Page 1


6KVGNHQVQ 0T   WÜRZBURG, BISTUM Unter schwedischer Besatzung. Axel Oxenstierna, 1633-1634. Reichstaler o. J. (1633/1634), Würzburg.  29,17 g. Ahlström 15 (R); Dav. 4561; Helmschrott -.


AUKTION 183 Münzen und Medaillen aus Mittelalter und Neuzeit

ZEIT

Montag, 14. März 2011 16.00 Uhr - 18.30 Uhr Dienstag, 15. März 2011 09.30 Uhr - 13.00 Uhr 14.00 Uhr - 17.00 Uhr

ORT

Steigenberger Hotel Remarque Osnabrück, Natruper-Tor-Wall 1

AUKTIONS-TELEFON

+49 (0)541 60 96 633

AUKTIONS-FAX

+49 (0)541 60 96 634

Auktionen 182-187, März 2011 14. MÄRZ 2011

Auktion 182 Münzen aus der Welt der Antike

14./15. MÄRZ 2011

Auktion 183 Münzen und Medaillen aus Mittelalter und Neuzeit

15./16. MÄRZ 2011

Auktion 184 Die Talersammlung Dr. Heinz Pielsticker

17. MÄRZ 2011

17./18. MÄRZ 2011

18. MÄRZ 2011

Auktion 185 Schweden und seine Besitzungen Die Sammlung Julius Hagander, Teil 1 Auktion 186 Russische Münzen und Medaillen Goldprägungen Auktion 187 Deutsche Münzen ab 1871


Sehr geehrte Münzfreunde/Dear Coin Collectors Ich wünsche Ihnen viel Freude bei der Lektüre unserer aktuellen Auktionskataloge und hoffe, dass Sie darin einige schöne Stücke für Ihre Sammlung finden. Bei Fragen hilft Ihnen unsere Kundenbetreuung gerne persönlich weiter. Wie gewohnt finden Sie die Hinweise „Wie biete ich richtig“ am Ende des Kataloges. I wish you a lot of pleasure with the new auction catalogues and I hope that you will find a few additional items for your collection. If you have any questions, our customer center will be glad to assist you. According to customs you may find the instructions “How to bid in our auctions” at the end of this catalogue. Mit herzlichen Grüßen/With warm regards

Fritz Rudolf Künker

Besichtigung/On View Die Besichtigung des Auktionsgutes kann in unseren Geschäftsräumen, Gutenbergstraße 23, 49076 Osnabrück ab dem 7. Februar 2011 nach vorheriger telefonischer Vereinbarung unter +49 (0)541 96 20 20 erfolgen. Besonderer Service anlässlich der Numismata München: Wir bieten Ihnen die Möglichkeit, das Auktionsgut in unseren Münchner Büroräumen am Maximiliansplatz 12a zu folgenden Zeiten zu besichtigen: Freitag bis Sonntag, 4. – 6. März, jeweils von 10.00 bis 18.00 Uhr. The coins are on view at our premises in Osnabrück from February 7 by prior appointment at +49 (0)541 96 20 20. Special service for our clients participating in the Numismata Munich: Auction lot viewing is possible in our munich office (Maximiliansplatz 12a) on Friday, Saturday and Sunday, March 4 – 6, from 10.00 a. m. to 6.00 p. m.

Online-Katalog/Online Catalogue

KUENKER.DE

Betrachten Sie unsere Auktionskataloge im Internet! Unter www.kuenker.de und www.sixbid.com haben Sie die Möglichkeit, Abbildungen zu vergrößern, Ihre Gebote direkt abzugeben und die Ergebnisse der Auktionen abzurufen. Please browse our auction catalogues at www.kuenker.com or at www.sixbid.com! You will have the possibility to zoom all images, to place your bids and to view all auction results online.

Association Internationale des Numismates Professionels (AINP) Verband der Deutschen Münzenhändler e.V.

2

TEL +49 (0)541 96 20 20, FAX +49 (0)541 96 20 222, SERVICE@KUENKER.DE, WWW.KUENKER.DE


Standorte/Locations Wir sind mittlerweile mit sechs eigenen Standorten in Deutschland und Europa vertreten. So können wir Ihnen unseren beliebten Künker-Service auch in Ihrer Nähe anbieten. Unsere Leistungen vor Ort: • Persönliche Beratung und Betreuung in Ihrer Nähe. • Sie können Ihre Münzen direkt einliefern oder verkaufen, ersteigerte Münzen abholen und sich nach Vereinbarung Einlieferungen auszahlen lassen. • Sie können sich von unserem Kooperationspartner auf den Künker-Auktionen vertreten lassen. We are now represented with six locations in Germany and Europe so that we can also provide you the best service in your vicinity. Our local services: • You always have a point of contact nearby. • You can directly consign or sell your coins, collect purchases and receive by appointment payment for consignments. • You can have our cooperation partner represent you at our auctions.

OSNABRÜCK

BERLIN

Fritz Rudolf Künker GmbH & Co. KG Gutenbergstraße 23, 49076 Osnabrück Tel. +49 (0)541 96 20 20 USt-IdNr./VAT-No: DE256270181 Fritz Rudolf Künker GmbH & Co. KG Poststraße 22, 10178 Berlin-Mitte, im Kunsthaus Lempertz Tel. +49 (0)30 247 248 91 Fritz Rudolf Künker GmbH & Co. KG Wollankstraße 117, 13187 Berlin-Pankow Tel. +49 (0)30 247 248 91

MÜNCHEN

Künker Numismatik AG Löwengrube 12, 80333 München Tel. +49 (0)89 242 198 38 Fritz Rudolf Künker GmbH & Co. KG Maximiliansplatz 12a, 80333 München Tel. +49 (0)89 242 16 990

ZÜRICH

Künker Zürich, c/o Hess-Divo AG Löwenstraße 55, 8001 Zürich, Schweiz Tel. +41 (0)44 225 40 90

ZNOJMO

Künker Znojmo, c/o Petr Kovaljov 17. Listopadu 18, 66902 Znojmo, Tschechische Republik Tel. +42 (0)603 81 10 31

MOSKAU

Künker Moskau, c/o Russian Coin Co. Ltd. 2/21 Makarenko St., 123001 Moskau, Russland Tel. +7 (495) 589 56 10

TEL +49 (0)541 96 20 20, FAX +49 (0)541 96 20 222, SERVICE@KUENKER.DE, WWW.KUENKER.DE

3


Was ist für Ihre schriftliche Auktionsteilnahme besonders wichtig?

DEUTSCH

• Bitte senden Sie uns Ihre Aufträge möglichst frühzeitig zu. Wenn uns Ihr Auftrag erst kurz vor der Auktion erreicht, können sich bei der Bearbeitung Fehler einschleichen. Das beiliegende Formular erleichtert Ihnen die Abgabe eines schriftlichen Gebots. Gerne nehmen wir Ihre Gebote per Post, Fax oder Email entgegen. • Wenn Sie noch nicht bei uns gekauft haben, bitten wir Sie, uns als Referenz eine Münzhandlung anzugeben, mit der Sie bereits in Geschäftsverbindung stehen. • Wir gewährleisten die Echtheit aller verkauften Objekte auch über die gesetzliche Frist hinaus.

Sie möchten telefonisch an der Auktion teilnehmen? Die telefonische Teilnahme an der Auktion ist bei uns selbstverständlich möglich. Wir rufen Sie während der Auktion gerne an und helfen Ihnen, die gewünschten Stücke zu ersteigern. Aus organisatorischen Gründen bitten wir Sie, die folgenden Punkte zu beachten:

Ulrich Künker Leiter Kundenbetreuung

• Telefonisches Bieten ist nur bei Losen mit einer Taxe von mind. € 500,– möglich. • Bitte teilen Sie uns mindestens 48 Stunden vor der Auktion mit, zu welchen Stücken Sie angerufen werden möchten. • Bitte achten Sie darauf, dass Sie erreichbar sind, wenn Ihre Stücke versteigert werden. Der Zeitplan in diesem Katalog hilft Ihnen dabei, den Zeitpunkt der Versteigerung abzuschätzen. • Für den Fall, dass wir Sie nicht erreichen können, bieten wir in Ihrem Namen bis zur Höhe Ihres schriftlichen Gebotes, mindestens aber bis zur Höhe des Schätzpreises. • Bitte beachten Sie, dass telefonisches Bieten eine unsichere Variante der Auktionsteilnahme sein kann. Wir können keine Garantie für das Zustandekommen der telefonischen Verbindung übernehmen. Wenn Sie sicher gehen wollen, besuchen Sie bitte unsere Auktion persönlich oder geben Sie uns ein schriftliches Gebot.

Was passiert nach der Auktion? Barbara Westmeyer deutschsprachige Kundenbetreuung

Telefon: +49 (0)541 96 20 20 Fax: +49 (0)541 96 20 222 Gebührenfrei: 0800 58 36 537 E-Mail: service@kuenker.de Internet: www.kuenker.de Montag – Donnerstag 8.30 – 17.00 Uhr Freitag 8.00 – 15.30 Uhr

4

• Der Versand der Auktionsware startet sofort nach Beendigung der Auktion und dauert in der Regel 8 Tage. • Alle Kunden, die an unserer Auktion schriftlich teilgenommen haben, erhalten innerhalb von 2 Wochen nach der Auktion unsere Ergebnisliste gratis. • Alle Ergebnisse sind spätestens einen Tag nach Auktionsende auf unserer Internetseite verfügbar.

Sie möchten Ihre Münzen in unsere Auktion einliefern? Sollten Sie sich zum Verkauf Ihrer Münzen entschlossen haben, kommen Sie zu uns. Seit 1985 beweisen wir mit derzeit 4 Auktionsterminen und ca. 15 Katalogen pro Jahr unsere Kompetenz und Zuverlässigkeit. Wichtige Informationen für Sie im Überblick: • Ihre Münzen werden von unseren Experten nach neuestem numismatischem Standard bestimmt und in hochwertigen Farbkatalogen präsentiert. • Wir verfügen mit mehr als 10.000 Kunden über eine der besten Kundendateien weltweit. Im Durchschnitt verkaufen wir mehr als 95 % der Stücke einer Auktion, nicht selten erzielen wir dabei Rekordzuschläge. Für nicht verkaufte Objekte werden keine Gebühren erhoben. • Ab der Übergabe an uns sind Ihre Münzen mit dem doppelten Schätzwert versichert. Unsere Kundenbetreuung bespricht gerne mit Ihnen wie Ihre Stücke sicher zu uns gelangen können. • Ihre Einlieferung wird Ihnen sofort nach der Übernahme quittiert. Spätestens 5 Wochen vor der Auktion erhalten Sie eine Auflistung Ihrer Stücke inkl. Katalognummern und Schätzpreisen. • Unmittelbar nach der Auktion erhalten Sie die Ergebnisliste und können dann alle erzielten Preise feststellen. Den Auktionserlös erhalten Sie innerhalb von 45 Tagen nach der Auktion.

TEL +49 (0)541 96 20 20, FAX +49 (0)541 96 20 222, SERVICE@KUENKER.DE, WWW.KUENKER.DE


Important facts for a written participation in the auction • Please send us your instructions as early as possible. The likelihood of errors occurring increases if we receive your instructions only shortly before the auction. The enclosed form should make it simple for you to submit a written bid, you may send your bids by mail, fax or e-mail. • If you are a new customer who has not yet purchased from us, we do request references. Please name a coin dealer with whom you have already done business. • The genuineness of all objects sold is warranted beyond the statutory length of time.

ENGLISH

Do you wish to participate by telephone? You are welcome to participate in our auction by telephone. We are glad to call you during the auction and to assist you in bidding for your items. Please take notice of the following conditions: • Telephone bidding is accepted exclusively on lot numbers with estimates at 500 Euro or above. • Please inform us at least 48 hours in advance if you wish to register for telephone bidding, even for single lots. We do need 48 hours to schedule all incoming requests. • Please be available, when your lots will be sold. The time schedule in the catalogue will help you to estimate the approximate time when your items are going to be sold. • Should you not be available by phone, we will bid on your behalf up to your submitted written limit or at least up to the estimate of the lot for which you requested to be called. • Please be aware that telephone bidding is a risky way of participation in our auction. We do not assume liability should the telephone line be interrupted or not be achieved. We advise you to attend the auction in person or to send written bids.

Nadine Zuber English, Deutsch

What occurs after the auction? • The shipment of all auction goods starts immediately after the completion of the entire auction week and it usually takes 8 days to be completed. • All auction results are available on our website one day after the end of the auction week. • All clients who submitted bids for the auction will automatically receive the list of auction results free of charge within two weeks after the end of auction.

Do you wish to consign your coins to our auction? Should you decide to sell your coins, we are ready to assist you. Since 1985 we have earned our bona fides in conducting over 4 auctions and in publishing 15 catalogues per year. In the following you will find the most important information on consigning: • We guarantee the professional handling of your consignment following the latest numismatic level of expertise including its presentation in colour catalogues of outstanding quality. • We possess one of the best customer lists worldwide. On average we sell more than 95 % of all items in our auction, and it is not unusual for us to achieve record hammer prices for lots submitted. Unsold items incur no fees. • Once the coins are consigned they are covered by our insurance at double the estimate. Upon consultation with our customer service we try to advise you on the safest way of shipping for your coins. • Your delivery will be confirmed in writing immediately on receipt. At least five weeks before the auction, you will receive an exact list of your objects with the relevant catalogue numbers and descriptions. • Within a week of the end of auction, you will receive a list of auction results in order to see what prices were reached for each individual lot. As a consignor, you will receive the auction proceeds within 45 days after the end of auction.

Marion Künker English, Deutsch

Phone: +49 (0)541 96 20 20 Fax: +49 (0)541 96 20 222 E-Mail: service@kuenker.de Website: www.kuenker.com Monday –Thursday 8.30 AM – 5 PM Friday 8 AM – 3.30 PM

TEL +49 (0)541 96 20 20, FAX +49 (0)541 96 20 222, SERVICE@KUENKER.DE, WWW.KUENKER.DE

5


Votre participation par écrit – Les points essentiels

FRANCAIS

• Veuillez nous faire parvenir vos ordres le plus tôt possible. Si vos ordres nous parviennent juste avant la vente aux enchères, des erreurs risquent d’être commises lors de leur traitement. Le formulaire ci-joint vous aidera à rédiger facilement votre offre. Vous pouvez nous envoyer vos ordres par la poste, par fax ou par e-mail. • Si vous n’avez encore fait aucune acquisition chez nous, nous vous prions de nous indiquer une ou deux références d’autres maisons numismatiques où vous avez déjà acheté. • L’authenticité des pièces vendues est garantie même au-delà des délais légaux.

Vous voulez participer par téléphone? La participation par téléphone est bien sûr possible. Nous vous appelons volontiers pour vous aider à acquérir les pièces voulues. Pour des raisons d´organisation veuillez noter les points suivants:

Alexandra Elflein, M. A. Français, Deutsch, English, Italiano

• La participation par téléphone est possible seulement pour les lots estimé à plus de 500 Euros chacun. • Veuillez nous informer au moins 48 heures avant la vente de la liste des pièces pour lesquelles vous voudriez être appelé. • Veuillez prendre soin d´être joignable quand vos pièces seront mises en vente. L’ordre de vente dans ce catalogue vous aidera à estimer l´heure de la vente. • Dans le cas où nous ne parviendrions pas à vous joindre, nous enchérirons pour vous jusqu’au montant que vous nous indiquez par écrit, égal ou supérieur au prix d’estimation. • La participation par téléphone présente des risques, et nous déclinons toute responsabilité dans le cas où la communication téléphonique serait interrompue, ou bien ne pourrait être établie.

Ce qui se passe après la vente Kmar Chachoua Français, Deutsch, English, Arabic

Tél. +49 (0)541 96 20 20 Facs. +49 (0)541 96 20 222 E-Mail: service@kuenker.de Site: www.kuenker.de Lundi à Jeudi de 8h30 à 17h00 Vendredi de 8h00 à 15h30

6

• L´expédition des biens va commencer immédiatement après la fin de la vente complète, et prend généralement 8 jours. • Tous les clients qui ont participé à l’une de nos ventes aux enchères recevront gratuitement une liste de résultats dans les deux semaines qui suivent. • Les résultats seront disponibles sur notre site internet, au plus tard un jour après la fin de la vente.

Vous voulez confier vos monnaies pour nos ventes aux enchères? Contactez nous si vous envisagez de vendre vos pièces. Notre compétence et fiabilité est prouvée depuis 1985 par actuellement 4 ventes aux enchères et environ 15 catalogues par an. Le plus important pour vous est que: • Vos pièces seront décrites par notre équipe d’experts selon les standards numismatiques les plus récents, et elles seront présentées dans des catalogues de haute qualité en couleurs. • Nous avons un des meilleurs fichiers-clientèle du monde avec plus de 10.000 clients. Nous vendons en moyenne plus de 95% de la vente aux enchères, et obtenons souvent des prix records. Les monnaies invendues n’encourent aucun frais. • Notre service clientèle est disponible pour vous conseiller pour l’envoi de vos pièces, et dès leur réception vos pièces seront assurées pour le double de la valeur d´estimation. • Vous recevrez une liste détaillée des pièces fournies au moment de la prise en charge puis, au plus tard cinq semaines avant la vente aux enchères, vous recevrez leur liste exacte avec les numéros de catalogue correspondants. • Immédiatement après la vente aux enchères, vous recevrez la liste des résultats et pourrez prendre connaissance des prix obtenus. Vous recevrez le produit de la vente dans les 45 jours après les enchères.

TEL +49 (0)541 96 20 20, FAX +49 (0)541 96 20 222, SERVICE@KUENKER.DE, WWW.KUENKER.DE


I punti piú importanti per la Sua partecipazione per iscritto • La preghiamo di farci pervenire i Suoi ordini al piú presto possibile. Se i Suoi ordini ci arrivano poco prima dell´inizio dell´asta possono verificarsi errori. Il formulario allegato Le faciliterá l´invio dei Suoi ordini per iscritto. Ci puó far pervenire i Suoi ordini per posta, per fax o per email. • Se non ha mai acquistato presso di noi, La preghiamo di volerci indicare a titolo di referenza il nome di uno o due commercianti numismatici presso i quali è giá cliente. • L’autenticità di tutti gli oggetti venduti viene garantita anche oltre i termini previsti dalla legge.

ITALIANO

Desidera partecipare telefonicamente alla nostra asta? La partecipazione telefonica è naturalmente da noi possibile. La chiameremo durante l´asta e La assisteremo volentieri per ottenere l´aggiudicazione dei pezzi desiderati. Per motivi di organizzazione La preghiamo di voler tenere conto dei seguenti punti: • La partecipazione telefonica è possibile solo per lotti stimati con almeno 500,– € l´uno. • La preghiamo di volerci comunicare almeno 48 ore prima dell´inizio dell´asta per quali pezzi desidera essere chiamato. • La preghiamo di aver cura di essere raggiungibile telefonicamente al momento in cui vengono messi all´asta i pezzi che Le interessano. Lo schema orario in catalogo La aiuterá a stimare a che ora verranno messi all´asta i pezzi che Le interessano. • Nel caso in cui non riuscissimo a contattarLa telefonicamente, provvederemo ad offrire a Suo nome fine all´importo massimo indicatoci per iscritto, in ogni caso offriremo a Suo nome come minimo il prezzo di stima. • La partecipazione telefonica è un modo incerto di partecipare alle aste. Non assumiamo nessuna responsabilità se per esempio la linea telefonica è occupata o interrotta o se Lei non sará raggiungibile per altri motivi.

Sonia Russo, M. A. Italiano, Deutsch, English, Español

Cosa succede dopo l´asta? • La spedizione del materiale d´asta comincia subito dopo la fine dell´intera asta e termina normalmente entro 8 giorni. • Tutti i clienti che hanno partecipato all´asta ricevono entro 2 settimane dopo l´asta la lista dei prezzi di realizzo. • I prezzi di realizzo sono visionabili sul nostro sito internet al piú tardi un giorno dopo la fine dell´intera asta.

Vuole consegnarci le Sue monete per una nostra asta? Ci contatti se ha deciso di vendere le Sue monete. Dal 1985 la nostra competenza ed affidabilità è dimostrata da attualmente 4 aste e circa 15 cataloghi all´anno. Quali sono i punti di maggior importanza per Lei:

Cristina Welzel Italiano, Deutsch, English, Français

Tel.: +49 (0)541 96 20 20 Fax: +49 (0)541 96 20 222 E-Mail: service@kuenker.de Internet: www.kuenker.de Lunedì a giovedì dalle 8.30 alle 17.00 Venerdì dalle 8.00 alle 15.30

• Le Sue monete vengono valutate dal nostro staff di esperti secondo i piú attuali standard numismatici e vengono presentati in cataloghi di alto valore a colori. • Con piú di 10.000 clienti disponiamo di una delle migliori banca dati clienti del mondo. In media vendiamo oltre il 95% del materiale d´asta realizzando spesso prezzi da record. Per i pezzi invenduti non ci sono nessune spese da pagare. • Dal momento della consegna le Sue monete sono assicurate per il doppio del valore di stima. Il nostro servizio clientela Le consiglierá volentieri come farci avere le Sue monete nel modo piú sicuro. • La Sua consegna Le verrá immediatamente quietanzata al momento della resa dei pezzi. Al piú tardi 5 settimane prima dell´asta riceverá una lista dettagliata dei Suoi pezzi con i numeri di catalogo ed i prezzi di stima. • Subito dopo l´asta riceverá la lista con i risultati d´asta dalla quale potrá subito controllare i prezzi realizzati. Riceverá l´importo di realizzo entro 45 giorni dopo la fine dell´asta.

TEL +49 (0)541 96 20 20, FAX +49 (0)541 96 20 222, SERVICE@KUENKER.DE, WWW.KUENKER.DE

7


Что особенно важно при заочном участии на аукционе?

RUSSKIJ

• Тщательно изучите наш каталог и запишите те лоты, которые Вас заинтересовали. Заполните приложенный формуляр и отправьте нам его заранее по почте, факсу или электронной почте. Мы обращаем внимание на то, что если Ваши ставки придут перед самым началом аукциона либо во время аукциона, то существует вероятность допуска ошибки в процессе обработки заказа. • Если Вы впервые принимаете участие в нашем аукционе, то мы рекомендуем Вам указать Ваш референц – аукционные дома, с которыми Вы уже сотрудничали. Или свяжитесь с нами по телефону +49(0)541 9620268. • Подлинность купленных на нашем аукционе лотов гарантируется нами на протяжении неограниченного времени.

Вы хотели бы принять участие на аукционе по телефону? У нас, конечно, есть возможность организовать Ваше телефонное участие на торгах, но мы бы хотели обратить внимание на следующие пункты: Anastasija Koepsell Russkij, Deutsch

• Участие в телефонных торгах возможно только для лотов со стартовой ценой свыше 500 евро. • Для участия в торгах по телефону просим Вас связаться с нами не позднее 48 часов до начала аукциона. • Мы хотим подчеркнуть, что телефонное участие на аукционе – не самый безопасный способ: в случае плохой связи, недоступности клиента во время торгов либо других технических проблем мы не несем ответственности.

Что происходит после окончания аукциона?

Dzmitry Nikulin Russkij, Deutsch, English

Телефон: +49 (0)541 96 20 20 Факс: +49 (0)541 96 20 222 E-Mail: service@kuenker.de интернет: www.kuenker.de понедельник – четверг 8.30 – 17.00 пятница 8 – 15.30

8

• Результаты аукционов доступны на нашем сайте на следующий день после окончания торгов. • Вы можете лично забрать приобретенные лоты. По окончании торгов мы готовим все необходимые документы на вывоз из Евросоюза. • Почтовые отправки в Россию ( Беларусь, Украину ) осуществляются по предварительной договоренности. Для связи с нами звоните по телефону +49 (0)541 9620268.

Вы хотели бы выставить Ваши предметы на аукцион? Более 160-ти успешно проведенных аукционов, тысячи участников, 4 аукциона в год - эти и другие преимущества, которые говорят в пользу выставления Ваших коллекций на аукцион Кюнкер: • Ваши монеты будут оценены нашими экспертами по самым новым нумизматическим стандартам и представлены в высококачественном цветном каталоге. • Более 10000 клиентов со всего мира оказывают нам свое доверие. В среднем мы продаем более 95% всех выставляемых предметов, при этом зачастую достигая рекордных сумм. • Все Ваши предметы, после передачи их нам, хранятся у нас до начала аукциона застрахованными. Не позднее 5-ти недель до начала аукциона Вы получите по почте подробное описание Ваших лотов с указаннами номерами в каталоге, а также их оценочной стоимостью. • Результаты аукционов также будут высланы Вам по почте после окончания торгов. В течение 45 дней после аукциона Вам будет выплачено Ваше вознаграждение.

TEL +49 (0)541 96 20 20, FAX +49 (0)541 96 20 222, SERVICE@KUENKER.DE, WWW.KUENKER.DE


Zeitplan/Timetable Auktion 182 Münzen aus der Welt der Antike

Montag, 14. März 2011 09.30 Uhr - 13.00 Uhr Nr. 1 bis Nr. 761 Kelten, Griechen, Römer: Römische Republik, Imperatoren, Kaiserzeit: Augustus - Pertinax 14.00 Uhr - 16.00 Uhr Nr. 762 bis Nr. 1143 Kaiserzeit: Didius Julianus - Basiliscus, Lots Römer, Völkerwanderung, Byzanz, Kreuzfahrer, Orientalen

Auktion 183 Münzen und Medaillen aus Mittelalter und Neuzeit

16.00 Uhr - 18.30 Uhr Nr. 1501 bis Nr. 1941 Europa: Baltikum - Norwegen

Dienstag, 15. März 2011 09.30 Uhr - 13.00 Uhr Nr. 1942 bis Nr. 2708 Europa: Polen - Ungarn, Übersee, RDR, Deutschland: Aichach - Erfurt

Auktion 184 Die Talersammlung Dr. Heinz Pielsticker

14.00 Uhr - 17.00 Uhr Nr. 2709 bis Nr. 3386 Deutschland: Frankfurt - Würzburg, Medaillen, Münzwaagen, Münzgefäße, Lots 17.00 Uhr - 19.00 Uhr Nr. 4001 bis Nr. 4400 Deutschland: Aachen - Essen

Mittwoch, 16. März 2011 09.30 Uhr - 13.00 Uhr Nr. 4401 bis Nr. 5118 Deutschland: Frankfurt - Würzburg, Deutsche Münzen ab 1871 14.00 Uhr - 18.00 Uhr Nr. 5119 bis Nr. 5850 RDR, Europa, Übersee

Auktion 185 Schweden und seine Besitzungen Die Sammlung Julius Hagander, Teil 1 Auktion 186 Russische Münzen und Medaillen

Donnerstag, 17. März 2011 09.30 Uhr - 11.30 Uhr Nr. 6001 bis Nr. 6225 11.30 Uhr - 13.00 Uhr Nr. 6501 bis Nr. 6746 Alexei Michailowitsch - Paul I. 14.00 Uhr - 18.30 Uhr Nr. 6747 bis Nr. 7332 Alexander I. - Nikolaus II., Sowjetunion, Russische Republik, Lots, Stadt Kaffa, Nowgorod

Goldprägungen

Freitag, 18. März 2011 09.30 Uhr - 13.00 Uhr Nr. 7501 bis Nr. 8290 Europa, Übersee 14.00 Uhr - 15.30 Uhr Nr. 8291 bis Nr. 8576 RDR, Deutschland, Medaillen

Auktion 187 Deutsche Münzen ab 1871

15.30 Uhr - 18.30 Uhr Nr. 9001 bis Nr. 9800 9


INHALT AUKTION 183 Nr. MÜNZEN UND MEDAILLEN AUS MITTELALTER UND NEUZEIT Europäische Münzen und Medaillen Baltikum Belgien Bulgarien Dänemark Frankreich Griechenland Großbritannien Italien Jugoslawien Kroatien Liechtenstein Luxemburg Malta Monaco Montenegro Niederlande Niederländische Gebiete in Übersee Norwegen Polen Rumänien San Marino Schweden Schweiz Serbien Spanien Tschechien Ungarn Münzen und Medaillen aus Übersee Ägypten Äthiopien Argentinien Australien Bolivien Brasilien China El Salvador Ghana Iran Japan Kambodscha Komoren Korea Marokko Panama 10

1501

Seite

-

3387

14

-

306

1501 1501 1543 1567 1571 1596 1705 1717 1755 -

2229 1542 1566 1570 1595 1704 1716 1754 1873 1874 1876 1878 1880 1883 1884 1886 1926 1929 1941 2031 2104 2106 2163 2193 2198 2203 2210 2229

14 14 18

-

21 27 43 44 51

-

71

-

77 79 89

-

100 110

-

114 115

-

118 17 21 21 26 42 44 51 69 69 69 69 70 70 70 71 77 77 79 89 99 100 109 113 113 114 115 118

119

-

1875 1877 1879 1881

-

1885 1887 1927 1930 1942 2032 2105 2107 2164 2194 2199 2204 2211

-

2230

-

2234

-

2238 2241 2243 2245 2247

-

2252

-

2287 2230 2231 2232 2233 2236 2237 2240 2242 2244 2246 2249 2250 2251 2253 2254 2255

127 119 119 119 120 120 121 121 121 122 122 122 123 123 123 123 123


Nr. Peru Philippinen Sri Lanka (Ceylon) Sudan Tunesien Uruguay Venezuela Vereinigte Staaten von Amerika/USA Vietnam Habsburgische Erblande - Österreich Tirol, Grafschaft Görz, Grafschaft Römisch-Deutsches Reich Kaiserreich Österreich Republik Österreich, Lots Geistlichkeit Die österreichischen Standesherren Städte in den habsburgischen Erblanden Deutsche Münzen und Medaillen Aichach (bei Augsburg) Amberg Augsburg Baden Bamberg Barby Bayern Bonn Brandenburg in Franken Brandenburg-Preußen Braunschweig, Stadt Braunschweig und Lüneburg Breisach Breisgau Bremen Breslau Bretzenheim Cham Corvey Deutscher Orden Donauwörth Dortmund Eichstätt Einbeck Emden Erfurt Frankfurt Freckenhorst (Kreis Warendorf) Freising

2256

-

2262

-

2266 2286

-

2288

-

2289 2291 2397 2423 2435

-

2456

-

2458

-

2459 2461 2480 2488

-

2496

-

2542 2555

-

2626 2684

-

2687 2691

-

2697 2699

-

2703 2705

-

2709

-

Seite 2257 2258 2259 2260 2261 2264 2265 2285 2287 2457 2288 2290 2396 2422 2434 2454 2455 2457 3317 2458 2460 2479 2487 2494 2495 2540 2541 2554 2624 2625 2683 2685 2686 2690 2693 2694 2695 2696 2698 2701 2702 2704 2706 2707 2708 2739 2740 2741

123

-

124

-

125

-

128

-

128 146 151 152

-

157

-

157 160

-

163

-

169 171

-

182

-

193 194

-

198

-

124 124 124 124 124 125 125 127 127 156 128 128 146 151 152 156 156 156 292 157 157 160 162 162 163 169 169 171 181 182 193 193 193 194 195 195 195 195 196 196 196 197 197 198 198 203 203 203 11


Nr. Friedberg Fulda Göttingen Halberstadt Hamburg Hanau Harz Henneberg Herford Hessen Hildesheim Hohenzollern Isny Kempten Köln Konstanz Lindau Lippe Löwenstein Sammlung Lübeck Magdeburg Mainz Mansfeld Marsberg Mecklenburg Memmingen München Münster Neustadt an der Aisch Nördlingen Northeim Nürnberg Öttingen Osnabrück Ostfriesland Ottobeuren Paderborn Pappenheim Passau Pfalz Pommern Quedlinburg Randerath Ravensburg Regensburg Regenstein Reichenau Remagen Reuss 12

2742

-

2747 2749 2757 2759

-

2763 2776 2780 2782 2785 2789 2795 2799 2801 2812 2820 2948 2953

-

2961

-

2966

-

2975

-

2981 3001 3006 3009

-

3014 3017 3022

-

3030 3034

-

3075

-

3078

-

Seite 2744 2745 2746 2748 2756 2758 2760 2761 2762 2775 2779 2781 2784 2788 2794 2798 2800 2811 2819 2947 2951 2952 2959 2960 2963 2964 2965 2973 2974 2979 2980 3000 3005 3008 3010 3011 3012 3013 3016 3021 3027 3028 3029 3033 3073 3074 3076 3077 3079

205

-

208 211

-

213 214 215

-

216

-

219

-

238

-

239

-

242

-

243

-

248 249

-

250 251

-

204 204 204 204 206 207 207 208 208 210 212 212 213 214 215 216 216 217 218 236 237 237 239 239 239 239 239 242 242 243 243 245 246 246 247 247 247 248 248 249 250 250 250 251 256 256 256 256 257


Nr. Rottenburg am Neckar Rottweil Sachsen, sächsische Herzogtümer Sayn Schaumburg-Lippe Schlesien Schleswig-Holstein Schongau Schwäbisch Gmünd Schwäbisch Hall Schwäbischer Bund Schwarzburg Schwarzenberg Sindelfingen Solms Stolberg Stralsund Straubing Trier Tübingen Überlingen Ulm Wallenstein Werden und Helmstedt Westfalen Wismar Worms Württemberg Würzburg Medaillen

3258 3262 3266 3268 3298 -

3080 3082 3187 3189 3190 3195 3197 3201 3202 3204 3208 3213 3215 3217 3233 3234 3236 3237 3238 3239 3246 3255 3256 3257 3261 3265 3267 3297 3317

3318

3329

3081 3083 3188

-

3191 3196 3198

-

3203 3205 3209 3214 3216 3218

-

3235

-

3240 3247

-

-

Papiergeldsammlung Herbert Sirb Münzwaagen

Seite

3331

-

Einsatzgewichte und Gewichte

258 275

-

279

-

280

-

284

-

288 291

-

257 257 275 276 276 276 277 277 278 278 278 279 280 280 282 282 283 283 284 284 284 286 286 286 286 287 288 290 292 293

3330

294

-

297

3338

298

-

301

3339

302

Münzgefäße und Münzschmuck

3340

-

3341

302

-

303

Münzenlots

3342

-

3386

304

-

306

Ein Stichwortverzeichnis finden Sie am Ende des Auktionskataloges 186.

13


BALTIKUM

'7412+5%*'/ª0<'070&/'&#+..'0

1502

1501

'56.#0&&QTRCV 

1503

1504

$#.6+-7/

*GTOCPP+++9GUGN(GTFKPIQ,&QTRCV0GWOCPP  -N2T·IGUEJY·EJGUGJTUEJÌPpXQT\ÒINKEJ



*GTOCPP9GUGNUVCTDKP)GHCPIGPUEJCHVKP/QUMCW/KVKJOUEJNQ­CWEJFKG&QTRCVGT/ÒP\G&CUDCNVKUEJG )GDKGVYWTFGWPVGTFGP-TKGIUIGYKPPGTPCWHIGVGKNV

'56.#0&4GXCN 

7PVGT5EJYGFGP'TKM:+8/CTM (GTFKPI #JNUVTÌOC0GWOCPPC  -N2T·IGUEJY·EJGXQT\ÒINKEJ





/CTM (GTFKPI #JNUVTÌO0GWOCPPD

*ÒDUEJG2CVKPCUGJTUEJÌP





,QJCP+++/CTM (GTFKPI Q,#JNUVTÌO0GWOCPP  4&WPMNG2CVKPCOKP1DGTHN·EJGPMQTTQUKQPUGJTUEJÌP



1506

1505

1505

-74.#0& 

2GVGT$KTQP#NDGTVWUVCNGT&CX-QRKEMK 4   *ÒDUEJG2CVKPCNGKEJVLWUVKGTVUGJTUEJÌPpXQT\ÒINKEJ



4+)#56#&6 

7PVGT2QNGP5VGRJCP$CVJQT[)TÌUEJGT+IGT4G 4 -QRKEMKXCT 4  445GJTUEJÌP

1507



)TQUEJGP-QRKEMK 4 



)TQUEJGP-QRKEMKXCT 4 

14



1508

4(GKPG2CVKPCHCUVUGJTUEJÌP



-N<CKPGPFGUGJTUEJÌP




BALTIKUM

1510

1509

1511



)TÌUEJGT+IGT4C 4 -QRKEMKXCT 4 



)TQUEJGP-QRKEMKXCT 4 



1513

1512

9KP\<CKPGPFGUGJTUEJÌP



9KP\<CKPGPFGUGJTUEJÌP



)TÌUEJGT+IGT4C 4 -QRKEMK 4 

2TCEJVXQNNG2CVKPCXQT\ÒINKEJGU'ZGORNCT





)TÌUEJGT+IGT4C 4 -QRKEMK 4 

5GJTUEJÌP





)TÌUEJGT+IGT4F 4 -QRKEMKXCT 4 

5GJTUEJÌP



1515

1514

1516



)TÌUEJGT+IGT4C 4 -QRKEMK 4 



)TÌUEJGT+IGT4E 4 -QRKEMKXCT 4 



)TÌUEJGT+IGT4EXCT 4 -QRKEMKXCT 4 



)TQUEJGP-QRKEMKXCT 4 

1518

1519

1517

5GJTUEJÌP



9KP\<CKPGPFGUGJTUEJÌP



(GKPG2CVKPCUGJTUEJÌP



4*ÒDUEJG2CVKPCMN5EJTÌVNKPIUHGJNGTCO4CPFUGJTUEJÌP



1521

1520



)TÌUEJGT+IGT4IXCT 4 -QRKEMKDXCT 4 



1522

5GJTUEJÌP



)TÌUEJGT+IGT4M 4 -QRKEMKDXCT 4 

*ÒDUEJG2CVKPCUGJTUEJÌPpXQT\ÒINKEJ





)TÌUEJGT+IGT4CD 4 -QRKEMKXCT 4 

5GJTUEJÌPpXQT\ÒINKEJ





)TÌUEJGT+IGT4D 4 -QRKEMKXCT 4 

(CUVXQT\ÒINKEJ





5KIKUOWPF+++)TÌUEJGT+IGT4G-QRKEMKXCT 4   2TCEJVGZGORNCT5VGORGNINCP\

 15


BALTIKUM

1524

1523

1523



-CTN:+4GKEJUVCNGT#JNUVTÌOC&CX#0GWOCPP  9KP\*GPMGNURWTHCUVUGJTUEJÌP



5VGRJCP$CVJQT[XQP2QNGP)TÌUEJGT8KNPKWU+IGT8D 4 -QRKEMK XCT 4  44-N5EJTÌVNKPIUHGJNGTCO4CPFUGJTUEJÌP



.+6#7'0

1526

1525



1527



)TÌUEJGT8KNPKWU+IGT8F 4 -QRKEMKXCT 4   445EJTÌVNKPIUHGJNGTCO4CPFUGJTUEJÌP



 

)TÌUEJGT8KNPKWU+IGT8EXCT 4 -QRKEMKXCT 4  )TÌUEJGT8KNPKWU+IGT8G 4 -QRKEMKXCT 4 

 

5GJTUEJÌP 45GJTUEJÌP

1528

1,5:1

1,5:1



)TQUEJGP  8KNPKWU /KV /ÒP\\GKEJGP FTGKUVKGNKIGU $NCVV ÒDGT FGP 9CRRGP KP FGT 4ÒEMUGKVGP   FCTUVGNNWPI-QRKEMKXCT 4  8QPITQ­GT5GNVGPJGKV2T·IGUEJY·EJGUGJTUEJÌP 

1529

     16

1530

1531

1532

)TÌUEJGT8KNPKWU+IGT8FXCT 4 -QRKEMKXCT 4  45GJTUEJÌP )TÌUEJGT8KNPKWU+IGT8DXCT 4 -QRKEMK 4  5GJTUEJÌP )TÌUEJGT8KNPKWU+IGT8D 4 -QRKEMKXCT 4  -N2T·IGUEJY·EJGUGJTUEJÌP )TÌUEJGT8KNPKWU+IGT8DXCT 4 -QRKEMKXCT 4  5GJTUEJÌPpXQT\ÒINKEJ )TÌUEJGT8KNPKWU+IGT8C 4 -QRKEMKXCT 4  5GJTUEJÌP

1533

    


BALTIKUM

1535

1534

1536

1537



)TÌUEJGT8KNPKWU+IGT8EXCT 4 -QRKEMKXCT 4 

5GJTUEJÌP





)TÌUEJGT8KNPKWU/KVLGGKPGONCPIUVKGNKIGP$NCVV\WFGP5GKVGPXQP.+6+IGT8C 4  -QRKEMK 4  5GJTUEJÌPpXQT\ÒINKEJ





)TÌUEJGT8KNPKWU/KVLGGKPGONCPIUVKGNKIGP$NCVV\WFGP5GKVGPXQP.+6+IGT8CXCT

4 -QRKEMK 4  9KP\<CKPGPFGUGJTUEJÌP





)TÌUEJGT  8KNPKWU 8CTKCPVG OKV LGGKPGO2WPMVCPUVGNNGFGTNCPIUVKGNKIGP$N·VVGT\WFGP5GKVGP XQP.+6+IGTp XIN8C -QRKEMKp XIN  7PGFKGTV!(CUVUGJTUEJÌP



1538

1,5:1



1,5:1

)TÌUEJGT8KNPKWU/KV/ÒP\\GKEJGP$NCVVKO<GPVTWOFGT4ÒEMUGKVGPFCTUVGNNWPI-QRKEMK 4  8QPITQ­GT5GNVGPJGKV(GKPG2CVKPCUGJTUEJÌP

1539

1540

1542



)TÌUEJGT8KNPKWU+IGT8D 4 -QRKEMKXCT 4 

 



1541

1542

5GJTUEJÌP



)TÌUEJGT8KNPKWU+IGT8CXCT 4 -QRKEMKCXCT 4 

5GJTUEJÌP



)TÌUEJGT8KNPKWU+IGT8C 4 -QRKEMK 4 

5GJTUEJÌP



.+8.0&+5%*'414&'0 

*GKPTKEJXQP)CNGP/CTM4KIC)GOGKPUEJCHVURT·IWPIOKV'T\DKUEJQH9KNJGNO XQP$TCPFGPDWTI  0GWOCPPD  5GJTUGNVGPKPFKGUGT'TJCNVWPI-N2T·IGUEJY·EJGHCUVXQT\ÒINKEJ

 17


BELGIEN

1543 1544

1544

#069'42'0

$'.)+'0



5VCFV -W %GPVKOGU  IGRT·IV Y·JTGPF FGT $GNCIGTWPI FWTEJ FKG #NNKKGTVGP $TCWUG/CPUHGNF   6H)CFQWT[C/C\CTFE 2TCEJVGZGORNCT.GKEJVLWUVKGTVHCUV5VGORGNINCP\



2JKNKRR++XQP5RCPKGP'EW2JKNKRRG/CCUVTKEJV&CX&GNO  45GJTUEJÌP



$4#$#06 

1545 1546

 

1546

'EW2JKNKRRG#PVYGTRGP&GNO 4  'EW2JKNKRRG#PVYGTRGP&CX&GNO

1547

1548

5EJTÌVNKPIUHGJNGTUGJTUEJÌP 5GJTUEJÌP

 

1549

 

'EW2JKNKRRG#PVYGTRGP&CX&GNOC 4  'EW2JKNKRRG#PVYGTRGP&CX&GNO 4 

5GJTUEJÌP 5GJTUEJÌP

 



2JKNKRR+8XQP5RCPKGP2CVCIQP#PVYGTRGP&CX&GNO  5GNVGPKPFKGUGT'TJCNVWPI8QT\ÒINKEJ



18


BELGIEN

1551

1550

1550



-CTN++XQP5RCPKGP2CVCIQP$TÒUUGN&CX&GNO 4 

5GJTUEJÌP



1VVQ +++  &GPCT  I 1661 Û 4':  -TGW\ KP FGP 9KPMGNP LG GKPG -WIGN5  &'   108#Û&CPPGPDGTIXCT 5GNVGPDGUQPFGTUKPFKGUGT'TJCNVWPI5GJTUEJÌP



&+0#06 

1553

1552

(.#0&'40 

2JKNKRR++XQP5RCPKGP'EW2JKNKRRG&CX&GNO  44-N-TCV\GTHCUVUGJTUEJÌP





'EW2JKNKRRG&GNOp \W4 



8QPITQ­GT5GNVGPJGKV(CUVUGJTUEJÌP

ex 1554

.ª66+%* 

.QV&KXGTUG6CNGTRT·IWPIGPFGU,CJTJWPFGTVU 5VÒEM &C\W\YGK6CNGTVGKNUVÒEMG*QEJKPVG TGUUCPVGU.QVDKVVGDGUKEJVKIGP 5VÒEM/GKUVUGJTUEJÌP

 19


BELGIEN

1556

1555

1557

56#8'.16 

%JTKUVQRJ XQP /CPFGTUEJGKF  4GKEJUVCNGT  OKV 6KVGN /CZKOKNKCPU ++ &CX    &GNO 4  5GJTUGNVGPKPFKGUGT'TJCNVWPI *ÒDUEJG2CVKPCYKP\5EJTÌVNKPIUHGJNGTHCUVXQT\ÒINKEJGU'ZGORNCT

-¤0+)4'+%*$'.)+'0





.GQRQNF+(TCPEU$TÒUUGN&CX/QTKPC  5GJTUGNVGPKPFKGUGT'TJCNVWPI2TCEJVGZGORNCT9KP\-TCV\GTRQNKGTVG2NCVVG 2TQQH





(TCPEU$TÒUUGN&CX/QTKPC



1558

  

1559

(TCPEU$TÒUUGN-NGKPGT-QRH/QTKP (TCPEU$TÒUUGN-NGKPGT-QRH/QTKP (TCPEU$TÒUUGN)TQ­GT-QRH/QTKPC

1561



48QT\ÒINKEJp5VGORGNINCP\

(TCPE$TÒUUGN/QTKP

1562

1560

8QT\ÒINKEJ (CUVXQT\ÒINKEJ 5GJTUEJÌP

1563

5GJTUGNVGPKPFKGUGT'TJCNVWPI2TCEJVGZGORNCT5VGORGNINCP\



5GJTUEJÌP





%GPVKOGU$TÒUUGN/QTKP



 (TCPE  2TQDG KP 5KNDGT  I /KV -GTDTCPF -/ 2P  FQTV OKV HCNUEJGT #DDKNFWPI    /QTKPp 2TCEJVGZGORNCT(CUV5VGORGNINCP\

20

  




DÄNEMARK

ex 1565 1564

1564



.GQRQNF++(TCPEUCWHFGP$GUWEJXQP%J(TGOCPVNG9%JCPFNGT4QDGTVUWPF ,/0CRKGTKO*QVGNFGU/QPPCKGUCO,WNKKP$TÒUUGN2TQDGOKVINCVVGO4CPFI -/p/QTKPp 2TCEJVGZGORNCTOKVHGKPGT2CVKPC(CUV5VGORGNINCP\ 



(TCPE%GPVKOGUDGKFG/ÒP\UV·VVG$TÒUUGN/QTKPC  5VÒEM2TCEJVGZGORNCTG5VGORGNINCP\





.GQRQNF+++(TCPEU$TÒUUGNCWHFKG9GNVCWUVGNNWPIKP$TÒUUGNWPFCWHFKG ,CJTHGKGT FGT DGNIKUEJGP 'KUGPDCJP <YGK 8CTKCPVGP OKV HN·OKUEJGT D\Y HTCP\ÌUKUEJGT .GIGPFG   &CX#PO/QTKP Z  5VÒEM8QT\ÒINKEJ



1567 1,5:1

1,5:1

$7.)#4+'0 

(GTFKPCPF.GY9KGPQFGT-TGOPKV\-/  44*GTTNKEJG2CVKPCHCUV5VGORGNINCP\

1568



1569



5VQVKPMK9KGPQFGT-TGOPKV\-/  42TCEJVGZGORNCTOKVHGKPGT2CVKPC(CUV5VGORGNINCP\





$QTKU+++5VQVKPMK9KGP-/  5GJTUGNVGPKPFKGUGT'TJCNVWPI2QNKGTVG2NCVVG



.16$7.)#4+'0 

5COONWPI XQP DWNICTKUEJGP /ÒP\GP FGU  ,CJTJWPFGTVU XQO 5VQVKPMC DKU \WO  .GYC5VÒEM   FCTWPVGTCWEJGKPKIGDGUUGTG,CJTI·PIGWCWPF.GYCUQYKGGKPKIGUGJTCVVTCMVKXG'TJCNVWP IGP*QEJKPVGTGUUCPVGU.QVDKVVGDGUKEJVKIGP 5VÒEM5GJTUEJÌPp5VGORGNINCP\

1571

-¤0+)4'+%* 



1572

&0'/#4-

*CTCNF$NCW\CJP&GPCT*CKVJCDW *GFGD[ I1TPCOGPVCNCWHIGNÌUVG%#41.85WPF &14'56#&.GIGPFGPCWH8QTFGTWPF4ÒEMUGKVG 5GJTUEJÌPpXQT\ÒINKEJ



<WFGP2T·IWPIGPFKGUGUDGFGWVGPFGPHTÒJOKVVGNCNVGTNKEJGP*CPFGNURNCV\GUXIN,CPMWJP**CKVJCDW'KP*CPFGNU RNCV\FGT9KMKPIGT\GKV0GWOÒPUVGT5WPF/CNOGT$0QTFKUMCOKPVHÌTGCT.WPF



*CTFG-PWF&GPCT.WPFI$TWUVDKNFNOKV.KNKGP\GRVGTKO(GNFT-WIGN-+GK PGU&QRRGNHCFGPMTGW\KPFGP9KPMGNP%48:*CWDGTI #VVTCMVKXGUUGJTUEJÌPGU'ZGORNCT

 21


DÄNEMARK

1573

1575

1574

1576



&GPCT .WPF  I $TWUVDKNF N&QRRGNHCFGPMTGW\ KO GTUVGP WPF XKGTVGP 9KPMGN LG GKP *CNDOQPF   *CWDGTIXCT (CUVXQT\ÒINKEJGU'ZGORNCTOKVHGKPGT2CVKPC





/CIPWU FGT )WVG  &GPCT .WPF  I $TWUVDKNF N FCXQT *CNDOQPFG&QRRGNHCFGP   MTGW\KOGTUVGPWPFXKGTVGP9KPMGNLGGKP*CNDOQPF*CWDGTIXCT  .GKEJVIGYGNNVWPF-QTTQUKQPUURWTGPCWHFGT4ÒEMUGKVGUQPUVXQT\ÒINKEJGU'ZGORNCT





5XGPF'UVTKFUGP&GPCT.WPFI%JTKUVWUVJTQPVXXOKV$KDGN&QRRGNHCFGPMTGW\ *CWDGTI 5GJTUEJÌPpXQT\ÒINKEJ





&GPCT .WPF I%JTKUVWUUVGJVXXOKVUGIPGPFGT4GEJVGP#WU4CWVGPIGDKNFGVGU-TGW\OKVLG FTGK-WIGNPCPFGP'PFGPFGT#TOGWPF-WIGNKO<GPVTWO*CWDGTI  (GKPG2CVKPCNGKEJVIGYGNNVUGJTUEJÌP



1577



%JTKUVKCP+85KNDGTOGFCKNNGXQP05EJYCDGCWHFKG'TQDGTWPIXQP-CNOCT)GJCT PKUEJVGU*ÒHVDKNFTOKVWOIGNGIVGT(GNFDKPFGKPFGT4GEJVGP-QOOCPFQUVCDFCXQT6KUEJOKV*GNO #PUKEJVFGU5EJNQUUGUXQP-CNOCTKO8QTFGTITWPF4GKVGTITWRRGOOI)CNUVGT  44(GNFGTIGIN·VVGVUGJTUEJÌPGU'ZGORNCTOKVHGKPGT2CVKPC 'ZGORNCTFGT#WMVKQP(TKV\4WFQNH-ÒPMGT1UPCDTÒEM0T







%JTKUVKCP+8DGICPPFKG$GNCIGTWPI-CNOCTUCO/CKYKGCWEJKPFGT4ÒEMUGKVGPWOUEJTKHVFGT/GFCKNNG CPIGIGDGP KUV #O  /CK  IGNCPI GU FGP F·PKUEJGP 6TWRRGP KP FKG 5VCFV GKP\WFTKPIGP FKG UEJYGFKUEJGP   5QNFCVGPXGTUEJCP\VGPUKEJKO5EJNQ­'TUVCO,WPKGTTGKEJVG-CTN+:OKVUGKPGO*GGTFKG5VCFVMQPPVG UKG CDGT CWEJ KP GTDKVVGTVGP -·ORHGP PKEJV DGHTGKGP 0CEJFGO FKG &·PGP 'PFG ,WNK  YGKVGTG 8GTUV·TMWPI   GTJKGNVGP DGUEJNQ­ -CTN +: FGP 4ÒEM\WI #O  #WIWUV  XGTJCPFGNVG FGT UEJYGFKUEJG -QOOCPFCPV FGU   5EJNQUUGU-TKUVQHHGT5QOGFKG-CRKVWNCVKQP&KGCWHFKGUGT/GFCKNNGFCTIGUVGNNVG'TUVÒTOWPIFGU5EJNQUUGUJCVKP 9KTMNKEJMGKV CNUQ PKEJV   UVCVVIGHWPFGP %JTKUVKCP +8 JCV 0KEQNCWU 5EJYCDG QHHGPDCT RGTUÌPNKEJ DGCWHVTCIV FKG   /GFCKNNGCWHFKGF·PKUEJG'TQDGTWPI-CNOCTU\WRT·IGPYKGCWUFGO#DUEJPKVVFGT4ÒEMUGKVG%Û)Û'6Û2Û.Û 4Û/Û EWOITCVKCGVRWDNKECNKEGPVKCTGIKCGOCLGUVCVKU JGTXQTIGJV&CTWPVGTKUVFCU/ÒP\\GKEJGP5EJYCDGU GKP -NGGDNCVV \WUGJGP

1578

 22

-TQPG /CTM -QRGPJCIGP&KEMUVÒEMI&CX\W*GFG

5EJÌPpUGJTUEJÌP




DÄNEMARK

1579



1580

1581

(TGFGTKM +++   -TQPGP  -QRGPJCIGP IGRT·IV CWH FKG 8GTGKVGNWPI FGT 'TQDGTWPI   -QRGPJCIGPUFWTEJFKG5EJYGFGPCO(GDTWCTI&CXXCT*GFG  44*ÒDUEJG2CVKPCMN4CPFHGJNGTUGJTUEJÌP  #WEJ PCEJ FGT 0KGFGTNCIG IGIGP FKG OKV FGP &·PGP XGTDÒPFGVGP 0KGFGTNCPFG KP FGT 5GGUEJNCEJV KO ¤TGUWPF CO    1MVQDGT  WPF FGO 4ÒEM\WI FGT UEJYGFKUEJGP (NQVVG KP FKG 1UVUGG DTCEJ -CTN : FKG $GNCIGTWPI XQP   -QRGPJCIGPPKEJVCD+PFGT0CEJVXQOCWHFGP(GDTWCTUEJGKVGTVGUEJNKG­NKEJFGTUEJYGFKUEJG5VWTO CWH-QRGPJCIGPWPFFKG5EJYGFGPOW­VGPUKEJOKVITQ­GP8GTNWUVGP\WTÒEM\KGJGP&GTF·PKUEJG-ÌPKI(TGFGTKM +++FGTRGTUÌPNKEJCPFGP-·ORHGPVGKNIGPQOOGPJCVVGNKG­CPN·­NKEJFKGUGU5KGIGUFKGUG&QRRGNMTQPGRT·IGPFKG KPDGUQPFGTGT9GKUGFCU5GNDUVXGTUV·PFPKUFGU&·PGPMÌPKIUFQMWOGPVKGTV#WHFGT8QTFGTUGKVGKUVUGKP/QPQITCOO \W UGJGP FCU CWH FGO DKDNKUEJGP 5VGKP FGT *KNHG TWJV FGT CWUFTÒEMNKEJ OKV UGKPGT JGDT·KUEJGP $G\GKEJPWPI   'DGPG\GTCWUFGO#NVGP6GUVCOGPVIGPCPPVYKTF&KG4ÒEMUGKVG\GKIVFCU&CVWOFGU5KGIGU (GD WPFFKG CWU 9QNMGP MQOOGPFG *CPF )QVVGU FKG OKV FGO 5EJYGTV FKG *CPF FGU UEJYGFKUEJGP -ÌPKIU CDJCEMV FKG   YKGFGTWOPCEJFGTF·PKUEJGP-TQPGITGKHV-ÌPKI(TGFGTKM+++JCVOKVUGKPGO5KGICNUQNGFKINKEJFGP9KNNGP)QVVGU CWUIGHÒJTVFGOIGO·­FGT7OUEJTKHV51.+&'1).14+# 0WT)QVVCNNGKPUGKFGT4WJO HÒTFGP5KGIWPFFCU 'PFGFGT$GNCIGTWPI\WFCPMGPKUV



%JTKUVKCP8-TQPGP /CTM -QRGPJCIGP&CX*GFG  -N5VGORGNpWPF5EJTÌVNKPIUHGJNGTUGJTUEJÌP



(TGFGTKM +8  5RGEKGUVCNGT  -QRGPJCIGP  I )GJCTPKUEJVGU $TWUVDKNF T OKV   WOIGNGIVGT -GVVG FGU 1TFGPU XQO )QNFGPGP 8NKGU)GMTÌPVGU FTGKHGNFKIGU 9CRRGP WOJGT \YGK   1TFGPUMGVVGP/KV4CPFUEJTKHVf&1/+075/+*+#&+7614#0014')0+37+061&CX *GFG# 44#VVTCMVKXGU'ZGORNCTOKVHGKPGT2CVKPCYKP\4CPFHGJNGTUGJTUEJÌPpXQT\ÒINKEJ 



1582



%JTKUVKCP 8+  5KNDGTOGFCKNNG  XQP , $CIIG CWH FGP 0GWDCW FGU 5EJNQUUGU %JTKUVK   CPUDQTI KP -QRGPJCIGP #PUKEJV FGU 5EJNQUUGU FCXQT 5QNFCVGP 4GKVGT WPF 2HGTFGYCIGP <GKNGP   5EJTKHVOOI)CNUVGT 44(GKPG6ÌPWPIMN-TCV\GTXQT\ÒINKEJ

 23


DÄNEMARK

1583



5KNDGTOGFCKNNG  XQP ) 9 9CJN CWH FKG 8GTO·JNWPI FGU -TQPRTKP\GP (TKGFTKEJ UR·VGT -ÌPKI   (TKGFTKEJ8 OKV.WKUG6QEJVGT)GQTIU++XQP$TCWPUEJYGKI%CNGPDGTI*CPPQXGT-ÌPKIXQP)TQ­ DTKVCPPKGP)GHNÒIGNVGT*[OGPOKV(CEMGNWPF#DWPFCPVKCOKV(ÒNNJQTPJCNVGPGKPGP/[TVGPMTCP\FCTKP DGHKPFGP UKEJ FKG IGMTÌPVGP 9CRRGPUEJKNFG XQP &·PGOCTM 'PINCPF WPF .ÒPGDWTI#EJV -T·P\G OKV   0COGPFGTXGTUVQTDGPGP8GTYCPFVGPFKGKP8GTDKPFWPI\W&·PGOCTM'PINCPFWPF.ÒPGDWTIUVGJGP KP FGT /KVVG GKP -TCP\ OKV FGP 0COGP FGU *QEJ\GKVURCCTGU  OO  I $TQEMOCPP    'KOGTp)CNUVGT -N4CPFHGJNGTUGJTUEJÌPpXQT\ÒINKEJ



1584



(TGFGTKM 8   5RGEKGUVCNGT  -QRGPJCIGP CWH UGKPG -TÌPWPI  I &CX    *GFG 5GNVGPDGUQPFGTUKPFKGUGT'TJCNVWPI2TCEJVGZGORNCT (GKPG2CVKPCHCUV5VGORGNINCP\  (TGFGTKM8 YCTFGTGKP\KIG5QJPXQP%JTKUVKCP8+'TUVTGDVGUGKV$GIKPPUGKPGT4GIKGTWPIPCEJFGO<KGN CNNG6GKNG5EJNGUYKIUWPF*QNUVGKPUWPVGTFGTCNNGKPKIGPMÌPKINKEJGP4GIKGTWPI\WXGTGKPKIGPGTYCTDGTFWTEJ -CWH FGP DKUJGT FGO *GT\QI XQP )NÒEMUDWTI IGJÌTGPFGP 6GKN FGT +PUGN #GTQG UQ FC­ FKGUG LGV\V ICP\ \WO   MÌPKINKEJGP #PVGKN IGJÌTVG  UEJNQ­ GT OKV FGO *GT\QI XQP 2NÌP (TKGFTKEJ -CTN WPVGT <WUVKOOWPI FGT   GTDDGTGEJVKIVGP*GT\ÌIGXQP)NÒEMUDWTI#WIWUVGPDWTIWPF$GEMGKPGP'TDXGTVTCIPCEJFGOFGTRNÌPKUEJG#PVGKN CP FGP -ÌPKI HCNNGP UQNNVG YGPP FGT *GT\QI QJPG O·PPNKEJG 'TDGP UVGTDGP YÒTFG INGKEJ\GKVKI XGT\KEJVGVGP FKG   *GT\ÌIGXQP2NÌPWPFXQP$GEMCWHFKG'TDHQNIGKOINÒEMUDWTIKUEJGP.CPF#NUOKVFGO6QF(TKGFTKEJ-CTNU FKG 2NÌPGT .KPKG GTNQUEJ PCJO FGT -ÌPKI FGTGP )GDKGV KP $GUKV\ &WTEJ FGP 8GTVTCI XQP  GTJKGNV *GT\QI   (TKGFTKEJ %JTKUVKCP CWU FGO #WIWUVGPDWTIGT *CWU XQP (TGFGTKM 8 XGTUEJKGFGPG )ÒVGT CWH  #NUGP HÒT FKG GT KO   )GIGP\WI CWH UGKP 'TDTGEJV CWH FKGRNÌPKUEJGPWPFINÒEMUDWTIKUEJGP.CPFGXGT\KEJVGVG(TGFGTKM8YCT\YGKOCN XGTJGKTCVGVXGTO·JNVGGTUKEJOKV.WKUG6QEJVGT)GQTIU++XQP$TCWPUEJYGKI.ÒPGDWTIWPF)TQ­DTKVCPPKGP FKGLGFQEJUVCTD5GKPG\YGKVG8GTO·JNWPIHCPFOKV,WNKCPG/CTKG6QEJVGTFGU*GT\QIU(GTFKPCPFXQP $TCWPUEJYGKI9QNHGPDÒVVGNUVCVV(TGFGTKM8UVCTDCO,CPWCTKO5EJNQ­%JTKUVKCPUDQTI

1585



24

5KNDGTOGFCKNNGQ,  XQP/)#TDKGP2TGKUFGT#MCFGOKGFGT-ÒPUVG$ÒUVGTOKVWOIGNGI VGO /CPVGN2CNODCWO CWH GKPGO 5VGKP OKV -WPUVYGTM\GWIGP KP .CPFUEJCHV  OO  I   )CNUVGT -TCV\GTUGJTUEJÌP




DÄNEMARK

1586



%JTKUVKCP8++5KNDGTOGFCKNNGXQP&,#F\GTCWHUGKPG-TÌPWPICO/CK$ÒUVG T OKV .QTDGGTMTCP\&GT -ÌPKI MPKGV PCEJ N XQT GKPGO 6KUEJ CWH FGO GKP $WEJ NKGIV FCXQT GKP   5EJGOGNOKV-TQPGWPF<GRVGTOOI)CNUVGT  0WT'ZGORNCTGIGRT·IV5EJÌPG6ÌPWPIUGJTUEJÌPpXQT\ÒINKEJ



1587



5KNDGTOGFCKNNGXQP&,#F\GTCWHFKG'KPHÒJTWPIFGT5VCCVUDÒTIGTUEJCHV7PKHQTOKGTVGU$TWUV DKNFT2KGVCUOKV<GRVGTUKV\VPCEJNWPFTGKEJVFTGK-KPFGTPFKG&·PGOCTM0QTYGIGPWPF*QNUVGKP XGTMÌTRGTPFKG*CPFOOI)CNUVGT 5EJÌPG6ÌPWPIHCUVXQT\ÒINKEJ



1588



5KNDGTOGFCKNNG Q , XQP 2 )KCPGNNK 2TGKU FGT #MCFGOKG FGT -ÒPUVG $ÒUVG T OKV *CCTDCPF2CNO   DCWO CWH GKPGO 5VGKP OKV -WPUVYGTM\GWIGP KP .CPFUEJCHV  OO  I $GTIUÎG    8QT\ÒINKEJGU2TCEJVGZGORNCTOKVHGKPGT6ÌPWPI



&KG XQTNKGIGPFG /GFCKNNG KUV PCEJ FGO 8QTDKNF FGT KO ,CJT  XQP /CIPWU )WUVCX #TDKGP IGUEJCHHGPGP   2T·OKGPOGFCKNNGCPIGHGTVKIVYQTFGP

25


DÄNEMARK

1589



(TGFGTKM8+5KNDGTOGFCKNNGXQP%#/ÌNNGTWPF*'(TGWPFCWHFKG-TÌPWPI FGU -ÌPKIURCCTGU $TWUVDKNFGT FGU 2CCTGU PGDGPGKPCPFGTTOKVWOIGNGIVGO/·PVGNP&CPKCOKV-TQPG WPFF·PKUEJGO9CRRGPUEJKNFUVGJVPCEJNOOI$GTIUÎG 5GJTUEJÌPGU'ZGORNCT



1591

1590

1590



(TGFGTKM8++5RGEKGUFCNGT-QRGPJCIGP&CX*GFG#  -N5VGORGNHGJNGTCO4CPFXQT\ÒINKEJ



4KIUFCNGT-QRGPJCIGP*GFG

 2TCEJVGZGORNCTXQPRQNKGTVGP5VGORGNP(CUV5VGORGNINCP\

1593 1592



 

1592

%JTKUVKCP+:4KIUFCNGT-QRGPJCIGPCWHFGP6QF(TGFGTKMU8++WPFFGP4GIKG TWPIUCPVTKVV%JTKUVKCPU+:&CX*GFG 8QT\ÒINKEJ



&0+5%*9'56+0&+'0 

(TGFGTKM85MKNNKPI-QRGPJCIGP*GFG

5GJTUEJÌPpXQT\ÒINKEJ





&KXGTUG /ÒP\GP FGU  ,CJTJWPFGTVU XQP FGT -W¤TG DKU \WO 5RGEKGUFCNGT W C 5RGEKGUFCNGT      4KIUFCNGT  FKXGTUG )GFGPMOÒP\GP \W  -TQPGT GVE &C\W GKPKIG /ÒP\GP XQP   )TÌPNCPFUQYKGGKPJCDUDWTIKUEJGT6CNGT)+PVGTGUUCPVGU.QVDKVVGDGUKEJVKIGP  5VÒEM5GJTUEJÌPpXQT\ÒINKEJ



5RGEKGFCNGT  HÒT 5EJNGUYKI*QNUVGKP   4KIUFCNGT   &C\W 0QTYGIGP  5MKNNKPI   75#5KNXGT&QNNCT 5VÒEM5GJTUEJÌP



.165&0'/#4-

 26


FRANKREICH

1,5:1

5#//.70)-#41.+0)'4 

1596

1,5:1

(4#0-4'+%*

2KRRKPFGT-WT\G&GPCTWPDGUVKOOVG/ÒP\UV·VVGI ++2+2+ÒDGTNKGIGPFGT#ZV 46Û2/) 8QPITQ­GT5GNVGPJGKV4CPFCWUIGDTQEJGPUGJTUEJÌP



'ZGORNCT FGT #WMVKQP ,CESWGU 5EJWNOCP  #OUVGTFCO  0T  +P  QRIGDCIIGTGF VG 4Q\GPDWTI    'WTQRQQTV 

1,5:1



1597

1,5:1

-CTN FGT )TQ­G  &GPCT %NGTOQPV(GTTCPF  I %ÕQ  .85Õ8#4  0+5 &GRG[TQV   XCT/)XCT 8QPITÌ­VGT5GNVGPJGKV9QJNWPGFKGTVG8CTKCPVG8QT\ÒINKEJGU'ZGORNCT



&GTCWHFGP/ÒP\GP\WHKPFGPFG5VCFVPCOG#48#40+5IGJVCWHFKG<GKV\WTÒEMCNU%NGTOQPVWPVGTFGO0COGP #WIWUVQPGOGVWO8GTYCNVWPIUUKV\FGTICNNQTÌOKUEJGP%KXKVCUFGT#XGTPGTYCT&KG#XGTPGTYCTGPGKPICNNKUEJGT 5VCOO FGT PCEJ FGT 0KGFGTNCIG KJTGU *·WRVNKPIU 8GTEKPIGVQTKZ DGK #NGUKC  X %JT  FGO 4ÌOKUEJGP 4GKEJ   GKPIGINKGFGTV YWTFG $GTGKVU UGKV FGO  ,CJTJWPFGTV YCT %NGTOQPV $KUEJQHUUKV\ &GT 0COG %NCKTOQPV VCWEJV   GTUVOCNU KP GKPGT 7TMWPFG FGU ,CJTGU  CWH &CU XQTNKGIGPFG 'ZGORNCT YGKUV KO )GIGPUCV\ \W FGO DGK )   &GRG[TQVWPF-(/QTTKUQP*)TWPVJCNDGUEJTKGDGPGP6[RCNU$GK\GKEJGPGKPGP-GKN\YKUEJGPFGP\YGK<GKNGP FGT .GIGPFG CWH 8QP FGO 6[RWU QJPG -GKN MCPPVG ) &GRG[TQV NGFKINKEJ \YGK 'ZGORNCTG KP ÌHHGPVNKEJGP   5COONWPIGP

1,5:1



1,5:1

&GPCT&QTGUVCFI%ÕQ.85&1456#5ÒDGTNKGIGPFGT#ZV/)XIN  8QPITQ­GT5GNVGPJGKV5GJTUEJÌPGU'ZGORNCTOKVFWPMNGT2CVKPC

1,5:1



1598

1599



1,5:1

&GPCT/GNNGI%ÕQ.85WOJGT2GTNMTGKU-TGKUHÌTOKIm'&1%85KPFGT/KVVG4QUGVVG WOJGT2GTNMTGKU/)XCT FQTVWPDGMCPPVG/ÒP\UV·VVG  45GJTUEJÌP 

)TKGTUQP$NCEMDWTP NGIGP FGP DGK /QTTKUQP)TWPVJCN WPVGT +PFGVGTOKPCVG /KPVU XGT\GKEJPGVGP 6[R KP FKG   /ÒP\UV·VVG/GNNGKPFGOUKGFKG$WEJUVCDGPXGTDKPFWPIGPKPFGT7OUEJTKHV\W/'61.1CWHNÌUGP XIN/'% 

1,5:1



1600

1,5:1

&GPCT6QWTUI %#4.854':(4-TGW\ 68410+5-CTQNWUOQPQITCOO/)  445GJTUEJÌP

 27


FRANKREICH

1601

1,5:1



.WFYKI FGT (TQOOG  &GPCT %NGTOQPV(GTTCPF  I J.7  &7J +O (GNF XKGT -WIGNP   MTGW\HÌTOKI#48O067FC\YKUEJGP$CNMGPN\YGK-WIGNPTXKGT-WIGNP&GRG[TQVp XIN  /)p XIN  8QPITÌ­VGT5GNVGPJGKV8GTOWVNKEJWPGFKGTV5GJTUEJÌP

1602

1,5:1





1,5:1

&GPCT&QTGUVCFI*.8&188+%85+/2#8%$ÒUVGOKV.QTDGGTMTCP\WPFWOIGNGIVGO/CPVGN &14'6#56855EJKHH/)XCT 44#VVTCMVKXGUUGJTUEJÌPGU'ZGORNCT 

1603

1,5:1



1,5:1

1,5:1

&GPCT3WGPVQXKEI*.8&188+%85+/2#8)$TWUVDKNFTOKV.QTDGGTMTCP\WPFWOIGNGIVGO /CPVGN 38'06188+%855EJKHH/) 8QT\ÒINKEJGU2TCEJVGZGORNCT



)&GRG[TQVMCPPVGXQPFGOXQTNKGIGPFGP6[RNGFKINKEJ'ZGORNCTGKPÌHHGPVNKEJGP5COONWPIGP XIN&GRG[TQV ).GPWO¾TCKTGECTQNKPIKGP9GVVGTGP50T &KG$GFGWVWPIFGU2QTVT·V[RUHÒTFKG/ÒP\RT·IWPI WPVGT.WFYKIFGO(TQOOGP  MQPPVGDKUJGWVGPQEJPKEJV\YGKHGNHTGKIGMN·TVYGTFGP'PVYGFGTUVGJVGTCO $GIKPP FGT 2T·IWPI \YKUEJGP  WPF  QFGT GU JCPFGNV UKEJ ·JPNKEJ YKG WPVGT -CTN FGO )TQ­GP =WO? GKPG   DGUQPFGTG RCTCNNGN \W FGP IGYÌJPNKEJGP 4GKEJURT·IWPIGP NCWHGPFG 'OKUUKQP -NWIG $ 0WOKUOCVKM FGU   /KVVGNCNVGTU 9KGP  $GTNKP  5   #P FGT 2T·IWPI FGT 2QTVT·VFGPCTG YCTGP  /ÒP\UV·VVGP DGVGKNKIV XQP   FGPGP#TNGU&QTGUVCFWPF3WGPVQXKEDGTGKVUWPVGT-CTNFGO)TQ­GP  /ÒP\GPOKV*GTTUEJGTRQTVT·V IGRT·IVJCVVGP %QWRNCPF5/QPG[CPF%QKPCIGWPFGT.QWKUVJG2KQWUKP(TCPEKC5KIOCTKPIGP5 

1604

1605

1606

1607



&GPCT2CXKCI *.8&188+%85+/2-TGW\2#2+#&GRG[TQV*XCT/)XCT  4/KPIGYGNNVHCUVXQT\ÒINKEJ





&GPCT8GPGFKII *.8&188+%85+/2-TGW\ 8'0'%+#5/)  5EJÌPpUGJTUEJÌP





&GPCT8GPGFKII*.8&188+%85+/2-TGW\ 8'0Û'%+#5/)  2T·IGUEJY·EJGWPFMN4CPFHGJNGTUGJTUEJÌP





2KRRKP+-ÌPKIXQP#SWKVCPKGPQFGT2KRRKP++-ÌPKIXQP#SWKVCPKGP&GPCT WPDGUVKOOVG /ÒP\UV·VVG  I 2+2+0+85 4': '1 -TGW\ KP FGP 9KPMGNP LG GKPG -WIGN#2   8+584'+5·WNGPVGORGN/)XIN 4&WPMNG2CVKPCUGJTUEJÌP



28


FRANKREICH

1608



1609

1610

1611

-CTN FGT -CJNG  &GPCT #TTCU  I %4#6+# &Û+ 4': -CTQNWUOQPQITCOO   Ú#64'$Ú#6+5%+8+6#5-TGW\/)XCT  44.GKEJVIGYGNNVWPFMN2T·IGUEJY·EJGCO4CPF UQPUVCVVTCMVKXGUUGJTUEJÌPGU'ZGORNCTOKVHGKPGT2CVKPC





&GPCT $QWTIGU  I %#4.85 +/2 #8% -TGW\ $+68+%'5 %+8+6 -CTQNWUOQPQITCOO   /)XCT #VVTCMVKXGUUGJTUEJÌPGU'ZGORNCTOKVJÒDUEJGT2CVKPC





&GPCT %CODTCK  I )4#6+# &+ 4': -CTQNWUOQPQITCOO %#/#4#%85 %+8+5 -TGW\   /) 5EJTÌVNKPIUTK­UGJTUEJÌP





&GPCT %WTVKUCUQPGP  I %4#6+# &+ 4': -CTQNWUOQPQITCOO %846+5#510+'* -TGW\   /) 5GJTUEJÌP



1612

1613

1614

1615



&GPCT .G /CPU  I %4#6+# &+ 4': -CTQNWUOQPQITCOO %+01/#0+5 %+8+6#5   -TGW\/) (GKPGFWPMNG2CVKPCHCUVXQT\ÒINKEJ





&GPCT .KUKGWZ  I )4#6+# &+ 4': -CTQNWUOQPQITCOO .+%518+85 %+8++ -TGW\   /) #PO  44#VVTCMVKXGUUGJTUEJÌPGU'ZGORNCTOKVHGKPGT6ÌPWPI





&GPCT /GNNG  I %#4.85 4': (4 -TGW\ /'68..1 -CTQNWUOQPQITCOO /)    &WPMNG2CVKPCUGJTUEJÌP





&GPCT 1TN¾CPU  I %#4.85 4': (4 -TGW\ KPFGP9KPMGNPLGGKPG-WIGN #84'.+#0+5 5VCFVVQT/) 5GJTUEJÌP



1616

1617



&GPCT1TN¾CPUI %4#6+#&+4':-CTQNWUOQPQITCOO #84'.+#0+5%+8+6#5-TGW\ /) #VVTCMVKXGUUGJTUEJÌPGU'ZGORNCT





&GPCT1TN¾CPUI %4#6+#&+4':-CTQNWUOQPQITCOO #84'. #0+5%+8+6#5-TGW\ /) 5GJTUEJÌP

 29


FRANKREICH

1618

1,5:1



1,5:1

&GPCT 2CNCUVOÒP\UV·VVG  I %4#6+# &+ 4': -CTQNWUOQPQITCOO 2#.#6+0# /Û0'   -TGW\ 4(CUVXQT\ÒINKEJ



9·JTGPFGKP)TQ­VGKNFGTMCTQNKPIKUEJGP)GRT·IG/ÒP\UV·VVGPPGPPVFKG\YGKHGNHTGK\W\WQTFPGPUKPFIKDVGUFTGK .GIGPFGP FGTGP <WYGKUWPI PQEJ KOOGT 4·VUGN CWHIKDV 0GDGP :2+56+#0# 4'.+)+1 WPF #38+6#0+# IGJÌTV   CWEJFCUDGKFGOXQTNKGIGPFGP'ZGORNCT\WNGUGPFG2#.#6+0#/10'6#FC\W'UKUVXGTOWVGVYQTFGPFCUUUKEJ JKPVGT FGO $GITKHH GKPG OKV FGOMÌPKINKEJGP*QHTGKUGPFG/ÒP\UV·VVGXGTDKTIVFKGUQOKVCPOGJTGTGP5VGNNGPFGU 4GKEJGU NQMCNKUKGTV YGTFGP MÌPPVG WPF LG PCEJ $GFCTH RT·IVG &CIGIGP URTKEJV LGFQEJ FC­ PKEJV XQP CNNGP   MCTQNKPIKUEJGP *GTTUEJGTP GPVURTGEJGPFG /ÒP\GP DGMCPPV UKPF XIN )TKGTUQP 2  $NCEMDWTP / /GFKGXCN   'WTQRGCP%QKPCIG+6JG'CTN[/KFFNG#IGUVJEGPVWTKGU%CODTKFIG5 9·JTGPF-(/QTTKUQP * )TWPVJCN 0T   WPF ) &GRG[TQV 0T   CWH GKPG IGPCWGTG <WYGKUWPI XGT\KEJVGP UEJN·IV $ -NWIG  

0WOKUOCVKMFGU/KVVGNCNVGTU$GTNKP9KGP0T GKPG8GTQTVWPIPCEJ#CEJGPXQT/ÌINKEJGTYGKUGUKPF CDGT CWEJ OGJTGTG YGEJUGNPFG 1TVG IGOGKPV FKG FGP 5VCVWU GKPGU 8GTYCNVWPIU\GPVTWOU FGU -CTQNKPIGTTGKEJGU   KPPGJCVVGP (ÒT -CTN FGP )TQ­GP   M·OG DGKURKGNUYGKUG FCU DGTGKVU GTY·JPVG #CEJGP KP (TCIG -CTN FGT   -CJNGJKGNVUKEJÒDGTYKGIGPFKP8GTDGTKG3WKGT\[WPF2QPVJKQP  CWH XIN)TKGTUQP$NCEMDWTP5  .GFKINKEJ GKPG /ÒP\G -CTNU FGU -CJNGP PGPPV FKG 7OUEJTKHV 2#.#6+0# /10' KP 8GTDKPFWPI OKV 2CTKU  

2#4+5++%+8+6#5)&GRG[TQV0T$ 

1619

1620

1622

1621



&GPCT2CTKUI %4#6+#&+4':-CTQNWUOQPQITCOO 2#4+5++%+8+6#5-TGW\/) 4#VVTCMVKXGUUGJTUEJÌPGU'ZGORNCTOKVHGKPGT2CVKPC





&GPCT 3WGPVQXKE  I )4#6+# &+ 4': -CTQNWUOQPQITCOO 388'06188+%+ -TGW\ KO   GTUVGPWPFXKGTVGP9KPMGNLGGKPG-WIGN/) 5GJTUEJÌPpXQT\ÒINKEJ





&GPCT 4GPPGU  I %4#6+# &+ 4': -CTQNWUOQPQITCOO *4'&10+5 %+8+6#5 -TGW\   /) (CUVXQT\ÒINKEJGU'ZGORNCTOKVFWPMNGT2CVKPC





&GPCT6QWNQWUGI %#4.85':(-TGW\ 61.15#%+8+-CTQNWUOQPQITCOO/) 4GUVGXQP)TÒPURCPUGJTUEJÌPpXQT\ÒINKEJ



1,5:1



1623

1,5:1

1DQN$QWTIGUI-CTQNWUOQPQITCOO $+684+%#5-TGW\/)p  8QPITÌ­VGT5GNVGPJGKV(GKPG2CVKPCUGJTUEJÌPpXQT\ÒINKEJ )GQTIGU&GRG[TQVMCPPVGNGFKINKEJGKP'ZGORNCTFKGUGU6[RUCWUGKPGOKP&QTGUVCFIGOCEJVGP(WPF &GRG[TQV) .GPWO¾TCKTGECTQNKPIKGP9GVVGTGP0T &KGUGU5VÒEMKUVCWEJDGK*CPU*GTOCPP8ÌNEMGTUXGT\GKEJPGV

8ÌNEMGTU * * -CTQNKPIKUEJG /ÒP\HWPFG FGT (TÒJ\GKV  )ÌVVKPIGP  5  0T +++     *ÌEJUVYCJTUEJGKPNKEJ JCPFGNV GU UKEJ DGK FGO JKGT \WT 8GTUVGKIGTWPI IGNCPIGPFGP 1DQN WO FCU \YGKVG DGMCPPVG   'ZGORNCT

30




FRANKREICH

1625

1624

1627

1626



1DQN %CODTCK  I %4#6+# &+ 4': -CTQNWUOQPQITCOO %#/#4#%85 %+ -TGW\   /)XCT 45GJTUEJÌP





-CTN FGT &KEMG  &GPCT #TNGU  I %#4.85 +/2'4#6 -TGW\ #4'.# %+8+5   -CTQNWUOQPQITCOO/) 45GJTUEJÌPpXQT\ÒINKEJ



&KG <WYGKUWPI FGU XQTNKGIGPFGP 'ZGORNCTU KUV PKEJV \YGKHGNUHTGK IGUKEJGTV 9·JTGPF - /QTTKUQP* )TWPVJCN   FKGUGP WPF ·JPNKEJG6[RGP /) NGFKINKEJWPVGT.CVG0KPVJ%GPVWT[+UUWGUQHCP'ORGTQT%JCTNGU GKPQTFPGPURTKEJVUKEJ)&GRG[TQVHÒTGKPG2T·IWPIWPVGT-CTNFGO-CJNGP  QFGT-CTNFGO&KEMGP   CWU &GRG[TQV).GPWO¾TCKTGECTQNKPIKGP9GVVGTGP50T 





1FQ&GPCT#TTCUI %4#6+#&+4':+O(GNF&TGKGEMÒDGT\YGK4KPIGPFC\YK UEJGP-WIGN Ú#Ú64'$Ú#5%+#+-TGW\/)  *ÒDUEJG2CVKPCYKP\-QTTQUKQPUURWTGPUGJTUEJÌPpXQT\ÒINKEJ



&GPCT.KOQIGUI )4#6+#&+4'+O(GNF1&1\YKUEJGP\YGK-TGW\GP .+/18+%#5%+8+5 -TGW\/) 5GJTUEJÌPpXQT\ÒINKEJ



1628

1630

1629

1631



&GPCT.KOQIGUI )4#6+#&+4'+O(GNF1&1\YKUEJGP\YGK-TGW\GP .+/18+%#5%+8+5 -TGW\/) 5EJTÌVNKPIUTKUUGUQPUVUGJTUEJÌPpXQT\ÒINKEJ





-CTN FGT 'KPH·NVKIG  &GPCT $TÒIIG  I -CTQNWUOQPQITCOO $48%%+#/1 -TGW\   KPFGP9KPMGNPLGGKP-GKN/)XINp 444CPFCWUIGDTQEJGPUGJTUEJÌP



'ZGORNCTFGT#WMVKQP,CESWGU5EJWNOCP#OUVGTFCO0T





.WFYKIFCU-KPF&GPCT-ÌNPI .8&188%854':-TGW\LGGKPG-WIGNKPFGP 9KPMGNP5%1.10+##/) 5GNVGPDGUQPFGTUKPFKGUGT'TJCNVWPI *ÒDUEJG2CVKPCMN2T·IGUEJY·EJGCO4CPFHCUVXQT\ÒINKEJ



4CQWN  &GPCT %JCVGCWFWP  I %4#6+# &+ 4': 4QFWNHWUOQPQITCOO &80+5   %#56..+-TGW\/) 45GJTUEJÌP



1,5:1



1632

1,5:1

.WFYKI +8  &GPCT 2CTKU  I )4#6+# &'+ 4': 7O GKPG -WIGN .1&18+%     2#4+5+%+8+6# /) 445GJTUEJÌP  31


FRANKREICH

1634

1633



.QVJCT  &GPCT $QWTIGU  I .16'4+85 4': -TGW\: $+684+%'5 %+8+6 -CTQ   NWUOQPQITCOO/) 5GJTUEJÌP



%QPTCF NG 2CEKHKSWG  &GPCT .[QP  I %104#&85 -TGW\ .8)&8085 -TGW\   ÒDGT&TGKGEM/) 5GJTUEJÌP



&#5-¤0+)4'+%*$74)70&

1635 1,5:1





1,5:1

&#5-¤0+)4'+%*(4#0-4'+%*

(TCP¼QKU+6GUVQPQ,6[R'6QWTU&WRNGUU[

8QT\ÒINKEJ





*GPTK+++(TCPE)2QKVKGTU&WRNGUU[  *ÒDUEJG2CVKPCUGJTUEJÌPpXQT\ÒINKEJ





.QWKU:+8'EW¯NCO½EJGNQPIWG0/QPVRGNNKGT&C\W'EW¯NCO½EJGNQPIWG *.C4QEJGNNG&CX&WRNGUU[)CFQWT[  5VÒEM-N&TWEMUVGNNGPWPF4CPFHGJNGTUGJTUEJÌP



