPFGP #WU\GKEJPWPIGP   2TGW­GP 'KUGTPG -TGW\   #WUICDG  -TGW\  -NCUUG 'KUGP IGUEJY·T\V 5KNDGT\CTIG KO 4KPI RWP\KGTV (4 YQJN HÃ&#x2019;T   (TKGFN·PFGTKP$GTNKP  9Ã&#x2019;TVVGODGTI/KNKV·TXGTFKGPUVOGFCKNNG/QFGNN OKV2QTVTCKVXQP9KNJGNO++  5KNDGTPG/GFCKNNG5KNDGTOKV5VGORGNUEJPGKFGT5KIPCVWT-5%*9'0<'4 9Ã&#x2019;TVVGO DGTI /KNKV·T &KGPUVCWU\GKEJPWPI  /QFGNN   /GFCKNNG  -NCUUG #WUHÃ&#x2019;JTWPI   'KUGPIGUEJY·T\V &GWVUEJGU4GKEJ'JTGPMTGW\FGU9GNVMTKGIGUHÃ&#x2019;T(TQPVM·ORHGT CWHFGO4GXGTU*GTUVGNNGTRWP\G1$1JPG4GXGTUUGKVKIG#DFGEMWPICP0CFGN 5VÃ&#x2019;EM++



)TQ­G INCVVG 1TFGPUUEJPCNNG OKV \YGK NQUG J·PIGPFGP #WU\GKEJPWPIGP   *CPPQXGT 9KNJGNOU   -TGW\HÃ&#x2019;T&KGPUVLCJTGFGT1HHK\KGTG$TQP\GQJPG8GTIQNFWPI *CPPQXGT.CPIGPUCN\C/GFCKNNG $TQP\GOKV4CPFKPUEJTKHV%*'&'.'41JPGTGXGTUUGKVKIG#DFGEMWPICP0CFGN 5VÃ&#x2019;EM++



8352





)TQ­G MTCWUG 1TFGPUUEJPCNNG OKV FTGK #WU\GKEJPWPIGP   2TGW­GP 'KUGTPGU -TGW\ #WUICDG    -TGW\ ++ -NCUUG CO $CPFHÃ&#x2019;T0KEJVM·ORHGT 2TGW­GP-TKGIUFGPMOÃ&#x2019;P\GKP5VCJN HÃ&#x2019;T0KEJVM·ORHGT $CFGP(GNFFKGPUVCWU\GKEJWPIOKV$CPFURCPIG#P0CFGN ++



)TQ­G MTCWUG 1TFGPUUEJPCNNG OKV HÃ&#x2019;PH #WU\GKEJPWPIGP   'KUGTPGU -TGW\ #WUICDG  -TGW\   ++-NCUUG<CTIG5KNDGTKO$CPFTKPIWPNGUGTNKEJRWP\KGTV 9GKOCTGT4GRWDNKM/GFCKNNGFGU$WPFGU &GWVUEJGT /CTKPG8GTGKPG HÃ&#x2019;T 6CRHGTMGKV KO 9GNVMTKGI   2TGW­GP &KGPUVCWU\GKEJPWPI  /QFGNN  

   -NCUUG -TGW\ HÃ&#x2019;T :8 &KGPUVLCJTG -WRHGT   9GKOCTGT 4GRWDNKM -TKGIUFGPMOÃ&#x2019;P\G   FGT &GWVUEJGP 'JTGPNGIKQP OKV $GY·JTWPIUCD\GKEJGP   9GKOCTGT 4GRWDNKM 'JTGPMTGW\ 6TGW FGO   4GIKOGPVOKV$CPFURCPIG5/5/#45#P0CFGN 5VÃ&#x2019;EM++



*Ã&#x2019;DUEJG5EJPCNNGGKPGUDGY·JTVGP/CTKPG8GVGTCPGPFGU'TUVGP9GNVMTKGIU

190

8353 (1:2)


DEUTSCHLAND - ORDENSSCHNALLEN

8355 (1:2) 8354 (1:2)





)TQ­G MTCWUG 1TFGPUUEJPCNNG OKV \YGK CPJ·PIGPFGP #WU\GKEJPWPIGP   $C[GTP -ÌPKITGKEJ   /KNKV·T8GTFKGPUVMTGW\ FGU /KNKV·T8GTFKGPUVQTFGPU  /QFGNN   -TGW\ QJPG 5EJYGTVGT   5KNDGT/GFCKNNQPU)QNFGOCKNNKGTVOGJTGTG%JKRUKPFGTDNCWGP'OCKNNG 2TGW­GP-TKGIUFGPMOÒP\G  HÒT -·ORHGT OKV 4CPFRT·IWPI OKV PGWP \WUCOOGPIGNÌVGVGP )GHGEJVUURCPIGP 9¤46*   9'+55'0$74) 5'&#0 2#4+5 .1+)0;21724;  $'#7/106 $'#7)'0%;   )4#8#06#0&'4.+5#+0'WPF#0&'4*#..7'#P0CFGN 5VÒEM4++p++



)TQ­G MTCWUG 1TFGPUUEJPCNNG OKV XKGT DCFKUEJGP #WU\GKEJPWPIGP   )TQ­JGT\QINKEJGT 1TFGPXQO <·JTKPIGT.ÌYGP4KVVGTMTGW\-NCUUGOKV5EJYGTVGTP5KNDGTVGKNYGKUGXGTIQNFGVVGKNYGKUGGOCKNNKGTV )NCUHNW­'OCKNNGOCNGTGK -TKGIUXGTFKGPUVMTGW\-TKGIUOGVCNN (TKGFTKEJ.WKUGP/GFCKNNG 4GIKG TWPIULWDKN·WOU/GFCKNNGKP$TQP\G4ÒEMUGKVKIG5VQHHCDFGEMWPIGTPGWGTVCP0CFGN 5VÒEM++



8357 (1:2) 8356 (1:2)



)TQ­GINCVVG1TFGPUUEJPCNNGOKVUKGDGPCPJ·PIGPFGP#WU\GKEJPWPIGP $TCWPUEJYGKI-TKGIUXGT FKGPUVMTGW\CO$CPFHÒT-·ORHGT $TCWPUEJYGKI*GT\QINKEJ$TCWPUEJYGKIKUEJGT*CWUQTFGP*GKP TKEJFGU.ÌYGP8GTFKGPUVMTGW\-NCUUGCWHFGT4ÒEMUGKVGRWP\KGTV/QPF-TQPG5 /GEMNGP DWTI5VTGNKV\ -TGW\ HÒT #WU\GKEJPWPI KO -TKGIG   -NCUUG $TQP\G XGTUKNDGTV CO PKEJV   MQTTGMVGP  $CPF FGT UEJYGTKPKUEJGP 8GTFKGPUVOGFCKNNG (TKGFTKEJ (TCP\ ++ QFGT FGU (TKGFTKEJ (TCP\   #NGZCPFTC-TGW\GU .KRRG &GVOQNF (ÒTUVNKEJ.KRRKUEJGT*CWUQTFGP/QFGNN OKV/QPQITCOO .CD 'JTGPMTGW\-NCUUG++#DVGKNWPIOKV5EJYGTVGTP#PHGTVKIWPIXQP%(<KOOGTOCPP KP 2HQT\JGKO 5KNDGT 4QUG 5KNDGT XGTIQNFGV VGKNYGKUG GOCKNNKGTV MCWO UKEJVDCTGT %JKR KP GKPGO   4QUGPDNCVV   1NFGPDWTI (TKGFTKEJ #WIWUV-TGW\ ++-NCUUG'KUGPOKV4GUVUEJY·T\WPI 2TGW­GP <GPVGPCTOGFCKNNG 0KGFGTNCPFG$TQP\GOGFCKNNGHÒTVTGWGP&KGPUVKPFGT#TOGG/QFGNNOKV /QPQITCOO91JPGTÒEMUGKVKIG#DFGEMWPICP0CFGN 5VÒEM44++



/ÌINKEJGTYGKUG KUV FCU WTURTÒPINKEJ XQTJCPFGPG WPF XGTNQTGP IGICPIGPG UEJYGTKPKUEJ (TKGFTKEJ (TCP\#NGZCPFTC   -TGW\ H·NUEJNKEJGTYGKUG FWTEJ FCU UVTGNKV\KUEJG -TGW\ HÒT #WU\GKEJPWPI KO -TKGIG   -NCUUG GTUGV\V YQT   FGP$GKFGO'JTGPMTGW\-NCUUG++#DVGKNWPIOKV5EJYGTVGTPJCPFGNVGUUKEJWOGKP\YGKHGNUHTGKGU1TKIKPCNGZGO RNCT FCU NCWV 5EJYCTM KP 5- 5  0T DE  FGT (KTOC % ( <KOOGTOCPP KP 2HQT\JGKO CNU *GTUVGNNGT   \WIGYKGUGP MCPP FGT FKGUGU -TGW\G XQP  DKU  IGHGTVKIV JCV 'DGPHCNNU NCWV 5EJYCTM KP 5-   50TD UKPFXQO#WIWUVDKU0QXGODGTPWT'JTGPMTGW\G-NCUUG++#DVGKNWPI OKV5EJYGTVGTPXGTNKGJGPYQTFGP



)TQ­GMTCWUG1TFGPUUEJPCNNGOKVFTGK#WU\GKEJPWPIGP 2TGW­GP'KUGTPGU-TGW\#WUICDG -TGW\++-NCUUG<CTIG5KNDGT &GWVUEJGU4GKEJ'JTGPMTGW\FGU9GNVMTKGIGUHÒT(TQPV M·ORHGT   *GKNKIGT 5VWJN )QNFGPGU 'JTGPMTGW\ 2TQ 'EENGUKC GV 2QPVKHKEG XGTIQNFGV 4ÒEMUGKVKIG   5VQHHCDFGEMWPIGTPGWGTVCP0CFGN 5VÒEM++

 191


DEUTSCHLAND - ORDENSSCHNALLEN

8358 (1:2)





8359 (1:2)

)TQ­GMTCWUG1TFGPUUEJPCNNGOKVFTGK#WU\GKEJPWPIGP 2TGW­GP'KUGTPGU-TGW\#WUICDG -TGW\++-NCUUG<CTIG5KNDGT 9ÒTVVGODGTI/KNKV·T8GTFKGPUVQTFGP/QFGNN  4KVVGT MTGW\#PHGTVKIWPIFGT-ÌPKINKEJGP/ÒP\G5KNDGTXGTIQNFGVWPFGOCKNNKGTVGKPKIG#DRNCV\WPIGPKPFGT ITÒPGP 'OCKNNG FGU TÒEMUGKVKIGP -TCP\GU $CPFTKPI GTI·P\V CWH FGO $CPF GOCKNNKGTVG .QTDGGTMTCP\    &GWVUEJGU4GKEJ'JTGPMTGW\FGU9GNVMTKGIGUHÒT(TQPVM·ORHGT#P0CFGN 5VÒEM++



)TQ­G MTCWUG 1TFGPUUEJPCNNG OKV FTGK RTGW­KUEJGP #WU\GKEJPWPIGP   -TKGIUFGPMOÒP\G    HÒT -·ORHGT QJPG 4CPFRT·IWPI   <GPVGPCTOGFCKNNG    &KGPUVCWU\GKEJPWPI  /QFGNN     5EJPCNNGPRT·IWPIHÒTFKG-NCUUG$TQP\GXGTUKNDGTVVGKNYGKUGNCEMKGTV#P0CFGN 5VÒEM++



8361 (1:2)

8360 (1:2)





)TQ­G INCVVG 1TFGPUUEJPCNNG OKV FTGK CPJ·PIGPFGP RTGW­KUEJGP #WU\GKEJPWPIGP   &ÒRRGNGT   5VWTOMTGW\QHHK\KGNNG#WUICDGCO$CPFHÒT-·ORHGT -TKGIUFGPMOÒP\GHÒT-·ORHGT OKV 4CPFRT·IWPI   -TKGIU&GPMOÒP\G  HÒT -·ORHGT RTGW­KUEJG #WUICDG OKV 4CPFRT·IWPI   1JPGTÒEMUGKVKIG#DFGEMWPICP0CFGN 5VÒEM++



)TQ­GMTCWUG1TFGPUUEJPCNNGOKVXKGT#WU\GKEJPWPIGP 2TGW­GP'KUGTPGU-TGW\#WUICDG -TGW\ ++ -NCUUG <CTIG 5KNDGT   *QJGP\QNNGTP (ÒTUVNKEJGT *CWUQTFGP XQP *QJGP\QNNGTP  /QFGNN  

UGKV   'JTGPMTGW\  -NCUUG OKV 5EJYGTVGTP 5KNDGT VGKNYGKUG XGTIQNFGV WPF GOCKNNKGTV   *CO   DWTI *CPUGCVGPMTGW\  XGTUKNDGTV WPF GOCKNNKGTV   2TGW­GP .CPFYGJT&KGPUVCWU\GKEJPWPI    /QFGNN    -NCUUG -WRHGT #WH FGT 4ÒEMUGKVG *GTUVGNNGTDG\GKEJPWPI FGT (KTOC 9KNJGNO   9GKNJCWUGPKP*CPPQXGTCP0CFGN 5VÒEM++



8362 (1:2)





8363 (1:2)

)TQ­GMTCWUG1TFGPUUEJPCNNGOKVXKGT#WU\GKEJPWPIGP *GUUGP &CTOUVCFV &KGPUVGJTGP\GKEJGP HÒT&KGPUVLCJTGHÒT7PVGTQHHK\KGTGWPF5QNFCVGP#WUICDGOKVCTCDKUEJGP<KHHGTP5KNDGT *GUUGP

&CTOUVCFV  -TKGIUGJTGP\GKEJGP   2TGW­GP <GPVGPCTOGFCKNNG    *GUUGP &CTOUVCFV    &KGPUVCWU\GKEJPWPI/QFGNN  -TGW\HÒT:8&KGPUVLCJTG#P0CFGN 5VÒEM++



)TQ­GINCVVG1TFGPUUEJPCNNGOKVXKGTCPJ·PIGPFGP#WU\GKEJPWPIGP *GUUGP &CTOUVCFV #NNIG OGKPGU'JTGP\GKEJGP/QFGNN OKV-QRH'TPUV.WFYKIU /GFCKNNG(ª48'4&+'056' 5KNDGT   2TGW­GP 4QVG #FNGT/GFCKNNG  /QFGNN 5KNDGTPG /GFCKNNG OKV /QPQITCOO 9      5KNDGT CO $CPF FGU -ÌPKINKEJGP *CWUQTFGPU XQP *QJGP\QNNGTP   2TGW­GP -TKGIUFGPMOÒP\G    HÒT-·ORHGTOKV4CPFRT·IWPI 2TGW­GP<GPVGPCTOGFCKNNG#P0CFGN ++



5CWGTYCNF WPF -NGPCW GTY·JPGP KP 24- 5  0T D  FKG 8GTNGKJWPI FGT 4QVG #FNGT/GFCKNNG CO$CPFFGU -ÌPKINKEJGP*CWUQTFGPUXQP*QJGP\QNNGTP

192


DEUTSCHLAND - ORDENSSCHNALLEN

8364 (1:2)



)TQ­G MTCWUG 1TFGPUUEJPCNNG OKV XKGT RTGW­KUEJGP #WU\GKEJPWPIGP   #NNIGOGKPGU 'JTGP\GKEJGP    -NCUUG #WUHÒJTWPI  5KNDGT   .CPFYGJT&KGPUVCWU\GKEJPWPI  /QFGNN      -NCUUG -WRHGT   -TKGIUFGPMOÒP\G  HÒT -·ORHGT OKV 4CPFRT·IWPI   <GPVGPCTOGFCKNNG   #WHFGT4ÒEMUGKVG*GTUVGNNGTDG\GKEJPWPIFGT(KTOC,)QFGV5QJPKP$GTNKPCP0CFGN  5VÒEM++



8365 (1:2)



)TQ­G JGUUKUEJG 1TFGPUUEJPCNNG OKV XKGT CPJ·PIGPFGP #WU\GKEJPWPIGP   )TQ­JGT\QINKEJ *GUUK   UEJGT 8GTFKGPUV1TFGP 2JKNKRRU FGU )TQ­OÒVJKIGP D\Y)TQ­JGT\QINKEJ*GUUKUEJGT2JKNKRRU1TFGP CD    /QFGNN   OKV FGT $ÒUVG FGU .CPFITCHGP 2JKNKRR  4KVVGTMTGW\ ++ -NCUUG OKV   5EJYGTVGTPCWHFGOTÒEMUGKVKIGP/GFCKNNQPTKPI.7&18+%75++/#)05KNDGT/GFCKNNQPU )QNF GOCKNNKGTV FGT .ÌYG CWH FGT 4ÒEMUGKVG WPDGUEJ·FKIV FKG UKNDGTPGP 5EJYGTVGT OKVIQNFHCTDGPGP )TKHHGP  IGUEJTCWDV   *GUUGP &CTOUVCFV  &KGPUVGJTGP\GKEJGP HÒT  &KGPUVLCJTG HÒT 7PVGTQHHK\KGTG   WPF 5QNFCVGP  #WUICDG OKV CTCDKUEJGP <KHHGTP 5KNDGT   *GUUGP &CTOUVCFV  (GNFFKGPUV\GKEJGP     $CFGP)GF·EJVPKUOGFCKNNGHÒTDCFKUEJG#WUICDGOKV-CWHFGO#XGTU(·FGPCWHFGT4ÒEM UGKVGPKEJVHNWQTGU\KGTGPFQJPGTÒEMUGKVKIG#DFGEMWPICP0CFGN 5VÒEM44++



#WHITWPFFGU4KVVGTMTGW\GU++-NCUUGOKV5EJYGTVGTPFÒTHVGGUUKEJWOFKG5EJPCNNGGKPGU1HHK\KGTUJCPFGNP1DFCU OÌINKEJGTYGKUGWTURTÒPINKEJCPFGT5EJPCNNGDGHKPFNKEJG&KGPUVGJTGP\GKEJGPHÒT&KGPUVLCJTGHÒT1HHK\KGTGKP)QNF FWTEJFCULGPKIGHÒT7PVGTQHHK\KGTGWPF5QNFCVGPKP5KNDGTGTUGV\VYQTFGPKUVN·­VUKEJPKEJVHGUVUVGNNGP  <WT0KGFGTUEJNCIWPIFGTDCFKUEJGP4GXQNWVKQPXQPYWTFGPWPVGT(ÒJTWPI2TKP\9KNJGNOUXQP2TGW­GP   FGOUR·VGTGP-CKUGT9KNJGNO+PGDGPRTGW­KUEJGPCWEJNKGEJVGPUVGKPKUEJG  WPFIGIGPFGP9KFGTUVCPFFGT JGUUKUEJGP$GXÌNMGTWPICWEJJGUUKUEJG6TWRRGPPCEJ$CFGPGPVUCPFVFKGKPFGT(QNIG\GKVDKUWPVGTCPFGTGO CWEJFKG5VCFV-QPUVCP\DGUGV\VJKGNVGP

8366 (1:2)





8367 (1:2)

)TQ­G MTCWUG 1TFGPUUEJPCNNG OKV FTGK #WU\GKEJPWPIGP   2TGW­GP 'KUGTPGU -TGW\ #WUICDG   -TGW\++-NCUUG<CTIG5KNDGT $CFGP)TQ­JGT\QINKEJGT1TFGPXQO<·JTKPIGT.ÌYGP4KVVGT MTGW\-NCUUGOKV5EJYGTVGTP5KNDGTVGKNYGKUGXGTIQNFGVVGKNYGKUGGOCKNNKGTV)NCUHNW­'OCKNNGOCNG TGK   &GWVUEJGU 4GKEJ 'JTGPMTGW\ FGU 9GNVMTKGIGU  HÒT (TQPVM·ORHGT CWH FGT 4ÒEMUGKVG   *GTUVGNNGTDG\GKEJPWPI1$#P0CFGN 5VÒEM++



)TQ­G MTCWUG 1TFGPUUEJPCNNG OKV UGEJU #WU\GKEJPWPIGP   2TGW­GP 'KUGTPGU -TGW\ #WUICDG    -TGW\ ++ -NCUUG <CTIG 5KNDGT   5CEJUGP (TKGFTKEJ #WIWUV/GFCKNNG KP 5KNDGT 5KNDGT CO   -TKGIUDCPF   *CODWTI *CPUGCVGPMTGW\  XGTUKNDGTV WPF GOCKNNKGTV GKP -TGW\CTO DGUEJ·FKIV     &GWVUEJGU 4GKEJ 'JTGPMTGW\ FGU 9GNVMTKGIGU HÒT(TQPVM·ORHGTCWHFGT4ÒEMUGKVG*GT UVGNNGTDG\GKEJPWPI9&.FGT(KTOC9KNJGNO&GWOGTKP.ÒFGPUEJGKF .KRRG &GVOQNF /KNK V·TXGTFKGPUVOGFCKNNGOKV5EJYGTVGTP 2TGW­GP&KGPUVCWU\GKEJPWPI/QFGNN  -TGW\ -NCUUGHÒT:8&KGPUVLCJTG-WRHGT#WHFGT4ÒEMUGKVG*GTUVGNNGTDG\GKEJPWPIFGT(KTOC,*'UUGTKP -ÌNPCP0CFGN 5VÒEM++

 193


DEUTSCHLAND - ORDENSSCHNALLEN

8368 (1:2)





)TQ­G MTCWUG (TCEMUEJPCNNG OKV UGEJU RTGW­KUEJGP #WU\GKEJPWPIGP   'KUGTPGU -TGW\ #WUICDG    -TGW\ ++ -NCUUG <CTIG 5KNDGT CO $CPF HÒT 0KEJVM·ORHGT   8GTFKGPUVMTGW\ HÒT -TKGIUJKNHG   <KPM   4QVGT #FNGT 1TFGP  /QFGNN OKV \KGIGNTQVGO #FNGT    -TGW\  -NCUUG    #WUHÒJTWPI OKV IGMÌTPVGP -TGW\CTOGP    5KNDGT VGKNYGKUG GOCKNNKGTV 'OCKNNGOCNGTGK   QJPG UKEJVDCTG *GTUVGNNGT-GPP\GKEJPWPI   -ÌPKINKEJGT -TQPGPQTFGP  /QFGNN OKV ITQ­GT RTGW­K   UEJGT-ÌPKIUMTQPGEC -TGW\-NCUUG#WUHÒJTWPIOKVGEMKIGP-TGW\CTOT·PFGTP)QNF GOCKNNKGTV CWH FGO 4CPF FGU WPVGTGP -TGW\CTOU 4KV\OCTMG 9   4QVG -TGW\/GFCKNNG  -NCUUG   $TQP\GXGTUKNDGTVWPFVGKNYGKUGGOCKNNKGTV 4QVG-TGW\/GFCKNNG-NCUUG$TQP\GXGTIQNFGV#WHFGT 4ÒEMUGKVG*GTUVGNNGTDG\GKEJPWPIFGT(KTOC,)QFGV5QJPKP$GTNKPCP0CFGN 5VÒEM++



)TQ­G MTCWUG 1TFGPUUEJPCNNG OKV HÒPH #WU\GKEJPWPIGP   'KUGTPGU -TGW\ #WUICDG  -TGW\   ++-NCUUG<CTIG5KNDGTCO$CPFHÒT0KEJVM·ORHGT 1NFGPDWTI(TKGFTKEJ#WIWUV-TGW\++-NCUUG 'KUGP IGUEJY·T\V   &GWVUEJGU 4GKEJ 'JTGPMTGW\ FGU 9GNVMTKGIGU  HÒT (TQPVM·ORHGT CWH   FGT4ÒEMUGKVG*GTUVGNNGTDG\GKEJPWPI94 2TGW­GP&KGPUVCWU\GKEJPWPI/QFGNN   /GFCKNNG-NCUUGHÒT:++&KGPUVLCJTGXGTIQNFGV &GWVUEJGU4GKEJ6TGWFKGPUV'JTGP\GK EJGP5VWHGHÒT&KGPUVLCJTG#P0CFGN 5VÒEM++



8370 (1:2)





8371 (1:2)

)TQ­G INCVVG 1TFGPUUEJPCNNG OKV HÒPH CPJ·PIGPFGP RTGW­KUEJGP #WU\GKEJPWPIGP   &ÒRRGNGT   5VWTOMTGW\  QHHK\KGNNG #WUICDG $CPFTKPI GTI·P\V CO $CPF HÒT 4GUGTXGVTWRRGP   #NUGP-TGW\    QHHK\KGNNG #WUICDG CO $CPF HÒT -·ORHGT   -TKGIU&GPMOÒP\G  HÒT -·ORHGT RTGW­KUEJG   #WUICDGQJPG4CPFRT·IWPI 'TKPPGTWPIUMTGW\-ÌPKIIT·V\QHHK\KGNNG#WUICDG -TKGIUFGPMOÒP\G  HÒT -·ORHGT OKV 4CPFRT·IWPI $·PFGT UVCTM XGTUEJOWV\V WPF VGKNYGKUG DGUEJ·FKIV QJPG   TÒEMUGKVKIG#DFGEMWPICP0CFGN0CFGNJCMGPCDIGDTQEJGP 5VÒEM+++ )TQ­G INCVVG 1TFGPUUEJPCNNG OKV HÒPH CPJ·PIGPFGP RTGW­KUEJGP #WU\GKEJPWPIGP   &ÒRRGNGT   5VWTOMTGW\QHHK\KGNNG#WUICDGCO$CPFHÒT-·ORHGT #NUGP-TGW\QHHK\KGNNG#WUICDG CO$CPFHÒT-·ORHGT 'TKPPGTWPIUMTGW\&GT/CKP#TOGGQHHK\KGNNG#WUICDG -TKGIU&GPMOÒP\G HÒT-·ORHGTRTGW­KUEJG#WUICDGOKV4CPFRT·IWPI -TKGIUFGPMOÒP\GHÒT0KEJVM·OR HGTKP5VCJNCO$CPFHÒT-·ORHGT$·PFGTUVCTMXGTUEJOWV\VWPFVGKNYGKUGDGUEJ·FKIVQJPGTÒEMUGKVKIG #DFGEMWPICP0CFGN 5VÒEM+++





8372 (1:2)



194

)TQ­G INCVVG 1TFGPUUEJPCNNG OKV HÒPH CPJ·PIGPFGP #WU\GKEJPWPIGP   2TGW­GP -TGW\ FGU #NNIG   OGKPGP 'JTGP\GKEJGPU 5KNDGT /GFCKNNQPU )QNF   2TGW­GP #NNIGOGKPGU 'JTGP\GKEJGP  -NCUUG   #WUHÒJTWPI5KNDGT 2TGW­GP-TKGIUFGPMOÒP\GHÒT-·ORHGTOKV4CPFRT·IWPI OKV\YGK)GHGEJVUURCPIGP#0&'4.+5#+0'WPF$'.(146 2TGW­GP<GPVGPCTOGFCKNNG   )TQ­JGT\QINKEJ *GUUKUEJGT 8GTFKGPUV1TFGP 2JKNKRRU FGU )TQ­OÒVJKIGP D\Y )TQ­JGT\QINKEJ   *GUUKUEJGT 2JKNKRRU1TFGP CD    /QFGNN   OKV FGT $ÒUVG FGU .CPFITCHGP 2JKNKRR    5KNDGTPGU -TGW\  MNGKPGTG #WUHÒJTWPI   CWH FGO TÒEMUGKVKIGP /GFCKNNQPTKPI       &18+%75+++/#)05KNDGTVGKNYGKUGGOCKNNKGTV1JPGTÒEMUGKVKIG#DFGEMWPICP0CFGN  5VÒEM++




DEUTSCHLAND - ORDENSSCHNALLEN

8373





8374 (1:2)

)TQ­G MTCWUG 1TFGPUUEJPCNNG OKV \YGK RTGW­KUEJGP #WU\GKEJPWPIGP   4QVGT #FNGT 1TFGP   /QFGNN OKV\KGIGNTQVGO#FNGT -TGW\-NCUUG#WUHÃ&#x2019;JTWPI OKVINCVVGP-TGW\CT OGP    5KNDGT VGKNYGKUG GOCKNNKGTV 'OCKNNGOCNGTGK QJPG UKEJVDCTG *GTUVGNNGT-GPP\GKEJ   PWPI   &KGPUVCWU\GKEJPWPIUMTGW\ HÃ&#x2019;T  &KGPUVLCJTG FGT 1HHK\KGTG  #WUICDG OKVINCVVGP-TGW\CT OGPWPFXGTVKMCNGT¤UG 4Ã&#x2019;EMUGKVKIG#DFGEMWPIGTPGWGTVCP0CFGN 5VÃ&#x2019;EM++



)TQ­G INCVVG 1TFGPUUEJPCNNG OKV XKGT XQP WTURTÃ&#x2019;PINKEJ UKGDGP CPJ·PIGPFGP #WU\GKEJPWPIGP    2TGW­GPNGGTGU$CPFFGU'KUGTPGP-TGW\GU#WUICDG++-NCUUG *GUUGP &CTOUVCFV NGGTGU $CPF\WO)TQ­JGT\QINKEJ*GUUKUEJGP8GTFKGPUV1TFGP2JKNKRRUFGU)TQ­OÃ&#x2019;VJKIGPD\Y)TQ­JGT\QINKEJ *GUUKUEJGP2JKNKRRU1TFGP CD  *GUUGP &CTOUVCFV NGGTGU$CPF\WO&KGPUVGJTGP\GKEJGP  *GUUGP &CTOUVCFV  (GNFFKGPUV\GKEJGP   2TGW­GP -TKGIUFGPMOÃ&#x2019;P\G  HÃ&#x2019;T -·ORHGT OKV   4CPFRT·IWPIOKVHÃ&#x2019;PH)GHGEJVUURCPIGP14.Â&#x2014;#05/'6<01+55'8+..')4#8'.166' 5624+8#6WPF8+108+..'/#45.#6174 2TGW­GP#NNIGOGKPGU'JTGP\GKEJGP-NCUUG #WUHÃ&#x2019;JTWPI  5KNDGT   2TGW­GP <GPVGPCTOGFCKNNG  1JPG TÃ&#x2019;EMUGKVKIG #DFGEMWPI CP   0CFGN 5VÃ&#x2019;EM++



8375





)TQ­GMTCWUG1TFGPUUEJPCNNGOKV\YGKRTGW­KUEJGP#WU\GKEJPWPIGP 2TGW­GP-TKGIUFGPMOÃ&#x2019;P\G  HÃ&#x2019;T -·ORHGT OKV 4CPFRT·IWPI OKV XKGT )GHGEJVUURCPIGP 2#4+5 5'&#0   $'#7/106WPF)4#8'.166'5624+8#6 2TGW­GP<GPVGPCTOGFCKNNG#P0CFGN 5VÃ&#x2019;EM++



)TQ­G MTCWUG 1TFGPUUEJPCNNG OKV  #WU\GKEJPWPIGP OKV HCUV RCUUGPFGT (GNFUEJPCNNG     2TGW­GP 'KUGTPGU -TGW\ #WUICDG  -TGW\ ++ -NCUUG <CTIG 5KNDGT $CPFTKPI GTI·P\V     &GWVUEJGU 4GKEJ  1TFGP FGU -TKGIUXGTFKGPUVMTGW\GU  -TKGIUXGTFKGPUVMTGW\   -NCUUGOKV5EJYGTVGTP &GWVUEJGU4GKEJ'JTGPMTGW\FGU9GNVMTKGIGUHÃ&#x2019;T(TQPVM·OR HGTOKV*GTUVGNNGTDG\GKEJPWPI482(14<*'+/ &GWVUEJGU4GKEJ&KGPUVCWU \GKEJPWPIFGT9GJTOCEJV-NCUUG/GFCKNNGHÃ&#x2019;T&KGPUVLCJTGKPFGT#TOGGQFGT/CTKPG ¤UVGT TGKEJ -TKGIUGTKPPGTWPIUOGFCKNNG  OKV 5EJYGTVGTP   7PICTP -TKGIUGTKPPGTWPIUOGFCKNNG   OKV5EJYGTVGTP $WNICTKGP-TKGIUGTKPPGTWPIUOGFCKNNG/KVGTI·P\VGOTÃ&#x2019;EMUGK VKIGP#DFGEMVWEJCP0CFGN/KVHCUVKFGPVKUEJGT(GNFUEJPCNNGQJPG$·PFEJGPHÃ&#x2019;T#P0CFGN  5VÃ&#x2019;EM++

 195


DEUTSCHLAND - ORDENSSCHNALLEN 



)TQ­G MTCWUG 1TFGPUUEJPCNNG OKV FTGK #WU\GKEJPWPIGP FGU &GWVUEJGP4GKEJGUXQPDKU OKV\WIGJÌTKIGT(GNFUEJPCNNG 1TFGPFGU'KUGTPGP-TGW\GU-TGW\++-NCUUG<CTIGXGTUKNDGTV  &KGPUVCWU\GKEJPWPIFGT9GJTOCEJV-NCUUG/GFCKNNGHÒT&KGPUVLCJTGKPFGT#TOGGQFGT/CTKPG  /GFCKNNG\WT'TKPPGTWPICPFGP1MVQDGT UQIGPCPPVG5WFGVGPNCPF#PUEJNW­/GFCKNNG #P 0CFGNOKV\WIGJÌTKIGT(GNFUEJPCNNG 5VÒEM++



)TQ­G MTCWUG 1TFGPUUEJPCNNG OKV FTGK #WU\GKEJPWPIGP FGU &GWVUEJGP4GKEJGUXQPDKU OKV\WIGJÌTKIGT(GNFUEJPCNNG 1TFGPFGU'KUGTPGP-TGW\GU-TGW\++-NCUUG<CTIGXGTUKNDGTV  &KGPUVCWU\GKEJPWPIFGT9GJTOCEJV-NCUUG/GFCKNNGHÒT&KGPUVLCJTGKPFGT#TOGGQFGT/CTKPG  /GFCKNNG\WT'TKPPGTWPICPFGP1MVQDGT UQIGPCPPVG5WFGVGPNCPF#PUEJNW­/GFCKNNG OKV $CPFCWHNCIG2TCIGT$WTI#P0CFGNOKV\WIGJÌTKIGT(GNFUEJPCNNG 5VÒEM++



8380 (1:2)

8379 (1:2)



)TQ­G INCVVG 1TFGPUUEJPCNNG OKV HÒPH CPJ·PIGPFGP RTGW­KUEJGP #WU\GKEJPWPIGP   'KUGTPGU   -TGW\#WUICDG-TGW\++-NCUUG'KUGPMGTPIGUEJY·T\VOKV-QTTQUKQPUURWTGP5KNDGT\CTIGCO $CPF HÒT 0KEJVM·ORHGT FCTCWH 'KEJGPNCWDURCPIG    #NNIGOGKPGU 'JTGP\GKEJGP  -NCUUG 5KNDGT    -TKGIUFGPMOÒP\GHÒT-·ORHGT 'TKPPGTWPIUMTGW\2(.+%*664'7'+/-4+')' HÒT0KEJVM·ORHGT <GPVGPCTOGFCNNG$·PFGTXGTUEJOWV\VCP0CFGN 5VÒEM++



/ÌINKEJGTYGKUG KUV FKG -&/ HÒT 0- CO $CPF HÒT -·ORHGT  UR·VGT FWTEJ GKPG -&/ HÒT -·ORHGT WPUCEJIGO·­   GTUGV\VYQTFGP



)TQ­G INCVVG 1TFGPUUEJPCNNG OKV FTGK #WU\GKEJPWPIGP   2TGW­GP /KNKV·T'JTGP\GKEJGP  -NCUUG   5KNDGT &GWVUEJGU4GKEJ5ÒFYGUVCHTKMC&GPMOÒP\GHÒT-·ORHGTOKVXKGT)GHGEJVUURCPIGP)4155 0#/#.#0&*'4'41.#0&)41550#$#5WPF9#6'4$'4) 2TGW­GP.CPFYGJT &KGPUVCWU\GKEJPWPI/QFGNN/GFCKNNG-NCUUG$·PFGTGVYCU\GTUEJNKUUGPCP0CFGN 5VÒEM++

8381 (1:2)





196



8382 (1:2)

)TQ­G INCVVG 1TFGPUUEJPCNNG OKV FTGK #WU\GKEJPWPIGP   2TGW­GP -TKGIUFGPMOÒP\G  HÒT   -·ORHGT 2TGW­GP<GPVGPCTOGFCNNG 4GWUU,ÒPIGTG.KPKG'TKPPGTWPIU\GKEJGP\WOUKNDGTPGP 'JGLWDKN·WO#WUHÒJTWPIHÒTÒDTKIG(GUVVGKNPGJOGT4ÒEMUGKVKIGU#DFGEMVWEJGTPGWGTVCP0CFGN  5VÒEM++



)TQ­GINCVVG1TFGPUUEJPCNNGJGUUKUEJGPGT-TKGIUXGVGTCPGPOKVFTGKCPJ·PIGPFGPRTGW­KUEJGP #WU\GKEJPWPIGP   'KUGTPGU -TGW\ #WUICDG  'KUGPMGTP IGUEJY·T\V 5KNDGT\CTIG OKV 'KEJGP   NCWDURCPIG -TKGIUFGPMOÒP\GOKV4CPFRT·IWPIOKVXKGT)GHGEJVUURCPIGP14.'#05 /'6< 01+55'8+..' WPF )4#8'.166'5624+8#6   <GPVGPCTOGFCKNNG  CWH FGO   $CPF CWHIGUVGEMV FCU #D\GKEJGP FGT -TKGIUMCOGTCFUEJCHV *CUUKC CP 0CFGN &C\W #D\GKEJGP HÒT   L·JTKIG/KVINKGFUEJCHVFGT-TKGIUMCOGTCFUEJCHV*CUUKCCP0CFGN 5VÒEM++




DEUTSCHLAND - ORDENSSCHNALLEN

8384 (1:2)

8383 (1:2)







)TQ­G 1TFGPUUEJPCNNG OKV XKGT #WU\GKEJPWPIGP   5CEJUGP (TKGFTKEJ #WIWUV/GFCKNNG KP $TQP\G   CO -TKGIUDCPF   &GWVUEJGU 4GKEJ 'JTGPMTGW\GU 9GNVMTKGIGU  HÒT (TQPVM·ORHGT CWH FGT   4ÒEMUGKVG *GTUVGNNGTDG\GKEJPWPI )  5   5CEJUGP &KGPUVCWU\GKEJPWPI  /QFGNN      -NCUUG /GFCKNNG HÒT +: &KGPUVLCJTG   &GWVUEJGU 4GKEJ -TKGIUFGPMOÒP\G  FGU 4GKEJU   MTKGIGTDWPFGU -[HHJ·WUGT OKV HÒPH 5RCPIGP 814/#45%*  /#40'5%*.#%*6    &+0#06  8'4&70 WPF/##5#+50'CP0CFGN 5VÒEM++



)TQ­G 1TFGPUUEJPCNNG OKV FTGK #WU\GKEJPWPIGP   2TGW­GP 'KUGTPGU -TGW\#WUICDG-TGW\ ++ -NCUUG 'KUGP IGUEJY·T\V <CTIG 5KNDGT   $C[GTP /KNKV·T8GTFKGPUVMTGW\ FGU /KNKV·T8GTFKGPUV   QTFGPU  /QFGNN   -TGW\  -NCUUG OKV -TQPG WPF 5EJYGTVGTP  #WUHÒJTWPI -TKGIU   OGVCNN 5EJYGTVGT 'KUGP   &GWVUEJGU 4GKEJ 'JTGPMTGW\GU 9GNVMTKGIGU  HÒT (TQPVM·ORHGT   CWHFGT4ÒEMUGKVG*GTUVGNNGTDG\GKEJPWPI)CP0CFGN 5VÒEM++



&KGUG-CVCNQIRQUKVKQPGPVH·NNV



8386 (1:2)



)TQ­G MTCWU IGP·JVG 1TFGPUUEJPCNNG OKV UGEJU #WU\GKEJPWPIGP   '- ++    2TGW­GP 8GT   FKGPUVMTGW\ HÒT -TKGIUJKNHG   5EJCWODWTI.KRRG -TGW\ HÒT VTGWG &KGPUVG    'JTGPMTGW\ FGU   9GNVMTKGIGU HÒT (TQPVM·ORHGT   /KNKV·T&KGPUVCWU\GKEJPWPI -TGW\ HÒT :8 ,CJTG -TKGIUOGVCNN    <GPVGPCTOGFCKNNG 5VÒEM++

8387 (1:2)





8387

)TQ­G MTCWUG 1TFGPUUEJPCNNG GKPGU U·EJUKUEJGP 1HHK\KGTU WPF 8GVGTCPGP FGU 'TUVGP 9GNVMTKGIU   ņOKVHÒPH#WU\GKEJPWPIGPOKVFC\WIGJÌTKIGO/KPKCVWTGPMGVVEJGPOKVUGEJU#WU\GKEJ PWPIUOKPKCVWTGP 2TGW­GP'KUGTPGU-TGW\#WUICDG-TGW\++-NCUUG'KUGPMGTPIGUEJY·T\V <CTIG5KNDGTKO4KPIWPNGUGTNKEJRWP\KGTV 5CEJUGP-ÌPKITGKEJ-ÌPKINKEJ5·EJUKUEJGT#NDTGEJVUQT FGP/QFGNN OKVFGO2QTVTCKVXQP*GT\QI#NDTGEJV+++FGO$GJGT\VGP #WUHÒJTWPI

  #WUHÒJTWPI KP 5KNDGT XGTIQNFGV OKV GKPVGKNKIGP /GFCKNNQPHGNFGTP  4KVVGTMTGW\  -NCUUG   OKV 5EJYGTVGTP #WUHÒJTWPI OKV GKPUGKVKI IGRT·IVGP 5EJYGTVGTP#PHGTVKIWPIFGT(KTOC5EJCTHHGPDGTI KP &TGUFGP 5KNDGT VGKNYGKUG XGTIQNFGV WPF GOCKNNKGTV CWH FGP 4·PFGTP FGTUGKVNKEJGP#TOG*GTUVGNNGT DG\GKEJPWPI5%*#4(('0$'4)WPF&4'5&'0CWHFGO4CPFFGUWPVGTGP-TGW\CTOU2WP\G5 HÒT5KNDGT &GWVUEJGU4GKEJ'JTGPMTGW\FGU9GNVMTKGIGUHÒT(TQPVM·ORHGT'KUGPDTQP\KGTV CWH FGT 4ÒEMUGKVG *GTUVGNNGTDG\GKEJPWPI   48 2(14<*'+/   5CEJUGP (TGKUVCCV 'JTGP   \GKEJGPFGT*CPFGNUMCOOGT%JGOPKV\HÒT6TGWGKPFGT#TDGKV$TQP\G 7PICTP9GNVMTKGIU'TKPPG TWPIUOGFCKNNGOKV5EJYGTVGTPWPF*GNO#P0CFGN&CU\WIGJÌTKIG-GVVEJGP\WU·V\NKEJOKV FGT/KPKCVWTFGTDWNICTKUEJGP'TKPPGTWPIUOGFCKNNG(ÒTFGP-TKGIHÒT/KNKV·TCPIGJÌTKIG  5VÒEM++



*ÒDUEJG)TWRRGDGUQPFGTUKPVGTGUUCPVFWTEJFKGUGNVGPG/KPKCVWTFGU'JTGP\GKEJGPUFGT*CPFGNUMCOOGT%JGOPKV\ HÒT6TGWGKPFGT#TDGKV

197


DEUTSCHLAND - ORDENSSCHNALLEN

8388



8389

)TQ­GMTCWUG1TFGPUUEJPCNNGOKVFTGK#WU\GKEJPWPIGP 2TGW­GP'KUGTPGU-TGW\#WUICDG -TGW\ ++ MNCUUG 'KUGP IGUEJY·T\V <CTIG 5KNDGT   1NFGPDWTI (TKGFTKEJ #WIWUV-TGW\ ++ -NCUUG   'KUGP IGUEJY·T\V PKEJV NCEMKGTV  CO $CPF HÒT -·ORHGT   9ÒTVVGODGTI /KNKV·TXGTFKGPUVOGFCKNNG   /QFGNN OKVFGO2QTVTCKV-ÌPKI9KNJGNOU++ 5KNDGTPG/KNKV·TXGTFKGPUVOGFCKNNG5KNDGT OKV5VGORGNUEJPGKFGTUKIPCVWT-5%*9'0<'44ÒEMUGKVGPCDFGEMWPIHGJNV#P0CFGN ++



+PVGTGUUCPVG 1TFGPUUEJPCNNG GKPGU 1NFGPDWTIGTU PKEJV PWT YGIGP FGT <WUCOOGPUVGNNWPI UQPFGTP XQT CNNGO CWH   ITWPFFGT4GKJGPHQNIGFGT'JTGP\GKEJGP



)TQ­G 1TFGPUUEJPCNNG OKV  #WU\GKEJPWPIGP   'KUGTPGU -TGW\ ++ -NCUUG    6CRHGTMGKVU   OGFCKNNG $TQP\G     'JTGPMTGW\ FGU 9GNVMTKGIGU HÒT (TQPVM·ORHGT CWH FGT 4ÒEMUGKVG *GTUVGNNGT   DG\GKEJPWPI1&KG$·PFGTVGKNYGKUG'VYCUHNGEMKICP0CFGN 5VÒEM++



#O(GDTWCTFWTEJ*GT\QI'TPUV++IGUVKHVGVYWTFGFKG6CRHGTMGKVUOGFCKNNGKPFKGUGT#WUHÒJTWPIPWTDKU 'PFG,CPWCTXGTNKGJGPFCPCEJMCOGP#WUHÒJTWPIGPKPCPFGTGP/GVCNNGP\WT8GTNGKJWPI

8390 (1:1,5)



)TQ­GMTCWUG1TFGPUUEJPCNNGGKPGU7PVGTQHHK\KGTUOKV\GJP#WU\GKEJPWPIGPOKV\WIGJÌTKIGT(GNF UEJPCNNG 2TGW­GP'KUGTPGU-TGW\-TGW\-NCUUG $CFGP8GTFKGPUVMTGW\XQO<·JTKPIGT .ÌYGP CO $CPFG FGU /KNKV·T -CTN(TKGFTKEJ8GTFKGPUVQTFGPU 1NFGPDWTI(TKGFTKEJ#WIWUV-TGW\  -NCUUG CO -·ORHGTDCPF   'JTGPMTGW\ FGU 9GNVMTKGIGU HÒT (TQPVM·ORHGT   2TGW­GP 1HHK\KGTU   &KGPUVCWU\GKEJPWPI HÒT  ,CJTG   $CFGP &KGPUVCWU\GKEJPWPI  /QFGNN   $TQP\G     2TGW­GP #NNIGOGKPGU 'JTGP\GKEJGP  -NCUUG   $CFGP 4GIKGTWPIULWDKN·WOU/GFCKNNG KP $TQP\G     2TGW­GP <GPVGPCTOGFCKNNG   7PICTP 9GNVMTKGIUGTKPPGTWPIUOGFCKNNG OKV 5EJYGTVGTP #P 0CFGN   &KG\WIGJÌTKIG(GNFUEJPCNNGGVYCUXGTHNGEMV 5VÒEM++ .CWV8QNNG KP8.5 YWTFGPXQPDKUPWT8GTFKGPUVMTGW\GXQO<·JTKPIGT.ÌYGPCO$CPFGFGU /KNKV·T -CTN (TKGFTKEJ8GTFKGPUVQTFGPU XGTNKGJGP .CWV #TOGG8GTQTFPWPIUDNCVV XQO  #WIWUV  5QPFGT    CWUICDG MQPPVGPCWEJ7PVGTQHHK\KGTGWPF/CPPUEJCHVGPPCEJCMVKXGP&KGPUVLCJTGPFCU&KGPUVCWU\GKEJPWPIUMTGW\ HÒT1HHK\KGTGGTJCNVGP#NNGTFKPIUYWTFGPFKG8GTNGKJWPIGPNCWV#TOGG8GTQTFPWPIUDNCVVXQP5Y·JTGPF FGU-TKGIGUCWUIGUGV\VWPFGTUVPCEJFGUUGP'PFGYKGFGTCWHIGPQOOGP

198




DEUTSCHLAND - ORDENSSCHNALLEN

8391 (1:2)



)TQ­G INCVVG 1TFGPUUEJPCNNG OKV CEJV RTGW­KUEJGP #WU\GKEJPWPIGP   -TGW\ FGU #NNIGOGKPGP 'J   TGP\GKEJGPU 5KNDGT /GFCKNNQP )QNF CPIGNCWHGP    #NNIGOGKPGU 'JTGP\GKEJGP  -NCUUG 5KNDGT    &ÒRRGNGT5VWTO-TGW\CO$CPFHÒT-·ORHGT #NUGPMTGW\5EJPCNNGPRT·IWPICO$CPFHÒT-·OR HGT 'TKPPGTWPIUMTGW\-¤0+))46<5EJPCNNGPRT·IWPI -TKGIUFGPMOÒP\GOKV 4CPFRT·IWPIOKVUKGDGP)GHGEJVUUEJPCNNGP14.—#05.'/#05$'#7)'0%;%4#8#06 $'#70' .# 41.#0&' /'6< )4#8'.166'5624+8#6 WPF 8+108+..'/#45   .#6174   -TKGIUFGPMOÒP\G  RTGW­KUEJG #WUICDG OKV 4CPFRT·IWPI   <GPVGPCTOGFCKNNG   1JPGTÒEMUGKVKIG#DFGEMWPI#P0CFGN 5VÒEM++



8392 (1:2)

ex 8395 8393 (1:2)









)TQ­G INCVVG 1TFGPUUEJPCNNG OKV HÒPH #WU\GKEJPWPIGP   2TGW­GP #NNIGOGKPGU 'JTGP\GKEJGP    -NCUUG 5KNDGT   2TGW­GP -TKGIU&GPMOÒP\G  OKV 4CPFRT·IWPI   $CFGP (GNFFKGPUV   #WU\GKEJPWPI OKV $CPFURCPIG    $CFGP &KGPUVCWU\GKEJPWPI  /QFGNN     -NCUUGHÒT::+&KGPUVLCJTGXGTIQNFGV 2TGW­GP<GPVGPCTOGFCKNNG1JPGTÒEMUGKVKIG#DFGE MWPICP0CFGN 5VÒEM++



)TQ­G INCVVG 1TFGPUUEJPCNNG OKV HÒPH #WU\GKEJPWPIGP   2TGW­GP -TKGIU&GPMOÒP\G    OKV 4CPFRT·IWPI OKV \YGK )GHGEJVUURCPIGP #0 &'4 .+5#+0' WPF 564#55$74)   $CFGP   (GNFFKGPUV#WU\GKEJPWPI OKV \YGK $CPFURCPIG  WPF    2TGW­GP <GPVGPCT   OGFCKNNG    $CFGP .CPFYGJT&KGPUVCWU\GKEJPWPI  /QFGNN   1JPG TÒEMUGKVKIG   #DFGEMWPICP0CFGN 5VÒEM++



<YGKITQ­GINCVVG1TFGPUUEJPCNNGP#  $CFGP(GNFFKGPUVCWU\GKEJPWPIOKV$CPFURCPIG   2TGW­GP -TKGIUFGPMOÒP\G  HÒT -·ORHGT OKV 4CPFRT·IWPI   2TGW­GP <GPVGPCTOG   FCKNNG   $CFGP .CPFYGJT&KGPUVCWU\GKEJPWPI  /QFGNN 0CFGN HGJNV $    2TGW­GP #NNIGOGKPGU   'JTGP\GKEJGP  -NCUUG 5KNDGT   2TGW­GP -TKGIUFGPMOÒP\G  HÒT -·ORHGT OKV 4CPFRT·   IWPI OKV \YGK )GHGEJVUURCPIGP /'6< WPF 01+55'8+..'   2TGW­GP <GPVGPCTOGFCKNNG #P   0CFGN 5VÒEM++p+++



-QPXQNWVXQPHÒPHINCVVGPQFGTMTCWUGP<YGKGT1TFGPUUEJPCNNGP7COKV-TGW\FGU#NNIGOGKPGP 'JTGP\GKEJGPU 5KNDGT /GFCKNNQPU )QNF  WPF )QNFGPGO 8GTFKGPUVMTGW\ $TQP\G XGTIQNFGV /GFCKNNQPU   )QNF 8GTUEJKGFGPG/GVCNNGCWEJ5KNDGTLGYGKNUCP0CFGN 5VÒEM++

 199


DEUTSCHLAND - MINIATURENSCHNALLEN

ex 8397 (1:2)

ex 8396 (1:2)





-QPXQNWVXQPHÒPHMTCWUGPNGGTGP1TFGPUUEJPCNNGP QJPGFKG#WU\GKEJPWPIGP 5KGDGPGT GKPGOKV GKPGO HGJNGPFGP $CPF   5GEJUGT&TGKGTWPF<YGKGT,GYGKNUCP0CFGNKPWPVGTUEJKGFNKEJGP'T JCNVWPIGP 5VÒEM++++p++++++



-QPXQNWV XQP CEJV\GJP INCVVGP NGGTGP 1TFGPUUEJPCNNGP QJPG FKG #WU\GKEJPWPIGP   8KGTGT    &TGKGT  <YGKGT FCXQP GKPG OKV )GHGEJVUURCPIG 8+108+..'/#45 .# 6174  ,GYGKNU CP   0CFGNKPWPVGTUEJKGFNKEJGP'TJCNVWPIGP 5VÒEM++++p++++++



8398 (1:2)

8400 8399 Rv.

&'765%*.#0&/+0+#674'05%*0#..'070&-'66%*'0 

/KPKCVWTGPMGVVEJGP OKV  #WU\GKEJPWPIUOKPKCVWTGP   $TCWPUEJYGKI *GT\QINKEJ $TCWPUEJYGKIK   UEJGT 1TFGP *GKPTKEJ FGU .ÌYGP 4KVVGTMTGW\  -NCUUG 5KNDGT HGKPUV GOCKNNKGTV OKV 'OCKNNGOCNGTGK     2TGW­GP 'TKPPGTWPIUMTGW\ 6TGWGP -TKGIGTP    2TGW­GP -ÌPKINKEJGT 4QVGT #FNGT1TFGP    /QFGNN   -TGW\  -NCUUG OKV 5EJYGTVGTP  #WUHÒJTWPI OKV IGMÌTPVGP -TGW\CTOGP     2TGW­GP -TKGIUFGPMOÒP\G  HÒT -·ORHGT   2TGW­GP -ÌPKINKEJGT 4QVGT #FNGT1TFGP    /QFGNN   -TGW\  -NCUUG OKV 5EJYGTVGT CO 4KPI WPF OKV 5EJNGKHG $TQP\G XGTIQNFGV    -TKGIU&GPMOÒP\GHÒT-·ORHGT 2TGW­GP&KGPUVCWU\GKEJPWPIU-TGW\HÒT&KGPUVLCJTGFGT 1HHK\KGTG 2TGW­GP#NUGP-TGW\ 2TGW­GP'KUGTPGU-TGW\#WUICDG-TGW\++-NCUUG OKV'KEJGPNCWDURCPIG 2TGW­GP<GPVGPCTOGFCKNNG   5VÒEM++



/KPKCVWTGPMGVVEJGP OKV HÒPH #WU\GKEJPWPIUOKPKCVWTGP   'KUGTPGU -TGW\ #WUICDG  -TGW\   ++ -NCUUG   *QJGP\QNNGTP (ÒTUVNKEJ *QJGP\QNNGTPUEJGT *CWUQTFGP  /QFGNN UGKV   -TGW\    -NCUUG OKV 5EJYGTVGTP $TQP\G XGTUKNDGTV VGKNYGKUG XGTIQNFGV   *CODWTI *CPUGCVGPMTGW\    &GWVUEJGU4GKEJ5EJYCT\GU8GTYWPFGVGPCD\GKEJGP 9GKOCTGT4GRWDNKM'TKPPGTWPIUMTGW\ FGU/CTKPGMQTRU(NCPFGTP 5VÒEM++



/KPKCVWTGPUEJPCNNGOKVFTGKDC[GTKUEJGP#WU\GKEJPWPIUOKPKCVWTGP /KNKV·T&GPM\GKEJGPHÒT HÒT1HHK\KGTGWPF/CPPUEJCHVGP .WFYKI1TFGP'JTGPOÒP\GOKV-TQPG  )QNFGVYCU \GTMTCV\V   8GVGTCPGP&GPM\GKEJGP HÒT FKG (GNF\ÒIG    ,GYGKNU CP 1TKIKPCND·PFEJGP OKV   ¤UGOKV2T·UGPVCVKQPU$KNFGTTCJOGP 5VÒEM++p



5GJTKPVGTGUUCPVGU-GVVEJGPFCUYGPPCWEJPKEJVKPFGTQTFPWPIUIGO·­GP4GKJGPHQNIGGTUVGNNVFGPPQEJCWVJGPVKUEJ KUV $GUQPFGTU FKG /KPKCVWT FGU 4QVGP #FNGT1TFGPU  -NCUUG OKV 5EJYGTVGTP CO 4KPI WPF OKV 5EJNGKHG KUV XQP   ITQ­GT5GNVGPJGKV





$GFGWVGPFG /KPKCVWTGPITWRRG GKPGU 8GVGTCPGP FGT 0CRQNGQPKUEJGP -TKGIG KPVGTGUUCPV DGUQPFGTU JKPUKEJVNKEJ FGT   'JTGPOÒP\GFGU.WFYKIUQTFGPUOKV-TQPGFKGKPFKGUGT#WUHÒJTWPIDKUJGTPKEJVDGMCPPVKUV

200


DEUTSCHLAND - MINIATURENSCHNALLEN

8401

8402





/KPKCVWTGPMGVVEJGP OKV UKGDGP RTGW­KUEJGP #WU\GKEJPWPIUOKPKCVWTGP WPF FC\W RCUUGPFGT (GNF    UEJPCNNG 'KUGTPGU-TGW\#WUICDG-TGW\++-NCUUGOKV'KEJGPNCWDURCPIG -ÌPKINKEJGT 4QVGT#FNGT1TFGP/QFGNN  -TGW\-NCUUG#WUHÒJTWPIOKVIGMÌTPVGP-TGW\CTOGP   -ÌPKINKEJGT -TQPGP1TFGP -TGW\  -NCUUG )QNF     &KGPUVCWU\GKEJPWPIUMTGW\ HÒT  &KGPUV   LCJTGFGT1HHK\KGTG -TKGIUFGPMOÒP\GHÒT-·ORHGT 'TKPPGTWPIUMTGW\-ÌPKIIT·V\ <GP VGPCTOGFCKNNG /KV FC\W RCUUGPFGT (GNFUEJPCNNG FKGUG OÌINKEJGTYGKUG PKEJV \GKVIGPÌUUKUEJ CPIGHGTVKIV   /KV2T·UGPVCVKQPU$KNFGTTCJOGP 5VÒEM++



/KPKCVWTGPMGVVEJGP OKV HÒPH #WU\GKEJPWPIUOKPKCVWTGP   $C[GTP /KNKV·T8GTFKGPUVQTFGP 4KVVGT   MTGW\ +8 -NCUUG OKV -TQPG WPF 5EJYGTVGTP 5KNDGT GOCKNNKGTV   2TGW­GP 'KUGTPGU -TGW\ #WUICDG   -TGW\++-NCUUG $C[GTP,WDKN·WOUOGFCKNNGHÒTFKGDC[GTKUEJG#TOGGKP$TQP\G $C[GTP &KGPUVCWU\GKEJPWPIUMTGW\ HÒT ::+8 &KGPUVLCJTG   #FNKIG )CPGTDUEJCHV #NVGP.KORWTI \W (TCPMHWTV   CO/CKP1TFGPUFGMQTCVKQP/QFGNN OKVUQIGPCPPVGTTWFQNRJKPKUEJGT-CKUGTMTQPGCD 5KNDGT XGTIQNFGVWPFGOCKNNKGTV#P0CFGNWPF-PQRH 5VÒEM44++



8404

8403 8405







/KPKCVWTGPMGVVEJGPOKVPGWP#WU\GKEJPWPIUOKPKCVWTGP 2TGW­GP'KUGTPGU-TGW\#WUICDG -TGW\ ++ -NCUUG   2TGW­GP -ÌPKINKEJGT *CWUQTFGP XQP *QJGP\QNNGTP 4KVVGTMTGW\ OKV 5EJYGTVGTP   5KNDGTXGTIQNFGVWPFGOCKNNKGTV /GEMNGPDWTI5EJYGTKP/KNKV·TXGTFKGPUVMTGW\#WUICDG-TGW\ ++ -NCUUG   .ÒDGEM *CPUGCVGPMTGW\    &GWVUEJGU 4GKEJ 'JTGPMTGW\ FGU 9GNVMTKGIGU HÒT   (TQPVM·ORHGT   &GWVUEJGU 4GKEJ  6TGWFKGPUV'JTGP\GKEJGP  5VWHG   ¤UVGTTGKEJ   -TKGIUGTKPPGTWPIUOGFCKNNGOKV5EJYGTVGTP -TKGIUGTKPPGTWPIUOGFCKNNGOKV5EJYGT VGTP $WNICTKGP-TKGIUGTKPPGTWPIUOGFCKNNG#P0CFGNWPF-PQRH 5VÒEM++



/KPKCVWTGPMGVVEJGPOKVFTGKRTGW­KUEJGP#WU\GKEJPWPIUOKPKCVWTGP 4QVGT#FNGT1TFGP/QFGNN OKV \KGIGNTQVGO #FNGT    -TGW\  -NCUUG OKV 5EJYGTVGTP  #WUICDG OKV IGMÌTPVGP   -TGW\CTOGP  'TKPPGTWPIUMTGW\-ÌPKIIT·V\ <GPVGPCTOGFCKNNG#P\YGK0CFGNP 5VÒEM++



/KPKCVWTGPUEJPCNNGOKVUKGDGPRTGW­KUEJGP#WU\GKEJPWPIUOKPKCVWTGP &ÒRRGNGT5VWTOMTGW\ $·PFEJGPHÒT-·ORHGT #NUGP-TGW\$·PFEJGPHÒT-·ORHGT -TKGIUFGPMOÒP\GHÒT -·ORHGTOKV)GHGEJVUURCPIG/'6< 'TKPPGTWPIUMTGW\-ÌPKIIT·V\ -TKGIU&GPMOÒP\GHÒT -·ORHGT RTGW­KUEJG #WUICDG   <GPVGPCTOGFCKNNG    .CPFYGJT&KGPUVCWU\GKEJPWPI  -NCUUG   /QFGNN1TFGPUUEJPCNNGP&GMQTCVKQP#P0CFGN 5VÒEM++

 201


DEUTSCHLAND - MINIATURENSCHNALLEN

8407

8406



/KPKCVWTGPUEJPCNNG OKV UGEJU RTGW­KUEJGP #WU\GKEJPWPIUOKPKCVWTGP   'KUGTPGU -TGW\ #WUICDG    -TGW\ ++ -NCUUG   &ÒRRGNGT 5VWTOMTGW\  $·PFEJGP HÒT -·ORHGT   #NUGP-TGW\    $·PFEJGP HÒT -·ORHGT   -TKGIUFGPMOÒP\G  HÒT -·ORHGT   'TKPPGTWPIUMTGW\ -ÌPKIIT·V\    -TKGIU&GPMOÒP\GHÒT-·ORHGTRTGW­KUEJG#WUICDG1JPG0CFGN 5VÒEM++



/ÌINKEJGTYGKUGUR·VGT\WUCOOGPIGUVGNNV



4GXGTUUEJNGKHGOKVUGEJUCPJ·PIGPFGPRTGW­KUEJGP#WU\GKEJPWPIUOKPKCVWTGP 4QVGT#FNGT1TFGP /QFGNN OKV\KGIGNTQVGO#FNGT -TGW\-NCUUG#WUICDG OKVIGMÌTPVGP-TGW\CT OGP      -ÌPKINKEJGT -TQPGP1TFGP -TGW\  -NCUUG   -TKGIUFGPMOÒP\G  HÒT   -·ORHGT 'TKPPGTWPIUMTGW\-ÌPKIIT·V\ <GPVGPCTOGFCKNNG .CPFYGJT&KGPUVCWU\GKEJPWPI -NCUUG/QFGNN1TFGPUUEJPCNNGP&GMQTCVKQP#P-PQRH 5VÒEM++

8409 (1:2)

8408







4GXGTUUEJNGKHG OKV HÒPH CPJ·PIGPFGP #WU\GKEJPWPIUOKPKCVWTGP   2TGW­GP 'KUGTPGU -TGW\ #WU   ICDG  -TGW\ ++ -NCUUG   $CFGP 5KNDGTPG 8GTFKGPUVOGFCKNNG /QFGNN (TKGFTKEJ ++ OKV $·PF   EJGP FGT /KNKV·T -CTN (TKGFTKEJ8GTFKGPUVOGFCKNNG   *GUUGP #NNIGOGKPGU 'JTGP\GKEJGP    /QFGNN /GFCKNNG (ÒT 6CRHGTMGKV   1NFGPDWTI (TKGFTKEJ #WIWUV-TGW\ ++ -NCUUG OKV -·ORHGT   D·PFEJGP   /GEMNGPDWTI5EJYGTKP /KNKV·TXGTFKGPUVMTGW\ #WUICDG  -TGW\ ++ -NCUUG OKV   -·ORHGTD·PFEJGP#P-PQRH 5VÒEM++



(GNFUEJPCNNGGKPGUJQJGPRTGW­KUEJGP1HHK\KGTUHÒT#WU\GKEJPWPIGP 2TGW­GP'KUGTPGU-TGW\ #WUICDG  ++ -NCUUG   2TGW­GP *CWUQTFGP XQP *QJGP\QNNGTP 4KVVGTMTGW\ OKV 5EJYGTVGTP     2TGW­GP 4QVGT #FNGT1TFGP -TGW\  QFGT  -NCUUG OKV -TQPG WPF 5EJYGTVGTP CO -TKGIUDCPF     2TGW­GP4QVGT#FNGT1TFGP 2TGW­GP-TQPGP1TFGP 2TGW­GP&KGPUVCWU\GKEJPWPIUMTGW\HÒT &KGPUVLCJTGFGT1HHK\KGTG &GWVUEJGU4GKEJ-QNQPKCN&GPMOÒP\G 2TGW­GP<GPVGPCTOGFCKNNG  *GUUGP &CTOUVCFV #NNIGOGKPGU'JTGP\GKEJGP(ÒT-TKGIUXGTFKGPUVQFGT(ÒT6CRHGTMGKV 5CEJUGP /GKPKPIGP 'JTGP\GKEJGP HÒT 8GTFKGPUV KO -TKGIG -·ORHGTDCPF   *CODWTI *CPUGCVGPMTGW\     9ÒTVVGODGTI (TKGFTKEJU1TFGP   ¤UVGTTGKEJ /KNKV·T8GTFKGPUVMTGW\  -NCUUG OKV FGT -TKGIUFGMQ   TCVKQP   $WNICTKGP /KNKV·TQTFGP HÒT 6CRHGTMGKV   $WNICTKGP /KNKV·T8GTFKGPUVQTFGP #P 0CFGN   &C\WGKPYGKVGTGUUEJOCNGU'ZGORNCTKPINGKEJGT#PQTFPWPILGFQEJQJPGFKG#WHNCIGPOKVFTGK*CMGP \WO 'KPJ·PIGP &C\W UGRCTCV \YGK -TQPGP#WHNCIGP WPF GKP .QTDGGTMTCP\ #NNGU \WUCOOGP KO CWH   YGPFKIGP'VWKFGT(KTOC,)QFGVWPF5QJPKP$GTNKP ++



1TKIKPCNG(GNFUEJPCNNGGKPGUJQJGPRTGW­KUEJGP1HHK\KGTUKO'TUVGP9GNVMTKGIFKGXQTGPVUVCPFGPUGKPFÒTHVG FCFKG9GNVMTKGIU'TKPPGTWPIU#WU\GKEJPWPIGPFGU&GWVUEJGP4GKEJGU¤UVGTTGKEJU7PICTPWPF$WNICTKGPHGJNGP

8410 (1:2) ex 8411 (1:2)





202

(GNFUEJPCNNGGKPGUYÒTVVGODGTIKUEJGP1HHK\KGTUHÒT#WU\GKEJPWPIGP 2TGW­GP'KUGTPGU-TGW\ ++-NCUUG 9ÒTVVGODGTI(TKGFTKEJUQTFGP4KVVGTMTGW\-NCUUGOKV5EJYGTVGTP 9ÒTVVGO DGTI /KNKV·T8GTFKGPUVQTFGP 4KVVGTMTGW\   2TGW­GP -ÌPKINKEJGT *CWUQTFGP XQP *QJGP\QNNGTP 4KV   VGTMTGW\OKV5EJYGTVGTP $C[GTP/KNKV·T8GTFKGPUVQTFGP-TGW\-NCUUGOKV5EJYGTVGTP 5CEJ UGP #NDTGEJVU1TFGP 4KVVGTMTGW\  -NCUUG OKV 5EJYGTVGTP   5CEJUGP/GKPKPIGP 'JTGP\GKEJGP HÒT   8GTFKGPUVKO-TKGIGCO-·ORHGTDCPF *CODWTI*CPUGCVGPMTGW\ 9ÒTVVGODGTI&KGPUVCWU\GKEJ PWPI 9ÒTVVGODGTI(TKGFTKEJUQTFGP4KVVGTMTGW\++-NCUUG#DFGEMVWEJGTPGWGTVCP0CFGN ++



-QPXQNWVXQPCEJVITQ­GP  (GNFUEJPCNNGP5KGDGPGT Z*GUUGPWPFZ9ÒTVVGODGTI 8KGTGT

FCXQPGKPGOKV4QVGT#FNGT1TFGPOKV-TQPGWPF-TKGIUFGPMOÒP\GOKV)GHGEJVUURCPIG56 37'06+0&TGKGTWPF<YGKGT,GYGKNUCP0CFGN ++




DEUTSCHLAND - KONVOLUTE

8412 (1:2)

8413 (1:2)



-QPXQNWVXQPUGEJU(GNFURCPIGPVGKNYGKUGOKVKPVGTGUUCPVGP#WHNCIGP GTXQTYKGIGPF9ÒTVVGO DGTIWC'-++OKV'KEJGPNCWD GTXQTYKGIGPF2TGW­GP GTWCOKV4#1-NOKV FGT5EJNGKHG$CF<·JTKPIGT.ÌYGOKV'KEJGPNCWD GTWCOKV$CF<·JTKPIGT.ÌYGOKV'KEJGP NCWD WPF 5EJYGTVGTP   GT W C OKV QUOCPKUEJGT .K[CMCV/GFCKNNG KP 5KNDGT OKV 5EJYGTVGT   $CPFURCPIG  WPF /GFLKFLKG1TFGP   GT OKV 5ÒFYGUVCHTKMC&GPMOÒP\G OKV )GHGEJVUURCPIG   *'4'41.#0&WPF)41550#/#.#0&LGYGKNUCP0CFGN 5VÒEM++





-QPXQNWVXQP(GNFUEJPCNNGP#EJVGTUEJPCNNG5GEJUGT(ÒPHGT8KGTGT&TGKGT<YGKGT WPF'KPGTUQYKGUKGDGP-PQRHNQEJUEJNGKHEJGP/GKUVCP0CFGNP 5VÒEM+++++





-QPXQNWV XQP FTGK­KI (GNFUEJPCNNGP XQO -CKUGTTGKEJ DKU \WT $WPFGUYGJT &CTWPVGT XQP 'KPGT   DKU #EJVGT5EJPCNNG QHV OKV #WHNCIGP FCTWPVGT CWEJ UGNVGPGTG -QODKPCVKQPGP +P WPVGTUEJKGFNKEJGP   'TJCNVWPIGPITÌ­VGPVGKNUOKV0CFGNP 5VÒEM+p++++++p++++++



&'765%*.#0&#..)'/'+0'-1081.76' 

-QPXQNWV XQP EC  FGWVUEJGP 'JTGP\GKEJGP #D\GKEJGP /GFCKNNGP CWEJ PKEJV VTCIDCT  WPF   /ÒP\GP&CTWPVGT5VÒEMGCWU$CFGP$C[GTP2TGW­GP5CEJUGP9ÒTVVGODGTIFGO&GWVUEJGP4GKEJ WUYKPXGTUEJKGFGPGP/GVCNNGP CWEJ5KNDGT KPWPVGTUEJKGFNKEJGP'TJCNVWPIGPVGKNUCP$·PFGTPVGKNU CP0CFGNP 5VÒEM+p++++++p++++++



ex 8416



-QPXQNWV FGWVUEJGP#WU\GKEJPWPIGP8QTYKGIGPFFGT$WPFGUUVCCVGPFGUFGWVUEJGP-CKUGTTGKEJGU WCCWU#PJCNV$CFGP*GUUGP4GWUU5CEJUGP9GKOCT5CEJUGP%QDWTI)QVJC5CEJUGP/GKPKPIGP WPF9ÒTVVGODGTI&C\WUKGDGPYGKVGTGVGKNUCWUN·PFKUEJG#WU\GKEJPWPIGP+PXGTUEJKGFGPGP/GVCNNGP CWEJ5KNDGTKPWPVGTUEJKGFNKEJGP'TJCNVWPIGPVGKNUCP$·PFGTPVGKNUCP0CFGN&C\WÒDGT·NVGTGWPF PGWG$CPFCDUEJPKVV 5VÒEM++





-QPXQNWVXQPPGWP#WU\GKEJPWPIGP7CCWU*CODWTI *CPUGCVGPMTGW\ 2TGW­GP Z'-++  &GWVUEJGU4GKEJ&C\WXKGT/KPKCVWTGPWPF\YGK#PUVGEMPCFGNP8GTUEJKGFGPG/GVCNNGKPWPVGTUEJKGF NKEJGP'TJCNVWPIGPVGKNUCP$·PFGTP 5VÒEM++++p+++





-QPXQNWV XQP  FGWVUEJGP 'JTGP WPF #D\GKEJGP XQP XQT  7 C CWU $CFGP $TCWPUEJYGKI  *GUUGP1NFGPDWTIWPF2TGW­GPUQYKGXKGT'JTGP\GKEJGPWCCWU(TCPMTGKEJWPF4W­NCPF8GTUEJKG FGPG/GVCNNGKPWPVGTUEJKGFNKEJGP'TJCNVWPIGPVGKNUCP$·PFGTPVGKNUCP0CFGNP 5VÒEM++

 203


PHALERISTISCHE LITERATUR

ex 8419 (1:2,5)



-QPXQNWV XQP CEJV 'JTGP WPF #D\GKEJGP 7 C '- ++  /WVVGTMTGW\ KP $TQP\G \YGK (TGK   OCWTGT$KLQWUWPFGKP5RTWPITKPICWUXGTIQNFGVGO5KNDGT 5VÃ&#x2019;EM++



ex 8420 (1:2,5)



5COONWPI XQP EC  #WU\GKEJPWPIUOKPKCVWTGP 8QTYKGIGPF FGT 5VCCVGP FGU &GWVUEJGP -CKUGT   TGKEJGU UQ WPVGT CPFGTGO CWU $CFGP $C[GTP *GUUGP 2TGW­GP 5CEJUGP 5CEJUGP/GKPKPIGP   9Ã&#x2019;TVVGODGTI KP XGTUEJKGFGPGP /GVCNNGP CWEJ 5KNDGT  VGKNU XGTIQNFGV VGKNU GOCKNNKGTV VGKNU CP $·PF   EJGPVGKNUCP5EJNGKHEJGPVGKNUCP-GVVEJGPKPWPVGTUEJKGFNKEJGP'TJCNVWPIGP 5VÃ&#x2019;EM++++p+++



2*#.'4+56+5%*'.+6'4#674 

$QPCPPK2JKNKRRQ1TFKPWO'SWGUVTKWOGV/KNKVCTKWO%CVCNQIWUKP+OCIKPKDWUGZRQUKVWUEWO DTGXK PCTTCVKQPG =-CVCNQI FGT 4KVVGT WPF /KNKV·T1TFGP FCTIGUVGNNV KP $KNFGTP WPF OKV MWT\GT 'TN·W   VGTWPI? 'TUVG #WUICDG 4QO  (QTOCV  Z  EO KP NCVGKPKUEJGT WPF KVCNKGPKUEJGT 5RTCEJG   OKV6KVGNMWRHGT5GKVGPOKV-WRHGTUVKEJVCHGNPFCXQPOKV#DDKNFWPIGPXQP1TFGPUVTCEJVGP WPFOKV#DDKNFWPIGPXQP1TFGPUKPUKIPKGPKP5EJYGKPUNGFGTIGDWPFGP 44++p+++  5GNVGPG'TUVCWUICDGOKVCNNGP-WRHGTUVKEJVCHGNPGKPGUFGTDGFGWVGPFUVGPQTFGPUMWPFNKEJGP6KVGNFGU,CJTJWPFGTVU FCUUR·VGTKPYGKVGTGP#WHNCIGPWPFCWEJHTGOFURTCEJKIGP#WUICDGP WCKPFGWVUEJ GTUEJKGPGPKUV7OHCPITGKEJ DGDKNFGTVGU9GTMFGU,GUWKVGP$QPCPPKÃ&#x2019;DGTFKGUGKPGT\GKVDGMCPPVGPDGUVGJGPFGPGTNQUEJGPGPYKGCWEJUCIGPJCHVGP IGKUVNKEJGPWPFYGNVNKEJGP4KVVGTQTFGPOKV&CTUVGNNWPIKJTGT6TCEJVGPWPF+PUKIPKGP(Ã&#x2019;TFCUJQJG#NVGTIWVGTJCNVGP



=9CJNGP#WIWUVG?&CU$WEJFGT4KVVGTQTFGPWPF'JTGP\GKEJGP.GKR\KIHQTVIGUEJTKGDGPG#WH NCIG  +P FGWVUEJGT 5RTCEJG  5GKVGP OKV  JCPFMQNQTKGTVGP 1TFGPUVCHGNP PGW KP *CNDNGFGT   IGDWPFGP ++  0GDGP 5EJWN\G WPF $KGFGPHGNF FCU DGFGWVGPUVG FGWVUEJURTCEJKIG RJCNGTKUVKUEJG 9GTM FGU  ,CJTJWPFGTVU GKP   DKDNKQRJKNGU-NGKPQFYGIGPFGTPCJG\WGKPJWPFGTVJCPFMQNQTKGTVGP1TFGPUVCHGNP



9CNFQTH#UVQTKC)OD*1TFGP'KPG5COONWPIFGTDGMCPPVGUVGP&GWVUEJGP1TFGPWPF#WU \GKEJPWPIGP/Ã&#x2019;PEJGPQJPG,CJT<KICTGVVGPDKNFGTCNDWO)TQ­HQTOCV5GKVGPOKV(CTDCDDKNFWP IGP <KICTGVVGPDKNFEJGP MQORNGVVMCTVQPKGTV +++ 5EJQPCNU-NCUUKMGTMCPPOCPFKGUGU<KICTGVVGPDKNFGTCNDWOCWUFGP&TGK­KIGT,CJTGPDG\GKEJPGPIKDVGUFQEJGKPGP ªDGTDNKEM Ã&#x2019;DGT GKPGP ITQ­GP 6GKN FGT \CJNTGKEJGP Y·JTGPF FGU 'TUVGP 9GNVMTKGIU KP &GWVUEJNCPF FGO &GWVUEJGP   4GKEJWPFUGKPGT$WPFGUUVCCVGP DGUVGJGPFGPOKNKV·TKUEJGPWPF\KXKNGP1TFGP'JTGP\GKEJGPWPF#WU\GKEJPWPIGP

204




ERSTER WELTKRIEG

'456'49'.6-4+') 

+PVGTCNNKKGTVG5KGIGUOGFCKNNG-QPXQNWVXQPUKGDGPXGTUEJKGFGPGP'ZGORNCTGPCWU$GNIKGP(TCPM TGKEJ \YGKXGTUEJKGFGPG )TQ­DTKVCPPKGP+VCNKGP6UEJGEJQUNQYCMGKWPFFGP75# OKVXKGT)GHGEJVU URCPIGP HÒPHCP$·PFGTP 5VÒEM++



ex 8425 (1:2)



-QPXQNWV XQP FTGK 1TFGPUUEJPCNNGP FGU 'TUVGP 9GNVMTKGIU #WU $GNIKGP (TCPMTGKEJ WPF FGP 75#   LGYGKNUOKVFTGK#WU\GKEJPWPIGP FCDGKFKG75+PVGTCNNKKGTVG5KGIGUOGFCKNNGOKVHÒPH)GHGEJVUURCPIGP  5VÒEM++++p



ex 8426 (1:2)



&TGK /KPKCVWTGP )TWRRGP XQP 8GVGTCPGP FGU 'TUVGP 9GNVMTKGIU #WU $GNIKGP -GVVEJGP OKV CEJV   #WU\GKEJPWPIUOKPKCVWTGP(TCPMTGKEJ5EJPCNNGOKVUGEJU#WU\GKEJPWPIUOKPKCVWTGPWPF)TQ­DTKVCPPKGP OKV XKGT #WU\GKEJPWPIUOKPKCVWTGP OKV FC\WIGJÌTKIGT (GNFUEJPCNNG 8GTUEJKGFGP /GVCNNG KP WPVGT   UEJKGFNKEJGP'TJCNVWPIGP 5VÒEM++++p+++





-QPXQNWV XQP  'JTGP\GKEJGP #D\GKEJGP WPF 5VQHH#D\GKEJGP FGU 4QVGP -TGW\GU 7 C CWU   $GNIKGP $TCUKNKGP .GVVKUEJG 554 4WO·PKGP WPF 7PICTP XGTUEJKGFGPG /CVGTKCNKGP VGKNU XGTUKNDGTV   VGKNUXGTIQNFGVVGKNUGOCKNNKGTVQFGTNCEMKGTVVGKNUCP$·PFGTPQFGT0CFGNPKPQTFGPVNKEJGT'TJCNVWPI  5VÒEM++



-1081.76'+06'40#6+10#. 

-QPXQNWVOKVEC#WU\GKEJPWPIGPWPF#D\GKEJGP7CCWU(KPPNCPF)TQ­DTKVCPPKGPFGT0#61FGP 0KGFGTNCPFGP¤UVGTTGKEJ2QNGP5GTDKGPFGT5QYLGVWPKQPFGT6UEJGEJQUNQYCMGKWPFFGT701+PXGT UEJKGFGPGP/GVCNNGPKPWPVGTUEJKGFNKEJGP'TJCNVWPIGPVGKNUCP$·PFGTPVGKNUCP0CFGNP 5VÒEM++





-QPXQNWV XQP UKGDGP XGTUEJKGFGPGP 1TFGP WPF 'JTGP\GKEJGP #WU $GNIKGP )TKGEJGPNCPF +VCNKGP   .WZGODWTI WPF FGT 5QYLGVWPKQP XGTUEJKGFGPG /GVCNNG CWEJ 5KNDGT  VGKNU GOCKNNKGTV KP WPVGTUEJKGFNK   EJGT'TJCNVWPICP$·PFGTPGKPGUCP5EJTCWDUEJGKDG ++++p+++



-QPXQNWV XQP ÒDGT  #WU\GKEJPWPIGP 7 C CWU $GNIKGP $WNICTKGP &GWVUEJGU 4GKEJ -CKUGTTGKEJ   (TCPMTGKEJ)TQ­DTKVCPPKGP+VCNKGP-CKUGTTGKEJ¤UVGTTGKEJ7PICTP75#KPXGTUEJKGFGPGP/GVCNNGP

CWEJ5KNDGT VGKNUGOCKNNKGTVITÌ­VGPVGKNUCP$·PFGTPKPWPVGTUEJKGFNKEJGP'TJCNVWPIGP  5VÒEM++++p+++++++8



-QPXQNWV XQP  XGTUEJKGFGPGP \KXKNGP WPF OKNKV·TKUEJGP #WU\GKEJPWPIGP 7 C CWU FGT &&4   (KPPNCPF)TKGEJGPNCPF,CRCP/CFCICUMCT/[CPOCT $KTOC 2TGW­GP6JCKNCPFWPF<CKTGXGTUEJKG FGPG /GVCNNG CWEJ 5KNDGT  VGKNU XGTIQNFGV QFGT XGTUKNDGTV VGKNU GOCKNNKGTV QFGT NCEMKGTV CP $·PFGTP   6TCIGURCPIGPQFGT0CFGNP 5VÒEM++



-QPXQNWV XQP EC  #WU\GKEJPWPIGP WPF #D\GKEJGP 7 C CWU &·PGOCTM (KPPNCPF (TCPMTGKEJ   )TQ­DTKVCPPKGP -WYCKV 2QNGP 5CWFK #TCDKGP 5EJYGFGP FGT 5QYLGVWPKQP WPF FGP 75# XGTUEJKG   FGPG /GVCNNG VGKNU GOCKNNKGTV VGKNU CP $·PFGTP QFGT CP0CFGNPKPWPVGTUEJKGFNKEJGP'TJCNVWPIGPGKPG KO'VWK 5VÒEM++



-QPXQNWVXQPXKGT#WU\GKEJPWPIGP#WU$GNIKGP(KPPNCPF2TGW­GPWPF¤UVGTTGKEJFC\W(TGKOCWTGT 5EJ·TRGOKVVGKNYGKUGGOCKNNKGTVGO$TWUVUVGTP8GTUEJKGFGPG/GVCNNGKPWPVGTUEJKGFNKEJGP'TJCNVWPIGP 5VÒEM+++++











205


MINIATUREN INTERNATIONAL

ex 8434 (1:1)

/+0+#674'0+06'40#6+10#. 

/KPKCVWTGPURCPIG OKV CEJV 1TFGPUOKPKCVWTGP CNNG OKV &KCOCPVTQUGP DGUGV\V   $TCUKNKGP 4GRW   DNKM 1TFGP XQO -TGW\ FGU 5ÒFGPU 1TFGPUFGMQTCVKQP CO HCNUEJGP $·PFEJGP   +VCNKGP -ÌPKITGKEJ   1TFGP FGU -QNQPKCNUVGTPU 1HHK\KGTUFGMQTCVKQP #WUHÒJTWPI OKV FGO /QPQITCOO FGU ++ 6[RU     $GNIKGP 1TFGP .GQRQNF ++  /QFGNN   4KVVGTMTGW\   +VCNKGP -ÌPKITGKEJ 1TFGP FGT   +VCNKGPKUEJGP -TQPG $TWUVUVGTP \WO )TQ­MTGW\   5QWXGT·PGT /CNVGUGT 4KVVGTQTFGP 1TFGPUMTGW\    *GKNKIGT5VWJN4KVVGTQTFGPXQO*GKNKIG)TCD$TWUVUVGTP\WO)TQ­MTGW\ #WUHÒJTWPI  +VCNKGP -ÌPKITGKEJ5V/CWTKVKWUWPF5V.C\CTWU1TFGP1HHK\KGTUMTGW\ *GKNKIGT5VWJN1TFGPXQOJGKNKIGP 2CRUV5[NXGUVGT4KVVGTMTGW\)QNFQFGT5KNDGTVGKNGOCKNNKGTVOKVKPUIGUCOV&KCOCPVTQUGP 'EJVJGKV IGRTÒHV DGUGV\VCP6TCIGURCPIGOKV0CFGN 5VÒEM+p++  #NNGCEJV/KPKCVWTGPKPNWZWTKÌUGT#WUUVCVVWPIOKVGEJVGP&KCOCPVGPWPFXQPCNNGTHGKPUVGT#PHGTVKIWPIUSWCNKV·VCWU FGT GTUVGP *·NHVG FGU  ,CJTJWPFGTVU &KG 8GTYGPFWPI FGU 4QVGP $CPFGU DGK FGT 'TUVGP /KPKCVWT FGWVGV FCTCWH   JKPFC­JKGTYQJNGKPG&GMQTCVKQPFGUHTCP\ÌUKUEJGP1TFGPUFGT'JTGPNGIKQPCPIGDTCEJVYGTFGPUQNNVGXGTUGJGPV NKEJLGFQEJFKG/KPKCVWTFGMQTCVKQPFGUDTCUKNKCPKUEJGP1TFGPXQO-TGW\FGU5ÒFGPUIGPQOOGPYWTFGFKGUKEJXQP FGT GTUVGTGP FWTEJ FKG<YGKHCTDKIMGKVFGT$NCVVMT·P\GUQYKGFWTEJFKGWPVGTUEJKGFNKEJG)GUVCNVWPIFGU4ÒEMUGKVGP OGFCKNNQPUWPVGTUEJGKFGV





-QPXQNWV XQP EC  #WU\GKEJPWPIUOKPKCVWTGP 7 C CWU (TCPMTGKEJ FTGKOCN 'JTGPNGIKQP  )TQ­   DTKVCPPKGP +PFKGP +VCNKGP 2QNGP 4WO·PKGP 6UEJGEJQUNQYCMGK 7PICTP75#8GTUEJKGFGPG/GVCNNG WPVGTUEJKGFNKEJG'TJCNVWPIGPVGKNUGOCKNNKGTVOGKUVCP$·PFEJGP 5VÒEM++



-QPXQNWVXQP#WU\GKEJPWPIUOKPKCVWTGP7CCWU$GNIKUEJ-QPIQ(KPPNCPF(TCPMTGKEJ4WO· PKGP FKGUGKP)QNFCDGTDGUEJ·FKIV 5EJYGFGP*GKNKIGT5VWJN+PXGTUEJKGFGPGP/GVCNNGP CWEJ)QNF WPF5KNDGT VGKNUGOCKNNKGTVVGKNUCP$·PFEJGPKPWPVGTUEJKGFNKEJGP'TJCNVWPIGP 5VÒEM++++++8



8437

70$'-#006'#75<'+%*070)'0  206

7PDGMCPPVGOKNKV·TKUEJG#WU\GKEJPWPI5KNDGTXGTIQNFGVVGKNYGKUGGOCKNNKGTVCO$CPFOKV#ITCHHG ++




KÖNIGREICH BELGIEN

8438

8441

8440

8439

-¤0+)4'+%*$'.)+'0 

.GQRQNF1TFGP=1TFTGFG.¾QRQNF.GQRQNFUQTFG?/QFGNN OKVGKPURTCEJKIGT/GFCKNNQPWOUEJTKHV  4KVVGTMTGW\#WUICDGOKV+KO4GXGTUOGFCKNNQPWPF-TQPGFGU6[RUENCUUKSWG5KNDGT VGKNYGKUG XGTIQNFGV GOCKNNKGTV CO $CPF HÒT -TKGIUGKPUCV\  OKV GOCKNNKGTVGT $CPFURCPIG HÒT   *KPVGTDNKGDGPG$9-<- ++



5EJQPMWT\PCEJFGT6JTQPDGUVGKIWPI CO,WPK JCV-ÌPKI.GQRQNF+CO,WNKFKGUGPCNU\WP·EJUV XKGTMNCUUKIGP <KXKN WPF /KNKV·TXGTFKGPUVQTFGP IGUVKHVGV /KV -ÌPKINKEJGO &GMTGV XQO  /CK  GTJKGNV FGT   1TFGP GKPG YGKVGTG -NCUUG FKG FGT )TQ­QHHK\KGTG FKG PWT CWU GKPGO $TWUVUVGTP QJPG YGKVGTG +PUKIPKGP YKG *CNU   QFGT $TWUVMTGW\G DGUVCPF 7O FGT<YGKURTCEJKIMGKVFGU.CPFGU4GEJPWPI\WVTCIGPJCV-ÌPKI$CWFQWKP+UEJQP MWT\PCEJªDGTPCJOGFGT4GIKGTWPI CO,WNK OKV&GMTGVXQP1MVQDGTXGTHÒIVFC­MÒPHVKICWH CNNGPUVCCVNKEJGP1TFGPWPF'JTGP\GKEJGPFKG+PUEJTKHVGPUQYQJNKPHTCP\ÌUKUEJYKGCWEJHN·OKUEJCP\WDTKPIGPUKPF



.GQRQNF1TFGP=1TFTGFG.¾QRQNF.GQRQNFUQTFG?/QFGNN OKVGKPURTCEJKIGT/GFCKNNQPWOUEJTKHV  -QOOCPFGWTMTGW\ZOO)QNFVGKNYGKUGHGKPUV\KUGNKGTVGOCKNNKGTVIOKV HGKPIGMÌTFGNVGOUVCTTGO#WHJ·PIWPIUTKPIQJPG*CNUDCPF$9-<- 4+



*GTXQTTCIGPFG#PHGTVKIWPICWUFGT/KVVGFGU,CJTJWPFGTVUOKVIGYÌNDVGO8QTFGTUGKVGPOGFCKNNQPKPQRVKOCNGT 'TJCNVWPIUSWCNKV·V





.GQRQNF1TFGP=1TFTGFG.¾QRQNF.GQRQNFUQTFG?/QFGNN OKVGKPURTCEJKIGT/GFCKNNQPWOUEJTKHV    1HHK\KGTUMTGW\ #WUICDG OKV -TQPG FGU 6[RU ¾NCTIK EC   )QNF GOCKNNKGTV   IGKPKIG#DRNCV\WPIGPKPFGTITÒPGP'OCKNNGXQP#XGTUWPF4GXGTUUQYKGMCWOUKEJVDCTGT%JKR KP FGT UEJYCT\GP 'OCKNNG FGU 4GXGTUOGFCKNNQPU CO CNVGP $CPF OKV CWHIGNGIVGT 4QUGVVG $9-    <- ++



.GQRQNF1TFGP=1TFTGFG.¾QRQNF.GQRQNFUQTFG?/QFGNN OKVGKPURTCEJKIGT/GFCKNNQPWOUEJTKHV  4KVVGTMTGW\#WUICDGOKV-TQPGFGU6[RUCRNCVK5KNDGTVGKNYGKUGXGTIQNFGVGOCKNNKGTV CO$CPFOKV6TCIGTCJG$9-<- ++

 207


KÃ&#x2013;NIGREICH BELGIEN

8443

8442







-TQPGP1TFGP =1TFG FG NC %QWTQPPG  -TQQPQTFG? -QOOCPFGWTUFGMQTCVKQP 5KNDGT XGTIQNFGV WPF   GOCKNNKGTV QDGTHN·EJNKEJGT 'OCKNNGEJKR CWH FGO #XGTU FGU TGEJVGP WPVGTGP #TOU CO WPIGVTCIGPGP   *CNUDCPFHÃ&#x2019;T-TKGIUGKPUCV\OKV\YGKCWHIGNGIVGPIQNFHCTDGPGP5VGTPGPHÃ&#x2019;TCW­GTQTFGPVNKEJGP -TKGIUGKPUCV\$9-<- ++p



-TQPGP1TFGP=1TFGFGNC%QWTQPPG-TQQPQTFG?4KVVGTFGMQTCVKQP5KNDGTVGKNYGKUGXGTIQNFGVWPF GOCKNNKGTV CO $CPF HÃ&#x2019;T -TKGIUGKPUCV\  OKV GOCKNNKGTVGT $CPFURCPIG HÃ&#x2019;T *KPVGTDNKGDGPG   $9-<- +p++



-TQPGP1TFGP =1TFG FG NC %QWTQPPG  -TQQPQTFG?-TQPGP/GFCKNNG/QFGNN OKVGKPURTCEJKIGT +PUEJTKHV    $TQP\GPG /GFCKNNG CO $CPF OKV $CPFURCPIG HÃ&#x2019;T 8GVGTCPGP XGTIQNFGV VGKN   YGKUG GOCKNNKGTV &C\W 9KGFGTUVCPFU/GFCKNNG CO $CPF OKV GOCKNNKGTVGT $CPFURCPIG HÃ&#x2019;T *KPVGTDNKG   DGPG 5VÃ&#x2019;EM++



8446

8445



1TFGP .GQRQNFU ++ =1TFTG FG .¾QRQNF ++  1TFG XCP .GQRQNF ++?  /QFGNN OKV \YGKURTCEJKIGT   /GFCKNNQPWOUEJTKHVUGKV $TWUVUVGTP\WO)TQ­QHHK\KGT5KNDGTVGKNYGKUGXGTIQNFGVWPFGOCKNNKGTV CWHFGT4Ã&#x2019;EMUGKVG*GTUVGNNGTDG\GKEJPWPIFGT(KTOC2&G)TGGHKP$TÃ&#x2019;UUGNCP0CFGNOKV\YGK5GKVGP JCMGP \WUCOOGP OKV -PQRHNQEJTQUGVVG KO QTKIKPCNGP IQNFGP DGFTWEMVGP 8GTNGKJWPIUGVWK   $9-XCT<- ++ 8GTNKGJGPCP)GPGTCN4KEECTFQ$KUQIPKGTQ IGD XQPDKU%JGHFGUKVCNKGPKUEJGP)GPGTCNUVCDGUFGT 8GTVGKFKIWPI  &GT $TWUVUVGTP YKTF CNNGKPG QJPG YGKVGTG &GMQTCVKQPGP YKG *CNU QFGT $TWUVMTGW\ XGTNKGJGP WPF   IGVTCIGP





208



1TFGP.GQRQNFU++=1TFTGFG.¾QRQNF++1TFGXCP.GQRQNF++?/QFGNN OKVGKPURTCEJKIGT/G FCKNNQPWOUEJTKHV 4KVVGTMTGW\5KNDGTVGKNYGKUGGOCKNNKGTVCO$CPFHÃ&#x2019;T-TKGIUGKPUCV\ OKVGOCKNNKGTVGT$CPFURCPIGHÃ&#x2019;T*KPVGTDNKGDGPG$9-<- ++



<KXKNXGTFKGPUV#WU\GKEJPWPI-QPXQNWVFGT-TGW\GWPF-NCUUGWPFFGT/GFCKNNGDKU-NCUUG $TQP\G XGTIQNFGV D\Y XGTUKNDGTV GKPG 5KNDGT LGYGKNU CO $CPF HÃ&#x2019;T VTGWGP &KGPUV KP FGT 8GTYCNVWPI   UQYKG <KXKNXGTFKGPUV#WU\GKEJPWPI  DKU  /GFCKNNG  WPF  -NCUUG $TQP\G XGTIQNFGV D\Y   XGTUKNDGTVLGYGKNUCO$CPFOKV$CPFURCPIG 5VÃ&#x2019;EM++




KÃ&#x2013;NIGREICH BELGIEN

8449

8450

8451

ex 8448



'JTGP\GKEJGPFGT#TDGKVU.CWTGCVGP$TQP\GGOCKNNKGTVCO$CPFKO1TKIKPCNGVWKFC\WGKPYGKVGTGU $TQP\GXGTIQNFGVWPFGOCKNNKGTVCO$CPF 5VÃ&#x2019;EM++





'JTGP\GKEJGP HÃ&#x2019;T +PFWUVTKG WPF .CPF#TDGKVGT #DVGKNWPI HÃ&#x2019;T +PFWUVTKGCTDGKVGT  /QFGNN OKV   \YGKURTCEJKIGT /GFCKNNQPKPUEJTKHV  &GMQTCVKQP  -NCUUG $TQP\G XGTUKNDGTV VGKNYGKUG XGTIQNFGV WPF   GOCKNNKGTV CO $CPF OKV CWHIGNGIVGT 4QUGVVG WPF $CPFURCPIG HÃ&#x2019;T #TDGKVUQRHGT #4$'+655.#%*6   1(('4/146#764#8#+.$9- ++





-TKGIUGTKPPGTWPIUOGFCKNNG$TQP\GCO$CPFOKVXKGT$CPFURCPIGP'/&'0#4&'0 0'5$'.)+37'WPF014/#0&+'UQYKGMNGKPGPIGMTGW\VGP5·DGNP ++





-TKGIUGTKPPGTWPIUOGFCKNNG  $TQP\G CO $CPF OKV XKGT $CPFURCPIGP $#6 & #0).'   6'44' #4&'00'5 $'.)'5 &+'22' WPF %#/2 & #..'/#)0' UQYKG MNGKPGP   IGMTGW\VGP5·DGNPWPF#WHNCIG(4#0%' ++



8452



8453

8454

8455

-TKGIUGTKPPGTWPIUOGFCKNNG  $TQP\G CO $CPF OKV XKGT $CPFURCPIGP %#/2 &' *1.   .#0&'014/#0&+'#4&'00'5$'.)'5WPF$#6& #0).'6'44'UQYKGMNGKPGP IGMTGW\VGP5·DGNP ++



-TKGIUGTKPPGTWPIUOGFCKNNG  $TQP\G CO $CPF OKV HÃ&#x2019;PH $CPFURCPIGP %#/2 &' *1.   .#0&' 014/#0&+' %#0#. &' 9'55'/ %#0#. #.$'46 WPF $#6 &'   $'.)+37'UQYKGMNGKPGPIGMTGW\VGP5·DGNP ++





-TKGIUGTKPPGTWPIUOGFCKNNG  $TQP\G CO $CPF OKV HÃ&#x2019;PH $CPFURCPIGP 1.&'0$74)   014/#0&+' #4&'00'5 $'.)'5 '/&'0 WPF$'.)+37'UQYKGMNGKPGPIGMTGW\VGP 5·DGNPIGMTGW\VGP$NKV\GPWPFTQVGO-TGW\ ++





-TKGIUGTKPPGTWPIUOGFCKNNG  $TQP\G CO $CPF OKV \YGK $CPFURCPIGP #6.#06+37'   014&WPF/#0%*'UQYKGMNGKPGPIGMTGW\VGP#PMGTP ++





209


BOSNIEN UND HERZEGOWINA

ex 8458 8456

8457



-TKGIUGTKPPGTWPIUOGFCKNNG  $TQP\G CO $CPF OKV GKPGT $CPFURCPIG %#0#. &'   9'55'/WPF#WHNCIG(4#0%'UQYKGMNGKPGPIGMTGW\VGP5·DGNP ++





-TKGIUGTKPPGTWPIUOGFCKNNG  $TQP\G CO $CPF OKVFTGK$CPFURCPIGP;17)15.#9+' +6#.+'WPF9#.%*'4'0UQYKGMNGKPGPIGMTGW\VGP5·DGNP ++





-QPXQNWV XQP  XGTUEJKGFGPGP #WU\GKEJPWPIGP <KXKNG WPF OKNKV·TKUEJG FGU 'TUVGP WPF <YGKVGP   9GNVMTKGIU UQYKG GKPG /KPKCVWT XGTUEJKGFGPG /GVCNNG VGKNU GOCKNNKGTV KP XQT\ÒINKEJGO <WUVCPF LG   YGKNUCPFGPMQTTGMVGP$·PFGTP 5VÒEM++



8459

8461 8460



/KPKCVWTGPUEJPCNNG GKPGU 8GVGTCPGP FGU 'TUVGP 9GNVMTKGIU OKV  #WU\GKEJPWPIGP   1TFGP   .GQRQNF ++ 4KVVGTMTGW\   -TKGIUMTGW\    ;UGT-TGW\   +PVGTCNNKKGTVG 5KGIGUOGFCKNNG    -TKGIUGTKPPGTWPIUOGFCKNNG ,WDKN·WOUOGFCKNNG /KNKV·T'JTGP\GKEJGP  ,WDKN·WOUOGFCKNNG    )QNFGPG 2CNOGP FGU -TQPGPQTFGPU   )QNFGPG 8GTFKGPUVOGFCKNNG FGU   1TFGPU.GQRQNF++ #TDGKVGT#WU\GKEJPWPI-NCUUG#P0CFGN 5VÒEM++





/KPKCVWTGPUEJPCNNG GKPGU 8GVGTCPGP FGU 'TUVGP 9GNVMTKGIUOKVUGEJU#WU\GKEJPWPIGP .GQRQNF 1TFGP 4KVVGTMTGW\   -TQPGPQTFGP 4KVVGTFGMQTCVKQP   -TKGIUMTGW\  OKV 2CNOGP   )QN    FGPGU <KXKNXGTFKGPUVMTGW\   -TKGIUFGPMOÒP\G  OKV FTGK $CPFURCPIGP   +PVGTCNNKKGTVG   5KGIGUOGFCKNNG 5VÒEM++