'EW¯NCO½EJGNQPIWG+.KOQIGU&WRNGUU[)CFQWT[  ,WUVKGTVUGJTUEJÌPpXQT\ÒINKEJ



1636



1638

1636

1639



32

5KNDGTOGFCKNNGXQP,4QGVVKGTUCWHFKG$GNCIGTWPIFGT5VCFV)GPV)GJCTPKUEJVGU$TWUVDKNFTOKV .QTDGGTMTCP\ WPF WOIGNGIVGO /CPVGN&KG RGTUQPKHK\KGTVG 8QTUKEJV UKV\V PCEJ N CWH 9CHHGP KP FGT   4GEJVGP(ÒNNJQTPNUEJYGDVFKGRGTUQPKHK\KGTVG)GUEJYKPFKIMGKVTOKV2HGKNKPFGT.KPMGPKPFGTGTJQ DGPGP4GEJVGPJ·NVUKGGKPGIGHNÒIGNVG5CPFWJTKO*KPVGTITWPFFKG5VCFVCPUKEJVXQP)GPVKO#DUEJPKVV \YGK<GKNGP5EJTKHVOOIX.QQP+++5  -N5VGORGNHGJNGTXQT\ÒINKEJGU'ZGORNCT 


FRANKREICH

1641

1640

1642



'EWFG(NCPFTG...KNNGI$TWUVDKNFTOKVWOIGNGIVGO/CPVGN)GMTÌPVGUXKGTHGNFKIGU 9CRRGP&CX&WRNGUU[)CFQWT[ 44(CUVXQT\ÒINKEJXQT\ÒINKEJ



'EWFG(NCPFTG..KNNG&WRNGUU[)CFQWT[

445EJÌPpUGJTUEJÌPUGJTUEJÌP





'EWCWZJWKV.)2QKVKGTU4¾HQTOCVKQP&CX&WRNGUU[#)CFQWT[  *ÒDUEJG2CVKPCUGJTUEJÌP



1643



1645



1644

'EW CWZ RCNOGU  $$ 5VTC­DWTI 4¾HQTOCVKQP &CX  &WRNGUU[  # )CFQWT[    5NI8QN\p 45GJTUEJÌP





'EWCWZJWKV.14KQO4¾HQTOCVKQP&CX&WRNGUU[#)CFQWT[  ªDGTRT·IWPIUURWTGPUGJTUEJÌP





.QWKU:8'EWFG0CXCTTG86TQ[GU&CX&WRNGUU[)CFQWT[  9KP\5EJTÌVNKPIUHGJNGTMN-TCV\GTXQT\ÒINKEJ



'UJCPFGNVUKEJDGKFGOXQTNKGIGPFGP5VÒEMWOFKGGTUVGMÌPKINKEJG'EW2T·IWPIXQP5VTC­DWTIPCEJFGT#PPGZKQP 0CEJFGT-CRKVWNCVKQPXQP+NNMKTEJJCVVG.QWKU:+85VTC­DWTIXGTURTQEJGPFQTVMGKPGMÌPKINKEJGP2T·IWPIGP XQT\WPGJOGP  DTCEJ GT FKGUGU 8GTURTGEJGP &WTEJ FKG  WPF  4GHQTOCVKQP YWTFGP FKG OGKUVGP 5VÒEMG   XGTPKEJVGV

33


FRANKREICH

1647

1646

1646



'EWCWDCPFGCW#2CTKU&CX&WRNGUU[)CFQWT[  2TCEJVXQNNG2CVKPCMN5EJTÌVNKPIUHGJNGTNGKEJVLWUVKGTVXQT\ÒINKEJ



.WFYKI :8 ICNV CNU KPVGNNKIGPV CDGT CWEJ IGPW­UÒEJVKI 'T YCT FGP KPPGP WPF CW­GPRQNKVKUEJGP 2TQDNGOGP FGU   .CPFGU PKEJV IGYCEJUGP WPF YWTFG RQNKVKUEJ UQICT XQP UGKPGP /·VTGUUGP /CFCOG FG 2QORCFQWT /CFCOG   &WDCTT[ DGGKPHNW­V&GTJKGT\WT8GTUVGKIGTWPIIGNCPIGPFG/ÒP\V[R'EWCWDCPFGCWYWTFG\WOGTUVGP/CN IGRT·IV &GT 6[R UQNNVG  ,CJTG NCPI IGRT·IV YGTFGP WPF YWTFG FCOKV FGT CO N·PIUVGP IGRT·IVG /ÒP\V[R FGT   HTCP\ÌUKUEJGP-ÌPKIUOÒP\GP*GWVGMQOOGPFKGUG'EWUOGKUVPWTKPO·­KIGP'TJCNVWPIGPXQT



'EWCWDCPFGCW#2CTKU&WRNGUU[)CFQWT[  *ÒDUEJG2CVKPCOKPLWUVKGTVXQT\ÒINKEJp5VGORGNINCP\

1648



1649



1650

.QWKU:8+$TQP\GOGFCKNNGXQP0)CVVGCWZCWHFGP$CNNQPHNWIFGT$TÒFGT,QUGRJ /KEJGN WPF ,CESWGU 'VKGPPG /QPVIQNHKGT -ÌRHG FGT $TÒFGT PGDGPGKPCPFGT N#PUKEJV FGU %JCOR FG   /CTUKP2CTKUQDGPUEJYGDGPFGT*GK­NWHVDCNNQPKP9QNMGPKO#DUEJPKVVXKGT<GKNGP5EJTKHVOO /¾FCKNNGUHTCP¼CKUGU 8QT\ÒINKEJ





'EWCWZTCOGCWZF QNKXKGT41TN¾CPU&WRNGUU[)CFQWT[





%QPXGPVKQP  $TQP\GRTQDG  XQP # )CNNG CWH FGP 0CVKQPCNMQPXGPV IGRT·IV XQP FGT   -ÒPUVNGTXGTGKPKIWPIFGT5VCFV.[QPJGTIGUVGNNVCWU)NQEMGPOGVCNN(TGKJGKVUMQRHNFCJKPVGT5VCDOKV(TGK JGKVUOÒV\G<GJP<GKNGP5EJTKHVWOJGT'KEJGPMTCP\OOI/C\CTF 5GJTUEJÌP

(CUVXQT\ÒINKEJ

&GT CWH FGT 8QTFGTUGKVG FKGUGT /GFCKNNG FCTIGUVGNNVG (TGKJGKVUMQRH .KDGTV[  DKNFGV FKG 8QTNCIG HÒT FKG COGTKMCPK   UEJGP%GPVWPF*CNHEGPVUVÒEMGFGU<GKVTCWOGU

34




FRANKREICH

1651

1651

1653

1652



1652

5KNDGTOGFCKNNG  XQP 2 $CNFGPDCEJ CWH FGP 6QF FGU -ÌPKIU .QWKU :8+ $ÒUVG T6TCWGTPFG   )CNNKCUKV\VPCEJNFGPNKPMGP#TOCWHFGPHTCP\ÌUKUEJGP9CRRGPUEJKNFIGNGIVOKVFGOTGEJVGP#TO WOHC­VUKGGKPG7TPGCWH5QEMGNXQTKJT2QUVCOGPVOKVXKGT<GKNGP5EJTKHVCO$QFGPNKGIVGKPG\GTDTQ EJGPG-TQPGWPFGKP\GTDTQEJGPGU<GRVGTOOI5NI,WNKWU 5GJTUEJÌPpXQT\ÒINKEJ





-W5QNUCWZ$CNCPEGU##/GV\)CFQWT[/C\CTF  44#VVTCMVKXGUHCUVXQT\ÒINKEJGU'ZGORNCT





6TCIDCTGGKPUGKVKIG$TQP\GIW­OGFCKNNGQ, WO WPUKIPKGTVCWH/CZKOKNKCPFG4QDGURKGTTGWPF %¾EKNG 4GPCWNV 4GPCWF  $GKFGT $TWUVDKNFGT GKPCPFGT IGIGPÒDGT KP -CTVWUEJGP FC\YKUEJGP 5VCD OKV   (TGKJGKVUOÒV\GWPFUVTCJNGPFGO#WIGOO5NI,WNKWU 5GJTUEJÌPpXQT\ÒINKEJ



/CZKOKNKCP /CTKG +UQFQTG FG 4QDGURKGTTG  #TTCU Ó 2CTKU YCT 4GEJVUCPYCNV WPF 2QNKVKMGT HÒJTGPFGU   /KVINKGFFGT,CMQDKPGTWPFOC­IGDNKEJDGVGKNKIVCPFGTGTUVGP2JCUGFGT(TCP\ÌUKUEJGP4GXQNWVKQP5GKPRQNKVKUEJGU <KGN YCT FKG 'TTKEJVWPI GKPGU 5VCCVUYGUGPU KP FGO CNNGKP FGT 8QNMUYKNNG GPVUEJGKFGPF UGKP UQNNVG 7O FKGU \W   GTTGKEJGP DGFKGPVG GT UKEJ CNNGTFKPIU GKPGU UV·PFKI \WPGJOGPFGP 6GTTQTU +P UGKPGT 4GFG XQO  &G\GODGT    HQTFGTVG GT FGP 6QF XQP .QWKU :8+ FC FKGUGT GKPG \W ITQ­G )GHCJT HÒT FKG 4GXQNWVKQP FCTUVGNNVG'TGTMN·TVGKJP \WO8GTT·VGT(TCPMTGKEJUWPF8GTDTGEJGTCPFGT/GPUEJJGKV#O,CPWCTYWTFGFGT-ÌPKIGPVJCWRVGV+O ,WNK  YWTFG 4QDGURKGTTG \WO /KVINKGF FGU 9QJNHCJTVUCWUUEJWUUGU DGTWHGP #WU FKGUGT 2QUKVKQP JGTCWU   WPVGTUVÒV\VG4QDGURKGTTGCNNG/C­PCJOGPIGIGPFKG(GKPFGFGT4GXQNWVKQPGTXGTVTCVFKGªDGT\GWIWPIPWTFGT 6GTTQT IGIGP FCU 8GTDTGEJGP XGTUEJCHHG FKG PQVYGPFKIG 5KEJGTJGKV &KG WP\·JNKIGP *KPTKEJVWPIGP DTCEJVGP KJO   UEJNKG­NKEJ FKG $G\GKEJPWPI $NWVTKEJVGT GKP #O  GTNKG­ GT OKV FGO UQIGPCPPVGP 2TCKTKCN&GMTGV GKP   )GUGV\PCEJFGOFGP8GTWTVGKNVGPMGKP4GEJVUDGKUVCPF\WMQOOGPFWTHVGWPFLGFGTQJPG/GJTJGKVUDGUEJNW­XQTFCU 4GXQNWVKWQPUVTKDWPCN IGDTCEJV YGTFGP MQPPVG 'U HQNIVGP YKGFGTWO \CJNTGKEJG 8GTWTVGKNWPIGP #O  ,WNK    MÒPFKIVG GT YGKVGTG 8GTUEJ·THWPIGP FGU 6GTTQTIGUGV\GU CP WPF URKGNVG CWEJ CWH OWVOC­NKEJG 8GTT·VGT KP FGP   GKIGPGP 4GKJGP CP &KGU HÒJTVG UEJNKG­NKEJ \WO 5VWT\ 4QDGURKGTTGU WPF GT YWTFG CO  QJPG   )GTKEJVUXGTHCJTGPFWTEJFKG)WKNNQVKPGJKPIGTKEJVGV%¾EKNG4GPCWNV ÓYWTFGYGIGPGKPGUXGTUWEJVGP #VVGPVCVU CWH 4QDGURKGTTG \WO 6QFG XGTWTVGKNV WPF UVCTD CO  ,WPK  GDGPHCNNU FWTEJ FKG )WKNNQVKPG ,GFQEJ   YWTFGPKGICP\IGMN·TVQDFKGUGT#PUEJNCIYKTMNKEJIGRNCPVYCT$GTKEJVGP\WHQNIGUWEJVGUKG4QDGURKGTTGKPUGKPGT 9QJPWPICWHFCUKGUGJGPYQNNVGYKGGKP6[TCPPCWUUKGJV&KG6CVUCEJGFC­UKGGKPMNGKPGU(GFGTOGUUGTDGKUKEJ VTWIYCT\WT<GKVFGT5EJTGEMGPUJGTTUEJCHV4QDGURKGTTGUHTGKNKEJ#PNC­IGPWIWOUKG\WO6QFG\WXGTWTVGKNGP



0CRQN¾QP +   #EJVGEMKIG 5KNDGTOGFCKNNG Q ,   XQP , ' )CVVGCWZ CWH FKG   MCKUGTNKEJG /WUKM#MCFGOKG $ÒUVG T OKV .QTDGGTMTCP\0CEMVGT #RQNNQ OKV .QTDGGTMTCP\ WOIGNGI   VGO/CPVGNWPF.[TCUVGJVXXFGP-QRHPCEJTIGYCPFVT5·WNGZZZ OOI&C\W#EJVGEMKIG5KNDGTOGFCKNNGXQP$#PFTKGWCWHFKG2CTKUGT(NGKUEJGTGK$ÒUVG TOKV.QTDGGTMTCP\5VKGTNFGP-QRHPCEJXQTPIGYCPFVZZZOOI 5NI,WNKWU 5VÒEM4CPFHGJNGTUGJTUEJÌPWPFXQT\ÒINKEJ



35


FRANKREICH

1656

1657

1655



(TCPEU#0  #2CTKU&CX)CFQWT[/C\CTF  2TCEJVGZGORNCT44/KP$GCTDGKVWPIUURWTGPXQT\ÒINKEJ



#EJVGEMKIG5KNDGTOGFCKNNGXQP,2&TQ\CWHFKG5VKHVWPIFGU1TFGPUFGT'KUGTPGP-TQPG-QRHN OKV.QTDGGTMTCP\#PUKEJVFGU1TFGPUZZZOOI5NI,WNKWU 8QPITQ­GT5GNVGPJGKV8QT\ÒINKEJ 



#EJVGEMKIG$TQP\GOGFCKNNGXQP,2&TQ\CWHFKG5VKHVWPIFGU1TFGPUFGT'KUGTPGP-TQPG-QRHN OKV.QTDGGTMTCP\#PUKEJVFGU1TFGPUZZZOO5NI,WNKWU  44.CEMTGUVGUGJTUEJÌP





1658



$TQP\GOGFCKNNGXQP#)CNNGWPF0)$TGPGVCWHUGKPGP#WHGPVJCNVKP5EJÌPDTWPPWPFCWHFKG 5EJNCEJVDGK9GTVKPIGP0CRQN¾QPWPFUGKP5EJYCIGT,QCEJKO/WTCV/CTUEJCNNXQP(TCPMTGKEJUVGJGP PCEJNWPFGORHCPIGPFKG#DQTFPWPIFGT2CTKUGT$ÒTIGTOGKUVGTKO8QTFGTITWPFTNCIGTVGKPG3WGNN P[ORJG8KMVQTKCOKV5EJTKHVTQNNGWPF2QUCWPGUEJTGKVGVPCEJNKO*KPVGTITWPF-TKGIUVTQRJ·GPOO 5NI,WNKWU 8QT\ÒINKEJ



1659 1660

  36

%GPVKOGU#2CTKU)CFQWT[/C\CTF (TCPEU#2CTKU&CX)CFQWT[/C\CTF

1660

(CUV5VGORGNINCP\ 8QT\ÒINKEJ

 


FRANKREICH

1662

1661



(TCPEU#2CTKU2¾TKQFGFGU%GPVLQWTU&CX)CFQWT[/C\CTF  5GNVGPKPFKGUGT'TJCNVWPI(GKPG2CVKPCYKP\4CPFHGJNGTXQT\ÒINKEJp5VGORGNINCP\



.QWKU :8+++    (TCPEU  $TÒUUGN 2TQDG XQP 6T¾DWEJGV OKV GTJCDGPGT 4CPF   UEJTKHVI/C\CTF 449KP\4CPFHGJNGTXQT\ÒINKEJGU2TCEJVGZGORNCTOKVHGKPGT6ÌPWPI 



1663



%JCTNGU:5KNDGTOGFCKNNGXQP4)C[TCTFCWHUGKPG-ÌPKIUYGKJGFWTEJFGP'T\DK UEJQH XQP 4GKOU $ÒUVG N&CTUVGNNWPI FGT <GTGOQPKG  OO  I /¾FCKNNGU HTCP¼CKUGU   5 (GKPG6ÌPWPIXQT\ÒINKEJ

1664

1665



(TCPEU9.KNNG&CX)CFQWT[/C\CTF



.QWKU 2JKNKRRG   (TCPEU  2TQDG XQP %CWPQKU KP <KPPOKVINCVVGO4CPFI /C\CTF 2TCEJVGZGORNCT(CUV5VGORGNINCP\

1666



(CUVXQT\ÒINKEJ

 

1667



(TCPEU9.KNNG&CX)CFQWT[/C\CTF  (GKPG2CVKPCNGKEJVG-QTTQUKQPUURWTGPCO4CPFXQT\ÒINKEJp5VGORGNINCP\





(TCPEU9.KNNG&CX)CFQWT[/C\CTF  (GKPG2CVKPCMN-QTTQUKQPUUVGNNGCO4CPFXQT\ÒINKEJ

 37


FRANKREICH

1669

1668

1668



 (TCPEU  2TQDG KP -WRHGT IGHGTVKIV KP FGT 9GTMUVCVV & 7JNJQTP KP )TGXGPDTQKEJ  I   /C\CTFC 8QPITÌ­VGT5GNVGPJGKV8QT\ÒINKEJp5VGORGNINCP\





(TCPEU#2CTKU)CFQWT[/C\CTF



8QT\ÒINKEJp5VGORGNINCP\

1670

1671



 4GRWDNKM   (TCPEU  2TQDG KP $TQP\G XQP )C[TCTF WPUKIPKGTV   I   )CFQWT[XCT/C\CTFE *GTTNKEJG2CVKPCXQT\ÒINKEJp5VGORGNINCP\



(TCPEU2TQDGKP$TQP\GXQP)C[TCTFI)CFQWT[/C\CTFE

1672

 (CUV5VGORGNINCP\

 

1673



(TCPEU2TQDGKP<KPPXQP/CIPKCFCUI)CFQWT[/C\CTFF  8QT\ÒINKEJp5VGORGNINCP\





(TCPEU2TQDGKP<KPPXQP4G[PCWFI)CFQWT[/C\CTFC  8QT\ÒINKEJp5VGORGNINCP\



1674

1675



(TCPEU2TQDGXQP&WRT¾KP$TQP\GI)CFQWT[/C\CTFC

(CUVXQT\ÒINKEJ





(TCPEU2TQDGKP$TQP\GWPUKIPKGTVI)CFQWT[/C\CTFC  2TCEJVGZGORNCTOKVHGKPGT2CVKPC(CUV5VGORGNINCP\



38


FRANKREICH

1676

1677



(TCPEU2TQDGKP<KPPXQP/CNDGVI)CFQWT[/C\CTFC  2TCEJVGZGORNCT(CUV5VGORGNINCP\





(TCPEU#2CTKU&CX)CFQWT[/C\CTF



*ÒDUEJG2CVKPCXQT\ÒINKEJ

1678



.QWKU 0CRQN¾QP 2T·UKFGPV FGT  4GRWDNKM  5KNDGTOGFCKNNG  XQP . /GTNG[ CWH   FKG'KPYGKJWPIFGT4GKVGTUVCVWG0CRQN¾QPU+KP.[QP#PUKEJVFGT4GKVGTUVCVWG6CHGNOKVUGEJU<GKNGP 5EJTKHVFCTÒDGTFCU5VCFVYCRRGPXQP.[QP\WFGP5GKVGP.QTDGGT\YGKIGWPFLGGKP-PCDGOKVGKPGO .QTDGGTMTCP\ D\Y GKPGO 2CNO\YGKI FCTÒDGT UKGDGP <GKNGP 5EJTKHV KP 6CDGNNGPHQTO /KV 4CPFRWP\G  

(KPIGT #4)'06OOI2CIG&KXQ&KXQ 4(CUVXQT\ÒINKEJ



1679

1680

1680



(TCPEU#2CTKU&CX)CFQWT[/C\CTF



0CRQN¾QP +++  5KNDGTOGFCKNNGXQP#$QTTGNCWHFKG9KGFGTGTTKEJVWPIFGUHTCP\ÌUK UEJGP -CKUGTTGKEJGU FWTEJ FCU 2NGDKU\KV XQO  0QXGODGT $ÒUVG N#FNGT OKV CWUIGDTGKVGVGP   (NÒIGNPXXFGP-QRHPCEJNIGYCPFVWPVGP6CHGNOKVFGT0T $GHÒTYQTVGT QDGP-TQPG XQT\YGKIGMTGW\VGP<GRVGTPWOJGT5VTCJNGPOOI2CIG&KXQ&KXQ  4(GKPG6ÌPWPIXQT\ÒINKEJ

8QT\ÒINKEJ

0CEJQHHK\KGNNGP#PICDGPUVKOOVGP$ÒTIGTHÒTWPFPWTIGIGPFKG9KGFGTGKPHÒJTWPIFGU-CKUGT VWOU5VKOOGPYCTGPWPIÒNVKI'UICDCNNGTFKPIUEC/KQ'PVJCNVWPIGP





39


FRANKREICH

1681

1682

1682



(TCPE$$5VTC­DWTI)CFQWT[/C\CTF

2TCEJVGZGORNCT(CUV5VGORGNINCP\





(TCPEU$$5VTC­DWTI&CX)CFQWT[/C\CTF

8QT\ÒINKEJ





(TCPEU$$5VTC­DWTI&CX)CFQWT[/C\CTF  *GTTNKEJG2CVKPCXQT\ÒINKEJp5VGORGNINCP\





(TCPEU#2CTKU&CX)CFQWT[/C\CTF

1683

1685

1684

 *ÒDUEJG2CVKPCXQT\ÒINKEJp5VGORGNINCP\



1686



4GRWDNKM(TCPEU#2CTKU&CX)CFQWT[/C\CTF  *ÒDUEJG2CVKPCXQT\ÒINKEJ





(TCPEU#2CTKU&CX)CFQWT[C/C\CTF  2TCEJVGZGORNCT*GTTNKEJG2CVKPCHCUV5VGORGNINCP\





4GRWDNKMUGKV(TCPEU2CTKU)CFQWT[/C\CTF&C\W7PICTP/KNNGPKWO VCNGT 0GWRT·IWPI )CFQWT[/C\CTF 5VÒEM(CUV5VGORGNINCP\



.165(4#0-4'+%* 

.QWKU:8+'EWCWZTCOGCWZF QNKXKGT/6QWNQWUG &CX 0CRQN¾QP+(TCPEU* .C4QEJGNNG &CX .QWKU:8+++(TCPEU/6QWNQWUG &CX   5VÒEM5GJTUEJÌPpXQT\ÒINKEJ





0CRQN¾QP +  (TCPEU  $ 4QWGP &CX   .QWKU :8+++  (TCPEU  + .KOQIGU &CX     %JCTNGU:(TCPEU9.KNNG &CX  5VÒEM.GKEJVG-QTTQUKQPUURWTGP Z XQT\ÒINKEJ





7OHCPITGKEJG 5COONWPI XQP HTCP\ÌUKUEJGP -NGKPOÒP\GP5·V\GP 2TQQH5GVU 5QPFGTRT·IWPIGP WPF   &KEMCDUEJN·IGPFGU,CJTJWPFGTVU#NNG/ÒP\GPDGHKPFGPUKEJKPQTKIKPCNGP'VWKUD\Y$NKUVGTP WPFUKPF\WOITÌ­VGP6GKNOKV<GTVKHKMCVGPXGTUGJGP*QEJKPVGTGUUCPVGU1DLGMVOKVDGUUGTGP,CJTI·PIGP DKVVGDGUKEJVKIGP 5VÒEM5VGORGNINCP\D\YRQNKGTVG2NCVVG 

40


FRANKREICH

1692

1693

1691

1691

(4#0-4'+%*('1&#.'5

$'#40 

*GPTK++(TCPE&WRNGUU[XCT

*ÒDUEJG2CVKPCUGJTUEJÌP



%#4%#5510' 

#PQP[O &GPKGT  I %+28+ 6#6'5 8GTYKNFGTVGU 'WFGUOQPQITCOO %#4%#510#   -TGW\&WRNGUU[ 5GJTUEJÌP



%*#6'#7.#0&10 

4CQWN  &GPKGT  I %4#6+# &+ 4QFWNHWUOQPQITCOO %#56+5. #*&*+ -TGW\   /)XINHH 45GJTUEJÌP

1694



1695 1694

%*#6'#74'0#7& 

.QWKUG/CTIWGTKVG FG .QTTCKPG CNNGKP   5QNU #FNGTUEJKNNKPI  Q , FG /G[ &    )CODGTKPKp2QG[F #XCPVp .GKEJVG2T·IGUEJY·EJGHCUVXQT\ÒINKEJ



014/#0&+' 

4KEJCTF +  &GPKGT 4QWGP  I 4+%#4&85+ -TGW\ KP FGP 9KPMGNP LG GKPG -WIGN   4161/#)856GORGNKO<GPVTWO#PFTGCUMTGW\KPFGP9KPMGNPLGGKPG-WIGN&WRNGUU[  2T·IGUEJY·EJGUGJTUEJÌPpXQT\ÒINKEJ



4KEJCTF+IGPCPPVQJPG(WTEJVYCTFGT5QJP9KNJGNOU+XQP4QWGP(ÒTUVFGT0QTOCPPGPWPF5RTQVCUGKPGT DTGVQPKUEJGP-TKGIUIGHCPIGPGPWPF-QPMWDKPG<WO<GKVRWPMVFGT'TOQTFWPIUGKPGU8CVGTUYCT4KEJCTFPQEJGKP -KPFUQFC­GTFGPHTCP\ÌUKUEJGP-ÌPKI.WFYKI+8  PKEJVFCTCPJKPFGTPMQPPVGKJPKP.CQPIGHCPIGP\W JCNVGP WPF CP UGKPGT 5VGNNG GKPGP 5VCVVJCNVGT GKP\WUGV\GP &KG PQTOCPPKUEJG $GXÌNMGTWPI GTJQD UKEJ FCTCWHJKP OKV   7PVGTUVÒV\WPI FGU F·PKUEJGP -ÌPKIU *CTCNF $NCW\CJP   IGIGP FGP -ÌPKI FGT KP FGP HQNIGPFGP -·ORHGP   WPVGTNCI4KEJCTFMQPPVGKPUGKPG*GKOCV\WTÒEMMGJTGPWPFYWTFGFGTGTUVG*GT\QIFGT0QTOCPFKG

1697

1696



&GPKGT 4QWGP  I  4+%#4&85 -TGW\ KP FGP 9KPMGNP LGGKPG-WIGN 4161/#%85/Q PQITCOO&WRNGUU[ 5GJTUEJÌPpXQT\ÒINKEJ



(4#0-4'+%*'.5#55 564#55$74)4'+%*5/ª0<5666' 

.WFYKI FCU -KPF  &GPCT  I *.8&188+%85 2+85 TÒEMN·WHKI  -TGW\'PUVGNNVG   \YGK\GKNKIG #4)'06+  0#%+8+6 .GIGPFG &GRG[TQV XIN  'PIGN.GJT XIN  HH /) XIN    44*ÒDUEJGFWPMNG2CVKPCYKP\5EJTÌVNKPIUTK­CO4CPFUGJTUEJÌP

 41


FRANKREICH

1699

1698



*GKPTKEJ+++&GPCTI)GMTÌPVGUD·TVKIGU$TWUVDKNFXX8GTUEJNGKGTVGU$TWUVDKNF FGT)QVVGUOWVVGT&CPPGPDGTI FQTVWPVGT*KNFGUJGKO  ªDNKEJG2T·IGUEJY·EJGUGJTUEJÌP



&GPCT  I 8GTUEJNGKGTVGU $TWUVDKNF FGT )QVVGUOWVVGT N&TGKVÒTOKIGU )GD·WFG &CPPGPDGTI   

FQTVWPVGT*KNFGUJGKO  44&WTEJIGJGPFGT5EJTÌVNKPIUHGJNGTWPF2T·IGUEJY·EJGUGJTUEJÌP



$GTPF-NWIGJCVFKGUGP2HGPPKIKPUGKPGT&GWVUEJGP/ÒP\IGUEJKEJVGXQPFGTUR·VGP-CTQNKPIGT\GKVDKU\WO'PFG FGT5CNKGT 5KIOCTKPIGP FGT/ÒP\UV·VVG5VTC­DWTIWPVGT-CKUGT*GKPTKEJ+++\WIGYKGUGP 50T 



1701

1700

*'4<1)67/  

(4#0-4'+%*.16*4+0)'0

-CTN+8\WOGTUVGP/CN6GUVQP0CPE[(NQP 5GJTUEJÌP 6GUVQP0CPE[(NQP 2TCEJVGZGORNCT9KP\$GNCITGUVXQT\ÒINKEJp5VGORGNINCP\

 

1703

1702

1702

/'6<56#&6 

4GKEJUVCNGT&CXp \W (NQP

*ÒDUEJG2CVKPCCVVTCMVKXGUUGJTUEJÌPGU'ZGORNCT



(4#0-4'+%*-1.10+'0 +.'5&'(4#0%''6$10#2#46' /#74+6+7570&4'70+10  

0CRQN¾QP +   .KXTGU 2KCUVGT &GECGP   0QVOÒP\G IGRT·IV Y·JTGPF FGT DTKVKUEJGP   5GGDNQEMCFG&CX)CFQWT[/C\CTF  5GNVGPKPFKGUGT'TJCNVWPIªDNKEJG2T·IGUEJY·EJGKO<GPVTWOXQT\ÒINKEJ



&KG\W#PHCPIFGU,CJTJWPFGTVUXQP2QTVWIKGUGPGPVFGEMVGP+PUGNPYCTGPXQPDKUGKPGJQNN·PFKUEJG $GUKV\WPI  DGO·EJVKIVG UKEJ (TCPMTGKEJ FGT +PUGNP FKG UKG KO ,CJTG  PCEJ VCRHGTGT 8GTVGKFKIWPI CP   )TQ­DTKVCPPKGP XGTNQT +P FGP NGV\VGP 6CIGP FGT HTCP\ÌUKUEJGP *GTTUEJCHV NKG­ FGT +PUGNMQOOCPFCPV 0QVOÒP\GP   RT·IGPFCFKG)GNFXGTUQTIWPIFGT'KNCPFGKPHQNIGFGTDTKVKUEJGP5GGDNQEMCFGPKEJVIGIGDGPYCT

/#41--1 

42

&KTJCOU 4KCN  #* 2CTKU/QWNC[*CHKF+#*  &C\W &KTJCOU  4KCN     #*  2CTKU #DFÒN #\K\ +  #*   &CX    .GEQORVG 5VÒEM-N4CPFHGJNGT Z XQT\ÒINKEJp5VGORGNINCP\




GRIECHENLAND

1706

1705

1705

)4+'%*'0.#0&  

,QJCPPGU-CRQFKUVTKCU2T·UKFGPV-W.GRVCIKPC&KXQ -W.GRVCIKPC&KXQ

(CUVXQT\ÒINKEJ 8QT\ÒINKEJ

 

1708

1707





1707

1VVQ +  $TQP\GOGFCKNNG  XQP - .CPIG CWH FKG )TWPFUVGKPNGIWPI FGT 7PKXGTUKV·V   #VJGP FGP 9QJNV·VGTP IGYKFOGV $TWUVDKNF N KP ITKGEJKUEJGT 6TCEJV#PUKEJV FGU 7PKXGTUKV·VUIGD·W   FGUOO9KVV#PO (CUV5VGORGNINCP\



-W.GRVC#VJGP&KXQD 5GNVGPDGUQPFGTUKPFKGUGT'TJCNVWPI 5GJTCVVTCMVKXGU'ZGORNCTOKVJÒDUEJGT2CVKPCXQT\ÒINKEJp5VGORGNINCP\



1709 1,5:1

1,5:1



)GQTI+&TCEJOG#2CTKU&KXQD  5GJTUGNVGPKPFKGUGT'TJCNVWPI-CDKPGVVUVÒEM 2TCEJVXQNNG2CVKPC'TUVCDUEJNCI5VGORGNINCP\ 2TQQHNKMG

1,5:1



1710



1,5:1

.GRVC#2CTKU&KXQC  W­GTUVUGNVGPKPFKGUGT'TJCNVWPI-CDKPGVVUVÒEM2TCEJVXQNNG2CVKPCRQNKGTVG2NCVVG 2TQQH

 43


GROSSBRITANNIEN

1712

1711

1711



&TCEJOGP#2CTKU/KV/ÒP\\GKEJGP#PMGTPCEJQDGP\GKIGPF&CX&KXQC#PO  445GNVGPG8CTKCPVG#VVTCMVKXGUUGJTUEJÌPGU'ZGORNCT





-W.GRVC#2CTKU&KXQD





.QV&TCEJOGP Z  Z .GRVC.GRVC-W.GRVC&C\W-W .GRVC-W.GRVC 5VÒEM5EJÌPpUGJTUEJÌP

(GKPG2CVKPCUGJTUEJÌPpXQT\ÒINKEJ



1715

1714



1714

4GRWDNKM$TQP\GOGFCKNNGXQP'-GNCKFKUPCEJGKPGT8QTNCIGXQP2,&CXKFCWH FGP HTCP\ÌUKUEJGP )GPGTCN %JCTNGU 0KEQNCU $CTQP (CDXKGT  2QPV¯/QWUUQP Ó 2CTKU WPF   UGKPG .GKUVWPIGP KO ITKGEJKUEJGP $GHTGKWPIUMCORH $TWUVDKNF FGU )GPGTCNU T&TGK <GKNGP 5EJTKHV T   .QTDGGT\YGKIOO 8QT\ÒINKEJ



+10+5%*'+05'.0 

7PVGTDTKVKUEJGT8GTYCNVWPI-W1DQNK-/  5GNVGPKPFKGUGT'TJCNVWPI8QT\ÒINKEJ





-W 1DQNK  -W .GRVC  -W.GRVQP  Z  &C\W )TKGEJGPNCPF ,QJCPPGU -CRQ   FKUVTKCU-W.GRVC 5VÒEM(CUVUGJTUEJÌPpUGJTUEJÌP



1718

'0).#0& 

1717

1718

)4155$4+6#00+'0+4.#0&

#GVJGNTGF ++  2GPP[ EC  .KPEQNP  I .CUV UOCNN ETQUU V[RG /ÒP\OGKUVGT   28.($'40 9WNHDGQTP $ÒUVGN-NGKPGU-TGW\KO(GNFFGT$WEJUVCDG'0QTVJ5GCD[ 5GJTUGNVGPG8CTKCPVG5GJTUEJÌP

8INFGP-QOOGPVCTDGK0QTVJ58CTKQWUU[ODQNUUWEJCUETQUUGUCPPWNGVUQTRGNNGVUUQOGVKOGUCTGHQWPF QPVJGQDXGTUGQTTGXGTUGQHEQKPUQHJKUTGKIP $0,:+++R 

 44

'NK\CDGVJ+2GPEG.QPFQP/ÒP\\GKEJGP-TQPG5GCD[  *ÒDUEJG2CVKPCUGJTUEJÌP






GROSSBRITANNIEN

1720

1719

8'4'+0+)6'5-¤0+)4'+%* 

%JCTNGU +   %TQYP Q ,   .QPFQP 6QYGT OKPV  /ÒP\\GKEJGP (CNNICVVGT   5GCD[ 5GJTUEJÌP





5JKNNKPI 2GPEG Q,  .QPFQP/ÒP\\GKEJGP(C­5GCD[  *ÒDUEJG2CVKPCUGJTUEJÌP



1722

1721



%TQYPQ,  .QPFQP 6QYGTOKPV /ÒP\\GKEJGP&TGKGEMKP-TGKU5GCD[  5GJTUEJÌP





5JKNNKPI 2GPEG Q,  .QPFQP 6QYGTOKPV /ÒP\\GKEJGP&TGKGEMKP-TGKU5GCD[ *ÒDUEJG2CVKPCUGJTUEJÌP



1723



%JCTNGU++5KNDGTOGFCKNNGQ,  WPUKIPKGTVXQP0%JGXCNKGTCWHFKG8GTO·JNWPI UGKPGT 0KEJVG /CT[ 6QEJVGT XQP ,COGU ++ OKV 9KNJGNO +++ XQP 0CUUCW1TCPKGP 5VCVVJCNVGT FGT   0KGFGTNCPFG )GJCTPKUEJVGU $TWUVDKNF 9KNJGNOU +++ T$TWUVDKNF /CT[U N OKV WOIGNGIVGO /CPVGN   OOI'KOGTX.QQP+++5 8QT\ÒINKEJ



1724



9KNNKCO+++WPF/CT[$TGVVUVGKPCWUFWPMNGO#JQTPJQN\IGHGTVKIVKP0ÒTPDGTIXQP 2 * /ÒNNGT CWH FGP (ÒTUVGPMQPITG­ KP &GP *CCI )ÌVVGTXGTUCOONWPI OKV ,WRKVGT KP FGT /KVVG KO   #DUEJPKVV XKGT <GKNGP 5EJTKHV WPF /GFCKNNGWTUUKIPCVWT OKV 8GT\KGTWPIGP&KG 2GTUQPKHKMCVKQPGP XQP   6CRHGTMGKVWPF'KPVTCEJVTGKEJGPUKEJÒDGTGKPGOHNCOOGPFGP#NVCTFKG*·PFGKO*KPVGTITWPFUVGJVFKG RGTUQPKHK\KGTVG9GKUJGKVXXOO'KOGTp XIN *KOOGNJGDGT 5GJTUEJÌP

 45


GROSSBRITANNIEN

1725



9KNNKCO +++  5KNDGTOGFCKNNQP  XQP , %TQMGT CWH FGP (TKGFGP XQP 4KLUYKLM WPF FKG   5KEJGTWPI XQP )TQ­DTKVCPPKGP )GJCTPKUEJVGU $TWUVDKNF T OKV .QTDGGTMTCP\ WPF WOIGNGIVGO /CPVGN   &KGRGTUQPKHK\KGTVG$TKVCPPKCUKV\VPCEJNFGP-QRHPCEJXQTPIGYCPFVOKV&TGK\CEMWPF9CRRGPUEJKNF KP.CPFUEJCHVPGDGPKJTGKPIGUEJNQUUGPGU$WEJOKV2CNO\YGKIOOI'KOGT2CZ KP0WOOKUX.QQP+85 4*GTTNKEJG2CVKPCYKP\-TCV\GTMN4CPFHGJNGTXQT\ÒINKEJ



&GT (TKGFG XQP 4KLUYKLM XQO  5GRVGODGT  DGGPFGVG FGP 2H·N\KUEJGP 'TDHQNIGMTKGI   FGT ICP\   'WTQRC KP /KVNGKFGPUEJCHV IG\QIGP JCVVG .QWKU :+8 XQP (TCPMTGKEJ UEJNQ­ (TKGFGP OKV )TQ­DTKVCPPKGP FGP   0KGFGTNCPFGP5RCPKGPUQYKGOKV-CKUGTWPF4GKEJ

1726 1727

1727



-W(CTVJKPI.QPFQP5GCD[



#PPG  5KNDGTOGFCKNNG  XQP , %TQMGT CWH FKG 'TQDGTWPI XQP )KDTCNVCT WPF CWH FCU   5GGUEJNCEJV XQP /CNCIC $TWUVDKNF N0GRVWP OKV &TGK\CEM UVGJV PCEJ N KP /WUEJGNYCIGP FGT XQP   \YGK5GGRHGTFGPIG\QIGPYKTFKPFGT.KPMGP-TQPGFKGGTFGTXQTKJOUVGJGPFGP$TKVCPPKCGPVIGIGP J·NVOOI'KOGTX.QQP+85 'VYCU$GNCIXQT\ÒINKEJ

1728





46

5GNVGPKPFKGUGT'TJCNVWPI8QT\ÒINKEJ





1729

5KNDGTOGFCKNNGXQP)*CWVUEJCWHFKG5KGIGDGK&QPCWYÌTVJ)KDTCNVCTWPF*ÌEJUV·VV$TWUVDKNF N$TKVCPPKC UKV\V X X CP 2CNOG IGNGJPV CP FGT 2CNOG FTGK /GFCKNNQPU OKV 5EJTKHV KO *KPVGTITWPF   &CTUVGNNWPI FGT 5GGUEJNCEJV XQT )KDTCNVCT /KV 4CPFUEJTKHV  OO  I 'KOGT  X .QQP   +85 8QT\ÒINKEJ



5KNDGTOGFCKNNG  XQP 2 * /ÒNNGT CWH FKG 5KGIG FGU *GT\QIU XQP /CTNDQTQWIJ ÒDGT .QWKU :+8   XQP (TCPMTGKEJ KP $TCDCPV WPF (NCPFGTP )GJCTPKUEJVGU $TWUVDKNF FGU *GT\QIU XQP /CTNDQTQWIJ HCUV   X X/CTU UEJTGKVGV N \YKUEJGP CO $QFGP NKGIGPFGP (GKPFGP KP FGT 4GEJVGP FKG FTGK XGTDWPFGPGP   9CRRGPUEJKNFGXQP$TCDCPV(NCPFGTPWPF#PVYGTRGPKPFGT.KPMGP6TQRJ·G/KV4CPFUEJTKHVOO I(QTUVGT5NI'TNCPIGT5NI*QTUM[5NI,WNKWUX.QQP+85  (GKPG2CVKPCUGJTUEJÌPpXQT\ÒINKEJ




GROSSBRITANNIEN

1731

1730

 

%TQYP 4GIKGTWPIULCJT ''FKPDWTIJ2QUV7PKQPV[RG/KV4CPFUEJTKHV5GCD[  5GJTUEJÌP )GQTIG+-W2GPP[.QPFQP5GCD[  5GNVGPKPFKGUGT'TJCNVWPI*GTTNKEJG-WRHGTRCVKPCXQT\ÒINKEJp5VGORGNINCP\

1732







1730

1733

 

1734

)GQTIG +++  5KNDGTOGFCKNNG  WPUKIPKGTV XGTOWVNKEJ XQP , -KTM CWH UGKPG -TÌPWPI   )GJCTPKUEJVGU $TWUVDKNF N OKV WOIGNGIVGO /CPVGN$TWUVDKNF UGKPGT )GOCJNKP 5QRJKG %JCTNQVVG XQP   /GEMNGPDWTI5VTGNKV\TOKVWOIGNGIVGO/CPVGNOOI'KOGT  4#VVTCMVKXGUXQT\ÒINKEJGU'ZGORNCT



$TQP\GOGFCKNNGXQP,2&TQ\CWHFKG$GNCIGTWPIXQP)KDTCNVCTWPVGT)QWXGTPGWT)GQTIG#W IWUV 'NKQVV 7PKHQTOKGTVGU $TWUVDKNF FGU )QWXGTPGWTU N*GTMWNGU UVGJV X X PGDGP 5·WNG KO *KPVGT   ITWPF/GGTWPF.CPFUEJCHVOKVGKPGTYGKVGTGP5·WNGOO'KOGT  48QT\ÒINKEJp5VGORGNINCP\



4GCNGU/Q(/XQP/GZKMQ%CTNQU+++/ÒP\UV·VVG/GZKMQ%KV[OKV)GIGPUVGO RGN XQP )TQ­DTKVCPPKGP CWH FGT 8QTFGTUGKVG 1XCN FCTKP $TWUVDKNF )GQTIU +++ -ÌPKIUDTWUVDKNF  T   )TQXG\W5GCD[ 5GJTUEJÌP

 47


GROSSBRITANNIEN

1736

1735





1735

$TQP\GOGFCKNNG  XQP 6 9GDD CWH FGP6QFFGUDTKVKUEJGP#FOKTCNU*QTCVKQ0GNUQP 0QT HQNM KP FGT 5EJNCEJV XQP 6TCHCNICT 5RCPKGP  $ÒUVG FGU #FOKTCNU N$GNNQPC T UEJNGWFGTV $NKV\G CWH   )CNGGTGPFKGKO*KPVGTITWPFCWH5GGNKGIGPOO'KOGT 8QT\ÒINKEJ



5KNDGTOGFCKNNG OKV4CPFITCXWTXQP XQP69[QPCWHFGP5KGIDGK9CVGTNQQ$ÒUVGNOKV .QTDGGTMTCP\(CJPG /KV 4CPFITCXWT 2106' 9#6'4.11'05+ &'&+%#61 +70     OOI$TQYP'KOGTp5NI,WNKWU *GTTNKEJG2CVKPCXQT\ÒINKEJ



1738

1737





1737

)GQTIG +8  5KNDGTOGFCKNNG  XQP 6 9GDD CWH UGKPGP 4GIKGTWPIUCPVTKVV $TWUVDKNF N   OKV .QTDGGTMTCP\ WPF WOIGNGIVGO /CPVGN5QEMGN OKV -KUUGP FCTCWH -TÌPWPIUKPUKIPKGP FCTÒDGT   5VTCJNGPOOI$TQYP'KOGTp *GTTNKEJG2CVKPCXQT\ÒINKEJ



%TQYP 4GIKGTWPIULCJT .QPFQP/KV4CPFUEJTKHV&CX5GCD[  *ÒDUEJG2CVKPC4CPFHGJNGTUGJTUEJÌPpXQT\ÒINKEJ



1739

1740



%TQYP.QPFQP5GCD[

*ÒDUEJG2CVKPCXQT\ÒINKEJ





-W2GPP[.QPFQP5GCD[

2TCEJVGZGORNCT(CUV5VGORGNINCP\



48


GROSSBRITANNIEN

1741



9KNNKCO+8%TQYP.QPFQP5GCD[

 (GKPG6ÌPWPIXQT\ÒINKEJp5VGORGNINCP\



1742



8KEVQTKC5KNDGTOGFCKNNGXQP,'$QGJOWPF(.GKIJVQPCWHKJTL·JTKIGU4GIKG TWPIULWDKN·WO 1HHK\KGNNG 2T·IWPI FGT 4Q[CN /KPV )GMTÌPVGU $TWUVDKNF N OKV 5EJNGKGT$TKVCPPKC OKV   5EJYGTV WPF 4GKEJUCRHGN VJTQPV X X WOJGT FKG 2GTUQPKHKMCVKQPGP FGT 9KUUGPUEJCHV FGT -ÒPUVG FGT   .CPFYKTVUEJCHV WPF FGT +PFWUVTKG \W KJTGP (Ò­GP FGT FGP *CPFGN RGTUQPKH\KGTGPFG PCEJ T NCIGTPFG   /GTMWT WPF GKP UKV\GPFGT IGHNÒIGNVGT )GPKWU QDGP\YGKUEJYGDGPFG'PIGNOKV-T·P\GPWPF5EJKNFGP KO #DUEJPKVV HÒPH 5EJKNFG FKG OKV FGP 0COGP FGT -QPVKPGPVG DGUEJTKHVGV UKPF  OO  I   'KOGTC +P1TKIKPCNGVWK-T·HVKIG2CVKPCGVYCUDGTKGDGPXQT\ÒINKEJ



1743







5KNDGTOGFCKNNGXQP)9FG5CWNNGUPCEJ6$TQEMCWHKJTL·JTKIGU4GIKGTWPIULWDKN·WONVG TGU $TWUVDKNF 8KEVQTKCU N OKV 9KVYGPUEJNGKGT,WPIG $ÒUVG 8KEVQTKCU N \YKUEJGP +PUEJTKHV FCTWPVGT   .QTDGGT\YGKIGOOI'KOGTC +P1TKIKPCNGVWK8QT\ÒINKEJ



5KNDGTOGFCKNNGXQP)9FG5CWNNGUPCEJ6$TQEMCWHKJTL·JTKIGU4GIKGTWPIULWDKN·WONVG TGU $TWUVDKNF 8KEVQTKCU N OKV 9KVYGPUEJNGKGT,WPIG $ÒUVG 8KEVQTKCU N \YKUEJGP +PUEJTKHV FCTWPVGT   .QTDGGT\YGKIGOOI'KOGTC *ÒDUEJG2CVKPCMN4CPFHGJNGTXQT\ÒINKEJ



)GQTIG82TQQH5GV.QPFQPDGUVGJGPFCWU%TQYP%TQYP(NQTKP5JKN NKPI2GPEGWPF2GPEG5GCD[25 5VÒEM+P1TKIKPCNGVWK2QNKGTVG2NCVVG

 49


GROSSBRITANNIEN

ex 1747

.165)4155$4+6#00+'0 

%TQYP5JKNNKPIU $CPMFQNNCT %TQYP  5VÒEM(CUVUGJTUEJÌPWPFUGJTUEJÌP





-NGKPG 5COONWPI XQP DTKVKUEJGP 5KNDGT WPF $TQP\GOGFCKNNGP FGU  ,CJTJWPFGTVU FCTWPVGT CWEJ   DGUUGTG6[RGPWPFJÒDUEJG'TJCNVWPIGP+PVGTGUUCPVGU.QVDKVVGDGUKEJVKIGP  5VÒEM5GJTUEJÌPpXQT\ÒINKEJ



1,5:1

1748

1,5:1

+4.#0& 

#PQP[O  2GPP[ &WDNKP  I /ÒP\OGKUVGT (“4'/+0 &;/041' /0')/+   $TWUVDKNF N (“  /+'0  /01  &;'/ .CPIGU &QRRGNHCFGPMTGW\ OKV FTGK *CNDOQPFGP CP FGP   'PFGP5GCD[ 4.GKEJVIGYGNNVXQT\ÒINKEJ 

1749

1750

1751



)GQTIG+-W2GPP[$TKUVQN5GCD[  5GNVGPKPFKGUGT'TJCNVWPI8QT\ÒINKEJ



(TGKUVCCV   %TQYP  2TQDG KP -WRHGT  I *CTHG#WHD·WOGPFGU4Q­-/ 2T 8QPITQ­GT5GNVGPJGKV(CUV5VGORGNINCP\ 



(NQTKP2TQDGKP-WRHGTI*CTHG(KUEJ-/p \W2TFQTVKP5KNDGT   8QPITQ­GT5GNVGPJGKV(CUV5VGORGNINCP\

50






ITALIEN

1753 1754

1752

$4+6+5%*'-1.10+'0 

$TKVKUJ'CUV#HTKEC%QORCP[/QODCUC4WRGG*$KTOKPIJCO-/  'VYCUHNGEMKIG2CVKPCXQT\Ã&#x2019;INKEJp5VGORGNINCP\





 #PPCU  * $KTOKPIJCO +P 752NCUVKMJQNFGT FGT 0)% OKV FGT $GYGTVWPI /5  -/    2TCEJVGZGORNCTOKVJGTTNKEJGT2CVKPC(CUV5VGORGNINCP\





5VTCKVU5GVVNGOGPVU /CNC[UKC %GPVU-/

44(CUVXQT\Ã&#x2019;INKEJ



5KEQPG&GPCTQI/QPQITCOO5+%15VWHGPMTGW\$KCIIK  &WPMNG2CVKPCXQT\Ã&#x2019;INKEJ



1,5:1

1,5:1



1756

1,5:1

#FGNEJK&GPCTQI-TGW\OKVLGGKPGT-WIGNKPFGP9KPMGNP-TGW\\WFGP5GKVGPLG GKPG-WIGN$KCIIK 442TCEJVXQNNG2CVKPCXQT\Ã&#x2019;INKEJGU'ZGORNCT

1,5:1



1,5:1

+6#.+'0

$'0'8'061 

1755

1757

&GPCTQI6GORGNFCTKP-TGW\5VWHGPMTGW\$KCIIK

1,5:1

1758



1,5:1

 *GTTNKEJG2CVKPCXQT\Ã&#x2019;INKEJGU'ZGORNCT



1,5:1

$'4)#/1 

5VCFV)TQUUQFC&GPCTKQ,  OKV6KVGN(GFGTKEQU++I-KTEJGPIGD·WFGCWH5·WNGP FCTÃ&#x2019;DGT-TGW\\YKUEJGP\YGK5RKV\VÃ&#x2019;TOGP\WFGP5GKVGPLGGKP<KPPGPVWTOWPVGP(GNUGP\WFGP5GKVGP 2)#/8/$TWUVDKNF(GFGTKEQU++TOKV.QTDGGTMTCP\WPFWOIGNGIVGO/CPVGN$KCIIK%0$ 442TCEJVXQNNG2CVKPCXQT\Ã&#x2019;INKEJ

 51


ITALIEN

1759

1760

1761

$1.1)0#   

2TQXKUQTKUEJG4GIKGTWPI5EWFQ 2CQNK 8CTGUK 8QT\ÒINKEJ 5EWFQ 2CQNK &CX8CTGUK -N5EJTÌVNKPIUHGJNGTXQT\ÒINKEJp5VGORGNINCP\ 5EWFQ 2CQNK 8CTGUK 2TCEJVGZGORNCT*GTTNKEJG2CVKPCXQT\ÒINKEJp5VGORGNINCP\

  

1763

1762

 

1762

%#4/#)01.#

/KEJGNG#PVQPKQFK5CNW\\Q4QNCDCUUQQ,8CTGUK 4 

%#5#.'/106('44#6

)WINKGNOQ)QP\CIC$KCPEQ8CTGUK

1,5:1

1764

5GJTUEJÌP



5GJTUEJÌP



1,5:1

%1/1 

52

#\\QPG8KUEQPVK)TQUUQQ,I$NWOGPMTGW\KP8KGTRC­5V#DWPFKWUVJTQPVX XOKVUGIPGPFGT4GEJVGPWPF-TWOOUVCD8CTGUK  8QPITQ­GT5GNVGPJGKV*GTTNKEJG2CVKPCHCUVXQT\ÒINKEJ




ITALIEN

1765

%144'))+1 

1765 1,5:1

5KTQF #WUVTKC6GUVQPG .KTCFC5QNFK $GKUEJNCI\WFGP&KEMGPXQP.W\GTPI &CU 9CRRGP XQP %QTTGIIKQ FCTÒDGT &QRRGNCFNGT OKV -QRHUEJGKPGP \YKUEJGP FGP -ÌRHGP -TGW\   $TWUVDKNFFGU*GKNKIGP3WKTKPWUTKPIGKUVNKEJGO1TPCVOKVFGT4GEJVGPFCU-TGW\UEJWNVGTPF.WUWCTFK 8CTGUK 4  8QPITQ­GT5GNVGPJGKV(GKPG2CVKPCMN2T·IGUEJY·EJGUGJTUEJÌPpXQT\ÒINKEJ 

1766

1767

1768

%4'8#%714' 2+'/106  

#PQP[OG2T·IWPIGPFGU,CJTJWPFGTVU6KTQNKPQQ,$GKUEJNCI\WFGP'VUEJMTGW\GTP$KCIIK 8CTGUKXCT 4  44/KP-PKEMURWTNGKEJVG2T·IGUEJY·EJGUGJTUEJÌP



)'07# 

4GRWDNKM)TQUUQFC&GPCTKQ,I-CUVGNN-TGW\.WPCTFKXCT  *GTTNKEJG2CVKPCXQT\ÒINKEJ





(TCP¼QKU + XQP (TCPMTGKEJ 5KIPQTG XQP )GPWC  4GIKGTWPI  %CXCNNQVVQ Q ,)GPWC .WPCTFK 4  5GJTUEJÌP



1770

1769

1769



4GRWDNKM &QIK$KGPPCNK 5EWFQNCTIQ)GPWCI/KV/ÒP\\GKEJGP+55CWHFGT 4ÒEMUGKVG&CX.WPCTFK 4  *ÒDUEJG2CVKPCUGJTUEJÌP





5EWFQUVTGVVQ)GPWC/KV/ÒP\\GKEJGP5/CWHFGT4ÒEMUGKVG&CX.WPCTFK 4   *GTTNKEJG2CVKPCMN5EJTÌVNKPIUHGJNGTCO4CPFXQT\ÒINKEJ

 53


ITALIEN

1771

1772

1772



.KTG.WPCTFK

2TCEJVXQNNG2CVKPCXQT\ÒINKEJ





.KIWTKUEJG4GRWDNKM.KTG#001&CX.WPCTFK 4   2TCEJVXQNNG2CVKPCYKP\5EJTÌVNKPIUHGJNGTXQT\ÒINKEJp5VGORGNINCP\



1773

1,5:1

1,5:1

-+4%*'056##68#6+-#0 

5VGRJCP8++WPF#TPWNH&GPCTQ4QOI/QPQITCOO/QPQITCOO/WPVQPK 445GJTUEJÌP

1774







1775

4ÌOKUEJGT5GPCV)TQUUQTKPHQT\CVQQ, QFGT 4QO5GPCVQT-CTN + XQP #PLQW  5GPCVQTKCV QFGT  5GPCVQTKCV   I .ÌYG N FCTÒDGT HTCP\ÌUKUEJG .KNKG4QOC   VJTQPVXXOKV)NQDWUWPF2CNO\YGKI/WPVQPK8CT+ 45GJTUEJÌP



,WNKWU+++)KWNKQ#08  4QO/WPVQPK  *ÒDUEJG2CVKPCUGJTUEJÌPpXQT\ÒINKEJ



1776

1777



2CWN8.KTC$QNQIPC/WPVQPKC  -N$GCTDGKVWPIUUVGNNGKO(GNFUGJTUEJÌPpXQT\ÒINKEJ





6GUVQPG(GTTCTC/WPVQPK



54

45GJTUEJÌP


ITALIEN

1778

1,5:1

1,5:1



7TDCP8+++6GUVQPG#008  4QO/WPVQPKXCT  5GJTUGNVGPKPFKGUGT'TJCNVWPI2TCEJVGZGORNCT8QT\ÒINKEJp5VGORGNINCP\



1779

1779 1,5:1



+PPQEGP\:+6GUVQPG#0+  4QO/WPVQPK

8QT\ÒINKEJ



1780

1781

 

5GFKUXCMCP\2KCUVTC4QO&CX/WPVQPK 5GFKUXCMCP\2KCUVTC4QO&CX/WPVQPK

1781

5GJTUEJÌP 5GNVGPG8CTKCPVG5GJTUEJÌP

  55


ITALIEN

1782



1783

%NGOGPU :+  5KNDGTOGFCKNNG  XQP ) *COGTCPK CWH FKG 5EJNKG­WPI FGT *GKNKIGP   2HQTVGCO2GVGTUFQOCO*GKNKICDGPF$TWUVDKNFTKPIGKUVNKEJGO1TPCV&GT2CRUVNGIVFGPGTUVGP 5VGKP \WT 5EJNKG­WPI FGT *GKNKIGP 2HQTVG WOJGT -CTFKP·NG FKG KJP DGINGKVGP  OO  I   /KUGNNK *ÒDUEJG2CVKPCXQT\ÒINKEJ



+O ,CJTG  YWTFG FCU GTUVG *GKNKIG ,CJT FWTEJ $QPKHC\ 8+++ XGTMÒPFGV GU UQNNVG CNNG  ,CJTG DGICPIGP   YGTFGPFKGUGT<GKVTCWOYWTFGUR·VGTCWH,CJTGTGFW\KGTV$GKFKGUGO+PVGTXCNNDNKGDGUDKUJGWVG&CU*GKNKIG ,CJTDGIKPPVOKVFGT¤HHPWPIFGT*GKNKIGP2HQTVGKP5V2GVGTCO#DGPFXQT9GKJPCEJVGPKPFGOFGT2CRUVUKGOKV GKPGO IQNFGPGP *COOGT GKPUEJN·IV <GKVINGKEJ ÌHHPGP -CTFKPCN.GICVGP KP FTGK YGKVGTGP 2CVTKCTEJDCUKNKMGP 4QOU   FKG*GKNKIGP2HQTVGP0CEJ#DNCWHFGU,CJTGUYGTFGPCNNG2HQTVGPCO*GKNKIGP#DGPFYKGFGTXGTOCWGTV



$GPGFKMV :+++  5KNDGTOGFCKNNG #0 +8$+. ITCXKGTV   XQP ' WPF ) *COGTCPK CWH   FKG¤HHPWPIFGT*GKNKIGP2HQTVGCO2GVGTUFQOCO*GKNKICDGPF$TWUVDKNFTKPIGKUVNKEJGO1TPCV &GT2CRUVUEJN·IVFKG*GKNKIG2HQTVGOKV5RKV\JCEMGGKPJKPVGTKJO-CTFKP·NGKJOIGIGPÒDGTFCU8QNM WPF2KNIGTOOI/KUGNNK  4(GKPG2CVKPCYKP\5COONGT\GKEJGPKO(GNFFGT8QTFGTUGKVGXQT\ÒINKEJ

1784



1786



1785

$GPGFKMV :+8  5KNDGTOGFCKNNG #0 :++ XQP 1 *COGTCPK CWH FKG 4GPQXKGTWPI FGT   TÌOKUEJGP5VCFVOCWGTP$TWUVDKNFTKPIGKUVNKEJGO1TPCV&KG2GTUQPKHKMCVKQPFGT5KEJGTJGKVTWJVPCEJ NCWHGKPGO5QEMGNWPFGKPGTMNGKPGP5·WNGFCTCWHFKG,CJTGU\CJNNFKGMCRKVQNKPKUEJG9ÌNHKPOKV FGP<YKNNKPIGPKO*KPVGTITWPFFKG5VCFVOCWGTPXQP4QOOOI2CVTKIPCPKC  4*ÒDUEJG2CVKPCHCUVXQT\ÒINKEJ





5GFKUXCMCP\5EWFQTQOCPQ4QO&CX/WPVQPK  4#VVTCMVKXGU'ZGORNCTOKVJÒDUEJGT2CVKPCUGJTUEJÌPpXQT\ÒINKEJ





%NGOGPU :+8  5KNDGTOGFCKNNG  XQP , . 1GZNGKP CWH FKG 8GTVTGKDWPI FGT ,GUWKVGP   $TWUVDKNF T KP IGKUVNKEJGO 1TPCV OKV UGIPGPFGT 4GEJVGP%JTKUVWU 2GVTWU WPF 2CWNWU UVGJGP T WPF   XGTVTGKDGPFKG,GUWKVGPOOI2CVTKIPCPK5RKPM *GTTNKEJG2CVKPCXQT\ÒINKEJ



56


ITALIEN

1787

1789

1788



2KWU8+-W$CKQEEJK#::+  (QNKIPQ/WPVQPK



5GFKUXCMCP\$TQP\GOGFCKNNGWPUKIPKGTVCWHFGP-CTFKPCN6JQOCU$GTPGVVK5EJKTOFCTWPVGT \YGKIGMTGW\VGOKVGKPCPFGTXGTDWPFGPG5EJNÒUUGN9CRRGPFGU-CTFKPCNU6JQOCU$GTPGVVKOO 2CVTKIPCPK (CUV5VGORGNINCP\



2KWU8+++$CKQEEJK 6GUVQPG #001++4QO2CICPK  -N4CPFHGJNGTXQT\ÒINKEJ





1790

1792

5GJTUEJÌPpXQT\ÒINKEJ



1791



)TGIQT:8+$CKQEEJK 5EWFQ #+844QO2CICPK  -N4CPFHGJNGTHCUVXQT\ÒINKEJ





2KWU+:-W$CKQEEQ#001844QO2CICPK

2QNKGTVG2NCVVG





.GQ:+++.KTG$2TKXCVRT·IWPICWU$TÒUUGNI-/2P  (GKPG6ÌPWPIXQT\ÒINKEJ

 57


ITALIEN

–– ex 1793 ––

5#//.70))'9+%*6'(ª42256.+%*'/ª0<'0 

$GFGWVGPFG5COONWPIXQP)GYKEJVGPHÒTR·RUVNKEJG)QNFWPF5KNDGTOÒP\GPXQP5KGDGP )GYKEJVGCWUFGT<GKVFGT2·RUVG+PPQEGP\:+  WPF$GPGFKMV:+++  GPVURTGEJGP UKNDGTPGP 6GUVQPGP Y·JTGPF FKG ÒDGTYKGIGPFG /GJT\CJN FGT )GYKEJVG  5VÒEM  FGP I·PIKIGP   )QNFPQOKPCNGPFGU-KTEJGPUVCCVUGPVURTGEJGP&KG5COONWPIGPVJ·NVITQ­G4CTKV·VGPFKG\WO6GKNUGKV ,CJT\GJPVGP PKEJV CO /CTMV CPIGDQVGP YWTFGP 'KPG IGPCWG .KUVG OKV FGP <KVCVGP FGU GKPUEJN·IKIGP   5VCPFCTFYGTMGU ( /C\\C + RGUK OQPGVCTK FK OQPGVG RCRCNK 5W\\CTC Q ,  UQYKG (QVQU U·OVNKEJGT   5VÒEMGMÌPPGPCPIGHQTFGTVYGTFGP 5VÒEM 'KPOCNKIGU1DLGMVXQPITQ­GT$GFGWVWPIHÒTFKG)GNFIGUEJKEJVGFGU-KTEJGPUVCCVGU 7PVGTUEJKGFNKEJGTJCNVGPUGJTUEJÌPpXQT\ÒINKEJ  8QP'PFGFGU,CJTJWPFGTVUDKUICDFGT-KTEJGPUVCCV&WMCVGPWPFUR·VGTCNU(KQTKPKFKECOGTCDG\GKEJPGVG )QNFOÒP\GPKPMCT·VKIGO)QNFWPFMQPUVCPVGO)GYKEJVJGTCWU#W­GTFGOYWTFGPCWEJMCT·VKIG)QNFOÒP\GP CNU 5EWFK F QTQ <GEEJKPK F QTQ WPF &QRRKG TQOCPG IGRT·IV &KG )QNFOÒP\GP FGU -KTEJGPUVCCVGU YWTFGP KP FGT   ICP\GP 9GNV CNU XQNNYGTVKIG 5VÒEMG IGUEJ·V\V +PHQNIGFGUUGP YWTFGP UKG TGIGNO·­KI KP WPVGTYGTVKIGO )QNF   PCEJIGCJOV QFGT FKG GEJVGP 5VÒEMG DGUEJPKVVGP WO FCTCWU 2TQHKV \W \KGJGP &CFWTEJ GPVUVCPF HÒT FGP   \GKVIGPÌUUKUEJGP *CPFGN WPF FKG $CPMGP FGT $GFCTH PCEJ MQTTGMVGP 9KGIGOGVJQFGP WPF GZCMVGP )GYKEJVGP &C   )QNFOÒP\GPKOKPVGTPCVKQPCNGP*CPFGNXQTJGTTUEJVGPUVGNNVGOCPÒDGTYKGIGPF)GYKEJVGHÒTFKG)QNFPQOKPCNGJGT 9KTHTGWGPWPU+JPGPFKGYQJNDGFGWVGPFUVG5COONWPIR·RUVNKEJGT)GYKEJVGCPDKGVGP\WMÌPPGP

1794

-145+-# 

58

2CUSWCNG 2CQNK   5QNFK  /WTCVQ IGRT·IV Y·JTGPF FGU 9KFGTUVCPFUIGIGPFKG*GTT UEJCHV)GPWCUWPF(TCPMTGKEJU$TCWUG/CPUHGNFp)CFQWT[8CTGUK  <CKPGPFGFG\GPVTKGTVUGJTUEJÌPpXQT\ÒINKEJ




ITALIEN 5GKV FGO JQJGP /KVVGNCNVGT JGTTUEJVG FKG 4GRWDNKM )GPWC ÒDGT -QTUKMC YCU DGTGKVU HTÒJ CWH FGP 9KFGTUVCPF FGT   +PUGNDGXÌNMGTWPIUVKG­&KG'TMN·TWPIFGTMQTUKUEJGP5QWXGT·PKV·VWPFFKG)TÒPFWPIFGU-ÌPKITGKEJU-QTUKMCKPFGP ,CJTGPWPFYWTFGXQPFGP)GPWGUGPOKV*KNHG(TCPMTGKEJUPCEJMÒT\GUVGT<GKV\WPKEJVGIGOCEJVFQEJ YCT FGT 9KFGTUVCPF FGT +PUGNDGYQJPGT FCOKV PKEJV IGDTQEJGP &GT IGDÒTVKIG -QTUG 2CUSWCNG 2CQNK FGT \WXQT CNU   1HHK\KGT KP PGCRQNKVCPKUEJGP &KGPUVGP IGUVCPFGP JCVVG MGJTVG  CWH FKG +PUGN \WTÒEM WPF QTICPKUKGTVG JKGT FGP   9KFGTUVCPFIGIGP)GPWCPCEJFGOGTXQO)TQ­TCVFGT-QTUGP\WO)GPGTCNGTPCPPVYQTFGPYCTWPFXQNNG<KXKN WPF /KNKV·TIGYCNV GTJCNVGP JCVVG #NU (ÒJTGT FGT KP )WGTKNNCVCMVKM QRGTKGTGPFGP (TGKJGKVUM·ORHGT FT·PIVG GT FKG   )GPWGUGPPCJG\WXQNNUV·PFKIXQPFGT+PUGN0CEJGKPGT4GKJGXQP4ÒEMUEJN·IGPXGTMCWHVG)GPWCKO,CJTGFKG +PUGN -QTUKMC CP (TCPMTGKEJ #WEJ IGIGP FKG (TCP\QUGP UGV\VG 2CQNK UGKPGP -CORH WO 7PCDJ·PIKIMGKV HQTV FQEJ   PCEJ FGT XGTPKEJVGPFGP 0KGFGTNCIG KP FGT 5EJNCEJV XQP 2QPVG 0WQXQ CO  /CK  OWUUVG GT PCEJ .QPFQP   HNKGJGP'TMQPPVGLGFQEJKPUGKPG*GKOCV\WTÒEMMGJTGPPCEJFGOFKGHTCP\ÌUKUEJG0CVKQPCNXGTUCOONWPIFKG IGHNQJGPGPMQTUKUEJGP(TGKJGKVUM·ORHGTCOPGUVKGTVJCVVG\WO2T·UKFGPVGPFGTPCVKQPCNGP8GTYCNVWPIGTJQDGP IGTKGVGTKPFGUPCEJGKPKIGP,CJTGPKP)GIGPUCV\\WOTGXQNWVKQP·TGP(TCPMTGKEJWPFXGTNKG­\WO\YGKVGP/CN FKG+PUGN4KEJVWPI.QPFQPYQGTUVCTD

1796

1795

1795

.7%%#



4GRWDNKM5EWFQ$GNNGUKC&CX



'NKUC $QPCRCTVG WPF (GNKZ $CEKQEEJK   (TCPEJK  (NQTGP\ &CX  2CICPK    'VYCUHNGEMKIXQT\ÒINKEJ

1797



1798

*ÒDUEJG2CVKPCHCUVXQT\ÒINKEJ

1799

/#%'4#6#

5VCFV$QNQIPKPQQ,  $KCIIK

 

1800

*ÒDUEJG2CVKPCXQT\ÒINKEJ



/#+.#0& 

)KCP)CNGC\\Q/CTKC5HQT\CWPF.WFQXKEQ/CTKC5HQT\C6GUVQPGQ,%TKRRC  45GJTUEJÌP

 

.QFQXKEQ:++XQP1TN¾CPU6GUVQPGQ,%TKRRC# (TCPEGUEQ++5HQT\C5QNFKQ,%TKRRC

445GJTUEJÌP 5GJTUEJÌP

   59


ITALIEN

1801

1802

1803

/#55#&+.70+)+#0# 

#NDGTKEQ ++ %[DQ /CNCURKPC  .WKIKPQ \W  $QNQIPKPK  $GNNGUKC % %COOC   TCPQ 4  8QPITQ­GT5GNVGPJGKV/KPLWUVKGTVUGJTUEJÌPpXQT\ÒINKEJ





.WKIKPQ\W$QNQIPKPK$GNNGUKC#D FKGUGU'ZGORNCT %COOCTCPQ  4*ÒDUEJG2CVKPCUGJTUEJÌPpXQT\ÒINKEJ





/CTKC$GCVTKEGWPF5QNFK$GNNGUKC

 44(GKPG2CVKPCHCUVXQT\ÒINKEJ



1805

1804

1804

/1&'0#



'TEQNG+++F 'UVG6CNNGTQ&CX8CTGUK

5GJTUEJÌP



4QDGTVXQP#PLQW)KINKCVQQ,I)GMTÌPVGT*GTTUEJGTVJTQPVXXOKVFGT4GEJVGP FCU <GRVGT UEJWNVGTPF KP FGT .KPMGP 4GKEJUCRHGN$NWOGPMTGW\ OKV LG GKPGT .KNKG KP FGP 9KPMGNP   2CPPWVK4KEEKQ *ÒDUEJG2CVKPCHCUVXQT\ÒINKEJ



0'#2'.70&5+<+.+'0

1806

1807



-CTN++XQP5RCPKGP6CTK0GCRGN2CPPWVK4KEEKQ



-CTN8+XQP¤UVGTTGKEJ -CTN+++XQP5RCPKGP 6CTK0GCRGN2CPPWVK4KEEKQC (GKPG2CVKPCXQT\ÒINKEJ

1809



1808

8QT\ÒINKEJp5VGORGNINCP\

 

1809



&WECVQ0GCRGN2CPPWVK4KEEKQ



(GTFKPCPF +8 +  XQP $QWTDQP  2GTKQFG    6TCIDCTG 5KNDGTOGFCKNNG    WPUKIPKGTV CWH FKG \WT 7PVGTUVÒV\WPI FGU 2CRUVGU GPVUCPFVGP PGCRQNKVCPKUEJGP 6TWRRGP Y·JTGPF FGU   +VCNKGPHGNF\WIGU XQP 0CRQN¾QP $TWUVDKNF T KP CPVKMGT -NGKFWPI-TKGIGT OKV *GNO 5RGGT WPF 5EJKNF     UVGJV JCNDT WPF YKTF XQP GKPGT XQT KJO UVGJGPFGP YGKDNKEJGP )GUVCNV DGMT·P\V  OO  I   4KEEKCTFK *GTTNKEJG6ÌPWPIXQT\ÒINKEJ 

60

5GJTUEJÌP




ITALIEN

1811

1810



,QCEJKO/WTCV-ÌPKIXQP0GCRGN%CTNKPK 2KCUVTC 0GCRGN&CX$2CICPKE (CUVXQT\ÒINKEJ



.KTG0GCRGN&CX2CICPKF

*ÒDUEJG2CVKPCYKP\4CPFHGJNGTHCUVXQT\ÒINKEJ

 

1812 1813

1813

2#&7# 

7NTKEQ FK 8CNUGG  )TQUUQ CSWKNKPQ Q ,  I #FNGT FGP -QRH PCEJ T IGYCPFV.CPI   MTGW\$KCIIK .GKEJVG2T·IGUEJY·EJGPUGJTUEJÌP



/CTKC.QWKUC.KTG/CKNCPF&CX2CICPK

2#4/#



(CUVXQT\ÒINKEJ



1814 1815

1815



.KTCPWQXC/CKNCPF2CICPK

5GNVGPKPFKGUGT'TJCNVWPI2TCEJVGZGORNCT(CUV5VGORGNINCP\





4QDGTVQFK$QTDQPG.KTG2CTOC&CX2CICPK  442QNKGTVG2NCVVGOKPDGTKGDGP



1816 1817

1817

2#8+#  'KPGP-CTQNKPIGTFGPCTCWUFGT/ÒP\UV·VVG2CXKCHKPFGP5KGWPVGTFGT0T 

2+5# 

4GRWDNKM  )TQUUQ Q , OKV /QPQITCOO (GFGTKEQU +  I +  2  5  # 2+5#  KPU   -TGW\IGUVGNNVKPFGT/KVVG2WPMV/QPQITCOO($KCIIK 4*ÒDUEJG2CVKPCXQT\ÒINKEJ



5#4&+0+'0 

2JKNKRR ++ XQP 5RCPKGP   4GCNK Q , %CINKCTK &CX  5QNNCK  8CTGUK  4    'VYCU$GNCIHCUVUGJTUEJÌP

 61


ITALIEN

1819

1818





1818

-CTN'OCPWGN+++5KNDGTOGFCKNNGXQP..CX[CWHFKG8GTO·JNWPIUGKPGU5QJPGU 8KEVQT#OCFGWU+++OKV2TKP\GUUKP/CTKC#PVQPKCXQP$QWTDQP)GJCTPKUEJVGU$TWUVDKNFTOKVWOIG NGIVGO /CPVGN&CU $TCWVRCCT TGKEJV UKEJ ÒDGT GKPGO MNGKPGP #NVCT FKG TGEJVG *CPF \W FGP 5GKVGP   UVGJGP #DWPFCPVKC WPF *[IKGKC KO #DUEJPKVV FTGK <GKNGP 5EJTKHV  OO  I 7 FK 5 +   59WT\DCEJ FQTVKP$TQP\G  4*ÒDUEJG2CVKPCXQT\ÒINKEJ



5EWFQPWQXQ6WTKP%WFC\\QD

8QT\ÒINKEJ



8QT\ÒINKEJp5VGORGNINCP\



(KNKDGTVQ++2CTRCINKQNCQ,6WTKP%WFC\\Q 4 5KOQPGVVK  8QPITÌ­VGT5GNVGPJGKV4CPFCWUDTWEJYKP\5EJTÌVNKPIUTK­UEJÌP



1821

1820

1820

1821

1,5:1



-CTN#NDGTV%GPVGUKOK6WTKP2CICPK

5#81;'0 

1822

1823

1824

1825



'OCPWGNG(KNKDGTVQ)TQUUKWPDGUVKOOVG/ÒP\UV·VVG%WFC\\QF5KOQPGVVK $GNCIUGJTUEJÌP





)TQUUKWPDGUVKOOVG/ÒP\UV·VVG%WFC\\QF5KOQPGVVK

5GJTUEJÌP





$KCPEQ 5QNFK $QWTI%WFC\\QS5KOQPGVVK

5GJTUEJÌP





$KCPEQ 5QNFK $QWTI%WFC\\QW5KOQPGVVK

5GJTUEJÌP



62


ITALIEN

1826

 

1827

57$#.2+0'4'27$.+-

(TCPEU#0  6WTKP&CX2CICPK (TCPEU#0  6WTKP&CX2CICPK

1828

9KP\5EJTÌVNKPIUHGJNGTUGJTUEJÌP (CUVUGJTUEJÌPUGJTUEJÌP

1831

1830

1829

 

615%#0# 

%QUKOQ+/GFKEKCNU*GT\QIXQP(NQTGP\WPF5KGPC6GUVQPG(NQTGP\ )CNGQVVK:.+++ #VVTCMVKXGU'ZGORNCTOKVJÒDUEJGT2CVKPCUGJTUEJÌP





%QUKOQ + /GFKEK  CNU )TQ­JGT\QI XQP 6QUECPC  6GUVQPG  (NQTGP\   )CNGQVVK.:+8 4*ÒDUEJG2CVKPCYKP\-TCV\GTUGJTUEJÌP





(TCPEGUEQ+/GFKEK6GUVQPG(NQTGP\)CNGQVVK:+XCT  4*GTTNKEJG2CVKPCCVVTCMVKXGUUGJTUEJÌPGU'ZGORNCT





6GUVQPG(NQTGP\)CNGQVVK:+++



(GKPG2CVKPCCVVTCMVKXGUUGJTUEJÌPGU'ZGORNCT

1833

1832

1832



(GTFKPCPFQ++/GFKEK6CNNGTQ2KUC&CX)CNGQVVK:.8



6GUVQPG(NQTGP\)CNGQVVK:8+

5GJTUEJÌP



 4#VVTCMVKXGU'ZGORNCTOKVHGKPGT2CVKPCUGJTUEJÌPpXQT\ÒINKEJ

 63


ITALIEN

1835

1834

1834



%QUKOQ+++/GFKEK6GUVQPG(NQTGP\)CNGQVVK:+++  44#VVTCMVKXGU'ZGORNCTOKVJÒDUEJGT2CVKPCUGJTUEJÌP



2G\\CFGNNC4QUC.KXQTPQ&CX)CNGQVVK:.8+++

*GTTNKEJG2CVKPCXQT\ÒINKEJ

 

1836

1837

 

1837

2G\\CFGNNC4QUC.KXQTPQ)CNGQVVK.+ 6QNNGTQ.KXQTPQ&CX)CNGQVVK:.8

1838

1839

445GJTUEJÌPpXQT\ÒINKEJ (CUVXQT\ÒINKEJXQT\ÒINKEJ

1840



2G\\CFGNNC4QUC.KXQTPQ&CX)CNGQVVK:.+:



(TCPEGUEQ++ +++ FK.QTGPC(TCPEGUEQPG 2CQNK (NQTGP\&CX)CNGQVVK :++ *ÒDUEJG2CVKPCXQT\ÒINKEJ



2KGVTQ.GQRQNFQFK.QTGPC6CNNGTQ 2CQNK (NQTGP\&CX)CNGQVVK+: &WPMNG2CVKPCXQT\ÒINKEJp5VGORGNINCP\

64

 

(GKPG2CVKPCHCUVXQT\ÒINKEJ

  


ITALIEN

1842

1841

1843



 (TCPEGUEQPG  2CQNK   (NQTGP\ /KV -ÌPKIUVKVGN )GRT·IV XQT FGT -CKUGTMTÌPWPI .GQRQNFU   )CNGQVVK::8++ 4(GKPG2CVKPCYKP\2T·IGUEJY·EJGXQT\ÒINKEJ 



(GTFKPCPFQ +++ FK .QTGPC  4GIKGTWPIU\GKV  (TCPEGUEQPG  2CQNK   (NQTGP\   &CX#)CNGQVVK+8 5GJTUEJÌP





.QFQXKEQ + FK $QTDQPG -ÌPKI XQP 6QUECPC  (TCPEGUEQPG  2CQNK   (NQTGP\   &CX2CICPKE #VVTCMVKXGU'ZGORNCTUGJTUEJÌPpXQT\ÒINKEJ



1844

1846

1845



%CTNQ .WFQXKEQ FK $QTDQPG -ÌPKI XQP 6QUECPC WPF UGKPG /WVVGT /CTKC .WKIKC    (TCPEGUEQPG 2CQNK (NQTGP\&CX2CICPKD 5GJTUEJÌPUGJTUEJÌPpXQT\ÒINKEJ





(GTFKPCPFQ +++ FK .QTGPC  4GIKGTWPIU\GKV  (TCPEGUEQPG  2CQNK   (NQTGP\   &CX2CICPK 48QT\ÒINKEJ





.GQRQNFQ++FK.QTGPC(TCPEGUEQPG 2CQNK (NQTGP\2CICPK  2TCEJVGZGORNCT*GTTNKEJG2CVKPCHCUV5VGORGNINCP\

 65


ITALIEN

1847

1848

1848



(TCPEGUEQPG 2CQNK (NQTGP\2CICPK  442TCEJVGZGORNCT*GTTNKEJG2CVKPCYKP\2T·IGUEJY·EJGXQT\ÒINKEJp5VGORGNINCP\



(TCPEGUEQPG 2CQNK (NQTGP\&CX2CICPK

1849

8QT\ÒINKEJp5VGORGNINCP\

 

1850

64+'06 

#PQP[O  5QNFQ FC  FGPCTK Q , 6TKGPV -CKUGTNKEJG /ÒP\UV·VVG  I 6 KO (GNF   -TGW\KPFGP9KPMGNP\YGKOCN5VGTPWPF-GKN$KCIIK 5GJTUEJÌP





)TQUUQ FC  &GPCTK 6TKGPV $KUEJÌHNKEJG /ÒP\UV·VVG  I $TWUVDKNF OKV GTJQDGPGT *CPF WPF   -TWOOUVCDN-TGW\XQTITQ­GO($KCIIK -N<CKPGPFGUGJTUEJÌP



1851 1,5:1

1,5:1

64+'56 

8QNTKEQ FG 2QTVKU  &GPCTQ Q ,  I $KUEJQH UKV\V X X OKV -TWOOUVCD WPF $WEJ   <KPPGPOCWGTOKV2QTVCNFCTÒDGT<KPPGPVWTO$GTPCTFK6[R8/$KCIIK  8QPITQ­GT5GNVGPJGKV2TCEJVXQNNG2CVKPCXQT\ÒINKEJ 

1852 1854

1854

8'0'&+)

 

 66

<YGK-CTQNKPIGTFGPCTGCWUFGT/ÒP\UV·VVG8GPGFKIHKPFGP5KGWPVGTFGP0TPWPF 0KEQNQ6TQP-W$CICVVKPQ )TQUUQ Q,I)CODGTKPK 5GJTUEJÌP



2CUSWCNG%KEQIPC.QV5EWFQFGNNCETQEG 5QNFK Q, WO /ÒP\OGKUVGT#NXKUG $CHHQ&CX)CODGTKPK&C\W#NXKUG+/QEGPKIQ5QNFK 5CPVC)KWUVKPC Q, WO  /ÒP\OGKUVGT $GTPCTFQ %QTPGT )CODGTKPK  &C\W )KQXCPPK + %QTPGT  5EWFQ  5QNFK  Q ,  

WO /ÒP\OGKUVGT)KCEQOQ2GUCTQ)CODGTKPK 5VÒEM5GJTUEJÌP



)KQXCPPK+%QTPGT-W5QNFK 6QTPGUK Q,HÒT%CPFKCCWH-TGVC/KVITKGEJKUEJGT .GIGPFG)CODGTKPK 45GJTUEJÌP




ITALIEN

1855 1856

1856

 

-W5QNFK 6QTPGUK Q,HÒT%CPFKCCWH-TGVC/KVITKGEJKUEJGT.GIGPFG)CODGTKPK  44-N5EJTÌVNKPIUTK­UGJTUEJÌP /CTE #PVQPKQ )KWUVKPKCP  5KNDGTOGFCKNNG  XQP ) *CWVUEJ CWH FKG 5KGIG ÒDGT FKG   6ÒTMGP)GHNÒIGNVGT/CTMWUNÌYGNQDGPGKPGCWU9QNMGPMQOOGPFG*CPFOKV-TQPGWPF2CNO\YGKI \W FGP 5GKVGP OKV -GVVGP IGHGUUGNVG VÒTMKUEJG 5QNFCVGP-CTVG FGT *CNDKPUGN 2GNGRQPPGU OKV FGT   &CTUVGNNWPI WPF FGP 0COGP FGT GTQDGTVGP 5V·FVG /KV 4CPFUEJTKHV 8+4676' '6 (14670#   8'0'6147/OOI5NI'TNCPIGT++5NI,WNKWU8QNVQNKPC  #VVTCMVKXGUUGJTUEJÌPGU'ZGORNCT

1857

  

1858





1859

(TCPEGUEQ /QTQUKPK  1UGNNC #001 +8   /ÒP\OGKUVGT +UGRRQ $CUGIIKQ   )CODGTKPK 44*GTTNKEJG2CVKPCUGJTUEJÌPpXQT\ÒINKEJ  2KGVTQ )TKOCPK  1UGNNC #0 +: /ÒP\OGKUVGT )GTQNCOQ &QPC )CODGTKPK    2TCEJVGZGORNCT(GKPG2CVKPCXQT\ÒINKEJp5VGORGNINCP\  (TCPEGUEQ .QTGFCP  1UGNNC #0 +8 /ÒP\OGKUVGT #PVQPKQ &KGFQ )CODGTKPK    2TCEJVGZGORNCT5VGORGNINCP\ 

1860



2CQNQ 4GPKGT 5KNDGTPG8GTFKGPUVOGFCKNNGQ,  XQP#5EJCDGNHÒT5VWFGPVGPFGT .KVGTCVWTYKUUGPUEJCHVGP XGTNKGJGP XQO 5GPCV /KPGTXC OKV .QTDGGTMTCP\KPFGT4GEJVGPWPF.QTDGGT \YGKI KP FGT .KPMGP UVGJV HCUV X X FGP -QRH PCEJ N IGYCPFV CO $QFGP GKPG 'WNG8'0'6“   +78'0676+  #& .+66'4#47/ 567&+#  +0%+6#/'067/  5 % QDGP OWUEJGNCTVKIG   8GT\KGTWPIOOI8QNVQNKPC 44(GKPG2CVKPCMN4CPFHGJNGTXQT\ÒINKEJ  67


ITALIEN

1862

1861



.QFQXKEQ /CPKP  -W5QNFQ Q ,   HÒT &CNOCVKGP WPF #NDCPKGP )CODGTKPK    5GJTUEJÌP



8'410# 

(GFGTKEQ ++ FK 5XGXKC  )TQUUQ FC  &GPCTK Q ,  I $GKFGTUGKVU -TGW\ KPFQRRGNVGT 7OUEJTKHV$KCIIK%0+8+5HH *GTTNKEJG2CVKPCXQT\ÒINKEJ

1863



1864

-¤0+)4'+%*+6#.+'0 

0CRQNGQP.KTG//CKNCPF2CICPK

2TCEJVXQNNG2CVKPCXQT\ÒINKEJ





.KTG8 /ÒP\\GKEJGPKO5VGORGNCWU/IG·PFGTV 8GPGFKI2CICPKD  49KP\5EJTÌVNKPIHGJNGTKO4CPFXQT\ÒINKEJ



1865

1866

1866



8KEVQT'OCPWGN+++.KTG/CKNCPF2TQDGKP5KNDGTI2CICPK  44(CUV5VGORGNINCP\



4GRWDNKM+VCNKGPUGKV.KTG44QO#NWOKPKWO2CICPK

1867

1868



.KTC44QO#NWOKPKWO2CICPK



.KTG44QO#NWOKPKWO2CICPK

  68

1869

44(CUV5VGORGNINCP\

 

1870

48QT\ÒINKEJ



W­GTUVUGNVGPGT,CJTICPI8QT\ÒINKEJ



.KTG44QO#NWOKPKWO2CICPK

442TCEJVGZGORNCT5VGORGNINCP\



.KTG44QO#NWOKPKWO2CICPK

444CPFUVCDXGTRT·IVUQPUVXQT\ÒINKEJ




LIECHTENSTEIN

ex 1873

1871



.KTG44QO#NWOKPKWO2CICPK



.KTC44QO#NWOKPKWO2CICPK

1872

448QT\ÒINKEJp5VGORGNINCP\



44-N-TCV\GTXQT\ÒINKEJ



.16+6#.+'0 

-ÌPKITGKEJ5CTFKPKGP8KEVQT#OCFGWU+++5QNFK6WTKP/CKNCPF/GUUKPI/ÒP\IGYKEJVQ,

WO HÒT<GEEJKPQ0QXCTCUKNDGTPG2T·OKGPOGFCKNNGFGT.CPFYKTVUEJCHVUCWUUVGNNWPI  5VÒEM5GJTUEJÌPpXQT\ÒINKEJ

,7)15.#9+'0

.16,7)15.#9+'0 

5COONWPI XQP LWIQUNCYKUEJGP /ÒP\GP FGU  ,CJTJWPFGTVU XQO  2CTC DKU \WO  &KPCT5VÒEM   FCTWPVGT CWEJ XKGNG JÒDUEJG 'TJCNVWPIGP &GU 9GKVGTGP GPVJCNVGP UKPF -WTUOÒP\GPU·V\G KP 1TKIKPCN   DNKUVGTP XQP        WPF  5GJT KPVGTGUUCPVGU .QV DKVVG   DGUKEJVKIGP 5VÒEM5GJTUEJÌPp5VGORGNINCP\

1875



1875

1876

-41#6+'0

4#)75# &7$4180+-  



5VCFV6CNNGTQ4GVVQTCNG&CX

#VVTCMVKXGUUGJTUEJÌPGU'ZGORNCT



#)4#/ <#)4'$  

'T\DKUVWO ,WTCL *CWNKM XQP 8±TCN[C  $TQP\GOGFCKNNG  XQP % 4CFPKV\M[ CWH FKG   'TJGDWPI \WO 'T\DKUVWO #PUKEJV FGU &QOU OKV FGT GT\DKUEJÌHNKEJGP 4GUKFGP\ KO #DUEJPKVV FCUOKV FGO-CTFKPCNUJWVDGNGIVGGT\DKUEJÌHNKEJG9CRRGP\YKUEJGP\YGK4QUGVVGP<GKNGP5EJTKHVOO 5NI*QTUM[9WT\DCEJ 2TCEJVGZGORNCT(CUV5VGORGNINCP\

ex 1878

1877

(ª456'067/



.+'%*6'056'+0



,QUGRJ9GP\GN-QPX6CNGT9KGP&KXQ

(CUVXQT\ÒINKEJ





(TCP\,QUGRJ-QPX6CNGT9KGP-TGW\GT9KGP&KXQ  5VÒEM5EJTÌVNKPIUTK­ Z XQT\ÒINKEJ

 69


MONACO

1879

1880

.7:'/$74) *'4<1)67/#$)4155*'4<1)67/ 

9GPEGUNCU +  $NCP)TQU Q , .WZGODWTI I-TGW\<YGK9CRRGPUEJKNFGFCTÒDGT -TQPG2TQDUV.p #VVTCMVKXG2CVKPCMN5EJTÌVNKPIUHGJNGTCO4CPFUGJTUEJÌP





#FQNH XQP 0CUUCW   %GPVKOGU  2TQDG KP -WRHGT  I 5GNVGPG 8CTKCPVG OKV   UEJOCNGO9CRRGPUEJKNFCWHFGT4ÒEMUGKVG2TQDUV.p  440WT'ZGORNCTGIGRT·IV8QT\ÒINKEJp5VGORGNINCP\



1881

,1*#00+6'414&'0

1882

1883

/#.6#



'OOCPWGNFG4QJCP6CTK&CX4GUVGNNK



(GTFKPCPFXQP*QORGUEJ6CTK&CX4GUVGNNK

.GKEJVLWUVKGTVUGJTUEJÌP



6CTK&CX4GUVGNNK



8QT\ÒINKEJ



(GKPG2CVKPCNGKEJVLWUVKGTVUGJTUEJÌPpXQT\ÒINKEJ



1884

(ª456'067/  70

/10#%1

*QPQT¾++'EW&CX8CTGUK

45GJTUEJÌP




NIEDERLANDE

1885

(ª456'067/

/106'0')41



0KMQNCWU+2GTRGTC2CTKU+P752NCUVKMJQNFGTFGT0)%OKVFGT$GYGTVWPI#7 &CX 8QT\ÒINKEJ



5COONWPI XQP OQPVGPGITKPKUEJGP /ÒP\GP FGU <GKVTCWOGU  XQO 2CTC DKU \WO  2GTRGTC   5VÒEMFCTWPVGTCWEJUGNVGPG,CJTI·PIGWC2GTRGTCWPFOKV\WO6GKNRTCEJVXQNNGP'T JCNVWPIGP*QEJKPVGTGUUCPVGU1DLGMVDKVVGDGUKEJVKIGP 5VÒEM5GJTUEJÌPp5VGORGNINCP\ 



.16/106'0')41

1887

0+'&'4.#0&' /'&#+..'0 *+5614+'2'00+0)'0  

/QTKV\XQP1TCPKGP)TCHXQP0CUUCW5VCVVJCNVGTFGT0KGFGTNCPFG5KNDGTOGFCKNNG WPUKIPKGTV CWH FKG 5EJNCEJV XQP 6WTPJQWV WPF FKG 'TQDGTWPI FGT 5V·FVG #NRGP $GTI /ÌTU $TGHQTV   )TQNNG )QGT 'PUEJGFG.KPIGP1NFGP\CCNWPF1QVOCTUWO9CHHGPVTQRJ·GOKVFGOPKGFGTN·PFKUEJGP 5EJKNFXQT.CPFMCTVGOKVFGP(NÒUUGP'OU4JGKPWPF/CCUUQYKGOKVFGP\GJPGTQDGTVGP5V·FVGPWPF 6WTPJQWV5KGDGP <GKNGP 5EJTKHV KO #DUEJPKVV ,CJTGU\CJN WPF 5 %  OO  I X .QQP +   5:+ (GKPG2CVKPCCVVTCMVKXGUHCUVXQT\ÒINKEJGU'ZGORNCT 

1888



9KNJGNO +8 (TKUQ )GPGTCNUVCVVJCNVGT FGT 0KGFGTNCPFG  5KNDGTOGFCKNNG  XQP   , ) *QNV\JG[ CWH UGKP $GIT·DPKU KP &GNHV )GJCTPKUEJVGU $TWUVDKNF T OKV WOIGNGIVGO /CPVGN WPF   1TFGPUDCPFQDGP5VGTPGPMTCP\*GTMWNGUKP3WCFTKICCWH9QNMGPFCTWPVGT#PUKEJVFGT$GKUGV\WPIKP &GNHV8GTXX.QQP *ÒDUEJG2CVKPCXQT\ÒINKEJ

 71


NIEDERLANDE

1889

#/56'4&#/ 

5VCFV5KNDGTOGFCKNNGXQP,$QUMCOCWHFKG$GKNGIWPIFGT7PTWJGPKPFGT5VCFV0GRVWPUVGJVT KPGKPGO9CIGPFGTKPDGYGIVGT5GGXQP\YGK2HGTFGPIG\QIGPYKTFWPFCPFGUUGP*GEMFGTIGMTÌPVG #OUVGTFCOGT5VCFVUEJKNFCPIGDTCEJVKUV<YGK5GGXÌIGNKPGKPGOCWHTWJKIGT5GGUEJYKOOGPFGP0GUV CO *QTK\QPV CWHIGJGPFG 5QPPG QDGP 5EJTKHVDCPF OKV UGEJU <GKNGP 5EJTKHV  OO  I   -2- FQTVOKVCPFGTGO&WTEJOGUUGT X.QQP+85XCT *ÒDUEJG2CVKPCXQT\ÒINKEJ



1891 1890



1890

%#/2'0

5VCFV4GKEJUVCNGTQ,OKV6KVGN4WFQNHU++&GNO 4 

4-N2T·IGUEJY·EJGUGJTUEJÌP



&'8'06'4 

4GKEJUOÒP\UV·VVG1VVQ+++2HGPPKII1661Û4':)GMTÌPVGTD·TVKIGT-QRHXX Û &#8'0&4# -TGW\ KP FGP 9KPMGNP LG GKPG -WIGN &CPPGPDGTI  +NKUEJ ,CCTDQGM XQQT   /WPVGP2GPPKPIMWPFG5 44'VYCUMPCRRGT5EJTÌVNKPIUGJTUEJÌP



1893 ex 1892



ex 1892

5VCFV -W 5VÒDGT  0QXGODGTGOKUUKQP  -W 5VÒDGT  0QXGODGTGOKUUKQP  -W5VÒDGT    0QXGODGTGOKUUKQP IGRT·IVY·JTGPFFGT$GNCIGTWPIFWTEJ6TWRRGPFGT)GPGTCNUVCCVGP,GYGKNU OKV)GIGPUVGORGNCWHFGT4ÒEMUGKVG#FNGTUEJKNF$TCWUG/CPUHGNF6H  5VÒEM-PKEMURWT Z UGJTUEJÌP

0CEJFGT$GUKV\GTITGKHWPIXQP%CORGPCO,WPK\QIFKGXQP)TCHXQP4GPPGPDGTIIGHÒJTVG5VTGKVOCEJVFGT )GPGTCNUVCCVGPCO#WIWUVXQTFGT5VCFV&GXGPVGTCWH&KGKPFGP&KGPUVGPFGU-ÌPKIUXQP5RCPKGPUVGJGPFG $GUCV\WPI MCRKVWNKGTVG CO  0QXGODGT FGU ,CJTGU WPF GTJKGNV FCTCWHJKP HTGKGP #D\WI 9·JTGPF FGT HCUV   HÒPHOQPCVKIGP $GNCIGTWPI GTHQNIVGP KP FGT 5VCFV \YGK WPVGTUEJKGFNKEJG 0QVIGNFGOKUUKQPGP #O  ,WPK GTJKGNV FGT   JKGTCPYGUGPFG/ÒP\OGKUVGTFGT5V·FVG&GXGPVGT%CORGPWPF<YQNNGFGP#WHVTCIFCU4CVUUKNDGTGKP\WUEJOGN\GP WPF FCTCWU MNKRRGPHÌTOKIG /ÒP\GP JGT\WUVGNNGP FKG KP 5EJTQV WPF -QTP FGO 4GKEJUVCNGT WPF UGKPGP 6GKNUVÒEMGP   GPVURTGEJGP UQNNVGP &KGUG /ÒP\GP YWTFGP FCPP OKV GTJÌJVGO -WTU KP 8GTMGJT IGDTCEJV #O  1MVQDGT FCU   &CVWOKUVCWHFGP0QVOÒP\GP\WNGUGP YWTFGFGT/ÒP\OGKUVGTDGCWHVTCIVMWRHGTPGU-TGFKVIGNFCWU\WRT·IGPFCU FCPP UR·VGT IGIGP XQNNYGTVKIG /ÒP\GP WOIGVCWUEJV YGTFGP UQNNVG &KG OGKUVGP FGT XQTMQOOGPFGP -WRHGTPQV   OÒP\GPYWTFGPPCEJKJTGT#WUICDGOKVGKPGO)GIGPUVGORGNKP(QTOFGU5VCFVUEJKNFGUIGMGPP\GKEJPGV



&14'56#& 

&GPCT (TKGUKUEJG +OKVCVKQP GKPGU MCTQNKPIKUEJGP &GPCTU  I -TGW\&14  '56#  +++++   8IN/'%6H0T 44(GNFGTDGCTDGKVGVUGJTUEJÌP 'ZGORNCTFGT#WMVKQP,CESWGU5EJWNOCP#OUVGTFCO0T 

9GKVGTG-CTQNKPIGTFGPCTGCWUFGT/ÒP\UV·VVG&QTGUVCFHKPFGP5KGWPVGTFGP0TPWPF 72






NIEDERLANDE

1896

1895

1894

(4+'5.#0& 

<GKVFGT-CTQNKPIGT&GPCTI(TKGUKUEJG+OKVCVKQPGKPGU&GPCTU.WFYKIUFGU-KPFGU   +NKUEJ,CCTDQGMXQQT/WPVGP2GPPKPIMWPFG5  44CPFCWUIGDTQEJGPUQPUVUGJTUEJÌPOKVHGKPGT2CVKPC





)TCHUEJCHV$TWPQ+++&GPCT.GGWYCTFGPI *'+04+%854')GMTÌPVGT-QRH T OKV <GRVGT.+#8  8'41 <YKUEJGP \YGK RWPVMKGTVGP .KPKGP $480 &CPPGPDGTI  F XCT   +NKUEJ,CCTDQGMXQQT/WPVGP2GPPKPIMWPFG5  (GKPG2CVKPCMN4CPFHGJNGTUGJTUEJÌP





&GPCT .GGWYCTFGP  I  *'04+%85 4' )GMTÌPVGT -QRH T OKV <GRVGT.+80  8'46 TÒEM   N·WHKI <YKUEJGP\YGKRWPVMKGTVGP.KPKGP$4Û80&CPPGPDGTIXCT+NKUEJ,CCTDQGMXQQT/WPVGP 2GPPKPIMWPFG5XCT 5GJTUEJÌP



1897

1899

1898

)'.&'40 

*GT\QIVWO2JKNKRR++XQP5RCPKGP2JKNKRRUVCNGT&CX&GNOC  45GJTUEJÌP





2JKNKRRUVCNGT&CX&GNOC





2JKNKRRUVCNGT  OKV )GIGPUVGORGN FGT 5V·PFG XQP *QNNCPF CWH FGT 8QTFGTUGKVG .ÌYGPUEJKNF OKV   IGRGTNVGO1XCN&CX&GNOC 4/ÒP\GWPF)GIGPUVGORGNHCUVUGJTUEJÌPpUGJTUEJÌP

4(CUVUGJTUEJÌP



1901 1900

 

2JKNKRRUVCNGT&CX&GNO 4  2JKNKRRUVCNGT&GNO 4 #PO

1900

(CUVUGJTUEJÌP 5EJTÌVNKPIUHGJNGTUGJTUEJÌP

  73


NIEDERLANDE

1902

1903

1904



2TQXKP\)WNFGP&GNO 4 

445EJÌP





)TCHUEJCHV2JKNKRR++XQP5RCPKGP2JKNKRRUVCNGT&GNO 4   4(CUVUGJTUEJÌP





2TQXKP\)WNFGP&CX&GNO

448QT\ÒINKEJ



44#VVTCMVKXGUUGJTUEJÌPGU'ZGORNCT 44-N5EJTÌVNKPIUHGJNGTUGJTUEJÌP

 

*1..#0&

1905

 

)WNFGP&GNO 4  )WNFGP&GNO 4 

1907

1906

1908

1907

.'+&'0 

5VCFV5KNDGTPGT,GVQPQ,  WPUKPIKGTVCWHFKG$GNCIGTWPIFGT5VCFV.GKFGPKO,CJT&GT PKGFGTN·PFKUEJG .ÌYG UVGJV N OKV GTJQDGPGO 5EJYGTV FKG .KPMG CWH FCU IGMTÌPVG 5VCFVYCRRGP XQP   .GKFGPIGNGIV5KGDGP<GKNGP5EJTKHVOOIX.QQP+5 5GJTUEJÌP



/+&&'.$74) 

74

5VCFV'KPUGKVKIG6CNGTMNKRRG\W5VÒDGTP YCJTUEJGKPNKEJ/·T\GOKUUKQP IGRT·IVY·JTGPFFGT $GNCIGTWPIFWTEJFKG6TWRRGPFGT)GPGTCNUVCCVGP$TCWUG/CPUHGNF6H&GNO  *GTTNKEJG2CVKPCXQT\ÒINKEJ




NIEDERLANDE

1909

1910



1910

18'4+,55'.

2TQXKP\&WMCVQP 5KNDGTPGT4GKVGT &CX&GNO

8QT\ÒINKEJp5VGORGNINCP\



4166'4&#/ 

5VCFV5KNDGTOGFCKNNGXQP/*QNV\JG[CWHFKG'TÌHHPWPIFGTPGWGP$ÌTUG5VCFVIÌVVKPUKV\VPCEJ TOKV/CWGTMTQPG(ÒNNJQTPWPF5VCFVYCRRGPCWH9CTGPDCNNGPFGPTGEJVGP(W­CWHGKPG3WGNNWTPG FKG /CCU IGUGV\VQDGPUEJYGDGPFGT/GTMWTFGTGKPGP-TCP\ÒDGTKJT*CWRVJ·NVKO*KPVGTITWPF5EJKHHG CWH 5GG WPF 5VCFVCPUKEJV#PUKEJV FGT $ÌTUG CWU FGT 8QIGNRGTURGMVKXG  OO  I 8GTX X   .QQP 2TCEJVXQNNG2CVKPCXQT\ÒINKEJ

1911

1912



1913

764'%*6 

2TQXKP\ 2JKNKRR ++ XQP 5RCPKGP   4GKEJUVCNGT PCEJ DWTIWPFKUEJGO (W­    &GNO 4  4-N5EJTÌVNKPIUHGJNGTUGJTUEJÌP





2TQXKP\ &WMCVQP 5KNDGTPGT 4GKVGT   +P 752NCUVKMJQNFGT FGT 0)% OKV FGT $GYGTVWPI /5    &CX&GNO /KPLWUVKGTVHCUV5VGORGNINCP\





&WMCVQP&GNO 4 

445GJTUEJÌPpXQT\ÒINKEJ

 75


NIEDERLANDE

1914 1915

1915

9'56(4+'5.#0& 



2TQXKP\5VÒDGT8GTMCFG6H

4-QTTQUKQPUURWTGPUGJTUEJÌP



.WFYKI0CRQNGQP5VÒDGT7VTGEJV&CX5EJWNOCP  *ÒDUEJG2CVKPCUGJTUEJÌP



-¤0+)4'+%**1..#0&

1916

-¤0+)4'+%*&'40+'&'4.#0&' 

9KNJGNO+)WNFGP7VTGEJV&C\W)WNFGP$TÒUUGN5EJWNOCP 5VÒEM8QT\ÒINKEJ

1917

1919



)WNFGP$$TÒUUGN5EJWNOCP



9KNJGNO +++   %GPVU  7VTGEJV /KV QHHGPGT  +P 752NCUVKMJQNFGT FGT 0)% OKV   FGT$GYGTVWPI/5&C\W%GPVU7VTGEJV/KV2WPMVPCEJFGT,CJTGU\CJN+P752NCUVKMJQN FGTFGT0)%OKVFGT$GYGTVWPI/55EJWNOCPC 5VÒEM(CUV5VGORGNINCP\





/KPLWUVKGTVXQT\ÒINKEJ

)WNFGP7VTGEJV5EJWNOCP

8QT\ÒINKEJ



 

1920

1,5:1

 76

1,5:1

9KNJGNOKPC)WNFGP7VTGEJV5EJWNOCP  5GJTUGNVGPGT,CJTICPIWPFXQPITÌ­VGT5GNVGPJGKVKPFKGUGT'TJCNVWPI2QNKGTVG2NCVVG




NORWEGEN

1921

1922

 

1922

-W%GPV ,CJTGU\CJNKO5VGORGNCWUIG·PFGTV 7VTGEJV5EJWNOCP 45GJTUEJÌP )WNFGP7VTGEJV&CX5EJWNOCP (CUV5VGORGNINCP\

 

.165 

&KXGTUG /ÒP\GP FGU  ,CJTJWPFGTVU XQO 6GUVQPDKU\WO6CNGT+PVGTGUUCPVGU.QVDKVVGDGUKEJVK IGP 5VÒEM6GKNYGKUGOKVMN(GJNGTPHCUVUGJTUEJÌP





1XGTKLUUGN2TQXKP\&WMCVQP 5KNDGTPGT4GKVGT  &CX 7VTGEJV2TQXKP\&WMCVQP 5KNDGTPGT 4GKVGT  &CX 9GUVHTKGUNCPF2TQXKP\)WNFGP &CX   5VÒEM5GJTUEJÌPpXQT\ÒINKEJ





-QPXQNWVXQP/ÒP\GPFGU,CJTJWPFGTVUXQO%GPVDKU\WO6CNGTFCTWPVGTUGNVGPG5VÒEMG WC)WNFGP HCUVUGJTUEJÌP )WNFGP UGJTUEJÌP )WNFGP HCUVXQT\ÒI NKEJ %GPV UGJTUEJÌP GVE&C\W$GNIKGP(TCPEU%GPV+PVGTGUUCPVGU .QVDKVVGDGUKEJVKIGP 5VÒEM5EJÌPpXQT\ÒINKEJ



5COONWPI XQP PKGFGTN·PFKUEJGP /ÒP\GP FGU  ,CJTJWPFGTVU XQO %GPV DKU \WO   )WNFGP   5VÒEM FCTWPVGT CWEJ GKPKIG DGUUGTG 6[RGP W C )WNFGP    )WNFGP  GVE &GU 9GKVGTGP   GPVJCNVGPUKPFGKPKIG2T·IWPIGPCWU$GNIKGP&GWVUEJNCPF(TCPMTGKEJ*CDUDWTIWPFFGT75#*QEJ KPVGTGUUCPVGU1DLGMVDKVVGDGUKEJVKIGP 5VÒEM5EJÌPpXQT\ÒINKEJ





1929

1927

1930

1928

0+'&'4.0&+5%*')'$+'6'+0ª$'45'' $#6#8+5%*'4'27$.+-



*QNNCPF5KNDGTCDUEJNCIXQPFGP5VGORGNPFGU-W&WKV'PMJWK\GP5EJQNVGP

8QT\ÒINKEJ



 

9KNJGNO+)WNFGP7VTGEJV5EJQNVGP )WNFGP7VTGEJV5EJQNVGP

4*GTTNKEJG6ÌPWPIXQT\ÒINKEJ 8QT\ÒINKEJ

 



(TGFGTKM+++/CTM%JTKUVKCPKC#JNUVTÌO#VVTCMVKXGUUGJTUEJÌPGU'ZGORNCT





 5MKNNKPI  %JTKUVKCPKC &C\W %JTKUVKCP 8++   5MKNNKPI  -QPIUDGTI #JNUVTÌO    5VÒEM.GKEJVMQTTQFKGTVUGJTUEJÌPWPFXQT\ÒINKEJ

0+'&'4.0&+5%*+0&+5%*'4')+'470)

-¤0+)4'+%*

0149')'0

 77


NORWEGEN

1933

1932



1932

(TGFGTKM+85KNDGTOGFCKNNGXQP2$GTICWHFGP6QF-CTNU:++XQTFGTPQTYGIK UEJGP (GUVWPI (TGFGTKMUVGP CO  0QXGODGT PCEJ ITGIQTKCPKUEJGO -CNGPFGT CO  &G\GODGT    .CPFUEJCHV OKV FGT PQTYGIKUEJGP (GUVWPI (TGFGTKMUVGP XQP FGT CWU GKP 5EJW­ CDIGHGWGTV YKTF KO   8QTFGTITWPF NKGIV FGT VQVG UEJYGFKUEJG XQT FGO PQTYGIKUEJGP .ÌYGP#EJV <GKNGP PQTYGIKUEJG   5EJTKHVOOI)CNUVGT 8QPITQ­GT5GNVGPJGKV(GNFGTIGIN·VVGVUGJTUEJÌP



&KG F·PKUEJG 4ÒEMUGKVGPKPUEJTKHV FKGUGT ·W­GTUV UGNVGPGP /GFCKNNG NCWVGV &GT UEJYGFKUEJG .ÌYG H·NNV FGO   PQTYGIKUEJGP.ÌYGPXQTFKG(Ò­G&CDGKJCVGTUGKP.GDGPXGTNQTGPWPFNGV\VGTGT$NWVXGTIQUUGP



-TQPG /CTM -QPIUDGTI#JNUVTÌO&CX

1934

1935

5GJTUEJÌP



1936



(TGFGTKM8+-W5MKNNKPI-QPIUDGTI#JNUVTÌO

8QT\ÒINKEJ





-W5MKNNKPI-QPIUDGTI#JNUVTÌO

8QT\ÒINKEJ





-W5MKNNKPI-QPIUDGTI#JNUVTÌO

8QT\ÒINKEJ



1938

1937



-CTN:+8,QJCP5RGEKGFCNGT-QPIUDGTI#JNUVTÌO&CX



1UMCT++¤TG 5MKNNKPI -QPIUDGTI#JNUVTÌO

78

1938

5GJTUEJÌP



5GJTUEJÌP




POLEN

1940

1939



5KNDGTOGFCKNNGXQP+6JTQPFUGPCWHFKG#WHNÌUWPIFGT7PKQP\YKUEJGP0QTYGIGPWPF5EJYGFGP CO  ,WPK  WPF FKG 7PCDJ·PIKIMGKV 0QTYGIGPU 5EJTKHVDCPF CWH 'KEJGP\YGKIGP.GGTG 5EJTKHVVCHGN   FCTWPVGTFTGK<GKNGP5EJTKHVWOJGT-TCP\CWUKPGKPCPFGTITGKHGPFGP*·PFGPOOI  445VGORGNINCP\ 



*CCMQP 8++   -TQPGP  -QPIUDGTI CWH FKG7PCDJ·PIKIMGKVKO,CJTG+P75 2NCUVKMJQNFGTFGT0)%OKVFGT$GYGTVWPI/5#JNUVTÌO 8QT\ÒINKEJp5VGORGNINCP\



1941



5GV XQP \YGK 2TQDGP  -TQPGP  -QPIUDGTI 2TQDG KP $TQP\G  I WPF  -TQPGP    -QPIUDGTI2TQDGKP-WRHGTI#JNUVTÌO FQTVKP)QNF (D FQTVKP)QNF 5EJN

FQTVKP)QNF  5VÒEM8QPITÌ­VGT5GNVGPJGKV'PVYGTVGVUGJTUEJÌP 

1942

1943

21.'0

-¤0+)4'+%* 

#PQP[O  2HGPPKI +OKVCVKQP GKPGU 1VVQ#FGNJGKF2HGPPKIU  I -KTEJG-TGW\ KP FGP   9KPMGNP1&&1 4.GKEJVIGYGNNVWPF-QTTQUKQPUURWTGPUGJTUEJÌP





#PQP[O,CJTJWPFGTV-PQRHDTCMVGCVI#FNGTFGP-QRHPCEJNIGYCPFV-QRKEMKDNpDPXCT #VVTCMVKXGUUGJTUEJÌPGU'ZGORNCTOKVFWPMNGT2CVKPC



1944



.WFYKI + XQP 7PICTP  5KNDGTPG 5WKVGPOGFCKNNG Q , WO   XQP , 2 *QN\J·WUGT   )GMTÌPVGUWPFIGJCTPKUEJVGU$TWUVDKNFTOKVWOIGNGIVGO/CPVGN<GKNGP5EJTKHVOOI *%\ 8QT\ÒINKEJp5VGORGNINCP\ 

1945

1946



5VGRJCP$CVJQT[)TÌUEJGT1NMWU\+IGT1E 4 -QRKEMKDXCT 4  445GJTUEJÌP





)TQUEJGP1NMWU\-QRKEMKCXCT 4 



445GJTUEJÌP

79


POLEN

1947

1948

1949

1950

1951



)TÌUEJGT2<1NMWU\+IGT1C 4 -QRKEMKXCT 4   8QPITQ­GT5GNVGPJGKV<CRQPKGTVMN5EJTÌVNKPIUHGJNGTUGJTUEJÌP



5EJKNNKPI/ÒP\\GKEJGP(KUEJ1NMWU\-QRKEMKXCT 4   44-N5EJTÌVNKPIUHGJNGTCO4CPF\CRQPKGTVUGJTUEJÌPpXQT\ÒINKEJ



  

5EJKNNKPI1NMWU\-QRKEMKXCT 4  44'VYCU$GNCIHCUVUGJTUEJÌP )TÌUEJGT1NMWU\+IGT1EXCT 4 -QRKEMKC 4  445GJTUEJÌP )TÌUEJGT1NMWU\+IGT1G 4 -QRKEMKCXCT 4  445GJTUEJÌP

  

1952

    

1953

1954

1957

1958

1956

1955

)TÌUEJGT1NMWU\+IGT1H 4 -QRKEMKXCT 4  )TÌUEJGT1NMWU\+IGT1R 4 -QRKEMKXCT 4  )TÌUEJGT1NMWU\+IGT1R 4 -QRKEMKXCT 4  )TÌUEJGT1NMWU\+IGT1C 4 -QRKEMKXCT 4  )TÌUEJGT1NMWU\+IGT1C 4 -QRKEMKXCT 4 

2CVKPCUGJTUEJÌP *ÒDUEJG2CVKPCUGJTUEJÌP 5GJTUEJÌP 5GJTUEJÌP 5GJTUEJÌP

1959



    

1961

1960



)TÌUEJGT+&1NMWU\+IGT1XCT 4 -QRKEMKXCT 4   5EJÒTHURWTGPCO4CPFDGTGKEJUQPUVXQT\ÒINKEJ





)TÌUEJGT+&1NMWU\+IGT1XCT 4 -QRKEMKXCT 4 

5GJTUEJÌP





)TÌUEJGT+&1NMWU\+IGT1C 4 -QRKEMK 4 

 9KP\5EJTÌVNKPIUHGJNGTUGJTUEJÌP





)TÌUEJGT)*+&1NMWU\+IGT1C 4 -QRKEMK 4 



)TÌUEJGT)*+&1NMWU\8CTKCPVGOKV-TQPGÒDGTFGO(COKNKGPYCRRGP$CVJQT[+IGT1 CXCT 4 -QRKEMKXCT 4  5GJTUEJÌP

80

5GJTUEJÌP

 


POLEN

1962

1963

1964

1966

1965

  

)TÌUEJGT2QUGP+IGT2C 4 -QRKEMKXCT 4  )TÌUEJGT2QUGP+IGT2EXCT 4 -QRKEMKXCT 4  )TÌUEJGT)*+&1NMWU\+IGT1CD 4 -QRKEMKXCT 4 



)TÌUEJGT)*+&1NMWU\+IGT1CXCT 4 -QRKEMKXCT 4   (GKPG2CVKPCUGJTUEJÌP



)TÌUEJGT0*+&1NMWU\+IGT1C 4 -QRKEMK 4 

1967

1968

5GJTUEJÌP 5GJTUEJÌP 5GJTUEJÌP

   

5GJTUEJÌP

1969

1970



1971

 

5EJKNNKPI/CTKGPDWTIHÒTFKGRTGW­KUEJGP.·PFGT-QRKEMK 4  5EJKNNKPI/CTKGPDWTIHÒTFKGRTGW­KUEJGP.·PFGT-QRKEMK 4 



)TÌUEJGT  0*+& 1NMWU\ 8CTKCPVG QJPG -TGW\ CWH FGT -TQPG +IGT 1 C 4  -QRKEMK   XCT 4  (GKPG2CVKPCUGJTUEJÌP





)TÌUEJGT0*+&1NMWU\8CTKCPVGQJPG-TGW\CWHFGT-TQPG+IGT1D 4 -QRKEMK XCT 4  (GKPG2CVKPCUGJTUEJÌP





)TÌUEJGT+&1NMWU\+IGT1CXCT 4 -QRKEMK 4 

1972

1973

1974

5GJTUEJÌP 5GJTUEJÌP

45GJTUEJÌP

1975

 



1976

 

)TÌUEJGT2QUGP+IGT2XCT 4 -QRKEMKXCT 4  )TÌUEJGT2QUGP+IGT2XCT 4 -QRKEMKXCT 4 

9KP\<CKPGPFGUGJTUEJÌP 5GJTUEJÌP

 



5KIKUOWPF+++)TÌUEJGT+(1NMWU\+IGT1C 4 -QRKEMK 4   4*GTTNKEJG2CVKPCUGJTUEJÌPpXQT\ÒINKEJ





)TÌUEJGT+(1NMWU\+IGT1F 4 -QRKEMK 4 

445GJTUEJÌP





)TÌUEJGT/CTKGPDWTI+IGT/CXCT 4 -QRKEMK  2TCEJVXQNNG2CVKPCXQT\ÒINKEJGU'ZGORNCT

 81


POLEN

1977

1978



)TÌUEJGT//CTKGPDWTI-QRKEMK 4 

445GJTUEJÌP





1TV 6CNGT  ,CJTGU\CJNKO5VGORGNCWUIG·PFGTV $TQODGTI-QRKEMK  8QPITÌ­VGT5GNVGPJGKV(CUVUGJTUEJÌP



1980

1979

1981



4GKEJUVCNGT++$TQODGTI&CX#-QRKEMK 4   42TCEJVXQNNG2CVKPCUGJTCVVTCMVKXGUXQT\ÒINKEJGU'ZGORNCT

 

4GKEJUVCNGT++$TQODGTI&CX-QRKEMK 4  4GKEJUVCNGT++$TQODGTI&CX-QRKEMK 4 

*GPMGNURWTUGJTUEJÌP *GPMGNURWTUGJTUEJÌP

  

1983

1982

1982



4GKEJUVCNGT++$TQODGTI&CX-QRKEMK 4 

-N5EJTÌVNKPIUHGJNGTUGJTUEJÌP





,QJCPP-CUKOKT)TÌUEJGT 1TV4GKEJUVCNGT -TCMCW-QRKEMK  -N-TCV\GTUGJTUEJÌP



/KVFGT5COONGTRWP\GXQP*WVVGP%\CRUMK

82


POLEN

1985 1984

1984



)TÌUEJGT 1TV4GKEJUVCNGT .GODGTI-QRKEMK 4   445VCTMGT&QRRGNUEJNCIHCUVUGJTUEJÌP





5KNDGTCDUEJNCI XQP FGP 5VGORGNP FGU   &WMCVGP  6.$ -TCMCW (D  C FQTV  &WMCV    -QRKEMK 4FQTV&WMCV  8QPITQ­GT5GNVGPJGKV5EJTÌVNKPIUNQEJUGJTUEJÌP



1987

1986





#WIWUV ++ FGT 5VCTMG  5KNDGTOGFCKNNG  XQP %JTKUVKCP 9GTOWVJ CWH UGKPG <WUCO   OGPMWPHVOKVFGOUEJYGFKUEJGP-ÌPKI-CTN:++KP#NVTCPUV·FVCO&G\GODGT)GJCTPKUEJVGU$TWUV DKNFTOKV.QTDGGTMTCP\WPFWOIGNGIVGO/CPVGN$TWUVDKNFFGUUEJYGFKUEJGP-ÌPKIU-CTN:++TOKV .QTDGGTMTCP\WPFWOIGNGIVGO/CPVGN/KV\YGK\GKNKIGT4CPFUEJTKHVOOI*%\

4 *KNFGDTCPF+59QJNHCJTV 444CPFHGJNGTHCUVUGJTUEJÌP



5VCPKUNCWU + .GU\E\[PUMK  5KNDGTOGFCKNNG  XQP % ( 0KEQNG CWH FGP IGRNCPVGP $CW   GKPGU%JCNGVUDGK%JCPVJGWZKPFGT0·JGXQP0CPE[<YGKIGMTÌPVG#FNGTJCNVGPFCUIGMTÌPVGXKGTHGN FKIG 9CRRGP OKV /KVVGNUEJKNF)GD·WFGCPUKEJV KO #DUEJPKVV %*#06*'8:  OO  I   *%\ 45GJTUEJÌP



1988

1989

1990



#WIWUV+++$CPEQ6CNGT'&%.GKR\KI&CX-QRKEMK 4 5EJPGG 5GJTCVVTCMVKXGU'ZGORNCTUGJTUEJÌPpXQT\ÒINKEJ



5VCPKUNCWU #WIWUV  -QPX6CNGT  (5 9CTUEJCW &CX  -QRKEMK  4    (GNFGTIGIN·VVGVUGJTUEJÌP





-QPX6CNGT'$9CTUEJCW&CX-QRKEMK 4 



4(GKPG2CVKPCUGJTUEJÌP



83


POLEN

1991

1992



-QPX6CNGT'$9CTUEJCW&CX-QRKEMK 4 



#NGZCPFGT + XQP 4W­NCPF  $TQP\GOGFCKNNG  XQP ( # %CWPQKU CWH FGP 6QF FGU   RQNPKUEJGP#FGNKIGP,Q\GH#PVQPK2QPKCVQYUMK)GPGTCN/KPKUVGTWPF/CTUEJCNNXQP(TCPMTGKEJ$ÒUVG 2QPKCVQYUMKU N5GEJU <GKNGP 5EJTKHV FC\YKUEJGP #DUEJPKVVUNKPKG \W FGP 5GKVGP .QTDGGT WPF 'KEJGP   \YGKIOO*%\ 8QT\ÒINKEJ

1993







84

1994

/KPLWUVKGTVUGJTUEJÌP





1995

0KMQNCWU+XQP4W­NCPF$TQP\GOGFCKNNGXQP,,$CTTGCWHFGP$GHTGKWPIUMCORH FGT 2QNGP .KVJCWGT WPF 4WVJGPGP IGHGTVKIV KO #WHVTCI FGU NKVCWKUEJTWVJGPKUEJGP -QOKVGGU KP 2CTKU   *GTMWNGUOKVWOIGNGIVGO6WEJWPF\GTTKUUGPGP(W­HGUUGNPUVGJVXXCWH)NQDWUCWHFGO21.10+# \W NGUGP KUV OKV FGT 4GEJVGP \GTTGK­V GT UGKPG *CPFHGUUGNP&KG (CJPGP XQP CEJV 9QKYQFUEJCHVGP   QDGPFGTRQNPKUEJG#FNGTWPVGPNKVJCWKUEJGT4GKVGTNOO*%\ 8QT\ÒINKEJ



5KNDGTOGFCKNNG Q , ITCXKGTV   XQP ) /CKPGTV

 Ó  9CTUEJCW CWH FKG 6CWHG KO   ,QTFCP&KG6CWHG%JTKUVKKO,QTFCP\WFGP5GKVGPMNGKPG(GNUGPQDGPFKG6CWDGFGU*GKNKIGP)GKUVGU KP5VTCJNGP0#2#/+H6-F%*4<67FCTWPVGTITCXKGTVG9KFOWPI*KNCTGIQ#NHCYKEMKGIQ&PKC -YKGVPKCTQF2)WPVGP4QUGP\YGKIOOI*%\p XIN   (GKPG2CVKPCYKP\4CPFHGJNGTUGJTUEJÌP



4GXQNWVKQP$TQP\GOGFCKNNGXQP,,$CTTGCWHFKGRQNPKUEJG'OKITCVKQPKPHQNIGFGT 0KGFGTNCIGKPFGP(TGKJGKVUM·ORHGPIGHGTVKIVKO#WHVTCIFGU-QOKVGGUKP$TÒUUGN&KG2GTUQPKHKMCVKQP $GNIKGPU OKV (TGKJGKVUOÒV\G J·NV WPF WOCTOV FCU PGDGP KJT UVGJGPFG RGTUQPKHK\KGTVG 2QNGP FCU GKPG   /CWGTMTQPG VT·IV WPF KP FGT 4GEJVGP GKPG 5VCPFCTVG J·NV&TGK <GKNGP 5EJTKHV QDGP 5VGTPGPMTCP\   WPVGP .QTDGGT WPF 2CNO\YGKI IGMTGW\V FCTWPVGT IGMTÌPVGT DGNIKUEJGT .ÌYG N OKV 5EJYGTV   OO*%\ 448QT\ÒINKEJ




POLEN

1997 1996

1996



<NQV[EJ-)9CTUEJCW2T·IWPIFGT#WHUV·PFKUEJGP-QRKEMK 4   (GKPG2CVKPCOKPLWUVKGTVHCUVXQT\ÒINKEJ





4GRWDNKM-W)TQU\$KTOKPIJCO+P752NCUVKMJQNFGTFGT2%)5OKVFGT$GYGTVWPI 524$-QRKEMK 5VGORGNINCP\



1999

1998

1999



 <NQV[EJ  2TQDG KP -WRHGT +P 752NCUVKMJQNFGT FGT 2%)5 OKV FGT $GYGTVWPI 52  4$   -QRKEMK 4  (CUV5VGORGNINCP\





<NQVG2TQDG+P752NCUVKMJQNFGTFGT2%)5OKVFGT$GYGTVWPI52-QRKEMK 4   42QNKGTVG2NCVVG





&KXGTUG /ÒP\GP FGU  ,CJTJWPFGTVU XQO5EJKNNKPIDKU\WO6CNGTFCTWPVGTCWEJ2T·IWPIGP HÒT&CP\KI.KVCWGP4KICGVE*QEJKPVGTGUUCPVGU.QVDKVVGDGUKEJVKIGP  5VÒEM'KPKIGOKVMN(GJNGTPOGKUVUGJTUEJÌP





-NGKPG5COONWPIXQP/ÒP\GPFGU,CJTJWPFGTVUXQO-W)TQU\[DKU\WO6CNGTFCTWPVGT DGUUGTG6[RGP*QEJKPVGTGUUCPVGU.QVDKVVGDGUKEJVKIGP 5VÒEM/GKUVUGJTUEJÌP





5KIKUOWPF +  )TQUEJGP  6JQTP  )TQUEJGP  &CP\KI  )TQUEJGP  'NDKPI    &C\W2TGW­GP*\O)GQTI(TKGFTKEJ)TQUEJGP 5VÒEM5GJTUEJÌP





&KXGTUG-NGKPOÒP\GPFGU,CJTJWPFGTVUFCTWPVGT2T·IWPIGPHÒT.KXNCPF+PVGTGUUCPVGU.QVDKVVG DGUKEJVKIGP 5VÒEM/GKUVUGJTUEJÌP





2QNGP 5KIKUOWPF +++ )TÌUEJGT  +( 2QUGP +IGT 2 C -QRKEMK   &C\W $CNVKMWO   .KVCWGP 5KIKUOWPF #WIWUV XQP 2QNGP  )TQUEJGP  -QRKEMK   5KIKUOWPF +++ XQP 2QNGP   )TÌUEJGT8KNPKWU +IGT8C-QRKEMK  5VÒEM5GJTUEJÌPpXQT\ÒINKEJ





&KXGTUG5KNDGTOÒP\GPFGU,CJTJWPFGTVUXQO<NQV[EJDKU\W<NQV[EJFCTWPVGTDGUUGTG 6[RGPWPF,CJTI·PIG+PVGTGUUCPVGU.QVDKVVGDGUKEJVKIGP 5VÒEM5GJTUEJÌPpRQNKGTVG2NCVVG





-NGKPG6[RGPUCOONWPIRQNPKUEJGT/ÒP\GPXQPDKUFCTWPVGT\CJNTGKEJG)GFGPMOÒP\GP  5VÒEM5GJTUEJÌPpHCUV5VGORGNINCP\





-NGKPG5GTKGXQP$TQP\GOGFCKNNGPFGU,CJTJWPFGTVUCWHXGTUEJKGFGPG#PN·UUGWPF2GTUÌPNKEJMGKVGP FCTWPVGTDGUUGTG5VÒEMG+PVGTGUUCPVGU.QVDKVVGDGUKEJVKIGP  5VÒEM6GKNYGKUGUGNVGP/GKUVXQT\ÒINKEJ 

.16521.'0

2008

2009

&#0<+) 

5VCFV )TÌUEJGT  OKV 6KVGN 5KIKUOWPFU +   &WVMQYUMK5WEJCPGM  ++ D -QRKEMK    4  8QT\ÒINKEJ





)TQUEJGPIGRT·IVY·JTGPFFGT$GNCIGTWPIFGT5VCFV\WT<GKVFGU$ÒTIGTCWHUVCPFU$TCWUG /CPUHGNF6H&WVMQYUMK5WEJCPGM-QRKEMK 4  -N<CKPGPFGUGJTUEJÌP

 85


POLEN

2011

2010

2013

2012



)TQUEJGP  IGRT·IV Y·JTGPF FGT $GNCIGTWPI FGT 5VCFV \WT <GKV FGU $ÒTIGTCWHUVCPFU    $TCWUG/CPUHGNF6HXCT&WVMQYUMK5WEJCPGMDXCT OKV-TGW\GPCPUVGNNGFGT5VGTPGKPFGT 7OUEJTKHV -QRKEMKXCT 4  45EJÌPpUGJTUEJÌP





)TQUEJGP  IGRT·IV Y·JTGPF FGT $GNCIGTWPI FGT 5VCFV \WT <GKV FGU $ÒTIGTCWHUVCPFU    $TCWUG/CPUHGNF6HXCT&WVMQYUMK5WEJCPGMI-QRKEMKXCT 4  5EJÌPpUGJTUEJÌP





)TQUEJGPOKV6KVGN5VGRJCP$CVJQT[U  &WVMQYUMK5WEJCPGM-QRKEMK 4  45GJTUEJÌPpXQT\ÒINKEJ





)TQUEJGPOKV6KVGN5VGRJCP$CVJQT[U  &WVMQYUMK5WEJCPGMCXCT-QRKEMK XCT 4  45GJTUEJÌPpXQT\ÒINKEJ



2014

2016

2015



)TQUEJGPOKV6KVGN5VGRJCP$CVJQT[U  &WVMQYUMK5WEJCPGM-QRKEMK 4  49KP\<CKPGPFGXQT\ÒINKEJ





)TQUEJGPOKV6KVGN5VGRJCP$CVJQT[U  &WVMQYUMK5WEJCPGM-QRKEMK 4  9KP\5EJTÌVNKPIUHGJNGTXQT\ÒINKEJp5VGORGNINCP\





)TQUEJGP  OKV 6KVGN 5VGRJCP $CVJQT[U   &WVMQYUMK5WEJCPGM  XCT-QRKEMK XCT 4  4#VVTCMVKXGU'ZGORNCTOKVJÒDUEJGT2CVKPCXQT\ÒINKEJ



2017

2019

2018

2019



5EJKNNKPIOKV6KVGN5VGRJCP$CVJQT[U  &WVMQYUMK5WEJCPGM+8-QRKEMK 4  (GKPG2CVKPCUGJTUEJÌP





5EJKNNKPIOKV6KVGN5VGRJCP$CVJQT[U  &WVMQYUMK5WEJCPGM8-QRKEMK 4  8QT\ÒINKEJ





1TV  4GKEJUVCNGT   OKV 6KVGN 5KIKUOWPFU +++   &WVMQYUMK5WEJCPGM  C XCT   -QRKEMK 4  2TCEJVGZGORNCT(CUV5VGORGNINCP\



86


POLEN

2020



5KNDGTOGFCKNNGQ, WO XQP,*ÌJPWPF5&CFNGTCWHFKG5GIPWPIGPFGU9CHHGPUVKNNUVCPFUOKV 5EJYGFGP KP 5VWJOUFQTH  (KFGU WPF 2KGVCU TGKEJGP UKEJ FKG *·PFG KO *KPVGTITWPF 5VCFVCPUKEJV   XQP&CP\KIQDGPUVTCJNGPFGT0COG,GJQXCU,WUVKVKCOKVDGD·PFGTVGO5EJYGTVWPF2CZOKV%CFWEGWU ¤NWPF2CNO\YGKIWOCTOGPGKPCPFGTFCXQT5EJTKHVVCHGNOOI&WVMQYUMK5WEJCPGM

FQTVKTTVÒONKEJPWT*ÌJPCNU/GFCKNNGWTCPIGIGDGP /CW¾2CZKP0WOOKUXCT  -N4CPFHGJNGTUGJTUEJÌPpXQT\ÒINKEJ



2021



5KNDGTOGFCKNNGQ, WO XQP,*ÌJPCWHFKG5GIPWPIGPFGU9CHHGPUVKNNUVCPFUOKV5EJYGFGPKP 5VWJOUFQTH  (KFGU WPF 2KGVCU TGKEJGP UKEJ FKG *·PFG KO *KPVGTITWPF 5VCFVCPUKEJV XQP &CP\KI   QDGP UVTCJNGPFGT 0COG ,GJQXCU,WUVKVKC OKV DGD·PFGTVGO 5EJYGTV WPF 2CZ OKV %CFWEGWU ¤N WPF   2CNO\YGKI WOCTOGP GKPCPFGT FCXQT 5EJTKHVVCHGN  OO  I &WVMQYUMK5WEJCPGM    /CW¾#PO2CZKP0WOOKU *ÒDUEJG2CVKPCYKP\5EJTÌVNKPIUHGJNGTCO4CPFXQT\ÒINKEJ

2022





2023



2022

5KNDGTOGFCKNNGWPUKIPKGTVCWHFKG8GTO·JNWPIXQP9NCFKUNCWU+8OKV.WFQXKEC/CTKC)QP\CIC 2TKP\GUUKP XQP /CPVWC 8GT\KGTVG 6CHGN OKV HÒPH <GKNGP 5EJTKHV QDGP -TQPG FCTWPVGT 2CNO\YGKI WPF   (GFGTIGMTGW\V2CNOGQDGP-TQPGOOI*%\ 5GJTUEJÌPpXQT\ÒINKEJ



5KNDGTOGFCKNNGXQP#-CTNUVGGPCWHFGP6QFXQP,QJCPP*GXGNKWU$TWUVDKNFOKV)GYCPFJCNDN 8QP5QPPGDGUVTCJNVGT#FNGTUEJYGDVÒDGT.CPFUEJCHVOOI&WVMQYUMK5WEJCPGMC 442TCEJVGZGORNCT*GTTNKEJG2CVKPCXQT\ÒINKEJp5VGORGNINCP\



,QJCPP*GXGNKWU *GYGNMG  ÓUVWFKGTVGKP.GKFGP4GEJVUYKUUGPUEJCHVGPÒDGTPCJOFCPPFKG $TCWGTGK UGKPGU 8CVGTU KP &CP\KI YKFOGVG UKEJ CDGT DCNF FGT #UVTQPQOKG 'T GTNCPIVG FWTEJ UGKPG 'PVFGEMWPIGP   WPF9GTMG \$FKG5GNGPQITCRJKG FGP4WHGKPGUDGFGWVGPFGP)GNGJTVGPCWHFKGUGO)GDKGV

87


POLEN

2024



5KNDGTOGFCKNNQPXQP,2.WVVOGTCWHFKG,CJTHGKGTFGU(TKGFGPUXQP1NKXC5VCFVCPUKEJVOKV FGT9GKEJUGNWPFFGT1UVUGGKO*KPVGTITWPFFCTCWH5EJKHHGWPVGPJCNVGP\YGK.ÌYGPFCU5VCFVYCRRGP #PUKEJVFGU-NQUVGTU1NKXCFCTÒDGTIGDWPFGPG<YGKIGÒDGTPGWP<GKNGP5EJTKHVOOI &WVMQYUMK5WEJCPGM2CZKP0WOOKU 44*GTTNKEJG2CVKPCXQT\ÒINKEJGU2TCEJVGZGORNCT 

2025

2028

2029



 )TQUEJGP )WNFGP <NQV[   OKV 6KVGN #WIWUVU +++ (TKGFTKEJ #WIWUV ++ XQP 5CEJUGP     &WVMQYUMK5WEJCPGM-QRKEMK 4  -N2T·IGUEJY·EJGXQT\ÒINKEJ



1TV  4GKEJUVCNGT   OKV6KVGN5KIKUOWPFU+++  )TQUEJGP )WNFGP<NQV[  OKV6KVGN#WIWUVU+++ (TKGFTKEJ#WIWUV++XQP5CEJUGP 5EJKNNKPIOKV/QPQITCOO XQP5VCPKUNCWU#WIWUV  &C\W-W5EJKNNKPI 5VÒEM5GJTUEJÌP





1TV 4GKEJUVCNGT CNNGOKV6KVGN5KIKUOWPFU+++&WVMQYUMK5WEJCPGM +++ED 5VÒEM5GJTUEJÌPpXQT\ÒINKEJ





*GT\QIVWO (TKGFTKEJ #WIWUV XQP 5CEJUGP  $TQP\GOGFCKNNG  XQP $ #PFTKGW   WPF 0 ) $TGPGV CWH FKG 'TTKEJVWPI FGU *GT\QIVWOU 9CTUEJCW $ÒUVG 0CRQN¾QPU + T OKV .QTDGGT   MTCP\)QVKUEJGT 6JTQP OKV -TQPG \W FGP 5GKVGP 5EJYGTV WPF <GRVGT  OO *%\  5NI   ,WNKWU<GKV\ 8QT\ÒINKEJ 6CNCT+$&CX-QRKEMK 4  45GJTUEJÌP



.165&#0<+)

9#45%*#7

 88

 


RUMÄNIEN

2030

2031

<#/15% 

5VCFV<NQVGIGRT·IVY·JTGPFFGT$GNCIGTWPIFWTEJTWUUKUEJG6TWRRGP8CTKCPVGOKVURKGIGNXGT MGJTVGO&KP&121/1<$TCWUG/CPUHGNF6HXCT-QRKEMKE 4   (GKPG2CVKPCNGKEJVG2T·IGUEJY·EJGUGJTUEJÌPpXQT\ÒINKEJ



0CEJ FGO 4ÒEM\WI FGT HTCP\ÌUKUEJGP #TOGG  CWU 4WUUNCPF .KVCWGP WPF 9CTUEJCW XGTUWEJVG FKG MNGKPG   (GUVWPI <COQUE FGP JGTCPFTKPIGPFGP TWUUKUEJGP 6TWRRGP 9KFGTUVCPF \W NGKUVGP <WP·EJUV ICD GU PQEJ IGPÒIGPF   .GDGPUOKVVGNKPFGT5VCFV#NUFKG4WUUGPLGFQEJ<COQUEWO\KPIGNVJCVVGPYCTGPFKG'KPYQJPGTIG\YWPIGPKJTGP 8KGJDGUVCPF  FCTWPVGT UQICT FKG 2HGTFG  \W UEJNCEJVGP #NU CWEJ FKGUG 4GUGTXGP CWHIG\GJTV YCTGP UCJ UKEJ FGT   MQOOCPFKGTGPFG )GPGTCN *CWMG IG\YWPIGP CWU FGO IGUCOOGNVGP 5EJOWEM FGT $ÒTIGT WPF FGO -KTEJGPUKNDGT   IWVJCNVKIG 5KNDGTOÒP\GP \W RT·IGP /KV FKGUGP /ÒP\GP \W  <NQV[ MQPPVGP FKG $GNCIGTVGP DGK FGP TWUUKUEJGP   $GNCIGTGTP0CJTWPIUOKVVGNMCWHGP'UUVGNNVGUKEJJGTCWUFC­FKG$GNCIGTWPIUOÒP\GPUQICTOGJT5KNDGTGPVJKGNVGP CNU FKG /ÒP\GP FGU *GT\QIVWOU 9CTUEJCW (KPFKIG )GUEJ·HVUNGWVG MCWHVGP FGP TWUUKUEJGP 5QNFCVGP FKG UKNDGTPGP   $GNCIGTWPIUOÒP\GPCDWPFNKG­GPUKGGKPUEJOGN\GP&CJGTUKPFFKGUG5VÒEMGUGNVGP



 <NQVG  IGRT·IV Y·JTGPF FGT $GNCIGTWPI FWTEJ TWUUKUEJG 6TWRRGP $TCWUG/CPUHGNF 6H     -QRKEMKD 4  5EJTÌVNKPIUHGJNGTKO4CPFDGTGKEJYKP\-TCV\GTUGJTUEJÌP

47/0+'0

-¤0+)4'+%* 



-CTN +  2TQQH 5GV  *GCVQP DGUVGJGPF CWU -W $CPK -W $CPK -W $CPK   -W$CPK5EJ·HHGT5VCODWNKWCCCC 5VÒEM2QNKGTVG2NCVVGOKPDGTÒJTV



2033 2035

2034



-W$CP$KTOKPIJCO5EJ·HHGT5VCODWNKW  5GNVGPKPFKGUGT'TJCNVWPI*GTTNKEJG2CVKPCXQT\ÒINKEJp5VGORGNINCP\





.GW%$WMCTGUV-GJTRT·IWPI5EJ·HHGT5VCODWNKW  5GNVGPKPFKGUGT'TJCNVWPI8QT\ÒINKEJp5VGORGNINCP\





.GW%$WMCTGUV-GJTRT·IWPI5EJ·HHGT5VCODWNKW

2037

2038

2036

5GJTUEJÌPpXQT\ÒINKEJ



2039

2036



.GK$TÒUUGN5EJ·HHGT5VCODWNKW

8QT\ÒINKEJ





.GW$TÒUUGN5EJ·HHGT5VCODWNKW

8QT\ÒINKEJp5VGORGNINCP\





-W$CPK$$WMCTGUV5EJ·HHGT5VCODWNKW  5GNVGPKPFKGUGT'TJCNVWPI2TCEJVGZGORNCT4GUVGXQP<CRQPNCEM5VGORGNINCP\





-W$CPK$$WMCTGUV5EJ·HHGT5VCODWNKWD



*ÒDUEJG2CVKPCXQT\ÒINKEJ

89


RUMÄNIEN

2041

2040

2042



.GK$$WMCTGUV/KV5VGORGNUEJPGKFGTUKIPCVWTCO2GTNMTGKU&CX5EJ·HHGT5VCODWNKWC 5GNVGPKPFKGUGT'TJCNVWPI-CDKPGVVUVÒEMOKVJGTTNKEJGT2CVKPC5VGORGNINCP\





.GK$$WMCTGUV/KV5VGORGNUEJPGKFGTUKIPCVWTCO2GTNMTGKU&CX5EJ·HHGT5VCODWNKWC #VVTCMVKXGUXQT\ÒINKEJGU'ZGORNCT





.GK$$WMCTGUV/KV5VGORGNUEJPGKFGTUKIPCVWTCO2GTNMTGKU&CX5EJ·HHGT5VCODWNKWC 8QT\ÒINKEJ



2043

2044



-W$CPK ,CJTGU\CJNKO5VGORGNCWUIG·PFGTV $$WMCTGUV5EJ·HHGT5VCODWNKW  48QT\ÒINKEJp5VGORGNINCP\





.GK89KGP5EJ·HHGT5VCODWNKW





.GW89KGP5EJ·HHGT5VCODWNKW  #VVTCMVKXGU'ZGORNCTOKVJÒDUEJGT2CVKPCXQT\ÒINKEJp5VGORGNINCP\





-W$CPK$$WMCTGUV5EJ·HHGT5VCODWNKW



5GJTUEJÌPpXQT\ÒINKEJ

2046

2045

-QTTQUKQPUURWTGPUGJTUEJÌPpXQT\ÒINKEJ

2047



90

$TQP\GOGFCKNNGXQP(9-WNNTKEJCWHFKG2TQMNCOCVKQPFGU-ÌPKITGKEJGU4WO·PKGP-QRHN <GKNGP5EJTKHVCWHGKPGT6CHGNFKGCPLGFGT5GKVGOKVGKPGT-TQPGWPF<YGKIGPXGT\KGTVKUVOO 5QOOGT- 5GNVGPKPFKGUGT'TJCNVWPI-CDKPGVVUVÒEMOKVRTCEJVXQNNGT2CVKPC5VGORGNINCP\




RUMÄNIEN 



$TQP\GOGFCKNNGXQP(9-WNNTKEJCWHFKG2TQMNCOCVKQPFGU-ÌPKITGKEJGU4WO·PKGP-QRHN  <GKNGP 5EJTKHV CWH GKPGT 6CHGN FKG CP LGFGT 5GKVG OKV GKPGT -TQPG WPF <YGKIGP XGT\KGTV KUV   OO5QOOGT- 8QT\ÒINKEJp5VGORGNINCP\



<KPPOGFCKNNG  XQP ( 9 -WNNTKEJ CWH FKG 2TQMNCOCVKQP FGU -ÌPKITGKEJGU 4WO·PKGP -QRH N   <GKNGP 5EJTKHV CWH GKPGT 6CHGN FKG CP LGFGT 5GKVG OKV GKPGT -TQPG WPF <YGKIGP XGT\KGTV KUV   OO5QOOGT- 2TCEJVGZGORNCT(CUV5VGORGNINCP\



2050





$TQP\GOGFCKNNGXQP(9-WNNTKEJCWHFGPTWUUKUEJVÒTMKUEJGP-TKGI7PKHQTOKGTVGU $TWUVDKNF N4QOCPKC UVGJV X X FGP -QRH PCEJ T IGYCPFV KP FGT GTJQDGPGP4GEJVGP-TCP\KPFGT .KPMGP XKGTHGNFKIGP 9CRRGPUEJKNF N 2QUVCOGPV OKV FGT ,CJTGU\CJN  FCTCWH -TQPG WOJGT4GNKGH OKV$KNFGTPCWUFGO-TKGIOO5QOOGT- #VVTCMVKXGUXQT\ÒINKEJGU'ZGORNCT



<KPPOGFCKNNG  XQP ( 9 -WNNTKEJ CWH FGP TWUUKUEJVÒTMKUEJGP -TKGI  7PKHQTOKGTVGU   $TWUVDKNF N4QOCPKC UVGJV X X FGP -QRH PCEJ T IGYCPFV KP FGT GTJQDGPGP4GEJVGP-TCP\KPFGT .KPMGP XKGTHGNFKIGP 9CRRGPUEJKNF N 2QUVCOGPV OKV FGT ,CJTGU\CJN  FCTCWH -TQPG WOJGT4GNKGH OKV$KNFGTPCWUFGO-TKGIOO5QOOGT-  2TCEJVGZGORNCT(CUV5VGORGNINCP\CWURQNKGTVGT2NCVVG



2052





5KNDGTOGFCKNNG Q ,   XQP ( 9 -WNNTKEJ 2T·OKG HÒT .CPFYKTVUEJCHV WPF +PFWUVTKG -QRH N   &TGK<GKNGP5EJTKHVWOJGTGKP-TCP\CWU)GVTGKFG6TCWDGPWPF(TÒEJVGPFCTCWHXKGT/GFCKNNQPUOKV 2HGTFG9KFFGTD\Y-WJMQRHUQYKGGKPGO2HNWIOOI5QOOGT-  5GJTUEJÌPpXQT\ÒINKEJ



8GTUKNDGTVG$TQP\GOGFCKNNGQ,  XQP(9-WNNTKEJ2T·OKGHÒT.CPFYKTVUEJCHVWPF+PFWUVTKG -QRH N&TGK <GKNGP 5EJTKHV WOJGT GKP -TCP\ CWU )GVTGKFG 6TCWDGP WPF (TÒEJVGP FCTCWH XKGT   /GFCKNNQPUOKV2HGTFG9KFFGTD\Y-WJMQRHUQYKGGKPGO2HNWIOO5QOOGT-  -N4CPFHGJNGTXQT\ÒINKEJ

 91


RUMÃ&#x201E;NIEN

2054

2055

 

2055

.GK$$WMCTGUV&CX5EJ·HHGT5VCODWNKW -W$CPK$$WMCTGUV5EJ·HHGT5VCODWNKW

8QT\Ã&#x2019;INKEJ 8QT\Ã&#x2019;INKEJ

 

2056



<KPPOGFCKNNG  XQP ( 9 -WNNTKEJ CWH FKG 8QNNGPFWPI FGU .WUVUEJNQUUGU 2GNGUEJ KP 4WO·PKGP   $Ã&#x2019;UVGP -CTNU WPF UGKPGT )GOCJNKP 'NKUCDGVJ 1VVKNKG XQP 9KGF %CTOGP 5[NXC  PGDGPGKPCPFGT N   #PUKEJVFGU5EJNQUUGUOO5QOOGT- 2QNKGTVG2NCVVG



2058

2057



.GK$$WMCTGUV&KG-TQPGKUVOKV&QRRGNRWPMVGPXGT\KGTV&CX5EJ·HHGT5VCODWNKWC #VVTCMVKXGU'ZGORNCTYKP\4CPFHGJNGTXQT\Ã&#x2019;INKEJ





.GK$$WMCTGUV&KG-TQPGKUVOKV&QRRGNRWPMVGPXGT\KGTV&CX5EJ·HHGT5VCODWNKWC .GKEJVDGTKGDGPHCUVXQT\Ã&#x2019;INKEJ



2060 2059

   92

-W$CPK$$WMCTGUV5EJ·HHGT5VCODWNKW .GW$$WMCTGUV5EJ·HHGT5VCODWNKW .GW$$WMCTGUV5EJ·HHGT5VCODWNKW

2061

8QT\Ã&#x2019;INKEJ (GKPG2CVKPCXQT\Ã&#x2019;INKEJp5VGORGNINCP\ (CUVXQT\Ã&#x2019;INKEJ

  


RUMÄNIEN

2062

 

2063

.GW$$WMCTGUV5EJ·HHGT5VCODWNKW -W$CPK$$WMCTGUV5EJ·HHGT5VCODWNKWC

2064

2065

(CUVXQT\ÒINKEJ 8QT\ÒINKEJ

 

8QT\ÒINKEJ



2064



-W$CPK$$WMCTGUV5EJ·HHGT5VCODWNKW



-W $CP  $ $WMCTGUV 2TQDG KP $TQP\G OKV INCVVGO 4CPF  I 5EJ·HHGT5VCODWNKW 442TCEJVGZGORNCTOKVJGTTNKEJGT2CVKPC(CUV5VGORGNINCP\

2066

2068



2067



.GK$TÒUUGN5EJ·HHGT5VCODWNKW

 2TCEJVGZGORNCTOKVJGTTNKEJGT2CVKPC(CUV5VGORGNINCP\



 

.GK$TÒUUGN5EJ·HHGT5VCODWNKW .GW$TÒUUGN5EJ·HHGT5VCODWNKW

8QT\ÒINKEJ *ÒDUEJG2CVKPCMN-TCV\GTXQT\ÒINKEJp5VGORGNINCP\

 

2069



5KNDGTOGFCKNNGXQP#5EJCTHHCWHFKG)TWPFUVGKPNGIWPIFGU*CHGPUXQP-QPUVCP\C7PKHQTOKGT VGU $TWUVDKNF N#PUKEJV FGT *CHGPCPNCIG OKV /QNG KO *KPVGTITWPF CWHIGJGPFG 5QPPG  OO   I5NI2GNV\GT 4CPFHGJNGT-TCV\GTUGJTUEJÌPpXQT\ÒINKEJ

 93


RUMÄNIEN

2070



$TQP\GOGFCKNNGXQP#5EJCTHHCWHFKG'KPYGKJWPIFGUPGWGP7PKXGTUKV·VURCNCUVUKP%QRQW +CUK FGWVUEJ ,CUU[  CO  1MVQDGT 7PKHQTOKGTVGU $TWUVDKNF N(ÒPH <GKNGP 5EJTKHV WOJGT .QTDGGTMTCP\   OO 2TCEJVGZGORNCTOKVJGTTNKEJGT2CVKPC(CUV5VGORGNINCP\



&GT7PKXGTUKV·VUDCWYWTFGXQPFGO#TEJKVGMVGP.QWKU$NCPEGPVYQTHGPWPF\YKUEJGPWPFIGDCWVGKPG -QODKPCVKQP CWU MNCUUKUEJGO WPF DCTQEMGO 5VKN -ÌPKI -CTN + WPF UGKPG )GOCJNKP 'NKUCDGVJ 1VVKNKG XQP 9KGF  

%CTOGP5[NXC YCTGPDGKFGT'KPYGKJWPIU\GTGOQPKGCPYGUGPF

2072

2071



.GK*CODWTI5EJ·HHGT5VCODWNKW



.GW*CODWTI+P752NCUVKMJQNFGTFGT0)%OKVFGT$GYGTVWPI/55EJ·HHGT5VCODWNKW 2TCEJVGZGORNCT(CUV5VGORGNINCP\

.GKEJVLWUVKGTVXQT\ÒINKEJ

 

2073

2074

 

2074

$CPK*CODWTI5EJ·HHGT5VCODWNKW .GK$*CODWTI&CX5EJ·HHGT5VCODWNKW

2075

2TCEJVGZGORNCT(CUV5VGORGNINCP\ 9KP\4CPFHGJNGTXQT\ÒINKEJ

2076



.GK*CODWTI5EJ·HHGT5VCODWNKW



.GW*CODWTI+P752NCUVKMJQNFGTFGT0)%OKVFGT$GYGTVWPI/55EJ·HHGT5VCODWNKW 2TCEJVGZGORNCT(CUV5VGORGNINCP\

94

 

445EJÌPpUGJTUEJÌP

 


RUMÄNIEN

2078

2077



.GW*CODWTI5EJ·HHGT5VCODWNKW



$CPK*CODWTI5EJ·HHGT5VCODWNKW

9KP\4CPFHGJNGTHCUV5VGORGNINCP\



8QT\ÒINKEJ



2079



4GEJVGEMKIG $TQP\GRNCMGVVG  9GTMUVCVV /C[GT  9KNJGNO 5VWVVICTV CWH FGP)GDWTVUVCIXQP %CTQN&CXKNC

2CTOCÓ$WMCTGUV )TÒPFGTFGUOQFGTPGPTWO·PKUEJGP)GUWPFJGKVUU[UVGOU 7PKHQTOKGTVGU$TWUVDKNF&CXKNCUNFCTWPVGT5EJTKHVVCHGNOKVHÒPH<GKNGP5EJTKHV*[IKGCUVGJVDGKGKPGO 2CVKGPVGPCO-TCPMGPDGVVFCTWPVGT5EJTKHVVCHGNOKV<GKNGP5EJTKHV 0COGPFGT-QOKVGG/KVINKGFGT  ZOO5NI$TGVVCWGT 9KP\4CPFHGJNGTXQT\ÒINKEJ



2080



$TQP\GOGFCKNNG  XQP / %CTPKQN CWH FKG 'TVGKNWPI FGT (TGKJGKV FGU )QVVGUFKGPUVGU WPF CWH FKG   8GTYGPFWPI FGT /WVVGTURTCEJG 7PKHQTOKGTVGU $TWUVDKNF JCNDN XQT IGMTÌPVGO 9CRRGPOCPVGN \W FGP   5GKVGP LG GKP 4GKVGTFGPMOCN WPVGP 'KEJGP\YGKI OKV FGP -ÌRHGP FGU 6JTQPHQNIGTU (GTFKPCPF + WPF   UGKPGT -KPFGT -CTN WPF 0KMQNCWU4QOCPKC UVGJV X X OKV (CJPG KP FGT 4GEJVGP FCXQT MPKGV 4GNIKQ   OKV -KTEJGPOQFGNN WOJGT 'KEJGPMTCP\ OKV FGP -ÌRHGP XQP CEJV TWO·PKUEJGP /KPKUVGTP  OO   9WT\DCEJ <CRQPKGTVXQT\ÒINKEJ

 95


RUMÃ&#x201E;NIEN

2081





8GTIQNFGVG $TQP\GOGFCKNNG  XQP / %CTPKQN CWH UGKP L·JTKIGU 4GIKGTWPIULWDKN·WO 2TGKU   OGFCKNNGFGT#NNIGOGKPGP4WO·PKUEJGP#WUUVGNNWPIKP$WMCTGUV$Ã&#x2019;UVGPXQP-CTN+WPFUGKPGU6JTQP HQNIGTUPGDGPGKPCPFGTN'KPG5RKPPGTKPOKV5RKPPTQEMGPPGDGPKJTGKP-KPFFCUFGP-QRHCWHDGKFG *·PFGUVÃ&#x2019;V\VQDGP9CRRGPUEJKNFGKO*CNDMTGKUKO*KPVGTITWPFT.CPFUEJCHVWPVGPNGGTG5EJTKHV VCHGNCWH.QTDGGT\YGKIGPOO9WT\DCEJXCT 2TCEJVGZGORNCT5VGORGNINCP\



$TQP\GOGFCKNNG  XQP / %CTPKQN CWH UGKP L·JTKIGU 4GIKGTWPIULWDKN·WO 2TGKUOGFCKNNG FGT   #NNIGOGKPGP4WO·PKUEJGP#WUUVGNNWPIKP$WMCTGUV$Ã&#x2019;UVGPXQP-CTN+WPFUGKPGU6JTQPHQNIGTUPGDGP GKPCPFGTN'KPG5RKPPGTKPOKV5RKPPTQEMGPPGDGPKJTGKP-KPFFCUFGP-QRHCWHDGKFG*·PFGUVÃ&#x2019;V\V QDGP  9CRRGPUEJKNFG KO *CNDMTGKU KO *KPVGTITWPF T .CPFUEJCHV WPVGP NGGTG 5EJTKHVVCHGN CWH   .QTDGGT\YGKIGPOO9WT\DCEJXCT 8QT\Ã&#x2019;INKEJ



2083





96

4GEJVGEMKIG $TQP\GRNCMGVVG  XQP 4 %K\GM 9GTMUVCVV 4GUEJ CWH UGKPL·JTKIGU4GIKGTWPIULWDK N·WO2T·OKGFGT#NNIGOGKPGP4WO·PKUEJGP#WUUVGNNWPIKP$WMCTGUV/GFCKNNQPOKVFGOWPKHQTOKGTVGP $TWUVDKNF -CTNU N FCTWPVGT 9CRRGPUEJKNF KO 8QTFGTITWPF T UVGJV GKPG YGKDNKEJG )GUVCNV OKV 2CNO   \YGKI CO $QFGP 4QUGPIKTNCPFG#TDGKVGT UKV\V PCEJ T CWH 5QEMGN FGP NKPMGP #TO CWH GKPGP #ODQ­   IGNGJPVXQTKJOUVGJGPFKG2GTUQPKHKMCVKQPGPXQP/CNGTGKWPF#TEJKVGMVWTZOO9WT\ DCEJ +P1TKIKPCNGVWK(CUV5VGORGNINCP\



4GEJVGEMKIG $TQP\GRNCMGVVG  XQP 4 %K\GM 9GTMUVCVV 4GUEJ CWH UGKPL·JTKIGU4GIKGTWPIULWDK N·WO2T·OKGFGT#NNIGOGKPGP4WO·PKUEJGP#WUUVGNNWPIKP$WMCTGUV/GFCKNNQPOKVFGOWPKHQTOKGTVGP $TWUVDKNF -CTNU N FCTWPVGT 9CRRGPUEJKNF KO 8QTFGTITWPF T UVGJV GKPG YGKDNKEJG )GUVCNV OKV 2CNO   \YGKI CO $QFGP 4QUGPIKTNCPFG#TDGKVGT UKV\V PCEJ T CWH 5QEMGN FGP NKPMGP #TO CWH GKPGP #ODQ­   IGNGJPVXQTKJOUVGJGPFKG2GTUQPKHKMCVKQPGPXQP/CNGTGKWPF#TEJKVGMVWTZOO9WT\ DCEJ (GKPG2CVKPCXQT\Ã&#x2019;INKEJp5VGORGNINCP\




RUMÄNIEN

2085



4GEJVGEMKIG $TQP\GRNCMGVVG  XQP . 5VGNOCPU CWH UGKP L·JTKIGU 4GIKGTWPIULWDKN·WO WPF FKG   ,CJTHGKGTFGT-QNQPKUCVKQP&CEKGPUFWTEJ6TCKCPWUKO,CJTP%JT&KG$ÒUVGPXQP6TCKCPWPF -CTN + KP /GFCKNNQPU PCEJ N WOJGT .QTDGGT\YGKIG )GVTGKFG WPF FGT 9CRRGPUEJKNF XQP 4WO·PKGP   FCPGDGP FKG 5VCFVCPUKEJV XQP $WMCTGUV OKV CWHIGJGPFGT 5QPPG-CTN + TGKVGV T XQT 5QNFCVGP KO   *KPVGTITWPF5\GPGPXQP.CPFYKTVUEJCHVWPF+PFWUVTKG/KV4CPFRWP\G$410<'ZOO  8QT\ÒINKEJ



2086

2087

2087



 .GK  $TÒUUGN CWH UGKP L·JTKIGU 4GIKGTWPIULWDKN·WO 2TQDG KP $TQP\G OKV IGTKHHGNVGO 4CPF   I5EJ·HHGT5VCODWNKW 44GUVGXQP<CRQPNCEMUGJTUEJÌPpXQT\ÒINKEJ





.GK$TÒUUGNCWHUGKPL·JTKIGU4GIKGTWPIULWDKN·WO&CX5EJ·HHGT5VCODWNKW  8QT\ÒINKEJ



2088

2089

2090



.GW$TÒUUGN5EJ·HHGT5VCODWNKW



.GK*CODWTI+P752NCUVKMJQNFGTFGT0)%OKVFGT$GYGTVWPI/55EJ·HHGT5VCODWNKW 2TCEJVGZGORNCT5VGORGNINCP\

2QNKGTVG2NCVVGOKPDGTKGDGP





.GK*CODWTI5EJ·HHGT5VCODWNKWC



(CUV5VGORGNINCP\



97


RUMÄNIEN

2091



(GTFKPCPF +  $TQP\GOGFCKNNG  XQP * 0QES CWH FKG (TCP\ÌUKUEJ4WO·PKUEJG   .WHVHCJTVIGUGNNUEJCHV %QORCIPKG(TCPEQ4QWOCKPGFG0CXKICVKQP#¾TKGPPG #PUKEJVXQO5VTGEMGPPGV\ FGT .WHVHCJTIGUGNNUEJCHV FCTÒDGT \YGK (NWI\GWIG(NWI\GWI ÒDGT .CPFUEJCHV OKV -WVUEJG #WVQ WPF   'KUGPDCJP/KV4CPFRWP\G%7+84'OO$WVVQPp-CKUGTp (CUV5VGORGNINCP\



2092



5KNDGTOGFCKNNGXQP%%TKUVGUEWCWHFKG\QQNQIKUEJG#WUUVGNNWPIFGU.CPFYKTVUEJCHVUOKPKUVGTKWOU )GMTÌPVGU9CRRGPCWH.QTDGGT\YGKIGPJTGPWPF/CKUMQNDGPWPVGPFTGK<GKNGP5EJTKHVÒDGT,CJTGU \CJN4Q­NOOI 48QT\ÒINKEJ



2093



$TQP\GOGFCKNNG  XQP % %TKUVGUEW CWH FKG -ÌPKINKEJG $GUUCTCDKUEJG #WUUVGNNWPI KP %JKUKPCW  

JGWVG*CWRVUVCFVXQP/QNFCYKGP &KGIGMTÌPVGP$TWUVDKNFGT(GTFKPCPFU+WPFUGKPGT)GOCJNKP/CTKG 6QEJVGT #NHTGFU XQP 'FKPDWTIJ *GT\QI XQP 5CEJUGP%QDWTI)QVJC PGDGPGKPCPFGT N9GKDNKEJG   )GUVCNVUVGJVXXOKV(CJPGKPFGT4GEJVGPFGPNKPMGP#TOCWHFKG5EJWNVGTGKPGUXQTKJTUVGJGPFGP /·FEJGPU IGNGIV WOJGT #VVTKDWVG FGT .CPFYKTVUEJCHV N MPKGV GKP 5QNFCV OKV )GYGJT PCEJ T KO   *KPVGTITWPF6WTOIGD·WFGOO 8QT\ÒINKEJ





-CTN++.GK$WMCTGUV.GK$WMCTGUV5EJ·HHGT5VCODWNKW  5VÒEM'PVYGTVGVXQT\ÒINKEJ



98


RUMÄNIEN

2096

2095

2095





$TQP\GOGFCKNNGXQP'9$GEMGTCWHUGKPL·JTKIGU4GIKGTWPIULWDKN·WO7PKHQTOKGTVGT-CTN++ TGKVGV T KO #DUEJPKVV FCU &CVWO UGKPGU 4GIKGTWPIUCPVTKVVU)GMTÌPVGT TWO·PKUEJGT #FNGT WOJGT   5EJTKHVVCHGNPOO (CUV5VGORGNINCP\



5Q\KCNKUVKUEJG8QNMUTGRWDNKM.GK$WMCTGUV5EJ·HHGT5VCODWNKW  8QT\ÒINKEJp5VGORGNINCP\



2097

2098

2099

2100

2101



.GW$WMCTGUV5EJ·HHGT5VCODWNKW  5GNVGPKPFKGUGT'TJCNVWPI-N5VGORGNHGJNGTHCUV5VGORGNINCP\





$CPK$WMCTGUV5EJ·HHGT5VCODWNKW  5GNVGPKPFKGUGT'TJCNVWPI2TCEJVGZGORNCT(CUV5VGORGNINCP\





$CPK$WMCTGUV5EJ·HHGT5VCODWNKW

8QT\ÒINKEJp5VGORGNINCP\





-W$CPK$WMCTGUV5EJ·HHGT5VCODWNKW  5GJTUGNVGPKPFKGUGT'TJCNVWPI2TCEJVGZGORNCTOKVJGTTNKEJGT2CVKPC5VGORGNINCP\





$CPK$WMCTGUV5EJ·HHGT5VCODWNKW  5GNVGPKPFKGUGT'TJCNVWPI2TCEJVGZGORNCT(CUV5VGORGNINCP\



.16547/0+'0 

7OHCPITGKEJG5COONWPIXQPTWO·PKUEJGP/ÒP\GPWPF/GFCKNNGPFGU,CJTJWPFGTVUGKPUEJNKG­ NKEJ FGT 8QNMUTGRWDNKM WPF FGT UQ\KCNKUVKUEJGP 4GRWDNKM 4WO·PKGP XQO  $CP DKU \WO    .GK5VÒEMFCTWPVGTCWEJGKPKIGRTCEJVXQNNG'TJCNVWPIGPWPFGKPG4GKJGUGNVGPGT8CTKCPVGPWC.GW OKV5KIPCVWTFGU5VGORGNUEJPGKFGTU#/KEJCWZOKV2WPMV.GKOKVVT·PGPFGO#WIGGVE *QEJKPVGTGUUCPVGU1DLGMVDKVVGDGUKEJVKIGP 5VÒEM5GJTUEJÌPpRQNKGTVG2NCVVG 



5COONWPI XQP TWO·PKUEJGP /ÒP\GP FGU  ,CJTJWPFGTVU XQO  $CP DKU \WO.GK5VÒEM FCTWPVGT CWEJ GKPKIG DGUUGTG 6[RGP W C  $CPK   $CPK  $CPKWPFGVE&GU 9GKVGTGPGPVJCNVGPUKPFGKPKIG5KNDGTRT·IWPIGP\WO6JGOC1N[ORKC#TEJKVGMVWT6KGTGWPF.WHVHCJTV YGNEJG VGKNU PWT KP IGTKPIGT 5VÒEM\CJN IGRT·IV YWTFGP UQYKG 2TQDGP *QEJKPVGTGUUCPVGU 1DLGMV DKVVG   WPDGFKPIVDGUKEJVKIGP 5VÒEM8QT\ÒINKEJpRQNKGTVG2NCVVG 