$150+'070&*'4<')19+0# 5'4$+5%*'4'27$.+- 

0LGIQU1TFGP =Îðäåí Œåãîøà?  /QFGNN -NGKPQF KP /GFCKNNGPHQTO  !  5GV FGT  -NCUUG   DGUVGJGPFCWU-NGKPQF$TQP\GXGTIQNFGVCOQTKIKPCNGP5EJWNVGTDCPFWPF$TWUVUVGTP$TQP\GXGTIQN FGV VGKNYGKUG GOCKNNKGTV 'OCKNNGOCNGTGK CWH FGT 4ÒEMUGKVG -NGOOXQTTKEJVWPI KO QTKIKPCNGP IQNFGP   DGFTWEMVGP8GTNGKJWPIUGVWK82'5 5VÒEM444++ 7PUGTGU 9KUUGPU KUV FKGUGT UGJT UGNVGPG 1TFGP PQEJ PKG KO *CPFGN CPIGDQVGP YQTFGP&GT FTGKMNCUUKIG 1TFGP HÒT   8GTFKGPUVGWOFKG.CPFYKTVUEJCHV9KUUGPUEJCHVWPF-WNVWTYWTFGCO#RTKNKP$CPLC.WMCXQPFGT0CVKQ PCNXGTUCOONWPIFGT5GTDKUEJGP4GRWDNKMKP$QUPKGPWPF*GT\GIQYKPC=4GRWDNKMC5TRUMC?IGUVKHVGV<WGKPGOPKEJV DGMCPPVGPUR·VGTGP<GKVRWPMV XQT YWTFGFCU-NGKPQFIG·PFGTVKPFGODKUJGTKIGOGFCKNNGPHÌTOKIGFWTEJGKP -TGW\KP(QTOFGT#WHNCIGFGU$TWUVUVGTPUGTUGV\VYWTFG

210




BULGARIEN

8462

8464

<#4'067/   



8463

$7.)#4+'0

1TFGP ō(ÒT 6CRHGTMGKVŌ =Îðäåí „Çà Õðàáðîñò“?  /QFGNN OKVFGT,CJTGU\CJNCWHFGOXQT FGTUGKVKIGP/GFCKNNQPTKPI -TGW\+8-NCUUG5VWHG$TQP\GXGTUKNDGTVVGKNYGKUGXGTIQN FGVWPFGOCKNNKGTVCOQTKIKPCNGPCNVGP&TGKGEMUDCPF$9-<- ++



1TFGP ō5V #NGZCPFGTŋ =Îðäåí „Ñâ. Àëåêñàíäúð“ D\Y 1TFGP ō5V #NGZCPFGT 0GYUM[ŋ Îðäåí   „Ñâ. Àëåêñàíäúð Íåâñêèé“?  /QFGNN OKVUQIGPCPPVGTGEMKIGTDWNICTKUEJGT<CTGPMTQPG    $TWUVUVGTP \WO )TQ­MTGW\ 5KNDGT VGKNYGKUG XGTIQNFGV WPF GOCKNNKGTV 5EJTKHV WPF   <YGKIGUGRCTCVCWHFGP/GFCKNNQPTKPICWHIGNGIVCP0CFGNFKGUGOKVHTCP\ÌUKUEJGT*GTUVGNNGTRWP\GWPF HTCP\ÌUKUEJG)CTCPVKGRWP\GHÒT5KNDGT 'DGTMQRH UGKV NGV\VGTGCWEJCWHFGO0CFGNJCMGP OKV\YGK 5GKVGPJCMGP$9-<- +p++



/KV7MCUXQO&G\GODGTUVKHVGVG#NGZCPFGT+XQP$CVVGPDGTI(ÒTUVXQP$WNICTKGPFGP\WP·EJUVHÒPHMNCU UKIGP + DKU 8 -NCUUG  CNNIGOGKPGP 8GTFKGPUVQTFGP OKV CHHKNKKGTVGO 5KNDGTPGP <GKEJGP  /QFGNN  'T YWTFG \W   'JTGPFGTTWUUKUEJGP$GHTGKGT$WNICTKGPUPCEJFGOTWUUKUEJGP0CVKQPCNJGNFGPWPFJGKNKIGP)TQ­HÒTUV5V#NGZCPFGT 0GYUM[ EC DGPCPPV(ÒTFGP(ÒTUVGPCNU)TQ­OGKUVGTFGU1TFGPUYCTGKPG-QNNCPG CDō)TQ­G -QNNCPGŋ IGPCPPV  XQTIGUGJGP  YWTFGP HÒT -TKGIU\GKVGP 5EJYGTVGT FWTEJ FKG /KVVG HÒT 6CRHGTMGKV XQT FGO   (GKPFGWPF5EJYGTVGTÒDGTFGO-TGW\IGUVKHVGV/KV7MCU0T(ÒTUV(GTFKPCPFU+XQO#WIWUVYWTFG FCU5KNDGTPG-TGW\KP8+-NCUUGWODGPCPPVWPFFKGUQIGPCPPVGō-NGKPG-QNNCPGŋHÒTHTGOFG5QWXGT·PGWPFFGTGP (COKNKGPOKVINKGFGT UQYKG HÒT JGTXQTTCIGPFG 2GTUÌPNKEJMGKVGP IGUVKHVGV+P (QNIG FGT 'TNCPIWPI FGT XQNNUV·PFKIGP   7PCDJ·PIKIMGKV $WNICTKGPU WPF UGKPGT 2TQMNCOCVKQP \WO <CTGPVWO KO ,CJTG  YWTFGP FKG -QNNCPGP PGW   IGUVCNVGV FKG DKUJGTKIG ō+ -NCUUGŋ KP ō)TQ­MTGW\ŋ WODGPCPPV WPF GKPG PGWG ō+ -NCUUGŋ OKV ITÒP GOCKNNKGTVGO   -NGKPQFIGUVKHVGVUQYKGFKG-NCUUGPGW ITÒPGOCKNNKGTV IGUVCNVGV /QFGNN &CU)TQ­MTGW\WPFFKG+DKU+++ -NCUUG MQPPVGP CWEJ KP $TKNNCPVGP XGTNKGJGP YGTFGP <YKUEJGP  WPF  YWTFG OWVOC­NKEJ FKG   )TQ­OGKUVGTMQNNCPG PQEJ GKPOCN PGW IGUVCNVGV 0CEJ UGKPGT 4GIKGTWPIUÒDGTPCJOG WPVGTVGKNVG <CT $QTKU +++ FKG       WPF FKG  -NCUUG KP \YGK 5VWHGP LGYGKNU OKV WPF QJPG -TQPG #O  5GRVGODGT  KP (QNIG FGU   'KPOCTUEJGUFGT5QYLGVWPKQPÒDGTPCJOGKPGUQIGPCPPVGō8QNMUHTQPVTGIKGTWPIŋFKG/CEJVWPFGPVOCEJVGVGHCMVKUEJ FGP HÒT FGP OKPFGTL·JTKIGP -ÌPKI 5KOGQP UGKV  TGIKGTGPFGP 4GIGPVUEJCHVUTCV $KU CWH FKG 'PVHGTPWPI FGU   5CEJUGPUEJKNFGUCWHFGT$TWUVFGU9CRRGP.ÌYGPFGU$TWUVUVGTPUFGT+WPFFGU-TGW\GUFGT+++-NCUUGGTHQNIVGP MGKPGYGKVGTGP8GT·PFGTWPIGP /QFGNN &KG&GEMGNFGT8GTNGKJWPIUGVWKUYWTFGPLGFQEJPGWIGUVCNVGV0CEJFGO CO5GRVGODGTKPGKPGT8QNMUCDUVKOOWPIFKG/QPCTEJKGCDIGUEJCHHVYQTFGPYCTTKGH)GQTIK&KOKVTQXCO  5GRVGODGT  FKG 4GRWDNKM CWU YQTCWH FGT 0COG FGU 1TFGPU 1TFGP ō5V #NGZCPFGT 0GYUM[ŋ  WPF FKG   +PUKIPKGP FGU 1TFGPU IG·PFGTV YWTFGP &KG CWH FGO -QRH FGU 9CRRGP.ÌYGP GKPKIGT +PUKIPKGP UKV\GPFG -TQPG   YWTFGGPVHGTPVWPFFKG-TQPGPªDGTJÌJWPIFWTEJGKPGPUVKNKUKGTVGPJTGPMTCP\GTUGV\V /QFGNN &KGUGU/QFGNN XGTHÒIVGOWVOC­NKEJYGFGTÒDGTGKPG)TQ­OGKUVGTMQNNCPGPQEJÒDGTGKPGUQIGPCPPVGō-NGKPG-QNNCPGŋ&KGNGV\VGP 8GTNGKJWPIGPFGU1TFGPUGTHQNIVGP2CXNQX 2#5 \WHQNIGCO,WPK#O,WPKKUVFGT1TFGPRGT 7MCUFGU/KPKUVGTTCVGUCDIGUEJCHHVYQTFGP#NNGTFKPIUYKTFGTXQP5KOGQPFGONGV\VGP-ÌPKIXQP$WNICTKGPDKUKP FKG )GIGPYCTV CNU *CWUQTFGP YGKVGT XGTNKGJGP &GUUGP +PUKIPKGP \GKIGP PWPOGJT IGPGTGNN FGP IGMTÌPVGP DWNICTK   UEJGP.ÌYGP /QFGNN 



1TFGP ō5V #NGZCPFGTŋ =Îðäåí „Ñâ. Àëåêñàíäúð“ D\Y 1TFGP ō5V #NGZCPFGT 0GYUM[ŋ =Îðäåí   „Ñâ. Àëåêñàíäúð Íåâñêèé“?  /QFGNN OKVUQIGPCPPVGTGEMKIGTDWNICTKUEJGT<CTGPMTQPG  -NGKPQF\WT-NCUUG CD OKV5EJYGTVGTP5KNDGTXGTIQNFGVWPFGOCKNNKGTVQJPG 2WP\KGTWPICOQTKIKPCNGPCNVGP5EJWNVGTDCPF$9-<- 44++

 211


BULGARIEN

8467

8466

8465



1TFGP ō5V #NGZCPFGTŋ =Îðäåí „Ñâ. Àëåêñàíäúð“ D\Y 1TFGP ō5V #NGZCPFGT 0GYUM[ŋ Îðäåí   „Ñâ. Àëåêñàíäúð Íåâñêèé“?  /QFGNN OKVUQIGPCPPVGTGEMKIGTDWNICTKUEJGT<CTGPMTQPG  -TGW\\WT-NCUUGOKV5EJYGTVGTPÒDGTFGO-TGW\5KNDGTXGTIQNFGVWPFGOCKNNKGTV KPFGT¤UG*GTUVGNNGTRWP\G(4FGT(KTOC4QVJGWPF0GHHGKP9KGPÌUVGTTGKEJKUEJG)CTCPVKGRWP\GHÒT GT 5KNDGT  9KPFJWPFMQRH  XQP  DKU  WPF #OVURWP\G # CO QTKIKPCNGP *CNUDCPF   $9-<- +p++



#WHITWPFFGT2WP\GP#PHGTVKIWPIXQPXQT



1TFGP ō5V #NGZCPFGTŋ =Îðäåí „Ñâ. Àëåêñàíäúð“? D\Y 1TFGP ō5V #NGZCPFGT 0GYUM[ŋ Îðäåí   „Ñâ. Àëåêñàíäúð Íåâñêèé“?  /QFGNN OKVUQIGPCPPVGTGEMKIGTDWNICTKUEJGT<CTGPMTQPG    -TGW\ +8 -NCUUG OKV -TQPG  $TQP\G XGTIQNFGV WPF GOCKNNKGTV CO QTKIKPCNGP &TGK   GEMUDCPFOKVCWHIGNGIVGT4QUGVVG$9-<- ++



#PHGTVKIWPIYQJNCWUFGT<GKVFGU<YGKVGP9GNVMTKGIGU



'JTGP\GKEJGP ō<CTKP 'NGQPQTGŋ =ÏQ÷Gòíè ÇíCê „Öaðèíà Åëåîíîðà“?  /QFGNN OKV FGP ,CJTGU   \CJNGP     #WUHÒJTWPI HÒT *GTTGP 5KNDGT VGKNYGKUG GOCKNNKGTV CWH FGO 4GXGTU   RWP\KGTVCOPGWGP$CPF ++



&CU GKPMNCUUKIG 'JTGP\GKEJGP HÒT 8GTFKGPUVG WO FCU4QVG-TGW\Y·JTGPFFGT$CNMCPMTKGIGYWTFGXQP<CT(GTFK PCPF + CO  #WIWUV  IGUVKHVGV  /QFGNN  0CEJ 'KPVTKVV $WNICTKGPU KP FGP 'TUVGP 9GNVMTKGI YWTFG FCU   'JTGP\GKEJGPXQP<CT(GTFKPCPFGTPGWGTVWPFDKUXGTNKGJGP /QFGNN 

8470 8468



8469

#D\GKEJGP HÒT #WUIG\GKEJPGVGP /KNKV·TFKGPUV  /QFGNN !  #D\GKEJGP  -NCUUG  

HÒT7PVGTQHHK\KGTG #WUHÒJTWPIOKVGOCKNNKGTVGO(GNF$TQP\GXGTIQNFGVVGKNYGKUGGOCKNNKGTVCWHFGO 4GXGTU*GTUVGNNGTDG\GKEJPWPIFGT(KTOC5VTCEJKN/KNQUEJGYKP5QHKCCP0CFGN$9- ++





#D\GKEJGPHÒT(NWICWUDKNFGTFGT.WHVYCHHG5KNDGTVGKNYGKUGGOCKNNKGTVCP5EJTCWDGOKV)GIGPRNCVVG WPF5EJTCWDUEJGKDG$9- ++





5RQTV(NWI\GWIHÒJTGT#D\GKEJGP#WUHÒJTWPIWPVGT<CT$QTKU+++$TQP\GXGTIQNFGVCP0CFGN

212

++




KÖNIGREICH DÄNEMARK

8471 8472

8473

-¤0+)4'+%*&0'/#4- 

&CPPGDTQI1TFGP =&CPPGDTQIQTFGPGP? $TWUVUVGTP \WO )TQ­MTGW\ HTCP\ÌUKUEJG#PHGTVKIWPI5KNDGT DTKNNCPVKGTVWPFTGRGTEKGTVVGKNYGKUGXGTIQNFGVWPFGOCKNNKGTVUVCTMIGFWPMGNVCWHFGO4GXGTU*GTUVGNNGT DG\GKEJPWPIFGT(KTOC.GOCÄVTGKP2CTKUCP0CFGNOKV\YGK5GKVGPJCMGP$9-<- ++



&CDKUFCU)TQ­MTGW\FGU&CPPGDTQI1TFGPUOKVGKPGOIGUVKEMVGP$TWUVUVGTPXGTNKGJGPYWTFGYCTGPFKG 6T·IGTIG\YWPIGPWOGKPGIGYKUUG2TCMVKMCDKNKV·VDGKO6TCIGP\WJCDGPUKEJ<YGKVCPHGTVKIWPIGPXQP$TWUVUVGT PGPKP/GVCNN\WDGUEJCHHGPYCUFGTGPITQ­GP8CTKCPVGP4GKEJVWOGTMN·TV  &GT &CPPGDTQI1TFGP YWTFG CO  1MVQDGT  XQP -ÌPKI %JTKUVKCP 8 XQP &·PGOCTM WPF 0QTYGIGP     KP 'TPGWGTWPI GKPGU UEJQP XQP-ÌPKI9CNFGOCT++XQP&·PGOCTM  IGUVKHVGVGP4KVVGTQTGPU GTPGWGTV<WP·EJUVPWTCWUGKPGT-NCUUGDGVGJGPFGTYGKVGTVGKJP-ÌPKI(TGFGTKM8+XQP&·PGOCTMWPF0QTYGIGP

  CO  ,WPK  \W GKPGO CWU XKGT -NCUUGP )TQ­MQOOCPFGWT  CD  FKG QDGTUVG -NCUUG    )TQ­MTGW\4KVVGT -QOOCPFGWT WPF 4KVVGT  DGUVGJGPFGP CNNIGOGKPGP 8GTFKGPUVQTFGP CNU ·W­GTGU <GKEJGP   CPGTMCPPVGT$ÒTIGTRHNKEJVHÒTCNNG7PVGTVCPGPQJPG4ÒEMUKEJVCWH5VCPFQFGT#FGN 1JO*KGTQP[OWUUGPKP'15    YWTFG FKG -QOOCPFGWTMNCUUG  FKG 4KVVGTMNCUUG KP LGYGKNU \YGK )TCFG WPVGTVGKNV &GO 1TFGP KUV   UGKVFCU'JTGP\GKEJGPFGU&CPGDTQI1TFGPU 5KNDGTPGU-TGW\ CPIGUEJNQUUGP  WPF  PCEJ 4GIKGTWPIUCPVTKVV FGU LGYGKNKIGP 5QWXGT·PU YWTFG FKG )GUVCNVWPI FGT 1TFGPUMTGW\G FWTEJ   #PDTKPIWPIFGULGYGKNKIGPMÌPKINKEJGP/QPQITCOOUXGT·PFGTV



&CPPGDTQI1TFGP =&CPPGDTQIQTFGPGP?  /QFGNN OGJTMNCUUKI UGKV   $TWUVUVGTP \WO )TQ­   MTGW\ IGUVKEMVG #WUHÒJTWPI QHHK\KGNN XGTNKGJGP XQP  DKU   NGKEJV IGYÌNDV 5KNDGT WPF   )QNFNCCP XGTIQNFGVGU5KNDGT 5VKEMGTGK2CKNNGVVGPCNNG5EJNCWHGPXQTJCPFGPCWHFGT4ÒEMUGKVGYGK­GU #DFGEMNGFGTOKVJCPFUEJTKHVNKEJGT#WHUEJTKHV*U'ZEGNNGPEG$T'.CIGTJGKO ++



$KUYWTFGFCU)TQ­MTGW\FGU&CPPGDTQI1TFGPUOKVGKPGOIGUVKEMVGP$TWUVUVGTPXGTNKGJGP



&CPPGDTQI1TFGP =&CPPGDTQIQTFGPGP?  /QFGNN OGJTMNCUUKI UGKV   $TWUVUVGTP \WO -QO   OCPFGWT)TCFGU UGKV IGUVKEMVG#WUHÒJTWPI QHHK\KGNNXGTNKGJGPXQPDKU 5KN DGTWPF)QNFNCCP XGTIQNFGVGU5KNDGT 5VKEMGTGK2CKNNGVVGPCNNG5EJNCWHGPXQTJCPFGPGVYCUIGFWPMGNV CWHFGT4ÒEMUGKVGYGK­GU#DFGEMNGFGT ++



$KU  YWTFG FCU -QOOCPFGWTMTGW\  )TCFGU FGU &CPPGDTQI1TFGPU OKV GKPGO IGUVKEMVGP $TWUVUVGTP   XGTNKGJGP

213


REPUBLIK ESTLAND

8474 (1:1)

8477

8476 (1:1) 8475



&CPPGDTQI1TFGP=&CPPGDTQIQTFGPGP?/QFGNN#WUICDG OKV/QPQITCOO-ÌPKI%JTKUVKCP+:  /KPKCVWTFGU4KVVGTMTGW\GU)QNFGOCKNNKGTVCOMWT\GP$·PFEJGP ++





&CPPGDTQI1TFGP =&CPPGDTQIQTFGPGP?  /QFGNN OGJTMNCUUKI UGKV #WUICDGOKV/QPQ ITCOO-ÌPKI%JTKUVCPU: 4KVVGTMTGW\)QNFGOCKNNKGTV\YGKMCWOUKEJVDCTG4GRCTCVWTGP KP FGT TQVGP 'OCKNNG FGT 8QTFGTUGKVG CO QTKIKPCNGP F·PKUEJGP CDGT UR·VGTGP 2GPVCIQPCNDCPF $9-   <- ++



&CPPGDTQI1TFGP =&CPPGDTQIQTFGPGP?  /QFGNN  #WUICDG OKV /QPQITCOO -ÌPKI (TGFGTKMU   +: /KPKCVWTFGU-QOOCPFGWTMTGW\GU5KNDGTXGTIQNFGVWPFGOCKNNKGTVCO$·PFEJGPOKV CWHIGNGIVGT5KNDGTNKV\GWPF4QUGVVGCO-PQRH ++



&CPPGDTQI1TFGP =&CPPGDTQIQTFGPGP?  /QFGNN  #WUICDG OKV /QPQITCOO -ÌPKI (TGFGTKMU   +:    4KVVGTMTGW\   5KNDGT XGTIQNFGV WPF GOCKNNKGTV CO $CPF QJPG 4QUGVVG  

DKU \WUCOOGPOKVFGT(TGKJGKVUOGFCKNNG%JTKUVKCPU:241&#0+#5KNDGTWPF 5KNDGTPGU'JTGP\GKEJGPFGU5EJYGFKUEJGP4GKEJU.WHVUEJWV\8GTDCPFGU5KNDGTCWHFGT4ÒEMUGKVGRWP \KGTVCP&TGKGT1TFGPUUEJPCNNGCP0CFGN 5VÒEM++







8479 (1:1) 8480

8478

8481



(TGKJGKVU/GFCKNNG -ÌPKI %JTKUVKCPU : 241 &#0+#  5KNDGT CO $CPF OKV 6TCIGURCPIG   0CFGNJCMGPCDIGDTQEJGPKOQTKIKPCNGP8GTNGKJWPIUGVWKFGT(KTOC/KEJGNUGPKP-QRGPJCIGP ++





'TKPPGTWPIU#D\GKEJGP CP -ÌPKI %JTKUVKCP : %:      Z  OO )QNF I CWHFGT4ÒEMUGKVGGT)QNFWPF*GTUVGNNGTRWP\GCP$GHGUVKIWPIUMPQRH ++



4'27$.+-'56.#0&

'456' 4'27$.+-   

1TFGP XQO #FNGTMTGW\ =-QVMCTKUVK?  /QFGNN  -TGW\-NCUUG$TQP\GXGTIQNFGVWPF GOCKNNKGTV 5KNDGT VGKNYGKUG GOCKNNKGTV OKP 4GRCTCVWTGP KP FGT UEJYCT\GP 'OCKNNG QJPG $CPFTKPI WPF   QJPG$CPF ++



&GT1TFGPKUVNCWV9CNVGT KP9.5HH KPFKGUGT-NCUUGXQPDKUPWTOCNXGTNKGJGPYQTFGP

 214

5EJWV\MQTRU'JTGP\GKEJGP 'JTGP\GKEJGP  -NCUUG $TQP\G XGTIQNFGV 5KNDGT GOCKNNKGTV OGJTGTG   HGKPGU*CCTTKUUGCO1TKIKPCNDCPF ++




REPUBLIK FINNLAND

8483

8482

4'27$.+-(+00.#0& <WT5VCCVU5[ODQNKMFGT4GRWDNKM(KPPNCPFIGJÌTVPGDGPFGO.ÌYGPKOHKPPKUEJGP5VCCVUYCRRGPCWEJ GKPCNU(TGKJGKVUMTGW\DG\GKEJPGVGU*CMGPMTGW\FGUUGP*CMGPLGFQEJKPGPVIGIGPIGUGV\VGT4KEJVWPI YKG DGKO 5[ODQN FGU FGWVUEJGP 0CVKQPCNUQ\KCNKUOWU XGTNCWHGP &KGUGU (TGKJGKVUMTGW\ YWTFG DGTGKVU   Y·JTGPF FGU 'TUVGP 9GNVMTKGIU \WO 5[ODQN FGT HKPPKUEJGP (TGKJGKVUDGYGIWPI IGIGP FKG \CTKUVKUEJ   TWUUKUEJG*GTTUEJCHVWPFJCVUQOKVPKEJVIGOGKPOKVFGOGTUVUR·VGTGPVUVCPFGPGP5[ODQNFGU0CVKQPCN UQ\KCNKUOWU $KU JGWVG KUV GU CWH FGO JÌEJUVGP HKPPKUEJGP 1TFGP FGO 1TFGP FGU (TGKJGKVUMTGW\GU \W   UGJGPWPFFKGPV\$CWEJCNU5[ODQNHÒTFGPHKPPKUEJGP5VCCVURT·UKFGPVGPD\YFKG5VCCVURT·UKFGPVKPKP FGUUGPD\YFGTGP5VCPFCTVG  5QOKV MCPP CWUFTÒEMNKEJ HGUVIGUVGNNV YGTFGP FC­ FKGUGU (TGKJGKVUMTGW\ CNU PKEJV FGO 0CVKQPCNUQ\KCNKU   OWU\WIGJÌTKIGU5[ODQNPKEJVWPVGTFKG$GUVKOOWPIGPFGThhC#DUD\Y#DU5V)$H·NNV  

4KVVGTQTFGPFGU(TGKJGKVUMTGW\GU=8CRCWFGPKUVKP4KVCTKMWPVC?/QFGNN OKVFGT,CJTGU\CJN CWH FGT 4ÒEMUGKVG  -TGW\  -NCUUG OKV 5EJYGTVGTP WPF 'KEJGPNCWD VGKNYGKUG IGUEJY·T\VWPFXGTIQN FGVCO-TKGIUDCPFOKV5EJNGKHG$9-<- ++



*CPMKOQIKDV KP(-5 HÒTFGP<GKVTCWOXQPDKUGKPG8GTNGKJWPIU\CJNXQPCP



4KVVGTQTFGPFGU(TGKJGKVUMTGW\GU=8CRCWFGPKUVKP4KVCTKMWPVC?/QFGNN OKVFGT,CJTGU\CJN CWH FGT 4ÒEMUGKVG  -TGW\  -NCUUG OKV 5EJYGTVGTP WPF 'KEJGPNCWD VGKNYGKUG IGUEJY·T\V WPF XGTUKN   DGTVCO-TKGIUDCPFOKV5EJNGKHG$9-<- ++



8486 8484







8485

4KVVGTQTFGPFGU(TGKJGKVUMTGW\GU=8CRCWFGPKUVKP4KVCTKMWPVC?/QFGNN OKVFGT,CJTGU\CJN CWH FGT 4ÒEMUGKVG  -TGW\  -NCUUG OKV 5EJYGTVGTP HÒT *KPVGTDNKGDGPG VGKNYGKUG IGUEJY·T\V WPF XGT   UKNDGTVCOUEJYCT\GP$CPFOKV5EJNGKHG$9-<- ++



4KVVGTQTFGPFGU(TGKJGKVUMTGW\GU=8CRCWFGPKUVKP4KVCTKMWPVC?/QFGNN OKVFGT,CJTGU\CJN CWH FGT 4ÒEMUGKVG  -TGW\  -NCUUG OKV 5EJYGTVGTP HÒT *KPVGTDNKGDGPG VGKNYGKUG IGUEJY·T\V WPF XGT   UKNDGTVCOUEJYCT\GP$CPFOKV5EJNGKHG$9-<- ++



4KVVGTQTFGPFGU(TGKJGKVUMTGW\GU=8CRCWFGPKUVKP4KVCTKMWPVC?/QFGNN OKVFGT,CJTGU\CJN CWH FGT 4ÒEMUGKVG  (TGKJGKVUOGFCKNNG  -NCUUG 5KNDGT CWH FGT 4ÒEMUGKVG OGJTHCEJ IGRWP\V  

WC*5KNDGTRWP\GWPF,CJTGURWP\G/HÒT CO$CPF$9-<- ++

 215


REPUBLIK FINNLAND

8488

ex 8489 8487



4KVVGTQTFGP FGT (KPPKUEJGP 9GK­GP 4QUG =5WQOGP 8CNMQKUGP 4WWUWP 4KVCTKMWPVC? -QOOCPFGWT   MTGW\#WUHÒJTWPI OKVJQTK\QPVCNCPIGNÌVGVGT¤UGUGKV 5KNDGTXGTIQNFGVWPFGOCKNNKGTVKPFGT ¤UGOGJTHCEJRWP\KGTV WC*HÒTGT5KNDGTWPF*GTUVGNNGTRWP\G#6FGT(KTOC#6KNNCPFGT KP*GNUKPMK CO*CNUDCPFOKVUEJYGFKUEJGP/GVCNNXGTUEJNÒUUGP$9-<- ++



#O,CPWCTUVKHVGVGFGTPWPOGJTKIG4GKEJUXGTYGUGT%CTN)WUVCX(TGKJGTTXQP/CPPGTJGKOFGPMNCUUKIGP 1TFGP FGO FCU <GKEJGP FGT (KPPKUEJGP 9GK­GP 4QUG UQYKG GKPG FTGKUVWHKIG 8GTFKGPUVOGFCKNNG CPIGUEJNQUUGP KUV    YWTFGP +PUKIPKGP OKV 5EJYGTVGTP HÒT 6CRHGTMGKV KO (GNFG IGUEJCHHGP XIN -NKGVOCPP -WTV) (KPPNCPF    1TFGPFGT(KPPKUEJGP9GK­GP4QUG+P1TFGPU.GZKMQP$CPF$GTNKPQ, 



4KVVGTQTFGP FGT (KPPKUEJGP 9GK­GP 4QUG =5WQOGP 8CNMQKUGP 4WWUWP 4KVCTKMWPVC? 4KVVGTMTGW\    #WUHÒJTWPI OKV XGTVKMCN CPIGNÌVGVGT ¤UG    5KNDGT XGTIQNFGV WPF GOCKNNKGTV KP FGT ¤UG   OGJTHCEJ RWP\KGTV W C * HÒT GT 5KNDGT WPF *GTUVGNNGTRWP\G #6 FGT (KTOC # 6KNNCPFGT KP   *GNUKPMK CO$CPFKOQTKIKPCNGPIQNFGPDGFTWEMVGP8GTNGKJWPIUGVWKFGT(KTOC6KNNCPFGT$9- <- ++



9TGFGUEJTGKDV KP94& FC­FKG4KVVGTMTGW\GDKUOKVUGPMTGEJV\WO-TGW\UVGJGPFGT¤UGXGTNKGJGPYQTFGP UKPFWPFIKDVHÒTFKGUGP<GKVTCWOGKPG)GUCOV\CJNXQP JÌEJUVGPU 8GTNGKJWPIGPCP



4KVVGTQTFGP FGT (KPPKUEJGP 9GK­GP 4QUG =5WQOGP 8CNMQKUGP 4WWUWP 4KVCTKMWPVC? 5KNDGTPGU <GK   EJGP  /QFGNN   INCVVGU 4GXGTU 4QUG PKEJV GOCKNNKGTV  5KNDGT CWH FGO 4GXGTU *GTUVGN   NGTRWP\GFGT(KTOC#6KNNCPFGT5KNDGTRWP\GPWPF,CJTGURWP\G/HÒTCO$CPF\WUCOOGPOKV /KPKCVWT FGU  /QFGNNU 5KNDGT VGKNYGKUG GOCKNNKGTV CO $·PFEJGP KO QTKIKPCNGP IQNFGP DGFTWEMVGP   8GTNGKJWPIUGVWKXQP6KNNCPFGT<WUCOOGPOKV241$'0+)0+6#6'*7/#0#/GFCKNNGOKV/KPKCVWT LGYGKNU$TQP\GCO$·PFEJGPWPF-PQRHNQEJCD\GKEJGP$9- 5VÒEM4++



&CU5KNDGTPG<GKEJGPFGU1TFGPUFGT9GK­GP4QUGFCUCWUUEJNKG­NKEJ(TCWGPXQTDGJCNVGPKUVYWTFGDKUKPFKGGT ,CJTGXGTNKGJGP+O,WPKDGUEJNQ­FCU1TFGPUMCRKVGNFCU<GKEJGPMÒPHVKIOKVGOCKNNKGTVGO/KVVGNOGFCKNNQP\W XGTNGKJGP$KUFCJKPYCTGPPCEJ9TGFG<GKEJGPKP5KNDGTXGTNKGJGPYQTFGP

8490



4KVVGTQTFGP FGU (KPPKUEJGP .ÌYGP =5WQOGP .GKLQPCP 4KVCTKMWPVC? -QOOCPFGWTMTGW\ 5KNDGT XGT   IQNFGVWPFGOCKNNKGTVKPFGT¤UGOGJTHCEJRWP\KGTV WC#6HÒTFKG(KTOC#6KNNCPFGTWPF* HÒT GT 5KNDGT  CO *CNUDCPF KO IQNFGP DGFTWEMVGP 8GTNGKJWPIUGVWK FGT (KTOC # 6KNNCPFGT   $9-<- ++ #O5GRVGODGTUVKHVGVGFGTHKPPKUEJG2T·UKFGPV4[UVQ4[VKFGPHÒPHMNCUUKIGP1TFGPFGOGKP8GTFKGPUVMTGW\ WPFFKGCO&G\GODGTIGUVKHVGVG2TQ(KPNCPFKC/GFCKNNGCPIGUEJNQUUGPKUV(ÒTOKNKV·TKUEJG8GTFKGPUVGKP -TKGIU\GKVGPYKTFFGT1TFGPOKV5EJYGTVGTPXGTNKGJGP

216




REPUBLIK FINNLAND

8491







8493

8492

4KVVGTQTFGP FGU (KPPKUEJGP .ÌYGP =5WQOGP .GKLQPCP 4KVCTKMWPVC? -QOOCPFGWTMTGW\ 5KNDGT XGT   IQNFGVWPFGOCKNNKGTVKPFGT¤UGOGJTHCEJRWP\KGTV WC*GTUVGNNGTRWP\GFGT(KTOC#6KNNCPFGTWPF *GT5KNDGT CO*CNUDCPF$9-<- ++



4KVVGTQTFGP FGU (KPPKUEJGP .ÌYGP =5WQOGP .GKLQPCP 4KVCTKMWPVC? -QOOCPFGWTMTGW\ 5KNDGT XGT   IQNFGVWPFGOCKNNKGTVKPFGT¤UGOGJTHCEJRWP\KGTV WC*GTUVGNNGTRWP\GFGT(KTOC#6KNNCPFGTWPF *HÒTGT5KNDGT CO*CNUDCPF$9-<- ++



4KVVGTQTFGPFGU(KPPKUEJGP.ÌYGP=5WQOGP.GKLQPCP4KVCTKMWPVC?4KVVGTMTGW\-NCUUG5KNDGTXGT IQNFGV WPF GOCKNNKGTV KP FGT ¤UG OGJTHCEJ RWP\KGTV W C 2WP\G #6 FGT (KTOC # 6KNNCPFGT WPF   *HÒTGT5KNDGT CO$CPFOKVCWHIGNGIVGT4QUGVVG$9-<- ++



8494 8497

8495

8496



8GTFKGPUVOGFCKNNG FGU 6KGTUEJWV\XGTGKPU KP *GNUKPMK 5KNDGTPG 8GTFKGPUVOGFCKNNG 5KNDGT CWH FGO   4GXGTU9KFOWPIUKPUEJTKHV4GIKOGPVUXGVGTKPCT#)(NQT¾PCP$CPFTCJGQJPG$CPF 4++



YCT(KPPNCPFPQEJGKPTWUUKUEJGU)TQ­HÒTUVGPVWOKP2GTUQPCNWPKQPOKVFGO4WUUKUEJGP4GKEJ



'TKPPGTWPIUOGFCKNNG FGT 5EJYGFKUEJGP (TGKYKNNKIGP $TKICFG KO (KPPKUEJGP (TGKJGKVUMTKGI    5KNDGT CWH FGT 4ÒEMUGKVG FGT #ITCHHG *GTUVGNNGTDG\GKEJPWPI FGT (KTOC % % 5RQTTQPI KP 5VQEMJQNO   CO$CPFKPFGTQTKIKPCNGP8GTNGKJWPIUUEJCEJVGN 4++





9KPVGTMTKGIU6GKNPGJOGT/GFCKNNG  HÒT CWUN·PFKUEJG (TGKYKNNKIG 'KUGP IGUEJY·T\V CO   QTKIKPCNGP$CPFOKV$CPFURCPIG.#22+WPFIGMTGW\VGP5·DGNP$9- 44++





8GTFKGPUVOGFCKNNG FGT (KPPKUEJGP 5EJWNG HÒT 4GUGTXGQHHK\KGTG 5KNDGT VGKNYGKUG XGTIQNFGV CWH FGT   4ÒEMUGKVG *GTUVGNNGTDG\GKEJPWPI FGT (KTOC -WNVCVGQNNKUWWU CO $CPF OKV 0CFGN \WUCOOGP OKV (GNF   UEJPCNNGKPFGT8GTNGKJWPIUUEJCEJVGN +p++

 217


FRANKREICH

8498 (1:1)

(4#0-4'+%*

'456'5 (4#0<¤5+5%*'5-#+5'44'+%*   

'JTGPNGIKQP =.¾IKQP F JQPPGWT?   /QFGNN#WUICDG .CWDMTQPGOKVHÒPH$ÒIGNP QJPG -ÒIGNEJGP CP FGP 5RKV\GP  EC   .GIKQP·TU CD  4KVVGT&GMQTCVKQP #WU   HÒJTWPI OKV FGO -QRH PCEJ TGEJVU 5KNDGT /GFCKNNQPU )QNF GOCKNNKGTV MNGKPGTG #DRNCV\WPIGP KP FGT   ITÒPGP'OCKNNGKO4KPI2CTKUGT)CTCPVKGRWP\GXQPDKU .KMVQTGPDÒPFGN COQTKIKPCNGPCNVGP \GKVIGPÌUUKUEJGP$CPF<- 4++



5GNVGP KP FKGUGT 'TJCNVWPI 6TQV\ FGU JQJGP #NVGTU XQP \KGONKEJ IGPCW \YGKJWPFGTV ,CJTGP DGHKPFGV UKEJ FKGUGU   'ZGORNCTKPGKPGOIGTCFG\WJGTXQTTCIGPFGP<WUVCPFDGUQPFGTUYGPPOCPDGFGPMVFC­\WLGPGT<GKVFKG+PUKIPKGP FGT'JTGPNGIKQPRTCMVKUEJFCWGTPFIGVTCIGPYWTFGP

8499 8501 8500

-¤0+)4'+%* <9'+6'4'56#74#6+10  

-ÌPKINKEJGT WPF /KNKV·TKUEJGT 1TFGP XQO JN .WFYKI =1TFTG 4Q[CN GV /KNKVCKTG FG 5CKPV .QWKU?   (TÒJG#WUHÒJTWPIFGT<YGKVGP4GUVCWTCVKQP 4KVVGTMTGW\ZOO)QNFGOCKNNKGTV  I OGJTGTG 'OCKNNGURTÒPIG CWUDTÒEJG WPF CNVG 4GRCTCVWTGP FKG /GFCKNNQPU OKV \CJNTGKEJGP   'OCKNNGUEJ·FGPCOCNVGPLGFQEJPKEJVMQTTGMVGP$CPF$9-<- ++



'KPPCJG\WKFGPVKUEJGU'ZGORNCTKUVDGK%QNNKIPQP %..U0T CDIGDKNFGV





218

-ÌPKINKEJGT 1TFGP FGT 'JTGPNGIKQP =1TFTG TQ[CN FG NC .¾IKQP F JQPPGWT?    /QFGNN  

OKVFGO2QTVTCKV-ÌPKI*GKPTKEJU+8CWHFGO#XGTUWPFFTGK.KNKGPCWHFGO4GXGTUOG FCKNNQP FKG &GMQTCVKQP ÒDGTJÌJV XQP GKPGT .KNKGPMTQPG  1HHK\KGTUFGMQTCVKQP )QNF GOCKNNKGTV  I   ITÌ­GTG $GUEJ·FKIWPIGP XQT CNNGO KP FGT YGK­GP 'OCKNNG CWH#XGTUWPF4GXGTUUGKVG#XGTUOGFCKNNQP GKPIGFTÒEMVCOQTKIKPCNGPCWUIGDNGKEJVGP$CPFOKVCWHIGNGIVGT4QUGVVG$9-<- +8



'JTGP\GKEJGPFGT.KNKGHÒTFKG0CVKQPCNICTFGXQP2CTKUUQIGPCPPVGT1TFGTFGT6TGWG=1TFTGFGNC (KF¾NKV¾?  #WUHÒJTWPI OKV (+&'.+6'  &'817'/'06 KO #XGTU/GFCKNNQPTKPI  5KNDGT   /GFCKNNQPU)QNFGOCKNNKGTV#DRNCV\WPIGPWPF%JKRUKPFGTYGK­GPWPFKPFGTDNCWGP'OCKNNGCOCNVGP

ITÒPGP LGFQEJPKEJVMQTTGMVGP$CPF$9- +++++




FRANKREICH

8502 (1:1)

8504 (1:1) 8506

8503 (1:1)

8505 (1:1)

ex 8507 (1:1)



'JTGP\GKEJGPFGT.KNKG=&¾EQTCVKQPFW.KU?#WUHÒJTWPIOKV-TQPG5KNDGTCOQTKIKPCNGPCNVGPYGK­GP 5GKFGPDCPF$9- ++





'JTGP\GKEJGPFGT.KNKG=&¾EQTCVKQPFW.KU?#WUHÒJTWPIOKV-TQPG5KNDGTQJPG$CPF$9- ++





'JTGP\GKEJGPFGU$TCUUCTFXQP$QTFGCWZ=&¾EQTCVKQPFW$TCUUCTFFG$QTFGCWZ?ZOO )QNFGOCKNNKGTV#DRNCV\WPIGPKPFGTYGK­GPWPFITÒPGP'OCKNNGCOQTKIKPCNGPCNVGP$·PFEJGP$9-  ++p+++



/KPKCVWTOGFCKNNG CWH FKG -TÌPWPI -ÌPKI -CTNU : KO ,CJTG  &WTEJOGUUGT  OO 5KNDGT   CO$·PFEJGP ++





-¤0+)4'+%*&'4(4#0<15'0 $ª4)'4-¤0+)67/  



'JTGPNGIKQP =.¾IKQP F JQPPGWT?    /QFGNN  #WUHÒJTWPI OKVFGO2QTVTCKV*GKPTKEJU +8 CWH FGO #XGTU WPF IGMTGW\VGP 6TKMQNQTGP CWH FGO 4GXGTUOGFCKNNQP OKV -TQPG      4KVVGTFGMQTCVKQP 5KNDGT /GFCKNNQP )QNF GOCKNNKGTV OGJTGTG #DRNCV\WPIGP KP FGT ITÒPGP 'OCKNNG FGT   $N·VVEJGP CWH FGP $CPFGPFGP FGU .QTDGGT'KEJGPNCWDMTCP\GU 2CTKUGT MNGKPG )CTCPVKGRWP\G HÒT 5KNDGT  

*CUGPMQRHXQPDKU COQTKIKPCNGPCNVGP$CPF$9-<- ++p



,WNK-TGW\=%TQKZFG,WKNNGV?4GFWMVKQPFGU-TGW\GUZOO5KNDGT/GFCKNNQPU)QNF GOCKNNKGTVCOMWT\GP$·PFEJGP&C\W/GFCKNNGHÒTFGP+VCNKGP(GNF\WI=/¾FCKNNGFGNC%CORCIPGF +VCNKG? /KPKCVWTFGT#WUICDG QJPG-TQPG &WTEJOGUUGTOOCO$·PFEJGP 5VÒEM++



8508

<9'+6' (4#0<¤5+5%*'4'27$.+-24+0<245+&'065%*#(6  =24'5+&'0%'?.17+50#21.—10$10#2#46'5   

'JTGPNGIKQP=.¾IKQPF JQPPGWT?  /QFGNN OKV2QTVTCKV-CKUGT0CRQN¾QPU+PCEJ TGEJVUCWHFGO8QTFGTUGKVGPWPFFGOMCKUGTNKEJGP#FNGTOKV-QRHPCEJTGEJVUQFGTNKPMUCWHFGO4ÒEM UGKVGP/GFCKNNQPFKG&GMQTCVKQPÒDGTJÌJVXQPGKPGTPCRQNGQPKUEJGP-CKUGTMTQPGOKV#MCPVJWUDN·VVGTP  -QOOCPFGWTFGMQTCVKQP #WUHÒJTWPI QJPG -ÒIGNEJGP CP FGP #TOURKV\GP 5KNDGT XGTIQNFGV WPF GOCKN   NKGTVOGJTGTGOKP'OCKNNGTGRCTCVWTGPFKG-TQPGOKV5VQHHIGHÒVVGTVCOPGWGP*CNUDCPFCDUEJPKVV 4++



5GNVGPGU 'ZGORNCT FKGUGU 6[RWU FGT PWT HÒT YGPKIG 9QEJGP KP FGT <GKV XQO  ,CPWCT DKU \WO/·T\ XGTNKGJGP YWTFG .QWKU 0CRQN¾QP $QPCRCTVG 2T·UKFGPV FGT (TCP\ÌUKUEJGP 4GRWDNKM WPF 0GHHG -CKUGT 0CRQN¾QP +   GTJKGNV OKV FGO 5VCCVUUVTGKEJ XQO  &G\GODGT  UGKPG 2T·UKFGPVUEJCHV CWH .GDGPU\GKV &CTCWHJKP YWTFG OKV   &GMTGVXQO&G\GODGTFKG9KGFGTCPDTKPIWPIFGU#FNGTUCWHFGT4ÒEMUGKVGFGT&GMQTCVKQPGPFGT'JTGPNG IKQPXGTHÒIV#O,CPWCTGTHQNIVGGKPYGKVGTGU&GMTGVÒDGTFKG9KGFGTCPDTKPIWPIFGT-TQPG GKPGT.CWD MTQPG ÒDGTFGP&GMQTCVKQPGPFGT'JTGPNGIKQP$GTGKVUCO/·T\GTHQNIVGGKPYGKVGTGU&GMTGVYGNEJGU KP 8QTDGTGKVWPI CWH FGP 9GI \WO -CKUGTVWO  FKG -TQPG KP KJTG GPFIÒNVKIG PCRQNGQPKUEJG (QTO DTCEJVG FKG UKG DKU   \WO7PVGTICPIFGU-CKUGTTGKEJGUJCDGPUQNNVG'UFÒTHVGUKEJJKGTDGKWOGKPG#PHGTVKIWPICWUFGT<GKVFGU<YGKVGP -CKUGTTGKEJU DKU JCPFGNPQFGTUQICTCWUGVYCUUR·VGTGT<GKV

219


FRANKREICH

8511 8510

ex 8512

8509 (1:1)

<9'+6'5 (4#0<¤5+5%*'5-#+5'44'+%*   





-CKUGTNKEJGT1TFGPFGT'JTGPNGIKQP=1TFTGKOR¾TKCNFGNC.¾IKQPF JQPGWT?  /QFGNN

OKV2QTVTCKV-CKUGT0CRQN¾QPU+PCEJTGEJVUCWHFGO85WPFFGOMCKUGTNKEJGP#FNGTOKV -QRH PCEJ TGEJVU QFGT NKPMU CWH FGO 45/GFCKNNQP FKG &GMQTCVKQP ÒDGTJÌJV XQP GKPGT JGTCNFKUEJGP   PCRQNGQPKUEJGP -CKUGTMTQPG OKV #FNGTP  -QOOCPFGWTFGMQTCVKQP PQTOCNG UQIGPCPPVG 1TFQPPCP\   #WUHÒJTWPI )QNF GOCKNNKGTV  I OKP MCWO UKEJVDCTG %JKRU 4GRCTCVWTGP WPF *CCTTKUUG KP FGT   YGK­GP'OCKNNGHTCP\ÌUKUEJG)QNFRWP\GUGKV #FNGTMQRH CWHFGT4ÒEMUGKVGFGT$CPFGPFGPFGU .QTDGGTWPF'KEJGPMTCP\GUWPFCWHFGO5RTWPITKPIOKVNCPIGOCNVGP$CPFCDUEJPKVV$9-<-  ++



-CKUGTNKEJGT1TFGPFGT'JTGPNGIKQP=1TFTGKOR¾TKCNFGNC.¾IKQPF JQPGWT?  /QFGNN

OKV2QTVTCKV-CKUGT0CRQN¾QPU+PCEJTGEJVUCWHFGO#XGTUWPFFGOMCKUGTNKEJGP#FNGT OKV-QRHPCEJTGEJVUCWHFGO45/GFCKNNQPFKG&GMQTCVKQPÒDGTJÌJVXQPGKPGTJGTCNFKUEJGPPCRQNGQPK UEJGP-CKUGTMTQPGOKV#FNGTP 4GFWMVKQP ZOO GKPGT1HHK\KGTUFGMQTCVKQP5KNDGTXGTIQNFGV

PWTPQEJUEJYCEJGTJCNVGP FKG/GFCKNNQPU)QNFGOCKNNKGTVOGJTGTG'OCKNNGUEJ·FGPWPFTGRCTCVWTGP CWHFGP$CPFGPFGPFGU.QTDGGT'KEJGPNCWDMTCP\GUHTCP\ÌUKUEJG)CTCPVKGRWP\GHÒT5KNDGT 'DGTMQRH  UGKVCOUR·VGTGP$CPFOKVCWHIGNGIVGT4QUGVVG$9-XCT<-XCT +++



-CKUGTNKEJGT1TFGPFGT'JTGPNGIKQP=1TFTGKOR¾TKCNFGNC.¾IKQPF JQPGWT?  /QFGNN

OKV2QTVTCKV-CKUGT0CRQN¾QPU+PCEJTGEJVUCWHFGO85WPFFGOMCKUGTNKEJGP#FNGTOKV -QRH PCEJ TGEJVU QFGT NKPMU CWH FGO 45/GFCKNNQP FKG &GMQTCVKQP ÒDGTJÌJV XQP GKPGT JGTCNFKUEJGP   PCRQNGQPKUEJGP-CKUGTMTQPGOKV#FNGTP 4KVVGTFGMQTCVKQPPQTOCNGUQIGPCPPVG1TFQPPCP\#WUHÒJTWPI OKV TKPIHÌTOKIGT #WHJ·PIWPI KPPGTJCND FGT -TQPG 5KNDGT FKG /GFCKNNQPU )QNF GOCKNNKGTV PCJG\W   WPUKEJVDCTG 'OCKNNGTGRCTCVWT KP GKPGT -TGW\CTOURKV\G CWH FGP $CPFGPFGP FGU .QTDGGT'KEJGP   NCWDMTCP\GUHTCP\ÌUKUEJG)CTCPVKGRWP\GHÒT5KNDGT 'DGTMQRHUGKV COGVYCUUR·VGTGPLGFQEJ CNVGP$CPF ++



-CKUGTNKEJGT1TFGPFGT'JTGPNGIKQP=1TFTGKOR¾TKCNFGNC.¾IKQPF JQPGWT?  /QFGNN

OKV2QTVTCKV-CKUGT0CRQN¾QPU+PCEJTGEJVUCWHFGO#XGTUWPFFGOMCKUGTNKEJGP#FNGT OKV-QRHPCEJTGEJVUCWHFGO45/GFCKNNQPFKG&GMQTCVKQPÒDGTJÌJVXQPGKPGTJGTCNFKUEJGPPCRQNGQPK UEJGP-CKUGTMTQPGOKV#FNGTP 4KVVGTFGMQTCVKQP5KNDGTFKG/GFCKNNQPU)QNFGOCKNNKGTVOGJTGTGOKP 'OCKNNGCDRNCV\WPIGP CWH FGP $CPFGPFGP FGU .QTDGGT'KEJGPNCWDMTCP\GU HTCP\ÌUKUEJG )CTCPVKGRWP\G   HÒT5KNDGT 'DGTMQRHUGKV COQTKIKPCNGP$CPF&C\W/QFGNN  4KVVGTFGMQTCVKQP 5KNDGT FKG /GFCKNNQPU )QNF GOCKNNKGTV OGJTGTG OKP 'OCKNNGCDRNCV\WPIGP CWH FGP $CPFGPFGP FGU   .QTDGGT'KEJGPNCWDMTCP\GU HTCP\ÌUKUEJG )CTCPVKGRWP\G HÒT 5KNDGT 'DGTMQRH  UGKV   CO QTKIK   PCNGP$CPF5$9-<- 5VÒEM++p



(TÒJGU'ZGORNCTFGU<YGKVGP-CKUGTTGKEJU  GVYCCWUFGT<GKVFGU-TKOMTKGIGU  KPJGTXQT TCIGPFGT'TJCNVWPI



'ZGORNCTCWUFGT'PF\GKVFGU<YGKVGP-CKUGTTGKEJU

220


FRANKREICH

8513

8514

&4+66' (4#0<¤5+5%*'4'27$.+-   

0CVKQPCNGT1TFGPFGT'JTGPNGIKQP=1TFTGPCVKQPCNFGNC.¾IKQPFÅ&#x2030;JQPPGWT? UGKV /QFGNN

  OKV /CTKCPPG WPF  CWH FGO #XGTUOGFCKNNQP FGT 1TFGPUFGMQTCVKQP WPF FGU $TWUV   UVGTPU $TWUVUVGTP\WO)TQ­MTGW\WPF\WO)TQ­QHHK\KGT5KNDGTVGKNYGKUGDTKNNCPVKGTV/GFCKNNQPFTGK VGKNKICWHFGO4GXGTU*GTUVGNNGTDG\GKEJPWPIFGT(KTOC1WK\KNNG.GOQKPGKP2CTKUCP0CFGNKO0CFGN JCMGP MNGKPG )CTCPVKGRWP\G HÃ&#x2019;T GT 5KNDGT XQP  DKU  'DGTMQRH  OKV \YGK 5GKVGPJCMGP   $9-<- ++



#PHGTVKIWPICWUFGONGV\VGP8KGTVGNFGU,CJTJWPFGTVU



0CVKQPCNGT1TFGPFGT'JTGPNGIKQP=1TFTGPCVKQPCNFGNC.¾IKQPFÅ&#x2030;JQPPGWT? UGKV /QFGNN

  OKV /CTKCPPG WPF  CWH FGO #XGTUOGFCKNNQP FGT 1TFGPUFGMQTCVKQP WPF FGU $TWUV   UVGTPU $TWUVUVGTP\WO)TQ­MTGW\WPF\WO)TQ­QHHK\KGT5KNDGTVGKNYGKUGDTKNNCPVKGTV/GFCKNNQPFTGK VGKNKICP0CFGNKO0CFGNJCMGPMNGKPG)CTCPVKGRWP\GHÃ&#x2019;TGT5KNDGTXQPDKU 'DGTMQRH  OKV\YGK5GKVGPJCMGP$9-<- ++



#PHGTVKIWPICWUFGO\YGKVGP8KGTVGNFGU,CJTJWPFGTVU

8515





8516

0CVKQPCNGT1TFGPFGT'JTGPNGIKQP=1TFTGPCVKQPCNFGNC.¾IKQPFÅ&#x2030;JQPPGWT? UGKV /QFGNN

OKV/CTKCPPGWPFCWHFGO#XGTUOGFCKNNQPFGT1TFGPUFGMQTCVKQP -QOOCPFGWTFG MQTCVKQP PQTOCNG UQIGPCPPVG 1TFQPPCP\#WUHÃ&#x2019;JTWPI )QNF GOCKNNKGTV  I OKP MCWO UKEJVDCTG   *CCTTKUUGCWHFGO#XGTU\YGKOKP#DURNKVVGTWPIGPCWHFGO4GXGTUXQP\YGK5RKV\GPCWHFGO$CPFTKPI 2CTKUGT)QNFRWP\G #FNGTMQRHUGKV COQTKIKPCNGP*CNUDCPF$9-<- +p++++



0CVKQPCNGT1TFGPFGT'JTGPNGIKQP=1TFTGPCVKQPCNFGNC.¾IKQPFÅ&#x2030;JQPPGWT? UGKV /QFGNN

OKV/CTKCPPGWPFCWHFGO#XGTUOGFCKNNQPFGT1TFGPUFGMQTCVKQP 1HHK\KGTUFGMQTC VKQPPQTOCNGUQIGPCPPVG1TFQPPCP\#WUHÃ&#x2019;JTWPI)QNFGOCKNNKGTVI OKV$CPF CWHFGP$CPFGP FGPFGU.QTDGGT'KEJGPNCWDMTCP\GU2CTKUGT)QNFRWP\G #FNGTMQRHUGKV COCNVGP1TKIKPCNDCPF OKV CWHIGNGIVGT 4QUGVVG KO UEJYCT\GP IQNFGP DGFTWEMVGP 8GTNGKJWPIUGVWK FGT (KTOC .GOQKPG (KNU KP   2CTKU$9-<- +p++

 221


FRANKREICH

8517

8520 8518







8521

8519

0CVKQPCNGT1TFGPFGT'JTGPNGIKQP=1TFTGPCVKQPCNFGNC.¾IKQPFʼnJQPPGWT? UGKV /QFGNN

OKV/CTKCPPGWPFCWHFGO#XGTUOGFCKNNQPFGT1TFGPUFGMQTCVKQP 1HHK\KGTUFGMQTC VKQP PQTOCNG UQIGPCPPVG 1TFQPPCP\#WUHÒJTWPI )QNF GOCKNNKGTV  I CWH FGP $CPFGPFGP FGU   .QTDGGT'KEJGPNCWDMTCP\GU 2CTKUGT )QNFRWP\G #FNGTMQRH  UGKV   CO CNVGP 1TKIKPCNDCPF QJPG   4QUGVVGKOFWPMGNTQVGP8GTNGKJWPIUGVWK$9-<- ++



0CVKQPCNGT1TFGPFGT'JTGPNGIKQP=1TFTGPCVKQPCNFGNC.¾IKQPFʼnJQPPGWT? UGKV /QFGNN

OKV/CTKCPPGWPFCWHFGO#XGTUOGFCKNNQPFGT1TFGPUFGMQTCVKQP 1HHK\KGTUFGMQTC VKQP PQTOCNG UQIGPCPPVG 1TFQPPCP\#WUHÒJTWPI 5KNDGTXGTIQNFGV/GFCKNNQPU)QNFGOCKNNKGTVCWH FGP$CPFGPFGPFGU.QTDGGT'KEJGPNCWDMTCP\GU)CTCPVKGRWP\GHÒT5KNDGT 'DGTMQRHUGKV CO 1TKIKPCNDCPF OKV CWHIGNGIVGT 4QUGVVG KO DTCWPGP IQNFDGFTWEMVGP 8GTNGKJWPIUGVWK FGT (KTOC #TVJWU   $GTVTCPFKP2CTKU$9-<- +p++



0CVKQPCNGT1TFGPFGT'JTGPNGIKQP=1TFTGPCVKQPCNFGNC.¾IKQPFʼnJQPPGWT? UGKV /QFGNN

OKV/CTKCPPGWPFCWHFGO#XGTUOGFCKNNQPFGT1TFGPUFGMQTCVKQP 1HHK\KGTUFGMQTC VKQPUQIGP)TQ­G.WZWUCWUHÒJTWPI=ITCPFG¾FKVKQPFGNWZG?OKVFTGKFKOGPUKQPCNCWUIGHÒJTVGP.QT DGGT WPF 'KEJGPMTCP\ KP FGT ªDGTJÌJWPI 5KNDGT XGTIQNFGV /GFCKNNQPU FTGKVGKNKI  ¯ LQWT  )QNF   GOCKNNKGTV CWH FGO #XGTU FGT -TCP\UEJNGKHGPGPFGP HTCP\ÌUKUEJG 2WP\G HÒT GT 5KNDGT UGKV   

'DGTMQRH COCNVGP1TKIKPCNDCPFOKVCWHIGNGIVGT4QUGVVGKOQTKIKPCNGPTQVDTCWPGP8GTNGKJWPIUGVWK FGT(KTOC(C[QNG2QWVGCWKP2CTKU$9-XCT<-XCT ++



$GK FGT UQIGPCPPVGP )TQ­GP .WZWUCWUHÒJTWPI KUV FGT .QTDGGT WPF 'KEJGPDN·VVGTMTCP\ FGT ªDGTJÌJWPI FWTEJ   #WHNÌVGPUGRCTCVGT$N·VVGTFTGKFKOGPUKQPCNCWUIGHÒJTV



0CVKQPCNGT1TFGPFGT'JTGPNGIKQP=1TFTGPCVKQPCNFGNC.¾IKQPFʼnJQPPGWT? UGKV /QFGNN

OKV/CTKCPPGWPFCWHFGO#XGTUOGFCKNNQPFGT1TFGPUFGMQTCVKQP 4KVVGTFGMQTCVKQP PQTOCNGUQIGPCPPVG1TFQPPCP\#WUHÒJTWPI5KNDGT/GFCKNNQPU)QNFGOCKNNKGTVCOCNVGP1TKIKPCNDCPF KODTCWPTQVGPIQNFGPDGFTWEMVGP8GTNGKJWPIUGVWK$9-<- +



+PUGNVGPGT2TCEJVGTJCNVWPI



0CVKQPCNGT1TFGPFGT'JTGPNGIKQP=1TFTGPCVKQPCNFGNC.¾IKQPFʼnJQPPGWT? UGKV /QFGNN

OKV/CTKCPPGWPFCWHFGO#XGTUOGFCKNNQPFGT1TFGPUFGMQTCVKQP 4KVVGTFGMQTCVKQP PQTOCNG UQIGPCPPVG1TFQPPCP\#WUHÒJTWPI5KNDGT/GFCKNNQPU)QNFGOCKNNKGTVCWHFGO#XGTUFGT -TCP\UEJNGKHGPGPFGPHTCP\ÌUKUEJG2WP\GHÒTGT5KNDGTUGKV 'DGTMQRH COCNVGP1TKIKPCNDCPF OKV6TCIGTCJG$9-<- p++



'ZGORNCTCWUFGT<GKVFGU'TUVGP9GNVMTKGIU



222

0CVKQPCNGT1TFGPFGT'JTGPNGIKQP=1TFTGPCVKQPCNFGNC.¾IKQPFʼnJQPPGWT? UGKV /QFGNN

OKV/CTKCPPGWPFCWHFGO#XGTUOGFCKNNQPFGT1TFGPUFGMQTCVKQP 4KVVGTFGMQTCVKQP PQTOCNG UQIGPCPPVG 1TFQPPCP\#WUHÒJTWPI 5KNDGT /GFCKNNQPU )QNF GOCKNNKGTV #DRNCV\WPI KP FGT   DNCWGP'OCKNNGFGUCXGTUUGKVKIGP/GFCKNNQPTKPIUCWHFGT4GXGTUUGKVGFGT-TCP\UEJNGKHGPGPFGPHTCP\ÌUKUEJG 2WP\GHÒTGT5KNDGTUGKV 'DGTMQRH COCNVGP1TKIKPCNDCPF$9-<- ++p+++




FRANKREICH

8523





8524

8525

0CVKQPCNGT1TFGPFGT'JTGPNGIKQP=1TFTGPCVKQPCNFGNC.¾IKQPFʼnJQPPGWT? UGKV /QFGNN

OKV/CTKCPPGWPFCWHFGO#XGTUOGFCKNNQPFGT1TFGPUFGMQTCVKQP 4KVVGTFGMQTCVKQP PQTOCNGUQIGPCPPVG1TFQPPCP\#WUHÒJTWPI5KNDGT/GFCKNNQPU)QNFGOCKNNKGTV'OCKNNGEJKRKPGKPGT 5RKV\G FGU 4GXGTU FGU QDGTGP #TOGU CWH FGT #XGTUUGKVG FGT -TCP\UEJNGKHGPGPFGP HTCP\ÌUKUEJG 2WP\G   HÒTGT5KNDGTUGKV 'DGTMQRH COCNVGP1TKIKPCNDCPFOKVUEJYGFKUEJGT6TCIGURCPIG$9- <- +p++++p+++



0CVKQPCNGT1TFGPFGT'JTGPNGIKQP=1TFTGPCVKQPCNFGNC.¾IKQPFʼnJQPPGWT? UGKV /QFGNN

OKV/CTKCPPGWPFCWHFGO#XGTUOGFCKNNQPFGT1TFGPUFGMQTCVKQP 4KVVGTFGMQTCVKQP ,WYGNKGT#WUHÒJTWPI¯HKNGVU #TOGOKV4CPFXGTVKGHWPI OKV&KCOCPVGP5KNDGT/GFCKNNQPU FTGKVGKNKI ¯ LQWT  )QNF GOCKNNKGTV CWH FGO 4GXGTU FGT -TCP\UEJNGKHGPGPFGPHTCP\ÌUKUEJG2WP\GHÒTGT5KNDGT UGKV 'DGTMQRH FKG-ÒIGNEJGPFGT5RKV\GPWPFFGT$CPFTKPIDGUGV\V¯LQWTOKV&KCOCPVTQUGP

CWH 'EJVJGKV IGRTÒHV  CO CNVGP 1TKIKPCNDCPF KO FWPMGNTQVGP IQNFGP DGFTWEMVGP 8GTNGKJWPIUGVWK FGT   (KTOC#TVJWU$GTVTCPFKP2CTKU$9-XCT<-XCT +p



0CVKQPCNGT1TFGPFGT'JTGPNGIKQP=1TFTGPCVKQPCNFGNC.¾IKQPFʼnJQPPGWT? UGKV /QFGNN

OKV/CTKCPPGWPFCWHFGO#XGTUOGFCKNNQPFGT1TFGPUFGMQTCVKQP 4KVVGTFGMQTCVKQP UQIGPCPPVG )TQ­G .WZWUCWUHÒJTWPI =ITCPFG ¾FKVKQP FG NWZG? OKV FTGKFKOGPUKQPCN CWUIGHÒJTVGP .QT   DGGTWPF'KEJGPMT·P\GP5KNDGT/GFCKNNQPU FTGKVGKNKI¯LQWT )QNFGOCKNNKGTVCWHFGO#XGTUFGT -TCP\UEJNGKHGPGPFGPHTCP\ÌUKUEJG2WP\GHÒTGT5KNDGTUGKV 'DGTMQRH COCNVGP1TKIKPCNDCPF KOQTKIKPCNGPTQVDTCWPGP8GTNGKJWPIUGVWKFGT(KTOC*,QPFGVKP2CTKU$9-XCT<-XCT ++



5GNVGPGDGUQPFGTUNWZWTKÌUG#WUHÒJTWPI



8528 (1:1) 8526





8527

0CVKQPCNGT1TFGPFGT'JTGPNGIKQP=1TFTGPCVKQPCNFGNC.¾IKQPFʼnJQPPGWT? UGKV /QFGNN

OKV/CTKCPPGWPFCWHFGO#XGTUOGFCKNNQPFGT1TFGPUFGMQTCVKQP 4KVVGTFGMQTCVKQP UQIGPCPPVG )TQ­G .WZWUCWUHÒJTWPI =ITCPFG ¾FKVKQP FG NWZG? OKV FTGKFKOGPUKQPCN CWUIGHÒJTVGP .QT   DGGTWPF'KEJGPMT·P\GP5KNDGT/GFCKNNQPU FTGKVGKNKI¯LQWT )QNFGOCKNNKGTVGKPKIG#DRNCV\WPIGP KPFGTITÒPGP'OCKNNGCOCNVGP1TKIKPCNDCPF$9-XCT<-XCT ++



0CVKQPCNGT1TFGPFGT'JTGPNGIKQP=1TFTGPCVKQPCNFGNC.¾IKQPFʼnJQPPGWT? UGKV /QFGNN

OKV/CTKCPPGWPFCWHFGO#XGTUOGFCKNNQPFGT1TFGPUFGMQTCVKQP 4GFWMVKQPFGT 4KVVGTFGMQTCVKQP UQIGPCPPVG )TQ­G .WZWUCWUHÒJTWPI =ITCPFG ¾FKVKQP FG NWZG? OKV FTGKFKOGPUKQPCN   CWUIGHÒJTVGP.QTDGGTWPF'KEJGPMTCP\FGTªDGTJÌJWPI5KNDGT/GFCKNNQPU FTGKVGKNKI¯LQWT )QNF GOCKNNKGTVCOCNVGP1TKIKPCNDCPF$9-XCT<-XCT ++



0CVKQPCNGT1TFGPFGT'JTGPNGIKQP=1TFTGPCVKQPCNFGNC.¾IKQPFʼnJQPPGWT? UGKV /QFGNN

  OKV /CTKCPPG WPF  CWH FGO #XGTUOGFCKNNQP FGT 1TFGPUFGMQTCVKQP  /KPKCVWT FGT   4KVVGTFGMQTCVKQP OKV 5VGKPGP 5KNDGT /GFCKNNQPU )QNF GOCKNNKGTV FGT $CPFTKPI DGUGV\V OKV FTGK &KC   OCPVTQUGP CWH'EJVJGKVIGRTÒHV CO$·PFEJGPKO1TKIKPCNGVWK ++



4GFWMVKQPGPFKGUGU/QFGNNUUKPFPKEJVCNN\WJ·WHKI\WHKPFGP



223


FRANKREICH 

0CVKQPCNGT1TFGPFGT'JTGPNGIKQP=1TFTGPCVKQPCNFGNC.¾IKQPFʼnJQPPGWT? UGKV /QFGNN

OKV/CTKCPPGWPFCWHFGO#XGTUOGFCKNNQPFGT1TFGPUFGMQTCVKQP  GKPGGKPUGKVKI CWUIGHÒJTVG4KVVGTFGMQTCVKQP$TQP\GXGTUKNDGTVVGKNYGKUGXGTIQNFGVWPFGOCKNNKGTV 1TFQPCP\#WUHÒJ TWPI GKPGT 4KVVGTFGMQTCVKQP 5KNDGT VGKNYGKUGXGTIQNFGVWPFGOCKNNKGTV 4GFWMVKQPGKPGT4KVVGTFGMQTC VKQP5KNDGT/GFCKNNQPU)QNFGOCKNNKGTV,GYGKNUCP$·PFGTP 5VÒEM++++p+++



8530

8531

8533



8532

#D\GKEJGP GKPGU 5GPCVQTU #WUHÒJTWPI FGT +++ 4GRWDNKM   $TQP\G XGTIQNFGV VGKNYGKUG   XGTUKNDGTVVGKNYGKUGGOCKNNKGTVOKP#WUDTÒEJGKPFGTYGK­GP'OCKNNGCOQTKIKPCNGP5EJWNVGTDCPF  4++p



8+'46' (4#0<¤5+5%*'4'27$.+-   



0CVKQPCNGT1TFGPFGT'JTGPNGIKQP=1TFTGPCVKQPCNFGNC.¾IKQPFʼnJQPPGWT? UGKV /QFGNN

  QJPG  CWH FGO #XGTUOGFCKNNQP FGT 1TFGPUFGMQTCVKQP  -QOOCPFGWTFGMQTCVKQP   -QOOCPFGWTFGMQTCVKQPPQTOCNGUQIGPCPPVG1TFQPPCP\#WUHÒJTWPI5KNDGTXGTIQNFGVWPFGOCKNNKGTV CWHFGO#XGTUFGT-TCP\UEJNGKHGPGPFGPWPFCWHFGO$CPFTKPI JKGTCWEJ*GTUVGNNGTRWP\G HTCP\ÌUKUEJG 2WP\GHÒTGT5KNDGTUGKV 'DGTMQRH OKP#WUDTÒEJGKPFGTDNCWGP'OCKNNGCWHFGO4GXGTU MCWOUKEJVDCTG*CCTTKUUGWPFMCWOUKEJVDCTG#DURNKVVGTWPIKPGKPGT5RKV\GCO*CNUDCPFCDUEJPKVVKO 1TKIKPCNGVWKFGT(KTOC#$CSWGXKNNGKP2CTKU<- ++



0CVKQPCNGT1TFGPFGT'JTGPNGIKQP=1TFTGPCVKQPCNFGNC.¾IKQPFʼnJQPPGWT? UGKV /QFGNN

  QJPG  CWH FGO #XGTUOGFCKNNQP FGT 1TFGPUFGMQTCVKQP  -QOOCPFGWTFGMQTCVKQP   ,WYGNKGTU#WUHÒJTWPI¯HKNGVU #TOGOKV4CPFXGTVKGHWPI $TQP\GXGTIQNFGVWPFGOCKNNKGTVCOQTKIKPC NGP*CNUDCPF<- ++



#WHITWPFFGTTGNCVKXMWT\GP8GTNGKJWPIU\GKVXQPPWT,CJTGPUKPFFKG+PUKIPKGPFKGUGU/QFGNNUPKEJVCNN\WJ·WHKI \WHKPFGP



0CVKQPCNGT1TFGPFGT'JTGPNGIKQP=1TFTGPCVKQPCNFGNC.¾IKQPFʼnJQPPGWT? UGKV /QFGNN

QJPGCWHFGO#XGTUOGFCKNNQPFGT1TFGPUFGMQTCVKQP 4KVVGTFGMQTCVKQPUQIGPCPPVG )TQ­G.WZWUCWUHÒJTWPI=ITCPFG¾FKVKQPFGNWZG?OKVFTGKFKOGPUKQPCNCWUIGHÒJTVGP.QTDGGTWPF'K EJGPMTCP\FGTªDGTJÌJWPI5KNDGT/GFCKNNQPU FTGKVGKNKI¯LQWT )QNFGOCKNNKGTVCWHFGO4GXGTU FGT -TCP\UEJNGKHGPGPFGP HTCP\ÌUKUEJG 2WP\G HÒT GT 5KNDGT UGKV  'DGTMQRH  FGT $CPFTKPI   DGUGV\V OKV GKPGT &KCOCPVTQUG CWH 'EJVJGKV IGRTÒHV  CO CNVGP 1TKIKPCNDCPF KO QTKIKPCNGP TQVDTCWPGP   IQNFGPDGFTWEMVGP8GTNGKJWPIUGVWK<-XCT ++ +PFKGUGO/QFGNNPKEJVJ·WHKI\WHKPFGPFCPWTTWPF,CJTGXGTNKGJGPYQTFGP

224




FRANKREICH

8534

(ª0(6' (4#0<¤5+5%*'4'27$.+- 5'+6  

0CVKQPCNGT1TFGPFGT'JTGPNGIKQP=1TFTGPCVKQPCNFGNC.¾IKQPFʼnJQPPGWT? UGKV /QFGNN

UGKV   QJPG  CWH FGO#XGTUOGFCKNNQPFGT1TFGPUFGMQTCVKQPWPFFGU$TWUVUVGTPUOKVFGO 5VKHVWPIUFCVWO(.14'#.#0:CWHFGO4GXGTUUGKVGP/GFCKNNQPFGT1TFGPUFGMQTCVKQP $TWUVUVGTP \WO)TQ­MTGW\GKPHCEJG#WUHÒJTWPIOKVGKPVGKNKIGO/GFCKNNQP5KNDGTXGTIQNFGVCP0CFGNFKGUGOKV *GTUVGNNGTRWP\GWPFHTCP\ÌUKUEJG2WP\GHÒTGT5KNDGTUGKV 'DGTMQRH OKV\YGK5GKVGPJCMGP <- ++



8536

ex 8535 8537





0CVKQPCNGT1TFGPFGT'JTGPNGIKQP=1TFTGPCVKQPCNFGNC.¾IKQPFʼnJQPPGWT? UGKV /QFGNN

UGKVOKVFGO5VKHVWPIUFCVWO(.14'#.#0:CWHFGO4GXGTUUGKVGP/GFCKNNQPFGT1TFGPUFG MQTCVKQP 'ZGORNCTG 1HHK\KGTUFGMQTCVKQP,WYGNKGTU#WUHÒJTWPI¯HKNGVU #TOGOKV4CPFXGTVKG HWPI  OKV FTGK 5VGTPGP CWH FGO #XGTU $TQP\G XGTIQNFGV WPF GOCKNNKGTV CO $CPF   1HHK\KGTUFGMQTC   VKQP,WYGNKGTU#WUHÒJTWPI¯HKNGVU #TOGOKV4CPFXGTVKGHWPI OKVGKPGO5VGTPCWHFGO#XGTU$TQP\G XGTIQNFGVWPFGOCKNNKGTVCO$CPFOKVCWHIGNGIVGT4QUGVVG<- 5VÒEM++



0CVKQPCNGT8GTFKGPUVQTFGP=1TFTGPCVKQPCNFW/¾TKVG?1HHK\KGTUFGMQTCVKQPPQTOCNGUQIGPCPPVG1T FQPPCP\#WUHÒJTWPI5KNDGTXGTIQNFGVVGKNYGKUGGOCKNNKGTVCWHFGT4ÒEMUGKVGFGU6TCIGINKGFUOGJTHCEJ RWP\KGTVCOQTKIKPCNGP$CPFOKVCWHIGNGIVGT4QUGVVG<- +p++



&GT 0CVKQPCNG 8GTFKGPUVQTFGP KUV OKV &GMTGV XQO  &G\GODGT  XQP 5VCCVURT·UKFGPV %JCTNGU FG )CWNNG CNU   HÒPHMNCUUKIGTCNNIGOGKPGT8GTFKGPUVQTFGPIGUVKHVGVYQTFGP/KV&GMTGVXQO,WPKYWTFGPFKG$TWUVUVGTPGKP KJTGT)GUVCNVWPINGKEJVXGT·PFGTV

&4+66'$+5(ª0(6' (4#0<¤5+5%*'4'27$.+- 5'+6  

.CPFYKTVUEJCHVU8GTFKGPUVQTFGP =1TFTG FG O¾TKVG CITKEQNG? -QOOCPFGWTFGMQTCVKQP #WUHÒJTWPI   OKVCWHFGO<GPVTWOUTKPIXGTIQNFGVWPFGOCKNNKGTVCO*CNUDCPFCDUEJPKVV ++





-QPXQNWV XQP XKGT 1TFGP WPF \YGK 'JTGP\GKEJGP   0CVKQPCNGT 1TFGP FGT 'JTGPNGIKQP  /QFGNN  

OKV/CTKCPPGWPFCWHFGO#XGTUOGFCKNNQP 4KVVGTFGMQTCVKQPUVCTMDGUEJ·FKIVCO $CPF 1TFGPHÒT8GTFKGPUVGWOFKG.CPFYKTVUEJCHV1HHK\KGTUFGMQTCVKQP'ZGORNCTGDGKFGDGUEJ· FKIV CP $·PFGTP OKV 4QUGVVG   1TFGP HÒT 5Q\KCNXGTFKGPUV 1HHK\KGTUFGMQTCVKQP   )QNFGPG /GFCKNNG   HÒT#WHQRHGTWPICO$CPFOKV4QUGVVG #TDGKVUOGFCKNNGFGU.CPFYKTVUEJCHVU/KPKUVGTKWOUCO$CPF 8GTUEJKGFGPG/GVCNNGKPWPVGTUEJKGFNKEJGP'TJCNVWPIGP 5VÒEM++++++8

 225


FRANKREICH

ex 8544

ex 8539



ex 8543

8546

/KNKV·T/GFCKNNG =/¾FCKNNG /KNKVCTKG? -QPXQNWV XQP  'ZGORNCTGP WPVGTUEJKGFNKEJG #WUHÒJTWPIGP   XGTUEJKGFGPG /GVCNNG WPVGTUEJKGFNKEJG 'TJCNVWPIGP LGYGKNU CO $CPF GKPG OKV (QWTTCI½TG GKPG KO   'VWK 5VÒEM++++p+++



-TKGIUMTGW\=%TQKZFG)WGTTG?WPF61'-QPXQNWVXQP5VÒEMFCTWPVGT        KP HTCP\ÌUKUEJGP WPF   COGTKMCPKUEJGP ·NVGTGP WPF PGWGTGP #PHGTVKIWPIGP $TQP\G ITÌ­VGPVGKNU CP $·PFGTP GKPGU KO 'VWK   &C\WITQ­G ZOO GKPUGKVKIGIW­GKUGTPGWPFIGUEJY·T\VG#WUHÒJTWPI YQJNHÒTGKP&GPMOCN IGFCEJV  5VÒEM++++p+++





-QPXQNWVXQP#WU\GKEJPWPIGPXQO<YGKVGP-CKUGTTGKEJDKU\WT(ÒPHVGP4GRWDNKM+PXGTUEJKG FGPGP/GVCNNGPWPFKPWPVGTUEJKGFNKEJGP'TJCNVWPIGPXQTYKGIGPFOKV$·PFGTP 5VÒEM++





-QPXQNWVXQPUKGDGPXGTUEJKGFGPGP#WU\GKEJPWPIGP&CTWPVGTCWEJFGU'TUVGPWPF<YGKVGP9GNVMTKG IGU WCGKPGKPQHHK\KGNNG#WUICDGFGT+PVGTCNNKKGTVGP5KGIGUOGFCKNNG XGTUEJKGFGPG/GVCNNG CWEJ 5KNDGT GKPGGOCKNNKGTVKPWPVGTUEJKGFNKEJGP'TJCNVWPIGPLGYGKNUCP$·PFGTP 5VÒEM++++p



/KPKCVWTGPUEJPCNNGOKVUKGDGPHTCP\ÌUKUEJGP#WU\GKEJPWPIU/KPKCVWTGP /KNKV·TOGFCKNNG/QFGNN PCEJ  QJPG     -TKGIUMTGW\    -·ORHGT-TGW\   9GNVMTKGIU'TKPPGTWPIUOG   FCKNNG    +PVGTCNNKKGTVG 5KGIGUOGFCKNNG    8GTYWPFGVGPOGFCKNNG   8GTFWP/GFCKNNG   OKV $CPFURCPIG 8'4&70 <WUCOOGP OKV FTGK )TCPCVURNKVVGTP WPF MCNNKITCRJKUEJ IGHGTVKIVGP $G   UEJTGKDWPIU\GVVGNP OKV FGP #WHUEJTKHVGP $NGUU¾ NG  5GRVGODTG =8GTYWPFGV CO  5GRVGODGT   ?5GRVGODTG1EVQDTGWPF1EVQDTGKO2T·UGPVCVKQPUTCJOGP 5VÒEM+







<WO  ,CJTGUVCI FGU 9CHHGPUVKNNUVCPFU XQP  CO 0QXGODGTYWTFGCPCNNGPQEJNGDGPFGP8GVGTCPGP FGU'TUVGP9GNVMTKGIGUCWUFGO7PVGTQHHK\KGTUWPF5QNFCVGPUVCPFFKGFKG/KNKV·TOGFCKNNGPQEJPKEJVDGUC­GPFKGUG OKVDGUQPFGTGO'TNC­FGUHTCP\ÌUKUEJGP5VCCVURT·UKFGPVGP)GPGTCN%JCTNGUFG)CWNG  XGTNKGJGP&KGUGU GKPGO4GNKSWKGPUEJTGKP·JPNKEJG5EJCWM·UVEJGPFÒTHVGCWUFKGUGO#PNC­GPVUVCPFGPUGKP



-QPXQNWV XQP  'KPJGKVUCD\GKEJGP =+PUKIPGU? /GKUV ·NVGTG $TQP\G ITÌ­VGPVGKNU GOCKNNKGTV VGKNU OKV   *GTUVGNNGTDG\GKEJPWPIGPKPÒDGTYKGIGPFQTFGPVNKEJGT'TJCNVWPI 5VÒEM++





-QPXQNWV XQP HÒPH (QWTTCI½TGU 'KPG KP TQV (CTDG FGT 'JTGPNGIKQP  GKPG KP ITÒPTQV (CTDG FGU   -TKGIUMTGW\GU WPFFTGKKPIGNDITÒP (CTDGFGT/KNKV·T/GFCKNNG  5VÒEM++





-1.10+#.'14&'0

1TFGPFGU5EJYCT\GP5VGTPUXQP$¾PKP=1TFTGFGN —VQKNG0QKTFW$¾PKP?/QFGNN COJGNNDNCWGP $CPF    -QOOCPFGWTMTGW\ 5KNDGT XGTIQNFGV VGKNYGKUG GOCKNNKGTV CWH FGO $CPFTKPI WPNG   UGTNKEJG *GTUVGNNGTRWP\G WPF HTCP\ 2WP\G HÒT GT 5KNDGT XQP  DKU  'DGTMQRH  CO   QTKIKPCNGP*CNUDCPF$9- +p++ 0CEJFGOFCUYGUVCHTKMCPKUEJG-ÌPKITGKEJ2QTVQ0QXQ KOJGWVKIGP$¾PKPIGNGIGP GKPHTCP\ÌUKUEJGU2TQVGMVQ TCVIGYQTFGPYCTUVKHVGVG-ÌPKI6QHHCXQP2QTVQ0QXQCO&G\GODGTFGPHÒPHMNCUUKIGP )TQ­MTGW\-QO OCPFGWT OKV 5VGTP -QOOCPFGWT 1HHK\KGT 4KVVGT  CNNIGOGKPGP 8GTFKGPUVQTFGP FGT XQP FGT HTCP\ÌUKUEJGP 4GIKG   TWPI \WP·EJUV PKEJV CPGTMCPPV YWTFG 5GKPG +PUKIPKGP YWTFGP CP GKPGO JGNNDNCWGP $CPF OKV TQVGP 4CPFUVTGKHGP   IGVTCIGP /QFGNN 0CEJGKPGT5VCVWVGP·PFGTWPIXQO#WIWUVFKGWCFKGJGNNDNCWG$CPFHCTDGHGUVNGIVG

/QFGNN YWTFGFGT1TFGPXQPFGTHTCP\ÌUKUEJGP4GIKGTWPICPGTMCPPV/KV&GMTGVGPXQOWPF/CK ÒDGTVTWI FGT HTCP\ÌUKUEJG 5VCCVURT·UKFGPV (GNKZ (CWTG   FKG 8GTYCNVWPI FGU 1TFGPU CP FKG )TQ­MCP\NGK   FGT'JTGPNGIKQPKP2CTKUYQFWTEJGTGKPHTCP\ÌUKUEJGT-QNQPKCNQTFGPYWTFG9GKVGTG(GUVNGIWPIGPGTHQNIVGPFWTEJ GKPRT·UKFKCNGU&GMTGVXQO,CPWCT/KV&GMTGVXQP2T·UKFGPV%JCTNGUFG)CWNNG  XQO&G \GODGTYWTFGFGT1TFGPYKGCNNG-QNQPKCNQTFGPCWHIGJQDGP

226




FRANKREICH

8549

8547



8548

8550

-ÌPKINKEJGT DKU   1TFGP XQP -CODQFUEJC =1TFTG 4Q[CN  FW %CODQFIG?  /QFGNN     #WUHÒJTWPI   OKV -TQPG MÌPKINKEJG 8GTNGKJWPIGP CO TQVGP $CPF OKV ITÒPGP 5GKVGPUVTGK   HGP &GMQTCVKQP-NCUUGHTCP\ÌUKUEJG#PHGTVKIWPI5KNDGTDTKNNCPVKGTVTGRGTEKGTVWPFXGTIQNFGV/G FCKNNQP)QNFGOCKNNKGTVCWHFGO4GXGTUHTCP\ÌUKUEJG*GTUVGNNGTWPF5KNDGTRWP\GCOQTKIKPCNGPGVYCU CWUIGDNGKEJVGP$CPFOKVCWHIGNGIVGT4QUGVVG82'5 ++



-ÌPKINKEJGT DKU   1TFGP XQP -CODQFUEJC =1TFTG 4Q[CN  FW %CODQFIG?  /QFGNN     #WUHÒJTWPI   OKV -TQPG MÌPKINKEJG 8GTNGKJWPIGP CO TQVGP $CPF OKV ITÒPGP 5GKVGPUVTGK   HGP  &GMQTCVKQP  -NCUUG HTCP\ÌUKUEJG #PHGTVKIWPI 5KNDGT DTKNNCPVKGTV VGKNYGKUG XGTIQNFGV WPF VGKN   YGKUGGOCKNNKGTVCWHFGO4GXGTUHTCP\ÌUKUEJG*GTUVGNNGTWPF5KNDGTRWP\GCOQTKIKPCNGP$CPF82' 5 ++



0CEJFGOFCU-ÌPKITGKEJGKPHTCP\ÌUKUEJGU2TQVGMVQTCVIGYQTFGPYCTUVKHVGVG-ÌPKI0QTQFQO+   CO  (GDTWCT  FGP HÒPHMNCUUKIGP )TQ­MTGW\ )TQ­QHHK\KGT -QOOCPFGWT 1HHK\KGT WPF 4KVVGT  CNNIGOGKPG   8GTFKGPUVQTFGPFGUUGP5VCVWVGPCO,CPWCTXGTÌHHGPVNKEJVYWTFGP /QFGNN <WGKPGOWPDGMCPPVGPUR·VG TGP <GKVRWPMV XQT   YWTFGP FKG 1TFGPUFGMQTCVKQPGP XQP GKPGT YGUVNKEJ IGUVCNVGVGP -TQPG ÒDGTJÌJV  /Q   FGNN /KV&GMTGVXQOWPF/CKÒDGTVTWIFGTHTCP\ÌUKUEJG5VCCVURT·UKFGPV(GNKZ(CWTG  FKG 8GTYCNVWPI FGU 1TFGPU PWPOGJT QJPG FKG $G\GKEJPWPI TQ[CN CP FKG )TQ­MCP\NGK FGT 'JTGPNGIKQP KP 2CTKU YQ   FWTEJGTGKPHTCP\ÌUKUEJGT-QNQPKCNQTFGPYWTFG9GKVGTG(GUVNGIWPIGPGTHQNIVGPFWTEJGKPRT·UKFKCNGU&GMTGVXQO ,CPWCT/KV&GMTGVXQO&G\GODGTYWTFGHÒTFKGFWTEJFGPHTCP\ÌUKUEJGP5VCCVURT·UKFGPVGPCWUIG URTQEJGPGP 8GTNGKJWPIGP GKP PGWGU 1TFGPUDCPF YGK­ OKV QTCPIGPGP 5GKVGPUVTGKHGP  GKPIGHÒJTV FCU CNU   ōOGVTQRQNKVCPGUŋ $CPFDG\GKEJPGVYWTFG /QFGNN  ōOGVTQRQNKVCPGŋ#WUHÒJTWPI &KGFWTEJFGP-ÌPKIXQP -CODQFUEJC CWUIGURTQEJGPGP 8GTNGKJWPIGP YWTFGP YGKVGTJKP CO DKUJGTKIGP TQVGP $CPFOKVITÒPGP5GKVGPUVTGKHGP XGTNKGJGP/QFGNN  ōMÌPKINKEJGŋ#WUHÒJTWPI   /KV&GMTGVXQO#WIWUVYWTFGWPVGT-ÌPKI0QTQFQO5KJCPQWM IGD FKG8GTYCNVWPIYKGFGTPCEJ -CODQFUEJC \WTÒEMÒDGTVTCIGP FGT 1TFGP UQOKV YKGFGT GKP TGKP MCODQFUEJCPKUEJGT 1TFGP &KG 4GIKGTWPI FGU   &GOQMTCVKUEJGP -CODQFUEJC JCV FGP 1TFGP  CDIGUEJCHHV +P (QNIG FGT 4ÒEMMGJT 0QTQFQO 5KJCPQWMU PCEJ   -CODQFUEJC CNU -ÌPKI YWTFG FGT 1TFGP OKV MÌPKINKEJGO &GMTGV 0T  XQO  1MVQDGT  YKGFGT   GTTKEJVGVYQDGKFKG+PUKIPKGPPWPOGJTXQPFGTMCODQFUEJCPKUEJGP-ÌPKIUMTQPGÒDGTJÌJVUKPF /QFGNN 



*#.$70&+01((+<+'..'#75<'+%*070)0'0 

1TFGP FGT *QPKIDKGPG =1TFTG FG NC /QWEJG ¯ /KGN? -NGKPQF FGU 1TFGPU KP /GFCKNNGPHQTO     #WUHÒJTWPI  5KNDGT&WTEJOGUUGTOO#XGTUOKV7OUEJTKHV.$#4&5%&2&.1&. /#/ 4GXGTU HNKGIGPFG $KGPG OKV 7OUEJTKHV 2+%%1.# 5+/# (# 274 )4#8+ .' ('4+6'    COPGWGP$CPF 44++  &KG 7OUEJTKHV FGT 8QTFGTUGKVG UVGJV HÒT .QWKUG $#4QPPG &G 5EGCWZ &KEVCVTKEG 2GTRGVWGNNG &G . 1TFTG &G .C   /QWEJG # /KGN =.QWKUG $CTQPKPXQP5EGCWZNGDGPUN·PINKEJG)GDKGVGTGPFGU1TFGPUFGT*QPKIDKGPG?WPFCWHFGT 4ÒEMUGKVGUVGJV2KEEQNCUKOCHCRWTITCXKNGHGTKVG=<YCTMNGKPUQOCEJVUKGFGPPQEJUEJNKOOG8GTNGV\WPIGP?  7O FKG CO *QHG -ÌPKI .WFYKIU :+8   UQ YKEJVKI IGYQTFGP 4KVVGTQTFGP XQO *N )GKUV XQO JN   /KEJCGNWPFXQOJN.WFYKI\WRCTQFKGTGPUVKHVGVG#PPG.QWKUG$¾P¾FKEVGFG$QWTDQP  *GT\QIKPXQP /CKPG WPF $CTQPKP XQP 5EGCWZ KO ,CJT  KP 5EGCWZ CDUGKVU FGU *QHGU XQP 8GTUCKNNGU  FKGUG CNU 1TFGP   DG\GKEJPGVG 8GTGKPKIWPI +JT IGJÌTVGP  /KVINKGFGT CP YQTWPVGT UKEJ UR·VGT W C CWEJ 8QNVCKTG     DGHCPF1TFGPMNGKPQFYCTGKPG/GFCKNNG·JPNKEJFGTJKGTCPIGDQVGPGPCNNGTFKPIUKP)QNFCPIGHGTVKIVWPFCPGKPGO JQPKIIGNDGP$CPFIGVTCIGP<W1TFGPUHGKGTPVTWIGPFKG/KVINKGFGTCWEJDGUQFGTG1TFGPUWPKHQTOGP/KVFGO6QF FGT*GT\QIKPXQP/CKPGUEJGKPVFGT1TFGPGTNQUEJGP\WUGKP<WT<YGKJWPFGTVLCJTHGKGTFGT5VKHVWPIYWTFGGT  CWH +PKVKCVKXG XQP / &WXCN6T¾RKGF PGW IGITÒPFGV YQHÒT -NGKPQFG PGW PWPOGJT KP 5KNDGT WPF $TQP\GCNU 0CEJRT·IWPIGPFGUWTURTÒPINKEJGP-NGKPQFUKP)QNFJGTIGUVGNNVYWTFGP XIN$KGFGPHGNF(GTFKPCPF(TGKJGTTXQP )GUEJKEJVG WPF 8GTHCUUWPI CNNGT IGKUVNKEJGP WPF YGNVNKEJGP GTNQUEJGPGP WPF DNÒJGPFGP4KVVGTQTFGP'TUVGT$CPF 'TNQUEJGPG1TFGP9GKOCT5HH7PF+EJGU.WEKGP1TFTGFGNCOQWEJG¯OKGN2CTKU 



'JTGPMTGW\ FGT )GUGNNUEJCHV FGT (TCP\ÌUKUEJ$TKVKUEJGP (TGWPFUEJCHV =%TQKZ F JQPPGWTU FG N #U   UQEKCVKQP #OKECN (TCPEQ$TKVCPPKSWG?  /QFGNN QJPG ,CJTGU\CJNGP   -NGKPQF FGT    -NCUUG )TQ­MTGW\ HÒT CW­GTQTFGPVNKEJG 8GTFKGPUVG  $TQP\G XGTIQNFGV WPF GOCKNNKGTV CO QTKIKPCNGP   5EJWNVGTDCPF\WUCOOGPOKV/KPKCVWTXGTIQNFGVWPFGOCKNNKGTVCO$·PFEJGPOKVCWHIGNGIVGT)QNFNKV\G WPF4QUGVVG5450T ++ &CU'JTGP\GKEJGPYWTFGHÒT8GTFKGPUVGWOFKG(TCP\ÌUKUEJ$TKVKUEJG8GTUV·PFKIWPIIGUVKHVGVWPFYKTFDKUKP FKG)GIGPYCTVXGTNKGJGP



227


FRANKREICH

8552

8551 8553







'JTGPMTGW\ FGT )GUGNNUEJCHV FGT (TCP\ÌUKUEJ$TKVKUEJGP (TGWPFUEJCHV =%TQKZ F JQPPGWTU FG N #U   UQEKCVKQP #OKECN (TCPEQ$TKVCPPKSWG?  /QFGNN OKV   $TWUVUVGTP \WT  -NCUUG  

)TQ­MTGW\ HÒT CW­GTQTFGPVNKEJG 8GTFKGPUVG  $TQP\G XGTUKNDGTV #WHNCIGP XGTIQNFGV WPF GOCKNNKGTV CP   3WGTPCFGN5450T ++



'JTGPMTGW\ FGT )GUGNNUEJCHV FGT (TCP\ÌUKUEJ$TKVKUEJGP (TGWPFUEJCHV =%TQKZ F JQPPGWTU FG N #U   UQEKCVKQP #OKECN (TCPEQ$TKVCPPKSWG?  /QFGNN OKV ,CJTGU\CJNGP   -TGW\  -NCUUG  

4KVVGTMTGW\HÒT<KXKNKUVGP $TQP\GXGTIQNFGVWPFGOCKNNKGTVCO1TKIKPCNDCPF5450T ++



1TFGP XQO 5VGTP FGU )WVGP WPF FGU 8GTFKGPUVGU =1TFTG FG . ¾VQKNG FW DKGP GV FW /¾TKVG? 1HHK   \KGTUFGMQTCVKQP$TQP\GXGTIQNFGVWPFGOCKNNKGTVCO$CPFOKV4QUGVVG ++



8554 8555



1TFGP HÒT 8GTFKGPUVG WO FKG 5Q\KCNG #WHQRHGTWPI =1TFTG FW &GXQWGOGPV 5QEKCN? 4KVVGTMTGW\   $TQP\GXGTIQNFGVWPFGOCKNNKGTVMCWOUKEJVDCTG#DURNKVVGTWPIGPKPFGTDNCWGP'OCKNNG ++





1TFGP&GT8GTFKGPUV=1TFTG.G/¾TKVG?4KVVGTFGMQTCVKQP$TQP\GXGTIQNFGVWPFGOCKNNKGTVCO$CPF ++



74-70&'0 

228

-ÌPKINKEJGT 1TFGP FGT 'JTGPNGIKQP =1TFTG TQ[CN FG NC .¾IKQP F JQPPGWT?    /QFGNN  

OKVFGO2QTVTCKV-ÌPKI*GKPTKEJU+8CWHFGO#XGTUWPFFTGK.KNKGPCWHFGO4GXGTUOG FCKNNQP FKG &GMQTCVKQP ÒDGTJÌJV XQP GKPGT .KNKGPMTQPG  8GTNGKJWPIUWTMWPFG \WT 4KVVGTFGMQTCVKQP HÒT   .QWKU/CTKG,QUGRJ%QOVG=)TCH?FG-GTQWCTV\FCVKGTV6WKNGTKGPCO&G\GODGTOKV2CRKGTRT· IGUKGIGN WPF GVYCU XGTYKUEJVGT OÌINKEJGTYGKUG 1TKIKPCN 7PVGTUEJTKHV -ÌPKI .WFYKIU :8+++ WPF FGU   )TQ­MCP\NGTU/CEFQPCNF/CTUEJCNNXQP(TCPMTGKEJ2GTICOGPVXKGTOCNIGHCNVGV ++




FRANKREICH

8557











-CKUGTNKEJGT1TFGPFGT'JTGPNGIKQP=1TFTGKOR¾TKCNFGNC.¾IKQPF JQPGWT?  /QFGNN

OKV2QTVTCKV-CKUGT0CRQN¾QPU+PCEJTGEJVUCWHFGO#XGTUWPFFGOMCKUGTNKEJGP#FNGT OKV-QRHPCEJTGEJVUCWHFGO45/GFCKNNQPFKG&GMQTCVKQPÒDGTJÌJVXQPGKPGTJGTCNFKUEJGPPCRQNGQPK UEJGP -CKUGTMTQPG OKV #FNGTP  8GTNGKJWPIUWTMWPFG \WT 4KVVGTFGMQTCVKQP HÒT FGP #T\V ,QUGRJ 2TQURGT   ;XCTGP FCVKGTV 6WKNGTKGP CO  1MVQDGT  OKV 2T·IGUKGIGN WPF GVYCU XGTYKUEJVGT 1TKIKPCN!    7PVGTUEJTKHV -CKUGT 0CRQN¾QPU +++ WPF FGU )TQ­MCP\NGTU *GT\QI XQP /CNCMQHH /CTUEJCNN XQP (TCPM   TGKEJ2GTICOGPV\YGKOCNIGHCNVGVOKVFGOQTKIKPCNGP8GTUCPFEQWXGTV ++



0CVKQPCNGT1TFGPFGT'JTGPNGIKQP=1TFTGPCVKQPCNFGNC.¾IKQPFʼnJQPPGWT?/QFGNN  OKV /CTKCPPG WPF  CWH FGO #XGTUOGFCKNNQP FGT 1TFGPUFGMQTCVKQP  8GTNGKJWPIUWTMWPFG \WT   -QOOCPFGWTFGMQTCVKQPHÒTFGP1DGTUV2CWN.QWKU,WNGU(NGWTKQVFG.CPINGFCVKGTV2CTKUCO(GDTWCT  OKV 2T·IGUKGIGN WPF XGTYKUEJVGT OÌINKEJGTYGKUG 1TKIKPCN 7PVGTUEJTKHV FGU 5VCCVURT·UKFGPVGP   ,WNGU)T¾X[WPFFGU)TQ­MCP\NGTU)GPGTCN(CKUJGTDG2GTICOGPVRCRKGTXKGTOCNIGHCNVGV ++



0CVKQPCNGT 1TFGP FGT 'JTGPNGIKQP =1TFTG PCVKQPCN FG NC .¾IKQP FʼnJQPPGWT? -QPXQNWV XQP FTGK   8GTNGKJWPIUWTMWPFGP\WT4KVVGTFGMQTCVKQP /QFGNN OKV/CTKCPPGWPFCWHFGO #XGTUOGFCKNNQP FGT 1TFGPUFGMQTCVKQP  8GTNGKJWPIUWTMWPFG HÒT FGP F·PKUEJGP .GWVPCPV \WT 5GG %JTK   UVKCP5EJGNNGTFCVKGTV2CTKUCO,CPWCTOKV2T·IGUKGIGNWPF1TKIKPCNWPVGTUEJTKHVFGU)TQ­MCP\ NGTU )GPGTCN (CKUJGTDG 2GTICOGPVRCRKGT FTGKOCN IGHCNVGV   &KVQ HÒT FGP 8GTYCNVWPIUJCWRVOCPP   .¾QP (TCP¼QKU /CWTKP FCVKGTV 2CTKU CO  &G\GODGT  OKV GKPGT 1TKIKPCN WPF \YGK (CMUKOKNG   7PVGTUEJTKHVGP 2CRKGT IGTQNNV KP FGT GVYCU DGUEJ·FKIVGP QTKIKPCNGP 8GTUCPFTQNNG    /QFGNN UGKV     QJPG  CWH FGO #XGTUOGFCKNNQP FGT 1TFGPUFGMQTCVKQP WPF FGU $TWUVUVGTPU OKV FGO 5VKH   VWPIUFCVWO  (.14'#. #0 : CWH FGO 4GXGTUUGKVGP/GFCKNNQP FGT 1TFGPUFGMQTCVKQP  HÒT FGP GJG   OCNKIGP #TVKNNGTKUVGP ,WNGU (GTFKPCPF 0QTOCPF FCVKGTV 2CTKU CO  ,WNK  OKV (CMUKOKNG7PVGT   UEJTKHVGPFGU5VCCVRT·UKFGPVGPFG)CWNNGWPFFGU)TQ­MCP\NGT)GPGTCN%CVTQWZ2CRKGTGVYCUXGTHNGEMV IGTQNNV8GTNGKJWPICWU#PNC­FGU,CJTGUVCIUFGU$GIKPPUFGU'TUVGP9GNVMTKGIU 5VÒEM++



/KNKV·T/GFCKNNG =/¾FCKNNG /KNKVCKTG? -QPXQNWV XQP UGEJU 8GTNGKJWPIUWTMWPFGP    /QFGNN OKV   FGO2QTVTCKV0CRQN¾QPU+++ HÒTGKPGP*GTTP/CWDCP2GTICOGPV'KPVTCIWPIGPITÌ­ VGPVGKNU CWUIGDNGKEJV IGTQNNV    /QFGNN OKV /CTKCPPG WPF ,CJTGU\CJN     HÒT ,GCP   &GPKU2CRQPFCVKGTVCO5GRVGODGT2GTICOGPVRCRKGT\YGKOCNIGHCNVGV &KVQHÒT*KRRQN[VG )TCPUCIPGFCVKGTVCO/·T\2GTICOGPVRCRKGT\YGKOCNIGHCNVGV &KVQHÒT/CTKGP/CVJKCU FCVKGTVCO,WNK2CRKGTIGTQNNVKPFGTQTKIKPCNGPDGUEJ·FKIVGP8GTUCPFTQNNG &KVQHÒT#PFT¾ #TOCPF8GTPGVFCVKGTVCO/CK2CRKGTIGTQNNV /QFGNN OKV/CTKCPPGQJPG,CJTGU\CJN UGKV HÒT,WNKGP,GCP$CRVKUVG5GOR¾FCVKGTVCO#WIWUV2CRKGTIGTQNNVKPFGTQTKIKPCNGP 8GTUCPFTQNNG 5VÒEM+++++



-QPXQNWVXQPHÒPH7TMWPFGPHTCP\ÌUKUEJGT2TKXCV1TFGP&CXQPXKGTHÒT&¾UKT¾)TCXGUUQYKG\YGK YGKVGTG&QMWOGPVG 5VÒEM++

 229


GRIECHENLAND

8562

)4+'%*'0.#0&

<9'+6'5 -¤0+)4'+%*   

+PVGTCNNKKGTVG5KGIGUOGFCKNNG)TKGEJKUEJG#WUICDGCOCNVGP1TKIKPCNDCPF

++



8563

&4+66'5 -¤0+)4'+%*   

)TQ­GMTCWUG1TFGPUUEJPCNNGGKPGUITKGEJKUEJGP1HHK\KGT8GVGTCPGPFGTDGKFGP$CNMCPMTKGIG OKVUKGDGP#WU\GKEJPWPIGPOKV\WIGJÌTKIGO/KPKCVWTGPMGVVEJGP 'TNÌUGTQTFGP/QFGNN

   )QNFGPGU -TGW\ 1HHK\KGTUMTGW\  #PHGTVKIWPI XQP *WIW¾PKP (T½TGU  .G   .QENG 5KNDGT XGTIQNFGV WPF GOCKNNKGTV HGKPUV 'OCKNNGOCNGTGK   -TGW\ HÒT 6CRHGTMGKV  #WUICDG  

  -TGW\-NCUUG#PHGTVKIWPIXQP)QFGV$GTNKP5KNDGTXGTIQNFGVWPFGOCKNNKGTV'OCKNNGEJKR CWH FGT 4ÒEMUGKVG   /KNKV·T8GTFKGPUVOGFCKNNG  -NCUUG #WUICDG QJPG   CWH FGO 4GXGTU    /GFCKNNGHÒTFGP)TKGEJKUEJ6ÒTMKUEJGP-TKGIOKVUGEJU)GHGEJVUURCPIGPō+Ω#00+0#ŋ ō'ΛΛ'Π1061Σŋō1Σ6Ρ1$10ŋōΓ+#0+6Σ#ŋōΣ#Ρ#06#Π1Ρ10ŋWPFō'Λ#ΣΣΩ0ŋ /G FCKNNGHÒTFGP)TKGEJKUEJ$WNICTKUEJGP-TKGIGU 2TGW­GP-ÌPKINKEJGT-TQPGP1TFGP/QFGNN

EC   -TGW\  -NCUUG )QNF CWH FGO 4CPF FGU WPVGTGP -TGW\CTOU 4KV\OCTMG 9     5GTDKGP 1TFGP XQO 9GK­GP #FNGT  /QFGNN CWH FGO 4GXGTU ,CJTGU\CJN       &GMQTCVKQP-NCUUG#PHGTVKIWPIFGT(KTOC)GQTI#FCO5EJGKF9KGP5KNDGTVGKNYGKUGXGTIQNFGVWPF GOCKNNKGTV OKP #DRNCV\WPIGP KP FGT 'OCKNNG FGT -TQPGP2GPFKNKGP #WH FGT 4ÒEMUGKVG *GTUVGNNGT   DG\GKEJPWPI FGT (KTOC , )QFGV  5QJP KP $GTNKP CP 0CFGN <WUCOOGP OKV /KPKCVWTGPMGVVEJGP OKV   /KPKCVWTGPFGT#WU\GKEJPWPIGPDKU HGJNV #P0CFGNWPF-PQRH 5VÒEM++



8564



2JÌPKZ1TFGP=ΤαγzCΑριστειαςτονΦοινικος?/QFGNN  -QOOCPFGWTMTGW\5KNDGT XGTIQNFGV WPF GOCKNNKGTV CO *CNUDCPF KO QTKIKPCNGP IQNFGP DGFTWEMVGP 8GTNGKJWPIUGVWK FGT (KTOC   4WFQNH5QWXCNKP9KGP<- ++ 8QPFKGUGO*GTUVGNNGTPKEJVJ·WHKI\WHKPFGP

230




GROSSBRITANNEN / NORDIRLAND

8565 (1:1)

8'4'+0+)6'5-¤0+)4'+%*810)4155$4+6#00+'0 70&014&+4.#0& 

&GTUGJT#WUIG\GKEJPGVG1TFGPXQOJN/KEJCGNWPFXQOJN)GQTI=6JG/QUV&KUVKPIWKUJGF1T FGT QH 5CKPV /KEJCGN CPF 5CKPV )GQTIG? $TWUVUVGTP \WO )TQ­MTGW\ -PKIJV )TCPF %TQUU    )%/)  5KNDGT DTKNNCPVKGTV VGKNYGKUG TGRGTEKGTV VGKNYGKUG )QNF RNCVVKGTV #WHNCIGP )QNF ITCXKGTV   GOCKNNKGTVMNGKPG'OCKNNGTGRCTCVWTKPGKPGO-TGW\CTO'OCKNNGOCNGTGKCPGEJVIQNFGPGT0CFGN$9- <- ++p  NVGTGVGKNYGKUG)QNFRNCVKGTVG#WUHÒJTWPICWUFGONGV\VGP&TKVVGNFG,CJTJWPFGTVU  &KG$GNGKJWPIOKVFKGUGT-NCUUGHÒJTVHÒT$TKVGP WPFHTÒJGTCWEJHÒT-CPCFKGT#WUVTCNKGT0GWUGGN·PFGTGVE FKG 8GTNGKJWPIFGURGTUÌPNKEJGP#FGNUOKVUKEJWPFFCOKVFWTEJFKG#WHPCJOGKPFKG4KVVGTUEJCHVCWEJFCU4GEJVFKG #PTGFG5KTQFGT&COG\WHÒJTGP)GUVKHVGVCO#RTKNXQO2TKP\TGIGPVGP)GQTI FGOUR·VGTGP-ÌPKI)GQTI +8 KO0COGPUGKPGU8CVGTU-ÌPKI)GQTI+++\WT#WU\GKEJPWPIXQP$ÒTIGTPFGTUGKV\W)TQ­DTKVCPPKGP IGJÌTGPFGP +QPKUEJGP +PUGNP WPF /CNVCU 5EJQP  YWTFG FKG 8GTNGKJWPI FGU 1TFGPU CWH FCU ICP\G 'ORKTG   CWUIGYGKVGV (TCWGP YGTFGP GTUV UGKV  KP FGP 1TFGP CWHIGPQOOGP *GWVG YKTF FGT 1TFGP XQT CNNGO CP   &KRNQOCVGP WPF $GCOVG KO CWUY·TVKIGP &KGPUV UQYKG CP 2GTUQPGP FKG YGTVXQNNG &KGPUVG KP FGP %QOOQPYGCNVJ  .·PFGTP IGNGKUVGV JCDGP XGTNKGJGP <W FGP )TQ­MTGW\KPUKIPKGP IGJÌTGP CWEJ GKP 1TFGPUOCPVGN WPF GKP *WV XIN   CWEJ)CNNQYC[2GVGT6JG1TFGTQH5V/KEJCGNCPF5V)GQTIG.QPFQP 

8566



&GTUGJT#WUIG\GKEJPGVG1TFGPXQOJN/KEJCGNWPFXQOJN)GQTI=6JG/QUV&KUVKPIWKUJGF1T FGT QH 5CKPV /KEJCGN CPF 5CKPV )GQTIG? 5GV GKPGU -QOOCPFGWT4KVVGTU -PKIJV %QOOCPFGT    -%/) DGUVGJGPFCWU*CNUFGMQTCVKQP5KNDGTXGTIQNFGV/GFCKNNQP)QNFGOCKNNKGTVHGKPUVG'OCKN NGOCNGTGK GKPKIG MCWO UKEJVDCTG %JKRU KP FGP /GFCKNNQPU CO UR·VGTGP *CNUDCPFCDUEJPKVV WPF $TWUV   UVGTP 5KNDGT DTKNNCPVKGTV WPF TGRGTEKGTV #WHNCIGP )QNF VGKNYGKUG HGKPUV ITCXKGTV GOCKNNKGTV HGKPUVG   'OCKNNGOCNGTGKCPGEJVIQNFGPGT0CFGN$9-/;<- 5VÒEM++  231


GROSSBRITANNEN / NORDIRLAND

8567



8569 8568

&GT -ÌPKINKEJG 8KMVQTKC1TFGP =6JG 4Q[CN 8KEVQTKCP 1TFGT? -QOOCPFGWTMTGW\ %QOOCPFGT    %81  5KNDGT XGTIQNFGV WPF GOCKNNKGTV CWH FGT 4ÒEMUGKVG OKV /CVTKMGNPWOOGT ō%ŋ QJPG *CNU   DCPF$9-<- ++





&GT -ÌPKINKEJG 8KMVQTKC1TFGP =6JG 4Q[CN 8KEVQTKCP 1TFGT? -TGW\ FGT 'JTGPOKVINKGFGT  -NCUUG   =*QPQTCT[/GODGTVJENCUU/81VJENJQP?5KNDGTXGTIQNFGVWPFGOCKNNKGTVCWHFGT4ÒEMUGKVG /CVTKMGNPWOOGT  CO $QIGPDCPF \WUCOOGP OKV -PQRHNQEJTQUGVVG QJPG $GHGUVKIWPIUMPQRH KO   QTKIKPCNGPFWPMGNDTCWPGPIQNFGPDGFTWEMVGP8GTNGKJWPIUGVWKFGT(KTOC%QNNKPIYQQF%QKP.QPFQP $9-/;<- ++





&CU)TQ­RTKQTCVFGU5GJT'JTYÒTFKIGP1TFGPUXQO*QURKVCNFGUJN,QJCPPGUXQP,GTWUCNGO=6JG )TCPF2TKQT[QHVJG/QUV8GPGTCDNG1TFGTQHVJG*QURKVCNQH5V,QJPQH,GTWUCNGO? UGKV  /QFGNN QJPG-TQPGUGKV $TWUVMTGW\FGT4GEJVUTKVVGT#WUHÒJTWPI UGKV &WTEJOGUUGT OO$TQP\GXGTIQNFGVWPFGOCKNNKGTVCP0CFGN 4++



-ÌPKIKP8KMVQTKCUVKHVGVGFGPHÒPHMNCUUKIGP1TFGP )TQ­MTGW\4KVVGT-QOOCPFGWT4KVVGT-QOOCPFGWT/KVINKGFGT WPF-NCUUGUR·VGT.GWVPCPVWPF/KVINKGF OKVCHHKNKKGTVGT\YGKUR·VGTFTGKUVWHKIGT )QNF5KNDGTWPF$TQP\G  /GFCKNNGCO#RTKN\WT$GNQJPWPIKJTRGTUÌPNKEJIGNGKUVGVGT&KGPUVG&GT1TFGPKUVUQOKVCNU*CWUQTFGP\W DGVTCEJVGPFGTCNNGKPGFGO5QWXGT·P\WT8GTHÒIWPIUVGJV QJPGFKG$GVGKNKIWPIFGT4GIKGTWPIQFGTFGU2CTNCOGPVU  &KG 8GTNGKJWPIGP YGTFGP PKEJV CWH FGT CNNIGOGKPGP ō*QPQT .KUVŋ FGT 4GIKGTWPI UQPFGTP CWH GKPGT UGRCTCVGP   ō3WGGPʼnU*QPQT.KUVŋXGTÌHHGPVNKEJV

#PHGTVKIWPICWUFGONGV\VGP&TKVVGNFGU,CJTJWPFGTVU+O,CJTGYWTFGFWTEJFCU)GPGTCNMCRKVGNDGUEJNQU UGPFKG+PUKIPKGPFGU1TFGPUMÒPHVKIPKEJVOGJTCWU5KNDGTJGTUVGNNGP\WNCUUGP

8571

8570

8572



/KNKV·T/GFCKNNG =/KNKVCT[ /GFCN?  #WUICDG )GQTI 8 QJPG -TQPG    5KNDGT OKV   4CPFKPUEJTKHV  (.65)6 * / 56'2*'0510 4#( 4CPFFGNNGP CO GVYCU XGTH·TDVGP   $CPF$9-/; ++p



9CVGTNQQ/GFCKNNG=9CVGTNQQ/GFCN?5KNDGTOKVPWTVGKNYGKUGNGUGTNKEJGT4CPFKPUEJTKHV'05+)0 (4'&&'4100'TF.+0'$#66UGJTUVCTMIGVTCIGP¤UGCNVGTI·P\VQJPG$CPFTKPIWPFQJPG $CPF <WUCOOGP OKV 4GMQPUVTWMVKQPU7PVGTNCIGP 6JG 9CVGTNQQ /GFCN 4QNN DG\ÒINKEJ FGT 4CPF   KPUEJTKHV$9-/; +++p+8





-TKO/GFCKNNG =%TKOGC /GFCN?  5KNDGT QJPG 4CPFPCOGP UQ CP HTCP\ÌUKUEJG -TKGIUVGKNPGJOGT   XGTNKGJGP COQTKIKPCNGP$CPFOKV$CPFURCPIG5'$#56121.WPFHTCP\ÌUKUEJGT6TCIGTCJG$9- /;$ ++





-TKO/GFCKNNG =%TKOGC /GFCN?  5KNDGT QJPG 4CPFPCOGP UQ CP HTCP\ÌUKUEJG -TKGIUVGKNPGJOGT   XGTNKGJGP QJPG$CPF$9-/;$ ++p





-TKO/GFCKNNG =%TKOGC /GFCN?  5KNDGT QJPG 4CPFPCOGP UQ CP HTCP\ÌUKUEJG -TKGIUVGKNPGJOGT   XGTNKGJGP QJPG$CPF$9-/;$ ++





232


GROSSBRITANNEN / NORDIRLAND

Rv.