&KXGTUG TWO·PKUEJG -WRHGT D\Y $TQP\GOGFCKNNGP FGU  ,CJTJWPFGTVU W C \GKIGP UGEJU   FGT IGPCPPVGP /GFCKNNGP FCU 2QTVT·V -CTNU + WPF RT·UGPVKGTGP GKPKIG KPVGTGUUCPVG 'TGKIPKUUG UGKPGT   4GIKGTWPIU\GKV+PVGTGUUCPVGU.QVDKVVGDGUKEJVKIGP 5VÒEM5GJTUEJÌPpXQT\ÒINKEJ

 99


SCHWEDEN

2105

2106

5#0/#4+01  

4GRWDNKM.KTG44QO&CX2CICPK .KTG44QO&CX2CICPK

8QT\ÒINKEJp5VGORGNINCP\ 8QT\ÒINKEJp5VGORGNINCP\

 

2107

1,5:1

-¤0+)4'+%* 

1,5:1

5%*9'&'0

1NCH 5MÌVMQPWPI  2HGPPKI 5KIVWPC  I5SWCTG%QKP -NKRRG 3WCVTGHQKNV[RG )GMTÌPVGU$TWUVDKNFN-N-TGW\/CNOGTXIN  44(GKPG2CVKPC&QRRGNUEJNCICWHFGT8QTFGTUGKVGHCUVUGJTUEJÌPUGJTUEJÌP 'KPG 2T·IWPI CWH SWCFTCVKUEJGP 5EJTÌVNKPIGP KUV IGPCWUQ EJCTCMVGTKUVKUEJ HÒT FKG CPINQUMCPFKPCXKUEJGP )GRT·IG   WPVGT 1NCH 5MÌVMQPWPI YKG GKP\KICTVKI HÒT FGP GWTQR·KUEJGP 4CWO WO FCU ,CJT  'VYC  CNNGT DGMCPPVGP   /ÒP\GPUKPF-NKRRGPWPFGUUEJGKPVUQCNUQDFCU)GYKEJVUXGTJ·NVPKUXQPTWPFGP\WGEMKIGP)GRT·IGPHGUVIGNGIV IGYGUGPKUV

1,5:1



2108



1,5:1

#PQP[O  ,CJTJWPFGTV 2HGPPKI  I .QPI ETQUU V[RG $TWUVDKNF N-NGKPGU -TGW\ /CNOGT    8QPITÌ­VGT5GNVGPJGKV8GTOWVNKEJDGMCPPVGU'ZGORNCT .GKEJVFG\GPVTKGTVUGJTUEJÌPpXQT\ÒINKEJ  $ /CNOGT MCPPVG XQP FGT XQTNKGIGPFGP 5VGORGNXGTDKPFWPI PWT GKP 'ZGORNCT CWU -QRGPJCIGP /CNOGT $ 6JG   #PINQ5ECPFKPCXKCP%QKWPCIGE5VQEMJQNO5%JCKP 

1,5:1



2109

1,5:1

2HGPPKII.QPIETQUUV[RG$TWUVDKNFN.CPIGU&QRRGNHCFGPMTGW\/CNOGT  8QPITÌ­VGT5GNVGPJGKV8GTOWVNKEJDGMCPPVGU'ZGORNCT -N2T·IGUEJY·EJGCO4CPFUGJTUEJÌPpXQT\ÒINKEJ

$ /CNOGT MCPPVG XQP FGT XQTNKGIGPFGP 5VGORGNXGTDKPFWPI PWT GKP HTCIOGPVKGTVGU 'ZGORNCT CWU 5VQEMJQNO  

/CNOGT$6JG#PINQ5ECPFKPCXKCP%QKWPCIGE5VQEMJQNO5%JCKP 

100




SCHWEDEN

1,5:1



2110

1,5:1

2HGPPKI  I .QPI ETQUU V[RG $TWUVDKNF N KO (GNF XKGT -WIGNP.CPIGU &QRRGNHCFGPMTGW\ /CN   OGT%p 44)WVCWUIGRT·IVGUHCUVXQT\ÒINKEJGU'ZGORNCT

2111

2112



)WUVCX8CUC¤TG5XCTVULÌ#JNUVTÌO



/CTM5VQEMJQNO#JNUVTÌO 4 

(GKPG2CVKPCHCUVUGJTUEJÌP



(GKPG2CVKPCUGJTUEJÌP



2115

2113



2114



/CTM5VQEMJQNO#JNUVTÌO 4   (GKPG2CVKPCYKP\5EJTÌVNKPIUHGJNGTCO4CPFHCUVXQT\ÒINKEJ





'TKM:+8/CTM5VQEMJQNO/KV#PUKEJVFGU5EJ·TGPICTVGPU#JNUVTÌO  445VCTMGT-TCV\GTKO(GNFFGT4ÒEMUGKVGGVYCUDGTKGDGPUGJTUEJÌPpXQT\ÒINKEJ





/CTM ¤TG 5VQEMJQNO#JNUVTÌO  /KP1DGTHN·EJGPMQTTQUKQPYKP\<CKPGPFGUGJTUEJÌP



2116



/CTM5VQEMJQNO#JNUVTÌOD



-NKRRG\W¤TG5VQEMJQNO#JNUVTÌO

2117

45GJTUEJÌP



5GJTUEJÌP

 101


SCHWEDEN

2118

2119

2121

2120



-NKRRG\W¤TG5VQEMJQNO#JNUVTÌO

5GJTUEJÌP





/CTM5VQEMJQNO#JNUVTÌO 4 

49KP\5EJTÌVNKPIUHGJNGTHCUVXQT\ÒINKEJ





,QJCPP+++-NKRRG\W/CTM5VQEMJQNO#JNUVTÌO$TCWUG/CPUHGNF6H XCT 5GJTUEJÌPpXQT\ÒINKEJ





-NKRRG\W/CTM5VQEMJQNO#JNUVTÌO$TCWUG/CPUHGNFp XIN6H 



8QT\ÒINKEJ

2123

2122

2122



%JTKUVKPC4KMUFCNGT5VQEMJQNO#JNUVTÌO&CX  #VVTCMVKXGU'ZGORNCTOKVJÒDUEJGT2CVKPCUGJTUEJÌPpXQT\ÒINKEJ





4KMUFCNGT5VQEMJQNO#JNUVTÌOD





5KNDGTOGFCKNNG Q , CWH FKG 0CEJHQNIG %JTKUVKPCU PCEJ FGO 6QF KJTGU 8CVGTU )WUVCX ++ #FQNH KP FGT   5EJNCEJVDGK.ÒV\GPCO0QXGODGT *KNFGDTCPF+5 5KNDGTOGFCKNNGQ,CWHFKG-TÌ PWPI FGT UEJYGFKUEJGP -ÌPKIKP %JTKUVKPC KP FGT 5VQEMJQNOGT 5VQTM[TMC CO  1MVQDGT  *KNFG   DTCPF + 5    5KNDGTOGFCKNNG Q ,CWHFGPXQTVTGHHNKEJGP%JCTCMVGTFGTUEJYGFKUEJGP-ÌPKIKP %JTKUVKPC *KNFGDTCPF+5 5KNDGTOGFCKNNGQ,CWHFKG#DNGJPWPIFGU+TFKUEJGPFWTEJFKG UEJYGFKUEJG-ÌPKIKP%JTKUVKPCWPFKJTG5GJPUWEJVPCEJGVYCU8QNNMQOOGPGTGO *KNFGDTCPF+5  5VÒEM5GJTUEJÌPpXQT\ÒINKEJ



$TQP\GOGFCKNNGQ,CWHFKGUEJYGFKUEJG-ÌPKIKP%JTKUVKPC *KNFGDTCPF+5 $TQP\GOGFCKNNG Q,CWHFGP(TKGFGPXQP$TÌOUGDTQ\YKUEJGP5EJYGFGPWPF&·PGOCTMCO#WIWUV *KNFG DTCPF + 5    Z $TQP\GOGFCKNNG Q,CWHFGP9GUVH·NKUEJGP(TKGFGPXQP/ÒPUVGTWPF1UPC DTÒEMCO1MVQDGT *KNFGDTCPF+5WPF5 $TQP\GOGFCKNNGQ,CWHFKG #DNGJPWPIFGU+TFKUEJGPFWTEJFKGUEJYGFKUEJG-ÌPKIKP%JTKUVKPCWPFKJTG5GJPUWEJVPCEJGVYCU8QNN MQOOGPGTGO *KNFGDTCPF+5  5VÒEM/GKUVXQT\ÒINKEJ





102

(CUVUGJTUEJÌP


SCHWEDEN

2126

2127

2127



-CTN:)WUVCX/CTM5VQEMJQNOCWHUGKPG-TÌPWPI#JNUVTÌOC  4*ÒDUEJG2CVKPCUGJTUEJÌP





5KNDGTOGFCKNNG Q ,   XQP # -CTNUVGGP CWH FKG 6CRHGTMGKV FGU UEJYGFKUEJGP -ÌPKIU KO 0QTFK   UEJGP -TKGI  )GJCTPKUEJVGU $TWUVDKNF T OKV WOIGNGIVGO /CPVGN*GTMWNGU GTUEJN·IV OKV   UGKPGT-GWNGGKPGPXKGNMÌRHKIGP&TCEJGPOOI*KNFGDTCPF+5  *GTTNKEJG2CVKPCXQT\ÒINKEJ



9GKN FKG &·PGP FKG (TKGFGPUDGUVKOOWPIGP XQP 4QUMKNFG PWT UGJT UEJNGRRGPF WPF \WTÒEMJCNVGPF CWUHÒJTVGP   GTPGWGTVG FGT UEJYGFKUEJG -ÌPKI -CTN : )WUVCX DGTGKVU KO #WIWUV  FKG -TKGIUJCPFNWPIGP WPIGCEJVGV FGT   &TQJWPIGP FWTEJ FKG #NNKKGTVGP &·PGOCTMU 4W­NCPF 2QNGP $TCPFGPDWTI FGT -CKUGT WPF FKG 0KGFGTNCPFG  &KG   7OUEJTKHVFGT/GFCKNNGNCWVGV0'%08/'48/*144'5%+68+4685 &KG6CRHGTMGKVYKTFPKEJVFWTEJFKG #P\CJN=FGT(GKPFG?GTUEJTQEMGP 

2129

2128

2130



-CTN:+/CTM5VQEMJQNO#JNUVTÌO&CX  44*GTTNKEJG2CVKPCYKP\4CPFHGJNGTHCUVXQT\ÒINKEJ



/CTM5VQEMJQNO#JNUVTÌO



-CTN :++  5KNDGTOGFCKNNG  XQP , 4 'PIGNJCTV $TGUNCW CWH FGP FWTEJ 5EJYGFGP   GT\YWPIGPGP (TKGFGP XQP 6TCXGPVJCN \YKUEJGP 5EJYGFGP &·PGOCTM WPF *QNUVGKP)QVVQTR CO   #WIWUV)GJCTPKUEJVGU$TWUVDKNFTOKVWOIGNGIVGO/CPVGN&GTUEJYGFKUEJG.ÌYGUEJTGKVGVCWHFGT PÌTFNKEJGP'TFJCNDMWIGNNQDGPUVTCJNGPFGU5[ODQNFGT&TGKHCNVKIMGKVOOI*KNFGDTCPF+ 52CZKP0WOOKUp -N4CPFHGJNGTUGJTUEJÌP

(GKPG2CVKPCUGJTUEJÌPpXQT\ÒINKEJ

 

 103


SCHWEDEN

2131





2132

2133

5CVKTKUEJG5KNDGTOGFCKNNGWPUKIPKGTVXQP,4'PIGNJCTV$TGUNCWCWHUGKPG-TKGIUGTHQNIGIGIGP &·PGOCTM 2QNGP WPF 4W­NCPF &KG FTGK UEJYGFKUEJGP -TQPGP WPVGP \YGK .QTDGGT\YGKIG&TGK   *·PFGCWU9QNMGP FKGCPVKUEJYGFKUEJG#NNKCP\CWU4W­NCPF2QNGP5CEJUGPWPF&·PGOCTM ITGKHGP KPGKPCPFGTWPVGP\YGK5EJNCPIGPOOI%QNN(KGYGIGT*KNFGDTCPF+5 448QT\ÒINKEJGU'ZGORNCTOKVHGKPGT6ÌPWPI



5KNDGTOGFCKNNGXQP$4KEJVGT5EJÒNGTWPF5EJYKGIGTUQJPFGU/GFCKNNGWTU#TXKF-CTNUVGGPCWH FKG ªDGTSWGTWPI FGU (NWUUGU &ÒPCFWTEJFKGUEJYGFKUEJG#TOGGWPFFGPUEJYGFKUEJGP5KGIÒDGTFKG XGTGKPKIVGU·EJUKUEJRQNPKUEJGWPFTWUUKUEJG#TOGGDGK4KICCO,WNK)GJCTPKUEJVGU$TWUVDKNFT OKV.ÌYGPMQRHUEJWNVGT/KPGTXCOKVFGOUEJYGFKUEJGP5EJKNFUEJYGDVÒDGTFGP(NW­&ÒPCWPFXGTLCIV FKG CWH FGT CPFGTGP (NW­UGKVG UVCVKQPKGTVGP U·EJUKUEJGP 6TWRRGP WPVGP DTGKVGV FGT (NW­IQVV &ÒPC FKG   #TOGCWUGKPCPFGTOOI*KNFGDTCPF+5  44#VVTCMVKXGU'ZGORNCTOKVHGKPGT2CVKPCUGJTUEJÌPpXQT\ÒINKEJ



0CEJFGO5KGIDGK0CTXCCO0QXGODGTPCJO-CTN:++OKVUGKPGP6TWRRGP9KPVGTSWCTVKGTKPFGOJGWVG KP'UVNCPFIGNGIGPGPNKXN·PFKUEJGP5EJNQ­.CKU0CEJFGOGT#PHCPIUGKPG#TOGGXGTUV·TMVJCVVGDGUEJNQ­FGT UEJYGFKUEJG-ÌPKIFGP#PITKHHCWHFKG6TWRRGPFGURQNPKUEJU·EJUKUEJGP-ÌPKIU#WIWUV++ FGP5VCTMGP FKGUKEJ XGTUV·TMVFWTEJTWUUKUEJG4GIKOGPVGTKP.KXNCPFDGHCPFGP-CTN:++ÒDGTSWGTVGOKVOGJTCNU/CPPKPFGT 0·JG XQP 4KIC FGP (NW­ &ÒPC WPVGT JGHVKIGO $GUEJW­ FGT U·EJUKUEJGP 6TWRRGP FKG UKEJ CO IGIGPÒDGTNKGIGPFGP   (NW­WHGTDGHCPFGP#O,WNKMCOGUDGK4KIC\WT5EJNCEJVKPFGTFKG/CPPWOHCUUGPFGU·EJUKUEJ RQNPKUEJTWUUKUEJG#TOGGWPVGTFGO*GT\QIXQP-WTNCPFWPFFGP)GPGT·NGP5VGKPCWWPF2CVMWNXQNNUV·PFKIXQPFGP 5EJYGFGPDGUKGIVYWTFG)TQ­G8QTT·VGCP9CHHGPWPF2TQXKCPVUQYKGFCUIGUCOVG.KXNCPFWPF-WTNCPFHKGNGPPWP CP 5EJYGFGP &KG 4ÒEMUGKVGPKPUEJTKHV FGT XQTNKGIGPFGP /GFCKNNG GTN·WVGTV 0'% (.8/+0# 0'% *156'5   /14#0684  9GFGT (NÒUUG PQEJ (GKPFG JKPFGTP KJP = -CTN :++?  +O #DUEJPKVV UVGJV 5#:10'5 +0   #&8'45# &80#' 4+2# (85+ /&%%+  &KG 5CEJUGP YWTFGP  CO IGIGPÒDGTNKGIGPFGP &ÒPCWHGT   IGUEJNCIGP 



104

5KNDGTOGFCKNNGXQP#-CTNUVGGPCWHFGP(TKGFGPXQP#NVTCPUV·FVXQO5GRVGODGT PCEJLWNKC PKUEJGO -CNGPFGT CO  5GRVGODGT  )GJCTPKUEJVGU $TWUVDKNF T OKV .ÌYGPMQRHUEJWNVGT&GT U·EJUK   UEJG UEJYGFKUEJG WPF RQNPKUEJG 5EJKNF J·PIGP CP GKPGT 5·WNG KP .CPFUEJCHV  OO  I   *%\ 4 *KNFGDTCPF+52CZKP0WOOKU  448QT\ÒINKEJGU'ZGORNCTOKVHGKPGT6ÌPWPI




SCHWEDEN

2136

2134







2135

5KNDGTOGFCKNNGQ,  WPUKIPKGTVXQP)*CWVUEJ0ÒTPDGTICWHUGKPG-TKGIUGTHQNIGKPFGP,CJTGP  )GJCTPKUEJVGU $TWUVDKNF T OKV WOIGNGIVGO /CPVGN WPF .ÌYGPMQRHUEJWNVGT&GT UEJYGFK   UEJG .ÌYG UEJTGKVGV N WPF GTJGDV FTQJGPF FKG 8QTFGTRTCPMGP WPVGP FCU UEJYGFKUEJG 4GKEJUYCRRGP   \YKUEJGP 2CNO WPF .QTDGGT\YGKI /KV 4CPFUEJTKHV  OO  I *KNFGDTCPF + 5     5NI'TNCPIGTp 44*GTTNKEJG2CVKPCHCUVXQT\ÒINKEJ



5KNDGTOGFCKNNGQ,  WPUKIPKGTVXQP)*CWVUEJ0ÒTPDGTICWHUGKPG-TKGIUGTHQNIGKPFGP,CJTGP  )GJCTPKUEJVGU $TWUVDKNF T OKV WOIGNGIVGO /CPVGN WPF .ÌYGPMQRHUEJWNVGT&GT UEJYGFK   UEJG .ÌYG UEJTGKVGV N WPF GTJGDV FTQJGPF FKG 8QTFGTRTCPMGP WPVGP FCU UEJYGFKUEJG 4GKEJUYCRRGP   \YKUEJGP 2CNO WPF .QTDGGT\YGKI /KV 4CPFUEJTKHV  OO  I *KNFGDTCPF + 5     5NI'TNCPIGTp 44*ÒDUEJG2CVKPCHCUVXQT\ÒINKEJ



5KNDGTOGFCKNNG Q ,   XQP 2 * /ÒNNGT CWH FCU 'ZKN FGU UEJYGFKUEJGP -ÌPKIU KO VÒTMKUEJGP   $GPFGT )GJCTPKUEJVGU $TWUVDKNF T OKV WOIGNGIVGO/CPVGNWPF.ÌYGPMQRHUEJWNVGT5EJNCHGPFGT.ÌYG NKGIV PCEJ N XQT GKPGT $WEJV OKV $QQVGP KO *KPVGTITWPF VÒTMKUEJG /QUEJGG XQT GKPGO$GTIFCTÒDGT 5VGTPGPJKOOGNOOI(QTUVGT*KNFGDTCPF+5  *ÒDUEJG2CVKPCHCUVXQT\ÒINKEJ



0CEJFGTMCVCUVTQRJCNGP0KGFGTNCIGDGK2QNVCYCCO,WNK\QI-CTN:++OKVFGOMNGKPGP4GUVUGKPGU*GGTGU PCEJ 5ÒFGP 'T ÒDGTSWGTVG FGP &PLGRT WPF OCTUEJKGTVG DKU $GPFGT TWO·PKUEJ 6KIJKPC JGWVG KP /QNFCYKGP   6TCPUPKUVTKGP  &QTV YWTFG GT XQP FGP 6ÒTMGP HTGWPFNKEJ GORHCPIGP 'T NKG­ HÒT UKEJ WPF UGKPG .GWVG )GD·WFG   GTTKEJVGP WPF GVCDNKGTVG UKEJ HÒT OGJTGTG ,CJTG #WH FGT XQTNKGIGPFGP /GFCKNNG YKTF FKG HTGWPFNKEJG *CNVWPI   FGT6ÒTMGPJGTXQTIGJQDGP2'4#/+%#5+.'06+#.80#' +PFGTHTGWPFNKEJGP4WJGFGU*CNDOQPFU +O #DUEJPKVV JGK­V GU YCTPGPF ÒDGT FGP UEJYGFKUEJGP .ÌYGP -CTN :++  1%8.+5 &14/+6#6 #2'46+5  'T   UEJN·HVOKVQHHGPGP#WIGP 

2137 1,5:1



1,5:1

-NGKPG 5KNDGTOGFCKNNG  WPUKIPKGTV XQP %JT 9GTOWVJ CWH FCU 'ZKN FGU UEJYGFKUEJGP -ÌPKIU KO   VÒTMKUEJGP$GPFGT)GJCTPKUEJVGU$TWUVDKNFTOKVWOIGNGIVGO/CPVGNKPQXCNGT'KPHCUUWPI5EJNCHGPFGT .ÌYG NKGIV PCEJ N FCTÒDGT 5VGTPGPJKOOGN WPF *CNDOQPF  OO  I *KNFGDTCPF + 5    9QJNHCJTV 2TCEJVXQNNG2CVKPCXQT\ÒINKEJ



&KG4ÒEMUGKVGPNGIGPFGFKGUGT/GFCKNNGNCWVGVU KNFQTVKNUGTCIWGTK 9GPPGTUEJN·HVGTJQNVGTUKEJ 

105


SCHWEDEN

2139

2138

2138





(TKGFTKEJ+5KNDGTOGFCKNNGXQP,%*GFNKPIGTCWHFKG'TPGPPWPIFGU-CP\NGKRT· UKFGPVGP )TCH #TXKF *QTP \WO .CPFOCTUEJCNN IGHGTVKIV KO #WHVTCI FGU UEJYGFKUEJGP 4KVVGTUVCPFGU   $TWUVDKNF FGU )TCHGP T OKV WOIGNGIVGO /CPVGN#NVCT FGT OKV FGO /QPQITCOO (TKGFTKEJU + WPF   FGO(COKNKGPYCRRGP*QTPIGUEJOÒEMVKUVFCTCWHNKGIGP-TÌPWPIUKPUKIPKGPWOJGTXKGTYGKVGTG#NV·TG FKGFKG'ODNGOGFGTXKGT5V·PFG -KTEJG#FGN$ÒTIGT$CWGTP VTCIGPOOI(GNFGT *KNFGDTCPF5 45GJTCVVTCMVKXGUXQT\ÒINKEJGU'ZGORNCTOKVHGKPGT2CVKPC



#FQNH (TKGFTKEJ  4KMUFCNGT  ,CJTGU\CJN KO 5VGORGN CWU  IG·PFGTV  5VQEMJQNO   #JNUVTÌO#PO&CX5/* 5GJTUEJÌP



2140

2141

2141



)WUVCX+++4KMUFCNGT5VQEMJQNO#JNUVTÌO&CX5/*  *ÒDUEJG2CVKPCMN4CPFHGJNGTUGJTUEJÌPpXQT\ÒINKEJ





-CTN:+++5KNDGTOGFCKNNGXQP%'PJÌTPKPICWHFKG#FQRVKQP-CTN#WIWUVU2TKP\ XQP 5EJNGUYKI*QNUVGKP5QPFGTDWTI#WIWUVGPDWTI 7PKHQTOKGTVGU $TWUVDKNF FGU 2TKP\GP T&GT 2TKP\   UVGJV X X KP CPVKMGO *CTPKUEJ FKG 4GEJVG CWH FGP JQNUVGKPKUEJGP 5EJKNF IGUVÒV\V WPF YKTF XQP FGT   2GTUQPKHKMCVKQP5EJYGFGPUIGMTÌPVOOI*KNFGDTCPF++5  8QT\ÒINKEJGU'ZGORNCTOKVHGKPGT6ÌPWPI



106


SCHWEDEN

2143

2142

2144



4KMUFCNGT5VQEMJQNO#JNUVTÌO&CX5/* #VVTCMVKXGUHCUVXQT\ÒINKEJGU'ZGORNCT





5KNDGTOGFCKNNGXQP/(TWOGTKGFGT8QTFGTUGKVGPUVGORGNFWTEJ%'PJÌTPKPIXGT·PFGTVCWHFKG ,CJTHGKGTFGT4GHQTOCVKQP$ÒUVGTOKVWOIGNGIVGO/CPVGN#NVCTOKVFGO&CVWO:::+1%6Û /&%%%:8++CWHFTGK5VWHGPFCTCWHUVTCJNGPFGU-TGW\OOI*KNFGDTCPF++5 5NI9JKVKPIp 8QT\ÒINKEJGU'ZGORNCTOKVUEJÌPGT2CVKPC



4KMUFCNGT5VQEMJQNO#JNUVTÌO&CX5/*  5GNVGPGT,CJTICPI9KP\5EJTÌVNKPIUHGJNGTUGJTUEJÌP





2145

2147

2146



-CTN :+8 ,QJCPP  4KMUFCNGT  IGRT·IV   5VQEMJQNO CWH FKG ,CJTHGKGT FGT   'KPHÒJTWPIFGT4GHQTOCVKQP#JNUVTÌO&CX -TCV\GTUGJTUEJÌP



4KMUFCNGT5VQEMJQNO#JNUVTÌO&CX

8QT\ÒINKEJp5VGORGNINCP\





4KMUFCNGT5VQEMJQNO#JNUVTÌOC  (GKPG6ÌPWPIMN4CPFXGTRT·IWPICVVTCMVKXGUXQT\ÒINKEJGU'ZGORNCT





107


SCHWEDEN

2149

2148

2150



-W5MKNNKPI5VQEMJQNO#JNUVTÌO  440WT'ZGORNCTGIGRT·IV2TCEJVGZGORNCT5VGORGNINCP\





-W5MKNNKPI5VQEMJQNO#JNUVTÌO  5GNVGPKPFKGUGT'TJCNVWPI2TCEJVGZGORNCT5VGORGNINCP\





-W5MKNNKPI5VQEMJQNO#JNUVTÌO



1UMCT+¤TG5VQEMJQNO-W¤TG KO5VGORGNCWUIG·PFGTV 5VQEM JQNO#JNUVTÌOD 5VÒEM(CUV5VGORGNINCP\

8QT\ÒINKEJp5VGORGNINCP\

 

2153

2152

2152



-CTN:84KMUFCNGTTKMUO[PV5VQEMJQNO#JNUVTÌOC&CX  (GKPG6ÌPWPIXQT\ÒINKEJ





1UMCT++4KMUFCNGTTKMUO[PV5VQEMJQNO#JNUVTÌO  4(GKNURWTCO4CPFHCUVXQT\ÒINKEJ



'ZGORNCTFGT5NIFGT(TGKJGTTGP$QPFG6GKN#WMVKQP0QTFNKPF5VQEMJQNO0T

2154



108

5KNDGTOGFCKNNG  XQP # .KPFDGTI CWH FGP  +PVGTPCVKQPCNGP 1TKGPVCNKUVGPMQPITG­KP5VQEMJQNO $ÒUVGN5RJKPZNKGIVPCEJTCWHGKPGO5VGKPN2CNOGPTCWHIGJGPFG5QPPGWPVGPNGGTG6CHGNHÒTGKPG )TCXWTFCJKPVGT.QTDGGT\YGKIOOI*[EMGTV0WOKUOCVKUMC/GFFGNCPFGP0T (GKPG2CVKPCXQT\ÒINKEJ




SCHWEDEN

2155

2156

2157



-TQPGP5VQEMJQNO#JNUVTÌO



5KNDGTOGFCKNNGWPUKIPKGTV9GTMUVCVV.CWGT&TGUFGPCWHFGP)GDWTVUVCI)WUVCX++#FQNHU $TWUVDKNF)WUVCX++#FQNHUJCNDNOKVWOIGNGIVGO/CPVGN<GKNGP5EJTKHVWPVGP4GKEJUCRHGNWOJGT .QTDGGTWPF'KEJGPMTCP\OOI *GTTNKEJG2CVKPCXQT\ÒINKEJ



-TQPGP5VQEMJQNO#JNUVTÌO





2TCEJVGZGORNCT(CUV5VGORGNINCP\

2TCEJVGZGORNCT5VGORGNINCP\



2159

2158

2158



-TQPGP5VQEMJQNO#JNUVTÌO

2TCEJVGZGORNCT5VGORGNINCP\





¤TG5VQEMJQNO+P752NCUVKMJQNFGTFGT0)%OKVFGT$GYGTVWPI/5#JNUVTÌO  8QT\ÒINKEJp5VGORGNINCP\



2:1

2160

2:1

)16.#0& 

7NH ,CTN  2HGPPKI WPDGMCPPVG /ÒP\UV·VVG  I -TGKUHÌTOKIG 4WPGPUEJTKHV&QRRGNHC   FGPMTGW\LGFTGK-WIGNPKPFGP9KPMGNP.CIGTSXKUV)TWRRG::+#  8QPITQ­GT5GNVGPJGKV7PTGIGNO·­KIGT5EJTÌVNKPI&QRRGNUEJNCIHCUVUGJTUEJÌP



.1655%*9'&'0 

 4KMUFCNGT 4KMUO[PV   4KMUFCNGT  &CNGT 5KNXGTO[PV    4KMUFCNGT 4KMUO[PV     4KMUFCNGT  &CNGT 5KNXGTO[PV    4KMUFCNGT 5RGEKG  &C\W 5KNDGTOGFCKNNG  CWH FKG   $GKUGV\WPIXQP-CTN:+8,QJCP 5VÒEM5GJTUEJÌPpXQT\ÒINKEJ





-NGKPG 5COONWPI XQP UEJYGFKUEJGP -WRHGTOÒP\GP FGU  ,CJTJWPFGTVUFC\WCWEJGKPKIG5KNDGT OÒP\GPUQYKG5VÒEMGCPFGTGT.·PFGT+PVGTGUUCPVGU.QV 5VÒEM/GKUVUGJTUEJÌPpXQT\ÒINKEJ





-NGKPG 5COONWPI XQP UEJYGFKUEJGP 5KNDGT Z  WPF <KPPOGFCKNNGP Z  FGU  ,CJTJWPFGTVU   FCTWPVGTUGNVGPG5VÒEMGWC5KNDGTOGFCKNNGCWHFGP6QF-CTNU:++ *KNFGDTCPF GVE*QEJ KPVGTGUUCPVGU.QVDKVVGDGUKEJVKIGP 5VÒEM(GNFGTIGIN·VVGV Z UGJTUEJÌPpXQT\ÒINKEJ  109


SCHWEIZ

2165 2164

5%*9'+<

2164

#22'0<'..#755'44*1&'0 

-CPVQP(TCPMGP 0GWVCNGT $GTP&6&CX  0WT'ZGORNCTGIGRT·IV(GKPG2CVKPCXQT\ÒINKEJp5VGORGNINCP\





$KUVWO $GTVJQNF ++ XQP 2HKTV  'KPUGKVKIGT 2HGPPKI  I $TWUVDKNF JCNDT OKV /KVTC   UGIPGPFGT4GEJVGPWPF-TWOOUVCD$GTIGTp*/<pC FQTVWPVGT$KUEJQH*GKPTKEJ+8XQP+UP[  5NI9ÒVJTKEJp9KGNCPFV $CUGN  45GJTUEJÌPpXQT\ÒINKEJ



2167 2166

2166



5VCFV)WNFGPVCNGT -TGW\GT &CX*/<pT

5GJTUEJÌP





5VCFV$CV\GPQ, PCEJ */<pD

5GJTUEJÌP





$KUVWO1TVNKGDXQP$TCPFKU'KPUGKVKIGT2HGPPKIQ,*/<pE  /KP2T·IGUEJY·EJGUGJTUEJÌP





5VCFV-TGW\GT )WNFGP &6C Z 

$'40

2168

ex 2169

ex 2169

%*74

(4'+$74)

5VÒEM5GJTUEJÌPWPFDGUUGT



2171 2170

  110

)'0(

5VCFV6CNGT&CX*/<pG 5QNU*/<pM

2170

4*GPMGNURWTUGJTUEJÌP 5GJTUEJÌP

 


SCHWEIZ

2172

2173



5QNU*/<p\

5GJTUEJÌP





5QNU*/<p\

-N5EJTÌVNKPIUHGJNGTUGJTUEJÌP



2174 2175

2175



5QNU*/<pEE



6CNGT&6H

-N5EJTÌVNKPIUHGJNGTXQT\ÒINKEJ



5GJTUEJÌP



2177 2176

2176



6CNGT&6K&CX

5EJTÌVNKPIUHGJNGTCO4CPFUGJTUEJÌP





5QNU 6GUVQP &6D

5GJTUEJÌPpXQT\ÒINKEJ



2178

2179

*#.&'056'+0 

)WDGTVXQP5CNKU$NW\IGT&6H

*ÒDUEJG2CVKPCUGJTUEJÌP



56)#..'0 

#PQP[OWO'KPUGKVKIGTXKGT\KRHGNKIGT2HGPPKII=/10'6#5%+?)#.=.+?.COO UEJTGKVGVPCEJNFGP-QRH\WTÒEMIGYCPFVFCJKPVGT-TGW\UVCD$GTIGTp-NGKP7NOGT %%   445EJÌPpUGJTUEJÌP

2180



5VCFV&KEMGP*/<pH



2181

5GJTUEJÌP



*ÒDUEJG2CVKPCXQT\ÒINKEJ



<7) 

5VCFV&KEMGP&6L

111


SCHWEIZ

2183

2182

<ª4+%*



5VCFV6CNGT&CX*/<pF



-CPVQP$CV\GP 0GWVCNGT &6&CX

2184

5GJTUEJÌP



2TCEJVGZGORNCT(CUV5VGORGNINCP\



2186

2185

2187

'+&)'0155'05%*#(6 

(TCPMGP#2CTKU&KXQ

2TCEJVGZGORNCT(CUV5VGORGNINCP\





(TCPMGP#2CTKU&CX&KXQ  5GJTUGNVGPKPFKGUGT'TJCNVWPI-CDKPGVVUVÒEM2TCEJVXQNNG2CVKPCHCUV5VGORGNINCP\





(TCPMGP#2CTKU&CX&KXQ

(CUV5VGORGNINCP\





(TCPMGP#2CTKU&KXQ

2TCEJVGZGORNCT(CUV5VGORGNINCP\



2188

 

(TCPMGP#2CTKU&KXQ (TCPMGP$$GTP&CX&KXQ

2189

2188

2TCEJVGZGORNCT(CUV5VGORGNINCP\



448QT\ÒINKEJp5VGORGNINCP\



.CWV &KXQ KUV FKG CPIGIGDGPG 2T·IG\CJN XQP  5VÒEM GPVYGFGT HCNUEJ QFGT GU YWTFGP KO <WIG FGT   0GWQTKGPVKGTWPI FGU /ÒP\YGUGPU FKG OGKUVGP 5VÒEMG YKGFGT GKPIGUEJOQN\GP 'U FÒTHVGP JGWVG YGPKIGT CNU    'ZGORNCTGGZKUVKGTGP

112


SERBIEN

2191

2190



5%*ª6<'06#.'4(TCPMGP$GTP'KFIGPÌUUKUEJGU(TGKUEJKG­GPKP$GTP&CX&KXQ5 8QT\ÒINKEJ





(TCPMGP$GTP'KFIGPÌUUKUEJGU(TGKUEJKG­GPKP<ÒTKEJ&CX&KXQ5  0WT'ZGORNCTGIGRT·IV8QT\ÒINKEJ



2192

2194 2192



(TCPMGP$GTP'KFIGPÌUUKUEJGU5EJÒV\GPHGUVKP<WI&CX&KXQ5  0WT'ZGORNCTGIGRT·IV9KP\-TCV\GTXQT\ÒINKEJ





.16 5%*ª6<'06#.'4 5EJÒV\GPVCNGT  (TCPMGP   .CWUCPPG   $CUGN   .WICPQ   Z &C\WYGKVGTGOQFGTPG5EJÒV\GPVCNGTFGU<GKVTCWOGU  5VÒEM5GJTUEJÌPXQT\ÒINKEJpRQNKGTVG2NCVVG



5'4$+'0 

2GVGT +  6TCIDCTG XGTUKNDGTVG DTQP\GPG 8GTFKGPUVOGFCKNNG Q , WPUKIPKGTV )GMTÌPVGU   9CRRGP8KGT<GKNGP5EJTKHVOO (CUVXQT\ÒINKEJ



2196

2195



&KPCTC9KGP,CJTHGKGTFGT-CTCIGQTIG&[PCUVKG&CX  2TCEJVGZGORNCT(CUV5VGORGNINCP\





 &KPCTC  9KGP ,CJTHGKGT FGT -CTCIGQTIG&[PCUVKG +P 752NCUVKMJQNFGT FGT 0)% OKV FGT   $GYGTVWPI/5&CX 9KP\4CPFHGJNGTXQT\ÒINKEJ



2197



2CTC+P752NCUVKMJQNFGTFGT0)%OKVFGT$GYGTVWPI/5-/

(CUV5VGORGNINCP\



5COONWPIXQPUGTDKUEJGP/ÒP\GPFGU,CJTJWPFGTVUXQO2CTCDKU\WO&KPCTC5VÒEMFCTWPVGT CWEJDGUUGTG6[RGPWPF,CJTI·PIGWC2CTC2CTC -GJTRT·IWPI &KPCTC &KPCTC -GJTRT·IWPI &KPCTC -GJTRT·IWPI GVE*QEJKPVGTGUUCPVGU1DLGMV OKVGKPKIGPJÒDUEJGP'TJCNVWPIGPDKVVGDGUKEJVKIGP 5VÒEM5GJTUEJÌPpHCUV5VGORGNINCP\



.165'4$+'0

 113


TSCHECHIEN

2200

2201

2199

-¤0+)4'+%*

52#0+'0



(GNKRG+84GCNGU5GIQXKC%CNKEÉ  -N<CKPGPFGYKP\&TWEMUVGNNGCVVTCMVKXGUUGJTUEJÌPGU'ZGORNCT





,QUGRJ0CRQN¾QP$QPCRCTVG4GCNGU/#+/CFTKF%CNKEÉ&CX  5EJÌPG2CVKPCXQT\ÒINKEJp5VGORGNINCP\





4GCNGU/#+/CFTKF%CNKEÉ&CX

8QT\ÒINKEJ



2TCEJVGZGORNCT(CUV5VGORGNINCP\



2202

ex 2203



+UCDGNNC++4GCNGU/CFTKF%CNKEÉ



2TQXKUQTKUEJG 4GIKGTWPI  .QV -W %GPVKOQU  1/ -W %GPVKOQU  1/   -W%GPVKOQU1/-W%GPVKOQ1/CNNG/ÒP\UV·VVG$CTEGNQPC%CNKEÉ  5VÒEM5VGORGNINCP\

1,5:1

$¤*/'0/*4'0 

114

2204



1,5:1

65%*'%*+'0

7NTKEJ   &GPCT 2TCI  I *GT\QI OKV (CJPG KPFGT4GEJVGPVJTQPVXX$TWUV DKNF5V9GP\GNUN#WMVKQP.CP\:+++)TC\XCT%CEJ  45EJCTHCWUIGRT·IVGU'ZGORNCTOKVJGTTNKEJGT2CVKPCXQT\ÒINKEJ




UNGARN

1,5:1



2205

1,5:1

9NCFKUNCWU +  WPF  &GPCT 2TCI  I $·TVKIGU $TWUVDKNF N OKV GTJQDGPGP   *·PFGP KO (GNF $WEJUVCDG 4-TKGIGT UVGJV X X OKV 5EJYGTV WPF 5EJKNF %CEJ p 8QTFGTUGKVG   XIN  8QPITQ­GT5GNVGPJGKV9QJNWPGFKGTV #VVTCMVKXGUUGJTUEJÌPGU'ZGORNCTOKVMN2T·IGUEJY·EJG



&KG <WYGKUWPI FGU XQTNKGIGPFGP 6[RU KUV PKEJV \YGKHGNUHTGK IGUKEJGTV #WHITWPF FGT UVKNKUVKUEJGP JPNKEJMGKV FGU   /ÒP\DKNFGU\W)GRT·IGP9NCFKUNCWU+XQP$ÌJOGPUEJNCIGPYKTFKGCPIGIGDGPG8GTQTVWPIXQT

2206



2207

2208

2210

2209

#PQP[O*CNDFGPCTQ,'IGT4GKEJUOÒP\UV·VVG(TKGFTKEJ++I#EJV DN·VVTKIG 4QUGVVG KO 9WNUVTGKH CW­GP *CNDDÌIGP OKV -TGW\GP FC\YKUEJGP .KNKGP<YGK 6KGTG KP   .KNKGPTCPF ! *CUMQXC 6GKYGKNUGUEJYCEJCWUIGRT·IVUGJTUEJÌPUEJÌP





*CNDFGPCT Q , 'IGT 4GKEJUOÒP\UV·VVG (TKGFTKEJ++I-QRHTWOJGT4QUGVVGP #FNGTWOJGT5VGTPG*CUMQXC 2T·IGUEJY·EJGHCUVUGJTUEJÌP





*CNDFGPCTQ,'IGT4GKEJUOÒP\UV·VVG(TKGFTKEJ++I$TWUVDKNFFGU-ÌPKIUXX OKV\YGK.KNKGP\GRVGTP#FNGTWPVGT\YGKGKPCPFGT\WIGYCPFVGP.ÌYGP*CUMQXC  'VYCUUEJYCEJCWUIGRT·IVNGKEJVFG\GPVTKGTVUGJTUEJÌPHCUVUGJTUEJÌP



*CNDFGPCT Q , 'IGT 4GKEJUOÒP\UV·VVG (TKGFTKEJ ++   I )GHNÒIGNVGU $TWUVDKNF FGU   -ÌPKIUXX7PMGPPVNKEJCWUIGRT·IV*CUMQXCp 42T·IGUEJY·EJGUGJTUEJÌP





&KG<WYGKUWPIFKGUGUUGNVGPGP2HGPPKIUKUVPKEJVGKPFGWVKIIGUKEJGTV



2HGPPKIQ,'IGT ! I#FNGTOKVCWUIGDTGKVGVGP5EJYKPIGPWPFIGMTÌPVGO/GPUEJGPMQRHXX $·TVKIG$ÒUVGXXOKVGORQTIGJCNVGPGP*·PFGP ! *CUMQXCp 9KP\5EJTÌVNKPIUTK­UGJTUEJÌP



&KG <WYGKUWPI FGU XQTNKGIGPFGP 5VÒEMGU KUV PKEJV IGUKEJGTV 5EJYKPMQYUMK $N·VVGT HÒT /ÒP\HTGWPFG  5R    0T   NGIVG FKGUGP 6[R PCEJ 0QTFDÌJOGP QFGT (TCPMGP )CGVVGPU 5NI )CGVVGPU  (WPFG   7PVGTJGTOUITÒP UR·VGTPCEJ'IGT

2212

2211 2213

70)#40 

5VGRJCP +  5KNDGTOÒP\G 1DQN!   I 56'2*#085 4': -TGW\ LG GKP -GKN KP FGP   9KPMGNP 4')+#%+8+6#5-TGW\LGGKP-GKNKPFGP9KPMGNP*WU\CT  /KPIGYGNNVUGJTUEJÌP





5KNDGTOÒP\G 1DQN!   I 56'2*#085 4': -TGW\ LG GKP -GKN KP FGP 9KPMGNP 4')+#   %+8+6#5-TGW\LGGKP-GKNKPFGP9KPMGNP*WU\CTC /KPFG\GPVTKGTVUGJTUEJÌP





$GNC +++  -WRHGTOÒP\G Q ,I<YGK-ÌPKIUIGUVCNVGPVJTQPGPXXFC\YKUEJGPGKP .CPIMTGW\ QFGT GXVN GKP #TEJKVGMVWTQTPCOGPV  FCTWPVGT WPVGT GKPGO *CNDOQPF FTGK 5VTKEJG/C   FQPPCOKV*GKNKIGPUEJGKPXXJ·NVNGKP<GRVGTTFCU,GUWUMKPF*WU\CT 8QT\ÒINKEJ

 115


UNGARN

2214

2215





1,5:1

1,5:1

2215

5VGRJCP 8  1DQN  I -ÌPKI VJTQPV X X OKV 4GKEJUCRHGN WPF -TGW\\GRVGT.KNKGP   UEJKNFWOJGTFTGKMNGKPGTG.KNKGP*WU\CT 4   8QPITQ­GT5GNVGPJGKV5GJTUEJÌPGU'ZGORNCTOKVITÒPGT2CVKPC



.WFYKI ++  5KNDGTOGFCKNNG  XQP %JT (ÒUUGN -TGOPKV\ \WT 'TKPPGTWPI CP UGKPG   -TÌPWPI WPF UGKPGP HTÒJGP 6QF &GT LWIGPFNKEJG -ÌPKI UKV\V CWH GKPGO -KUUGP KP FGT 7OUEJTKHV FKG   ,CJTGU\CJN 5KGDGP <GKNGP 5EJTKHV FCTÒDGT FKG ,CJTGU\CJN  WPVGP *GNO \YKUEJGP 8  )  

8CTCFKP)GQTIKWU OOI*WU\CT2TQEQRKWU5NI*QTUM[ FQTVOKV/GFCKNNGWT9 )WINKPIGT  4*ÒDUEJG2CVKPCUGJTUEJÌPpXQT\ÒINKEJ



$GKFGTXQTNKGIGPFGP<YKVVGTOGFCKNNGJCPFGNVGUUKEJWOGKPGRQUVJWOG2T·IWPI.WFYKI++YWTFGCO,WNK KP2TCIIGDQTGPWPFYCTFGTNGV\VG-ÌPKIXQP$ÌJOGPWPF7PICTPCWUFGO)GUEJNGEJVFGT,CIKGNNQPGP0CEJFGT 5EJNCEJVDGK/QJ±EU  GTVTCPMGTCWHFGT(NWEJVKPGKPGO5GKVGPCTOFGT&QPCW5GKPG.GKEJGYWTFGGTUV\YGK /QPCVGUR·VGTIGHWPFGP

2216

2219

2219



4GIGPVUEJCHVFGU4GKEJUXGTYGUGTU/KMNÉU*QTVJ[2GPIÌ2TQDGI*WU\CT #PO 440WT'ZGORNCTGIGRT·IV(CUV5VGORGNINCP\



2GPIÌCWHUGKPGP)GDWTVUVCI*WU\CT

5VÒEM5VGORGNINCP\

 

.1670)#40 

-NGKPG5COONWPIXQPWPICTKUEJGP&GPCTGPFGU,CJTJWPFGTVU+PVGTUUCPVGU.QVDKVVGDGUKEJVKIGP 5VÒEM'KPKIGOKVMN(GJNGTPOGKUVUGJTUEJÌP



5+'$'0$ª4)'0(ª456'0 

5KIKUOWPF$CVJQT[4GKEJUVCNGT/KV.ÌYGPMQRHCWHFGT5EJWNVGT&CX4GUEJ 5GNVGPG8CTKCPVG5EJTÌVNKPIUHGJNGTCO4CPFUGJTUEJÌP

2220



2221

2222

2222



)TQUEJGP4GUEJ

4-N&TWEMUVGNNGXQT\ÒINKEJ





)TQUEJGP4GUEJ

45EJTÌVNKPIUHGJNGTUGJTUEJÌP





)CDTKGN$CVJQT[0QVVCNGT&CX4GUEJ

445GJTUEJÌP



116


UNGARN

2223

2224

2224



)TQUEJGP4GUEJ

5EJYCEJCWUIGRT·IV5EJTÌVNKPIUHGJNGTUGJTUEJÌP





)CDTKGN$GVJNGP4GKEJUVCNGT0$0CI[D±P[C&CX#4GUEJ  44#VVTCMVKXGUUGJTUEJÌPGU'ZGORNCT



2225

1,5:1

1,5:1



4GKEJUVCNGT0$0CI[D±P[CI)#$Û&Ú)Û5#Û41Û+/2ÙÛ'6Û64#0Û24+0Ùr )GJCTPKUEJVGU $TWUVDKNF T OKV WOIGNGIVGO /CPVGNÛ 2#4 Û 4') Û *80 Û &1/ Û 5+% Û %1 Ú 12 Û   4#6 Û &8: Û < Û )GMTÌPVGU XKGTHGNFKIGU 9CRRGP OKV FGO /KVVGNUEJKNF $GVJNGP \W FGP 5GKVGP   KPPGTJCNDFGT8GT\KGTWPIFCU/ÒP\\GKEJGP0$ 0CI[D±P[C &CX4GUEJ  5GJTUGNVGPKPFKGUGT'TJCNVWPI2TCEJVGZGORNCT(CUV5VGORGNINCP\ 

2226



4GKEJUVCNGT/%-CUEJCW&CX4GUEJ  (GKPG2CVKPCMN5VGORGNHGJNGTCO4CPFUGJTUEJÌP

 117


UNGARN

2227



4GKEJUVCNGT%%-CUEJCW&CX4GUEJXCT  4CPFWPF(GNFGTUVCTMÒDGTCTDGKVGVUGJTUEJÌP

2228



2228 1,5:1



4GKEJUVCNGT0$0CI[D±P[C&CX4GUEJXCT

#VVTCMVKXGUUGJTUEJÌPGU'ZGORNCT



2229

1,5:1



118

1,5:1

#EJCVKWU$CTEUCK4GKEJUVCNGT%8-NCWUGPDWTI*ÒHVDKNFTOKV&QNOCP 7PKHQTOLC EMG  OKV FGT 4GEJVGP FCU <GRVGT UEJWNVGTPF)GMTÌPVGU XGT\KGTVGU 9CRRGP OKV FGO /KVVGNUEJKNF   $CTEUCK\WFGP5GKVGP%8 %QNQUX±T &CX4GUEJ# 8QPITQ­GT5GNVGPJGKV5GJTUEJÌP 


ARGENTINIEN

/ª0<'070&/'&#+..'0#75ª$'45''

2230

);26'0 

#DFWN*COKF++8GTIQNFGVG$TQP\GOGFCKNNGQ,OKV5KIPCVWT5,CWHFKGKPVGTPCVKQ PCNG *CPFGNUCWUUVGNNWPI HÒT +ORQTV WPF 'ZRQTV KP 5WG\ 7PKHQTOKGTVGU $TWUVDKNF FGU -JGFKXGP VÒTMK   UEJGT 8K\GMÌPKI  #DDCU *KNOK 2CEJC

 Ó  X X<YGK 5EJKHHG CWHFGO5WG\-CPCNWOJGT .QTDGGT\YGKIGWPF5EJTKHVDCPFOO 44(CUV5VGORGNINCP\



2231

6*+12+'0 

/GPGNKM++-W)GTUJ '' #2CTKU-/  440WT'ZGORNCTGIGR·IV8QT\ÒINKEJ



2232

#4)'06+0+'0 

$WGPQU #KTGU 5VCFV 5KNDGTOGFCKNNG  XQP 2 ) #TTCDCN CWH FKG 2TQMNCOCVKQP (GTFKPCPFU 8++   IGYKFOGV XQP FGT 5VCFV 7PKHQTOKGTVGU $TWUVDKNF (GTFKPCPFU 8++ N-TKGIGT MPKGV PCEJ N JKPVGT   5VCFVYCRRGP KP FGT .KPMGP -GWNG 5EJYGTV WPF .QTDGGT\YGKI OKV FGT 4GEJVGP ÒDGTTGKEJV GT FGT CWH   GKPGO.ÌYGPUKV\GPFGPRGTUQPKHK\KGTVGP5VCFVGKP*GT\CO$QFGP/GTMWTUVCDWPF#TOCVWTGPOO I5NI(QPTQDGTV 2TCEJVXQNNG2CVKPCXQT\ÒINKEJp5VGORGNINCP\

 119


BOLIVIEN

2233

#7564#.+'0 %1%15 -''.+0) +5.#0&5 

'NK\CDGVJ++UGKV6QMGP%QKPCIGXQPKPTQVGO2NCUVKMDGUVGJGPFCWU4WRGGU UQYKG4WRGG-/6P 5VÒEM8QT\ÒINKEJ

2234

2235



2236

$1.+8+'0 

%CTNQU+++4GCNGU265,42QVQUK%CNKEÉ 2TCEJVGZGORNCT(CUV5VGORGNINCP\



(GTFKPCPF8++5KNDGTOGFCKNNGXQP/QPEC[QCWHFGP7PVGTFTÒEMGTFGU#WHUVCPFGU IGIGPFGP-ÌPKI)GPGTCN,QUGRJ'OCPWGNC)Q[GPGEJGIGYKFOGVXQPFGT5VCFVDGJÌTFG2QVQUK7PK HQTOKGTVGU$TWUVDKNFFGU)GPGTCNUT<GKNGP5EJTKHVOOI5NI(QPTQDGTV  *ÒDUEJG2CVKPCCVVTCMVKXGUHCUVXQT\ÒINKEJGU'ZGORNCT



4GCNGU2652,2QVQUK%CNKEÉ



 120

8QT\ÒINKEJ




EL SALVADOR

2237

$4#5+.+'0 

4GRWDNKMUGKV4GKU2CTKUCWHFKG,CJTHGKGTFGT'PVFGEMWPI$TCUKNKGPU&CX -/ 4(GKPG2CVKPCUGJTUEJÌPpXQT\ÒINKEJ

2239

2238



ex 2240

%*+0#  

2TQXKP\-YCPIVWPI-W%GPV %CUJ Q,  ;GQ #NNIGOGKPG2T·IWPIGP&QNNCTQ,  6KGPVUKP&CX-CPP

5VGORGNINCP\ 5GJTUEJÌP



2TQXKP\*WRGJ&QNNCTQ,  &CX2TQXKP\-YCPIVWPI&QNNCTQ,  &CX 2TQXKP\2GK;CPI&QNNCT,CJT  &CX Z &C\W#NNIGOGKPG2T·IWPIGP&QNNCT,CJT

 6KGPVUKP&CX 5VÒEM5GJTUEJÌPpXQT\ÒINKEJ

 

.16%*+0# 

2242

2241

'.5#.8#&14 

4GRWDNKM2GUQ%JTKUVQRJ%QNWODWU-/



2GUQ%JTKUVQRJ%QNWODWU-/

 2TCEJVXQNNG2CVKPCXQT\ÒINKEJp5VGORGNINCP\ *ÒDUEJG2CVKPCXQT\ÒINKEJ

  121


JAPAN

2244

2243

2243

)*#0# 

)GQTIG+++#EMG[-/ FQTVWPVGT)QNFMÒUVG   442TCEJVXQNNG2CVKPCXQT\ÒINKEJp5VGORGNINCP\





#EMG[-/ FQTVWPVGT)QNFMÒUVG   442TCEJVGZGORNCT*GTTNKEJG2CVKPCHCUV5VGORGNINCP\



2246

2245

2245

+4#0 

0CUTGFKP6QOCP -TCP  #* 6GJTCPCWHUGKPL·JTKIGU4GIKGTWPIU LWDKN·WOCNU5WNVCPI5KNDGTCDUEJNCIXQPFGP5VGORGNPFGU6QOCP5VÒEMGU&CX#PO -/ 44*GTTNKEJG2CVKPCXQT\ÒINKEJGU'ZGORNCT



/QJCOOGF4K\C2CJNGXK4KCNU 5* -/  5GNVGPGT,CJTICPI2TCEJVGZGORNCT5VGORGNINCP\

 

2248

2247

2249

2247

,#2#0 

/WVUWJKVQ;GP,CJT/GKLKTC  1UCMC&CX,CEQDU8GTOGWNG3  5GJTUGNVGPGT,CJTICPI(GKPG6ÌPWPIMN4CPFHGJNGTXQT\ÒINKEJ

 

5GP,CJT/GKLKTC  1UCMC,CEQDU8GTOGWNG7 5GP,CJT/GKLKTC  1UCMC,CEQDU8GTOGWNG6

122

8QT\ÒINKEJ 8QT\ÒINKEJ

  


PERU

ex 2250 2251

-¤0+)4'+%* 

-#/$1&5%*#

0QTQFQO+-W%GPVKOGU-W%GPVKOGU-/  5VÒEM(CUV5VGORGNINCP\



-1/14'0

4'27$.+- 

2251

(TCP\ÌUKUEJGU2TQVGMVQTCV(TCPEU #* &CX  440WT'ZGORNCTGIGRT·IV8QT\ÒINKEJ

2252

2253



2252

-14'# 

;K*[QPI CD-YCPI/W %JQPQ,  -/  5GJTUEJÌPpXQT\ÒINKEJ





%JQPQ,  -/



2255

5GJTUEJÌPpXQT\ÒINKEJ

2254

2256

/#41--1 

/QJCOOGF+++/KVJSCN #* 4KDCVCNHCVJ 4CDCV -/  45GJTUEJÌPpXQT\ÒINKEJ



4GRWDNKM%GPVGUKOQU-/



2#0#/# 2TCEJVXQNNG2CVKPCXQT\ÒINKEJp5VGORGNINCP\



2'47 

%CTNQU+++4GCNGU,/.KOC%CNKEÉ

5GJTUEJÌP

 123


URUGUAY

2258

2257



2257

4GRWDNKM UGKV  5KNDGTOGFCKNNG  WPUKIPKGTV CWH FKG 'KPYGKJWPI FGU *CHGPU XQP %CNNCQ   #PUKEJVFGU*CHGPUCWUFGT8QIGNRGTURGMVKXGWOJGT8KGTRC­5KGDGP<GKNGP\WO6GKNIGDQIGPG5EJTKHV OOI5NI(QPTQDGTV (GKPG2CVKPCYKP\4CPFHGJNGTXQT\ÒINKEJ



2*+.+22+0'0 

#NHQPUQ:++%GPVCXQUFG2GUQ/CFTKF%CNKEÉ

8QT\ÒINKEJ



7PVGT)TQ­DTKVCPPKGP8KEVQTKC-W%GPVU-/2TKFOQTG  (GKPG2CVKPCHCUV5VGORGNINCP\



2259

2260

54+.#0-# %';.10  

57&#0 

#DFWNNCJ+DP/QJCOOGF2KCUVGT #* 1OFWTOCP-/  -N-TCV\GTUGJTUEJÌPpXQT\ÒINKEJ

2261



2262

670'5+'0 

7PVGTQUOCPKUEJGT*GTTUEJCHV5WNVCP#DFWN/GLKF2KCUVGT #* 6WPKU -/ 5GJTUEJÌPpXQT\ÒINKEJ



747)7#;  124

4GRWDNKMUGKV2GUQ-/C

#VVTCMVKXGUXQT\ÒINKEJGU'ZGORNCT




USA

2264

2263

2265



%GPVGUKOQU2QKUU[2TQDGKP0KEMGN+P752NCUVKMJQNFGTFGT0)%OKVFGT$GYGTVWPI/5 -/' 442TCEJVGZGORNCTOKVHGKPGT2CVKPC(CUV5VGORGNINCP\





 %GPVGUKOQU  # 9KGP +P 752NCUVKMJQNFGT FGT 0)% OKV FGT $GYGTVWPI /5  -/    8QT\ÒINKEJp5VGORGNINCP\



8'0'<7'.# 

4GRWDNKM$QNKXCTGU%CTCECU;GQ

#VVTCMVKXGU'ZGORNCTOKVHGKPGT2CVKPCXQT\ÒINKEJ



2266 2:1

2:1

8'4'+0+)6'56##6'0810#/'4+-#75# 

(ÌFGTCVKQP -W %GPV  2JKNCFGNRJKC .KDGTV[ %CR  I .+$'46;$ÒUVGNFCJKPVGT5VCD OKV(TGKJGKVUOÒV\GWPVGPFKG,CJTGU\CJN70+6'&56#6'51(#/'4+%#9GTVCPICDGKP\YGK <GKNGPWOJGT.QTDGGTMTCP\/KV4CPFUEJTKHV691*70&4'&(14#&1..#4;GQ5 5GJTUGNVGPKPFKGUGT'TJCNVWPI8QT\ÒINKEJGU'ZGORNCTOKVHGKPGT2CVKPC 

2268

2267

 

2267

5KNXGT&QNNCT2JKNCFGNRJKC.KDGTV[;GQ5 #VVTCMVKXGUUGJTUEJÌPGU'ZGORNCT 5KNXGT&QNNCT2JKNCFGNRJKC&TCRGFDWUVV[RG5OCNN;GQ5 5GJTUEJÌP

  125


USA

2269

2270



-W.CTIG %GPV  ,CJTGU\CJN KO 5VGORGN CWU  IG·PFGTV  2JKNCFGNRJKC .KDGTV[ %NCUUKE JGCF   V[RG;GQ5 45GJTUEJÌPpXQT\ÒINKEJ





-W.CTIG%GPV2JKNCFGNRJKC.KDGTV[%NCUUKEJGCFV[RG;GQ5

5EJÌPpUGJTUEJÌP



&KOG2JKNCFGNRJKC.KDGTV[%CRRGF$WUVV[RG.CTIG;GQ5  2TCEJVGZGORNCTOKVHGKPGT6ÌPWPI(CUV5VGORGNINCP\



2271

1,5:1

1,5:1



2272

1,5:1

1,5:1



&KOG2JKNCFGNRJKC.KDGTV[%CRRGF$WUVV[RG.CTIG%;GQ5  2TCEJVGZGORNCTOKVHGKPGT6ÌPWPI5VGORGNINCP\



5KNXGT&QNNCT2JKNCFGNRJKC.KDGTV[UGCVGF&C\W&QNNCT2JKNCFGNRJKC.KDGTV[$CTDGT JGCFV[RG;GQ55 5VÒEM(CUVXQT\ÒINKEJ

2274

2275

2276



2277

  

&QNNCT2JKNCFGNRJKC.KDGTV[UGCVGF;GQ5 -W%GPVU2JKNCFGNRJKC5JKGNFV[RG;GQ5 %GPVU2JKNCFGNRJKC5JKGNFV[RG;GQ5



&QNNCT+UCDGNNC3WCTVGT%QNWODKCP'ZRQUKVKQPKP%JKECIQ+P752NCUVKMJQNFGTFGT0)%OKV FGT$GYGTVWPI#7;GQ5 8QT\ÒINKEJ

126



8QT\ÒINKEJ 8QT\ÒINKEJp5VGORGNINCP\ 8QT\ÒINKEJ

   


VIETNAM

2278



5KNXGT&QNNCT.CHC[GVVG&QNNCT;GQ5

8QT\ÒINKEJ



2281 2280

2279

 

%GPVU2JKNCFGNRJKC.KDGTV[*GCF;GQ5 %GPVU2JKNCFGNRJKC.KDGTV[*GCF;GQ5

2TCEJVGZGORNCT(CUV5VGORGNINCP\ 2TCEJVGZGORNCT(CUV5VGORGNINCP\



&KOG2JKNCFGNRJKC9KPIGFJGCF /GTEWT[ +P752NCUVKMJQNFGTFGT0)%OKVFGT$GYGTVWPI /5;GQ5 48QT\ÒINKEJp5VGORGNINCP\

2282

 

  

2283

&QNNCT*CYCKKCP5GUSWKEGPVGPPKCN;GQ5 &QNNCT2JKNCFGNRJKC.KDGTV[YCNMKPI;GQ

44(CUV5VGORGNINCP\ 8QT\ÒINKEJ

 

.16575# 



(ÌFGTCVKQP-NGKPG5COONWPIXQP/ÒP\GPFGU,CJTJWPFGTVUXQO%GPVDKU\WO&QNNCTFCTWP VGTDGUUGTG,CJTI·PIGWPFGKPKIGJÒDUEJG3WCNKV·VGP  5VÒEM+P#NDWO5EJÌPpHCUV5VGORGNINCP\



%GPVUDGKFG/ÒP\UV·VVG2JKNCFGNRJKC-W%GPVU2JKNCFGNRJKC 5JKGNFV[RG -W .CTIG %GPV  2JKNCFGNRJKC .KDGTV[ /CVTQP JGCF  -W %GPV  2JKNCFGNRJKC .KDGTV[   &TCRGFDWUV  5VÒEM5EJÌPpUGJTUEJÌP



2287 2286

 

#00#/

2286

8+'60#/

/KPJ/CPI6KGP 2KCUVGT ,CJT  &CX5EJTQGFGT &GOQMTCVKUEJG4GRWDNKM8KGVPCO&QPI-/

5GJTUEJÌP 448QT\ÒINKEJ

 

$KUCWHYGPKIG'ZGORNCTGYWTFGFKGIGUCOVG#WHNCIGXGTPKEJVGV

127


RÖMISCH-DEUTSCHES REICH

*#$5$74)+5%*''4$.#0&'¤56'44'+%* 6+41.)4#(5%*#(6 5#//.70)/+66'.#.6'4.+%*'4-.'+0/ª0<'0#756+41. 

5COONWPI XQP 6KTQNGT -NGKPOÒP\GP FGU /KVVGNCNVGTU FC\W GKPKIG )GRT·IG XQP )ÌT\  #FNGTITQUEJGP   <YCP\KIGT 8KGTGT 4CKVRHGPPKIG WPF -TGW\GT XQP /GKPJCTF ++   DKU (GTFKPCPF +  

  FCTWPVGT GKPKIG UGNVGPG 6[RGP WPF DGUUGTG 'TJCNVWPIGP #NNG /ÒP\GP UKPF PCEJ FGO   %QTRWU0WOOQTWO#WUVTKCEQTWODGUVKOOVYQTFGP*QEJKPVGTGUUCPVGU.QVFCUUKEJJGTXQTTCIGPF\WO #WHDCWGKPGTJCDUDWTIKUEJGP/KVVGNCNVGTUCOONWPIGKIPGVDKVVGWPDGFKPIVDGUKEJVKIGP  5VÒEM5GJTUEJÌPpXQT\ÒINKEJ 

2289

2290

)¤4<)4#(5%*#(6 

#NDGTV++2HGPPKIQ, WO .KGP\#INGKGT%0#+-  .GKEJVG2T·IGUEJY·EJGUQPUVUGJTUEJÌP



&GT #WUFTWEM #INGKGT CWEJ #INCKGT QFGT #ING[GT  DG\GKEJPGVG WTURTÒPINKEJ FKG 0CEJRT·IWPIGP XQP (TKGUCEJGT   2HGPPKIGPFGU,CJTJWPFGTVUFWTEJFKG2CVTKCTEJGPXQP#SWKNGLC



*GKPTKEJ++2HGPPKIQ,.KGP\%0#+-C  +P6GKNGPUEJYCEJCWUIGRT·IVWPFOKP-TCV\GTUGJTUEJÌP



2292

2291

2291

4¤/+5%*&'765%*'54'+%* 

/CZKOKNKCP+)WNFKPGT5V8GKVI&CX'II8QINJ  4-N5COONGTRWP\GCWHFGT8QTFGTUGKVGUGJTUEJÌPGU'ZGORNCT



/CZKOKNKCP +  9KGPGT 0GWUVCFV Ó 9GNU JGKTCVGVG  /CTKC XQP $WTIWPF YWTFG  TÌOKUEJGT   -ÌPKIWPFHQNIVGUGKPGO8CVGT(TKGFTKEJ+++KPFGT4GIKGTWPI&CGKPG-CKUGTMTÌPWPIFWTEJFGP2CRUVYGIGP FGTCPIGURCPPVGPOKNKV·TKUEJGPWPFRQNKVKUEJGP.CIGKP+VCNKGPPKEJVOÌINKEJYCTPCJO/CZKOKNKCPFGP6KVGN 'TY·JNVGT TÌOKUEJGT -CKUGT CP 1DYQJN GT RGTUÌPNKEJ VCRHGT M·ORHVG WPF FCJGT KO 8QNMUOWPF CNU FGT NGV\VG   4KVVGTDG\GKEJPGVYWTFGNKGIVUGKPG$GFGWVWPIYGPKIGTCWHOKNKV·TKUEJGO)GDKGVCNUKPUGKPGTITQ­CPIGNGIVGPFGP YGEJUGNPFGP (TQPVGP CPIGRC­VGP *GKTCVU WPF 8GTVTCIURQNKVKM OKVFGTGTFKG/CEJVFGU*CWUGU*CDUDWTIUV·TMVG &WTEJFKG8GTJGKTCVWPIUGKPGU5QJPGU2JKNKRRFGU5EJÌPGPOKV,QJCPPCFGT9CJPUKPPKIGPNGIVGGTFGP)TWPFUVGKP HÒTFKG9GNVIGNVWPIUGKPGT(COKNKG+PPGPRQNKVKUEJHÒJTVGFGTNGV\VG4KVVGTDGFGWVGPFG4GHQTOGPFWTEJ \$'YKIGT .CPFHTKGFG 'KPHÒJTWPI FGU )GOGKPGP 2HGPPKIU  WPF TKEJVGVG \GPVTCNG 4GKEJUDGJÌTFGP GKP \ $ 4GKEJUMCOOGT   IGTKEJV 4GKEJUTGIKOGPV  /CZKOKNKCP DGV·VKIVG UKEJ CWEJ NKVGTCTKUEJ WPF XGTCPNC­VG FKG #DHCUUWPI FGU 6JGWGT   FCPMGKPGT&CTUVGNNWPIUGKPGT$TCWVHCJTVUQYKGFGU9GK­MWPKIGKPGT8GTJGTTNKEJWPIUGKPGT6CVGP

 128

(GTFKPCPF+6CNGT,QCEJKOUVCN/ÒP\OGKUVGT4WRRTGEJV2WGNNCEJGT8CTKCPVG OKV*+2#0+#4&CX&KGVKMGT*CNCEMC8QINJ8++ 45GJTUEJÌP




RÖMISCH-DEUTSCHES REICH

2296

2293

2294

2295

2295



4GKEJUIWNFKPGT -TGW\GT Q, WO *CNN&CX/68QINJ+++  *ÒDUEJG2CVKPCUGJTUEJÌP





4GKEJUVCNGT Q , *CNN 2QUVJWOG 2T·IWPI XQP  $GKFGTUGKVU GKPG 4QUGVVG CO #PHCPI FGT   7OUEJTKHV&CX#$XCT/6XCT8QINJ++XCT+++  -N5EJTÌVNKPIUHGJNGTXQT\ÒINKEJp5VGORGNINCP\





4WFQNH++)TQUEJGP -TGW\GT 9KGP/\#5

45GJTUEJÌP





4GKEJUVCNGT-WVVGPDGTI/ÒP\OGKUVGT,KTÃ5CVPÓXQP1NKXGV&KGVKMGT*CNCEMC  (CUVUGJTUEJÌP



2297

2300

2299

2298

2298



4GKEJUVCNGT-WVVGPDGTI/ÒP\OGKUVGT9QNH*GTQNFXQP#WRC&CX&KGVKMGT*CNCEMC 8QINJ+ -N5EJTÌVNKPIUTK­XQT\ÒINKEJ



 

)TQUEJGP -TGW\GT 9KGP/\#5 4GKEJUVCNGT*CNN&CX/6XCT8QINJ++

 



4GKEJUVCNGT  -WVVGPDGTI /ÒP\OGKUVGT &CXKF 'PFGTNG &CX  &KGVKMGT  *CNCEMC    8QINJ+++ *ÒDUEJG2CVKPCYKP\5EJTÌVNKPIUHGJNGTUGJTUEJÌP

5GJTUEJÌP 8QT\ÒINKEJ

 129


RÖMISCH-DEUTSCHES REICH

2301 2302

2302

 

4GKEJUVCNGT*CNN/6 4GKEJUVCNGT'PUKUJGKO&CX8QINJ8

*ÒDUEJG2CVKPCUGJTUEJÌPpXQT\ÒINKEJ 5GJTUEJÌP

 

2303

2304 (doppelt)

2304 (doppelt)



'T\JGT\QI /CZKOKNKCP CNU *QEJOGKUVGT FGU &GWVUEJGP 1TFGPU   4GKEJUVCNGT   *CNN/6XCT2TQMKUEJ#XCTCXCT *ÒDUEJG2CVKPCUGJTUEJÌP



&QRRGNVGT4GKEJUVCNGT*CNNI&CX/62TQMKUEJ  *ÒDUEJG2CVKPCMN5EJTÌVNKPIUHGJNGTCO4CPFUGJTUEJÌPpXQT\ÒINKEJ

2305

2306

 

2307



'T\JGT\QI /CZKOKNKCP CNU .CPFGUHÒTUV XQP 6KTQN  4GKEJUVCNGT  *CNN &CX    /6XCT8QINJ8++ /KPLWUVKGTVUGJTUEJÌP





4GKEJUVCNGT*CNN&CX/6XCT8QINJ+:

5GJTUEJÌP





4GKEJUVCNGT*CNN&CX/6XCT8QINJ:++  2TCEJVXQNNG2CVKPCYKP\<CKPGPFGXQT\ÒINKEJ



130


RÖMISCH-DEUTSCHES REICH

2308

2310

2309



4GKEJUVCNGT*CNN&CX%/6XCT8QINJ:++

5GJTUEJÌP





4GKEJUVCNGT*CNN&CX/68QINJ:+++XCT

5GJTUEJÌP





4GKEJUVCNGT*CNN&CX/6XCT8QINJ:+++

5GJTUEJÌP



2311

2312

2313



4GKEJUVCNGT'PUKUJGKO2QUVJWOG2T·IWPI&CX8QINJ++

 4-N<CKPGPFGUGJTUEJÌP





/CVVJKCU4GKEJUVCNGT-$-TGOPKV\&CX8QINJ+  (NGEMKIG2CVKPC-QTTQUKQPUURWTGP-TCV\GTUGJTUEJÌP





4GKEJUVCNGT-$-TGOPKV\&CX8QINJ+

44-N4CPFHGJNGTXQT\ÒINKEJ

 131


RÖMISCH-DEUTSCHES REICH

2314

2315 (doppelt)

2316



4GKEJUVCNGT-$-TGOPKV\&CX8QINJ+++  9KP\5EJTÌVNKPIUHGJNGTCO4CPFUGJTUEJÌP



&QRRGNVGT 4GKEJUVCNGT  9KGP  I )GJCTPKUEJVGU $TWUVDKNF T OKV .QTDGGTMTCP\ *CNUMTCWUG   WPF FGT -GVVG FGU 1TFGPU XQO )QNFGPGP 8NKGU WPVGP KP FGT 7OUEJTKHV /ÒP\OGKUVGT\GKEJGP $CWO  

+UCKCU,GUUGPUM[/ÒP\OGKUVGTKP9KGP )GMTÌPVGT&QRRGNCFNGTOKV5EJYGTVWPF<GRVGTKP FGP(·PIGP\YKUEJGPFGP*·NUGP4GKEJUCRHGNCWHFGT$TWUVOGJTHGNFKIGU9CRRGPWOJGTFKG-GVVGFGU 1TFGPU XQO )QNFGPGP 8NKGU WPVGP KP FGT 7OUEJTKHV 9CRRGPUEJKNF ¤UVGTTGKEJ$WTIWPF  &CX    /\#5 44*ÒDUEJG2CVKPCCVVTCMVKXGUUGJTUEJÌPGU'ZGORNCT 



4GKEJUVCNGT-$-TGOPKV\2QUVJWOG2T·IWPI&CX8QINJ+++  445GJTUEJÌPpXQT\ÒINKEJ

2317

2318





2319



(GTFKPCPF ++  4GKEJUVCNGT  )TC\ 2T·IWPI CNU 'T\JGT\QI &CX  8QINJ   +++ 445GJTUEJÌP





4GKEJUVCNGT)TC\2T·IWPICNU'T\JGT\QI*GTKPGMp/\#p  8QPITQ­GT5GNVGPJGKV8GTOWVNKEJWPGFKGTV5GJTUEJÌP





4GKEJUVCNGT'PUKUJGKO&CX8QINJ+XCT



132

*ÒDUEJG2CVKPCUGJTUEJÌPpXQT\ÒINKEJ


RÖMISCH-DEUTSCHES REICH

2320

2321

2322



4GKEJUVCNGT-NCIGPHWTV&CX8QINJ++



4GKEJUVCNGT-NCIGPHWTV&CX8QINJXCT



4GKEJUVCNGT,QCEJKOUVCN/ÒP\OGKUVGT)TGIQT5VGKPOÒNNGT&CX&KGVKMGT*CNCEMC 8QINJ++ 5GJTUEJÌP

2323

2324

*ÒDUEJG2CVKPCUGJTUEJÌP



5GJTUEJÌP

 

2325



4GKEJUVCNGT2TCI/ÒP\OGKUVGT$GPGFKMV*WGDOGT&CX&KGVKMGT*CNCEMC8QINJ + #VVTCMVKXGUUGJTUEJÌPGU'ZGORNCT





4GKEJUVCNGT)TC\&CX8QINJ8

5GJTUEJÌPpXQT\ÒINKEJ





4GKEJUVCNGT-$-TGOPKV\&CX8QINJ

5GJTUEJÌP

 133


RÖMISCH-DEUTSCHES REICH

2326

2328

2327



4GKEJUVCNGT0$0CI[D±P[C&CX8QINJ+



4GKEJUVCNGT2TCI/ÒP\OGKUVGT,CMQD99QNMGT&CX&KGVKMGT*CNCEMC8QINJ ++ 5GJTUEJÌPpXQT\ÒINKEJ





6CNGTHÌTOKIG 5KNDGTOGFCKNNG Q , XQP , 4QVJ -TGOPKV\ CWH FKG (TGWPFUEJCHV <YGK KPGKPCPFGTITGK   HGPFG*·PFGÒDGT5VCFVCPUKEJVFCTÒDGTFGTUVTCJNGPFG0COG,GJQXCUKP9QNMGP<YGK9CRRGPUEJKNFG CWH FGPGP FKG 0COGP ,QPCVJCP D\Y &CXKF \W NGUGP UKPF NGJPGP CP GKPGO $CWO KP .CPFUEJCHV   OOI*WU\CT2TQEQRKWU5NI)QRRGNp XIN   4(GKPG2CVKPCOKPÒDGTCTDGKVGVHCUVXQT\ÒINKEJ



2329

 5GJTUEJÌPGU'ZGORNCTOKVHGKPGT6ÌPWPI

2331



2330



(TKGFTKEJXQPFGT2HCN\ FGT9KPVGTMÌPKI -KRRGT-TGW\GT,QCEJKOUVCN/ÒP\ OGKUVGT%GPVWTKQ.GPIGHGNFGT&KGVKMGT*CNCEMC 4-N5EJTÌVNKPIUHGJNGTUGJTUEJÌP





-KRRGT-TGW\GT-WVVGPDGTI/ÒP\OGKUVGT5GDCUVKCP*ÌN\N&KGVKMGT*CNCEMC  (CUVUGJTUEJÌP





'T\JGT\QI .GQRQNF 8  4GKEJUVCNGT  'PUKUJGKO &CX  8QINJ  + XCT  

CPFGTG8QTFGTUGKVGPWOUEJTKHV  5GJTUEJÌP



134


RÖMISCH-DEUTSCHES REICH

2332

2333

2334 (doppelt)



4GKEJUVCNGT*CNN2QUVJWOG2T·IWPI&CX/6XCT8QINJ+8

8QT\ÒINKEJ





4GKEJUVCNGT*CNN2QUVJWOG2T·IWPI&CX/68QINJ+8  5GJTUEJÌPpXQT\ÒINKEJ





'T\JGT\QI(GTFKPCPF-CTN&QRRGNVGT4GKEJUVCNGTQ,  *CNNI&CX /6 *ÒDUEJG2CVKPCUGJTUEJÌPpXQT\ÒINKEJ



2335

2336

2337



(GTFKPCPF+++4GKEJUVCNGT9KGP&CX8QINJ+  2TCEJVGZGORNCT2TCEJVXQNNG2CVKPCUEJCTHCWUIGRT·IVXQT\ÒINKEJp5VGORGNINCP\



4GKEJUVCNGT/+$TGUNCW&CX(W58QINJ+



4GKEJUVCNGT,QCEJKOUVCN/ÒP\OGKUVGT&CXKF-PQDNQEJ&CX&KGVKMGT*CNCEMC 8QINJ++ 44.GKEJVÒDGTCTDGKVGVUGJTUEJÌP 

 44(GNFGTIGIN·VVGVUGJTUEJÌP

 

135


RÖMISCH-DEUTSCHES REICH

2338

2340

2339



4GKEJUVCNGT-$-TGOPKV\&CX8QINJ



4GKEJUVCNGT)TC\&CX8QINJ8



.GQRQNF+4GKEJUVCNGT-X$-TGOPKV\&CX8QINJ+

2341

5GJTUEJÌPpXQT\ÒINKEJ



(GNFFGT8QTFGTUGKVGGVYCUDGTKGDGPXQT\ÒINKEJ



2343

5GJTUEJÌP



2342



4GKEJUVCNGT-X$-TGOPKV\&CX8QINJ+

(GKPG2CVKPCUGJTUEJÌP





4GKEJUVCNGT-X$-TGOPKV\&CX8QINJ+  *ÒDUEJG2CVKPCMN5EJTÌVNKPIUHGJNGTCO4CPFUGJTUEJÌPpXQT\ÒINKEJ





-TGW\GT-$-TGOPKV\*GTKPGM

136

5GJTUEJÌPpXQT\ÒINKEJ




RÖMISCH-DEUTSCHES REICH

2345

2344 (doppelt)

2344 (doppelt)

 

&QRRGNVGT4GKEJUVCNGTQ, EC *CNNI&CX/6  (GNFGTIGIN·VVGVUGJTUEJÌPpXQT\ÒINKEJ -TGW\GT-$-TGOPKV\*GTKPGM 5VGORGNINCP\

 

2346

2347

2347



-TGW\GT-$-TGOPKV\*GTKPGM

5VGORGNINCP\



5KNDGTOGFCKNNG  XQP 2 * /ÒNNGT CWH UGKPG FTKVVG 8GTO·JNWPIOKV'NGQPQTG/CIFCNGPG6JGTGUG XQP2HCN\0GWDWTI)GJCTPKUEJVGU$TWUVDKNFFGU-CKUGTUTOKV.QTDGGTMTCP\WPFFGT-GVVGFGU1TFGPU XQO )QNFGPGP 8NKGU$ÒUVG FGT -CKUGTKP N OKV JQEJIGUVGEMVGO *CCT /KV 4CPFUEJTKHV /'/14+#   #8)856+55+/+%10+8)++#8564+#%12#.#6+0+#001ÊÊOOI(QTUVGT 5NI/QPVGPWQXQ5VGORGT *ÒDUEJG2CVKPCYKP\4CPFHGJNGTUGJTUEJÌPpXQT\ÒINKEJ





2348



5KNDGTOGFCKNNGXQP**CHHPGT0ÒTPDGTICWHFKG$GNCIGTWPIWPFFGP'PVUCV\9KGPU)TWPFTK­ FGU .CIGTU WPF 5VCFV 9KGP8GTHQNIVGU 6ÒTMGPJGGT XQT FGT 5VCFVCPUKEJV XQP 9KGP KO *KPVGTITWPF   $GTINCPFUEJCHVOKVCWHIGJGPFGT5QPPGY·JTGPFUKEJFGT*CNDOQPFJKPVGT9QNMGPXGTDKTIV/KV4CPF UEJTKHV g %#575 +0 1%%#57 Ù 2'6' 07038#/ 674%# 8+'00#/ Û  OO  I   *KTUEJ5NI/QPVGPWQXQ 44(GKPG6ÌPWPIYKP\4CPFHGJNGTXQT\ÒINKEJ

 137


RÖMISCH-DEUTSCHES REICH

2349



2350

2351

5EJCWVCNGTXQP//KVVGTOCKGTCWHFKG$GNCIGTWPIWPFFGP'PVUCV\9KGPU&GTIGMTÌPVG&QRRGN CFNGT UKV\V CWH GKPGO )NQDWU CWH FGO FKG 5VCFV 9KGP \W UGJGP KUV N QDGP UVTCJNGPFGU )QVVGUCWIG T   WPVGP WPVGTIGJGPFG /QPFUKEJGN <GKNGP 5EJTKHV  OO  I *KTUEJ  5NI /QPVGPWQXQ   8QINJ .GKEJVFG\GPVTKGTVUGJTUEJÌPpXQT\ÒINKEJ



$GK FGT XQTNKGIGPFGP /GFCKNNG JCPFGNV GU UKEJ WO GKPG 9CN\GPRT·IWPI &C CWEJ FKG UQPUVKIG )GUVCNVWPI FGT   /GFCKNNG FWTEJCWU GKPGP OÒP\·JPNKEJGP %JCTCMVGT JCV PCJO 8QINJWDGT FCU 5VÒEM KP UGKP 9GTM ÒDGT FKG   JCDUDWTIKUEJGP 6CNGT CWH &CU UVTCJNGPFG )QVVGUCWIG U[ODQNKUKGTV FKG UKGITGKEJG %JTKUVGPJGKV Y·JTGPF FKG   WPVGTIGJGPFG/QPFUKEJGNHÒTFKGIGUEJNCIGPGP6ÒTMGPUVGJV



5KNDGTOGFCKNNG  XQP , , 9QNTCD CWH FKG 'KPPCJOG XQP 1HGP $WFC  5VCFVCPUKEJV QDGP FCU   $TWUVDKNF .GQRQNFU + KP .QTDGGTMTCP\ ÒDGT IGMTGW\VGP 2CNO\YGKIGP&GT -CKUGT CNU ,QUWC UVGJV X X   KP 4ÒUVWPI OKV <GRVGT WPF 5EJKNF QDGP N 5QPPG KP 9QNMGP T UKPMGPFGT *CNDOQPF KO *KPVGTITWPF   5EJNCEJVU\GPG/KV4CPFUEJTKHVOOI2QRGNMC5NI/QPVGPWQXQ  4-N4CPFHGJNGTHCUVXQT\ÒINKEJ 



5KNDGTOGFCKNNG  XQP ) *CWVUEJ WPF . ) .CWHHGT CWH FKG -TÌPWPI UGKPGU 5QJPGU ,QUGH UR·VGT   -CKUGT,QUGH+ \WOTÌOKUEJGP-ÌPKIKP#WIUDWTI)GMTÌPVGU$TWUVDKNF,QUGHUHCUVXXKO MÌPKINKEJGP )GYCPF&GT -ÌPKI MPKGV T WPF DGVGV QDGP UVTCJNGPFGU 5[ODQN FGT &TGKHCNVKIMGKV /KV   4CPFUEJTKHVÈ&'852#64+568+'4+6#&+86146885'6$'0'&+%'66+$+Û)'0Û:.+:Û OOI5NI/QPVGPWQXQ 4(GKPG2CVKPCYKP\4CPFHGJNGTUGJTUEJÌPpXQT\ÒINKEJ