8575

Rv.

8576

8577

)TWRRGXQP\YGK(GNF\WIOGFCKNNGPFGU2TKXCVG)GQTIG9JKVG$GUVGJGPFCWU +PFKUEJG#WHUVCPFU /GFCKNNG =+PFKCP /WVKP[ /GFCN?  5KNDGT OKV 4CPFKPUEJTKHV )'1G 9*+6' */ VJ *+)*   .#0&'45FKGUGGVYCU\GTMTCV\VOKV)GHGEJVUURCPIG.7%-019OKVUR·VGTGO$CPF +PFKUEJG #NNIGOGKPG(GNF\WIU/GFCKNNG=+PFKC)GPGTCN5GTXKEG/GFCN?5KNDGTOKV4CPFKPUEJTKHV2VG )'14)' 9*+6' VJ (116 OKV )GHGEJVUURCPIG 0146*9'56 (4106+'4 OKV UR·VGTGO   $CPF$9-/; 5VÒEM++p+++



.CWV *C[YCTF $KTEJ WPF $KUJQR KP $/ 5   GTJKGNVGP  /CPP FGU  *KIJNCPF4GIKOGPVU FKG +PFKUEJG   #WHUVCPFU/GFCKNNG OKV FGT )GHGEJVUURCPIG .7%-019 HÒT KJTG 6GKNPCJOG CP FGP 1RGTCVKQPGP DGK .WEMPQY   \YKUEJGPFGO0QXGODGTWPF/·T\.CWVFGPINGKEJGP#WVQTGP KP$/5 JCDGPPWT/CPPFGU  4GIKOGPVU \W (W­ FKG )GHGEJVUURCPIG 0146*9'56 (4106+'4 \WT +PFKUEJGP #NNIGOGKPGP (GNF\WIU/G   FCKNNGHÒTKJTG6GKNPCJOGCPGKPGT'ZRGFKVKQPIGIGP5WNVCP/WJCOOGF-JCPDGK5JCDMCFCTXQO&G\GODGT WPF,CPWCTGTJCNVGP





+PFKUEJG #NNIGOGKPG (GNF\WIUOGFCKNNG =+PFKC )GPGTCN 5GTXKE /GFCN?  5KNDGT GKPG 4CPFMGTDG   OKV4CPFKPUEJTKHV5'2*+&#;#6$#-*5*270,#$4OKV)GHGEJVUURCPIG0146* 9'56(4106+'4COMWT\GP$CPF$9-/; ++



'JTGP\GKEJGP FGT -ÌPKINKEJGP /CTKPGTGUGTXG =4Q[CN 0CXCN 4GUGTXG &GEQTCVKQP?  /QFGNN OKV   /QPQITCOO)4+-ÌPKI)GQTIU8+ 5KNDGTVGKNYGKUGXGTIQNFGV 8GTIQNFWPIGVYCUXGT DNC­V CWHFGT4ÒEMUGKVGITCXKGTVCO$CPF6[RU CD KOQTKIKPCNGP8GTNGKJWPIUGVWKFGT -ÌPKINKEJGP/ÒP\GKP.QPFQP$9-/; ++



8580 8578

8579



6GTTKVQTKCNG /GFCKNNG HÒT 6ÒEJVKIMGKV =6GTTKVQTKCN'HHKEKGP[/GFCN?  5KNDGTOKV4CPFKP UEJTKHV%2.*()1&9+0%.17%4CO$CPF$9-/;$ ++p+++





+PQHHK\KGNNG 'TKPPGTWPIUOGFCKNNG \WO &KCOCPVGP 6JTQPLWDKN·WO -ÌPKIKP 8KMVQTKCU  &WTEJ   OGUUGTOO5KNDGTCOGVYCU\GTUEJNKUUGPGP$CPFOKV6TCIGURCPIG ++





-TÌPWPIUOGFCKNNG =%QTQPCVKQP /GFCN?  5KNDGT CO GVYCU \GTUEJNKUUGPGP $CPF $9-    /; ++

 233


GROSSBRITANNEN / NORDIRLAND

8581



8582

7PDGMCPPVG /GFCKNNG  Z  OO $TQP\G XGTIQNFGV 4GXGTUUGKVG NGGT CO OKP \GTUEJNKUUGPGP   $CPFOKV0CFGN 4++



&KG)GUVCNVWPIFGT/GFCKNNGDCUKGTVCWHFGOUQIGPCPPVGP.GUUGT)GQTIGFGO5EJWNVGTDCPF-NGKPQFFGU*QUGPDCP FQTFGPUOKVGKPGT6WFQT4QUGCNUªDGTJÌJWPI



/KPKCVWTGPUEJPCNNG OKV  #WU\GKEJPWPIU/KPKCVWTGP   1TFGP FGU $TKVKUEJGP 'ORKTG  /QFGNN  

 1HHK\KGTUMTGW\5KNDGTXGTIQNFGVCO/KNKV·TD·PFEJGP 5VGTPOKV$CPFURCPIGVJ #7)PF 018    -TKGIUOGFCKNNG  5KNDGT   +PVGTCNNKKGTVG 5KGIGUOGFCKNNG    OKV 'KEJGPNCWDURCPIG   +PFKUEJG #NNIGOGKPG 'KPUCV\OGFCKNNG   #WUICDG )GQTI 8 OKV   -#+5#4+*+0& OKV\YGK$CPFURCPIGP9#<+4+56#0WPF9#<+4+56#0   5VGTP   #HTKMC5VGTP   -TKGIUOGFCKNNG  ,WDKN·WOUOGFCKNNG5KNDGT  -TÌPWPIUOGFCKNNG#P0CFGN 5VÒEM++



*ÒDUEJG/KPKCVWTGPUEJPCNNGGKPGU1HHK\KGTUYQJNFGTDTKVKUEJKPFKUEJGP#TOGGWPF8GVGTCPGPDGKFGT9GNVMTKGIG

ex 8583

8585 ex 8584









234

8586

-QPXQNWV XQPFTGK/KPKCVWTGPUEJPCNNGPOKVKPUIGUCOVCEJV#WU\GKEJPWPIUOKPKCVWTGP C 1TFGP HÒT CWUIG\GKEJPGVGP &KGPUV =&KUVKPIWKUJGF 5GTXKEG 1TFGT? #WUHÒJTWPI OKV /QPQITCOO -ÌPKI )GQTI   8 5KNDGT XGTIQNFGV WPF GOCKNNKGTV D  5VGTP OKV $CPFURCPIG VJ #7)  PF 018    E  $TKVKUEJG -TKGIUOGFCKNNG  5KNDGT F  +PVGTCNNKKGTVG 5KGIGUOGFCKNNG  OKV 'KEJGP\YGKI   $CPFURCPIG   C  1TFGP XQP 5V ,QJP 1HHK\KGTUMTGW\ 5KNDGT GOCKNNKGTV D  4GIKGTWPIULWDKN·WOU/G   FCKNNG5KNDGT C 8GTVGKFKIWPIUOGFCKNNG5KNDGTD -TKGIUOGFCKNNG5KNDGT ,GYGKNUCP0CFGN 5VÒEM++



-QPXQNWVXQP#WU\GKEJPWPIUOKPKCVWTGP'KPG/KPKCVWTGPUEJPCNNGOKVCEJV#WU\GKEJPWPIUOKPKCVW TGPGKPGOKVUKGDGP\YGKOKVFTGKWPFGKPGOKV\YGK#WU\GKEJPWPIUOKPKCVWTGPFKGUGEJUYGKVGTGPCP $·PFEJGP8GTUEJKGFGPG/GVCNNG CWEJ5KNDGT KPWPVGTUEJKGFNKEJGP'TJCNVWPIGP 5VÒEM++



(4'+/#74'4

#1&'JTGP\GKEJGPFGT2GEMJCO4[G.QFIG$T5KNDGTXGTIQNFGVWPFVGKNYGKUGGOCKNNKGTVCWH FGO4GXGTUITCXKGTVG9KFOWPIUKPUEJTKHV#1&24'5'06'&612#)(729#4&$; 6*'$41U1(.1&)'(14*+58#.7#$.'5'48+%'5#50#/#;CP $CPFTCJGOKV$CPFWPF#WHNCIGCP6TCIGURCPIG ++



,WDKN·WOUDKLQW \WO )QNFGPGP 6JTQPLWDKN·WO -ÌPKIKP 8KEVQTKCU  5KNDGT VGKNYGKUG XGTIQNFGV   VGKNYGKUGGOCKNNKGTVCO\GTUEJNKUUGPGP$CPFOKV\YGK$CPFURCPIGPVJ,70'WPF ++




INTERNATIONALE / GESELLSCHAFTSORDEN

8588 8587 (1:2)

+06'40#6+10#.'70&)'5'..5%*#(6514&'0 

1TFGP %QTFQP $NGW FW 5CKPV 'URTKV =$NCWGU $CPF XQO JN )GKUV? -QNNCPG FGT 'JTGPOKVINKGFGT   XGTUKNDGTV CWHIGP·JV CWH 5COVWPVGTNCIG OKV -NGKPQFXGTUKNDGTVWPFGOCKNNKGTVCWHFGT4ÒEMUGKVG*GT UVGNNGTDG\GKEJPWPIFGT(KTOC4GVVGPOCKGTKP5EJY·DKUEJ)OÒPF ++



.CWV#PICDGPFGU8QTGKIGPVÒOGTUCWUFGO$GUKV\FGUGJGOCNKIGP0#61)GPGTCN5GMTGV·TU&T/CPHTGF9ÌTPGT &T/CPHTGF*GTOCPP9ÌTPGT KP5VWVVICTV$CF%CPPUVCVVKP$TÒUUGN /KVINKGFFGT %&7  /KVINKGF FGU &GWVUEJGP $WPFGUVCIGU \WNGV\V FKTGMV IGY·JNVGT #DIGQTFPGVGT FGU 9CJNMTGKUGU   )ÌRRKPIGP  UVGNNXGTVTGVGPFGT 8QTUKV\GPFGT FGT %&7%57 $WPFGUVCIUHTCMVKQP  8QTUKV\GPFGT   FGU8GTVGKFKIWPIUCWUUEJWUUGUFGU&GWVUEJGP$WPFGUVCIGU  'TPGPPWPI\WO$WPFGUOKPKUVGTFGT8GTVGK FKIWPIKO-CDKPGVV-QJN  'KPHÒJTWPIKPFCU#OVFGU)GPGTCNUGMTGV·TUFGU0QTFCVNCPVKUEJGP8GTVGKFK IWPIUDÒPFPKUUGU0#61 0CVQ)GPGTCNUGMTGV·TWPFDKUJGTGKP\KIGT&GWVUEJGTKPFKGUGO#OV &GT$WPFGUOKPK UVGT FGT 8GTVGKFKIWPI XGTNGKJV UGKV  L·JTNKEJ FKG /CPHTGF9ÌTPGT/GFCKNNG CP 2GTUÌPNKEJMGKVGP FKG UKEJ KP   DGUQPFGTGT9GKUGWO(TKGFGPWPF(TGKJGKVKP'WTQRCXGTFKGPVIGOCEJVJCDGP



-QPITGICVKQP FGT 4KVVGT XQO JN /CTVKP GU *GKNKIGP #DGPFN·PFKUEJGP 4GKEJGU #DGPFN·PFKUEJGU   8GTFKGPUV\GKEJGP-NCUUG/QFGNNXGTIQNFGVWPFVGKNYGKUGGOCKNNKGTVCOQTKIKPCNGP*CNUDCPFKO 1TKIKPCNGVWKFGT(KTOC4QVJGKP9KGP ++



&KG-QPITGICVKQPYWTFGCO0QXGODGTXQP&T(TKGFTKEJ2GTMQ X)TGKHHGPDÒJN KP9KGPCNUKPVGTPCVKQ PCNGT 4KVVGTQTFGP \WT 'TPGWGTWPIWPF8GTDTGKVWPIFGTCDGPFN·PFKUEJGP4GKEJUVTCFKVKQPIGITÒPFGVWPFIGPKG­VGKPG IGYKUUGÌHHGPVNKEJG#PGTMGPPWPIKOJGWVKIGP¤UVGTTGKEJ



-QPXQNWVXQPFTGK8GTNGKJWPIUWTMWPFGPXQP)GUGNNUEJCHVUQTFGP

++



8590 (1:1)

+4.#0& 

)QNFOGFCKNNG(#+6*%*#4+6;*12'/KV9CRRGPXQP+TNCPFWPF0GWUGGNCPF&WTEJOGUUGT OO)QNFVGKNYGKUGGOCKNNKGTVICWHFGO4GXGTURWP\KGTVHÒTGT)QNF ++

 235


ISLAND

8592

8591

-¤0+)4'+%*  

+5.#0&



-ÌPKINKEJ DKU   +UN·PFKUEJGT (CNMGPQTFGP =+UNGP\MC (±NMCQTFC?  /QFGNN   OKV   -ÌPKIMTQPG UR·VGTG#PHGTVKIWPI CWUFGPGT,CJTGP FGU-TGW\GUFGT)TQ­TKVVGT -QOOCPFGWTG  5KNDGTXGTIQNFGVWPFGOCKNNKGTVKO$CPFTKPIRWP\KGTV%12;CO*CNUDCPFCDUEJPKVV ++





-ÌPKINKEJ DKU   +UN·PFKUEJGT (CNMGPQTFGP =+UNGP\MC (±NMCQTFC?  /QFGNN UGKV   QJPG   -ÌPKIUMTQPG  )TQ­MTGW\UCV\ DGUVGJGPF CWU -NGKPQF 5KNDGT XGTIQNFGV WPF GOCKNNKGTV DT·WPNKEJG   'OCKNNGHNGEMGP CWH #XGTU WPF 4GXGTU CO QTKIKPCNGP 5EJWNVGTDCPF WPF $TWUVUVGTP 5KNDGT VGKNYGKUG   DTKNNCPVKGTVVGKNYGKUGXGTIQNFGVWPFGOCKNNKGTVCWHFGT4ÒEMUGKVG*GTUVGNNGTRWP\G-#FGT(KTOC-LCTVCP ŠUOWPFUUQP KP 4G[MLCXÃM WPF 55KNDGTRWP\G CP &QRRGNPCFGN \WUCOOGP OKV -PQRHNQEJTQUGVVG KO   QTKIKPCNGPDNCWGPGVYCUXGTHNGEMVGP8GTNGKJWPIUGVWKXQPŠUOWPFUUQP<- 5VÒEM++



8GTNKGJGPCP)GPGTCN4KEECTFQ$KUQIPKGTQ IGD XQPDKU%JGHFGUKVCNKGPKUEJGP)GPGTCNUVCDGUFGT 8GTVGKFKIWPI  #O  ,WNK  JCV -ÌPKI %JTKUVKCP : XQP &·PGOCTM WPF +UNCPF FGP FTGKMNCUUKIGP CNNIGOGKPGP 8GTFKGPUVQTFGP   IGUVKHVGVYQDGKFKG-NCUUGKP\YGK5VWHGPWPVGTVGKNVYCT0CEJFGOFCU.CPFUGKPGXÌNNKIG7PCDJ·PIKIMGKV GTNCPIV WPF UKEJ \WT 4GRWDNKM GTMN·TV JCVVG GTJKGNV FGT 1TFGP CO  ,WNK FGU INGKEJGP ,CJTGU PGWG 5VCVWVGP &KG   8GTNGKJWPI FGU 1TFGPU GTHQNIV PQTOCNGTYGKUG CWH 8QTUEJNCI GKPGU HÒPHMÌRHKIGP 1TFGPUTCVGU FKG +PKVKCVKXG MCPP   LGFQEJCWEJXQO2T·UKFGPVGPD\YFGT2T·UKFGPVKPCWUIGJGP+PFKGUGTJÌEJUVGP-NCUUGFGU1TFGPUUGJTUGNVGPFC HÒT CNNG +PUKIPKGP FGU 1TFGPU GKPG UVTGPI IGJCPFJCDVG 4ÒEMICDGRHNKEJ DGUVGJV XIN ,QTIGPUGP 2GVGT , &GP   +UNCPFUMG(CNMGQTFGPQIFG+UNCPFUMG/GFCNLGT-QRGPJCIGP7PF6JQTNCEKWU$KTIKT›UNGPUM*GKFWTUOGTMK *±UMÉNCÐVI±HCP 7PF-NKGVOCPP-WTV)+UNCPF+UN·PFKUEJGT(CNMGPQTFGP+P1TFGPU.GZKMQP$CPF $GTNKPQ, 

8593



236

-ÌPKINKEJ DKU   +UN·PFKUEJGT (CNMGPQTFGP =+UNGP\MC (±NMCQTFC?  /QFGNN UGKV   QJPG   -ÌPKIUMTQPG -TGW\FGT)TQ­TKVVGT -QOOCPFGWTG 5KNDGTXGTIQNFGVWPFGOCKNNKGTVCO*CNUDCPF/KV 8GTNGKJWPIUWTMWPFG HÒT &T 5XGP 9KNUQP FCVKGTV 4G[MLCXÃM CO  ,WNK  OKV 2CRKGTUKGIGN WPF   1TKIKPCNWPVGTUEJTKHV FGU KUN·PFKUEJGP 5VCCVURT·UKFGPVGP XQP  DKU   -TKUVL±P 'NFL±TP     GVYCUXGTHNGEMVUQYKGHÒPHYGKVGTGP7PVGTUEJTKHVGP\WUCOOGPOKVFGP1TFGPUUVCVWVGPKPGPINK UEJGT5RTCEJGKP&QMWOGPVGPOCRRGCWU-CTVQP<- ++




ITALIEN

8595 8594

+6#.+'0 *'4<1)67//1&'0# $+5  

/GFCKNNG HÒT FKG VTGW IGDNKGDGPGP /KNKV·TCPIGJÌTKIGP WPF $GCOVGP $TQP\G OGJTGTG 4CPFFGNNGP   QJPG$CPF*&+ ++



&KG/GFCKNNGYWTFGXQP*GT\QI(TCPEGUEQ8  KPUGKPGO9KGPGT'ZKNIGUVKHVGVWPFCPFKGOQFGPG UKUEJGP /KNKV·TCPIGJÌTKIGP WPF $GCOVGP XGTNKGJGP FKG KJO DKU \WT 8GTGKPKIWPI FGU *GT\QIVWOU OKV FGO -ÌPKI   TGKEJ+VCNKGPFKG6TGWGIGJCNVGPJCVVGP



/GFCKNNG HÒT FKG VTGW IGDNKGDGPGP /KNKV·TCPIGJÌTKIGP WPF $GCOVGP $TQP\G OGJTGTG 4CPFFGNNGP   QJPG$CPF*&+ ++



8597

8597 8596



#NNGTJÌEJUVGT 1TFGP FGT *GKNKIUVGP 8GTMÒPFKIWPI =1TFKPG 5WRRTGOQ FGNNC 5CPVKUUKOC #PPWP   \KCVC? OGKUV CNU #PPWP\KCVGP1TFGP DG\GKEJPGV #NVGT 'KUGPIW­ GKPGU -NGKPQFU KO5VKNFGUQFGT ,CJTJWPFGTVUZOOCWHFGO4GXGTU4GUVGGKPGUCNVGP$GUEJTGKDWPIUGVKMGVVU ++



'UJCPFGNVUKEJJKGTOÌINKEJGTYGKUGWOGKPG&GMQTCVKQPHÒTGKP&GPMOCNQFGTGKP'RKVCRJ



#NNGTJÌEJUVGT 1TFGP FGT *GKNKIUVGP 8GTMÒPFKIWPI =1TFKPG 5WRRTGOQ FGNNC 5CPVKUUKOC #PPWP   \KCVC?OGKUVCNU#PPWP\KCVGP1TFGPDG\GKEJPGV1TFGPUUVCVWVGP.G.KXTGFGU5VCVWUGV1TFQPPCPEGU FW6T½U0QDNG1TFTGFGN #PPQPEKCFG6WTKP#WUICDG(QTOCVZOOKPHTCP\ÌUKUEJGT 5RTCEJG5GKVGPITÒPGT'KPDCPFOKVIQNFHCTDGPGP$QTFÒTGPWPF9CRRGP&C\W5GTOGPVRT¿V¾RCT NGUEJGXCNKGTUFGN 1TFTG5WRT¿OGFGNC6T½U5CKPVG#PPQPEKCFGCW%JCRKVTGFGN QTFTGVGPWNG/CTU +PHTCP\ÌUKUEJGT5RTCEJG5GKVGP 5VÒEM444++p+++



(TÒJG#WUICDGFGT1TFGPUUVCVWVGP

237


ITALIEN

8598



*GKNKIGT /KNKV·TKUEJGT -QPUVCPVKPKUEJGT 4KVVGTQTFGP XQO JGKNKIGP )GQTI =5CETQ /KNKVCTG 1TFKPG   %QPUVCPVKPKCPQFK5CP)KQTIKQ?(TCP\ÌUKUEJKVCNKGPKUEJG1DQGFKGP\$TWUVUVGTPFGT)TQ­MTGW\-QO OCPFGWTG WPF 4KVVGT FGT )PCFGP WPF FGT 8GTFKGPUVMNCUUG 5KNDGT VGKNYGKUG XGTIQNFGV GOCKNNKGTV KO   'VWK ++



#WEJPCEJFGT#PPGMVKQPFGU-ÌPKITGKEJU$GKFGT5K\KNKGPFWTEJFCU-ÌPKITGKEJ+VCNKGPD\YFGT#WHNÌUWPIFGT UK\KNKCPKUEJGP 'ZKNTGIKGTWPI KP 4QO  DGUVCPF WPF DGUVGJV FGT 1TFGP YGKVGT WPVGT FGO )TQ­OGKUVGTVWO FGU   1DGTJCWRVUFGT-IN(COKNKGFGT$QWTDQPGP$GKFGT5K\KNKGP7PVGTFGO5EJWV\FGT2·RUVG2KWU: TGI  $GPGFKMV:8 TGI WPF2KWU:++ TGI FGTUGNDUV1TFGPUTKVVGTYCTDGUVCPFFGT1TFGPCWEJ KO-ÌPKITGKEJ+VCNKGPYGKVGT0CEJFGO6QF)TQ­OGKUVGT2TKP\(GTFKPCPFU*GT\QIUXQP-CNCDTKGPGTM·TVGP UKEJ UQYQJN UGKP LÒPIGTGT $TWFGT2TKP\4CKPKGTK*GT\QIXQP%CUVTQCNUCWEJUGKP0GHHG2TKP\#NHQPUQ*GT\QI XQP -CNCDTKGP LGYGKNU \WO1DGTJCWRVFGT-IN(COKNKG$GKFGT5K\KNKGPWPFUQOKVLGYGKNUCWEJ\WO)TQ­OGKUVGT FGU1TFGPUYCUHCMVKUEJFGUUGP5RCNVWPIKP\YGK1DQGFKGP\GP KPFKGHTCP\ÌUKUEJKVCNKGPKUEJGWPFKPFKGURCPKUEJG  DGYKTMVG 2CRUV ,QJCPPGU ::+++ TGI   GTMN·TVG PQEJ KO INGKEJGP,CJTFKG#PURTÒEJGFGU*GT\QIUXQP %CUVTQCNUNGIKVKOWPFOKV&GMTGVXQO,WNKYWTFGGTXQOKVCNKGPKUEJGP5VCCVURT·UKFGPVGP  CNUNGIKVKOGT 1TFGP FGU -IN *CWUGU FGT $QWTDQPGP$GKFGT 5K\KNKGP WPVGT FGO )TQ­OGKUVGTVWO FGU *GT\QIU XQP %CUVTQ CPGT   MCPPV #NNGTFKPIU DGUV·VKIVGP FCU URCPKUEJG ,WUVK\OKPKUVGTKWO CO  1MVQDGT  FGT URCPKUEJG 5VCCVUTCV CO    (GDTWCTWPFUEJNKG­NKEJ-ÌPKI,WCP%CTNQU+XQP5RCPKGPCO/·T\FKG4GEJVO·­KIMGKVFGT#PURTÒEJG XQP 2TKP\ #NHQPUQ *GT\QI XQP -CNCDTKGP D\Y XQP FGUUGP 5QJP 2TKP\ &QP %CTNQU *GT\QI XQP -CNCDTKGP UGKV   +PHCPVXQP5RCPKGPCWHFCU)TQ­OGKUVGTVWO5QOKVDGUVGJGPJGWVGHCMVKUEJ\YGK-QPUVCPVKPKUEJG5V)GQTIU 1TFGPFGTGKPGFKG1DQGFKGP\FGU*GT\QIUXQP-CNCDTKGPOKVNGV\VGP5VCVWVGPXQO0QXGODGTWPFFGT CPFGTG 1DQGFKGP\ FGU *GT\QIU XQP %CUVTQ OKV NGV\VGP 5VCVWVGP XQO  ,WPK  2TCMVKUEJGTYGKUG YGTFGP FKG   +PUKIPKGPDGKFGT1DQGFKGP\GPJGWVGXQPGKPGTWPFFGTUGNDGP/CPWHCMVWTKP4QOJGTIGUUVGNNV 8INCWEJ8KNNCTTGCN FG#NCXC/CTSWGUFG.C/CKUQP4Q[CNGFGU&GWZ5KEKNGUN 1TFTG%QUPVCPVKPKGPFG5CKPV)GQTIGUGVN 1TFTGFG 5CKPV,CPXKGT/CFTKF)TCP/CIKUVGTQFGNN 1TFKPG+N5CETQ/KNKVCTG1TFKPG%QPUVCPVKPKCPQFK5CP)KQTIKQ 0GCRGN5GYCTF&GUOQPF+VCN[ U-PKIJVUQH5V)GQTIG6JG%QPUVCPVKPKCP1TFGT)GTTCTFU%TQUU )CNNQ 'VVQTG +N )TCP /CIKUVGTQ FGN 5CETQ /KNKVCTG 1TFKPG %QPUVCPVKPKCPQ FK 5CP )KQTIKQ 4QO   /CTKPK   &GVVKPC#NHQPUQ+N.GIKVVKOQ'UGTEK\KQFGN)TCP/CIKUVGTQFGN5CETQ/KNKVCTG1TFKPGEQPUVCPVKPKCPQFK5CP)KQT IKQ8CVKMCPUVCFV 

8599



238

*GKNKIGT /KNKV·TKUEJGT -QPUVCPVKPKUEJGT 4KVVGTQTFGP XQO JGKNKIGP )GQTI =5CETQ /KNKVCTG 1TFKPG   %QPUVCPVKPKCPQ FK 5CP )KQTIKQ? (TCP\ÌUKUEJKVCNKGPKUEJG 1DQGFKGP\  /QFGNN UGKV   5GV FGT   8GTFKGPUV-QOOCPFGWTG KVCNKGPKUEJG #PHGTVKIWPI FGT (KTOC )WEEKQPG KP 4QO KP GKPUGKVKIGT #WUHÒJ   TWPICWUFGPGT,CJTGPDGUVGJGPFCWU-QOOCPFGWTMTGW\5KNDGTXGTIQNFGVWPFGOCKNNKGTVCWHFGT 4ÒEMUGKVG 5KNDGTRWP\G  CO *CNUDCPF WPF $TWUVMTGW\ 5KNDGT XGTIQNFGV WPF GOCKNNKGTV CWH FGT   4ÒEMUGKVG5KNDGTRWP\GCP3WGTPCFGN 5VÒEM++




ITALIEN

(1:1)

(1:1)

8600

-¤0+)4'+%*   

#NNGTJÌEJUVGT 1TFGP FGT *GKNKIUVGP 8GTMÒPFKIWPI =1TFKPG 5WRRTGOQ FGNNC 5CPVKUUKOC #PPWP   \KCVC? OGKUV CNU #PPWP\KCVGP1TFGP DG\GKEJPGV 1TFGPUUGV DGUVGJGPF CWU -NGKPG -QNNCPG OKV    ITQ­GPMNGKPGPGKPGO6TCIGWPFGKPGO8GTUEJNW­INKGFFKGUGUOKV*GTUVGNNGTDG\GKEJPWPIFGT(KTOC )CTFKPQKP4QOOKV-NGKPQFLGYGKNU5KNDGTXGTIQNFGVWPF$TWUVUVGTP5KNDGTFKG\CJNTGKEJGPGKP\GNPGP #WHNCIGP5KNDGTXGTIQNFGVWPFGKP\GNPOKVFGO5VGTPMQTRWUXGTUEJTCWDVCP0CFGN<-  5VÒEM++ 

W­GTUV SWCNKV·VUXQNNG #PHGTVKIWPI FGU MÌPKINKEJGP *QHLWYGNKGTU )CTFKPQ%TCXCP\QNC FKG -QNNCPG IGCTDGKVGV OKV   IGMÌTFGNVGP8GTDKPFWPIUTKPIGPWPFOKV\YGKVGKNKIGO8GTUEJNW­INKGFFCU-NGKPQFCWUOGJTGTGP6GKNGPIGHGTVKIVFGT $TWUVUVGTPCWUÒDGTUGRCTCVJGTIGUVGNNVGP'KP\GNVGKNGPDGUVGJGPF'UFÒTHVGUKEJJKGTDGKWOGKPG#PHGTVKIWPICWU FGT 'PF\GKV FGU -ÌPKITGKEJGU \YKUEJGP  WPF  QFGT FCPCEJ JCPFGNP FC GT CWEJ PCEJ #DFCPMWPI -ÌPKI   7ODGTVQU++KPYGPKIGP(·NNGPCNU*CWUQTFGPFGTMÌPKINKEJGP(COKNKGXQP+VCNKGP*GT\ÌIGXQP5CXQ[GPXGTNKGJGP YQTFGPKUV#WHFGT4ÒEMUGKVGFGU-NGKPQFUUKPFOKP6TCIGURWTGPFWTEJ#DTKGDFGT8GTIQNFWPI\WGTMGPPGP&KG UGKV FGP GT ,CJTGP KOOGT YKGFGT KO *CPFGN CWHVCWEJGPFGP WPF UCVVUCO DGMCPPVGP (·NUEJWPIGP XQP MNGKPGT   -QNNCPGOKV-NGKPQFKP5KNDGTXGTIQNFGV GKPHCEJ\WGTMGPPGPCPFGTFÒTHVKIGP8GTCTDGKVWPIWPFFGOGKPHCEJGPCWU \YGK IGDQIGPGP *CMGP DGUVGJGPFGP 8GTUEJNW­U[UVGO  WPF $TWUVUVGTP GDGPHCNNU CP FGT GKPHCEJGP 8GTCTDGKVWPI \W   GTMGPPGP MÌPPGPKPGKPGO8GTINGKEJOKVFKGUGPJKGTCPIGDQVGPGPUGNVGPGPWPFJQEJYGTVKICPIGHGTVKIVGP1TKIKPCNKP UKIPKGPMGKPGTNGK$GUVCPFCWHYGKUGP

239


ITALIEN

8601



1TFGP FGT JGKNKIGP /CWTKVKWU WPF .C\CTWU =1TFKPG FGK 5CPVK /CWTK\KQ G .C\CTQ? )TQ­MTGW\UGV   DGUVGJGPF CWU-NGKPQF)QNFGOCKNNKGTVCOQTKIKPCNGPCNVGP5EJWNVGTDCPFWPF$TWUVUVGTP5KNDGTDTKN NCPVKGTV#WHNCIGP)QNF CWHFGO4GXGTUXGTPKGVGV GOCKNNKGTVGKPKIGYGPKIGMCWOUKEJVDCTG-TCV\GTKP FGT YGK­GP 'OCKNNG LGFQEJ MGKPGT 5RTÒPIG CWH FGO 4GXGTU *GTUVGNNGTDG\GKEJPWPI FGT (KTOC &Q   %4#8#0<1.#UWEEGUUKC(4#V$14#0+41/#CP0CFGNOKV\YGK5GKVGPJCMGP<-  5VÒEM+p++  5GJTUEJÌPGU5GVKPGKPGTUGJTSWCNKV·VUXQNNGP#PHGTVKIWPIXQO'PFGFGU,CJTJWPFGTVUQJPGFKGUQPUVÒDNKEJGP 'KPUEJT·PMWPIGPYKG'OCKNNGURTÒPIGQFGTCWUDTÒEJG  #O1MVQDGTUVKHVGV#OCFGWU8++CNUGTUVGT*GT\QIXQP5CXQ[GPFGP5V/CWTKVKWU1TFGPFGTUKEJLGFQEJ OKV FGUUGP 6QF YKGFGT CWHNÌUVG 'TUV KO ,CJTG  GPVUEJNKG­V UKEJ *GT\QI 'OOCPWGN2JKNKDGTV \W GKPGT   4GUVCWTKGTWPIFGU1TFGPUCNU*CWUQTFGP&QEJDGTGKVUKOINGKEJGP,CJTXGTGKPKIV2CRUV)TGIQT:+++OKVFGT$WNNG ō2TQ EQOOKUUCŋ XQO  0QXGODGT  FGP 1TFGP OKV FGO CNVGP 5V .C\CTWU1TFGP FGU *GKNKIGP .CPFGU   &CFWTEJYKTFFGT%JGHFGU*CWUGU5CXQ[GPCWHGYKI)TQ­OGKUVGTFGU&QRRGN1TFGPUOKVFGT-QPUGSWGP\FC­FGT FGT\GKVKIG %JGH FGU *CWUGU 8KMVQT'OOCPWGN 2TKP\ XQP 0GCRGN DKU KP FKG )GIGPYCTV FGP 1TFGP XGTNGKJV /KV   &GMTGV XQO  &G\GODGT  YCPFGNVG -ÌPKI -CTN #NDGTV XQP 5CTFKPKGP FGP 1TFGP KP GKPGP FTGKMNCUUKIGP   8GTFKGPUVQTFGPWO/KV&GMTGVXQO/·T\YKTFFKG-NCUUGFGT4GEJVUTKVVGTXQP-ÌPKI8KMVQT'OOCPWGN ++CWHIGJQDGPWPFOKV&GMTGVXQO&G\GODGTFKG-NCUUGP)TQ­QHHK\KGTWPF1HHK\KGTIGUEJCHHGP/KVFGT )TÒPFWPIFGU-ÌPKITGKEJGU+VCNKGPYWTFGFGT1TFGP\WFGUUGPJÌEJUVGO8GTFKGPUVQTFGPYCUGTDKU\WT#WHJGDWPI FGT/QPCTEJKGDNKGD#WEJPCEJFGO7PVGTICPIFGT/QPCTEJKGKP+VCNKGPDGUVCPFFGT1TFGPYGKVGTWPVGTFGO )TQ­OGKUVGTVWO-ÌPKI7ODGTVQU++WPFXQPFGUUGP5QJP2TKP\8KMVQT'OOCPWGNXQP5CXQ[GP#O,WPK GTJKGNVFGTWOGKPG#DVGKNWPIHÒT&COGPGTYGKVGTVGPWPOGJTUGEJUMNCUUKIG1TFGPPGWG5VCVWVGP XINCWEJ5RCFC #PVQPKQ1TFKPK&KPCUVKEKFGNNC4GCN%CUCFK5CXQKC$TGUEKC$CUECR¾)KCEQOQ%)NK1TFKPK%CXCNNGTGUEJK KP+VCNKC5VQTKCG&KTKVVQ/CKNCPF5HH(GTTK(CDTK\KQ1TFKPK%CXCNNGTGUEJKG&GEQTC\KQPKKP+VCNKG /QFGPC5HH.CWTGCW)¾TCTF.ʼn1TFTGFGU5CKPVU/CWTKEGGV.C\CTG7PXGTÌHHGPVNKEJVGU/CPWUMTKRV 5VTC­DWTIQJPG,CJT 

8602



1TFGP FGT JGKNKIGP /CWTKVKWU WPF .C\CTWU =1TFKPG FGK 5CPVK /CWTK\KQ G .C\CTQ? -NGKPQF \WO   )TQ­MTGW\ )QNF GOCKNNKGTV  I -TGW\EJGP ÒDGTFGT-TQPGCDIGDTQEJGPQJPG5EJWNVGTDCPF<-  ++p+++ 'ZGORNCTQJPG'OCKNNGURTÒPIGQFGTCDRNCV\WPIGP

240




ITALIEN

8603 8604



1TFGP FGT JGKNKIGP /CWTKVKWU WPF .C\CTWU =1TFKPG FGK 5CPVK /CWTK\KQ G .C\CTQ? $TWUVUVGTP \WO   )TQ­QHHK\KGT5KNDGTDTKNNCPVKGTVWPFTGRGTEKGTV#WHNCIGP)QNF CWHFGO4GXGTUXGTURNKPVGV GOCKNNKGTV \YGK FGT -TGW\MWIGNP DGUEJ·FKIV CP 0CFGN KO 0CFGNJCMGP ÌUVGTTGKEJKUEJG )CTCPVKGRWP\G HÒT GT   5KNDGT 6KIGTMQRH XQPDKUOKV\YGK5GKVGPJCMGP<- ++p++



/WVOC­NKEJÌUVGTTGKEJKUEJG#PHGTVKIWPICWUFGONGV\VGP8KGTVGNFGU,CJTJWPFGTVU



1TFGP FGT JGKNKIGP /CWTKVKWU WPF .C\CTWU =1TFKPG FGK 5CPVK /CWTK\KQ G .C\CTQ? -QOVWTMTGW\   /QFGNN OKV-TQPGUGKV )QNFGOCKNNKGTVOGJTGTGMNGKPG4GRCTCVWTGPKPFGTITÒPGP'OCKNNG COCNVGPCWHGKPGT5GKVGGVYCUDGUEJPKVVGPGP1TKIKPCNJCNUDCPF<- ++p+++

8605 8606





8607

1TFGP FGT JGKNKIGP /CWTKVKWU WPF .C\CTWU =1TFKPG FGK 5CPVK /CWTK\KQ G .C\CTQ? -QOOCPFGWT   MTGW\/QFGNN OKV-TQPGUGKV 5KNDGTXGTIQNFGVWPFGOCKNNKGTVCOQTKIKPCNGPCNVGP*CNUDCPF <- +p++



#PHGTVKIWPICWUFGT'PF\GKVFGU-ÌPKITGKEJGU\YKUEJGPWPFKPJGTXQTTCIGPFGT'TJCNVWPIQJPG'OCKNNG URTÒPIG QFGT CWUDTÒEJG 0KEJV \W XGTYGEJUGNP OKV FGP UR·VGTGP #PHGTVKIWPIGP KP 5KNDGT XGTIQNFGV FKG XQP FGT   -ÌPKINKEJGP(COKNKGFGT*GT\ÌIGXQP5CXQ[GPXGTNKGJGPYQTFGPUKPF





1TFGPFGTJGKNKIGP/CWTKVKWUWPF.C\CTWU=1TFKPGFGK5CPVK/CWTK\KQG.C\CTQ?1HHK\KGTUMTGW\ /QFGNN OKV-TQPGUGKV )QNFGOCKNNKGTVIDKUCWHGKPGMCWOUKEJVDCTG#DURNKVVGTWPIKPFGT ITÒPGP'OCKNNGFGT4ÒEMUGKVGXQNNMQOOGPKPVCMVCOMWT\GPCNVGP$CPF<- +++



1TFGPFGT-TQPGXQP+VCNKGP=1TFKPGFGNNC%QTQPCF +VCNKC?UQIGPCPPVG-NGKPFGMQTCVKQP\WO)TQ­ MTGW\ OKV -TQPG ÒDGT FGO -TGW\  ZOO)QNFGOCKNNKGTVICOPKEJVKVCNKGPKUEJGP $CPFOKVFWTEJ0CFGNDGHGUVKIVGT5EJNGKHG 44++



)GUVKHVGVXQP-ÌPKI8KMVQT'OCPWGN++  CO(GDTWCTCWU#PNC­FGT*QEJ\GKVFGU-TQPRTKP\GP *WODGTVOKV2TKP\GUUKP/CTIGTKVCXQP5CXQ[GP)GPWCCNUHÒPHMNCUUKIGTCNNIGOGKPGT8GTFKGPUVQTFGP0CEJ#DUEJCH HWPI FGT /QPCTEJKG XQO 5VCCV PKEJV OGJT XGTNKGJGP YWTFG GT LGFQEJ GTUV OKV )GUGV\ 0T  XQO  /·T\    FGO 5VKHVWPIUIGUGV\ \WO 8GTFKGPUVQTFGP FGT +VCNKGPKUEJGP 4GRWDNKM GTNCUUGP XQP 2T·UKFGPV .WKIK 'KPCWFK  

 HQTOGNNCDIGUEJCHHV#NNGTFKPIUJCVKJPFGTGZKNKGTVG-ÌPKI*WODGTV++XQP+VCNKGP  DKU\W UGKPGO6QFGHÒTKJORGTUÌPNKEJIGNGKUVGVG&KGPUVGXGTNKGJGP

241


ITALIEN

8609









8610

1TFGP FGT -TQPG XQP +VCNKGP =1TFKPG FGNNC %QTQPC F +VCNKC? $TWUVUVGTP \WO )TQ­QHHK\KGT #PHGTVK   IWPIFGU*QHLWYGNKGTU%TCXCP\QNC)CTFKPQKP4QO5KNDGTDTKNNCPVKGTV#WHNCIG)QNFGOCKNNKGTVCWHFGT 4ÒEMUGKVG *GTUVGNNGTDG\GKEJPWPI FGT (KTOC ' )CTFKPQ 5WEE %TCXCP\QNC KP4QOCP0CFGNKOQTKIK PCNGP8GTNGKJWPIUGVWKFGT(KTOC%TCXCP\QNC5WEE')CTFKPQOKVIQNFIGFTWEMVGO/QPQITCOO-ÌPKI 8KMVQT'OCPWGNU+++ TGIDKU <- ++



1TFGP FGT -TQPG XQP +VCNKGP =1TFKPG FGNNC %QTQPC F +VCNKC? -QOOCPFGWTMTGW\ DGUQPFGTU HGKPG   #WUHÒJTWPI )QNF GOCKNNKGTV  I CO QTKIKPCNGP *CNUDCPF KO QTKIKPCNGP OKV IQNFHCTDGPGO /QPQ   ITCOO 8KMVQT 'OOCPWGNU +++ TGI XQP  DKU   DGFTWEMVGP 8GTNGKJWPIUGVWK FGT (KTOC &EQ   %TCXCP\QNCKP4QO<- ++



1TFGPFGT-TQPGXQP+VCNKGP=1TFKPGFGNNC%QTQPCF +VCNKC?4KVVGTMTGW\UR·VGTGWPFNGKEJVITÌ­GTG #WUHÒJTWPI)QNFGOCKNNKGTVCO$CPFKOMNGKPGP1TKIKPCNGVWKFGU,WYGNKGTU%TCXCP\QNC5WEE')CT FKPQ KP 4QO OKV IQNFHCTDGPGO /QPQITCOO -ÌPKI 8KMVQT 'OOCPWGNU +++ TGI  DKU <-  +p++



1TFGP FGT -TQPG XQP +VCNKGP =1TFKPG FGNNC%QTQPCF +VCNKC?.GGTGU'VWK\WO4KVVGTMTGW\FGU*GT UVGNNGTU&EQ%TCXCP\QNCUWEEGUUQTG(TCVGNNK$QTCPKKP4QOOKV/QPQITCOO-ÌPKI7ODGTVQU+ TGI XQPDKU  ++



8612



8608

8613

8614

1TFGP XQO -QNQPKCNUVGTP =1TFKPG FGNNC 5VGNNC %QNQPKCNG? 1HHK\KGTUFGMQTCVKQP  #WUHÒJTWPI OKV   CWHIGNGIVGO /QPQITCOO  6[RU )QNF GOCKNNKGTV 'OCKNNGCWUDTÒEJG CWH FGT #XGTU WPF 4GXGTUUGKVG   FGTQDGTGPOKP%JKRUKO/GFCKNNQPFGO4GXGTUCO1TKIKPCNDCPF<- ++p+++



0KEJVJ·WHKIKPFKGUGTHTÒJGP#WUHÒJTWPI



1TFGP XQO -QNQPKCNUVGTP =1TFKPG FGNNC 5VGNNC %QNQPKCNG? 1HHK\KGTUFGMQTCVKQP  #WUHÒJTWPI OKV   CWHIGNGIVGO/QPQITCOO6[RU)QNFGOCKNNKGTVFKG-WIGNGKPGT-TGW\URKV\GHGJNVOKP#WUDTÒEJG KPGKPKIGP5VGTPURKV\GPCO1TKIKPCNDCPF<- +++



)GUVKHVGVXQP-ÌPKI8KMVQT'OCPWGN+++CO,CPWCTCNUHÒPHMNCUUKIGT-QNQPKCN8GTFKGPUVQTFGPYWTFGGTOKV FGO'PFGFGT/QPCTEJKGCWHIGJQDGP



242

<KXKN8GTFKGPUVQTFGPXQP5CXQ[GP=1TFKPGFK/GTKVQ%KXKNGFK5CXQKC?1TFGPUMTGW\5KNDGTXGTIQN FGV /GFCKNNQPU )QNFGOCKNNKGTVCO$CPFKOQTKIKPCNGPOKVIQNFHCTDGPGT/GVCNNMTQPGDGNGIVGP8GT NGKJWPIUGVWKFGT(KTOC%TCXCP\QNU5WEE)CTFKPQ<- 4++




ITALIEN

8615



/GFCKNNGHÒT<KXKNG6CRHGTMGKV=/GFCINKC#N8CNQTG%KXKNG?/QFGNN  #WUICDG OKV -WIGNÌUG    #WUHÒJTWPI QJPG 5VGORGNUEJPGKFGT 5KNDGT CWH FGT 4ÒEMUGKVG ITCXKGTV #   )+#%+061(140#%#41/#COCNVGP1TKIKPCNDCPF$$5$0+5 ++



&KG \WP·EJUV \YGKUVWHKIG )QNF WPF 5KNDGT  /GFCKNNG YWTFG OKV &GMTGV 0T  XQO  #RTKN  XQP -ÌPKI   8KMVQT'OCPWGN++  XQP5CTFKPKGPIGUVKHVGV /QFGNN WPFXQO-ÌPKITGKEJ+VCNKGPQJPG8GT·PFGTWPIGP ÒDGTPQOOGP5KGYWTFGCP2GTUQPGPXGTNKGJGPFKGUKEJWPVGT'KPUCV\FGUGKIGPGP.GDGPUFCHÒTGKPIGUGV\VJCVVGP /GPUEJGPNGDGP\WTGVVGP-CVCUVTQRJGP\WXGTJKPFGTPFKGÌHHGPVNKEJG1TFPWPIYKGFGTJGT\WUVGNNGPQFGT8GTDTGEJGT \WHCPIGP/KVMÌPKINKEJGO&GMTGV0TXQO#RTKNUVKHVGVG-ÌPKI*WODGTV+  XQP+VCNKGP FKG$TQP\GUVWHG0CEJ#DUEJCHHWPIFGT/QPCTEJKGYWTFGFKGFTGKUVWHKIG/GFCKNNG\WP·EJUVPKEJVYGKVGTXGT NKGJGP LGFQEJ OKV )GUGV\ 0T  XQO  ,WPK  YKGFGT KP PGWGT )GUVCNVWPI XQP FGT +VCNKGPKUEJGP 4GRWDNKM   GKPIGHÒJTV /QFGNN 

8616





8619

/GFCKNNGHÒTFKG7PCDJ·PIKIMGKVUWPF'KPKIWPIUMTKGIG+VCNKGPU=/GFCINKCRGTNGIWGTTGF +PFKRGP FGP\C G N 7PKV¯ F +VCNKC? #WUICDG HÒT FGP 'TUVGP 7PCDJ·PIKIMGKVUMTKGI  #WUHÒJTWPI OKV   5VGORGNUEJPGKFGTUKIPCVWT%#0<#0+KO*CNUCDUEJPKVV5KNDGTUVCTMCPIGNCWHGPCOCNVGP1TKIKPCNDCPF OKV$CPFURCPIGPWPF$$5$0+5H 4++



-QPXQNWVXQP\YGK/KPKCVWTGP 1TFGPFGU-QNQPKCN5VGTPU=1TFKPGFGNNC5VGNNC%QNQPKCNG?/KPKCVWT FGT4KVVGTFGMQTCVKQP)QNFGOCKNNKGTV 'JTGP\GKEJGPGKPGU4KVVGTUFGT#TDGKV=&GEQTC\KQPGFGN%CXC NKGTGFGN.CXQTQ?/QFGNN/KPKCVWTFGU'JTGP\GKEJGPU)QNFGOCKNNKGTVCWHFGO4GXGTUGKPGU-TGW \CTOGUQDGTHN·EJNKEJGT'OCKNNGUEJCFGPLGYGKNUCO$·PFEJGP&C\WFTGKYGKVGTG/KPKCVWTGP $GNIKGP KPVGTPCVKQPCNG1TFGP FCXQPGKPGUCO$·PFEJGP 5VÒEM++



-¤0+).+%*' (#/+.+' &'4 *'4<¤)' 810 5#81;'0 '*'/ -¤0+)' 810   +6#.+'0 5'+6  



#NNGTJÌEJUVGT 1TFGP FGT *GKNKIUVGP 8GTMÒPFKIWPI =1TFKPG 5WRRTGOQ FGNNC 5CPVKUUKOC #OOWP   \KCVC? OGKUV CNU #PPWP\KCVGP1TFGP DG\GKEJPGV (GUVUEJTKHV \WO L·JTKIGP $GUVGJGP FGU 1TFGPU   . 1TFKPG5WRTGOQFGNNC55#PPWP\KCVC/CKNCPF(QTOCV#KPKVCNKGPKUEJGT5RTC EJG5GKVGPWPF(CTDVCHGNP'ZGORNCT0TIGDWPFGP ++



1TFGP FGT JGKNKIGP /CWTKVKWU WPF .C\CTWU =1TFKPG FGK 5CPVK /CWTK\KQ G .C\CTQ? 4KVVGTMTGW\ HÒT   &COGP 5KNDGT XGTIQNFGV WPF GOCKNNKGTV CP &COGPUEJNGKHG \WUCOOGP OKV /KPKCVWT 5KNDGT XGTIQNFGV   WPFGOCKNNKGTVCO5EJNGKHEJGPWPF-PQRHNQEJTQUGVVGKOQTKIKPCNGP8GTNGKJWPIUGVWK 4++



5GJTUEJÌPGUMQORNGVVGUPGWYGTVKIGU5GVKPGKPGTIGIGPY·TVKIGP#PHGTVKIWPIKPJGTXQTTCIGPFGT'TJCNVWPI

243


ITALIEN

ex 8620

+6#.+'0+5%*'4'27$.+- 5'+6  

8GTFKGPUVQTFGPFGT+VCNKGPKUEJGP4GRWDNKM=1TFKPG#N/GTKVQFGNNC4GRWDDNKEC+VCNKCPC?/QFGNN

 )TQ­MTGW\UGV0QTOCNCWUHÒJTWPIHÒT*GTTGP#PHGTVKIWPIFGT(KTOC%TCXCP\QNC5WEE' )CTFKPQKP4QODGUVGJGPFCWU-NGKPQF$TQP\GXGTIQNFGVWPFGOCKNNKGTVCOQTKIKPCNGP5EJWNVGTDCPF WPF$TWUVUVGTP5KNDGTDTKNNCPVKGTV#WHNCIG$TQP\GXGTIQNFGVWPFGOCKNNKGTVCWHFGT4ÒEMUGKVG*GTUVGN NGTDG\GKEJPWPI FGT (KTOC ' )CTFKPQ 5WEE %TCXCP\QNC CP 0CFGN FKGUG OKV GT 5KNDGTRWP\G WPF   GKPGT YGKVGTGP WPNGUGTNKEJGP 2WP\G \WUCOOGP OKV /KPKCVWT $TQP\G VGKNYGKUG XGTUKNDGTV VGKNYGKUG   XGTIQNFGVWPFGOCKNNKGTVCO$·PFEJGPOKV#WHNCIGWPF-PQRHNQEJTQUGVVGOKV#WHNCIG$TQP\GVGKNYGKUG XGTUKNDGTV VGKNYGKUG XGTIQNFGV WPF GOCKNNKGTV KO QTKIKPCNGP NGKEJV DGUEJ·FKIVGP 8GTNGKJWPIUGVWK FGT   (KTOC%TCXCP\QNC5WEE')CTFKPQOKVIQNFHCTDGPGO5VCCVUYCRRGP<- 5VÒEM++



.CWV#PICDGPFGU8QTGKIGPVÒOGTUCWUFGO$GUKV\FGUGJGOCNKIGP0#61)GPGTCN5GMTGV·TU&T/CPHTGF9ÌTPGT FGTFGP1TFGPCO0QXGODGTXQOKVCNKGPKUEJGP5VCCVURT·UKFGPVGP(TCPEGUEQ%QUUKIC  XGTNKGJGP DGMQOOGPJCV  )GUVKHVGV XQO KVCNKGPKUEJGP 5VCCVURT·UKFGPVGP .WKIK 'KPCWFK   OKV )GUGV\ 0T  XQO  /·T\   

XGTÌHHGPVNKEJV KP FGT )C\GVVC 7HHKEKCNG XQO  /·T\  CNU UGEJUMNCUUKIGT -QNNCPG )TQ­MTGW\ )TQ­QHHK\KGT   -QOOCPFGWT1HHK\KGTWPF4KVVGT CNNIGOGKPGT8GTFKGPUVQTFGP/KV&GMTGVFGU5VCCVURT·UKFGPVGPXQO1MVQDGT  YWTFGP FKG 5VCVWVGP FGU 1TFGPU XGTÌHHGPVNKEJV /KV &GMTGV 0T  FGU 5VCCVURT·UKFGPVGP (TCPEGUEQ %QUUKIC  

 XQO/·T\GTHWJTGTGKPGIGUVCNVGTKUEJGPWPOGJTGVYCUVTCFKVKQPGNNGTG)GUVCNVWPI KP#PNGJ PWPICPFGPDKUDGUVGJGPFGP1TFGPFGT-TQPGXQP+VCNKGP 

8621 8622





244

8GTFKGPUVQTFGPFGT+VCNKGPKUEJGP4GRWDNKM=1TFKPG#N/GTKVQFGNNC4GRWDDNKEC+VCNKCPC?/QFGNN

  $TWUVUVGTP \WO )TQ­MTGW\ 0QTOCNCWUHÒJTWPI #PHGTVKIWPI FGT (KTOC %TCXCP\QNC 5WEE   ' )CTFKPQ KP 4QO 5KNDGT DTKNNCPVKGTV VGKNYGKUG XGTIQNFGV WPF GOCKNNKGTV 5VGTPEJGPCWHNCIG )QNF CWH   FGT4ÒEMUGKVG*GTUVGNNGTDG\GKEJPWPIFGT(KTOC')CTFKPQ5WEE%TCXCP\QNCCP0CFGN<- ++



8GTFKGPUVQTFGPFGT+VCNKGPKUEJGP4GRWDNKM=1TFKPG#N/GTKVQFGNNC4GRWDDNKEC+VCNKCPC?/QFGNN

  -QOOCPFGWTMTGW\ 0QTOCNCWUHÒJTWPI 5KNDGT XGTIQNFGV WPF GOCKNNKGTV 5VGTPEJGP KO   <GPVTWO)QNFCOQTKIKPCNGP*CNUDCPF<- ++




REPUBLIK LETTLAND

8623 8624



5VGTP FGT )CTTKDCNFK$TKICFGP   #WUHÒJTWPI  $TQP\GUVGTP $TQP\G CO $CPF OKV   6TCIGURCPIG$$5 ++



&KG )CTTKDCNFK$TKICFGP YCTGP 2CTVKUCPGP'KPJGKVGP FKG CWU FGO NKPMGP XQT CNNGO MQOOWPKUVKUEJGP  9KFGTUVCPF   IGIGPFKGFGWVUEJG$GUGV\WPIKP+VCNKGPXQPDKUGPVUVCPFGPUKPF&GT5VGTPFGTCPCNNG#PIGJÌTKIGPFGT $TKICFGPXGTNKGJGPYQTFGPKUVYWTFGOKVGKPGT8GTNGKJWPIUWTMWPFGFCVKGTVCO5GRVGODGTWPFFGP7PVGT UEJTKHVGP FGU )GPGTCN-QOOKUUCTU FGT $TKICFGP 2KGTVTQ 5GEEJKC WPF FGU )GPGTCN-QOOCPFCPVGP .WKIK .QPIQ   XGTIGDGP &CU 'JTGP\GKEJGP FGUUGP FKTGMVGU 8QTDKNF FGT  IGUVKHVGVG 75COGTKMCPKUEJG $TQP\G 5VCT   YCT   YWTFGPXQPFGT(KTOC5VGHCPQ,QJPUQPKP/CKNCPFJGTIGUVGNNV

4'27$.+-.'66.#0&

'456' 4'27$.+-   

1TFGP FGT &TGK 5VGTPG =6TKLW <XCKIĻPW QTFGPKU?  /QFGNN   -TGW\  -NCUUG 5KNDGT   XGTIQNFGVWPFGOCKNNKGTVFKGFTGK5VGTPG)QNFCWHFGO4GXGTUFGT#WHJ·PIWPIOGJTHCEJRWP\KGTV WC *GTUVGNNGTRWP\G(/HÒTFKG(KTOC9(/ÒNNGTKP4KICWPFGT5KNDGTRWP\G COQTKIKPCNGP$CPF OKVCWHIGNGIVGT4QUGVVGKOQTKIKPCNGPIQNFGPDGFTWEMVGP8GTNGKJWPIUGVWK<- +p++

8625



8626 8627



1TFGP FGT &TGK 5VGTPG =6TKLW <XCKIĻPW QTFGPKU?  /QFGNN   5KNDGTPG /GFCKNNG 5KNDGT   CO&TGKGEMUDCPFOKV0CFGN<- ++





1TFGP FGT &TGK 5VGTPG =6TKLW <XCKIĻPW QTFGPKU?  /QFGNN   5KNDGTPG /GFCKNNG 5KNDGT   CO&TGKGEMUDCPFOKV0CFGN<- ++





'TKPPGTWPIU'JTGP\GKEJGPHÒTFGP(TGKJGKVUMTKGIXQPDKU5KNDGTGOCKNNKGTVCO$CPFOKV 0CFGN-8'6CHGN ++

 245


GROSSHERZOGTUM LUXEMBURG

8628

)4155*'4<1)67/.7:'/$74) 

1TFGP FGT 'KEJGPMTQPG =1TFTG FG NC %QWTQPPG FG %J¿PG?  /QFGNN UGKV   )TQ­MTGW\UGV   DGUVGJGPF CWU )TQ­MTGW\-NGKPQF #WUHÒJTWPI OKV GKPIGNCUUGPGP /QPQITCOOGP KP FGP /GFCKNNQPU   )QNFGOCKNNKGTVCWHGKPGO-TGW\CTOMCWOUKEJVDCTGT*CCTTK­OKP'OCKNNGEJKRCO4CPFFGUWPVGTGP -TGW\CTOU CO QTKIKPCNGP CNVGP 5EJWNVGTDCPF WPF $TWUVUVGTP #WUHÒJTWPI OKV CWHIGNGIVGO /QPQ   ITCOO5KNDGT#WHNCIGP)QNFGOCKNNKGTVCWHFGO4GXGTU*GTUVGNNGTDG\GKEJPWPIFGT(KTOC,/,XCP 9KGNKM KP &GP *CCI CP 0CFGN FKGUG WPF FGT 0CFGNJCMGP OGJTHCEJ RWP\KGTV W C OKV HTCP\ÌUKUEJGT   'KPHWJT5KNDGTRWP\GXQPDKU 5EJYCPGPRWP\G <- 5VÒEM++ 

&GT1TFGPYWTFGOKV-ÌPKINKEJ)TQ­JGT\QINKEJGO$GUEJNW­XQO&G\GODGTXQP9KNJGNO ++ -ÌPKIFGT 0KGFGTNCPFG WPF )TQ­JGT\QI XQP .WZGODWTI CNU XKGTMNCUUKIGT )TQ­MTGW\ 4KVVGT XQO 5VGTP -QOOCPFGWT WPF   4KVVGT CNNIGOGKPGT8GTFKGPUVQTFGPHÒTFCU)TQ­JGT\QIVWO.WZGODWTIIGUVKHVGVYWTFGHÒTFCU)TQ­MTGW\GKP GKIGPGTCEJVUVTCJNKIGT$TWUVUVGTPGKPIGHÒJTVFKG-NCUUGFGT4KVVGTOKV5VGTPKP)TQ­QHHK\KGTWODGPCPPVUQYKGFKG 1HHK\KGTUMNCUUG WPF FKG FTGKUVWHKIG )QNF 5KNDGT WPF $TQP\G  CHHKNKKGTVG 8GTFKGPUVOGFCKNNG IGUVKHVGV <WT HTÒJGP   )GUEJKEJVGFGU1TFGPUWPFUGKPGT6T·IGTDKUUKGJG/WNFGT%2WPF%JTKUVKCCPU2#ņ1PFGTUEJGKFKPIGP XCPFG-QPKPI)TQQVJGTVQIņ&G1TFGECPFG'KMGPMTQQPʼnU)TCXGPJCIG

8629

8630 8631



1TFGP FGT 'KEJGPMTQPG =1TFTG FG NC %QWTQPPG FG %J¿PG?  /QFGNN UGKV   )TQ­MTGW\   -NGKPQF  Z  OO HTCP\ÌUKUEJG #PHGTVKIWPI OKV KP FKG 'OCKNNG GKPIGNGIVGP /QPQITCOOGP   )QNFGOCKNNKGTVQJPG5EJWNVGTDCPF<- ++





1TFGP FGT 'KEJGPMTQPG =1TFTG FG NC %QWTQPPG FG %J¿PG?  /QFGNN UGKV   )TQ­MTGW\   -NGKPQF HTCP\ÌUKUEJG #PHGTVKIWPIOKVCWHIGNGIVGP/QPQITCOOGP5KNDGTXGTIQNFGVWPFGOCKNNKGTVCO QTKIKPCNGP5EJWNVGTDCPF$TWUVUVGTPHGJNV  KOQTKIKPCNGP8GTNGKJWPIUGVWK<- ++



1TFGPFGT'KEJGPMTQPG=1TFTGFGNC%QWTQPPGFG%J¿PG?/QFGNN UGKV $TWUVUVGTP#PHGT VKIWPI FGT (KTOC % 9GKUJCWRV 5ÌJPG KP *CPCW OKV CWHIGNGIVGO /QPQITCOO 5KNDGT FKG VGKNYGKUG   XGTUEJTCWDVGP #WHNCIGP )GND WPF 4QVIQNF VGKNU DTKNNCPVKGTV QFGT ITCXKGTV GOCKNNKGTV MCWO UKEJVDCTG   #DRNCV\WPI KP FGT TQVGP 'OCKNNG FGT -TQPG WPF \YGK OKP #DRNCV\WPIGP KP FGT ITÒPGP 'OCKNNG FGU   'KEJGPDNCVVMTCP\GU CWH FGO 4GXGTU *GTUVGNNGTDG\GKEJPWPI FGT FGT (KTOC 9GKUJCWRV CP 0CFGN <-    4+p





*GTXQTTCIGPFG HTÒJG #PHGTVKIWPIUSWCNKV·V FGU DGFGWVGPFGP *CPCWGT *GTUVGNNGTU WO EC  KP QRVKOCNGT   'TJCNVWPI

246


GROSSHERZOGTUM LUXEMBURG

8636

8633

8634

8632











8635

1TFGP FGT 'KEJGPMTQPG =1TFTG FG NC %QWTQPPG FG %J¿PG? 1HHK\KGTUMTGW\ #PHGTVKIWPI FGT (KTOC   #TVJWU$GTVTCPFKP2CTKU UGKV CWUIGNKGHGTVXQPFGT(KTOC.5EJTQGFGTKP.WZGODWTI OKV-WIG NÌUGWPFCWHIGNGIVGO/QPQITCOOGPKO/GFCKNNQP 5KNDGTXGTIQNFGVWPFGOCKNNKGTV8GTIQNFWPIGVYCU XGTDNCUUVCOQTKIKPCNGP$CPFOKVCWHIGNGIVGT4QUGVVG<- ++



1TFGPFGT'KEJGPMTQPG=1TFTGFGNC%QWTQPPGFG%J¿PG?/QFGNN UGKV 4KVVGTMTGW\HTCP \ÌUKUEJG#PHGTVKIWPIOKVGKPIGNGIVGP/QPQITCOOGP)QNFGOCKNNKGTVCO$CPFKOQTKIKPCNGP8GTNGK JWPIUGVWKFGT(KTOC#$CSWGXKNNGKP2CTKU<- ++



1TFGPFGT'KEJGPMTQPG=1TFTGFGNC%QWTQPPGFG%J¿PG?/QFGNN UGKV 4KVVGTMTGW\HTCP \ÌUKUEJG #PHGTVKIWPI OKV UGRCTCV CWHIGNGIVGP /QPQITCOOGP 5KNDGT XGTIQNFGV GOCKNNKGTV CO $CPF   <- +p++



1TFGPFGT'KEJGPMTQPG=1TFTGFGNC%QWTQPPGFG%J¿PG?/QFGNN UGKV 4KVVGTMTGW\HTCP \ÌUKUEJG#PHGTVKIWPIOKVGKPIGNGIVGP/QPQITCOOGP)QNFGOCKNNKGTVCO$CPFOKV6TCIGURCPIG<-  ++



8GTFKGPUVQTFGP FGU )TQ­JGT\QIVWOU .WZGODWTI =1TFTG FG /¾TKVG FW )TCPF&WEJ¾ FG .WZGO   DQWTI? -NGKPQF \WO )TQ­MTGW\ \YGKVG #WUHÒJTWPI OKV OGJTVGKNKIGP /GFCKNNQPU  $TQP\G XGTIQNFGV   WPFGOCKNNKGTVCO5EJWNVGTDCPF ++



&GT HÒPHMNCUUKIG CNNIGOGKPG 8GTFKGPUVQTFGP YWTFG CO  ,CPWCT  XQP )TQJGT\QIKP %JCTNQVVG     IGUVKHVGV +JO KUV GKPG GKPMNCUUKIG 8GTFKGPUVOGFCKNNG CHHKNKGTV &KG 1TFGPUKPUKIPKGP YGTFGP UGKV  CWUUEJNKG­NKEJ   XQPFGT(KTOC#TVJWU$GTVTCPFKP2CTKUJGTIGUVGNNV

8637





8638

8GTFKGPUVQTFGP FGU )TQ­JGT\QIVWOU .WZGODWTI =1TFTG FG /¾TKVG FW )TCPF&WEJ¾ FG .WZGO   DQWTI? )TQ­QHHK\KGTUUCV\  #WUHÒJTWPI OKV GKPVGKNKIGP /GFCKNNQPU  DGUVGJGPF CWU )TQ­QHHK\KGTU   MTGW\ $TQP\G XGTIQNFGV WPF GOCKNNKGTV KO $CPFTKPI HTCP\ÌUKUEJG *GTUVGNNGTRWP\G CO *CNUDCPF WPF   $TWUVUVGTP $TQP\G XGTUKNDGTV VGKNYGKUG XGTIQNFGV WPF GOCKNNKGTV CP 0CFGN FKGUG OKV HTCP\ÌUKUEJGT   *GTUVGNNGTRWP\G OKV \YGK 5GKVGPJCMGP \WUCOOGP OKV-PQRHNQEJTQUGVVGKOQTKIKPCNGP8GTNGKJWPIUGVWK <- 5VÒEM++



8GTFKGPUVQTFGP FGU )TQ­JGT\QIVWOU .WZGODWTI =1TFTG FG /¾TKVG FW )TCPF&WEJ¾ FG .WZGO   DQWTI?-QOOCPFGWTMTGW\GTUVG#WUHÒJTWPI OKVGKPVGKNKIGP/GFCKNNQPU $TQP\GXGTIQNFGVWPFGOCKN NKGTVCO*CNUDCPF<- +p++

 247


MALTESER RITTERORDEN

8640

8639 (1:1)

8641

ex 8642

5178'40'4/#.6'5'44+66'414&'0 5178'40'44+66'4 70&*152+6#.14&'081/*.,1*#00'5<7,'475#.'/ )'0#0068104*1&15)'0#006810/#.6# 

1TFGPUKPUKIPKGP KPVGTPCVKQPCNG (QTO OKV .KNKGP \YKUEJGP FGP -TGW\CTOGP  1TFGPUMTGW\ FGT   4KVVGT#WUHÒJTWPI DKU #WUICDGFGTHTCP\ÌUKUEJGP<WPIGPZOO)QNFVGKNYGKUG HGKPUV \KUGNKGTV GOCKNNKGTV  I OKP 'OCKNNGCDURNKVVGTWPIGP KP FGP <GPVTGP XQP #XGTU WPF 4GXGTU   FKG-TQPGOKV-NGDUVQHHDGHGUVKIVQJPG$CPFTKPIWPFQJPG$CPF 4++p+++  $GUQPFGTUITQ­GU'ZGORNCTKPGKPGTUGJTUEJÌPGP#PHGTVKIWPIUSWCNKV·VCWUFGOGTUVGP&TKVVGNFGU,CJTJWPFGTVU VTQV\FGT'KPUEJT·PMWPIGPKPGKPGTQTFGPVNKEJGP'TJCNVWPI  0CEJFGO KO ,CJTG  FCU )TQ­RTKQTCV $ÌJOGP WPF ¤UVGTTGKEJ GKPG 8GTQTFPWPI HÒT FKG )GUVCNVWPI FGT   1TFGPUKPUKIPKGP WPF WPKHQTOGP FGT XGTUEJKGFGPGP 4KVVGTITCFG GTNCUUGP JCVVG GTNKG­  FCU 1TFGPUMCRKVGN WPVGT   FGO5VCVVJCNVGTFGU)TQ­OGKUVGTVWOUWPFUR·VGTGP)TQ­OGKUVGT(T¯)KQXCPPK$CVVKUVC%GUEJKC5CPVC%TQEG    GKPG UQNEJG 1TFPWPI HÒT FGP )GUCOVQTFGP &CXQT ICD GU KO 2TKP\KR MGKPG GKPJGKVNKEJG 4GIGNWPI PWT GKPG   5WOOGXQP'KP\GNXGTQTFPWPIGPWPFXQTUEJTKHVGP#DIGUGJGPXQPFGT8GTYGPFWPIFGU/CNVGUGTMTGW\GUFKGCNNGP /KVINKGFGT IGOGKPUCO YCT WPVGTNCI FKG )GUVCNVWPI FGT 1TFGPUKPUKIPKGP WPF KJTGT 5EJOWEMVGKNG YKG #D\GKEJGP   \YKUEJGP FGP -TGW\CTOGP -TQPG 6TQRJ·GP $CPFUEJNGKHGP WUY  FGP GKP\GNPGP <WPIGP D\Y )TQ­RTKQTCVGP +O   <WIGFGT4GUVCWTCVKQPYWTFGGUKP(TCPMTGKEJÒDNKEJFKG+PUKIPKGPFGT/KVINKGFGTFGTFTGKCNVGPHTCP\ÌUKUEJGP <WPIGP(TCPMTGKEJ#WXGTIPGWPF2TQXGPEGOKVFGT.KNKGPMTQPGFGT$QWTDQPGP\WÒDGTJÌJGPGKP$TCWEJFGTUKEJ VGKNYGKUGDKUKPFKG)GIGPYCTVGTJCNVGPJCV



1TFGPUKPUKIPKGP  DKU  #WUHÒJTWPI  -CUUG ,WUVK\MNCUUG  2TQHG­MTGW\ FGT ,WUVK\4KVVGT 5KNDGT   XGTIQNFGVWPFGOCKNNKGTVMCWOUKEJVDCTG'OCKNNGTGRCTCVWTCWHGKPGO-TGW\CTOCP0CFGN<- ++



9GPPFKG,WUVK\4KVVGTKJTG2TQHG­FJFKG'YKIGP)GNÒDFGCDNGIGPGTJCNVGPUKGCNU·W­GTGU<GKEJGPGKPUQNEJGU 2TQHG­MTGW\FCUCWHFGTNKPMGP$TWUVUGKVGIGVTCIGPYKTF



1TFGPUKPUKIPKGPKPVGTPCVKQPCNG(QTO OKV.KNKGP\YKUEJGPFGP-TGW\CTOGP WPF#WUHÒJTWPI

UGKV    -NCUUG $TWUVMTGW\ FGT 1DQGFKGP\4KVVGT WPF &COGP  /QFGNN 5KNDGT XGTIQNFGV WPF   GOCKNNKGTVCP0CFGN<- 4++



5GJTUEJÌPGUWPFUGNVGPGU$TWUVMTGW\KPGKPGTIGIGPY·TVKIGP#PHGTVKIWPIKPJGTXQTTCIGPFGT'TJCNVWPI  &KG1DQGFKGP\MNCUUGCNU6GKNFGT-NCUUGFGU1TFGPUYWTFGOKVFGT8GTHCUUWPIXQO,WPKIGUEJCHHGP&KG /KVINKGFGTFKGUGT-NCUUGFKGFCOCNUCWUUEJNKG­NKEJCWU'JTGPWPF&GXQVKQPU4KVVGTPDGUVCPFXGTRHNKEJVGPUKEJOKV GKPGO DGUQPFGTGP 8GTURTGEJGP MGKP )GNÒDFG  UGNDUVGPVURTGEJGPFFGO)GKUVGFGU1TFGPUPCEJEJTKUVNKEJGT8QNN MQOOGPJGKV\WUVTGDGP #TV2CT #NU·W­GTGU<GKEJGPGTJCNVGPUKGDGKOÌHHGPVNKEJGP#DNGIGPFKGUGU8GTURTG EJGPUGKPUQNEJGU$TWUVMTGW\/KVFGTPGWGP8GTHCUUWPIWPFFGOPGWGP%QFGZFGU1TFGPUXQODKU#RTKN  YWTFG FKG /ÌINKEJMGKV GKP UQNEJGU 8GTURTGEJGP CD\WNGIGP CWH )TCVKCN WPF &GXQVKQPU WPF CWH /CIKUVTCN   4KVVGTGTYGKVGTVWPFFKG1DQGFKGP\MNCUUGWOFKGUGXGTOGJTV



248

1TFGPUKPUKIPKGPKPVGTPCVKQPCNG(QTO OKV.KNKGP\YKUEJGPFGP-TGW\CTOGP #WUHÒJTWPI   -NCUUG4CPI-TGW\FGT'JTGPWPF&GXQVKQPU4KVVGTKVCNKGPKUEJG#PHGTVKIWPIFGT(KTOC 5VGHCPQ ,QJPUQP KP /CKNCPF WPF 4QO CWU FGP GT ,CJTGP 5KNDGT XGTIQNFGV WPF GOCKNNKGTV CWH FGT   4ÒEMUGKVG FGU *CNUDCPFU WPNGUGTNKEJ RWP\KGTV CO *CNUDCPF \WUCOOGP OKV /KPKCVWT 5KNDGT XGTIQNFGV   WPFGOCKNNKGTVKO4KPIRWP\KGTVCO$·PFEJGPWPF-PQRHNQEJTQUGVVGKOQTKIKPCNGPOKVYGK­GO /CNVGUGTMTGW\DGFTWEMVGP8GTNGKJWPIUGVWKFGT(KTOC,QJPUQP<- 5VÒEM++




MALTESER RITTERORDEN

8643

8644



1TFGPUKPUKIPKGPKPVGTPCVKQPCNG(QTO OKV.KNKGP\YKUEJGPFGP-TGW\CTOGP WPF#WUHÒJ TWPI UGKV -NCUUG)TCF-TGW\FGT/CIKUVTCN1DÌFKGP\-CRN·PG DKU D\Y/CIKUVTCN -CRN·PG UGKV 5KNDGTXGTIQNFGVWPFGOCKNNKGTVCO&TGKGEMUDCPF\WUCOOGPOKV/KPKCVWT5KNDGT XGTIQNFGV CO $·PFEJGP CP 0CFGN WPF -PQRHNQEJTQUGVVG KO 1TKIKPCNGVWK XQP ) )WEEKQPG KP 4QO   <- 4++





1TFGPUKPUKIPKGPKPVGTPCVKQPCNG(QTO OKV.KNKGP\YKUEJGPFGP-TGW\CTOGP WPF#WUHÒJTWPI

 -NCUUG)TCF-TGW\FGT&GXQVKQPU&QPCVGP-NCUUG  5KNDGTXGTIQNFGV WPFGOCKNNKGTVCO&TGKGEMUDCPF<- 4++



.CWV2TQEJ±\MC KP2415 JCPFGNVGGUUKEJDGKFGP-TGW\GPFGT&GXQVKQPUFQPCVGP\WP·EJUVWO'JTGPMTGW\G HÒT1TFGPUDGCOVGWPF5VKHVGT5KGYWTFGPKP\YGK-NCUUGPIGUEJCHHGPFKGWOGKPGFTKVVG-NCUUGGTI·P\V YWTFGP#TVKMGNFGU%QFGZXQO0QXGODGTURTKEJVXQP8GTFKGPUVGPDGUQPFGTGT#TVKO&KGPUVGFGTFGO 1TFGPIGJÌTKIGP9GTMGFKGHÒTGKPG#WHPCJOGWPVGTFKG&GXQVKQPUFQPCVGPXGTNCPIVYGTFGP/KVFGT2TQOWNICVKQP FGTPGWGP8GTHCUUWPIWPFFGUPGWGP%QFGZFGU1TFGPUCODKU#RTKNYWTFGPFKG&GXQVKQPUFQPCVGPCWH GKPG -NCUUG TGFW\KGTV FGTGP &GMQTCVKQP FGO HTÒJGTGP -TGW\ FGT &GXQVKQPUFQPCVGP  -NCUUG GPVURTKEJV  YQDGK   PWPOGJTCWEJ&COGP#WHPCJOGHKPFGPMÌPPGP&KGDKUJGTKIGWPF-NCUUGFGT&GXQVKQPUFQPCVGPYWTFGCDIG UEJCHHV

8645

ex 8646



1TFGPUKPUKIPKGPKPVGTPCVKQPCNG(QTO OKV.KNKGP\YKUEJGPFGP-TGW\CTOGP DKU#WUHÒJTWPI

UGKV    -NCUUG  )TCF -TGW\ FGT 'JTGP WPF &GXQVKQPU4KVVGT KVCNKGPKUEJG #PHGTVKIWPI FGT   (KTOC%TCXCP\QNC5WEE)CTFKPQKP4QOCWUFGPUR·VGPGT,CJTGP5KNDGTXGTIQNFGVWPFGOCKNNKGTV CO*CNUDCPF\WUCOOGPOKV/KPKCVWT5KNDGTXGTIQNFGVWPFGOCKNNKGTVCO$·PFEJGPWPF-PQRHNQEJTQ UGVVGKOQTKIKPCNGP8GTNGKJWPIUGVWKFGT(KTOC%TCXCP\QNC5WEE)CTFKPQOKVYGK­GO1TFGPUMTGW\CWH FGO&GEMGN<- ++





1TFGPUKPUKIPKGP KPVGTPCVKQPCNG (QTO OKV .KNKGP \YKUEJGP FGP -TGW\CTOGP   #WUHÒJTWPI UGKV      -NCUUG  )TCF -TGW\ FGT 'JTGP WPF &GXQVKQPU&COGP $TQP\G XGTIQNFGV WPF GOCKNNKGTV   CP FGT &COGPUEJNGKHG \WUCOOGP OKV /KPKCVWT $TQP\G XGTIQNFGV WPF GOCKNNKGTV CO 5EJNGKHEJGP WPF   -PQRHNQEJTQUGVVGKOQTKIKPCNGP8GTNGKJWPIUGVWK<- 5VÒEM++



5GJTUEJÌPGTMQORNGVVGTPGWYGTVKIGT5GVKPGKPGTIGIGPY·TVKIGP#PHGTVKIWPI

249


MALTESER RITTERORDEN

8647 (1:1)



)TQ­RTKQTCV$ÌJOGPWPF¤UVGTTGKEJ-TGW\FGT'JTGPWPF&GXQVKQPUTKVVGTKP$TKNNCPVGP/KVFGT UQIGPCPPVGP&KUVKPEVKQPHÒT,GTWUCNGO  ZOO)QNFWPFVGKNYGKUG5KNDGTCWHFGT 4ÒEMUGKVG HGKPUV ITCXKGTV ¯ LQWT DGUGV\V OKV KPUIGUCOV  GEJVGP &KCOCPVGP KP #NVUEJNKHH MQPVTQNNKGTV    XQPWPVGTUEJKGFNKEJGT)TÌ­GWPFIWVGT3WCNKV·V KO)GUCOVIGYKEJVXQPÒDGTEV VGKNYGKUGGOCKNNKGTV  I QJPG LGINKEJG 2WP\KGTWPI OKV UR·VGTGO NCPIGP *CNUDCPFCDUEJPKVV KO CNVGP LGFQEJ UR·VGTGP   RCUUGPFGP#WHDGYCJTWPIUGVWK +p++  'Z#WMVKQP1TFGPCWUCNNGT9GNV5COONWPI6COOCPPFGT7$5KP$CUGNCOWPF0QXGODGT.QV0T 7TURTÒPINKEJGTYQTDGPXQP&T4QOGFKQ)TCHXQP6JWP*QJGPUVGKP0CEJFGUUGP#PICDGPWTURTÒPINKEJCWU FGO$GUKV\XQPUGKPGO7T7T7TITQ­XCVGT1VVQ)TCH$NQOG  (KGFGKMQOOK­JGTTCWH5CN\CWWPFMÌPKI NKEJF·PKUEJGT)GJGKOGT-QPHGTGP\TCV#NUFG\KFKGTVGT2TQVGUVCPV FGTUKEJÒDGTFKG-QPXGTUKQPUGKPGU5QJPGU)W UVCX\WT-CVJQNKUEJGP-KTEJGGORÌTVG YWTFGGTUR·VGTFGPPQEJ'JTGPWPF&GXQVKQPUTKVVGTFGU)TQ­RTKQTCVGU$ÌJ OGPWPF¤UVGTTGKEJFGU5QWXGT·PGP/CNVGUGT4KVVGTQTFGPUPCEJFGOGTDGKGKPGO$GUWEJKP2CN·UVKPCGKPGWOHCPI TGKEJG5RGPFGOÌINKEJGTYGKUGKO<WUCOOGPJCPIOKVFGT'TTKEJVWPID\Y'TJCNVWPIFGU*QURK\GUFGU/CNVGUGTQT FGPU KP 6CPVWT DGK $GVNGJGO WPVGT .GKVWPI FGU )TQ­RTKQTCVGU IGOCEJV JCVVG GT NKG­ UKEJ OKV FGO /CNVGUGTMTGW\   RQTVTCKVKGTGP&KGUGTDQUVGUGKPGP5QJPFGTCNUPWPOGJTKIGT-CVJQNKMDGTGKVU/CNVGUGTTKVVGTIGYQTFGPYCTFGTCTV FC­ GT KJP CWHHQTFGTVG +PUKIPKGP WPF 7PKHQTO \WTÒEM\WIGDGP YQTCWH KJO FKGUGT CPVYQTVGVG FC­ GT PKEJV FCTCP   F·EJVG 0CEJUGKPGO6QFIKPIFCU'ZGORNCTÒDGTCPUGKPGP5QJP)WUVCX)TCH$NQOG  (KFGKMQOOK­ JGTTCWH5CN\CWMWM-·OOGTGT)GJGKOGT4CVWPFCW­GTQTFGPVNKEJGTÌUVGTTGKEJKUEJWPICTKUEJGT)GUCPFVGTWPF DGXQNNO·EJVKIVGT/KPKUVGT\WT&KURQUKVKQP'JTGPWPF&GXQVKQPUTKVVGTFGU5QWXGT·PGP/CNVGUGT4KVVGTQTFGPU&KGUGT ICDGUYGKVGTCPUGKPGP5QJP,QJCPPGU)TCH$NQOG  UGKVMWM-·OOGTGTUGKV4KVVGT -NCUUGFGU1TFGPUFGT'KUGTPGP-TQPGWPFUGKV,CPWCT'JTGPWPF&GXQVKQPUTKVVGTFGU)TQ­RTKQTCVGU$ÌJ OGPWPF¤UVGTTGKEJYGNEJGTOÌINKEJGTYGKUGFCUPGWG'VWKCPHGTVKIGPNKG­  

$GFGWVGPFGU'ZGORNCTKPCNNGTDGUVGT#PHGTVKIWPIUSWCNKV·VCWUFGONGV\VGP&TKVVGNFGU,CJTJWPFGTVUDGUGV\VOKV JQEJYGTVKIGP5VGKPGPKPCDUQNWVGT$GUVGTJCNVWPI+PUKIPKGPFGU/CNVGUGTQTFGPUOKV'FGNUVGKPGPUKPFPWTUGJTUGNVGP CWHFGO/CTMV\WHKPFGP <WT)GUEJKEJVGFGU1TFGPUKP¤UVGTTGKEJXIN5VGGD%JTKUVKCPWPF5VTKOKV\GT$KTIKV &GT5QWXGT·PG/CNVGUGT4KVVGT1TFGPKP¤UVGTTGKEJ)TC\ 

250


FÜRSTENTUM MONACO

8648



2CCT5RQTGPHÒT,WUVK\WPFHÒT'JTGPWPF&GXQVKQPU4KVVGT\WT1TFGPUWPKHQTO$TQP\GXGTIQNFGV 4++

5GJTUEJÌPGUWPFUGNVGP\WHKPFGPFGU2CCTKPGKPGTIGIGPY·TVKIGP#PHGTVKIWPIKPJGTXQTTCIGPFGT'TJCNVWPI



8649

8652



8650

8651

4KVVGTQTFGP HÒT /CNVGUKUEJGU 8GTFKGPUV =/KNKVCTKU 1TFQ 'SWKVWO /GNKVGPUG $GPGOGTGPVK? CWEJ   8GTFKGPUVQTFGPFGU5QWXGT·PGP/CNVGUGT4KVVGTQTFGPUIGPCPPV /QFGNN UGKV /KNKV·TKUEJG #DVGKNWPI )TQ­QHHK\KGTUUGV DGUVGJGPF CWU )TQ­QHHK\KGTUMTGW\ 5KNDGT XGTIQNFGV WPF GOCKNNKGTV CO   *CNUDCPFWPF$TWUVUVGTP5KNDGTDTKNNCPVKGTVVGKNYGKUGXGTIQNFGVWPFGOCKNNKGTVCWHFGT4ÒEMUGKVG*GT UVGNNGTDG\GKEJPWPIFGT(KTOC')CTFKPQ5WEE%TCXCP\QNCKP4QOCP0CFGN\WUCOOGPOKV/KPKCVWT 5KNDGTVGKNYGKUGXGTIQNFGVWPFGOCKNNKGTVCO$·PFEJGP-PQRHNQEJTQUGVVGOKV#WHNCIGWPF7PKHQTODCPF OKV#WHNCIGKOQTKIKPCNGPIQNFGPDGFTWEMVGP8GTNGKJWPIUGVWKFGT(KTOC%TCXCP\QNC5WEE)CTFKPQ<-  5VÒEM4++



8GTNKGJGPCP)GPGTCN4KEECTFQ$KUQIPKGTQ IGD XQPDKU%JGHFGUKVCNKGPKUEJGP)GPGTCNUVCDGUFGT 8GTVGKFKIWPI



8GTFKGPUVOGFCKNNGFGU1TFGPU(ÒT/CNVGUKUEJGU8GTFKGPUV=/GFCINKCFGNN1TFKPGRTQ/GTKVQ/GNK VGPUK?5KNDGTPG/GFCKNNG5KNDGT  COUEJYCT\GP$CPF<- ++

(TÒJG#WUHÒJTWPIKPGEJV5KNDGT



(ª456'067//10#%1 

1TFGP XQO JGKNKIGP -CTN =1TFTG FG 5CKPV %JCTNGU? 1HHK\KGTUMTGW\ )QNF VGKNYGKUG \KUGNKGTV GOCKN   NKGTVICOQTKIKPCNGPCNVGP$CPFOKVCWHIGNGIVGT4QUGVVG<- +p++ &GT 1TFGP YWTFG XQP (ÒTUV %JCTNGU +++ FWTEJ 1TFQPPCP\ 0T  XQO  /·T\  CNU \WP·EJUV FTGKMNCUUKIGT   CNNIGOGKPGT8GTFKGPUVQTFGPIGUVKHVGV&WTEJ1TFQPCP\XQO,CPWCTYWTFGGTCWHHÒPH-NCUUGPGTYGKVGTV+P FKGUGT(QTOYKTFGTCWEJJGWVGPQEJXGTNKGJGP



/106'0')41 (ª456'067/70&-¤0+)4'+%*   

/GFCKNNG HÒT 'KHGT )QNFGPG /GFCKNNG #WUHÒJTWPI OKV $CPFTCJG$TQP\GXGTIQNFGVOKVWPMQTTGMVGO PGWGP$CPF4/1 ++ +PFKGUGT#WUHÒJTWPIPKEJVJ·WHKI

 251


KÖNIGREICH DER NIEDERLANDE

8654 8653

-¤0+)4'+%*&'40+'&'4.#0&' 

/KNKV·T9KNJGNO1TFGP =/KNKVCKTG9KNNGOU1TFG? 4KVVGTMTGW\  -NCUUG  Z  OO 5KNDGT   <GPVTGP )QNF GOCKNNKGTV OGJTGTG 'OCKNNG#WUDTÒEJG WPF 4GRCTCVWTGP CWH #XGTU WPF 4GXGTUUGKVG   -TQPGCWHFGO#XGTUGVYCUGKPIGFTÒEMV-TGW\EJGPÒDGTFGT-TQPGGVYCUXGTDQIGPCOCNVGPUEJOCNGP $CPFUVÒEM<- +++p+8



1TCPKGP0CUUCW1TFGP =1TFG XCP 1TCPKG 0CUUCW? )TQ­QHHK\KGTUUGV OKV 5EJYGTVGTP DGUVGJGPF CWU   )TQ­QHHK\KGTUMTGW\ 5KNDGT VGKNYGKUG XGTIQNFGV WPF GOCKNNKGTV CO *CNUDCPF WPF $TWUVUVGTP 5KNDGT   VGKNYGKUG XGTIQNFGV WPF GOCKNNKGTV CWH FGT 4ÒEMUGKVG *GTUVGNNGTDG\GKEJPWPI FGT 4GKEJUOÒP\G KP   7VTGEJVU CP 0CFGN OKV \YGK 5GKVGPJCMGP \WUCOOGP OKV /KPKCVWT 5KNDGT VGKNYGKUG XGTIQNFGV CO   $·PFEJGP OKV .KV\GP WPF 4QUGVVGP#WHNCIG WPF 4QUGVVG KO IQNFGP DGFTWEMVGP QTKIKPCNGP 8GTNGK   JWPIUGVWKFGT-CP\NGKFGT0KGFGTN·PFKUEJGP1TFGPKPU )TCXGPJCIG<- 5VÒEM+p++



.CWVXCP<GNOXCP'NFKM KP/&5 JCPFGNVGUUKEJJKGTDGKCWHITWPFFGT(QTOFGT-TQPGWOGKPG#PHGTVKIWPI WOEC



8GTNKGJGPCP)GPGTCN4KEECTFQ$KUQIPKGTQ IGD XQPDKU%JGHFGUKVCNKGPKUEJGP)GPGTCNUVCDGUFGT 8GTVGKFKIWPI )GUVKHVGV CO  #RTKN  XQP FGT 4GIGPVKP WPF -ÌPKIKPYKVYG 'OOC KO 0COGP KJTGT 6QEJVGT   -ÌPKIKP9KNJGNOKPCCNUHÒPHMNCUUKIGTCNNIGOGKPGT8GTFKGPUVQTFGPFGOGKPGFTGKUVWHKIG/GFCKNNGCHHKNKKGTVKUV(ÒT OKNKV·TKUEJG8GTFKGPUVGYKTFFGT1TFGPOKVIGMTGW\VGP5EJYGTVGTPXGTNKGJGP

8655



8656

8657

1TCPKGP0CUUCW1TFGP =1TFG XCP 1TCPKG 0CUUCW? -QOOCPFGWTMTGW\ )QNF GOCKNNKGTV  I   5RTÒPIG KP FGT DNCWGP 'OCKNNG FGU TÒEMUGKVKIGP /GFCKNNQPHGNFGU CO QTKIKPCNGP CNVGP *CNUDCPF <-    ++



1TCPKGP0CUUCW1TFGP =1TFG XCP 1TCPKG 0CUUCW? -QOOCPFGWTMTGW\ OKV 5EJYGTVGTP )QNF GOCKN   NKGTV5EJYGTVGTMNKPIGP5KNDGTICOQTKIKPCNGPCNVGP*CNUDCPF<- ++



1TCPKGP0CUUCW1TFGP =1TFG XCP 1TCPKG 0CUUCW? 1HHK\KGTUMTGW\ OKV 5EJYGTVGTP )QNF GOCKNNKGTV   5EJYGTVGTMNKPIGP5KNDGTICOQTKIKPCNGP$CPFOKVCWHIGNGIVGT4QUGVVG<- ++



#PHGTVKIWPICWUFGOGTUVGP&TKVVGNFGU,CJTJWPFGTVU



#PHGTVKIWPICWUFGOGTUVGP&TKVVGNFGU,CJTJWPFGTVU

 252


NORWEGEN

8658

8659

8660

8661

0149')'0

-¤0+)4'+%*2'4510#.70+10/+65%*9'&'0 $+5  

-ÌPKINKEJ 0QTYGIKUEJGT 5CPMV 1NCXU1TFGP =-QPIGNKIG 0QTUM 5V 1NCXUQTFGP?  /QFGNN      4KVVGTMTGW\   -NCUUG )QNF GOCKNNKGTV  I CWH FGO 4GXGTU FGU WPVGTGP -TGW\CTOU *CCT   TKUUGCO1TKIKPCNDCPF<- ++ #PHGTVKIWPICWUFGOGTUVGP&TKVVGNFGU,CJTJWPFGTVU



70#$*0)+)'5-¤0+)4'+%* #$  

-ÌPKINKEJ0QTYGIKUEJGT5CPMV1NCXU1TFGP=-QPIGNKIG0QTUM5V1NCXUQTFGP?/QFGNN   OKV GKPGO .ÌYGP ÒDGT FGT -TQPG  4KVVGTMTGW\ 5KNDGT /GFCKNNQPU )QNF GOCKNNKGTV MCWO UKEJVDCTG   'OCKNNGTGRCTCVWTGPKP\YGK-TGW\URKV\GPWPVGTJCNDFGT-TQPGWPFKO$CPFTKPIHTCP\ÌUKUEJG2WP\GUGKV HÒTGT5KNDGT 'DGTMQRH COCNVGP1TKIKPCNDCPF<- 4++



-ÌPKINKEJ 0QTYGIKUEJGT 5CPMV 1NCXU1TFGP =-QPIGNKIG 0QTUM 5V 1NCXUQTFGP?  /QFGNN      OKV GKPGO .ÌYGP ÒDGT FGT -TQPG  4KVVGTMTGW\   -NCUUG )QNF GOCKNNKGTV CO 1TKIKPCNDCPF   <- ++



-ÌPKINKEJ 0QTYGIKUEJGT 5CPMV 1NCXU1TFGP =-QPIGNKIG 0QTUM 5V 1NCXUQTFGP?  /QFGNN      OKV GKPGO .ÌYGP ÒDGT FGT -TQPG  4KVVGTMTGW\ -NCUUG)QNFGOCKNNKGTVI OKV$CPF  CO1TKIKPCNDCPF<- +p++



5GJT UGNVGPG HTCP\ÌUKUEJG #PHGTVKIWPI  &KG GKPHCEJGP 4KVVGTMTGW\G FKGUGU PWT  ,CJTG NCPI XGTNKGJGPGP /QFGNNU   UKPFYGKVCWUUGNVGPGT\WHKPFGPCNUFKG4KVVGTMTGW\G-NCUUG





8662 (1:1)



-ÌPKINKEJ0QTYGIKUEJGT5CPMV1NCXU1TFGP=-QPIGNKIG0QTUM5V1NCXUQTFGP?/QFGNN UGKV  QJPG .ÌYGP ÒDGT FGT -TQPG  )TQ­MTGW\UGV DGUVGJGPF CWU -NGKPQF )QNF GOCKNNKGTV CO QTKIKPCNGP   5EJWNVGTDCPF WPF $TWUVUVGTP 5KNDGT DTKNNCPVKGTV #WHNCIGP )QNF GOCKNNKGTV CWH FGT 4ÒEMUGKVG *GTUVGN   NGTD\GKEJPWPI FGT (KTOC 6QUVTWR KP 1UNQCP0CFGNKOQTKIKPCNGPIQNFGPDGFTWEMVGP8GTNGKJWPIUGVWK OKVGKPGODGUEJ·FKIVGP8GTUEJNW­<- +p++  253


NORWEGEN

8664 (1:1) 8663 (1:1)





-ÌPKINKEJ0QTYGIKUEJGT5CPMV1NCXU1TFGP=-QPIGNKIG0QTUM5V1NCXUQTFGP?/QFGNN UGKV QJPG.ÌYGPÒDGTFGT-TQPG -QOOCPFGWTMTGW\)QNFGOCKNNKGTVIOKP#DRNCV\WPIGPKPFGP 5VGKPGP FGU -TQPTGKHU CWH FGT 4ÒEMUGKVG FGU $CPFTKPIGU *GTUVGNNGTD\GKEJPWPI FGT (KTOC 6QUVTWR KP   -TKUVKCPKCWPFGT)QNFRWP\GCO*CNUDCPF<- ++



-ÌPKINKEJ0QTYGIKUEJGT5CPMV1NCXU1TFGP=-QPIGNKIG0QTUM5V1NCXUQTFGP?/QFGNN UGKV QJPG.ÌYGPÒDGTFGT-TQPG 4KVVGTMTGW\5KNDGTGOCKNNKGTVCO$CPFOKV6TCIGURCPIGKOQTKIKPCNGP 8GTNGKJWPIUGVWKFGT(KTOC6QUVTWRKP1UNQ<- 4++



8666



8665 (1:1)

8667

5CPMV1NCXU/GFCKNNG/QFGNN OKVFGO2QTVTCKV-ÌPKI*CCMQPU8++ 5KNDGTCO$CPF KOQTKIKPCNGPOKVIQNFGPGT-TQPGDGFTWEMVGP8GTNGKJWPIUGVWKFGT(KTOC*4WKKP1UNQ 44++



'KPXGTINGKEJDCTGU'ZGORNCTLGFQEJQJPG'VWKKUVKPWPUGTGT#WMVKQPCO1MVQDGT .QV0T HÒT RNWU#WHIGNF\WIGUEJNCIGPYQTFGP





254

(TGKJGKVUMTGW\ -ÌPKI *CCMQP U 8++ 5KNDGT XGTIQNFGV WPF GOCKNNKGTV CWH FGO 4GXGTU *GTUVGNNGTDG   \GKEJPWPIFGT(KTOC6QUVTWRKP1UNQCOQTKIKPCNGP$CPFCPFGTQTKIKPCNGP6TCIGURCPIGKOQTKIKPCNGP 8GTNGKJWPIUGVWKFGT(KTOC6QUVTWROKVIQNFHCTDGPGO/QPQITCOO-ÌPKI*CCMQP U8++FC\W/KPKCVWT 5KNDGTXGTIQNFGVWPFGOCKNNKGTVCO$·PFEJGP'1 ++



(TGKJGKVUMTGW\ -ÌPKI *CCMQP U 8++ 5KNDGT XGTIQNFGV WPF GOCKNNKGTV CWH FGO 4GXGTU *GTUVGNNGTDG   \GKEJPWPIFGT(KTOC6QUVTWRKP1UNQCOQTKIKPCNGP$CPFCPFGTQTKIKPCNGP6TCIGURCPIGKOQTKIKPCNGP 8GTNGKJWPIUGVWKFGT(KTOC6QUVTWROKVIQNFHCTDGPGO/QPQITCOO-ÌPKI*CCMQP U8++'1 ++




ÖSTERREICH

8668

8670 8669

-#+5'44'+%*   

¤56'44'+%*

1TFGPXQO)QNFGPGP8NKGU3WCNKV·VUXQNNG5COONGTCPHGTVKIWPI EQR[ FGT1TFGPUMQNNCPGOKV-NGKPQF DGUVGJGPFCWU(GWGTUVCJNWPF(GWGTUVGKP)NKGFGTPXGTIQNFGVWPFVGKNYGKUGGOCKNNKGTV ++



5EJÌPGU'TUCV\GZGORNCTHÒTGKPGKO1TKIKPCNPKEJV\WDGUEJCHHGPFG-QNNCPG



/KNKV·T/CTKC6JGTGUKGP1TFGP5COONGTCPHGTVKIWPIFGU-QOOCPFGWTMTGW\GU$TQP\GXGTIQNFGVWPF GOCKNNKGTVCWHFGT4ÒEMUGKVGFGU$CPFTKPIGURWP\KGTV%12;CO*CNUDCPF +p++



5GJTUEJÌPIGCTDGKVGVGU'TUCV\GZGORNCTHÒTGKPKO1TKIKPCNPCJG\WWPDGUEJCHHDCTGU1TKIKPCNMTGW\



/KNKV·T/CTKC6JGTGUKGP1TFGP 5COONGTCPHGTVKIWPI FGU 4KVVGTMTGW\GU $TQP\G XGTIQNFGV WPF GOCKN   NKGTVCWHFGT4ÒEMUGKVGFGU$CPFTKPIGURWP\KGTV%12;CO&TGKGEMUDCPF ++

5GJTUEJÌPIGCTDGKVGVGU'TUCV\GZGORNCTHÒTGKPKO1TKIKPCNPWTUGJTVGWGTDGUEJCHHDCTGU1TKIKPCNMTGW\



8672 (1:1) 8671 (1:1)



¤UVGTTGKEJKUEJ-CKUGTNKEJGT 1TFGP FGT 'KUGTPGP-TQPG/QFGNN  #WUHÒJTWPI OKV DGYGINKEJGT -TQPG    -TGW\  -NCUUG 5KNDGT VGKNYGKUG GOCKNNKGTV GKPKIG 'OCKNNGCDRNCV   \WPIGPCOCNVGP1TKIKPCNDCPF$9-<- 4++ 

)GUVKHVGV CNU FTGKMNCUUKIGT CNNIGOGKPGT 8GTFKGPUVQTFGP XQP -CKUGT (TCP\ + CO  (GDTWCT  KP #PNGJPWPI CP   FGP XQP -CKUGT 0CRQNGQP CO  ,WPK  WPF PCEJ FGUUGP #DFCPMWPI GTNQUEJGPGP 1TFGP FGT 'KUGTPGP -TQPG   WPFXGT·PFGTVWPFGTYGKVGTVGTNQUEJGTHCMVKUEJOKVFGO8GT\KEJV-CKUGT-CTNU+CWHFKG#WUÒDWPI FGT4GIKGTWPIKOÌUVGTTGKEJKUEJGP4GKEJUVGKNCO0QXGODGT



-CKUGTNKEJ¤UVGTTGKEJKUEJGT (TCP\,QUGRJ1TFGP )TQ­MTGW\-NGKPQF )QNF GOCKNNKGTV 4GXGTUOG   FCKNNQPCWHMNCRRDCTKO4KPI*GTUVGNNGTRWP\G8/FGT(KTOC8KPE/G[GT U5ÌJPGKP9KGP)GOU MQRH#2WP\GHÒTGT)QNFXQPDKUCOQTKIKPCNGPCNVGPOQKTKGTVGP5GKFGP5EJWNVGTDCPF $9-<- + 

&GT \WP·EJUV PWT FTGKMNCUUKIG CNNIGOGKPG 8GTFKGPUVQTFGP YWTFG CO  &G\GODGT  XQP -CKUGT (TCP\ ,QUGRJ   MWT\ PCEJ UGKPGT 6JTQPDGUVGKIWPI IGUVKHVGV 'T YWTFG OGJTHCEJ XGT·PFGTV WPF GTYGKVGV = -QOVWT OKV 5VGTP     PFGTWPI FGU $TWUVUVGTPU   1HHK\KGTUMTGW\   -TKGIUFGMQTCVKQP \W CNNGP -NCUUGP  WPF   

5EJYGTVGT  5QOKV DGUVCPF FGT 1TFGP CD  CWU HÒPH -NCUUGP )TQ­MTGW\ -QOVWT OKV WPF QJPG 5VGTP 1HHK   \KGTUMTGW\ 4KVVGTMTGW\  /KV FGO 8GT\KEJV -CKUGT -CTNU + CWH FKG #WUÒDWPI FGT 4GIKGTWPI KO ÌUVGTTGKEJKUEJGP   4GKEJUVGKNCO0QXGODGTGTNQUEJFGT1TFGPHCMVKUEJ

255


ÖSTERREICH

8673 (1:1) 8674 (1:1)

8674 (1:1)



-CKUGTNKEJ¤UVGTTGKEJKUEJGT(TCP\,QUGRJ1TFGP$TWUVUVGTP\WO)TQ­MTGW\/QFGNN   5KNDGT DTKNNCPVKGTV WPF TGRGTEKGTV #WHNCIGP )QNF GOCKNNKGTV \YGK MCWO UKEJVDCTG #WUDTÒEJG KP FGT   'OCKNNGFGT5EJYCP\HGFGTPCWHFGO4GXGTURWP\KGTV)\YGK-QTRWU5RKV\GPOKV*GTUVGNNGTRWP\G8/ WPF&KCPCMQRH#2WP\GXQPDKUHÒTGT5KNDGTOKV*GTUVGNNGTDG\GKEJPWPIFGT(KTOC 8KPE/G[GT U5ÌJPGKP9KGPCP0CFGNFKGUGOKV\YGK#2WP\GP$9-<- +p++ 



-CKUGTNKEJ¤UVGTTGKEJKUEJGT (TCP\,QUGRJ1TFGP -QOVWTMTGW\ )QNF GOCKNNKGTV 4GXGTUOGFCKNNQP   CWHMNCRRDCTKO4KPIVGKNYGKUGXGTUEJNCIGPG*GTUVGNNGTRWP\G)GOUMQRH2WP\GHÒTGT)QNFXQP DKUQJPG$CPF$9-<- +p++ 

8676

8675 (1:1)

8677



-CKUGTNKEJ¤UVGTTGKEJKUEJGT (TCP\,QUGRJ1TFGP -QOVWTMTGW\ )QNF GOCKNNKGTV 4GXGTUOGFCKNNQP   CWHMNCRRDCTKO4KPI*GTUVGNNGTRWP\G)4FGT(KTOC)GDTÒFGT4GUEJKP9KGP)GOUMQRH2WP\G HÒTGT)QNFXQPDKUQJPG$CPF$9-<- +p++ 



-CKUGTNKEJ¤UVGTTGKEJKUEJGT (TCP\,QUGRJ1TFGP 1HHK\KGTUMTGW\   #WUHÒJTWPI XQP    DKU$TQP\GXGTIQNFGVGOCKNNKGTV5VGTPEJGPRWP\GCWHGKPGT-TQPGPRGPFKNKGCWHFGO4GXGTU*GT UVGNNGTDG\GKEJPWPIFGT(KTOC4Q\GV(KUEJOGKUVGTKP9KGPUQYKGGKPKIG&GNNGP-TQPGNGKEJVDGYGI NKEJCP0CFGN$9-<- ++



'JTGP\GKEJGPXQO4QVGP-TGW\'JTGP\GKEJGP-NCUUGOKVFGT-TKGIUFGMQTCVKQP5KNDGTGOCKNNKGTVKP FGT¤UGOGJTHCEJRWP\KGTVCOCNVGP&TGKGEMUDCPF$9-<- ++



 256


ÖSTERREICH

ex 8678

8679

ex 8680



/KNKV·T8GTFKGPUVMTGW\-TGW\+++-NCUUG QJPG-TKGIUFGMQTCVKQP 5KNDGTGOCKNNKGTVMN'OCKNNGUEJ· FGPCWH#XGTUWPF4GXGTUUGKVGKPFGT¤UG*GTUVGNNGTRWP\G(4FGT(KTOC4QVJGKP9KGPWPF&KCPC MQRHRWP\GHÒTGT5KNDGTXQPDKUCO&TGKGEMUDCPF&C\W$TQP\GPG'JTGPOGFCKNNGXQO 4QVGP -TGW\ OKV FGT -TKGIUFGMQTCVKQP $TQP\G XGTIQNFGV WPF VGKNYGKUG GOCKNNKGTV CO &TGKGEMUDCPF   $9- 5VÒEM+++++





5CNXCVQT/GFCKNNG FGT 5VCFV 9KGP /GFCKNNG KP 'KUGP &WTEJOGUUGT  OO KO GVYCU DGTKGDGPGP   UKNDGTDGFTWEMVGP8GTNGKJWPIUGVWKFCVKGTV ++





-QPXQNWV XQP FTGK -TKGIUCWU\GKEJPWPIGP FGU 'TUVGP 9GNVMTKGIU   5KNDGTPGU 8GTFKGPUVMTGW\ OKV   -TQPGWPF5EJYGTVGTP5KNDGTVGKNYGKUGGOCKNNKGTVKO$CPFTKPIOGJTHCEJRWP\KGTVCO-TKGIUDCPFOKV CWHIGNGIVGP 5EJYGTVGTP   )TQ­G  5KNDGTPG 6CRHGTMGKVU/GFCKNNG  -NCUUG #WUICDG -GKUGT -CTN  

  5KNDGT OKV 5VGORGNUEJPGKFGTUKIPCVWT -#765%* QJPG $CPF   -NGKPG  5KNDGTPG   6CRHGTMGKVU/GFCKNNG #WUICDG -CKUGT (TCP\,QUGRJ   5KNDGT OKV 5VGORGNUEJPGKFGTUKIPCVWT    6#76'0*#;0 CO HCNUEJGP &TGKGEMUDCPF &C\W 7PICTKUEJG 9GNVMTKGIU'TKPPGTWPIUOGFCKNNG   OKV5EJYGTVGTPQJPG$CPF 5VÒEM++



8681

8682

8681

-¤0+)4'+%*$¤*/'0+00'4*#.$&'5-#+5'44'+%*'5 

7PDGMCPPVG2T·OKGPOGFCKNNG&WTEJOGUUGTOO5KNDGTIGJGPMGNV

++



'456' 4'27$.+-  70&560&'56##6   

'JTGP\GKEJGP HÒT 8GTFKGPUVG WO FKG 4GRWDNKM ¤UVGTTGKEJ   D\Y ¤UVGTTGKEJKUEJGT 8GT   FKGPUVQTFGP    /QFGNN  DKU  D\Y   )TQ­GU 5KNDGTPGU 'JTGP\GKEJGP HÒT   8GTFKGPUVG   D\Y 1HHK\KGTUMTGW\    #WUHÒJTWPI -TWEMGPMTGW\      #PHGTVKIWPIFGT(KTOC,5QWXCNKP9KGP$TQP\GXGTUKNDGTVWPFYGK­GOCKNNKGTV'OCKNNGTGRCTCVWTCWH GKPGO-TGW\CTOCP0CFGNFKGUGOKV*GTUVGNNGTDG\GKEJPWPIFGT(KTOC5QWXCN ++p

 257


POLEN

8683 (1:1)

-¤0+)4'+%* $+5  

21.'0

/GFCKNNG ŋ8KTVWVK /KNKVCTKŌ  D\Y1TFGPFGU/KNKV·T-TGW\GU  D\Y/KNKV·TKUEJGT1T FGP FGU *GT\QIVWOU 9CTUEJCW   D\Y /KNKV·T1TFGP 2QNGPU   D\Y /KNKV·T1TFGP   ŋ8KTVWVK /KNKVCT[Ō UGKV    /QFGNN )QNFGPG /GFCKNNG  OKV ¤UG   Z OO)QNF ICWHFGO4GXGTUWPVGTFGPIGMTGW\VGP2CNO\YGKIGPUEJYCEJGKPIGTKV\VGō:8+++ŋCOCNVGPGVYCU \GTUEJNKUUGPGP5GKFGPDCPFFGU/QFGNNU 4444++  <YGKHGNUHTGKQTKIKPCNG)QNFGPG/GFCKNNGFGU/QFGNNUFKG\YKUEJGPFGO,WPKWPFFGO#WIWUVOKV FGOGTUVGP5VGORGNKPFGT/ÒP\GKP9CTUEJCWIGRT·IVYWTFG5KGKUVGKPYKEJVKIGU<GWIPKUFGUJGTQKUEJGP8GTVGK FKIWPIUMCORHGUFGTVCRHGTGPRQNPKUEJGP6TWRRGPIGIGPFKGÒDGTO·EJVKIGPTWUUKUEJGP5VTGKVMT·HVGKPFGOXQP<CTKP -CVJCTKPC ++ ōFGT )TQ­GPŋ   DGIQPPGPGP 4WUUKUEJ2QNPKUEJGP -TKGI XQP  FGT NGV\VGPFNKEJ \WT   <YGKVGP 2QNPKUEJGP6GKNWPIXQO,CPWCTWPFFCOKV\WGKPGTYGKVGTGPFGWVNKEJGP5EJY·EJWPIFGU.CPFGU FWTEJUGKPGCIITGUUKXGP0CEJDCTPHÒJTVG  #WHFGT8QTFGTUGKVGKUVFCUDGMTÌPVG/QPQITCOOō5#4ŋXQP-ÌPKI5VCPKUNCY++#WIWUV2QPKCVQYUMK   ÒDGT\YGKIGMTGW\VGP2CNO\YGKIGP\WUGJGPCWHFGT4ÒEMUGKVGFKG9QTVGō8+4676+/+.+6#4+ŋ=(ÒTOKNKV·TKUEJG 6WIGPF? GDGPHCNNU ÒDGT \YGK IGMTGW\VGP 2CNO\YGKIGP &KGUG /GFCKNNG ÒDGTFCWGTVG PGDGP \YGK YGKVGTGP XQP   WTURTÒPINKEJNCWV9GUQNQYUMK KP955 XGTNKGJGPGP'ZGORNCTGPHÒTÒDGT,CJTGKP2TKXCVDGUKV\DKUKPFKG )GIGPYCTV  $KUJGT UKPF YGNVYGKV PWT \YGK YGKVGTG )QNFGPG /GFCKNNGP DGMCPPV GKP UVGORGNINGKEJGU 'ZGORNCT KO 2QNPKUEJGP   0CVKQPCNOWUGWO KP -TCMCW WPF GKP WPIGJGPMGNVGU 'ZGORNCT FGU \YGKVGP 5VGORGNU FCU KO /KNKV·T/WUGWO KP   9CTUEJCWCWUIGUVGNNVWPFDGK2WEJCNUMKWPF9QLEKGEJQYUMK 5 CDIGDKNFGVKUV#NNGTFKPIUFÒTHVGGUUKEJJKGTDGK FCQJPG¤UGWOGKPWPXGTNKGJGPGU$GNGIGZGORNCTFGT/ÒP\GKP9CTUEJCWJCPFGNP  #O  /CK  JCVVG FGT UQIGPCPPVG ō8KGTL·JTKIG 5GLOŋ FCU RQNPKUEJG 2CTNCOGPV OKV <WUVKOOWPI XQP -ÌPKI   5VCPKUNCY ++ #WIWUV GKPG HÒT FKG FCOCNKIG <GKV ÒDGTCWU OQFGTPG 8GTHCUUWPI GTNCUUGP &C UKEJ FGT RQNPKUEJG YKG   CWEJ FGT NKVCWKUEJG #FGN JKGTFWTEJ KP UGKPGP CPIGUVCOOVGP 4GEJVGP DGFTQJV UCJ HQTOKGTVG UKEJ GKP JGHVKIGT   9KFGTUVCPF FGT UKEJ KP GKPGT &GNGICVKQP CP FKG TWUUKUEJG <CTKP -CVJCTKPC ++ OKV FGT $KVVG WO 7PVGTUVÒV\WPI   YCPFVG7PVGTKJTGO2CVTQPCVHQTOKGTVGUKEJCO#RTKNGKPG-QPHÌFGTCVKQPKO$ÒPFPKUOKVFGO4WUUKUEJGP 4GKEJ FKG CO  /CK KP 6CTIQYKEC KP FGT 7MTCKPG XGTMÒPFGV YWTFG +P GKPGT CO  FGUUGNDGP /QPCVU FGO   RQNPKUEJGP -ÌPKI KP 9CTUEJCW XQTIGVTCIGPGP &GMNCTCVKQP -CVJCTKPCU YWTFG FGT -TKGIU\WUVCPF \YKUEJGP 4W­NCPF   WPF 2QNGP GTMN·TV &C UKEJ FKG RQNPKUEJGP 6TWRRGP GKPGT FGWVNKEJGP ªDGTOCEJV CP TWUUKUEJGP 6TWRRGP IGIGPÒDGT   IGUVGNNV UCJ UEJNWI )GPGTCNNGWVPCPV (ÒTUV ,É\GH #PVQPK 2QPKCVQYUMK   0GHHG FGU -ÌPKIU WPF   -QOOCPFGWT FGT RQNPKUEJGP 6TWRRGP KP FGT 7MTCKPG FGO -ÌPKI XQT GKPG OKNKV·TKUEJG #WU\GKEJPWPI \W UVKHVGP   ōWOFGP-CORIGKUV\WUVGKIGTPWPFFKG/QTCNFGT6TWRRG\WUV·TMGPŋ .WE\CM*[NC 0CEJFGOFKGUGT8QTUEJNCIFKG $KNNKIWPIFGU-ÌPKIUGTHCJTGPJCVVGYWTFGPKPFGT<GKV\YKUEJGPFGO,WPKWPFFGO#WIWUVKPUIGUCOV  )QNFGPG HÒT 1HHK\KGTG  WPF  5KNDGTPG /GFCKNNGP HÒT 7PVGTQHHK\KGTG WPF /CPPUEJCHVGP  HÒT OKNKV·TKUEJG    -TKGIUXGTFKGPUVG IGRT·IV  /QFGNN  *KGTDGK YWTFGP YKG 8GTINGKEJG GTIGDGP JCDGP \YGK XGTUEJKGFGPG5VGORGN XGTYGPFGV  &KG ITQ­G $GUQPFGTJGKV FKGUGT #WU\GKEJPWPI KUV KP FGO 7OUVCPF DGITÒPFGV FC­ JKGT \WO GTUVGP OCN KP FGT   )GUEJKEJVG FGU #WU\GKEJPWPIUYGUGPU 1HHK\KGTG WPF 7PVGTQHHK\KGTG D\Y /CPPUEJCHVGP FKG INGKEJG #WU\GKEJPWPI   GTJCNVGP UQNNVGP WPF CWEJ GTJKGNVGP  YGPP CWEJ KP WPVGTUEJKGFNKEJGT /GVCNN#WUHÒJTWPI WPF FKGU  ,CJTG XQT   'TTKEJVWPIFGTHTCP\ÌUKUEJGP'JTGPNGIKQPD\Y,CJTGXQT#WUICDGXQPFGTGPGTUVGP+PUKIPKGPFKGIGOGKPJKPCNU GKIGPVNKEJGU /QFGNN HÒT GKPG ō&GOQMTCVKUKGTWPIŋ KP FGP 6TWRRGP IKNV YCU FKG 7PVGTUEJKGFG DGK 'JTWPIGP XQP   1HHK\KGTGP WPF 7PVGTQHHK\KGTGP D\Y /CPPUEJCHVGP CPIGJV &KGU XGTFGWVNKEJV YKG UGJT FCU )GFCPMGPIWV FGT   #WHMN·TWPIWPFFGTHTCP\ÌUKUEJGP4GXQNWVKQPCWEJWPFIGTCFGKP2QNGPUEJQPCNNIGIGPY·TVKIYCTWPFYKGOCPFQTV CWEJXGTUWEJVGFKGUG2TKP\KRKGPCWEJKPFKG4GCNKV·VWO\WUGV\GP  0CEJ FGT HÒT FKG RQNPKUEJG 5GKVG UKGITGKEJGP 5EJNCEJV XQP <KGNGPKEG CO  ,WPK  UCPFVG -ÌPKI 5VCPKUNCY ++   #WIWUVCO,WPK\WUCOOGPOKVGKPGO5EJTGKDGP)QNFGPGWPF5KNDGTPG/GFCKNNGPCP(ÒTUV2QPKCVQYUMKKP 1UVTQIFKGCO,WPK\WT8GTNGKJWPIMCOGP5EJQPUGJTMWT\PCEJFKGUGP'TUVXGTNGKJWPIGPYWTFGCNNGTFKPIUFKG )QNFGPG/GFCKNNGFWTEJGKP-TGW\GTUGV\V9CPPFKGUIGPCWGTHQNIVKUVMQPPVGDKUJGWVGPQEJPKEJVIGMN·TVYGTFGP CDGT UEJQP KP FGT -QTTGURQPFGP\ \YKUEJGP FGO -ÌPKI WPF UGKPGO 0GHHGP XQO ,WNK  KUV FKG 4GFG XQP GKPGO   ō/KNKV·T-TGW\ŋ &KGU YKTF CWEJ KP FGP CP FKG 1HHK\KGTG DGK FGT 8GTNGKJWPI XGTIGDGPGP 2CVGPVGP UQ DG\GKEJPGV   FGPGP \W (QNIG FKG #WU\GKEJPWPI HÒT ō    OKNKV·TKUEJG 8GTFKGPUVG WPF 4QWVKPG KP FGT -TKGIUMWPUV   ŋ GT   HQNIVG9QJN PQEJ KO INGKEJGP /QPCV YWTFGP HÒT FKG PWPOGJT CNU ō1TFGP FGU /KNKV·T-TGW\GUŋ DG\GKEJPGVG #WU   \GKEJPWPI 5VCVWVGP GTNCUUGP YQFWTEJ  -NCUUGP )TQ­MTGW\ -QOOCPFGWT 4KVVGT +8WPF8-NCUUG IGUEJCHHGP YWTFGP /QFGNN &GT1TFGPGTJKGNVCWEJGKPCWUXKGT\GJP1HHK\KGTGPDGUVGJGPFGU1TFGPUMCRKVGNWPVGTFGO8QT UKV\XQP(ÒTUV2QPKCVQYUMK&KGGTUVGP1TFGPMTGW\GYWTFGPNCWV9GUQNQYUMK  KO#WHVTCIFGT$GNKGJGPGPCWH FGTGP -QUVGP CWU FGP KJPGP XGTNKGJGPGP /GFCKNNGP CPIGHGTVKIV YCU GKPG 'TMN·TWPI FCHÒT KUV YCTWO UKEJ CWIGP   UEJGKPNKEJPWT\YGKIGJGPMGNVG'ZGORNCTGDKUKPFKG)GIGPYCTVGTJCNVGPJCDGP  5EJQP CO  ,WNK KUV FGT 1TFGP CWH $GVTGKDGP -CVJCTKPCU ++ XQP FGT -TQP-QPHÌFGTCVKQP XQP 6CTIQYKEC  RGT   $GUEJNW­XGTDQVGPYQTFGP&C-ÌPKI5VCPKUNCY++#WIWUVCO,WNKUGNDUVFGT-TQP-QPHÌFGTCVKQPDGKVTCV YQOKV GT HCMVKUEJ UGKPG GKIGPG 6TWRRGP ōKO 5VKEJ NKG­ŋ  YWTFG FGT $GUEJNW­ FGU 8GTDQVU FGU 1TFGPU XQO  ,WNK OKV   &GMTGVFGU4GIGPVGPFGT-TQP-QPHÌFGTCVKQP)TCH5VCPKUNCY5\E\GUP[2QVQEMKXQO#WIWUVGTPGWGTVYQOKVGT HQTVCP CWEJ PKEJV OGJT IGVTCIGP YGTFGP FWTHVG #WH #PVTCI XQP /KEJCN -NGQHCU 1IKPUMK   YWTFG FGT   1TFGPKP)TQFPQCO0QXGODGTKPFGT5KV\WPIFGU5GLOYKGFGTGTPGWGTVFKG$GUEJNÒUUGFGT-TQP -QPHÌFGTCVKQP CWHIGJQDGPWOGTPGWVCWH$GVTGKDGP-CVJCTKPCU++OKV$GUEJNW­FGU-QNNGIKCNGP4GIKGTWPIUQTICPU XQO,CPWCTYKGFGTCDIGUEJCHHV\WYGTFGP0CEJFGOFKGUGT$GUEJNW­CO,CPWCTXGTÌHHGPVNKEJVYQTFGP YCT OW­VGP CNNG 2CVGPVG WPF +PUKIPKGP ōWPVGT #PFTQJWPI XQP )GYCNVCPYGPFWPI FWTEJ 2QNK\GK WPF /KNKV·Tŋ   \WTÒEMIGIGDGPYGTFGPYQOKVFKG'ZKUVGP\FGU1TFGPUXQTGTUVGTNQUEJ

258


POLEN

8684



/GFCKNNG ŋ8KTVWVK /KNKVCTKŌ  D\Y1TFGPFGU/KNKV·T-TGW\GU  D\Y/KNKV·TKUEJGT1T FGP FGU *GT\QIVWOU 9CTUEJCW   D\Y /KNKV·T1TFGP 2QNGPU   D\Y /KNKV·T1TFGP   ŋ8KTVWVK/KNKVCT[Ō UGKV /QFGNN5KNDGTPG/GFCKNNG OKV¤UG ZOO5KNDGT  I QJPG $CPF OKV CNVGO (CFGP CP GKPGO DGUEJ·FKIVGP DGUEJTKHVGVGP CNVGP 5COONWPIUMCTVQP   DGHGUVKIV 44++  <YKUEJGP FGO  ,WPK WPF FGO  #WIWUV  UKPF KPUIGUCOV  5KNDGTPG /GFCKNNGP HÒT 7PVGTQHHK\KGTG WPF   /CPPUEJCHVGP HÒTOKNKV·TKUEJG-TKGIUXGTFKGPUVGIGRT·IVYQTFGP

8685



/GFCKNNG-ÌPKI5VCPKUNCY#WIWUVUHÒT,CJTG/KNKV·TFKGPUV#WUICDG OKV%14275+'CWHFGO 4GXGTU 5KNDGT&WTEJOGUUGTOOOKV¤UGOOJQEJIQJPG$CPFOKVCNVGO(CFGPCP GKPGODGUEJ·FKIVGPDGUEJTKHVGVGPCNVGP5COONWPIUMCTVQPDGHGUVKIV 44++



-ÌPKI5VCPKUNCY++#WIWUV2QPKCVQYUMK  UVKHVGVGFKGGKPMNCUUKIG/GFCKNNGFKGHÒT&KGPUVLCJTG KOUGNDGP%QTRUD\YKOUGNDGP4GIKOGPVXGTNKGJGPYWTFGWPFDGKFGP5QNFCVGPKPJQJGO#PUGJGPUVCPF#WHFGT 4ÒEMUGKVGFGU-CTVQPUKUVKPHGKPGT*CPFUEJTKHVGKPMNGKPGT6GKNFGT5COONWPIUIGUEJKEJVGDGUEJTKGDGPWOXQP $G[GTC9CTEJXGTMCP<GJVYKGFGTGTYXQP,WPIHGTÒDGTNCUUGPC-ÌJPGK2GVGTUDIXQPFKUGOCP 5VTQICPQY\WTÒEMGTJ&G\

259


POLEN

8686 (1:1)

*'4<1)67/9#45%*#7  1&'4-¤0+)4'+%*   

/GFCKNNG ŋ8KTVWVK /KNKVCTKŌ  D\Y1TFGPFGU/KNKV·T-TGW\GU  D\Y/KNKV·TKUEJGT1T FGP FGU *GT\QIVWOU 9CTUEJCW   D\Y /KNKV·T1TFGP 2QNGPU   D\Y /KNKV·T1TFGP   ŋ8KTVWVK/KNKVCT[Ō UGKV ++-NCUUG -QOOCPFGWTMTGW\ ZOO)QNFGOCKNNKGTVI ITQ­GT QDGTHN·EJNKEJGT 'OCKNNGUEJCFGP CWH FGO QDGTGP -TGW\CTO GKP YGKVGTGT FGWVNKEJ MNGKPGTGT CWH   FGO WPVGTGP -TGW\CTO FKG IQNFGPGP $WEJUVCDGP CWH FGO #XGTU UKPF VGKNYGKUG XGTICPIGP \YKUEJGP   -TGW\ WPF $NCVV#ITCHHG PGW\GKVNKEJG WPUCEJIGO·­G 4GRCTCVWT OKV -NGDUVQHH CO CNVGP OQKTKGTVGP 5GK   FGPDCPFOKVOO$TGKVGWPFOO.·PIG 4444+++p+8  &KG 8QTFGTUGKVG FGT UEJYCT\ GOCKNNKGTVGP -TGW\CTOG \GKIGP FKG 9QTVUKNDGP ō8+4ŋ ō676+ŋ ō/+.+ŋ WPF 6#4+ŋ FCU   /GFCKNNQP FGP IGMTÌPVGP YGK­GP RQNPKUEJGP 9CRRGPCFNGT WOIGDGP XQP GKPGO UVKNKUKGTVGP .QTDGGTMTCP\ &KG IQNFHCTDGPGP    4ÒEMUGKVGP FGT -TGW\CTOG \GKIGP FKG $WEJUVCDGP ō5ŋ ō#ŋ ō4ŋ WPF ō2ŋ HÒT ō5VCPKUNCWU #WIWUV 4GZ 2QNQPKCGŋ =5VCPKUNCWU   #WIWUV -ÌPKI XQP 2QNGP? FCU /GFCKNNQP FGP CNU ō2QIQPŋ DG\GKEJPGVGP 4GKVGT FCU 9CRRGPDKNF .KVCWGPU WPF FKG ,CJTGU\CJN   ōŋ DGKFGU GDGPHCNNU KPPGTJCND GKPGU UVKNKUKGTVGP .QTDGGTMTCP\GU ªDGTJÌJV KUV FCU -TGW\ XQP GKPGT -ÌPKIUMTQPG FKG OKV   GKPGT FTGKDN·VVTKIGP #ITCHHG V[RKUEJ HÒT FKG +PUKIPKGP FGU  /QFGNNU XQP   OKV FGO -TGW\ XGTDWPFGP KUV 6TQV\ FGT   FGWVNKEJGP 6TCIGURWTGP WPF CNVGTUDGFKPIVGP 'KPUEJT·PMWPIGP JCPFGNV GU UKEJ JKGTDGK WO GKP DGFGWVGPFGU JKUVQTKUEJGU   1TFGPUMTGW\FGUUGP#PHGTVKIWPIUWPF8GTCTDGKVWPIUSWCNKV·VCWHFCUGTUVG&TKVVGNFGU,CJTJWPFGTVUJKPYGKUV  $GXQT GKPG QFGT OGJTGTG OÌINKEJG &GWVWPIGP FGU 'ZGORNCTU XQTIGPQOOGP YGTFGP MÌPPGP UQNNVG \WP·EJUV CWH FKG   'PVYKEMNWPI FGU 1TFGPU \W $GIKPP FGU  ,J GKPIGICPIGP YGTFGP +P (QNIG FGU (TKGFGPU XQP 6KNUKV XQO  WPF  ,WNK    \YKUEJGP -CKUGT 0CRQN¾QP +   WPF <CT #NGZCPFGT +   UQYKG -ÌPKI (TKGFTKEJ 9KNJGNO +++ XQP   2TGW­GP   GPVUVCPF FCU *GT\QIVWO 9CTUEJCW WPVGT FGT 4GIKGTWPI XQP -ÌPKI (TKGFTKEJ #WIWUV +   XQP   5CEJUGP CNU *GT\QI TGI   #TVKMGN  FGT CO  ,WNK  XGTCDUEJKGFGVGP 8GTHCUUWPI DGUVKOOVG FC­ CNNG   DKUJGTKIGP RQNPKUEJGP 1TFGP YGKVGT DGUVGJGP D\Y YKGFGT GTPGWGTV YGTFGP UQNNVGP /KV &GMTGV XQO  &G\GODGT    GTJKGNV FGT 1TFGP FKG PGWG $G\GKEJPWPI ō/KNKV·T1TFGP FGU *GT\QIVWOU 9CTUEJCWŋ  /QFGNN  #O INGKEJGP 6CI GTHQNIVGP   \YGK 8GTNGKJWPIGP FGT ++ -NCUUG FKGUGU /QFGNNU WPF \YCT CP )GPGTCNOCLQT (ÒTUV ,É\GH <CLCE\GM   WPF CP   &KXKUKQPU)GPGTCN ,CP *GPT[M &CDTQYUMK   &CU 'ZGORNCT (ÒTUV <CLCE\GM FCU UKEJ KO 2QNPKUEJGP /KNKV·T   OWUGWO KP 9CTUEJCW GTJCNVGP JCV WPF DGK 2WEJCNUMK WPF 9QLEKGEJQYUMK 5   CDIGDKNFGV KUV YGKUV MGKPG -TQPGP   ÒDGTJÌJWPI CWH #WH KPVGPUKXGU &T·PIGP <CT #NGZCPFGTU + JKP NKG­ *GT\QI (TKGFTKEJ #WIWUV XQP 9CTUEJCW OKV &GMTGV XQO    (GDTWCT  FGP NKVCWKUEJGP 4GKVGT CWH FGO TÒEMUGKVKIGP /GFCKNNQP FWTEJ FKG 9QTVG ō4': '6 2#64+#ŋ GTUGV\GP  

 /QFGNN  YCU LGFQEJ CWIGPUEJGKPNKEJ PKEJV KOOGT DGHQNIV YQTFGP KUV +P FKGUGT IG·PFGTVGP (QTO UQNNVG FKG ++ -NCUUG XQP    DKU  PQEJ PGWP YGKVGTG /CNG XGTNKGJGP YGTFGP YQXQP UKEJ FCU CO  0QXGODGT  CP $TKICFG)GPGTCN ,É\GH   )T\GIQT\ %JNQRKEMK   XGTNKGJGPG 'ZGORNCT GTJCNVGP JCV FCU JGWVG KO /KNKV·T/WUGWO KP 9CTUEJCW CWUIGUVGNNV   WPF GDGPHCNNU DGK 2WEJCNUMK WPF 9QLEKGEJQYUMK 5   CDIGDKNFGV KUV #WEJ FKGUGU -TGW\ \GKIV CWH FGO 4ÒEMUGKVGPOGFCKNNQP   FGPNKVCWKUEJGP4GKVGTXQPXQT  0CEJ #WHJGDWPI FGU *GT\QIVWOU 9CTUEJCW WPF FGT FWTEJ FGP 9KGPGT -QPITG­   GTHQNIVGP 0GWITÒPFWPI FGU   -ÌPKITGKEJU 2QNGP QHV CNU ō-QPITG­2QNGPŋ DG\GKEJPGV  WPVGT FGO KP 2GTUQPCNWPKQP TGIKGTGPFGP -ÌPKI WPF TWUUKUEJGP <CTGP   #NGZCPFGT + DNKGDGP FKG RQNPKUEJGP 1TFGP NCWV #TVKMGN  FGT PGWGP 8GTHCUUWPI \YCT DGUVGJGP FGT PWPOGJTKIG UQ   DG\GKEJPGVG /KNKV·T1TFGPU 2QNGPU YWTFG LGFQEJ KP FGT (QNIG\GKV CDIGUGJGP XQP GKPKIGP 0CEJXGTNGKJWPIGP HÒT FKG   XQTCPIGICPIGPGP(GNF\ÒIGWPF-TKGIGPKEJVOGJTXGTNKGJGP  0CEJ FGO 0QXGODGT#WHUVCPF XQP  DGUEJNQ­ FGT 5GLO CO  ,CPWCT  FC­ MÒPHVKI FKG + WPF ++ -NCUUG FGU   1TFGPU CWH 8QTUEJNCI FGU 1DGTDGHGJNUJCDGTU FGT RQNPKUEJGP 6TWRRGP FWTEJ FKG 4GIKGTWPI WPF FKG +++ +8 WPF 8 -NCUUGP   FWTEJ FGP 1DGTDGHGJNUJCDGT UGNDUV XGTNKGJGP YGTFGP UQNNVGP  /QFGNN  )GPGTCN ,CP <[IOWPV 5MT\[PGEMK     1DGTDGHGJNUJCDGT FGT CWHUV·PFKUEJGP 6TWRRGP HÒJTVG GKP 8QTUEJNCIUU[UVGO FWTEJ FKG 6TWRRG GKP DGK FGO 1HHK\KGTG WPF   5QNFCVGPUGNDUVFKGLGPKIGPCWUY·JNVGPFGPGPFGT1TFGPXGTNKGJGPYGTFGPUQNNVG  &CU 8QTGTY·JPVG N·UUV UQOKV OGJTGTG &GWVWPIGP FGU JKGT CPIGDQVGPGP 'ZGORNCTU \W 'PVYGFGT JCPFGNV GU UKEJ WO GKP   -TGW\ FGU  /QFGNNU CWU FGP ,CJTGP  GTMGPPDCT CP FGT $NCVV#ITCHHG FGT ªDGTJÌJWPI FGU -TGW\GU  FCU   WTURTÒPINKEJ QJPG -TQPG CPIGHGTVKIV UR·VGT GKP UQNEJG GTJCNVGP JCV &CPP M·OGP <CLCE\GM WPF &CDTQYUMK CNU 6T·IGT KP   (TCIGņYQDGKCWEJ\WDGTÒEMUKEJVKIGPKUVFC­DGKFGCWH2QTVTCKVULGYGKNUGKP-QOOCPFGWTMTGW\OKV-TQPGVTCIGP  1FGT GU JCPFGNV UKEJ WO GKP -TGW\ FGU  /QFGNNU FCU \YKUEJGP  WPF  WPVGT 8GTYGPFWPI GKPGU -TGW\GU FGU   XQTJGTIGJGPFGP  /QFGNNU CPIGHGTVKIV WPF XGTNKGJGP YQTFGP KUV YQHÒT NCWV 9GUQNQYUMK   PWT &KXKUKQPU)GPGTCN   5VCPKUNCY (KU\GT &KXKUKQPU)GPGTCN #PVQPK #OKNMCT -QUKPUMK &KXKUKQPU)GPGTCN #NGMUCPFGT 4Q\PKGEMK WPF &KXKUKQPU  )GPGTCN /KEJCGN 0QYKPC 5QMQNPKEMK CNU 'ORH·PIGT KP (TCIG MQOOGP FKG CNNG KJT -TGW\  GTJCNVGP JCDGP &CDGK OW­   DGFCEJV YGTFGP FC­ FCU -TGW\ KP FKGUGO (CNN TGIGNYKFTKI OKV FGO NKVCWKUEJGP 4GKVGT KO 4ÒEMUGKVGPOGFCKNNQP XGTNKGJGP  YQTFGP Y·TG YCU WPVGT $GTÒEMUKEJVKIWPI FGU  CP %JNQRKEMK XGTNKGJGPGP -TGW\GU FWTEJCWU KO $GTGKEJ FGU /ÌINKEJGP   NKGIGP YÒTFG 7PF CWEJ JKGT DGUVGJV FKG /ÌINKEJMGKV FCUU FKG /GFCKNNQPU \W GKPGO UR·VGTGP <GKVRWPMV CWU YGNEJGP )TÒPFGP   CWEJ KOOGT CWUIGVCWUEJV YQTFGP UGKP MÌPPVGP 0CVÒTNKEJ MQOOGP CWEJ FKG YGKVGTGP \YKUEJGP  WPF  DGNKGJGPGP   2GTUQPGP CNU 6T·IGT KP (TCIG UQ &KXKUKQPU)GPGTCN 1VVQP -CTQN -PKC\KGYKE\   &KXKUKQPU)GPGTCN .WFYKM 2CE     WPF&KXKUKQPU)GPGTCN/KMQNCL$TQPKMQYUMK  'KPG YGKVGTG /ÌINKEJMGKV DGUVGJV FCTKP FC­ GU UKEJ JKGTDGK WO FCU  CP 5MT\[PGEMK XGTNKGJGPG -TGW\  /QFGNN    JCPFGNV FCU WPVGT 8GTYGPFWPI GKPGU -TGW\GU FGU  /QFGNNU CPIGHGTVKIV YQTFGP KUV 0CVÒTNKEJ KUV GU ITWPFU·V\NKEJ CWEJ   OÌINKEJFC­GUUKEJJKGTDGKWOGKP<YGKVGZGORNCTGKPGUFGTXQTIGPCPPVGP$GNKGJGPGPJCPFGNPMÌPPVG  9GNEJG FGT GTY·JPVGP &GWVWPIGP NGV\VGPFNKEJ FGHKPKVKX \WVTKHHV MCPP NGKFGT XQO #WVQT CWEJ PCEJ DGUVGO 9KUUGP WPF   )GYKUUGP PKEJV HGUVIGNGIV YGTFGP YQOKV FKG 'PVUEJGKFWPI \WT 'KPQTFPWPI FKGUGU 5VÒEMGU FGO UCEJMWPFKIGP 7TVGKN FGU   .GUGTUWPF$GVTCEJVGTUÒDGTNCUUGPYGTFGPOW­

260


PORTUGAL

8687

8688



/GFCKNNG \WO <GJPVGP ,CJTGUVCI FGT 7PCDJ·PIKIMGKV 2QNGPU  $TQP\G CO CNVGP $CPF TWO·PK   UEJGT0·JCTV ++





'TKPPGTWPIUMTGW\ CP FGP 9CTUEJCWGT #WHUVCPF XQP  <KPPIW­ IGHGTVKIV CWH $CUKU GKPGU FGWV   UEJGP'KUGTPGP-TGW\GU++-NCUUG\YGK'EMGPDGUVQ­GPCO$CPF 44++



8689

-¤0+)4'+%* $+5  

8690

21467)#.

/KNKV·TKUEJGT1TFGP7PUGTGU*GTTP,GUWU%JTKUVWU=/KNKVCT1TFGOFG0QUUQ5GPJQT,GUWU%JTKUVQ?

DKU D\Y/KNKV·TKUEJGT%JTKUVWU1TFGP=1TFGO/KNKVCTFG%TKUVQ? UGKV /QFGNN OKV UQIGPCPPVGT *GT\ ,GUW&GMQTCVKQP    ITQ­GU $TWUVMTGW\ GKPGU 1TFGPURT·NCVGP KP HGKPUVGT   UKNDGTXGTIQNFGVGT(KNKITCPCTDGKVOKVCWHIGNGIVGOGOCKNNKGTVGP1TFGPUMTGW\KO4KPIOGJTHCEJRWP\KGTV (QTOCVZOOCOCNVGPDTGKVGP5GKFGPJCNUDCPFKPFGT6TCIGHQTOHÒT)GKUVNKEJG 444++  )TQ­G WPF FGPPQEJ HKNKITCP IGCTDGKVGVG &GMQTCVKQP XQP FGT 9GPFG FGU  \WO  ,CJTJWPFGTV WPF UQOKV XQP   ITÌ­VGT5GNVGPJGKV



/KNKV·TKUEJGT1TFGP7PUGTGU*GTTP,GUWU%JTKUVWU=/KNKVCT1TFGOFG0QUUQ5GPJQT,GUWU%JTKUVQ?

DKU D\Y/KNKV·TKUEJGT%JTKUVWU1TFGP=1TFGO/KNKVCTFG%TKUVQ? UGKV /QFGNN OKV UQIGPCPPVGT *GT\ ,GUW&GMQTCVKQP    $TWUVUVGTP \WO )TQ­MTGW\ GTMGPPVNKEJ CP FGP HÒPH   $NÒVGP CWH FGO /GFCKNNQPTKPI   RQTVWIKGUKUEJG #WUHÒJTWPI OKV DTKNNCPVKGTVGP 5VTCJNGP  KP ITQ­GT  

&WTEJOGUUGT  OO  YQJN HTCP\ÌUKUEJGT #PHGTVKIWPI 5KNDGT DTKNNCPVKGTV #WHNCIGP )QNF VGKNYGKUG   \KUGNKGTV WPF VGKNYGKUG GOCKNNKGTV QJPG *GTUVGNNGTDG\GKEJPWPI CP 0CFGN OKV \YGK 5GKVGPJCMGP <-    +p++



5GJTSWCNKV·VUXQNNGWPFITQ­G#PHGTVKIWPICWUFGT/KVVGFGU,CJTJWPFGTVUKPCNNGTDGUVGT'TJCNVWPI

261


PORTUGAL

8691 (1:1)



/KNKV·TKUEJGT1TFGP7PUGTGU*GTTP,GUWU%JTKUVWU=/KNKVCT1TFGOFG0QUUQ5GPJQT,GUWU%JTKUVQ?

DKU   D\Y /KNKV·TKUEJGT %JTKUVWU1TFGP =1TFGO /KNKVCT FG %TKUVQ? UGKV    /QFGNN  

  -QOOCPFGWTMTGW\ KP FGT UQIGPCPPVGP OKNKV·TKUEJGP QFGT OQFGTPGP #WUHÒJTWPI )QNF   GOCKNNKGTVIKO$CPFTKPIRWP\KGTV8#CO*CNUDCPFCDUEJPKVV<- +



'U KUV CWHHCNNGPF FC­ FKGUG +PUKIPKGP PCJG\W CWUUEJNKG­NKEJ HTCP\ÌUKUEJGT WPF ÌUVGTTGKEJKUEJGT *GTMWPHV UKPF 'KP   OÌINKEJGT)TWPFJKGTHÒTMÌPPVGFKG)GHCJTGKPGT8GTYGEJUNWPIFGTUVCVWVGPO·­KIGP+PUKIPKGPOKVFGO2·RUVNKEJGP %JTKUVWUQTFGP UGKP 1D GU UKEJ DGK FKGUGP 5VÒEMGP YKTMNKEJ PWT WO XQP FGP $GNKGJGPGP UGNDUV GTYQTDGPG  

\GKVIGPÌUUKUEJG  <YGKVCPHGTVKIWPIGP QFGT CWEJ WO VCVU·EJNKEJ KO #WUNCPF FWTEJ DGCWHVTCIVG RQTVWIKGUKUEJG $QV   UEJCHVGTGTYQTDGPGWPFXGTNKGJGPG5VÒEMGJCPFGNVMQPPVGDKUJGTPKEJVIGMN·TVYGTFGP

8692

8693



/KNKV·TKUEJGT1TFGP7PUGTGU*GTTP,GUWU%JTKUVWU=/KNKVCT1TFGOFG0QUUQ5GPJQT,GUWU%JTKUVQ?

DKU D\Y/KNKV·TKUEJGT%JTKUVWU1TFGP=1TFGO/KNKVCTFG%TKUVQ? UGKV /QFGNN OKV UQIGPCPPVG *GT\ ,GUW&GMQTCVKQP    $TWUVUVGTP \WO -QOOCPFGWT GTMGPPVNKEJ CP FGP XKGT   $NÒVGP CWH FGO /GFCKNNQPTKPI   RQTVWIKGUKUEJG #WUHÒJTWPI OKV DTKNNCPVKGTVGP 5VTCJNGP  5KNDGT DTKN   NCPVKGTV VGKNYGKUG \KUGNKGTV WPF XGTIQNFGV %JTKUVWU-TGW\ WPF *GT\ ,GUW&GEQTCVKQP )QNF VGKNYGKUG   GOCKNNKGTV FCU %JTKUVWU-TGW\ OKV OKP 'OCKNNGCDRNCV\WPI CWH FGO 4GXGTU *GTUVGNNGTDG\GKEJPWPI FGT   (KTOC5QW\CKP.KUUCDQPCP&QRRGNPCFGN<- ++





/KNKV·TKUEJGT1TFGP7PUGTGU*GTTP,GUWU%JTKUVWU=/KNKVCT1TFGOFG0QUUQ5GPJQT,GUWU%JTKUVQ?

DKU D\Y/KNKV·TKUEJGT%JTKUVWU1TFGP=1TFGO/KNKVCTFG%TKUVQ? UGKV /QFGNN OKV UQIGPCPPVGT*GT\,GUW&GMQTCVKQP $TWUVUVGTP\WO-QOOCPFGWT GTMGPPVNKEJCPFGPXKGT $NÒVGP CWH FGO /GFCKNNQPTKPI   RQTVWIKGUKUEJG #WUHÒJTWPI OKV DTKNNCPVKGTVGP 5VTCJNGP  5KNDGT DTKN   NCPVKGTV VGKNYGKUG \KUGNKGTV WPF XGTIQNFGV %JTKUVWU-TGW\ WPF *GT\ ,GUW&GQTCVKQP )QNF VGKNYGKUG   GOCKNNKGTV/GFCKNNQPHGNFDGYGINKEJCWHFGO4GXGTUXGTIQNFGVG*GTUVGNNGTDG\GKEJPWPIFGT(KTOC5QW\C KP.KUUCDQPCP&QRRGNPCFGN<- +p++



262


PORTUGAL

8694



8695

-ÌPKINKEJGT /KNKV·TKUEJGT1TFGPFGUJN$GPGFKMVXQP#XKU=4GCK  1TFGO /KNKVCTFG5$GPVQFG#XKU?D\Y/KNKV·TKUEJGT#XKU1TFGP=1TFGO/KNKVCTFG#XKU? UGKV  /QFGNN   4KVVGTMTGW\ KP FGT UQIGPCPPVGP OKNKV·TKUEJGP QFGT OQFGTPGP #WUHÒJTWPI 5KNDGT   XGTIQNFGVWPFGOCKNNKGTV\YGKOKP%JKRUCWH#XGTUWPF4GXGTUCOCNVGP$CPFOKV$CPFUEJPCNNG<- XCT ++



/KNKV·TKUEJGT1TFGPFGUJN,CMQDWUXQO5EJYGTV=1TFGO/KNKVCTFG56KCIQFC'URCFC? DKU  D\Y#NVGT8QTPGJOUVGTWPF#WUIG\GKEJPGVGT1TFGPFGUJN,CMQDWUHÒT8GTFKGPUVKP9KUUGPUEJCHV .KVGTCVWT WPF -WPUV =#PVKIC PQDKNÃUUKOC G GUENCTGEKFC 1TFGO FG 5 6KCIQ FQ O¾TKVQ EKGPVKHKEQ    NKVGT±TKQ G CTVÃUVKEQ?   D\Y /KNKV·TKUEJGT 1TFGP FGU JN ,CMQDWU =1TFGO /KNKVCT FG 5    6KCIQ? UGKV /QFGNN 1TFGPUMTGW\OKV5EJTKHVDCPF $TWUVUVGTP\WO)TQ­MTGW\#WU HÒJTWPI OKVINCVVGP5VTCJNGP 5KNDGTVGKNYGKUG5KNDGTXGTIQNFGV#WHNCIGPVGKNYGKUG)QNFGOCKNNKGTVCWH FGT 4ÒEMUGKVG *GTUVGNNGTDG\GKEJPWPIFGT(KTOC,#FC%QUVCKP.KUUCDQPCP&QRRGNPCFGNFKGUGOKV HTCP\ÌUKUEJGT'KPHWJT5KNDGTRWP\GXQPDKU 5EJYCPGPRWP\G <- ++



&KG\YKUEJGPWPFYQJNKP%QKODTCXQP#FNKIGPIGITÒPFGVG0GWGP/KNK\\WT$GM·ORHWPIFGT/CWTGP YWTFGXQP-ÌPKI&#NHQPUQ*GPTKSWGKPGKPGP4KVVGTQTFGPOKVFGT4GIGNFGUJN$GPGFKMVWOIGYCPFGNV YWTFG FGT 1TFGP PCEJ #XK\ VTCPUHGTKGTV WPF  YWTFG FCU ITÒPG .KNKGPMTGW\ CNU 1TFGPU\GKEJGP DGUV·VKIV /KV   )GUGV\ XQO  ,WPK  YCPFGNVG -ÌPKIKP & /CTKC XQP 2QTVWICN FGP DKUJGTKIGP 4KVVGTQTFGP \WUCOOGP OKV   /KNKV·TKUEJGP 1TFGP 7PUGTGU *GTTP ,GUW %JTKUVWU WPF FGO /KNKV·TKUEJGP 1TFGP FGU JN ,CMQDWU XQO 5EJYGTV  KP   GKPGP FTGKMNCUUKIGP )TQ­MTGW\ -QOOCPFGWT WPF 4KVVGT  8GTFKGPUVQTFGP WO WPF HÒIVG FGP 1TFGPUKPUKIPKGP FGU   UQIGPCPPVGP *GT\,GUW&GMQTCVKQP JKP\W /KV &CVWO XQO  #WIWUV  TGQTICPKUKGTVG -ÌPKI & %CTNQ XQP   2QTVWICN   FGP 1TFGP HÒIVG GKPG )TQ­QHHK\KGTUMNCUUG JKP\W WPF ·PFGTVG FKG +PUKIPKGP /KV &GMTGV XQO    1MVQDGT  YWTFG FGT 1TFGP XQP FGT RTQXKUQTKUEJGP 4GIKGTWPI FGT RQTVWIKGUKUEJGP 4GRWDNKM CWHIGJQDGP   LGFQEJOKV&GMTGVFGURQTVWIKGUKUEJGP5VCCVURT·UKFGPVGPXQO5GRVGODGTYKGFGTWPVGTFGO0COGP/KNKV·TK UEJGT#XK\1TFGPYKGFGTGTTKEJVGVYWTFGUEJNKG­NKEJPQEJFKG1HHK\KGTUMNCUUGJKP\WIGHÒIV XINCWEJ(QPUGEC #NXCTQ#WIWUVQFCWPF/CEGFQG%JCXGU,QµQ1TFGPU*QPQTÃHKECU2QTVWIWGUCU.KUUCDQPQ,%QUVC(TGFGTKEQ FC&¾EQTCVKQPU2QTVWICKUGU.KUUCDQP/CTKPK#FTKCPQ)NK1TFKPK%CXCNNGTGUEJK2QTVQIJGUK4QO 



8696





8697

1TFGP FGT 'ORH·PIPKU 7PUGTGT .KGDGP (TCW XQP 8KNC 8K¼QUC =1TFGO FG 0QUUC 5GPJQTC FG %QP   EGK¼µQ FG 8KNC 8K¼QUC? -NGKPQF \WO )TQ­MTGW\ )QNF VGKNYGKUG HGKPUV ITCXKGTV VGKNYGKUG GOCKNNKGTV   OOQJPG5EJWNVGTDCPF<- +p



1TFGP FGT 'ORH·PIPKU 7PUGTGT .KGDGP (TCW XQP 8KNC 8K¼QUC =1TFGO FG 0QUUC 5GPJQTC FG %QP   EGK¼µQFG8KNC8K¼QUC?-NGKPQF\WO)TQ­MTGW\5KNDGTXGTIQNFGVWPFVGKNYGKUGGOCKNNKGTVCOQTKIKPC NGPCNVGP5EJWNVGTDCPF<- ++

 263


PORTUGAL

8698

4'27$.+- 5'+6  

-ÌPKINKEJGT /KNKV·TKUEJGT1TFGPFGUJN$GPGFKMVXQP#XKU=4GCK  1TFGO /KNKVCTFG5$GPVQFG#XKU?D\Y/KNKV·TKUEJGT#XKU1TFGP=1TFGO/KNKVCTFG#XKU? UGKV  /QFGNN HÒPHMNCUUKI  UGKV   )TQ­QHHK\KGTUUGV DGUVGJGPF CWU )TQ­QHHK\KGTUMTGW\ 5KNDGT XGTIQNFGV   WPFGOCKNNKGTVCWHFGO$CPFTKPIRWP\KGTVCO*CNUDCPFWPF$TWUVUVGTP5KNDGTDTKNNCPVKGTVWPFXGTIQN FGV VGKNYGKUGGOCKNNKGTVCP0CFGN\WUCOOGPOKV/KPKCVWT5KNDGTXGTIQNFGVWPFGOCKNNKGTVCO$·PF EJGP KO QTKIKPCNGP OKV IQNFHCTDGPGO 5VCCVUYCRRGP DGFTWEMVGP 8GTNGKJWPIUGVWK FGT (KTOC (TGFGTKEQ   %QUVCKP.KUUCDQP<- 5VÒEM++



8GTNKGJGPCP)GPGTCN4KEECTFQ$KUQIPKGTQ IGD XQPDKU%JGHFGUKVCNKGPKUEJGP)GPGTCNUVCDGUFGT 8GTVGKFKIWPI

8699



/KNKV·TKUEJGT 1TFGP FGU JN ,CMQDWU XQO 5EJYGTV =1TFGO /KNKVCT FG 5 6KCIQ FC 'URCFC? DKU    D\Y#NVGT8QTPGJOUVGTWPF#WUIG\GKEJPGVGT1TFGPFGUJN,CMQDWUHÒT8GTFKGPUVKP9KU UGPUEJCHV .KVGTCVWT WPF -WPUV =#PVKIC PQDKNÃUUKOC G GUENCTGEKFC 1TFGO FG 5 6KCIQ FQ O¾TKVQ   EKGPVKHKEQNKVGT±TKQGCTVÃUVKEQ?  D\Y/KNKV·TKUEJGT1TFGPFGUJN,CMQDWU=1TFGO/KNK VCTFG56KCIQ? UGKV /QFGNN UGKV -QNNCPGFGT)TQ­MTGW\G)TQ­QHHK\KGTG-QOOCP FGWTG WPF 1HHK\KGTG DGUVGJGPF CWU  -TGW\ WPF -TCP\INKFGT OKV -NGKPQF 5KNDGT XGTIQNFGV WPF   GOCKNNKGTVGKPKIGMNGKPG'OCKNNGEJKRUCWHFGO8GTUEJNW­INKGF*GTUVGNNGTDG\GKEJPWPIFGT(KTOC,#FC %QUVCKP.KUUCDQP<- ++ NVGTGUEJYGTG#PHGTVKIWPICWUFGOGTUVGP&TKVVGNFGU,CJTJWPFGTVU

264




RUMÄNIEN

8702 8700 8701

47/0+'0 -¤0+)4'+%*   





/KNKV·TKUEJGT-TKGIUQTFGP/KEJCGNFGT6CRHGTG=1TFKPWN/KNKVCTFG4C\DQK/KJCK8KVGC\WN?/Q FGNN OKV /QPQITCOO -ÌPKI /KJCKU WPF ,CJTGU\CJN     -TGW\  -NCUUG $TQP\GXGT IQNFGVWPFGOCKNNKGTVCOCNVGPCWHFGT4ÒEMUGKVGXGTUEJOWV\VGP1TKIKPCNDCPF<- ++



1TFGP5VGTP4WO·PKGPU CWEJ1TFGPFGU5VGTPUXQP4WO·PKGP =1TFKPWN5VGCWC4QO³PKGK?/Q FGNN   #WUHÒJTWPI HÒT -TKGIU\GKVGP IGUVKHVGV  D\Y   OKV 5EJYGTVGTP FWTEJ FCU   /GFCKNNQP  4KVVGTMTGW\ 5KNDGT VGKNYGKUG XGTIQNFGV WPF GOCKNNKGTV QJPG 2WP\KGTWPI CO 6CRHGTMGKVU   DCPFTWO·PKUEJGT0·JCTVOKVCWHIGNGIVGT4QUGVVG UKE <- ++



1TFGP-TQPG4WO·PKGPU CWEJ1TFGPFGT-TQPGXQP4WO·PKGP =1TFKPWN%QTQCPC4QO³PKGK?/Q FGNN    #WUICDG OKV -TQPG CWU 'KUGP KO /GFCKNNQP    )TQ­QHHK\KGTUUGV   DGUVGJGPFCWU*CNUMTGW\5KNDGTXGTIQNFGVGOCKNNKGTV-TQPGCWU'KUGPQJPG2WP\KGTWPICO*CNUDCPF WPF$TWUVUVGTP5KNDGTVGKNYGKUGGOCKNNKGTV-TQPGCWU'KUGP/GFCKNNQPNGKEJVGKPIGFTÒEMV4GXGTUUVGTP LGFQEJWPDGUEJ·FKIVCWHFGO4GXGTU*GTUVGNNGTDG\GKEJPWPIFGT(KTOC,QUGRJ4GUEJ5QJPKP$WMC TGUVCP0CFGN<- ++



0CEJFGOFCUUKEJFCU(ÒTUVGPVWO4WO·PKGPCO/·T\\WOUQWXGT·PGP-ÌPKITGKEJRTQMNCOKGTVWPF(ÒTUV %CTQN CWU FGO *CWUG *QJGP\QNNGTP5KIOCTKPIGP  \WO -ÌPKI CWUIGTWHGP JCVVG UVKHVGVG FKGUGT CO  /CK    FGO 6CIG UGKPGT -TÌPWPI FGP HÒPHMNCUUKIGP )TQ­MTGW\ )TQ­QHHK\KGT -QOOCPFGWT 1HHK\KGT WPF 4KVVGT  <KXKN   WPF/KNKV·T8GTFKGPUVQTFGPOKVFGP-ÌPKINKEJGP&GMTGVGP0T8WPF8$KUEC YCTFKG-TQPGKO/GFCKNNQPXQP-TGW\WPF$TWUVUVGTPKP#PNGJPWPICPFKGō5V·JNGTPG-TQPG4WO·PKGPŋCWU'KUGP

/QFGNN#WUHÒJTWPI FCPCEJCWU5KNDGTQFGTXGTUKNDGTVGT$TQP\G /QFGNN#WUHÒJTWPI #O#WIWUV VTCV4WO·PKGPCWHFGT5GKVGFGT'PVGPVGKPFGP'TUVGP9GNVMTKGIGKPYQTCWH-ÌPKI(GTFKPCPFOKV-ÌPKINKEJGO &GMTGV0T+:XQO5GRVGODGTHÒT8GTFKGPUVGKO-TKGI5EJYGTVGTHÒTCNNG-NCUUGPUVKHVGVG /KV-ÌPKINKEJGO&GMTGV0T+8XQO#RTKNYWTFGHÒTFKGFTGKWPVGTGP-NCUUGP -QOOCPFGWT 1HHK\KGT WPF 4KVVGT  HÒT DGUQPFGTU VCRHGTGP 'KPUCV\ FKG /ÌINKEJMGKV FGT 8GTNGKJWPI CO $CPFG HÒT ō/KNKV·TKUEJG   6WIGPFŋ 6CRHGTMGKVUDCPF  IGUEJCHHGP #O  /CK  TGQTICPKUKGTVG -ÌPKI%CTQN++FGP1TFGPXQNNUV·PFKIOKV -ÌPKINKEJGO &GMTGV 0T  8  WPF ICD FGP +PUKIPKGP GKP PGWGU #WUUGJGP  /QFGNN  YQDGK FKG $TWUV   UVGTPG CPHCPIU PQEJ KJTG WTURTÒPINKEJG )TÌ­G DGJKGNVGP CDGT DCNF YGUGPVNKEJ MNGKPGT YWTFGP UQYKG GKP PGWGU   1TFGPUDCPF#O(GDTWCTUVKHVGVGGTOKV-ÌPKINKEJGO&GMTGV0T++GTI·P\VFWTEJFCU-ÌPKI NKEJG&GMTGV0T8+++XQO#WIWUVFKGō/KNKV·TCDVGKNWPIKP(TKGFGPU\GKVGPŋIGUVKHVGVFGTGP +PUKIPKGP GKPG -ÌPKIUMTQPG CNUªDGTJÌJWPIGTJKGNVGPWPFCO&G\GODGTYWTFGOKV-ÌPKINKEJGO&GMTGV 0T  :++  FKG ō#DVGKNWPI HÒT -TKGIU\GKVGPŋ FWTEJ *KP\WHÒIWPI XQP IGMTGW\VGP 5EJYGTVGTP HÒT FKG   +PUKIPKGP FGT/KNKV·TCDVGKNWPIWPFFCUUQIGPCPPVGō-TKGIUDCPFŋIGUEJCHHGP/KV-ÌPKINKEJGO&GMTGV0T :++XQO&G\GODGTIGUVCVVGVG-ÌPKI%CTQN++CWEJFKG8GTNGKJWPICNNGT-NCUUGPFGT\KXKNGP#DVGKNWPI CP (TCWGP YQDGK GKPG DGUQPFGTG &GMQTCVKQP FGT -QOOCPFGWTG UVCVV FGU *CNUMTGW\GU  IGUEJCHHGP YWTFG /KV   -ÌPKINKEJGO&GMTGV0T8+XQO,WPKYWTFGXQP-ÌPKI/KJCK+HÒTCNNG-NCUUGPFGT#DVGK NWPI HÒT -TKGIU\GKVGP HÒT DGUQPFGTU VCRHGTGP 'KPUCV\ FKG /ÌINKEJMGKV FGT 8GTNGKJWPI CO $CPFG HÒT ō/KNKV·TKUEJG   6WIGPFŋ 6CRHGTMGKVUDCPF IGUEJCHHGP#O,WPKUVKHVGVGGTOKV-ÌPKINKEJGO&GMTGV0T8+ HÒTFKGFTGKWPVGTGP-NCUUGPō'KEJGPDN·VVGTŋCNUDGUQPFGTG6CRHGTMGKVUCWU\GKEJPWPIFKG QFGT$N·VVGT CWHFGO 6CRHGTMGKVUDCPF FGU 4KVVGT QFGT 1HHK\KGTMTGW\GU D\Y CNU IGMTGW\VGU 'KEJGPNCWD CNU ªDGTJÌJWPI ÒDGT FGT -TQPG   FGU-QOOCPFGWTMTGW\GUCPIGDTCEJVYCTGPWPFUEJNKG­NKEJPQEJOKV-ÌPKINKEJGO&GMTGV0T:XQO 1MVQDGTHÒTFKG1HHK\KGTUMNCUUGFGT-TKGIUCDVGKNWPICO6CRHGTMGKVUDCPFCNUDGUQPFGTG#WU\GKEJPWPIGKPGP XKGTUVTCJNKIGP/GVCNNUVGTPFGTCWHFCU$CPFCWHIGNGIVYWTFG/KVFGT#DFCPMWPI-ÌPKI/KJCKU+CO&G\GODGT YWTFGCWEJFKG8GTNGKJWPIFGU1TFGPUō-TQPG4WO·PKGPUŋKP4WO·PKGPGKPIGUVGNNV#NNGTFKPIUJCVKP-ÌPKI /KJCKIGNGIGPVNKEJKO'ZKNCNU*CWUQTFGPYGKVGTJKPXGTNKGJGP 8INCWEJ9GDGT9KNJGNO-ÌPKI-CTN+5EJÌR HGTFGUOQFGTPGP4WO·PKGPU)TÒPFGTFGUTWO·PKUEJGP1TFGPUYGUGPUWPF5VKHVGTFGU1TFGPUō-TQPG4WO·PKGPUŋ +P1TFGPWPF'JTGP\GKEJGP,CJTICPI  0T5 

265


RUMÄNIEN

8705

8703 8706









8706

1TFGP-TQPG4WO·PKGPU CWEJ1TFGPFGT-TQPGXQP4WO·PKGP =1TFKPWN%QTQCPC4QO³PKGK?/Q FGNN    #WUICDG OKV -TQPG CWU 'KUGP KO /GFCKNNQP    1HHK\KGTUMTGW\   5KNDGT XGTIQNFGV WPF GOCKNNKGTV -TQPG 'KUGP #WUHÒJTWPI OKV CWH FGO 4GXGTU INCVVGP /QPQITCOOGP   CO$CPFQJPG4QUGVVG<- ++ 1TFGP-TQPG4WO·PKGPU CWEJ1TFGPFGT-TQPGXQP4WO·PKGP =1TFKPWN%QTQCPC4QO³PKGK?/Q FGNN    #WUICDG OKV -TQPG CWU 'KUGP KO /GFCKNNQP    1HHK\KGTUMTGW\   5KNDGT XGTIQNFGV WPF GOCKNNKGTV -TQPG 'KUGP #WUHÒJTWPI OKV CWH FGO 4GXGTU INCVVGP /QPQITCOOGP   QJPG$CPF<-&C\W/GFCKNNG\WOL·JTKIGP4GIKGTWPIULWDKN·WO-ÌPKI%CTQNU#WUICDGHÒT <KXKNKUVGPCO$CPF7PF-TKGIUGTKPPGTWPIUMTGW\CO$CPFUQYKGGKPGMNGKPG/GFCKNNGWPF GKP#D\GKEJGP/#46+' ++ 1TFGP-TQPG4WO·PKGPU CWEJ1TFGPFGT-TQPGXQP4WO·PKGP =1TFKPWN%QTQCPC4QO³PKGK?/Q FGNN    #WUICDG OKV -TQPG CWU 'KUGP KO /GFCKNNQP    4KVVGTMTGW\ 5KNDGT   GOCKNNKGTV -TQPG 'KUGP #WUHÒJTWPI OKV CWH FGO 4GXGTU INCVVGP /QPQITCOOGP CO PKEJV MQTTGMVGP   $CPFTWO·PKUEJGT0·JCTV<-&C\W1TFGP8GTVGKFKIWPIFGU8CVGTNCPFGU/QFGNNOKV454 &GMQTCVKQP-NCUUGXGTIQNFGVVGKNYGKUGXGTUKNDGTVQJPG2GPVCIQPCNURCPIG<- ++ 1TFGP-TQPG4WO·PKGPU CWEJ1TFGPFGT-TQPGXQP4WO·PKGP =1TFKPWN%QTQCPC4QO³PKGK?/Q FGNN    #WUICDG OKV -TQPG CWU 5KNDGT KO /GFCKNNQP    )TQ­MTGW\-NGKPQF   5KNDGTXGTIQNFGVGOCKNNKGTVQJPG2WP\KGTWPIFKGDGKFGPWPVGTGP-TGW\URKV\GPMCWOUKEJVDCTIGUVCWEJV QJPG5EJWNVGTDCPF<- ++

8707











8708 8709

1TFGP-TQPG4WO·PKGPU CWEJ1TFGPFGT-TQPGXQP4WO·PKGP =1TFKPWN%QTQCPC4QO³PKGK?/Q FGNN  #WUICDG OKV-TQPGCWU5KNDGTKO/GFCKNNQP 1HHK\KGTUMTGW\$TQP\G XGTIQNFGVGOCKNNKGTVCOQTKIKPCNGP$CPFTWO·PKUEJGT0·JCTVOKVCWHIGNGIVGT4QUGVVG<- ++





1TFGP-TQPG4WO·PKGPU CWEJ1TFGPFGT-TQPGXQP4WO·PKGP =1TFKPWN%QTQCPC4QO³PKGK?/Q FGNN    #WUICDG OKV -TQPG CWU 5KNDGT KO /GFCKNNQP    4KVVGTMTGW\ OKV   5EJYGTVGTP 5KNDGT GOCKNNKGTV 'OCKNNGCDURNKVVGTWPIGP WPF TGRCTCVWTGP KP FGP /GFCKNNQPTKPIGP CO   QTKIKPCNGP$CPFTWO·PKUEJGT0·JCTV<- ++p





1TFGP-TQPG4WO·PKGPU CWEJ1TFGPFGT-TQPGXQP4WO·PKGP =1TFKPWN%QTQCPC4QO³PKGK?/Q FGNN   #WUHÒJTWPI HÒT /KNKV·TXGTFKGPUV KP (TKGFGPU\GKVGP OKV -TQPG  4KVVGTMTGW\ 5KNDGT   VGKNYGKUGXGTIQNFGVWPFGOCKNNKGTVKO$CPFTKPIOGJTHCEJIGRWP\VCO-TKGIUDCPFTWO·PKUEJGT0·JCTV KP GKPGO TQVGP 'VWK FGT /QPVCTKC 0CVKQPCNC HÒT GKP 1HHK\KGTUMTGW\ OKV IQNFHCTDGPGO /QPQITCOO   -ÌPKI%CTQNU++<- ++



&KG #WUICDGP OKV -TQPG WPF QJPG 5EJYGTVGT FKGUGU /QFGNNU UKPF YGKVCWU UGNVGPGT \W HKPFGP CNU FKGLGPKIGP OKV   5EJYGTVGTP

266


RUMÄNIEN

8713 (1:1) 8710 8711









1TFGP -TQPG 4WO·PKGPU CWEJ 1TFGP FGT -TQPG XQP 4WO·PKGP  =1TFKPWN %QTQCPC 4QO³PKGK?    /QFGNN   #WUHÒJTWPI HÒT -TKGIU\GKVGP OKV -TQPG WPF 5EJYGTVGTP  4KVVGTMTGW\5KNDGT VGKNYGKUG XGTIQNFGV WPF GOCKNNKGTV CO -TKGIUDCPF TWO·PKUEJGT 0·JCTV KP GKPGO 'VWK FGT /QPVCTKC   0CVKQPCNCHÒTGKP1HHK\KGTUMTGW\OKVIQNFHCTDGPGO/QPQITCOO-ÌPKI/KJCKU<- ++



1TFGP -TQPG 4WO·PKGPU CWEJ 1TFGP FGT -TQPG XQP 4WO·PKGP  =1TFKPWN %QTQCPC 4QO³PKGK?   /QFGNN  #WUHÒJTWPIHÒT-TKGIU\GKVGP OKV-TQPGWPF5EJYGTVGTP 1HHK\KGTUMTGW\$TQP\G XGTIQNFGV WPF GOCKNNKGTV CO 6CRHGTMGKVUDCPF TWO·PKUEJGT 0·JCTV OKV CWHIGNGIVGT 4QUGVVG KO GVYCU   DGUEJ·FKIVGP'VWKFGT/QPVCTKC0CVKQPCNCHÒTGKP1HHK\KGTUMTGW\OKVIQNFHCTDGPGO/QPQITCOO-ÌPKI /KJCKU<- ++



1TFGP -TQPG 4WO·PKGPU CWEJ 1TFGP FGT -TQPG XQP 4WO·PKGP  =1TFKPWN %QTQCPC 4QO³PKGK?   /QFGNN  #WUHÒJTWPIHÒT-TKGIU\GKVGP OKV-TQPGWPF5EJYGTVGTP 1HHK\KGTUMTGW\$TQP\G XGTIQNFGVWPFGOCKNNKGTVCO6CRHGTMGKVUDCPFTWO·PKUEJGT0·JCTVQJPG4QUGVVG<- ++



'TKPPGTWPIUOGFCKNNGFGT0CVKQPCNGP4WO·PKUEJGP1TVJQFQZGP)GUGNNUEJCHVCP5VGHCPFGP)TQ­GP =5VGHCPEGN/CTG?5KNDGTOOQJPG$CPF ++



5VGHCPFGT)TQ­G=5VGHCPEGN/CTG?  YCTGKPOQNFCWKUEJGT9QLYQFGFGTWPF/KVJKNHGFGUYCNCEJK UEJGP9QLYQFGP8NCF+++&TCEWNGC  FGP6JTQPFGU(ÒTUVGPVWOU/QNFCWDGUVKGI'TYKTFKPFGTTWO· PKUEJGPQTVJQFQZGP-KTEJGCNU*GKNKIGTXGTGJTVFCGTPGDGP\CJNTGKEJGP$GHGUVKIWPIGPCWEJ-KTEJGPWPF-NÌUVGT GTTKEJVGP NKG­ YQXQP JGWVG GKPKIG \WO 9GNVMWNVWTGTDG FGT 70'5%1 \·JNGP  WO FCU .CPF CWEJ MWNVWTGNN CWH\W   DCWGP +P GKPGT ¤HHGPVNKEJGP #DUVKOOWPI  ÒDGT FKG  ITÌ­VGP 4WO·PGP FGT )GUEJKEJVG YWTFG GT CP GTUVGT   5VGNNG\WO)TÌ­VGPCNNGT4WO·PGPIGY·JNVIGHQNIVXQOGTUVGPTWO·PKUEJGP-ÌPKI%CTQN+  

8714

51<+#.+56+5%*'4'27$.+-   

1TFGP#WIWUV=1TFKPWN#WIWUV?/QFGNN OKV454KO/GFCKNNQP $TWUVUVGTP -NCUUG$WPVOGVCNNXGTIQNFGVVGKNYGKUGGOCKNNKGTVOKV5KOKNKUVGKPGPDGUGV\VGVYCUCPIGNCWHGPCP0CFGN <- ++p

 267


RUSSLAND

4755.#0& <#4'067/ $+5 14&'0 

&KGUG-CVCNQIRQUKVKQPGPVH·NNV





-CKUGTNKEJGT WPF -ÌPKINKEJGT 1TFGP XQO 9GK­GP #FNGT =Îðäåí èìïåð±òîðñêèé è êîðîë¾âñêèé   Áåëîãî Îðëà? 'KPHCEJG 5COONGTCPHGTVKIWPI UKORNG EQNNGEVQT U EQR[  FGU -NGKPQFGU FGU 'TUVGP /Q   FGNNUXQPDKUXGTIQNFGVWPFGOCKNNKGTVD\YNCEMKGTV ++

8718

8717





-CKUGTNKEJGT 1TFGP FGU JGKNKIGP )TQ­O·TV[TGTU )GQTI FGU 5KGITGKEJGP =Îðäåí èìïåð±òîðñêèé   Ñâÿòîãî Âåëèêîìó÷åíèêà è Ïîáåäîíîñöà Ãåîðãèÿ?5V)GQTIU5QNFCVGPMTGW\/QFGNN GKPMNCUUKI  ZOO5KNDGTCWHFGO4GXGTUPWOOGTKGTVUGJTUVCTMIGVTCIGPQJPG $CPF447 4+++



&GO  XQP <CTKP -CVJCTKPC ++ IGUVKHVGVGP 5V )GQTIU1TFGP CHHKNKKGTV YCT FCU OKV /CPKHGUV <CT #NGZCPFGT +   2GVTQYKVUEJ XQO  (GDTWCT IGUVKHVGVGGKPMNCUUKIGō'JTGP\GKEJGPFGU/KNKV·TKUEJGP1TFGPUŋ#O#WIWUV YWTFGFCU-TGW\HÒT0KEJV%JTKUVGPIGPGJOKIV/KVMCKUGTNKEJGO7MCU<CT#NGZCPFGTU++XQO/·T\ GTJKGNV FCU 'JTGP\GKEJGP  -NCUUGP /KVFGPPGWGP1TFGPUUVCVWVGPXQO#WIWUVGTJKGNVFCU'JTGP\GKEJGP FGP0COGPō5V)GQTIU-TGW\ŋ0CEJFGOGUXQPFGT2TQXKUQTKUEJGP4GIKGTWPIÒDGTPQOOGPYQTFGPYCTKUV GUXQPFGP$QNUEJGYKMKCDIGUEJCHHVYQTFGPYWTFGCDGTY·JTGPFFGU$ÒTIGTMTKGIGUXQPGKPKIGP)GPGT·NGPFGT UQIGPCPPVGP9GK­GP#TOGGDKUKPFKGHTÒJGPGT,CJTGYGKVGTXGTNKGJGP/KVFGPPGWGP1TFGPUUVCVWVGPYWTFGCWEJ FKGXQP<CT#NGZCPFGT++IGUVKHVGVGWPFCO#WIWUVCWHXKGT-NCUUGPGTYGKVGTVG6CRHGTMGKVUOGFCKNNGOKVFGT PGWGP $G\GKEJPWPI ō5V )GQTIU/GFCKNNG HÒT 6CRHGTMGKVŋ FGO 1TFGP CHHKNKKGTV 'DGPHCNNU  XQP FGT 2TQXKUQTK   UEJGP4GIKGTWPIÒDGTPQOOGPYQTFGPKUVUKGXQPFGP$QNUEJGYKMKCDIGUEJCHHVYQTFGPYWTFGCDGTY·JTGPF FGU$ÒTIGTMTKGIGUXQPGKPKIGP)GPGT·NGPFGTUQIGPCPPVGP9GK­GP#TOGGDKUKPFKGHTÒJGPGT,CJTGYGKVGTXGTNKG JGP#NUGKP\KIG\CTKUVKUEJG#WU\GKEJPWPIGPFWTHVGPKPFGT7F554FCU5V)GQTIU-TGW\WPFFKG5V)GQTIU/GFCKNNG HÒT 6CRHGTMGKV KP KJTGP LGYGKNKIGP -NCUUGP YGKVGT IGVTCIGP YGTFGP&KG 6TCFKVKQP FGU 5V )GQTI1TFGPU YWTFG KP   IGYKUUGT9GKUGKPFGTUR·VGTGP5QYLGVWPKQPFWTEJFGPFTGKMNCUUKIGP4WJOGU1TFGP=Îðäåí Ñëàâü³?HQTVIGHÒJTVFGT OKV &GMTGV FGU 2T·UKFKWOU FGU 1DGTUVGP 5QYLGVU FGT 7F554 XQO  0QXGODGT  IGUVKHVGV YWTFG&GT1TFGP FGTCO$CPFFGU5V)GQTI1TFGPUIGVTCIGPYWTFGMQPPVGHÒTRGTUÌPNKEJG6CRHGTMGKVY·JTGPFFGU)TQ­GP8CVGT N·PFKUEJGP-TKGIGUXQPDKUXGTNKGJGPYGTFGP



-CKUGTNKEJGT 1TFGP FGU JGKNKIGP )TQ­O·TV[TGTU )GQTI FGU 5KGITGKEJGP =Îðäåí èìïåð±òîðñêèé   Ñâÿòîãî Âåëèêîìó÷åíèêà è Ïîáåäîíîñöà Ãåîðãèÿ?5V)GQTIU5QNFCVGPMTGW\/QFGNN GKPMNCUUKI     Z  OO 5KNDGT CWH FGO 4GXGTU PWOOGTKGTV   UGJT UVCTM IGVTC   IGPQJPG$CPF447 4+++

8719





8720

-CKUGTNKEJGT 1TFGP FGU JGKNKIGP )TQ­O·TV[TGTU )GQTI FGU 5KGITGKEJGP =Îðäåí èìïåð±òîðñêèé   Ñâÿòîãî Âåëèêîìó÷åíèêà è Ïîáåäîíîñöà Ãåîðãèÿ? 5V )GQTIU5QNFCVGPMTGW\ #WUICDG HÒT FKG   2TGW­KUEJGP #NNKKGTVGP   Z  OO 5KNDGT CWH FGO 4GXGTU 6T·IGTPWOOGT 0  QJPG   $CPF447 4++



<CT0KMQNCWU+2CYNQYKVUEJ  UVKHVGVGFCU-TGW\KO,WNKCWU#PNC­FGT'PVJÒNNWPIFGU&GPMOCNUHÒT FKG5EJNCEJVXQP$QTQFKPQ 5GRVGODGT WPFXGTNKGJGUCPPQEJNGDGPFGRTGW­KUEJGP8GVGTCPGPFGT5EJNCEJ VGP\YKUEJGPWPF



268

-CKUGTNKEJGT 1TFGP FGU JGKNKIGP )TQ­O·TV[TGTU )GQTI FGU 5KGITGKEJGP =Îðäåí èìïåð±òîðñêèé   Ñâÿòîãî Âåëèêîìó÷åíèêà è Ïîáåäîíîñöà Ãåîðãèÿ? 5V )GQTIU5QNFCVGPMTGW\  /QFGNN  

XKGTMNCUUKI #WUHÒJTWPI  -TGW\-NCUUG5KNDGTCWHFGO4GXGTUPWOOG TKGTV0QCOCNVGP$CPFOKV$CPFUEJNGKHG447 ++




RUSSLAND

8721 Rv.



8722 Rv.

8723 Rv.

8724 Rv.

-CKUGTNKEJGT 1TFGP FGU JGKNKIGP )TQ­O·TV[TGTU )GQTI FGU 5KGITGKEJGP =Îðäåí èìïåð±òîðñêèé   Ñâÿòîãî Âåëèêîìó÷åíèêà è Ïîáåäîíîñöà Ãåîðãèÿ? 5V )GQTIU5QNFCVGPMTGW\  /QFGNN  

XKGTMNCUUKI #WUHÒJTWPI  -TGW\-NCUUG5KNDGTCWHFGO4GXGTUPWOOG TKGTVQJPG$CPF447 ++p+++



-CKUGTNKEJGT 1TFGP FGU JGKNKIGP )TQ­O·TV[TGTU )GQTI FGU 5KGITGKEJGP =Îðäåí èìïåð±òîðñêèé   Ñâÿòîãî Âåëèêîìó÷åíèêà è Ïîáåäîíîñöà Ãåîðãèÿ? 5V )GQTIU5QNFCVGPMTGW\  /QFGNN  

XKGTMNCUUKI #WUHÒJTWPI  -TGW\-NCUUG5KNDGTCWHFGO4GXGTUPWOOG TKGTV )TCXWT COCNVGP$CPF447 ++p+++





-CKUGTNKEJGT 1TFGP FGU JGKNKIGP )TQ­O·TV[TGTU )GQTI FGU 5KGITGKEJGP =Îðäåí èìïåð±òîðñêèé   Ñâÿòîãî Âåëèêîìó÷åíèêà è Ïîáåäîíîñöà Ãåîðãèÿ? 5V )GQTIU5QNFCVGPMTGW\  /QFGNN  

XKGTMNCUUKI #WUHÒJTWPI  -TGW\-NCUUG5KNDGTCWHFGO4GXGTUPWOOG TKGTVQJPG$CPF447 ++p+++





-CKUGTNKEJGT 1TFGP FGU JGKNKIGP )TQ­O·TV[TGTU )GQTI FGU 5KGITGKEJGP =Îðäåí èìïåð±òîðñêèé   Ñâÿòîãî Âåëèêîìó÷åíèêà è Ïîáåäîíîñöà Ãåîðãèÿ? 5V )GQTIU5QNFCVGPMTGW\  /QFGNN  

XKGTMNCUUKI #WUHÒJTWPI  -TGW\-NCUUG5KNDGTCWHFGO4GXGTUPWOOG TKGTVQJPG$CPF447 ++





8725 Rv.



8726 Rv.

8727 Rv.

8728 Rv.

-CKUGTNKEJGT 1TFGP FGU JGKNKIGP )TQ­O·TV[TGTU )GQTI FGU 5KGITGKEJGP =Îðäåí èìïåð±òîðñêèé   Ñâÿòîãî Âåëèêîìó÷åíèêà è Ïîáåäîíîñöà Ãåîðãèÿ? 5V )GQTIU5QNFCVGPMTGW\  /QFGNN  

XKGTMNCUUKI #WUHÒJTWPI  -TGW\-NCUUG5KNDGTCWHFGO4GXGTUPWOOG TKGTVQJPG$CPF447 ++p+++



-CKUGTNKEJGT 1TFGP FGU JGKNKIGP )TQ­O·TV[TGTU )GQTI FGU 5KGITGKEJGP =Îðäåí èìïåð±òîðñêèé   Ñâÿòîãî Âåëèêîìó÷åíèêà è Ïîáåäîíîñöà Ãåîðãèÿ? 5V )GQTIU5QNFCVGPMTGW\  /QFGNN  

XKGTMNCUUKI #WUHÒJTWPI  -TGW\-NCUUG5KNDGTCWHFGO4GXGTUPWOOG TKGTVCOCNVGPRGPVCIQPCNIGHCNVGVGP$CPF447 ++p+++



-CKUGTNKEJGT 1TFGP FGU JGKNKIGP )TQ­O·TV[TGTU )GQTI FGU 5KGITGKEJGP =Îðäåí èìïåð±òîðñêèé   Ñâÿòîãî Âåëèêîìó÷åíèêà è Ïîáåäîíîñöà Ãåîðãèÿ? 5V )GQTIU5QNFCVGPMTGW\  /QFGNN  

XKGTMNCUUKI #WUHÒJTWPI  -TGW\-NCUUG5KNDGTCWHFGO4GXGTUPWOOG TKGTV/QJPG$CPF447 ++





-CKUGTNKEJGT 1TFGP FGU JGKNKIGP )TQ­O·TV[TGTU )GQTI FGU 5KGITGKEJGP =Îðäåí èìïåð±òîðñêèé   Ñâÿòîãî Âåëèêîìó÷åíèêà è Ïîáåäîíîñöà Ãåîðãèÿ? 5V )GQTIU5QNFCVGPMTGW\  /QFGNN  

XKGTMNCUUKI #WUHÒJTWPI OKV$WEJUVCDGPÁWPF/HÒT9GK­OGVCNNCWHFGT4ÒEM UGKVG -TGW\-NCUUG9GK­OGVCNNCWHFGO4GXGTUPWOOGTKGTVQJPG$CPF447 # ++





-CKUGTNKEJGT 1TFGP FGU JGKNKIGP )TQ­O·TV[TGTU )GQTI FGU 5KGITGKEJGP =Îðäåí èìïåð±òîðñêèé   Ñâÿòîãî Âåëèêîìó÷åíèêà è Ïîáåäîíîñöà Ãåîðãèÿ? 5V )GQTIU5QNFCVGPMTGW\  /QFGNN  

XKGTMNCUUKI    YQJN UQYLGVKUEJG   0CEJHGTVKIWPI EQR[ GKPGU-TGW\GU-NCUUGCWUFGO NGV\VGP&TKVVGNFGU<YCP\KIUVGP,CJTJWPFGTVUXGTIQNFGVCPUQYLGVKUEJGT2GPVCIQPCNDCPFURCPIG ++







#NU GKP\KIG \CTKUVKUEJG #WU\GKEJPWPIGP FWTHVGP KP FGT <GKV FGT 5QYLGVWPKQP XQP FGP $GNKGJGPGP FKG 5V )GQTIU   5QNFCVGPMTGW\GWPFFKG5V)GQTIU/GFCKNNGPHÒT6CRHGTMGKVYGKVGTIGVTCIGPYGTFGPCWEJ\WUCOOGPOKVFGPUR·VGT GTYQTDGPGPUQYLGVKUEJGP1TFGPWPF'JTGP\GKEJGPYCU\CJNTGKEJG2JQVQITCRJKGPDGNGIGPMÌPPGP



&KGUG-CVCNQIRQUKVKQPGPVH·NNV

 269


RUSSLAND

8731 (1:1)



-CKUGTNKEJGT1TFGPFGTJGKNKIGP#PPC=Îðäåí èìïåð±òîðñêèé Ñâÿòîé Àííû?/QFGNN CD  $TWUVUVGTP &WTEJOGUUGT  OO 5KNDGT VGKNYGKUG XGTIQNFGV VGKNYGKUG GOCKNNKGTV CWH FGO 4GXGTU   &QRRGNCFNGTRWP\GFGT*QHNKGHGTCPVGPXQPDKU*GTUVGNNGTDG\GKEJPWPIFGT(KTOC-GKDGNKP5V 2GVGTUDWTIWPF5V2GVGTUDWTIGT<QNQVPKMK5KNDGTRWP\GXQPDKUCP0CFGNFKGUGGDGPHCNNU OKV &QRRGNCFNGTRWP\G FGT *QHNKGHGTCPVGP XQP  DKU  *GTUVGNNGTDG\GKEJPWPI FGT (KTOC -GKDGN   WPFGVYCUXGTUEJNCIGPGT5V2GVGTUDWTIGT<QNQVPKMK5KNDGTRWP\GXQPDKU<- ++  #NUGKPMNCUUKIGT1TFGPYWTFGGTCO(GDTWCTXQP%CTN(TKGFTKEJ*GT\QIXQP*QNUVGKP)QVVQTR   \WO )GFGPMGP CP UGKPG XGTUVQTDGPG )GOCJNKP #PPC 2GVTQYPC GKPGT 6QEJVGT <CT 2GVGTU FGU )TQ­GP IGUVKHVGV    /QFGNN  'T YWTFG FGT JGKNKIGP #PPC FKG KP GKPKIGP CRQMT[RJGP 'XCPIGNKGP CNU /WVVGT FGT )QVVGUOWVVGT /CTKC   IGPCPPVKUVIGYKFOGVō#WHFGO'TDYGIŋIGNCPIVGGTÒDGT%CTN(TKGFTKEJU5QJP*GT\QI%CTN2GVGT(TKGFTKEJXQP *QNUVGKP)QVVQTR FGO UR·VGTGP <CTGP 2GVGT +++   )GOCJN <CTKP -CVJCTKPCU ++ FGT )TQ­GP      PCEJ4W­NCPFYQGTCWEJPCEJFGO8GT\KEJV-CVJCTKPCU++ HÒTKJTGP5QJP2CWN CWHFCU*GT\QIVWO*QN UVGKP)QVVQTR KO ,CJT  XGTDNKGD/KV FGT #RRTQDCVKQP PGWGT 1TFGPUUVCVWVGPCO#RTKNFGO6CIUGKPGT -TÌPWPIFWTEJ<CT2CWN+2GVTQYKVUEJ  YWTFGGTCNUGTUVXQPFCCPTWUUKUEJGT1TFGPCWHFTGK-NCUUGP GTYGKVGTV  /QFGNN  5GKV FGO  #WIWUV  MQPPVGP IGO·­ GKPGT LGYGKNKIGP RGTUÌPNKEJGP 'PVUEJGKFWPI FGU   <CTGP 4KVVGT FGU 5V #PFTGCU1TFGPU FKG FGP 5V #PPGP1TFGP PQEJ PKEJV GTJCNVGP JCVVGPFKGUGPINGKEJ\GKVKIOKV LGPGOGTJCNVGP+O5GRVGODGTYWTFGFKGDKUJGTKIG-NCUUG FGTDGTGKVUOKV7MCUXQO0QXGODGT IGUVKHVGVG5V#PPGP5·DGN KPFKG-NCUUGWOIGYCPFGNVWPFGKP-TGW\-NCUUGIGUVKHVGV#WUFGT-NCUUGFGO 5V #PPGP5·DGN FGT CNU #WU\GKEJPWPI HÒT  &KGPUVLCJTG XQP 7PVGTQHHK\KGTG WPF /CPPUEJCHVGP IGFCEJV YCT FGT   UR·VGT CDGT CWEJ CNU 6CRHGTMGKVU#WU\GKEJPWPI XGTYGPFGV YWTFG IKPI UR·VGT FCU 5V #PPGP'JTGP\GKEJGP JGT   XQT YWTFG FKG )GUVCNVWPI FGT +PUKIPKGP XGT·PFGTV  /QFGNN  WPF OKV 7MCU <CT 0KMQNCWU + 2CYNQYKVUEJ  

 XQO,WPKGTJKGNVFKGFTKVVG-NCUUGHÒT/KNKV·TXGTFKGPUVGKPGCWHFGO$CPFCPIGDTCEJVG5EJNGKHG /KVFGPPGWGP5VCVWVGPXQPYWTFGKPFGTWPF-NCUUGCNUDGUQPFGTGT)PCFGPGTYGKUFKG-TQPGÒDGTFGO -TGW\ XGTNKGJGPDKU #O#WIWUVYWTFGPFKG-NGKPQFGWPFCO1MVQDGTFKG$TWUVUVGTPGHÒT 0KEJV%JTKUVGPIGPGJOKIV7PVGTFGO,WNKGTJKGNVFGT1TFGPPGWG5VCVWVGPYWTFGFKG8GTNGKJWPIXQP $TWUVUVGTPGP KP /GVCNN QHHK\KGNN IGPGJOKIV /KV MCKUGTNKEJGO 7MCU <CT #NGZCPFGT ++ 0KMQNCLGYKVUEJ     XQO  #WIWUV  YWTFGP IGMTGW\VG 5EJYGTVGT CWH FGP +PUKIPKGP HÒT 8GTNGKJWPIGP ōHÒT 6CRHGTMGKV KO -CORHŋ   IGPGJOKIV<YCT JÌTVG OKVFGO7PVGTICPIFGU<CTGPVWOUCWEJFGT1TFGPCWH\WDGUVGJGPYWTFGCDGTY·J TGPFFGU$ÒTIGTMTKGIGUXQPGKPKIGP)GPGT·NGPFGTUQIGPCPPVGP9GK­GP#TOGGDKUKPFKGHTÒJGPGT,CJTGYGKVGT XGTNKGJGP