2352 2353



 138

2353

5KNDGTOGFCKNNG  XQP ) *CWVUEJ WPF . ) .CWHHGT CWH FKG -TÌPWPI UGKPGU 5QJPGU ,QUGH UR·VGT   -CKUGT ,QUGH +   \WO TÌOKUEJGP -ÌPKI KP #WIUDWTI $TWUVDKNF ,QUGHU T OKV .QTDGGTMTCP\   WPF KO MÌPKINKEJGP )GYCPF5·WNGPJCNNG WPF 8QTJCPI KP FGT /KVVG -TÌPWPIUKPUKIPKGP CWH GKPGO   -KUUGP/KV4CPFUEJTKHVÈ#/14'Û'6Û6+/14'OOI5NI/QPVGPWQXQ  5GJTUEJÌP



4GKEJUVCNGT)TC\&CX8QINJ+8



*GTTNKEJG2CVKPC<CKPGPFGXQT\ÒINKEJ


RÖMISCH-DEUTSCHES REICH

2354 (doppelt)

2355

2356



&QRRGNVGT4GKEJUVCNGTQ, PCEJ *CNNI&CX/6  *ÒDUEJG2CVKPC(GNFGTVGKNYGKUGIGIN·VVGVUGJTUEJÌPpXQT\ÒINKEJ





4GKEJUVCNGT%$$TKGI9CTFGKP%JTKUVQRJ$TGVVUEJPGKFGT&CX(W58QINJ+ 45GJTUEJÌP





4GKEJUVCNGT-$-TGOPKV\&CX8QINJ8+



5GJTUEJÌPpXQT\ÒINKEJ

2358

2357

2357



4GKEJUVCNGT%$$TKGI9CTFGKP%JTKUVQRJ$TGVVUEJPGKFGT&CX(W58QINJ++ 442CVKPCYKP\5EJTÌVNKPIUHGJNGT4ÒEMUGKVGGVYCUTCWJUGJTUEJÌPpXQT\ÒINKEJ





5KNDGTOGFCKNNG  WPUKIPKGTV XQP 2 * /ÒNNGT CWH UGKPGP 6QF WPFFGP4GIKGTWPIUCPVTKVV,QUGHU+ #WHGKPGO2QUVCOGPVFGTCWHIGUVGNNVG5CTMQRJCIFCTCWHFTGK-TQPGPCWHFGO2QUVCOGPVUGEJU<GKNGP 5EJTKHVKO8QTFGTITWPFNKGIVFKGVTCWGTPFG)GTOCPKCPCEJTFKG4GEJVGCWHFGPÌUVGTTGKEJKUEJGP9CR RGPUEJKNF IGNGJPV)GTOCPKC UKV\V PCEJ N OKV #FNGT WPF JWNFKIV FGO WPVGT GKPGO $CNFCEJKP XQT KJT   UVGJGPFGP -CKUGT ,QUGH + KP -TÌPWPIUQTPCV QDGP UEJYGDV GKPG YGKDNKEJG)GUVCNVCWHGKPGT9QNMGWPF J·NV GKPGP QXCNGP 5EJKNF OKV FGO 2QTVT·V .GQRQNFU + /KV 4CPFUEJTKHV È 8+8+5 '4'2685 2#64+“   2#6'4&+885.'121.&85+0+15'2*1(+.+14'&+8+885OOI(QTUVGT 5NI/QPVGPWQXQ /KPDGTKGDGPXQT\ÒINKEJ

 139


RÖMISCH-DEUTSCHES REICH

2361

2359

2360



&KG /CNMQPVGPVGP #WHUVCPF WPVGT (TCP\4CMQE\[4GKEJUVCNGT-$-TGOPKV\ *GTKPGM 5GJTUEJÌP





,QUGH+4GKEJUVCNGT*CNN8CTKCPVGOKVYKP\KIGO/ÒP\OGKUVGT\GKEJGP+#-COWPVG TGP4CPFFGT8QTFGTUGKVG&CX/68QINJ+ 8QT\ÒINKEJp5VGORGNINCP\





5KNDGTOGFCKNNG  WPUKIPKGTV CWH FKG 'KPPCJOG XQP .KNNG FWTEJ 2TKP\ 'WIGP XQP 5CXQ[GP WPF FGP   *GT\QIXQP/CTNDQTQWIJ#PUKEJVFGTDGUEJQUUGPGP5VCFVFCTÒDGTUVTCJNGPFG5QPPGKO#DUEJPKVVFTGK <GKNGP 5EJTKHV6WTO \W $CDGN *QEJOWV MQOOV XQT FGO (CNN  KO #DUEJPKVV HÒPH <GKNGP5EJTKHV/KV 4CPFUEJTKHVr80+6#8+46858#.'6ÛOOI5NI,WNKWU5NI/QPVGPWQXQpX .QQP+85 (GNFGTCNVIGIN·VVGVWPFOKVCNVGT2WP\GUGJTUEJÌPpXQT\ÒINKEJ



2362

2363 (doppelt)

2363 (doppelt)



4GKEJUVCNGT$TGUNCW&CX(W58QINJ+8  44#VVTCMVKXGU'ZGORNCTOKVHGKPGT2CVKPCHCUVXQT\ÒINKEJ





-CTN8+&QRRGNVGT4GKEJUVCNGTQ,*CNNI&CX/6  *ÒDUEJG2CVKPCXQT\ÒINKEJ



140


RÖMISCH-DEUTSCHES REICH

2365

2364

2366



4GKEJUVCNGTQ,*CNN/6



4GKEJUVCNGT*CNN&CX/68QINJ+

8QT\ÒINKEJ



2TCEJVGZGORNCT(CUV5VGORGNINCP\



5GJTUEJÌPpXQT\ÒINKEJXQT\ÒINKEJ



&KG4GKEJUVCNGTXQPCWU*CNNVTCIGPPQEJFCU$TWUVDKNF,QUGHU+



4GKEJUVCNGT*CNN&CX/68QINJ+

2368

2367

2369



4GKEJUVCNGT5KGDGPDÒTIGP*GTKPGM

442CVKPCMN5EJTÌVNKPIUHGJNGTUGJTUEJÌP



4GKEJUVCNGT$TGUNCW&CX(W58QINJ+++



4GKEJUVCNGT  *CNN +P 752NCUVKMJQNFGT FGT 2%)5 OKV FGT $GYGTVWPI #7  &CX  /6   8QINJ++ 8QT\ÒINKEJ

2CVKPCHCUVXQT\ÒINKEJ

   141


RÖMISCH-DEUTSCHES REICH

2371

2370



4GKEJUVCNGT5KGDGPDÒTIGP*GTKPGM

44'VYCUDGTKGDGPUGJTUEJÌP





-TGW\GT2TCI/ÒP\OGKUVGT(GTFKPCPF5EJCTHH&KGVKMGT*CNCEMC  4-N5EJTÌVNKPIUHGJNGTCO4CPF5VGORGNINCP\



2373

2372

2372



4GKEJUVCNGT*CNN&CX/68QINJ8



 -TGW\GT  ,CJTGU\CJN KO 5VGORGN CWU  IG·PFGTV  2TCI /ÒP\OGKUVGT (GTFKPCPF 5EJCTHH   &KGVKMGT*CNCEMC (CUV5VGORGNINCP\

2374

   142

2375

4GKEJUVCNGT*CNN&CX/68QINJ8 -TGW\GT*CNN/6XCT 4GKEJUVCNGT-$-TGOPKV\&CX8QINJ+8

 *GTTNKEJG2CVKPCXQT\ÒINKEJp5VGORGNINCP\

 

2376

8QT\ÒINKEJ 5VGORGNINCP\ (CUVXQT\ÒINKEJ

  


RÖMISCH-DEUTSCHES REICH

2377



2379

2378

/CTKC6JGTGUKC5KNDGTOGFCKNNGQ,  XQP*(WEJUCWHFGP(TKGFGPXQP&TGUFGP $TWUVDKNF T OKV &KCFGO WPF WOIGNGIVGO /CPVGN.QTDGGT\YGKI WPF 5EJYGTV IGMTGW\V FCJKPVGT (ÒNN   JQTPCWUFGO/ÒP\GPHCNNGPOOI2CZKP0WOOKU5NI/QPVGPWQXQ  5GJTUEJÌPpXQT\ÒINKEJ



5KNDGTOGFCKNNG XQP+9WTUEJDCWGTCWHFKG5VKHVWPIFGU/CTKC6JGTGUKC1TFGPU$TWUVDKNFGTFGU -CKUGTRCCTGUPGDGPGKPCPFGTT)GPKWUUVGJV\YKUEJGP#TOCVWTGPKPFGT4GEJVGP1TFGPKPFGT.KPMGP 2CNO\YGKIOOI5NI/QPVGPWQXQ *GTTNKEJG2CVKPCXQT\ÒINKEJ



5KNDGTOGFCKNNGXQP(:9ÒTVJCWHFKG5VGWGTTGHQTOKP5KGDGPDÒTIGP$TWUVDKNFOKV9KVYGPUEJNGK GTT5VGJGPFG(TCWNGIV/ÒP\GPKPFKG9CCIGFGTUKV\GPFGP#GSWKVCUNKPMU-PCDGWPF9CRRGPOO I5NI/QPVGPWQXQ *GTTNKEJG2CVKPCMN-TCV\GTKO(GNFFGT4ÒEMUGKVGXQT\ÒINKEJ



#O&G\GODGTYWTFGKP&TGUFGPGKP(TKGFGPUXGTVTCI\YKUEJGP2TGW­GP¤UVGTTGKEJWPF5CEJUGPIGUEJNQU UGP FGT FGP \YGKVGP UEJNGUKUEJGP -TKGI DGGPFGVG &GT UQIGPCPPVG (TKGFGP XQP &TGUFGP DGUV·VKIVG 2TGW­GP FGP   $GUKV\XQP5EJNGUKGPWPF(TCP\+'JGOCPP/CTKC6JGTGUKCUYWTFGXQP(TKGFTKEJ++CNU-CKUGTCPGTMCPPV,GFQEJ YKTMVGUKEJFGTIGUEJNQUUGPG(TKGFGPUXGTVTCIHÒT5CEJUGPPGICVKXCWUFCWPVGTCPFGTGOGKPG-TKGIUGPVUEJ·FKIWPICP 2TGW­GPIG\CJNVYGTFGPOW­VGWPF<QNNUVTGKVKIMGKVGP\W7PIWPUVGP5CEJUGPUGPVUEJKGFGPYWTFGP





2380



5KNDGTOGFCKNNGXQP/-TCHHVCWHKJTG)GPGUWPIXQPFGP2QEMGP$TWUVDKNFTOKV9KVYGPUEJNGKGT 2TQXKFGPVKC5CVWTPWPF/KPGTXCWOFGPÌUVGTTGKEJKUEJGP5EJKNFQDGPUVTCJNGPFGU)QVVGUCWIGOO I5NI/QPVGPWQXQ #VVTCMVKXGUXQT\ÒINKEJGU'ZGORNCT

 143


RÖMISCH-DEUTSCHES REICH

2383

2381



2381

5KNDGTOGFCKNNGXQP/-TCHHVCWHKJTG)GPGUWPIXQPFGP2QEMGP$TWUVDKNFTOKV9KVYGPUEJNGKGT 2TQXKFGPVKC5CVWTPWPF/KPGTXCWOFGPÌUVGTTGKEJKUEJGP5EJKNFQDGPUVTCJNGPFGU)QVVGUCWIGOO I5NI/QPVGPWQXQ -N4CPFHGJNGTHCUVXQT\ÒINKEJ





-TQPGPVCNGT$TÒUUGN&CX Z &GNO Z '[RGNVCWGT Z   5VÒEM.GKEJVLWUVKGTVHCUVXQT\ÒINKEJ





-QPX6CNGT#5*CNN'[RGNVCWGT/6



2TCEJVXQNNG2CVKPCXQT\ÒINKEJ

2386

2384

2385



-QPX6CNGT+%(#9KGP'[RGNVCWGT



(TCP\+-TGW\GT242TCI/ÒP\OGKUVGT2CXGN'TFOCPP&KGVKMGT*CNCEMC *GTKPGM 5VGORGNINCP\



,QUGH++.KCTFU$TÒUUGN,

2387

5GJTUEJÌPpXQT\ÒINKEJ

2TCEJVGZGORNCT(CUV5VGORGNINCP\

  

2388



$GNIKUEJGT#WHUVCPF.KQPF #TIGPV$TÒUUGN&CX,  *ÒDUEJG2CVKPCMN5EJTÌVNKPIUHGJNGTXQT\ÒINKEJ





.KQPF #TIGPV$TÒUUGN&CX,  -N-TCV\GTKO(GNFFGT8QTFGTUGKVGUGJTUEJÌPpXQT\ÒINKEJ



144


RÖMISCH-DEUTSCHES REICH

2389

2391

2390



.KQPF #TIGPV$TÒUUGN&CX,

5GJTUEJÌP





(TCP\++-TQPGPVCNGT#9KGP&CX,  8QT\ÒINKEJXQT\ÒINKEJp5VGORGNINCP\





-TQPGPVCNGT*)ÒP\DWTI&CX,



'VYCUDGTKGDGPHCUVXQT\ÒINKEJ

2392

2393

2393



-TQPGPVCNGT%2TCI&CX,



5KNDGTOGFCKNNGXQP2$CNFGPDCEJCWHFGP5KGIUGKPGU$TWFGTU'T\JGT\QI-CTN.WFYKI,QJCPPDGK 5VQEMCEJ$ÒUVG-CTNUNOKVCPVKMGO(GFGTJGNO8KEVQTKCOKV-TCP\WPF2CNO\YGKIXXCWH2QUVCOGPV FCXQT'WNGOKV#TOCVWTGPOOI5NI/QPVGPWQXQ 9KP\-TCV\GTXQT\ÒINKEJ

2394

 

*ÒDUEJG2CVKPCHCUVXQT\ÒINKEJXQT\ÒINKEJ





2395

5QNFK -TGW\GT (*CNNHÒT)ÌT\WPF)TCFKUMC, 8QT\ÒINKEJp5VGORGNINCP\ -TGW\GT%2TCI, ªDGTRT·IWPIUURWTGP5VGORGNINCP\

  145


KAISERREICH ÖSTERREICH

2398

2396



2397

-QPX6CNGT#9KGP&CX,-CJPV  42TCEJVXQNNG2CVKPCXQT\ÒINKEJXQT\ÒINKEJp5VGORGNINCP\



-#+5'44'+%*¤56'44'+%* 

(TCP\+-QPX6CNGT#9KGP&CX,-CJPV  (GKPG2CVKPCXQT\ÒINKEJ5VGORGNINCP\





5KNDGTOGFCKNNG  XQP , FG .GTEJGPCW CWH FGP $GUWEJ FGU -CKUGTRCCTGU KP 2TCI $TWUVDKNFGT XQP   (TCP\ + WPF UGKPGT )GOCJNKP -CTQNKPG #WIWUVG XQP $C[GTP PGDGPGKPCPFGT T)GMTÌPVGT .ÌYG OKV   <GRVGTNKGIVPCEJTKO*KPVGTITWPFDGMT·P\VGT1DGNKUMOKVCPIGDTCEJVGO5EJKNFCWHFGPGPFKG+PKVKCNGP FGU-CKUGTRCCTGU\WNGUGPUKPFQDGPIGMTÌPVGT&QRRGNCFNGTOKV<GRVGTWPF4GKEJUCRHGNKPFGP(·PIGP WOJGTXKGT5·WNGPOKVDTGPPGPFGP.CORGPOOI5NI/QPVGPWQXQ  *GTTNKEJG2CVKPCYKP\4CPFHGJNGTXQT\ÒINKEJ



2399



(GTFKPCPF+$TQP\GOGFCKNNGXQP-.CPIGCWHFGP&KTGMVQTFGU9KGPGT/ÒP\WPF #PVKMGPMCDKPGVVUUQYKGFGUI[RVKUEJGP/WUGWOU/QTKV\)TCHXQP&KGVTKEJUVGKP Ó9KF OWPI FGT $GCOVGP FGT XQP &KGVTKEJUVGKP IGNGKVGVGP +PUVKVWVKQPGP $ÒUVG T<YGK )TGKHGP JCNVGP IG   MTÌPVGU9CRRGPUEJKNFOKV1TFGPUMGVVGOO5NI/QPVGPWQXQ 8QT\ÒINKEJp5VGORGNINCP\ /KVQTKIKPCNGOXKGTUGKVKIGP2TQURGMVFGT/GFCKNNG

146




KAISERREICH ÖSTERREICH

ex 2400

2401

2402



.QV-QPX6CNGT###&CX,-CJPV  5VÒEM5GJTUEJÌPpXQT\ÒINKEJ Z WPFXQT\ÒINKEJ





4GXQNWVKQP KP 7PICTP  )WNFGP  <CITGD 5QIGPCPPVGT ,GNCEKE)WNFGP 2T·IWPI FGT   #WHUV·PFKUEJGPKP-TQCVKGP5NI*QTUM[ 45GJTUEJÌPpXQT\ÒINKEJ



-W-TCLE\±T0$0CI[D±P[C,



,QUGRJ )TCH ,GNCEKE XQP $W\KO  2GVGTYCTFGKPÓ YCT ÌUVGTTGKEJKUEJGT )GPGTCN 'T HÒJTVG   CNU $CPWU XQP -TQCVKGP WPF 5NCYQPKGP  FKG MCKUGTVTGWGP MTQCVKUEJGP )TGP\VTWRRGP IGIGP FKG WPICTKUEJG   4GXQNWVKQP



8QT\ÒINKEJp5VGORGNINCP\

2403

1,5:1



1,5:1

(TCP\,QUGH+-QPX6CNGT )WNFGP #9KGP,  44-CDKPGVVUVÒEM2TCEJVXQNNG2CVKPCHCUV5VGORGNINCP\



2404 1,5:1



1,5:1

-TGW\GT'-CTNUDWTI2TQDGOKVINCVVGO4CPFI,  8QPITQ­GT5GNVGPJGKV-CDKPGVVUVÒEM2TCEJVXQNNG2CVKPCHCUV5VGORGNINCP\

 147


KAISERREICH ÖSTERREICH

2406

2405



5EWFQ88GPGFKI&CX,



&QRRGNIWNFGP#9KGPCWHUGKPG8GTO·JNWPIOKV'NKUCDGVJXQP$C[GTP&CX,-CJPV 8QT\ÒINKEJp5VGORGNINCP\

48QT\ÒINKEJ

 

2407



5KNDGTOGFCKNNG  XQP - .CPIG CWH UGKPG 8GTO·JNWPI OKV 'NKUCDGVJ #OCNKG 'WIGPKG 5KUK    6QEJVGT /CZKOKNKCPU *GT\QI KP $C[GTP

 Ó  $TWUVDKNFGT FGU 2CCTGU PGDGPGKPCPFGT T   'KPUGIPWPI FWTEJ FGP 'T\DKUEJQH KP FGT *QHMCRGNNG KP 9KGP  OO  I 5NI /QPVGPWQXQ   9KVV *GTTNKEJG2CVKPCXQT\ÒINKEJ

'NKUCDGVJ IGDQTGP CO  &G\GODGT  YCT FKG 6QEJVGT FGU XQNMUVÒONKEJGP *GT\QIU /CZ KP $C[GTP WPF FGT   .WFQXKMG9KNJGNOKPG6QEJVGT-ÌPKI/CZKOKNKCP+,QUGRJU&KGJÒDUEJG'NKUCDGVJYWTFGCO#RTKNOKV -CKUGT (TCP\ ,QUGH + XQP ¤UVGTTGKEJ XGTO·JNV WPF PCJO \WP·EJUV ITQ­GP 'KPHNW­ CWH FKG 2QNKVKM FGU /QPCTEJGP   &CFWTEJIGTKGVUKGKP-QPHNKMVOKVKJTGT5EJYKGIGTOWVVGT5QRJKGFGT5EJYGUVGTKJTGTGKIGPGP/WVVGT#O/·T\ YWTFGFKG'T\JGT\QIKP5QRJKGIGDQTGPFKGLGFQEJPQEJCNU-NGKPMKPFCO/CKKP$WFCRGUVXGTUVCTD #O  #RTKN  MCO FGT NCPIGTUGJPVG 6JTQPHQNIGT -TQPRTKP\ 4WFQNH \WT 9GNV 5GKV FGO KVCNKGPKUEJGP -TKGI    DGICPP FKG 'PVHTGOFWPI \YKUEJGP FGO-CKUGTWPFUGKPGT)GOCJNKPFKGKO8QNMUOWPF5KUK QFGT5KUUK  IGPCPPVYWTFG&KG-CKUGTKPDGICPPGKPGCWUIGFGJPVG4GKUGV·VKIMGKVWPFJKGNVUKEJIGTPGKP7PICTPWPFKO5EJNQ­ #EJKNNGKQPCWH-QTHWCWH5KGUGV\VGUKEJDGUQPFGTUHÒTFKG+PVGTGUUGPFGT7PICTPGKPWPFYWTFGOKVKJTGO)CVVGP CO  ,WPK  KP $WFCRGUV OKV FGT 5VGRJCPUMTQPG IGMTÌPV 'KP UEJYGTGT 5EJNCI YCT HÒT FKG -CKUGTKP FGT   5GNDUVOQTF KJTGU 5QJPGU FGU -TQPRTKP\GP 4WFQNH CO  ,CPWCT  XQP FGO UKG UKEJ KO )TWPFG PKEJV OGJT   GTJQNVG5KGJKGNVUKEJPCEJFGO6QFKJTGU5QJPGUPWTPQEJUGNVGPKP9KGPCWH#O5GRVGODGTYWTFGUKGKP )GPHXQPFGOKVCNKGPKUEJGP#PCTEJKUVGP.WKIK.WEEJGPKGTFQNEJV



2408



148

5KNDGTOGFCKNNG  XQP % 4CFPKV\M[ CWH FKG #WHHQTFGTWPI FGU -CKUGTU CP FKG -KTEJGPHÒTUVGP \WT   &WTEJHÒJTWPIFGUOKVFGO*GKNKIGP5VWJNIGUEJNQUUGPGP-QPMQTFCVU%JTKUVWUUVGJVXXOKVGTJQDGPGT 4GEJVGP WPF 4GKEJUCRHGNKPFGT.KPMGPXQTKJOMPKGPFGT2CRUVWPF-CKUGT(TCP\,QUGH+<GKNGP 5EJTKHVOOI5NI*QTUM[5NI/QPVGPWQXQp  2TCEJVGZGORNCT*GTTNKEJG2CVKPCXQT\ÒINKEJp5VGORGNINCP\




KAISERREICH ÖSTERREICH

2409



5KNDGTOGFCKNNGXQP95GKFCPCWHFKG,CJTHGKGTFGU/CTKC6JGTGUKC1TFGPU$TWUVDKNF/CTKC 6JGTGUKCU T1TFGP FCJKPVGT 5EJYGTV WPF .QTDGGT\YGKI IGMTGW\V  OO  I 5NI *QTUM[   XIN FQTVKP)QNF 5NI/QPVGPWQXQp  2TCEJVGZGORNCT*GTTNKEJG2CVKPCXQT\ÒINKEJp5VGORGNINCP\

2410



2411



8GTGKPUVCNGT//CKNCPF&CX,-CJPV6JWP  5GNVGPDGUQPFGTUKPFKGUGT'TJCNVWPI8QT\ÒINKEJp5VGORGNINCP\





&QRRGNIWNFGP88GPGFKI&CX,-CJPV6JWP



44(CUVXQT\ÒINKEJ

2413

2412





2412

5KNDGTOGFCKNNG  XQP % 4CFPKV\M[ CWH FKG 'KPYGKJWPI FGU 'T\JGT\QI-CTN&GPMOCNU KP 9KGP   7PKHQTOKGTVGU $TWUVDKNF FGU 'T\JGT\QIU N#PUKEJV FGU &GPMOCNU  OO  I 5NI /QPVG   PWQXQXIN FQTVKP$TQP\GWPFXQP  *GTTNKEJG2CVKPCYKP\-TCV\GTHCUV5VGORGNINCP\ &QRRGNVGT8GTGKPUVCNGT#9KGP&CX,-CJPV6JWP  4(GKPG6ÌPWPIHCUV5VGORGNINCP\

  149


KAISERREICH ÖSTERREICH

2414



&QRRGNVGT8GTGKPUVCNGT#9KGP&CX,-CJPV6JWP

2415 1,5:1



(CUVXQT\ÒINKEJ



1,5:1

)WNFGP (TCPMGP 9KGP2TQDGKP5KNDGTOKVINCVVGO4CPFI8QO8QTFGTUGKVGPUVGORGN FGU CD  CWUIGRT·IVGP  )WNFGP5VÒEMGU WPF XQO 4ÒEMUGKVGPUVGORGN FGU UGKV  CWUIGRT·IVGP   -TGW\GT5VÒEMGU, 8QTFGTUGKVG  4ÒEMUGKVG  8QPCNNGTITÌ­VGT5GNVGPJGKV8QT\ÒINKEJ 

2417

2416



)WNFGP (QTKPV );(-CTNUDWTI,



-TGW\GT9KGP,

445GJTUEJÌP



4(CUV5VGORGNINCP\



2418



5KNDGTOGFCKNNG  XQP ( .GKUGM CWH FKG ,CJTHGKGT FGT <WIGJÌTKIMGKV 6TKGUVU \W ¤UVGTTGKEJ   7PKHQTOKGTVGU $TWUVDKNF T#EJV <GKNGP 5EJTKHV QDGP 5VCFVYCRRGP WPVGP 5EJKHHUUEJPCDGN  OO   I5NI*QTUM[ 442TCEJVGZGORNCTXQPRQNKGTVGP5VGORGNP(CUV5VGORGNINCP\

2419



2420



-TCLE\±T-$-TGOPKV\2TQDGKP#NWOKPKWOI,p \W 48QT\ÒINKEJp5VGORGNINCP\





-TQPG9KGP,



150

449KP\-TCV\GTXQT\ÒINKEJ


REPUBLIK Ã&#x2013;STERREICH

2421



6CNGT PCEJ FGO 6[R FGT 5V)GQTIUVCNGT/KNNGPKWORT·IWPI\WT,CJTVCWUGPFHGKGTFGT.CPFPCJOG XQP7PICTP&CXp*GTKPGM,p 40WT'ZGORNCTGIGRT·IV8QT\Ã&#x2019;INKEJ



2422



$TQP\GOGFCKNNGXQP#*CTVKIIGHGTVKIVKO#WHVTCIFGU(NQVVGPXGTGKPUHÃ&#x2019;T-TKGIUHÃ&#x2019;TUQTIG$TWUV DKNF FGU 'T\JGT\QIU -CTN (TCP\ ,QUGRJ UR·VGT -CKUGT -CTN +   N KP /CTKPGWPKHQTO&CU   -TKGIUUEJKHH5/56GIGVVJQHHCWH5GGOO9WT\DCEJ 8QT\Ã&#x2019;INKEJp5VGORGNINCP\

2423



2424

4'27$.+-¤56'44'+%* 

4GRWDNKMUGKV5EJKNNKPI,



5EJKNNKPI,

2426



)TQUEJGP,



5EJKNNKPI/CTKC\GNN,

2425

42QNKGTVG2NCVVG



2QNKGTVG2NCVVG



8QT\Ã&#x2019;INKEJp5VGORGNINCP\



2QNKGTVG2NCVVG



2426

151


GEISTLICHKEIT

2427

  

2429

5EJKNNKPI, 5EJKNNKPI%CTN#WGTXQP9GNUDCEJ, 5EJKNNKPI6KTQNGT(TGKJGKV,

2428

2QNKGTVG2NCVVG 42QNKGTVG2NCVVG 2QNKGTVG2NCVVG

  

.165*#$5$74) 

'T\JGT\QI(GTFKPCPF4GKEJUVCNGTQ,'PUKUJGKO &CX 'T\JGT\QI/CZKOKNKCPCNU*QEJOGKUVGT FGU &GWVUEJGP 1TFGPU 4GKEJUVCNGT  *CNN &CX   4WFQNH ++ 4GKEJUVCNGT  *CNN &CX     WPF 4GKEJUVCNGT  -$ -TGOPKV\ &CX   .GQRQNF + 4GKEJUVCNGT  -$ -TGOPKV\  

&CX   (GTFKPCPF +++ 4GKEJUVCNGT  -X$ -TGOPKV\ &CX   'T\JGT\QI .GQRQNF 8   4GKEJUVCNGT  *CNN &CX   .GQRQNF + 4GKEJUVCNGT  *CNN &CX   -CTN 8+   4GKEJUVCNGT *GTKPGM (TCP\,QUGH+&QRRGNIWNFGP# 6JWP   5VÒEM6GKNYGKUGOKVMN(GJNGTPOGKUVUGJTUEJÌP 



-NGKPG5COONWPIXQPJCDUDWTIKUEJGP/ÒP\GPFGU,CJTJWPFGTVUXQO-TGW\GTDKU\W-TGW \GTP+PVGTGUUCPVGU.QVDKVVGDGUKEJVKIGP 5VÒEM9GPKIGOKVMN(GJNGTPOGKUVUGJTUEJÌP





4GKEJUVCNGT Q , *CNN 4GKEJUVCNGT  *CNN 4GKEJUVCNGT  *CNN 4GKEJUVCNGT  2TCI   4GKEJUVCNGT2TCI4GKEJUVCNGT*CNN 5VÒEM/GKUVUGJTUEJÌP





7OHCPITGKEJGU .QV XQP JCDUDWTIKUEJGP  -TGW\GT5VÒEMGP FGU  ,CJTJWPFGTVU +PVGTGUUCPVGU .QV   DKVVGDGUKEJVKIGP 5VÒEM5EJÌPpUGJTUEJÌP 



/CTKC6JGTGUKC5KNDGTOGFCKNNGXQP,09ÒTVJCWHFKG8GTNGIWPIFGTWPICTKUEJGP7PKXGTUKV·V XQP 6[TPCW PCEJ 1HGP  OO  I 5NI /QPVGPWQXQ  (TCP\ ,QUGH + 5KNDGTOGFCKNNG    XQP + / 5EJCTHH \W 'JTGP FGU ÌUVGTTGKEJKUEJGP (GNFOCTUEJCNNU ,QUGRJ )TCH XQP 4CFKV\M[ 

6T\GDPKV\ $ÌJOGP Ó/CKNCPFOOI5NI/QPVGPWQXQWPF5KNDGT OGFCKNNGXQP%4CFPKV\M[CWHFKG7PVGT\GKEJPWPIFGU-QPMQTFCVUKP9KGPOOI 5NI*QTUM[ 5VÒEM/KVMN(GJNGTPUGJTUEJÌPpXQT\ÒINKEJ



2435

&+')'+56.+%*-'+6+0&'0*#$5$74)+5%*'0'4$.#0&'0 $4+:'0$+567/ 

152

5GFKUXCMCP\5KNDGTOGFCKNNGXQP,,0GWUUF#FNGTXXFGP-QRHPCEJNIGYCPFV OKV SWGT IGJCNVGPGO $KUEJQHUUVCD &QOMCRKVGNYCRRGP  WOJGT  9CRRGP FGT &QOJGTTGP#PUKEJV   FGT$TKZGPGT&QOMKTEJGOOI)WOOGTGTKP*CNNGT/ÒP\DN·VVGT$CPF+++/·T\ <GRGTPKEM 9KP\5EJTÌVNKPIUHGJNGTCO4CPFXQT\ÒINKEJ




GEISTLICHKEIT

2436

2437

2438

)¤669'+)#$6'+ 

)QVVHTKGF $GUUGN  5KNDGTOGFCKNNG  XQP 2 % $GEMGT CWH FKG 9KGFGTJGTUVGNNWPI FGU   5VKHVU PCEJ FGO $TCPF $TWUVDKNF T KP IGKUVNKEJGO 1TPCV#PUKEJVFGTPGWGP5VKHVUIGD·WFGOO I5NI*QTUM[<GRGTPKEM 4-N-QTTQUKQPUUVGNNGPXQT\ÒINKEJ



1./ª6<$+567/5'+6'4<$+567/ 

-CTN+++XQP.QVJTKPIGP4GKEJUVCNGT&CX5WEJQOGN8KFGOCP  *ÒDUEJG2CVKPCXQT\ÒINKEJ





4GKEJUVCNGT&CX5WEJQOGN8KFGOCP



5GJTUEJÌPpXQT\ÒINKEJ

2439

2440



2440

#PVQP 6JGQFQT XQP %QNNQTGFQ  -QPX6CNGT  &CX  5WEJQOGN8KFGOCP    -CDKPGVVUVÒEM2TCEJVXQNNG2CVKPCHCUV5VGORGNINCP\ 

24#)'4<$+567/ 

9GP\GN .GQRQNF %JNWOG\CPUM[  5KNDGTOGFCKNNG  XQP ( 2WVKPCVK CWH FKG    ,CJTHGKGT FGT *GKNKIURTGEJWPI 5V 0GRQOWMU 0GWP <GKNGP 5EJTKHV \YKUEJGP <YGKIGP#PUKEJV FGT   &QOMKTEJGOOI5NI*QTUM[ 9KP\4CPFHGJNGTHCUVXQT\ÒINKEJ

 153


GEISTLICHKEIT

1,5:1

2441

1,5:1

5#.<$74)-¤0+).+%*'/<56 

*GKPTKEJ ++  &GPCT Q ,    I 78*%858+7% -TGW\ KP FGP 9KPMGNP   FTGK2WPMVG&TGKGEM&TGKGEM-TGKU 5%481&&685.GVVGTPMKTEJGOKV/ÒP\OGKUVGT\GKEJGPWPF \YGK5VWHGP*CJPC 44'VYCUWPTGIGNO·­KIGT5EJTÌVNKPIUQPUVHCUVXQT\ÒINKEJGU'ZGORNCT



&CU XQTNKGIGPFG 'ZGORNCT KUV JÌEJUVYCJTUEJGKPNKEJ UVGORGNINGKEJ OKV FGO DGK 9 4 1 *CJP CDIGDKNFGVGP 6[R   +8$C

2442

2443

2443

5#.<$74)'4<$+567/ 

-QPTCF +  *CNDDTCMVGCV .CWHGP  I $TWUVDKNF FGU'T\DKUEJQHUXXOKV-TWOOUVCD WPFUGIPGPFGT.KPMGP&TGKVÒTOKIGU-KTEJGPIGD·WFGOKV-TGW\KO6QT%0#+# 45GJTUEJÌP



2CTKUXQP.QFTQP4GKEJUVCNGT&CX<ÌVVN

ex 2444



2445

(CUVXQT\ÒINKEJ

 

2446

)WKFQDCNF XQP 6JWP WPF *QJGPUVGKP  4GKEJUVCNGT  &CX  <ÌVVN  &C\W   ,QJCPP'TPUVXQP6JWPWPF*QJGPUVGKP-TGW\GT-TGW\GT-TGW\GT  5VÒEM8QT\ÒINKEJ





,QJCPP'TPUVXQP6JWPWPF*QJGPUVGKP4GKEJUVCNGT&CX<ÌVVN  8QT\ÒINKEJ





(TCP\#PVQPXQP*CTTCEJ4GKEJUVCNGT&CX<ÌVVN  45GJTUEJÌPpXQT\ÒINKEJ



154


GEISTLICHKEIT

2447

2448

2449



.GQRQNF#PVQP'NGWVJGTKWUXQP(KTOKCP4GKEJUVCNGT&CX<ÌVVN  *GTTNKEJG2CVKPCXQT\ÒINKEJ





5KIKUOWPF+++XQP5EJTCVVGPDCEJ-QPX6CNGT&CX<ÌVVN  9KP\5EJTÌVNKPIUTK­HGKPG2CVKPCXQT\ÒINKEJ





-QPX6CNGT8CTKCPVGQJPG5KIPCVWT/-WPVGTFGO$TWUVDKNF&CX<ÌVVN  5GJTUEJÌPpXQT\ÒINKEJ



2450



2452

2451

*KGTQP[OWUXQP%QNNQTGFQ-QPX6CNGT#PVTKVVUVCNGT&CX<ÌVVN  4(GKPG2CVKPCOKPLWUVKGTVUGJTUEJÌPpXQT\ÒINKEJ



5#.<$74)-74(ª456'067/ 

(GTFKPCPF-QPX6CNGT&CX<ÌVVN

8QT\ÒINKEJp5VGORGNINCP\



5#.<$74)56#&6 

2TCIGT )TQUEJGP Q , FGU DÌJOKUEJGP -ÌPKIU 9GP\GN +++ +8   OKV )GIGPUVGORGN XQP   5CN\DWTICWHFGT8QTFGTUGKVG5VCFYCRRGP IGURCNVGPGT5EJKNF -TWU[5  4)GIGPUVGORGNUGJTUEJÌP/ÒP\GHCUVUGJTUEJÌP

 155


HABSBURGISCHE STÄDTE

2453



2TCIGT )TQUEJGP Q , FGU DÌJOKUEJGP -ÌPKIU 9GP\GN +++ +8   OKV )GIGPUVGORGN XQP   5CN\DWTI CWH FGT 8QTFGTUGKVG 5VCFYCRRGP IGURCNVGPGT 5EJKNF  &C\W )GIGPUVGORGN XQP 7NO 5VCFV   YCRRGP IGVGKNVGTURCPKUEJGT5EJKNF -TWU[5WPF7  )GIGPUVGORGNHCUVUGJTUEJÌP/ÒP\GHCUVUGJTUEJÌP



.165#.<$74) 

2CTKU XQP .QFTQP 4GKEJUVCNGT  CWH FKG &QOYGKJG &CX   /CZ )CPFQNRJ XQP -ÒGPDWTI   4GKEJUVCNGT &CX 5KIKUOWPF+++XQP5EJTCVVGPDCEJ-QPX6CNGT &CX *KGTQ P[OWUXQP%QNNQTGFQ-QPX6CNGT &CX   5VÒEM(GNFGTIGIN·VVGV Z UGJTUEJÌPpXQT\ÒINKEJ

2455

2456



2457

&+'¤56'44'+%*+5%*'056#0&'5*'44'0 &+'64+%*56'+0)4(.+%*'.+0+'27.)#7 

5KIKUOWPF.WFYKIXQP9GEJUGNUV·VV4GKEJUVCNGT)TC\&CX*QN\OCKT5  *ÒDUEJG2CVKPCMN4CPFHGJNGTYKP\5EJTÌVNKPIUHGJNGTUGJTUEJÌP



56&6'+0&'0*#$5$74)+5%*'0'4$.#0&'0 -4'/0+6< 



156

5EJCWVCNGTQ, ,CJTJWPFGTV 5V)GQTIUVCNGTI5V)GQTITGKVGVTWPFVÌVGVFGP&TCEJGP OKVFGT.CP\G9KPFIQVVDN·UVNCWH5EJKHHFCTKP%JTKUVWUWPF\YGK#RQUVGN*WU\CT  2TCEJVXQNNG2CVKPCHCUVXQT\ÒINKEJ



5EJCWVCNGTQ, ,CJTJWPFGTV 5V)GQTIUVCNGTI5V)GQTITGKVGVTWPFVÌVGVFGP&TCEJGP OKVFGT.CP\G9KPFIQVVDN·UVNCWH5EJKHHFCTKP%JTKUVWUWPF\YGK#RQUVGN*WU\CT  *ÒDUEJG2CVKPCUGJTUEJÌP




AUGSBURG

&'765%*'/ª0<'070&/'&#+..'0

2458

2459

#+%*#%* DGK#WIUDWTI 

56#&6 

2460

2TCIGT )TQUEJGP Q , FGU DÌJOKUEJGP -ÌPKIU 9GP\GN +++ +8   OKV )GIGPUVGORGN XQP   #KEJCEJ ! CWHFGT4ÒEMUGKVG$CWOOKV9WT\GNUVQEM-TWU[#QFGT:  44)GIGPUVGORGNHCUVUGJTUEJÌP/ÒP\GUEJÌP



(ÒTFKG*GTMWPHVFKGUGU)GIGPUVGORGNUYKTFCWEJ$WEJJQTPFKUMWVKGTV-TWU[HÒJTVWPVGT#GKPGP5VGORGNOKVFGO $KNFGKPGT'KEJGCWHWPFWPVGT:GKPGPPKEJVP·JGTDGUVKOOVGP$CWO.GKFGTKUVCWHFGTXQTNKGIGPFGP2T·IWPIFGT $CWOPKEJVIGPCW\WGTMGPPGP

#/$'4)

56#&6 



2TCIGT )TQUEJGP Q , FGU DÌJOKUEJGP -ÌPKIU 9GP\GN +++ +8   OKV )GIGPUVGORGN XQP   #ODGTICWHFGT4ÒEMUGKVG5VCFVYCRRGP .ÌYGNÒDGT9GEMGP -TWU[#  )GIGPUVGORGNUGJTUEJÌP/ÒP\GUEJÌP



2TCIGT )TQUEJGP Q , FGU DÌJOKUEJGP -ÌPKIU 9GP\GN +++  /ÒP\UV·VVG -WVVGPDGTI OKV   )GIGPUVGORGN XQP #ODGTI CWH FGT 4ÒEMUGKVG 5VCFVYCRRGP .ÌYG N ÒDGT 9GEMGP  -TWU[ #    5NI&QPGDCWGT\W 5GJTUEJÌP



2461

#7)5$74)

$+567/ 

-QPTCFXQP*KTUEJGEM&GPCT#WIUDWTII5VGJGPFGT$KUEJQHOKVGTJQDGPGT4GEJ VGPWPF-TWOOUVCD$ÒUVGFGU*GKNKIGP7NTKEJ\YKUEJGP\YGK6ÒTOGPÒDGT/CWGTOKV6QTKO6QTDQ IGP-QRH5NI$QPJQHH5VGKPJKNDGT  4(GKPG6ÌPWPIKP6GKNGPUEJYCEJCWUIGRT·IVUGJTUEJÌP

2462

2463



2464



*CTVOCPP XQP &KNNKPIGP  $TCMVGCV  I $TWUVDKNF FGU $KUEJQHU X X \YKUEJGP \YGK   JCNDOQPFHÌTOKIGP$ÌIGP$GTIGT5VGKPJKNDGT 5GJTUEJÌP





$WEMJCTFXQP'NNGTDCEJ*GNNGT&KNNKPIGP5VGKPJKNDGT

45GJTUEJÌP





*GNNGT&KNNKPIGP5VGKPJKNDGT

5GJTUEJÌP

 157


AUGSBURG

2465

2467

2466

2468

56#&6 

2TCIGT )TQUEJGP Q , FGU DÌJOKUEJGP -ÌPKIU 9GP\GN +++ +8   OKV )GIGPUVGORGN XQP   #WIUDWTICWHFGT8QTFGTUGKVG5VCFVR[T-TWU[# )GIGPUVGORGNUGJTUEJÌP/ÒP\GUEJÌP





2TCIGT )TQUEJGP Q , FGU DÌJOKUEJGP -ÌPKIU 9GP\GN +++ +8   OKV )GIGPUVGORGN XQP   #WIUDWTI CWH FGT 4ÒEMUGKVG 5VCFVR[T &CTWPVGT)GIGPUVGORGNXQP7NO5VCFVYCRRGP IGVGKNVGTURCPK UEJGT5EJKNF -TWU[#WPF7 )GIGPUVGORGNUGJTUEJÌP/ÒP\GHCUVUGJTUEJÌP



2TCIGT )TQUEJGP Q , FGU DÌJOKUEJGP -ÌPKIU 9GP\GN +++ +8   OKV )GIGPUVGORGN XQP   #WIUDWTI CWH FGT4ÒEMUGKVG5VCFVR[T7OUGKVKI)GIGPUVGORGNXQP7NO5VCFVYCRRGP IGVGKNVGTURCPK UEJGT5EJKNF -TWU[#WPF7 )GIGPUVGORGNUEJÌP/ÒP\GUEJÌP



2TCIGT )TQUEJGP Q , FGU DÌJOKUEJGP -ÌPKIU 9GP\GN +++ +8   OKV )GIGPUVGORGN XQP   #WIUDWTICWHFGT8QTFGTUGKVG5VCFVR[T-TWU[# )GIGPUVGORGNUGJTUEJÌP/ÒP\GUEJÌP







2470

2469

2471



*CNDDCV\GPQ,OKV6KVGN-CTNU8(QTUVGT  4.GKEJVG2T·IGUEJY·EJGUQPUVCVVTCMVKXGUUGJTUEJÌPGU'ZGORNCT



4GKEJUVCNGTOKV6KVGN(GTFKPCPFU++5V7NTKEJUVCNGT8CTKCPVG#8)856#085KPFGT8QTFGTUGK VGPWOUEJTKHVWPFOKV*WHGKUGPCWHFGT4ÒEMUGKVG&CX#(QTUVGT  5GJTUGNVGPG8CTKCPVG'VYCUDGTKGDGPUGJTUEJÌPpXQT\ÒINKEJ



4GKEJUVCNGTIGRT·IVWPVGTUEJYGFKUEJGT$GUGV\WPIFWTEJ)WUVCX++#FQNH#JNUVTÌO&CX (QTUVGT (CUUWPIUURWTGPGVYCUDGTKGDGPUGJTUEJÌP



 158




AUGSBURG

2472

2473

2474



4GKEJUVCNGTOKV6KVGN(GTFKPCPFU+++&CX(QTUVGT

4*ÒDUEJG2CVKPCXQT\ÒINKEJ





4GKEJUVCNGTOKV6KVGN(GTFKPCPFU+++&CX(QTUVGT  *ÒDUEJG2CVKPCUGJTUEJÌPpXQT\ÒINKEJ





4GKEJUVCNGTOKV6KVGN(GTFKPCPFU+++&CX#(QTUVGT



5GJTUEJÌP

2475

2476

2476



4GKEJUVCNGTOKV6KVGN(GTFKPCPFU+++&CX(QTUVGT

5GJTUEJÌP



5KNDGTOGFCKNNG  XQP % 7PIGNVGT CWH FKG +PFWUVTKG FGT 5VCFV #PUKEJV FGU 4CVJCWUGU FCTÒDGT CP   $·PFGTP FKG 9CRRGP FGT DGKFGP5VCFVRHNGIGT.CPIGPOCPVGNWPF9GKUU#NVCTFCTCWHUVGJGPFGTIGHNÒ IGNVG )GPKWU FGT 5VCFV WPF FKG -ÌPKIKP FGT -ÒPUVG FKG UKEJ FKG *·PFG TGKEJGP WOJGT GKP -TCP\   XQP 'ODNGOGP FGU )GYGTDGU FGT -WPUV WPF FGT 9KUUGPUEJCHV /KV 4CPFUEJTKHV  OO  I   (QTUVGT *GPMGNURWTXQT\ÒINKEJ



 159


BADEN

2477

2478

2479



4GKEJUVCNGTOKV6KVGN.GQRQNFU+&CX(QTUVGT *ÒDUEJG2CVKPCUGJTUEJÌPpXQT\ÒINKEJ





-QPX6CNGTOKV6KVGNXQP(TCP\+&CX(QTUVGT  5GJTUGNVGPKPFKGUGT'TJCNVWPI2TCEJVGZGORNCT(CUV5VGORGNINCP\





-QPX6CNGTOKV6KVGNXQP(TCP\+&CX(QTUVGT



5GJTUEJÌPpXQT\ÒINKEJ

2480

$#&'0 $#&'0$#&'0/#4-)4#(5%*#(6 

.WFYKI 9KNJGNO  5KNDGTOGFCKNNG  XQP ) *CWVUEJ CWH FGP 5KGI DGK 5CNCPMCOGP   6ÒTMKUEJG6TQRJ·GPTGKP)GHCPIGPGTFGTCPGKPG-CPQPGIGHGUUGNVKUVQDGPFCUIGMTÌPVG9CRRGPXQP $CFGP WPF 5RQPJGKO-CKUGT .GQRQNF UVGJV X X KP GKPGT 3WCFTKIC KP FGT TGEJVGP *CPF J·NV GT GKPG   8KMVQTKCUVCVWGCWHFGO$QFGPNKGIGPVÒTMKUEJG$GWVGYCHHGPWPFGKP5EJKNFOKVFGP.KNKGPFGT$QWTDQ PGP /KV 4CPFUEJTKHV È &1/+085 %10%8.%#$+6 *156'5 0156415 Û 25 Û   8 Û   Û    OOI5NI/QPVGPWQXQ9KGNCPFV<GKV\  44-N4CPFHGJNGTUGJTUEJÌPpXQT\ÒINKEJ .WFYKI 9KNJGNO  #RTKN  KP 2CTKU Ó ,CPWCT  KP 4CUVCVV YCT FGT GKP\KIG 5QJP FGU 'TDRTKP\GP   (GTFKPCPF /CZKOKNKCP WPF .QWKUG %JTKUVKPG XQP 5CXQ[GP%CTKIPCP 5GKPGP 0COGP XGTFCPMVG GT UGKPGP DGKFGP   6CWHRCVGP -ÌPKI .WFYKI :+8 XQP (TCPMTGKEJ WPF UGKPGO )TQ­XCVGT 9KNJGNO $GTGKVU CNU L·JTKIGT YWTFG GT   5QNFCVWPF\GKEJPGVGUKEJDCNFFGTCTVCWUFC­KJODGK#WUDTWEJFGT6ÒTMGPMTKGIGCNU(GNFOCTUEJCNNGWVPCPVGKP #TOGGMQOOCPFQ CPXGTVTCWV YWTFG 'T URKGNVG DGKO 'PVUCV\ XQP 9KGP WPF KO YGKVGTGP 8GTNCWH FGT 6ÒTMGPMTKGIG   GKPG YKEJVKIG WPF TWJOTGKEJG 4QNNG FKG KJO FGP XQNMUVÒONKEJGP $GKPCOGP 6ÒTMGPNQWKU GKPVTWI YWTFGGT 1DGTDGHGJNUJCDGTFGTIGUCOVGPKP7PICTPM·ORHGPFGP#TOGG7PYGKVFGT6JGK­OÒPFWPIKPFKG&QPCWVTCHGPDGK 5CNCPMCOGPCO#WIWUVGKPXQPKJOIGHÒJTVGUMCKUGTNKEJGU*GGTOKV5QNFCVGPWPFGKPGGVYC /CPP UVCTMG VÒTMKUEJG 5VTGKVOCEJV WPVGT FGO -QOOCPFQ FGU )TQ­YGUKTU -ÌTRTÒNÒ CWHGKPCPFGT&GO/CTMITCHGP IGNCPI GU UEJNKG­NKEJ FGP ÒDGTO·EJVKIGP )GIPGT PCEJ GKPGO <CPIGPCPITKHH \W UEJNCIGP 'VYC  (GKPFG   YCTGPIGHCNNGPFCTWPVGTCWEJFGT)TQ­YGUKTWPF2CUEJCU&KG-CKUGTNKEJGPJCVVGPTWPFGKP8KGTVGNKJTGT.GWVG XGTNQTGP

160




BADEN

2482



2483

2481

.WFYKI)GQTIWPVGT8QTOWPFUEJCHVUGKPGT/WVVGT(TCP\KUMC5KD[NNC#WIWUVC Ó  5KNDGTOGFCKNNG  XQP ) 9 8GUVPGT CWH FGP (TKGFGP XQP 4CUVCVV <YGK XGT\KGTVG /GFCKNNQPU OKV   FGO $TWUVDKNF .WFYKI )GQTIU WPF FGO UGKPGT /WVVGT (TCP\KUMC 5KD[NNC GKPCPFGT IGIGPÒDGT WPVGP   \YGK CPGKPCPFGT IGNGJPVG 9CRRGPUEJKNFG QDGP 6CWDG OKV -TCP\ KO 5EJPCDGN#PUKEJV FGU 4CUVCVVGT   5EJNQUUGU FCTÒDGT #FNGT OKV 0GUV KP FGP (·PIGP  OO  I $GTPJGKOGT  FQTV CPFGTGT   &WTEJOGUUGTWPF)GYKEJV 2CZKP0WOOKU9KGNCPFV<GKV\ 5GJTUEJÌPpXQT\ÒINKEJ



$#&'0&74.#%*/#4-)4#(5%*#(65'+6-74(ª456'067/  5'+6)4155*'4<1)67/ 

-CTN.GQRQNF(TKGFTKEJ-TQPGPVCNGT#WUDGWVG#-5&CX-CJPV6JWP #VVTCMVKXGU'ZGORNCTOKVJÒDUEJGT2CVKPCXQT\ÒINKEJ





-TQPGPVCNGT<W+JTGT8ÌNMGT*GKN#-5&CX-CJPV6JWP



8QT\ÒINKEJ

2484

2485

2485



8GTGKPUFQRRGNVCNGT%CTN(TKGFTKEJ&GPMOCN#-5&CX-CJPV6JWP  *GTTNKEJG2CVKPCXQT\ÒINKEJ





8GTGKPUFQRRGNVCNGT8CTKCPVGOKVCEJVUVTCJNKIGP5VGTPGPKPFGT4CPFUEJTKHV#-5#PO&CX -CJPV#PO6JWP#PO *GTTNKEJG2CVKPCXQT\ÒINKEJp5VGORGNINCP\

 161


BADEN

2487

2486

2486



8GTGKPUFQRRGNVCNGT8CTKCPVGOKVCEJVUVTCJNKIGP5VGTPGPKPFGT4CPFUEJTKHV#-5#PO&CX -CJPV#PO6JWP#PO *ÒDUEJG2CVKPCXQT\ÒINKEJ





&QRRGNIWNFGP#-5&CX-CJPV6JWP



2489

2488









2491

2490

2492

$#/$'4)

$+567/ 

*GTTNKEJG2CVKPCXQT\ÒINKEJ

1VVQ + FGT *GKNKIG  2HGPPKI  I $TWUVDKNF GKPGU )GKUVNKEJGP X X OKV -TWOOUVCD   &TGKVÒTOKIGU -KTEJGPIGD·WFG KO 6QT GKP UKGDGPUVTCJNKIGT 5VGTP \W FGP 5GKVGP FGU /KVVGNVWTOU LG GKP   4KPIGN-TWI 5GNVGPDGUQPFGTUKPFKGUGT'TJCNVWPI5GJTUEJÌPUGJTUEJÌP



1VVQ++XQP#PFGEJU/GTCPKGP2HGPPKII-TGW\KO9WNUVTGKHKPFGP9KPMGNPLG GKPG -WIGN WOIGDGP XQP UGEJU $ÌIGP OKV -TGW\EJGP KO <YKEMGN LG GKPG -WIGN$TWUVDKNF FGU   $KUEJQHU MCWOCWUIGRT·IV 8INFGP#WHUCV\XQP*GKP\/9GKVGTG$CODGTIGT&ÒPPRHGPPKIG!KP 00$5HH-TWIXCT .GKEJVG2T·IGUEJY·EJGUGJTUEJÌP



2HGPPKI  I &QRRGNMTGW\ KP 9WNUVTGKH WOIGDGP XQP CEJV *CNDDÌIGP OKV LG GKPGT 4QUGVVG$TWUV   DKNF FGU $KUEJQHU MCWO CWUIGRT·IV  8IN FCU 'ZGORNCT FGT #WMVKQP *CWEM  #WHJ·WUGT      0T-TWIp 9QJNWPGFKGTV(GKPG2CVKPCUGJTUEJÌPpXQT\ÒINKEJ



*GTOCPP++2HGPPKII)GMTÌPVGU$TWUVDKNFXX\WFGP5GKVGPFKG$WEJUVCDGP* WPF'$KUEJQHVJTQPVXXOKV-WOOUVCDWPF$WEJ-TWI  44+P6GKNGPUEJYCEJCWUIGRT·IVHCUVUGJTUEJÌP



2HGPPKI  I $TWUVDKNF FGU $KUEJQHU N OKV -TWOOUVCD WPF $WEJ&TGKVÒTOKIG 6QTDWTI KO 6QT   GKPGQHHGPG*CPF8INFGP#WHUCV\XQP4W­*<WT$CODGTIGT/ÒP\RT·IWPIWPVGT$KUEJQH*GTOCPP++ KP,0)5-TWIp 'VYCUFG\GPVTKGTVWPFMN2T·IGUEJY·EJGUQPUVUGJTUEJÌP



2493

2494



%JTKUVQRJ(TCP\XQP$WUGEM-QPX6CNGT&CX-TWI  #VVTCMVKXGUHCUVXQT\ÒINKEJGU'ZGORNCT





-QPX6CNGT0ÒTPDGTI&CX#-TWI



162

-N5EJTÌVNKPIUHGJNGTUGJTUEJÌPpXQT\ÒINKEJ


BAYERN

2495

)4#(5%*#(6 

2496

2497

$#4$;

9QNHICPI(TKGFTKEJ6CNGT )TQUEJGP $CTD[OKV6KVGNXQP/CVVJKCU/GJNL 9KP\2T·IGUEJY·EJGXQT\ÒINKEJ



$#;'40 *'4<1)67/5'+6-74(ª456'067/5'+6-¤0+)4'+%* 

#NDGTV+++'KPUGKVKIGT2HGPPKIQ,  5VTCWDKPI2HNWI'OOGTKI$/9KVV 8QPITÌ­VGT5GNVGPJGKV8GTOWVNKEJGKP\KIGUDGMCPPVGU'ZGORNCTKO*CPFGN5EJÌP





/CZKOKNKCP+6CNGTQ,/ÒPEJGP*CJP



2498

2499

5GJTUEJÌP

2500



4GKEJUVCNGT/ÒPEJGP&CX*CJP  *ÒDUEJG2CVKPCMN5EJTÌVNKPIUHGJNGTXQT\ÒINKEJp5VGORGNINCP\





4GKEJUVCNGT/ÒPEJGP&CX*CJP





/CZKOKNKCP++'OCPWGN$TQP\GOGFCKNNGXQP)*CWVUEJWPF.).CWHHGTCWHFKG 'TQDGTWPI XQP $GNITCF )GJCTPKUEJVGU $TWUVDKNF T#PUKEJV XQP $GNITCF OKV FGO CPITGP\GPFGP (NW­   IGDKGVCWUFGT8QIGNRGTURGMVKXG1JPG4CPFUEJTKHVOO5NI/QPVGPWQXQ FQTVKP5KNDGT  9KVV FQTVKP5KNDGTWPFOKV4CPFUEJTKHV  9KP\4CPFHGJNGTXQT\ÒINKEJ

(GKPG2CVKPCXQT\ÒINKEJp5VGORGNINCP\



2501



-CTN#NDGTV4GKEJUVCNGT/ÒPEJGPCWHFCU8KMCTKCV)GOGKPUEJCHVURT·IWPIOKV-CTN 2JKNKRR-WTHÒTUVXQPFGT2HCN\&CX*CJP5NI/GOOGUJ  (CUVXQT\ÒINKEJXQT\ÒINKEJ

 163


BAYERN

2503

2502



-CTN6JGQFQT-QPX6CNGT/ÒPEJGP*CJP

/KPLWUVKGTVXQT\ÒINKEJ





/CZKOKNKCP+ +8 ,QUGRJ-TGW\GT#-5*CJP  4.GKEJVLWUVKGTVXQT\ÒINKEJ



2504

2505

2506



-QPX6CNGT  /KV /#:+/ +15'2* KP FGT 8QTFGTUGKVGPWOUEJTKHV #-5  #PO &CX    -CJPV6JWP 44.GKEJVLWUVKGTVCVVTCMVKXGUUGJTUEJÌPGU'ZGORNCT 



-QPX6CNGT/KV(ª4)16670&8#6'4.#0&ÜKPFGT4ÒEMUGKVGPWOUEJTKHVWPFHGJNGT JCHVGT4CPFUEJTKHV'*'0UVCVV<'*'0#-5#POXCT&CXXCT-CJPVC6JWPXCT (GKPG2CVKPCOKPLWUVKGTVUGJTUEJÌPpXQT\ÒINKEJ



5KNDGTOGFCKNNGKPFGT)TÌ­GGKPGUHTCP\ÌUKUEJGP(TCPEU5VÒEMUXQP,26KQNKGTCWHFGP$GUWEJ FGU-TQPRTKP\GP.WFYKIKPFGT2CTKUGT/ÒP\UV·VVG$TWUVDKNFTKP7PKHQTOOKVWOIGNGIVGO1TFGPUDCPF 5GEJU<GKNGP5EJTKHV/KV4CPFITCXWT‰$#.#0%+'4 #8+41.'#&126'y'0OO I/C\CTF9KVV 8QT\ÒINKEJ





2508 2507

2507



-QPX6CNGT#-5&CX-CJPV6JWP

5GJTUEJÌP





-QPX6CNGTQ,  *CNDGT5EJWNRTGKUVCNGT#-5#PO,  4*GTTNKEJG2CVKPCXQT\ÒINKEJ



164


BAYERN

2510

2509



-QPX6CNGT#-5&CX-CJPV6JWP

*ÒDUEJG2CVKPCXQT\ÒINKEJ





-QPX6CNGT#-5&CX-CJPVE6JWP  -CDKPGVVUVÒEMXQPHGKPUVGT'TJCNVWPI'TUVCDUEJNCI5VGORGNINCP\



2512

2513

2511



6TCIDCTGU QXCNGU UKNDGTPGU &KGPUV\GKEJGP Q , CD   WPUKIPKGTV HÒT FGP )GOGKPFGXQTUVGJGT FGT   )GOGKPFG&KVVNQHHUTQVJ JGWVG&KVVNQHUTQFC)GOGKPFG9CTVOCPPUTQVJ-TGKU$CF-KUUKPIGP )GMTÌPVGU DC[GTKUEJGU 9CRRGP OKV /KVVGNUEJKNF FCTKP 5EJYGTV WPF <GRVGT IGMTGW\V WPVGT -TQPG \W FGP 5GKVGP   .QTDGGTWPF2CNO\YGKI)TCXWT)'/'+0&'&+66.1((5416*ZOOI #PJGNNDNCWGO$CPFXQT\ÒINKEJ





-QPX6CNGTQ, IGRT·IVDKU *CNDGT5EJWNRTGKUVCNGT#-5,

8QT\ÒINKEJ





-QPX6CNGTQ, IGRT·IVDKU *CNDGT5EJWNRTGKUVCNGT#-5,

8QT\ÒINKEJ



2514

2515



.WFYKI+-QPX6CNGT8GTNGIWPIFGT.WFYKI/CZKOKNKCPU*QEJUEJWNGXQP.CPFU JWVPCEJ/ÒPEJGP#-5&CX-CJPV6JWP (GKPG2CVKPCHCUV5VGORGNINCP\





-QPX6CNGT$C[GTPU6TGWG#-5&CX-CJPV6JWP  2TCEJVGZGORNCT(CUV5VGORGNINCP\

 165


BAYERN

2516

2517



-QPX6CNGT$C[GTPU6TGWG#-5&CX-CJPV6JWP  8QT\ÒINKEJp5VGORGNINCP\CWURQNKGTVGT2NCVVG





-QPX6CNGT.CPFVCI#-5&CX-CJPV6JWP



2518

(GKPG2CVKPCXQT\ÒINKEJ

2519



-QPX6CNGT$C[GTKUEJG*[RQVJGMGP$CPM#-5&CX-CJPV6JWP  (GKPG2CVKPCXQT\ÒINKEJ





-QPX6CNGT&GPMOCNFGU-ÌPKIU/CZKOKNKCP,QUGRJ8CTKCPVGOKVXGTMÒT\VGO<GRVGT#-5D &CX#PO-CJPVC6JWP#PO 8QT\ÒINKEJ



2520

2521



-QPX6CNGT&GP$GPGFKMVKPGTPYKGFGTGKPG.GJTCPUVCNVÒDGTIGDGP#-5&CX-CJPV 6JWP (GKPG2CVKPCXQT\ÒINKEJ





-QPX6CNGT1VVQ-CRGNNG#-5&CX-CJPV6JWP



2522

(GKPG2CVKPCXQT\ÒINKEJ

2523



8GTGKPUFQRRGNVCNGT  /ÒP\XGTGKPKIWPI UÒFFGWVUEJGT 5VCCVGP /KV 4CPFUEJTKHV m m &4';'+0   *#.$)7.&'0mm8++'(/#-5CXCT&CX-CJPVD6JWP 8QT\ÒINKEJ





8GTGKPUFQRRGNVCNGT#-5&CX-CJPV6JWP



166

(CUVXQT\ÒINKEJXQT\ÒINKEJ


BAYERN

2524

2525



8GTGKPUFQRRGNVCNGT#-5&CX-CJPV6JWP



8GTGKPUFQRRGNVCNGT5VCPFDKNFXQP,GCP2CWN(TKGFTKEJ4KEJVGT/KV4CPFUEJTKHVmm&4';'+0 *#.$)7.&'0mm8++'(/#-5D&CX-CJPVC6JWP  2TCEJVGZGORNCT5VGORGNINCP\HCUV5VGORGNINCP\

2526

(CUVXQT\Ã&#x2019;INKEJXQT\Ã&#x2019;INKEJ





2527



8GTGKPUFQRRGNVCNGT5VCPFDKNFXQP,GCP2CWN(TKGFTKEJ4KEJVGT/KV4CPFUEJTKHVmm&4';'+0 *#.$)7.&'0mm8++'(/#-5C&CX-CJPV6JWPXCT 8QT\Ã&#x2019;INKEJ





8GTGKPUFQRRGNVCNGT9CNJCNNC/KV4CPFUEJTKHVmm&4';'+0*#.$)7.&'0mm8++'(/ #-5D&CX-CJPVC6JWP 2TCEJVGZGORNCT(GKPG2CVKPCHCUV5VGORGNINCP\



2528

2529



8GTGKPUFQRRGNVCNGT9CNJCNNC/KV4CPFUEJTKHVmm&4';'+0*#.$)7.&'0mm8++'(/ #-5D&CX-CJPVC6JWP 8QT\Ã&#x2019;INKEJ





8GTGKPUFQRRGNVCNGT8GTO·JNWPIFGU-TQPRTKP\GP/CZKOKNKCPOKV/CTKGXQP2TGW­GP/KV4CPF UEJTKHVmm&4';'+0*#.$)7.&'0mm8++'(/#-5D&CX-CJPVD6JWP 2TCEJVGZGORNCT(GKPG2CVKPCHCUV5VGORGNINCP\



2530





2531

8GTGKPUFQRRGNVCNGT  )TÃ&#x2019;PFWPI FGT *QEJUEJWNG KP 'TNCPIGP /KV 4CPFUEJTKHV m m &4';'+0   *#.$)7.&'0mm8++'(/#-5C&CX-CJPV6JWPXCT  -N4CPFHGJNGTXQT\Ã&#x2019;INKEJ



8GTGKPUFQRRGNVCNGT'TDRTKP\.WFYKI/KV4CPFUEJTKHVmm&4';'+0*#.$)7.&'0mm8++ '(/#-5C&CX-CJPVXCT6JWPXCT 8QT\Ã&#x2019;INKEJ

 167


BAYERN

2532

2533



8GTGKPUFQRRGNVCNGT.WFYKIUMCPCN/KV4CPFUEJTKHVmm&4';'+0*#.$)7.&'0mm8++'(/ #-5C&CX-CJPV6JWPXCT 8QT\ÒINKEJ





8GTGKPUFQRRGNVCNGT  ,WNKWU 'EJVGT XQP /GURGNDTWPP /KV 4CPFUEJTKHV m m &4';'+0*#.$   )7.&'0mm8++'(/#-5C&CX-CJPV6JWPXCT  /KP4CPFHGJNGTXQT\ÒINKEJ



2534



2535

8GTGKPUFQRRGNVCNGTªDGTICDGFGT-TQPG/KV4CPFUEJTKHVmm&4';'+0*#.$)7.&'0mm 8++'(/#-5C&CX-CJPV6JWPXCT  &GTUGNVGPUVGDC[GTKUEJG)GUEJKEJVUFQRRGNVCNGT9KP\-TCV\GTXQT\ÒINKEJGU'ZGORNCT  -ÌPKI .WFYKI + KUV GU \W XGTFCPMGP FC­ UKEJ FKG DC[GTKUEJG .CPFGUJCWRVUVCFV \W GKPGT DGFGWVGPFGP   -WPUVOGVTQRQNG GPVYKEMGNVG 'T XGTNGIVG FKG 7PKXGTUKV·VXQP.CPFUJWVPCEJ/ÒPEJGPWPFNKG­FKG)N[RVQVJGMFKG #NVG WPF 0GWG 2KPCMQVJGM WPF FKG 2TQR[N·GP GTTKEJVGP +O ,CJT  DGICPP .WFYKI + GKPG $G\KGJWPI OKV FGT   KNNGIKVKOGP 6QEJVGT GKPGU UEJQVVKUEJGP 1HHK\KGTU WPF GKPGT -TGQNKP FKG PCEJ KJTGT IGUEJGKVGTVGP 'JG OKV GKPGO   GPINKUEJGP1HHK\KGTCNUURCPKUEJG6·P\GTKPWPVGTFGO-ÒPUVNGTPCOGP.QNC/QPVG\KP/ÒPEJGPCWHVTCV&KG6·P\GTKP IGYCPP \WPGJOGPF 'KPHNW­ CWH FGP -ÌPKI WPF YWTFG   \WO 5EJTGEMGP FGT $GXÌNMGTWPI  \WT )T·HKP XQP   .CPFUDGTIGTJQDGP#PHCPI/·T\MCOGUKPFGTXQPFGT/QPVG\DGIÒPUVKIVGP5VWFGPVGPXGTDKPFWPI#NGOCPPKC \W FGTCTVKIGP 7PTWJGP FC­ .WFYKI /KNKV·T GKPUGV\VG FKG 7PKXGTUKV·V UEJNQ­ WPF FKG DC[GTKUEJG 2QORCFQWT   XGTDCPPVG&CU)GTÒEJVKJTGT4ÒEMMGJTHÒJTVGKO<WUCOOGPJCPIOKVFGP/·T\GTGKIPKUUGP\WOQHHGPGP#WHUVCPFKP /ÒPEJGP WPF \YCPI FGP -ÌPKI CO  /·T\  \WO 4ÒEMVTKVV WPF \WT ªDGTICDG FGT -TQPG CP UGKPGP 5QJP   /CZKOKNKCP++



/CZKOKNKCP++&QRRGNIWNFGPQ,  8GTUKNDGTVG-W2TQDGOKVINCVVGO4CPFI /CTKGPU·WNG#-5&CX\W-CJPVF6JWP\W  4*ÒDUEJG2CVKPCYKP\4CPFHGJNGTXQT\ÒINKEJ

2536



 168



2537

8GTGKPUFQRRGNVCNGT UR·VGTG2T·IWPICD &GPMOCNFGU-ÌPKIUKP.KPFCW/KV4CPFUEJTKHVn &4';'+0*#.$)7.&'0n:8'+02(70&('+0#-5&CX-CJPV6JWP  0WT'ZGORNCTGIGRT·IV8QT\ÒINKEJ



&QRRGNVGT8GTGKPUVCNGT#-5&CX-CJPV6JWP



8QT\ÒINKEJ


BRANDENBURG IN FRANKEN

2538



.WFYKI++8GTGKPUVCNGT5VGORGNXQP,4KGU#-5&CX-CJPV6JWP 45EJTÌVNKPIUHGJNGTUGJTUEJÌP



5COONWPI XQP DC[TKUEJGP /ÒP\GP FGU  ,CJTJWPFGTVU XQO -W2HGPPKI DKU \WO &QRRGNVCNGT &KG   5COONWPI GPVJ·NV \CJNTGKEJG DGUUGTG 6[RGP FCTWPVGT XKGNG )GUEJKEJVUVCNGT WPF )GUEJKEJVUFQRRGNVCNGT   UQYKGVGKNYGKUGCVVTCMVKXG'TJCNVWPIGP*QEJKPVGTGUUCPVGU1DLGMVDKVVGDGUKEJVKIGP  5VÒEM+P#NDWO'KPKIGOKVMN(GJNGTPUGJTUEJÌPpXQT\ÒINKEJ 



-NGKPGU-QPXQNWVXQP5KNDGTOGFCKNNGPWPF$TQP\GOGFCKNNGFGU,CJTJWPFGTVU+PVGTGUUCPVGU.QV DKVVGDGUKEJVKIGP 5VÒEM-N4CPFHGJNGT Z $TQUEJKGTURWT Z UQPUVXQT\ÒINKEJ



.165$#;'40



2541

$100

56#&6 

5KNDGTOGFCKNNGQ,  XQP/5OGNV\KPICWHFKG'KPPCJOGXQP$QPP*W[.KODWTI4JGKPDGTI WPF)GNFGTPFWTEJFKG#NNKKGTVGP*QNNCPFKCOKV-TQPGPUVCDWPFGKPGO5·EMEJGPKPFGT*CPFUVGJVXX TPGDGPKJT/CTUWPF0GRVWPJKPVGTGKPGO'TFYCNNKO*KPVGTITWPF5GIGNUEJKHHGWPF5V·FVGNCPFUEJCHV <YGK .QVVGTKGNQUDGJ·NVGT \YKUEJGP \YGK (ÒNNJÌTPGTP KP FGT /KVVG GKPG UKV\GPFG 2WVVG OKV GTJQDGPGP   #TOGPQDGPGKP2WVVGPGPIGNOKV9CCIUEJCNGOOIX.QQPp9GKNGT  4(GKPG2CVKPCUGJTUEJÌPpXQT\ÒINKEJ &KGXQTNKGIGPFG/GFCKNNGYWTFGCP6GKNPGJOGTGKPGT.QVVGTKGFGU#NOQG\GPKGT*CWUGUXQP#NMOCCTCWUIGIGDGP

2542

2543



2544

2545

2545

$4#0&'0$74)+0(4#0-'0 $4#0&'0$74)+0(4#0-'0/#4-)4#(5%*#(6 

(TKGFTKEJ 8  2HGPPKI Q , CWH5EJYCT\DWTIGT5EJNCI-QRHXX.ÌYGNKP5GEJURC­ X5EJTG 4+P6GKNGPUEJYCEJCWUIGRT·IVUGJTUEJÌP





2HGPPKI Q , CWH 5EJYCT\DWTIGT 5EJNCI I$TCEMGPMQRHPCEJN<QNNGTPUEJKNFKO5GEJURCUUX 5EJTp 5GNVGPG8CTKCPVG(CUVUGJTUEJÌP





2HGPPKIQ,CWH5EJYCT\DWTIGT5EJNCI$TCEMGPMQRHN<QNNGTPUEJKNFKP5GEJURC­X5EJT  5GJTUEJÌP





5EJKNNKPIQ, PCEJ 2T·IWPIKO/ÒP\XGTGKPOKVFGO$CODGTIGT$KUEJQH.CORTGEJVXQP$TWPP X5EJT 4-N5EJTÌVNKPIUTKUUGWPF2T·IGUEJY·EJGHCUVUGJTUEJÌP

 169


BRANDENBURG IN FRANKEN

2546

2547

2549

2548

2549



'KPUGKVKIGT2HGPPKIQ,  0GWUVCFV#KUEJX5EJT



$WTIITCHGPXQP0ÒTPDGTIWPF$KUEJÌHGXQP9ÒT\DWTI'KPUGKVKIGT2HGPPKIQ,-QPXGP VKQPURT·IWPI  CWHGEMKIGO5EJTÌVNKPI'JYCNFpX5EJT  42T·IGUEJY·EJGWPF4GUVGXQP)TÒPURCPHCUVUGJTUEJÌP



(TKGFTKEJ8+'KPUGKVKIGT2HGPPKIQ, PCEJ X5EJTp





(CUVUGJTUEJÌP

445GJTUEJÌP



-QPXGPVKQPUJGNNGT OKV 8KGTUEJNCI YWTFGP PWT PCEJ FGP /ÒP\GKPWPIGP XQP  WPF  IGRT·IV #WHITWPF FGT   8QTCPUVGNNWPIFGU9GEMGPUEJKNFGUOÒUUVGFKG2T·IWPIXQPFGT1DGTRHCN\CWUIGICPIGPUGKP$KUJGTUKPFLGFQEJXQP 2HCN\ITCH,QJCPP+MGKPG2T·IWPIGPCWHFGT$CUKUFKGUGT8GTVT·IGDGMCPPV



)GQTI WPF #NDTGEJV  OKV 6KVGN )GQTIU DKU   6CNGT  5EJYCDCEJ &CX    X5EJT 9KP\5EJTÌVNKPIUHGJNGTCO4CPFUGJTUEJÌPpXQT\ÒINKEJ

2550

2552



2553

2551

$4#0&'0$74)#05$#%*/#4-)4#(5%*#(6 

(TKGFTKEJ#NDGTVWPF%JTKUVKCP4GKEJUVCNGT0ÒTPDGTI&CX5NI9KNO 5GJTUEJÌP





#NDTGEJV'KPUGKVKIGT2HGPPKIQ,5NI9KNO





-CTN9KNJGNO(TKGFTKEJ5KNDGTPG.QVVGTKGOGFCKNNGXQP,56CPPGTCWHUGKPG6CPVG 9KNJGNOKPG-CTQNKPG%JCTNQVVG6QEJVGT,QJCPP(TKGFTKEJUWPF)GOCJNKP)GQTIU++XQP$TCWPUEJYGKI %CNGPDGTI*CPPQXGT -ÌPKI XQP )TQ­DTKVCPPKGP /KPGTXC UVGJV X X OKV 5RGGT WPF 2CNO\YGKI CO   $QFGPN/GFWUGPUEJKNFWPF-TKGIUVTQRJ·GPT)NQDWU\YKUEJGP'ODNGOGPFGT-WPUVWPFFGT9KUUGP UEJCHV&KG-ÌPKIKPUVGJVTOKV<GRVGTWPFDGIKG­VGKPGP2CNOGPJCKPOOI$TQEMOCPP 5NI9KNO (CUVXQT\ÒINKEJ

445GJTUEJÌP



&KG XQTNKGIGPFG /GFCKNNG YCT GKPG <WICDG \W GKPGT \YCT XQP FGT -ÌPKIKP WPVGTUVÒV\VGP UQPUV CDGT RTKXCVGP   .QVVGTKG

 170

%JTKUVKCP (TKGFTKEJ -CTN #NGZCPFGT  -QPX6CNGT  5EJYCDCEJ CWH FKG -TGKUQDTKU   VGPYÒTFG&CX5NI9KNO *ÒDUEJG2CVKPCXQT\ÒINKEJ




BRANDENBURG-PREUSSEN

2554



-QPX6CNGT5EJYCDCEJ&CX5NI9KNO  2TCEJVXQNNG2CVKPCYKP\4CPFHGJNGTXQT\ÒINKEJ

2555



2558

2557

$4#0&'0$74)24'755'0  

$4#0&'0$74)/#4-)4#(5%*#(65'+6&'/,#*4*70&'46  -74(ª456'067/ (TKGFTKEJ++8KGTEJGPQ,2TGP\NCW$CJTHSS 8KGTEJGPQ,2TGP\NCW$CJTH

5GJTUEJÌP 8CTKCPVGP5EJÌPpUGJTUEJÌP

 



,QJCPP5KIKUOWPF6CNGT )TQUEJGP *.&TKGUGP/KVDCTQEMGO9CRRGPUEJKNF $CJTHXCT -N2T·IGUEJY·EJGUGJTUEJÌPpXQT\ÒINKEJ





6CNGT &TGKRÌNMGT -ÌPKIUDGTI2QUVJWOG2T·IWPI/CTKGPD  -N5EJTÌVNKPIUHGJNGTCO4CPFUGJTUEJÌP



,QJCPP5KIKUOWPFUVCTDCO&G\GODGT&T'$CJTHGNFVKP&KG/ÒP\GPWPF/GFCKNNGP5COONWPIKPFGT /CTKGPDWTI$CPFXGTOWVGVFC­FKG5VGORGN\WFKGUGT2T·IWPIUEJQPXQTUGKPGO6QFHGTVKIYCTGP

2559

2560

2561



)GQTI9KNJGNO1TV 6CNGT -ÌPKIUDGTI9CTFGKP\GKEJGPCO#PHCPIFGT4ÒEM UGKVGPWOUEJTKHV/CTKGPD1NFC 5GJTUEJÌP





(TKGFTKEJ 9KNJGNO FGT )TQ­G -WTHÒTUV   6CNGT  +# *CNDGTUVCFV &CX    X5EJT 5GNVGPKPFKGUGT'TJCNVWPI8QT\ÒINKEJp5VGORGNINCP\



&GP XQTNKGIGPFGP  6CNGT QTFPGV X 5EJTÌVVGT KP UGKPGO 9GTM ÒDGT FKG /ÒP\GP FGU )TQ­GP -WTHÒTUVGP FGT   /ÒP\UV·VVG4GIGPUVGKP\WMQTTKIKGTVFCUUR·VGTCDGTKP*CNDGTUVCFV UKGJG0WOKUOCVKUEJG<GKVUEJTKHV9KGP$CPF 5 



6CNGT%5$GTNKP&CXX5EJTXCT

5GJTUEJÌPpXQT\ÒINKEJ

 171


BRANDENBURG-PREUSSEN

2562 2563

2563



6CNGT &TGKRÌNMGT $GTNKPX5EJT

(CUVUGJTUEJÌP



(TKGFTKEJ +++   6CNGT  .%5 $GTNKP /KV ITQ­GT 4CPMGWPVGTFGO$TWUVDKNF&CX &X5EJT 5GJTUEJÌP

 

2565

2564

2564

24'755'0-¤0+)4'+%* 

(TKGFTKEJ +++ +6CNGT*(*/CIFGDWTI&CXX5EJT



(TKGFTKEJ9KNJGNO+FGT5QNFCVGPMÌPKI6CNGT*(*/CIFGDWTIX5EJT 5GJTUEJÌP

2566

5GJTUEJÌP

 

2567



6CNGT+(5$GTNKP&CXX5EJT

 44-N<CKPGPFGMN5EJTÌVNKPIUHGJNGTUGJTUEJÌP





6CNGT*(*/CIFGDWTI&CXp \W X5EJTp \W   8QPITQ­GT5GNVGPJGKV#VVTCMVKXGUUGJTUEJÌPGU'ZGORNCT



2568



6CNGT*(*/CIFGDWTI&CXX5EJT



6CNGT+)0$GTNKP&CXX5EJT

172

2569

4#VVTCMVKXGUUGJTUEJÌPGU'ZGORNCT



(CUVUGJTUEJÌP




BRANDENBURG-PREUSSEN

2571

2570



4GKEJUVCNGT$GTNKPCWHFKG*WNFKIWPIKP5VGVVKP5NI*GPEMGNX5EJT5#PO  9KP\5EJTÌVNKPIUHGJNGTCO4CPFUGJTUEJÌP





(TKGFTKEJ++FGT)TQ­G)WVG)TQUEJGP#$GTNKP1NF#POX5EJT *GTTNKEJG2CVKPCOKPLWUVKGTVXQT\ÒINKEJ



2575

2573

2572

2574



4GKEJUVCNGTRTGW­$$TGUNCW&CX1NFCX5EJT  ªDGTFWTEJUEJPKVVNKEJGTJCNVGPGU'ZGORNCT5GJTUEJÌPpXQT\ÒINKEJ



4GKEJUVCNGTRTGW­$$TGUNCW1NFCX5EJT

 (GKPG2CVKPCXQT\ÒINKEJp5VGORGNINCP\





4GKEJUVCNGTRTGW­%%NGXG&CX1NFCX5EJT  .GKEJVG,WUVKGTURWTGPCO4CPFUGJTUEJÌP 6CNGT%%NGXG1NFX5EJT 9KP\2T·IGUEJY·EJGXQT\ÒINKEJ

 





2576

2577

 

2577

)WVG)TQUEJGP&#WTKEJ1NFCX5EJT 445GJTUEJÌP 4GKEJUVCNGTRTGW­#$GTNKP5QIGPCPPVGT5VGTDGVCNGT&CX#1NF#POX5EJT /KPLWUVKGTVXQT\ÒINKEJ

  173


BRANDENBURG-PREUSSEN

2578 2579

2579



4GKEJUVCNGTRTGW­#$GTNKP1NFCX5EJT

8QT\ÒINKEJ





4GKEJUVCNGTRTGW­(/CIFGDWTI&CX1NFX5EJT

5GJTUEJÌP



2580

2581

2581



-W#DUEJNCIXQPFGP5VGORGNPGKPGUPKGCWUIGIGDGPGP(TKGFTKEJUF QT$$TGUNCWI1NFp

\W X5EJTp \W  448QT\ÒINKEJ





$TQP\GOGFCKNNG  XQP , &CUUKGT CWH UGKPGP 4GIKGTWPIUCPVTKVV )GJCTPKUEJVGU$TWUVDKNFOKVWOIG NGIVGO /CPVGN WPF 1TFGPUUVGTP HCUV X X#FNGT ÒDGT 5VCFVCPUKEJV XQP -ÌPKIUDGTI  OO   1NF 8QT\ÒINKEJp5VGORGNINCP\



2582



5KNDGTOGFCKNNGXQP&(GJTOCPCWHFKG)GDWTVUGKPGU0GHHGP)WUVCX5QJP#FQNH(TKGFTKEJUXQP 5EJYGFGPWPFUGKPGT)GOCJNKP.WKUG7NTKMG5EJYGUVGT(TKGFTKEJU++IGRT·IVKO#WHVTCIFGTUEJYGFK UEJGP (TGKOCWTGTNQIG 5V,GCPCWZKNKCKTG'KPMCEJGNHÌTOKIGT$QFGPKO*KPVGTITWPFUVTCJNGPFGCWH IGJGPFG5QPPGFKGFKGFWPMNGP9QNMGPFGT0CEJVXGTVTGKDV#WHGKPGT9QNMGUKV\V/KPGTXCOKV5RGGT WPFQXCNGO5EJKNFFCTCWHFKG+PKVKCNG)WPVGPCO$QFGPNKGIGP#VVTKDWVGFGT(TGKOCWTGTGKOO I*KNFGDTCPF++51NFp  8QPITQ­GT5GNVGPJGKV*GTTNKEJG2CVKPCXQT\ÒINKEJp5VGORGNINCP\ #FQNH (TKGFTKEJ IGDQTGP CO  KP )QVVQTH YCT FGT \YGKVG 5QJP XQP %JTKUVKCP XQP 5EJNGUYKI*QNUVGKP   )QVVQTRWPFFGUUGP)GOCJNKP#NDGTVKPGXQP$CFGP&WTNCEJ9GIGPUGKPGTXGTYCPFVUEJCHVNKEJGP$G\KGJWPIGP UGKP 5EJYCIGT YCT -ÌPKI -CTN :++  YWTFG #FQNH (TKGFTKEJ PCEJ FGO 6QF FGU UEJYGFKUEJGP -ÌPKIU (TGFGTKM +    \WO0CEJHQNIGTIGY·JNV#FQNH(TGFGTKMJCVVGCOFKGRTGW­KUEJG2TKP\GUUKP.WKUG7NTKMGIGJGKTCVGVFKG UGEJUVG 6QEJVGT FGU 5QNFCVGPMÌPKIU (TKGFTKEJ 9KNJGNO +WPFLÒPIGTG5EJYGUVGT(TKGFTKEJU++FGU)TQ­GP.WKUG 7NTKMG JKGNV KP 5EJNQ­ &TQVVPKPIJQNO GKPGP IN·P\GPFGP *QH WPF HÌTFGTVG -WPUV WPF 9KUUGPUEJCHVGP KP 5VQEMJQNO   &KG-ÌPKIKPWPVGTUVÒV\VGCWEJKJTGP)GOCJNFGTQHVOCNUKP-QPHNKMVOKVFGO4GKEJUTCVWPFFGPRQNKVKUEJGP2CTVGKGP 5EJYGFGPUUVCPF#FQNH(TGFGTKMUVCTDCOKP5VQEMJQNOUGKPG)GOCJNKPÒDGTNGDVGKJPPQEJ\GJP,CJTG WPFUVCTDCO