270


RUSSLAND

8732 (1:1)



-CKUGTNKEJGT1TFGPFGTJGKNKIGP#PPC=Îðäåí èìïåð±òîðñêèé Ñâÿòîé Àííû?/QFGNN CD  -TGW\-NCUUGZOO)QNFVGKNYGKUG\KUGNKGTVWPFGOCKNNKGTVI'OCKNNGOCNGTGKXKGT 'OCKNNGUEJ·FGPCWH#XGTUWPF4GXGTU'OCKNNGURTÒPIGWPFMTCV\GTCWHFGO4GXGTUWPVGTFGT'OCKNNG &QRRGNCFNGTRWP\GFGT*QHNKGHGTCPVGPXQPDKUWPF/GKUVGTOCTMG+-HÒT,WNKWU-GKDGNKP5V 2GVGTUDWTIKPFGT¤UG5V2GVGTUDWTIGT<QNQVPKMK)QNFRWP\GXQPDKUQJPG$CPF<-  +8



/KV1VVQ5COWGN-GKDGN  DGVTCVNCWV6COOCPP KP6425HH FCUGTUVG/KVINKGFGKPGTICP\GP)QNF UEJOKGFG&[PCUVKG FKG TWUUKUEJG $ÒJPG FGT UGNDUV CDGT PQEJ MGKPG 1TFGP HGTVKIVG 5GKP 0GHHG ,QJCPP 9KNJGNO  

 GTJKGNVKP0CEJHQNIGXQP'OOCPWGN)GQTIXQP2CPPCUEJ\WUCOOGPOKV9KNJGNO-·OOGTGTXQO 1TFGPUMCRKVGN FGP #WHVTCI \WT *GTUVGNNWPI CNNGT TWUUKUEJGP 1TFGP 5GKP 5QJP ,WNKWU +XCP  'FWCTF -GKDGN     NGTPVGDGKUGKPGO8CVGTWPFYWTFG/GKUVGT0CEJFGUUGP6QFÒDGTPCJOGTUEJNKG­NKEJFKG(KTOC FKGGTDKU\WUGKPGO6QFGNGKVGVG

8733 (1:1)





8734 (1:1)

-CKUGTNKEJGT1TFGPFGTJGKNKIGP#PPC=Îðäåí èìïåð±òîðñêèé Ñâÿòîé Àííû?/QFGNN CD  -TGW\FGT-NCUUGZOO)QNFGOCKNNKGTVI'OCKNNGOCNGTGKCWHFGO4GXGTUFGUQDG TGP-TGW\CTOUWPVGTFGT'OCKNNGWPNGUGTNKEJG/GKUVGTOCTMGWPFCWHFGO4GXGTUFGUWPVGTGP-TGW\CTOU WPVGTFGT'OCKNNG*GTUVGNNGTDG\GKEJPWPIÝÄÓÀÐÄÚHÒTFKG(KTOC'FWCTFKP5V2GVGTUDWTICWHFGT ¤UG  <QNQVPKMK -QMQUJPKM)QNFRWP\G XQP  DKU  CO $CPFTKPI FCTCWH -QMQUJPKM)QNF   RWP\GXQPDKUQJPG$CPF447<- ++



-CKUGTNKEJGT1TFGPFGTJGKNKIGP#PPC=Îðäåí èìïåð±òîðñêèé Ñâÿòîé Àííû?/QFGNN CD  -TGW\ FGT  -NCUUG  Z OOIGHGTVKIVCWUGKPGO-TGW\OKV5EJYGTVGTPFKG5EJYGTVGTITKHHG WPF URKV\GP HCEJIGTGEJV GPVHGTPV )QNF GOCKNNKGTV  I 'OCKNNGOCNGTGK OGJTGTG 'OCKNNGEJKRU CWH   8QTFGT WPF 4ÒEMUGKVG CWH FGO 4GXGTU FGU QDGTGP -TGW\CTOU WPVGT FGT 'OCKNNG UEJYGT NGUGTNKEJG   /GKUVGTOCTMGYQJNÏÀ"HÒT2CXGN#PFTGGXKP5V2GVGTUDWTICWHFGT¤UGPWTPQEJVGKNYGKUGNGUGTNKEJG <QNQVPKMK)QNFRWP\GCOYQJNUR·VGTGTI·P\VGP$CPFTKPIFCTCWH-QMQUJPKM)QNFRWP\GXQPDKU QJPG$CPF447<- ++p+++



2CXGN #PFTGGX CTDGKVGVG NCWV 6COOCP KP 642 5   KP FGT \YGKVGP *·NHVG FGU ,CJTJWPFGTVUKP5CPMV2GVGTU DWTI



&KGUG-CVCNQIRQUKVKQPGPVH·NNV





&KGUG-CVCNQIRQUKVKQPGPVH·NNV

 271


RUSSLAND

8739 (1:1) 8737 (1:1)







-CKUGTNKEJGT WPF -ÌPKINKEJGT 1TFGP XQO JGKNKIGP 5VCPKUNCWU =Îðäåí èìïåð±òîðñêèé è   êîðîë¾âñêèé Ñâÿòîãî Ñòàíèñëàâà?  /QFGNN  #WUICDG EC   -TGW\  -NCUUG )QNF   GOCKNNKGTVI'OCKNNGOCNGTGKNKPMGT-TGW\CTOUKEJVDCTPCEJGOCKNNKGTVCWHFGO4GXGTU&QRRGNCF NGTHÒT*QHNKGHGTCPVGPXQPDKUWPF/GKUVGTOCTMG#-HÒT#NDGTV-GKDGNKP5CPMV2GVGTUDWTI KPFGT¤UG5V2GVGTUDWTIGT<QNQVPKMK)QNFRWP\GXQPDKUCWHFGO$CPFTKPI5V2GVGTUDWT IGT5VCFVRWP\GXQPDKUQJPG$CPF<- ++p+++



-CKUGTNKEJGT WPF -ÌPKINKEJGT 1TFGP XQO JGKNKIGP 5VCPKUNCWU =Îðäåí èìïåð±òîðñêèé è   êîðîë¾âñêèé Ñâÿòîãî Ñòàíèñëàâà?  /QFGNN  #WUICDG EC   -TGW\  -NCUUG )QNF   GOCKNNKGTV  I 'OCKNNGOCNGTGK CWH FGO 4GXGTU &QRRGNCFNGT HÒT *QHNKGHGTCPVGP XQP  DKU    WPF/GKUVGTOCTMG+-HÒT,WNKWU-GKDGNKP5CPMV2GVGTUDWTIKPFGT¤UG<QNQVPKMK)QNFRWP\GXQP DKUWPF,CJTGURWP\GQJPG$CPF<- ++



-CKUGTNKEJGT WPF -ÌPKINKEJGT 1TFGP XQO JGKNKIGP 5VCPKUNCWU =Îðäåí èìïåð±òîðñêèé è   êîðîë¾âñêèé Ñâÿòîãî Ñòàíèñëàâà?  /QFGNN  #WUICDG EC   ,WYGNKGTUCPHGTVKIWPI   GKPGU -TGW\GU  -NCUUG OKV DGKFUGKVKI GOCKNNKGTV UEJYCT\TQV -TGW\CTOGP )QNF GOCKNNKGTV  I   'OCKNNGOCNGTGKFKGUGGVYCUXGTFTGJVWPFDGTKGDGPFKG&QRRGNCFNGT\YKUEJGPFGP-TGW\CTOGPGPVHGTPV FKG-WIGNGKPGU-TGW\URKV\GGVYCUXGTDQIGPKPFGT¤UGWPNGUGTNKEJRWP\KGTVKO$CPFTKPI5V2GVGTUDWT IGT5VCFVRWP\GQJPG$CPF<- +++8



6TQV\ FGT HGJNGPFGP WPF NGKEJV GTI·P\DCTGP  #FNGT ·W­GTUV SWCNKV·VUXQNNG #PHGTVKIWPI YQJN WO FKG /KVVG FGU    ,CJTJWPFGTVU

8740 (1:1)



272

/GFCKNNG(ÒT'KHGT=Ìåäàë „Çà Óñåðä³å“?/QFGNN#WUICDG OKVFGO2QTVTCKV<CT#NGZCPFGTU++ PCEJNKPMU )TQ­G)QNFGPG/GFCKNNG)QNFINGKEJVIGYGNNVMNGKPG4CPFMGTDGPQJPG $CPF447 ++p




RUSSLAND

8742

8741

8743



/GFCKNNG(ÒT'KHGT=Ìåäàë „Çà Óñåðä³å“?/QFGNN OKVFGO2QTVTCKV<CT0KMQNCWU++  )TQ­G5KNDGTPG/GFCKNNG5KNDGTQJPG$CPFTKPIWPFQJPG$CPF447 ++





/GFCKNNGHÒTVCFGNNQUGP&KGPUVKPFGT)GH·PIPKUYCEJG/QFGNN OKVFGO2QTVTCKV<CT0KMQNCWU++  5KNDGTQJPG$CPF447 ++





5V )GQTIU/GFCKNNG HÒT 6CRHGTMGKV /GFCKNNG  -NCUUG 5KNDGT OKV 6T·IGTPWOOGT  CO   UR·VGTGP2GPVCIQPCNDCPF ++



8744

8746

8745

8747



/GFCKNNGHÒTFKG5GGUEJNCEJVXQP%JGUOC  #NVGT<KPPIW­ VKPECUV &WTEJOGUUGTOO +++





-TGW\HÒTFKG'TUVÒTOWPIFGT(GUVWPIXQP1EJCMQY#NVGTGKPUGKVKIGT<KPPCDUEJNCIFGT4ÒEM UGKVGCOCNVGP$CPFUVÒEMFGU5V9NCFKOKT1TFGPU ++p+++



+O1TKIKPCNYCTFCU-TGW\KP)QNFIGHGTVKIV



/GFCKNNGHÒTFGP(TKGFGPOKV5EJYGFGP  #NVGTGKPUGKVKIGT<KPPCDUEJNCIFGT4ÒEMUGKVGCOCNVGP $CPFUVÒEMFGU5V)GQTI1TFGPU ++





-TGW\ HÒT FKG 5EJNCEJV XQP 2TGWUUKUEJ'[NCW   $NGKIW­ NGCFECUV  FGU 4ÒEMUGKVG FGU -TGW\GU   FCUKO1TKIKPCNKP)QNFIGHGTVKIVYQTFGPKUV +++



8748 (1:1)



/GFCKNNG ŋ8KTVWVK /KNKVCTKŌ  D\Y1TFGPFGU/KNKV·T-TGW\GU  D\Y/KNKV·TKUEJGT1T FGP FGU *GT\QIVWOU 9CTUEJCW   D\Y /KNKV·T1TFGP 2QNGPU   D\Y /KNKV·T1TFGP   ŋ8KTVWVK /KNKVCT[Ō UGKV    /QFGNN OKV FGT ,CJTGU\CJN     -TGW\  -NCUUG  Z   OO5KNDGTVGKNYGKUGMQTTQFKGTVQJPG$CPF447<- ++



&GT 1TFGP KUV Y·JTGPF FGU RQNPKUEJGP #WHUVCPFGU FCU 5[ODQN FGU 9KFGTUVCPFGU IGIGP FKG TWUUKUEJG *GTTUEJCHV   IGYQTFGPWPFDGUQPFGTUKPFGPWPVGTGP-NCUUGPKPGKPGTITÌ­GTGP#P\CJN /QFGNN XGTNKGJGPYQTFGP7OPCEJ FGT GPFIÒNVKIGP 0KGFGTUEJNCIWPI KO *GTDUV  FCU RQNPKUEJG CWHUV·PFKUEJG /KNKV·T \W FGOÒVKIGP PCJO <CT   0KMQNCWU+  FGP1TFGPWPVGTFKGTWUUKUEJGPCWHOKVFGT,CJTGU\CJNCWHFGT4ÒEMUGKVG /QFGNN  WPFXGTICDFKGUGPHÒT6CRHGTMGKVCPFKGUKGITGKEJGPTWUUKUEJGP1HHK\KGTG7PVGTQHHK\KGTGWPF5QNFCVGPYQDGK GDGPHCNNUFKG-NCUUGJ·WHKI\WT8GTNGKJWPIMCO2QNPKUEJG2JCNGTKUVKMGTDGVTCEJVGPVGKNYGKUGFKGUGU/QFGNNCNU PKEJVFGO1TFGP\WIGJÌTKI

273


RUSSLAND

8751 8750

8754

8749

8752



'TKPPGTWPIUMTGW\HÒTFGP-TKGIXQPDKUHÒTFGP-NGTWU  -WRHGTQJPG$CPF447 # ++





/GFCKNNG HÒT FKG 7PVGTYGTHWPI FGU YGUVNKEJGP -CWMCUWU   5KNDGT OKV 5VGORGNUEJPGKFGTUKIPC   VWTQJPG$CPF447 ++





/GFCKNNG HÒT FGP 4WUUKUEJ6ÒTMKUEJGP -TKGI    /GFCKNNG KP JGNNGT $TQP\G HÒT FKG   6GKNPGJOGT CP FGP 5EJNCEJVGP WPF )GHGEJVGPFGT-CWMCUKUEJGP(TQPVQFGTKO5EJYCT\OGGTUVCTMDG UEJ·FKIVGP1TKIKPCNDCPF447 ++





+PQHHK\KGNNG'TKPPGTWPIUOGFCKNNG\WT-TÌPWPI<CT#NGZCPFGTU+++KP/QUMCW+P(QTOGKPGT XGTUKGIGNVGP-CRUGN&WTEJOGUUGTOOCO$CPF ++





'TKPPGTWPIUOGFCKNNG CP FKG 4GIKGTWPI <CT #NGZCPFGTU +++   5KNDGT CP CNVGT 2GPVCIQPCNDCPF   URCPIG447 ++





/GFCKNNG HÒT FGP %JKPC(GNF\WI  \WT 0KGFGTYGTHWPI FGU UQIGPCPPVGP $QZGT#WHUVCP   FGU 5KNDGTPG/GFCKNNGOKV$CPFTKPIQJPG$CPF447 ++



8755

8757 8759



5KNDGTPG 2TGKUOGFCKNNG GKPGT 8KGJ\ÒEJVGT#WUUVGNNWPI GKPGU 5GOUVYQ 0KEJV VTCIDCT 5KNDGT &WTEJ   OGUUGTOO ++



&KGUG-CVCNQIRQUKVKQPGPVH·NNV



#DUQNXGPVGP#D\GKEJGP FGT *QEJUEJWNG HÒT 8GTMGJTUYGIG+PIGPKGWTG -NGKPGU #D\GKEJGP 5KNDGT   OGJTVGKNKIIGHGTVKIVCWHFGT4ÒEMUGKVG/GKUVGTOCTMG#Á"XQP#NGMUCPFT$T[NQYKP5V2GVGTUDWTICP 5EJTCWDGOKV5EJTCWDUEJGKDGFCTCWHGDGPHCNNU/GKUVGTOCTMG#Á"WPF-QMQUEJPKM2WP\GXQPDKU 5#5 ++







&CU#D\GKEJGPYWTFGCO,WPKGKPIGHÒJTV#NGZCPFT$T[NQYCTDGKVGVGNCWV6COOCPP KP6425 WO FKG9GPFGXQO\WO,CJTJWPFGTVUCNU1TFGPUJGTUVGNNGTKP5CPMV2GVGTUDWTI



&KGUG-CVCNQIRQUKVKQPGPVH·NNV



#DUQNXGPVGP#D\GKEJGPFGT/KEJCKNQYUMK#TVKNNGTKGUEJWNGKP5V2GVGTUDWTI5KNDGTVGKNYGKUGXGTIQN FGV VGKNYGKUG GOCKNNKGTV CWH FGT 4ÒEMUGKVG /GKUVGTOCTMG ÂÄ" HÒT 8CTXCTC 2GVTQYPC &KGVYCNF KP 5V   2GVGTUDWTI<QNQVPKMK-QMQUEJPKM5KNDGTRWP\GXQPDKUWPF-QMQUEJPKM2WP\GXQP DKUCP5EJTCWDGOKV7PVGTNCIUUEJGKDGFKGUGGDGPHCNNUOKV/GKUVGTOCTMGÂÄ"WPF-QMQUEJPKM 2WP\G XQP  DKU  WPF 5EJTCWDUEJGKDG FKGUG GDGPHCNNU -QMQUEJPKM2WP\G XQP  DKU   5#5 ++

274






RUSSLAND

8761

8760



8763

8762

#DUQNXGPVGP#D\GKEJGPFGT#NGZGLGYUM[/KNKV·T5EJWNGKP/QUMCW$TQP\GVGKNYGKUGXGTIQNFGVWPF GOCKNNKGTV OGJTGTG 'OCKNNGCDURNKVVGTWPIGP CWH FGO 4GXGTU FGT -TQPG PWOOGTKGTV  CP 5EJTCWDG   OKV /WVVGT WPF 7PVGTNGIUEJGKDG FKGUG OKV *GTUVGNNGTDG\GKEJPWPI FGT (KTOC Ê.È.Áîêú KP /QUMCW   5#5 ++p+++



&CU#D\GKEJGPYWTFGCO1MVQDGTGKPIGHÒJTV



,WDKN·WOU#DUQNXGPVGP#D\GKEJGPFGT2CYNQYUM[/KNKV·T5EJWNGKP5V2GVGTUDWTI$TQP\GXGTIQN FGVCP5EJTCWDGOKV5EJTCWDUEJGKDG5#5 ++



&CU#D\GKEJGPYWTFGCO&G\GODGTGKPIGHÒJTV



#DUQNXGPVGP#D\GKEJGPFGT9NCFKOKTQYUMK/KNKV·TUEJWNGKP5V2GVGTUDWTI5KNDGTXGTIQNFGVCWHFGT 4ÒEMUGKVG \GJPHCEJ XGTPKGVGV OKV ITCXKGTVGT 6T·IGTPWOOGT  CP 5EJTCWDG OKV 7PVGTNCIU FKGUG   OKV*GTUVGNNGTDG\GKEJPWPIÝÄÓÀÐÄÚFGT(KTOC'FWCTFKP5V2GVGTUDWTI WPF5EJTCWDUEJGKDG5# 5 ++



&CU#D\GKEJGPYWTFGCO#RTKNGKPIGHÒJTV



#DUQNXGPVGP#D\GKEJGP FGT PKEJVOGFK\KPKUEJGP (CMWNV·VGP FGT TWUUKUEJGP 7PKXGTUKV·VGP $TQP\G   XGTIQNFGVWPFGOCKNNKGTVCP5EJTCWDGOKV5EJTCWDUEJGKDG5#5 ++



&CU#D\GKEJGPYWTFGCO,WPK

8764







8765

8766

8767

8768

#DUQNXGPVGP#D\GKEJGP FGT PKEJVOGFK\KPKUEJGP (CMWNV·VGP FGT TWUUKUEJGP 7PKXGTUKV·VGP -NGKPG   #WUHÒJTWPI5KNDGTGOCKNNKGTVDNCWG'OCKNNGOGJTHCEJIGEJKRVCWHFGO4GXGTU/GKUVGTOCTMG/-WPF /QUMCWGT<QNQVPKMK-QMQUEJPKM5KNDGTRWP\GXQPDKUCP5EJTCWDGOKV5EJTCWDUEJGKDG 5#5 ++



#DUQNXGPVGP#D\GKEJGP FGT PKEJVOGFK\KPKUEJGP (CMWNV·VGP FGT TWUUKUEJGP 7PKXGTUKV·VGP -NGKPG   #WUHÒJTWPI5KNDGTGOCKNNKGTVYGK­G'OCKNNGOGJTHCEJIGEJKRVCWHFGO4GXGTU/GKUVGTOCTMGÈÆ /QUMCWGT<QNQVPKMK-QMQUEJPKM5KNDGTRWP\GXQPDKUWPF-QMQUEJPKM2WP\GXQP DKUCP5EJTCWDGOKV5EJTCWDUEJGKDGFCTCWH-QMQUEJPKM2WP\GXQPDKU5#5  ++p+++



#D\GKEJGP FGT -CWMCUKUEJGP )GUGNNUEJCHV FGT (ÒTUQTIG HÒT 6KGTG 5KNDGT XGTIQNFGV GOCKNNKGTV CWH   FGT 4ÒEMUGKVG /GKUVGTOCTMG ÂÄ HÒT 8CTXCTC 2GVTQXPC &KGVYCNF  <QNQVPKMK -QMQUEJPKM5KNDGT   RWP\G XQP  DKU  WPF -QMQUEJPKM 2WP\G CP XQP  CP 5EJTCWDG OKV 5EJTCWD   UEJGKDG5#5 ++



&CU#D\GKEJGPYWTFGCO/·T\GKPIGHÒJTV



'TKPPGTWPIUCD\GKEJGP\WO,CJTGUVCIFGU$GUVGJGPUFGT)GTKEJVUQTFPWPI$TQP\GVGKNYGKUGXGT UKNDGTVVGKNYGKUGXGTIQNFGVCP5EJTCWDGOKV7PVGTNCIU FKGUGOKV*GTUVGNNGTDG\GKEJPWPIÝÄÓÀÐÄÚ FGT(KTOC'FWCTFKP5V2GVGTUDWTI WPF5EJTCWDUEJGKDG5#5 ++



&CU#D\GKEJGPYWTFGCO0QXGODGTGKPIGHÒJTV



'TKPPGTWPIUCD\GKEJGP\WO,CJTGUVCIFGU$GUVGJGPUFGT)GTKEJVUQTFPWPI$TQP\G8GTUKNDGTWPI WPF 8GTIQNFWPI HCUV XQNNUV·PFKI XGTICPIGP CP 5EJTCWDG OKV 7PVGTNCIU WPF 5EJTCWDUEJGKDG 5# 5    +++

 275


RUSSLAND

8771

8770

8772 8769



#D\GKEJGP \WT +PMTCHVUGV\WPI FGT 8GTQTFPWPI XQO  (GDTWCT  $TQP\G XGTIQNFGV VGKNYGKUG   IGUEJY·T\V 5EJY·T\WPIVGKNYGKUGXGTICPIGP CP0CFGN5#5 ++





7PDGMCPPVG #PUVGEMPCFGN /KV /QPQITCOO %# WPF &CVKGTWPI /15%17  5KNDGT CP   0CFGN ++





7PDGMCPPVG#PUVGEMPCFGN/KV/QPQITCOO%<WPF&CVKGTWPI/15%175KNDGTCP0CFGN ++





#D\GKEJGPFGU+PHCPVGTKG4GIKOGPVU\W$GNQOQTUM)TÌ­GTG#WUHÒJTWPI$TQP\GXGTIQNFGVVGKN YGKUG GOCKNNKGTV CP 5EJTCWDG FKGUG XGTDQIGP  OKV 7PVGTNCIU FKGUG OKV *GTUVGNNGTDG\GKEJPWPI   ÝÄÓÀÐÄÚFGT(KTOC'FWCTFKP5V2GVGTUDWTI WPF5EJTCWDUEJGKDG5#5XCT ++



&CU#D\GKEJGPYWTFGCO,WNKGKPIGHÒJTV

8774

8773

8775



#D\GKEJGP FGU  +PHCPVGTKG4GIKOGPVU \W $GNQOQTUM -NGKPGTG #WUHÒJTWPI $TQP\G XGTIQNFGV   VGKNYGKUGGOCKNNKGTVCP5EJTCWDGOKV7PVGTNCIUWPF5EJTCWDUEJGKDG5#5XCT ++





#D\GKEJGP FGU  +PHCPVGTKG4GIKOGPVU \W &XKPUM )TQ­G #WUHÒJTWPI $TQP\G XGTIQNFGV VGKNYGKUG   GOCKNNKGTVCP5EJTCWDGOKV7PVGTNCIU FKGUGOKV*GTUVGNNGTDG\GKEJPWPIÝÄÓÀÐÄÚFGT(KTOC'FW CTFKP5V2GVGTUDWTI WPF5EJTCWDUEJGKDG5#5XCT ++



#D\GKEJGPFGU+PHCPVGTKG4GIKOGPVU\W&XKPUM-NGKPGTG#WUHÒJTWPI5KNDGTXGTIQNFGVVGKNYGKUG GOCKNNKGTVCWHFGT4ÒEMUGKVG\YGKHCEJXGTPKGVGV5V2GVGTUDWTIGT<QNQVPKMK-QMQUEJPKM5KNDGTRWP\G XQP  DKU  CP 5EJTCWDG OKV 7PVGTNCIU FKGUG OKV /GKUVGTOCTMG 'Ï WPF -QMQUEJPKM   2WP\G XQP  DKU  WPF5EJTCWDUEJGKDGFKGUGOKV-QMQUEJPKM2WP\GXQPDKU 5#5XCT ++



&CU#D\GKEJGPYWTFGCO#RTKNGKPIGHÒJTV



8776

8778 8777



#D\GKEJGP FGU  +PHCPVGTKG4GIKOGPVU \W &XKPUM -NGKPGTG PKEJV GOCKNNKGTVG #WUHÒJTWPI $TQP\G   XGTIQNFGVCP5EJTCWDGOKV5EJTCWDUEJGKDG5#5 ++





)GFGPMCD\GKEJGP \WO  ,CJTGUVCI FGT 'TPGPPWPI 5 - * )TQ­HÒTUV /KEJCGN 0KMQNCLGYKVUEJ   \WO )GPGTCN(GNF\GWIOGKUVGT $TQP\G VGKNYGKUG XGTIQNFGV VGKNYGKUG GOCKNNKGTV CP 5EJTCWDG OKV   7PVGTNCIUUEJGKDGFKGUGMQTTQFKGTVWPF5EJTCWDUEJGKDG5#5 ++p+++



7PDGMCPPVGU#D\GKEJGP$TQP\GXGTIQNFGVVGKNYGKUGGOCKNNKGTVCP5EJTCWDGOKV7PVGT NCIU FKGUGOKV*GTUVGNNGTDG\GKEJPWPIÝÄÓÀÐÄÚFGT(KTOC'FWCTFKP5V2GVGTUDWTI WPF5EJTCWD UEJGKDG ++





276


RUSSLAND

8782 8779



8780

2QTV #TVJWT-TGW\ -TGW\ KP 5KNDGT 5KNDGT VGKNYGKUG GOCKNNKGTV 'OCKNNGOCNGTGK CWH FGT 4ÒEMUGKVG   /GKUVGTOCTMG Ã- WPF  <QNQVPKMK -QMQUEJPKM5KNDGTRWP\G XQP  WPF -QMQUEJPKM   2WP\GXQPCP5EJTCWDGOKV5EJTCWDUEJGKDGFCTCWH*GTUVGNNGTDG\GKEJPWPIÝÄÓÀÐÄÚ HÒTFKG(KTOC'FWCTFKP5V2GVGTUDWTI4475#5 4++



&CU-TGW\YWTFGCO,CPWCTIGUVKHVGVWPFKP5KNDGTCP1HHK\KGTGWPFKP$TQP\GCP/CPPUEJCHVGPXGTNKGJGP FKG KO 4WUUKUEJ,CRCPKUEJGP -TKGI CP FGT 8GTVGKFKIWPI FGT TWUUKUEJGP /CTKPGDCUKU 2QTV #TVJWT XQO  (GDTWCT   DKU\WO,CPWCTFGO6CIGKJTGT-CRKVWNCVKQPXQTFGPLCRCPKUEJGP6TWRRGPDGVGKNKIVYCTGP



2QTV#TVJWT-TGW\-TGW\KP$TQP\G$TQP\GCWHFGT4ÒEMUGKVG/GKUVGTOCTMGß-CP5EJTCWDGOKV 5EJTCWDUEJGKDG5#5 ++



&KGUG-CVCNQIRQUKVKQPGPVH·NNV



-COOGTJGTTGP5EJNÒUUGN#WUHÒJTWPIFGT4GIKGTWPIU\GKV<CT0KMQNCWU+XQPDKU$TQP\G XGTIQNFGVCNVG4GRCTCVWTFGU4GKEJUCRHGNUFGT-TQPGFWTEJ#PDTKPIWPIGKPGT8GTUV·TMWPIURNCVVG ++p+++







8783 8784





8785

8786

#D\GKEJGPFGT4WUUKUEJ1TVJQFQZGP1NIC)GUGNNUEJCHV5KNDGTXGTIQNFGVWPFVGKNYGKUGGOCKNNKGTVCWH FGO4GXGTU/GKUVGTOCTMG#ÁXQP#NGMUCPFT$T[NQYKP5V2GVGTUDWTIWPF5V2GVGTUDWTIGT<QNQV PKMK-QMQUEJPKM5KNDGTRWP\GXQPDKUCP0CFGN5#5 ++



#D\GKEJGP FGT 4WUUKUEJ1TVJQFQZGP $TWFGTUEJCHV FGT *GKNKIGP ,WPIHTCW XQP %JQNO $TQP\G XGT   IQNFGV /GFCKNNQP \W ÌHHPGP OKV GKPIGNGIVGO IGOCNVGO /CFQPPGP/GFCKNNQP CP 5EJTCWDG QJPG   5EJTCWDUEJGKDG5#5 ++



&CU#D\GKEJGPFGTIGITÒPFGVGP$TWFGTUEJCHVYWTFGCO,CPWCTGKPIGHÒJTV



#D\GKEJGP FGT $TWFGTUEJCHV XQP FGT #NNGTJGKNKIUVGP &TGKHCNVKIMGKV \W 2QFQNUM $TQP\G XGTIQNFGV   VGKNYGKUG GOCKNNKGTV CP 5EJTCWDG OKV 7PVGTNCIU FKGUG OKV *GTUVGNNGTDG\GKEJPWPI ÝÄÓÀÐÄÚ FGT   (KTOC'FWCTFKP5V2GVGTUDWTI WPF5EJTCWDUEJGKDG5#5 ++



&CU#D\GKEJGPYWTFGCO0QXGODGTGKPIGHÒJTV



#D\GKEJGP FGT $TWFGTUEJCHV XQO *GKNKIGP )GKUV \W 9KNPC #D\GKEJGP  -NCUUG $TQP\G XGTIQNFGV   WPFGOCKNNKGTVOKV¤UG5#5 ++



'KPHCEJGUR·VG#PHGTVKIWPI

277


RUSSLAND

8787



8788

8790

$TWFGTUEJCHVUMTGW\FGT1TVJQFQZGP$TWFGTUEJCHVFGUPKEJVXQP/GPUEJGPJCPFIGUEJCHHGPGP#PV NKV\GU WPUGTGU CNNGTJGKNKIUVGP 'TNÌUGTU CWH -COVUEJCVMC -TGW\  5VWHG 5KNDGT VGKNYGKUG GOCKNNKGTV   QJPG$CPFTKPIWPFQJPG$CPF5#5XCT ++



#D\GKEJGPHÒT-CPFKFCVGPFGT6JGQNQIKGFKGPKEJV/KVINKGFFGU-NGTWUUKPF$TQP\GXGTUKNDGTVWPF VGKNYGKUGGOCKNNKGTVCP5EJTCWDGOKV5EJTCWDUEJGKDG5#5 ++





4QOCPQY-TGW\ HÒT 2TKGUVGT FGU 9GNVNKEJGP WPF 1TFGPU-NGTWU $TQP\G 4GUVGOCKNNG UVCTM IGVTC   IGP4475#5 +8





'TKPPGTWPIUMTGW\CPFKG,CJTHGKGTFGT/KUUKQPUTGKUGFGTJGKNKIGP-[TKNNWPF/GVJQFKO )TQ­O·JTKUEJGP4GKEJ'KUGPVGKNYGKUGIGUEJY·T\VQJPG-GVVGQFGT$CPF ++



&CUXKGTUVWHKIG$TWFGTUEJCHVUMTGW\YWTFGCO,WNKGKPIGHÒJTV



&CU#D\GKEJGPYWTFG#O0QXGODGTGKPIGHÒJTV

9·JTGPF FKGUGT /KUUKQPUTGKUG DGICPPGPFKGDGKFGPUR·VGTCNU#RQUVGNFGT5NCYGPDG\GKEJPGVGP/ÌPEJG6GKNGFGT $KDGNKPU5NCYKUEJG\WÒDGTUGV\GPWPFGPVYKEMGNVGPJKGTHÒTFCU#NVMKTEJGPUNCYKUEJG#NRJCDGVCWUFGOUKEJUR·VGT FCU -[TKNNKUEJ GPVYKEMGNVG FKG 5EJTKHVHQTO FKG JGWVG KP 4W­NCPF FGT 7MTCKPG 9GK­TW­NCPF $WNICTKGP 5GTDKGP   /QPVGPGITQWUYIGDT·WEJNKEJKUV

8791

8793 (1:1)

8794 (1:1)



8792

4WUUKUEJGU -TGW\ 5KNDGTIW­  Z  OO CWH FGO 4GXGTU  <QNQVPKMK -QMQUEJPKM5KNDGTRWP\G   XQP  DKU  OKV -GVVG MGKP 5KNDGT  FCTCP 6·HGNEJGP 5KNDGT KP FGT ¤UG OGJTHCEJ TWUUKUEJ   RWP\KGTVOKVITCXKGTVGO/QPQITCOO-)WPFUR·VGTG#PHGTVKIWPIGKPGU5V)GQTIUMTGW\G-NCUUG MGKP5KNDGTPWOOGTKGTV ++





/CTKPGCPMGTZOO/GUUKPIXGTIQNFGVCWHFGT4ÒEMUGKVGFTGK/GVCNNÌUG&C\W-PQRHOKV <CTGPCFNGTCWH5COVWPVGTNCIG ++





,GVQPFGT-CKUGTNKEJGP5QPFGTMQOKVGGU\WT(ÌTFGTWPIFGT.WHVYCHHG5KNDGTVGKNYGKUGXGTIQNFGVWPF GOCKNNKGTVCWHFGO4GXGTU/GKUVGTRWP\GÂÄWPF<QNQVPKMK-QMQUEJPKM5KNDGTRWP\GXQPDKU  ++



$TQUEJGOKV<CTGPMTQPGZOO)QNFFKG-TQPGDGUGV\VOKV&KCOCPVTQUGP CWH'EJVJGKV IGRTÒHV WPF\YGK5OCTCIF ! %CDQEJQPUCP0CFGNFKGUGOKV-QMQUEJPKM2WP\GXQPKO 1TKIKPCNGVWKFGT(KTOC+XCPQHHKP5CPMV2GVGTUDWTI +





278


RUSSLAND

8797

8796





8795 (1:1)

2418+514+5%*'4755+5%*'4')+'470)  

1TFGP XQO JGKNKIGP 5VCPKUNCWU =Îðäåí Ñâÿòîãî Ñòàíèñëàâà?  /QFGNN EC   -TGW\    -NCUUGOKV5EJYGTVGTP$TQP\GXGTIQNFGVWPFGOCKNNKGTVCWHFGT4ÒEMUGKVG*GTUVGNNGTDG\GKEJPWPI- ÝÄÓÀÐÄÚHÒTFKG(KTOC'FWCTFKP5V2GVGTUDWTICO*CNUDCPF<- 4++



4755+5%*'4$ª4)'4-4+')  

5V )GQTIU5QNFCVGPMTGW\ 'KPMNCUUKIG #WUHÒJTWPI PKEJV TWUUKUEJGOÌINKEJGTYGKUGFGWVUEJG#PHGTVK IWPIOKVUGRCTCVIGHGTVKIVGP/GFCKNNQPUXGTUKNDGTVCO$CPF ++



9·JTGPFFGUTWUUKUEJGP$ÒTIGTMTKGIUCPFGOCWEJ\CJNTGKEJGCWUN·PFKUEJG'KPJGKVGP $TKVGP(TCP\QUGPFGWVUEJG (TGKMQTRU  VGKNPCJOGP XGTNKGJGPOGJTGTGTWUUKUEJG-QOOCPFGWTGGJGOCNU\CTKUVKUEJG#WU\GKEJPWPIGPUQFGP5V #PPGPQTFGPWPFFCU5V)GQTIU5QNFCVGPMTGW\&KG#WU\GKEJPWPIYWTFGOGKUVKPFKG2CRKGTGGKPIGVTCIGPQFGTFKG $GNKGJGPGP GTJKGNVGP GKPG 7TMWPFG QFGT GKP HQTONQUGU 5EJTGKDGP OW­VGP UKEJ CDGT FKG &GMQTCVKQP UR·VGT UGNDUV   GTYGTDGP



)'14)+5%*'.')+10

1TFGP FGT -ÌPKIKP 6COCTC 5VGTPU  -NCUUG 5KNDGT /GFCKNNQP XGTIQNFGV 8GTIQNFWPI HCUV XGT   ICPIGP CP0CFGN1#0 ++

8798



8801 8799

8800 8802 (1:1)

':+.



1TFGPFGUOKVNGKFXQNNGP*GT\GPU$TQP\GXGTIQNFGVGOCKNNKGTVCO2GPVCIQPCNDCPF<-

++





1TFGPFGUJN0KMQNCWUFGU9WPFGTV·VKIGP1TFGPUMTGW\$TQP\GXGTIQNFGVWPFGOCKNNKGTVCO2GPVC IQPCNDCPF<- ++





1TFGPFGUJN0KMQNCWUFGU9WPFGTV·VKIGP1TFGPUMTGW\HÒT/KNKV·T·T\VGWPFOGFK\KPKUEJGU2GTUQPCN $TQP\GXGTIQNFGVWPFGOCKNNKGTVCO2GPVCIQPCNDCPF<- ++





'TKPPGTWPIUCD\GKEJGP \WT ,CJTHGKGT FGU TWUUKUEJGP 5KGIGU ÒDGT 0CRQN¾QP + 5KNDGT VGKNYGKUG   GOCKNNKGTVCP0CFGN ++





/GFCKNNG\WO.GPKP2TGKU=Ìåäàëü Ëàóðåòàì Ëåíèíñêîé ïðåìèè?)QNFOKV/CVTKMGNPWOOGTOKV 6TCIGURCPIGI ++

70+10&'451<+#.+56+5%*'0519,'64'27$.+-'0 519,'670+10 

 279


REPUBLIK SAN MARINO

ex 8803 8804



8805

8806

1TFGPFGU8CVGTN·PFKUEJGP-TKGIGU=Îðäåí Îòå÷åñòâåííîé Âîéíû?/QFGNN  &GMQ TCVKQP-NCUUG5KNDGT#WHNCIG)QNFGOCKNNKGTVCWHFGO4GXGTU*GTUVGNNGTDG\GKEJPWPIFGU/ÒP\JQHU KP /QUMCW OKV 8GTNGKJWPIUPWOOGT \YKUEJGP  WPF  6CWUGPF XGTNKGJGP \YKUEJGP  WPF    CP5EJTCWDGOKV5EJTCWDUEJGKDG&C\WGKPYGKVGTGU'ZGORNCT5KNDGT#WHNCIG)QNFGOCKNNKGTV FKG 5VGTPUVTCJNGP NCEMKGTV   CWH FGO 4GXGTU *GTUVGNNGTDG\GKEJPWPI FGU /ÒP\JQHU KP /QUMCW OKV   8GTNGKJWPIUPWOOGT\YKUEJGPWPF6CWUGPF XGTNKGJGP CP5EJTCWDGOKV5EJTCWDUEJGKDG /KVGKPGTDTCWPGP5EJCEJVGN*(<- 5VÒEM++



4755+5%*146*1&1:'52#64+#4%*#6810/15-#7 

1TFGPFGUJN(ÒTUVGP9NCFKOKT-NCUUG5KNDGTVGKNYGKUGXGTIQNFGVWPFGOCKNNKGTVCP0CFGN CWH FGO-QRHUVGJGPF  4++



1TFGPFGUJN(ÒTUVGP9NCFKOKT-NCUUG$TQP\GXGTIQNFGVWPFGOCKNNKGTVCP0CFGN



1TFGPFGUGJTYÒTFKIGP5GTIKWUXQP4CFQPG\-NCUUGXGTUKNDGTVWPFVGKNYGKUGGOCKNNKGTVCP6TCIG DTQUEJGOKV0CFGN ++

4++

  

8808

8807

4'27$.+-5#0/#4+01 

<KXKN WPF /KNKV·TXGTFKGPUVQTFGP XQO JGKNKIGP /CTKPWU=1TFKPG%KXKNGG/KNKVCTGFK5CP/CTKPQ?  /QFGNN 4GXGTUUGKVKIG /GFCKNNQPKPUEJTKHV OKV %+8+.' QFGT /+.+6#4'  EC   $TWUV   UVGTP\WO)TQ­QHHK\KGT&WTEJOGUUGTOO5KNDGTVGKNYGKUGDTKNNCPVKGTV#WHNCIGP CWHFGO4GXGTU XGTURNKPVGV  )QNF GOCKNNKGTV 'OCKNNGEJKR CWH GKPGO -TGW\CTO 4GXGTUUGKVKIG<GPVTWOUCDFGEMWPIHGJNV CP0CFGN<- ++p



)GUVKHVGV YWTFG FGT HÒPHMNCUUKIG 1TFGP OKV &GMTGV XQO  /·T\  FWTEJ FKG DGKFGP %CRKVCPK 4GIIGPVK FGT   4GRWDNKMYWTFGFKG)TQ­OGKUVGT&GMQTCVKQP WPFFCOKVFKG#OVUKPUKIPKGFGTCNU5VCCVUQDGTJ·WRVGTHWPIKGTGP FGP%CRKVCPK4GIIGPVK WPFCO#RTKNFKG1TFGPUMQNNCPGGKPIGHÒJTV XINCWEJ#WVGPITWDGT/KEJCGN&KG 1TFGPWPF'JTGP\GKEJGPFGT4GRWDNKM5CP/CTKPQ+P+PVGTPCVKQPCNGU/KNKVCTKC/CIC\KP0T  5HH 



280

<KXKN WPF /KNKV·TXGTFKGPUVQTFGP XQO JGKNKIGP /CTKPWU=1TFKPG%KXKNGG/KNKVCTGFK5CP/CTKPQ?  /QFGNN 4GXGTUUGKVKIG /GFCKNNQPKPUEJTKHV OKV %+8+.' ' /+.+6#4'  UGKV EC   -QOOCP   FGWTMTGW\ 5KNDGT XGTIQNFGV WPF GOCKNNKGTV HGKPG 'OCKNNGOCNGTGK CO CNVGP QTKIKPCNGP *CNUDCPF <-    ++




REPUBLIK SAN MARINO

8809



<KXKN WPF /KNKV·TXGTFKGPUVQTFGP XQO JGKNKIGP /CTKPWU=1TFKPG%KXKNGG/KNKVCTGFK5CP/CTKPQ? 8GTNGKJWPIUWTMWPFG \WO -QOOCPFGWTMTGW\ HÒT 8KVVQTKQ )KWNKQ 8KEVQT ,WNGU  $QPPGV KP 2CTKU FCVKGTV   5CP /CTKPQ CO  WPF  ,WPK  OKV 1TKIKPCNWPVGTUEJTKHVGP FGT DGKFGP %CRKVCPK 4GIIGPVK  

5VCCVUQDGTJ·WRVGT OKV2CRKGTUKGIGNWPFOGJTGTGPHTCP\ÌUKUEJGP5VGORGNPGKPOCNIGHCNVGV ++p



5GJTUGNVGPG7TMWPFG

8810



8811

5V #ICVJC1TFGP =1TFKPG FK 5CPV  #ICVJC? 4KVVGTMTGW\ 5KNDGT XGTIQNFGV WPF GOCKNNKGTV CO $CPF   4++



)GUEJGPMDTQUEJGFGT4GRWDNKM5CP/CTKPQKP(QTOFGUITQ­GP5VCCVUYCRRGPU9GK­IQNFIGIQUUGP I GKPUEJNKG­NKEJ5VGKPGP RWP\KGTVKPFGT-TQPG$TKNNCPVGP 'EJVJGKVIGRTÒHV KO9CRRGP TCPF5CRJKTG 'EJVJGKVIGRTÒHV LGYGKNU¯LQWTIGHCUUVCP0CFGNKO'VWK ++



&KG4KVVGTWPF1HHK\KGTUMTGW\GFKGUGU1TFGPUUKPFTGNCVKXUGNVGPKO8GTJ·NVPKU\WFGPJÌJGTGP-NCUUGP



&KG)GUEJGPMDTQUEJGYKTFKPUGNVGPGP(·NNGPXQPFGP%CRKVCPK4GIGPVK 4GIKGTWPIUEJGHU FGT4GRWDNKM5CP/CTKPQ PCOGPU FGU 8QNMGU WPF FGT 4GIKGTWPI HÒT FGO 5VCCV DGUQPFGTU IGNGKUVGVG &KGPUVG CP (TCWGP XGTNKGJGP 'ZVTGO   UGNVGPGU'JTGP\GKEJGP

281


KÖNIGREICH SCHWEDEN

8812 (1:1)

-¤0+)4'+%*5%*9'&'0 

-ÌPKINKEJGT 5GTCRJKO1TFGP =-WPINKIC 5GTCHKOGTQTFGP? $TWUVUVGTP ,WYGNKGTUCPHGTVKIWPI FGT    #WUICDG QHHK\KGNNDKUPWTKPIGUVKEMVGT(QTOXGTNKGJGP ZOO5KNDGTFKG5GTCRJKOKP FGP -TGW\YKPMGNP UGRCTCV IGHGTVKIV WPF CWHIGUGV\V /GFCKNNQP )QNF GOCKNNKGTV FKG -WIGN GKPGT -TGW\   URKV\GHGJNVCWHFGT4ÒEMUGKVG*GTUVGNNGTRWP\G+9*FGU1TFGPULWYGNKGTU,CMQD9KNJGNO*LQTVUDGTI KP5VQEMJQNOKO8KGTVGNFGU,CJTJWPFGTVU,CJTGURWP\G.HÒTWPF5VQEMJQNOGT5VCFVRWP\G CP0CFGN#PIGDQVGPOKVOGJTGTGP2JQVQMQRKGPOKV#PICDGP\WT2TQXGPKGP\<-XCT 44++  .CWV 'KPNKGHGTGT CWU FGO $GUKV\ FGU )GPGTCNNGWVPCPVU WPF )GPGTCNDGHGJNUJCDGTU 'TNCPF *GFGTUVKGTPC     FGTXQP-ÌPKI-CTN:+8,QJCPPCO/CKCWU#PNC­UGKPGUL·JTKIGP4GIKGTWPIULWDKN·WOUCNU4KVVGT KPFGP1TFGPCWHIGPQOOGPYWTFG XIN085 

8813 (1:1)



1,5:1

8813 (1:1)

-ÌPKINKEJGT5GTCRJKO1TFGP=-WPINKIC5GTCHKOGTQTFGP?-NGKPGU-TGW\FGT1TFGPUDGCOVGPZ OO)QNFGOCKNNKGTVIOKP#DRNCV\WPIGPKPFGTYGK­GPWPFDNCWGP'OCKNNGQJPG$CPF  44++p+++

.CWV'KPNKGHGTGTCWUFGO$GUKV\FGU2TQVQMQNNUGMTGV·TU%CTN*GFGTUVKGTPCXQPDKU*GTQNFFGU-ÌPKINKEJGP 5EJYGTVQTFGPUWPFXQPDKU#TEJKXCTFGU5GTCRJKO1TFGPU XIN085WPF5 

282




KÖNIGREICH SCHWEDEN

8814 (1:1)



-ÌPKINKEJGT 5EJYGTVQTFGP =-WPINKIC 5X·TFUQTFGP?  /QFGNN UGKV   /KPKCVWT FGU $TWUVUVGTPU   \WO-QOOCPFGWT-NCUUG5KNDGTDTKNNCPVKGTV/GFCKNNQP)QNFGOCKNNKGTV#DRNCV\WPIGPKPFGTDNCWGP 'OCKNNGCWH4QUGVVGOQPVKGTVCP4GXGTUMPQRH ++p+++



#O  (GDTWCT  UVKHVGVG -ÌPKI (TGFTKM + XQP 5EJYGFGP CWU FGO *CWUG *GUUGP-CUUGN  FGP \WP·EJUV   \YGKMNCUUKIGP -QOOCPFGWTWPF4KVVGT 1TFGP\WUCOOGPOKVFGO-ÌPKINKEJGP5GTCRJKO1TFGPWPFFGO-ÌPKINK EJGP 5EJYGTVQTFGP  TGQTICPKUKGTVG -ÌPKI )WUVCX +++ FGP 1TFGP KPFGO GT GKP )TQ­MTGW\ UVKHVGVG YQDGK FKG   +PJCDGTFKGUGT-NCUUGō-QOOCPFGWTOKV)TQ­MTGW\ŋIGPCPPVYWTFGP UVKHVGVGGTHÒT-TKGIU\GKVGPFKG-NCUUG FGT4KVVGTOKVFGO)TQ­GP-TGW\-NCUUGFGU5EJYGTVQTFGPU 4KVVGTMTGW\CO*CNUOKVCWHTGEJVUVGJGPFGO5EJYGTV CWH FGT NKPMGP $TWUV  FKG FWTEJ -ÌPKI -CTN :+++  WO FKG -NCUUG FGT 4KVVGT OKV FGO )TQ­GP -TGW\ FGU   5EJYGTVQTFGPU 4KVVGTMTGW\CO*CNUOKVIGMTGW\VGP5EJYGTVGTPCWHFGTNKPMGP$TWUV GTYGKVGTVYWTFG#O,WPK UVKHVGVG-ÌPKI1UECT+FCUCHHKNKKGTVG5EJYGTV\GKEJGPWPFFKGCHHKNKKGTVG5EJYGTVOGFCKNNGHÒT7PVGTQHHK\KGTGWPF /CPPUEJCHVGP+O/CKYWTFG-CKUGT9KNJGNO+XQP-ÌPKI1UECT++GKPGIQNFGPG5EJYGTVOGFCKNNGXGTNKGJGP FKG\YCTGDGPHCNNUIGUVKHVGVYQTFGPYCTCDGTPWTGKPOCNXGTNKGJGPYWTFGGDGPCP-CKUGT9KNJGNO+ XIN'8 5H -ÌPKI%CTN:8UVKHVGVGGKPGP$TWUVUVGTP\WO-QOOCPFGWTWPF-ÌPKI1UECT++WPVGTVGKNVGCWU #PNC­UGKPGT-TÌPWPIFKG-QOOCPFGWTGKP-QOOCPFGWTG-NCUUG OKV$TWUVUVGTP WPF-QOOCPFGWTG-NCUUG

QJPG$TWUVUVGTPCDō-QOOCPFGWTŋIGPCPPV YQDGKNGV\VGTGDKU\WO5GRVGODGT#WUN·PFGTPXQTDG JCNVGPYCT$GTGKVUYCTGPFKGDKUFCJKPIGUVKEMVGP$TWUVUVGTPGQHHK\KGNNKP/GVCNNUVGTPGWOIGYCPFGNVYQTFGP FGTGP#TOHN·EJGPDKUDTKNNCPVKGTVXQPDKUIGUEJWRRVWPFUGKVFKGUGO<GKVRWPMVINCVVYCTGP/KVFGP PGWGP5VCWVGPXQO0QXGODGTYWTFGCWEJFKG4KVVGTMNCUUGKP4KVVGT-NCUUGWPF4KVVGT-NCUUG CD ō4KVVGTŋ IGPCPPV  WPVGTVGKNV YQDGK NGV\VGTG \WP·EJUV GDGPHCNNU PWT #WUN·PFGTP XQTDGJCNVGP YCT  YWTFG FCU   5EJYGTV\GKEJGP QJPG 5EJYGTVGT XQP -ÌPKI 1UECT ++ IGUVKHVGV #O  /·T\  GTNKG­ -ÌPKI)WUVCX8+#FQNH PGWG 5VCVWVGP OKV FGPGP HÒT -TKGIU\GKVGP GKP FTGKMNCUUKIGU CHHKNKKGTVGU -TKGIUMTGW\ FGU 5EJYGTVQTFGPU IGUVKHVGV   YWTFG#WH$GUEJNW­FGU5EJYGFKUEJGP4GKEJUVCIGUXQO,WPKYWTFGFKG8GTNGKJWPIFGU5EJYGTVQTFGPUOKV 9KTMWPIXQO,CPWCTIGPGTGNNGKPIGUVGNNV

8815 (1:1)



-ÌPKINKEJGT 5EJYGTVQTFGP =-WPINKIC 5X·TFUQTFGP?/QFGNN UGKV -QOOCPFGWTMTGW\)QNF GOCKNNKGTVIQJPG2WP\KGTWPIGPCOMWT\GPCNVGP*CNUDCPFCDUEJPKVV<- 4++



NVGTG#PHGTVKIWPICWUFGO\YGKVGP&TKVVGNFGU,CJTJWPFGTVU

283


KÖNIGREICH SCHWEDEN

8816 (1:1)



-ÌPKINKEJGT 5EJYGTVQTFGP =-WPINKIC 5X·TFUQTFGP?/QFGNN UGKV -QOOCPFGWTMTGW\)QNF GOCKNNKGTV  I CWH #XGTU WPF 4GXGTU OGJTGTG 'OCKNNGUEJ·FGP #XGTU WPF 4GXGTUOGFCKNNQP UKPF   XGTVCWUEJVOKVCNVGOGVYCU\GTUEJNKUUGPGP*CNUDCPFCDUEJPKVV<- ++++8  NVGTGXKGNIGVTCIGPG#PHGTVKIWPICWUFGO\YGKVGP&TKVVGNFGU,CJTJWPFGTVU

8817 (1:1)



284

-ÌPKINKEJGT 5EJYGTVQTFGP =-WPINKIC 5X·TFUQTFGP?  /QFGNN UGKV   -QOOCPFGWTMTGW\ #WU   HÒJTWPIOKVHNCEJGT-TQPG)QNFGOCKNNKGTVIQJPG2WP\KGTWPIGPDNCWG'OCKNNGGVYCUWPTGIGN O·­KILGFQEJPKEJVDGUEJ·FKIVCOIGP·JVGP*CNUDCPF<- ++




KÖNIGREICH SCHWEDEN

8819

8818









8820

8821

-ÌPKINKEJGT5EJYGTVQTFGP=-WPINKIC5X·TFUQTFGP?/QFGNN UGKV 4KVVGTMTGW\ CD4KV VGTMTGW\  -NCUUG  )QNF GOCKNNKGTV  I OKV $CPF  CWH FGO 4CPF FGU NKPMGP WPVGTGP -TGW\CTOU   OGJTHCEJRWP\KGTV WC%(%HÒTFGP*GTUVGNNGT%(%CTNOCPKP5VQEMJQNO-HÒTEVQJPG ,CJTGURWP\G OKVGTI·P\VGO$CPFTKPICO$CPF<- ++



-ÌPKINKEJGT5EJYGTVQTFGP=-WPINKIC5X·TFUQTFGP?/QFGNN UGKV 4KVVGTMTGW\ CD4KV VGTMTGW\-NCUUG )QNFGOCKNNKGTVI OKV$CPF CWHFGO4CPFFGUTGEJVGPWPVGTGP-TGW\CTOU OGJTHCEJRWP\KGTV WC%(%HÒTFGP*GTUVGNNGT%(%CTNOCPKP5VQEMJQNO-HÒTEVQJPG ,CJTGURWP\G COCNVGP$QIGPDCPFKOQTKIKPCNGP8GTNGKJWPIUGVWKXQP%CTNOCP<- +p++



-ÌPKINKEJGT5EJYGTVQTFGP=-WPINKIC5X·TFUQTFGP?/QFGNN UGKV 4KVVGTMTGW\ CD4KV VGTMTGW\  -NCUUG  )QNF GOCKNNKGTV  I CWH FGO 4CPF FGU NKPMGP QDGTGP -TGW\CTOU OGJTHCEJ   RWP\KGTV W C %(% HÒT FGP *GTUVGNNGT % ( %CTNOCP KP 5VQEMJQNO - HÒT  EV ,CJTGURWP\G   7HÒT CO$CPF<- +p++



-ÌPKINKEJGT5EJYGTVQTFGP=-WPINKIC5X·TFUQTFGP?/QFGNN UGKV 4KVVGTMTGW\ CD4KV VGTMTGW\  -NCUUG  5KNDGT XGTIQNFGV /GFCKNNQPU )QNF CO $CPF OKV UEJYGFKUEJGT 6TCIGURCPIG KO   QTKIKPCNGP8GTNGKJWPIUGVWKFGT(KTOC%(%CTNOCPKP5VQEMJQNO<- +p++



'ZGORNCTGKP5KNDGTXGTIQNFGVUKPFYGKVCWUUGNVGPGTCNUGEJVIQNFGPG

ex 8822 (1:1)

8823 (1:1)

8826 8824



8825

-ÌPKINKEJGT5EJYGTVQTFGP=-WPINKIC5X·TFUQTFGP?/QFGNN UGKV /KPKCVWTFGU4KVVGTMTGW\GU

CD  4KVVGTMTGW\  -NCUUG  )QNF GOCKNNKGTV \WUCOOGP OQPVKGTV CP <YGKGT /KPKCVWTGPUEJPCNNG    OKV/KPKCVWTFGT)QNFGPGP/GFCKNNGHÒT'KHGTWPF4GFNKEJMGKVKO4GKEJUFKGPUV#WUICDGOKVLÒPIGTGO 2QTVTCKV-ÌPKI%CTN:8+)WUVCX5KNDGTXGTIQNFGV#P6TCIGMPQRH 5VÒEM+p++





-ÌPKINKEJGT5EJYGTVQTFGP=-WPINKIC5X·TFUQTFGP?/QFGNN UGKV /KPKCVWTFGU4KVVGTMTGW\GU

CD4KVVGTMTGW\-NCUUG 5KNDGTXGTIQNFGV/GFCKNNQPU)QNFGOCKNNKGTVCO$·PFEJGP ++





-ÌPKINKEJGT5EJYGTVQTFGP=-WPINKIC5X·TFUQTFGP?5EJYGTVGTMTGW\OKV5EJYGTVGTP#WUICDG OKV IQNFGPGO#XGTU/GFCKNNQP 5KNDGT#XGTU/GFCKNNQP)QNFGOCKNNKGTVCOCNVGP$QIGPDCPFKOQTKIKPC NGP8GTNGKJWPIUGVWKFGT(KTOC%(%CTNOCPKP5VQEMJQNO<- ++





-ÌPKINKEJGT 5EJYGTVQTFGP =-WPINKIC 5X·TFUQTFGP? 5EJYGTVGTMTGW\ QJPG 5EJYGTVGT 5KNDGT #XGTU  /GFCKNNQP)QNFGOCKNNKGTVCOCNVGP1TKIKPCNDCPFOKV6TCIGURCPIG<- 4++





-ÌPKINKEJGT5EJYGTVQTFGP=-WPINKIC5X·TFUQTFGP?5EJYGTVGTMTGW\OKV5EJYGTVGTP#WUICDG OKV IQNFGPGO #XGTU/GFCKNNQP  5KNDGT #XGTU/GFCKNNQP )QNF GOCKNNKGTV \WUCOOGP OQPVKGTV CP ITQ­GT   <YGKGT1TFGPUUEJPCNNG  OKV GKPGT 5KNDGTPGP /GFCKNNG FGT 5GGHCJTVHNQVKNNG FGU¤TGUWPF5KNDGTCWHFGO 4GXGTUOGJTHCEJRWP\KGTVOKV)TCXWT#2KJN<- 5VÒEM++

 285


KÖNIGREICH SCHWEDEN

8827 (1:1) 8828



-ÌPKINKEJGT 5EJYGTVQTFGP =-WPINKIC 5X·TFUQTFGP? /KPKCVWT FGU 5EJYGTVGTMTGW\GU OKV 5EJYGTVGTP   #WUICDG OKVIQNFGPGO#XGTU/GFCKNNQP 5KNDGT#XGTU/GFCKNNQP)QNFGOCKNNKGTVCOCNVGP$QIGP D·PFEJGP ++



#NU/KPKCVWTPKEJVJ·WHKI\WHKPFGP



-ÌPKINKEJGT 0QTFUVGTPQTFGP =-WPINKIC 0QTFUVL·TPGQTFGP? 'KP\GNPGU /QPQITCOOINKGF FGT 1TFGPU   MQNNCPG$TQP\GXGTIQNFGVWPFGOCKNNKGTV 4++



#O  (GDTWCT  UVKHVGVG -ÌPKI (TGFTKM + XQP 5EJYGFGP CWU FGO *CWUG *GUUGP-CUUGN  FGP \WP·EJUV   \YGKMNCUUKIGP -QOOCPFGWTWPF4KVVGT 1TFGP\WUCOOGPOKVFGO-ÌPKINKEJGP5GTCRJKO1TFGPWPFFGO-ÌPKINK EJGP5EJYGTVQTFGPUVKHVGVG-ÌPKI)WUVCX+++-QNNCPGPHÒTFKG-QOOCPFGWTG-ÌPKI1UECT+UVKHVGVGFKG )TQ­MTGW\MNCUUG IGPCPPV ō-QOOCPFGWT OKV )TQ­MTGW\ŋ -ÌPKI %CTN :8 UVKHVGVG  GKPGP $TWUVUVGTP \WO   -QOOCPFGWTWPF-ÌPKI1UECT++WPVGTVGKNVGCWU#PNC­UGKPGT-TÌPWPIFKG-QOOCPFGWTGKP-QOOCPFGWTG -NCUUG OKV $TWUVUVGTP  WPF -QOOCPFGWTG  -NCUUG QJPG $TWUVUVGTP CD  ō-QOOCPFGWTŋ IGPCPPV  YQDGK   NGV\VGTG DKU  #WUN·PFGTP XQTDGJCNVGP YCT $GTGKVU  YCTGP FKG DKU FCJKP IGUVKEMVGP $TWUVUVGTPG QHHK\KGNN KP   /GVCNNUVGTPG WOIGYCPFGNV YQTFGP FGTGP #TOHN·EJGP DKU  DTKNNCPVKGTV XQP  DKU  IGUEJWRRV WPF UGKV   FKGUGO<GKVRWPMVINCVVYCTGP+PDGUQPFGTGP(·NNGPMQPPVGPFKG+PUKIPKGPCNNGT-NCUUGPCWEJōOKV$TKNNCPVGPŋXGT NKGJGPYGTFGP#WH$GUEJNW­FGU5EJYGFKUEJGP4GKEJUVCIGUXQO,WPKYWTFGFKG8GTNGKJWPIFGU0QTFUVGT PQTFGPU CP UEJYGFKUEJG 5VCCVUDÒTIGT OKV 9KTMWPI XQO  ,CPWCT  GKPIGUVGNNV /KV FGT 4GHQTO FGU UEJYGFK   UEJGP1TFGPUYGUGPUXQPYWTFGCWEJFKG4KVVGTMNCUUGKP4KVVGT-NCUUGWPF4KVVGTCWHIGVGKNVUQYKGGKPGPGWG $CPFHCTDG DNCW OKV IGNDGP 4CPFUVTGKHGP  GKPIGHÒJTV  YWTFG XQP -ÌPKI %CTN :8+ )WUVCX FKG FGO 1TFGP   CHHKNKKGTVG0QTFUVGTPOGFCKNNGIGUVKHVGV/KV&CVWOXQO#WIWUVGTJKGNVFGT1TFGPPGWG5VCVWVGP

8829







286

8831

8830

-ÌPKINKEJGT 0QTFUVGTPQTFGP =-WPINKIC 0QTFUVL·TPGQTFGP? $TWUVUVGTP \WO )TQ­MTGW\  #WUICDG  

OKVIGUEJWRRVGP-TGW\CTOHGNFGTP 5KNDGTFKG5VTCJNGP\YKUEJGPFGP-TGW\CTOGPUGRCTCV CWUIGHÒJTVWPFOKVFGO5VGTPMQTRWUXGTUEJTCWDVCWHFGO0CFGNDQEMOGJTHCEJRWP\KGTV WC%(%HÒT FGP*GTUVGNNGT%(%CTNOCPKP5VQEMJQNO5HÒT5KNDGTWPF,CJTGURWP\G.HÒT CP0CFGN <- ++



-ÌPKINKEJGT 0QTFUVGTPQTFGP =-WPINKIC 0QTFUVL·TPGQTFGP? $TWUVUVGTP \WO -QOOCPFGWT  -NCUUG   #WUICDG OKVDTKNNCPVKGTVGP-TGW\CTOGP ITÌ­GTG#WUHÒJTWPI CDEC Z OO5KNDGTDTKNNCPVKGTVWPFTGRGTEKGTVQJPG2WP\KGTWPICP0CFGN<- ++



-ÌPKINKEJGT0QTFUVGTPQTFGP=-WPINKIC0QTFUVL·TPGQTFGP?-QOOCPFGWTMTGW\)QNFGOCKNNKGTVI QJPG2WP\KGTWPIGPCOQTKIKPCNGPUEJYCT\GP*CNUDCPFKOQTKIKPCNGP8GTNGKJWPIUGVWKFGT(KTOC%( %CTNOCPKP5VQEMJQNO<- +p++




KÖNIGREICH SCHWEDEN

8832 (1:1)

8833

8834

8835 8836



-ÌPKINKEJGT0QTFUVGTPQTFGP=-WPINKIC0QTFUVL·TPGQTFGP?/KPKCVWTFGU-QOOCPFGWTMTGW\GUZ OO)QNFGOCKNNKGTVQJPG2WP\KGTWPIGPCOUEJYCT\GP$·PFEJGPOKV6TCIGMPQRH +p++





-ÌPKINKEJGT 0QTFUVGTPQTFGP =-WPINKIC 0QTFUVL·TPGQTFGP? 4KVVGTMTGW\ UGKV  4KVVGTMTGW\    -NCUUG )QNFGOCKNNKGTVI QJPG$CPFTKPI QJPG2WP\KGTWPIGPCOUEJYCT\GP$CPF<- ++





-ÌPKINKEJGT 0QTFUVGTPQTFGP =-WPINKIC 0QTFUVL·TPGQTFGP? 4KVVGTMTGW\ UGKV  4KVVGTMTGW\    -NCUUG )QNFGOCKNNKGTVI OKV$CPFWPF6TCIGURCPIG QJPG2WP\KGTWPIGPCOUEJYCT\GP$CPF OKV6TCIGURCPIGKOQTKIKPCNGP8GTNGKJWPIUGVWKFGT(KTOC%(%CTNOCPKP5VQEMJQNO<- +p++



-ÌPKINKEJGT 0QTFUVGTPQTFGP =-WPINKIC 0QTFUVL·TPGQTFGP? 4KVVGTMTGW\ UGKV  4KVVGTMTGW\    -NCUUG )QNFGOCKNNKGTVI OKV$CPF CWHFGO4CPFFGUWPVGTGP-TGW\CTOUOGJTHCEJRWP\KGTV W C %(% HÒT FGP *GTUVGNNGT % ( %CTNOCP KP 5VQEMJQNO - HÒT  EV QJPG ,CJTGURWP\G  CO   UEJYCT\GP $CPF OKV 5KEJGTJGKVUPCFGN KO QTKIKPCNGP 8GTNGKJWPIUGVWK FGT (KTOC % ( %CTNOCP KP   5VQEMJQNO<- ++



-ÌPKINKEJGT 0QTFUVGTPQTFGP =-WPINKIC 0QTFUVL·TPGQTFGP? 4KVVGTMTGW\ UGKV  4KVVGTMTGW\    -NCUUG )QNFGOCKNNKGTVI4GXGTUGKPGT-TGW\URKV\GGVYCUXGTUEJOWV\VCWHFGO4CPFFGUWPVG TGP-TGW\CTOUOGJTHCEJRWP\KGTV WC%(%HÒTFGP*GTUVGNNGT%(%CTNOCPKP5VQEMJQNO- HÒTEVQJPG,CJTGURWP\G COUEJYCT\GP$CPF<- ++







8841 (1:1) 8837

8838

8839 (1:1)

8840 (1:1)



-ÌPKINKEJGT 0QTFUVGTPQTFGP =-WPINKIC 0QTFUVL·TPGQTFGP? 4KVVGTMTGW\ UGKV  4KVVGTMTGW\    -NCUUG  5KNDGT XGTIQNFGV /GFCKNNQPU )QNF GOCKNNKGTV QJPG 2WP\KGTWPIGP CO UEJYCT\GP $CPF <-    +p++





-ÌPKINKEJGT 0QTFUVGTPQTFGP =-WPINKIC 0QTFUVL·TPGQTFGP? 4GFWMVKQP FGU 4KVVGTMTGW\GU UGKV    4KVVGTMTGW\-NCUUG ZOO)QNFGOCKNNKGTVI'OCKNNGCWUDTWEJCWHFGT4ÒEMUGKVGGKPGU -TGW\CTOUQJPG2WP\KGTWPIGPCOUEJYCT\GP$CPF 4+++++



#PHGTVKIWPIOKV-TQPGFGU·NVGTGP6[RUCWUFGO\YGKVGP&TKVVGNFGU,CJTJWPFGTVU







-ÌPKINKEJGT 0QTFUVGTPQTFGP =-WPINKIC 0QTFUVL·TPGQTFGP? /KPKCVWT FGU 4KVVGTMTGW\GU UGKV    4KVVGTMTGW\  -NCUUG  )QNF GOCKNNKGTV QJPG 2WP\KGTWPIGP CO UEJYCT\GP $·PFEJGP \WUCOOGP   OQPVKGTV CP <YGKGT/KPKCVWTGPUEJPCNNG  OKV /KPKCVWT FGU 4KVVGTMTGW\GU  -NCUUG FGU 9CUC1TFGPU   5KNDGTXGTIQNFGV/GFCKNNQPU)QNFGOCKNNKGTVOKV6TCIGMPQRH 5VÒEM++



-ÌPKINKEJGT 0QTFUVGTPQTFGP =-WPINKIC 0QTFUVL·TPGQTFGP? /KPKCVWT FGU 4KVVGTMTGW\GU UGKV    4KVVGTMTGW\  -NCUUG  )QNF GOCKNNKGTV QJPG 2WP\KGTWPIGP CO UEJYCT\GP $·PFEJGP \WUCOOGP   OQPVKGTV CP <YGKGT/KPKCVWTGPUEJPCNNG  OKV /KPKCVWT FGU 4KVVGTMTGW\GU  -NCUUG FGU 9CUC1TFGPU   )QNFGOCKNNKGTVOKV6TCIGMPQRH ++



/KPKCVWTDCTGVV OKV \YGK 1TFGPUOKPKCVWTGP   -ÌPKINKEJGT 0QTFUVGTPQTFGP 1TFGPUMTGW\ )QNF   GOCKNNKGTV'OCKNNGCWUDTWEJOKVQDGTGP-TGW\CTO 1TFGP%CTNU:+++1TFGPUMTGW\)QNFGOCKNNKGTV 'OCKNNGEJKRKO/GFCKNNQP$CTGVVTCJOGPITCXKGTVCP0CFGN 4++p+++



5GJTSWCNKV·VUXQNNG#PHGTVKIWPIYQJNCWUFGT\YGKVGP*·NHVGFGU,CJTJWPFGTVU

287


KÖNIGREICH SCHWEDEN

8842



8843

-ÌPKINKEJGT9CUC1TFGP=-WPINKIC8CUCQTFGP?/QFGNN UGKV $TWUVUVGTP\WO-QOOCPFGWT  -NCUUG  #WUICDG OKV DTKNNCPVKGTVGP -TGW\CTOGP     ITÌ­GTG #WUHÒJTWPI CD EC    5KNDGTDTKNNCPVKGTVWPFTGRGTEKGTVQJPG2WP\KGTWPICP0CFGN<- ++



)GUVKHVGV CO  /CK  XQP -ÌPKI )WUVCX +++   CNU \WP·EJUV FTGKMNCUUKIGT -QOOCPFGWT OKV)TQ­ MTGW\ -QOOCPFGWT 4KVVGT  1TFGP HÒT 8GTFKGPUVG WO FKG .CPFYKTVUEJCHV *CPFGN )GYGTDG WPF +PFWUVTKG -WPUV   WPF9KUUGPUEJCHV&WTEJ-ÌPKI1UECT+GTJKGNVGPFCU-NGKPQFFGU)TQ­MTGW\GUWPFFKG-QOOCPFGWTFGMQTC VKQPLGYGKNUGKPGMÌPKINKEJG-TQPGCNUªDGTJÌJWPI#O#RTKNTGQTICPKUKGTVG-ÌPKI%CTN:8   FGP 1TFGP ICD FGP +PUKIPKGP GKPG )GUVCNV WPF HÒJTVG GKPGP $TWUVUVGTP \WO -QOOCPFGWT GKP #WU #PNC­ UGKPGT   -TÌPWPI VGKNVG -ÌPKI 1UECT ++    FKG -QOOCPFGWTMNCUUG KP -QOOCPFGWTG  -NCUUG OKV $TWUV   UVGTP WPF-QOOCPFGWTG-NCUUG QJPG$TWUVUVGTPCDō-QOOCPFGWTŋIGPCPPV YQDGKNGV\VGTGDKU\WO 5GRVGODGT  #WUN·PFGTP XQTDGJCNVGP YCT $GTGKVU  YCTGP FKG DKU FCJKP IGUVKEMVGP $TWUVUVGTPG QHHK\KGNN KP   /GVCNNUVGTPG WOIGYCPFGNV YQTFGP FGTGP #TOHN·EJGP DKU  DTKNNCPVKGTV XQP  DKU  IGUEJWRRV WPF UGKV   FKGUGO<GKVRWPMVINCVVYCTGP/KVFGPPGWGP5VCWVGPXQO0QXGODGTYWTFGCWEJFKG4KVVGTMNCUUGKP4KVVGT -NCUUGWPF4KVVGT-NCUUG CDō4KVVGTŋIGPCPPV WPVGTVGKNVYQDGKNGV\VGTG\WP·EJUVGDGPHCNNUPWT#WUN·P FGTP XQTDGJCNVGP YCT #O  0QXGODGT  UVKHVGVG 1UECT ++ FCU 9CUC\GKEJGP WPF FKG OGJTUVWHKIG 9CUC/G   FCKNNG KP )QNF WPF5KNDGT#O,WPKDGUEJNQ­FGT4GKEJUVCIFCUUEJYGFKUEJG2CTNCOGPVFC­FKGUEJYGFK UEJGP 1TFGP WPF UQOKV CWEJ FGT 9CUC1TFGP MÒPHVKI PWT PQEJ #WUN·PFGTP XQTDGJCNVGP UGK WPF OKV FGP PGWGP   5VCVWVGP FGT UEJYGFKUEJGP 1TFGP XQO  #WIWUV  YWTFG FKG 8GTNGKJWPI FGU 9CUC1TFGPU YKG CWEJ FGU   5EJYGTVQTFGPU IGPGTGNNGKPIGUVGNNV



-ÌPKINKEJGT9CUC1TFGP=-WPINKIC8CUCQTFGP?/QFGNN UGKV $TWUVUVGTP\WO-QOOCPFGWT -NCUUG#WUICDG OKVIGUEJWRRVGP-TGW\CTOHGNFGTP 5KNDGTKO0CFGNDQEMOGJTHCEJ RWP\KGTV WC%(%HÒTFGP*GTUVGNNGT%(%CTNOCPKP5VQEMJQNOWPF,CJTGURWP\G#HÒT  CP0CFGNKOQTKIKPCNGP8GTNGKJWPIUGVWKXQP%CTNOCP<- ++

8844





288



8845

-ÌPKINKEJGT 9CUC1TFGP =-WPINKIC 8CUCQTFGP?  /QFGNN UGKV   -QOOCPFGWTMTGW\ )QNF   GOCKNNKGTV  I CWH FGO 4CPF FGU WPVGTGP -TGW\CTOU OGJTHCEJ RWP\KGTV W C %(% HÒT FGP   *GTUVGNNGT%(%CTNOCPKP5VQEMJQNO-HÒTEV,CJTGURWP\G-HÒT COIGVTCIGPGP *CNUDCPFOKV/GVCNNUEJNKG­GPUEJYGFKUEJGT#TV<- +p++



-ÌPKINKEJGT 9CUC1TFGP =-WPINKIC 8CUCQTFGP?  /QFGNN UGKV   -QOOCPFGWTMTGW\ 5KNDGT   XGTIQNFGV /GFCKNNQPU )QNF GOCKNNKGTV FCU -TGW\ GVYCU IGYÌNDV QJPG 2WP\KGTWPIGP CO IGVTCIGPGP   *CNUDCPF<- ++




KÖNIGREICH SCHWEDEN

8846 (1:1)

8847 (1:1) 8849

8848



-ÌPKINKEJGT9CUC1TFGP=-WPINKIC8CUCQTFGP?/KPKCVWTFGU-QOOCPFGWTMTGW\GUZOO )QNFGOCKNNKGTVQJPG2WP\KGTWPIGPCO$·PFEJGPOKV6TCIGMPQRH ++





-ÌPKINKEJGT9CUC1TFGP=-WPINKIC8CUCQTFGP?/KPKCVWTFGU-QOOCPFGWTMTGW\GUZOO )QNF GOCKNNKGTV QJPG 2WP\KGTWPIGP CWH FGT 4ÒEMUGKVG FGU TGEJVGP -TGW\CTOU 'OCKNNGEJKR CO $·PF   EJGPOKV6TCIGMPQRH ++++p+++



-ÌPKINKEJGT9CUC1TFGP=-WPINKIC8CUCQTFGP?/QFGNN UGKV 4KVVGTMTGW\ UGKV4KVVGT MTGW\-NCUUG )QNFGOCKNNKGTVIQJPG2WP\KGTWPIGPCOQTKIKPCNGPCNVGPCWUIGDNGKEJVGP$CPF <- 4+p++





5GJTSWCNKV·VUXQNNG#PHGTVKIWPIWOCWUFGT<GKVMWT\PCEJFGO/QFGNNYGEJUGN  



-ÌPKINKEJGT9CUC1TFGP=-WPINKIC8CUCQTFGP?/QFGNN UGKV 4KVVGTMTGW\ UGKV4KVVGT MTGW\-NCUUG )QNFGOCKNNKGTVIQJPG2WP\KGTWPIGPCOCNVGPGVYCUCWUIGDNGKEJVGP$CPF<-  ++

8850









8851

8852



8853

-ÌPKINKEJGT9CUC1TFGP=-WPINKIC8CUCQTFGP?/QFGNN UGKV 4KVVGTMTGW\ UGKV4KVVGT MTGW\-NCUUG )QNFGOCKNNKGTVICWHFGO4CPFFGUWPVGTGP-TGW\CTOUOGJTHCEJRWP\KGTV WC %(%HÒTFGP*GTUVGNNGT%(%CTNOCPKP5VQEMJQNO-HÒTEVQJPG,CJTGURWP\G COCNVGP 1TKIKPCNDCPFKO1TKIKPCNGVWKXQP%CTNOCP<- +p++



-ÌPKINKEJGT9CUC1TFGP=-WPINKIC8CUCQTFGP?/QFGNN UGKV 4KVVGTMTGW\ UGKV4KVVGT MTGW\-NCUUG )QNFGOCKNNKGTVICWHFGO4CPFFGUWPVGTGP-TGW\CTOUOGJTHCEJRWP\KGTV WC %(%HÒTFGP*GTUVGNNGT%(%CTNOCPKP5VQEMJQNO-HÒTEVQJPG,CJTGURWP\G COCNVGP $QIGPDCPF<- +p++



-ÌPKINKEJGT9CUC1TFGP=-WPINKIC8CUCQTFGP?/QFGNN UGKV 4KVVGTMTGW\ UGKV4KVVGT MTGW\-NCUUG )QNFGOCKNNKGTVI OKV$CPFWPF6TCIGURCPIG CWHFGO4CPFFGUWPVGTGP-TGW \CTOUOGJTHCEJRWP\KGTV WC%(%HÒTFGP*GTUVGNNGT%(%CTNOCPKP5VQEMJQNO-HÒTEV QJPG,CJTGURWP\G COCNVGP$CPFOKVUEJYGFKUEJGT6TCIGURCPIG<- +p++



-ÌPKINKEJGT9CUC1TFGP=-WPINKIC8CUCQTFGP?/QFGNN UGKV 4KVVGTMTGW\ UGKV4KVVGT MTGW\-NCUUG )QNFGOCKNNKGTVI OKV$CPFWPF6TCIGURCPIG CWHFGO4CPFFGUWPVGTGP-TGW \CTOUOGJTHCEJRWP\KGTV WC%(%HÒTFGP*GTUVGNNGT%(%CTNOCPKP5VQEMJQNO-HÒTEV QJPG ,CJTGURWP\G  CO CNVGP $CPF OKV UEJYGFKUEJGT 6TCIGURCPIG KO QTKIKPCNGP 8GTNGKJWPIUGVWK XQP   %CTNOCP<- +p++

 289


KÖNIGREICH SCHWEDEN

8856 (1:1)

8857 (1:1) 8855

8854





-ÌPKINKEJGT9CUC1TFGP=-WPINKIC8CUCQTFGP?/QFGNN UGKV 4KVVGTMTGW\ UGKV4KVVGT MTGW\-NCUUG )QNFGOCKNNKGTVI OKV$CPFWPF6TCIGURCPIG CWHFGO4CPFFGUWPVGTGP-TGW\ CTOUOGJTHCEJRWP\KGTV WC%(%HÒTFGP*GTUVGNNGT%(%CTNOCPKP5VQEMJQNO-HÒTEV QJPG,CJTGURWP\G COCNVGP$CPFOKVUEJYGFKUEJGT6TCIGURCPIG<- +p++



-ÌPKINKEJGT9CUC1TFGP=-WPINKIC8CUCQTFGP?/QFGNN UGKV 4KVVGTMTGW\ UGKV4KVVGT MTGW\  -NCUUG  5KNDGT XGTIQNFGV /GFCKNNQPU )QNF GOCKNNKGTV FKG 4ÒEMUGKVGP \YGKGT -TGW\CTOG DG   JGNHUO·­KITGRCTKGTVFTGK-TGW\URKV\GPIGUVCWEJVWPFOKVOKP'OCKNNGCWUDTÒEJGPUVCTMCPIGNCWHGPCO CNVGP$QIGPDCPF<- +++



'ZGORNCTGKP5KNDGTXGTIQNFGVUKPFYGKVCWUUGNVGPGTCNUGEJVIQNFGPG



-ÌPKINKEJGT 9CUC1TFGP =-WPINKIC 8CUCQTFGP?  /QFGNN UGKV   /KPKCVWT FGU 4KVVGTMTGW\GU  

UGKV4KVVGTMTGW\-NCUUG )QNFGOCKNNKGTVCO$·PFEJGPOKV6TCIGMPQRH ++





-ÌPKINKEJGT 9CUC1TFGP =-WPINKIC 8CUCQTFGP?  /QFGNN UGKV   /KPKCVWT FGU 4KVVGTMTGW\GU  

UGKV4KVVGTMTGW\-NCUUG )QNFGOCKNNKGTVCO$·PFEJGPOKV6TCIGMPQRH ++





-ÌPKINKEJGT 9CUC1TFGP =-WPINKIC 8CUCQTFGP?  /QFGNN UGKV   /KPKCVWT FGU 4KVVGTMTGW\GU  

UGKV4KVVGTMTGW\-NCUUG )QNFGOCKNNKGTVCO$·PFEJGPOKV6TCIGMPQRH ++



8859 8860 8861



8862

-ÌPKINKEJGT9CUC1TFGP=-WPINKIC8CUCQTFGP?/QFGNN UGKV /KPKCVWTFGU4KVVGTMTGW\GU UGKV 4KVVGTMTGW\-NCUUG )QNFGOCKNNKGTVCO$·PFEJGPOKV6TCIGMPQRH&C\WGKPYGKVGTGU'ZGORNCTKP 5KNDGTXGTIQNFGVWPFGOCKNNKGTVUQYKGGKPG-PQRHNQEJUEJNGKHGOKVCWHIGNGIVGO1TFGPUMTGW\ 5VÒEM++





-ÌPKINKEJGT 9CUC1TFGP =-WPINKIC 8CUCQTFGP? -NGKPG )QNFGPG 9CUC/GFCKNNG )TÌ­G   &WTEJ   OGUUGTOO)QNFIQJPG2WP\KGTWPIQJPG$CPF<- ++





#FNKIGU,WPIHTCWGPUVKHV\W8CFUVGPC=8CFUVGPCCFNKICLWPIHTWUVKHV?5VKHVUFGMQTCVKQP/QFGNN OKV TQVYGK­GP (NCOOGP \YKUEJGP FGP -TGW\CTOGP  8GTFKGPUVMTGW\ HÒT *GTTGP )QNF GOCKNNKGTV HGKPUVG   'OCKNNGOCNGTGKCWHFGT4ÒEMUGKVGCNVG'OCKNNGDNCUGCOQTKIKPCNGPNCPIGPCNVGP*CNUDCPF ++



*GTXQTTCIGPFG#PHGTVKIWPIYQJNCWUFGTGTUVGP*·NHVGFGU,CJTJWPFGTVU#O/CKGTJKGNVGPFKGGTUVGP 5VKHVUHT·WNGKPFGUDGTGKVUIGITÒPFGVGPCDGTPQEJPKEJVGTTKEJVGVGP,WPIHTCWGPUVKHVGU1VVKNKCPC)T·HKP.CIGTDGTI IGD8GNNKPIM CNUGTUVGDVKUUKPIGUV %JCTNQVVC*COKNVQPCH*CIGD[WPF/CTKC(CNMGPDGTICH6T[UVQTRCWU FGT*CPFXQP-ÌPKIKP.QXKUC7NTKMCXQP5EJYGFGP  FGTIGDQTGPGP2TKP\GUUKP.QWKUG7NTKMGXQP$TCP FGPDWTI2TGW­GP WPF 5EJYGUVGT (TKGFTKEJU FGU )TQ­GP FKG PGW IGUVKHVGVGP +PUKIPKGP &CU$CPFKUVPQTOCNGTYGKUG YGK­OKVJKOOGNDNCWGP4CPFUVTGKHGPDGKDGUQPFGTGP8GTFKGPUVGPMQPPVGFCU-TGW\CWEJCP*GTTGPXGTNKGJGPYGT FGPFKGGUFCPPGKPGO$CPFKPWOIGMGJTVGT(CTDHQNIG JKOOGNDNCWOKVYGK­GP4CPFUVTGKHGP CO*CNUGVTWIGP(ÒT IKDV)TKV\PGTKP)4+&5GKPG<CJNXQP5VKHVUFCOGPCP



290

#FNKIGU ,WPIHTCWGPUVKHV \W 8CFUVGPC =8CFUVGPC CFNKIC LWPIHTWUVKHV? #MVWGNNG #WUHÒJTWPI KP GKPGT   IGIGPY·TVKIGP #PHGTVKIWPI $TQP\G XGTIQNFGV WPF GOCKNNKGTV CP &COGPUEJNGKHG \WUCOOGP OKV   /KPKCVWT$TQP\GXGTIQNFGVWPFGOCKNNKGTVCO5EJNGKHEJGP +p++




KÖNIGREICH SCHWEDEN

8863 (1:1)



/GFCKNNG FGU -ÌPKIU /QFGNN OKV FGO LÒPIGTGP 2QTVTCKV XQP -ÌPKI -CTN :8+ )WUVCX)TQ­G )TÌ­G  /GFCKNNGKP)QNFCPFGT-GVVG)QNF&WTEJOGUUGTOOIKO4CPFOGJTHCEJRWP\KGTV W C*GTUVGNNGTRWP\G/81-HÒTEV)QNFWPF,CJTGURWP\G-HÒT CWHFGT4ÒEMUGKVG ITCXKGTV.'00#46.,70)CPFGTQTKIKPCNGP6TCIGMGVVGKO1TKIKPCNGVWKFGT(KTOC%( %CTNOCPKP5VQEMJQNO 444++  8QPCNNGTITÌ­VGT5GNVGPJGKV&KG)TQ­G/GFCKNNGKP)QNFCPFGT-GVVGKUVFKGJÌEJUVG#WU\GKEJPWPIFKGFGT-ÌPKI CPUEJYGFKUEJG$ÒTIGTXGTIGDGPMCPP#TOGGIGPGTCN.GPPCTV.LWPI  YCTXQPDKU1DGTDG HGJNUJCDGTFGTUEJYGFKUEJGP5VTGKVMT·HVG'TGTJKGNVFKGUG/GFCKNNG\WUGKPGT8GTCDUEJKGFWPICNU1DGTDGHGJNUJCDGT

8864 ex 8865 (1:1)

8866

ex 8867



%CTN,QJCPPU/GFCKNNG/GFCKNNGQJPG-TQPG5KNDGTQJPG$CPF#450T

++



'JTGP\GKEJGP \WT )QNFGPGP *QEJ\GKV -ÌPKI 1UECTU ++ WPF -ÌPKIKP 5QRJKCU CO  ,WPK    5KNDGT XGTIQNFGV QJPG $CPF \WUCOOGP OKV /KPKCVWT 5KNDGT XGTIQNFGV QJPG $·PFEJGP 6*1 5    5VÒEM++





1N[ORKUEJG/GFCKNNG-ÌPKI)WUVCX8  5KNDGTOKV5VGORGNUEJPGKFGTPCOGP#.+0&'0$'4) CO$CPF.¤)TWRRG* ++





-TGW\ HÒT 8GTFKGPUVG WO FKG 5EJYGFKUEJGP 5VTGKVMT·HVG )QNFGPGU -TGW\ $TQP\G XGTIQNFGV WPF   VGKNYGKUGGOCKNNKGTVCWHFGT4ÒEMUGKVG*GTUVGNNGTDG\GKEJPWPIFGT(KTOC5RQTTQPIWPF/CVTKMGNPWOOGT 04WPF9KFOWPIUITCXWT.'00#46.,70)CO$CPFKO'VWK&C\W#PUVGEMPCFGNOKV /QPQITCOO -ÌPKI)WUVCX8WPFITQ­GGKPUGKVKIG2NCMGVVGFGUHKPPKUEJGP8GTVGKFKIWPIUOKPKUVGTKWOU &WTEJOGUUGTOO$TQP\GOKVTÒEMUGKVKIGT9KFOWPIUITCXWT)GPGTCN.GPPCTV.LWPI (KPNCPFUHÌTUXCTUOKPKUVGT8GKMMQ2KJNCLCO·MK 5VÒEM++



6JQTPKV KP6*15 IKDVCPFC­XQPFKGUGO'JTGP\GKEJGPPWT5VÒEMCPIGHGTVKIVYQTFGPUKPF



#TOGGIGPGTCN.GPPCTV.LWPI  YCTXQPDKU1DGTDGHGJNUJCDGTFGTUEJYGFKUEJGP5VTGKVMT·HVG

291


KÖNIGREICH SCHWEDEN

8868 (1:1)



8869

/GFCKNNGHÒT8GTFKGPUVGWOFCU4QVG-TGW\/QFGNNOKVFGOLÒPIGTGP2QTVTCKVXQP-ÌPKI%CTN:8+ )WUVCX-NGKPG)QNFGPG/GFCKNNG&WTEJOGUUGTOO)QNFI OKV$CPF CWHFGT4ÒEMUGKVG 9KFOWPIUITCXWT.GPPCTV.LWPICO$CPFKO1TKIKPCNGVWK ++



&KGUG/QFGNNKPGEJV)QNFUGJTUGNVGP&GT1DGTDGHGJNUJCDGTFGTUEJYGFKUEJGP5VTGKVMT·HVG#TOGGIGPGTCN.GPPCTV .LWPI  JCVFKG/GFCKNNGXGTNKGJGPDGMQOOGP



8GTFKGPUVOGFCKNNG FGU 5EJYGFKUEJGP (GWGTYGJT8GTDCPFGU #WUICDG OKV FGO LÒPIGTGP 2QTVTCKV   -ÌPKI %CTNU :8+ )WUVCX )QNFGPG 8GTFKGPUVOGFCKNNG 5KNDGT XGTIQNFGV CWH FGT 4ÒEMUGKVG OGJTHCEJ   RWP\KGTV WC*GTUVGNNGTRWP\G52144FGT(KTOC5RQTTQPI5KNDGTRWP\G5WPF,CJTGURWP\G$ HÒT OKV9KFOWPIUITCXWT#*+.&+0)CP$CPFOKV0CFGNKOQTKIKPCNGP8GTNGKJWPIU GVWK 4+p++



8870 1:1,5



)TQ­G 1TFGPUUEJPCNNG FGU #TOGGIGPGTCNU .GPPCTV .LWPI   OKV  #WU\GKEJPWPIGP    )QNFGPG.KPICFGP/GFCKNNG5KNDGTXGTIQNFGVRWP\KGTV )QNFGPG8GTFKGPUVOGFCKNNGFGU<GP VTCNXGTDCPFGUHÒT$GHGJNU#WUDKNFWPI/QFGNN%CTN:8+)WUVCX5KNDGTXGTIQNFGVRWP\KGTV )QNFGPG /GFCKNNGHÒT8GTFKGPUVGWOFKG(TGKYKNNKIGP#WVQOQDKNMQTRU/QFGNN%CTN:8+)WUVCX5KNDGTXGTIQN FGV RWP\KGTV OKV 6T·IGTPCOGP   )QNFGPG 8GTFKGPUVOGFCKNNG FGU 4GKEJXGTDCPFGU FGT HTGKYKNNKIGP   /KNKV·T/QVQTTCFHCJTGT /QFGNN %CTN :8+ )WUVCX 5KNDGT XGTIQNFGV RWP\KGTV OKV 6T·IGTPCOGP     )QNFGPG 8GTFKGPUVOGFCKNNG FGU 0CVKQPCNXGTDCPFGU FGT 8GTVGKFKIWPIUJGNHGTKPPGP /QFGNN %CTN :8+   )WUVCX5KNDGTXGTIQNFGVRWP\KGTV )QNFGPG8GTFKGPUVOGFCKNNGFGU$NCWGP5VGTPU/QFGNN%CTN:8+ )WUVCXXGTIQNFGVOKV6T·IGTPCOGP )QNFGPG8GTFKGPUVOGFCKNNGFGT5EJYGFKUEJGP*GKOYGJT/Q FGNN%CTN:8+)WUVCXXGTIQNFGV )QNFGPG8GTFKGPUVOGFCKNNGFGU0CVKQPCNGP8GTDCPFGUFGT#WVQHCJ TGTKPPGP /QFGNN %CTN :8+ )WUVCX 5KNDGT XGTIQNFGV RWP\KGTV   )QNFGPG 8GTFKGPUVOGFCKNNG FGU   8GTDCPFGUFGTHTGKYKNNKIGP/KNKV·THWPMGT5KNDGTXGTIQNFGVRWP\KGTV )QNFGPGU'JTGP\GKEJGP-ÌPKI WPF 8CVGTNCPF XGTIQNFGV OKV 6T·IGTPCOGP   )QNFGPG 8GTFKGPUVOGFCKNNG FGU 8GTDCPFGU FGT $G   HGJNUCWUDKNFGT XQP 7RRNCPF 5KNDGT XGTIQNFGV RWP\KGTV OKV 6T·IGTPCOGP   5KNDGTPG 8GTFKGPUVOG   FCKNNG FGU 8GTDCPFGU FGT $GHGJNUCWUDKNFGT XQP 5VQEMJQNO 5KNDGT RWP\KGTV OKV 6T·IGTPCOGP    (TCPMTGKEJ0CVKQPCNGT8GTFKGPUVQTFGP )TQ­ 1HHK\KGTUFGMQTCVKQP5KNDGTXGTIQNFGVWPFGOCKNNKGTV CP0CFGN 5VÒEM++ $GGKPFTWEMGPFG1TFGPUUEJPCNNGFGU#TOGGIGPGTCNU.GPPCTV.LWPI  FGTXQPDKU1DGTDGHGJNU JCDGTFGTUEJYGFKUEJGP5VTGKVMT·HVGYCT.LWPIYCTCWEJ)TQ­QHHK\KGTFGUHTCP\ÌUKUEJGP0CVKQPCNGP8GTFKGPUVQTFGPU WPF+PJCDGT\CJNTGKEJGTYGKVGTGTCWUN·PFKUEJGT1TFGPWPF'JTGP\GKEJGP

292




SCHWEIZ

8874 8871 (1:2)







/KPKCVWTGPURCPIG GKPGU /CTKPGQHHK\KGTU OKV UKGDGP #WU\GKEJPWPIUOKPKCVWTGP   9CUC1TFGP   4KVVGTMTGW\  -NCUUG 5KNDGT XGTIQNFGV WPF GOCKNNKGTV   )QNFGPG 8GTFKGPUVOGFCKNNG FGT 1TICPKUCVKQP   HÒT YGKDNKEJG 8GTVGKFKIWPIUJGNHGTKPPGP /QFGNN )WUVCX 8+ #FQNH 5KNDGT XGTIQNFGV   )QNFGPG /G   FCKNNG HÒT 8GTFKGPUVG WO FKG 5GGHCJTV /QFGNN )WUVCX 8+ #FQNH 5KNDGT XGTIQNFGV   )QNFGPG 8GT   FKGPUVOGFCKNNGFGU$NCWGP5VGTPU/QFGNN)WUVCX8+#FQNH5KNDGTXGTIQNFGV 5KNDGTPG-ÌPKIKP8KM VQTKC8GTFKGPUVOGFCKNNG 5KNDGT   -QNWODKGP 1HHK\KGTUMTGW\ FGU /CTKPG8GTFKGPUVQTFGPU #FOKTCN   2CFKNNC $TCUKNKGP1HHK\KGTUMTGW\FGU/CTKPG8GTFKGPUVQTFGPU#P0CFGN 5VÒEM++



5COONWPIXQPXQTYKGIGPFOKNKV·TKUEJGP#WU\GKEJPWPIGPCWUFGP4GIKGTWPIU\GKVGP)WUVCX8 )WUVCX8+#FQNHWPF%CTNU:8+)WUVCX7C)QNFGPG8GTFKGPUVOGFCKNNGFGT9GKDNKEJGP8GTVGKFK IWPIUJGNHGTKPPGP 8GTFKGPUVOGFCKNNG FGU 5EJYGFKUEJGP 4QVGP -TGW\GU  Z  8GTFKGPUVOGFCKNNG XQP   5VQEMJQNO Z )QNFGPGWPF5KNDGT8GTFKGPUVOGFCKNNGOGJTGTGT/KNKV·TXGTD·PFGLGYGKNUKP5KNDGTQFGT 5KNDGT XGTIQNFGV RWP\KGTV VGKNU OKV 6T·IGTPCOGP CP $·PFGTP CNNG KP JGTXQTTCIGPFGT 'TJCNVWPI VGKNU   KO1TKIKPCNGVWK 5VÒEM++



-ÌPKINKEJG2CVTKQVKUEJG)GUGNNUEJCHVWPF-ÌPKINKEJG)GUGNNUEJCHV2412#64+#-QPXQNWVXQPUGEJU #WU\GKEJPWPIUOGFCKNNGP LGYGKNU 5KNDGT OKV 6T·IGTPCOGP XKGT CO *CNUDCPF GKPG CO $TWUVDCPF WPF   GKPGCPFGT&COGPUEJNGKHGKPQTFGPVNKEJGT'TJCNVWPILGYGKNUKO'VWK 5VÒEM++



-#061051.16*740 

5%*9'+<

5EJWNRT·OKGFGU-CPVQPU5QNQVJWTP#WUHÒJTWPI5KNDGTOKVCPIGRT·IVGT¤UGQJPG$CPFTKPIWPF QJPG$CPF.'7 ++



8875

5'4$+'070&,7)15.#9+'0 (ª456'067/70&-¤0+)4'+%*5'4$+'0   

1TFGPXQO9GK­GP#FNGT=Îðäåí Áåëîã îðëà?/QFGNN CWHFGO4GXGTU,CJTGU\CJN  &GMQTCVKQP-NCUUGOKV5EJYGTVGTP5KNDGTXGTIQNFGVWPFGOCKNNKGTVOKP'OCKNNGCWUDTWEJCWH FGO4GXGTUGKPGT-TQPGP2GPFKNKGCOPGWGP*CNUDCPFCDUEJPKVV%/-9GZ+++<- ++



.CWV%CTWPF/WJKE KP%#/5HH JCPFGNVGUUKEJJKGTDGKWOGKPG#PHGTVKIWPIFGT(KTOC#TVJWU$GTVTCPFKP 2CTKU)GUVKHVGVXQP-ÌPKI/KNCP+81DTGPQYKEJCO,CPWCTRGT)GUGV\7PVGT-ÌPKI2GVGT+-CTCIGQTIG YKEJ YWTFG FKG )GUVCNVWPI FGU 1TFGPU\GKEJGPU FWTEJ #WUVCWUEJ FGU 5VKHVGTOQPQITCOOU OKV FGT ,CJTGU\CJN    XGT·PFGTV &KG OKNKV·TKUEJG #DVGKNWPI OKV 5EJYGTVGTP YWTFG XQP -ÌPKI 2GVGT + -CTCIGQTIGXKEJ GTUV CO  /CK   Y·JTGPFFGU'TUVGP9GNVMTKGIGUGKPIGHÒJTV

293


SERBIEN UND JUGOSLAWIEN

8876 (1:1)



1TFGP FGU -CTCFQTFG5VGTPU =Îðäåí Êàðàîðåâå çâåçäå? -TGW\  -NCUUG 5KNDGT XGTIQNFGV WPF   GOCKNNKGTVKO6TCIGTKPI*GTUVGNNGTRWP\G)#5FGT(KTOC)GQTI#FCO5EJGKFXGTUEJNCIGPGÌUVGTTGKEJK UEJG 5KNDGTRWP\G XQP  DKU  WPF #OVURWP\G # $CPFTKPI GTI·P\V CO UR·VGTGP *CNUDCPFCD   UEJPKVV%/--5+++<- ++



¤UVGTTGKEJKUEJG#PHGTVKIWPI\YKUEJGPWPF

8878 (1:1)

8877



8877

-TGW\ FGT )GUGNNUEJCHV XQO 4QVGP -TGW\ FGU -ÌPKITGKEJU 5GTDKGP =Êðñò Äðóøòâà Öâåíîã Êðñòà Êðàšåâèíå Ñðáè¼å?D\Y1TFGPFGT)GUGNNUEJCHVXQO4QVGP-TGW\FGU5GTDKUEJ-TQCVKUEJ5NQYG PKUEJGP-ÌPKITGKEJUÎðäåí Äðóøòâà Öâåíîã Êðñòà Êðàšåâèíå%:%?D\Y1TFGPFGT)GUGNNUEJCHV XQO 4QVGP -TGW\ FGU -ÌPKITGKEJU ,WIQUNCYKGP Îðäåí Äðóøòâà Öâåíîã Êðñòà Êðàšåâèíå   Jóãîñëàâè¼å?  /QFGNN OKV -TQPG    5KNDGT GOCKNNKGTV CO &TGKGEMUDCPF KO QTKIKPCNGP   YGK­GPTQVDGFTWEMVGP8GTNGKJWPIUGVWK%/-4%4%D ++



.CWV%CTWPF/WJKE KP%#/5 JCPFGNVGUUKEJJKGTDGKWOGKPG#PHGTVKIWPIFGT(KTOC*WIWGPKP(T½TGUKP .G.QENGKPFGT5EJYGK\



5V#PFTGCU/GFCKNNGHÒT.Q[CNKV·V5KNDGTQJPG$CPFTKPIWPFQJPG$CPF%/-%/ &KG/GFCKNNGKUVPWTUGNVGP\WHKPFGP

294

44++




SERBIEN UND JUGOSLAWIEN

8879

(¤&'4#.+56+5%*'81.-54'27$.+-,7)15.#9+'0   

1TFGPXQOLWIQUNCYKUEJGP5VGTP=1TFGPLWIQUNQXGPUMG\XG\FG?/QFGNN  #WUICDG

9CRRGPCWHFGT4ÒEMUGKVGFGT&GMQTCVKQPFGTWPF-NCUUGOKVHÒPH(CEMGNP 5GVFGU 1TFGPU XQO LWIQUNCYKUEJGP 5VGTP OKV )QNFGPGO -TCP\  -NCUUG  DGUVGJGPF CWU &GMQTCVKQP FGT    -NCUUG5KNDGTXGTIQNFGVVGKNYGKUGGOCKNNKGTVFGT5VGTPCWHFGO8QTFGTUGKVGPOGFCKNNQPDGUGV\VOKVHÒPH ITÌ­GTGP WPF HÒPH MNGKPGP 5KOKNK4WDKPGP UGKVNKEJ CWH FGO 6TCIGTKPI *GTUVGNNGTRWP\G FGT +-1/ KP   <CITGD WPF 5KNDGTRWP\G CO QTKIKPCNGP *CNUDCPF WPF $TWUVUVGTP  #WUHÒJTWPI   5KNDGT   JCNDMWIGNHÌTOKIDTKNNCPVKGTVVGKNYGKUGXGTIQNFGVWPFGOCKNNKGTVFGT5VGTPCWHFGO/GFCKNNQPDGUGV\VOKV HÒPHITÌ­GTGPWPFHÒPHMNGKPGP5KOKNK4WDKPGPCWHFGT4ÒEMUGKVG*GTUVGNNGTRWP\GFGT+-1/KP<CITGD WPF5KNDGTRWP\GCP0CFGNQJPG'VWK<- 44++



8QPCNNGTITÌ­VGT5GNVGPJGKV&CFGT1TFGPKPCNNGP/QFGNNGP#WUICDGPWPF-NCUUGPPWT·W­GTUVURCTUCOXGTNKGJGP YQTFGPKUVUKPFCNNGUGKPG+PUKIPKGPIGPGTGNNCNUUGJTUGNVGP\WDGVTCEJVGPDGUQPFGTULGFQEJFKGLGPKIGPFGT-NCUUG FGU  /QFGNNU KP FGT  #WUHÒJTWPI OKV TQVGP 5VGKPGP CWH DGKFGP +PUKIPKGP  FKG XQP  DKU  CNUQ PWT    ,CJTGNCPIXGTNKGJGPYQTFGPUKPF)GUVKHVGVCO(GDTWCTXQP/CTUEJCNN,QUKR$TQ\6KVQ  2T·UK FGPVXQP,WIQUNCYKGPCNUFTGKMNCUUKIGT DKU-NCUUG 1TFGP /QFGNN#WUICDG HÒTWPIGYÌJPNKEJGPMWNVW TGNNGP RQNKVKUEJGP QFGT YKUUGPUEJCHVNKEJGP 'KPUCV\ WPF HÒT 8GTFKGPUVG WO FKG 'PVYKEMNWPI FGT HTKGFNKEJGP<WUCO OGPCTDGKVWPFFGTHTGWPFUEJCHVNKEJGP8GTDKPFWPIGP\YKUEJGP,WIQUNCYKGPWPFCPFGTGP.·PFGTP0CEJFGT8GTHCU UWPIU WPF FCOKV GKPJGTIGJGPFGP 9CRRGP·PFGTWPI XQO  #RTKN  PWPOGJT UGEJU UVCVV DKUJGT HÒPH (CEMGNP    YWTFGP CWEJ FKG 9CRRGPFCTUVGNNWPIGP CWH FGT 4ÒEMUGKVG FGT &GMQTCVKQPGP FGT  WPF  -NCUUG FGOGPVURTGEJGPF   IG·PFGTV /QFGNN#WUICDG &GT1TFGPYWTFGXQPFGTCO#RTKNIGITÒPFGVGP$WPFGUTGRWDNKM,WIQ UNCYKGP ÒDGTPQOOGP YQDGK CWH FGT 4ÒEMUGKVG FGT &GMQTCVKQPGP FGT  WPF  -NCUUG FCU PGWG CD  IÒNVKIG   9CRRGP FCU DKUJGTKIG GTUGV\VG  /QFGNN  +O &G\GODGT  XGTCDUEJKGFGVG FCU LWIQUNCYKUEJG 2CTNCOGPV GKP   )GUGV\ÒDGTFKG0GWQTFPWPIFGU1TFGPUYGUGPUYCUCDGTMGKPG#WUYKTMWPICWHFKG)GUVCNVWPIFGT1TFGPUKPUKIPKGP JCVVG&GT1TFGPYWTFGCWEJXQPFGTCO(GDTWCTIGITÒPFGVGP5VCCVGPWPKQP5GTDKGPWPF/QPVGPGITQQJPG YGKVGTGPFGTWPIGPÒDGTPQOOGP/KVFGT#WHNÌUWPIFGT5VCCVGPWPKQPCO,WPKKP(QNIGFGTINGKEJV·IKIGP 7PCDJ·PIKIMGKVUGTMN·TWPI/QPVGPGITQUIKPICWEJFGT1TFGPWPVGT

8880



ex 8881

ex 8882

1TFGP FGT 8QNMUCTOGG =1TFGP 0CTQFPG #TOKLG? )QNFGPGT 5VGTP  -NCUUG  5KNDGT VGKNYGKUG XGT   IQNFGVWPFGOCKNNKGTVCP0CFGN\WUCOOGPOKV+PVGTKOUURCPIGKOQTKIKPCNGPIQNFGPDGFTWEMVGP8GT NGKJWPIUGVWK<- ++



1TFGPFGU2CTVKUCPGPUVGTPU=1TFGPRCTVK\CPUMG\XKLG\FG?5VGTPOKV)GYGJTGP 5VWHG 5KNDGTCWH FGT 4ÒEMUGKVG 561.20,' WPF /CVTKMGNPWOOGT  CP 5EJTCWDG OKV 5EJTCWDUEJGKDG FCTCWH *GT   UVGNNGTDG\GKEJPWPI FGU /ÒP\JQHU KP /QUMCW OKV+PVGTKOUUEJPCNNG&C\W\YGK'ZGORNCTGFGU/KNKV·T 8GTFKGPUVQTFGPU =1TFGP \C XQLPG \CUNWIG? 5VGTP OKV UKNDGTPGP 5EJYGTVGTP  5VWHG  5KNDGT VGKNYGKUG   XGTIQNFGVWPFGOCKNNKGTVDGKGKPGO#DRNCV\WPIKPFGTTQVGP'OCKNNGCP0CFGNP 5VÒEM++



/KNKV·T8GTFKGPUVQTFGP=1TFGP\CXQLPG\CUNWIG?1TFGPOKVIQNFGPGP5EJYGTVGTP 5VWHG $TQP\G XGTUKNDGTVVGKNYGKUGXGTIQNFGVWPFGOCKNNKGTVCP0CFGNWPF1TFGPOKVUKNDGTPGP5EJYGTVGTP 5VWHG  5KNDGTVGKNYGKUGXGTIQNFGVWPFGOCKNNKGTVCP0CFGN 5VÒEM++



8GTNKGJGPCP)GPGTCN4KEECTFQ$KUQIPKGTQ IGD XQPDKU%JGHFGUKVCNKGPKUEJGP)GPGTCNUVCDGUFGT 8GTVGKFKIWPI





295


SPANIEN

8883

52#0+'0 

&4+66'5 -¤0+)4'+%*4')+'470)+5#$'..#5++  

-ÌPKINKEJ #OGTKMCPKUEJGT 1TFGP +UCDGNNCU FGT -CVJQNKUEJGP =4GCN 1TFGP #OGTKECPC FG +UCDGN NC   %CVQNKEC?  D\Y-ÌPKINKEJGT  1TFGP+UCDGNNCUFGT-CVJQNKUEJGP=4GCN   1TFGPFGU+UCDGNNC%CVQNKEC? UGKV /QFGNN OKV/QPQITCOO,4-ÌPKIKP+UCDGNNCU++    $TWUVUVGTP GKPGU -QOOCPFGWT XQP 0WOOGT $TQP\G XGTIQNFGV /GFCKNNQP 5KNDGT XGT   IQNFGVVGKNYGKUGGOCKNNKGTVCP0CFGNOKV\YGK5GKVGPJCMGP<-XCT ++p



'KPHCEJG #PHGTVKIWPI WO  CWU FGT 'PF\GKV FGT 4GIKGTWPI -ÌPKIKP +UCDGNNCU ++  &KGUGT 5VGTP YWTFG CNNGKPG   QJPGYGKVGTG+PUKIPKGPYKG*CNUQFGT$TWUVMTGW\XGTNKGJGPWPFIGVTCIGP&GTWTURTÒPINKEJFTGKMNCUUKIG )TQ­MTGW\ -QOOCPFGWTWPF4KVVGT 1TFGPHÒT8GTFKGPUVGKPFGPCOGTKMCPKUEJGP-QNQPKGPYWTFGOKV-ÌPKINKEJGT8GTQTFPWPI XQO  /·T\  XGTÌHHGPVNKEJV KP FGT )CEGVC FG /CFTKF  XQP -ÌPKI (GTFKPCPF 8++   IGUVKHVGV    /QFGNN -ÌPKIKP+UCDGNNC++  GTYGKVGTVGFGP1TFGPWOFKG-NCUUGFGTWPVGTJCNDFGU)TQ­MTGW\GUCPIG UKGFGNVGP-QOOCPFGWTGXQP0WOOGTWPFXGT·PFGTVGFKG)GUVCNVWPIFGT+PUKIPKGPOKV-ÌPKINKEJGO&GMTGVXQO ,WNK D\Y OKV 8GTQTFPWPI XQO  5GRVGODGT   /QFGNN  0CEJ UGKPGT 6JTQPDGUVGKIWPI CO  0QXGODGT    XGTNKGJ -ÌPKI #NHQPU :++   FGP 1TFGP YKGFGT KP FGT DKUJGTKIGP )GUVCNVWPI LGFQEJ PWPOGJT OKV   /QPQITCOO-ÌPKI(GTFKPCPF8++ /QFGNN /KV-ÌPKINKEJGO&GMTGVXQO#RTKNYWTFGFGTCOGTKMCPK UEJG$G\WIKO0COGPFGU1TFGPUIGUVTKEJGPOKV-ÌPKINKEJGO&GMTGVXQO/·T\GKPUKNDGTPGU-TGW\WPF OKV -ÌPKINKEJGO &GMTGV XQO  #TKN  GKPG /GFCKNNG KP 5KNDGT WPF $TQP\G GKPIGHÒJTV -ÌPKI #NHQPU :+++  

 GTYGKVGTVGOKV-ÌPKINKEJGO&GMTGVXQO,WPKWO-QNNCPGUQYKG5EJNGKHGWPF$CPF HÒT &COGP &KG <YGKVG 4GRWDNKM ÒDGTPCJO FGP 1TFGP OKV &GMTGV XQO  1MVQDGT  XGTÌHHGPVNKEJV KP FGT   )CEGVCFG/CFTKFXQO1VQDGT GPVHGTPVGFKGOQPCTEJKUEJGP5[ODQNGCWUFGP+PUKIPKGPFKGVGKNYGKUGFWTEJGKP 5GIGNUEJKHH GTUGV\V YWTFGP WPF HÒTVG \WT -QNNCPG IGUQPFGTVG 5EJWNVGTDCPF+PUKIPKGP GKP  /QFGNN  9GKVGTG   8GT·PFGTWPIGP GTHQNIVGP OKV &GMTGV XQO  &G\GODGT  XGTÌHHGPVNKEJV KP FGT )CEGVC FG /CFTKF XQO  &G   \GODGT )GPGTCN(TCPEKUEQ(TCPEQ[$CJCOQPFG  ÒDGTPCJOFGPPWPOGJTCEJVMNCUUKIGP KPMNWUKXGFGT /GFCKNNGP 1TFGPOKV&GMTGVXQO,WPK XGTÌHHGPVNKEJVKP$1'0TXQO5GRVGODGT WPFGTNKG­OKV &GMTGVXQO5GRVGODGT XGTÌHHGPVNKEJVKP$1'0TXQO1MVQDGT GKPPGWGU4GIQNCOGPVQ /QFGNN  9GKVGTG 8GT·PFGTWPIGP YWTFGP OKV &GMTGV  XQO  ,WPK  XGTÌHHGPVNKEJV KP $1' 0T  XQO    ,WPK FWTEJIGHÒJTV0CEJFGT6JTQPDGUVGKIWPIXQP-ÌPKI,WCP%CTNQU+YWTFGFKGUQIGPCPPVGKORGTKCNG-TQPGFGT MCVJQNKUEJGP -ÌPKIG CWH FGP $TWUVUVGTPGP FWTEJ GKPG -ÌPKIUMTQPG GTUGV\V  /QFGNN  &KG NGV\VG 8GT·PFGTWPI   GTHQNIVG OKV -ÌPKINKEJGO &GMTGV 0T  XQO  0QXGODGT  XGTÌHHGPVNKEJV KP $1' 0T  XQO    0QXGODGT 

8884



296

-ÌPKINKEJ #OGTKMCPKUEJGT 1TFGP +UCDGNNCU FGT -CVJQNKUEJGP   D\Y -ÌPKINKEJGT     1TFGP+UCDGNNCUFGT-CVJQNKUEJGP UGKV /QFGNN OKV/QPQITCOO,4  -QOOCPFGWTMTGW\UR·VGHTCP\ÌUKUEJG#PHGTVKIWPI5KNDGT/GFCKNNQPU)QNFGOCKNNKGTV4GRCTCVWTGPKP FGT'OCKNNGFGT-TGW\CTOGFTGK-TGW\URKV\GPXGTDQIGP#DRNCV\WPIGPKPFGT'OCKNNGFGU.QTDGGTMTCP \GUCOQTKIKPCNGPCNVGP*CNUDCPF<- +++




SPANIEN

8886 8885

8887

(ª0(6'5 -¤0+)4'+%*   

-ÌPKINKEJGTWPF8GTFKGPUVXQNNGT5RCPKUEJGT1TFGP-CTNU+++=4GCN[&KUVKPIWKFC1TFGP'URCÇQNC FG%CTNQU+++?  D\Y-ÌPKINKEJGTWPF=4GCN[?  5GJT=/W[?8GTFKGPUVXQNNGT 1TFGP -CTNU +++ =&KUVKPIWKFC 1TFGP FG %CTNQU +++? UGKV    /QFGNN   $TWUVUVGTP   \WT -QNNCPG #WUHÒJTWPI QJPG *GTUVGNNGTDG\GKEJPWPI 5KNDGT DTKNNCPVKGTV WPF VGKNYGKUG XGTIQNFGV   /GFCKNNQP)QNFGOCKNNKGTVHGKPUVG'OCKNNGOCNGTGKCP0CFGNOKV\YGK5GKVGPJCMGP 44++



#PHGTVKIWPI WO  XQP CNNGTITÌ­VGT 5GNVGPJGKV FC FKGUG 5VWHG PWT FGO -ÌPKI WPF YGPKIGP 5VCCVUQDGTJ·WRVGTP   XQTDGJCNVGPKUV/KV-ÌPKINKEJGO&GMTGVXQO5GRVGODGTUVKHVGVG-ÌPKI#NHQPU:++  GTI·P\V FWTEJ&GMTGVXQO,WNK XGTÌHHGPVNKEJKPFGT)CEGVCFG/CFTKFXQO1MVQDGT \WFGTDGTGKVUUGKV GZKUVKGTGPFGP-QNNCPGFGU1TFGPUDGUQPFGTG+PUKIPKGPFKG\WUCOOGPOKVFKGUGTXGTNKGJGPYWTFGP&GTYGUGPVNKEJG 7PVGTUEJKGF DGUVCPF KP FGT (CTDG FGU 5EJWNVGTDCPFGU JGNNDNCW OKV \YGK UEJOCNGPYGK­GP5GKVGPUVTGKHGPUVCVVFTGK INGKEJDTGKVGP5VTGKHGPKPJGNNDNCWYGK­JGNNDNCWYKGDGKOPQTOCNGP)TQ­MTGW\ WPFKPFGPIQNFHCTDGPGP.KNKGP \YKUEJGPFGP-TGW\CTOGPFGU$TWUVUVGTPUUVCVVFGPUKNDGTHCTDGPGPDGKO$TWUVUVGTPFGUPQTOCNGP)TQ­MTGW\GU XIN CWEJ-ÒPMGT#WMVKQPCO1MVQDGT-CVCNQI0T   &GT\WP·EJUVXKGTMNCUUKIG )TQ­MTGW\-QOOCPFGWT4KVVGTOKV2GPUKQPWPF4KVVGTXQP0WOOGT 1TFGPYWTFGXQP -ÌPKI %CTNQU +++   OKV 7TMWPFG XQO  5GRVGODGT  IGUVKHVGV  /QFGNN  XQP -ÌPKI %CTNQU +8  

 OKV-ÌPKINKEJGO&GMTGVXQO,WPK /QFGNN WPFXQP-ÌPKI(GTPCPFQ8++  OKV &GMTGV XQO  #RTKN  XGT·PFGTV 'KPG 8GT·PFGTWPI FGT +PUKIPKGP YWTFG FWTEJ &GMTGVG -ÌPKIKP +UCDGNNCU++

  XQO  ,WNK  WPF 8GTQTFPWPI XQO  5GRVGODGT  5VKHVWPI FGT -QNNCPG WPF FGU -QO   OCPFGWTUXQP0WOOGT#DUEJCHHWPIFGT4KVVGTOKV2GPUKQPWPFFGT4KVVGTXQP0WOOGT\W)WPUVGPFGTGKPHCEJGP 4KVVGT  FWTEJIGHÒJTV  /QFGNN  &KG RTQXKUQTKUEJG 4GIKGTWPI WPVGT 4GIGPV(TCPEKUEQ5GTTCPQ&QOÃPIWG\XGTNKGJ FGP1TFGPOKVGPVHGTPVGPDQWTDQPKUEJGP.KNKGPDKU\WO'PFGFGT4GIGPVUEJCHVYGKVGT /QFGNN -ÌPKI#OCFGQ

  YKG CWEJ FKG 'TUVG 5RCPKUEJG 4GRWDNKM XGTNKGJGP FGP 1TFGP PKEJV -ÌPKI #NHQPUQ :++     PCJOPCEJUGKPGT6JTQPDGUVGKIWPICO&G\GODGTHQTONQUFKG8GTNGKJWPIGPFGU1TFGPUCDYKGFGTCWH

 /QFGNN  /KV -ÌPKINKEJGO &GMTGV XQO  5GRVGODGT  UVKHVGVG #NHQPU :++ GTI·P\V FWTEJ &GMTGV XQO     ,WNK  XGTÌHHGPVNKEJ KP FGT )CEGVC FG /CFTKF XQO  1MVQDGT  \W FGT DGTGKVU UGKV  GZKUVKGTGPFGP   -QNNCPG FGU 1TFGPU DGUQPFGTG )TQ­MTGW\+PUKIPKGP FKG \WUCOOGP OKV FKGUGT XGTNKGJGP YWTFGP /KV &GMTGV XQO    ,CPWCT  XGTÌHHGPVNKEJV KP FGT )CEGVC FG /CFTKF XQO  ,CPWCT  YWTFG FGT 1TFGP WPVGT -ÌPKI #NHQPUQ   :+++   CDGTOCNU XGT·PFGTV WO PCEJ FGT #WUTWHWPI FGT 4GRWDNKM CO  #RTKN   CWHIGJQDGP \W   YGTFGP 5VCCVUEJGH )GPGTCN (TCPEKUEQ (TCPEQ [ $CJCOQPFG   GTPGWGTVG FGP 1TFGP OKV &GMTGV XQO   /CKXGTÌHHGPVNKEJVKO$1'XQO#WIWUV /QFGNN &KGNGV\VGP'TYGKVGTWPIGPYWTFGPXQP-ÌPKI,WCP %CTNQU + IGD   OKV &GMTGV  XQO  #WIWUV  XGTÌHHGPVNKEJV KO $1' XQO  #WIWUV     8GTQTFPWPIXQO1MVQDGT XGTÌHHGPVNKEJVKO$1'XQO1MVQDGT  5VKHVWPIFGT)TQ­MTGW\=$CPFC?WPF 4KVVGTMNCUUG =.C\Q? HÒT &COGP  WPF 8GTQTFPWPI XQO  /CK  XGTÌHHGPVNKEJV KO $1' XQO  /CK    FWTEJIGHÒJTV #DUEJCHHWPIFGTDGKFGP&COGP-NCUUGPWPFIGPGTGNNG¤HHPWPICNNGT-NCUUGPFGU1TFGPUHÒT(TCWGP YQDGKFKGWPVGTUVG-NCUUGō4KVVGTŋKPō-TGW\WODGPCPPVYWTFG 



-ÌPKINKEJGTWPF8GTFKGPUVXQNNGT5RCPKUEJGT1TFGP-CTNU+++=4GCN[&KUVKPIWKFC1TFGP'URCÇQNC FG%CTNQU+++?  D\Y-ÌPKINKEJGTWPF=4GCN[?  5GJT=/W[?8GTFKGPUVXQNNGT 1TFGP-CTNU+++=&KUVKPIWKFC1TFGPFG%CTNQU+++? UGKV /QFGNN  -NGKPQF\WO )TQ­MTGW\ #WUHÒJTWPI OKV UVCTTGO .QTDGGTMTCP\  Z  OO )QNF VGKNYGKUG HGKPUV \KUGNKGTV   GOCKNNKGTVIHGKPUVG'OCKNNGOCNGTGKQJPG$CPFTKPIWPFQJPG5EJWNVGTDCPF<- +



5GJTHGKPG#PHGTVKIWPIWOKPJÌEJUVGT3WCNKV·VWPFCNNGTDGUVGT'TJCNVWPI



-ÌPKINKEJGTWPF8GTFKGPUVXQNNGT5RCPKUEJGT1TFGP-CTNU+++=4GCN[&KUVKPIWKFC1TFGP'URCÇQNC FG%CTNQU+++?  D\Y-ÌPKINKEJGTWPF=4GCN[?  5GJT=/W[?8GTFKGPUVXQNNGT 1TFGP -CTNU +++ =&KUVKPIWKFC1TFGPFG%CTNQU+++? UGKV /QFGNN  $TWUVUVGTP GKPGU-QOOCPFGWTUXQP0WOOGT5KNDGTDTKNNCPVKGTVWPFTGRGTEKGTV#WHNCIGPVGKNYGKUG)QNFGOCKNNKGTV GKPKIGMCWOUKEJVDCTG'OCKNNGTGRCTCVWTGPCP0CFGNOKV\YGK5GKVGPJCMGP ++



5GJT HGKPG #PHGTVKIWPI CWU FGO NGV\VGP 8KGTVGN FGU  ,CJTJWPFGTVU &KG 5VGTPG FGT -QOOCPFGWTG XQP 0WOOGT   YWTFGPCNNGKPGQJPGYGKVGTG+PUKIPKGPYKG*CNUQFGT$TWUVMTGW\XGTNKGJGPWPFIGVTCIGP

297


SPANIEN

8889

8888





-ÌPKINKEJGTWPF8GTFKGPUVXQNNGT5RCPKUEJGT1TFGP-CTNU+++=4GCN[&KUVKPIWKFC1TFGP'URCÇQNC FG%CTNQU+++?  D\Y-ÌPKINKEJGTWPF=4GCN[?  5GJT=/W[?8GTFKGPUVXQNNGT 1TFGP-CTNU+++=&KUVKPIWKFC1TFGPFG%CTNQU+++? UGKV /QFGNN  4KVVGTMTGW\ #WUHÒJTWPIOKVUVCTTGO.QTDGGTMTCP\ZOO)QNFVGKNYGKUGHGKPUV\KUGNKGTVGOCKNNKGTVI HGKPUVG'OCKNNGOCNGTGKCOCNVGP1TKIKPCNDCPF<- +p++



-ÌPKINKEJ #OGTKMCPKUEJGT 1TFGP +UCDGNNCU FGT -CVJQNKUEJGP =4GCN 1TFGP #OGTKECPC FG +UCDGN NC   %CVQNKEC?  D\Y-ÌPKINKEJGT  1TFGP+UCDGNNCUFGT-CVJQNKUEJGP=4GCN   1TFGPFGU+UCDGNNC%CVQNKEC? UGKV /QFGNN  5KNDGTPG/GFCKNNG   5KNDGTCO$CPFOKV6TCIGURCPIG 4++



8890 (1:1)



-ÌPKINKEJGT1TFGPFGT'FNGP&COGPFGT-ÌPKIKP/CTKC.WKUC=4GCN1TFGPUFGNCU&COCU0QDNGU FGNC4GKPC/CTÃC.WKUC?1TFGPUMTGW\#WUHÒJTWPIOKVUVCTTGO.QTDGGTMTCP\WPFDGYGINKEJGT-GVVG 5KNDGTXGTIQNFGV/GFCKNNQPU)QNFGOCKNNKGTVHGKPUVG'OCKNNGOCNGTGKCPCNVGOQTKIKPCNGP5EJWNVGTDCPF <- ++  &GT CWUUEJNKG­NKEJ &COGP XQTDGJCNVGPG \WP·EJUV GKPMNCUUKIG 1TFGP CO 5EJWNVGTDCPF $CPFC IGPCPPV  YWTFG XQP   -ÌPKI-CTN+8  XQP5RCPKGPCWH+PKVKCVKXGUGKPGT)GOCJNKP/CTKC.WKUC  OKV-ÌPKINKEJGO &GMTGVXQO#RTKNIGUVKHVGVFKG5VCVWVGPCO/·T\XGTCDUEJKGFGV/KV-ÌPKINKEJGO&GMTGVXQO  0QXGODGT  UVKHVGVG #NHQPU :++   FKG CNU -TGW\ =%TW\? DG\GKEJPGVG WPVGTG -NCUUG FKG CP GKPGT   5EJNGKHG CP FGT $TWUV IGVTCIGP YWTFG &GT 1TFGP FGT DKU JGWVG GZKUVKGTV YCT UVGVU CP FKG 2GTUQP FGU  

DQWTDQPKUEJGP -ÌPKIUD\YFGU6JTQPRT·VGPFGPVGPIGDWPFGPWPFYWTFGYGFGTXQPFGT2TQXKUQTKUEJGP4GIKGTWPI PQEJKPFGPDGKFGP4GRWDNKMGPPQEJXQP-ÌPKI#OCFGQQFGT5VCCVUEJGH(TCPEQXGTNKGJGP

298


SPANIEN

8891



-ÌPKINKEJGT  WPF UGKV   WPF /KNKV·TKUEJGT 1TFGP FGU JN *GTOGPGIKNFQ  /QFGNN  

 WPF   $TWUVUVGTP \WO )TQ­MTGW\ 5KNDGT DTKNNCPVKGTV WPF TGRGTEKGTV VGKNYGKUG   XGTIQNFGV /GFCKNNQP WPF -TQPG )QNF GOCKNNKGTV GKP 5VTCJN TGEJVU WPVGP VGKNYGKUG CPIGDTQEJGP CP   0CFGNOKV\YGK5GKVGPJCMGP ++



1TKIKPCNG)TQ­MTGW\UVGTPG\WGTMGPPGPCPFGTCWHIGUGV\VGP-TQPGCWHFGOQDGTGP-TGW\CTOUKPFXQPCNNGTITÌ­VGT 5GNVGPJGKV5GJTSWCNKV·VUXQNNG#PHGTVKIWPICWUFGONGV\VGP8KGTVGNFGU,CJTJWPFGTVU  &GT FTGKMNCUUKIG )TQ­MTGW\ 5VGTP WPF -TGW\  /KNKV·T8GTFKGPUVQTFGP YWTFG OKV MÌPKINKEJGO &GMTGV XQO   0QXGODGTXQP-ÌPKI(GTFKPCPF8++  IGUVKHVGVFCU4GIQNCOGPVQFCVKGTVXQO,WNK/KV -ÌPKINKEJGO&GMTGVXQO,CPWCTGTJKGNVFCU$CPFPGWG(CTDGPWPFPQEJGKPOCNFWTEJ-ÌPKI#NHQPU:++

  OKV -ÌPKINKEJGO &GMTGV XQO  ,WPK   /QFGNN  &KG <YGKVG 4GRWDNKM ÒDGTPCJO KO *GTDUV   FGP1TFGPGTUGV\VGLGFQEJFKG-ÌPKIUMTQPGFWTEJGKPG/CWGTMTQPGWPFGPVHGTPVGFCU5VKHVGTOQPQITCOOCWH FGT 4ÒEMUGKVG FGU /GFCKNNQPU  /QFGNN  5VCCVUEJGH )GPGTCN (TCPEKUEQ (TCPEQ [ $CJCOQPFG     ÒDGTPCJOFGP1TFGP\WP·EJUVOKVFGTUQIGPCPPVGPKORGTKCNGP-TQPGFGTMCVJQNKUEJGP-ÌPKIGGTUGV\VGFKGULGFQEJ OKV&GMTGVXQO/CK XGTÌHHGPVNKEJVKO$1'0TXQO,WPK FWTEJFKGWTURTÒPINKEJG-ÌPKIUMTQPG /KV MÌPKINKEJGO &GMTGV  XQO  (GDTWCT  XGTÌHHGPVNKEJV KP $1' 0T  XQO  (GDTWCT  HÒIVG   -ÌPKI ,WCP %CTNQU + WPVGTJCND FGU 5VGTPU =2NCEC?GKPG-QOOCPFGWTUMNCUUGGKP0GWG5VCVWVGPYWTFGPUEJNKG­NKEJ OKV-ÌPKINKEJGO&GMTGVXQO,WPKGTNCUUGP

8892





8893

-ÌPKINKEJGTWPF=4GCN[? WPFUGKV /KNKV·TKUEJGT1TFGPFGUJN*GTOGPGIKNFQ =/KNKVCT 1TFGP FG 5CP *GTOGPGIKNFQ?  /QFGNN  WPF   $TWUVUVGTP FGT    -NCUUG )QNFWPF5KNDGTDTKNNCPVKGTV/GFCKNNQP)QNFGOCKNNKGTVICWHFGO4GXGTU*GTUVGNNGTDG \GKEJPWPIFGT(KTOC(*[#(KP/CFTKFCP0CFGNOKV\YGK5GKVGPJCMGP<- ++



<KXKNGT 1TFGP #NHQPU :++ =1TFGP %KXKN #NHQPUQ :++? $TWUVUVGTP \WO -QOOCPFGWT XQP 0WOOGT    /QFGNN #PHGTVKIWPI FGT (KTOC %GLCNXQ KP /CFTKF 5KNDGT VGKNYGKUG XGTIQNFGV VGKNYGKUG GOCKNNKGTV   MCWOUKEJVDCTG4GRCTCVWTKPFGTTQVGP'OCKNNGFGT-TQPGCWHFGT4ÒEMUGKVG*GTUVGNNGTDG\GKEJPWPIFGT (KTOC/CTKCPQ%GLCNXQCP0CFGNFKGUGOKVHTCP\ÌUKUEJGT'KPHWJTRWP\GXQPDKU 5EJYCPGP RWP\G OKV\YGK5GKVGPJCMGP<- ++



&GT XKGTMNCUUKIG )TQ­MTGW\ -QOOCPFGWT XQP 0WOOGT -QOOCPFGWT WPF 4KVVGT  1TFGP HÒT 8GTFKGPUVG WO FKG   -WNVWTDGPCPPVPCEJ-ÌPKI#NHQPU:++  FGO8CVGTFGU5VKHVGTUYWTFGOKV-ÌPKINKEJGO&GMTGVXQO /CK XGTÌHHGPVNKEJVKPFGT)CEGVCFG/CFTKF0TXQO,WPK XQP-ÌPKI#NHQPU:+++  WPF FGO /KPKUVGTKWO HÒT 8QNMUGT\KGJWPI WPF FKG 5EJÌPGP -ÒPUVG WPVGTUVGNNV &KG 5VCVWVGP YWTFGP OKV MÌPKINKEJGO   &GMTGVXQO/CK XGTÌHHGPVNKEJVKPFGT)CEGVCFG/CFTKF0TXQO,WNK GTNCUUGP<WP·EJUVGPVURTCEJ FGT5VGTPFGU-QOOCPFGWTUXQP0WOOGTFGTUVGVUCNNGKPGQJPGYGKVGTG+PUKIPKGPYKG*CNUQFGT$TWUVFGMQTCVKQP IGVTCIGPYWTFGKP(QTO)GUVCNVWPIWPF)TÌ­GFGOFGU)TQ­MTGW\GU<WGKPGOWPDGMCPPVGP<GKVRWPMVYWTFGFKG )GUVCNVWPIFGU5VGTPUFGU-QOOCPFGWTUXQP0WOOGTYGUGPVNKEJXGT·PFGTV &KGXKQNGVVGOCKNNKGTVGP5VTCJNGPHKGNGP YGIWPFFKGIQNFHCTDGPGP5VTCJNGPFGT5QPPGYWTFGPXGTN·PIGTVņ/QFGNN 0CEJ#WUTWHWPIFGT4GRWDNKMYWTFG FGT1TFGPOKV&GMTGVXQO,WNKCDIGUEJCHHV

299


SPANIEN

8894



8895

<KXKNGT1TFGPHÒT9QJNV·VKIMGKV=1TFGP%KXKNFG$GPGHKEGPEKC?$TWUVUVGTP-NCUUG5KNDGTDTKNNCP VKGTVWPFHGKPUVCWUIGU·IV#WHNCIGP)QNFGOCKNNKGTVCWHFGT4ÒEMUGKVG*GTUVGNNGTDG\GKEJPWPIFGT(KTOC /GFKPCKP$CTEGNQPCCP0CFGNOKV\YGK5GKVGPJCMGP<- 44++



5GJT UGNVGP (GKPG #PHGTVKIWPI CWU FGT GTUVGP &GMCFG FGU <YCP\KIUVGP ,CJTJWPFGTVU 8QP  DKU  YWTFGP   WPVGT-ÌPKI#NHQPU:+++PWT5VGTPGFGT-NCUUGXGTNKGJGP+PFKGUGT-NCUUGYKTFPWTGKP$TWUVUVGTPQJPGYGKVGTG +PUKIPKGPYKG*CNUQFGT$TWUVFGMQTCVKQPXGTNKGJGPWPFIGVTCIGP  &GTWTURTÒPINKEJFTGKMNCUUKIG1TFGPYWTFGOKV-ÌPKINKEJGO&GMTGVXQO/CK XGTÌHHGPVNKEJVKPFGT)CEGVC FG /CFTKF XQO  /CK  XQP -ÌPKIKP +UCDGNNC ++ IGUVKHVGV FKG 5VCVWVGP FCVKGTGP XQO  &G\GODGT  -ÌPKI  #NHQPU :+++ TGQTICPKUKGTVG FGP1TFGPOKV-ÌPKINKEJGO&GMTGVXQO,WNK XGTÌHHGPVNKEJVKPFGT)CEGVCFG /CFTKF XQO  #WIWUV  KPFGO GT FGP +PUKIPKGP GKPG XQNNMQOOGP PGWG )GUVCNVWPI ICD  /QFGNN  KJP KP XKGT   #DVGKNWPIGP WPVGTVGKNVG WPF GKPG )TQ­MTGW\MNCUUG GKPHÒJTVG +P FKGUGT (QTO YWTFG FGT 1TFGP CWEJ Y·JTGPF FGT   <YGKVGP 4GRWDNKM XQP  DKU  Y·JTGPF FGT 4GIKGTWPI XQP (TCPEKUEQ (TCPEQ XQP  DKU  WPF CD   FKGUGO<GKVRWPMVCWEJXQP-ÌPKI,WCP%CTNQUYGKVGTXGTNKGJGP&GT1TFGPYWTFGKPCNNGP-NCUUGPPWTUGJTURCTUCO XGTNKGJGP WPF KUV FCJGT KP CNNGP UGKPGP +PUKIPKGPPWTUGJTUGNVGP\WHKPFGP/KV-ÌPKINKEJGO&GMTGV0T XQO#RTKN XGTÌHHGPVNKEJVKP$1'XQO#RTKN JQD-ÌPKI,WCP%CTNQUFGP1TFGP\W)WPUVGPFGUPGWGP IGUVKHVGVGPFTGKMNCUUKIGP<KXKNGP1TFGPUFGU5Q\KCNGP5QNKFCTKV·V=1TFGP%KXKNFGNC5QNKFCTKFCF5QEKCN?



-ÌPKINKEJGTWPF=4GCN[? DKU /KNKV·TKUEJGT1TFGPXQP/CTKC%JTKUVKPC=/KNKVCT1TFGP FG /CTÃC %TKUVKPC?  /QFGNN   $TWUVUVGTP  -NCUUG QJPG 5EJYGTVGT =UKP GURCFCU?   &WTEJOGUUGTOO5KNDGT#WHNCIGP5KNDGTWPF)QNF IGRTÒHV VGKNYGKUGGOCKNNKGTVCP0CFGNOKV \YGK5GKVGPJCMGP<- ++



1DGUUKEJDGKFKGUGO'ZGORNCTQJPGFKG5EJYGTVGTWOGKPGDGUQPFGTGDKUJGTPQEJPKEJVDGUEJTKGDGPG#WUHÒJTWPI QFGTPWTWOGKP8GTUGJGPFGU*GTUVGNNGTUJCPFGNVMQPPVGPQEJPKEJVIGMN·TVYGTFGP#NNG+PUKIPKGPFKGUGU1TFGPU UKPFXQPCNNGTITÌ­VGT5GNVGPJGKV#NNGTFKPIUYGTFGPFKGCWHITWPFKJTGTUGJT·JPNKEJGP)GUVCNVWPIQHVOKVFGOMNGKPG TGP-TKGIUMTGW\XGTYGEJUGNV&GTHÒPHMNCUUKIG1TFGP )TQ­MTGW\5VGTPWPF-NCUUG5KNDGTPGU-TGW\ YWTFG CO,CPWCTXQPFGT4GIGPVKP-ÌPKIKPOWVVGT/CTKC%JTKUVKPCXQP5RCPKGP  IGUVKHVGV /QFGNN  &KG<YGKVG4GRWDNKMÒDGTPCJOOKV4WPFUEJTGKDGPXQO0QXGODGTFGP1TFGPPWPOGJTKP\YGK-NCUUGP

)TQ­MTGW\WPF5KNDGTPGU-TGW\ WPFWPVGT'PVHGTPWPICNNGTOQPCTEJKUEJGT5[ODQNG /QFGNN 

8897 8896





300

<KXKNGT1TFGP#NHQPU :++=1TFGP%KXKNFG#NHQPUQ:++?4KVVGTFGMQTCVKQP5KNDGTVGKNYGKUGXGTIQNFGV WPF GOCKNNKGTV CO QTKIKPCNGP $CPF OKV 0CFGN KO QTKIKPCNGP OKV IQNFHCTDGPGO MÌPKINKEJGP 9CRRGP   DGFTWEMVGP8GTNGKJWPIUGVWKFGT(KTOC%GLCNXQ[)CTEKCKP/CFTKF<- ++



'JTGP 8GTFKGPUV WPF $GUV·PFKIMGKVU#WU\GKEJPWPI FGU 5RCPKUEJGP 4QVGP -TGW\GU =%QPFGEQTC   EKQP FG *QPQT /¾TKVQ [ %QPUVCPEKC FG NC %TW\ 4QLC 'URCÇQNC? <YGKVGU /QFGNN     /GFCKNNG  -NCUUG CD   $TQP\G XGTIQNFGV VGKNYGKUG GOCKNNKGTV #WHNCIG CWH FGO -QRH UVGJGPF   QJPG*CNUDCPF<-XCT ++




SPANIEN

8898



8899

/KNKV·T8GTFKGPUVQTFGP=1TFGPFG/GTKVQ/KNKVCT?/QFGNN 9CRRGPQJPG/KVVGNUEJKNFOKV/CW GTMTQPGEC YGK­G#DVGKNWPIHÒT8GTFKGPUVKP(TKGFGPU\GKVGP5VGTP-NCUUG5KNDGTDTKN NCPVKGTV -TGW\ 5KNDGT XGTIQNFGV /GFCKNNQP 2N·VVEJGP WPF /CWGTMTQPG )QNF VGKNYGKUG GOCKNNKGTV   'OCKNNGOCNGTGKGKPKIG*CCTTKUUGMNGKPGTQDGTHN·EJNKEJGT'OCKNNGEJKRKPGKPGO9CRRGPHGNF4GXGTU\GP VTWOU#DFGEMWPIHGJNVCP0CFGNOKV\YGK5GKVGPJCMGP<- ++p



&KGUGT$TWUVUGTPYWTFGQJPGYGKVGTG+PUKIPKGPYKG*CNUQFGT$TWUVFGMQTCVKQPGPXGTNKGJGPWPFIGVTCIGP9KGCNNG 1TFGPUKPUKIPKGPFGT<YGKVGP4GRWDNKMUGNVGP\WHKPFGP  &KGUGTCWHITWPFUGKPGTJKUVQTKUEJGP'PVYKEMNWPIYQJNXCTKCPVGPTGKEJUVGURCPKUEJG1TFGPYWTFGXQP-ÌPKIKP+UCDGNNC ++  OKV-ÌPKINKEJGO&GMTGVXQO#WIWUVKPXKGT-NCUUGP )TQ­MTGW\-NCUUG IGUVKHVGV FKG4GINCOGPVQUFCVKGTGPXQO5GRVGODGT /QFGNN /KV-ÌPKINKEJGO&GMTGVXQO/CKGTJKGNV FGT 1TFGP GKP PGWGU $CPF UQYKG CNU WPVGTUVG -NCUUG FCU 5KNDGTPG -TGW\ +O 5GRVGODGT  PCEJ FGT (NWEJV   -ÌPKIKP+UCDGNNCU++YWTFGXQPFGTRTQXKUKQTKUEJGP4GIKGTWPIGKPG8GTQTFPWPIGTNCUUGPIGO·­FGT1TFGPMÒPHVKI MGKPG .KNKGP FCU 5[ODQN FGT $QWTDQPGP OGJT VTCIGP FWTHVGP #WEJ U·OVNKEJG /QPQITCOOG +UCDGNNCU YCTGP CD   UQHQTVGTUCV\NQU\WGPVHGTPGP /QFGNN 'TUVCO&G\GODGTFGUINGKEJGP,CJTGUYWTFGFCPPGKPG8GTQTFPWPI GTNCUUGP IGO·­ FGT FGT /KNKV·T8GTFKGPUVQTFGP MÒPHVKI FCU /QPQITCOO ō//ŋ HÒT /GTKVQ /KNKVCT  CWH FGT   4ÒEMUGKVG \W \GKIGP JCVVG  /QFGNN  0CEJ FGT 6JTQPDGUVGKIWPI -ÌPKI #OCFGQU +   YWTFG CWHITWPF   FGT-ÌPKINKEJGP8GTQTFPWPIGPXQO/CKWPFXQO1MVQDGTFCUUCXQ[GT9CRRGP YGK­GU-TGW\KPTQV  KP FCU 9CRRGP GKPIGHÒIV  /QFGNN  /KV 8GTQTFPWPI XQO  1MVQDGT  FGT 'TUVGP 4GRWDNKM YWTFGP CNNG   OQPCTEJKUEJGP5[ODQNGCWUFGP&GMQTCVKQPGPGPVHGTPV /QFGNN 0CEJUGKPGT6JTQPDGUVGKIWPICO&G\GODGT PCJO-ÌPKI#NHQPU:++  FKG8GTNGKJWPIGPFGU1TFGPUKPUGKPGTWTURTÒPINKEJGP(QTOYKGFGTCWH LGFQEJ OKV FGO /QPQITCOO // CWH FGO 4GXGTUOGFCKNNQP FGT -TGW\G  /QFGNN  9GKVGTG 8GT·PFGTWPIGP   GTHQNIVGPOKV-ÌPKINKEJGP8GTQTFPWPIGPXQO/CKWPFXQO,WNKUQYKGOKV)GUGV\XQO,WPK -ÌPKI#NHQPU:+++  TGQTICPKUGTVGFGP1TFGPOKVFGP-ÌPKINKEJGP&GMTGVGPXQO/·T\ WPF XQO  #RTKN  YQFWTEJ FKG $KEQNQT#DVGKNWPI GKPIGHÒJTV YWTFG  /QFGNN  9·JTGPF FGT <YGKVGP   4GRWDNKMYWTFGPFKG+PUKIPKGPFGU1TFGPUOGJTHCEJXGT·PFGTV\WP·EJUVYWTFGFCU/KVVGNUEJKNF OKVFGP.KNKGP FGU 9CRRGPUÒDGTFGEMVWPFFKG.KNKGPGPVHGTPV /QFGNN FCPPYWTFGFGT/KVVGNUEJKNFICP\GPVHGTPV /QFGNN WPF UEJNKG­NKEJ GKP ICP\ PGWGU 9CRRGP GKPIGHÒIV  /QFGNN  )GPGTCN (TCPEKUEQ (TCPEQ [ $CJCOQPFG     ÒDGTPCJOFGP1TFGPWPFRNCV\KGTVGÒDGTFGO-TGW\FKGUQIGPKORGTKCNG-TQPGFGTMCVJQNKUEJGP-ÌPKIGUQYKG .ÌYGPWPF6ÒTOGCPUVGNNGFGT5VGTPGYQUKEJHTÒJGFKG.KNKGPDGHCPFGP /QFGNN /KV&GMTGVXQO /·T\ XGTÌHHGPVNKEJVKP$1'0TXQO/CK GTJKGNVGPFKG+PUKIPKGPYKGFGTGKPG-ÌPKIUMTQPGWPFFGT 1TFGP GKP PGWGU 4GINCOGPVQ  /QFGNN  5GKVJGT DGUVGJVGTCWU)TQ­MTGW\-TGW\-NCUUG $TWUVUVGTP -TGW\ DKU-NCUUG -TGW\GCO$CPF 

52#0+5%*'456##64')+'470)810(4#0%+5%1(4#0%1   

-ÌPKINKEJGTWPF8GTFKGPUVXQNNGT5RCPKUEJGT1TFGP-CTNU+++=4GCN[&KUVKPIWKFC1TFGP'URCÇQNC FG%CTNQU+++?  D\Y-ÌPKINKEJGTWPF=4GCN[?  5GJT=/W[?8GTFKGPUVXQNNGT 1TFGP-CTNU+++=&KUVKPIWKFC1TFGPFG%CTNQU+++? UGKV /QFGNN UGKV $TWUVUVGTP\WO )TQ­MTGW\ 5KNDGT DTKNNCPVKGTV WPF TGRGTEKGTV /GFCKNNQPCWHNCIGP VGKNYGKUG )QNF GOCKNNKGTV HGKPUVG   'OCKNNGOCNGTGK MCWO UKEJVDCTG 'OCKNNGTGRCTCVWT KO )GYCPF FGT /CFQPPC WPF KP GKPGT 'EMG FGU   5EJTKHVDCPFGUOKP%JKRKO/GFCKNNQPHGNFCWHFGT4ÒEMUGKVG*GTUVGNNGTDG\GKEJPWPIFGT(KTOC.GOCKVTG KP 2CTKU CP 0CFGN FKGUG OKV *GTUVGNNGTRWP\G WPF HTCP\ÌUKUEJGT )CTCPVKGRWP\G XQP  DKU   

'DGTMQRH OKV\YGK5GKVGPJCMGP<- ++



$GOGTMGPUYGTVGU'ZGORNCTOKVUGRCTCVCWHIGUGV\VGP-TGW\CTOHGNFGTPCWUFGOFTKVVGP8KGTVGNFGU,CJTJWPFGTVU .CWV%GDCNNQU'UECNGTC[)KNCWPF)CTEÃC/GTECFCN[)CTEÃC.Q[IQTTK KP%$5 UKPFY·JTGPFFGT4GIKGTWPI XQP 5VCCVUEJGH (TCPEQ XQP  DKU  PWT  )TQ­MTGW\G XGTNKGJGP YQTFGP YCU FKG TGNCVKXG 5GNVGPJGKV FGT   $TWUVUVGTPGFKGUGU6[RUGTMN·TV

301


SPANIEN

8900



<KXKN8GTFKGPUVQTFGP=1TFGPFGN/GTKVQ%KXKN?/QFGNN OKVQHHGPGTUQIGPCPPVGTKORGTKCNGT-TQPG  EC   )TQ­MTGW\UGV DGUVGJGPF CWU -NGKPQF 5KNDGT VGKNYGKUG DTKNNCPVKGTV XGTIQNFGV VGKN   YGKUG GOCKNNKGTV CO QTKIKPCNGP 5EJWNVGTDCPF WPF $TWUVUVGTP 5KNDGT VGKNYGKUG DTKNNCPVKGTV WPF XGT   IQNFGV VGKNYGKUG GOCKNNKGTV MCWO UKEJVDCTG 'OCKNNGTGRCTCVWT KP GKPGO -TGW\CTO CP 0CFGN OKV \YGK   5GKVGPJCMGPKOQTKIKPCNGPOKVOGVCNNGPGO5VCCVUYCRRGPDGNGIVGP8GTNGKJWPIUGVWKFGT(KTOC%GLCNXQKP /CFTKF<- ++



&GT \WP·EJUV HÒPHMNCUUKIG )TQ­MTGW\ -QOOCPFGWT XQP 0WOOGT -QOOCPFGWT 1HHK\KGT WPF 4KVVGT  1TFGP HÒT   CNNIGOGKPG \KXKNG 8GTFKGPUVG WO 5RCPKGP OKV CHHKNKKGTVGO 5KNDGTPGP -TGW\ YWTFG OKV MÌPKINKEJGO &GMTGV #NHQPU   :+++  XQO,WPK XGTÌHHGPVNKEJVKPFGT)CEGVCFG/CFTKF0TXQO,WPK IGUVKHVGV &KGGTUVGP5VCVWVGPYWTFGPOKVMÌPKINKEJGO&GMTGV0TXQO/CK XGTÌHHGPVNKEJVKPFGT)CEGVCFG /CFTKF 0T  XQO INGKEJGP 6CI  GTNCUUGP /KV MÌPKINKEJGO <KTMWNCT$GHGJN 0T  XQO  /CK   

XGTÌHHGPVNKEJVKPFGT)CEGVCFG/CFTKF0TXQO/CK YWTFGPFKG5VCVWVGPPQEJGKPOCNXGTMÒPFGV<W GKPGO DKUJGT PKEJV DGMCPPVGP <GKVRWPMV \YKUEJGP  WPF  YWTFGP FKG (NCOOGP \YKUEJGP FGP #TOGP FGU   1TFGPUMTGW\GUFWTEJDTKNNCPVKGTVG5VTCJNGPGTUGV\V /QFGNN /KV&GMTGVFGU5VCCVUOKPKUVGTKWOUXQO,WNK

XGTÌHHGPVNKEJVKPFGT)CEGVCFG/CFTKF0TXQO,WNK YWTFGPCNNGXQO5VCCVUOKPKUVGTKWOCDJ·PIKIGP 1TFGP CW­GTFGO1TFGP+UCDGNNCUFGT-CVJQNKUEJGP CNUQCWEJFGT<KXKN8GTFKGPUVQTFGPCDIGUEJCHHV/KV&GMTGV XQO  0QXGODGT  XGTÌHHGPVNKEJV KO $1' 0T  XQO  0QXGODGT   UVGNNVG 5VCCVUEJGH (TCPEKUEQ   (TCPEQ [ $CJCOQPFG   FGP 1TFGP YKGFGT JGT UGV\VG LGFQEJ CP 5VGNNG FGT DKUJGTKIGP -ÌPKIUMTQPG FKG   QHHGPG UQIGPCPPVG KORGTKCNG -TQPG FGT MCVJQNKUEJGP -ÌPKIG  /QFGNN  &KG PGWGP 1TFGPUUVCVWVGP YWTFGP OKV   &GMTGVXQO(GDTWCT XGTÌHHGPVNKEJVKO$1'0TXQO(GDTWCT GTNCUUGPWPFOKV&GMTGVXQO  ,WNK  XGTÌHHGPVNKEJV KO $1' 0T  XQO  #WIWUV   IG·PFGTV YQDGK W C GKPG -QNNCPGPMNCUUG   GKPIGHÒJTV YWTFG 0CEJ FGO 4GIKGTWPIUCPVTKVV -ÌPKI ,WCP %CTNQU + CO  0QXGODGT   YWTFG \W GKPGO   WPDGMCPPVGP<GKVRWPMVFKGUQIGPCPPVGKORGTKCNG-TQPGYKGFGTFWTEJFKG-ÌPKIUMTQPGCWUIGVCWUEJV /QFGNN /KV MÌPKINKEJGO &GMTGV 0T  XQO  0QXGODGT  XGTÌHHGPVNKEJV KO $1' 0T  XQO  0QXGODGT     YWTFG FGT 1TFGP FGT 8GTYCNVWPI FGU /KPKUVGTKWOU HÒT FKG #WUY·TVKIGP #PIGNGIGPJGKV WPVGTUVGNNV WPF PGWG   5VCVWVGPGTNCUUGP

8901



8902

<KXKN8GTFKGPUVQTFGP=1TFGPFGN/GTKVQ%KXKN?/QFGNN OKVQHHGPGTUQIGPCPPVGTKORGTKCNGT-TQPG EC $CPFHÒT&COGP=DCPFC?OKV-NGKPQF5KNDGTVGKNYGKUGDTKNNCPVKGTVXGTIQNFGVVGKNYGKUG GOCKNNKGTVCOQTKIKPCNGP5EJWNVGTDCPFHÒT&COGP<- 4++



&KGUG HÒT &COGP DGUVKOOVG &GMQTCVKQP YWTFG QJPG YGKVGTG +PUKIPKGP YKG \ $ GKPGO $TWUVUVGTP XGTNKGJGP WPF   IGVTCIGP



302

-TKGIUMTGW\=%TW\FG)WGTTC?/QFGNN XKGTMNCUUKI 5VGTPOKV2CNOGP  HÒTHÒJTGPFG 1HHK\KGTG =LGHGU? XCTKCPVG #WUHÒJTWPI OKV DNCW   UVCVV OKV TQV GOCKNNKGTVGO /GFCKNNQPTKPI $TQP\G   XGTUKNDGTVVGKNYGKUGXGTIQNFGVVGKNYGKUGGOCKNNKGTVCP0CFGNOKV\YGK5GKVGPJCMGP2)XCT  4++




UKRAINE

8903

8904

5'%*56'5 -¤0+)4'+%* 5'+6  

<KXKN8GTFKGPUVQTFGP =1TFGP FGN /GTKVQ %KXKN?  /QFGNN OKV -ÌPKIUMTQPG  UGKV EC   1HHK   \KGTUMTGW\ 5KNDGT VGKNYGKUG DTKNNCPVKGTV XGTIQNFGV WPF VGKNYGKUG GOCKNNKGTV CO $CPF OKV 6TCIGURCPIG   KOQTKIKPCNGPOKVIQNFGPGO/GVCNNYCRRGPDGNGIVGP8GTNGKJWPIUGVWKFGT(KTOC%GLCNXQKP/CFTKF ++



65%*'%*15.19#-'+70&65%*'%*+5%*'4'27$.+- 65%*'%*15.19#-+5%*'81.-54'27$.+-   

'JTGP\GKEJGPHÒT#PIGJÌTKIGFGT0CVKQPCNGP4GXQNWVKQPUVTWRRGPXQP$TÒPPDKU'JTGP \GKEJGPKP$TQP\G$TQP\GCWHFGT4ÒEMUGKVG/CVTKMGNPWOOGTCO$CPF ++



8905 (1:1)

7-4#+0'

'456' 4'27$.+- 

-TGW\FGT(TGKYKNNKIGP7MTCKPKUEJGP5EJÒV\GP.GIKQP=Õðåñò Ëåã³îíó Óêðà¿íñüêèõ ñ³÷îâèõñòð³ëüö³â

ÓÑÑ ? )TÌ­GTG #WUHÒJTWPI  Z  OO  $TQP\G GOCKNNKGTV QJPG $CPF 57- 5  &C\W GKPG   GOCKNNKGTVG#PUVGEMPCFGN 44++



&KG.GIKQPGPVYKEMGNVGUKEJCWUGKPGTKPÌUVGTTGKEJKUEJ)CNK\KGPGTTKEJVGVGPWPF\WTÌUVGTTGKEJKUEJWPICTKUEJGP #TOGG IGJÌTKIGP HTGKYKNNKIGP 5EJÒV\GP#DVGKNWPI 0CEJ #WUTWHWPI FGT 9GUVWMTCKPKUEJGP 8QNMUTGRWDNKM CO    0QXGODGTDKNFGVGFKG.GIKQPFGPQTICPKUCVQTKUEJGP-GTPXQPFGTGP#TOGGWPFIKPIUR·VGTCNUGTUVG$TKICFGKP FGP5KVUEJGT5EJÒV\GPFGT7MTCKPKUEJGP8QNMUTGRWDNKMCWH&CU-TGW\YWTFGIGUVKHVGV

303


UNGARN

8906 (1:1)



5[OQP2GVNLWTC-TGW\D\Y1TFGP=Îðäåí Ñèìîíà Ïåòëþðè?$TQP\GXGTUKNDGTVWPFGOCKNNKGTVCWH FGT 4ÒEMUGKVG /CVTKMGNPWOOGT  WPF *GTUVGNNGTDG\GKEJPWPI FGT (KTOC , -YGMUKNDGT KP 9CTUEJCW   CO1TKIKPCNDCPF57-5 44++



&GT YQJN  IGUVKHVGVG GKPMNCUUKIG 1TFGP KUV PCEJ FGO WMTCKPKUEJGP 2QNKVKMGT 5[OQP 9CUU[NLQY[VUEJ 2GVNLWTC  

 DGPCPPVFGT/KVDGITÒPFGTFGTWMTCKPKUEJGP#TDGKVGTRCTVGKWMTCKPKUEJGT-TKGIUOKPKUVGTWPF 4GIKGTWPIUEJGHYCT

8907

8908 (1:1)

8909

70)#40

6+67.#4 -¤0+)4'+%*   

7PICTKUEJGT 8GTFKGPUVQTFGP =# /CI[CT —TFGOTGPF? -QOOCPFGWTMTGW\ 5KNDGT XGTIQNFGV WPF   GOCKNNKGTVGKPG-TGW\GEMGOKPIGUVCWEJVWPFOKV'OCKNNGCWUDTÒEJGPQJPG$CPF<- ++





1TFGPFGT7PICTKUEJGP*GKNKIGP-TQPG=#/CI[CT5\GPV-QTQPCTGPF?1HHK\KGTUMTGW\OKV-TKGIU FGMQTCVKQPWPF5EJYGTVGTP$TQP\GXGTIQNFGVWPFGOCKNNKGTVCP0CFGN<- ++



#PHGTVKIWPICWUFGO,CJTQFGT

70)#4+5%*'81.-54'27$.+-   

8GTFKGPUVQTFGP HÒT GKP 5Q\KCNKUVKUEJGU 7PICTP 8GTIQNFGV VGKNYGKUG GOCKNNKGTV CO &TGKGEMUDCPF   \WUCOOGPOKV+PVGTKOUUEJPCNNGKOTQVGP8GTNGKJWPIUGVWK<- ++



&GTGKPMNCUUKIG1TFGPYWTFGIGUVKHVGVWPFDKUXGTNKGJGP



304

-QPXQNWV XQP  #WU\GKEJPWPIGP 8QTYKGIGPF /KNKV·TCWU\GKEJPWPIGP $TQP\G OGKUV XGTIQNFGV CNNG   GOCKNNKGTVCP&TGKGEMUD·PFGPKPITÌ­VGPVGKNUQTFGPVNKEJGP'TJCNVWPIGP 5VÒEM++++p




KIRCHENSTAAT / VATIKAN

8911 (1:1)

-+4%*'056##6*'+.+)'4567*.70&8#6+-#0 

1TFGPXQO)QNFGPGP5RQTPQFGTXQPFGT)QNFGPGP/KNK\=1TFQ'SWGUVTK/KNKVKCG#WTCVCG?/Q FGNN $GIKPPFGU8KGTVGNUFGU,CJTJWPFGTVUDKUEC 1TFGPMTGW\ZOO)QNFIW­ GOCKNNKGTVOKVDGYGINKEJGO5RQTGPT·FEJGPQJPG$CPF<- 444++



5GJTUGNVGPGUWPF\WFGOHÒTUGKPJQJGU#NVGTCWEJPQEJUGJTIWVGTJCNVGPGU'ZGORNCTKPUGJTUEJÌPGT#PHGTVKIWPIU SWCNKV·VCWUFGO\YGKVGP8KGTVGNFGU,CJTJWPFGTVU  'KPGT .GIGPFG \WHQNIG UQNN -CKUGT -QPUVCPVKP   FGT )TQ­G GKPG 4KVVGT-QTRQTCVKQP OKV FGO 0COGP   )QNFGPG /KNK\ IGITÒPFGV WPF 2CRUV 5[NXGUVGT + IGUV   KJT FKG 4GIGN FGU JN $CUKNKWU XGTNKGJGP JCDGP YCU   LGFQEJMGKPGTJKUVQTKUEJGP0CEJHQTUEJWPIUVCPFJ·NV  5GKV $GIKPP FGU  ,CJTJWPFGTVU KUV DGMCPPV FC­ FKG -ÌPKIG XQP 7PICTP CP KJTGO -TÌPWPIUVCI GKPG 4GKJG XQP   2GTUQPGP FWTEJ FKG ªDGTTGKEJWPI XQP IQNFGPGP 5RQTGP KP FKG 4KVVGTUEJCHV CWHPCJOGP &KG 4KVVGT YWTFGP)QNFGPG 4KVVGT WPF UR·VGT 4KVVGT XQO )QNFGPGP 5RQTP IGPCPPV #WEJ XQP CPFGTGP OKVVGNCNVGTNKEJGP *ÌHGP KUV FKG 'ZKUVGP\   UQNEJGT )QNFGPGP 4KVVGT DGMCPPV 9CPP CO R·RUVNKEJGP *QHG OKV FGT 8GTNGKJWPI XQP IQNFGPGP 5RQTGP DGIQPPGP   YWTFG JCV UKEJ DKUJGT NGKFGT PKEJV GKPFGWVKI XGTKHK\KGTGP NCUUGP &KG 0CEJTKEJVGP FCTÒDGT UKPF ·W­GTUV UR·TNKEJ   LGFQEJ GTJKGNVGP DGTGKVU WO FCU ,CJT  FKG /CTMITCHGP \W (GTTCTC XQP 2CRUV 7TDCP 8   FKG   )GPGJOKIWPI )QNFGPG 4KVVGT \W GTPGPPGP &KGUG #TV FGT &GNGICVKQP FGU 4KVVGTUEJNCIU YCT HÒT FGP 2CRUV GKP   GKPVT·INKEJGU )GUEJ·HV WO UGKPG 5EJCVWNNGP \W HÒNNGP FGPP FKG KP (TCIG MQOOGPFGP (COKNKGP JCVVGP HÒT FKGUGU   2TKXKNGIPCVÒTNKEJGKPGDGVT·EJVNKEJG5WOOGCPFGP*GKNKIGP5VWJN\WDG\CJNGP&KGXGTNGKJGPFGP#FNKIGPYKGFGTWO NGIVGPFGP-CPFKFCVGPPCVÒTNKEJGDGPHCNNU)GDÒJTGPCWHUQFC­FGT8QTICPICWEJHÒTUKGGKPIWVGU)GUEJ·HVYWTFG &WTEJFGPKOOGTY·JTGPFGP$GFCTHCPHKPCP\KGNNGP/KVVGNPMCOGUKPFGT(QNIG\GKV\WGKPGTIGTCFG\WKPHNCVKQP·TGP )GY·JTWPIFGU4KVVGTUEJNCIGUCPJQJGWPFPKGFTKIGIGKUVNKEJGWPFYGNVNKEJG9ÒTFGPVT·IGT  $KUJGTDKNFGVGPFKG4KVVGTXQO)QNFGPGP5RQTPFKGCWEJFGP6KVGNGKPGU*QHRHCN\ITCHGPFGU.CVGTCPHÒJTGPFWTHVGP PQEJ MGKPG -QTRQTCVKQP CNUQ MGKPGP 1TFGP KO GKIGPVNKEJGP 5KPPG FGU 9QTVGU &GT /QFG HQNIGPF DGICPPGP UKG   LGFQEJ \W $GIKPP FGU  ,CJTJWPFGTVU GKP 1TFGPUMTGW\ \W VTCIGPWPF\YCTGKPYGK­GU/CNVGUGTMTGW\OKVGKPGO IQNFGPGP 5RQTP \YKUEJGP FGP WPVGTGP -TGW\CTOURKV\GP  /QFGNN  YQJN CD $GIKPP FGU <YGKVGP8KGTVGNUFGU ,CJTJWPFGTVUCWEJOKV.KNKGP\YKUEJGPFGP-TGW\CTOGP /QFGNN YCUFKG&GMQTCVKQPFGP-TGW\GPFGU/CNVGUGT 4KVVGTQTFGP UGJT ·JPNKEJ YGTFGP NKG­ YCU YQJN CWEJ FWTEJCWU DGCDUKEJVKIV YCT  *KGTIGIGP YGJTVG UKEJ PCVÒTNKEJ   FGT1TFGPYGIGPFGTOÌINKEJGP8GTYGEJUNWPIUIGHCJTCWHFCU*GHVKIUVG5QOKVXGTDQV2CRUV$GPGFKMV:+8    YQJN CWH FGUUGP #PVTCI JKP OKV UGKPGT $TGXG #RQUVQNKECO 2TGFGEGUUQTWO XQO  5GRVGODGT  FKGUGP   /K­DTCWEJFGU/CNVGUGTMTGW\GU#NNGTFKPIUYWTFGPFCTCWHJKPPWTFKG.KNKGP\YKUEJGPFGP-TGW\CTOGPFWTEJGKPGP VTKCPIWNCTGPMWT\GP5VTCJNGTUGV\V+PFKGUGT(QTOYWTFGFCPPFGT1TFGPDKU\WUGKPGTō#WHJGDWPIŋD\YHCMVKUEJGP 7OYCPFNWPIXGTNKGJGP  <W$GIKPPFGU,CJTJWPFGTVUYCPFGNVGUKEJFKG$TWUV\WGKPGT*CNUFGMQTCVKQPYQ\WCWEJGKP$TWUVUVGTPIGVTCIGP YWTFG /QFGNN <WFGPPCOGPVNKEJDGMCPPVGP1TFGPUTKVVGTPIGIGP'PFGFGUWPF#PHCPIFGU,CJTJWPFGTVU IGJÌTVGP W C )CGVCPQ &QPK\GVVK   #PVQPKQ %CPQXC   WPF FGT URCPKUEJG /CNGT .WKU FG NC   %TW\  &GTLWPIG9QNHICPI#OCFGWU/Q\CTV  GTJKGNVFGP1TFGPCPN·­NKEJGKPGT#WFKGP\DGK 2CRUV%NGOGPU:+8  WPFFGT-QORQPKUV%JTKUVQRJ9KNNKDCNF)NWEM  PCJOFKG8GTNGKJWPI FGU1TFGPU\WO#PNC­UKEJHQTVCP4KVVGTXQP)NWEM\WPGPPGP  2CRUV 2KWU 8++   VTGPPVG  FGP *QHRHCN\ITCHGPVKVGN XQO 1TFGP WPF JQD FKG FGNGIKGTVGP   8GTNGKJWPIUTGEJVGCWH&KG9KTMWPIJKGTCWHDNKGDCDGTCNNGTFKPIUCWUWPFFCUJGT\QINKEJG*CWU5HQT\C%GUCTKPKYKG CWEJCPFGTGXGTNKGJGPFGP1TFGPYGKVGTJKPLCXGTOGJTVGPFGUUGP+PUKIPKGPPQEJWOGKPGP$TWUVUVGTP  'TUV2CRUV)TGIQT:8+  UEJWHGPFIÒNVKI#DJKNHGKPFGOGTOKVFGT$TGXG%WOJQOKPWOOGPVGUXQO 1MVQDGTWPVGTXQNNUV·PFKIGT#WHJGDWPIFGU1TFGPUFGT)QNFGPGP/KNK\GKPGPPGWGP1TFGPGTTKEJVGVGOKV FGO 0COGP 1TFGP XQO JGKNKIGP 2CRUV 5[NXGUVGT QFGT XQP FGT )QNFGPGP /KNK\ 8IN CWEJ )KCEEJKGTK 2KGVTQ   /GOQTKG 5VQTKEJG UWNN  #PVKEJKV± GF 'EEGNGP\C FGNN 1TFKPG #WTGCVQ QUUKC FGNNQ 5RGTQP F 1TQ 4QO  #WHNCIG    



$WEJ)KCEEJKGTK2KGVTQ/GOQTKG5VQTKEJGUWNN #PVKEJKV±GF'EEGNGP\CFGNN 1TFKPG#WTGCVQQUUKC FGNNQ 5RGTQP F 1TQ 4QO  #WHNCIG  +P KVCNKGPKUEJGT 5RTCEJG  5GKVGP OKV FTGK XQP WT   URTÒPINKEJ XKGT -WRHGTUVKEJGP 6KVGNMWRHGT 1TFGPUMTGW\ CNVG (QTO WPF 1TFGPUWPKHQTO FKGUGT HGKPUV   MQNQTKGTV GKPKIG5GKVGPIGMPKEMV$KPFWPIVGKNYGKUGIGNÌUV2CRKGTWOUEJNCIOKV5KGIGNFGU<GTGOQPKGP OGKUVGTUFGU'T\DKUVWOU4CXGPPC ++p+++



5GNVGPGU 9GTM FGU DGFGWVGPFGP KVCNKGPKUEJGP 2JCNGTKUVKMGTU FCU CWU #PNC­ FGT 0GWUVKHVWPI FGU 1TFGPU  XQNN   MQOOGPÒDGTCTDGKVGVKPFTKVVGT#WHNCIGGTUEJKGPGPKUV

305


KIRCHENSTAAT / VATIKAN

8914 8913



8913

2KWU1TFGP=1TFQ2KCPWU?#WUHÒJTWPI \YGKUGKVKIG#WUHÒJTWPIEC 4KVVGTFGMQTCVKQP HTCP\ÌUKUEJG#PHGTVKIWPI5KNDGTXGTIQNFGV/GFCKNNQPU)QNFGOCKNNKGTVGKP5VGTPUVTCJNFGT8QTFGTUGKVG PCEJGOCKNNKGTVCOQTKIKPCNGPCNVGP$CPF<- ++



&GT 1TFGP YWTFG CO  ,WPK  XQP 2CRUV 2KWU +: CNU FTGKMNCUUKIGT YQDGK FKG \YGKVG -NCUUG KP \YGK )TCFG   WPVGTVGKNVKUV 1TFGPIGUVKHVGV$KUKPFCU2QPVKHKMCV2CRUV.GQU:+++ TGI YCTGTFGTJÌEJUVGR·RUVNKEJG 1TFGP2CRUV2KWU:TGQTICPKUKGTVGFGP1TFGPCO(GDTWCTWPF2CRUV2KWU:++UVKHVGVGCO&G\GODGT FKG-QNNCPGFGTGP+PUKIPKGPGKPGCPFGTG+PUEJTKHVJCDGPWPFFKG5VCCVUQDGTJ·WRVGTPXQTDGJCNVGPKUV8QPFGT 5VKHVWPI DKU  YWTFGP NCWV *GTMPGT  -QNNCPGP XGTNKGJGP 'TUV UGKV YGPKIGP ,CJTGP MÌPPGP FGP 1TFGP CWEJ   (TCWGPGTJCNVGP XINCWEJ*GTMPGT0QTDGTV&GT2KWU1TFGPUGKPG)QNFGPG-QNNCPGWPFKJTG6T·IGT+P1TFGP WPF'JTGP\GKEJGP*GHV  5HHWPF*GHV  5HH 



2KWU1TFGP=1TFQ2KCPWU?#WUHÒJTWPI GKPUGKVKIG#WUHÒJTWPIUGKVEC -QOOCPFGWTFGMQ TCVKQP KVCNKGPKUEJG #PHGTVKIWPI FGT (KTOC )WEEKQPG KP 4QOCWUFGPGT,CJTGP6[R OKVPKEJV GOCKNNKGTVGO TÒEMUGKVKIGO /GFCKNNQP  5KNDGT XGTIQNFGV WPF GOCKNNKGTV CO QTKIKPCNGP *CNUDCPF <-    4++



8915 (1:1)



1TFGP FGU JN )TGIQTU FGU )TQ­GP =1TFQ 5CPEVWU )TGIQTKWU /CIPWU?  #WUHÒJTWPI FKG 4G   XGTUUGKVGP FGT -TGW\CTOG PKEJV GOCKNNKGTV  DKU EC   $TWUVUVGTP \WO -QOOCPFGWT OKV 5VGTP   &WTEJOGUUGTOO5KNDGT#WHNCIGP)QNFGOCKNNKGTVYQJNUR·VGTPCEJGOCKNNKGTVD\YKO/GFCKN NQPTGRCTKGTVCWHFGT4ÒEMUGKVGXKGTHCEJXGTPKGVGVCP0CFGN<- 4++ #PHGTVKIWPICWUFGOFTKVVGP8KGTVGNFGU,CJTJWPFGTVU  8QP2CRUV)TGIQT:8+  CO5GRVGODGTCNU\WP·EJUVXKGTMNCUUKIGT )TQ­MTGW\WPF-NCUUGņ NGV\VGTG  YKGFGT CDIGUEJCHHV   -QOOCPFGWT WPF 4KVVGT  CD  FTGKMNCUUKIGT CNNIGOGKPGT \KXKNGT WPF   OKNKV·TKUEJGT 8GTFKGPUVQTFGP IGUVKHVGV YWTFG GT \WP·EJUV CP VTGWG $ÒTIGT WPF CP ÌUVGTTGKEJKUEJG 6TWRRGP HÒT KJTG   7PVGTUVÒV\WPIFGTYGNVNKEJGP/CEJVFGU*GKNKIGP5VWJNUKO-KTEJGPUVCCVY·JTGPFFGT7PTWJGPXQPXGTNKGJGP 'TXGTHÒIVÒDGTGKPG\KXKNGWPFGKPGOKNKV·TKUEJG#DVGKNWPIYQDGKNGV\VGTGKPLÒPIGTGT<GKV YQJNUGKVFGT#WHNÌUWPI FGTR·RUVNKEJGPOKNKV·TKUEJGP'KPJGKVGPņDKUCWHFKG2·RUVNKEJG5EJYGK\GTICTFGFWTEJ2CRUV2CWN8+   KO ,CJT   PKEJV OGJT XGTNKGJGP YQTFGP KUV <YKUEJGP EC  WPF  YWTFG GKPIGHÒJTV FC­ FGT   -QOOCPFGWTCWEJOKV$TWUVUVGTPXGTNKGJGPYGTFGPMQPPVGYCUFKGUG-NCUUGHCMVKUEJKP\YGK)TCFGWPVGTVGKNVGWPF FGT1TFGPUUQOKVYKGFGTXKGTMNCUUKIYWTFGTGQTICPKUKGTVG2CRUV2KWU:  FGP1TFGPFGTJGWVGHÒT DGYKGUGPGWPGTUEJÒVVGTNKEJG6TGWGWPF'KHGTKO&KGPUVFGU*GKNKIGP5VWJNUXGTNKGJGPYKTF/KV*CPFUEJTGKDGPXQO ,WNKXGTHÒIVG2CRUV,QJCPPGU2CWN++  FC­FGT1TFGPHQTVCPKPCNNGP-NCUUGPCWEJCP(TCWGP XGTNKGJGPYGTFGPMCPP

306




KIRCHENSTAAT / VATIKAN

8917

8916



1TFGP FGU JN )TGIQTU FGU )TQ­GP =1TFQ 5CPEVWU )TGIQTKWU /CIPWU?  #WUHÒJTWPI FKG 4G   XGTUUGKVGP FGT -TGW\CTOG PKEJV GOCKNNKGTV  DKU EC   -QOOCPFGWTMTGW\ HÒT <KXKNXGTFKGPUV )QNF   VGKNYGKUG \KUGNKGTV GOCKNNKGTV  I OKP #DRNCV\WPIGP KP FGTITÒPGP'OCKNNGFGT-TCP\ÒDGTJÌJWPI FCU4GXGTUHGKPUVITCXKGTVQJPG*CNUDCPF<- 4++



(TÒJGUGJTSWCNKV·VUXQNNG#PHGTVKIWPICWUFGT5VKHVWPIU\GKVFGU1TFGPUCNUQWOECDKUKPJGTXQTTCIGP FGT'TJCNVWPI





1TFGP FGU JN )TGIQTU FGU )TQ­GP =1TFQ 5CPEVWU )TGIQTKWU /CIPWU?  #WUHÒJTWPI FKG 4G   XGTUUGKVGP FGT -TGW\CTOG PKEJV GOCKNNKGTV  DKU EC   4KVVGTMTGW\ HÒT <KXKNXGTFKGPUV  Z    OO )QNF VGKNYGKUG \KUGNKGTV GOCKNNKGTV  I PCJG\W WPUKEJVDCTG 4GRCTCVWTGP KP FGT ITÒPGP 'OCKNNG   FGT-TCP\ÒDGTJÌJWPIFCU4GXGTUHGKPUVITCXKGTVCOCNVGPLGFQEJUR·VGTGPUEJOCNGP$CPF<- ++ (TÒJG#PHGTVKIWPICWUFGO\YGKVGP8KGTVGNFGU,CJTJWPFGTVU



1TFGP FGU JN )TGIQTU FGU )TQ­GP =1TFQ 5CPEVWU )TGIQTKWU /CIPWU?  #WUHÒJTWPI FKG 4G   XGTUUGKVGPFGT-TGW\CTOGPKEJVGOCKNNKGTVDKUEC 8GTNGKJWPIUWTMWPFG\WO4KVVGTMTGW\HÒT<K XKNXGTFKGPUVHÒTFGP#T\V,GCP,QUGRJ/CTVKPFCVKGTVDGK5V2GVGTCO,WNKOKV5KGIGNUVGORGN WPF 1TKIKPCNWPVGTUEJTKHV XQP -CTFKPCN %NCTGNNK OKV 6TCIGIGPGJOKIWPIU7TMWPFG FGT )TQ­MCP\NGK FGT   'JTGPNGIKQP FCVKGTV 2CTKU CO  0QXGODGT  OKV HCTDKI IGOCNVGT 1TFGPUFGMQTCVKQP 2T·IGUKGIGN   WPF7PVGTUEJTKHVGP2GTICOGPVGVYCUUVQEMHNGEMKIFTGKHCEJIGHCNVGVWPFªDGTUGPFWPIUWTMWPFGFCVKGTV 2CTKUCO0QXGODGTOKV5VGORGNWPF1TKIKPCNWPVGTUEJTKHVFGU)TQ­MCP\NGT)GPGTCN8KPQ[OKV 8GTUCPFEQWXGTV 5VÒEM++



5EJÌPGUXQNNUV·PFKIGUWPFPKEJVJ·WHKI\WHKPFGPFGU'PUGODNG

8919 8920



1TFGP FGU JN )TGIQTU FGU )TQ­GP =1TFQ 5CPEVWU )TGIQTKWU /CIPWU?  #WUHÒJTWPI FKG 4G   XGTUUGKVGPFGT-TGW\CTOGPKEJVGOCKNNKGTVDKUEC 4KVVGTMTGW\HÒT/KNKV·TXGTFKGPUVZ OO )QNF GOCKNNKGTV  I OKV $CPF  PCJG\W WPUKEJVDCTG 4GRCTCVWTGP KP FGT TQVGP 'OCKNNG FCU   4GXGTUHGKPUVITCXKGTVCOQTKIKPCNGPCNVGP5GKFGPDCPF<- ++



#PHGTVKIWPICWUFGT/KVVGFGU,CJTJWPFGTVU



1TFGP FGU JN )TGIQTU FGU )TQ­GP =1TFQ 5CPEVWU )TGIQTKWU /CIPWU?  #WUHÒJTWPI FKG 4G   XGTUUGKVGP FGT -TGW\CTOG PKEJV GOCKNNKGTV  DKU EC   4KVVGTMTGW\ HÒT /KNKV·TXGTFKGPUV )QNF VGKN   YGKUG\KUGNKGTVGOCKNNKGTVI OKV$CPF MNGKPGT'OCKNNGEJKRCWHFGONKPMGP-TGW\CTOFCU4GXGTU HGKPUVITCXKGTVCOQTKIKPCNGPCNVGP5GKFGP&TGKGEMUDCPF<- ++



3WCNKV·VUXQNNG#PHGTVKIWPIWOFKG/KVVGFGU,CJTJWPFGTVUYQJNHÒTGKPGPÌUVGTTGKEJKUEJGP$GNKGJGPGP

307


KIRCHENSTAAT / VATIKAN

8922

8921





1TFGP FGU JN )TGIQTU FGU )TQ­GP =1TFQ 5CPEVWU )TGIQTKWU /CIPWU?  #WUHÒJTWPI FKG 4G   XGTUUGKVGPFGT-TGW\CTOGPKEJVGOCKNNKGTVDKUEC 4KVVGTMTGW\HÒT/KNKV·TXGTFKGPUVZ OO )QNF GOCKNNKGTV  4GRCTCVWTGP KP FGT TQVGP 'OCKNNG FGT -TGW\CTOÒDGTJÌJWPI FCU 4GXGTU   GVYCUXGTDGWNVCO·NVGTGPLGFQEJPKEJV\GKVIGPÌUUKUEJGP$CPF<- ++



1TFGP FGU JN )TGIQTU FGU )TQ­GP =1TFQ 5CPEVWU )TGIQTKWU /CIPWU?  #WUHÒJTWPI FKG 4G   XGTUUGKVGP FGT -TGW\CTOG GOCKNNKGTV  UGKV   )TQ­MTGW\UGV HÒT /KNKV·TXGTFKGPUV #PHGTVKIWPI FGT   (KTOC4QVJGKP9KGPDGUVGJGPFCWU-NGKPQF5KNDGTXGTIQNFGVVGKNYGKUG\KUGNKGTVVGKNYGKUGGOCKNNKGTV CO 5EJWNVGTDCPF WPF $TWUVUVGTP 5KNDGT DTKNNCPVKGTV WPF TGRGTEKGTV #WHNCIG CWH FGO 4GXGTU XGT   UEJTCWDV 5KNDGTXGTIQNFGVWPFGOCKNNKGTVCP0CFGN<- ++



<WUCOOGPIGJÌTKIGU 5GV KP JGTXQTTCIGPFGT #PHGTVKIWPIUSWCNKV·V FGU DGFGWVGPFGP ÌUVGTTGKEJKUEJGP *GTUVGNNGTU CWU   FGO\YGKVGP&TKVVGNFGU,CJTJWPFGTVUKPCDUQNWVGT$GUVGTJCNVWPI

8923



8924

1TFGP FGU JN )TGIQTU FGU )TQ­GP =1TFQ 5CPEVWU )TGIQTKWU /CIPWU?  #WUHÒJTWPI FKG 4G   XGTUUGKVGPFGT-TGW\CTOGGOCKNNKGTVUGKV $TWUVUVGTP\WO)TQ­MTGW\5KNDGTDTKNNCPVKGTVWPFHGKPUV TGRGTEKGTV#WHNCIG)QNFVGKNYGKUG\KUGNKGTVGOCKNNKGTVCP0CFGN<- ++



$GOGTMGPUYGTVG#PHGTVKIWPIKPGKPGTDGUQPFGTGP)GUVCNVWPIWO



1TFGP FGU JN )TGIQTU FGU )TQ­GP =1TFQ 5CPEVWU )TGIQTKWU /CIPWU?  #WUHÒJTWPI OKV GOCKN   NKGTVGP4ÒEMUGKVGPFGT-TGW\CTOGUGKVEC $TWUVUVGTP\WO)TQ­MTGW\HTCP\ÌUKUEJG#PHGTVKIWPI FGT (KTOC $QWNNCPIGT KP 2CTKU &WTEJOGUUGT  OO 5KNDGT DTKNNCPVKGTV WPF TGRGTEKGTV #WHNCIGP   )QNFGOCKNNKGTVCWHFGT4ÒEMUGKVG*GTUVGNNGTDG\GKEJPWPIFGT(KTOC$QWNNCPIGT 4FGNC2CKZDKU  CP0CFGNFKGUGOKV*GTUVGNNGTRWP\GWPFHTCP\ÌUKUEJGT)CTCPVKGRWP\GHÒTGT5KNDGTXQP DKU 'DGTMQRH OKV\YGK5GKVGPJCMGP +p++ $GUQPFGTUITQ­GT$TWUVUVGTPXQPDGUVGT#PHGTVKIWPIUSWCNKV·VXQPXQTKPGKPGTJGTXQTTCIGPFGP'TJCNVWPI

308




KIRCHENSTAAT / VATIKAN

8925

8926

8927

8928



1TFGP FGU JN )TGIQTU FGU )TQ­GP =1TFQ 5CPEVWU )TGIQTKWU /CIPWU?  #WUHÒJTWPI OKV GOCKN   NKGTVGP 4GXGTUUGKVGP FGT -TGW\CTOG  UGKV EC   -QOOCPFGWTMTGW\ HÒT <KXKNXGTFKGPUV )QNF VGKN   YGKUG HGKPUV \KUGNKGTV GOCKNNKGTV  I PCJG\W WPUKEJVDCTG 6GKNCDRNCV\WPIGP CP \YGK $N·VVEJGP FGU   'KEJGPDNCVVMTCP\GUCONCPIGPCNVGP*CNUDCPFCDUEJPKVV<- +p



ªDGTTCIGPFG#PHGTVKIWPIUSWCNKV·VCWUFGONGV\VGP8KGTVGNFGU,CJTJWPFGTVUKPJGTXQTTCIGPFGT'TJCNVWPI



1TFGP FGU JN )TGIQTU FGU )TQ­GP =1TFQ 5CPEVWU )TGIQTKWU /CIPWU?  #WUHÒJTWPI OKV GOCKN   NKGTVGP4GXGTUUGKVGPFGT-TGW\CTOGUGKVEC -QOOCPFGWTMTGW\HÒT<KXKNXGTFKGPUVHTCP\ÌUKUEJG #PHGTVKIWPI)QNFGOCKNNKGTVIMCWOUKEJVDCTG*CCTTKUUGKPFGTTQVGP'OCKNNGKPFGT¤UGHTCP\Ì UKUEJG )CTCPVKGRWP\G UGKV  #FNGTMQRH  CO CNVGP 1TKIKPCN*CNUDCPF OKV )ÒTVGNUEJNKG­G <-    ++



5GJTSWCNKV·VUXQNNGWPFUEJYGTG#PHGTVKIWPICWUFGONGV\VGP&TKVVGNFGU,CJTJWPFGTVU



1TFGP FGU JN )TGIQTU FGU )TQ­GP =1TFQ 5CPEVWU )TGIQTKWU /CIPWU?  #WUHÒJTWPI OKV GOCKN   NKGTVGP 4GXGTUUGKVGP FGT -TGW\CTOG  UGKV EC   -QOOCPFGWTMTGW\ HÒT <KXKNXGTFKGPUV )QNF VGKN   YGKUGHGKPUV\KUGNKGTVWPFITCXKGTVGOCKNNKGTVIMCWOUKEJVDCTG4GRCTCVWTGPKPFGTITÒPGP'OCKNNG FGT.QTDGGTMTCP\ÒDGTJÌJWPICOCNVGP1TKIKPCN*CNUDCPF<- +p++



5GJTSWCNKV·VUXQNNG#PHGTVKIWPIOKVHGKPUVITCXKGTVGO2QTVTCKVFGU2CRUVGUCWUFGONGV\VGP&TKVVGNFGU,CJTJWPFGTVU



1TFGP FGU JN )TGIQTU FGU )TQ­GP =1TFQ 5CPEVWU )TGIQTKWU /CIPWU?  #WUHÒJTWPI OKV GOCKN   NKGTVGP 4GXGTUUGKVGP FGT -TGW\CTOG  UGKV EC   -QOOCPFGWTMTGW\ HÒT <KXKNXGTFKGPUV OQFGTPG   #PHGTVKIWPI )QNF GOCKNNKGTV /GFCKNNQPT·PFGT 5KNDGT  CWH FGT 4ÒEMUGKVG FGU .QTDGGTMTCP\GU KVC   NKGPKUEJG)QNFRWP\GCO*CNUDCPF<- 44++



+P FKGUGT OQFGTPGP LGFQEJ UGJT SWCNKV·VUXQNNGP #PHGTVKIWPI CWU FGO NGV\VGP 8KGTVGN FGU  ,CJTJWPFGTVU KP GEJV   )QNF  XQPCNNGTITÌ­VGT5GNVGPJGKV

309


KIRCHENSTAAT / VATIKAN

8929





1TFGP FGU JN )TGIQTU FGU )TQ­GP =1TFQ 5CPEVWU )TGIQTKWU /CIPWU?  #WUHÒJTWPI OKV GOCKN   NKGTVGP 4GXGTUUGKVGP FGT -TGW\CTOG  UGKV EC   -QOOCPFGWTMTGW\ HÒT<KXKNXGTFKGPUVKVCNKGPKUEJG #PHGTVKIWPI FGT (KTOC 6CPHCPK  $GTVCTGNNK KP 4QO 5KNDGT XGTIQNFGV WPF GOCKNNKGTV CWH FGO 4GXGTU   FGU.QTDGGTMTCP\GU/CTMG#HÒT5KNDGTWPF*GTUVGNNGTDG\GKEJPWPIFGT(KTOC6CPHCPK$GTVCTGNNKCO QTKIKPCNGP *CNUDCPF KO QTKIKPCNGP 8GTNGKJWPIUGVWK FGT (KTOC 6CPHCPK  $GTVCTGNNK OKV IQNFHCTDGPGO   R·RUVNKEJGP+PUKIPKGP<- ++



1TFGP FGU JN )TGIQTU FGU )TQ­GP =1TFQ 5CPEVWU )TGIQTKWU /CIPWU?  #WUHÒJTWPI OKV GOCKN   NKGTVGP 4GXGTUUGKVGP FGT -TGW\CTOG  UGKV EC   -QOOCPFGWTMTGW\ HÒT /KNKV·TXGTFKGPUV KVCNKG   PKUEJG #PHGTVKIWPI FGT (KTOC )WEEKQPGKP4QOCWUFGPGT,CJTGP6[R OKV6TQRJ·GCWHFGO *CNUDCPF 5KNDGTXGTIQNFGVWPFVGKNYGKUGGOCKNNKGTVCWHFGT4ÒEMUGKVGFGT6TQRJ·GWPFCWHFGO$CPF TKPI5KNDGTRWP\GCOQTKIKPCNGP*CNUDCPF ++



8931



8930

8932

1TFGP FGU JN )TGIQTU FGU )TQ­GP =1TFQ 5CPEVWU )TGIQTKWU /CIPWU?  #WUHÒJTWPI OKV GOCKN   NKGTVGP 4GXGTUUGKVGP FGT -TGW\CTOG  UGKV EC   4KVVGTMTGW\ HÒT <KXKNXGTFKGPUV  Z  OO   )QNF GOCKNNKGTV  I #DRNCV\WPIGP KP FGT ITÒPGP 'OCKNNG FGT -TCP\ÒDGTJÌJWPI WPF OKP 'OCKN   NGEJKRCWHFGT8QTFGTUGKVGFGUWPVGTGP-TGW\CTOUCOUR·VGTGP$CPF<- ++



5GJTIWVG#PHGTVKIWPIUSWCNKV·VCWUFGONGV\VGP8KGTVGNFGU,CJTJWPFGTVU



1TFGP FGU JN )TGIQTU FGU )TQ­GP =1TFQ 5CPEVWU )TGIQTKWU /CIPWU?  #WUHÒJTWPI OKV GOCKN   NKGTVGP4GXGTUUGKVGPFGT-TGW\CTOGUGKVEC 4KVVGTMTGW\HÒT/KNKV·TXGTFKGPUVZOO )QNFGOCKNNKGTVIQJPG$CPF<- +p++ *GTXQTTCIGPFG#PHGTVKIWPIUSWCNKV·VWOKPCNNGTDGUVGT'TJCNVWPI

310




KIRCHENSTAAT / VATIKAN

8933



1TFGPXQOJN2CRUV5[NXGUVGTQFGTXQO)QNFGPGP5RQTP=1TFQ5CPEVK5KNXGUVTK2CRCGUKXG'SWG UVTK /KNKVKCG #WTCVCG? -QNNCPG FGT -QOOCPFGWTG WPF 4KVVGT DGUVGJGPF CWU  -GVVGP WPF GKPGO   6TQRJ·GPINKGFOKV6TCIGJCMGPHÒTFCU1TFGPUMTGW\5KNDGTXGTIQNFGV<- 4++



#PHGTVKIWPICWUFGONGV\VGP8KGTVGNFGU,CJTJWPFGTVU2CRUV)TGIQT:8+YCPFGNVGCO1MVQDGTFGPCNVGP 1TFGPFGT)QNFGPGP/KNK\QFGTXQO)QNFGPGP5RQTPKPGKPGPPGWGPPWPOGJT\YGKMNCUUKIGP 4KVVGTWPF-QOOCP FGWT 1TFGPXQOJN2CRUV5[NXGUVGTWPFXQO)QNFGPGP5RQTPWOFGUUGP+PUKIPKGPPQTOCNGTYGKUGCO*CNUQFGT $TWUVDCPFDGKDGUQPFGTGPHGKGTNKEJGP)GNGIGPJGKVGPLGFQEJCPGKPGT-GVVGWPFFC\WGKPG1TFGPU7PKHQTOIGVTCIGP YWTFG

8934



8935

1TFGPXQOJN2CRUV5[NXGUVGTQFGTXQO)QNFGPGP5RQTP=1TFQ5CPEVK5KNXGUVTK2CRCGUKXG'SWG UVTK/KNKVKCG#WTCVCG?#WUHÒJTWPI FKG4GXGTUUGKVGPFGT-TGW\CTOGPKEJVGOCKNNKGTVDKUEC  4KVVGTMTGW\)QNFGOCKNNKGTVIOKP*CCTTKUUGCWHFGO4GXGTUOKP'OCKNNGTGRCTCVWT5RQTPFTGJ DCTCOQTKIKPCNGPCNVGPVTKCPIWNCTCPIGQTFPGVGP$CPF<- ++



#PHGTVKIWPICWUFGOFTKVVGP8KGTVGNFGU,CJTJWPFGTVU



1TFGPXQOJN2CRUV5[NXGUVGTQFGTXQO)QNFGPGP5RQTP=1TFQ5CPEVK5KNXGUVTK2CRCGUKXG'SWG UVTK /KNKVKCG #WTCVCG?  #WUHÒJTWPI OKV GOCKNNKGTVGP 4GXGTUUGKVGP FGT -TGW\CTOG  UGKV EC     -QOOCPFGWTMTGW\HTCP\ÌUKUEJG#PHGTVKIWPI)QNFVGKNYGKUGHGKPUV\KUGNKGTVGOCKNNKGTVI*CCT TKUUG CWH FGT #XGTU WPF4GXGTUUGKVG5RQTPFTGJDCTKPFGT¤UGHTCP\ÌUKUEJG)QNFRWP\GXQPDKU  #FNGTMQRH COCNVGPVGKNYGKUG\GTUEJNKUUGPGP1TKIKPCNJCNUDCPF<- 4++

 311


KIRCHENSTAAT / VATIKAN

8936 8938

8937



1TFGP FGU JN 2CRUVGU 5[NXGUVGT =1TFQ 5CPEVK 5KNXGUVTK 2CRCG? $TWUVUVGTP \WO )TQ­MTGW\ 5KNDGT   DTKNNCPVKGTV#WHNCIGP5KNDGTVGKNYGKUGXGTIQNFGVWPFGOCKNNKGTVGKPPCJG\WWPUKEJVDCTGT*CCTTK­CWHFGO WPVGTGP -TGW\CTO CWH FGO 4GXGTU *GTUVGNNGTDG\GKEJPWPI FGT (KTOC )WUVCXG 9QNHGTU KP $TÒUUGN CP   0CFGNOKV\YGK5GKVGPJCMGP<- +p++



*GTXQTTCIGPFG #PHGTVKIWPI CWU FGO GTUVGP 8KGTVGN FGU  ,CJTJWPFGTVU XQP FKGUGO *GTUVGNNGT PKEJV J·WHKI \W   HKPFGP#O(GDTWCT·PFGTVG2CRUV2KWU:FGP1TFGPXQOJN2CRUV5[NXGUVGTWPFXQO)QNFGPGP5RQTPKP GKPGP FTGKMNCUUKIGP YQDGK FKG \YGKVG-NCUUGKP\YGK)TCFGOKVWPFQJPG$TWUVUVGTPWPVGTVGKNVKUV CNNIGOGKPGP 8GTFKGPUVQTFGP WO /KV *CPFUEJTGKDGP XQO  ,WNK  XGTHÒIVG 2CRUV ,QJCPPGU 2CWN ++   FC­ FGT   1TFGPHQTVCPKPCNNGP-NCUUGPCWEJCP(TCWGPXGTNKGJGPYGTFGPMCPP





1TFGPFGUJN2CRUVGU5[NXGUVGT=1TFQ5CPEVWU5KNXGUVTK2CRCG?4KVVGTMTGW\#PHGTVKIWPIFGT(KTOC 6CPHCPK$GTVCTGNNKKP4QO5KNDGTVGKNYGKUGXGTIQNFGVWPFGOCKNNKGTVOKP#WUDTÒEJGKP\YGK-TGW\ CTOURKV\GP CO $CPF \WUCOOGP OKV /KPKCVWT 5KNDGT XGTIQNFGV WPF GOCKNNKGTV CO $·PFEJGP WPF   -PQRHNQEJTQUGVVGKOQTKIKPCNGP8GTNGKJWPIUGVWKFGT(KTOC6CPHCPK$GTVCTGNNKOKVIQNFHCTDGPGO9CR RGP2CRUV2KWU:++ TGIXQPDKU <- ++



1TFGP FGU JN 2CRUVGU 5[NXGUVGT =1TFQ 5CPEVK 5KNXGUVTK 2CRCG? -QOOCPFGWTMTGW\ )QNF GOCKNNKGTV   IGKPPCJG\WWPUKEJVDCTGT*CCTTK­GKP.QEJFGT-WIGNÌUGGVYCUCWUIGDGWNVQJPG*CNUDCPF<-  +p++



'Z\GNNGPVG#PHGTVKIWPICWUFGOGTUVGP8KGTVGNFGU,CJTJWPFGTVUKPGEJV)QNFPKEJVJ·WHKI\WHKPFGP

8939



ex 8940

1TFGP FGU JN 2CRUVGU 5[NXGUVGT =1TFQ 5CPEVK5KNXGUVTK2CRCG?-QOOCPFGWTMTGW\5KNDGTXGTIQNFGV WPFGOCKNNKGTVCWHFGT4ÒEMUGKVG\YGKMNGKPG4GRCTCVWTGPKO/GFCKNNQPTKPICO$CPFTKPI*GTUVGNNGTDG \GKEJPWPIFGT(KTOC6CPHCPK$GTVCTGNNKCOQTKIKPCNGPIGVTCIGPGP*CNUDCPFKOQTKIKPCNGP.GFGTGVWK XQP6CPHCPKWPF$GTVTCTGNNKKP4QOOKV9CRRGP2CRUV2KWU:+ TGIXQPDKU <- ++



#PHGTVKIWPICWUFGTGTUVGP*·NHVGFGU,CJTJWPFGTVU



1TFGPFGUJN2CRUVGU5[NXGUVGT=1TFQ5CPEVK5KNXGUVTK2CRCG?-QOOCPFGWTMTGW\$TQP\GXGTIQNFGV WPF GOCKNNKGTV CO *CNUDCPF \WUCOOGP OKV /KPKCVWT $TQP\G XGTIQNFGV WPF GOCKNNKGTV CO $·PFEJGP   OKV#WHNCIGWPF-PQRHNQEJTQUGVVGOKV#WHNCIGKOQTKIKPCNGP8GTNGKJWPIUGVWK<- 5VÒEM++ 5GJTUEJÌPGTMQORNGVVGTPGWYGTVKIGT5GVKPGKPGTIGIGPY·TVKIGP#PHGTVKIWPI

 312

&KGUG-CVCNQIRQUKVKQPGPVH·NNV






KIRCHENSTAAT / VATIKAN

8942 8943



ex 8944

1TFGP FGU JN 2CRUVGU 5[NXGUVGT =1TFQ 5CPEVK 5KNXGUVTK 2CRCG? 4KVVGTMTGW\ 5KNDGT XGTIQNFGV WPF   GOCKNNKGTVCWHFGT4ÒEMUGKVGFGU#MCPVJWU1TPCOGPVU*GTUVGNNGTDG\GKEJPWPIFGT(KTOC6CPHCPK$GTV CTGNNK KP4QO CWHFGO$CPFTKPICWHIGNÌVGVGU# HÒT5KNDGT COQTKIKPCNGP$CPF<-5 ++



5GJTSWCNKV·VUXQNNG#PHGTVKIWPICWUFGOGTUVGP&TKVVGNFGU,CJTJWPFGTVU





4KVVGTQTFGPXQO*GKNKIGP)TCDXQP,GTWUCNGO=1TFQ'SWGUVTKU5CPEVK5GRWNETK*KGTQUQN[OKVCPK? /QFGNN UGKV   -QOOCPFGWTMTGW\ KVCNKGPKUEJG #PHGTVKIWPI FGT (KTOC )WEEKQPG KP 4QO CWU FGP   GT ,CJTGP 5KNDGT XGTIQNFGV WPF GOCKNNKGTV CWH FGT 4ÒEMUGKVG FGT 6TQRJ·G WPF CWH FGO $CPFTKPI   5KNDGTRWP\GCOQTKIKPCNGP*CNUDCPF +p++



4KVVGTQTFGPXQO*GKNKIGP)TCDXQP,GTWUCNGO=1TFQ'SWGUVTKU5CPEVK5GRWNETK*KGTQUQN[OKVCPK? /QFGNN UGKV   -QOOCPFGWTMTGW\ $TQP\G XGTIQNFGV WPF GOCKNNKGTVCO*CNUDCPF\WUCOOGPOKV /KPKCVWT $TQP\G VGKNYGKUG XGTIQNFGV WPF GOCKNNKGTV CO $·PFEJGP WPF -PQRHNQEJTQUGVVG OKV#WHNCIG KOQTKIKPCNGP8GTNGKJWPIUGVWK 5VÒEM+p++



5GJTUEJÌPGTMQORNGVVGTPGWYGTVKIGT5GVKPGKPGTIGIGPY·TVKIGP#PHGTVKIWPI

8947 ex 8945



8946

4KVVGTQTFGPXQO*GKNKIGP)TCDXQP,GTWUCNGO=1TFQ'SWGUVTKU5CPEVK5GRWNETK*KGTQUQN[OKVCPK? /QFGNN UGKV   4KVVGTMTGW\ $TQP\G XGTIQNFGV WPF GOCKNNKGTV CO *CNUDCPF \WUCOOGP OKV /K   PKCVWT$TQP\GVGKNYGKUGXGTIQNFGVWPFGOCKNNKGTVCO$·PFEJGPWPF-PQRHNQEJTQUGVVGOKV#WHNCIGKO QTKIKPCNGP8GTNGKJWPIUGVWK<- 5VÒEM++



5GJTUEJÌPGTMQORNGVVGTPGWYGTVKIGT5GVKPGKPGTIGIGPY·TVKIGP#PHGTVKIWPI



4KVVGTQTFGPXQO*GKNKIGP)TCDXQP,GTWUCNGO=1TFQ'SWGUVTKU5CPEVK5GRWNETK*KGTQUQN[OKVCPK? /QFGNN UGKV   4KVVGTMTGW\ HÒT &COGP 5KNDGT XGTIQNFGV WPF GOCKNNKGTV CO NCPIGP *CNUDCPF \W   UCOOGP OKV /KPKCVWT 5KNDGT VGKNYGKUG XGTIQNFGV WPF GOCKNNKGTV CO $·PFEJGP WPF -PQRHNQEJTQUGVVG   OKV#WHNCIGKOQTKIKPCNGP8GTNGKJWPIUGVWK<- ++



5GJTUEJÌPGTWPFUGNVGPGTMQORNGVVGTPGWYGTVKIGT5GVKPGKPGTIGIGPY·TVKIGP#PHGTVKIWPI



4KVVGTQTFGP XQO *GKNKIGP )TCD XQP ,GTWUCNGO =1TFQ 'SWGUVTKU 5CPEVK 5GRWNETK *KGTQUQN[OKVCPK?   2CCT5RQTGP\WT1TFGPUWPKHQTO$TQP\GXGTIQNFGV 4++



5GJTUEJÌPGUWPFUGNVGP\WHKPFGPFGU2CCTKPGKPGTIGIGPY·TVKIGP#PHGTVKIWPI

313


KIRCHENSTAAT / VATIKAN

8949 8948

8950

8952



4KVVGTQTFGP XQO *GKNKIGP )TCD XQP ,GTWUCNGO =1TFQ 'SWGUVTKU 5CPEVK 5GRWNETK *KGTQUQN[OKVCPK?   $TWUVMTGW\FGU1TFGPU&WTEJOGUUGTOO5KNDGTXGTIQNFGVWPFGOCKNNKGTVCP\YGK0CFGNP ++