174




BRANDENBURG-PREUSSEN

2583

2584





2585

5KNDGTOGFCKNNG  WPUKIPKGTV XQP ) 9 -KVVGN JGTCWUIGIGDGP XQP FGT GXCPIGNKUEJGP -KTEJG KP   5EJYGKFPKV\CWHFKG,CJTHGKGTFGU9GUVH·NKUEJGP(TKGFGPU&KG$TWUVDKNFGT(TKGFGTKEJU++WPF(GTFK PCPFU+++GKPCPFGTIGIGPÒDGT7PVGTIGMTGW\VGO2CNOWPF.QTDGGT\YGKIUKGDGP<GKNGP5EJTKHVOO I&GVJ1TF(W51NF *ÒDUEJG2CVKPCXQT\ÒINKEJ



5KNDGTOGFCKNNG  XQP , #DTCJCO CWH FKG 5EJNCEJV DGK <QTPFQTH )GJCTPKUEJVGU $TWUVDKNF T FCT   ÒDGTJ·NVGKPGCWU9QNMGPMQOOGPFG*CPFGKPGP.QTDGGTMTCP\OKV:OC#PUKEJVFGU5EJNCEJVHGNFGU OKV FGO DTGPPGPFGP <QTPFQTH T FKG DTGPPGPFG (GUVWPI -ÒUVTKP  OO  I ( W 5 *QHHOCPP1NF 44-N5VGORGNHGJNGTHGKPG2CVKPCHCUVXQT\ÒINKEJ



&KG \YKUEJGP GKPGO RTGW­KUEJGPWPFGKPGOTWUUKUEJGP*GGTKO8GTNCWHFGU5KGDGPL·JTKIGP-TKGIGUCWUIGHQEJVGPG 5EJNCEJVGPFGVGCWHDGKFGP5GKVGPOKVCW­GTQTFGPVNKEJGP8GTNWUVGPLGFQEJQJPG5KGIGT&KG/GFCKNNGHGKGTVJKPIGIGP GKPGPRTGW­KUEJGP5KGI&KGXQTNKGIGPFG2T·IWPIKUVUQOKVGKPIWVGU$GKURKGNFCHÒTFC­/GFCKNNGPCWEJCNU/GFKWO RQNKVKUEJGT2TQRCICPFCHWPIKGTVGP



5KNDGTOGFCKNNG  XQP # 9KFGOCPP CWH FGP 5KGI FGT¤UVGTTGKEJGTDGK.CPFGUJWV 5EJNGUKGP ÒDGT FKG 2TGW­GP $TWUVDKNFGT XQP (TCP\ + WPF /CTKC 6JGTGUKC PGDGPGKPCPFGT T-TKGIUVTQRJ·GP KO *KP   VGTITWPF5VCFVCPUKEJVOOI1NF5NI/QPVGPWQXQ 5GJTUEJÌP



2587 2586



2586

(TKGFTKEJ9KNJGNO++5KNDGTOGFCKNNGXQP,,)5VKGTNGCWHFKG8GTO·JNWPIUGKPGT 6QEJVGT (TKGFGTKMG .WKUG 9KNJGNOKPG OKV FGO 'TDRTKP\GP 9KNJGNO (TKGFTKEJ XQP 1TCPKGP $GKFGT   $TWUVDKNFGT PGDGPGKPCPFGT N$QTWUUKC WPF *QNNCPFKC QRHGTP CP HNCOOGPFGO #NVCT FCTCP NGJPGP FKG   IGMTÌPVGP9CRRGPXQP2TGW­GPWPFFGP0KGFGTNCPFGPOOI/CTKGPDp8GTXX.QQP 2TCEJVGZGORNCT*GTTNKEJG2CVKPCXQT\ÒINKEJp5VGORGNINCP\



(TKGFGTKMG .WKUG 9KNJGNOKPG  Ó YCT FKG 6QEJVGT (TKGFTKEJ 9KNJGNOU ++ CWU \YGKVGT 'JG 9KNJGNO   (TKGFTKEJ  Ó UR·VGT -ÌPKI 9KNJGNO + FGT 0KGFGTNCPFG YCT XQP  CWEJ )TQ­JGT\QI XQP   .WZGODWTI



5KNDGTOGFCKNNG  WPUKIPKGTV CWH FGP $GUWEJ FGU VÒTMKUEJGP )GUCPFVGP #UOK #EJOGV 'HHGPFK KP   $GTNKP $TWUVDKNF #EJOGVU N OKV 6WTDCP WPF 2GN\MCHVCP#EJV <GKNGP 5EJTKHV  OO  I   /CTKGPD *ÒDUEJG2CVKPCMN5VGORGNHGJNGTXQT\ÒINKEJp5VGORGNINCP\

 175


BRANDENBURG-PREUSSEN

2588 2589

2589





5KNDGTOGFCKNNG  WPUKIPKGTV CWH FGP $GUWEJ FGU VÒTMKUEJGP )GUCPFVGP #UOK #EJOGV 'HHGPFK KP   $GTNKP $TWUVDKNF #EJOGVU N OKV 6WTDCP WPF 2GN\MCHVCP#EJV <GKNGP 5EJTKHV  OO  I   /CTKGPD *ÒDUEJG2CVKPCXQT\ÒINKEJ



(TKGFTKEJ9KNJGNO+++5KNDGTOGFCKNNGXQP&(WPF(9.QQUCWHFKG8GTUGV \WPIFGURTGW­KUEJGP-COOGTRT·UKFGPVGP*CPU,CMQDXQP#WGTUYCNF$TWUVDKNFFGU5VCCVUOCPPGUXX )GHNÒIGNVGT)GPKWUUVGJVXXFGP-QRHPCEJNIGYCPFVWPFNGIVGKPGP-TCP\CWHGKPGP5VGKPDNQEM FGT OKV \YGK IGMTGW\VGP (ÒNNJÌTPGTP XGT\KGTV KUV WPF CWH FGO #VVTKDWVG FGT -WPUV WPF 9KUUGPUEJCHV   NKGIGPCO$QFGPDNÒJGPXGTUEJKGFGPG2HNCP\GPKO*KPVGTITWPFT5VQTEJOOI5QOOGT # 4(GKPG6ÌPWPIXQT\ÒINKEJ



*CPU ,CMQD XQP #WGTUYCNF  )WV 2NCWVJ .CPFMTGKU 4QUGPDGTI 9GUVRTGW­GP  Ó KP -ÌPKIUDGTI  

1UVRTGW­GP  XGTNKG­  /CTKGPYGTFGT WPF YWTFG 2T·UKFGPV FGT QUVRTGW­KUEJGP WPF NKVCWKUEJGP -COOGT KP   -ÌPKIUDGTI +O ,CJTG  YWTFG GT \WO 9KTMNKEJGP )GJGKOGP 1DGTHKPCP\ -TKGIU WPF &QO·PGPTCV UQYKG   -WTCVQT FGT 7PKXGTUKV·V -ÌPKIUDGTI DGHÌTFGTV  \WO )GJGKOGP 5VCCVUTCV WPF 1DGTRT·UKFGPVGP XQP 1UV WPF   9GUVRTGW­GPUQYKG.KVCWGP\QIUKEJXQP#WGTUYCNFCWUFGO5VCCVUFKGPUV\WTÒEM

2590

2592

2593



2591

2593

5KNDGTOGFCKNNGXQP&(.QQU#-ÌPKIWPF#*QHHOCPPCWHFGP6QFUGKPGT)GOCJNKP.WKUG #WIWUVG 9KNJGNOKPG #OCNKG *GT\QIKP XQP /GEMNGPDWTI5VTGNKV\ $ÒUVG FGT -ÌPKIKP T QDGP -TQPG   'KP5VGKPDNQEMOKVFGORTGW­KUEJGP9CRRGPKP.CPFUEJCHVFCTÒDGTVKGHJ·PIGPFG9QNMGP(NCOOGWPF FGTUVTCJNGPFG0COG,GJQXCUOOI/CTKGPD5QOOGT#  *ÒDUEJG2CVKPCHCUVXQT\ÒINKEJ



$TQP\GOGFCKNNGXQP4)C[TCTFCWHUGKPGP$GUWEJKPFGT2CTKUGT/ÒP\G7PKHQTOKGTVGU$TWUVDKNF N(ÒPH<GKNGP5EJTKHVOO/CTKGPD5NI,WNKWU  -N5VGORGNHGJNGTXQT\ÒINKEJ





6CNGT##-5&CX-CJPV6JWP  2TCEJVGZGORNCT9KP\,WUVKGTURWTGPHCUV5VGORGNINCP\





-W2TQDG GKPGU PKEJV XGTCWUICDVGP 6CNGT5VÒEMGU  # /KV 4KHHGNTCPF  I #-5  #PO   X5EJTG FQTV-WRHGTXGTUKNDGTV  445GJTUEJÌP





176


BRANDENBURG-PREUSSEN

2595

2594



6CNGT##-5&CX-CJPVR6JWP  5GJTUGNVGPKPFKGUGT'TJCNVWPI-CDKPGVVUVÒEM *GTTNKEJG2CVKPCYKP\,WUVKGTURWTGPHGKPGT5VGORGNINCP\



6CNGT#-COOGTJGTTGPVCNGT#-5&CX-CJPV6JWP

45GJTUEJÌP





6CNGT&#-5&CX-CJPV5NI-KNNKUEJp6JWP&  ,CJTICPIXQPCNNGTITÌ­VGT5GNVGPJGKV5GJTUEJÌP





6CNGT##-5&CX-CJPV6JWP



&KG8QTFGTUGKVGPWOUEJTKHVOKVFGT#DMÒT\WPI-824'755UQNNFGP-ÌPKI\WFGT$GOGTMWPIXGTCPNC­VJCDGP +EJDKPFQEJPKEJVFGT-COOGTJGTTXQP2TGWUU&CJGTYKTFFKGUGT6[R-COOGTJGTTGPVCNGTIGPCPPV

2597

2596

#VVTCMVKXGUXQT\ÒINKEJGU'ZGORNCT



2598

2599

2599



(TKGFTKEJ9KNJGNO+88GTGKPUFQRRGNVCNGT##-5&CX-CJPV6JWP 5GNVGPGT,CJTICPIKPCW­GTIGYÌJPNKEJGT3WCNKV·V*ÒDUEJG2CVKPCXQT\ÒINKEJ





5KNDGTOGFCKNNG  XQP ( 9 -WNNTKEJ CWH FGP 6QF XQP )QVVHTKGF 5EJCFQY $TWUVDKNF 5EJCFQYU T   OKV%CNQVVG&CTUVGNNWPIFGUQDGTGP6GKNUFGT9CPFCTEJKVGMVWTFGUXQP5EJCFQYIGUEJCHHGPGP)TCDOCNU HÒTFGP)TCHGPXQPFGT/CTM&KGFTGK2CT\GP 5EJKEMUCNUIÌVVKPGP OOI/CTKGPD 5QOOGT- 5GJTCVVTCMVKXGU'ZGORNCTOKVJÒDUEJGT2CVKPCXQT\ÒINKEJp5VGORGNINCP\



,QJCPP )QVVHTKGF 5EJCFQY  KP $GTNKP IGJÌTV \W FGP ITÌ­VGP $KNFJCWGTP UGKPGT <GKV 5GKPG DGTÒJOVGUVGP   9GTMGUKPFFCU)TCDOCNFGU)TCHGPXQPFGT/CTMCWUFGO,CJTFCUJKGTCWHFGT4ÒEMUGKVGPFCTUVGNNWPIFGT /GFCKNNG CDIGDKNFGV KUV WPF FKG 3WCFTKIC CWH FGO $TCPFGPDWTIGT 6QT CWU FGO ,CJT  5EJCFQYU -WPUV YCT   UQYQJNXQO-NCUUK\KUOWUCNUCWEJXQO0CVWTCNKUOWUDGGKPHNW­V'TUVCTDCOKP$GTNKP

177


BRANDENBURG-PREUSSEN

2600

2601

2602

2603

2602



8GTGKPUFQRRGNVCNGT##-5&CX-CJPV6JWP  5GNVGPGT,CJTICPI(CUVXQT\ÒINKEJ





8GTGKPUFQRRGNVCNGT##-5&CX-CJPV6JWP

5GJTUEJÌPpXQT\ÒINKEJ





6CNGT##-5,

8QT\ÒINKEJ





8GTGKPUFQRRGNVCNGT##-5&CX-CJPV6JWP

8QT\ÒINKEJ



2604

2605

2606



8GTGKPUFQRRGNVCNGT##-5&CX-CJPV6JWP

(CUVXQT\ÒINKEJ





&QRRGNVGT8GTGKPUVCNGT##-5&CX-CJPV6JWP  (GKPG2CVKPCXQT\ÒINKEJp5VGORGNINCP\





&QRRGNVGT8GTGKPUVCNGT##-5&CX-CJPV6JWP

178

(CUVXQT\ÒINKEJ




BRANDENBURG-PREUSSEN

2608

2607

2609



8GTGKPUVCNGT#CWHUGKPGP6QF#-5&CX-CJPV6JWP  *ÒDUEJG2CVKPCHCUV5VGORGNICP\





9KNJGNO+&QRRGNVGT8GTGKPUVCNGT##-5&CX-CJPV6JWP  5GNVGPGT,CJTICPI2TCEJVGZGORNCT(CUV5VGORGNINCP\





&QRRGNVGT8GTGKPUVCNGT##-5&CX-CJPV6JWP  2TCEJVGZGORNCT5GNVGPGT,CJTICPI8QT\ÒINKEJp5VGORGNINCP\



2610

2611

2612



&QRRGNVGT8GTGKPUVCNGT##-5&CX-CJPV6JWP  5GNVGPGT,CJTICPI5EJÌPpUGJTUEJÌPUGJTUEJÌP





&QRRGNVGT8GTGKPUVCNGT##-5&CX-CJPV6JWP  9KP\-TCV\GTHCUVXQT\ÒINKEJ





&QRRGNVGT8GTGKPUVCNGT##-5&CX-CJPV6JWP



(CUVXQT\ÒINKEJ

179


BRANDENBURG-PREUSSEN

2613

2615

2614



&QRRGNVGT8GTGKPUVCNGT%#-5&CX-CJPV6JWP%

8QT\ÒINKEJ





&QRRGNVGT8GTGKPUVCNGT##-5&CX-CJPV6JWP  4-CDKPGVVUVÒEM2TCEJVXQNNG2CVKPCHCUV5VGORGNINCP\





5KNDGTOGFCKNNG  XQP ' 9GKICPF WPF ( 9 -WNNTKEJ 2T·OKGPOGFCKNNG FGU -TQPRTKP\GPRCCTGU   (TKGFTKEJ9KNJGNOWPF8KEVQTKCHÒTFKG(GTKGPMQNQPKG.QVVGTKG&KG-ÌRHGFGU-TQPRTKP\GPRCCTGUPGDGP GKPCPFGT N<YGK -KPFGT URKGNGP KO 5EJWV\G FGT *[IKGKC KO *KPVGTITWPF FCU /GGT OKV 5EJKHHGP WPF   DCFGPFGP-KPFGTPKO#DUEJPKVV5EJCNG\YKUEJGP\YGK5EJNCPIGPOOI*ÒUMGP 5NI$TGVVCWGT5QOOGT-WPF9 2TCEJVGZGORNCT*GTTNKEJG2CVKPCHCUV5VGORGNINCP\



&KGXQTNKGIGPFG/GFCKNNGYWTFGCPXGTFKGPVG/KVCTDGKVGTWPF*GNHGTUQYKGCPITQ­\ÒIKIG(ÌTFGTGTFGU*KNHUYGTMGU XGTNKGJGP&KG(GTKGPMQNQPKGPFKGITÌ­VGPVGKNUCWUFGO'TNÌUFGT.QVVGTKGHKPCP\KGTVYWTFGPDGUVCPFGPCWU*GKOGP HÒTGTJQNWPIUDGFÒTHVKIG-KPFGT

2616



180

(TKGFTKEJ +++  $TQP\GOGFCKNNG  9GTMUVCVV .CWGT 0ÒTPDGTI CWH UGKPGP #WHGPVJCNV KP 5CP   4GOQ 7PKHQTOKGTVGU $TWUVDKNF (TKGFTKEJU +++ CNU -TQPRTKP\ (TKGFTKEJ 9KNJGNO T OKV WOIGNGIVGO   /CPVGN&GT )GPKWU FGT *QHHPWPI OKV #PMGT WPF 2CNO\YGKI MPKGV JCNDT CWH GKPGO 5QEMGN FGT OKV   GKPGO-TCP\XGT\KGTVKUVKPFGO5#04'/1IGUEJTKGDGPUVGJVWPVGPGKP#FNGTUEJKNFCWH'K EJGP\YGKIGPKO*KPVGTITWPFFCU/GGTWPFFKG5VCFVCPUKEJVXQP5CP4GOQOO/CTKGPD 8QT\ÒINKEJ




BRANDENBURG-PREUSSEN

2617

2618

2624







2619

2624

9KNJGNO++5KNDGTOGFCKNNGQ,  WPUKIPKGTVCWHFGP)GDWTVUVCIUGKPGU5QJPGU -TQPRTKP\ (TKGFTKEJ 9KNJGNO $TWUVDKNF FGU -TQPRTKP\GP KP *WUCTGPWPKHQTO OKV -CNRCM X X$TWUV   DKNFFGT-CKUGTKPWPF/WVVGTFGU-TQPRTKP\GP#WIWUVG8KMVQTKCKO-NGKFWPFOKVWOIGNGIVGT*CNUMGVVGT OOI/CTKGPDp  5GNVGPDGUQPFGTUKPFKGUGT'TJCNVWPI2TCEJVGZGORNCT8QT\ÒINKEJp5VGORGNINCP\



5KNDGTOGFCKNNG9GTMUVCVV1GTVGN$GTNKPCWHFKG'KPYGKJWPIFGU4GKEJUVCIUIGD·WFGUKP$GTNKPCO  &G\GODGT $TWUVDKNF N KP 7PKHQTO OKV WOIGNGIVGT 1TFGPUMGVVG#PUKEJV FGU 4GKEJUVCIUIGD·WFGU   /KV4CPFITCXWT»241»).14+#»'6»2#64+#OOI/CTKGPDp  2TCEJVGZGORNCT(CUV5VGORGNINCP\



5KNDGTOGFCKNNG  9GTMUVCVV /C[GT 5VWVVICTV CWH FKG 'TÌHHPWPI FGU 0QTF1UVUGG-CPCNU $ÒUVGP   9KNJGNOU ++ (TKGFTKEJU +++ WPF 9KNJGNOU + PGDGPGKPCPFGT T WOJGT .QTDGGTMTCP\#PUKEJV FGU   -CPCNUOKVFGT$TÒEMGDGK*QNVGPCWOKVGKPGOHCJTGPFGP5EJKHHKO8QTFGTITWPFKO*KPVGTITWPFUVTCJ NGPFG5QPPGOOI.CPIG/CTKGPD FQTVKP$TQP\G   +P5KNDGTUGJTUGNVGP*ÒDUEJG2CVKPCXQT\ÒINKEJp5VGORGNINCP\



.165$4#0&'0$74)24'755'0 

7OHCPITGKEJG5COONWPIXQP/ÒP\GPCWUFGT4GIKGTWPIU\GKV(TKGFTKEJ9KNJGNOUFGUITQ­GP-WTHÒTUVGP WPF(TKGFTKEJU+++XQO2HGPPKIDKU\WO4GKEJUVCNGT&KG5COONWPIDKGVGVGKPGPJGTXQTTCIGPFGPªDGT DNKEMÒDGTFKGRTGW­KUEJG/ÒP\RT·IWPIFGT\YGKVGP*·NHVGFGU,CJTJWPFGTVUWPFGPVJ·NV\CJNTGKEJG DGUUGTG 6[RGP WPF ,CJTI·PIG 'KP JQEJKPVGTGUUCPVGU 1DLGMVFCUUKEJ\WO#WUDCWQFGTCNU'TI·P\WPI GKPGTDGTGKVUDGUVGJGPFGP5COONWPIGKIPGVDKVVGWPDGFKPIVDGUKEJVKIGP  5VÒEM7PVGTUEJKGFNKEJGTJCNVGPFGT)GUCOVGKPFTWEMKUVUGJTUEJÌP



-NGKPG5COONWPIXQPRTGW­KUEJGP/ÒP\GPFGU,CJTJWPFGTVUXQO2HGPPKIDKU\WO&QRRGNVCNGT FCTWPVGTUGNVGPG6[RGPWPFGKPKIGJÒDUEJG3WCNKV·VGP*QEJKPVGTGUUCPVGU1DLGMVDKVVGDGUKEJVKIGP  5VÒEM/GKUVUGJTUEJÌP





&QRRGNVCNGT  #  # 6CNGT  $  #  '  #  # #WUDGWVG   #  

#WUDGWVG ###6CNGT$ 5VÒEM5GJTUEJÌPpXQT\ÒINKEJ





&KXGTUG /GFCKNNGP FGU <GKVTCWOGU  FCTWPVGT FTGK 5KNDGTOGFCKNNGP +PVGTGUUCPVGU .QV DKVVG   DGUKEJVKIGP 5VÒEM5GJTUEJÌPpXQT\ÒINKEJ





)GQTI (TKGFTKEJ #FOKPKUVTCVQT  )TQUEJGP  -ÌPKIUDGTI /CTKGPD  XCT   0GWOCPPX5EJT 4*ÒDUEJG2CVKPCUGJTUEJÌP



24'755'0*'4<1)67/ 15624'755'0   181


BRAUNSCHWEIG UND LÜNEBURG

$4#705%*9'+) 56#&6 

.16 #PPGPITQUEJGP  ,GUUG  /CTKGPITQUEJGP  ,GUUG  &C\W $TCWPUEJYGKI WPF   .ÒPGDWTI 'TPUV #WIWUV  UGKV  $KUEJQH XQP 1UPCDTÒEM  /CTKGPITQUEJGP    %NCWUVJCN9GNVGT 5VÒEM5GJTUEJÌP

2627

2626

2629

2628

2630



2631

$4#705%*9'+)70&.ª0'$74) $4#705%*9'+).ª0'$74)*'4<1)67/ 

*GKPTKEJFGT.ÌYG*GT\QIXQP5CEJUGP$TCMVGCV$TCWPUEJYGKII.ÌYGN$GTIGT &GPKEMG 5GJTUEJÌPpXQT\ÒINKEJ





$TCMVGCV.ÒPGDWTII.ÌYGN·WHVN$GTIGT&GPKEMG

5GJTUEJÌP





$TCMVGCV.ÒPGDWTII.ÌYGN·WHVN$GTIGTXIN&GPKEMG

(CUVXQT\ÒINKEJ





9KNJGNOQFGT*GKPTKEJFGT.CPIG$TCMVGCV.ÒPGDWTII.ÌYGURTKPIVTÒDGT <KPPGPOCWGT$GTIGT 8QT\ÒINKEJ





*GKPTKEJ FGT .CPIG  $TCMVGCV .ÒPGDWTI  I .ÌYG N·WHV T FGP -QRHPCEJXQTPIG YCPFVFCXQT4KPIGN$GTIGT *ÒDUEJG2CVKPCXQT\ÒINKEJ



2632



2633

2634

1VVQFCU-KPF$TCMVGCV$TCWPUEJYGKII.ÌYGUEJTGKVGVTÒDGT<KPPGPVWTO$GTIGT &GPKEMGXIN FQTVWPVGT1VVQ+8  -N6WUEJG\CJNCWHFGT4ÒEMUGKVGHCUVXQT\ÒINKEJ



$4#705%*9'+))47$'0*#)'0(ª456'067/



9QNHICPIWPF2JKNKRR++4GKEJUVCNGT )TQUEJGP 1UVGTQFGOKV6KVGN4WFQNHU++ &CX9GNVGT 'VYCU$GNCIUGJTUEJÌP



4GKEJUVCNGT )TQUEJGP 1UVGTQFGOKV6KVGN4WFQNHU++&CX9GNVGT

 (CUVUGJTUEJÌP





4GKEJUVCNGT )TQUEJGP 1UVGTQFGOKV6KVGN4WFQNHU++&CX9GNVGT

5GJTUEJÌP



182




BRAUNSCHWEIG UND LÜNEBURG

2635

$4#705%*9'+)91.('0$ª66'.(ª456'067/ 

*GKPTKEJFGT,ÒPIGTG6CNGT)QUNCTQFGT4KGEJGPDGTII*'04+%85»& »)4#»$470»'6».80'»&»$TWUVDKNFNOKV-CRRGWPFWOIGNGIVGO/CPVGN010»8+&+ »+8568/»&'4'.+%68 5VGTPG $GJGNOVGUXKGTHGNFKIGU9CRRGP\WFGP5GKVGP(KCNCp 5NI&T-QEJp9GNVGTp  8QPCNNGTITÌ­VGT5GNVGPJGKV7PGFKGTVGT/ÒP\V[R$GNCIUEJÌPpUGJTUEJÌP



2636



,WNKWU  .ÌUGT \W  4GKEJUVCNGTP  *GKPTKEJUUVCFV /KV 9GTVCPICDG :  6CNGT    /ÒP\OGKUVGT*GKPTKEJ8GGDGTI)GJCTPKUEJVGUDGJGNOVGU*ÒHVDKNFHCUVXXOKVFGT4GEJVGP FKG 5VTGKVCZV UEJWNVGTPF FKG .KPMG CO 5EJYGTVITKHH WOJGT XKGT -TGKUG FCTKP DGHKPFGP UKEJ XQPKPPGP PCEJCW­GP 5KGDGPRGTUQPKHK\KGTVG2NCPGVGP 5VGTP\GKEJGP 5EJTKHV 5EJTKHV9KNFGT/CPP OKV4GKEJUCRHGNKPFGT4GEJVGPWPFYKNFGT/CPPOKV.KEJVKPFGT.KPMGPJCNVGPDGJGNOVGUXKGTHGNFKIGU 9CRRGPWOJGTXKGT-TGKUGFCTKPDGHKPFGPUKEJXQPKPPGPPCEJCW­GP 5KGDGPRGTUQPKHK\KGTVG2NCPG VGP 5VGTP\GKEJGP 5EJTKHV 5EJTKHV&CX#&WXG9GNVGT  8QPITÌ­VGT5GNVGPJGKV-N2WP\GKOKO4CPF (9 MN-TCV\GTUGJTUEJÌP  $GK FGT 4CPFRWP\G (9 KO 4CPF JCPFGNV GU UKEJ PCEJ WPUGTGP 'TMGPPVPKUUGP WO GKPG 5VGWGTOCTMG (TKGFTKEJ   9KNJGNOU +++ XQP 2TGW­GP OKV FGT UEJYGTG 5KNDGTUVÒEMG DGK 'ZRQTV ÒDGT FKG .CPFGUITGP\GP IGMGPP\GKEJPGV   YWTFGP

2637

2638



4GKEJUVCNGT)QUNCT*CNDGT.KEJVVCNGT9GNVGT

4#VVTCMVKXGUUGJTUEJÌPGU'ZGORNCT



*GKPTKEJ,WNKWU4GKEJUVCNGT<GNNGTHGNFCWHFGP6QFUGKPGT/WVVGT*GFYKIXQP $TCPFGPDWTI9GNVGT 8QPITQ­GT5GNVGPJGKV*ÒDUEJG2CVKPCMN*GPMGNURWTUGJTUEJÌP

 

*GFYKI  /·T\   YCT FKG 6QEJVGT FGU -WTHÒTUVGP ,QCEJKO ++ XQP $TCPFGPDWTI WPF FGUUGP )GOCJNKP   *GFYKI 6QEJVGT FGU -ÌPKIU 5KIKUOWPF XQP 2QNGP &KG 8GTO·JNWPI OKV ,WNKWU XQP 9QNHGPDÒVVGN HCPF CO    (GDTWCTKP$GTNKPUVCVV5KGUVCTDCO1MVQDGTCWH5EJNQ­*GUUGPDGK$TCWPUEJYGKIWPFYWTFGCO 0QXGODGTKP9QNHGPDÒVVGNDGKIGUGV\V

183


BRAUNSCHWEIG UND LÜNEBURG

2640

2639

2641



4GKEJUVCNGT<GNNGTHGNF&CX9GNVGT$

5GJTUEJÌPpXQT\ÒINKEJ





4GKEJUVCNGT<GNNGTHGNF9GNVGT  4*ÒDUEJG2CVKPCMN5EJTÌVNKPIUHGJNGTCO4CPFUGJTUEJÌP





(TKGFTKEJ7NTKEJ4GKEJUVCNGT)QUNCTQFGT<GNNGTHGNF9GNVGT  -N-TCV\GTUGJTUEJÌP



2642



2643

2644

4GKEJUVCNGT<GNNGTHGNF#WUDGWVGFGT)TWDG5V,CEQD&CX/ÒUGNGTI9GNVGT 5GNVGPG8CTKCPVG-N*GPMGNURWTUGJTUEJÌP



5V ,CEQD ,CEQDWU  IGJÌTVG \WO -TGKU FGT \YÌNH #RQUVGN WPF YCT UR·VGT 5EJWV\JGKNKIGT FGT 2KNIGT &GT .GIGPFG   PCEJUQNNGTKP5RCPKGPIGYKTMVJCDGPªDGTUGKPGOCPIGDNKEJGP)TCDYWTFGGKPG-KTEJGGTDCWVWOFKGJGTWOFKG 5VCFV 5CPVKCIQ FG %QORQUVGNC GPVUVCPF FKG DGTGKVU UGKV FGO /KVVGNCNVGT GKPGT FGT DGMCPPVGUVGP 9CNNHCJTVUQTVG FGT   %JTKUVGPJGKVKUV



#WIWUVFGT,ÒPIGTG4GKEJUVCNGT<GNNGTHGNF)NQEMGPVCNGT&CX9GNVGT 5GJTUEJÌP





4GKEJUVCNGT<GNNGTHGNF)NQEMGPVCNGT&CX&,9GNVGT



184

5GJTUEJÌPpXQT\ÒINKEJ


BRAUNSCHWEIG UND LÜNEBURG

2645

2646

2647



4GKEJUVCNGT<GNNGTHGNF&CX9GNVGT

*ÒDUEJG2CVKPCUGJTUEJÌP





.ÌUGT\W4GKEJUVCNGTP<GNNGTHGNF/KV9GTVRWP\GI&CX&WXG9GNVGT  #VVTCMVKXGU'ZGORNCTOKVJÒDUEJGT2CVKPCUGJTUEJÌPpXQT\ÒINKEJ





4GKEJUVCNGTQ,<GNNGTHGNF4GKUGVCNGT&CX9GNVGT#  *ÒDUEJG2CVKPCMN2T·IGUEJY·EJGCVVTCMVKXGUXQT\ÒINKEJGU'ZGORNCT



&KG&CVKGTWPIFGT4GKUGVCNGTKUVKPFGT.KVGTCVWTPKEJVCWUTGKEJGPFIGMN·TV(KCNCQTFPGVFKGUG)GRT·IGKPFCU,CJT  GKP YQDGK GT UKEJ XQTUKEJVKI CWH 4GVJOGKGT DG\KGJVPCEJFGUUGP#PUKEJVFKG4GKUGVCNGT\WFKGUGO<GKVRWPMV CWH$GHGJNFGU*GT\QIU#WIWUVFGU,ÒPIGTGPJGTIGUVGNNVYWTFGP-TQJCXGTOWVGVFC­FKG4GKUGPFGU*GT\QIUPCEJ +VCNKGP /CNVC 'PINCPF WUY FGT )TWPF HÒT FCU #WUDTKPIGP FKGUGU 6CNGTV[RU YCT 'KP FGPMDCTGT #PNC­ HÒT FKG   2T·IWPIGPMÌPPVGCDGTCWEJFGT6QF#WIWUVUKO,CJTGUGKP&CPPYÒTFGFKGCWHFGP4GKUGVCNGTPFCTIGUVGNNVG 5\GPGU[ODQNKUEJHÒTFGP*GT\QIUVGJGPFGTUGKPGNGV\VG4GKUGCPFCUCPFGTG7HGTCPVTKVV

2648



4WFQNH#WIWUV.ÌUGT\W4GKEJUVCNGTP<GNNGTHGNF/KV9GTVRWP\GI&CX &WXG9GNVGT (GNFGTIGIN·VVGVUQPUVUGJTUEJÌPpXQT\ÒINKEJ

 185


BRAUNSCHWEIG UND LÜNEBURG

2649

2650

2651



4WFQNH#WIWUVWPF#PVQP7NTKEJ4GKEJUVCNGT<GNNGTHGNF9GNVGT  *GTTNKEJG2CVKPCNGKEJVG2T·IGUEJY·EJGXQT\ÒINKEJ





#PVQP7NTKEJ4GKEJUVCNGT<GNNGTHGNF<YKVVGTRT·IWPIOKVFGO/ÒP\\GKEJGP%CWHFGT 8QTFGTUGKVGWPFFGO/ÒP\OGKUVGT\GKEJGP4$CWHFGT4ÒEMUGKVG&CX#PO9GNVGT0CEJVTCI# 44*ÒDUEJG2CVKPCCVVTCMVKXGUUGJTUEJÌPGU'ZGORNCT



-CTN +  4GKEJUVCNGT  <GNNGTHGNF #WUDGWVG FGT )TWDG .CWVGPVJCNU )NÒEM &CX    /ÒUGNGT9GNVGT (CUVUGJTUEJÌP





2652

2654

2653



4GKEJUVCNGTRTGW­$TCWPUEJYGKI&CX9GNVGT

4*ÒDUEJG2CVKPCXQT\ÒINKEJ





4GKEJUVCNGTRTGW­$TCWPUEJYGKI&CX9GNVGT

49KP\4CPFHGJNGTUGJTUEJÌP





-CTN ++  7PVGT 8QTOWPFUEJCHV -ÌPKI )GQTIU +8 XQP )TQ­DTKVCPPKGP    /CTKGPITQUEJGP%X%#-5,  2TCEJVGZGORNCTOKVJGTTNKEJGT2CVKPC8QT\ÒINKEJp5VGORGNINCP\

186




BRAUNSCHWEIG UND LÜNEBURG

2655



2657

2656

9KNJGNO  8GTGKPUFQRRGNVCNGT  $ L·JTKIGU 4GIKGTWPIULWDKN·WO #-5  &CX    -CJPV6JWP 8QT\ÒINKEJ



$4#705%*9'+).ª0'$74)%'..'(ª456'067/ 

%JTKUVKCP$KUEJQHXQP/KPFGP4GKEJUVCNGT%NCWUVJCN&CX9GNVGT  #VVTCMVKXGU'ZGORNCTOKVJÒDUEJGT2CVKPCUGJTUEJÌP





%JTKUVKCP.WFYKI4GKEJUVCNGT<GNNGTHGNF&CX HCNUEJG4ÒEMUGKVGPCDDKNFWPI  9GNVGT *ÒDUEJG2CVKPCUGJTUEJÌP



2659

2658

2660



4GKEJUVCNGT%NCWUVJCN&CX9GNVGT  *ÒDUEJG2CVKPCCVVTCMVKXGUUGJTUEJÌPGU'ZGORNCT





)GQTI9KNJGNO4GKEJUVCNGT%GNNG9GNVGT

45GJTUEJÌP





/CTKGPITQUEJGP%NCWUVJCN&CX9GNVGT

5GJTUEJÌP

 187


BRAUNSCHWEIG UND LÜNEBURG

2661 (doppelt)

1,5:1



188

1,5:1

)GQTI&QRRGNVGT4GKEJUVCNGT<GNNGTHGNFCWHUGKPGP6QFIÚ)'14)Ú&Ú)Û &8:Û$4805Ù'6.80%+4%Ú5#:10Ù+0('4Ú)'0'4#.Ù)GJCTPKUEJVGU*ÒHVDKNFNOKV*GNO KP FGT .KPMGP WPF -QOOCPFQUVCD KP FGT 4GEJVGP0#685  :8++ Û ('$48 Û #1  /&.:::++ Û   1$++6++Û#24+.Û*14#8'52Û8++Û#1Ú/&%:.+Û2#64+#4':+6Û.+$'4#6##0Ü8Ü /'05 Û  ++ Û 8+:+6 #1 5 .+: /'05  Û + Û &+'5 :+++ Û *'4152+85  ('.+: 8+%614    64+8/2*#  8GT\KGTWPI  614 8GT\KGTWPI  FCTWPVGT FKG 5KIPCVWT *5  IGMTGW\VG 5EJNÒUUGN *GP   PKPI5EJNÒVGT/ÒP\OGKUVGTKP<GNNGTHGNF &CX9GNVGT  2TCEJVGZGORNCTOKVHGKPGT6ÌPWPI8QT\ÒINKEJp5VGORGNINCP\ 


BRAUNSCHWEIG UND LÜNEBURG

2662

2663

2664



4GKEJUVCNGT<GNNGTHGNFCWHUGKPGP6QF&CX9GNVGT  449KP\*GPMGNURWTYKP\)TCHHKVKUGJTUEJÌP





)GQTI9KNJGNO5KNDGTOGFCKNNGQ,XQP*2)TQ­MWTV)GJCTPKUEJVGU$TWUVDKNFTOKV WOIGNGIVGO/CPVGN4Q­URTKPIVNÒDGT.CPFUEJCHVOOI$TQEMOCPP  4(GKPG2CVKPCMN4CPFHGJNGTXQT\ÒINKEJ



4GKEJUVCNGT<GNNGTHGNF&CX9GNVGT





5GJTUEJÌP

2665

2666

2666



4GKEJUVCNGT<GNNGTHGNF&CX9GNVGT

5GJTUEJÌP





4GKEJUVCNGT<GNNGTHGNF/KV9GTVRWP\GI&CX&WXG9GNVGT  #VVTCMVKXGU'ZGORNCTOKVHGKPGT2CVKPCHCUVXQT\ÒINKEJXQT\ÒINKEJ

 189


BRAUNSCHWEIG UND LÜNEBURG

2668

2667





2667

,QJCPP(TKGFTKEJ.ÌUGT\W4GKEJUVCNGTP%NCWUVJCNCWHUGKPGP6QF/KV9GTV RWP\GI&CX&WXG$9GNVGT  44*ÒDUEJG2CVKPCMN*GPMGNURWTUGJTUEJÌP



'TPUV#WIWUVUGKV$KUEJQHXQP1UPCDTÒEM4GKEJUVCNGT%NCWUVJCN&CX #PO9GNVGT 445EJÌPpUGJTUEJÌP



2670

2669 2670



6CNGT%NCWUVJCN&CX9GNVGT

5GJTUEJÌP



4GKEJUVCNGT%NCWUVJCN#WUDGWVGFGT*CT\GT)TWDGP/KV4CPFUEJTKHV#)4+%1.#/r5')'6+5 r52'5r015r#.+6r*“%%'r/'6#..+r&CX#/ÒUGNGTH9GNVGT 44(CUVXQT\ÒINKEJ

'ZGORNCTFGT#WMVKQP(TKV\4WFQNH-ÒPMGT1UPCDTÒEM0T

 

2671



190

5KNDGTOGFCKNNGXQP'$TCDCPFVCWHFKG'TNCPIWPIFGT-WTYÒTFG)GJCTPKUEJVGU$TWUVDKNFTOKV WOIGNGIVGO /CPVGN(ÒTUVGPJWV ÒDGT PGWP <GKNGP 5EJTKHV WPVGP 4QUGVVG /KV 4CPFUEJTKHV 676#674   '6140#6ÜOOI$TQEMOCPP  44(GKPG2CVKPCYKP\4CPFHGJNGTUGJTUEJÌPpXQT\ÒINKEJ




BRAUNSCHWEIG UND LÜNEBURG

2673

2672





2674

4GKEJUVCNGT%NCWUVJCN#WUDGWVGFGT*CT\GT)TWDGP/KV4CPFUEJTKHV#)4+%1.#/f5')'6+5 f52'5f015f#.+6f*“%%'f/'6#..+f&CX/ÒUGNGT9GNVGT  44*ÒDUEJG2CVKPCUGJTUEJÌPpXQT\ÒINKEJ



)GQTI+.WFYKI5KNDGTOGFCKNNGXQP5.CODGNGVCWHFKG0CEJHQNIGUGKPGT/WVVGT 5QRJKCXQPFGT2HCN\CWHFGPGPINKUEJGP6JTQP$TWUVDKNFFGT-WTHÒTUVKPTOKV9KVYGPUEJNGKGT$TWUV DKNF FGT *GT\QIKP /CVJKNFG )GOCJNKP *GKPTKEJU FGU .ÌYGPTOOI$TQEMOCPP 'VYCUDGTKGDGPXQT\ÒINKEJ



5QRJKC ÓYCTFKG6QEJVGTFGUWPINÒEMNKEJGP(TKGFTKEJXQPFGT2HCN\ 9KPVGTMÌPKI WPFFGT'NKUCDGVJ 5VWCTV 6QEJVGT ,CEQDU + XQP )TQ­DTKVCPPKGP 5KG DTCEJVG KJTG ,WIGPF KP *QNNCPF \W WPF YCT CW­GTIGYÌJPNKEJ   IGDKNFGV &WTEJ GKPG  GTNCUUGPG 2CTNCOGPVUCMVG YWTFG UKG CNU 'PMGNKP ,CEQDU +WPFFKGXQPKJTCDUVCOOGPFG MWTHÒTUVNKEJG (COKNKG CWH FGP 6JTQP XQP )TQ­DTKVCPPKGP DGTWHGP $GFKPIWPI YCT FC­ UKG WPF KJTG .GKDGUGTDGP   RTQVGUVCPVKUEJ DNKGDGP WPF -ÌPKIKP #PPC DGK KJTGO 6QFG QJPG 'TDGP YCT 5QRJKC UVCTD LGFQEJ \YGK /QPCVG XQT   -ÌPKIKP#PPC5QVTCVKJT·NVGUVGT5QJP)GQTI.WFYKIFKG6JTQPHQNIGCNU)GQTI+-ÌPKIXQP)TQ­DTKVCPPKGP CP&KG4ÒEMUGKVGPFCTUVGNNWPIFGTXQTNKGIGPFGP/GFCKNNG\GKIV/CVJKNFG6QEJVGTFGUGPINKUEJGP-ÌPKIU*GKPTKEJ++ 5KGIKNVJKGTCNU5VCOOWVVGTFGT$TCWPUEJYGKIGT*·WUGTWPF\GKIVGKPGHTÒJG8GTDKPFWPIOKV'PINCPFCP



4GKEJUVCNGT<GNNGTHGNF&CX9GNVGT

5GJTUEJÌP



2675



 CNU )GQTI + -ÌPKI XQP )TQ­DTKVCPPKGP  4GKEJUVCNGT  %NCWUVJCN &CX    5OKVJ9GNVGT 5GJTUEJÌP

 191


BRAUNSCHWEIG UND LÜNEBURG

2676



2677

2678

5KNDGTOGFCKNNGXQP,%TQMGTCWHFGP5GGUKGIDGK-CR2CUUCTQ 5K\KNKGP )GJCTPKUEJVGU$TWUVDKNF T OKV .QTDGGTMTCP\ WPF WOIGNGIVGO /CPVGN0GRVWP UVGJV CWH GKPGT 4QUVTCNU·WNG KPOKVVGP XQP 5GG   MTKGIUVTQRJ·GPOOI$TQEMOCPP'KOGT  *ÒDUEJG2CVKPCYKP\4CPFHGJNGTXQT\ÒINKEJ



0CEJFGO FKG 5RCPKGT 5CTFKPKGP GTQDGTV JCVVGP WPF KO $GITKHH YCTGP 5K\KNKGP \W DGUGV\GP YWTFG FGT DTKVKUEJG   #FOKTCN5KT)GQTIG$[PIOKV5EJKHHGPCWUIGUCPFVFGPURCPKUEJGP)GPGTCN&G.GFGFCTCP\WJKPFGTP/GUUKPC \W GTTGKEJGP 'U MCO \WO -CORH FKG \CJNGPO·­KI ÒDGTNGIGPG URCPKUEJG (NQVVG YWTFG \GTUVÌTV WPF FGT )GPGTCN   IGHCPIGPIGPQOOGP 4QUVTWO JKG­ FGT 4COOURQTP FGT CPVKMGP 5EJKHHG &KGUGT IGH·JTNKEJUVG 6GKN YWTFG FGP   GTQDGTVGP5EJKHHGPCDIGU·IVWPFCP4GFPGTVTKDÒPGPWPF5KGIGUU·WNGPDGHGUVKIVFCJGT4QUVTCNU·WNG



4GKEJUVCNGT%NCWUVJCN&CX5OKVJ9GNVGT

5GJTUEJÌP



)GQTI ++  5KNDGTOGFCKNNG  XQP , ) *QNV\JG[ CWH FGP 6QF UGKPGT 6QEJVGT #PPC   $TWUVDKNF #PPCU N OKV 9KVYGPUEJNGKGT ÒDGT KJTGO *CWRV GKP -TCP\ CWU \GJP 5VGTPGP8QT GKPGO   (ÒTUVGPOCPVGN GKP 2CTCFGDGVV FCTCWH UVGJV FGT 5CTI OKV FGP XGTGKPKIVGP 9CRRGPUEJKNFGP XQP 0CUUCW   1TCPKGP WPF 'PINCPF CO $QFGP )NQDWU $WEJ 9CCIG 4GIKGTWPIUTWFGT WPF \YGK MNGKPG 1TCPIGP   D·WOEJGPOOI$TQEMOCPP *GTTNKEJG2CVKPCXQT\ÒINKEJp5VGORGNINCP\





#PPC 0QXGODGTKP*CPPQXGTYCTFKGGTUVG6QEJVGT)GQTIU++WPFFGUUGP)GOCJNKP9KNJGNOKPG-CTQNKPG XQP$TCPFGPDWTI#PUDCEJ-WNODCEJ5KGXGTO·JNVGUKEJCO/·T\OKV2TKP\9KNJGNO+8-CTN*GKPTKEJ (TKUQ 'TDUVCVVJCNVGT FGT 0KGFGTNCPFG #PPC UVCTD PCEJ MWT\GT -TCPMJGKV CO  ,CPWCT  KP &GP *CCI WPF   JKPVGTNKG­ \YGK WPOÒPFKIG -KPFGT %CTQNKPC WPF 9KNJGNO UR·VGT 9KNJGNO 8 CNU 'TDUVCVVJCNVGT  FKG CWH FGT4U &CTUVGNNWPIFKGUGT/GFCKNNGFWTEJFKGDGKFGP1TCPIGPD·WOEJGPU[ODQNKUKGTVYGTFGP

2679

2680



)GQTI +++  4GKEJUVCNGT  %NCWUVJCN #WUDGWVG FGT )TWDG 5V #PFTGCU &CX    /ÒUGNGT5OKVJ9GNVGT -N5EJTÌVNKPIUHGJNGTXQT\ÒINKEJ





)GQTI +8  5KNDGTOGFCKNNG  XQP - ( 8QKIV 9GTMUVCVV .QQU $GTNKP CWH UGKPG #P   MWPHV KP *CPPQXGT $ÒUVG T OKV .QTDGGTMTCP\ WPF WOIGNGIVGO /CPVGN&GT -ÌPKI OKV .QTDGGTMTCP\   WPF WOIGNGIVGO /CPVGN TGKVGV T XQT KJO UEJTGKVGV (GNKEKVCU T OKV /GTMWTUVCD WPF (ÒNNJQTP 1JPG   4CPFUEJTKHVOOI$TQEMOCPP#PO  2TCEJVGZGORNCTOKVJGTTNKEJGT2CVKPC5VGORGNINCP\



192


BREMEN

2682

2681



9KNJGNO +8   6CNGT ##WUDGWVGFGT)TWDG$GTIYGTMU9QJNHCJTVDGK%NCWUVJCN #-5, 45GJTUEJÌP





6CNGT##-5&CX-CJPV6JWP



*GTTNKEJG2CVKPCXQT\ÒINKEJp5VGORGNINCP\

.16$4#705%*9'+).ª0'$74) 

#NNIGOGKP$TCWPUEJYGKI9QNHGPDÒVVGN6CNGT6CNGT6CNGT -QPX6CNGT  $TCWPUEJYGKI%CNGPDGTI*CPPQXGT/CTKGPITQUEJGP6CNGT)WVG)TQUEJGP 6CNGT ,CJTGU\CJNKO5VGORGNCWUIG·PFGTV#WUDGWVG   5VÒEM5GJTUEJÌPWPFDGUUGT



2684 1,5:1

4'+%*5/ª0<5666' 

1,5:1

$4'+5#%*

1VVQ+&GPCTQ, CD )GOGKPUEJCHVURT·IWPIOKV*GT\QI$WTMJCTF++  I 1661/2'4#64-TGW\ 84%*#4&85-TGW\&CPPGPDGTIXCT  8QPITQ­GT5GNVGPJGKV.GKEJVGªDGTRT·IWPIUURWTGPHGKPG6ÌPWPIHCUVXQT\ÒINKEJ



2685

56#&6 

-NKRRG \W  -TGW\GTP  IGRT·IV Y·JTGPF FGT $GNCIGTWPI FWTEJ FCU GXCPIGNKUEJG *GGT XQO    #WIWUVDKU\WO1MVQDGT$GTUVGVVNGKEJVXCT$TCWUG/CPUHGNF6HNGKEJVXCT  2T·IGUEJY·EJGUGJTUEJÌP



$4'+5)#7 

 ,CJTJWPFGTV .QV XQP GKPUGKVKIGP XKGT\KRHGNKIGP 2HGPPKIGP WO  )GHNÒIGNVGU (CDGNYGUGP  

.KPFYWTO T 5VÒEM5EJÌPpUGJTUEJÌP



2687

'4<$+567/ 

$4'/'0

#FCNDGTV  &GPCT  I -QRH N FCXQT -TGW\UVCD WPF XKGT 2WPMVG<YGK $WEJUVCDGP   UEJNÒUUGNOKV4WPF'CWH$QIGP&CPPGPDGTI-KNIGT$TGO&  ªDNKEJG2T·IGUEJY·EJGUQPUVUGJTUEJÌPGU'ZGORNCT

 193


BRESLAU

2689

2688

2688

56#&6 

4GKEJUVCNGTOKV6KVGN(GTFKPCPFU+++&CX,WPIM



)TQVG#-5,

 *ÒDUEJG2CVKPCUGJTUEJÌPpXQT\ÒINKEJ



5VGORGNINCP\



2690

$4'/'070&8'4&'0*'4<1)67/706'45%*9'&'0 

-CTN:+4GKEJUVCNGT5VCFGI$TWUVDKNFTOKVWOIGNGIVGO/CPVGNFCTWPVGT FKG5KIPCVWT,%# ,QJCPP%JTKUVKCP#TGPUDWTI/ÒP\OGKUVGTKP5VCFG )GMTÌPVGU9CRRGP XQP\YGK.ÌYGPIGJCNVGP#JNUVTÌO&CX  W­GTUVUGNVGPKPFKGUGT'TJCNVWPI2TCEJVGZGORNCT #WUFTWEMUXQNNG2CVKPCXQT\ÒINKEJp5VGORGNINCP\  &KG 5GNDUV·PFKIMGKV FGU 'T\DKUVWOU $TGOGP GPFGVG KO L·JTKIGP -TKGI  FWTEJ F·PKUEJG #FOKPKUVTCVKQP   WPFFWTEJUEJYGFKUEJG$GUGV\WPI&GTUEJYGFKUEJG$GUKV\FGU'T\DKUVWOU$TGOGPUQYKGFGU$KUVWOU8GTFGP YWTFG KO 9GUVH·NKUEJGP (TKGFGP XQP  CPGTMCPPV INGKEJ\GKVKI YWTFGP FKG DGKFGP -KTEJGPIGDKGVG KP FCU   *GT\QIVWO $TGOGP WPF 8GTFGP WOIGYCPFGNV 'TUV KO0QTFKUEJGP-TKGI  GTQDGTVGPF·PKUEJG6TWRRGP FKGPÌTFNKEJGP.CPFGUVGKNGY·JTGPF*CPPQXGT8GTFGPDGUGV\VGFCU*GT\QIVWOMCWHVGWPF,CJTGUR·VGT FKGUEJYGFKUEJGP4GEJVGOKV/KNNKQP6CNGTCDHCPF

2691

2692

2692

56#&6

$4'5.#7



)TQUEJGPQ,OKV6KVGNXQP/CVVJKCU(TKGFGPUDWTI

44-N2T·IGUUEJY·EJGUGJTUEJÌP





4GKEJUVCNGTOKV6KVGN.GQRQNFU+&CX(W5  44*GTTNKEJG2CVKPCUGJTCVVTCMVKXGUXQT\ÒINKEJGU'ZGORNCT



194


CORVEY

2693



4GKEJUVCNGTQ, PCEJ +)-OKV6KVGN-CTNU8+5EJWNRT·OKG&CX(W5  5GJTUEJÌP



2694

)4#(5%*#(6 

$4'6<'0*'+/

-CTN#WIWUV-QPX6CNGT/CPPJGKO&CX*CCU5NI/GOOGUJ 2TCEJVGZGORNCT8QT\ÒINKEJp5VGORGNINCP\  -CTN#WIWUVYCTGKPNGKDNKEJGT5QJPXQP-CTN6JGQFQTXQP2HCN\5WN\DCEJCWUFGT'JGOKV,QUGHKPG5GKHGTVIGCFGNVG )T·HKP *GKFGEM 'T JGKTCVGVG /CTKC 9CNDWTIC (ÒTUVKP XQP ¤VVKPIGP5RKGNDGTI GKPG *QHFCOG FGT -WTHÒTUVKP WPF   UVCTDKP9KGP

2695

56#&6 

%*#/

2TCIGT )TQUEJGP Q , FGU DÌJOKUEJGP -ÌPKIU 9GP\GN +++ +8   OKV )GIGPUVGORGN XQP   %JCOCWHFGT4ÒEMUGKVG-COOOKVXKGT<KPMGP-TWU[%  )GIGPUVGORGNHCUVUGJTUEJÌP/ÒP\GUEJÌP



2696

#$6'+ 

%148';

-CTNXQP$NKVVGTUFQTH4GKEJUVCNGT$TCWPUEJYGKI&CX+NKUEJ5EJYGFG#C 9KP\5EJTÌVNKPIUHGJNGTCO4CPFUGJTUEJÌP

 195


DORTMUND

2698 2697

2697

&'765%*'414&'0 &'765%*'414&'0+0/'4)'06*'+/ 



%CTN #NGZCPFGT XQP .QVJTKPIGP5KNDGTOGFCKNNGXQP,.1GZNGKPCWHUGKPG9CJN \WO)TQ­OGKUVGTFGU&GWVUEJGP1TFGPU)GJCTPKUEJVGU$TWUVDKNFTOKVWOIGNGIVGO/CPVGNWPF*QEJ OGKUVGTMTGW\)QVVHTKGF XQP $QWKNNQP UVGJV X X KO *CTPKUEJ OKV -TQPG WPF WOIGNGIVGO /CPVGN KP   FGT4GEJVGPFKG(CJPGFGU&GWVUEJGP1TFGPUFKG.KPMGNKGIVCWHFGO9CRRGPUEJKNFXQP,GTWUCNGOWPF .QVJTKPIGP KO *KPVGTITWPF 5VCFVCPUKEJV XQP ,GTWUCNGO  OO  I 2TQMKUEJ    5NI/QPVGPWQXQ 5GJTUEJÌP



/CZKOKNKCP++(TCP\XQP¤UVGTTGKEJ-QPX-TGW\GT9ÒT\DWTICWHUGKPGP6QF 2TQMKUEJ 2TCEJVGZGORNCT(GKPG2CVKPCHCUV5VGORGNINCP\



2699

4'+%*5/ª0<5666' 

2700

2701

&10#79¤46*

*GKPTKEJ 8+  $TCMVGCV  I &KG IGMTÌPVGP -ÌRHG *GKPTKEJU 8+ WPF -QPUVCP\GU XQP   5K\KNKGP PGDGPGKPCPFGT X X FC\YKUEJGP 5VCD WPVGP 5QPPG \YKUEJGP \YGK 2WPMVGP WPVGT &TGKDQIGP   $GTIGT)GDJCTV5VGKPJKNDGT )WVCWUIGRT·IVGUXQT\ÒINKEJGU'ZGORNCT



56#&6 

2TCIGT )TQUEJGP Q , FGU DÌJOKUEJGP -ÌPKIU 9GP\GN +++ +8   OKV )GIGPUVGORGN XQP   &QPCWYÌTVJCWHFGT8QTFGTUGKVG$WEJUVCDG97OUGKVKI)GIGPUVGORGNXQP-QPUVCP\$KUEJQHUMQRH OKV/KVTCXX-TWU[&WPF- )GIGPUVGORGNHCUVUGJTUEJÌP/ÒP\GUEJÌP





2HGPPKI Q , CWH 5VTC­DWTIGT 5EJNCI .KNKG ÒDGT $WEJUVCDG 9 )GDJCTV  'PIGN  .GJT  6H     4-QTTQUKQPUURWTGPHCUVUGJTUEJÌP



&KGUGT 2HGPPKIV[R HKPFGV UKEJ CWEJ KP FGT $GUEJTGKDWPI FGU 6ÒDKPIGT /ÒP\HWPFGU $GKVT·IG \WT UÒFFGWVUEJGP   /ÒP\IGUEJKEJVG (GUVUEJTKHVFGU9ÒTVVGODGTIKUEJGP8GTGKUPHÒT/ÒP\MWPFG WPVGTFGT0T #DDWPF  *KGTYKTFCNU/ÒP\UV·VVGFKG#DVGK9GK­GPDWTICPIGPQOOGP&KG<WYGKUWPIKUVPKEJVGKPFGWVKIIGMN·TV

2702

56#&6  196

&146/70&

4GKEJUVCNGTOKV6KVGN(GTFKPCPFU++$GTIJCWU&CX  5GJTUGNVGPKPFKGUGT'TJCNVWPI*ÒDUEJG2CVKPCXQT\ÒINKEJGU'ZGORNCT




EINBECK

2703

2704

2704

$+567/

'+%*5666



,QJCPP'WEJCTKWUXQP%CUVGNN4GKEJUVCNGT0ÒTPDGTI/KV4CPFUEJTKHV%CJPC &CX 44(GKPG2CVKPCXQT\ÒINKEJ5VGORGNINCP\



5GFKUXCMCP\-QPX6CNGT0ÒTPDGTI%CJP&CX<GRGTPKEM

8QT\ÒINKEJ

 

2705

56#&6 

'+0$'%-

4GKEJUQTV 4GKEJUVCNGT OKV6KVGN(GTFKPCPFU++/ÒP\OGKUVGT)GQTI-TWMGPDGTI$WEMC 445CWDGTMCWOUKEJVDCTIGUVQRHVGU.QEJUGJTUEJÌP



ex 2706

.16 

7OHCPITGKEJG5COONWPIXQP/ÒP\GPFGT5VCFV'KPDGEMFGU,CJTJWPFGTVU&KG5COONWPIWO HC­VU·OVNKEJG0QOKPCNGXQO-W2HGPPKIDKU\WO/CTKGPITQUEJGPWPFKUVPCEJ,CJTI·PIGPWPF8CTK CPVGP \WUCOOGPIGVTCIGP YQTFGP 'KP JQEJKPVGTGUUCPVGU 1DLGMV OKV \CJNTGKEJGP 5GNVGPJGKVGP FCU KP   FKGUGT)GUEJNQUUGPJGKVUGNVGPCPIGDQVGPYKTFDKVVGWPDGFKPIVDGUKEJVKIGP 5VÒEM/GKUVUGJTUEJÌP  197


FRANKFURT

2708

2707

56#&6 

'/&'0

5KNDGTPG8KGT\KIGT/GFCKNNGQ, ITCXKGTV XQP%(KUEJGT*CHGPWPF5VCFVCPUKEJVKO*KPVGT ITWPF T UVTCJNGPFG 5QPPG WPVGP IGMTÌPVGU 5VCFVYCRRGP<YGK KPGKPCPFGTITGKHGPFG *·PFG JCNVGP GKP   <GRVGT QDGP -TQPG \W FGP 5GKVGP 2CNO\YGKIG /KV 4CPFUEJTKHV  OO  I -P[RJ   

FQTVXQP  *GTTNKEJG2CVKPCXQT\ÒINKEJ

56#&6 

2707



'4(746

5KNDGTOGFCKNNG  XQP ( 9 (CEKWU CWH FGP (ÒTUVGPMQPITG­ 5VCFVCPUKEJV KO #DUEJPKVV FCTWPVGT   \YGK<GKNGP5EJTKHV<YGK<GKNGP5EJTKHVOOI.GKV\OCPP5NI,WNKWU  5GJTCVVTCMVKXGU'ZGORNCTOKVJGTTNKEJGT2CVKPCXQT\ÒINKEJp5VGORGNINCP\



2710

2709

56#&6

2709

(4#0-(746



4GKEJUVCNGTQ, WO OKV6KVGN(GTFKPCPFU++&CX,W(0CEJVTCI  4#VVTCMVKXGUUGJTUEJÌPGU'ZGORNCT





4GKEJUVCNGTOKV6KVGN(GTFKPCPFU+++&CX,W(



198

-N<CKPGPFGUGJTUEJÌP


FRANKFURT

2712

2713

2711



4GKEJUVCNGTOKV6KVGN(GTFKPCPFU+++&CX,W(D



5KNDGTOGFCKNNG  XQP , . 1GZNGKP CWH FKG )QNFGPG *QEJ\GKV FGU (TCPMHWTVGT -CWHOCPPU 4WFQNH   2CUUCXCPV

 $CUGN Ó (TCPMHWTV  WPF UGKPGT )GOCJNKP 9CNDGTVC .GDNQP /·PPNKEJG WPF   YGKDNKEJG )GUVCNVUVGJGPGKPCPFGTIGIGPÒDGTTGKEJGPUKEJFKGNKPMG*CPFWPFGTJGDGPFKG4GEJVG\WO 5EJYWTQDGPUEJYGDGPFGT'PIGNOKV2QUCWPGTOKVFGT4GEJVGPJ·NVGTGKPG-TQPGÒDGTFCU2CCT&KG (COKNKGPYCRRGP FGU 2CCTGU NGJPGP CP GKPGT 2CNOG QDGP N UVTCJNGPFG 5QPPG  OO  I   ,W( 442TCEJVGZGORNCTOKVHGKPGT6ÌPWPI8QT\ÒINKEJp5VGORGNINCP\



5KNDGTOGFCKNNGWPUKIPKGTVCWHFKG)QNFGPG*QEJ\GKVFGU(TCPMHWTVGT-CWHOCPPU,CEQD2CUUCXCPV

(TCPMHWTVÓ(TCPMHWTV WPFUGKPGT)GOCJNKP/CTICTGVJC<KGINGT5·WNGPJCNNGKO8QTFGT ITWPF UVGJGP O·PPNKEJG WPF YGKDNKEJG )GUVCNV GKPCPFGT IGIGPÒDGT WPF TGKEJGP UKEJ FKG TGEJVG *CPF   FCJKPVGT#NVCTOKVCWHIGUEJNCIGPGO$WEJQDGPUVTCJNGPFG5QPPGCPFGPXQTFGTGP5·WNGPDGHKPFGPUKEJ FKG(CONKGPYCRRGPFGU2CCTGU<GKNGP5EJTKHVOOI,W(  44(GKPGFWPMNG6ÌPWPIXQT\ÒINKEJ





45VGORGNHGJNGTUGJTUEJÌP



2714

2715

2715



5KNDGTOGFCKNNG Q ,   WPUKIPKGTV )[OPCUKCNRT·OKG )GMTÌPVGT #FNGT8KGT <GKNGP 5EJTKHV   \YKUEJGP4QUGVVGPWOJGT.QTDGGTMTCP\OOI,W( 5GJTUEJÌPpXQT\ÒINKEJ





-QPX6CNGT/ÒP\OGKUVGT,QJCPP1VVQ6TÒOOGT&CX,W(D



5GJTUEJÌP

199


FRANKFURT

2716

2717

2719



-QPX6CNGT&CX,W(C



-QPX6CNGT8CTKCPVGOKVFGO-QRHFGU/·PPEJGPUWPVGTFGO$TÒEMGPDQIGP&CX,W( #POXCT 9KP\5EJTÌVNKPIUHGJNGTXQT\ÒINKEJ



-QPX6CNGT&CX,W(C Z D Z 

5VÒEM5GJTUEJÌPWPFHCUVXQT\ÒINKEJ





-QPX6CNGTCWHFGP$TÒEMGPDCWDGK*CWUGP&CX,W(  5EJÌPG6ÌPWPIYKP\5EJTÌVNKPIUHGJNGTWPF,WUVKGTURWGPXQT\ÒINKEJ



2720

/KPLWUVKGTVXQT\ÒINKEJ

2721



-QPX6CNGT&CX,W(D



-QPX6CNGT-QPVTKDWVKQP&CX,W(D



8GTGKPUFQRRGNVCNGT#-5&CX-CJPV6JWP

200

 

2722

9KP\5EJTÌVNKPIUHGJNGTWPF,WUVKGTURWTGPXQT\ÒINKEJ



9KP\5EJTÌVNKPIUHGJNGTXQT\ÒINKEJ



-N-TCV\GTHCUVXQT\ÒINKEJ




FRANKFURT

2723

2724

2725



8GTGKPUFQRRGNVCNGT#-5&CX-CJPV6JWP  (GKPG6ÌPWPIXQT\ÒINKEJCWURQNKGTVGT2NCVVG



 

8GTGKPUFQRRGNVCNGT#-5&CX-CJPV6JWP 8GTGKPUFQRRGNVCNGT#-5&CX-CJPV6JWP

 

2726







(GKPG6ÌPWPIXQT\ÒINKEJ (GKPG6ÌPWPIXQT\ÒINKEJ

2728

2727

5KNDGTOGFCKNNGXQP-.CPIGCWHFGP)GDWTVUVCIXQP5CNQOQP/C[GTXQP4QVJUEJKNF

 (TCPMHWTV Ó 9KGP  %JGH FGU 9KGPGT $CPMJCWUGU $ÒUVG /C[GT XQP 4QVJUEJKNFU N.ÌYG WPF   'KPJQTP JCNVGP XKGTHGNFKIGU 9CRRGP OKV /KVVGNUEJKNF QDGP -TQPG OKV FTGK *GNOGP DGUGV\V WPVGP   5EJTKHVDCPFOOI,W( 448QT\ÒINKEJ



$TQP\GOGFCKNNGXQP-.CPIGCWHFGP)GDWTVUVCIXQP5CNQOQP/C[GTXQP4QVJUEJKNF

 (TCPMHWTV Ó 9KGP  %JGH FGU 9KGPGT $CPMJCWUGU $ÒUVG /C[GT XQP 4QVJUEJKNFU N.ÌYG WPF   'KPJQTP JCNVGP XKGTHGNFKIGU 9CRRGP OKV /KVVGNUEJKNF QDGP -TQPG OKV FTGK *GNOGP DGUGV\V WPVGP   5EJTKHVDCPFOO,W( 48QT\ÒINKEJ 8GTGKPUFQRRGNVCNGT#-5&CX-CJPV6JWP 9KP\-TCV\GTXQT\ÒINKEJ

  201


FRANKFURT

2730

2729 2730



&QRRGNIWNFGP)GRT·IVCWHFKG9CJNFGURTGW­KUEJGP-ÌPKIU(TKGFTKEJ9KNJGNO+8\WO-CKUGT FGT&GWVUEJGPCO/·T\#-5&CX-CJPV6JWP  440WT'ZGORNCTGIGRT·IV(GKPG6ÌPWPIRQNKGTVG2NCVVG 2TQQH



8GTGKPUFQRRGNVCNGT#-5&CX-CJPV6JWP

2731

 

*GTTNKEJG6ÌPWPIXQT\ÒINKEJ

 

2732

)WNFGP#-5, )WNFGP#-5,

8QT\ÒINKEJp5VGORGNINCP\ 5GNVGPGT,CJTICPI8QT\ÒINKEJ

 

2734

2733





202

2733

5KNDGTOGFCKNNGXQP%5EJPKV\URCJPCWHFCUL·JTKIG&QMVQTLWDKN·WOXQP)WUVCX#FQNRJ5RKGUU

 &WKUDWTI Ó (TCPMHWTV  $ÒUVG FGU #T\VGU N#EJV <GKNGP 5EJTKHV  OO  I   ,W(5NI$TGVVCWGT 4(GKPG6ÌPWPIXQT\ÒINKEJp5VGORGNINCP\



5KNDGTOGFCKNNG  XQP , -QYCT\KM CWH FKG L·JTKIG 5VKHVWPIUHGKGT FGT HTGKYKNNKIGP (GWGTYGJT   5VCFVCPUKEJVXQP5ÒFGPOKVFGTCNVGP/CKPDTÒEMGKO8QTFGTITWPF2QUVCOGPVOKVFGO5VCFVYCRRGP\W FGP 5GKVGP FKG ,CJTGU\CJNGP   <YGK (GWGTYGJTO·PPGT TGVVGP GKP /·FEJGP CWU GKPGODTGP PGPFGP*CWU/KV4CPFRWP\G*CNDOQPF-TQPGWPFOOI,W(0CEJVTCI 8QT\ÒINKEJ




FREISING

2736

2736 2735



'KPUGKVKIG$TQP\GIW­RNCMGVVGXQP-)QGV\CWHFKG'KPYGKJWPIFGTPGWGP5[PCIQIGFGT+UTCGNK UEJGP 4GNKIKQPUIGUGNNUEJCHV (TCPMHWTV 8GT\KGTVGT 6QTGKPICPI FCJKPVGT #PUKEJV FGU )GD·WFGU XQP   5VTCJNGPWOIGDGPZOO-KGPCUVXCT 8QT\ÒINKEJ



(ª456'067/(4#0-(746 

%CTN 6JGQFQT XQP &CNDGTI (ÒTUVRTKOCU FGU 4JGKPDWPFGU  5KNDGTOGFCKNNG  WPUKI   PKGTV CWH UGKPG *WNFKIWPI $TWUVDKNF N KP IGKUVNKEJGO 1TPCV WPF ,WYGNGPMTGW\CWHFGT$TWUV5VCFVCP UKEJVXQP(TCPMHWTVFCTÒDGTUVTCJNGPFGU)QVVGUCWIGOOI,W( 48QT\ÒINKEJ



.165(4#0-(746 

-NGKPG5COONWPI(TCPMHWTVGT/ÒP\GPFGUWPF,CJTJWPFGTVU&WMCV6CNGT 8CTK CPVGP  5VÒEM  5VÒEM   5VÒEM CW­GTFGO*CNDVCNGT Z 8KGTVGNVCNGT Z )WNFGP Z WPF6GKNUVÒEMG Z 5GJTKPVGTGUUCPVGU .QVDKVVGDGUKEJVKIGP 5VÒEM<WO6GKNOKVMN/·PIGNPUGJTUEJÌP





+PVGTGUUCPVG5COONWPI(TCPMHWTVGT5KNDGTOÒP\GPFGU,CJTJWPFGTVU&QRRGNVCNGT Z &QRRGNIWNFGP

Z 8GTGKPUVCNGT Z )WNFGP Z WPF-NGKPOÒP\GP Z  5VÒEM5GJTUEJÌPpXQT\ÒINKEJ





5COONWPI (TCPMHWTVGT /GFCKNNGP FGU  ,CJTJWPFGTVU KP 5KNDGT WPF WPGFNGP /GVCNNGP FCTWPVGT   DGUUGTG5VÒEMGYKG5KNDGTOGFCKNNGCWHFGP(TKGFGPXQP*WDGTVWUDWTI 8CTKCPVGP 5KNDGTOGFCKNNG CWHFKG'KPYGKJWPIFGTPGWGP*CWRVRQUV5KNDGTOGFCKNNGCWHFGP)GDWTVUVCI)QGVJGU WUY 5VÒEM5GJTUEJÌPpXQT\ÒINKEJ



2741 2740

2740

56#&6 

$TQP\GOGFCKNNGXQP,9KGPGTCWHFKG,CJTHGKGTFGT2HCTTWPF5VKHVUMKTEJGWPFFKG)TÒP FWPI FGU -NQUVGTU XQO *GKNKIGP -TGW\ #PUKEJV FGT 2HCTT WPF 5VKHVUMKTEJG5VTCJNGPFGU -TGW\ ÒDGT   PGWP<GKNGP5EJTKHVOO&GVJNGHU56CHGN 442TCEJVGZGORNCT(CUV5VGORGNINCP\

$+567/ 

(4'%-'0*1456 -TGKU9CTGPFQTH 



(4'+5+0)

1VVQ ++ XQP $GTI  'KPUGKVKIGT &ÒPPRHGPPKI  I -QRH PCEJ N KO 5GEJURC­ FCXQT   -TWOOUVCDWPF4KPIKPFGP9KPMGNPJGDT·KUEJG ! $WEJUVCDGP'OOGTKIp XINp   44)GYGNNVWPF5EJTÌVNKPIUTK­UQPUVUGJTUEJÌP



&CU/ÒP\DKNFFGUXQTNKGIGPFGP'ZGORNCTUYGKUVITQ­GJPNKEJMGKVOKVFGPXQP*'OOGTKIPCEJ(TGKUKPIIGNGIVGP 6[RGPWPFCWH 'OOGTKI*&GT4GIGPUDWTIGT2HGPPKI$GTNKP5WPF6H 

203


HALBERSTADT

2743 2742

2742

(4+'&$'4)

4'+%*5$74) 

*CPU'KVGN&KGFG\WO(ÒTUVGPUVGKP-TGW\GT )WNFGP (TKGFDGTIOKV6KVGN.GQ RQNFU+&CX.GLGWPGTXCT  5GNVGPKPFKGUGT'TJCNVWPI#VVTCMVKXGUXQT\ÒINKEJGU'ZGORNCT





-TGW\GT )WNFGP (TKGFDGTIOKV6KVGN.GQRQNFU+.GLGWPGE



2744



45GJTUEJÌP

ex 2745

(TCP\*GKPTKEJXQP&CNDGTI-QPX6CNGT0ÒTPDGTIOKV6KVGN,QUGHU++.GLGWPG 8QT\ÒINKEJp5VGORGNINCP\



(7.&# #$6'+5'+6$+567/ 

#FCNDGTV+++XQP*CTUVCNN-QPX6CNGT(WNFC-QPVTKDWVKQP&C\W-QPX6CNGT (WNFC-QPVTKDWVKQP$WEJQPKC&CX 5VÒEM5GJTUEJÌPpXQT\ÒINKEJ



)¤66+0)'0 

.16 &KXGTUG /ÒP\GP FGU  ,CJTJWPFGTVU XQO -W 2HGPPKI DKU \WO /CTKGPITQUEJGP   +PVGTGUUCPVGU.QVDKVVGDGUKEJVKIGP 5VÒEM/GKUVUGJTUEJÌP

2747 1,5:1

$+567/ 

2748

*#.$'456#&6

1,5:1

(TKGFTKEJ++XQP-KTEJDGTI$TCMVGCVI*GKNKIGTUKV\VXXCWH$QIGPKPFGP*·P FGPLGGKP6WTO$GTIGTp$GUUGT$T·OGT$ÒTIGTp XIN   *ÌEJUVYCJTUEJGKPNKEJWPGFKGTV&WPMNG2CVKPCUGJTUEJÌP



$TCMVGCV  I *GKNKIGT UKV\V X X CWH $QIGP KP FGP *·PFGP LG GKP &QRRGNMTGW\ $GTIGT p $GU   UGT$T·OGT$ÒTIGTp  *ÌEJUVYCJTUEJGKPNKEJWPGFKGTV-N2T·IGUEJY·EJGCO4CPFUGJTUEJÌPpXQT\ÒINKEJ



&KG<WYGKUWPIFGUXQTNKGIGPFGP'ZGORNCTUKUVPKEJV\YGKHGNUHTGKIGUKEJGTV



&KG<WYGKUWPIFGUXQTNKGIGPFGP'ZGORNCTUKUVPKEJV\YGKHGNUHTGKIGUKEJGTV

204




HAMBURG

2749

56#&6 

*#/$74)

&QRRGNVGT 5EJCWVCNGT Q ,   XQP %JT (GWUVGN CWH FKG 6TCWWPI WPF *QEJ\GKV KP -CPCC    I %JTKUVWU UGIPGV GKP $TCWVRCCT FCU UKEJ FKG *·PFG TGKEJV%JTKUVWU WPF /CTKCUKV\GPOKVFGO $TCWVRCCT CP GKPGO 6KUEJ T -GNNGTOGKUVGT FKG 4GEJVG CWH FGP 6KUEJ IGNGJPV KO 8QTFGTITWPF UGEJU   -TÒIG)CGFp (GNFGTNGKEJVÒDGTCTDGKVGVUGJTUEJÌP



2750



&QRRGNVGT5EJCWVCNGTQ,  XQP/CVVJKCU(TGWFGCWHFKG6TCWWPIWPF*QEJ\GKVKP-CPCC  I %JTKUVWU UGIPGV GKP $TCWVRCCT FCU UKEJ FKG *·PFG TGKEJV%JTKUVWU WPF /CTKCUKV\GPOKVFGO $TCWVRCCT CP GKPGO 6KUEJ T -GNNGTOGKUVGT OKV GTJQDGPGO )NCU CO $QFGP -TÒIG KO 8QTFGTITWPF   *WPFT)CGFp XIN  *ÒDUEJG2CVKPC(GNFGTCNVIGIN·VVGVUGJTUEJÌP



2751



&QRRGNVGT5EJCWVCNGTQ, WO CWHFKG6TCWWPIWPF*QEJ\GKVKP-CPCCI'KP$TCWVRCCT FCU UKEJ FKG *·PFG TGKEJV QDGP 6CWDG WPF 0COG ,GJQXCU KP 5VTCJNGP%JTKUVWU WPF /CTKC UKV\GP OKV   FGO$TCWVRCCTCPGKPGO6KUEJT-GNNGTOGKUVGTOKVGTJQDGPGO)NCUKO8QTFGTITWPF-TÒIG)CGFp

XIN  4CPFWPF(GNFGTDGCTDGKVGVUGJTUEJÌP

 205


HAMBURG

2752



2753

2754

5CVKTKUEJG <KPPIW­OGFCKNNG Q ,   WPUKIPKGTV CWH FKG 7PTWJGP WO FGP 2CUVQT ,QJCPP (TKGFTKEJ   /C[GT &GT 2CUVQT UKV\V X X CWH GKPGO 5VWJN N 6KUEJ OKV $WEJ KO #DUEJPKVV +0 *#/$14)* Û   &CU XQP GKPGO 2TKGUVGT KO 5EJCHURGN\ CWHIGYKGIGNVG 8QNM XGTUWEJV FCU 4CVJCWU \W UVÒTOGP KO #D   UEJPKVV#7(474Û#7(474OO%QNN(KGYGIGT FQTVIGRT·IV )CGF FQTVKP5KNDGT  5R·VGTGT)W­5GJTUEJÌP





4GKEJUVCNGTOKV6KVGNXQP(TCP\+CWHFKG,CJTHGKGTFGU9GUVH·NKUEJGP(TKGFGPU&CX &GVJ1TF)CGF *ÒDUEJG2CVKPCHCUVXQT\ÒINKEJ





4GKEJUVCNGT 5EJKNNKPI OKV6KVGNXQP(TCP\+&CX)CGF  9KP\5EJTÌVNKPIUHGJNGTCO4CPFUGJTUEJÌPpXQT\ÒINKEJ



2755

2756

2756



5EJKNNKPI#-5,C  5GJTCVVTCMVKXGU'ZGORNCTOKVJGTTNKEJGT2CVKPCOKPLWUVKGTVXQT\ÒINKEJ





5KNDGTOGFCKNNGXQP,.CPIGTCWHFKG5KNDGTJQEJ\GKVFGU*CODWTIGT-CWHOCPPUWPF4GGFGT*GKP TKEJXQP1JNGPFQTHHWPFUGKPGT)GOCJNKP'NKUCDGVJ<YGK.ÌYGPJCNVGPFCUDGJGNOVGXQP1JNGPFQTHH UEJG 9CRRGP5KGDGP<GKNGP5EJTKHVWOJGT'KEJGPMTCP\OOI)CGF0CEJVTCI  -N4CPFHGJNGTHCUV5VGORGNINCP\



206


HARZ

2758

2757

2757

*#0#7 *#0#7/ª0<'0$'4))4#(5%*#(6 

-CVJCTKPC $GNIKEC 8QTOÒPFGTKP HÒT 2JKNKRR /QTKV\  4GKEJUVCNGT  OKV 6KVGN   (GTFKPCPFU++&CX5WEJKGTXCT 5GJTUEJÌP





4GKEJUVCNGTOKV6KVGN(GTFKPCPFU++&CX5WEJKGTXCT  -N4CPFHGJNGTOKPMQTTQFKGTVUGJTUEJÌP



2759

2760

2760

*#4< 



6CWHVCNGT ,CJTGU\CJNKO5VGORGNCWUIG·PFGTV **<GNNGTHGNFI/ÒP\OGKUVGT*GKP TKEJ *QTUV  /ÒP\OGKUVGT\GKEJGP CWU 4$  4WFQNH $QTPGOCPP IG·PFGTV  -CVUQWTQU    *ÒDUEJG2CVKPCªDGTRT·IWPIUURWTGPUGJTUEJÌPpXQT\ÒINKEJ



6CWHVCNGT  ,CJTGU\CJN KO 5VGORGN CWU  IG·PFGTV  +$* <GNNGTHGNF  I /ÒP\OGKUVGT ,Q   JCPP$GPLCOKP*GEJV-CVUQWTQU *GTTNKEJG2CVKPCUGJTUEJÌPpXQT\ÒINKEJ

 207


HESSEN

2763

2761

*'00'$'4))4#(5%*#(6 

*'00'$'4)

)GOGKPUEJCHVNKEJ U·EJUKUEJGT #PVGKN 4GKEJUVCNGT  +NOGPCW #WUDGWVG FGT )TWDGP KP +NOGPCW   &CX/ÒUGNGTD #VVTCMVKXGUUGJTUEJÌPGU'ZGORNCT



*'4(14&

#$6'+ 

2762

,QJCPPC%JCTNQVVCXQP#PJCNV&GUUCW9KVYGFGU/CTMITCHGP5KNDGTOGFCKNNGXQP ( /CTG CWH KJTG 9CJN \WT DVKUUKP $TWUVDKNF T OKV 9KVYGPUEJNGKGT#EJV <GKNGP 5EJTKHV QDGP   -TWOOUVCDWPF5EJYGTVIGMTGW\VFCTÒDGT-TQPGOOI)TQVG  44*ÒDUEJG2CVKPCYKP\)TCHKVVKXQT\ÒINKEJ 

*'55'0 *'55'0-#55'..#0&)4#(5%*#(65'+6-74(ª456'067/ 

(TKGFTKEJ++6CNGT.CPFOÒP\G-CUUGN5VGTPVCNGT&CX5EJÒV\  5GNVGPKPFKGUGT'TJCNVWPI /KPLWUVKGTVYKP\5EJTÌVNKPIUHGJNGTCO4CPFXQT\ÒINKEJp5VGORGNINCP\



#WH FGT 4ÒEMUGKVG KUV FGT 5VGTP FGU 1TFGPU XQO )QNFGPGP .ÌYGP CDIGDKNFGV 5Q GTJKGNV FKGUGU 5VÒEM FGP 0COGP   5VGTPVCNGT &KG 5VGTPVCNGT YWTFGP WCFC\WXGTYCPFV(COKNKGP\WGPVUEJ·FKIGPFGTGP5ÌJPGKOCOGTKMCPKUEJGP (TGKJGKVUMTKGI IGHCNNGP YCTGP #WH FKGUGO OCMCDGTGP *KPVGTITWPF DCUKGTGPF GPVUVCPF FCU /·TEJGP XQP FGP   5VGTPVCNGTP FCU FKG )GDTÒFGT )TKOO KP FGT 7OIGDWPI XQP -CUUGN CWH\GKEJPGVGP .CPFITCH (TKGFTKEJ ++ DG\QI   ITQ­G 5WDUKFKGP XQP FGP 'PIN·PFGTP HÒT 5QNFCVGP FKG GT CP UKG XGTOKGVGVG +P COGTKMCPKUEJGP 5COONGTMTGKUGP   JGK­GPFKG5VGTPVCNGTFCJGTCWEJ$NQQFFQNNCT

2764



 208

2765

9KNJGNO+: +   -QPX6CNGT*CPCW#WUDGWVGFGT$KGDGTGT)TWDGP &CX/ÒUGNGTD5EJÒV\  (GKPG2CVKPCOKPLWUVKGTVCVVTCMVKXGUXQT\ÒINKEJGU'ZGORNCT



-QPX6CNGT  *CPCW #WUDGWVG FGT $KGDGTGT )TWDGP &CX  /ÒUGNGT5EJÒV\ 8QPITQ­GT5GNVGPJGKV2TCEJVGZGORNCT(GKPG2CVKPCXQT\ÒINKEJp5VGORGNINCP\ 


HESSEN

2766

2767

2767



9KNJGNO++WPF(TKGFTKEJ9KNJGNO6CNGT#-5&CX-CJPV6JWP 5GNVGPKPFKGUGT'TJCNVWPI8QT\ÒINKEJ



.WFYKI +  5KNDGTOGFCKNNG  XQP ) )QGV\G CWH UGKPG )QNFGPG *QEJ\GKV OKV .WKUG   IGYKFOGV XQP FGT 5VCFV &CTOUVCFV $GKFGT $ÒUVGP PGDGPGKPCPFGT T0GWP <GKNGP 5EJTKHV KP 'KEJGP   MTCP\OOI5EJÒV\  5GNVGPDGUQPFGTUKPFKGUGT'TJCNVWPI2TCEJVGZGORNCT*GTTNKEJG2CVKPCHCUV5VGORGNINCP\



*'55'0&#4/56#&6.#0&)4#(5%*#(65'+6)4155*'4<1)67/

2768



2769



2770

5KNDGTOGFCKNNGXQP))QGV\GCWHUGKPGP6QF-QRHT6TCWGTPFGTIGHNÒIGNVGT)GPKWUNGJPVCWH GTNQUEJGPGT(CEMGNOKV6TCWGTVWEJOOI5EJÒV\  5GNVGPDGUQPFGTUKPFKGUGT'TJCNVWPI-CDKPGVVUVÒEM2TCEJVXQNNG2CVKPCHCUV5VGORGNINCP\





.WFYKI++-TQPGPVCNGT#-5&CX-CJPV6JWP  (GKPG6ÌPWPIXQT\ÒINKEJp5VGORGNINCP\





.WFYKI +++  5KNDGTOGFCKNNG  XQP % 8QKIV CWH FGP #DUEJKGF UGKPGU 1PMGNU 2TKP\   'OKN /CZKOKNKCP .GQRQNF XQO 2T·UKFKWO FGT + -COOGTFGT.CPFUV·PFG-QRHFGU2TKP\GPN0GWP <GKNGP5EJTKHVKP'KEJGPMTCP\OOI5EJÒV\  42TCEJVGZGORNCT*GTTNKEJG2CVKPCXQT\ÒINKEJp5VGORGNINCP\

 209


HESSEN

2771



&QRRGNIWNFGP#-5&CX-CJPV6JWP (GKPG2CVKPCXQT\ÒINKEJp5VGORGNINCP\



2772



$TQP\GOGFCKNNG  XQP % 5EJPKV\URCJP CWH FKG 5KNDGTJQEJ\GKV OKV /CVJKNFG -CTQNKPG XQP $C[GTP   $GKFGT $ÒUVGP PGDGPGKPCPFGT T$TGPPGPFGT #NVCT T GKP IGHÒIGNVGT )GPKWU KP FGT CWUIGUVTGEMVGP   4GEJVGP -TCP\ KP FGT .KPMGP (CEMGN N YGKDNKEJG )GUVCNV FKG FCU &CVWO FGT 5KNDGTJQEJ\GKV CWH GKPG   6CHGNUEJTGKDVFCTWPVGT#OQTWPF.ÌYGOO5EJÒV\$T 8QT\ÒINKEJ



2773

2774

2774



8GTGKPUVCNGT#-5&CX-CJPV6JWP

*GTTNKEJG2CVKPCXQT\ÒINKEJ



.WFYKI +8  5KNDGTOGFCKNNG  WPUKIPKGTV CWH UGKPGP 6QF $ÒUVG T.ÌYGPUEJKNF KP   XGT\KGTVGT -CTVWUEJG \W FGP 5GKVGP UVGJGP \YGK YGKDNKEJG )GUVCNVGP OKV 5EJYGTV D\Y 2QUCWPG WPF   JCNVGPIGOGKPUCOGKPGP-TCP\ÒDGTFCU9CRRGPOOI5NI(KQTKPQp  5GNVGPDGUQPFGTUKPFKGUGT'TJCNVWPI-CDKPGVVUVÒEM2TCEJVXQNNG2CVKPC5VGORGNINCP\





.16*'55'0 

210

*GUUGP-CUUGN-QPX6CNGT5VGTPVCNGT-QPX6CNGT $KGDGTGT#WUDGWVG 5KNDGT OGFCKNNG 'TJGDWPI\WO-WTHÒTUVGPVWO 6CNGT&QRRGNVCNGTWPF&C\W*GUUGP &CTOUVCFV&QRRGNVCNGTWPF)WNFGP 5VÒEM/GKUVUGJTUEJÌP




HILDESHEIM

2776

1,5:1

1,5:1

$+567/ 

*+.&'5*'+/

'TPUV XQP $C[GTP  4GKEJUVCNGT  /QTKV\DGTI  I $TWUVDKNF T OKV WOIGNGIVGO   /CPVGN WOJGT FQRRGNVGT 5EJTKHVMTGKU8QP \YGK .ÌYGP IGJCNVGPGU OKV -WTJWV DGFGEMVGU 9CRRGP   WPVGP /ÒP\OGKUVGT\GKEJGP *. OKV <CKPJCMGP *CPU .CEJGPVTKU /ÒP\OGKUVGT KP /QTKV\DGTI  DKU   EC WOJGTMNGKPGXGT\KGTVG9CRRGP&CXp/GJN  8QPITÌ­VGT5GNVGPJGKV5GJTUEJÌP  'ZGORNCTFGT#WMVKQP/ÒP\GPWPF/GFCKNNGP#)$CUGN0T





&KGUGT UGJT UGNVGPG 6CNGT KUV GKP GKPFTWEMUXQNNGT $GNGI HÒT FKG/CEJVHÒNNGFKGUGUYKVVGNUDCEJKUEJGP-KTEJGPHÒTUVGP FGT UGNDUVDGYW­V KP FGT 6KVWNCVWT UGKPG OVGT CNU 'T\DKUEJQH XQP -ÌNP $KUEJQH XQP .ÒVVKEJ #FOKPKUVTCVQT XQP   *KNFGUJGKO /ÒPUVGT WPF (TGKUKPI 2HCN\ITCH DGK 4JGKP *GT\QI XQP $C[GTP 'PIGTP 9GUVHCNGP WPF $QWKNNQP   CWHHÒJTV&KG4GKJGFGTWOFCUYKVVGNUDCEJKUEJG*CWUYCRRGPCPIGQTFPGVGP9CRRGPUEJKNFGKUVPQEJWOHCPITGKEJGT -ÌNP.ÒVVKEJ*KNFGUJGKO/ÒPUVGT(TGKUKPI5VCDNQ/CNOGF[2HCN\9GUVHCNGP'PIGTP$QWKNNQP(TCPEJKOQPV #TPUDGTI.QQ\*CUUDCP*QTP'TPUVIGDQTGPCO&G\GODGTYCTFGTXKGTVG5QJPFGU*GT\QIU#NDGTV8 FGU )TQ­OÒVKIGP 9KG XKGNG CPFGTG PCEJIGDQTGPG 5ÌJPG TGIKGTGPFGT DC[GTKUEJGT *GT\ÌIG OCEJVG GT -CTTKGTG CNU   IGKUVNKEJGT(ÒTUVWPFYWTFGDGTGKVUKO#NVGTXQP,CJTGP$KUEJQHXQP(TGKUKPI8QTCNNGOXQPLGUWKVKUEJGP .GJTGTPJWOCPKUVKUEJWPFVJGQNQIKUEJCWUIGDKNFGVYWTFG'TPUV$KUEJQHXQP*KNFGUJGKOWPF$KUEJQHXQP .ÒVVKEJ0CEJFGO2CRUV)TGIQT:+++FGTVKGHGU8GTVTCWGP\WO8CVGT #NDGTV8FGO)TQ­OÒVKIGP JCVVG'TPUVKO ,CJT  \WO 7PKXGTUCNDKUEJQH HÒT FCU MCVJQNKUEJG &GWVUEJNCPF CWUGTMQTGP JCVVG FCPMVG FGT -ÌNPGT 'T\DKUEJQH   5CNGPVKPXQP+UGPDWTI\WIWPUVGPXQP'TPUVCD&CU-ÌNPGT&QOMCRKVGNY·JNVGLGFQEJ)GDJCTF6TWEJUG­XQP 9CNFDWTI \WO 0CEJHQNIGT &KGUGT 'T\DKUEJQH UQTIVG  HÒT GKPGP CWHUGJGPGTTGIGPFGP 5MCPFCN KPFGO GT \WO   2TQVGUVCPVKUOWU ÒDGTVTCV WPF UKEJ XGTJGKTCVGVG 0CEJ UGKPGT #DUGV\WPI Y·JNVG FCU &QOMCRKVGN GKPUVKOOKI FGP   9KVVGNUDCEJGT'TPUV&CTCWHJKPDGICPP)GDJCTFFGP-ÌNPKUEJGP-TKGIFGP'TPUVKO,CJTXQTCNNGOOKV*KNHG UGKPGU$TWFGTUFGUKP/ÒPEJGPTGIKGTGPFGP*GT\QIU9KNJGNO8IGYCPP&GTPGWG'T\DKUEJQHXQP-ÌNPFCUDKU  XQP 9KVVGNUDCEJGTP TGIKGTV YGTFGP UQNNVG YWTFG  CWEJ $KUEJQH XQP /ÒPUVGT 'TPUV HÌTFGTVG FKG   0KGFGTNCUUWPIXQP,GUWKVGPKPUGKPGP.·PFGTPWPFVTCVGPVUEJKGFGPHÒTFKGMCVJQNKUEJG5CEJGGKP&CGTFWTEJUGKP CWUUEJYGKHGPFGU.GDGPHTÒJIGCNVGTVYCTUGV\VGGTUGKPGP0GHHGPWPF0CEJHQNIGT(GTFKPCPF 5QJP9KNJGNOU 8  CNU -QCFLWVQT FGU 'T\DKUVWOU -ÌNP GKP WPF \QI UKEJ OKV UGKPGT -QPMWDKPG )GTVTWF XQP 2NGVVGPDGTI CWH UGKP   5EJNQ­#TPUDGTI\WTÒEMYQGTCOUVCTD

2777



(GTFKPCPFXQP$C[GTP4GKEJUVCNGT/QTKV\DGTI&CX/GJND  -N*GPMGNURWTUGJTUEJÌP

 211


HOHENZOLLERN

2778

2779

2779





5GFKUXCMCP\5KNDGTOGFCKNNGXQP,6JKGDCWF&KGCWH9QNMGPVJTQPGPFG/CTKCOKV,GUWU MKPFFGWVGVOKVGKPGO<GRVGTCWHFCUXQTKJTUEJYGDGPFGOKV(ÒTUVGPJWVDGFGEMVG5VKHVUYCRRGPFCUCWH GKPGOXGT\KGTVGP-KUUGPOKV1TFGPUMTGW\TWJVWPFOKV-TWOOUVCD5EJYGTVWPF2CNO\YGKIDGUVGEMVKUV QDGP FGT CNU 6CWDG IG\GKIVG *GKNKIG )GKUV KP 5VTCJNGP WOJGT 9CRRGPMTCP\#WH GKPGT FTGKUVWHKIGP   'UVTCFGOKV$CNFCEJKPUVGJVFGT$KUEJQHUUVWJNFGTOKVFGT/KVTCDGNGIVKUVKO*KPVGTITWPFTFGT*KN FGUJGKOGT&QOQDGPFCUIÌVVNKEJG#WIGFGT8QTUGJWPIKP5VTCJNGPWOJGT9CRRGPMTCP\OO I/GJN<GRGTPKEM (GKPG2CVKPCXQT\ÒINKEJ



5KNDGTOGFCKNNGXQP,6JKGDCWF&KGCWH9QNMGPVJTQPGPFG/CTKCOKV,GUWUMKPFFGWVGVOKVGKPGO <GRVGT CWH FCU XQT KJT UEJYGDGPFG OKV (ÒTUVGPJWV DGFGEMVG 5VKHVUYCRRGP FCU CWH GKPGO XGT\KGTVGP   -KUUGP OKV 1TFGPUMTGW\ TWJV WPF OKV -TWOOUVCD 5EJYGTV WPF 2CNO\YGKI DGUVGEMV KUV QDGP FGT CNU   6CWDG IG\GKIVG *GKNKIG )GKUV KP 5VTCJNGP WOJGT 9CRRGPMTCP\#WH GKPGT FTGKUVWHKIGP 'UVTCFG OKV   $CNFCEJKP UVGJV FGT $KUEJQHUUVWJN FGT OKV FGT /KVTC DGNGIV KUV KO *KPVGTITWPF T FGT *KNFGUJGKOGT   &QO QDGP FCU IÌVVNKEJG #WIG FGT 8QTUGJWPI KP 5VTCJNGP WOJGT 9CRRGPMTCP\  OO  I   /GJN<GRGTPKEM 8QT\ÒINKEJGU'ZGORNCTOKVHGKPGT6ÌPWPI



2780

2781

*1*'0<1..'40 *1*'0<1..'40*'%*+0)'0(ª456'067/ 

(TKGFTKEJ 9KNJGNO %QPUVCPVKP  8GTGKPUFQRRGNVCNGT  #-5  &CX  -CJPV    6JWP 40WT'ZGORNCTGIGRT·IV2TCEJVGZGORNCTOKVHGKPGT6ÌPWPIHCUV5VGORGNINCP\ 

*1*'0<1..'405+)/#4+0)'0(ª456'067/  212

%CTN8GTGKPUFQRRGNVCNGT5VGTPEJGPOKVIGDQIGPGP5VTCJNGPKPFGT4CPFUEJTKHV#-5 &CX-CJPVC#PO6JWP 9KP\4CPFHGJNGTUGJTUEJÌP




KEMPTEN

2782

2784

+50;

56#&6 

2783

2TCIGT )TQUEJGP Q , FGU DÌJOKUEJGP -ÌPKIU 9GP\GN +++ +8   OKV )GIGPUVGORGN XQP   +UP[CWHFGT4ÒEMUGKVG*WHGKUGP&CTÒDGT)GIGPUVGORGNXQP0ÌTFNKPIGP)GMTÌPVGT#FNGT-TWU[+ WPF0 )GIGPUVGORGNUGJTUEJÌP/ÒP\GHCUVUGJTUEJÌP





2TCIGT )TQUEJGP Q , FGU DÌJOKUEJGP -ÌPKIU 9GP\GN +++ +8   OKV )GIGPUVGORGN XQP   +UP[CWHFGT4ÒEMUGKVG*WHGKUGP-TWU[+ )GIGPUVGORGNUEJÌP/ÒP\GUEJÌP





/CKN·PFGT )TQUUQ Q , XQP)KCP)CNGC\\Q8KUEQPVK  OKV)GIGPUVGORGNXQP+UP[CWHFGT 4ÒEMUGKVG5VTCW­GPMQRHPCEJTOKV*WHGKUGP-TWU[:  )GIGPUVGORGNHCUVUGJTUEJÌP/ÒP\GUGJTUEJÌP



&KG<WYGKUWPIFGUXQTNKGIGPFGP)GIGPUVGORGNUCP+UP[KUVPKEJV\YGKHGNUHTGKIGUKEJGTV9·JTGPFUKEJ)2TQDU\VKP GKPGO #WHUCV\ 'KP CPIGDNKEJGT )GIGPUVGORGN XQP .GQDGP KP FGT 5VGKGTOCTM KP *$0  5   OKV   8GTYGKU CWH FGP (WPFJQTK\QPV IGIGP GKPG HTÒJGTG <WYGKUWPI CP .GQDGP CWUURTCEJ NGIVG UKEJ * -TWU[ )GIGP   UVGORGN CWH /ÒP\GP FGU 5R·VOKVVGNCNVGTU (TCPMHWTV/CKP  5   PKEJV HGUV WPF NGIVG FKG -QPVGTOCTMG   WPVGT FKG WPDGUVKOOVGP 5VGORGN &KG 9GUVH·NKUEJG #WMVKQPUIGUGNNUEJCHV KPVGTRTGVKGTVG FCU 5[ODQN CNU MNGKPGU   *WHGKUGPKPGKPGOITQ­GP*WHGKUGP XIN#WMVKQP9#)0T WPFYKGUGU+UP[\W'KPG2T·IWPIKP 8QJGPUVTCW­ 1DGTRHCN\ FCUGKPRCUUGPFGU9CRRGPHÒJTV 5VTCW­OKV*WHGKUGPKO5EJPCDGNFGOGKP(WEJUCPFKG )WTIGNURTKPIV UEJGKFGVWPVGT$GTÒEMUKEJVKIWPIFGT(WPFGYQJNGDGPHCNNUCWU&C/CKN·PFGT/ÒP\GPXQTTCPIKIKO UEJY·DKUEJGP4CWOCWHVCWEJGPYGTFGPKUVFKG<WYGKUWPICP+UP[CWIGPDNKEMNKEJCO9CJTUEJGKPNKEJUVGP

2785

56#&6 

2786

2787

-'/26'0

2TCIGT )TQUEJGP Q , FGU DÌJOKUEJGP -ÌPKIU 9GP\GN +++ +8   OKV )GIGPUVGORGN XQP   -GORVGPCWHFGT8QTFGTUGKVG5VCFVYCRRGP IGURCNVGPGT5EJKNF -TWU[-  )GIGPUVGORGNUGJTUEJÌP/ÒP\GUEJÌP





$CV\GPQ,  OKV6KVGN-CTNU8CNU'T\JGT\QI*CGTVNGXCT0CWXCT  &WPMNG2CVKPCNGKEJVG2T·IGUEJY·EJGUGJTUEJÌP





$CV\GPQ,  OKV6KVGN-CTNU8*CGTVNGXCT0CWEXCT  .GKEJVG2T·IGUEJY·EJGWPF4GUVGXQP)TÒPURCPUGJTUEJÌP

 213


KÖLN

2788



6CNGTQ, WO OKV6KVGN-CTNU8&CX0CW  8QPITQ­GT5GNVGPJGKV)GTGKPKIVDGTKGDGPUEJÌP

$GKFKGUGOUGJTUGNVGPGP5VÒEMJCPFGNVGUUKEJWOFGPGTUVGP-GORVGPGT6CNGTFGTWOIGRT·IVYQTFGPKUVCNU FKGUGUITQ­G5KNDGTPQOKPCNKO5ÒFGPWPF9GUVGP&GWVUEJNCPFU'KP\WIGTJKGNV&CU/ÒP\DKNFYKTFDGJGTTUEJVXQO 2QTVT·V -CKUGT -CTNU 8 UQYKG XQO 4GKEJUCFNGT WPF FGP JCDUDWTIKUEJGP .·PFGTYCRRGP /GJT CNU FKG CPFGTGP   QDGTUEJY·DKUEJGP 5V·FVG UKIPCNKUKGTVG -GORVGP FCOKV FKG #DJ·PIKIMGKV XQP ¤UVGTTGKEJ &KGU JCVVG \YGK   *CWRVITÒPFG<WOGKPGPJCVVG-CKUGT-CTN8KPFGT#WUGKPCPFGTUGV\WPI\YKUEJGP5VKHVWPF5VCFV-GORVGPWOFCU /ÒP\TGEJVCO1MVQDGTDGKFGP5V·PFGPFCU/ÒP\RTKXKNGIDGUV·VKIV<WOCPFGTGPYCTFKG5VCFV-GORVGP CWH FKG 5KNDGTNKGHGTWPIGP CWU FGP GTIKGDKIGP ,WPVCNGT $GTIYGTMGP CPIGYKGUGP 9KT HTGWGP WPU FGP GTUVGP   -GORVGPGT6CNGTGKP5EJNÒUUGNUVÒEMFGTQDGTUEJY·DKUEJGP/ÒP\IGUEJKEJVGCPDKGVGP\WMÌPPGP

2790

2791 2789

'4<$+567/ 



2792 2789

-¤.0 'KPGP-CTQNKPIGTFGPCTCWU-ÌNPHKPFGP5KGWPVGTFGT0T

-QPTCF XQP *QEJUVCFGP  &GPCT  -ÌNP  I 'T\DKUEJQH VJTQPV X X OKV   /KVTC-TWOOUVCDWPF$WEJ&TGKVÒTOKIGU)GD·WFGOKV6QTWPF\YGK-TGW\HCJPGP*·XGTPKEM  .GKEJVFG\GPVTKGTVUGJTUEJÌP



-¤.0+5%*'5*'4<1)67/9'56(#.'0 

(GTFKPCPFXQP$C[GTP4GKEJUVCNGT#TPUDGTI&CX0QUU  44#VVTCMVKXGUUGJTUEJÌPGU'ZGORNCTOKVUEJÌPGT6ÌPWPI

'ZGORNCTFGT5NI&T/G[GT%QNQPKGPUKU6GKN#WMVKQP/ÒP\\GPVTWO-ÌNP0T



56#&6 

4GKEJUVCNGTOKV6KVGN/CZKOKNKCPU++&CX0QUUG  5GNVGPKPFKGUGT'TJCNVWPI5EJCTHCWUIGRT·IVGUXQT\ÒINKEJGU'ZGORNCT





5KNDGTOGFCKNNG  XQP ) .G %NGTE CWH FKG *WNFKIWPI -CKUGT -CTNU 8+ &GT IGJCTPKUEJVG -CKUGT   OKV.QTDGGTMTCP\TGKVGVTKPFGT4GEJVGP<GRVGT5VCFVCPUKEJVOKVFGO4JGKPXQPFGT&GWV\GT5GKVGCWU IGUGJGPQDGP#FNGTOKV$NKV\WPF<GRVGTKPFGP(·PIGPOOI5NI/QPVGPWQXQ 9GKNGT *ÒDUEJG2CVKPCMN-TCV\GTHCUVXQT\ÒINKEJ



214


KONSTANZ

2793

2794

2794





5KNDGTOGFCKNNGWPUKIPKGTVCWHFKGIQNFGPG*QEJ\GKVXQP#PVQP(TCP\%CUUKQPGWPFUGKPGT)GOCJ NKP %CVJCTKPC #IPGU -T·OGT #NVCT OKV (ÒNNJQTP WPF 5VQTEJIGUEJOÒEMVFCTÒDGT\YGKKPGKPCPFGTITGK HGPFG *·PFG OKV /GTMWTUVCD JTG WPF -TGW\ \W FGP 5GKVGP $·WOG(ÒPH <GKNGP 5EJTKHV WOJGT   'KEJGPMTCP\OOI9GKNGT  (GKPG2CVKPCYKP\-TCV\GTXQT\ÒINKEJp5VGORGNINCP\



$TQP\GOGFCKNNG  XQP , 9KGPGT CWH FKG 'KPYGKJWPI FGT 5[PCIQIG KP FGT )NQEMGPICUUG #PUKEJV   FGT5[PCIQIG+PPGPCPUKEJVFGT5[PCIQIGOO9GKNGT 8QT\ÒINKEJ



2795 2797

2796

$+567/ 

-1056#0<

#PQP[O WO  'KPUGKVKIGT XKGT\KRHGNKIGT 2HGPPKI  I )TQD IG\GKEJPGVGT -QRH FGU $K   UEJQHUXX\WFGP5GKVGPFTGK-WIGNPWPF-TWOOUVCD$GTIGTp-NGKP7NOGT %%   445EJTÌVNKPIUTK­WPF2T·IGUEJY·EJGUEJÌPpUGJTUEJÌP



56#&6 



2TCIGT)TQUEJGPQ,OKV)GIGPUVGORGNXQP-QPUVCP\CWHFGT8QTFGTUGKVG$KUEJQHUMQRHOKV/KVTCXX &CTWPVGT )GIGPUVGORGN XQP 7NO 5VCFVYCRRGP IGVGKNVGT URCPKUEJGT 5EJKNF  -TWU[ -  WPF 7    )GIGPUVGORGNUGJTUEJÌP/ÒP\GUEJÌP



2TCIGT)TQUEJGPQ,FGUDÌJOKUEJGP-ÌPKIU9GP\GN+++ +8 OKVWPDGUVKOOVGO)GIGP UVGORGNCWHFGT8QTFGTUGKVG*CNDOQPFWPF5VGTPKPFGP9KPMGNPGKPGU-TGW\GU-TWU[:  44)GIGPUVGORGNUGJTUEJÌP/ÒP\GHCUVUGJTUEJÌP



&KG<WYGKUWPIFGUXQTNKGIGPFGP)GIGPUVGORGNUKUVPKEJVIGUKEJGTV<YCTMÌPPVGP-TGW\*CNDOQPFWPF5VGTPPCEJ -QPUVCP\XGTYGKUGPFQEJYWTFGFQTVJÌEJUVYCJTUEJGKPNKEJCWUUEJNKG­NKEJOKV$KUEJQHUMQRHIGRT·IV'KP·JPNKEJGU 9CRRGP MQPPVG DKUNCPI YGFGT KP 5ÒFFGWVUEJNCPF PQEJ KP FGT 5EJYGK\ CWUIGOCEJV YGTFGP /CP HKPFGV FKGUGP   )GIGPUVGORGNKP8GTIGUGNNUEJCHVWPIXQP-QPVGTOCTMGPCWU7NO#CNGP4GIGPUDWTIWPFFGU5EJY·DKUEJGP$WPFGU

8IN FGP -QOOGPVCT DGK -TWU[ 5  WPF *±UMQX± , %GUM¾ /QTCXUM¾ C 5NG\UM¾ /KPEG   5VQNGVÃ   2TC\UM¾)TQUG2TCI0T 

215


LIPPE



5EJKNNKPIQ, PCEJ PCEJFGO4KGFNKPIGT8GTVTCI0CWHH

4'+%*5/ª0<5666'

2800

2799

2798

4(CUVUGJTUEJÌP



.+0&#7



#PQP[OWO'KPUGKVKIGTXKGT\KRHGNKIGT2HGPPKIWOI.KPFGPDCWOOKVHÒPHUVGPCWH GKPGO*ÒIGN\WFGP5GKVGPLGGKP-TGW\WPVGPFTGK4KPIGN$GTIGTp-NGKP7NOGT %%   44'VYCUFG\GPVTKGTVUGJTUEJÌP





(TKGFTKEJ ++  $TCMVGCV WO   I )GMTÌPVGU $TWUVDKNF X X KP GKPGO FWTEJ GKPG   5RCPIG IGUEJNQUUGPGO /CPVGN \W FGP 5GKVGP LGGKPFTGKDN·VVTKIGT.KPFGP\YGKI$GTIGTp-NGKP7NOGT

%%  4-N5EJTÌVNKPIUCDDTWEJCO4CPFXQT\ÒINKEJ



2801

.+22' )4#(5%*#(65'+6(ª456'067/ 

5KOQP *GKPTKEJ  4GKEJUVCNGT  IGRT·IV  QFGT   &GVOQNF &CX    )TQVGCXCT (CUVUGJTUEJÌP

2802

2803



2804



(TKGFTKEJ#FQNH4GKEJUVCNGT&GVOQNF&CX)TQVGD  4(GKPG2CVKPCUGJTUEJÌPpXQT\ÒINKEJ



6CNGT&GVOQNF&CX)TQVG

4-N4·PFGNWPIUHGJNGTUGJTUEJÌP





5KOQP*GKPTKEJ#FQNH6CNGT&GVOQNF&CX)TQVGC  (GKPG2CVKPCUGJTUEJÌPpXQT\ÒINKEJ



216




LIPPE

2805



2808

2807

2806

5KOQP#WIWUV-QPX6CNGT&GVOQNFCWHUGKPGP)GDWTVUVCICO,WPK&CX )TQVG 4.GKEJVLWUVKGTVUGJTUEJÌPpXQT\ÒINKEJ



&CUXQTNKGIGPFG5VÒEMKUVFGTGKP\KIGLGOCNUPCEJFGO-QPXGPVKQPUHW­CWUIGDTCEJVGNKRRKUEJG6CNGT'TGPVURTKEJV CNNGTFKPIUPKEJVICP\FGP8QTUEJTKHVGPFCFKG9GTVCPICDGHGJNV



(TKGFTKEJ 9KNJGNO .GQRQNF  )WNFGP  /ÒP\UV·VVG XGTOWVNKEJ &GVOQNF 2T·OKGPIWN   FGPIGUVKHVGVHÒTFGP(NCEJUDCW)TQVG  5GNVGPKPFKGUGT'TJCNVWPI2TCEJVGZGORNCT(CUV5VGORGNINCP\





)WNFGP  /ÒP\UV·VVG XGTOWVNKEJ &GVOQNF 2T·OKGPIWNFGP IGUVKHVGV HÒT FGP (NCEJUDCW )TQVG    5GNVGPKPFKGUGT'TJCNVWPI2TCEJVXQNNG2CVKPCMN5EJTÌVNKPIUHGJNGTCO4CPFHCUV5VGORGNINCP\





2CWN#NGZCPFGT.GQRQNF8GTGKPUFQRRGNVCNGT#-5&CX-CJPV6JWP 5GJTUEJÌP



2810 2809





2809

5KNDGTOGFCKNNG  XQP % * .QTGP\ 9GTMUVCVV .QQU CWH UGKP L·JTKIGU 4GIKGTWPIULWDKN·WO WPF   UGKPG5KNDGTJQEJ\GKVOKV'OKNKGXQP5EJYCT\DWTI$GKFGT$ÒUVGPPGDGPGKPCPFGTN.KRRKCOKV9CRRGP UEJKNFWPF-TCP\KPFGT4GEJVGPUKV\VWPVGT'KEJGOOI)TQVG  *GTTNKEJG2CVKPCXQT\ÒINKEJp5VGORGNINCP\



2CWN(TKGFTKEJ'OKN.GQRQNF8GTGKPUVCNGT#-5&CX-CJPV6JWP 2CVKPCHCUV5VGORGNINCP\



5#//.70).+22' 

-NGKPG5COONWPIXQP/ÒP\GP/GFCKNNGPUQYKG1TFGPWPF'JTGP\GKEJGPFGT)TCHUEJCHV.KRRGFCTWP VGT GKPKIG DGUUGTG 5VÒEMG W C  4GKEJUVCNGTMNKRRG  CWHUGKPGP)GDWTVUVCI 5KNDGTOGFCKNNG  UQIGP2T·OKGPVCNGTHÒT(NCEJUDCW44 /CTM X\ GVE+PVGTGUUCPVGU.QVDKVVGDGUKEJVK IGP 5VÒEM(CUVUGJTUEJÌPpXQT\ÒINKEJ

 217


LÖWENSTEIN

2812

2813

2813

9'46*'+/)4#(5%*#(6 

.¤9'056'+0

,QJCPP+2HGPPKIQ,CWH9ÒT\DWTIGT5EJNCI-TGW\YGTVJGKO9KDGN  (GKPG2CVKPCHCUVUGJTUEJÌP



.¤9'056'+09'46*'+/41%*'(146)4#(5%*#(65'+6(ª456'067/ 

,QJCPP6JGQFQT4GKEJUVCNGT9GTVJGKOOKV6KVGN(GTFKPCPFU++&CX9KDGN 44-N5EJTÌVNKPIUHGJNGTUGJTUEJÌP

2814

2816



2815

 

-CTN6JQOCU-QPX6CNGT9GTVJGKO&CX9KDGN -QPX6CNGT9GTVJGKO&CX9KDGN



-QPUVCPVKP  -NKRRGPHÌTOKIG 5KNDGTOGFCKNNG  WPUKIPKGTV CWH UGKPGP 4GIKGTWPIUCPVTKVV   -QRH T8QP 5QPPG DGUEJKGPGPGT $CWO CP FGO GKP 9CRRGPUEJKNF NGJPV T )GPKWU FGT GKP (ÒNNJQTP   CWUNGGTVZOOI9KDGN 8QT\ÒINKEJ



-NKRRGPHÌTOKIG 5KNDGTOGFCKNNG  WPUKIPKGTV CWH UGKPGP 4GIKGTWPIUCPVTKVV -QRH T8QP 5QPPG   DGUEJKGPGPGT$CWOCPFGOGKP9CRRGPUEJKNFNGJPVT)GPKWUFGTGKP(ÒNNJQTPCWUNGGTVZ OOI&C\WGKPYGKVGTGU'ZGORNCTZOOI9KDGN  5VÒEM-N*GPMGNURWT Z UGJTUEJÌPpXQT\ÒINKEJ





2818

  218

-QPX6CNGT9GTVJGKOCWHUGKPGP4GIKGTWPIUCPVTKVV9KDGN -QPX6CNGT9GTVJGKOCWHUGKPGP4GIKGTWPIUCPVTKVV9KDGN

5GJTUEJÌP 5GJTUEJÌP

 

2819

5GJTUEJÌP 5GJTUEJÌP

 


LÜBECK

2824

2823 2821

2820

2822

5#//.70).ª$'%- 5V·FVKUEJG2T·IWPIGPXQT$GITÒPFWPIFGU9GPFKUEJGP/ÒP\XGTGKPU *QJNRHGPPKI Q ,  *·NHVG FGU  ,CJTJWPFGTVU   I)GMTÌPVGT-QRHXXFKG-TQPGKP(QTO XQP.KNKGP$GJTGPU 4*ÒDUEJG2CVKPCUGJTUEJÌP





*QJNRHGPPKIQ, *·NHVGFGU,CJTJWPFGTVU I)GMTÌPVGT-QRHXXOKVMWT\GP5GKVGPNQ EMGP$GJTGPU 4(CUVUGJTUEJÌP





*QJNRHGPPKI Q ,  *·NHVG FGU  ,CJTJWPFGTVU   I )GMTÌPVGTUEJOCNGT-QRHXXQJPG5GK VGPNQEMGP$GJTGPU (CUVUGJTUEJÌP





2HGPPKIQ,  $GJTGPUC

45GJTUEJÌP





2HGPPKIQ,  $GJTGPUD

45GJTUEJÌP





2825

2826

2827

2830

2829



9KVVGPQ, XQT $GJTGPUM

*ÒDUEJG2CVKPCUGJTUEJÌP



9KVVGPQ, XQT $GJTGPUK

*ÒDEJG2CVKPCUGJTUEJÌPpXQT\ÒINKEJ





9KVVGPQ, XQT $GJTGPUF

*ÒDUEJG2CVKPCUGJTUEJÌP





9KVVGPQ, XQT $GJTGPUD

5VÒEM5GJTUEJÌP





5V·FVKUEJG2T·IWPIGPCWUFGT<GKVFGU9GPFKUEJGP/ÒP\XGTGKPU 9KVVGPQ, PCEJFGO4G\G­XQP $GJTGPUE 4-N5EJTÌVNKPIUTK­HCUVUGJTUEJÌP



9KVVGPQ, PCEJFGP4G\GUUGPXQPWPF $GJTGPU  4-N5EJTÌVNKPIUCDDTWEJHCUVUGJTUEJÌP





2831

2832

2834



9KVVGPQ, PCEJFGO4G\G­XQP $GJTGPUJ



&TGKNKPIQ, PCEJ $GJTGPUO



&TGKNKPIQ, PCEJ $GJTGPUCFN



5GEJUNKPIQ, PCEJ $GJTGPUC



5GEJUNKPIQ, PCEJ $GJTGPUXCT

2835



2836

5GJTUEJÌP



#VVTCMVKXGU'ZGORNCTUGJTUEJÌP



5VÒEM5GJTUEJÌP



(GKPG2CVKPCUGJTUEJÌP



44<YGKHCEJIGNQEJVUGJTUEJÌP



'ZGORNCTFGT5COONWPI&T&KGVGT&WOONGT#WMVKQP(TKV\4WFQNH-ÒPMGT/·T\ 0T 



9KVVGPQ, PCEJFGO4G\G­XQP $GJTGPUC

-N5EJTÌVNKPIUHGJNGTCO4CPFUGJTUEJÌP

 219


LÜBECK

ex 2838

2837



5EJKNNKPIQ, PCEJFGO4G\G­XQP /KV$GK\GKEJGP-NGGDNCVVKPFGP-TGW\YKPMGNP$GJTGPU NGKEJVXCT 9KP\5EJTÌVNKPIUHGJNGTCO4CPFUGJTUEJÌP





5EJKNNKPIQ, PCEJFGO4G\G­XQP $GJTGPU

5VÒEM(CUVUGJTUEJÌPWPFUGJTUEJÌP



8CTKCPVGP(CUVUGJTUEJÌPWPFUGJTUEJÌP



5VÒEM5EJÌPWPFHCUVUGJTUEJÌP



ex 2839



$NCHHGTVQ, PCEJ $GJTGPU Z 



9KVVGP$GJTGPUEFC

2842

2841



/CTM$GJTGPUD



/CTM$GJTGPU

2845

8QPITQ­GT5GNVGPJGKV(GKPG2CVKPCHCUVUGJTUEJÌP



44*ÒDUEJG2CVKPCUGJTUEJÌP



2843

2846



/CTM$GJTGPU

44.GKEJVIGYGNNVYKP\-TCV\GTHCUVUGJTUEJÌP





/CTM$GJTGPU

445EJÌPpUGJTUEJÌP





&KG<GKV-CTNU8WPF(GTFKPCPFU+ 6CNGTOKV6KVGN-CTNU8&TKVVGT$TÌOUGPVCNGT/KVFGO#D\GKEJGPFGU$ÒTIGTOGKUVGTU0KEQNCWU $TÌOUG$GJTGPUC&CX 4(CUUWPIUURWTGPUEJÌPpUGJTUEJÌP



6CNGTOKVFGO#D\GKEJGPFGU$ÒTIGTOGKUVGTU)QVVJCTFXQP*ÌXGNP$GJTGPUCE&CX (GKPG2CVKPCUGJTUEJÌP



 220


LÜBECK

2847

2849

2848



6CNGTOKVFGO#D\GKEJGPFGU$ÒTIGTOGKUVGTU)QVVJCTFXQP*ÌXGNP$GJTGPUCNGKEJVXCT 44)GUVQRHVGU.QEJ-QTTQUKQPUURWTGPUGJTUEJÌP





6CNGTOKVFGP#D\GKEJGPFGT$ÒTIGTOGKUVGT)QVVJCTFXQP*ÌXGNPWPF#PVQPXQP5VKVGP$GJTGPU CD&CX  5GJTCVVTCMVKXGU'ZGORNCTOKVJÒDUEJGT2CVKPCYKP\2T·IGUEJY·EJGUGJTUEJÌPpXQT\ÒINKEJ



/CTM$GJTGPUC





5GJTUEJÌP

2851

2850





/CTM8CTKCPVGOKVXGT·PFGTVGT4GKJGPHQNIGFGT8GTGKPUUEJKNFGCWHFGT4ÒEMUGKVG9KUOCT QDGP NKPMU *CODWTI QDGPTGEJVU WPF.ÒPGDWTI WPVGP $GJTGPUCXCT  *ÒDUEJG2CVKPCMN5EJTÌVNKPIUHGJNGTCO4CPFUGJTUEJÌP



/CTM ,CJTGU\CJNKO5VGORGNCWUIG·PFGTV $GJTGPUH

5GJTUEJÌP



2852

2853



/CTM$GJTGPUE

44$GCTDGKVWPIUUVGNNGKO(GNFHCUVUGJTUEJÌP





/CTM$GJTGPUD

8QPITQ­GT5GNVGPJGKV*ÒDUEJG2CVKPCUGJTUEJÌP

 221


LÜBECK

ex 2856 2854

2854



6CNGTOKVFGO#D\GKEJGPFGU$ÒTIGTOGKUVGTU#ODTQUKWU/G[GT$GJTGPUCXCT&CX -N5EJTÌVNKPIUHGJNGTUGJTUEJÌP

 

&QRRGNUEJKNNKPI$GJTGPUEXCT &QRRGNUEJKNNKPI$GJTGPUINGKEJVXCTXCT



&QRRGNUEJKNNKPIOKVFGO#D\GKEJGPFGU$ÒTIGTOGKUVGTU#PVQPXQP5VKVGP Z WPFOKVFGO#D\GK EJGPFGU$ÒTIGTOGKUVGTU#ODTQUKWU/G[GT Z $GJTGPUDH  5VÒEM(CUVUGJTUEJÌP



5EJKNNKPIQ,  $GJTGPUC Z 





5GJTUEJÌP 5VÒEM5GJTUEJÌP

5VÒEM(CUVUGJTUEJÌPWPFUGJTUEJÌP

  

ex 2859

2861

2861



5GEJUNKPI Z $GJTGPU Z D

 5VÒEM(CUVUGJTUEJÌPWPFUGJTUEJÌP





-W5EJGTH Z $GJTGPUC Z   5VÒEM6GKNYGKUGUGNVGP5EJÌPpUGJTUEJÌP





&KG<GKV/CZKOKNKCPU++ 6CNGT 5EJKNNKPI2HGPPKI OKV6KVGN/CZKOKNKCPU++WPFFGO#D\GKEJGPFGU$ÒTIGTOGKUVGTU #ODTQUKWU/G[GT$GJTGPU&CX 9KP\2TÒHURWTUGJTUEJÌP

'ZGORNCTFGT5COONWPI&T&KGVGT&WOONGT#WMVKQP(TKV\4WFQNH-ÒPMGT/·T\ 0T 



2863

2862

2862



4GKEJUVCNGT 5EJKNNKPI OKV6KVGN/CZKOKNKCPU++WPFFGO#D\GKEJGPFGU$ÒTIGTOGKUVGTU*KG TQP[OWU.ÒPGDWTI$GJTGPU&CX 5GJTUEJÌP





6CNGT 5EJKNNKPI2HGPPKI OKV6KVGN/CZKOKNKCPU++WPFFGO#D\GKEJGPFGU$ÒTIGTOGKU VGTU#ODTQUKWU/G[GT$GJTGPUE 45GJTUEJÌP



222


LÜBECK

2864

2865

2866

&KG<GKV4WFQNHU++ 

4GKEJUVCNGT 5EJKNNKPI OKV6KVGN4WFQNHU++WPFFGO#D\GKEJGPFGU$ÒTIGTOGKUVGTU*GKPTKEJ 2NÌPPKGU$GJTGPU&CX #VVTCMVKXGU'ZGORNCTOKVJÒDUEJGT2CVKPCUGJTUEJÌP





4GKEJUVCNGT 5EJKNNKPI OKV6KVGN4WFQNHU++WPFFGO#D\GKEJGPFGU$ÒTIGTOGKUVGTU)QVVJCTF XQP*ÌXGNP$GJTGPUCXCT&CX 4-N2T·IGUEJY·EJGUGJTUEJÌP





4GKEJUVCNGT 5EJKNNKPI OKV6KVGN4WFQNHU++WPFFGO#D\GKEJGPFGU$ÒTIGTOGKUVGTU)QVVJCTF XQP*ÌXGNP$GJTGPUC&CX  *ÒDUEJG2CVKPCMN2T·IGUEJY·EJGYKP\5EJTÌVNKPIUHGJNGTUGJTUEJÌP



2867

2868

2868



4GKEJUVCNGT 5EJKNNKPI OKV6KVGN4WFQNHU++WPFFGO#D\GKEJGPFGU$ÒTIGTOGKUVGTU)QVVJCTF XQP*ÌXGNP$GJTGPUD&CX 4-N-TCV\GTUGJTUEJÌP





$TGKVGT6CNGTQ,  OKVFGO#D\GKEJGPFGU$ÒTIGTOGKUVGTU)QVVJCTFXQP*ÌXGNP$GJTGPU CNGKEJVXCT&CX 44(CUVUGJTUEJÌP

 223


LÜBECK

2869



2870

4GKEJUVCNGT 5EJKNNKPI OKV6KVGN4WFQNHU++WPFFGO#D\GKEJGPFGU$ÒTIGTOGKUVGTU#NGZCPFGT .ÒPGDWTI$GJTGPUDXCT&CXp XIN   5GJTUGNVGPGT,CJTICPI9KP\5EJTÌVNKPIUHGJNGTHCUVXQT\ÒINKEJ



'ZGORNCTFGT5COONWPI&T&KGVGT&WOONGT#WMVKQP(TKV\4WFQNH-ÒPMGT/·T\ 0T 



4GKEJUVCNGT 5EJKNNKPI OKV6KVGN4WFQNHU++WPFFGO#D\GKEJGPFGU$ÒTIGTOGKUVGTU#NGZCPFGT .ÒPGDWTI$GJTGPUCE&CX 45GJTUEJÌP

2871



2874

2872



4GKEJUVCNGT 5EJKNNKPI OKV6KVGN4WFQNHU++WPFFGO#D\GKEJGPFGU$ÒTIGTOGKUVGTU#NGZCP FGT.ÒPGDWTI$GJTGPUXCT 4(GKPG6ÌPWPIHCUVUGJTUEJÌP



4GKEJUVCNGT 5EJKNNKPI OKV6KVGNXQP/CVVJKCUWPFFGO#D\GKEJGPFGU$ÒTIGTOGKUVGTU#NGZCP FGT.ÒPGDWTI$GJTGPU0CEJVTCI&CX 5GJTUEJÌP





 4GKEJUVCNGT  5EJKNNKPI   OKV 6KVGN XQP /CVVJKCU WPF FGO #D\GKEJGP FGU $ÒTIGTOGKUVGTU   #NGZCPFGT.ÒPGDWTI$GJTGPUD Z  5VÒEM5VCTMG$GCTDGKVWPIUURWTGP Z UEJÌPpUGJTUEJÌP





4GKEJUVCNGT 5EJKNNKPI OKV6KVGNXQP/CVVJKCUWPFFGO#D\GKEJGPFGU$ÒTIGTOGKUVGTU#NG ZCPFGT.ÒPGDWTI$GJTGPUE 45GJTUEJÌP





&KG<GKVXQP/CVVJKCU

2875

2876

&KG<GKV(GTFKPCPFU++ 

4GKEJUVCNGT  5EJKNNKPI   OKV 6KVGN (GTFKPCPFU ++ WPF FGO #D\GKEJGP FGU $ÒTIGTOGKUVGTU   #NGZCPFGT.ÒPGDWTI$GJTGPUXCT&CX -N5EJTÌVNKPIUTK­UGJTUEJÌP





4GKEJUVCNGT 5EJKNNKPI OKV6KVGN(GTFKPCPFU++WPFFGP#D\GKEJGPFGT$ÒTIGTOGKUVGT.QTGP\ /ÌNNGTWPF*GKPTKEJ-ÌJNGT$GJTGPUEXCT&CX -N&TWEMUVGNNGWPF-TCV\GTUGJTUEJÌP



'ZGORNCTFGT5COONWPI&T&KGVGT&WOONGT#WMVKQP(TKV\4WFQNH-ÒPMGT/·T\ 0T 

224


LÜBECK

2877

2878

2879



4GKEJUVCNGT 5EJKNNKPI OKV6KVGN(GTFKPCPFU++WPFFGP#D\GKEJGPFGT$ÒTIGTOGKUVGT*GKPTKEJ -ÌJNGTWPF.QTGP\/ÌNNGT$GJTGPUXCT&CX 5GJTUEJÌP





4GKEJUVCNGT 5EJKNNKPI OKV6KVGN(GTFKPCPFU++WPFFGP#D\GKEJGPFGT$ÒTIGTOGKUVGT*GKPTKEJ -ÌJNGTWPF.QTGP\/ÌNNGT$GJTGPUDNGKEJVXCT&CX  9KP\5EJTÌVNKPIUHGJNGTUGJTUEJÌP



4GKEJUVCNGT 5EJKNNKPI  ,CJTGU\CJNKO5VGORGNCWUIG·PFGTV OKV6KVGN(GTFKPCPFU++ WPFFGO#D\GKEJGPFGU$ÒTIGTOGKUVGTU#NGZCPFGT.ÒPGDWTI$GJTGPUNGKEJVXCT  49KP\4CPFHGJNGTUGJTUEJÌP



4GKEJUVCNGT 5EJKNNKPI  ,CJTGU\CJNKO5VGORGNCWUIG·PFGTV OKV6KVGN(GTFKPCPFU++ WPFFGO#D\GKEJGPFGU$ÒTIGTOGKUVGTU#NGZCPFGT.ÒPGDWTI$GJTGPUNGKEJVXCT  4.GKEJVG-QTTQUKQPUURWTGPHCUVUGJTUEJÌP







2882

ex 2883

2881





2881

4GKEJUVCNGT 5EJKNNKPI  ,CJTGU\CJNKO5VGORGNCWUIG·PFGTV OKV6KVGN(GTFKPCPFU++ WPFFGP#D\GKEJGPFGT$ÒTIGTOGKUVGT*GKPTKEJ-ÌJNGTWPF.QTGP\/ÒNNGT$GJTGPUXCT  45GJTUEJÌP



 4GKEJUVCNGT  5EJKNNKPI   OKV 6KVGN (GTFKPCPFU ++ WPF FGO #D\GKEJGP FGU $ÒTIGTOGKUVGTU   #NGZCPFGT.ÒPGDWTI$GJTGPU0CEJVTCIXCT 44-N)TCHKVVKMN5EJTÌVNKPIUHGJNGTHCUVUGJTUEJÌP



'ZGORNCTFGT5COONWPI&T&KGVGT&WOONGT#WMVKQP(TKV\4WFQNH-ÒPMGT/·T\ 0T 



4GKEJUVCNGT 5EJKNNKPI OKV6KVGN(GTFKPCPFU++WPFFGP#D\GKEJGPFGT$ÒTIGTOGKUVGT*GKP TKEJ-ÌJNGTWPF.QTGP\/ÌNNGT$GJTGPUC Z   5VÒEM)GUVQRHVGU.QEJ Z 5EJTÌVNKPIUHGJNGTCO4CPFHCUVUGJTUEJÌPWPFUGJTUEJÌP

 225


LÜBECK

2885

ex 2884



4GKEJUVCNGT 5EJKNNKPI OKV6KVGN(GTFKPCPFU++WPFFGP#D\GKEJGPFGT$ÒTIGTOGKUVGT*GKP TKEJ-ÌJNGTWPF.QTGP\/ÌNNGT$GJTGPUCXCT 5VÒEM5EJÌPpUGJTUEJÌPWPFHCUVUGJTUEJÌP





4GKEJUVCNGT 5EJKNNKPI OKV6KVGN(GTFKPCPFU++WPFFGP#D\GKEJGPFGT$ÒTIGTOGKUVGT*GKP TKEJ-ÌJNGTWPF.QTGP\/ÌNNGT$GJTGPUXCT (CUVUGJTUEJÌP



2892

2889

ex 2886

2893

ex 2886



6CNGT &ÒVVEJGP OKVFGO#D\GKEJGPFGU$ÒTIGTOGKUVGTU%JTKUVQRJ)GTFGU Z  $GJTGPUXCTXCT 5VÒEM(CUVUGJTUEJÌPWPFUGJTUEJÌP





5GEJUNKPI    Z           Z    

Z $GJTGPU Z  Z  Z   5VÒEM(CUVUGJTUEJÌPWPFUGJTUEJÌP



&TGKNKPIQ, Z  Z  Z  Z    Z   Z    $GJTGPU   Z   Z          Z  Z  Z  Z  5VÒEM/GKUVUGJTUEJÌP



&KG<GKV.GQRQNFU+ 5EJKNNKPIOKVFGO#D\GKEJGPFGU$ÒTIGTOGKUVGTU/CVVJ·WU4QFFG$GJTGPUCGXCT&CX 9KP\5EJTÌVNKPIUHGJNGTCO4CPFUGJTUEJÌP



6CNGT &QRRGNUEJKNNKPI  Z 

Z $GJTGPU Z   Z  5VÒEM5EJÌPpUGJTUEJÌP



6CNGT &QRRGNUEJKNNKPI  Z  Z $GJTGPU  Z  Z  5VÒEM/GKUVUGJTUEJÌP



&KG<GKV-CTNU8+ 4GKEJUVCNGTOKVFGO#D\GKEJGPFGU$ÒTIGTOGKUVGTU*GKPTKEJ$CNGOCPPCWHFKG,CJTHGKGTFGT ªDGTICDGFGT#WIUDWTIGT-QPHGUUKQP$GJTGPUC&CX,5NI9JKVKPI  (CUVXQT\ÒINKEJ



4GKEJUVCNGTOKV6KVGN-CTNU8+WPFFGO#D\GKEJGPFGU$ÒTIGTOGKUVGTU*GKPTKEJ$CNGOCPP$GJ TGPUNGKEJVXCT&CX, (GKPG2CVKPCHCUVXQT\ÒINKEJ





 





 226


LÜBECK

2896

2894

2894



5KNDGTCDUEJNCI\WGKPGO4GKEJUVCNGTXQPFGP5VGORGNPFGU&QRRGNFWMCVGPOKVFGO#D\GKEJGP FGU$ÒTIGTOGKUVGTU#FQNRJ/CVVJ·WU4QFFGCWHFKG,CJTHGKGTFGT4GHQTOCVKQP$GJTGPUE5NI 9JKVKPIXCT #VVTCMVKXGU'ZGORNCTOKVHGKPGT2CVKPCXQT\ÒINKEJp5VGORGNINCP\



5KNDGTCDUEJNCI \W GKPGO  4GKEJUVCNGT XQP FGP 5VGORGNP FGU &WMCVGP  OKV FGO #D\GKEJGP FGU   $ÒTIGTOGKUVGTU #FQNRJ /CVVJ·WU 4QFFG CWH FKG ,CJTHGKGT FGT 4GHQTOCVKQP $GJTGPU  E Z    5NI9JKVKPI Z  5VÒEM*ÒDUEJG2CVKPCUGJTUEJÌP



5KNDGTCDUEJNCI \W GKPGO  4GKEJUVCNGT XQP FGP 5VGORGNP FGU &WMCVGP  OKV FGO #D\GKEJGP FGU   $ÒTIGTOGKUVGTU *GKPTKEJ $CNGOCPP CWH FKG ,CJTHGKGT FGT ªDGTICDG FGT #WIUDWTIGT -QPHGUUKQP   $GJTGPUE,#PO5NI9JKVKPI #VVTCMVKXGU'ZGORNCTOKVHGKPGT2CVKPCUGJTUEJÌP





5EJKNNKPI Z $GJTGPU Z , Z   5VÒEM/GKUVUGJTUEJÌP





&TGKNKPI Z  Z $GJTGPU  Z  Z , Z  Z   5VÒEM/GKUVUGJTUEJÌP







2899

2900

2901



&KG<GKV-CTNU8++ 4GKEJUVCNGTOKV6KVGN-CTNU8++WPFFGO#D\GKEJGPFGU$ÒTIGTOGKUVGTU*GKPTKEJ$CNGOCPP/KV 4CPFUEJTKHV$GJTGPU&CX, 45GJTUEJÌP





&KG<GKVXQP(TCP\+ 6CNGT  5EJKNNKPI   OKV FGO #D\GKEJGP FGU $ÒTIGTOGKUVGTU *GKPTKEJ 4WUV $GJTGPU  C   &CX, 5GJTUEJÌP



6CNGT 5EJKNNKPI OKVFGO#D\GKEJGPFGU$ÒTIGTOGKUVGTU*GKPTKEJ4WUV$GJTGPUCNGKEJV XCT&CX, (GKPG2CVKPCUGJTUEJÌP





227


LÜBECK

2903

  

2902

2904

6CNGT 5EJKNNKPI OKVFGO#D\GKEJGPFGU$ÒTIGTOGKUVGTU*GKPTKEJ4WUV$GJTGPUCNGKEJV XCT&CX, 5GJTUEJÌP 6CNGT 5EJKNNKPI OKVFGO#D\GKEJGPFGU$ÒTIGTOGKUVGTU*GKPTKEJ4WUV$GJTGPUCNGKEJV XCT&CX, 5GJTUEJÌP 6CNGT 5EJKNNKPI OKVFGO#D\GKEJGPFGU$ÒTIGTOGKUVGTU*GKPTKEJ4WUV$GJTGPUCNGKEJV XCT&CX, *ÒDUEJG2CVKPCUGJTUEJÌP

  

2905

   

6CNGT 5EJKNNKPI OKVFGO#D\GKEJGPFGU$ÒTIGTOGKUVGTU*GKPTKEJ4WUV$GJTGPUCNGKEJV XCT&CX, 5GJTUEJÌP 5EJKNNKPI Z OKVFGO#D\GKEJGPFGU$ÒTIGTOGKUVGTU*GKPTKEJ$CNGOCPP Z WPF OKV FGO #D\GKEJGP FGU $ÒTIGTOGKUVGTU *GKPTKEJ 4WUV $GJTGPU   Z   C &CX    

Z ,C Z  5VÒEM/GKUVUGJTUEJÌP  5EJKNNKPI  OKV FGO #D\GKEJGP FGU $ÒTIGTOGKUVGTU )QVVJCTF #TPQNF +UUGNJQTUV $GJTGPU  C  

Z DFF Z G&CX Z # Z , Z C Z D  5VÒEM/GKUVUGJTUEJÌP 5EJKNNKPI5GEJUNKPI&C\WGKP$NGKCDUEJNCIXQPFGP5VGORGNPFGU5EJKNNKPI$GJ TGPUXIN,XIN 5VÒEM5GJTUEJÌP

   

2909

 228

&KG<GKV,QUGHU++ 4GKEJUVCNGTOKV6KVGN,QUGHU++WPFFGO#D\GKEJGPFGU$ÒTIGTOGKUVGTU&CPKGN*CGMU$GJTGPUC &CX, 5GJTUEJÌPpXQT\ÒINKEJ




LÜBECK

2911 2910

2910



4GKEJUVCNGTOKV6KVGN,QUGHU++WPFFGO#D\GKEJGPFGU$ÒTIGTOGKUVGTU&CPKGN*CGMU$GJTGPUDC &CX 5GJTUEJÌPpXQT\ÒINKEJ



5EJKNNKPI$GJTGPUD,#PO



&KG<GKVXQP(TCP\++ 5EJKNNKPI Z  Z OKV#D\GKEJGPFGU$ÒTIGTOGKUVGTU*GTOCPP)GQTI$ÒPGMCW$GJTGPU  Z CD, Z  5VÒEM5GJTUEJÌPpXQT\ÒINKEJ

2914



445EJÌPpUGJTUEJÌP

2913

 



2915

5EJCWOÒP\GPWPF/GFCKNNGPFGT5VCFV.ÒDGEM  5EJCWVCNGT   I -ÌPKI &CXKF VJTQPV X X OKV 5EJYGTV KP FGT 4GEJVGP WPF *CTHG KP FGT   .KPMGP \W FGP 5GKVGP FKG IGVGKNVG ,CJTGU\CJN    WPVGP \YGK 9CRRGPUEJKNFG-TGW\KIWPIUU\GPG   FCTÒDGT)QVVXCVGTOKV4GKEJUCRHGNKPFGT.KPMGPKP9QNMGP$GJTGPU4ÌJN  8QPITQ­GT5GNVGPJGKV(CUVUGJTUEJÌP  'ZGORNCTFGT5COONWPI&T&KGVGT&WOONGT#WMVKQP(TKV\4WFQNH-ÒPMGT/·T\ 0T 



$TGKVGT FQRRGNVGT 5EJCWVCNGT Q , WO   1UVGTVCNGT  I /ÒP\OGKUVGT ,ÒTIGP 4QVJWUGP   %JTKUVWU CO -TGW\ \YKUEJGP FGP DGKFGP 5EJ·EJGTP WOJGT <WUEJCWGTWPF5QNFCVGP&KG#WHGTUVGJWPI %JTKUVK$GJTGPUp5NI)QRRGNp -N*GPMGNURWTUGJTUEJÌP



'ZGORNCTFGT5COONWPI&T&KGVGT&WOONGT#WMVKQP(TKV\4WFQNH-ÒPMGT/·T\ 0T 



$TGKVGT5EJCWVCNGTQ,*QEJ\GKVUVCNGTI,GUWU%JTKUVWUUGIPGVGKPTGKEJIGMNGKFGVGU$TCWVRCCT 5KGDGP2GTUQPGPUKV\GPCPGKPGT*QEJ\GKVUVCHGNKO8QTFGTITWPFGKP&KGPGTFGTGKPGP9GKPMTWIDGHÒNNVN UVGJGPHÒPHYGKVGTG9GKPMTÒIG$GJTGPUD -N*GPMGNURWTUGJTUEJÌP

 229


LÜBECK

2916



5GEJUGEMKIG5KNDGTOGFCKNNGWPUKIPKGTVCWHFGP(TKGFGPXQP.ÒDGEM\YKUEJGP-CKUGT(GTFKPCPF++ WPF&·PGOCTMCO,WNK5KGDGP<GKNGP5EJTKHVQDGP5VGTPWPVGP2CNOWPF.QTDGGT\YGKIIGMTGW\V 8KGT/·PPGTMPKGPXQTTCWEJGPFGO#NVCTWPFDGVGPQDGPFGTUVTCJNGPFG0COG,GJQXCUWPF4GIGPDQ IGPKO#DUEJPKVV,CJTGU\CJNWPF5VGTPZZOOI2CZKP0WOOKU 4ÌJN FQTVOKV,CJTGU\CJN  (GKPG2CVKPCIGUVQRHVGU.QEJUGJTUEJÌP



'ZGORNCTFGT5COONWPI&T&KGVGT&WOONGT#WMVKQP(TKV\4WFQNH-ÒPMGT/·T\ 0T 

2917



5KNDGTOGFCKNNG  XQP 5 &CFNGT 5VCFVCPUKEJV XQP 1UVGP OKV FGT 9CMGPKV\ CWH FGT MNGKPG $QQVG   HCJTGP WPF FGT (CNMGPJCNDKPUGN KO 8QTFGTITWPF 'PIGN OKV \YGK 9CRRGPUEJKNFGP QDGP UVTCJNGPFGU   )QVVGUCWIGKP9QNMGPCWUFGPGP9KPFIÌVVGTDNCUGP2CUVQTUGIPGVGKPTGKEJIGMNGKFGVGU$TCWVRCCTCO $QFGP2GNKMCPOKVUGKPGP,WPIGP\YGKUEJP·DGNPFG6CWDGPWPFGKP$KGPGPUVQEMQDGPUEJÒVVGVGKP2WVVQ 9CUUGTCWUGKPGO-TWICWHFCU$TCWRCCT\WFGP5GKVGPLGGKPGCWU9QNMGPMQOOGPFG*CPFOO I$GJTGPU/CW¾4ÌJN 4(GNFGTIGIN·VVGVUGJTUEJÌP  'ZGORNCTFGT5COONWPI&T&KGVGT&WOONGT#WMVKQP(TKV\4WFQNH-ÒPMGT/·T\ 0T 

2918



230

5KNDGTOGFCKNNGWPUKIPKGTVCWHFGP$ÒTIGTOGKUVGT/CVVJGWU4QFFG$TWUVDKNFFGU$ÒTIGTOGKUVGTUT 5VCFVCPUKEJV XQP 9GUVGP FCTÒDGT .8$'%# \YKUEJGP (TWEJVIKTNCPFGP QDGP QXCNGT 5EJKNF FCTKP   FGT IGMTÌPVG &QRRGNCFNGT OKV 5VCFYCRRGP CWH FGT $TWUV KO #DUEJPKVV FTGK <GKNGP 5EJTKHV  OO   I$GJTGPU4ÌJN 9KP\4CPFHGJNGTHCUVXQT\ÒINKEJ




LÜBECK

2920

2919







2921

5KNDGTOGFCKNNGWPUKIPKGTVCWHFGP$ÒTIGTOGKUVGT#PVJQP9KPMNGT$TWUVDKNFFGU$ÒTIGTOGKUVGTUT 5VCFVCPUKEJV XQP 1UVGP OKV FGT 9CMGPKV\ KO 8QTFGTITWPF 'PIGN OKV \YGK 9CRRGPUEJKNFGP QDGP   UVTCJNGPFGU&TGKHCNVKIMGKVUU[ODQN\YKUEJGP9QNMGPOOI$GJTGPU4ÌJN  44*ÒDUEJG2CVKPCHCUVXQT\ÒINKEJ



5KNDGTOGFCKNNG Q , WO   XQP , %JT 4GVGEMG 5VCFVCPUKEJV XQP .ÒDGEM XQP FGT 1UVUGKVG OKV   \CJNTGKEJGP 5EJKHHGP KO 8QTFGTITWPF FCXQT 'PIGN OKV \YGK 9CRRGPUEJKNFGP QDGP UVTCJNGPFGU &TGK   HCNVKIMGKVUU[ODQN<YGK YGKDNKEJG )GUVCNVGP GKPG OKV 5EJYGTV FKG CPFGTG OKV .KNKGPUVTCW­ JCNVGP   IGOGKPUCOGKPGP¤N\YGKIÒDGTGKPGP6KUEJFCXQT\YGKUEJP·DGNPFG6CWDGPFCTÒDGTGKPGCWU9QNMGP MQOOGPFG*CPFOKV9CCIGUQYKGFKGIÌVVNKEJG#NNYKUUGPJGKVOOI$GJTGPU4ÌJNp 44.GKEJVDGTKGDGPUGJTUEJÌPpXQT\ÒINKEJ



5KNDGTOGFCKNNG  WPUKIPKGTV CWH FKG )QNFGPG *QEJ\GKV FGU 2CUVQTU $GTPJCTF -TGEJVKPI WPF UGKPGT   )GOCJNKP /CTICTGVC 5VQNVGTHQTV <YGK \WUCOOGPIGDWPFGPG *GT\GP OKV FGP (COKNKGPYCRRGP <GK   NGP5EJTKHVOOI$GJTGPU4ÌJN 5GJTUEJÌP



'ZGORNCTFGT5COONWPI&T&KGVGT&WOONGT#WMVKQP(TKV\4WFQNH-ÒPMGT/·T\ 0T   $GTPJCTF-TGEJVKPIYCTCD2TGFKIGTKP5V/CTKGPWPFUVCTDCNU2CUVQTWPF5GPKQTFGU/KPKUVGTKQKO1MVQDGT

2923



2922

2923

5KNDGTOGFCKNNGWPUKIPKGTVCWHFGP6QFFGU$ÒTIGTOGKUVGTU,QJCPP4KVVGTCO5GRVGODGT$TWUV DKNFFGU$ÒTIGTOGKUVGTUT<GKNGP5EJTKHVOOI$GJTGPU4ÌJN  5GJTUEJÌP



5KNDGTOGFCKNNG  XQP + ( *KNMGP CWH FKG $ÒTIGTOGKUVGT ,QJCPP 9GUVMGP 5GDCUVKCP )GTMGP   6JQOCU XQP 9KEMGFG WPF #FQNRJ /CVVJ·WU 4QFFG 5VCFVCPUKEJV XQP 1UVGP QDGP UVTCJNGPFGT 0COG   ,GJQXCU$TWUVDKNFGT FGT XKGT $ÒTIGTOGKUVGT KP /GFCKNNQPU WOJGT 2CNO\YGKIG  OO  I   $GJTGPU4ÌJN *ÒDUEJG2CVKPCUGJTUEJÌP



'ZGORNCTFGT5COONWPI&T&KGVGT&WOONGT#WMVKQP(TKV\4WFQNH-ÒPMGT/·T\ 0T 



231


LÜBECK

2924



2926

2925

5KNDGTOGFCKNNGXQP,*(GNFCWHFGP$ÒTIGTOGKUVGT&CPKGN/ÒNNGT$TWUVDKNFFGU$ÒTIGTOGKUVGTU T)GMTÌPVGU9CRRGPOKV-COOTCFWPFGKPGOKO9CUUGTPCEJNUVGJGPFGP.ÌYGPOOI $GJTGPU4ÌJN 4-N5VGORGNHGJNGTHCUVXQT\ÒINKEJ



'ZGORNCTFGT5COONWPI&T&KGVGT&WOONGT#WMVKQP(TKV\4WFQNH-ÒPMGT/·T\ 0T 





5KNDGTOGFCKNNG  WPUKIPKGTV CWH FGP $ÒTIGTOGKUVGT *GKPTKEJ $CNGOCPP $TWUVDKNF FGU $ÒTIGTOGKU   VGTUT)GMTÌPVGU9CRRGPOKVYCEJUGPFGO#FNGT*QRHGPTCPMGWPF\YGK5RCTTGPOOI $GJTGPUC4ÌJN 8QT\ÒINKEJ



5KNDGTOGFCKNNG  XQP # 8GUVPGT CWH FGP 6QF FGU 2CUVQTU WPF 7PKXGTUKV·VRTQHGUUQTU #WIWUV *GT   OCPP (TCPEMG $TWUVDKNF HCUV X X KP IGKUVNKEJGO 1TPCV#PUKEJV FGT (TCPEMGUEJGP 5VKHVWPI KO 8QT   FGTITWPF GORH·PIV FKG RGTUQPKHK\KGTVG 4GNKIKQP 9CKUGPMKPFGT T FKG 2GTUQPKHKMCVKQP XQP -WPUV WPF   9KUUGPUEJCHV UQYKG XGTUEJKGFGPG 'ODNGOG FGT 9KUUGPUEJCHV  OO  I $GTPJGKOGT    .CXGTTGP\4ÌJN 44(GKPG2CVKPCYKP\4CPFHGJNGTXQT\ÒINKEJ



'ZGORNCTFGT5COONWPI&T&KGVGT&WOONGT#WMVKQP(TKV\4WFQNH-ÒPMGT/·T\ 0T 





#WIWUV*GTOCPP(TCPEMG /·T\KP.ÒDGEMÓ,WPKKP*CNNGCPFGT5CCNGYCTGKPFGWVUEJGTGXCP IGNKUEJGT 6JGQNQIG 2·FCIQIG WPF -KTEJGPNKGFFKEJVGT 'T YCT GKPGT FGT *CWRVXGTVTGVGT FGU 2KGVKUOWU &KG   $GITÒPFWPI FGT (TCPEMGUEJGP 5VKHVWPIGP KP *CNNG UVGNNV UGKP GKIGPVNKEJGU .GDGPUYGTM FCT  DGICPP (TCPEMG   -KPFGT KP UGKPGT )GOGKPFG )NCWEJC \W WPVGTTKEJVGP WPF \W XGTUQTIGP #O  5GRVGODGT  YWTFG FGT   )TWPFUVGKP HÒT GKP PGWGU 9CKUGPJCWU IGNGIV WPF KPPGTJCND XQP  ,CJTGP GPVUVCPFGP 5EJWN WPF 9QJPIGD·WFG   9GTMUV·VVGP)·TVGPWPFGKPG#RQVJGMG+PKPUIGUCOVL·JTKIGT$CWV·VKIMGKVYWEJUGKPG5EJWNUVCFVJGTCPKPFGTDKU \W/GPUEJGPNGDVGPWPFCPFGT-QP\GRVKQPGKPGTEJTKUVNKEJKPURKTKGTVGP)GUGNNUEJCHVUTGHQTOCTDGKVGVGP

2927





232

2928

5KNDGTOGFCKNNG  WPUKIPKGTV CWH FGP $ÒTIGTOGKUVGT *GKPTKEJ $CNGOCPP $TWUVDKNF FGU $ÒTIGTOGKU   VGTU T5VCFVCPUKEJV XQP 1UVGP FCXQT (CNMGPJCNDKPUGN OKV *ÒVVGP WPF $·WOGP  OO  I   $GJTGPU4ÌJN 4(GKPG2CVKPCHCUVXQT\ÒINKEJ



5KNDGTOGFCKNNG  WPUKIPKGTV CWHFGP$ÒTIGTOGKUVGT,QJCPP*GKPTKEJ&TG[GT$TWUVDKNFFGU$ÒTIGT OGKUVGTUT5VCFVIÌVVKPUVGJVXXFGP-QRHPCEJNIGYCPFV\WFGP5GKVGPNGKP#NVCTOKVFGP+PKVKC NGP*&FCTCWH$KDGNWPF2CNO\YGKITDGJGNOVGU(COKNKGPYCRRGPOOI$GJTGPUC 4ÌJN 4(GKPG2CVKPCUGJTUEJÌPpXQT\ÒINKEJ




LÜBECK

2930

2929



2929

5KNDGTOGFCKNNG  XQP # #CTQP CWH FKG )QNFGPG *QEJ\GKV FGU $ÒTIGTU *GKPTKEJ 9ÌJTOCPP WPF   UGKPGT )GOCJNKP 'PIGN 9ÌJTOCPP IGDQTGPG 6GUFQTRH $TWUVDKNF FGU $ÒTIGTU T KO #DUEJPKVV \YGK   <GKNGP 5EJTKHV$TWUVDKNF UGKPGT )GOCJNKP T KO #DUEJPKVV \YGK <GKNGP 5EJTKHV  OO  I   $GJTGPU4ÌJN 4(CUVXQT\ÒINKEJ



'ZGORNCTFGT5COONWPI&T&KGVGT&WOONGT#WMVKQP(TKV\4WFQNH-ÒPMGT/·T\ 0T 



6TCIDCTGUKNDGTPG/KPKCVWTOGFCKNNGWPUKIPKGTVXQP&(QFGT(9.QQUCWHFKG$GHTGKWPIFGT 5VCFV .ÒDGEM 5QIGPCPPVGT 5KGIGURHGPPKI (ÒPH <GKNGP 5EJTKHV8KEVQTKC UEJYGDV N KP FGT 4GEJVGP   (NCOOGPUEJYGTVKPFGT.KPMGP5KGIGUMTCP\OOI$GJTGPU4ÌJN5QOOGT # *ÒDUEJG2CVKPCHCUVXQT\ÒINKEJ

2931



2932



ex2933

6TCIDCTG5KNDGTOGFCKNNGQ,  XQP&(WPF(9.QQU8GTFKGPUVOGFCKNNGFGTJCPUGCVKUEJGP .GIKQP .ÒDGEM$TGOGP*CODWTI \WT'TKPPGTWPICPFKG$GHTGKWPIUMTKGIGXQP&KG9CR RGPUEJKNFGFGTFTGK5V·FVGCPFGP5VWORHGKPGTCNVGP'KEJGIGNGJPV(ÒPH<GKNGP5EJTKHVÒDGTFGOJCP UGCVKUEJGP-TGW\OOI$GJTGPU)CGF+5WPF+++5,WPIM 4ÌJN5QOOGT8 4#VVTCMVKXGU'ZGORNCTXQT\ÒINKEJ



&KG XQTNKGIGPFG/GFCKNNGYWTFGXQPFGP5GPCVGPFGT(TGKGP*CPUGUV·FVGKO,CJTGIGUVKHVGVKP*CODWTICO  KP $TGOGP CO  WPF KP .ÒDGEM CO  &KG /GFCKNNG YWTFG CP GKPGO FWPMGNTQUCYGK­GO $CPF   IGVTCIGPWPFCPFKG/KVINKGFGTFGT*CPUGCVKUEJGP.GIKQPXGTNKGJGP



5KNDGTOGFCKNNG  XQP % 8QKIV 9GTMUVCVV ) .QQU CWH FGP $ÒTIGTOGKUVGT ,QJCPP /CVVJ·WU 6GU   FQTRH $TWUVDKNF FGU $ÒTIGTOGKUVGTU N0GWP <GKNGP 5EJTKHV WOJGT 'KEJGPMTCP\  OO  I   $GJTGPU4ÌJN *ÒDUEJG2CVKPCYKP\4CPFHGJNGTWPF-TCV\GTUGJTUEJÌP



'ZGORNCTFGT5COONWPI&T&KGVGT&WOONGT#WMVKQP(TKV\4WFQNH-ÒPMGT/·T\ 0T 



5KNDGTOGFCKNNGQ, IGUVKHVGV XQP%JT2HGWHHGT8GTFKGPUVOGFCKNNGFGT)GUGNNUEJCHV\WT$GHÌTFG TWPIIGOGKPPÒV\KIGT6·VKIMGKVKP.ÒDGEM9GKDNKEJG)GUVCNVUKV\VPCEJTOKV'KEJGPMTCP\KPFGT4GEJVGP WPF \GKIV OKVFGT.KPMGPCWHFKG5VCFVCPUKEJVXQP.ÒDGEMKO#DUEJPKVV&'/8'4&+'056'5KGDGP <GKNGP5EJTKHVWOJGT'KEJGPMTCP\OOI&C\WGKPYGKVGTGU'ZGORNCTKP$TQP\GWPFKP XGTUKNDGTVGT$TQP\G$GJTGPU Z 4ÌJN Z 5QOOGT2XCT Z   5VÒEM8QT\ÒINKEJp5VGORGNINCP\



&KG/GFCKNNGPKP$TQP\GYCTGP\WO8GTMCWHCP/KVINKGFGTIGFCEJVFKGKJTGVTGWG&KGPGTUEJCHVGJTGPYQNNVGP

233


LÜBECK

2935

2934

2934





$TQP\GOGFCKNNG Q , IGUVKHVGV   XQP * *0CVJCP0GWGT9CNN*CODWTI'JTGPFGPM OÒP\GHÒT8GTFKGPUVGWO*CPFGNWPF8GTMGJTIGUVKHVGVXQPFGT*CPFGNUMCOOGTCPN·­NKEJFGTDGXQTUVG JGPFGP #OVU,WDGNHGKGT FGU 1DGTRQUVFKTGMVQTU .KPIPCW 8KGTHGNFKIGU 9CRRGP WOJGT 5EJTKHVDCPF OKV   FGT #WHUEJTKHV º &+' *#0&'.5-#//'4 <7 .7'$'%- CW­GP 'KEJGPMTCP\ DGNGIV OKV FGP   9CRRGP FGT CNVGP .ÒDGEMGT -CWHOCPPUMQNNGIKGP UQYKG FGT )GYCPFUEJPGKFGT WPF FGT -T·OGT  -QORCIPKG+0  #00'4-'0070)  &'5 8'4&+'056'5  7/ *#0&'. 70&  8'4-'*4   WOJGT'KEJGPMTCP\OOI$GJTGPU FQTVKP)QNFWPF5KNDGT 4ÌJN  2TCEJVGZGORNCT(CUV5VGORGNINCP\



$TQP\GOGFCKNNGWPUKIPKGTVCWHFKG,CJTHGKGTFGU8GTGKPUHÒT*CPFGNUIGJKNHGPKP.ÒDGEM9CR RGP OKV /GTMWTUVCD WPF 5GIGNUEJKHH8KGT <GKNGP 5EJTKHV WOJGT 'KEJGPMTCP\  OO  I   4ÌJN 8QT\ÒINKEJp5VGORGNINCP\



2937







234

ex 2936

ex 2938

5KNDGTOGFCKNNG  XQP 1 $GTIOCP *CODWTI CWH FGP  &GWVUEJGP /CNGT$WPFGUVCI KP .ÒDGEM   )GMTÌPVGT 9CRRGPUEJKNF OKV 4GKEJUCFNGT WOJGT 'KEJGPMTCP\5VCFVIÌVVKP UKV\V X X OKV.QTDGGTMTCP\ KP FGT4GEJVGPWPF9CRRGPUEJKNFKPFGT.KPMGP\WFGP5GKVGPUVGJVNGKP)GPKWUOKV$KNFWPFTGKP )GPKWU OKV GKPGT (CTDRCNGVVGOOI&C\WGKPYGKVGTGU'ZGORNCTKP$TQP\GOO I4ÌJN Z  5VÒEM(CUV5VGORGNINCP\



$TQP\GOGFCKNNGQ, IGRWP\V XQP9/G[GT5VWVVICTV2T·OKGFGU8GTGKPUHÒT)GHNÒIGN\WEJV XGTNKGJGP HÒT XGTFKGPUVXQNNG .GKUVWPIGP &QRRGNCFNGT CWH FGT $TWUV 5VCFVYCRRGP(ª4  8'4   &+'05681..'  .'+5670)'0  #7( &'/ )'$+'6'  & )'(.ª)'.<7%*6  º WOJGT 'K   EJGPMTCP\OKV5EJNGKHGCWHFGT5EJNGKHGFKG2WP\GOOI4ÌJN 8QT\ÒINKEJ



5KNDGTOGFCKNNG Q , ITCXKGTV   XQP 9 /G[GT 5VWVVICTV 2T·OKG FGU )CTVGPDCWXGTGKPU .ÒDGEM   &QRRGNCFNGTCWHFGT$TWUV5VCFVYCRRGP)TCXWTWOJGT-TCP\CWU$NWOGPWPF(TÒEJVGPOO I&C\WGKPYGKVGTGU'ZGORNCTKP$TQP\GOKVNGGTGO(GNFHÒTGKPG)TCXWTOOI 4ÌJN Z  5VÒEM8QT\ÒINKEJ




LÜBECK

ex 2939

ex 2940

ex 2941



5KNDGTOGFCKNNGQ, CD 9GTMUVCVV).QQU2T·OKGHÒT6TGWGKO&KGPUVIGUVKHVGVXQO5GPCVFGT 5VCFV $GJGNOVGU 9CRRGP.GGTGU (GNF HÒT GKPG )TCXWT WOJGT 'KEJGPMTCP\OOI'KP \YGKVGU'ZGORNCTKP5KNDGTOKV)TCXWTCWHFGT4ÒEMUGKVG&'/-4'+55)'4'&)'1*'+0' .7&1.($'%-/#00(ª464'7'+/&+'056'/4<OOI&C\W GKP FTKVVGU 'ZGORNCT KP <KPM DTQP\KGTV OKV )TCXWT CWH FGT 4ÒEMUGKVG &'/  /'%*#0+-'4  ,1   *#00'5 .#7&10  (ª4 64'7' +/  &+'056'   ('$47#4    OO  I   4ÌJN Z  5VÒEM8QT\ÒINKEJ





5KNDGTOGFCKNNG  XQP 1 $GTIOCPP CWH FCU  #NNIGOGKPG &GWVUEJG %QTRU%QOOGTU KP .ÒDGEM   CO  1MVQDGT *QNUVGPVQT FCTÒDGT 5VCFVYCRRGP$GJGNOVGT 5EJKNF OKV <KTMGN XQT IGMTGW\VGP   5EJN·IGTP  OO  I &C\W GKP YGKVGTGU VTCIDCTGU 'ZGORNCT KP <KPP  OO  I   4ÌJN FQTVPWTKP<KPP  5VÒEM8QT\ÒINKEJ





5KNDGTOGFCKNNG  WPUKIPKGTV 2T·OKG FGT &GWVUEJ0QTFKUEJGP *CPFGNUWPF +PFWUVTKGCWUUVGNNWPI KP   .ÒDGEM 'KPICPIUVQT \WO #WUUVGNNWPIUIGN·PFG KO *KPVGTITWPF 5VCFVCPUKEJV5VCFVIÌVVKP UVGJV PCEJ T   OKV.QTDGGT\YGKIKPFGT.KPMGP\WFGP5GKVGP/CUEJKPGPWPF5GIGNUEJKHHKO8QTFGTITWPF5EJTKHVVCHGN OKV FGT #WHUEJTKHV (ÒT  JGTXQTTCIGPFG .GKUVWPI WOJGT &TGKRC­  OO  I &C\W GKP   \YGKVGU 'ZGORNCT KP 5KNDGT XGTIQNFGV OKV 4CPFRWP\G 5+.$'4  ('+0  OO  I 4ÌJN    Z  5VÒEM'UYWTFGP'ZGORNCTGKP5KNDGT WPF'ZGORNCTGKP5KNDGTXGTIQNFGVIGRT·IV8QT\ÒINKEJ



'ZGORNCTFGT5COONWPI&T&KGVGT&WOONGT#WMVKQP(TKV\4WFQNH-ÒPMGT/·T\ 0T 

ex 2942



5KNDGTOGFCKNNGQ, IGUVKHVGV WPUKIPKGTV5VCCVURTGKUHÒTJGTXQTTCIGPFG.GKUVWPIGPIGUVKHVGVXQO 5GPCVCPN·­NKEJFGT&GWVUEJ0QTFKUEJGP*CPFGNUWPF+PFWUVTKGCWUUVGNNWPIXQO,WNK5GRVGODGT &QRRGNCFNGTOKV5VCFVYCRRGPCWHFGT$TWUV5EJTKHVVCHGNOKV\YGK<GKNGP5EJTKHVWOJGT.QTDGGT\YGKIG WPF 4CPMGPQDGPDQIKI56##6524'+5OOI&C\WGKPYGKVGTGU'ZGORNCTKPXGTUKN DGTVGT$TQP\GKP$TQP\GWPFKP/GUUKPI$GJTGPU ZFQTVPWTKP5KNDGT 4ÌJN Z/CVG TKCN/GUUKPIHGJNV  5VÒEM8QT\ÒINKEJ

 235


LÜBECK

2943



2944

2947

6TCIDCTG 5KNDGTOGFCKNNG Q ,   XQP , X .CPIC CWH FCU L·JTKIG /CWTGTLWDKN·WO FGU 'JTGP   ITQ­OGKUVGTU %CTN (TKGFTKEJ 9GJTOCPP FGT .QIG \WT 9GNVMWIGN KP .ÒDGEM IGRT·IV XQP FGT )TQ­GP   .QIG KP *CODWTI $TWUVDKNF FGU $TWFGTU 9GJTOCPP N&CU 9CRRGP FGT )TQ­GP .QIG KP *CODWTI   WOJGT.QTDGGT\YGKIGOOI*<%4ÌJN 448QT\ÒINKEJ



%CTN (TKGFTKEJ 9GJTOCPP YWTFG CO  ,CPWCT KP.ÒDGEMIGDQTGPUVWFKGTVG6JGQNQIKGKP,GPCWPFYCTDKU .GKVGTFGT'TPGUVKPGPUEJWNGKP.ÒDGEM&KGUG5VGNNWPIICDGTCWHCNUFGT5GPCVKJP\WO5VCCVUCTEJKXCT GTPCPPVG 0CEJ FGT )TÒPFWPI FGU *CPUGCVKUEJGP )GUEJKEJVUXGTGKPU GTYGKVGTVG GT UGKPG 6·VKIMGKV WPF UGKPG   (QTUEJWPIGP OCEJVGP KJP DCNF \W GKPGO JQEJIGGJTVGP -GPPGT FGT )GUEJKEJVG FGU *CPUCDWPFGU WPF FKG   7PKXGTUKV·VGP)ÌVVKPIGPWPF4QUVQEMGTVGKNVGPKJOFKG&QMVQTYÒTFG'TUVCTDCO5GRVGODGTYQTCWHUQICT FGT5GPCVFKG(NCIIGPFGU4CVJCWUGUCWH*CNDOCUVJKUUVGWPFFKG$GKUGV\WPIGTHQNIVGOKVÌHHGPVNKEJGP'JTGP&GT .ÒDGEMGT .QIG \WT 9GNVMWIGN VTCV 9GJTOCPP DGTGKVU CO  /·T\  DGK YWTFG 5EJTKHVHÒJTGT  \WO   FGRWVKGTVGPWPF\WOXQTUKV\GPFGP/GKUVGTIGY·JNV$GKUGKPGO4ÒEMVTKVVXQPFKGUGO#OVYWTFGKJOKO,CJT FKG9ÒTFGGKPGU#NVWPF'JTGPOGKUVGTUGTVGKNV'TYCTDKU\WUGKPGO6QFFGT8QTUKV\GPFGFGU)GUEJKEJVNKEJGP 8GTGKPUFGT.QIG$GKFGT(GKGT\WOL·JTKIGP)GDWTVUVCIXQP(TKGFTKEJ.WFYKI5EJTÌFGTYWTFG9GJTOCPP\WO 'JTGPITQ­OGKUVGT FGT )TQ­GP .QIG XQP *CODWTI GKPUVKOOKI IGY·JNV GKPG #WU\GKEJPWPI FKG \WO GTUVGP /CN   GKPGOPKEJVCO5KV\GFGT)TQ­GP.QIGYQJPJCHVGP$TWFGT\WVGKNYWTFG#O/·T\YWTFGKP.ÒDGEMFCU L·JTKIG/CWTGTLWDKN·WOFGU$TWFGTU9GJTOCPPIGHGKGTV<WO#PFGPMGPCPFGPWOFKG5CEJGFGT(TGKOCWTGTGK JQEJXGTFKGPVGP $TWFGT WPF KO 'KPXGTUV·PFPKU OKV FGT .QIG \WT 9GNVMWIGN .ÒDGEM NKG­ FKG )TQ­G .QIG XQP   *CODWTIFKGXQTNKGIGPFG/GFCKNNGRT·IGP