8GTFKGPUVOGFCKNNG$GPGOGTGPVK=0QOKUOC$GPGOGTGPVK?#NNIGOGKPGU/QFGNNWPVGT2CRUV)TGIQT:8+

TGIXQPDKU PKEJVVTCIDCTG#WUHÒJTWPIOKV#0:+8HÒT)TQ­G5KNDGTPG$GPGOG TGPVK/GFCKNNG&WTEJOGUUGTOO5KNDGTOKV5VGORGNUEJPGKFGT5KIPCVWT)%'4$#4#( 4++



&KG 8GTFKGPUVOGFCKNNG $GPGOGTGPVK KUV NCWV XQP *G[FGP KP *&+ 5  0T   WPF CPFGTGP #WVQTGP XQP   2CRUV2KWU8++  IGUVKHVGVYQTFGPWO%KXKNDGCOVGHÒTKJTG#PJ·PINKEJMGKVCPFGPR·RUVNKEJGP5VWJNWPF /KNKV·TU HÒT 6CRHGTMGKV /WV WPF 6TGWG IGIGP FGP NGIKVKOGP *GTTUEJGT \W DGNQJPGPŋ5KGYWTFGKPXGTUEJKGFGPGP /GVCNNGP )QNF5KNDGTWPF$TQP\G WPFKPXGTUEJKGFGPGP)TÌ­GPWPFUQYQJNKPVTCIDCTGTCNUCWEJPKEJVVTCIDCTGT #WUHÒJTWPICP<KXKNWPF/KNKV·T2GTUQPGPXGTNKGJGP /QFGNN 







8GTFKGPUVOGFCKNNG $GPGOGTGPVK =0QOKUOC $GPGOGTGPVK?  /QFGNN OKV IGMTGW\VGP 5EJNÒUUGP WPF   6KCTCEC #WUICDG OKVFGO2QTVTCKV2CRUV2KWU:++ )QNFGPG/GFCKNNG $TQP\GXGTIQNFGVCOQTKIKPCNGP$CPF ++



-QPXQNWVXQP\YGK$GPGOGTGPVK/GFCKNNGPWPFGKPGO2·RUVNKEJGP'JTGPMTGW\2TQ'EENGUKCGV2QP VGHKEG/QFGNN#WUICDGWPVGT2CRUV2KWU:++ TGIXQPDKU WPFWPVGT2CRUV2CWN8+ TGI XQP  DKU   LGYGKNU OKV 2·RUVNKEJGP +PUKIPKGP CNU ªDGTJÌJWPI $TQP\G XGTIQNFGV 2·RUVNKEJGU   'JTGPMTGW\ 2TQ 'EENGUKC GV 2QPVGHKEG  /QFGNN FTGKUVWHKI  )QNFGPGU 'JTGPMTGW\ 5KNDGT XGTIQNFGV   ,GYGKNUQJPG$CPF 5VÒEM++



/KNKV·TKUEJG 8GTFKGPUVOGFCKNNG $GPGOGTGPVK 'TUVG #WUICDG OKV FGO 2QTVTCKV XQP 2CRUV 2KWU :++    DKU $TQP\GOGFCKNNG$TQP\GCOQTKIKPCNGP$CPF ++



2CRUV 2KWU :++   UVKHVGVG KP FGP GT ,CJTGP FKG FTGKUVWHKIG )QNF 5KNDGT WPF $TQP\G  /KNKV·T8GT   FKGPUVOGFCKNNG$GPGOGTGPVKFGTGP)GUVCNVWPICPFCUXQP2CRUV2KWU+:  IGUVKHVGVG/KNKV·T'JTGP \GKEJGPCPNGJPVFCUDKUKPFCU2QPVKHKMCV2CRUV$GPGFKMVU:8  XGTNKGJGPYQTFGPKUV/KVFGT#WHNÌUWPI FGT R·RUVNKEJGP OKNKV·TKUEJGP 'KPJGKVGP DKUCWHFKG2·RUVNKEJG5EJYGK\GTICTFGFWTEJ2CRUV2CWN8+   KO,CJTYWTFGCWEJFKG/KNKV·T8GTFKGPUVOGFCKNNGō$GPGOGTGPVKŋYKGFGTCDIGUEJCHHV

8953

8955 8954



2GTUÌPNKEJG&CPMOGFCKNNG2CRUV2KWU:+ TGIXQPDKU )QNFGPG/GFCKNNG5KNDGTXGTIQNFGV CO$CPFKOGVYCUDGUEJ·FKIVGP1TKIKPCNGVWKOKVIQNFHCTDGPGO9CRRGP2CRUV2KWU:+ 4++





)QNFGPG/GFCKNNG2CRUV%NGOGPU:++ TGIXQPDKU HÒT8GTFKGPUVGWOFKG4GUVCWTKGTWPI FGU-QPUVCPVKPDQIGPUKP4QOKO,CJTG XQP*COGTCPK &WTEJOGUUGTOO5KNDGTXGTIQNFGV CWHFGT4ÒEMUGKVG5VGORGNUEJPGKFGT<GKEJGP1*OKVMCRKVQNKPKUEJGT9ÌNHKPCPCNVGT#WHJ·PIWPIOKV 6TCIGTCJGCOUR·VGTGP$CPF 4++



/GFCKNNG$GPGOGTGPVKHÒT8GTFKGPUVGWOFKG/KUUKQPUCWUUVGNNWPI5KNDGTCOQTKIKPCNGP$CPF ++





/KV /QVW 2TQRTKQ XQO  ,CPWCT  UVKHVGVG 2CRUV 2KWU :+   FKGUG /GFCKNNG HÒT 8GTFKGPUVG WO FKG   1TICPKUCVKQP&WTEJHÒJTWPIWPFYKUUGPUEJCHVNKEJG$GVTGWWPIFGT/KUUKQPU#WUUVGNNWPIXQP.CWV%JCORXCPU

5 KUVFKG/GFCKNNGCPEC2GTUQPGPXGTNKGJGPYQTFGP

314


KIRCHENSTAAT / VATIKAN

8958

8957 8956



$GPGOGTGPVK-TGW\HÒT8GTFKGPUVGWOFCU#W­GTQTFGPVNKEJG*GKNKIG,CJTFGT'TNÌUWPI$TQP \GPGU $GPGOGTGPVK-TGW\ $TQP\G CO $CPF KOQTKIKPCNGP8GTNGKJWPIUGVWKOKVIQNFHCTDGPGO9CRRGP 2CRUV2KWU:+ ++





$GPGOGTGPVK-TGW\HÒT8GTFKGPUVGWOFCU*GKNKIG,CJT5KNDGTPGU$GPGOGTGPVK-TGW\$TQP\G XGTUKNDGTVWPFVGKNYGKUGGOCKNNKGTVCO1TKIKPCNDCPF ++





$GPGOGTGPVK/GFCKNNG HÒT 8GTFKGPUVG WO FCU *GKNKIG ,CJT  )QNFGPG $GPGOTGPVK/GFCKNNG   $TQP\GXGTIQNFGVOKV5VGORGNUEJPGKFGT5KIPCVWT/+5647<<+CWHFGT8QTFGTUGKVGCO$CPFKOOKV IQNFHCTDGPGP5EJNÒUUGNPDGFTWEMVGPQTKIKPCNGPIGTKPIHÒIKITGRCTKGTVGP8GTNGKJWPIUGVWK ++





&KGUG-CVCNQIRQUKVKQPGPVH·NNV



8960

8961



8962

/GFCKNNG FGU -CTFKPCN%COGTNGPIQ FGT *GKNKIGP 4ÌOKUEJGP -KTEJG HÒT 8GTFKGPUVG Y·JTGPF FGT   5GFKUXCMCP\XQODKU\WO,WPK PCEJFGO6QF2CRUV,QJCPPGU::+++CO,WPK  5KNDGTPG /GFCKNNG &WTEJOGUUGT  OO 5KNDGT CWH FGT 8QTFGTUGKVG 5VGORGNUEJPGKFGT5KIPCVWT   5#8'..+CWHFGT4ÒEMUGKVG5KNDGTRWP\GCO$CPF 4++



&KG/GFCKNNGYWTFGXQP-CTFKPCN%COGTNGPIQ$GPGFGVVQ-CTFKPCN#NQKUK/CUGNNCCOXKQNGVVGP$CPFFGTMKTEJNKEJGP (CTDGFGT6TCWGTXGTIGDGP





/GFCKNNG FGU -CTFKPCN%COGTNGPIQ FGT *GKNKIGP 4ÌOKUEJGP -KTEJG HÒT 8GTFKGPUVG Y·JTGPF FGT   5GFKUXCMCP\XQODKU\WO,WPK PCEJFGO6QF2CRUV,QJCPPGU::+++CO,WPK  $TQP\GOGFCKNNG &WTEJOGUUGT  OO $TQP\G CWH FGT 8QTFGTUGKVG 5VGORGNUEJPGKFGT5KIPCVWT   5#8'..+CO$CPF 4++



$GPGOGTGPVKOGFCKNNG CWU #PNC­ FGT -TÌPWPI 2CRUV 2CWNU 8+ CO  ,WPK  &WTEJOGUUGT    OO5KNDGTCWHFGT8QTFGTUGKVG5VGORGNUEJPGKFGT5KIPCVWT)+#/2#1.+CWHFGT4ÒEMUGKVGRWP\KGTV GKPG4CPFFGNNGCO$CPF 4++



5GNVGPG/GFCKNNGFKGCPFCUOKNKV·TKUEJG2GTUQPCNFGU*GKNKIGP5VWJNUXGTIGDGPYWTFGFCUCPFGP-TÌPWPIUHGKGT NKEJMGKVGPVGKNPCJO

315


KIRCHENSTAAT / VATIKAN









8965

8964

8963

8966

$GPGOGTGPVK/GFCKNNG HÃ&#x2019;T 8GTFKGPUVG WO FKG 2KNIGTHCJTV 2CRUV 2CWNU 8+ KPU *GKNKIG .CPF XQO     DKU  ,CPWCT)QNFGPG$GPGOGTGPVK/GFCKNNG5KNDGTXGTIQNFGVCWHFGT8QTFGTUGKVG5VGORGN UEJPGKFGT5KIPCVWT.14+1.+CWHFGT4Ã&#x2019;EMUGKVG)+75'22'2+4410'WPF5KNDGTRWP\GCO $CPFOKV6TCIGURCPIGKOQTKIKPCNGPOKVIQNFHCTDGPGO9CRRGP2CRUV2CWNU8+WPFFGP4GKUGFCVGPDG FTWEMVGP8GTNGKJWPIUGVWK 4++



$GPGOGTGPVK/GFCKNNG HÃ&#x2019;T 8GTFKGPUVG WO FKG 2KNIGTHCJTV 2CRUV 2CWNU 8+ KPU *GKNKIG .CPF XQO     DKU  ,CPWCT  5KNDGTPG $GPGOGTGPVK/GFCKNNG 5KNDGT CWH FGT 8QTFGTUGKVG 5VGORGNUEJPGKFGT   5KIPCVWT.14+1.+CWHFGT4Ã&#x2019;EMUGKVG)+75'22'2+4410'WPF5KNDGTRWP\GCO$CPFOKV 6TCIGURCPIG ++



$GPGOGTGPVK/GFCKNNG HÃ&#x2019;T 8GTFKGPUVG WO FKG 2KNIGTHCJTV 2CRUV 2CWNU 8+ KPU *GKNKIG .CPF XQO    DKU,CPWCT$TQP\GPG$GPGOGTGPVK/GFCKNNG$TQP\GCWHFGT8QTFGTUGKVG5VGORGNUEJPGKFGT 5KIPCVWT.14+1.+CWHFGT4Ã&#x2019;EMUGKVG)+75'22'2+4410'CO$CPFOKV6TCIGURCPIG ++



$GPGOGTGPVK/GFCKNNG HÃ&#x2019;T 8GTFKGPUVG WO FKG 2KNIGTHCJTV 2CRUV 2CWNU 8+ KPU *GKNKIG .CPF XQO    DKU,CPWCT0KEJVVTCIDCTG#WUHÃ&#x2019;JTWPIHÃ&#x2019;TYGKDNKEJG'ORH·PIGT5KNDGTRWP\KGTV&WTEJOGUUGT OO ++



8970 8967









 316

8968

8969

8971

$GPGOGTGPVK/GFCKNNGHÃ&#x2019;T8GTFKGPUVGWOFKG&WTEJHÃ&#x2019;JTWPIFGU<YGKVGP8CVKMCPKUEJGP-QP\KN DKU)QNFGPG$GPGOGTGPVK/GFCKNNG5KNDGTXGTIQNFGVCWHFGT4Ã&#x2019;EMUGKVGRWP\KGTVCO$CPF OKV 6TCIGURCPIG KO PKEJV OGJT RGTHGMV UEJNKG­GPFGP QTKIKPCNGP 8GTNGKJWPIUGVWK OKV OGVCNNGPGO   9CRRGP2CRUV2CWNU8+ 4++



$GPGOGTGPVK/GFCKNNGHÃ&#x2019;T8GTFKGPUVGWOFKG&WTEJHÃ&#x2019;JTWPIFGU<YGKVGP8CVKMCPKUEJGP-QP\KN DKU5KNDGTPG$GPGOGTGPVK/GFCKNNG5KNDGTCO$CPFOKV6TCIGURCPIGKOQTKIKPCNGP8GTNGKJWPIU GVWKOKVOGVCNNGPGO9CRRGP2CRUV2CWNU8+ ++



$GPGOGTGPVK/GFCKNNGHÃ&#x2019;T8GTFKGPUVGWOFKG&WTEJHÃ&#x2019;JTWPIFGU<YGKVGP8CVKMCPKUEJGP-QP\KN DKU  $TQP\GPG $GPGOGTGPVK/GFCKNNG $TQP\G CO $CPF OKV 6TCIGURCPIG KO QTKIKPCNGP 8GTNGK   JWPIUGVWKOKVOGVCNNGPGO9CRRGP2CRUV2CWNU8+ ++



$GPGOGTGPVK/GFCKNNG HÃ&#x2019;T 8GTFKGPUVG WO FCU *GKNKIG ,CJT  )QNFGPG $GPGOGTGPVK/GFCKNNG   5KNDGT XGTIQNFGV CWH FGT 8QTFGTUGKVG 5VGORGNUEJPGKFGTPCOG ' /CPHCKPK WPF 5KNDGTRWP\G  CO   $CPFOKV6TCIGURCPIGKOQTKIKPCNGP8GTNGKJWPIUGVWKOKVOGVCNNGPGO9CRRGP2CRUV2CWNU8+ 4++



$GPGOGTGPVK/GFCKNNG HÃ&#x2019;T 8GTFKGPUVG WO FCU *GKNKIG ,CJT  5KNDGTPG $GPGOGTGPVK/GFCKNNG   5KNDGTCWHFGT8QTFGTUGKVG5VGORGNUEJPGKFGTPCOG'/CPHCKPKWPF5KNDGTRWP\GCO$CPF ++




KIRCHENSTAAT / VATIKAN

8973

8972



'TKPPGTWPIUOGFCKNNG CP FCU 2QPVKHKMCV 2CRUV 2CWN 8+ HÒT FKG FGUUGP GPIUVG /KVCTDGKVGT 5KNDGTPG   /GFCKNNG&WTEJOGUUGTOO5KNDGTCWHFGT8QTFGTUGKVG5VGORGNUEJPGKFGT5KIPCVWT)+#/2#1.+ CWHFGT4ÒEMUGKVG5KNDGTRWP\GCO$CPFOKV6TCIGURCPIG 4++



&KGUG /GFCKNNG GPVURTKEJV FGT PKEJV VTCIDCTGP QHHK\KGNNGP 2·RUVNKEJGP ,CJTGUOGFCKNNG FGU  2QPVKHCMVULCJTGU 2CRUV   2CWNUJCVLGFQEJGKPGPDTGKVGP*GPMGNWPFYKTFCO$CPFIGVTCIGP5KGYWTFGKP\WUCOOGPPWT'ZGORNCTGPKP 5KNDGTWPF5KNDGTXGTIQNFGVIGRT·IVWPFCPFKGGPIUVGP/KVCTDGKVGT2CRUV2CWN8+PCEJFGUUGP6QFGCWUIGIGDGP



/GFCKNNG FGU -CTFKPCN%COGTNGPIQ FGT *GKNKIGP 4ÌOKUEJGP -KTEJG HÒT 8GTFKGPUVG Y·JTGPF FGT   5GFKUXCMCP\XQODKU#WIWUV PCEJFGO6QF2CRUV2CWNU8+CO#WIWUV 5KNDGTPG /GFCKNNG XQP48KUVQNK &WTEJOGUUGTOO5KNDGTCWHFGT8QTFGTUGKVG5VGORGNUEJPGKFGT5KIPCVWT 48+561.+WPF5KNDGTRWP\GFGTKVCNKGPKUEJGP/ÒP\GKP4QOCO$CPF 4++



&KG /GFCKNNG YWTFG XQP -CTFKPCN%COGTNGPIQ ,GCP 8KNNQV CO XKQNGVVGP $CPF FGT MKTEJNKEJGP (CTDG FGT 6TCWGT   XGTIGDGP

8975

8974





5KNDGTPG/GFCKNNGHÒT8GTFKGPUVGWOFKG(GKGTNKEJMGKVGPCWU#PNC­FGU#OVUCPVTKVVU2CRUV,QJCPPGU 2CWNU++ TGIXQPDKU  XQP48KUVQNK &WTEJOGUUGTOO5KNDGTCWHFGT4ÒEMUGKVG 5VGORGNUEJPGKFGT5KIPCVWT48+561.+WPF5KNDGTRWP\G#ICO$CPF 4++



$GPGOGTGPVK/GFCKNNG HÒT 8GTFKGPUVG WO FCU #W­GTQTFGPVNKEJG *GKNKIG ,CJT FGT 'TNÌUWPI    5KNDGT CWH FGT 8QTFGTUGKVG OKV 5VGORGNUEJPGKFGTUKIPCVWT /#4%'..75 61//#5+ CWH FGT 4ÒEM   UGKVG *GTUVGNNGTDG\GKEJPWPI +2<5 WPF 5KNDGTRWP\G #I  CO 1TKIKPCNDCPF OKV 6TCIGURCPIG KO   UVCTM QDGTHN·EJGPDGUEJ·FKIVGP QTKIKPCNGP 8GTNGKJWPIUGVWK OKV IQNFHCTDGPGO 9CRRGP 2CRUV ,QJCPPGU   2CWNU++ 4++



8976



'JTGPMTGW\ (ÒT 9QJNV·VKIMGKV 2CRUV .GQU :+++ -WRHGTXGTIQNFGVWPFGOCKNNKGTV/GFCKNNQPU5KNDGT CO\GTUEJNKUUGPGP1TKIKPCNDCPF 4++



&CU'JTGPMTGW\YWTFGXQP2CRUV.GQ:+++  KPUGKPGO2QPVKHKMCVULCJTIGUVKHVGV

317


KIRCHENSTAAT / VATIKAN

8977 8978 (1:1)

8978 (1:1)



$TWUVUVGTPFGT2·RUVNKEJGP6KDGTKPKUEJGP#MCFGOKGMNGKPGTG#WUHÒJTWPI5KNDGTXGTIQNFGVVGKNYGKUG GOCKNNKGTVCP0CFGNKO1TKIKPCNGVWK 4++





/GFCKNNG(ÒT6TGWGWPF6WIGPFCWU#PNC­FGT,CJTHGKGTFGT2·RUVNKEJGP5EJYGK\GTICTFG 5KNDGTCO1TKIKPCNDCPF*&+ 44++



&KG GKPMNCUUKIG /GFCKNNG YWTFG CO  ,CPWCT  CWU #PNC­ FGT ,WDKN·WOUHGKGTNKEJMGKVGP XQP 2CRUV 2KWU :  

 IGUVKHVGVWPFPWTCPFKGEC1HHK\KGTG7PVGTQHHK\KGTGWPF5QNFCVGPFGT2·RUVNKEJGP5EJYGK\GTICTFG XGTNKGJGP

8980

8981 (1:1) 8979



/KNKV·T&KGPUVCWU\GKEJPWPI\YGKVG#WUICDG CWHFGT4ÒEMUGKVG 2#7.752#2#8+   'JTGP\GKEJGP KP 5KNDGT HÒT ::: &KGPUVLCJTG $TQP\G XGTUKNDGTV CO QTKIKPCNGP XQTFGTUGKVKI   GVYCUXGTUEJOWV\VGP$CPF ++



2CRUV2KWU:++  UVKHVGVGKPFGPGT,CJTGPFKG\YGKUVWHKIG 5KNDGTWPF$TQP\G /KNKV·T&KGPUVCW\GKEJ PWPI #WUICDG FGTGP)GUVCNVWPIUKEJCPFKG&KGPUVCWU\GKEJPWPIFGTKVCNKGPKUEJGP5VTGKVMT·HVGCPNGJPV0CEJFGT 9CJN2CRUV2CWNU8+  KO,CJTYWTFGFGUUGP0COGCWHFGT4ÒEMUGKVGGKPIGHÒIV #WUICDG /KV FGT#WHNÌUWPIFGTR·RUVNKEJGPOKNKV·TKUEJGP'KPJGKVGPņDKUCWHFKG2·RUVNKEJG5EJYGK\GTICTFGKO,CJTYWTFG CWEJFKG/KNKV·T&KGPUVCWU\GKEJPWPIYKGFGTCDIGUEJCHHV



.CFKUNCWU 4WDKP/GFCKNNG FGT 2·RUVNKEJGP -QPITGICVKQP HÒT FKG 1TKGPVCNKUEJGP -KTEJGP HÒT 8GT   FKGPUVG WO FKG #PP·JGTWPI \YKUEJGP FGT -CVJQNKUEJGP WPF FGT 1TVJQFQZGP -KTEJGP 5KNDGT CO   QTKIKPCNGP$CPF 4++



&GT RQNPKUEJG -CTFKPCN 9NCFKUNCY 4WDKP   YCTXQPDKU-CTFKPCNRT·HGMVFGT2·RUVNKEJG-QP ITGICVKQPHÒTFKG1TKGPVCNKUEJGP-KTEJGP





318

4GXGTU#D\GKEJGP GKPGU 'FGNOCPPGU 5GKPGT *GKNKIMGKV =)GPVKNWQOQ FK 5WC 5CPVKV±? #WUHÒJTWPI   WPVGT2CRUV2KWU:++ TGIXQPDKU 5KNDGTVGKNYGKUGXGTIQNFGVWPFGOCKNNKGTVCO-NGOO MPQRH 4++



-QPXQNWVXQPFTGK/KPKCVWTGPXQP2·RUVNKEJGP1TFGP 2KWU1TFGP/KPKCVWTFGU$TWUVUVGTPU\WO )TQ­MTGW\   4KVVGTQTFGP XQO *GKNKIGP )TCD /KPKCVWT FGU $TWUVUVGTPU \WO )TQ­QHHK\KGT   1TFGP   XQO JN 2CRUV 5[NXGUVGT /KPKCVWT FGU 4KVVGTMTGW\GU HGJNGPFGU #XGTUOGFCKNNQP FWTEJ 5EJGKDG GTUGV\V   ,GYGKNU5KNDGTQFGTXGTUKNDGTVVGKNYGKUGXGTIQNFGVWPFGOCKNNKGTVQJPG$·PFEJGP 5VÒEM++




ÄGYPTEN

8983

-¤0+)4'+%*   

);26'0

1TFGPFGU0KNU/QFGNN  5GVFGT-NCUUGDGUVGJGPFCWU*CNUFGMQTCVKQPZ OO 5KNDGT VGKNYGKUG DTKNNCPVKGTV VGKNYGKUG XGTIQNFGV #WHNCIGP WPF #ITCHHG )QNF IGRTÒHV  VGKNYGKUG   GOCKNNKGTVCWHFGO4GXGTU*GTUVGNNGTDG\GKEJPWPIFGT(KTOC6GYHKM$KEJC[KPCTCDKUEJGP5EJTKHV\GKEJGP WPFOGJTGTG2WP\GPFKG#ITCHHGGDGPHCNNUOGJTHCEJIGRWP\VWC-CKTQGT2WP\GHÒTGT)QNFQJPG *CNUDCPFWPF$TWUVUVGTP&WTEJOGUUGTOO5KNDGTDTKNNCPVKGTVVGKNYGKUGXGTIQNFGV#WHNCIGP)QNF

IGRTÒHV VGKNYGKUGGOCKNNKGTVOKP#WUDTÒEJGKPFGTDNCWGP'OCKNNGFGT5EJTKHV\GKEJGPCWHFGO4GXGTU *GTUVGNNGTDG\GKEJPWPIFGT(KTOC6GYHKM$KEJC[WPF-CKTQGT2WP\GHÒTGT5KNDGTCP0CFGNFKGUGOKV HTCP\ÌUKUEJGT 'KPHWJT5KNDGTRWP\G XQP  DKU  5EJYCPGPRWP\G  0CFGNJCMGP GDGPHCNNU OKV   5EJYCPGPRWP\GWPFHTCP\ÌUKUEJGT)QNF'KPHWJTRWP\GUGKV 7JWRWP\G OKV5GKVGPJCMGP$9-  +p++++p



5GJTUEJÌPGTJCNVGPWPFOKVGEJVIQNFGPGP#WHNCIGPUGJTUGNVGP&CU/QFGNNWPVGTUEJGKFGVUKEJXQOFCTKPFC­ FKG#ITCHHGFGU-NGKPQFUIQNFHCTDGPKUVWPFFGT$TWUVUVGTPXGTIQNFGVG5VTCJNGPCWHYGKUV5EJQPUVKHVGVG5WNVCP *WUGKP-GOCNFGPHÒPHMNCUUKIGP1TFGPFGUUGP5VCVWVGPGKPKIGPFGTWPIGPFKGUKEJCWEJCWHFKG)GUVCNVWPI FGT+PUKIPKGPCWUYKTMVGPGTHCJTGPJCDGP0CEJ#WUTWHWPIFGT4GRWDNKMYWTFGGT\WP·EJUVCWHIGJQDGP LGFQEJGTPGWVCNUGKPMNCUUKIGT1TFGPIGUVKHVGV

8984



1TFGPFGU0KNU/QFGNN  &GMQTCVKQPFGT-NCUUG5KNDGTVGKNYGKUGDTKNNCPVKGTVVGKNYGKUG XGTIQNFGV WPF GOCKNNKGTV OKP *CCTTKUUG KP GKPGO 5VGTPUVTCJN WPF #DRNCV\WPIGP KP FGT 'OCKNNG FGT   5EJTKHV\GKEJGP KO /GFCKNNQP CWH FGT 4ÒEMUGKVG *GTUVGNNGTDG\GKEJPWPI FGT (KTOC .CVVGU CO $CPF   $9- ++p

 319


REPUBLIK ÄQUATORIAL GUINEA

8985

8987 8986

4'27$.+- 5'+6  

1TFGPFGT7PCDJ·PIKIMGKV=0KUEJCPCN+UVKSNCN?#WUHÒJTWPI OKVFWPMGNTQVGT'OCKNNG $TWUVUVGTP \WT  -NCUUG &WTEJOGUUGT  OO #PHGTVKIWPI FGT (KTOC 6GYHKM $KEJC[ KP-CKTQ5KNDGTVGKNYGKUG XGTIQNFGV WPF GOCKNNKGTV 'OCKNNGTGRCTCVWT KO WPVGTGP 5VTCJN CWH FGT 4ÒEMUGKVG *GTUVGNNGTDG\GKEJPWPI   FGT (KTOC $EJC[ KP CTCDKUEJ CP 0CFGN FKGUG OKV GT 5KNDGTRWP\G XQP $GPK 5WGH WPF 4GIKGTWPIU   RWP\G82'5 ++



&GTFTGKMNCUUKIG WPF-NCUUG 1TFGPHÒT8GTFKGPUVGWOFKG#DUEJCHHWPIFGT/QPCTEJKGWPFFKG'TTKEJVWPI FGT 4GRWDNKM YWTFG  XQP 5VCCVURT·UKFGPV )COCN #DFGN 0CUUGT   IGUVKHVGV 0CEJ  YWTFG FGT   1TFGPPKEJVOGJTXGTNKGJGPWPFIKNVCNUCWHIGJQDGP



1TFGP HÒT 9KUUGPUEJCHVGP WPF -ÒPUVG  /QFGNN UGKV    #WUHÒJTWPI OKVFGO9CRRGPFGT 8GTGKPKIVGP #TCDKUEJGP 4GRWDNKM KP FGT #ITCHHG  PCEJ   &GMQTCVKQP FGT  -NCUUG 5KNDGT   DTKNNCPVKGTV VGKNYGKUG XGTIQNFGV WPF GOCKNNKGTV CWH FGT 4ÒEMUGKVG *GTUVGNNGTDG\GKEJPWPI FGT (KTOC 6   $KEJC[KP-CKTQWPF-CKTQGT2WP\GHÒTGT5KNDGTCO*CNUDCPF\WUCOOGPOKV-PQRHNQEJTQUGVVGKO QTKIKPCNGP 8GTNGKJWPIUGVWK FGT (KTOC $KEJC[ OKV IQNFHCTDGPGO 9CRRGP FGT #TCDKUEJGP 4GRWDNKM   I[RVGP  /KV8GTNGKJWPIUWTMWPFGHÒT&T5XGP9KNUQPFCVKGTV-CKTQOKV2TGUUUKGIGN WPF 1TKIKPCNWPVGTUEJTKHV QDGP NKPMU  FGU ·I[RVKUEJGP 5VCCVURT·UKFGPVGP /WJCOOCF #PYCT CU5CFCV  

  WPF JCPFUEJTKHVNKEJGU ªDGTUGPFWPIUUEJTGKDGP FGU ·I[RVKUEJGP $QVUEJCHVGTU KP 5VQEMJQNO   FCVKGTVCO(GDTWCT\WUCOOGPKOQTKIKPCNGPªDGTUGPFWPIUEQWXGTV82'5 4+p++



4'27$.+-37#614+#.)7+0'# 

)TQ­GU2CVTKQVKUEJGU/KNKV·TMTGW\FGT4GRWDNKMSWCVQTKCN)WKPGC5KNDGTXGTIQNFGVWPFGOCKNNKGTV CWHFGT4ÒEMUGKVGRWP\KGTVCP0CFGNOKV5GKVGPJCMGP 4++ &KGUGUITQ­G$TWUVMTGW\YKTFCNNGKPGQJPGYGKVGTG+PUKIPKGPYKG*CNUQFGT$TWUVFGMQTCVKQPGPXGTNKGJGPWPFIGVTC IGP

320




ÄTHIOPIEN

8989 8988

-#+5'44'+%* $+5 

6*+12+'0



1TFGPXQO5KGIGN-ÌPKI5CNQOQU#WUICDGOKVGWTQR·KUEJGTJGTCNFKUEJGT-TQPG#WUHÒJTWPIOKVPKEJV GOCKNNKGTVGO -TGW\HGNF -QOOCPFGWTFGMQTCVKQP HTCP\ÌUKUEJG #PHGTVKIWPI 5KNDGT XGTIQNFGV CO   *CNUDCPF$9- ++





1TFGP FGU 5VGTPU XQP VJKQRKGP  /QFGNN -QOOCPFGWTUFGMQTCVKQP $TQP\G XGTIQNFGV WPF GOCKN   NKGTV CWH FGT 4ÒEMUGKVG *GTUVGNNGTDG\GKEJPWPI FGT (KTOC $ # 5GXCFLKCP KP #FFKU #DDGDC CO *CNU   DCPFCDUEJPKVV$9- ++



$GTGKVUXQP-ÌPKI/GPGNKM FGOUR·VGTGP-CKUGT/GPGNKM++ CNUHÒPHMNCUUKIGT8GTFKGPUVQTFGPOKVCHHKNKKGTVGT 8GTFKGPUVOGFCKNNG IGUVKHVGV YWTFG GT DKU  XGTNKGJGP &KG )GUVCNVWPI FGT +PUKIPKGP YCT Y·JTGPF FGT NCPIGP   8GTNGKJWPIU\GKVOGJTGTGPYGUGPVNKEJGPPFGTWPIGPWPVGTYQTHGP5VCVWCTKUEJYCTFKG#P\CJNFGT)TQ­MTGW\GCWH DGITGP\V

8990



8991 (1:1)

1TFGP FGU 5VGTPU XQP VJKQRKGP  /QFGNN 4KVVGTFGMQTCVKQP $TQP\G XGTIQNFGV CWH FGT 4ÒEMUGKVG   *GTUVGNNGTDG\GKEJPWPIFGT(KTOC/CRRKP9GDDKP.QPFQPCO$CPFOKV6TCIURCPIGKOQTKIKPCNGP 8GTNGKJWPIUGVWKXQP/CRRKP9GDD$9- ++



7PDGMCPPVGMCKUGTNKEJG&COGP&GMQTCVKQP#WUIGHÒJTVKP)QNFHKNKITCPCTDGKV&WTEJOGUUGTOO )QNFVGKNYGKUGITCXKGTV1P[ZICWHFGT4ÒEMUKVG$TQUEJKGTWPIWPF¤UG +p++



3WCNKV·VUXQNNGDTKVKUEJG#PHGTVKIWPI



321


AFGHANISTAN

8992

8993

#()*#0+56#0 '/+4#670&-¤0+)4'+%*   

1TFGPFGT5QPPG=0KUEJCPK#NOCT?/QFGNN OKVGKPHCEJGP5VCCVUYCRRGPWPFQJPGDGUQPFGTUCWU IGHÒJTVGU -NGKPQF  EC   1TFGPUMQNNCPG CHIJCPKUEJG #PHGTVKIWPI DGUVGJGPF CWU UKGDGP   FWTEJ FQRRGNTGKJKIG 5KNDGTMGVVGP OKVGKPCPFGT XGTDWPFGPG -GVVGPINKGFGT 5KNDGT DTKNNCPVKGTV OKV GEJV   IQNFGPGP/GFCKNNQPUOKVFGO5VCCVYCRRGP GKPGUIGNQEMGTV $9- 444++  8QP CNNGTITÌ­VGT 5GNVGPJGKV YCT FKGUG -QNNCPG CWEJ KP FGT DGFGWVGPFGP #HIJCPKUVCP5COONWPI 6COOCP KP $CUGN   PKEJVXQTJCPFGP

$—0+0 &#*1/';  4'27$.+-&#*1/';   

322

0CVKQPCNQTFGP XQP &CJQOG[ =1TFTG 0CVKQPCN FW &CJQOG[? -QOOCPFGWTFGMQTCVKQP 5KNDGT  RWP   \KGTVXGTIQNFGVWPFVGKNYGKUGGOCKNNKGTVCO*CNUDCPF\WUCOOGPOKV-PQRHNQEJTQUGVVGKO1TKIKPCNGVWK FGT(KTOC#TVJWU$GTVTCPFKP2CTKU4(5 ++




BRASILIEN

8995 (1:1)

8996 (1:1)

8994 (1:1)

-#+5'44'+%*   

$4#5+.+'0

%JTKUVWU1TFGP =1TFGO FG %JTKUVQ?   $TWUVUVGTP \WO )TQ­MTGW\ &WTEJOGUUGT  OO   HTCP\ÌUKUEJG#PHGTVKIWPI5KNDGTDTKNNCPVKGTVWPFHGKPUVTGRGTEKGTV#WHNCIGP)QNFGOCKNNKGTVCP0CFGN FKGUG OKV HTCP\ÌUKUEJGT )CTCPVKGRWP\G HÒT 5KNDGT 'DGTMQRH  UGKV   $9-  XIN 6# 5    0T 44++



%JTKUVWU1TFGP=1TFGOFG%JTKUVQ?  $TWUVUVGTP\WO-QOOCPFGWT&WTEJOGUUGTOO HTCP\ÌUKUEJG#PHGTVKIWPI5KNDGTDTKNNCPVKGTVWPFHGKPUVTGRGTEKGTV#WHNCIGP)QNFGOCKNNKGTVOKPMCWO UKEJVDCTG 'OCKNNGEJKRU KP FGT *GT\ ,GUWU&GMQTCVKQP CP 0CFGN FKGUG OKV HTCP\ÌUKUEJGT )CTCPVKGRWP\G   HÒT5KNDGT 'DGTMQRHUGKV $9-XCT 44++



W­GTUVSWCNKV·VUXQNNG#PHGTVKIWPIWOFKG/KVVGFGU,CJTJWPFGTVU&QO2GFTQ++JCVNCWV2QNKCPQ KP215  FCU)TQ­MTGW\FGU%JTKUVWU1TFGPUXQPDKUKPUIGUCOVPWTOCNXGTNKGJGPYQXQPPWT8GTNGKJWPIGP KPFKG,CJTG\YKUEJGPWPFHCNNGP  'U JCPFGNV UKEJ JKGTDGK GKPFGWVKI WPF \YGKHGNUHTGK WO GKPGP $TWUVUVGTP FGU DTCUKNKCPKUEJGP WPF PKEJV FGU   RQTVWIKGUKUEJGP %JTKUVWU1TFGPU FGWVNKEJ GTMGPPDCT CP FGT -QODKPCVKQP FGU CNU )NCP\MÌTRGT DG\GKEJPGVGP   5VGTPMQTRWUOKVFGOYGNNGPHÌTOKIGP/GFCKNNQPTKPIGDGPHCNNUUQDGUEJTKGDGPXQP6COOCPPWPF#WVGPITWDGTKP6#

50TWPF5H0T CNU\YGKHGNUHTGKDTCUKNKCPKUEJG1TFGPUKPUKPUKIPKGPKPKJTGP1TKIKPCNGVWKU  #NU ,QµQ 8+ -ÌPKI XQP 2QTVWICN $TCUKNKGP WPF FGT #NICTXG PCEJ L·JTKIGT *QHJCNVWPI KP 4KQFG,CPGKTQ PCEJ 2QTVWICN \WTÒEMMGJTVG UGV\VG GT UGKPGP 5QJP &QO 2GFTQ \WO 4GIGPVGP KP $TCUKNKGP GKP OKV FGO 4GEJV FKG   FTGK RQTVWIKGUKUEJGP 4KVVGTQTFGP %JTKUVWU 5V $GPVQ #XK\ WPF 5V ,CMQD XQO 5EJYGTV  FQTV \W XGTNGKJGP  GKP   4GEJVFCUGTUEJQPPCEJXKGT/QPCVGPYKFGTTKGH#O5GRVGODGTGTMN·TVG&QO2GFTQFKG7PCDJ·PIKIMGKV $TCUKNKGPUWPFNKG­UKEJMWT\FCTCWHCNU-CKUGTMTÌPGPPCEJFGOUEJQPXQTJGT.KUUCDQP6TWRRGP\WT8GTJKPFGTWPI FKGUGT'PVYKEMNWPIGPGPVUCPFVJCVVG $TCUKNKCPKUEJGT7PCDJ·PIKIMGKVUMTKGI 7PDGKTTVDGUV·VKIVG&QO2GFTQ+ FGP %JTKUVWU1TFGP CNU DTCUKNKCPKUEJGP 1TFGP &GT 5VTGKV \YKUEJGP 8CVGT WPF 5QJP PCJO JQEJRQNKVKUEJG   &KOGPUKQPGP CP FC FKG 2QTVWIKGUGP WO FGP 1TFGP KJT 0CVKQPCNU[ODQNHÒTEJVGVGP#WEJFGT6QF,QµQU8+FGT &QO 2GFTQ \WU·V\NKEJ \WO -ÌPKI XQP 2QTVWICN OCEJVG DTCEJVG MGKPG .ÌUWPI FC GT CNU UQNEJGT \WIWPUVGP UGKPGT   6QEJVGT CDFCPMVG &GT WO GKP 5EJKGFUIGTKEJV CPIGTWHGPG 2CRUV .GQ :++ DGUVKOOVG  FC­ GU HQTVCP \YGK   WPCDJ·PIKIG %JTKUVWU1TFGPOKV\YGK)TQ­OGKUVGTPI·DG#O#RTKNFCPMVG&QO2GFTQ+CNU-CKUGTXQP $TCUKNKGPCDYQOKVFGTDTCUKNKCPKUEJG<YGKIFGU%JTKUVWU1TFGPUGTNQUEJ9·JTGPFFGT4GIGPVUEJCHVHÒT FGP OKPFGTL·JTKIGP &QO 2GFTQ ++ YWTFGP RTCMVKUEJ MGKPG 1TFGP XGTNKGJGP #NUGTCNU,·JTKIGTCWHFGP6JTQP MCO PCJO GT FKG 8GTNGKJWPIGP YKGFGT CWH CWEJ FKG XQP FTGK PGWGP TGKP PCVKQPCNGP PKEJVTGNKIKÌUGP WPF   DÒTIGTNKEJGPOKNKV·TKUEJGP8GTFKGPUV1TFGPFKGCPFKGFTGKCNVGPRQTVWIKGUKUEJGP4KVVGTQTFGPHQTOCNCPMPÒRHVGP&KG PGWGP +PUKIPKGP WPF $·PFGT YWTFGP FWTEJ FKG 5VCVWVGP XQO  5GRVGODGT  HGUVIGNGIV 5KG GTNQUEJGP CO    0QXGODGTOKVFGT#DFCPMWPIFGU-CKUGTU



W­GTUVSWCNKV·VUXQNNG#PHGTVKIWPIWOFKG/KVVGFGU,CJTJWPFGTVU&QO2GFTQ++JCVNCWV2QNKCPQ KP215  FCU)TQ­MTGW\FGU%JTKUVWU1TFGPUXQPDKUKPUIGUCOVPWTOCNXGTNKGJGP



-CKUGTNKEJGT 4QUGP1TFGP =1TFGO +ORGTKCN FC 4QUC? $TWUVUVGTP \WO 1HHK\KGT 5VGTPMQTRWU 5KNDGT   DTKNNCPVKGTV WPF XGTIQNFGV #WHNCIGP )QNF GOCKNNKGTV CP 0CFGN KO QTKIKPCNGP TQVUCOVGPGP OKV /QPQ   ITCOO2GFTQU++ GVYCDGTKGDGP 8GTNGKJWPIUGVWK$9-82'5 +  2TCEJVGZGORNCTKPCDUQNWVGO$GUV\WUVCPF<WT)GUEJKEJVGFGU1TFGPUXGTINGKEJGCWEJ#NVOCPP(TGF&GT-CK UGTNKEJ$TCUKNKCPKUEJG1TFGPFGT4QUG+P1TFGP/KNKVCTKC/CIC\KP0T  5

323


BRASILIEN

8998 8997 (1:1)

8999

9000



-CKUGTNKEJGT 4QUGP1TFGP =1TFGO +ORGTKCN FC 4QUC? $TWUVUVGTP \WO 1HHK\KGT 5VGTPMQTRWU 5KNDGT   PKEJV DTKNNCPVKGTV WPF XGTIQNFGV #WHNCIGP )QNF GOCKNNKGTV GKPG 4QUG MCWO UKEJVDCT TGUVCWTKGTV GKPG   YGKVGTGOKVMCWOUKEJVDCTGT#DRNCV\WPIFGT/GFCKNNQPTKPITGUVCWTKGTVWPFOKV5KEJGTWPIUNCEMDGNGIVCP 0CFGN$9-82'5 ++ 



/GFCKNNGHÒTFGP(GNF\WIXQP7TWIWC[=/GFCNJCFC%CORCPJCFW7TWIWCK?#WUHÒJTWPI/G FCKNNG-NCUUG<KPPQJPG$CPF$9- 4++ #WHFGOGWTQR·KUEJGP/CTMVPKEJVJ·WHKI\WHKPFGP



(¤&'4#6+8'4'27$.+- 5'+6 

/CTKPG8GTFKGPUVQTFGP =1TFGO FQ /GTKVQ 0CXCN?  /QFGNN OKV TÒEMUGKVKIGO /GFCKNNQPVGZV   4'27$.+%#&15'56#&1570+&15&1$4#5+. 1HHK\KGTUMTGW\5KNDGTXGTIQNFGV WPFGOCKNNKGTVCO$CPFOKVCWHIGNGIVGT LGFQEJIGNÌUVGT 4QUGVVG$9- ++



/CTKPG8GTFKGPUVQTFGP =1TFGO FQ /GTKVQ 0CXCN?  /QFGNN OKV TÒEMUGKVKIGO /GFCKNNQPVGZV   $4#5+.UGKV 4KVVGTMTGW\$TQP\GXGTUKNDGTVWPFGOCKNNKGTVCO$CPF\WUCOOGPOKV/KPKCVWT $TQP\GXGTUKNDGTVWPFGOCKNNKGTVCO$·PFEJGP-PQRHNQEJTQUGVVGWPF7PHQTO$CPFUEJPCNNGKOQTKIKPC NGP8GTNGKJWPIUGVWK$9- +p++



)GUVKHVGVCO,WNKXQP2T·UKFGPV)GVÐNKQ8CTICUOKV&GMTGV0TJCVFGT1TFGPHÒPH-NCUUGP'TMCPP KP WPF CWUN·PFKUEJGP /CTKPGCPIGJÌTKIGP HÒT FGT DTCUKNKCPKUEJGP 4GRWDNKM IGNGKUVGVG &KGPUVG KP DGUQPFGTGP #WU   PCJOGH·NNGPCWEJCP<KXKNRGTUQPGPXGTNKGJGPYGTFGP





9001



8GTFKGPUVQTFGP FGT DGYCHHPGVGP 5VTGKVMT·HVG =1TFGO FQ /¾TKVQ FCU (QT¼CU #TOCFCU? )TQ­QHHK   \KGTUUGV DGUVGJGPF CWU )TQ­QHHK\KGTUMTGW\ $TQP\G XGTIQNFGV WPF GOCKNNKGTV CO *CNUDCPF WPF $TWUV   UVGTP 5KNDGT VGKNYGKUG XGTIQNFGV WPF GOCKNNKGTV CP 0CFGN \WUCOOGP OKV /KPKCVWT $TQP\G XGTIQNFGV   WPF GOCKNNKGTV CO $·PFEJGP OKV CWHIGNGIVGT 4QUGVVG (GNFURCPIG WPF 4GXGTUCD\GKEJGP KO QTKIKPCNGP   8GTNGKJWPIUGVWKFGT(KTOC,/CTVKPUKP4KQFG,CPGKTQ82'5 5VÒEM44++ 8GTNKGJGPCP)GPGTCN4KEECTFQ$KUQIPKGTQ IGD XQPDKU%JGHFGUKVCNKGPKUEJGP)GPGTCNUVCDGUFGT 8GTVGKFKIWPI&GTHÒPHMNCUUKIG/KNKV·T8GTFKGPUVQTFGPKUVOKV&GMTGV0TXQO#WIWUVFGU2T·UK FGPVGP IGUVKHVGV YQTFGP WPF YWTFG OKV &GMTGV 0T  XQO  ,WPK  FGU 2T·UKFGPVGP (GTPCPFQ *GPTKSWG   %CTFQUQKPFGP1TFGPHÒT8GTFKGPUVGWOFKG8GTVGKFKIWPIWOIGYCPFGNV

324




BURUNDI

9002



1TFGP XQP 4KQ $TCPEQ =1TFGO FG 4KQ $TCPEQ? )TQ­QHHK\KGTUUGV DGUVGJGPF CWU *CNUMTGW\ 5KNDGT   XGTIQNFGVWPFGOCKNNKGTVCO*CNUDCPFWPF$TWUVUVGTP5KNDGTVGKNYGKUGXGTIQNFGVWPFVGKNYGKUGGOCKN NKGTV CWH FGO 4GXGTU *GTUVGNNGTDG\GKEJPWPI FGT (KTOC * 5VGTP KP 4KQ FG ,CPGKTQ WPF 5KNDGTRWP\G   24#6#   CP 0CFGN \WUCOOGPOKV/KPKCVWT5KNDGTXGTIQNFGVWPFGOCKNNKGTVCO$·PFEJGPOKV CWHIGNGIVGT4QUGVVGWPF-PQRHNQEJTQUGVVGKO1TKIKPCNGVWKXQP*5VGTPOKVIQNFGPDGFTWEMVGO1TFGPU MTGW\ 5VÒEM++



&GT1TFGPYWTFGXQODTCUKNKCPKUEJGP5VCCVURT·UKFGPVGP,QCQ$GNEJKQT/CTSWGU)QWNCTV  OKV&GMTGV0T XQO(GDTWCTCNU1TFGPHÒT8GTFKGPUVGWOFKG#W­GPRQNKVKMFGU.CPFGUKPHÒPH-NCUUGPHÒT+PWPF #WUN·PFGTIGUVKHVGV1TFGPVNKEJG/KVINKGFGTOÒUUGPKOFKRNQOCVKUEJGP&KGPUVV·VKIUGKPCWUUGTQTFGPVNKEJG/KVINKGFGT JCDGP UQPUVKIG 8GTFKGPUVG WO FKG 0CVKQP &KG DGKFGP -CVGIQTKGPVTCIGPFKGINGKEJGP+PUKIPKGP&GTDTCUKNKCPKUEJG 2T·UKFGPVKUV)TQ­OGKUVGTFGU1TFGPUFGT#W­GPOKPKUVGTFGUUGP-CP\NGT&GT1TFGPGTHWJTOGJTHCEJPFGTWPIGP UQOKVFGP&GMTGVGP0TXQO#RTKNWPF0TXQO/·T\ 8INCWEJ/KPKUV¾TKQFG 4GNC¼ËGU 'ZVGTKQTGU  %GTKOQPKCN #PWCTKQ FC 1TFGO FG 4KQ$TCPEQ$TCUÃNKC7PF/KPKUV¾TKQFQ'Z¾TEKVQ /CFCNJÃUVKEC/KNKVCT$TCUKNGKTCQ1 

9004 9003

4'27$.+- 5'+6  

$7470&+

1TFGPFGT8ÌNMGTHTGWPFUEJCHV=1TFTGFGN #OKVK¾FGU2GWRNGU?-QOOCPFGWTMTGW\$TQP\GXGTIQN FGVWPFGOCKNNKGTVCOQTKIKPCNGP*CNUDCPF 4++



&GTXKGTMNCUUKIG )TQ­QHHK\KGT-QOOCPFGWT1HHK\KGTWPF4KVVGT 1TFGPYWTFGXQP2T·UKFGPV,GCP$CRVKUVG$CIC\C

IGD   OKV &GMTGV 0T  XQO  ,WPK  IGUVKHVGV WPF YKTF HÒT 8GTFKGPUVG WO FKG (ÌTFGTWPI FGT   /GPUEJGPTGEJVG FKG 'PVYKEMNWPI FGT PCVKQPCNGP 9KTVUEJCHV WPF FGU UQ\KCNGP (QTVUEJTKVV FGU 8QNMGU XQP $WTWPFK   XGTNKGJGP 'T MCPP CWEJ CP CWUN·PFKUEJG &KRNQOCVGP WPF /KVINKGFGT KPVGTPCVKQPCNGT 1TICPKUCVKQPGP HÒT 8GTFKGPUVG   WOFGP(TKGFGPWPFFKGINQDCNG'PVYKEMNWPIFGT9KTVUEJCHVWPFFGTUQ\KCNGP9QJNHCJTVXGTNKGJGPYGTFGP

4'27$.+-%*+.' 

/GFCKNNGō&GO8GTFKGPUVŋ=/GFCNNC#N/¾TKVQ?D\Y  1TFGPō&GO8GTFKGPUVŋ=1TFGP #N/¾TKVQ?D\Y UGKV %JKNGPKUEJGT1TFGPō&GO8GTFKGPUVŋ=1TFGP#N/¾TKVQFG%JKNG? /QFGNN UGKV   )TQ­MTGW\UGV DGUVGJGPF CWU -NGKPQF 5KNDGT XGTIQNFGV WPF VGKNYGKUG GOCKNNKGTV   $TQP\G XGTIQNFGV CO QTKIKPCNGP 5EJWNVGTDCPF WPF $TWUVUVGTP  #WUHÒJTWPI OKV MNGKPGTGP KO /G   FCKNNQPHGNF IGRT·IVGP 9CRRGP QJPG GOCKNNKGTVG (GFGTP  5KNDGT WPF $TQP\G XGTIQNFGV VGKNYGKUG GOCKN   NKGTV CP 0CFGN OKV \YGK 5GKVGPJCMGP \WUCOOGP OKV -PQRHNQEJTQUGVVG KO QTKIKPCNGP DTCWPGP 8GTNGK   JWPIUGVWK FGT (KTOC *QWTU KP 5CPVKCIQ FG %JKNG 8GTUEJNW­ DGUEJ·FKIV  OKV CWHIGNGIVGO OGVCNNGPGP   5VCCVUYCRRGP6#82'5 5VÒEM++

 325


REPUBLIK ELFENBEINKÜSTE

9006 9005



/GFCKNNGō&GO8GTFKGPUVŋ=/GFCNNC#N/¾TKVQ?D\Y  1TFGPō&GO8GTFKGPUVŋ=1TFGP #N/¾TKVQ?D\Y UGKV %JKNGPKUEJGT1TFGPō&GO8GTFKGPUVŋ=1TFGP#N/¾TKVQFG%JKNG? /QFGNN UGKV 1HHK\KGTUFGMQTCVKQP5KNDGTDNCWGOCKNNKGTVUVCTMIGFWPMGNVCO$CPFOKVCWHIGNGIVGT DGUEJ·FKIVGT4QUGVVG$9- ++p



&KGWPVGTGP-NCUUGPFKGUGU1TFGPU 1HHK\KGTWPF4KVVGT UKPFUGJTUGNVGPCWHFGOGWTQR·KUEJGP/CTMV\WHKPFGP



1TFGP XQP $GTPCTFQ 1 *KIIKPU =1TFGP FG $GTPCTFQ 1 *KIIKPU? )TQ­QHHK\KGTUUGV DGUVGJGPF CWU   )TQ­QHHK\KGTUFGMQTCVKQP 5KNDGT XGTIQNFGV WPF VGKNYGKUG GOCKNNKGTV CO QTKIKPCNGP *CNUDCPF WPF $TWUV   UVGTP5KNDGTXGTIQNFGVWPFVGKNYGKUGGOCKNNKGTVCP0CFGN82'5 5VÒEM++



&KG/GFCKNNG$GTPCTFQ1ʼn*KIIKPUYWTFGKP\YGK-NCUUGPCNU'TYGKVGTWPIFGU1TFGPU#N/¾TKVQHÒT.GKUVWPIGP XQP#WUN·PFGTPCWHFGO)GDKGVFGT-ÒPUVG9KUUGPUEJCHVGP'T\KGJWPI+PFWUVTKGFGU*CPFGNUWPFFGTJWOCPKV·TGP QFGT UQ\KCNGP <WUCOOGPCTDGKV IGUVKHVGV  YWTFG UKG WODGPCPPV KP 1TFGP XQP $GTPCTFQ 1ʼn*KIIKPU =1TFGP FG   $GTPCTFQ 1ʼn*KIIKPU? WPF CWH XKGT -NCUUGP )TQ­QHHK\KGT =)TCP 1HKEKCN? %QOOCPFGT =%QOGPFCFQT? 1HHK\KGT   =1HKEKCN?WPF4KVVGT=%CDCNNGTQ? GTYGKVGV&KGQDGTUVG-NCUUG)TQ­MTGW\=)TCP%TW\?YWTFGJKP\WIGHÒIV

9007 9008 Rv.

4'27$.+-'.('0$'+0-ª56' 



326

0CVKQPCNQTFGP =1TFTG0CVKQPCN?)TQ­QHHK\KGTUUGVDGUVGJGPFCWU)TQ­QHHK\KGTUMTGW\5KNDGTXGTIQNFGV WPFGOCKNNKGTVOKP4GRCTCVWTGPKPFGTITÒPGP'OCKNNGKO$CPFTKPIHTCP\ÌUKUEJG*GTUVGNNGTRWP\GCO QTKIKPCNGP*CNUDCPFWPF$TWUVUVGTP5KNDGTVGKNYGKUGXGTIQNFGVWPFGOCKNNKGTV4GRCTCVWTGPKPFGTTQVGP 'OCKNNGOKP*CCTTKUUGKPFGTYGK­GP'OCKNNGCP0CFGNFKGUGOKVHTCP\ÌUKUEJGT*GTUVGNNGTRWP\GOKV \YGK5GKVGPJCMGPKOQTKIKPCNGP8GTNGKJWPIUGVWK4(5 5VÒEM++



0CVKQPCNQTFGP=1TFTG0CVKQPCN?-QOOCPFGWTMTGW\5KNDGTXGTIQNFGVWPFGOCKNNKGTVOKP4GRCTCVWTGP KP FGT ITÒPGP 'OCKNNG KO 8GTDKPFWPIUUVÒEM \WT ¤UG WPF KO $CPFTKPI HTCP\ÌUKUEJG *GTUVGNNGT WPF   5KNDGTRWP\G  CO QTKIKPCNGP *CNUDCPF KO QTKIKPCNGP 8GTNGKJWPIUGVWK FGT (KTOC # %JQDKNNQP KP   2CTKU4(5 ++




INDIEN

9011 9009 9010





1TFGPFGTHÒPH8WNMCPG=1TFGPFGNQUEKPEQUXQNECPQU?)TQ­MTGW\UGVDGUVGJGPFCWU-NGKPQF5KNDGT XGTIQNFGV WPF GOCKNNKGTV CO QTKIKPCNGP 5EJWNVGTDCPF WPF $TWUVUVGTP 5KNDGT XGTIQNFGV WPF VGKNYGKUG   GOCKNNKGTVCP0CFGNOKV\YGK5GKVGPJCMGPKOQTKIKPCNGP8GTNGKJWPIUGVWK82'5 5VÒEM4++



3WGV\CN1TFGP =1TFGP FGN 3WGV\CN? -QOOCPFGWTUFGMQTCVKQP -QOOCPFGWTUFGMQTCVKQP 5KNDGT   XGTIQNFGVWPFGOCKNNKGTVHGKPUVG'OCKNNGOCNGTGKCOCNVGP1TKIKPCNJCNUDCPF\WUCOOGPOKV-PQRHNQEJ TQUGVVGKOQTKIKPCNGP8GTNGKJWPIUGVWKFGT(KTOC%TCXCP\QNCUWEE')CTFKPQKP4QOOKVIQNFHCTDKIGO 5VCCVUYCRRGP82'5 ++



1TFGPXQP,QU¾%GEKNKQFGN8CNNG=1TFGP,QU¾%GEKNKQFGN8CNNG?)TQ­MTGW\UGVDGUVGJGPFCWU-NGKPQF 5KNDGT XGTIQNFGV WPF GOCKNNKGTV CO QTKIKPCNGP 5EJWNVGTDCPF WPF $TWUVUVGTP 5KNDGT VGKNYGKUG XGTIQNFGV   WPFGOCKNNKGTVCP0CFGNFKGUGOKV*GTUVGNNGTRWP\GFGT(KTOC%GLCNXQKP/CFTKFWPF5KNDGTRWP\GPOKV \YGK5GKVGPJCMGP82'5 5VÒEM4+p++



#WHITWPF FGU MÌPKINKEJ KVCNKGPKUEJGP 9CRRGPU KO 'VWK N·­V UKEJ FKG #PHGTVKIWPIU\GKV FGU 'ZGORNCTU CWH DKU    DGITGP\GP+PCNNGP-NCUUGPUGJTUGNVGP\WHKPFGPFGT1TFGP7TURTÒPINKEJCWUFTGK-NCUUGPDGUVGJGPFYWTFGFGTPCEJ FGO0CVKQPCNXQIGNDGPCPPVGCNNIGOGKPG8GTFKGPUVQTFGPCO#RTKNXQP2T·UKFGPV,QTIG7DKEQIGUVKHVGVWPF CWHUGEJU-NCUUGPGTYGKVGTV1HHK\KGNNGT*GTUVGNNGTFGT+PUKIPKGPYCTHÒTXKGNG,CJTGFGTGJGOCNKIGMÌPKINKEJG *QHLWYGNKGT%TCXCP\QNC0CEJH')CTFKPQKP4QO



&GT1TFGPKUVCO1MVQDGT\WO)GDWTVUVCIFGUGTUVGP5VCCVURT·UKFGPVGPFGN8CNNGIGUVKHVGVYQTFGPWPF YKTFKPUKGDGP-NCUUGPXGTNKGJGP

9012

9013

+0&+'0 4'27$.+-(4ª*'4+0&+5%*'70+10 5'+6  

)TQ­G 1TFGPUUEJPCNNG OKV CEJV #WU\GKEJPWPIGP OKV FC\WIGJÌTKIGT $CPFUEJPCNNG   /GFCKNNG HÒT   DGUQPFGTGP'KPUCV\ 1RGTCVKQP8KLC[/GFCKNNG 5CKP[C5JGXC/GFCKNNG /GFCKNNGHÒT'KPUCV\KP ITQ­GT *ÌJG   8KFGUJ 5JGXC/GFCKNNG   /GFCKNNG \WO  ,CJTGUVCI FGT 7PCDJ·PIKIMGKV      /KNKV·T&KGPUVCWU\GKEJPWPIUOGFCKNNGHÒT,CJTG 8GTGKPVG0CVKQPGP70/16/GFCKNNGHÒTHTKGFGPU UVKHVGPFGP'KPUCV\KP6CFUEJKMKUVCPCP0CFGN 5VÒEM++





)TQ­G1TFGPUUEJPCNNGOKVUGEJU#WU\GKEJPWPIGP /GFCKNNGHÒTDGUQPFGTG'KPU·V\G 5CKP[C5GXC /GFCKNNG 8KFGUJ5GXC/GFCKNNG /GFCKNNG\WO,CJTGUVCIFGT7PCDJ·PIKIMGKV /GFCKNNGHÒT ,CJTG&KGPUVKPFGP5VTGKVMT·HVGP 8GTGKPVG0CVKQPGP70+(+./GFCKNNGHÒTFGP'KPUCV\KO.KDCPQP CP0CFGNP 5VÒEM++

 327


IRAK

+4#- 

-QPXQNWVXQPXGTUEJKGFGPGP<KXKNWPF/KNKV·T#WU\GKEJPWPIGPFGU-ÌPKITGKEJUWPFFGT4GRW DNKM $TQP\G VGKNU XGTIQNFGV VGKNU XGTUKNDGTV VGKNU GOCKNNKGTV QFGT NCEMKGTV CP $·PFGTP QFGT CP 6TCIG   URCPIGPKPFWTEJYGIQTFGPVNKEJGT'TJCNVWPI 5VÒEM++



9015 (1:1)

-#+5'44'+%*,#2#0 

1TFGPFGT#WHIGJGPFGP5QPPG=-[QMWLKVUWUJQ?5GVFGT-NCUUGD\Y UGKV FGU)TQ­-QTFQPU FGU1TFGPUFGT#WHIGJGPFGP5QPPG=-[QMWLKVUW&CKLWUJQ?DGUVGJGPFCWU-NGKPQF5KNDGTXGTIQNFGVWPF GOCKNNKGTV OKP 5RTWPI KP FGT 4GXGTUUGKVKIGP ITÒPGP 'OCKNNG FGT ªDGTJÌJWPI CO QTKIKPCNGP MQPHGM   VKQPKGTVGP 5EJWNVGTDCPF WPF $TWUVUVGTP 5KNDGT VGKNYGKUG XGTIQNFGV WPF GOCKNNKGTV CP &TGKHCEJ0CFGN   KO QTKIKPCNGP GVYCU TGRCTCTKGTVGP UEJYCT\NCEMKGTVGP 8GTNGKJWPIUGVWK OKV IQNFHCTDGPGP 5EJTKHV\GKEJGP   82'5 5VÒEM++  &GT1TFGPKUVCO#RTKNFWTEJFGP-CKUGTNKEJGP5VCCVUTCVWPVGT-CKUGT/GKLKVGPPQ /WVUWJKVQņ  OKV&GMTGV0TCNUGTUVGTFGTLCRCPKUEJGP1TFGPIGUVKHVGVYQTFGP'TYWTFGXQO<GKVRWPMVFGT5VKHVWPICPKP -NCUUGP XGTNKGJGP FKG CWEJ DGIKPPGPF OKV FGT  -NCUUG CNU )TQ­MTGW\UVWHG CNU UQNEJG DG\GKEJPGV YWTFGP &KG   +PUKIPKGP FKG DKU KP FKG )GIGPYCTV PCJG\W WPXGT·PFGTV XGTNKGJGP YGTFGP UKPF XQP FGO DGFGWVGPFGP %NQKUUQPP¾   -ÒPUVNGT*CTW[WMK*KTCVCWPFXQP5GKMKEJK5WIKOWTCIGUVCNVGVYQTFGP&WTEJ4GIKGTWPIUGPVUEJGKFYWTFGFKG 8GTNGKJWPIU·OVNKEJGTLCRCPKUEJGT1TFGP OKV#WUPCJOGFGU1TFGPHÒT8GTFKGPUVGWOFKG-WNVWT WPFFCOKVCWEJ FGU1TFGPUFGT#WHIGJGPFGP5QPPGCP,CRCPGTCWUIGUGV\V#WEJOKV#PPCJOGFGTPGWGP8GTHCUUWPIKO/CK DNKGDFKG8GTNGKJWPIXQP1TFGPCP+PN·PFGTDKUCWH9GKVGTGUUWURGPFKGTVCNNGTFKPIUYWTFGPWCKO<WUCOOGPJCPI OKVFGTPCVKQPCNGP(NWVMCVCUVTQRJGGKP\GNPG8GTNGKJWPIGPXQTIGPQOOGP'TUVCO,WNKYWTFGKPGKPGT 5KV\WPI FGU -CDKPGVVU FGU 2TGOKGTOKPKUVGTU +MGFC GPVUEJKGFGP IGPGTGNN FKG 8GTNGKJWPI XQP 1TFGP CP +PN·PFGT \W   .GD\GKVGPYKGFGT\WGTOÌINKEJGP&KGWPVGT-CKUGT*GKUGKVGPPQ #MKJKVQņIGD FWTEJIGHÒJTVG4GXKUKQP TGFW\KGTVFGP1TFGPCWHUGEJU5VWHGPYQDGKFKGDKUJGTKIGUKGDVGWPFCEJVG-NCUUGGTUCV\NQUIGUVTKEJGPYWTFGP&KG )GUVCNVWPI FGT +PUKIPKGP UGNDUV KUV PKEJV XGT·PFGTV YQTFGP #WEJ (TCWGP MÌPPGP LGV\V OKV FKGUGO 1TFGP DGNKGJGP   YGTFGP WPF GU KUV CP\WPGJOGP FC­ FKG +PUKIPKGP FGT DKUJGTKIGP \YGKVGP DKU UGEJUVGP -NCUUG KP FKGUGO (CNN CP   &COGPUEJNGKHGP·JPNKEJYKGDGKO1TFGPFGUIGJGKNKIVGP5EJCV\GU\WT8GTNGKJWPIIGNCPIGPYGTFGP

328


JAPAN

9016



1TFGPFGT#WHIGJGPFGP5QPPG=-[QMWLKVUWUJQ?5GV-NCUUGD\YFGT-NCUUGFGU)QNFGPGPWPF5KN DGTPGP5VGTPU=-[QMWLKVUW,WMQUJQ?DGUVGJGPFCWU*CNUFGMQTCVKQP5KNDGTXGTIQNFGVWPFGOCKNNKGTVOKP QDGTHN·EJNKEJGT'OCKNNGEJKRCWHFGT4ÒEMUGKVGFGU2CYNQYPKC$NCVVGUCO*CNUDCPFCDUEJPKVVWPF$TWUV UVGTP5KNDGTVGKNYGKUGXGTIQNFGVWPFGOCKNNKGTVCP0CFGNOKV\YGK5GKVGPJCMGP82'5  5VÒEM++



9019

9018 9017





1TFGP FGT #WHIGJGPFGP 5QPPG =-[QMWLKVUWUJQ? &GMQTCVKQP  -NCUUG D\Y FGT -NCUUG )QNFGPG   5VTCJNGPCO*CNUDCPF=-[QMWLKVUW%JWLWUJQ?5KNDGTXGTIQNFGVWPFGOCKNNKGTVCO*CNUDCPFCDUEJPKVVOKV /GVCNNUEJNKG­GP\WUCOOGPOKV-PQRHNQEJTQUGVVGKPUEJYCT\NCEMKGTVGO8GTNGKJWPIUGVWKOKVIQNFHCTDGPGP 5EJTKHV\GKEJGP82'5 ++



1TFGP FGU )GJGKNKIVGP 5EJCV\GU =<WKJQUJQ?  /QFGNN QJPG 2CWNQYPKC $NÒVG CNU ªDGTJÌJWPI       $TWUVUVGTP  -NCUUG 5KNDGT XGTIQNFGV WPF GOCKNNKGTV OGJTGTG OKP *CCTTKUUG 'OCKNNGTG   RCTCVWTGPWPF#DRNCV\WPIGPCP0CFGNOKV\YGK5GKVGPJCMGP82'5 ++p



(TÒJGUVCTMIGYÌNDVG#PHGTVKIWPICWUFGT<GKVFGUGTUVGP9GNVMTKGIGU+PFKGUGT-NCUUGYWTFGFGT1TFGPDKU QJPGYGKVGTG+PUKIPKGPYKG*CNUQFGT$TWUVFGMQTCVKQPXGTNKGJGPWPFIGVTCIGP  &GT1TFGPKUVCO,CPWCTFWTEJ-CKUGT/GKLKVGPPQ /WVUWJKVQņ OKV-CKUGTNKEJGO'FKMV0T IGUVKHVGV YQTFGP 'T YWTFG XQO <GKVRWPMV FGT 5VKHVWPI CP KP  -NCUUGP XGTNKGJGP FKG CWEJ DGIKPPGPF OKV FGT    -NCUUG CNU )TQ­MTGW\UVWHG CNU UQNEJG DG\GKEJPGV YWTFGP $GTGKVU CO  /CK  KUV FGT 1TFGP FWTEJ   MCKUGTNKEJGU'FKMVCWEJHÒT(TCWGP\WI·PINKEJIGOCEJVYQTFGP&GPPQEJUKPFUGKVJGTPWTYGPKIG8GTNGKJWPIGPCP (TCWGP KPUDGUQPFGTG KP FGP JÌJGTGP -NCUUGP XQTIGPQOOGP YWTFGP &WTEJ 4GIKGTWPIUGPVUEJGKF YWTFG  FKG   8GTNGKJWPIU·OVNKEJGTLCRCPKUEJGT1TFGP OKV#WUPCJOGFGU1TFGPHÒT8GTFKGPUVGWOFKG-WNVWT WPFFCOKVCWEJ FGU1TFGPUFGU)GJGKNKIVGP5EJCV\GUCP,CRCPGTCWUIGUGV\V#WEJOKV#PPCJOGFGTPGWGP8GTHCUUWPIKO/CK DNKGDFKG8GTNGKJWPIXQP1TFGPCP+PN·PFGTDKUCWH9GKVGTGUUWURGPFKGTVCNNGTFKPIUYWTFGPWCKO<WUCOOGPJCPI OKVFGTPCVKQPCNGP(NWVMCVCUVTQRJGGKP\GNPG8GTNGKJWPIGPXQTIGPQOOGP'TUVCO,WNKYWTFGKPGKPGT 5KV\WPI FGU -CDKPGVVU FGU 2TGOKGTOKPKUVGTU +MGFC GPVUEJKGFGP IGPGTGNN FKG 8GTNGKJWPI XQP 1TFGP CP +PN·PFGT \W   .GD\GKVGPYKGFGT\WGTOÌINKEJGP&KGWPVGT-CKUGT*GKUGKVGPPQ #MKJKVQņIGD FWTEJIGHÒJTVG4GXKUKQP XGT·PFGTVG \WP·EJUV FKG ·W­GTG 'TUEJGKPWPIUHQTO FGU -NGKPQFU FGO CNU ªDGTJÌJWPI ·JPNKEJ FGO 1TFGP FGT   #WHIGJGPFGP5QPPGGKPYGK­WPFTQVGOCKNNKGTVGU2CWNQYPKC$NCVVOKV$NÒVGPUV·PFGPDGKIGHÒIVYWTFGYKGCWEJFCU 1TFGPUDCPF FGUUGP )TWPFHCTDG XQP NGKEJVGO JKOOGNDNCW YGK­ KP KPVGPUKXGU JGNNDNCW IG·PFGTV YWTFG &CTÒDGT   JKPCWU YWTFG FGT 1TFGP FWTEJ GTUCV\NQUG 5VTGKEJWPI FGT DKUJGTKIGP UKGDVGP WPF CEJVGP -NCUUG CWH UGEJU 5VWHGP   TGFW\KGTV



1TFGPFGU)GJGKNKIVGP5EJCV\GU=<WKJQUJQ?/QFGNN QJPG2CWNQYPKC$NÒVGCNUªDGTJÌJWPI  $TWUVUVGTP-NCUUG5KNDGTXGTIQNFGVWPFGOCKNNKGTVGKPKIGMCWOUKEJVDCTG*CCTTKUUGCP0CFGN OKV\YGK5GKVGPJCMGP82'5 ++

 329


JAPAN

9021

9020





1TFGP FGU )GJGKNKIVGP 5EJCV\GU =<WKJQUJQ?  /QFGNN QJPG 2CWNQYPKC $NÒVG CNU ªDGTJÌJWPI       &GMQTCVKQP  -NCUUG 5KNDGT XGTIQNFGV WPF GOCKNNKGTV OKP 'OCKNNGTGRCTCVWT CO QTKIK   PCNGP*CNUDCPF82'5 ++



1TFGP FGU )GJGKNKIVGP 5EJCV\GU =<WKJQUJQ?  /QFGNN QJPG 2CWNQYPKC $NÒVG CNU ªDGTJÌJWPI      &GMQTCVKQP-NCUUG5KNDGTGOCKNNKGTVMCWOUKEJVDCTG4GRCTCVWTKPFGTTQVGP'OCKNNGCO QTKIKPCNGP &TGKGEMUDCPF LCRCPKUEJGT 0·JCTV KO CNVGP OKP DGUEJ·FKIVGP .CEMGVWK OKV IQNFHCTDGPGP   GVYCUXGTDNCUUVGP5EJTKHV\GKEJGPQJPG'KPNCIG82'5 ++p



9022



9024 9023

1TFGT FGT )QNFGPGP 9GKJG =-KPUJK -WPUJQ? &GMQTCVKQP  -NCUUG 5KNDGT VGKNYGKUG XGTIQNFGV WPF   GOCKNNKGTV 5RTÒPIG WPF OKP #DRNCV\WPIGP KP FGT TQVGP WPF OKP #DRNCV\WPIGP KP FGT JGNNDNCWGP WPF   DTCWPGP'OCKNNGFGU)ÒTVGNUCOCNVGPLGFQEJPKEJVLCRCPKUEJGP$CPF82'5 4++p+++



&GT 1TFGP KUV CO  (GDTWCT  CWU #PNC­ FGT  ,CJTHGKGT FGT )TÒPFWPI FGT -CKUGTNKEJGP &[PCUVKG FWTEJ   -CKUGT,KOOWVGPPQXQP-CKUGT/GKLKVGPPQ /WVUWJKVQņ OKV-CKUGTNKEJGO4GUMTKRVIGUVKHVGVYQTFGP'T YWTFGXQO<GKVRWPMVFGT5VKHVWPICPKP-NCUUGPXGTNKGJGPFKGCWEJDGIKPPGPFOKVFGT-NCUUGCNU)TQ­MTGW\ UVWHGCNUUQNEJGDG\GKEJPGVYWTFGP/KVMCKUGTNKEJGO'FKMV0TXGTQTFPGVG-CKUGT*KTQJKVQCO5GRVGODGT FC­CNNG5VWHGPCWEJOGJTHCEJCPGKPWPFFKGUGNDG2GTUQPXGTNKGJGPYGTFGPMQPPVG/KV1TFQPCP\0TFGT 4GIKGTWPIYWTFGFGT1TFGPCDIGUEJCHHV



1TFGT FGT )QNFGPGP 9GKJG =-KPUJK -WPUJQ? &GMQTCVKQP  -NCUUG 5KNDGT VGKNYGKUG XGTIQNFGV CO   1TKIKPCNDCPFKPLCRCPKUEJGT0·JCTV82'5 ++





8GTFKGPUVOGFCKNNG/GFCKNNGCO&WPMNGP/CTKPGDNCWGP$CPF=-QPLWJQUJQ? HÒTRJKNCPVJTQRKUEJG8GT FKGPUVG  GTUVGU /QFGNN  D\Y     5KNDGT OKV $CPFURCPIG OKVITCXKGTVGO8GTNGKJWPIU FCVWO CO FWPMGNDNCWGP $CPF LCRCPKUEJGT 0·JCTV \WUCOOGP OKV 4GXGTUUEJNGKHG KO QTKIKPCNGP IQNF   DG\GKEJPGVGPUEJYCT\GP.CEMGVWK ++



+P 'WTQRC PWT UGJT UGNVGP \W HKPFGP  &KG 8GTFKGPUVOGFCKNNG YWTFG WPVGT -CKUGT /GKLKVGPPQ /WVUWJKVQ ņ      OKV &GMTGV 0T  FGU 5VCCVUTCVGU XQO  &G\GODGT  IGUVKHVGV <WP·EJUV YWTFGP PWT FKG /GFCKNNG CO   4QVGP $CPF =-QLWJQUJQ? HÒT .GDGPUTGVVWPI CO ITÒPGP $CPF =4[QMWLWJQUJQ? HÒT CWHQRHGTWPIUXQNNG #NVGPRHNGIG   NCPIGWPFVTGWG&KGPUVGXQP&KGPUVDQVGPWPFNCPIL·JTKIG#TDGKVGTWPFCODNCWGP$CPF=4CPLWJQUJQ?HÒT8GTFKGPUVG KP 'T\KGJWPI WPF 7PVGTTKEJV WO FKG ÌHHGPVNKEJG 9QJNHCJTV WUY XGTNKGJGP /KV -CKUGTNKEJGO 'FKMV 0T XQO  5GRVGODGT  UVKHVGVG -CKUGT 6CKUJQVGPPQ ;QUJKJKVQ ņ   FKG 8GTFKGPUVOGFCKNNG CO FWPMGNDNCWGP   $CPF =-QPLWJQUJQ? HÒT RJKNCPVJTQRKUEJG 8GTFKGPUVG +P FGT WPVGT -CKUGT *GKUGKVGPPQ #MKJKVQ ņ IGD      FWTEJIGHÒJTVGP4GXKUKQPGTJKGNVFKG/GFCKNNGGKPGPGWG)GUVCNVWPI

330


JORDANIEN

ex 9025

,14&#0+'0 

'/+4#664#05,14&#0+'0  70&*#5%*'/+6+5%*'5-¤0+)  4'+%*,14&#0+'0 5'+6 

7PCDJ·PIKIMGKVU1TFGP =9KUCO CN 1TFCPKC CN +UVKSNCN?  /QFGNN )TQ­MQTFQPUGV DGUVGJGPF CWU   -NGKPQF $TQP\G VGKNYGKUG XGTUKNDGTV VGKNYGKUG XGTIQNFGV WPF GOCKNNKGTV CO 5EJWNVGTDCPF WPF $TWUV   UVGTP $TQP\G DTKNNCPVKGTV VGKNYGKUG XGTUKNDGTV VGKNYGKUG XGTIQNFGV WPF GOCKNNKGTV CP 0CFGN \WUCOOGP   OKV/KPKCVWTVGKNYGKUGXGTUKNDGTVVGKNYGKUGXGTIQNFGVWPFGOCKNNKGTVCO$·PFEJGPOKVCWHIGNGIVGT.KV\G WPF 4QUGVVG KO QTKIKPCNGP IQNFGP DGFTWEMVGP 8GTNGKJWPIUGVWK FGT (KTOC *WI¾PKP (T½TGU KP .G .QENG   82'5 5VÒEM++



8GTNKGJGPCP)GPGTCN4KEECTFQ$KUQIPKGTQ IGD XQPDKU%JGHFGUKVCNKGPKUEJGP)GPGTCNUVCDGUFGT 8GTVGKFKIWPI

9026 9027 Rv.



9028

7PCDJ·PIKIMGKVU1TFGP=9KUCOCN1TFCPKCCN+UVKSNCN?/QFGNN5GVFGT-NCUUGDGUVGJGPFCWU &GMQTCVKQPFGT-NCUUG5KNDGTVGKNYGKUGXGTIQNFGVWPFGOCKNNKGTVCWHFGT4ÒEMUGKVGDTKVKUEJIGRWP\V CO *CNUDCPF WPF $TWUVUVGTP 5KNDGT VGKNYGKUG XGTIQNFGV WPFGOCKNNKGTVCWHFGT4ÒEMUGKVGDTKVKUEJIG RWP\V CP 0CFGN \WUCOOGP \YGK -PQRHNQEJTQUGVVGP KO 8GTNGKJWPIUGVWK FGT (KTOC )CTTCTF  %Q KP   .QPFQP82'5 5VÒEM+p++



-#/$1&5%*# -¤0+)4'+%*706'4(4#0<¤5+5%*'/2416'-614#6   

8GTFKGPUVOGFCKNNG FGU -ÌPKITGKEJU  /QFGNN OKV FGO 0COGP -ÌPKI 0QTQFQOU +  XGTNKGJGP DKU    )QNFGPG/GFCKNNG5KNDGTXGTIQNFGVCO$CPF ++





8GTFKGPUVOGFCKNNG FGU -ÌPKITGKEJU  /QFGNN OKV FGO 0COGP -ÌPKI 5KUQYCVJU +      )QNFGPG/GFCKNNG5KNDGTXGTIQNFGVCO$CPF&C\W/QFGNN OKVFGO0COGPXQP-ÌPKI0QTQFQO 5WTCOCTKV $TQP\GOGFCKNNGQJPGªDGTJÌJWPIWPFQJPG$CPF ++

 331


REPUBLIK KOLUMBIEN

9029

9030

4'27$.+--1.7/$+'0 

/CTKPG8GTFKGPUVQTFGP #FOKTCN 2CFKNNC =1TFGP 0CXCN #NOKTCPVG 2CFKNNC? 1HHK\KGTUFGMQTCVKQP   5KNDGTXGTIQNFGVWPFVGKNYGKUGGOCKNNKGTVCWHFGT4ÒEMUGKVGFGT6TCIGCITCHHG*GTUVGNNGTDG\GKEJPWPIFGT (KTOC*WIW¾PKP(T½TGUKP.G.QENG 5EJYGK\ CO1TKIKPCNDCPF82'5 ++



&GT UGEJUMNCUUKIG OKNKV·TKUEJG /CTKPGXGTFKGPUVQTFGP YWTFG  IGUVKHVGV WPF PCEJ ,QU¾ 2TWFGPEKQ 2CFKNNC     FGOGTUVGP#FOKTCNXQP)TQ­-QNWODKGPDGPCPPV+PCNNGP-NCUUGPUGJTUGNVGP



'JTGPMTGW\HÒTFKG'JTGPICTFGFGU$GHTGKGTU5KOÉP$QNÃXCTCWU#PNC­UGKPGU'KPJWPFGTVUVGP6Q FGULCJTGU5KNDGTGOCKNNKGTVCOQTKIKPCNGP$CPF ++



)GPGTCN5KOÉP$QNÃXCT  UÒFCOGTKMCPKUEJGT7PCDJ·PIKIMGKVUM·ORHGTWPFGTUVGT2T·UKFGPVFGT4GRWDNKM )TQ­MQNWODKGP UVCTD CO  &G\GODGT  KP 5CPVC /CTVC CP FGT MQNWODKCPKUEJGP -ÒUVG 0CEJ UGKPGO 6QF   YWTFGFQTVGKPGITQ­G)GFGPMUV·VVG\W'JTGPFGU.KDGTVCFQTUGTTKEJVGVKPFGTUV·PFKIGKPGOKNKV·TKUEJG'JTGPYCEJG CPYGUGPF KUV #WU #PNC­ FGU  6QFGUVCIGU $QNÃXCTU YWTFG HÒT FKG Y·JTGPF FGU ,WDKN·WOU FKGPUVVWGPFG 9CEJ   OCPPUEJCHVFKGUGU'JTGPMTGW\IGUVKHVGV

9032 9031

-10)1 

&'/1-4#6+5%*'4'27$.+- 70&5'+6 

0CVKQPCNQTFGP FGU .GQRCTFGP =1TFTG 0CVKQPCN FW .¾QRCTF? 4KVVGTFGMQTCVKQP XGTUKNDGTV WPF GOCKN   NKGTVCO$CPF4(5 ++

4'27$.+- 5ª&  5'+6  

-14'#

1TFGPHÒT8GTFKGPUVGWOFKG0CVKQPCNG5KEJGTJGKV5GVFGT-NCUUG5KNDGTXGTIQNFGVWPFGOCKNNKGTV COQTKIKPCNGP5EJWNVGTDCPFWPF$TWUVUVGTP5KNDGTXGTIQNFGVWPFGOCKNNKGTVCP0CFGNKO1TKIKPCNGVWK 82'5 5VÒEM++ 8GTNKGJGPCP)GPGTCN4KEECTFQ$KUQIPKGTQ IGD XQPDKU%JGHFGUKVCNKGPKUEJGP)GPGTCNUVCDGUFGT 8GTVGKFKIWPI

332






KUBA

9035

9033

9034

-7$#

$ª4)'4.+%*' 4'27$.+- $+5  

/KNKV·T8GTFKGPUVQTFGP =1TFGP FGN /GTKVQ /KNKVCT? -CVGIQTKG HÒT DGUQPFGTG 8GTFKGPUVG OKV ITÒPGT   'OCKNNG WPF ITÒPGO $CPF  -TGW\  -NCUUG $TQP\G XGTIQNFGV WPF VGKNYGKUG GOCKNNKGTV CO $CPF   $9-G ++



&GT XKGTMNCUUKIG 1TFGP HÒT /KNKV·TXGTFKGPUV KP *GGT WPF /CTKPG CNU  #DVGKNWPIGP FGU 1TFGPU  YWTFG CO    (GDTWCTXQO-WDCPKUEJGP2T·UKFGPVGP,QU¾/KIWGN)ÉOG\IGUVKHVGVWPFKPUKGDGP-CVGIQTKGPHÒTFCU*GGTWPF UGEJU-CVGIQTKGPHÒTFKG/CTKPGFKGUKEJLGYGKNUFWTEJFKG(CTDGFGT'OCKNNGWPFFGU$CPFGUWPVGTUEJKGFGPXGTNKG JGP'UICDFKG-CVGIQTKGPHÒT/KNKV·TXGTFKGPUV TQVHÒTFKG/CTKPGFWPMGNDNCW HÒTJWOCPKV·TG*CPFNWPIGP DGKFG TQVYGK­  HÒT IWVG (ÒJTWPI DGKFG DNCW  HÒT CWHHCNNGPFG 8GTFKGPUVG DGKFG DNCWYGK­  HÒT DGUQPFGTG 8GTFKGPUVG  

DGKFGITÒP HÒTCPFGTG8GTFKGPUVG DGKFGYGK­ WPFPWTHÒTFCU*GGTHÒT6CRHGTMGKVKO)GHGEJV RWTRWTP +P (QNIGFGT-WDCPKUEJGP4GXQNWVKQPXQPYWTFGFKG8GTNGKJWPIFGU1TFGPUGKPIGUVGNNV

.#15 -¤0+)4'+%*706'4(4#0<¤5+5%*'/2416'-614#6   

-ÌPKINKEJGT1TFGPFGT/KNNKQP'NGRJCPVGPWPFFGU9GK­GP5QPPGPUEJKTOU=1TFTGTQ[CNFW/KNNKQP F 'N¾RJCPVUGVFW2CTCUQN?/QFGNN OGJTMNCUUKI 4KVVGTFGMQTCVKQP$TQP\GXGTIQNFGV -TQPGUGRCTCVCWHIGNGIVGOCKNNKGTVCO$CPF82'5 ++



&GT\WP·EJUVGKPMNCUUKIG1TFGPYWTFGOKVMÌPKINKEJGO&GMTGVXQO/CKXQP-ÌPKI5KUCXCPI8QPI   IGUVKHVGVWPFOKVMÌPKINKEJGO&GMTGVXQO0QXGODGTCWHHÒPH-NCUUGPGTYGKVGTV/KVFGT#DFCPMWPI XQP-ÌPKI5CXCPI8CVVJCPC  CO&G\GODGTWPFFGT'TTKEJVWPIFGT&GOQMTCVKUEJGP8QNMUTGRW DNKM.CQUGTNKUEJVCWEJFGT1TFGP

.+$#010 .+$#0'5+5%*'4'27$.+- 5'+6  

0CVKQPCNGT <GFGTP1TFGP =1TFTG 0CVKQPCN FW %¾FTG?  /QFGNN OKV NKDCPGUKUEJGT (CJPG CWH FGT   4ÒEMUGKVG FGT &GMQTCVKQPGP  UGKV   )TQ­MQTFQP5GV DGUVGJGPF CWU -NGKPQF 5KNDGT VGKNYGKUG   XGTIQNFGV WPF GOCKNNKGTV GT 5KNDGT WPF *GTUVGNNGTRWP\G FGT (KTOC #TVJWU $GTVTCPF KP 2CTKU KO   $CPFTKPICOQTKIKPCNGP5EJWNVGTDCPFWPF$TWUVUVGTP5KNDGTVGKNYGKUGXGTIQNFGVCP0CFGNOKVGT 5KNDGT WPF *GTUVGNNGTRWP\G FGT (KTOC #TVJWU $GTVTCPF OKV \YGK 5GKVGPJCMGP \WUCOOGP OKV   -PQRHNQEJTQUGVVG KO 1TKIKPCNGVWK FGT (KTOC #TVJWU $GTVTCPF OKV IQNFHCTDGPGO 5VCCVUGODNGO   82'5 5VÒEM+p++



&GT FWTEJ .GIKUNCVKX&GMTGV XQO  &G\GODGT  XQO 2T·UKFGPVGP FGT .KDCPGUKUEJGP 4GRWDNKM —OKNG 'FF¾  

  CNU WTURTÒPINKEJGKPMNCUUKIIGUVKHVGVGCNNIGOGKPG8GTFKGPUVQTFGPYWTFGCO,WPKKPGKPGPHÒPH MNCUUKIGP 1TFGP )TQ­MTQFQP )TQ­QHHK\KGT -QOOCPFGWT 1HHK\KGT WPF 4KVVGT  WOUVTWMVWTKGTV WPF GTPGWV CP    ,CPWCTXGT·PFGTV /QFGNN 0CEJFGOFKGKO0QXGODGTHCMVKUEJWPCDJ·PIKIIGYQTFGPG.KDCPGUKUEJG 4GRWDNKM CWEJ GKPG PGWG 5VCCVUHNCIIG CPIGPQOOGP JCVVG YWTFG FKGUG CWEJ CWH FGT 4ÒEMUGKVG FGT 1TFGPU\GKEJGPU   CPUVGNNGFGTDKUJGTKIGPHTCP\ÌUKUEJGP6TKMQNQTGOKVFGT<GFGTKOYGK­GP(GNFCPIGDTCEJV /QFGNN /KV.GIKUNC VKX&GMTGV 0T  XQO  ,WPK  GTPGWGTVG 5VCCVURT·UKFGPV (QWCF %J¾JCD   FGP 1TFGP FGT CP   NKDCPGUKUEJG WPF CWUN·PFKUEJG /·PPGT WPF (TCWGP HÒT DGUQPFGTG 8GTFKGPUVG WO FGP .KDCPQP HÒT JGNFGPJCHVG WPF   OWVKIG6CVGPWPFHÒTNCPIGWPFVTGWG&KGPUVGHÒTFGP5VCCVXGTNKGJGPMCPP9KEJVKIKUVCP\WOGTMGPFC­FKG)TQ­ MQTFQP-NCUUG WPF FKG 5QPFGTMNCUUG HÒT 5VCCVUQDGTJ·WRVGT FGT 'JTGPOGFCKNNG HÒT 8GTFKGPUVG WO FGP .KDCPQP  

/¾FCKNNG FW /¾TKVG .KDCPCKU  D\Y FGU 1TFGPU HÒT 8GTFKGPUVG WO FGP .KDCPQP 1TFTG FW /¾TKVG .KDCPCKU  ņ CD   ņH·NUEJNKEJGTYGKUGQHVCNUō<GFGTPQTFGPŋDG\GKEJPGVYWTFGPWPFYGTFGP

333


KAISERREICH MANCHUKUO

9037

9040

9036 9039

9041 (1:1)



9038

0CVKQPCNGT <GFGTP1TFGP =1TFTG 0CVKQPCN FW %¾FTG?  /QFGNN OKV NKDCPGUKUEJGT (CJPG CWH FGT   4ÒEMUGKVG FGT &GMQTCVKQPGP  UGKV 1HHK\KGTUFGMQTCVKQP5KNDGTVGKNYGKUGXGTIQNFGVWPFGOCKNNKGTV CO QTKIKPCNGP $CPF OKV CWHIGNGIVGT 4QUGVVG \WUCOOGP OKV -PQRHNQEJTQUGVVG KO QTKIKPCNGP 8GTNGK   JWPIUGVWKFGT(KTOC*WIWGPKPKP.G.QENGOKVIQNFHCTDGPGO5VCCVUGODNGO82'5 ++



-#+5'44'+%*/#0%*7-71 

8GTFKGPUVOGFCKNNGFGT)TÒPFWPIFGT0CVKQP$TQP\GVGKNYGKUGXGTUKNDGTVWPFNCEMKGTVCOQTKIKPCNGP $CPFLCRCPKUEJGT0·JCTV2'6 ++



/#41--1 (4#0<¤5+5%*'52416'-614#6 

#NCQWKVG %J¾TKHKGP1TFGP =1WKUUCO #NCQWKVG %J¾TKHKGP?  /QFGNN OKV 5EJTKHV\GKEJGP CWH FGP   5VTCJNGP    -QOOCPFGWTFGMQTCVKQP 5KNDGTXGTIQNFGVWPFGOCKNNKGTVKO*CNUDCPFTKPIHTCP \ÌUKUEJG*GTUVGNNGTRWP\GWPFHTCP\ÌUKUEJG)CTCPVKGRWP\GHÒT5KNDGT 'DGTMQRHUGKV COQTKIKPC NGP*CNUDCPF82'5 44++



#NU-QOOCPFGWTFGMQTCVKQPUGNVGPKPFGTPWT,CJTGNCPIXGTNKGJGPGP#WUHÒJTWPI





#NCQWKVG %J¾TKHKGP1TFGP =1WKUUCO #NCQWKVG %J¾TKHKGP?  /QFGNN OKV 5EJTKHV\GKEJGP CWH FGP   5VTCJNGP    4KVVGTFGMQTCVKQP 5KNDGT XGTIQNFGV WPF GOCKNNKGTV KP FGT 6TCIGÌUG HTCP\ÌUKUEJG   *GTUVGNNGTRWP\GWPFHTCP\ÌUKUEJG)CTCPVKGRWP\GHÒT5KNDGT 'DGTMQRHUGKV COQTKIKPCNGP$CPF 82'5 ++



5JGTKHKUEJGT /KNKV·T8GTFKGPUVQTFGP =1TFTG FW /¾TKVG /KNKVCKTG %J¾TKHKGP?  /QFGNN CWH FGT   4ÒEMUGKVG \YGK\GKNKIG CTCDKUEJG +PUEJTKHV    5KNDGT VGKNYGKUG XGTIQNFGV WPF GOCKNNKGTV CO   QTKIKPCNGP$CPF82'5 ++



&GT GKPMNCUUKIG 1TFGP YWTFG OKV &CJKT XQO  #WIWUV  XQP 5WNVCP /QWNC[ #DF CN*CHKF   XQP   /CTQMMQIGUVKHVGV/KV&CJKTXQO&G\GODGTGTNKG­UGKP0CEJHQNIGT5WNVCP/QWNC[;QWUUGH   FKG5VCVWVGPFKGFGTHTCP\ÌUKUEJG)GPGTCN4GUKFGPVKP/CTQMMQOKV&GMTGVXQO/CKKP-TCHVUGV\VG&GT 1TFGP FGT CNU JÌEJUVG OKNKV·TKUEJG #WU\GKEJPWPI /CTQMMQU ICNV MQPPVG UQYQJN CP #PIGJÌTKIG FGU OCTQMMCPK   UEJGP YKG CWEJ FGU HTCP\ÌUKUEJGP /KNKV·TU XGTNKGJGP YGTFGP 0CEJ FGT 'TNCPIWPI FGT 7PCDJ·PIKIMGKV WPF FGT   )TÒPFWPIFGU-ÌPKITGKEJU/CTQMMQYWTFGFGT1TFGPFWTEJGKPGPPGWGPOGJTMNCUUKIGP#N#UMCTK1TFGPHÒT /KNKV·TXGTFKGPUV=1WKUUCO#N#UMCTK?GTUGV\V

/10)1.'+ /10)1.+5%*'81.-54'27$.+-



5WEJG$CVQT1TFGP  #WUHÒJTWPI OKV 5EJTCWDG  5KNDGT )QNF 2NCVKP VGKNYGKUG GOCKNNKGTV  I   CWHFGO4GXGTU6T·IGTPWOOGTCP5EJTCWDGOKV5EJTCWDUEJGKDG*(/ ++ 



-QPXQNWV XQP  <KXKN WPF /KNKV·T#WU\GKEJPWPIGP &CTWPVGT 'JTGPOGFCKNNG HÒT 8GTFKGPUVG KO   -CORH OKV 0T  1TFGP FGU /WVVGTTWJOU  -N  5V  FKXGTUG ,WDKN·WOUOGFCKNNGP 8GTUEJKG   FGPG/GVCNNGCWEJ5KNDGTVGKNUGOCKNNKGTVQFGTNCEMKGTVCP6TCIGURCPIGPQFGTCP5EJTCWDGOKV5EJTCWD UEJGKDGKPFWTEJYGIQTFGPVNKEJGT'TJCNVWPI 5VÒEM++

334




NEPAL

9044 9043



-¤0+)4'+%* $+5 

9045

0'2#.

&GT UGJT 'TJCDGPG 1TFGP FGT FTGK )ÌVVNKEJGP )GYCNVGP =6TKUJCMVK 2CVVC? 5GV FGT  -NCUUG   =,[QVKTOC[C 5WXKMJ[CVC 6TKUJCMVK2CVVC? LÒPIGTG PGRCNGUKUEJG #WUHÒJTWPI QJPG 5VGKPG KO /GFCKNNQP   DGUVGJGPFCWU-NGKPQF5KNDGTGOCKNNKGTVWPF$TWUVUVGTP5KNDGTVGKNYGKUGXGTIQNFGVWPFGOCKNNKGTVCP 0CFGN 5VÒEM++



&GT HÒPHMNCUUKIG CNNIGOGKPG 8GTFKGPUVQTFGP OKV CHHKNKKGTVGT /GFCKNNG YWTFG CO  0QXGODGT  XQP -ÌPKI   6TKDJWDCP$KT$KMTCO5JCJ&GXIGUVKHVGVWPFKUVYQJNOKVFGO'PFGFGT/QPCTEJKGCDIGUEJCHHVYQTFGP

4'27$.+-0+)'4 

0CVKQPCNQTFGPXQP0KIGT=1TFTG0CVKQPCNFW0KIGT?)TQ­QHHK\KGTUUGVDGUVGJGPFCWU1HHK\KGTUFGMQTC VKQP 5KNDGT XGTIQNFGV WPF GOCKNNKGTV CO $CPF OKV 4QUGVVG WPF $TWUVUVGTP 5KNDGTVGKNYGKUGXGTIQNFGV WPF GOCKNNKGTV CP 0CFGN FKGUG RWP\KGTV OKV \YGK 5GKVGPJCMGP \WUCOOGP OKV -PQRHNQEJTQUGVVG KO   1TKIKPCNGVWKFGT(KTOC#TVJWU$GTVTCPFKP2CTKUOKVCDIGNÌUVGO-NGDGGVKMGVVOKVFGT#WHUEJTKHV$WP FGUOKPKUVGT9ÌTPGT)TQ­QHHK\KGT1TFTG0CVFW0KIGT1#0 ++



.CWV#PICDGPFGU8QTGKIGPVÒOGTUCWUFGO$GUKV\FGUGJGOCNKIGP0#61)GPGTCN5GMTGV·TU&T/CPHTGF9ÌTPGT



1TFGP FGT 2HNKEJVGTHÒNNWPI =0KUEJCPK+OVKC\? /KNKV·TKUEJG #DVGKNWPI 5GV FGT  -NCUUG =0KUEJCPK   +OVKC\?DGUVGJGPFCWU-NGKPQF5KNDGTXGTIQNFGVVGKNYGKUGGOCKNNKGTVCO5EJWNVGTDCPFWPF$TWUVUVGTP 5KNDGT DTKNNCPVKGTV VGKNYGKUG XGTIQNFGV VGKNYGKUG GOCKNNKGTV CWH FGT 4ÒEMUGKVG 9KFOWPIUITCXWT   )'0'4#.  4+%%#4&1 $+51)0+'41 +6#.+#0#4/'&(14%'5CP0CFGN\WUCOOGPOKV /KPKCVWT5KNDGTVGKNYGKUGXGTIQNFGVWPFGOCKNNKGTVQJPG$·PFEJGPKP YCJTUEJGKPNKEJFC\WIGJÌTKIGT  5EJCVWNNG82'5 5VÒEM44++



8GTNKGJGPCP)GPGTCN4KEECTFQ$KUQIPKGTQ IGD XQPDKU%JGHFGUKVCNKGPKUEJGP)GPGTCNUVCDGUFGT 8GTVGKFKIWPI

335


REPUBLIK NIGER

9046



1TFGPXQP8CUEQ0WÇG\FG$CNDQC=1TFGPFG8CUEQ0WÇG\FG$CNDQC?)TQ­MTGW\UGVDGUVGJGPFCWU -NGKPQF 5KNDGT XGTIQNFGV WPF GOCKNNKGTV CO QTKIKPCNGP 5EJWNVGTDCPF WPF $TWUVUVGTP 5KNDGT VGKNYGKUG   XGTIQNFGV WPF GOCKNNKGTV CWH FGT 4ÒEMUGKVG *GTUVGNNGTDG\GKEJPWPI FGT (KTOC 8KNCTFGDQ [4KGTCKP*C XCPPC CP 0CFGN KO QTKIKPCNGP IQNFGP DGFTWEMVGP 8GTNGKJWPIUGVWK XQP 8KNCTFGDQ [ 4KGTC OKV DGUEJ·   FKIVGO8GTUEJNW­82'5 5VÒEM4++



&GTHÒPHMNCUUKIGCNNIGOGKPG8GTFKGPUVQTFGPYWTFGIGUVKHVGVWPFCO,WNKDGUV·VKIV

9047



9048

5QPPGP WPF .ÌYGP1TFGP =0KUEJCP K 5EJKT W -JWTUEJKF?  /QFGNN   #WUICDG HÒT   <KXKNKUVGP WPF #WUN·PFGT OKV TWJGPFGO .ÌYGP  -NGKPQF FGT  -NCUUG  #WUHÒJTWPI OKV UGEJU   5VTCJNGP  HTCP\ÌUKUEJG #PHGTVKIWPI 5KNDGT DTKNNCPVKGTV WPF TGRGTEKGTV VGKNYGKUG GOCKNNKGTV HGKPUVG   'OCKNNGOCNGTGK CWH FGT 4ÒEMUGKVG *GTUVGNNGTDG\GKEJPWPIFGT(KTOC*CNNG[KP2CTKUOKVNCPIGOUR·VG TGOWPMQPHGMVKQPKGTVGP5EJWNVGTDCPF82'5 4++



&GT1TFGPGZKUVKGTVUGKVCNU0CEJHQNIGTFGU5QPPGP1TFGPU'KP(KTOCPXQO/CKDGUEJTGKDVFKG5VGTPG WPF $·PFGT FGT \CJNTGKEJGP -NCUUGP FGT /KNKV·T WPF <KXKNCDVGKNWPI FGU 1TFGPU PKEJV CDGT FKG CP FGP $·PFGTP   J·PIGPFGP 1TFGPU\GKEJGP 0CEJ GKPGO KO 'KP\GNPGP UEJYGT XGTUV·PFNKEJGP (KTOCP XQP  YWTFGP FKG \CJNTGK   EJGP-NCUUGPFGU1TFGPUGPVYGFGTCNU5VGTPQFGTCO$CPFIGVTCIGP'KP\KIFKG-NCUUG GXGPVWGNNPWTDGK#WUN·P FGTP JCVVGGKPGP5VGTPWPFGKP-NGKPQF.GV\VGTGUUGKINGKEJ IGOGKPVKUVYQJN·JPNKEJ YKGFGT5VGTP#WHUR·VGTGP +PUKIPKGPDNKEMVFGT.ÌYGHCUVKOOGTPCEJNKPMUYWTFGGTXQO*QOC[WWP1TFGPCDIGNÌUV



336

5QPPGP WPF .ÌYGP1TFGP =0KUEJCP K 5EJKT W -JWTUEJKF?  /QFGNN   #WUICDG HÒT   <KXKNKUVGPWPF#WUN·PFGT OKVTWJGPFGO.ÌYGP $TWUVUVGTP\WT-NCUUG OKVCEJV5VTCJNGP HTCP\ÌUK UEJG#PHGTVKIWPI5KNDGTDTKNNCPVKGTVWPFTGRGTEKGTVVGKNYGKUGGOCKNNKGTVHGKPUVG'OCKNNGOCNGTGKCWHFGT 4ÒEMUGKVG*GTUVGNNGTDG\GKEJPWPIFGT(KTOC-T½VN[KP2CTKUCP0CFGNFKGUGOKVHTCP\ÌUKUEJGT)CTCPVKG RWP\G HÒT 5KNDGT 'DGTMQRH  UGKV  GDGPUQ CWH FGO 0CFGNJCMGP  OKV \YGK 5GKVGPJCMGP 82'    5 ++




REPUBLIK NIGER

9049 (1:1)



5QPPGP WPF .ÌYGP1TFGP =0KUEJCP K 5EJKT W -JWTUEJKF?  /QFGNN   #WUICDG HÒT   <KXKNKUVGPWPF#WUN·PFGT OKVTWJGPFGO.ÌYGP *CNUFGMQTCVKQPFGT-NCUUGOKV$TKNNCPVGPTWUUKUEJG #PHGTVKIWPI5KNDGTXGTIQNFGV/GFCKNNQPTKPI)QNFVGKNYGKUGGOCKNNKGTVHGKPG'OCKNNGOCNGTGKDGUGV\V¯ LQWTOKVYGK­GP FCXQPGKPGTDGUEJ·FKIV WPFITÒPGPVTCPUNW\KFGP5KOKNKUVGKPGPCWHFGT4ÒEM UGKVGTWUUKUEJG/GKUVGTOCTMGÏÂWPF<QNQVPKMK-QMQUEJPKM5KNDGTRWP\GXQPDKUOKV UR·VGTGO*CNUDCPFCDUEJPKVV82'5 44++  2TCEJVGZGORNCT KP JGTXQTTCIGPFGT TWUUKUEJGT *GTUVGNNWPIUSWCNKV·V YQJN \YKUEJGP  WPF  KP CNNGTDGUVGT   'TJCNVWPI CNNG5VGKPGUKPFPQEJXQTJCPFGP 

9050 (1:1)



5QPPGP WPF .ÌYGP1TFGP =0KUEJCP K 5EJKT W -JWTUEJKF?  /QFGNN   #WUICDG HÒT   <KXKNKUVGPWPF#WUN·PFGT OKVTWJGPFGO.ÌYGP $TWUVUVGTPFGT-NCUUGOKV$TKNNCPVGPPKEJVRGTUKUEJG #PHGTVKIWPI5KNDGT/GFCKNNQPTKPI)QNFVGKNYGKUGGOCKNNKGTVCNNGTHGKPUVG'OCKNNGOCNGTGKDGUGV\V¯LQWT OKV  GKP 5VGKP HGJNV  YGK­GP VGKNYGKUG PKEJV VTCPUNW\KFGP 5KOKNKUVGKPGP OKV 3WGTDTQUEJKGTWPI WPF   $GHGUVKIWPIUJCMGP82'5 ++  5GJT UEJÌPGU 'ZGORNCT KP CNNGTHGKPUVGT GWTQR·KUEJGT *GTUVGNNWPIUSWCNKV·V XQO 'PFG FGU  ,CJTJWPFGTVU KP UGJT   IWVGT'TJCNVWPI PWTGKP5VGKPHGJNV 

337


REPUBLIK NIGER

9051 9052



5QPPGP WPF .ÌYGP1TFGP =0KUEJCP K 5EJKT W -JWTUEJKF?  /QFGNN   #WUICDG HÒT   <KXKNKUVGPWPF#WUN·PFGT OKVTWJGPFGO.ÌYGP &GMQTCVKQP-NCUUG#WUHÒJTWPI CNU*CNUFGMQTC VKQP RGTUKUEJG#PHGTVKIWPI5KNDGTDTKNNCPVKGTVVGKNYGKUGGOCKNNKGTV'OCKNNGOCNGTGKCOCNVGPUEJOCNGP NCPIGP$CPFCDUEJPKVV82'5 ++



(TÒJGGKPJGKOKUEJG#PHGTVKIWPICWUFGO\YGKVGP&TKVVGNFGU,CJTJWPFGTVU



1TFGPFGT5QPPG=1TFGPFGN5QN?  D\Y1TFGPō&KG5QPPGXQP2GTWŋ=1TFGP'N5QNFG 2GTÐ? UGKV   )TQ­MTGW\UGV KP GKPGT #PHGTVKIWPI FGT %CUC 0CEKQPCN FG /QPGFC 2CTGLC KP .KOC   DGUVGJGPF CWU -NGKPQF #WUHÒJTWPI OKVPKEJVGOCKNNKGTVGO.QTDGGTMTCP\WOFCU/KVVGNOGFCKNNQP  5KNDGTXGTIQNFGVWPFGOCKNNKGTVCWHFGT4ÒEMUGKVG*GTUVGNNGTDG\GKEJPWPIFGT%CUC0CEKQPCNFG/QPGFC 2CTGLC CO QTKIKPCNGP 5EJWNVGTDCPF WPF $TWUVUVGTP 5KNDGT XGTIQNFGV WPF VGKNYGKUG GOCKNNKGTV CWH FGT   4ÒEMUGKVG*GTUVGNNGTDG\GKEJPWPIFGT%CUC0CEKQPCNFG/QPGFC2CTGLCCP0CFGNOKV\YGK5GKVGPJCMGP KO1TKIKPCNGVWKOKVIQNFHCTDGPGO5VCCVUYCRRGP82'5 5VÒEM++

9053



9054



9055

1TFGPFGT5QPPG=1TFGPFGN5QN?  D\Y1TFGPō&KG5QPPGXQP2GTWŋ=1TFGP'N5QNFG 2GTÐ? UGKV   $TWUVUVGTP \WO )TQ­QHHK\KGT 5KNDGT XGTIQNFGV VGKNYGKUG GOCKNNKGTV CWH FGO 4GXGTU   *GTUVGNNGTDG\GKEJPWPI FGT (KTOC .GOCÄVTG KP 2CTKU CP 0CFGN FKGUG OKV HTCP\ÌUKUEJGT 'KPHWJT5KNDGT   RWP\GXQPDKU 5EJYCPGPRWP\G OKV\YGK5GKVGPJCMGP ++



&GTKP'WTQRCTGNCVKXUGNVGP\WHKPFGPFG$TWUVUVGTP\WO)TQ­QHHK\KGTFGTUKEJXQPFGOFGU)TQ­MTGW\GUFWTEJFKG HGJNGPFG 'OCKNNKGTWPI FGU FCU /GFCKNNQP WOIGDGPFGP .QTDGGTMTCP\GU WPVGTUEJGKFGV YKTF QJPG YGKVGTG +PUKIPKGP   YKG*CNUQFGT$TWUVFGMQTCVKQPXGTNKGJGPWPFIGVTCIGP





1TFGPFGT5QPPG=1TFGPFGN5QN?  D\Y1TFGPō&KG5QPPGXQP2GTWŋ=1TFGP'N5QNFG 2GTÐ? UGKV /QFGNN4KVVGTFGMQTCVKQPCO1TKIKPCNDCPF5KNDGTXGTIQNFGVWPFVGKNYGKUGGOCKN NKGTVCO$CPF82'5 ++



0CVKQPCNGT1TFGPFGU.ÌYGPXQP5GPGICN=1TFTG0CVKQPCNFW.KQPFW5GPGICN?-QOOCPFGWTFGMQ TCVKQP 5KNDGT XGTIQNFGV WPF VGKNYGKUG GOCKNNKGTV KO $CPFTKPI HTCP\ÌUKUEJ RWP\KGTV CO *CNUDCPF \W   UCOOGP OKV GKPGO CNVGP JCPFUEJTKHVNKEJGP <GVVGN ÒDGT FKG 2TQXGPKGP\ KO DGUEJ·FKIVGP 1TKIKPCN2CRR   MCTVQP4(5 ++



&KGUGU 'ZGORNCT KUV KO ,CJTG  CP FGP 2T·UKFGPVGP FGT <GPVTCNDCPM FGT 9GUVCHTKMCPKUEJGP 5VCCVGP XGTNKGJGP   YQTFGP

338


SYRIEN

ex 9056

5;4+'0 5;4+5%*'#4#$+5%*'4'27$.+-$<9#4#$+5%*'4'27$.+-5;4+'0 

5'+6  

-QPXQNWV XQP  XQTYKGIGP OKNKV·TKUEJGP 1TFGP WPF 'JTGP\GKEJGP &CTWPVGT CNNG FTGK -NCUUGP FGU   1TFGPU HÒT /WV 'JTGP\GKEJGP HÒT 8GTYWPFGVG WPFXGTUEJKGFGPG(GNF\WIU'JTGP\GKEJGP$TQP\GVGKNU XGTIQNFGV VGKNU GOCKNNKGTV QFGT NCEMKGTV CW­GT GKPG CNNG CP $·PFGTP KP FWTEJYGIU QTFGPVNKEJGT 'TJCN   VWPI 5VÒEM++



9058

9057

-¤0+)4'+%*6*#+.#0& $+55+#/  

&GT UGJT XQTPGJOG 1TFGP XQP %JWNC %JQO -NCQ &GMQTCVKQP FGT +PJCDGT 5KNDGT VGKNYGKUG GOCKN   NKGTVCOQTKIKPCNGP$CPF ++



 XQP -ÌPKI %JWNCNQPIMQTP CNU TGKPGT (COKNKGPQTFGP IGUVKHVGV GTJKGNV GT  WPF  GTYGKVGTVG 5VCVWVGP   0CEJ FGT 7OYCPFNWPI KP GKPGP CNNIGOGKPGP 8GTFKGPUVQTFGP YWTFGP  WPF  YGKVGTG 5VCVWVGP·PFGTWPIGP   XQTIGPQOOGP(ÒT*GTTGPXGTHÒIVFGT1TFGPJGWVGÒDGTUKGDGP-NCUUGPHÒT&COGPÒDGTHÒPH#NUGKP\KIGTVJCKN·P FKUEJGT1TFGPXGTHÒIVFGT1TFGPKPFGTGTUVGPDKUHÒPHVGP-NCUUGHÒT*GTTGPÒDGTGKPGP1TFGPUOCPVGN'KPGYGKVGTG $GUQPFGTJGKV FGU 1TFGPU KUV FC­ FGT ·NVGUVG 5QJP FGU $GNKGJGPGP CWVQOCVKUEJ F J QJPG GKIGPGU8GTFKGPUV GKPG PKGFTKIGTG-NCUUGFGU1TFGPUXGTNKGJGPDGMQOOV



&GTUGJTJQJG1TFGPFGU9GK­GP'NGRJCPVGP/QFGNN UGKV 5GVFGT-NCUUGDGUVGJGPFCWU &GMQTCVKQP FGT  -NCUUG 5KNDGT VGKNYGKUG XGTIQNFGV WPF GOCKNNKGTV CWH FGT 4ÒEMUGKVG RWP\KGTV CO   QTKIKPCNGPNCPIGP*CNUDCPFWPF$TWUVUVGTP5KNDGTVGKNYGKUGXGTIQNFGVWPFGOCKNNKGTVCWHFGT4ÒEMUGKVG OGJTHCEJ RWP\KGTV CP 0CFGN FKGUG RWP\KGTV KO 1TKIKPCNGVWK FGT -ÌPKINKEJGP /ÒP\G XQP $CPIMQM   DGNGIVOKVFGOVJCKN·PFKUEJGP5VCCVUYCRRGP 5VÒEM++



5GJTUEJÌPGWPFSWCNKV·VUXQNNG#PHGTVKIWPICWUFGPGT,CJTGP

339


KÖNIGREICH THAILAND

9059

9060

9061



&GT 5GJT 'JTGPYGTVG 1TFGPFGT5KCOGUKUEJGP-TQPG  D\Y&GT5GJT'JTGPYGTVG1T FGPFGT-TQPGXQP6JCKNCPF=OQPIIÈQFVCK? UGKV /QFGNN UGKV 5GVFGT4KVVGT)TQ­ MTGW\G  -NCUUG  =DRT¯V¯OCCRQP OQPIIÈQF VCK? #WUHÒJTWPI HÒT *GTTGP DGUVGJGPF CWU -NGKPQF   5KNDGT VGKNYGKUG XGTIQNFGV WPF GOCKNNKGTV CO QTKIKPCNGP 5EJWNVGTDCPF WPF $TWUVUVGTP 5KNDGTVGKNYGKUG XGTIQNFGV WPF GOCKNNKGTV CWH FGT 4ÒEMUGKVG 5VGTPRWP\G WPF 0T  CP0CFGNFKGUGOKVVJCKN·PFKUEJGT *GTUVGNNGTDG\GKEJPWPIWPF0T82'5 5VÒEM++



&GT \WP·EJUV HÒPHMNCUUKIG 4KVVGT OKV )TQ­MTGW\ 4KVVGT-QOOCPFGWT -QOOCPFGWT )GHQNIUOCPP WPF /KVINKGF    CNNIGOGKPG<KXKNWPF/KNKV·T8GTFKGPUVQTFGPHÒT+PWPF#WUN·PFGTYWTFGCO&G\GODGT=$'?XQP -ÌPKI 4COC 8 %JWNCNQPIMQTP   IGUVKHVGV  WPF  /QFGNN  /KV FGO 'TNC­ FGT GTUVGP 5VCVWVGP    YWTFG FKG )GUVCNVWPI FGT +PUKIPKGP IG·PFGTV  /QFGNN  WPF FKG /KVINKGFGT\CJN FGT GTUVGP XKGT -NCUUGP DGITGP\V  

YCUUR·VGTYKGFGTCWHIGJQDGPYWTFG &WTEJFKG5VKHVWPIFGT)QNFGPGPWPF5KNDGTPGP/GFCKNNGYWTFGFGT1TFGPCWH UKGDGP-NCUUGPGTYGKVGTV-ÌPKI4COC8+++#PCPFC/CJKFQN  TGQTICPKUKGTVGFGP1TFGPFWTEJGKPG WOHCPITGKEJG5VCVWVGPPFGTWPIYQFWTEJFKG+PUKIPKGPFGU1TFGPUPGWIGUVCNVGVFKG-NCUUGFGU4KVVGTUOKV)TQ­ MQTFQP IGUVKHVGV FCFWTEJ YCTFGT1TFGPPWPCEJVMNCUUKI WPFFKG/ÌINKEJMGKVFGT8GTNGKJWPIFGU1TFGPUKPCNNGP -NCUUGPCP(TCWGPGKPIGHÒJTVYWTFG /QFGNN 



&GT 5GJT 'JTGPYGTVG 1TFGPFGT5KCOGUKUEJGP-TQPG  D\Y&GT5GJT'JTGPYGTVG1T FGPFGT-TQPGXQP6JCKNCPF=OQPIIÈQFVCK? UGKV /QFGNN UGKV 5GVFGT4KVVGT-QO OCPFGWTG -NCUUG #WUHÒJTWPIHÒT*GTTGPDGUVGJGPFCWU*CNUFGMQTCVKQP5KNDGTVGKNYGKUGXGTIQNFGV WPF GOCKNNKGTV CWH FGT 4ÒEMUGKVG FGT -TQPG VJCKN·PFKUEJG 5KNDGTRWP\G WPF *GTUVGNNGTRWP\GCONCPIGP QTKIKPCNGP*CNUDCPFWPF$TWUVUVGTP5KNDGTVGKNYGKUGXGTIQNFGVWPFGOCKNNKGTVMCWOUKEJVDCTG4GRCTC VWTGP KP FGT TQVGP 'OCKNNG CP 0CFGN KO QTKIKPCNGP DNCWUCOVGPGP 8GTNGKJWPIUGVWK OKV CWHIGNGIVGO   OGVCNNGPGO5VCCVUGODNGO82'5 5VÒEM++



NVGTG#PHGTVKIWPICWUFGPGT,CJTGP

4'27$.+-65%*#& 

0CVKQPCNGT 1TFGP FGU 6UEJCF =1TFTG 0CVKQPCN FW 6EJCF? 1HHK\KGTUMTGW\ $TQP\G XGTIQNFGV WPF   GOCKNNKGTV PCJG\W WPUKEJVDCTG 'OCKNNGTGRCTCVWT KP GKPGT -TGW\CTOURKV\G CO $CPF OKVCWHIGNGIVGT4Q UGVVG82'5H ++ &KG PKGFTKIGTGP -NCUUGP FKGUGU QJPGJKP PKEJV J·WHKIGP 1TFGPU UKPF KP 'WTQRC YGKVCWU UGNVGPGT \W HKPFGP CNU FKG   JÌJGTGP  &GT CNNIGOGKPG 8GTFKGPUVQTFGP YWTFG XQP FGT #WVQPQOGP 4GRWDNKM MWT\ XQT 'TNCPIWPI FGT XQNNGP   7PCDJ·PIKIMGKV CO#WIWUV OKV&GMTGV0TXQO#RTKNIGUVKHVGVFKG#WUHÒJTWPIUDGUVKOOWP IGPYWTFGPOKV&GMTGV0T2)CO,WNKGTNCUUGP'TGTHWJTPFGTWPIGPOKVFGP&GMTGVGP0T24 XQO#WIWUVWPF0T24XQO#WIWUV&GT1TFGPWOHCUUVFTGK)TCFG -QOOCPFGWT1HHK\KGT WPF4KVVGT WPF\YGK9ÒTFGP )TQ­QHHK\KGTWPF)TQ­MTGW\ #NU·W­GTGU<GKEJGPUGKPGT9ÒTFGVT·IVFGTCNU)TQ­ OGKUVGTCOVKGTGPFG5VCCVURT·UKFGPVGKPG-QNNCPG

340




TÜRKEI

9062

9063

15/#0+5%*'54'+%* $+5  

6ª4-'+

/GFLKFLKG1TFGP=/GEKFÄ0KUCPK?&GMQTCVKQPFGTQFGT-NCUUG5KNDGTDTKNNCPVKGTV#WHNCIGP)QNF GOCKNNKGTV OKP %JKRU KP FGT TQVGP 'OCKNNG CWH FGT 4ÒEMUGKVG QUOCPKUEJ RWP\KGTV QJPG $CPF 82'   5 ++p



1UOCPKLG1TFGP =0KUCPK 1UOCPÄ?  /QFGNN &GMQTCVKQP  -NCUUG 5KNDGT VGKNYGKUG DTKNNCPVKGTV   VGKNYGKUGXGTIQNFGVWPFGOCKNNKGTVCOPKEJVICP\MQTTGMVGP$CPFFGUHTCP\ÌUKUEJGP1TFGPUHÒT8GTFKGP UVGWOFKG.CPFYKTVUEJCHV82'5 ++



&GTXQP$GIKPPCPHÒPHMNCUUKIG1TFGPYWTFGXQP5WNVCP#DFWN/GFLKFIGUVKHVGVFKGGTUVGP5VCVWVGPFCVKGTGP XQO#WIWUV <KNMCFG#* 9·JTGPFFGU'TUVGP9GNVMTKGIGUGTHQNIVGFKG#WUICDGXQP+PUKIPKGP OKV5·DGNP/KVFGT#DUEJCHHWPIFGU5WNVCPCVUKO0QXGODGTFWTEJ)C\K/WUVCHC-GOCN2CUEJCIGP#VCVÒTM IKPICWEJFGT/GFLKFLKG1TFGPWPVGT



'ZGORNCT CWU FGT <GKV FGU 'TUVGP 9GNVMTKGIU KP UGNVGP IWVGT 'TJCNVWPI  &GT HÒPHMNCUUKIG PCEJ 5WNVCP 1UOCP +  

  FGO )TÒPFGT FGU 1UOCPKUEJGP 4GKEJGU DGPCPPVG <KXKN WPF /KNKV·T8GTFKGPUVQTFGP YWTFG CO    ,CPWCT  XQP 5WNVCP #DFÒN #\K\ IGUVKHVGV WPF DKU \WO 'PFG FGT /QPCTEJKG  XGTNKGJGP XIN CWEJ )4 5   HH 

9064 (1:1)



/GFCKNNG HÒT 5V ,GCP F #ETG=#MM³/CFCN[CUK?=?)QNFGPG/GFCKNNG HÒT*CWRVNGWVGWPF (GNFQHHK\KGTG  &WTEJOGUUGT  OO )QNF  I CWH #XGTU WPF 4GXGTU LGYGKNU FWTEJ GKPG -GTDG   DGUEJ·FKIVQJPG$CPF/;$ 44+++p+8



6TQV\FGTFGWVNKEJGP'KPUEJT·PMWPICWHDGKFGP5GKVGPKP)QNF·W­GTUVUGNVGP\WHKPFGP

9065



9066

-TKGIU/GFCKNNG =*CTR /CFCN[CUK? UQIGPCPPVGT 'KUGTPGT *CNDOQPF QFGT )CNNKRQNK5VCT &GWVUEJG   #PHGTVKIWPI'KPHÒJTWPIOKVUGRCTCVCWUIGU·IVGT6WIJTC5KNDGTGOCKNNKGTVCWHFGT4ÒEMUGKVG*GTUVGNNGT DG\GKEJPWPIFGT(KTOCX,*9GTPGTKP$GTNKPWPF5KNDGTRWP\GCP0CFGN ++





-TKGIU/GFCKNNG =*CTR /CFCN[CUK? UQIGPCPPVGT 'KUGTPGT *CNDOQPF QFGT )CNNKRQNK5VCT &GWVUEJG   #PHGTVKIWPI$TQP\GXGTUKNDGTVWPFGOCKNNKGTVQJPG*GTUVGNNGTDG\GKEJPWPICP0CFGN ++





&KGUG-CVCNQIRQUKVKQPGPVH·NNV

 341


TUNESIEN

9068

9069

9070

670'5+'0 4')'065%*#(6 670+5 706'4 '+0'/ $'; ņ   ņ 810  $+5   (4#0<¤5+5%*'52416'-614#6 





1TFGPFGU4WJOU=0KUEJCPCN+HVKMJCT? QHVCNU0KUEJCP+HVKMJCT1TFGPDG\GKEJPGV /QFGNN#WU ICDG OKV /QPQITCOO =#JOCF $G[? XQP 5KFK #EJOGF ++ $G[    -QOOCPFGWTFGMQTC   VKQPHTCP\ÌUKUEJG#PHGTVKIWPI5KNDGTDTKNNCPVKGTVVGKNYGKUGGOCKNNKGTVCWHFGO$CPFTKPI\YGK2WP\GP FCTWPVGTHTCP\ÌUKUEJG)CTCPVKGRWP\GHÒT5KNDGT 'DGTMQRH UGKVQJPG$CPF +p++



1TFGPFGU4WJOU=0KUEJCPCN+HVKMJCT?/QFGNN  #WUICDG OKV0COGPUEJKHHTGXQP /WJCOOCF 8 CP0CUKT =DKP /WJCOOCF CN*WUUGKP 2CUEJC? $G[    &GMQTCVKQP  -NCUUG  

-QOOCPFGWT VWPGUKUEJG#PHGTVKIWPI5KNDGTDTKNNCPVKGTVVGKNYGKUGGOCKNNKGTVCWHFGO$CPFTKPIHTCP \ÌUKUEJG*GTUVGNNGTRWP\GCOUR·VGTGP*CNUDCPFCDUEJPKVV82'5H ++



1TFGPFGU4WJOU=0KUEJCPCN+HVKMJCT?/QFGNN  #WUICDG OKV0COGPUEJKHHTGXQP /WJCOOCF 8 CP0CUKT =DKP /WJCOOCF CN*WUUGKP 2CUEJC? $G[    &GMQTCVKQP  -NCUUG  

-QOOCPFGWT  HTCP\ÌUKUEJG #PHGTVKIWPI 5KNDGT DTKNNCPVKGTV VGKNYGKUG GOCKNNKGTV CO UR·VGTGP *CNU   DCPFCDUEJPKVV82'5H ++



9071

$1.+8#4+5%*'4'27$.+-8'0'<7'.# 

1TFGP FGU $GHTGKGTU =1TFGP FGN .KDGTVCFQT? CWEJ 1TFGP FGT $ÒUVG $QNKXCTU IGPCPPV  $TWUVUVGTP   \WO )TQ­MTGW\  /QFGNN OKV 1TFGPU\GKEJGP  XGTUKNDGTV VGKNYGKUG XGTIQNFGV WPFGOCKNNKGTVCWHFGT 4ÒEMUGKVG*GTUVGNNGTDG\GKEJPWPIFGT(KTOC05/G[GTKP0GY;QTMKO1TKIKPCNGVWKFGT(KTOC05 /G[GT82'5 +p++

&GTCO#RTKNKPHÒPH-NCUUGPIGITÒPFGVG1TFGPIGJVCWHFKG#WU\GKEJPWPIU/GFCKNNG /GFCNNCFG&GUVKP EKÉP XQP\WTÒEM&KGUGWTURTÒPINKEJQXCNGIQNFGPGQFGTUKNDGTPG/GFCKNNGOW­UEJQPXQTFKG(QTOFGU 1TFGPU\GKEJGPU FGU UR·VGTGP 1TFGPU FGU $GHTGKGTU CPIGPQOOGP JCDGP YWTFG CDGT CP GKPGO JGNNDNCWGP $CPF CO   *CNUIGVTCIGPWPFJCVVGPCEJ*5EJWN\GUEJQPOGJTCNUGKPG-NCUUG&GT1TFGPJKG­QHHK\KGNNXQP%QP FGEQTCEKÉP FGN $WUVQ FGN .KDGTVCFQT 8IN CWEJ 2NCPCU 5WCTG\ 5 *KUVQTKC FG NC1TFGPFGN.KDGTVCFQT%CTCECU 6GPTGKTQ6QOCU2%QPFGEQTCEKQPGU0CEKQPCNGU%CTCECU7TFCPGVC$TCUEJK'\GSWKGN$QNKXCTGP NCPWOKUOCVKECEQPOGOQTCVKXC[GPNCUEQPFGEQTCEKQPGU%CTCECU5)4+6<5HH 

342




USA

ex 9072



1TFGP FGU $GHTGKGTU =1TFGP FGN .KDGTVCFQT? CWEJ 1TFGP FGT $ÒUVG $QNKXCTU IGPCPPV  )TQ­QHHK   \KGTUUGV DGUVGJGPF CWU *CNUFGMQTCVKQP $TQP\G XGTIQNFGV WPF VGKNYGKUG GOCKNNKGTV CO *CNUDCPF WPF   $TWUVUVGTP /QFGNNKPFGT(QTOFGUHTÒJGTGP)TQ­MTGW\UVGTPGU XGTUKNDGTVVGKNYGKUGXGTIQNFGVWPF GOCKNNKGTVCWHFGO4GXGTU*GTUVGNNGTDG\GKEJPWPIFGT(KTOC05/G[GTKP0GY;QTMCP0CFGNOKV\YGK 5GKVGPJCMGPKOQTKIKPCNGPIQNFGPDGFTWEMVGP8GTNGKJWPIUGVWKFGT(KTOC/G[GT&C\W/KPKCVWTXGTIQN FGVWPFVGKNYGKUGGOCKNNKGTVCO$·PFEJGPOKVCWHIGNGIVGT4QUGVVGKO'VWK82'5 5VÒEM++



9074 (1:1)

9074 (1:1)

9073

8'4'+0+)6'56##6'0810#/'4+-# 75#  

8GTFKGPUV.GIKQP =.GIKQP QH /GTKV? $TWUVUVGTP %JKGH %QOOCPFGT  XGTIQNFGV WPF GOCKNNKGTV CP   0CFGN ++



7PXGTNKGJGPGU 'ZGORNCT  &GT $TWUVUVGTP YKTF CNNGKPG QJPG YGKVGTG +PUKIPKGP YKG *CNU QFGT $TWUVFGMQTCVKQPGP   XGTNKGJGPWPFIGVTCIGP



8GTFKGPUV.GIKQP=.GIKQPQH/GTKV?-QOOCPFGWTFGMQTCVKQP$TQP\GXGTIQNFGVWPFGOCKNNKGTVCWHFGT 4ÒEMUGKVG 9KFOWPIUITCXWT -#4. *+./'4  .'00#46  .,70) CO *CNUDCPF \WUCOOGP OKV   +PVGTKOUURCPIGKOGVYCUDGUEJ·FKIVGP'VWK 4++



-WTKQU OKV FGP DGKFGP ITCXKGTVGP 0COGP /ÌINKEJGTYGKUG GTJKGNV .LWPI \WP·EJUV FKGUGU 'ZGORNCT XGTNKGJGP WPF   UR·VGTCNUFGT)TCXWTHGJNGTQHHGPUKEJVNKEJIGYQTFGPYCTFCU\YGKVG'ZGORNCTCWHFGOPWTUGKP0COGITCXKGTVYCT

UKGJGHQNIGPFG0WOOGT #TOGGIGPGTCN.GPPCTV.LWPI  YCTXQPDKU1DGTDGHGJNUJCDGTFGT UEJYGFKUEJGP5VTGKVMT·HVG

343


USA

9075 (1:1)



8GTFKGPUV.GIKQP=.GIKQPQH/GTKV?-QOOCPFGWTFGMQTCVKQP$TQP\GXGTIQNFGVWPFGOCKNNKGTVCWHFGT 4ÒEMUGKVG 9KFOWPIUITCXWT .'00#46  .,70) CO *CNUDCPF \WUCOOGP OKV +PVGTKOUURCPIG KO   GVYCUDGUEJ·FKIVGP'VWK ++



#TOGGIGPGTCN.GPPCTV.LWPI  YCTXQPDKU1DGTDGHGJNUJCDGTFGTUEJYGFKUEJGP5VTGKVMT·HVG



-QPXQNWV XQP  OKNKV·TKUEJGP #WU\GKEJPWPIGP $TQP\G ITÌ­VGPVGKNU CP$·PFGTPOKV0CFGNPFCXQP GKPGKO'VWK&C\WXKGT(GNFUEJPCNNGPCP0CFGNP 5VÒEM++



9077



344

1TFGPUUEJPCNNG GKPGU /CTKPG8GVGTCPGP FGU <YGKVGP 9GNVMTKGIGU OKV HÒPH #WU\GKEJPWPIGP     &KGPUVCWU\GKEJPWPIUOGFCKNNG FGT /CTKPG   #OGTKMCPKUEJG 8GTVGKFKIWPIU/GFCKNNG   #UKCVKUEJGT   2C\KHKM (GNF\WIU/GFCKNNG   #OGTKMC (GNF\WIU/GFCKNNG   'TKPPGTWPIUOGFCKNNG  9GNVMTKGI #P   \YGK0CFGNP 5VÒEM++




Ergebnisse, die sich sehen lassen können! Vergleichen Sie unsere Resultate! Zum Beispiel aus unserer Auktion 173:

Münzen- und Goldhandel Auktionshaus für Münzen und Medaillen, Orden und Ehrenzeichen

Argumente, die überzeugen: • Von unserer Auktion 173 im Juni 2010 sind ca. 99 % zugeschlagen worden • Die Gesamt-Zuschlags-Summe lag mit € 642.000,– um ca. 147 % über der Taxe von € 260.000,– • Zahlreiche der angebotenen Lose erzielten neue Rekordzuschläge

Nehmen Sie Kontakt zu uns auf! Telefon: +49 (0)541 96 20 20 Gebührenfrei: 0800 58 36 537 Fax: +49 (0)541 96 20 222 E-Mail: service@kuenker.de Immer für Sie da: www.kuenker.de Los 8027 Hannover-Großbritannien, Kgl. GuelphenOrden, Ritterkreuz mit Schwertern, brit. Anfertigung von 1828, Gold, Emaille, ohne Band. Ausruf: € 800,– Zuschlag: € 4.000,–

Los 8014 Bayern, Goldene Ludwigsmedaille für Wissenschaft und Kunst, Gold, am originalen Band, im Verleihungsetui von Quellhorst in München. Ausruf: € 2.000,– Zuschlag: € 4.200,–

Los 8116 Deutsches Reich, Jerusalemkreuz 1908 (Originalexemplar), Silber vergoldet, Emaille, Medaillons Gold. Ausruf: € 240,– Zuschlag: € 1.400,–

Selbstverständlich sind für uns:

Los 8685 Schweden, Königlicher Schwertorden, Bruststern zum Großkreuz, 2. Drittel 19. Jh., Silber, Auflagen Gold, Emaille. Ausruf: € 1.200,– Zuschlag: € 3.200,–

Los 8762 Spanien, Bruststern der obersten Militärrichter, von G. Yaraburo in Madrid, um 1860, Gold, feinste Emaillemalerei. Ausruf: € 1.000,– Zuschlag: € 4.200,–

Weitere Ergebnisse sind verfügbar auf www.kuenker.de

• Ein bis zwei Ordensauktionen jährlich • Versierte Beschreibung und Bewertung der eingelieferten Objekte durch unsere wissenschaftlichen Experten • Farbige Abbildung der Lose in unseren Auktionskatalogen • Weltweite Werbung für unsere Auktionen • Auktionen in angenehmer und kundenfreundlicher Atmosphäre • Kompetente Betreuung von Verkäufern, Käufern und Interessenten durch unseren Kundenservice • Schneller, sachgerechter und versicherter Versand der ersteigerten Objekte • Garantiert pünktliche und unkomplizierte Abrechnung innerhalb von 42 Tagen nach dem Auktionstermin Fritz Rudolf Künker GmbH & Co. KG Gutenbergstraße 23 · 49076 Osnabrück Germany · www.kuenker.com Osnabrück · Berlin · München Konstanz · Zürich · Znojmo · Moskau


LITERATURZITATE #$ #4 #7# $$ $% $% $& $) $/ $0+ $0$81 $9 $9- $9- $;1 %#/ %& %'/ %*& %.. %/%59 &2 &9' '( '(9 '1 (( ((8/ )$ )'+ )+ )- )/) )55 *# *% *&+ *( *(# *2 *2 *2

346

5EJNQUU WPF 5RKGNMCTVGPOWUGWO #NVGPDWTI *I  'JTGP\GKEJGP FGU *GT\QIVWOU 5CEJUGP#NVGPDWTI  &GMQTCVKQPGP FGU *GT\QINKEJ5CEJUGP'TPGUVKPKUEJGP*CWUQTFGPU-CVCNQI\WT#WUUVGNNWPIXQO5GRVGODGTDKU(GDTWCT #NVGPDWTI #TGGP'TPUV'&G0QTFKUMC.·PFGTPCU1HHKEKGNNC$GNÌPWPIUOGFCNLGT5VQEMJQNO 5VGKFN2QTGPVC%JTKUVQRJ#WUGTY·JNVWPF#WUIG\GKEJPGV1TFGPFGU8CVKMCPUWPFFGTEJTKUVNKEJGP4KVVGTQTFGP+\DTCPKKP 1FNKMQXCPK1FNKMQXCPLC8CVKMCPCKPEGTMXGPKJXKVGUMKJTGFQX.LWDNLCPC $TCODKNNC#NGUUCPFTQ.G/GFCINKG+VCNKCPG/CKNCPF $CUECR¾)KCEQOQ%. 1TFKPGFK/CNVCGINK1TFKPK'SWGUVTKFGNNC%JKGUCPGNNC5VQTKCGPGN&KTKVVQ/CKNCPF $CUECR¾)KCEQOQ%)NK1TFKPK%CXCNNGTGUEJKKP+VCNKC5VQTKCG&KTKVVQ/CKNCPF $CTFWNGEM/CZ&KGNGV\VGP,CJTGFGT/ÒP\GKP&TGUFGP9GTMUXGT\GKEJPKU$GTNKP $KIQU\GYUMC9CPFC&¾EQTCVKQPUGV1TFTGU2QNQPCKU9CTUEJCW *C[YCTF,QJP$KTEJ&KCPCWPF$KUJQR4KEJCTF$TKVKUJ$CVVNGUCPF/GFCNU.QPFQP#WHNCIG $KPK&KOKVTK.G/GFCINKG7HHKEKCNK/KNKVCTKFGN4GIPQF +VCNKC1JPG1TVUCPICDG $GPMGT 5KGIOWPF -KGV\KI 1VVQ WPF CPFGTG 3WKU WV &GWU   ,CJTG 'T\DTWFGTUEJCHV 5V /KEJCGN $GTI CO .CKO /ÒPEJGP/ÒPEJGP )GKIGT4QNH.KPFPGT,ÒTIGPWPF9ÌTPGT(TCPM,CJTG8GTFKGPUVQTFGPFGT$WPFGUTGRWDNKM&GWVUEJNCPF*QH5CCNG  $QYGP8'6JG2TWUUKCPCPF)GTOCP+TQP%TQUU1JPG1TVUCPICDG#WHNCIGQJPG,CJTGUCPICDG $CTCE$QTPC4GHGTGPEG%CVCNQIWG1TFGTU/GFCNUCPF&GEQTCVKQPUQHVJG9QTNFKPUVKVWVGUWPVKN2CTV++TQP$QQM #&<CITGD $CTCE$QTPC4GHGTGPEG%CVCNQIWG1TFGTU/GFCNUCPF&GEQTCVKQPUQHVJG9QTNFKPUVKVWVGUWPVKN2CTV++$TQP\G $QQM&)<CITGD $G[TGK­ (TKGFJGNO &GT *CWUQTFGP WPF FKG VTCIDCTGP 'JTGP\GKEJGP FGU )TQ­JGT\QIVWOU 1NFGPDWTI    0QTFGTUVGFV Car, Pavel, und Muhić, Tomislav:5GTDKUEJGWPFLWIQUNCYKUEJG1TFGPWPF'JTGP\GKEJGPXQPDKU9KGP %CTFKPCNG*[IKPWU'WIGPG1TFGTUQH-PKIJVJQQF#YCTFUCPFVJG*QN[5GG)GTTCTFU%TQUU )WKIWG FG %JCORXCPU FG (CT¾OQPV (T¾F¾TKE /CTSWKU *KUVQKTG GV .¾IKUNCVKQP FGU 1TFTGU FG %JGXCNGTKG FW 5CKPV5K½IG 2CTKU )WKIWGFG%JCORXCPUFG(CT¾OQPV(T¾F¾TKE/CTSWKU)GUEJKEJVGWPF)GUGV\IGDWPIFGT 4KVVGTQTFGP 'JTGP\GKEJGP WPF /GFCKNNGPFGU*GKNKIGP5VWJNU0CEJFTWEMFGT#WUICDG2CTKU %QNNKIPQP,GCP2KGTTG1TFTGFG%JGXCNGTKG&¾EQTCVKQPUGVO¾FCKNNGUFG(TCPEG FGUQTKIKPGU¯NCHKPFW5GEQPF'ORKTG .C/QVJG#TEJCTF Car, Pavel, und Muhić, Tomislav:2TGKUMCVCNQIHÒT5GTDKUEJGWPF,WIQUNCYKUEJG1TFGP/GFCKNNGWPF#D\GKEJGP &GEQTCVKQPUCPF$CFIGUQH5GTDKCCPF;WIQUNCXKC2TKEG)WKFG-CVCNQIQFNKMQXCPLCK\PCMQXNLC5TDKLGK ,WIQUNCXKLG.LWDNLCPCWPF<CITGD 8CP&WTGP2GVGT$CPFGT6JG%TQUUQPVJG5YQTF)GTTCTFU%TQUU 8CP&WTGP2GVGT$CPFGT1TFGTUQH-PKIJVJQQFCPFQH/GTKV6JG2QPVKHKECN4GNKIKQWUCPF5GEWNCTKUGF%CVJQNKEHQWPFGF 1TFGTUCPFVJGKTTGNCVKQPUJKRVQVJG#RQUVQNKE5GG)GTTCTFU%TQUU &WYG)GQTI'T\M·OOGTGT-COOGTJGTTGPWPFKJTG5EJNÒUUGN1UPCDTÒEM 'HNGT)GTV&GWVUEJG(GWGTYGJT#WU\GKEJPWPIGP5EJYCNOUVCFV 'HNGT)GTV&KG1TFGPWPF'JTGP\GKEJGPFGU(ÒTUVGPVWOU9CNFGEMWPF2[TOQPV5EJYCNOUVCFV 1JO*KGTQP[OWUUGP2CWN*CPFDWEJGWTQR·KUEJGT1TFGPKP(CTDG$GTNKP#WHNCIG (GTTK(CDTK\KQ1TFKPK%CXCNNGTGUEJKG&GEQTC\KQPKKP+VCNKC/QFGPC *CPMKOQ1NCXK$GTITQVJ6QO%WPFCPFGTG8CRCWFGPTKUVKP4KVCTKMWPVC2QTXQQ (KNKRQY-T\[U\VQH1TFGT8KTVWVK/KNKVCTK9CTUEJCW+PRQNPKUEJGT5RTCEJG5GKVGP5EJYCT\YGK­ WPF(CTDVCHGNPIGDWPFGP )GDCWGT9QNHTCO&KG1TFGPWPF'JTGP\GKEJGPXQP5CEJUGPGKPUEJNKG­NKEJFGTU·EJUKUEJGP8GTFKGPUV2T·OKGP2TGKU WPF#WU\GKEJPWPIUOGFCKNNGP&TGUFGP#WHNCIG )GK­NGT*CTCNF&CU'KUGTPG-TGW\XQPDKUJGWVG0QTFGTUVGFV )KCEEJKGTK2KGVTQ%QOOGPVCTKQFGINK1TFKPK'SWGUVTKGUKUVGPVKPGINK5VCVKFK5CPVC%JKGUC4QO -NGPCW#TPJCTF)TCH1TFGPKP&GWVUEJNCPFWPF¤UVGTTGKEJ 0QTOCNCWUICDG $CPF&GWVUEJG5VCCVGPDKU 6GKN #PJCNVKUEJG5VCCVGP$CFGP$C[GTP$TCWPUEJYGKI*CPPQXGT)TQ­JGT\QIVWO(TCPMHWTV 1HHGPDCEJ )CNNQYC[2GVGT6JG1TFGTQH5V/KEJCGNCPF5V)GQTIG.KPIHKGNF )GPPGU,GCP2KGTTGFG+PUKIPGUGV&¾EQTCVKQPUFGN 1TFTG—SWGUVTGFW5CKPV5¾RWNEJTGFGU,¾TWUCNGO8GTUCKNNGU *CPU /CZ &KG 1TFGP WPF 'JTGP\GKEJGP XQP 5CEJUGP%QDWTI5CCNHGNF WPF 5CEJUGP%QDWTI)QVJC  %QDWTI  *GTEQNCPK 'TEQNCPQ )CFFK 5VQTKC FGINK 1TFKPK 'SWGUVTK 4QOCPK 7PXGT·PFGTVGT 0CEJFTWEM 5CNC $QNQIPGUG  FGT #WUICDG4QO *G[FGP *GTOCPP XQP 'JTGP\GKEJGP -TKGIU&GPM\GKEJGP 8GTFKGPUV &KGPUVCNVGT<GKEJGP 4GVVWPIU/GFCKNNGP  WPF #D\GKEJGP KO -ÌPKITGKEJ +VCNKGP WPF KP UGKPGP GTNQUEJGPGP 5VCCVGP 5CTFKPKGP .QODCTFGK 8GPGFKI 2CTOC /QFGPC .WEEC6QUECPC$GKFG5K\KNKGP-KTEJGPUVCCVUQYKG5CP/CTKPQ9KGUDCFGP *GTHWTVJ&KGVTKEJ5QYLGVKUEJG#WU\GKEJPWPIGP#WU\GKEJPWPIGPFGT/QPIQNKUEJGP8QNMUTGRWDNKM 'KP-CVCNQI8KGTVG#WUICDG$GTNKP#WHNCIG *G[FG(TKGFJGNO2TGW­GP5COONWPI/CZ#WTKEJ&CU'KUGTPG-TGW\1UPCDTÒEM *ÒUMGP #PFT¾ -WTHÒTUVGPVWO $TCPFGPDWTI /CTMITCHUEJCHV $TCPFGPDWTI#PUDCEJ /CTMITCHUEJCHV $TCPFGPDWTI $C[TGWVJ1TFGPFGU-ÌPKITGKEJU2TGW­GP$TGOGP *ÒUMGP#PFT¾'JTGP\GKEJGP#WU\GKEJPWPIGPWPF'JTGPICDGP$TGOGP *ÒUMGP#PFT¾'JTGP\GKEJGP#WU\GKEJPWPIGPWPF'JTGPICDGP$TGOGP


*5

,+ ,< -&1 -1. -1. -4 .%< .'7 .0.¤ .11 /& /'2 /.: /0+ /; 0'0* 0+ 0/ 08 1$ 1'- 10 2' 2)# 2). 21 2426 27 4( 417 447 5# 5# 5# 5$ 5%$ 5%5%8 55-1 5. 5/- 50'52$

*GUUGPVJCN9CNFGOCT'FNGTXQPWPF5EJTGKDGT)GQTI&KGVTCIDCTGP'JTGP\GKEJGPFGU&GWVUEJGP4GKEJGUGKPUEJNKG­NKEJ FGT XQTOCNU UGNDUV·PFKIGP FGWVUEJGP 5VCCVGP UQYKG FGU -CKUGTVWOU WPF FGU $WPFGUUVCCVGU ¤UVGTTGKEJ FGT (TGKGP 5VCFV &CP\KI FGU )TQ­JGT\QIVWOU .WZGODWTI FGU (ÒTUVGPVWOU .KGEJVGPUVGKP WPF FGT 'JTGP\GKEJGP FGU 05&#2 1TKIKPCNIGVTGWGT0CEJFTWEMQJPG1TVWPFQJPG,CJTFGT#WUICDG$GTNKP ,ÌTIGPUGP2GVGT,&GP+UNCPFUMG(CNMGQTFGPQIFG+UNCPFUMG/GFCNLGT-QRGPJCIGP ,G\KQTQYUMK6CFGWU\WPF.WE\CM,CTQUNCY1TFGT9QLGPP[8KTVWVK/KNKVCTK2Q\PCP 0KOOGTIWV,ÌTI(GFGT-NCWUWPFXQPFGT*G[FG4WFQNH&GWVUEJG1TFGPWPF'JTGP\GKEJGP-CVCNQI&TKVVGU4GKEJ &&4WPF$WPFGUTGRWDNKMDKUJGWVG#WHNCIG4GIGPUVCWHCMVWCNKUKGTVG#WHNCIG -NKGVOCPP&T-WTV)GTJCTF1TFGPU.GZKMQP$GTNKPQJPG,CJT -NKGVOCPP&T-WTV)GTJCTF1TFGPUNGZKMQP 6TQUV.WFYKI&KG)GUEJKEJVGFGU5V/KEJCGNU1TFGPUKP$C[GTPWPFFGT5V/KEJCGNU$TWFGTUEJCHVUGKVFGO,CJTG DKUCWHFKG)GIGPYCTV0CEJFTWEM*CODWTIFGT#WUICDG/ÒPEJGPWPF.GKR\KI .WE\CM,WPF*[NC4',CJTG1TFGP8KTVWVK/KNKVCTK5VGKPCW $CPM.GW#) *I 5EJYGK\GT/GFCKNNGPCWUCNVGO2TKXCVDGUKV\<ÒTKEJ .KPM'XCWPF)CWIIGN*GKP\(ÒTUVNKEJ*QJGP\QNNGTUEJG1TFGPWPF'JTGP\GKEJGP(TKFKPIGP .ÌYGPJKGNO(TGFTKM5XGPUMC1TFPCTQEJ/GFCNLGT5VQEMJQNO#WHNCIG 5QOOGT-NCWU&KG/GFCKNNGPFGU-IN2TGW­KUEJGP*QHOGFCKNNGWTU&CPKGN(TKGFTKEJ.QQUWPFUGKPGU#VGNKGTU1UPCDTÒEM  XCP<GNPXCP'NFKM,#/QGFGP&GWIF4KFFGTQTFGPGPKP0GFGTNCPF&G1PVYKMMGNKPIXCPGGPGKIGP9GTGNFDKPPGP FGU0GFGTNCPFUG5COGPNGXKPI<WVRJGP /WNFGT%22GTUKCP1TFGTU-QRGPJCIGP /WNFGT%2WPF%JTKUVKCCPU2#1PFGTUEJGKFKPIGPXCPFG-QPKPI)TQQVJGTVQI&G1TFGXCPFG'KMGPMTQQP  U)TCXGPJCIG /CTKPK &GVVKPC #NHQPUQ +N .GIKVVKOQ 'UGTEK\KQ FGN )TCP /CIKUVGTQ FGN 5CETQ /KNKVCTG 1TFKPG %QPUVCPVKPKCPQ FK 5CP )KQTIKQ%KVV¯FGN8CVKECPQ /WUUGNN,QJP9 *I /GFCN;GCTDQQM*QPKVQP#WHNCIG 0KOOGTIWV ,ÌTI *GTCWUIGDGT  &CU 'KUGTPG -TGW\   )GUEJKEJVG FGU #WU\GKEJPWPIUYGUGPU .ÒFGPUEJGKF  #WHNCIG 0WOKUOCVKUEJGT#TDGKVUMTGKU$TCPFGPDWTI2TGW­GP0WOKUOCVKUEJGU*GHV$GTNKP 0KOOGTIWV,ÌTI&GWVUEJG1TFGPWPF'JTGP\GKEJGPDKU)GUCOVCWUICDGKPHÒPH$·PFGP/ÒPEJGPDKU 0KGOCPP&GVNGX$GYGTVWPIU-CVCNQI&GWVUEJNCPF2TKEG)WKFG)GTOCP[-C!C!Q!1TFGP'JTGP\GKEJGP 8GTNGKJWPIU7TMWPFGP/KPKCVWTGPWPF'VWKU1TFGTU&GEQTCVKQPU#YCTF&QEWOGPVU/KPKCVWTGUCPF%CUGUQH+UUWG 1ðäåíàçíCêèQòëè÷èÿíàãðàäíü³å äîêóìåíòü³ìèíèàòþðü³ è ôóòëÿðü³*CODWTI#WHNCIG 0QTFGPXCNN2GT-WPINKIC5GTCHKOGTQTFGP5VQEMJQNO 1DGTNGKVPGT5VGHCP2QNUMKG1TFGT[1F\PCE\GPKC<KGNQPC)QTC 0KOOGTIWV ,ÌTI DGCTDGKVGV XQP &T )GTF 5EJCTHGPDGTI &GWVUEJG 1TFGP WPF 'JTGP\GKEJGP   #WUICDG  4GIGPUVCWHMQORNGVVÒDGTCTDGKVGVGWPFCMVWCNKUKGTVG#WHNCIG 9GTNKEJ4QDGTV1TFGTUCPF&GEQTCVKQPUQHCNN0CVKQPUņ#PEKGPVCPF/QFGTPņ%KXKNCPF/KNKVCT[9CUJKPIVQP#WHNCIG \YGKVGT&TWEM 2TGXKVGTC5VGRJGP6JQOCU6JG+TQP6KOG#*KUVQT[QHVJG+TQP%TQUU4KEJOQPF8KTIKPKC 2TQEJ±\MC4QOCP(TGKJGTTXQP¤UVGTTGKEJKUEJGU1TFGPUJCPFDWEJņ)TQ­G#WUICDG$CPFDKU/ÒPEJGP 2GTINGT2GVGT2CWNWPF5VQN\GT,QJCPP&GWU.Q8WNV&GT4KVVGTQTFGPXQO*GKNKIGP)TCDGXQP,GTWUCNGO9KGP 2QNKCPQ.WKU/CTSWGU1TFGPU*QPQTKHKECUFQ$TCUKN4KQFG,CPGKTQ -NGPCW #TPJCTF )TCH WPF 5CWGTYCNF 2GVGT &KG 1TFGP WPF 'JTGP\GKEJGP FGU -ÌPKITGKEJU 2TGW­GP  (CTDMCVCNQI OKV 2TGKUGP1HHGPDCEJCO/CKP 2GVGTUQP,COGU99GCXGT$CT[[%WPF3WKING[/KEJCGN#1TFGTUCPF/GFCNUQH,CRCPCPF#UUQEKCVGF5VCVGU5CP 4COQP 2WEJCNUMK<DKIPKGYWPF9QLEKGEJQYUMK+TGPGWU\,1TFGT[KQF\PCE\GPKCRQNUMKGKKEJMCYCNGTQYKG9CTUEJCW 4QHHKIPCE0KEQNCUFG1TFTGUGV/¾FCKNNGUFGU2C[UF #HTKSWG¯N 'RQSWG2QUV%QNQPKCNGFG¯PQU,QWTU2CTKU 4QUUGCW2KGTTG1TFTGUGV&¾EQTCVKQPUFGN 'ORKTG%J¾TKHKGP CW 6GORU FW 2TQVGEVQTCV (TCPECKU CW /CTQE    8GTUCKNNGU 4QOCPQHH2TKPEG&KOKVTK6JG1TFGTU/GFCNUCPF*KUVQT[QH+ORGTKCN4WUUKC4WPIUVGF-[UV 5CPMQ99 *I 0CITWFPKGRQNMQYKGUPCMK4QUUKK%JGUVTGIKOGPVDCFIGUQH4WUUKC4GIKOGPVUCD\GKEJGP4W­NCPFU /QUMCWWPF/KPUM 4QVJ 'TJCTF 8GTNGKJWPIGP FGU MÌPKINKEJ U·EJUKUEJGP 8GTFKGPUVQTFGPU OKV 5EJYGTVGTP FGU #NDTGEJVUQTFGPU OKV 5EJYGTVGTP CW­GT4KVVGTMTGW\-NCUUGOKV5EJYGTVGTP WPFFGU'JTGPMTGW\GUOKV5EJYGTVGTPKO'TUVGP9GNVMTKGI 1HHGPDCEJCO/CKP 5CPMQ 9 9 *I  0CITCFPKG K RCOLCVPKG UPCMK 4QUUKK  &GEQTCVKQPU CPF /GOQTKCN $CFIGU QH 4WUUKC  'JTGP WPF )GFGPM\GKEJGP4W­NCPFU/KPUM 5EJCTHGPDGTI)GTF&KG1TFGPWPF'JTGP\GKEJGPFGT#PJCNVKUEJGP5VCCVGP1HHGPDCEJCO/CKP 5CEECTGNNQ4QDGTVQ)NK1TFKPKECXCNGTGUEJKFGNNC4GCN%CUCFK$QTDQPGFGNNG&WG5KEKNKG8KEGP\C 5CEECTGNNQ4QDGTVQ+N5CETQ/KNKVCTG1TFKPG%QPUVCPVKPKCPQFK5CP)KQTIKQ5VQTKC+UVKVW\KQPK+PUGIPG8KVGTDQ 5CEECTGNNQ4QDGTVQ)NK1TFKPK'SWGUVTK2QPVKHKEKCFWPUGEQNQFCNNC4KHQTOCFK2KQ:8KEGP\C 5EJYCTM4GKPGT1TFGPWPF'JTGP\GKEJGPFGU(ÒTUVGPVWOU.KRRG&GVOQNF&GVOQNF 5GYCTF&GUOQPF+VCN[ U-PKIJVUQH5V)GQTIG6JG%QPUVCPVKPKCP1TFGT)GTTCTFU%TQUU 5CNNCEJ #NGZCPFGT XQP &KG 1TFGP WPF 'JTGP\GKEJGP WPUGTGT 4GRWDNKM  &TKVVG #WHNCIG -QPUVCP\ FTKVVG GTJGDNKEJ GTYGKVGTVGWPFXQNNMQOOGPÒDGTCTDGKVGVG#WHNCIG -NGKP 7NTKEJ WPF 4CHH #NDGTV &KG 9ÒTVVGODGTIKUEJGP /GFCKNNGP XQP  GKPUEJNKG­NKEJ FGT 1TFGP WPF 'JTGP\GKEJGP 5VWVVICTV 5EJPGKFGT.QWKU&CU$WEJXQO'KUGTPGP-TGW\G0CEJFTWEM$GTNKPFGT#WUICDG$GTNKP 5RCFC&T#PVQPKQ1TFKPK&KPCUVKEKFGNNC4GCN%CUCFK$QTDQPGFGNNG&WG5KEKNKG$TGUEKC

347


52/ 525 54

5RCFC&T#PVQPKQ5QXTCPQ/KNKVCTG1TFKPGFK/CNVC$TGUEKC 5RCFC&T#PVQPKQ1TFKPK&KPCUVKEKFGNNC4GCN%CUCFK5CXQKC$TGUEKC 5QW[TKU4QNNCPF#PFT¾)WKFGFGU1TFTGU&¾EQTCVKQPUGV/¾FCKNNGU/KNKVCKTGU(TCPECKUGUGV—VTCPI½TGU2CTKU  56/ 5VGGD%JTKUVKCPWPF5VTKOKV\GT$KTIKV&GT5QWXGT·PG/CNVGUGT4KVVGT1TFGPKP¤UVGTTGKEJ)TC\ 6# #WVGPITWDGT/KEJCGNWPF6COOCPP)#PFTGCU-CVCNQI\WT#WMVKQPWPF0QXGODGT1TFGPCWUCNNGT 9GNVņ5COONWPI6COOCPP9QTNF1TFGTUņ%QNNGEVKQP6COOCPP$CUGN 6*1 6JQTPKV2GT6JG4Q[CN%QOOGOQTCVKXGCPF%QTQPCVKQP/GFCNUQH5ECPFKPCXKC-QRGPJCIGP 6+5 6JQTNCEKWU$KTIKT+UNGPUM*GKFWTUOGTMK*±UMÉNCÐVI±HCP 64) 6TKIWGKTQU #PVÉPKQ / WPF 6COOCPP )WUVCX # 6JG 6JTGG 2QTVWIGUUG /KNKVCT[ 1TFGTU QH -PKIJVJQQF    )NCUUDQTQ 642 6COOCPP)WUVCX#+ORGTKCN4WUUKCP/CMGTU /CTMUQP1TFGTUCPF&GEQTCVKQPU.QPFQP 7$ 7DGTVK2KGT(GNKEGFGINKWPF2KPQVVK/CTKC.QTGFCPC+%CXCNKGTKFGN2CRC)NK1TFKPK'SWGUVTKGINK1PQTKFGNNC5CPVC 5GFG'FK\KQPG%QNQTCVC1JPG1TVUCPICDGPCEJ 75 5EJTQEM7NTKEJ')&GWVUEJG4GIKOGPVULWDKN·GPCWH/GFCKNNGPWPF#D\GKEJGPXQPDKU4GIGPUVCWH 8# #TPFV.WFYKIWPF5EJCTHGPDGTI)GTF8GTFKGPVWO#PJCNV8GTNGKJWPIGPFGU*GT\QINKEJ#PJCNVKUEJGP8GTFKGPUVQTFGPU HÒT9KUUGPUEJCHVWPF-WPUVCP2GTUÌPNKEJMGKVGPCW­GTJCND#PJCNVU&GUUCW 8. 8QNNG*GPPKPI$CFGPU1TFGP(TGKDWTI 82'82' 8QNRG/CTKQ5KIPUQH*QPQWT%QORGPFKWOQHQTFGTUQHMPKIJVJQQFCPFJQPQWTUQH+VCN['WTQRGCPFVJGTGUVQHVJG 9QTNF4QO 9$ 9GDGT&KGVGT#TPQNF2CWNWPF-GKN2GVGT&KG1TFGPFGU-ÌPKITGKEJU5CEJUGP1HHGPDCEJCO/CKP 9. 9CNVGT*CPPGU'GUVK6GGPGVGO·TIKF'UVQPKCP1TFGTUCPF&GEQTCVKQPU6CNNKPP 94& 9TGFG'((KPNCPFU7VO·TMGNUGVGEMGP*GNUKPMK 95 9GUQNQYUMK &T <F\KUNCY 2 2QNKUJ 1TFGTU /GFCNU $CFIGU CPF +PUKIPKC  /KNKVCT[ CPF %KXKNKCP &GEQTCVKQPU   /KCOK 98/ 9GUQNQYUMK&T<F\KUNCY26JG1TFGTUQHVJG8KTVWVK/KNKVCTKCPFKVU%CXCNKGTU/KCOK 9< 9KGNCPFV(TKGFTKEJWPF<GKV\,QCEJKO&GPMOÒP\GP\WT)GUEJKEJVGFGU\·JTKPIKUEJGPDCFKUEJGP(ÒTUVGPJCWUGUCWUFGT <GKVXQPDKU-CTNUTWJG <GKIG%CTUVGP'WTQR·KUEJG1TFGP QJPG&GWVUEJNCPF XQP2TGKUMCVCNQI*CODWTI#WUICDG <-

ERHALTUNGS- UND SELTENHEITSGRADE 1TFGP'JTGP\GKEJGPWPFJKUVQTKUEJG5COONWPIUIGIGPUV·PFGUKPF1DLGMVGFKG\WO6TCIGPD\Y\WO)GDTCWEJDGUVKOOVYCTGP WPFUQOKVGKPGTPCVWTIGO·­GP#DPWV\WPIWPVGTNKGIGP$GUQPFGTUDGKHTÒJGP'ZGORNCTGPDGTÒEMUKEJVKIVFKG'TJCNVWPIUGKPUVWHWPI FCU #NVGT /·PIGN QFGT $GUEJ·FKIWPIGP FKG ÒDGT FCU ÒDNKEJG /C­ JKPCWUIGJGP YGTFGP KP FGT $GUEJTGKDWPI CWUFTÒEMNKEJ GTY·JPV 9KT YGKUGP KP FKGUGO <WUCOOGPJCPI CWEJ CWUFTÒEMNKEJ FCTCWH JKP FC­ FGT -WPFG FKG /ÌINKEJMGKV \WT 8QTDGUKEJVKIWPIXQTFGT8GTUVGKIGTWPIJCV 'TJCNVWPIUCPICDGPCNU'TIGDPKUUWDLGMVKXGT$GVTCEJVWPIUKPFMGKP$GUVCPFVGKNFGT$GUEJTGKDWPI&GTLGYGKNKIG'TJCNVWPIU\WUVCPF KUVPCEJFGT$GUEJTGKDWPIYKGHQNIVCPIGIGDGP + ++ +++ +8

348

   

2TCEJVGZGORNCTPGWYGTVKIQFGTPGW XQT\ÒINKEJGTJCNVGPOKVMNGKPGP)GDTCWEJUURWTGP IWVGTJCNVGPOKV)GDTCWEJUURWTGP OKVUGJTFGWVNKEJGP)GDTCWEJUURWTGP


Bei uns sind Sie goldrichtig!

• Über 35 Jahre Erfahrung im Gold- und Münzenhandel • Faire und objektive Bewertung Ihrer Goldmünzen • Barankauf von Goldmünzen zu tagesaktuellen Preisen • Große Auswahl interessanter Goldmünzen • Vertrauen Sie Europas führendem Auktionshaus für Münzen und Medaillen

Sie möchten Ihre Münzen veräußern? 0800 5836537 (gebührenfrei) Fritz Rudolf Künker GmbH & Co. KG Gutenbergstraße 23 · 49076 Osnabrück · Germany Tel. +49 (0)541 96 20 20 · Fax +49 (0)541 96 20 222 www.kuenker.de · service@kuenker.de Osnabrück · Berlin · München · Zürich · Moskau


Pieter Brueghel d. J. Der Alchemist. Öl auf Holz, 68,8 x 96 cm. Verkauft für e 1.700.000,-

Höchstes Ergebnis für ein Altmeister-Gemälde 2010 in Deutschland

Einladung zu Einlieferungen für unsere Herbstauktionen 2011 Möbel, Porzellan, Fayence, Silber, Schmuck Gemälde, Zeichnungen, Skulpturen 15.–19. Jh. Zeitgenössische Kunst, Moderne Kunst, Design Photographie, Asiatische Kunst, Tribal Art

L E M PE RTZ Neumarkt 3 50667 Köln Poststraße 22 10178 Berlin St.-Anna-Platz 3 80538 München www.Lempertz.com

Tel. 02 21 ⁄ 92 57 29 - 0 Fax - 6 Tel. 030 ⁄ 27 87 60 8 - 0 Fax - 6 Tel. 089 ⁄ 98 10 77 67 Fax 21 01 96 95 info@Lempertz.com


Künker eAuctions

Künker eAuctions

Unsere eAuctions umfassen circa 250 Losnummern. In einem festgelegten Zeitraum von 14 Tagen haben Sie die Möglichkeit, online auf die für Sie interessanten Münzen und Medaillen zu bieten. Die einzelnen Losnummern laufen zeitlich versetzt aus. Selbstverständlich werden Sie über Ihren aktuellen Gebotsstatus laufend per Email informiert und können Ihre Gebote bei Bedarf bis zur letzten Sekunde erhöhen.

Our eAuctions contain 250 lots. During a fixed period of 14 days you have the opportunity to submit your bids online on your favourite coins and medals.

Weitere Informationen und die nächsten Termine zu den Künker eAuctions finden Sie unter:

You may find further information and the next dates of the Künker eAuctions here:

www.kuenker.de

www.kuenker.com

Each lot will expire at different times. Certainly you will be informed constantly by email about the current status of your bids so that you permanent have the possibility – if necessary – to raise your bids till the end of the eAuction.

Fritz Rudolf Künker GmbH & Co. KG Gutenbergstraße 23 · 49076 Osnabrück · Germany Tel. +49 (0)541 96 20 20 · Fax +49 (0)541 96 20 222 www.kuenker.de · service@kuenker.de Osnabrück · Berlin · München · Zürich


Leitfaden zur erfolgreichen schriftlichen Auktionsteilnahme • • • • •

Studieren Sie den Katalog sorgfältig und notieren Sie alle Lose, die interessant für Sie sind. Legen Sie für jedes Los Ihr persönliches Limit fest, das Sie maximal zu zahlen bereit sind. Füllen Sie das beiliegende Formular aus (siehe unten) und tragen Sie für jedes Los Ihr Höchstgebot ein. Schicken Sie uns Ihren Auftrag frühzeitig. Bei gleich hohen Geboten erhält das zuerst eingegangene Gebot den Zuschlag. Sie haben interessante Lose für insgesamt € 10.000,– gefunden, möchten jedoch nur € 2.000,– ausgeben. Kein Problem: Sie geben als Gesamtlimit (ohne Aufgeld) € 2.000,– an. • Wenn Sie Fragen haben: Die MitarbeiterInnen unserer Kundenbetreuung sind für Sie da: Telefon 0800 583 65 37 (gebührenfrei). • Wenn Sie telefonisch an unseren Auktionen teilnehmen möchten, ist das ab einer Schätzung von € 500,– pro Los möglich. Bitte teilen Sie uns diesen Wunsch mindestens einen Werktag vor Beginn der Versteigerung schriftlich mit.

Musterauftrag für schriftliche Gebote Name, Adresse, Telefon Ihre vollständige Anschrift ist wichtig, damit wir Ihren Auktionsauftrag annehmen und bearbeiten können. Ihre Telefonnummer brauchen wir, um Sie bei Rückfragen zu Ihren Geboten schnell erreichen zu können.

Ihre Kundennummer Die Angabe Ihrer Kundennummer unterstützt uns bei der Bearbeitung Ihres Auktionsauftrages. Viele Vorarbeiten für die Auktion werden dadurch einfacher und es werden Fehler vermieden.

Losnummern und Gebote Listen Sie alle Lose, für die Sie sich interessieren, mit ihrer Katalognummer auf und legen Sie für sich selbst fest, wie viel Sie bereit sind, für jedes einzelne Los zu bieten.

Ihr Limit pro Einzellos An dieser Stelle geben Sie an, was Sie für jedes einzelne Stück maximal bereit sind auszugeben.

„Oder“-Gebote Wenn Sie sich für mehrere Münzen interessieren, aber nur ein Stück davon erwerben wollen, können Sie Ihre Gebote einfach mit einem „Oder“ verbinden. Wichtig: bei den „Oder“Geboten können Sie nicht auf frühere Katalognummern zurückgreifen (z. B. 2890 oder 1558), da die Nr. 1558 dann bereits versteigert ist. Unterschreiben Sie Ihren Auktionsauftrag ... ... nachdem Sie Ihre Angaben noch einmal überprüft haben. Ihre Unterschrift ist wichtig, denn damit bestätigen Sie uns, dass sie tatsächlich teilnehmen wollen.

Überschreitung Ihrer Limits pro Einzellos In der Praxis zeigt sich, dass oft mehrere Bieter mit ihren Geboten dicht beieinander liegen. Deshalb empfiehlt es sich, an dieser Stelle einer geringfügigen Überschreitung Ihrer Gebote zuzustimmen. Dadurch erhöhen sich Ihre Chancen, im Wettbewerb mit anderen den Zuschlag zu erhalten.

Begrenzung Ihres Gesamtlimits Hier können sie die Gesamtsumme Ihrer Gebote begrenzen und festlegen, was Sie insgesamt maximal bereit sind auszugeben. Aufgeld und Mehrwertsteuer kommen später noch hinzu.

TEL +49 (0)541 96 20 20, FAX +49 (0)541 96 20 222, SERVICE@KUENKER.DE, WWW.KUENKER.DE


Wie entsteht der Preis einer Auktion? Der im Auktionskatalog angegebene Preis ist ein Schätzpreis, der durch unsere Experten festgelegt wurde. Das Mindestgebot liegt bei 80 % dieses Wertes. Die Zuschlagpreise sind oft deutlich höher als die Schätzpreise. Als Auktionshaus müssen wir bereits vor der Auktion alle schriftlichen Gebote koordinieren. Folgende Beispiele sind im Bietverfahren möglich: Beispiel 1 (Schätzpreis: € 1.000,–) Es liegt kein schriftlicher Auftrag vor: Der Auktionator ruft das Los in der Auktion mit € 800,– aus. Wenn im Saal nur ein Bieter darauf ein Gebot abgibt, erhält der Saalbieter den Zuschlag für € 800,–.

Beispiel 3 (Schätzpreis: € 1.000,–) Es liegt dem Auktionator nur ein schriftliches Gebot von € 850,– vor: Das Los wird in der Auktion mit € 800,– ausgerufen. Falls kein Bieter im Saal ein Gegenangebot abgibt, erhält der schriftliche Bieter den Zuschlag bei € 800,–.

Beispiel 2 (Schätzpreis: € 1.000,–) Es liegen dem Auktionator drei schriftliche Gebote vor:

Beispiel 4 (Schätzpreis: € 1.000,–) Es liegt dem Auktionator nur ein schriftliches Gebot von € 1.200,– vor: Der Auktionator ruft das Los mit € 800,– aus. Gibt es im Saal keinen Gegenbieter, erhält der schriftliche Bieter den Zuschlag bei € 800,–. Falls es im Saal Gegenbieter gibt, bietet der Auktionator für seinen schriftlichen Bieter bis maximal € 1.200,– und erteilt einem Gegenbieter im Saal erst bei mehr als € 1.200,– den Zuschlag.

Bieter 1: Limit € 2.900,– Bieter 2: Limit € 1.800,– Bieter 3: Limit € 800,– Nach der Versteigerungsordnung muss der Auktionator im Interesse von Bieter 1 und 2 angemessen überbieten (um ca. 5 bis 10 %). Der Ausrufpreis in der Auktion beträgt daher im Interesse von Bieter 1 € 1.900,– (obwohl die Schätzung € 1.000,– beträgt). Falls keine höheren Gebote aus dem Saal erfolgen, erhält Bieter 1 den Zuschlag für € 1.900,–. Das Höchstangebot von € 2.900,– musste nicht ausgeschöpft werden.

Beispiel 5 (Schätzpreis: € 1.000,–) Es liegen drei Gebote von je € 975,– vor: Um Missverständnisse zu vermeiden, überzieht der Auktionator das zuerst eingegangene Gebot geringfügig und erteilt den Zuschlag bei € 1.000,–.

Antworten auf Fragen, die uns oft gestellt werden • Zuschlagpreis/Aufgeld: Wir berechnen als Auktionshaus ein Aufgeld von 15 % auf den Zuschlagpreis, dazu kommt die gesetzliche Mehrwertsteuer. Beispiel 1

Zuschlagpreis Aufgeld 15 % Versandkosten, z. B. * MwSt. 7 % Rechnungs-Betrag

€ € € € €

100,00 15,00 5,90 8,46 129,36

Beispiel 2

Zuschlagpreis Aufgeld 15 % Versandkosten, z. B. * MwSt. 7 % Rechnungs-Betrag

€ 1.000,00 € 150,00 € 5,90 € 80,91 € 1.236,81

• Mehrwertsteuer: üblicherweise in Deutschland 7 %, seit dem 01.01.2000 sind viele Goldmünzen, die nach 1800 geprägt wurden, steuerfrei. Bei Fragen zu der MwSt.-Berechnung rufen Sie uns an, gebührenfrei unter: 0800 583 65 37. • Rücklosverkauf: Alle Lose, die in der Auktion nicht verkauft wurden, können Sie innerhalb von vier Wochen nach der Versteigerung zu 80 % des Schätzpreises (zzgl. Aufgeld und Mehrwertsteuer) erwerben. Achtung: Viele Rücklose sind schnell vergriffen. • Unser Spezialservice: Alle Bieter erhalten gratis die Ergebnisliste innerhalb von zwei Wochen nach der Auktion. Im Internet können Sie die Ergebnisliste der Auktion sofort nach der Auktion unter www.kuenker.de einsehen. * Die Kosten für Versand und Versicherung werden nach Aufwand berechnet.

Besuchen Sie uns doch einmal persönlich auf der Auktion! • Wir freuen uns sehr, wenn Sie persönlich nach Osnabrück kommen möchten. Das Flair einer Auktion und die Stimmung im Auktionssaal sind ein besonderes Erlebnis für Sie als Sammler. Osnabrück ist außerdem immer eine Reise wert und die persönliche Betreuung durch unsere Mitarbeiter wissen immer mehr Kunden zu schätzen. • Bitte rufen Sie uns rechtzeitig an, damit wir Ihnen Tipps für die Anreise geben und Ihnen ein Hotelzimmer reservieren können. Sie erreichen uns gebührenfrei unter: 0800 583 65 37. • Als erfolgreicher Bieter können Sie Ihre neu erworbenen Stücke gleich persönlich mit nach Hause nehmen. Als guter Kunde unseres Hauses haben Sie 20 Tage Zahlungsziel nach der Auktion.

TEL +49 (0)541 96 20 20, FAX +49 (0)541 96 20 222, SERVICE@KUENKER.DE, WWW.KUENKER.DE


Важная информация об участии на аукционе • Наши аукционные правила и условия Вы можете найти в конце каталога. • Мы просим Вас присылать Ваши ставки заранее. В противном случае вероятность ошибки при обработке заказа, присланного перед самым аукционом, возрастает. • Приложенный образец заполнения письменного заказа поможет Вам при отправлении Ваших письменных ставок. Ставки можно отправить как по почте, так и по факсу : +49 (0)541–96 20 222 круглосуточно. • Успешные заказы будут обрабатываться в порядке их поступления к нам. Все участники, которым не удалось что-либо купить на аукционе, будут также проинформированы после аукциона. • Если Вы впервые принимаете участие в нашем аукционе, то мы рекомендуем Вам сообщить нам Ваш референц – аукционные дома, с которыми Вы уже сотрудничали. Или свяжитесь с нами по телефону. • Мы гарантируем подлинность всех предметов, проданных на нашем аукционе, в течении неограниченного времени. • Все участники нашего аукциона получают в течении 2-ух недель результаты торгов бесплатно. • У Вас есть вопросы по определенной монете? Вы хотели бы лично принять участие в аукционе? У Вас возникли другие вопросы? Звоните нам по телефону +49 (0)541-96 20 268, и мы будем рады Вам помочь.

Мое заочное участие на аукционе • • • •

Тщательно изучите наш каталог и запишите те лоты, которые Вас заинтересовали. Определите для Себя ту максимальную сумму, которую Вы готовы заплатить за каждый лот. Заполните приложенный формуляр. Отправьте нам Ваш заказ заранее. При 2-ух и более равных ставок на один и тот же лот преимущество получает ставка, пришедшая к нам первой ( ранее других ). • Если стоимость выбранных Вами лотов составляет например 10.000 евро, а Вы могли бы потратить только 2.000 евро, то в этом случае укажите Ваш общий лимит в размере 2.000 евро. • Если у Вас возникли вопросы по заполнению формуляра, звоните нам по телефону +49 (0)541-96 20 268. Наши сотрудники будут рады Вам помочь.

Мое личное участие в Оснабрюке • Мы будем рады Вашему личному присутствию в Оснабрюке. Атмосфера, которая стоит во время аукционных торгов в зале, особенная и непередаваемая. • Для получения более подробной информации по Вашей поездке в Оснабрюк, в частности, бронирования номеров в гостинице, мы просим Вас заранее связаться с нами по телефону: +49 (0)541-96 20 268. • Приобретенные на аукционе лоты Вы можете лично забрать после окончания торгов. Наши постоянные клиенты осуществляют оплату в течение 20 дней после получения счета. Участвующие в аукционе впервые осуществляют 100%-ую предоплату.

Участие по интернету Все каталоги доступны для просмотра на нашем сайте в интернете по адресу www.kuenker.de. На сайте Вы можете выбрать интересующие Вас лоты и отправить Ваши ставки на нашу электронную почту service@kuenker.de. Если у Вас возникнут дополнительные вопросы, мы просим Вас связаться с нами по телефону +49 (0)5 41-96 20 268.

Участие по телефону Для участия в торгах по телефону просим Вас связаться с нами не позднее 48 часов до начала аукциона. Условием проведения телефонных торгов является письменное подтверждение ставки, равной как минимум стартовой цене. Участие в телефонных торгах возможно только для лотов со стартовой ценой свыше 500 евро. Для получения дополнительной информации и регистрации на аукционе звоните Анастасии Кепселль до аукциона по телефону +49 (0)5 41-96 20 268 и во время аукциона по телефону, указанному на первой странице каталога.

TEL +49 (0)541 96 20 20, FAX +49 (0)541 96 20 222, SERVICE@KUENKER.DE, WWW.KUENKER.DE


Как образовывается цена на аукционе? • Все лоты в нашем каталоге были предварительно оценены нашими экпертами. Минимальная ставка составляет 80 % от оценочной стоимости лота. Конечные цены зачастую намного превышают оценочные. • Ваши письменные ( заочные ) ставки должны быть обязательно обработаны нашими сотрудниками до начала аукциона. Рассмотрим несколько возможных примеров: Пример 1 ( Оценочная стоимость: € 1.000,– ) Заочных ставок нет. Аукционатор начинает торги с € 800,–. Если в зале только один человек, желающий приобрести этот лот, то соответственно он получит его за € 800,–. Пример 2 ( Оценочная стоимость: € 1.000,– ) У аукционатора имеются 3 заочные ставки: Заочный участник 1 : Лимит € 2.900,– Заочный участник 2 : Лимит € 1.800,– Заочный участник 3 : Лимит € 800,– По правилам аукциона аукционатор в интересах заочного участника 1 и 2 должен повышать ставку равномерно ( приблизительно на 5 – 10 % ). Поэтому в нашем случае в интересах заочного участника 1 аукционатор начнет торги с € 1.900,– ( хотя оценочная стоимость составляет € 1.000,–). Если среди очных участников никто не даст более высокую ставку, то заочный участник 1 получит этот лот за € 1.900,–. Его лимит в € 2.900,– ни в коем случае не будет исчерпан.

Пример 4 (Оценочная стоимость: € 1.000,– ) У аукционатора имеется только 1 заочная ставка в размере € 1.200,–. Аукционатор начнет торги с € 800,–. Если среди очных участников никто не даст более высокую ставку, то заочный участник получит этот лот за € 800,–. Если же в зале очный участник согласен на более высокую ставку ( больше € 800,– ), то в этом случае аукционатор в интересах заочного участника имеет право тоговаться до € 1.200,–. Следовательно только при ставке, превышающей € 1.200,–, данный лот получит очный участник в зале. Пример 5 (Оценочная стоимость: € 1.000,– ) У аукционатора имеются 3 заочные ставки, каждая в размере € 975,–. Среди очных участников интереса к лоту не имеется. В этом случае чтобы избежать недоразумений, аукционатор имеет право ненамного повысить лимит и сделать ставку равной € 1.000,–. Данный лот за € 1.000,– получит тот заочный участник, чей письменный формуляр мы получили раньше всего.

Пример 3 (Оценочная стоимость: € 1.000,– ) У аукционатора имеется только 1 заочная ставка в размере € 850,–. Аукционатор начнет торги с € 800,–. Если среди очных участников никто не даст более высокую ставку, то заочный участник получит этот лот за € 800,–.

Как я могу получить приобретенные лоты? Вывоз приобретенных на аукционе предметов осуществляется одним из следующих способов по Вашему выбору: • Вы можете лично забрать Ваши лоты. По окончании торгов мы готовим все необходимые документы на вывоз из Германии. При вывозе за пределы Евросоюза, НДС Вам возвращается. • Почтовые отправки в Россию ( Беларусь, Украину ) приобретенных Вами лотов осуществляются по предварительной договоренности. Для связи с нами звоните нам по телефону +49 (0)541-96 20 268. С 1971 года имя Кюнкер является гарантией надежности и компетентности. Мы не станем изменять нашим принципам и в будущем. Спасибо Вам за Ваше доверие, которое является не только самым сильным стимулом в нашей работе, но и наилучшей ее оценкой. Я желаю Вам успехов на нашем аукционе!

Фриц-Рудольф Кюнкер

TEL +49 (0)541 96 20 20, FAX +49 (0)541 96 20 222, SERVICE@KUENKER.DE, WWW.KUENKER.DE


Versteigerungsbedingungen Die Versteigerung erfolgt im Auftrag und für Rechnung der Eigentümer unter Einhaltung der sich aus der Versteigerungsordnung (BGB1 I 1976, 1346) ergebenden und für Kommissionäre geltenden gesetzlichen Bestimmungen des BGB und HGB gegen Barzahlung des Kaufpreises in €-Währung. Durch Abgabe eines Gebotes werden die Versteigerungsbedingungen anerkannt, dies gilt auch für die schriftlichen Gebote. Der Zuschlagpreis ist Nettopreis im Sinne des Umsatzsteuergesetzes und bildet die Berechnungsgrundlage für das vom Käufer zu zahlende Aufgeld in Höhe von 15 %. Auf den daraus entstehenden Gesamtpreis (Zuschlag + Aufgeld) wird die jeweils gültige Umsatzsteuer erhoben, soweit dies gesetzlich vorgeschrieben ist. Ausländischen Käufern aus Ländern der europäischen Gemeinschaft wird die in Deutschland gültige Umsatzsteuer berechnet. Anderen ausländischen Käufern (aus Drittländern) wird, sofern die Münzen durch uns exportiert werden, ein Aufgeld von 15 % netto auf den Zuschlagpreis berechnet; sie erhalten die Lieferung nur gegen Zahlung des Kaufpreises in €-Währung, bankspesenfrei. Ausländischen Münzhändlern aus Ländern der europäischen Gemeinschaft wird bei Nachweis der Umsatzsteuer-Identifi kationsnummer (§ 27 a USTG) und der sonstigen Voraussetzungen gemäß § 4 Nr. 1 b USTG in Verbindung mit § 6 a USTG die Lieferung ohne Umsatzsteuer berechnet. Sofern nichts anderes vereinbart wird, ist die Zahlung der Auktionsrechnung bei anwesenden Käufern sofort, bei schriftlichen Bietern spätestens 20 Tage nach Erhalt fällig. Bei Zahlungsverzug werden Zinsen von 1 % pro Monat berechnet. Wird die Zahlung nicht sofort an den Versteigerer geleistet oder die Abnahme der zugeschlagenen Sache verweigert, so findet die Übergabe der Sache an den Ersteigerer nicht statt. Der Ersteigerer verliert vielmehr seine Rechte aus dem Zuschlag, und die Sache kann auf seine Kosten erneut versteigert werden. In diesem Fall haftet der Ersteigerer für den Ausfall, dagegen hat er auf den Mehrerlös keinen Anspruch. Der Zuschlag erfolgt nach dreimaligem Ausruf des höchsten Gebotes und verpflichtet zur Abnahme und Zahlung. Bei Meinungsverschiedenheiten über den Zuschlag wird die Nummer noch einmal ausgerufen. Der Versteigerer ist berechtigt, Nummern zu vereinigen oder zu trennen. Eine Vorausnahme von Nummern erfolgt nicht. Der Zutritt zur Versteigerung ist nur Interessenten gestattet, die einen Katalog besitzen. Die Mindeststeigerungsstufen für das Bietungsverfahren betragen: Gebote

Mindeststeigerungsstufe

Schriftliche Aufträge werden von uns ohne Auftragsprovision gewissenhaft ausgeführt. Aufträge von uns unbekannten Sammlern können nur ausgeführt werden, wenn ein Depot hinterlegt wird oder Referenzen benannt werden. Schriftliche Gebote können nur bis 24 Stunden vor Auktionsbeginn verbindlich berücksichtigt werden. Im Bedarfsfall ist der Auktionator berechtigt, die Limits um 3 – 5 % zu überschreiten. Bei mehreren gleichhohen Geboten erhält das zuerst eingegangene den Zuschlag. Unlimitierte Aufträge haben keinen Anspruch auf unbedingte Ausführung. Telefonisches Bieten ist nur in Ausnahmefällen möglich. Telefonische Bieter müssen sich mindestens einen Werktag vor der Auktion voranmelden. Der Versand geht zu Lasten und auf Risiko des Ersteigerers bzw. Empfängers. Das Auktionsgut bleibt bis zur vollständigen Bezahlung aller Forderungen aus Anlass der Versteigerung Eigentum des Verkäufers. Ist der Käufer Vollkaufmann, so ist Osnabrück als Gerichtsstand vereinbart. Für das Mahnverfahren gilt die Zuständigkeit des Amtsgerichts Osnabrück auch in allen anderen Fällen als vereinbart. Ansonsten ist es Osnabrück nur, wenn nur die Firma Fritz Rudolf Künker GmbH & Co. KG ihren allgemeinen Gerichtsstand in der BRD hat, oder wenn alle Ansprüche im Wege des Mahnverfahrens geltend gemacht werden, oder wenn die im Klageweg in Anspruch zu nehmende Vertragspartei nach Vertragsabschluss ihren gewöhnlichen Aufenthaltsort aus dem Geltungsbereich der BRD verlegt hat, oder ihr Wohnsitz oder gewöhnlicher Aufenthaltsort zum Zeitpunkt der Klage nicht bekannt ist. Die Beschreibung im Katalog ist gewissenhaft durchgeführt. Sie begründet jedoch keine Rechts- oder Sachmängelhaftung gemäß §§ 434, 459 ff BGB. Die Angabe der Erhaltung ist streng nach den im deutschen Münzhandel üblichen Erhaltungseinstufungen vorgenommen und gilt als persönliche Beurteilung. Bei der Auktion anwesende Käufer kaufen grundsätzlich „wie besehen“. Da durch Vorbesichtigung Gelegenheit gegeben ist, sich vom Erhaltungszustand des Versteigerungsgutes zu überzeugen, können nach erfolgtem Zuschlag Reklamationen nur bei irrtümlich übersehener Henkel- oder Fassungsspur oder gestopftem Loch berücksichtigt werden. Bei Losen mit mehreren Stücken sind die Stückzahlen nur Circa-Angaben, irrtümliche Zuschreibungen sind im Einzelfall nicht ausgeschlossen. Diese Lose sind nach erfolgtem Zuschlag von jeder Reklamation ausgeschlossen. Der Versteigerer kann bei eventuellen Meinungsverschiedenheiten bzw. Beanstandungen einen vereidigten Sachverständigen seiner Wahl (die Kosten trägt der unterliegende Teil) beauftragen. Eventuelle Beanstandungen können nur innerhalb von 8 Tagen nach der Auktion bzw. nach Erhalt der ersteigerten Stücke berücksichtigt werden. Die Echtheit der Stücke wird bis zur Höhe des Kaufpreises garantiert. Die beigedruckten Preise sind Schätzpreise, die unter- oder überschritten werden können. Aufträge, die unter 80 % des Schätzpreises liegen, können nicht bearbeitet werden.

bis zu

€ 100,–

€ 5,–

bis zu

€ 200,–

€ 10,–

bis zu

€ 500,–

€ 20,–

bis zu

€ 1.000,–

€ 50,–

bis zu

€ 2.000,–

€ 100,–

Soweit nicht anders vermerkt, gelten im übrigen die allgemeinen Versteigerungsbestimmungen und – auch im Verhältnis zu ausländischen Kunden – gilt Deutsches Recht.

bis zu

€ 5.000,–

€ 200,–

Die Ergebnisliste erscheint sofort nach der Auktion.

bis zu

€ 10.000,–

€ 500,–

bis zu

€ 20.000,–

€ 1.000,–

bis zu

€ 50.000,–

€ 2.000,–

bis zu

€ 100.000,–

€ 5.000,–

ab

€ 100.000,–

€ 10.000,–

Ausländische Kunden kaufen nach den Devisen-, Zoll- und Steuerbestimmungen ihres Landes. Versandformalitäten werden vom Versteigerer erledigt.

Die Versteigerer:

Fritz Rudolf Künker Dr. Andreas Kaiser Arne Kirsch Oliver Köpp

TEL +49 (0)541 96 20 20, FAX +49 (0)541 96 20 222, SERVICE@KUENKER.DE, WWW.KUENKER.DE


Terms and Conditions of Auction The auction is conducted on behalf and for the account of the appropriate proprietors of the goods and is subject to the federal Auction Regulation (Versteigerungsordnung, BGB1 I 1976, 1346) published in the Federal Law Gazette Vol. I, 1976, 1346 and the relevant provisions for factors in accordance with the German Civil Code (BGB) and Commercial Code (HGB). Payment of the hammer-price has to be made in cash and in Euro. The submission of an offer implies the express acknowledgement of these Terms and Conditions of Auction; the same applies to the submission of an offer in writing. The hammer-price is exclusive of applicable German VAT according to the prevailing VAT-legislation and represents the basis for calculating the surcharge of 15 percent payable by the purchaser. The total price so calculated (hammer-price plus surcharge) is subject to the VAT (value added tax = Mehrwertsteuer), which is payable additionally. Purchasers from abroad will be charged a surcharge of 15 percent net on the hammerprice, provided the export of the coins is undertaken by the auctioneer. Buyers in European Community (EEC) countries (other than Germany) will be charged value added tax at the rates prevailing in Germany. Dealers from EEC countries (other than Germany) will receive goods free of tax upon presentation of their VAT ID number, and upon fulfillment of the other conditions set forth in Paragraph 4, Nr. 1 b, and Paragraph 6 a of the German Turnover Tax Law Buyers from other countries are not charged value added tax. Delivery will be made against payment in Euro with no bank charges to the auctioneer. Unless mutually agreed otherwise, payment of the auction bill from purchasers present at the auction is due immediately. From purchasers who have submitted a bid in writing, payment is due within 20 days after receipt of the goods. Defaulted payments shall bear an interest charge of 1 % per month in the amount in default. Should payment to the auctioneer not be made immediately or should the acceptance of the awarded item be refused, such item shall not be handed over to the purchaser. Instead the purchaser shall forfeit all right and title in and to such item from the award and the item may again be put to auction at this buyer’s cost. In this event the buyer shall be liable for any shortfall, while he shall have no right or claim towards any excess proceeds. An item will be knocked down after the highest bid has been called three times. The award shall be a binding commitment and liability on the part of the bidder to take acceptance and delivery of the item or items so awarded. In the event of any dispute with regard to the award the lot will be put up again for bidding. The auctioneer reserves the right to combine or to separate lots. Lots will not be called out of sequence. Access to the auction will only be permitted to interested persons who are in possession of the catalogue.

lot, the bid first received by the auctioneer shall be given the award. Unlimited bids shall not oblige the auctioneer to consider, accept or carry out such order. Telephone bidding is generally an option for lots of substantial value only. The registration is required at the latest a day before auction. Shipment (by mail or otherwise) of the goods shall be for the sole cost and risk of the purchaser or recipient, respectively. The auctioned goods remain the sole and exclusive property of the vendor until full payment and settlement of any and all dues and claims in connection with the auction. In the event the purchaser is a merchant (in the sense of the German commercial laws) Osnabrück shall be the agreed and exclusive place of jurisdiction. The competence of the District Court (Amtsgericht) of Osnabrück is agreed in respect of summary proceedings for the collection of defaulted payments (Mahnverfahren) as well as in any and all other cases. Should the purchaser not be a merchant Osnabrück shall be the place of jurisdiction with the District Court of Osnabrück’s competence, if only the auctioneer has his ordinary legal domicile in the Federal Republic of Germany or if claims are made by way of summary proceedings of collection (Mahnverfahren) or if the defendant has moved his ordinary legal domicile outside the jurisdiction of the Federal Republic of Germany or if the legal domicile of the defendant is unknown to the auctioneer at the time of filing a suit. To the exclusion of any other legislation German law, as in force at the time, shall be applied for the settlement of any and all legal or judicial matters. The specifications and descriptions in the catalogue have been prepared diligently and in good faith, however, do not constitute the acceptance by the auctioneer of any warranty or liability in respect of defect in material or title. The state of preservation of items is strictly assessed in accordance with the grades accepted by the German coin trade and only represents an individual and personal assessment. Purchasers present at the auction acquire items strictly on the basis of “as is where is” and “as inspected”. In view of the opportunity of prior inspection to ascertain the state and condition of the auction lots, complaints and objections made after the sale will only be considered, if by obvious error or mistake loop or traces or mountings, traces of trimmings or settings, or the plugging of a hole (eyelet) have remained unnoticed. If and when auctioned in lots, the quantities of individual pieces given, only represent an approximate figure. An error in the allocation of individual pieces to a certain lot cannot be excluded. Such lots are, therefore, excluded from any complaints or objections after the lot is knocked down. In the event of disputes or complaints as to the quality of an item the auctioneer may call upon a generally sworn expert of the trade, which the auctioneer may choose at his sole discretion, for assessment and the rendering of a decision as to the justification of such dispute or complaint. The costs of such expert shall be borne by the party loosing the dispute according to the expert’s decision. Complaints or objections, if justified, will only be considered if made and received by the auctioneer within 8 days after the auction or after receiving the lots, respectively.

The minimum rates of increase for the bidding procedure are: offers up to up to up to up to up to up to up to up to up to up to above

€ 100.– € 200.– € 500.– € 1,000.– € 2,000.– € 5,000.– € 10,000.– € 20,000.– € 50,000.– € 100,000.– € 100,000.–

minimum increase rate € 5.– € 10.– € 20.– € 50.– € 100.– € 200.– € 500.– € 1,000.– € 2,000.– € 5,000.– € 10,000.–

Orders submitted in writing will be carried out diligently and without charge of an extra commission. Orders from collectors unknown to the auctioneer can only be accepted and carried out if a deposit or references to the satisfaction on the auctioneer are given. To be bindingly accepted, written bids need to be received at least 24 hours before auction. If necessary, the auctioneer is allowed to increase the bids by 3 – 5 %. Should several bids be obtained in writing bidding the same price or prices for a given

The authenticity of the coins is warranted up to the total purchase price. The prices set out in the catalogue are estimates only, which may be exceeded or undercut. Orders for less than 80 per cent of the estimated price cannot be accepted. Purchasers from abroad will have to observe all applicable laws and regulations in respect of foreign exchange, customs duties and taxation of their country. The auctioneer will only discharge such formalities, which have to be observed, in the Federal Republic of Germany in connection with the export of the purchased item(s). Unless stipulated otherwise herein, the general rules regulations for auctions applicable in Germany shall govern any transaction in respect of the auction; German Law shall also be applicable in relation to purchasers from abroad. Only the German text has legal force. The prices realized will be published in the form of a list immediately after the auction. The auctioneers:

Fritz Rudolf Künker Dr. Andreas Kaiser Arne Kirsch Oliver Köpp

TEL +49 (0)541 96 20 20, FAX +49 (0)541 96 20 222, SERVICE@KUENKER.DE, WWW.KUENKER.DE


Numismatische Ausdrücke/Numismatic Terms/Expressions Numismatiques/ Termini di Numismatica/Нумизматические Термины DEUTSCH

ENGLISH

FRANCAIS

ITALIANO

RUSSKIJ

Abschlag Am Rand Berieben Blei Dezentriert Doppelschlag Einfassung Einseitig Emailliert Erhaltung Etwas Exemplar Fassungsspuren Fehlprägung

struck at the rim/border slightly polished lead uncentered double struck frame uniface enamelled condition/preservation slightly specimen, copy trace of mounting mis-strike

frappe en tranche frotté plomb décentré double frappe encadrement uniface émaillé conservation un peu exemplaire traces de monture défaut de frappe

coniazione al bordo trattato piombo non centrato ribattitura cornice uniface smaltato conservazione un poco esemplare tracce di montatura difetto di coniazione

Feld(er) Fundexemplar Gedenkmünze Geglättet Gelocht Geprägt Gewellt Goldpatina Henkelspur Hübsch Jahrh. = Jahrhundert Kl. = klein Korrosionsspuren Kratzer Kupfer Legierung Leicht(e) l. = links Min. = minimal Nachahmung Prachtexemplar Prägeschwäche Randdelle Randfehler Randschrift r. = rechts Rückseite

field(s) specimen from a hoard commemorative coin tooled holed minted bent golden patina mount mark attractive century small traces of corrosion scratch(es) copper alloy slightly left minimal imitation attractive, perfect piece weakly struck edge nick edge faults lettered edge to right reverse

champ exemplaire de trouvaille monnaie commémorative retouché troué frappé ondulé patine dorée trace de monture joli siècle petit traces de corrosion rayure cuivre alliage légèrement gauche minime imitation pièce magnifique de frappe faible défaut sur la tranche erreur sur la tranche tranche inscrite droite revers

campo da tesoretto moneta commemorativa liscio bucato coniato ondolato patina d´oro tracce di appicagnolo carino secolo piccolo segni di corrosione graffio(i) rame lega leggero sinistra minimamente contraffazione esemplare magnifico conio stanco ammaccatura al bordo errore nel bordo inscrizione sul bordo destra rovescio

оттиск на гурте потертая свинец ассиметричный двойной чекан кайма односторонняя эмалированная сохранность слегка экземпляр следы обработки ошибка в процессе чеканки поле экземпляр памятная монета отглаженная проколатая отчеканенная волнистая золотая патина следы от ушка красивая столетие маленький следы коррозии царапина медь сплав легкий слева минимальный имитация превосходный экземпляр издержкн при чеканкe вмятина на гурте ошибка на гурте гуртовая надпись справа реверс

TEL +49 (0)541 96 20 20, FAX +49 (0)541 96 20 222, SERVICE@KUENKER.DE, WWW.KUENKER.DE


DEUTSCH

ENGLISH

FRANCAIS

ITALIANO

RUSSKIJ

Schriftspuren

traces of inscription

traces de légende

tracce di leggenda

Schrötling Schrötlingsfehler Schwach ausgeprägt Selten in dieser Erhaltung

flan flan defect weakly struck rare in this condition

flan flan défectueux de frappe faible rare en cet état

tondello errore di tondello conio stanco conservazione rara

Seltener Jahrgang Stempel Stempelfehler Überdurchschnittlich erhalten Überprägt Unediert Unikum Vergoldet Von allergrößter Seltenheit Vorderseite Winz.= winzig Zain Zierrand Zinn ziseliert

rare year die(s) mistake in the die extraordinary condition

année rare coin erreur de frappe conservation extraordinaire

overstruck unpublished unique specimen gilt extremely rare averse tiny flan ornamental border tin chased

surfrappé inédit unique doré de toute rareté en face petit flan tranche ornée étain ciselé

annata rara conio errore di conio conservazione estraordinaria ribattuto inedito pezzo unico dorato di estrema raritá diritto veramente piccolo tondello taglio ornato stagno cesellato

следы предыдущей надписи заготовка брак заготовки слабо отчеканeна редкая в такой сохранности редкий год штамп ошибка штампа сохранность выше среднего перечекан неопубликованная монета уникальная позолоченная наиредчайшая аверс незначительный заготовка декоративный гурт цинк гравированный

Erhaltungsgrade/Grading Terms/Degrès de Conservation/Gradi di Conservazione/ Шкала сохранности DEUTSCH

ENGLISH

FRANCAIS

ITALIANO

RUSSKIJ

Polierte Platte Stempelglanz Vorzüglich Sehr schön Schön Gering erhalten

Proof Uncirculated Extremely fine Very fine Fine Very good

Flan bruni Fleur de coin Superbe Très beau Beau Très bien conservé

Fondo specchio Fior di conio Splendido Bellissimo Molto Bello Bello

полированная превосходная отличная очень хорошая хорошая удовлетворительная

Seltenheitsgrade/Rarity Terms/Degrés de Rareté/Grado di Raritá/ Шкала редкости DEUTSCH

ENGLISH

FRANCAIS

ITALIANO

RUSSKIJ

R = Selten RR = Sehr selten Von großer Seltenheit Von größter Seltenheit Von allergrößter Seltenheit Uneditiert

R = Rare RR = Very rare Very rare Extremely rare Extremely rare Unpublished

Rare Très rare De grande rareté Extrêmement rare De la plus extrême rareté Inédit

raro molto raro di grande raritá di grandissima raritá di estrema raritá inedito

редкая очень редкая большой редкости наибольшей редкости наиредчайшая ранее не описанная

TEL +49 (0)541 96 20 20, FAX +49 (0)541 96 20 222, SERVICE@KUENKER.DE, WWW.KUENKER.DE


IMPRESSUM NUMISMATISCHE BEARBEITUNG FOTOS LAYOUT DRUCK

Alexandra Spreu, Dr. Sebastian Steinbach, Jens Ulrich Thormann M. A., Eva Weber, Manuela Weiß Lübke & Wiedemann, Stuttgart danner pc - gesteuerte systeme waiblingen meister print und media, Kassel Jeglicher Nachdruck, auch auszugsweise, bedarf der Genehmigung des Auktionshauses

ZAHLUNGEN AUS DEM INLAND Deutsche Bank Osnabrück Commerzbank Osnabrück Sparkasse Osnabrück Volksbank eG Bad Laer-Borgloh-Hilter-Melle Bankhaus Lampe KG, Bielefeld Postbank Hannover HypoVereinsbank München WestLB Dortmund Paypal

(BLZ 265 700 90) Konto-Nummer 0 177 006 (BLZ 265 800 70) Konto-Nummer 780 520 200 (BLZ 265 501 05) Konto-Nummer 247 320 (BLZ 265 624 90) Konto-Nummer 1 200 222 400 (BLZ 480 201 51) Konto-Nummer 174 076 (BLZ 250 100 30) Konto-Nummer 2900 60-308 (BLZ 700 202 70) Konto-Nummer 24 17 952 (BLZ 440 500 00) Konto-Nummer 1128 842 paypal@kuenker.de, Service charge: 3,5 %

ZAHLUNGEN AUS DEM AUSLAND FOREIGN PAYMENTS Deutsche Bank Osnabrück Sparkasse Osnabrück Postbank Hannover Credit Suisse Credit Cards Paypal

IBAN: DE11 2657 0090 0017 7006 00 Swift-Code: DEUTDE3B265 IBAN: DE50 2655 0105 0000 2473 20 Swift-Code: NOLADE22XXX IBAN: DE73 2501 0030 0290 0603 08 Swift-Code: PBNKDEFF IBAN: CH43 0483 5177 3509 0200 0 Swift-Code: CRESCHZZ80A We do accept VISA and MASTERCARD, Service charge: 4,5 % paypal@kuenker.de, Service charge: 3,5 %

ZAHLUNGEN INNERHALB RUSSLANDS PAYMENTS WITHIN RUSSIA Deutsche Bank Moskau ʽʽʽΗʪ̸̨̜̖ʥ̡̦̌Η

ИНН 7728717332; КПП 772801001 Получатель: ЗАО "Кюнкер" счет №: 40702810500000000825; БИК: 044525101 корсчет №: 30101810100000000101

Auktion 192  
Auktion 192  

Russische Münzen und Medaillen Orden und Ehrenzeichen mit interessanten Serien aus europäischem Privatbesitz