$TQP\GOGFCKNNGQ,  XQP#(-ÌPKI9GTMUVCVV.QQU'JTGPFGPMOÒP\GHÒT#PGTMGPPWPI XQP8GTFKGPUVGP'KP\GNPGTJGTCWUIGIGDGPXQO5GPCV.WDGECUVGJVXXCPGKPG5·WNGIGNGJPVKPFGT .KPMGP (CUEGU KP FGT 4GEJVGP .QTDGGTMTCP\ KO *KPVGTITWPF #PMGT WPF 2TQTC KO #DUEJPKVV $'0'   /'4'06+$GJGNOVGU 5VCFVYCRRGP WOJGT #TCDGUMGP WPF 5'0#685  4'+8$.+%#'  .8$'%'0   5+5OOI$GJTGPUXIN4ÌJN 8QT\ÒINKEJ



&KG XQTNKGIGPFG /GFCKNNG KUV DGTGKVU  XQO 5GPCV DGYKNNKIV YQTFGP 5VÒEMG KP $TQP\G YWTFGP KP FGT <GKV XQP    JGTCWUIGIGDGP WPF MQPPVGP UR·VGT KP IQNFGPG WOIGVCWUEJV YGTFGP 8GTNGKJWPIGP FKGUGT 8GTFKGPUV   OGFCKNNGPHKPFGPDKUJGWVGUVCVV

.165.ª$'%- 

&KXGTUG.ÒDGEMGT*QJNRHGPPKIGWPF5EJGTHGFGU,CJTJWPFGTVU&C\WXKGT-NGKPOÒP\GP  5VÒEM)GTKPIGTJCNVGPpUEJÌP



7OHCPITGKEJG 5COONWPI XQP /GFCKNNGP /CTMGP #PUVGEMPCFGNP WPF #WU\GKEJPWPIGP FGU    ,CJTJWPFGTVU*QEJKPVGTGUUCPVGU1DLGMVDKVVGDGUKEJVKIGP 5VÒEM5GJTUEJÌPpXQT\ÒINKEJ



5GFKUXCMCP\4GKEJUVCNGTOKV6KVGN-CTNU8+$GJTGPU&CX<GRGTPKEM  /KPRQTÌUGT5EJTÌVNKPIUGJTUEJÌPpXQT\ÒINKEJ

 

$+567/.ª$'%-

236




MAINZ

2948 2951

2950

2949

'4<$+567/

/#)&'$74)



9KEJOCPP XQP 5GGDWTI  $TCMVGCV  I 5V /QTKV\UVGJVXXOKV5EJYGTVWPF(CJPG \YKUEJGP\YGK6ÒTOGPN-NGGDNCVVT5VGTPWOJGT8KGTRC­$GTIGT5NI*CWUYCNFV  5GJTUEJÌP





#NDTGEJV+8XQP$TCPFGPDWTI)TQUEJGP/CIFGDWTI<YKVVGTRT·IWPIOKVFGT ,CJTGU\CJNCWHFGT8QTFGTUGKVGWPFFGTCDIGMÒT\VGP,CJTGU\CJNCWHFGT4ÒEMUGKVGX5EJT 5GJTUEJÌP





%JTKUVKCP9KNJGNOXQP$TCPFGPDWTI4GKEJUVCNGTQ,*CNNG&CXX5EJT  45GJTUEJÌP





#WIWUVXQP5CEJUGP9GKUUGPHGNU6CNGT*CNNG&CX$#X5EJT  #VVTCMVKXGUXQT\ÒINKEJGU'ZGORNCT



2952

1,5:1

'4<$+567/ 

1,5:1

/#+0<

(TKGFTKEJ -CTN ,QUGRJ XQP 'TVJCN  -QPX6CNGT Q ,   /CKP\ 5VGORGNMQRRNWPI   IGRT·IV OKV FGO 8QTFGTUGKVGPUVGORGN FGU -QPX6CNGTU XQP  WPF WPF FGO 4ÒEMUGKVGPUVGORGN FGU   -QPX6CNGTUXQPCWHFGP'PVUCV\FGTXQPFGP(TCP\QUGPDGNCIGTVGP5VCFVFWTEJFGPMCKUGTNKEJGP (GNFOCTUEJCNN)TCH%NGTHC[VI$TWUVDKNFTKPIGKUVNKEJGO1TPCV2[TCOKFGOKV-TKGIUVTQRJ·GP FCTCWH9GNVMWIGN\YKUEJGP.QTDGGT\YGKIGP&CX$5NI9CNVJGT  8QPITÌ­VGT5GNVGPJGKV-CDKPGVVUVÒEM2TCEJVXQNNG2CVKPCHCUV5VGORGNINCP\  237


MANSFELD

2953 2954

2954

/#05('.&

/#05('.&$14056'&6)4#(5%*#(6 

(TCP\/CZKOKNKCPWPF*GKPTKEJ(TCP\6CNGT )TQUEJGP 'KUNGDGP6QTPCWDK *ÒDUEJG2CVKPCNGKEJVG2T·IGUEJY·EJGXQT\ÒINKEJ



/#05('.&'+5.'$'0)4#(5%*#(6 

,QJCPP)GQTI+%JTKUVQRJ++WPF,QJCPP'TPUV4GKEJUVCNGTQ,'KUNGDGP&CX 6QTPCWF *ÒDUEJG2CVKPCUGJTUEJÌP

2955

2957



2956

/#05('.&(4+'&'$74))4#(5%*#(6 

2GVGT 'TPUV + $TWPQ ++ )GDJCTF 8+++ WPF ,QJCPP )GQTI +8  4GKEJUVCNGT    'KUNGDGP&CX6QTPCWC 5GJTUEJÌP





4GKEJUVCNGT'KUNGDGP&CX6QTPCWE

*ÒDUEJG2CVKPCUGJTUEJÌP





4GKEJUVCNGT'KUNGDGP6QTPCWC  5GNVGPKPFKGUGT'TJCNVWPI*GTTNKEJG2CVKPCXQT\ÒINKEJGU'ZGORNCT



2958

 238

/#05('.&#46'40)4#(5%*#(6

2JKNKRR'TPUV4GKEJUVCNGT'KUNGDGP&CX6QTPCWG

5GJTUEJÌP




MÜNCHEN

2960

2959

2959

/#05('.&*+06'4146+5%*'.+0+')4#(5%*#(6 

%JTKUVKCP(TKGFTKEJ4GKEJUVCNGT'KUNGDGP6QTPCWF  5GJTCVVCMVKXGU'ZGORNCTOKVJÒDUEJGT2CVKPCXQT\ÒINKEJ

/#45$'4)

56#&6 



6CNGT )TQUEJGP OKV6KVGN4WFQNHU++5VCFGNOCKGT

(GKPG2CVKPCUGJTUEJÌP



/'%-.'0$74) /'%-.'0$74)(ª456'067/5'+6*'4<1)67/ 

#NDTGEJV8++.QV6CNGT)CFGDWUEJ Z &CX Z -WP\GN#C%C 6CNGT NGKEJVGT)WNFGP )CFGDWUEJ-WP\GN#C FQTVCNUJCNDGT)WNFGPDG\GKEJPGV   5VÒEM(CUUWPIUURWTGP-TCV\GTUGJTUEJÌP

2962





2963

/'%-.'0$74))ª56419*'4<1)67/

,QJCPP #NDTGEJV ++  -KRRGT 5EJKNNKPI Q , $QK\GPDWTI QFGT )PQKGP OKV 6KVGN XQP   /CVVJKCU-WP\GN)D5NI-TCC\XCT 4-N2T·IGUEJY·EJGXQT\ÒINKEJp5VGORGNINCP\



/'%-.'0$74)564'.+6<*'4<1)67/5'+6)4155*'4<1)67/ 

#FQNH(TKGFTKEJ+86CNGT0GWUVTGNKV\-WP\GN#C





/'//+0)'0

2TCIGT )TQUEJGP Q , FGU DÌJOKUEJGP -ÌPKIU 9GP\GN +++ +8   OKV )GIGPUVGORGN XQP   /GOOKPIGPCWHFGT8QTFGTUGKVG)QVKUEJGU/-TWU[/  )GIGPUVGORGNUGJTUEJÌP/ÒP\GHCUVUGJTUEJÌP

56#&6



2965

2964

56#&6

5GJTUEJÌP



/ª0%*'0

2TCIGT )TQUEJGP Q , FGU DÌJOKUEJGP -ÌPKIU 9GP\GN +++ +8   OKV )GIGPUVGORGN XQP   /ÒPEJGPCWHFGT4ÒEMUGKVG/ÌPEJUMQRHOKV)WIGNWPF-TGW\PCEJN-TWU[/  )GIGPUVGORGNUGJTUEJÌP/ÒP\GHCUVUGJTUEJÌP

 239


MÜNSTER

2966

$+567/ 

/ª056'4

%JTKUVQRJ$GTPJCTFXQP)CNGP$TGKVGT4GKEJUVCNGT/ÒPUVGTCWHFKG'KPPCJOGFGT 5VCFV&CX&GVJNGHU%I5EJWN\GFNGKEJVXCT 5GJTUEJÌP



2967



%NGOGPU #WIWUV XQP $C[GTP  5KNDGTOGFCKNNG  XQP ) 9 8GUVPGT CWH FGP GTUVGP   5RCVGPUVKEJ \WO -CPCNDCW \YKUEJGP /ÒPUVGT WPF <YQNNG $TWUVDKNF T KP IGKUVNKEJGO 1TPCV/KPGTXC   UVGJVPCEJTOKV5RCVGPWPF(ÒNNJQTPTXQTKJTGKP9CTGPDCNNGPOKV/GTMWTUVCDOOI $GTPJGKOGT9KVV 4*ÒDUEJG2CVKPCXQT\ÒINKEJ  $KUEJQH %NGOGPU #WIWUV VCV WPVGT HGKGTNKEJGO #WHYCPF CO  /CK  FGP GTUVGP 5RCVGPUVKEJ HÒT FGP /CZ   %NGOGPU5EJKHHCJTVUMCPCNXQP/ÒPUVGTPCEJ<YQNNGOKVGKPGOUKNDGTPGP5RCVGP/CPJCVVGUKEJLGFQEJÒDGTJCWRV PKEJV OKV FGT PKGFGTN·PFKUEJGP 5GKVG ÒDGT FGP $CW FGU -CPCNU XGTUV·PFKIV &C KP 1XGTKLUUGN CP FGO 2TQLGMV MGKP   +PVGTGUUGDGUVCPFYWTFGFGT9CUUGTYGIPWTGVYCMODKU-NGOGPUJCHGPDGK4JGKPGIGDCWVYQGTCNU5CEMICUUG GPFGVG&CU6GKNUVÒEMCWHFGOGUPWTDGUEJGKFGPGP5EJKHHUXGTMGJTIGDGPUQNNVGYWTFGGTÌHHPGV

2968



240

5GFKUXCMCP\  5KNDGTOGFCKNNG  XQP , 6JKGDCWF 5V 2CWNWU UVGJV HCUV X X OKV 5EJYGTV WPF   $WEJ WOJGT 9CRRGPMTCP\-CTN FGT )TQ­G UVGJV X X OKV 5EJYGTV WPF 4GKEJUCRHGN WOJGT 9CRRGP   MTCP\OOI5EJWN\G<GRGTPKEM *ÒDUEJG2CVKPCUGJTUEJÌPpXQT\ÒINKEJ




MÜNSTER

2969

&'49'56(.+5%*'(4+'&'0810/ª056'470&150#$4ª%- 

(TCPMTGKEJ .QWKU :+8  5KNDGTOGFCKNNG  XQP , /CWIGT WPF , .G $NCPE CWH FGP   (TKGFGP\YKUEJGP(TCPMTGKEJWPFFGOFGWVUEJGP4GKEJKP<WUCOOGPJCPIOKVFGO9GUVH·NKUEJGP(TKGFGP $ÒUVGT$GJGNOVG)GTOCPKCUVGJVPCEJNWPFUVÒV\VUKEJOKVKJTGT.KPMGPCWHGKPGP(TKGFGPUCNVCTCP FGO GKP /GTMWTUVCD \YKUEJGP \YGK 9CCIUEJCNGP CPIGDTCEJV KUV CO $QFGP NKGIV GKP 5EJKNF OKV FGO   MCKUGTNKEJGP&QRRGNCFNGTWPFGKP,QEJOOI&GVJ1TF&KXQp2CZKP0WOOKU 4*ÒDUEJG2CVKPCUGJTUEJÌPpXQT\ÒINKEJ



2970



/ÒPUVGT 5VCFV 5KNDGTOGFCKNNG  WPUKIPKGTV XQP ' -GVVGNGT CWH FGP 5RCPKUEJ0KGFGTN·PFKUEJGP   (TKGFGPKP/ÒPUVGTCO,CPWCT2CZTKPGKPGO5QPPGPYCIGPFGTXQP\YGK.ÌYGPIG\QIGPYKTF 0GWP<GKNGP5EJTKHVOOI&GVJ1TF2CZKP0WOOKU  *GTTNKEJG2CVKPCHGKPGT2T·IGINCP\XQT\ÒINKEJGU'ZGORNCT



2971



5KNDGTOGFCKNNG  XQP ' -GVVGNGT CWH FGP 9GUVH·NKUEJGP (TKGFGP XQP /ÒPUVGT WPF 1UPCDTÒEM CO    1MVQDGT  PCEJ ITGIQTKCPKUEJGO -CNGPFGT CO  1MVQDGT   'PIGN OKV 2CNO\YGKI WPF   2QUCWPGCWUFGT2#:GTVÌPVWPF'PIGNOKV.QTDGGT\YGKIWPF-TCP\ÒDGT5VCFVCPUKEJVXQP/ÒPUVGT <YGKCWU9QNMGPMQOOGPFGKPGKPCPFGTITGKHGPFG*·PFGFCJKPVGT\YGK(ÒNNJÌTPGTWPF.QTDGGT\YGKI FCTÒDGTUVTCJNGPFGT0COG,GJQXCUOOI&GVJ1TF2CZKP0WOOKU  (GKPG2CVKPCUGJTUEJÌPpXQT\ÒINKEJ



5GKV #PHCPI  VTCHGP UKEJ )GUCPFVG CNNGT MTKGIUHÒJTGPFGP 2CTVGKGP KP FGP YGUVH·NKUEJGP 5V·FVGP /ÒPUVGT WPF   1UPCDTÒEM\W(TKGFGPUXGTJCPFNWPIGPYQDGKKP1UPCDTÒEMFGT-CKUGTFKGKPFKGMCVJQNKUEJGPWPFRTQVGUVCPVKUEJGP .CIGTIGJÌTGPFGP4GKEJUUV·PFGUQYKG5EJYGFGPWPFKP/ÒPUVGTFGT-CKUGT(TCPMTGKEJWPFFKGÒDTKIGPCO-TKGI DGVGKNKIVGP/·EJVGXGTJCPFGNVGP(TCPMTGKEJWPF5EJYGFGPJCVVGPDGTGKVUDGUEJNQUUGPPWTIGOGKPUCO(TKGFGP \WUEJNKG­GP#WHUEJYGFKUEJGT5GKVGYWTFGPFKG8GTJCPFNWPIGPXQP#FNGT5CNXKWUWPF,QJCP1ZGPUVKGTPC FGT5QJP FGUUEJYGFKUEJGP4GKEJUMCP\NGTU#ZGN1ZGPUVKGTPC IGNGKVGV0CEJFTGKGKPJCND,CJTGPYWTFGFGT9GUVH·NKUEJG(TKGFGP GPFNKEJ CO  1MVQDGT  KP /ÒPUVGT WPF 1UPCDTÒEM WPVGT\GKEJPGV 5EJYGFGP GTJKGNV 8QTRQOOGTP OKV FGP   +PUGNP 4ÒIGP 7UGFQO WPF 9QNNKP6GKNGXQP*KPVGTRQOOGTP9KUOCTFCUCWUFGO'T\DKUVWO$TGOGPIGDKNFGVG *GT\QIVWO $TGOGP WPF 8GTFGP UQYKG GKPG -TKGIUGPVUEJ·FKIWPI XQP  /KNNKQPGP 4GKEJUVCNGTP #O  ,WPK    YWTFGFKGMQPMTGVG7OUGV\WPIFGT(TKGFGPUDGUVKOOWPIGPKO(TKGFGPUGZGMWVKQPUTG\G­XQP0ÒTPDGTIDGUEJNQUUGP

241


NÖRDLINGEN

2972

2973

2973





5KNDGTOGFCKNNGXQP,6JKGDCWFCWHFKG,CJTHGKGTFGU9GUVH·NKUEJGP(TKGFGPU)GTOCPKCUKV\V PCEJN\YKUEJGP#TOCVWTGPKPFGT.KPMGPJ·NVUKGGKP<GRVGTOKVFGT4GEJVGPYGKUVUKGCWHFKG5VCFVCP UKEJV XQP/ÒPUVGTKO*KPVGTITWPFNUVTCJNGPFG5QPPG)GPKWUOKVR[TIGUEJOÒEMVGT/CWGTMTQPGIGJV PCEJNXQTKJOGKP9CIGPOKV9CTGPDCNNGPWPFGKP2HNWIKO*KPVGTITWPF5VCFVCPUKEJVXQP#WIUDWTI QDGPUVTCJNGPFG5QPPGOKV)GUKEJVOOI&GVJ1TF(QTUVGT2CZKP0WOOKU 48QT\ÒINKEJ 0KGFGTNCPFG 5KNDGTOGFCKNNG  XQP 5 &CFNGT CWH FGP URCPKUEJPKGFGTN·PFKUEJGP (TKGFGP WPF FKG   (TGKJGKVFGTUKGDGPPÌTFNKEJGP2TQXKP\GPFGT0KGFGTNCPFG+PGKPGO-TCP\CWU¤N\YGKIGPVCP\GPUKGDGP MQP\GPVTKUEJCPIGQTFPGVGYGKDNKEJG)GUVCNVGPCPFGP*·PFGPJCNVGPUKGCP$·PFGTPFKGUKGDGP9CRRGP FGT 2TQXKP\GP FKG OKV GKPGT )KTNCPFG XGTDWPFGPGP UKPF KO <GPVTWO GKP (TGKJGKVUJWV<GJP <GKNGP   5EJTKHVKP-TCP\OOI&GVJ1TF/CW¾2CZKP0WOOKUX.QQP++5 4CPFÒDGTCTDGKVGVUGJTUEJÌPpXQT\ÒINKEJ

2974

56#&6 

2976



2977

0'756#&6#0&'4#+5%*

2TCIGT )TQUEJGP Q , FGU DÌJOKUEJGP -ÌPKIU 9GP\GN +++ +8   OKV )GIGPUVGORGN XQP   0GWUVCFVCWHFGT4ÒEMUGKVG)QVKUEJGU0-TWU[0 )GIGPUVGORGNHCUVUGJTUEJÌP/ÒP\GUEJÌP

4'+%*5/ª0<5666' 

2975





0¤4&.+0)'0

-CTN8XQP*CDUDWTI-ÌPKI-CKUGT2HCPFKPJCDGT'DGTJCTFXQP'RRUVGKP -ÌPKIUVGKP-TGW\GT*GT\HGNFGTC5EJWNVGP  44#VVTCMVKXGUUGJTUEJÌPGU'ZGORNCTOKVHGKPGT6ÌPWPI



56#&6  

242

2TCIGT )TQUEJGP Q , FGU DÌJOKUEJGP -ÌPKIU 9GP\GN +++ +8   OKV )GIGPUVGORGN XQP   0ÌTFNKPIGPCWHFGT8QTFGTUGKVG)GMTÌPVGT#FNGT-TWU[0  )GIGPUVGORGNUGJTUEJÌPpXQT\ÒINKEJ/ÒP\GHCUVUGJTUEJÌP 2TCIGT )TQUEJGP Q , FGU DÌJOKUEJGP -ÌPKIU 9GP\GN +++ +8   OKV )GIGPUVGORGN XQP   0ÌTFNKPIGP CWH FGT 8QTFGTUGKVG )GMTÌPVGT #FNGT &CTÒDGT )GIGPUVGORGN XQP 7NO 5VCFVYCRRGP IG   VGKNVGTURCPKUEJGT5EJKNF -TWU[0WPF7 )GIGPUVGORGNUGJTUEJÌP/ÒP\GUEJÌP

 


NÜRNBERG

2979

2978



2TCIGT )TQUEJGP Q , FGU DÌJOKUEJGP -ÌPKIU 9GP\GN +++ +8   OKV )GIGPUVGORGN XQP   0ÌTFNKPIGPCWHFGT8QTFGTUGKVG)GMTÌPVGT#FNGT-TWU[0 )GIGPUVGORGNUEJÌP/ÒP\GUEJÌP





2TCIGT )TQUEJGP Q , FGU DÌJOKUEJGP -ÌPKIU 9GP\GN +++ +8   OKV )GIGPUVGORGN XQP   0ÌTFNKPIGPCWHFGT4ÒEMUGKVG)GMTÌPVGT#FNGT-TWU[0  )GIGPUVGORGNHCUVUGJTUEJÌP/ÒP\GHCUVUGJTUEJÌP



0146*'+/

.160146*'+/ 

-NGKPG5COONWPIXQP/ÒP\GPFGT5VCFV0QTVJGKOFGU,CJTJWPFGTVUXQO&TGKGTDKU\WO/CTKGP ITQUEJGP&C\W0QVOÒP\GPFGU<GKVTCWOU+PVGTGUUCPVGU1DLGMVDKVVGDGUKEJVKIGP  5VÒEM/GKUVUGJTUEJÌP

2982

2981



2983

0ª40$'4)

4'+%*5/ª0<5666' 



-QPTCF +++  2HGPPKI  I $TWUVDKNF FGU -ÌPKIU X X OKV FGT JGKNKIGP .CP\G WPF   4GKEJUCRHGN-KTEJGPIGD·WFGOKV\YGK6ÒTOGPWPFITQ­GO-TGW\ÒDGTFGO2QTVCN'TNCPIGT  4+P6GKNGPUEJYCEJCWUIGRT·IVWPFFG\GPVTKGTVHCUVUGJTUEJÌP



(TKGFTKEJ+2HGPPKIQ, WO I4QUGOKV5VKGNQFGT-QOGVOKV5EJYGKH KO 2GTNMTGKU WOIGDGP XQP 8KGTRCUU OKV 8GT\KGTWPIGP JGDT·KUEJG $WEJUVCDGP QFGT 5VGTPDKNFGT!    6JTQPGPFGT*GTTUEJGTXXOKV.KNKGP\GRVGTWPF4GKEJUCRHGNKO(GNFFGT$WEJUVCDG$'TNCPIGT  4ªDNKEJG2T·IGUEJY·EJGUQPUVUGJTUEJÌPGU'ZGORNCT



9 *CJP HCXQTKUKGTVG GKPG CUVTQNQIKUEJG &CTUVGNNWPI CWH FGT 8QTFGTUGKVG HÒT FKG GU HÒT FGP 5GRVGODGT FGU ,CJTGU   UQICTJKUVQTKUEJG$GNGIG WCFGPUQIGPCPPVGP#UVTQNQIGPDTKGHFGU/GKUVGTU,QJCPPGUXQP6QNGFQ IKDV+P FGP XGTOGKPVNKEJGP JGDT·KUEJGP $WEJUVCDGP FGT 4CPFXGT\KGTWPI GTMGPPV GT GKPG /QPFUKEJGN WPF XGTUEJKGFGPG   5VGTPDKNFGT XIN*CJP9'KPKIG$GOGTMWPIGP\W0ÒTPDGTIGT/ÒP\V[RGPFGT5VCWHGT\GKVKP)05 



2HGPPKI  I -CKUGT VJTQPV X X OKV .KNKGP\GRVGT<YÌNHDN·VVTKIG 4QUGVVG KO 2GTNMTGKU CW­GP CEJV   .KNKGPKPYGNNGPHÌTOKIGT7OTCJOWPI'TNCPIGT  &WPMNG6ÌPWPIÒDNKEJG2T·IGUEJY·EJGHCUVUGJTUEJÌP

2984



2985



'KPUGKVKIGT 2HGPPKI Q , WO    I <GJPDN·VVTKIG 4QUGVVG KP 9WNUVTGKH CW­GP 0GWPRC­   OKV.KNKGP'TNCPIGT &WPMNG2CVKPCKP6GKNGPUEJYCEJCWUIGRT·IVUGJTUEJÌP





1VVQ+8QFGT(TKGFTKEJ++2HGPPKIQ, WO I)GMTÌPVGT #FNGT OKV IGURTGK\VGP (NÒIGNP FGP -QRH PCEJ T IGYCPFV-ÌPKI VJTQPV X X OKV 4GKEJUCRHGN WPF   .KNKGP\GRVGT'TNCPIGT +P6GKNGPUEJYCEJCWUIGRT·IVHCUVUGJTUEJÌPUEJÌP

 243


NÜRNBERG

2987

2986

2988

2990

2989



(TKGFTKEJ++2HGPPKIQ, WO I&WTEJDTQEJGPGU.KNKGPMTGW\KO9WNUV TGKH<YGKGKPCPFGT\WIGYCPFVG.ÌYGPFCTWPVGT#FNGT'TNCPIGT &WPMNG6ÌPWPIUGJTUEJÌP





2HGPPKI Q , WO    I 5RTKPIGPFGU 2HGTF PCEJ T FCTÒDGT .KNKG KO 9WNUVTGKH CW­GP   .KNKGPDQIGPTCPF<YGKGKPCPFGT\WIGYCPFVG.ÌYGPÒDGT-TGW\'TNCPIGT  'VYCUFG\GPVTKGTVUGJTUEJÌPHCUVUGJTUEJÌP



2HGPPKIQ, WO I<GJPDN·VVTKIG4QUGVVGKO2GTNMTGKUWPF9WNUVTGKHCW­GPXKGT$ÌIGP \YKUEJGP.KNKGP<YGKGKPCPFGT\WIGYCPFVG$TWUVDKNFGTFCTÒDGT\YGK#FNGTMÌRHGOKV(NÒIGNP ! CW­GP 2GTNMTGKUOKV.KNKGPDQIGPTCPF'TNCPIGT &WPMNG6ÌPWPIMPCRRGT5EJTÌVNKPIUGJTUEJÌP





*·NDNKPIQ, WO I.ÌYGUEJTGKVGVN$TWUVDKNFFGU-ÌPKIUXX'TNCPIGT  5GJTUEJÌPHCUVUGJTUEJÌP





2HGPPKI Q , WO    I )GMTÌPVGU $TWUVDKNF N OKV .KNKGP\GRVGT WPF 8QIGN)GMTÌPVGT   -ÌPKIUVGJVXXOKV(NÒIGNPFCTCWH\YGK#FNGTMÌRHG'TNCPIGT 5GJTUEJÌPHCUVUGJTUEJÌP





2991

2993

2992



2HGPPKI Q , WO    I 8KGTHÒ­KIGU 6KGT PCEJ N FGP -QRH TÒEMY·TVU IGYCPFV#FNGT   OKVCWUIGDTGKVGVGP5EJYKPIGPXXFGP-QRHPCEJTIGYCPFV'TNCPIGT 5GJTUEJÌP





#PQP[O  ,CJTJWPFGTV 2HGPPKI Q ,  I -TQPG ÒDGT .KNKGPQTPCOGPV 4CPF CWU 4KPIGNP   -TGW\OKVMTGW\HÌTOKIGP'PFGPCWHFGP#TOGPWPFKPFGT/KVVGLGGKP4KPIGNKPFGP9KPMGNPLGGKP IGMTÌPVGT-QRHXX'TNCPIGTp 5GJTUEJÌPUEJÌP



&KG <WYGKUWPI FGU XQTNKGIGPFGP 6[RU KUV PKEJV \YGKHGNUHTGK IGUKEJGTV 9 *CJP HCXQTKUKGTVG CWHITWPF FGT GKPGO   0ÒTPDGTIGT 2HGPPKI XGTYCPFVGP 4ÒEMUGKVGPFCTUVGNNWPI GKPG 8GTQTVWPI KP FKGUG 4GKEJUOÒP\UV·VVG XIN *CJP 9   'KPKIG $GOGTMWPIGP \W 0ÒTPDGTIGT /ÒP\V[RGP FGT 5VCWHGT\GKV KP )0  5  UQYKG $N·VVGT HÒT   /ÒP\HTGWPFG6H% 



-CTN+8QFGT9GP\GN+8*GNNGTQ, WO 'TNCPIGTH

5GJTUEJÌP



2994 2995

2995

56#&6 

5KNDGTOGFCKNNGWPUKIPKGTVCWHFGP$CWFGT(NGKUEJDTÒEMG4GKEJUUEJKNFÒDGTFGPDGKFGP5VCFVYCR RGP FC\YKUEJGP <YGKIG WPVGP -CTVWUEJG OKV FTGK <GKNGP 5EJTKHV#PUKEJV FGT $TÒEMG FCTCWH GKP   2HGTFGIGURCPP WPF GKP $CWGT FGT GKPGP 1EJUGP \WO (NGKUEJJCWU HÒJTV WPVGP CWH FGT 2GIPKV\ \YGK   (KUEJGTKO-CJPOOI5NI'TNCPIGT FQTVKTTVÒONKEJQ,   5GJTUGNVGPDGUQPFGTUKPFKGUGT'TJCNVWPI2TCEJVGZGORNCT #WUFTWEMUXQNNG2CVKPCHCUV5VGORGNINCP\



4GKEJUVCNGTOKV6KVGN(GTFKPCPFU++&CX-GNNPGT



&KG(NGKUEJDTÒEMGKUVGKPG5VGKPDQIGPDTÒEMGFKGÒDGTFKG2GIPKV\HÒJTVWPFFKG$G\KTMG5V5GDCNFWPF5V.QTGP\ OKVGKPCPFGTXGTDKPFGV5KG\·JNV\WFGPDGFGWVGPFUVGP$TÒEMGPDCWYGTMGPFGTFGWVUEJGP5R·VTGPCKUUCPEG

 244

8QPITQ­GT5GNVGPJGKV5GJTUEJÌP


NÜRNBERG

2996

2997

2998



4GKEJUVCNGTOKV6KVGN(GTFKPCPFU++&CX-GNNPGT  9KP\<CKPGPFGUGJTUEJÌPpXQT\ÒINKEJ





4GKEJUVCNGT&CX-GNNPGT





5KNDGTOGFCKNNGXQP2)0ÒTPDGTIGTCWHFKG,CJTHGKGTFGT7PKXGTUKV·V#NVFQTH5VCFVYCRRGP WOJGT\YGK.QTDGGT\YGKIGWPFFKG9CRRGPOKV+PKVKCNGPFGT-WTCVQTGP)WUVCX)GQTI6GV\GN.GQPJCTF )TWPFJGTT *KGTQP[OWU 9KNJGNO 'DPGT WPF ,QJCPP %JTKUVQRJ +OJQH#PVKMGT #NVCT WOJGT .QTDGGT   MTCP\OOI.CXGTTGP\5NI'TNCPIGT  44(GKPG2CVKPCYKP\5EJTÌVNKPIUHGJNGTCVVTCMVKXGUXQT\ÒINKEJGU'ZGORNCT

5GJTUEJÌP



2999

1,5:1



1,5:1

4GKEJUVCNGTCWHFCU5VÒEMUEJKG­GP5VCFVYCRRGPWOJGTUGEJU2CVTK\KGTYCRRGPCWH.QTDGGTMTCP\ .CPFUEJCHV OKV XKGT -CPQPGP KO 8QTFGTITWPF FKG CWH GKPG 5EJGKDG UEJKG­GP +P 752NCUVKMJQNFGT FGT   0)%OKVFGT$GYGTVWPI/5&CX-GNNPGT  442TCEJVXQNNG2CVKPCMN5EJTÌVNKPIUHGJNGTCO4CPFXQT\ÒINKEJ 

.160ª40$'4) 

-NGKPGU-QPXQNWVXQP4GEJGPRHGPPKIGPXGTUEJKGFGPGT,CJTJWPFGTVG

5VÒEM5EJÌPpUGJTUEJÌP

 245


OSNABRÜCK

3001

3002

3003

¤66+0)'0)4#(5%*#(6

¤66+0)'0



.WFYKI :+ WPF (TKGFTKEJ +++  2HGPPKI Q , CWH 4GIGPUDWTIGT 5EJNCI .ÌHHGNJQN\    5VGKPJKNDGT 4(CUVUGJTUEJÌP





9QNHICPI+WPF,QCEJKO5EJKNNKPIQ,(DXCT

45GJTUEJÌP





-CTN9QNHICPI.WFYKI:8WPF/CTVKP<GJPGT.ÌHHGNJQN\#PO  4#VVTCMVKXG2CVKPCNGKEJVGT&QRRGNUEJNCIUGJTUEJÌP



3004



3005

6CNGTOKV6KVGN-CTNU8&CX.ÌHHGNJQN\HHXCT

5GJTUEJÌP



¤66+0)'09#..'456'+0)4#(5%*#(65'+6(ª456'067/ 

9QNHICPI6CNGT -TGW\GT #WIUDWTI&CX(QTUVGT.ÌHHGNJQN\  44#VVTCMVKXGU'ZGORNCTOKVJÒDUEJGT2CVKPCHCUVXQT\ÒINKEJ

3007

$+567/ 

3006



3008

150#$4ª%-

'TPUV #WIWUV + XQP $TCWPUEJYGKI.ÒPGDWTI   /CTKGPITQUEJGP  6CNGT     /GNNG + #TV /KV 4ÒEMUGKVGPWOUEJTKHV 5QNC DQPC SWCG JQPGUVC &CX  FQTV WPVGT $TCWP   UEJYGKIp.ÒPGDWTI -GPPGRQJNC9GNVGT 5GJTUEJÌPpXQT\ÒINKEJ





5GFKUXCMCP\4GKEJUVCNGT*CPPQXGT&CX#-GPPGRQJNC<GRGTPKEM  5GJTUEJÌP





5GFKUXCMCP\4GKEJUVCNGT%NCWUVJCN ! &CX-GPPGRQJN<GRGTPKEM  (GKPG2CVKPCUGJTUEJÌP



246


PADERBORN

3009

3010

3010

156(4+'5.#0& 156(4+'5.#0&)4#(5%*#(65'+6(ª456'067/ 

'PPQ +++   5VÒDGT Q , 'OFGP! /ÒP\OGKUVGT XGTOWVNKEJ ,CEQD 5VCNRGTV -CRRGNJQHH    5GJTUEJÌP





%JTKUVKCP'DGTJCTF5KNDGTOGFCKNNGXQP'$TCDCPFVCWHFGP6QFUGKPGT)GOCJNKP 'DGTJCTFKPG 5QRJKG XQP ¤VVKPIGP¤VVKPIGP 'KPG KPU /GGT HÒJTGPFG .CPF\WPIG FCTCWH GKP CDIGUVQT   DGPGTUQYKGGKPITÒPGPFGT$CWOPGDGPGKPGO(GNUGPFCJKPVGT5EJNQ­KO*KPVGTITWPFTWPVGTIGJGPFG 5QPPGQDGP9QNMGWPVGTGKPGOITQ­GP5VGTPFGTFGP9KVYGTU[ODQNKUKGTVFCTÒDGTMNGKPGTG5VGTPG FKG FKG -KPFGT XGTUKPPDKNFNKEJGP <GKNGP 5EJTKHV  OO  I -P[RJ  .ÌHHGNJQN\   5:8++ 4.GKEJVG$GCTDGKVWPIUURWTGPCO4CPFUGJTUEJÌP



3011

3012

$'0'&'-6+0'4#$6'+ 

1661$'74'0

5KNDGTOGFCKNNG  XQP , 6JKGDCWF CWH FKG  5·MWNCTHGKGT FGT #DVGK (ÒPH <GKNGP 5EJTKHV KP XGT   \KGTVGT -CTVWUEJG&KG #PUKEJV FGT #DVGK CWU FGT 8QIGNRGTURGMVKXG  OO  I (QTUVGT    -N4CPFHGJNGTXQT\ÒINKEJ

$+567/ 

3012



2#&'4$140

(TCP\#TPQNFXQP9QNHH/GVVGTPKEJ\WT)TCEJV4GKEJUVCNGT/ÒPUVGT&CX 5EJYGFG#C #VVTCMVKXGUHCUVXQT\ÒINKEJGU'ZGORNCT

 247


PFALZ

3013

3014

3014

2#22'0*'+/

)4#(5%*#(6 

(TKGFTKEJ(GTFKPCPF5KNDGTCDUEJNCIXQPFGP5VGORGNPFGU&WMCVGPCWHUGKPG*WNFK IWPI(DXIN5EJÌP 449KP\&TWEMUVGNNGXQT\ÒINKEJ

2#55#7

$+567/ 



,QJCPP2JKNKRRXQP.CODGTI4GKEJUVCNGT4GIGPUDWTI&CX-GNNPGT  5GJTUEJÌP



3016

3015



3015

5GFKUXCMCP\5KNDGTOGFCKNNGXQP,%JT$WUEJWPF,.1GZNGKP5V5VGRJCPUKV\VXXOKV $WEJ WPF -TWOOUVCD FCXQT FCU 9CRRGP FGU &QOMCRKVGNU *CPF OKV 5VGKP CWU -TQPG #PUKEJV FGT   5VCFV CWU FGT 8QIGNRGTURGMVKXG OKV FGP FTGK (NÒUUGP +PP &QPCW WPF +N\ WOJGT 9CRRGPMTCP\   OOI-GNNPGT<GRGTPKEM 49KP\4CPFHGJNGTHCUVXQT\ÒINKEJ



56#&6 

2TCIGT )TQUEJGP Q , FGU DÌJOKUEJGP -ÌPKIU 9GP\GN +++ +8   OKV )GIGPUVGORGN XQP   2CUUCWCWHFGT8QTFGTUGKVG$WEJUVCDG2-TWU[2 )GIGPUVGORGNUGJTUEJÌP/ÒP\GUEJÌP

3017

1$'42(#.<

3018

2(#.<



-CTN +8  2HGPPKI Q , CWH 4GIGPUDWTIGT 5EJNCI 0GWDÌJOKUEJG /ÒP\UV·VVG .CWH   5VGKPJKNDGTC 5GJTUEJÌP



2HGPPKIQ,CWH4GIGPUDWTIGT5EJNCI0GWDÌJOKUEJG/ÒP\UV·VVG.CWH5VGKPJKNDGTD

248



 45GJTUEJÌP

 


POMMERN

3019

3020



2HGPPKIQ,CWH4GIGPUDWTIGT5EJNCI0GWDÌJOKUEJG/ÒP\UV·VVG.CWH5VGKPJKNDGTC  4(CUVUGJTUEJÌP





9GP\GN+++2HGPPKIQ,CWH4GIGPUDWTIGT5EJNCI0GWDÌJOKUEJG/ÒP\UV·VVG'TNCPIGP 5VGKPJKNDGTC 45EJTÌVNKPIUTK­UQPUVUGJTUEJÌP





5COONWPIXQP/ÒP\GPWPF/GFCKNNGPFGU,CJTJWPFGTVUXQO2HGPPKIDKU\WO6CNGTFCTWPVGT UGNVGPG5VÒEMG&C\WGKPKIG0CEJRT·IWPIGPWPF0CEJIÒUUGFGU,CJTJWPFGTVU*QEJKPVGTGUUCPVGU .QVDKVVGDGUKEJVKIGP 5VÒEM'KPKIGOKVMN(GJNGTPUEJÌPpXQT\ÒINKEJ

.165

3023

3022

21//'40*'4<1)67/



3024

21//'40



$QIKUNCY :+8  4GKEJUVCNGT  /ÒP\UV·VVG YCJTUEJGKPNKEJ 5VGVVKP &CX  #   *KNFKUEJ *ÒDUEJG2CVKPCMN2T·IGUEJY·EJGHCUVUGJTUEJÌP



4GKEJUVCNGT  ,CJTGU\CJN KO 5VGORGN CWU  IG·PFGTV  /ÒP\UV·VVG YCJTUEJGKPNKEJ 5VGVVKP   &CX*KNFKUEJXCT 44*ÒDUEJG2CVKPCNGKEJVG2T·IGUEJY·EJGUGJTUEJÌP 



2JKNKRR++4GKEJUVCNGTQ,5VGVVKP&CX*KNFKUEJ  445GJTCVVTCMVKXGU'ZGORNCTOKVJGTTNKEJGT2CVKPCUGJTUEJÌP



21//'4056'66+0*'4<1)67/ 

3025

21//'4091.)#56*'4<1)67/ 

2JKNKRR ,WNKWU  &QRRGNUEJKNNKPI Q , OKV)GIGPUVGORGNXQP9QNICUVCWHFGT8QTFGTUGKVG )TGKH\YKUEJGPFGP*KPVGTRTCPMGPFKG<CJN(TKGFGTKEJXIN#PO*KNFKUEJXCT 5GJTUEJÌP

 249


RAVENSBURG

3026

3028

3027

21//'40*'4<1)67/706'45%*9'&'0 

-CTN:+6CNGT5VGVVKP#JNUVTÌOXCT&CX  ªDGTFWTEJUEJPKVVNKEJGTJCNVGP5GJTUEJÌPpXQT\ÒINKEJ





6CNGT5VGVVKP#JNUVTÌOE&CX



37'&.+0$74)

#$6'+ 

5GJTUEJÌP

5QRJKC #NDGTVKPC XQP 5EJYGFGP  #EJVGEMKIG 5KNDGTOGFCKNNG Q ,   WPUKIPKGTV   )GMTÌPVGU&QRRGNOQPITCOO5#WOJGTFKGFTGK-TQPGPXQP5EJYGFGP(ÒPH<GKNGP5EJTKHVWOJGT 4QUGPMTCP\ZZOOI*KNFGDTCPF++50T/GJNp  44*GTTNKEJG2CVKPCXQT\ÒINKEJ



2TKP\GUUKP 5QRJKC #NDGTVKPC GTJKGNV XQP KJTGT /WVVGT FGT UEJYGFKUEJGP -ÌPKIKP .WKUC 7NTKMC FKGUG /GFCKNNG CNU   5RKGNRHGPPKICO9GKJPCEJVUCDGPFCNUFKG'T\KGJWPIFGT2TKP\GUUKPCNUXQNNGPFGVCPIGUGJGPYWTFG

3029

*'445%*#(6 



3031

4#0&'4#6*

#TPQNF+++6WTPQUGQ,4CPFGTCVJ/GPCFKGTE5NI9G[ICPF  .GKEJVG-QTTQUKQPUURWTGPUGJTUEJÌP

4'+%*5/ª0<5666' 

3030

4#8'05$74)

(TKGFTKEJ++$TCMVGCVWOI)GMTÌPVGT-QRHXXKP6QTDQIGPFCTÒDGT6WTO OKVFTGK<KPPGP\WFGP5GKVGPLGGKPYGKVGTGT6WTOOKV5RKV\FCEJ$GTIGT-NGKP7NOGT %%  4(CUVXQT\ÒINKEJGU'ZGORNCTOKVFWPMNGT6ÌPWPI



#PQP[O  'KPUGKVKIGT XKGT\KRHGNKIGT 2HGPPKI  I 6WTO N YGNVNKEJG 2GTUQP OKV   &TGKDNCVVT(CDGNYGUGP$GTIGTp-NGKP7NOGT %% p  9CJTUEJGKPNKEJWPGFKGTV.GKEJVFG\GPVTKGTVUGJTUEJÌP



&KG <WYGKUWPI FGU XQTNKGIGPFGP 'ZGORNCTU KUV NGFKINKEJ GKP 8QTUEJNCI )GRT·IG OKV 6WTO KO /ÒP\DKNF IKDV GU   X C CWU FGT /ÒP\UV·VVG 4CXGPUDWTI XIN -NGKP7NOGT  HH  $GK -NGKP7NOGT KUV CW­GTFGO GKP GKPUGKVKIGT   XKGT\KRHGNKIGT2HGPPKIOKVGKPGO&TGKDNCVVKO/ÒP\DKNFXGT\GKEJPGVFGTNGFKINKEJFGPWPDGUVKOOVGPF[PCUVKUEJGP TGKEJUXÌIVKUEJGPWPFCPFGTGP/ÒP\UV·VVGP\WIGYKGUGPYWTFG 0T 

250




REGENSBURG

3033

3032

56#&6 



2TCIGT )TQUEJGP Q , FGU DÌJOKUEJGP -ÌPKIU 9GP\GN +++ +8   OKV )GIGPUVGORGN XQP   4CXGPUDWTI CWH FGT 8QTFGTUGKVG 6WTO &C\W )GIGPUVGORGN XQP 5EJY·DKUEJ )OÒPF 'KPJQTP  WPF   )GIGPUVGORGNXQP7NO 5VCFVYCRRGP -TWU[45WPF7  )GIGPUVGORGNHCUVUGJTUEJÌP/ÒP\G5EJTÌVNKPIUTK­HCUVUGJTUEJÌP



2TCIGT )TQUEJGP Q , FGU DÌJOKUEJGP -ÌPKIU 9GP\GN +++ +8   OKV )GIGPUVGORGN XQP   4CXGPUDWTICWHFGT8QTFGTUGKVG6WTO)GIGPUVGORGNXQP7NOCWHFGT4ÒEMUGKVG5VCFVYCRRGP IGVGKN VGTURCPKUEJGT5EJKNF -TWU[4WPF7 )GIGPUVGORGNUGJTUEJÌP/ÒP\GHCUVUGJTUEJÌP



3035

3034

3036

3037

4')'05$74) /ª0<5666'&'4*'4<¤)'810$#;'40 

*GKPTKEJ +8 FGT *GKNKIG CNU *GT\QI  UR·VGT -CKUGT *GKPTKEJ ++  &GPCT /ÒP\OGKUVGT   5+)  I Û*'04+%85 &8: -TGW\ KP FGP 9KPMGNP 2WPMV  -GKN  4KPIGN  2WPMV4')0#   %8+6#5.GVVGTPMKTEJGOKV/ÒP\OGKUVGT\GKEJGPWPF\YGK5VWHGP*CJPF 8QT\ÒINKEJ





*GKPTKEJ8FGT/QUGNGT 4GIKGTWPI &GPCT/ÒP\OGKUVGT+% URKGIGNXGTMGJTV 1I 10#CWH-TGW\KPFGP9KPMGNPLGFTGK2WPMVGWPFGKP&TGKGEM.GVVGTPMKTEJGOKV/ÒP\OGKUVGTPCOGP *CJP4ÒEMUGKVGXINH 7PDGMCPPVG8CTKCPVG(CUVXQT\ÒINKEJGU'ZGORNCTOKVHGKPGT2CVKPC



)GOGKPUEJCHVURT·IWPI XQP *GT\QI WPF $KUEJQH 2HGPPKI WO  <GKV 9GNHU ++   

! I$TWUVDKNFXXOKV.CP\G ! TKO(GNF-TGW\/CWGTOKV\YGK6QTGPWPFFTGK6ÒTOGP *CJPXIN,0)  #DDHHXINFCU'ZGORNCTFGT#WMVKQP*CWEM#WHJ·WUGT

 0T 9QJNWPGFKGTV<CKPGPFGWPFNGKEJVGT&QRRGNUEJNCIHCUVUGJTUEJÌP



2HGPPKIWO<GKV9GNHU++ ! I$TWUVDKNFXXOKV.CP\G ! TKO(GNF -TGW\/CWGTOKV\YGK6QTGPWPFFTGK6ÒTOGP  9QJNWPGFKGTV5EJTÌVNKPIUTK­WPF4CPFCWUDTWEJUGJTUEJÌP



&KG <WYGKUWPI FGU XQTNKGIGPFGP 5VÒEMU KUV PKEJV \YGKHGNUHTGK IGUKEJGTV 9·JTGPF FKG 4ÒEMUGKVG OÌINKEJGTYGKUG   UVGORGNINGKEJ \W FGO DGK 9 *CJP CDIGDKNFGVGP 'ZGORNCT KUV *CJP  H   PGPPV FKG 8QTFGTUGKVG CPUVGNNG FGU   0COGPU FGU *GT\QIU KP FGT (QTO *'+04&8: GKPGP 10#  'KP 10# QFGT #01 YKGFGTWO KUV GDGPHCNNU CNU   /ÒP\OGKUVGTPCOGHÒT4GIGPUDWTIWPVGT*GKPTKEJ8DGNGIV *CJPD 'UNKG­GUKEJCNUQURGMWNKGTGPQDUKEJCWH FKGUGO6[R\YGK/ÒP\OGKUVGTOKV0COGPPGPPGP





3038





3039

2HGPPKIWO<GKV9GNHU++ ! I$TWUVDKNFXXOKV.CP\G ! TKO(GNF -TGW\/CWGTOKV\YGK6QTGPWPFFTGK6ÒTOGP  9QJNWPGFKGTV4CPFHGJNGTWPF2T·IGUEJY·EJGHCUVUGJTUEJÌP



2HGPPKI WO  <GKV 9GNHU ++  !   I $TWUVDKNF X X OKV (CJPG T KO (GNF   -TGW\/CWGTOKV\YGK6QTGPWPFFTGK6ÒTOGP  9QJNWPGFKGTV2QTÌUGT5EJTÌVNKPI2T·IGUEJY·EJGHCUVUGJTUEJÌP

 251


REGENSBURG

3040



















252

3042

3044

3043

2HGPPKI*·NHVGFGU,CJTJWPFGTVU*GT\QINKEJGT2HGPPKII4GKVGTPCEJTOKV5EJYGTVWPF 5EJKNF JKPVGT FGO 2HGTF IGHNÒIGNVGT &TCEJG)GDÒEMVG 2GTUQP PCEJ N UVÒV\V UKEJ CWH 5VQEM WPF YKTF   XQPGKPGO6KGTCPIGHCNNGP'OOGTKIC 4ªDNKEJG2T·IGUEJY·EJGWPFNGKEJVFG\GPVTKGTVUGJTUEJÌP



2HGPPKI*·NHVGFGU,CJTJWPFGTVU$KUEJÌHNKEJGT2HGPPKII$TWUVDKNFFGU$KUEJQHUXXOKV -TWOOUVCD WPF $WEJ \W FGP 5GKVGP LG GKP 5VGTP/CWGTTKPI OKV FTGK ITQ­GP 6ÒTOGP N KO (GNF GKP   -TGW\'OOGTKI 4.GKEJVFG\GPVTKGTVUQPUVUGJTUEJÌP



2HGPPKI*·NHVGFGU,CJTJWPFGTVU$KUEJÌHNKEJGT2HGPPKII$TWUVDKNFFGU$KUEJQHUXXOKV -TWOOUVCDWPF$WEJ\WFGP5GKVGPLGGKP5VGTP/CWGTTKPIOKVFTGKITQ­GP6ÒTOGP\WFGP5GKVGPLG GKP-TGW\'OOGTKIXCT 4'VYCUFG\GPVTKGTVUQPUVUGJTUEJÌP



2HGPPKI WO  *GT\QINKEJGT 2HGPPKI  I -TKGIGT PCEJ T OKV (CJPGPNCP\G KO (GNF FTGK   5VGTPG6QTIGD·WFGOKVFTGK6ÒTOGP'OOGTKI  4&G\GPVTKGTVWPF5EJTÌVNKPIUTK­CO4CPFUQPUVUGJTUEJÌP



2HGPPKIWO$KUEJÌHNKEJGT2HGPPKII)GMTÌPVGU$TWUVDKNFNKPFGT.KPMGPGKP.KNKGP \GRVGT OKV FGT 4GEJVGP CWH FCU *CWRV YGKUGPF<YGK GKPCPFGT \WIGYCPFVG $TWUVDKNFGT GKPGU 9GNVNK   EJGPWPFGKPGU)GKUVNKEJGPJCNVGPIGOGKPUCO-TWOOUVCD'OOGTKI  5GNVGPKPFKGUGT'TJCNVWPI-N5EJTÌVNKPIUTK­HCUVXQT\ÒINKEJ



3045



3041

3046

3047

3048

3049

2HGPPKIWO$KUEJÌHNKEJGT2HGPPKII)GMTÌPVGU$TWUVDKNFNKPFGT.KPMGPGKP.KNKGP \GRVGT OKV FGT 4GEJVGP CWH FCU *CWRV YGKUGPF<YGK GKPCPFGT \WIGYCPFVG $TWUVDKNFGT GKPGU 9GNVNK   EJGPWPFGKPGU)GKUVNKEJGPJCNVGPIGOGKPUCO-TWOOUVCD'OOGTKI  5GNVGPKPFKGUGT'TJCNVWPI8QT\ÒINKEJ



2HGPPKI WO  *GT\QINKEJGT 2HGPPKI  I )GMTÌPVGU $TWUVDKNF PCEJ N KP FGT .KPMGP GKP   .KNKGP\GRVGT OKV FGT 4GEJVGP CWH FCU *CWRV YGKUGPF<YGK GKPCPFGT \WIGYCPFVG $TWUVDKNFGT GKPGU   9GNVNKEJGPWPFGKPGU)GKUVNKEJGPJCNVGPIGOGKPUCO(CJPG'OOGTKI  4-N5EJTÌVNKPIUTK­UQPUVCVVTCMVKXGUUGJTUEJÌPGU'ZGORNCT



2HGPPKIWO$KUEJÌHNKEJGT2HGPPKII$TWUVDKNFGKPGU)GKUVNKEJGPXXOKV-TWOOUVCD WPF-KTEJGPOQFGNN5COUQP\YKUEJGPFGP5·WNGPGKPGU4WPFDQIGPU'OOGTKI  +P6GKNGPUEJYCEJCWUIGRT·IVGUUQPUVCVVTCMVKXGUUGJTUEJÌPGU'ZGORNCT



2HGPPKIWO*GT\QINKEJGT2HGPPKII$TWUVDKNFGKPGU-TKGIGTUPCEJTOKV5EJKNFWPF (CJPGPNCP\G)GD·WFGOKV\YGK5GKVGPVÒTOGPWPF/KVVGNMWRRGN'OOGTKI  5GNVGPKPFKGUGT'TJCNVWPI5EJTÌVNKPIUTKUUGCO4CPFUQPUVXQT\ÒINKEJGU'ZGORNCT



2HGPPKI WO  $KUEJÌHNKEJGT 2HGPPKI  I /CPP OKV 5EJYGTV WPF 4WPFUEJKNF PCEJ T   DGM·ORHV.ÌYGPNKO(GNF2HNCP\G4GKVGTPCEJTOKVCPIGNGIVGT.CP\G'OOGTKI  $KUNCPIWPDGMCPPV5VGORGNMQRRGNWPI(GKPGT5VGORGNUEJPKVVHCUVXQT\ÒINKEJUGJTUEJÌP




REGENSBURG

3050







3051

3052

3053

3054

2HGPPKIWO$KUEJÌHNKEJGT2HGPPKII$TWUVDKNFGKPGU)GKUVNKEJGPXXKPFGT.KPMGP -TWOOUVCD FKG 4GEJVG QHHGP XQT FGT $TWUV JCNVGPF/CPP OKV 5EJYGTV WPF 4WPFUEJKNF PCEJ T DG   M·ORHV.ÌYGPNKO(GNF2HNCP\G'OOGTKI 45GJTUEJÌP



2HGPPKI WO  -ÌPKINKEJGT 2HGPPKI  I )GMTÌPVGT -QRH OKV \QVVKIGO 8QNNDCTV X X   -TKGIGT OKV 5EJKNF WPF (CJPGPNCP\G PCEJ T KO (GNF N UGKVGPXGTMGJTVGT $WEJUVCDG 4 'OOGTKIC 5GJTUGNVGPDGUQPFGTUKPFKGUGT'TJCNVWPI5GJTUEJÌP



2HGPPKI WO  -ÌPKINKEJGT 2HGPPKI  I )GMTÌPVGT -QRH OKV \QVVKIGO 8QNNDCTV X X   -TKGIGT OKV 5EJKNF WPF (CJPGPNCP\G PCEJ T KO (GNF N UGKVGPXGTMGJTVGT $WEJUVCDG 4 'OOGTKIC 5GJTUGNVGPDGUQPFGTUKPFKGUGT'TJCNVWPI -N5EJTÌVNKPIUTK­UGJTUEJÌPpXQT\ÒINKEJUGJTUEJÌP



(CUV CNNG 'ZGORNCTG FKGUGU 6[RU UKPF UEJNGEJV GTJCNVGP CWUIGDTQEJGP QFGT \GTDTQEJGP 7PVGT  IGUGJGPGP   5VÒEMGPYCTGPPWTKPVCMVG 'OOGTKI*&GT4GIGPUDWTIGT2HGPPKI&KG/ÒP\RT·IWPIKP4GIGPUDWTIXQO ,CJTJWPFGTVDKU$GTNKP5 





2HGPPKIWO$KUEJÌHNKEJGT2HGPPKII$TWUVDKNFFGU$KUEJQHUXXOKV-TWOOUVCDFKG .KPMGQHHGPXQTFGT$TWUVJCNVGPF'PIGNNÒDGTIKDV-KPFCPUVGJGPFG2GTUQPT'OOGTKI  'VYCUFG\GPVTKGTVUGJTUEJÌP



2HGPPKIWO$KUEJÌHNKEJGT2HGPPKII$TWUVDKNFGKPGU)GKUVNKEJGPXXOKV-TWOOUVCD NKO(GNF-QRHJCNDT$GNGJPWPIUU\GPG'OOGTKI (CUVUGJTUEJÌP



3055

3056

3057

3058

3059



2HGPPKIWO$KUEJÌHNKEJGT2HGPPKII$TWUVDKNFGKPGU)GKUVNKEJGPXXOKV-TWOOUVCD NKO(GNF-QRHJCNDT$GNGJPWPIUU\GPG'OOGTKID 5GJTUEJÌP





2HGPPKIWO*GT\QINKEJGT2HGPPKII4QUGVVGOKV5VCEJGNPKO<GPVTWOGKP-QRHPCEJT $GNGJPWPIUU\GPG'OOGTKI 5GNVGPKPFKGUGT'TJCNVWPI.GKEJVFG\GPVTKGTVUQPUVUGJTUEJÌP





2HGPPKI WO  *GT\QINKEJGT 2HGPPKI  I 5VGJGPFGT -TKGIGT X X OKV (CJPGPNCP\G WPF   5EJKNF-TKGIGT OKV GTJQDGPGO 5EJYGTV WPF 5EJKNF PCEJ N DGM·ORHV GKPGP IGHNÒIGNVGP &TCEJGP   'OOGTKI 5GJTUEJÌP



$+567/ 

)GDJCTF+82HGPPKII$TWUVDKNFFGU$KUEJQHUXXOKV-TWOOUVCD&TGKVÒTOKIGU )GD·WFG8INFCU'ZGORNCTFGT#WMVKQP*CWEM#WHJ·WUGT  0T*CJPp XINp  8QPITQ­GT5GNVGPJGKV(CUVUGJTUEJÌP



2CTCNNGNRT·IWPI\WTMÌPKINKEJGP2T·IWPIWPVGT-CKUGT*GKPTKEJ+8  



2HGPPKII$TWUVDKNFFGU$KUEJQHUXXOKV-TWOOUVCD/CWGTTKPIOKV6ÒTOGP*CJPp  8QPITQ­GT5GNVGPJGKV5EJTÌVNKPIUTK­WPFpNQEJHCUVUGJTUEJÌP

 253


REGENSBURG

3060



5GFKUXCMCP\5KNDGTOGFCKNNGXQP,%$WUEJWPF,.1GZNGKP#PUKEJVFGU4GIGPDWTIGT &QOU XQP 5ÒFYGUVGP OKV PQEJ WPXQNNGPFGVGP 6ÒTOGP+P GKPGT OWUEJGNHÌTOKIGP -CTVWUEJG FCU   9CRRGPFGU&QOMCRKVGNU 'KPCWHFGO9CUUGTHCJTGPFGT-CJPFCTKPFGT#RQUVGN2GVTWUOKV5EJNÒUUGN WPF (KUEJ  WOIGDGP XQP  9CRRGP FGT &QOJGTTGP OKV 0COGP  OO  I 'OOGTKI   -Q\KPQYUMK<GRGTPKEM 9KP\4CPFHGJNGTHCUVXQT\ÒINKEJ

3061



3062

56#&6 



2TCIGT )TQUEJGP Q , FGU DÌJOKUEJGP -ÌPKIU 9GP\GN +++ +8   OKV )GIGPUVGORGN XQP   4GIGPUDWTI CWH FGT 8QTFGTUGKVG )GMTGW\VG 5EJNÒUUGN &CTCWH )GIGPUVGORGN XQP 7NO 5VCFVYCRRGP  

IGVGKNVGTURCPKUEJGT5EJKNF -TWU[4WPF7 )GIGPUVGORGNHCUVUGJTUEJÌP/ÒP\GUEJÌP



2TCIGT )TQUEJGP Q , FGU DÌJOKUEJGP -ÌPKIU 9GP\GN +++ +8   OKV )GIGPUVGORGN XQP   4GIGPUDWTICWHFGT8QTFGTUGKVG)GMTGW\VG5EJNÒUUGN-TWU[4  )GIGPUVGORGNHCUVUGJTUEJÌP/ÒP\GHCUVUGJTUEJÌP



3063 (doppelt)

3063 (doppelt)

1,5:1



254

&QRRGNVGT 4GKEJUVCNGTQ,  OKV6KVGN,QUGHU+I5VGORGNUEJPGKFGT,QJCPP2KEJNGT 5VCFVUEJNÒUUGN KP DCTQEMGT )TQVGUMGPMCTVWUEJG WPVGP DGKFGTUGKVU /ÒP\OGKUVGT\GKEJGP (NÒIGN ,QJCPP   /KEJCGN (GFGTGT /ÒP\OGKUVGT KP 4GIGPUDWTI  )GMTÌPVGT &QRRGNCFNGT OKV $·PFGTP CPFGT -TQPGWPFFGOJGT\HÌTOKIGPÌUVGTTGKEJKUEJGP5EJKNFCWHFGT$TWUV$GEMGPD&CX  8QPITQ­GT5GNVGPJGKV 5GJTCVVTCMVKXGU'ZGORNCTOKVHGKPGT2CVKPCYKP\4CPFHGJNGTXQT\ÒINKEJp5VGORGNINCP\ 


REGENSBURG

3064

3065

3066



4GKEJUVCNGTOKV6KVGN-CTNU8+$GEMGPD&CX

48QT\Ã&#x2019;INKEJ





4GKEJUVCNGTQ, WO OKV6KVGN-CTNU8++$GEMGPD&CX  42TCEJVGZGORNCT8QT\Ã&#x2019;INKEJp5VGORGNINCP\





-QPX6CNGT  OKV 6KVGN XQP (TCP\ + +P 752NCUVKMJQNFGT FGT 0)% OKV FGT $GYGTVWPI /5    $GEMGPD&CX 2TCEJVXQNNG2CVKPCXQT\Ã&#x2019;INKEJp5VGORGNINCP\

3068

3067



-QPX6CNGTOKV6KVGNXQP(TCP\+$GEMGPD&CX

 



3069

8QT\Ã&#x2019;INKEJ



-QPX6CNGTOKV6KVGN,QUGHU++$GEMGPD

8QT\Ã&#x2019;INKEJ



-QPX6CNGTOKV6KVGN,QUGHU++$GEMGPD

8QT\Ã&#x2019;INKEJp5VGORGNINCP\

 255


REMAGEN

3071 3070

3070



-QPX6CNGTOKV6KVGN.GQRQNFU++$GEMGPD&CX  8QT\ÒINKEJGU'ZGORNCTOKVJGTTNKEJGT2CVKPC





-QPX6CNGTOKV6KVGN.GQRQNFU++$GEMGPD



2TCEJVGZGORNCT(CUV5VGORGNINCP\

3072 3073

3073



-QPX6CNGTOKV6KVGN.GQRQNFU++$GEMGPD

8QT\ÒINKEJ





-QPX6CNGTOKV6KVGNXQP(TCP\++$GEMGPD&CX  -N<CPIGPLWUVKGTWPICO4CPFXQT\ÒINKEJ



ex 3074

)4#(5%*#(6 

3075

3076

3077

4')'056'+0

/CTVKP6CNGT )TQUEJGP  8CTKCPVGP  RQUVJWOG2T·IWPI /ÒP\OGKUVGT %JTKUVQRJ&[­F,5EJTQEM&GPKEMGKCCXCTCD 5VÒEM5GJTUEJÌP



4'+%*'0#7 #$6'+ 

/CTVKP XQP -TGPMKPIGP  'KPUGKVKIGT 2HGPPKI Q , PCEJ   %CJP  $GTUV  0CW    5NI*ÌHMGP 4.GKEJVFG\GPVTKGTVUGJTUEJÌP



*ÌHMGP\WHQNIGJCPFGNVGUUKEJJKGTDGKWOGKPG0CEJCJOWPIFGTUGKVIGRT·IVGP-QPUVCP\GT2HGPPKIG



'KPUGKVKIGT*GNNGTQ,  4CFQNH\GNN%CJP0CWp

-¤0+).+%*'/ª0<5666' 

8QT\ÒINKEJ

4'/#)'0

*GKPTKEJ +++  2HGPPKI  I 4=+)'/#?)1 &KG $TWUVDKNFGT FGT #RQUVGN 5KOQP WPF   ,WFCU PGDGPGKPCPFGT X X   5%#  %1.1  #) &CPPGPDGTI  *·XGTPKEM  FQTV WPVGT   *GKPTKEJ++  42T·IGUEJY·EJGUGJTUEJÌP $GTPF-NWIGJCVFKGUGP2HGPPKIKPUGKPGT&GWVUEJGP/ÒP\IGUEJKEJVGXQPFGTUR·VGP-CTQNKPIGT\GKVDKU\WO'PFG FGT5CNKGT 5KIOCTKPIGP -ÌPKI*GKPTKEJ+++\WIGYKGUGP 50T 

256






ROTTWEIL

3079

3078

3078

4'755 4'7551$'4)4'+<)4#(5%*#(65'+6(ª456'067/ 

*GKPTKEJ:+++-QPX6CNGT#-5&CX-CJPV6JWP 5GJTUEJÌP





*GKPTKEJ::8GTGKPUFQRRGNVCNGT#-5&CX-CJPV6JWP  9KP\$GCTDGKVWPIUUVGNNGCO4CPFXQT\ÒINKEJ



3080

56#&6 

3082

4166'0$74)#/0'%-#4

2TCIGT )TQUEJGP Q , FGU DÌJOKUEJGP -ÌPKIU 9GP\GN +++ +8   OKV )GIGPUVGORGN XQP   4QVVGPDWTICWHFGT4ÒEMUGKVG5VCFVYCRRGP IGVGKNVGT5EJKNF -TWU[4  44)GIGPUVGORGNUGJTUEJÌP/ÒP\G5EJTÌVNKPIUTK­HCUVUGJTUEJÌP

56#&6 

3081



41669'+.

2TCIGT )TQUEJGP Q , FGU DÌJOKUEJGP -ÌPKIU 9GP\GN +++ +8   OKV )GIGPUVGORGN XQP   4QVVYGKNCWHFGT4ÒEMUGKVG#FNGT-TWU[:0CW )GIGPUVGORGNHCUVUGJTUEJÌP/ÒP\GUEJÌP



9·JTGPF-TWU[FKGUGP)GIGPUVGORGNCNUKPEGTVCWHHÒJTVQTFPGVKJP0CWFGT5VCFV4QVVYGKN\W



2TCIGT )TQUEJGP Q , FGU DÌJOKUEJGP -ÌPKIU 9GP\GN +++ +8   OKV )GIGPUVGORGN XQP   4QVVYGKNCWHFGT4ÒEMUGKVG#FNGT&CTWPVGT)GIGPUVGORGNXQP7NO5VCFVYCRRGP IGVGKNVGTURCPKUEJGT 5EJKNF -TWU[:WPF70CWXIN  5GNVGPKPFKGUGT'TJCNVWPI)GIGPUVGORGNUGJTUEJÌP/ÒP\GUEJÌP

 257


SACHSEN

3083 3084

3084

5#%*5'0-74(ª456'067/

5#%*5'0



(TKGFTKEJ+++FGT9GKUG)WNFGPITQUEJGP0ÒTPDGTI-GKNKV\  44-QTTQFKGTVHCUVUGJTUEJÌP





,QJCPP(TKGFTKEJFGT)TQ­OÒVKIGWPF)GQTI6CNGT#PPCDGTI&CX5EJPGG *ÒDUEJG2CVKPCXQT\ÒINKEJ



3086

3085

3087



,QJCPP (TKGFTKEJ FGT )TQ­OÒVKIG WPF *GKPTKEJ  6CNGT  #PPCDGTI &CX    5EJPGG 5GJTUEJÌP



6CNGT#PPCDGTI2QUVJWOG2T·IWPI&CX5EJPGG  5GJTUGNVGPKPFKGUGT'TJCNVWPI(CUV5VGORGNINCP\





#WIWUV6CNGT5EJPGGDGTI&CX5EJPGG  5GNVGPKPFKGUGT'TJCNVWPI'VYCU$GNCIXQT\ÒINKEJ





3089 3088



6CNGT#PPCDGTI&CX5EJPGG



6CNGT&TGUFGP-GKNKV\-CJPV

258

3088

5GJTUEJÌP



44-N2T·IGUEJY·EJGHCUVXQT\ÒINKEJ




SACHSEN

3090

3091



4GKEJUVCNGT&TGUFGP&CX5EJPGG

8QT\ÒINKEJ





%JTKUVKCP+4GKEJUVCNGT&TGUFGP&CX5EJPGG  *GTTNKEJG2CVKPCHCUVXQT\ÒINKEJ



3093

3092



%JTKUVKCP ++ ,QJCPP )GQTI + WPF #WIWUV  4GKEJUVCNGT  &TGUFGP &CX  #   5EJPGG 5GNVGPGT6[R#WUFTWEMUXQNNG2CVKPCXQT\ÒINKEJ





4GKEJUVCNGT&TGUFGP&CX5EJPGG



3094

3095



4GKEJUVCNGT&TGUFGP-GKNKV\-CJPV



4GKEJUVCNGT&TGUFGP&CX5EJPGG



4GKEJUVCNGT&TGUFGP-GKNKV\-CJPV



4GKEJUVCNGT&TGUFGP&CX5EJPGG

5GJTUEJÌP

3097

3096

5GJTUEJÌP



5GJTUEJÌP



(GKPG2CVKPCUGJTUEJÌPpXQT\ÒINKEJ



*ÒDUEJG2CVKPCHCUVXQT\ÒINKEJ

 259


SACHSEN

3098



,QJCPP)GQTI+WPF#WIWUV4GKEJUVCNGT&TGUFGP&CX5EJPGG  *ÒDUEJG2CVKPCUGJTUEJÌP



3099 (doppelt)



&KEMGTFQRRGNVGT4GKEJUVCNGT&TGUFGPI&CX5EJPGG  44#VVTCMVKXGU'ZGORNCTOKVJÒDUEJGT2CVKPCUGJTUEJÌP

3100

3102



3101



4GKEJUVCNGT&TGUFGP&CX5EJPGG

8QT\ÒINKEJ





4GKEJUVCNGT&TGUFGP&CX5EJPGG

5GJTUEJÌPpXQT\ÒINKEJ





,QJCPP)GQTI+4GKEJUVCNGT&TGUFGPCWHFCU8KMCTKCV&CX#5EJPGG *ÒDUEJG2CVKPCUGJTUEJÌP

260




SACHSEN

3103

3105

3104



4GKEJUVCNGT&TGUFGPCWHFKG,CJTHGKGTFGTªDGTICDGFGT#WIUDWTIGT-QPHGUUKQP&CX # FQTVHCNUEJG#DDKNFWPI 5EJPGG5NI9JKVKPI (GKPG2CVKPCUGJTUEJÌP





4GKEJUVCNGT&TGUFGPCWHFKG,CJTHGKGTFGTªDGTICDGFGT#WIUDWTIGT-QPHGUUKQP&CX # FQTVHCNUEJG#DDKNFWPI 5EJPGG5NI9JKVKPI  *ÒDUEJG2CVKPC)TCHHKVKKO(GNFFGT8QTFGTpWPF4ÒEMUGKVGUQPUVUGJTUEJÌP



5KNDGTOGFCKNNG  XQP 5 &CFNGT CWH FGP .GKR\KIGT -QPXGPV FGT RTQVGUVCPVKUEJGP 5V·PFG CO    (GDTWCT 5VCFVCPUKEJV XQP .GKR\KI FCTÒDGT \YGK 'PIGN OKV ITQ­GO 5EJKNF ,GJQXCU XQP FGO FKG   5EJKNFG XQP -WTUCEJUGP WPF 5CEJUGP JGTCDJ·PIGP&KG RGTUQPKHK\KGTVG IGHNÒIGNVG 6WIGPF YGKUV FGP   LWPIGP *GTMWNGU CWH #RQNN WPF /GTMWT JKP  OO  I /CW¾  5NI /GTUGD    5NI9JKVKPI (CUVXQT\ÒINKEJGU'ZGORNCTOKVFWPMNGT2CVKPC





0CEJFGOUKEJ)WUVCX++#FQNHXGTIGDNKEJWOGKP$ÒPFPKUOKVFGPPGWVTCNGP-WTHÒTUVGPXQP$TCPFGPDWTIWPF 5CEJUGPDGOÒJVJCVVGNWF-WTHÒTUV,QJCPP)GQTI+XQP5CEJUGPU·OVNKEJGRTQVGUVCPVKUEJGP4GKEJUUV·PFGKO,CPWCT  \W GKPGT -QPHGTGP\ PCEJ .GKR\KI GKP WO GKPG IGOGKPUCOG *CNVWPI KO )TQ­GP -TKGI CD\WUVKOOGP &KG   6CIWPIDGICPPCO(GDTWCT PCEJITGIQTKCPKUEJGO-CNGPFGTCO(GDTWCT WPVGT6GKNPCJOG\CJNTGKEJGT (ÒTUVGP WPF 8GTVTGVGTPSWCUKCNNGTRTQVGUVCPVKUEJGP5V·PFG#O#RTKNXGTCDUEJKGFGVGFGTUQIGPCPPVG.GKR\KIGT $WPF GKPGP GTPGWVGP 2TQVGUV IGIGP FCU 4GUVKVWVKQPUGFKMV -CKUGT (GTFKPCPFU ++ XQP  WPF FKG #WHUVGNNWPI XQP   IGOGKPUCOGP 6TWRRGP KP GKPGO 7OHCPI XQP  /CPP 0KEJV DGUEJNQUUGP YWTFG FCIGIGP FKG XQP )WUVCX ++   #FQNHGTJQHHVG#NNKCP\OKV5EJYGFGP&KGUGT8GTUWEJFGT(QTOKGTWPIGKPGTFTKVVGP2CTVGKPGDGPFGO-CKUGTWPF 5EJYGFGPUQNNVGLGFQEJUEJGKVGTP

3106



5KNDGTOGFCKNNGXQP5&CFNGT<YKVVGTRT·IWPIFGT5VCFV.GKR\KICWHFCU&CPMHGUV\WT(GKGTFGU 9GUVH·NKUEJGP(TKGFGPUWPFCWHFGP.GKR\KIGT-QPXGPVXQP2CZUVGJVXXOKVUGIPGPFGT4GEJVGP WPF2CNO\YGKI\WFGP5GKVGP9QNMGPQDGPUVTCJNGPFGT0COG,GJQXCUWPVGP9CHHGP5VCFVCPUKEJVXQP .GKR\KI FCTÒDGT JCNVGP \YGK 'PIGN GKPGP ITQ­GP 5EJKNF OKV FGO UVTCJNGPFGP 0COGP ,GJQXCU CP FGO   \YGK MNGKPGTG 5EJKNFG J·PIGP  OO  I &GVJ1TF  /CW¾  2CZ KP 0WOOKU p   5NI/GTUGD 45GJTCVVTCMVKXGU'ZGORNCTOKVJÒDUEJGT2CVKPCUGJTUEJÌPpXQT\ÒINKEJ

 261


SACHSEN

3107

3109

3108



4GKEJUVCNGT&TGUFGP&CX5EJPGG

5GJTUEJÌPpXQT\ÒINKEJ





4GKEJUVCNGT&TGUFGP&CX5EJPGG  (GKPG2CVKPCYKP\5EJTÌVNKPIUHGJNGTCO4CPFUGJTUEJÌP





4GKEJUVCNGT&TGUFGP%NCW­-CJPV 2TCEJVGZGORNCT*GTTNKEJG2CVKPCHCUV5VGORGNINCP\



3110

3112

3111



4GKEJUVCNGT&TGUFGPCWHUGKPGP6QF&CX5EJPGG



,QJCPP )GQTI ++  4GKEJUVCNGT  &TGUFGP CWH FCU 8KMCTKCV &KG 7OUEJTKHV DGIKPPV   QDGPTGEJVU&CX5EJPGG 5GJTUEJÌP





 4GKEJUVCNGT  &TGUFGP CWH FCU 8KMCTKCV +P 752NCUVKMJQNFGT FGT 0)% OKV FGT $GYGTVWPI   #7%NCW­-CJPV *ÒDUEJG2CVKPCXQT\ÒINKEJ



262

5GJTUEJÌPpXQT\ÒINKEJ




SACHSEN

3113



8GTIQNFGVG 5KNDGTOGFCKNNG  XQP , $WEJJGKO WPF , (TGPV\GN CWH FCU 8KMCTKCV &GT -WTHÒTUV OKV   GTJQDGPGO5EJYGTVKPFGT4GEJVGPTGKVGVPCEJTKP.CPFUEJCHVQDGPJCNVGP\YGK'PIGNOKV2CNO\YGK IGP FCU MWTU·EJUKUEJG 9CRRGP#PUKEJV FGT (GUVWPI 0GW&TGUFGP OKV FGO MWTHÒTUVNKEJGP .WUVJCWU   FGT-TGW\MKTEJGFGOMWTHÒTUVNKEJGP4GUKFGP\UEJNQ­WPFFGT'NDDTÒEMGKO*KPVGTITWPFFKG$GTIHGUVWPI -ÌPKIUVGKPFCTÒDGTIGMTGW\VGU<GRVGTWPF5EJYGTV\YKUEJGP\YGK#WIGPQDGPUVTCJNGPFGT0COG,GJQ XCUKP9QNMGPOOI5NI/GTUGD  44#NVXGTIQNFGVYKP\-TCV\GTHCUVXQT\ÒINKEJ



#WHFGT4ÒEMUGKVGWPUGTGT/GFCKNNGDNKEMVFCUGKPG#WIGJKPCWH\WO0COGP,GJQXCUFCUCPFGTGUEJCWVJKPCDCWH FCU .CPF &GT FKGUGO 5KPPDKNF FGU -WTHÒTUVGP DGKIGUEJTKGDGPG 9CJNURTWEJ 57457/ &'1457/ JKPCWH WPF   JGTWPVGT  YKTF FWTEJ FKG 4ÒEMUGKVGPWOUEJTKHV 57457/ 1%7.75 WUY GTMN·TV FKG CWEJ FKG CWH FGP   8KMCTKCVOÒP\GPIGDTCWEJVGP9QTVG&'12#64+#'GPVJ·NVCWU*GZCOGVGTWPF2GPVCOGVGTDGUVGJVWPFUKEJYKG HQNIV ÒDGTUGV\VGP N·­V '+0 #7)  &'/ *+//'. <7 '4&9465 &#5 #0& 4' )'4+%*6'6 $.'+$   705'4/)166+%*)'64'756'*+%*(ª4 58#6'4.#0&'+0

3114

3116

3115



4GKEJUVCNGT&TGUFGP'TDN·PFKUEJGT6CNGT&CX5EJPGG  9KP\4CPFHGJNGTUGJTUEJÌP





(GKPUKNDGTVCNGTPCEJ\KPPCKUEJGO(W­&TGUFGPCWHFKG8GTNGKJWPIFGU*QUGPDCPFQTFGPUWPFCWH FCU5V)GQTIU1TFGPUHGUVI&CX5EJPGG *ÒDUEJG2CVKPCUGJTUEJÌPpXQT\ÒINKEJ





4GKEJUVCNGT&TGUFGP%NCW­-CJPVp \W 



445GJTUEJÌP

263


SACHSEN

3118

3117





3117

,QJCPP)GQTI+++5KNDGTOGFCKNNGQ, WO XQP/*1OGKUCWHUGKPG'THQNIGKO (GFN\WI CP FGP 4JGKP IGIGP (TCPMTGKEJ )GJCTPKUEJVGU $TWUVDKNF T OKV WOIGNGIVGO /CPVGN CWH FGT   $TWUV .ÌYGPMQRH#NVCT OKV FGO MWTU·EJUKUEJGP 9CRRGPUEJKNF XGT\KGTV FCTCWH GKP OKV FGO -WTJWV   DGFGEMVGT *GNO OKV .QTDGGT IGUEJOÒEMVGU 5EJYGTV WPF 5VCPFCTVG IGMTGW\V WPF GKP CWHIGUEJNCIGPGU   'XCPIGNKGPDWEJ/KV4CPFUEJTKHVOOI)TWPF1Q,5NI/GTUGD  44#VVTCMVKXGUHCUVXQT\ÒINKEJGU'ZGORNCT



5KNDGTOGFCKNNG  XQP / * 1OGKU CWH UGKPGP 6QF )GJCTPKUEJVGU $TWUVDKNF T OKV WOIGNGIVGO   /CPVGN CWH FGT 5EJWNVGT .ÌYGPMQRH)GHNÒIGNVGT .QTDGGTMTCP\ CP 'TFJCNDMWIGN CPIGMGVVGV QDGP GKPG   CWU 9QNMGP MQOOGPFG *CPF OKV -TQPG FWTEJ FKG FCU 5[ODQN FGT &TGKHCNVKIMGKV UVTCJNV /KV 4CPF   UEJTKHVOOI)TWPF15NI/GTUGD 9KP\4CPFHGJNGTUGJTUEJÌP



3120

3119

3121



4GKEJUVCNGT&TGUFGPCWHUGKPGP6QF&CX5EJPGG  (GKPG2CVKPCTCWJGT5EJTÌVNKPIUGJTUEJÌP





6CNGT&TGUFGPCWHUGKPGP6QF%NCW­-CJPV&CX

(GKPG2CVKPCUGJTUEJÌP





(TKGFTKEJ#WIWUV+ #WIWUVFGT5VCTMG 6CNGT&TGUFGP&CX-CJPV *ÒDUEJG2CVKPCUGJTUEJÌPpXQT\ÒINKEJ



264


SACHSEN

3122

3123

3123



5KNDGTOGFCKNNGXQP%JT9GTOWVJCWHFKGXQPFGTUEJYGFKUEJGP#TOGGKO-WTHÒTUVGPVWO5CEJ UGPGKPIGVTKGDGPGP-QPVTKDWVKQPGP#PUKEJVFGT5VCFV.GKR\KIKO8QTFGTITWPF5VCFVITCDGPOKV(KIWTGP FKG +PUEJTKHV FGU #DUEJPKVVU KUV KO 5VGORGN IGVKNIV&TGKUVÌEMKIGU *CWU KP FCU -QTPU·EMG JKPGKPIGVTC   IGPYGTFGPFCXQTGKP5EJ·HGTOKVUGKPGT*GTFGOOI5NI/GTUGDp9QJNHCJTV 44*ÒDUEJG2CVKPCXQT\ÒINKEJ  8GTOWVNKEJCWU#PIUVXQTGKPGTOÌINKEJGP$GUVTCHWPIFWTEJFKG5EJYGFGPJCV%JTKUVKCP9GTOWVJUGKPG5KIPCVWTKO 5VGORGNIGVKNIV



4GKEJUVCNGT&TGUFGPCWHFCU8KMCTKCV&CX5EJPGG

3125

*ÒDUEJG2CVKPCHCUVXQT\ÒINKEJ

3124



3126



4GKEJUVCNGT&TGUFGPCWHFCU8KMCTKCV-CJPV

*ÒDUEJG2CVKPCHCUVXQT\ÒINKEJ





(TKGFTKEJ#WIWUV++4GKEJUVCNGT&TGUFGP&CX5EJPGG  *GPMGNURWT(GNFGTIGIN·VVGVUGJTUEJÌP





(TKGFTKEJ%JTKUVKCP-QPX6CNGT.GKR\KI&CX$5EJPGG



(CUVXQT\ÒINKEJ

265


SACHSEN

3127

3129

3128



(TKGFTKEJ #WIWUV +++ +   -QPX6CNGT  &TGUFGP &CX  5EJPGG    8QT\ÒINKEJp5VGORGNINCP\





-QPX6CNGT  &TGUFGP #WUDGWVG FGT U·EJUKUEJGP )TWDGP &CX  /ÒUGNGT    5EJPGG *ÒDUEJG2CVKPCHCUVXQT\ÒINKEJ





5KNDGTOGFCKNNG Q , WO   XQP # #DTCOUQP CWH FGP U·EJUKUEJGP 5EJTKHVUVGNNGT WPF 2·FCIQIGP   %JTKUVKCP (GNKZ 9GK­G $TWUVDKNF 9GK­GU N$ÒUVG FGT 2CNNCU #VJGPG T FCPGDGP $CWO OKV 5[ODQNGP   FGT6TCIÌFKGWPF-QOÌFKGOOI*QHHOCPP5NI/GTUGD  5GJTCVVTCMVKXGU'ZGORNCTOKVJGTTNKEJGT2CVKPCXQT\ÒINKEJp5VGORGNINCP\



3130

3132

3131



-QPX6CNGT&TGUFGPCWHFCU8KMCTKCV&CX5EJPGG  -N5EJTÌVNKPIUHGJNGTCO4CPFHCUVXQT\ÒINKEJ





-QPX6CNGT+'%#WUDGWVG&CX-CJPV6JWP  *ÒDUEJG2CVKPCOKPLWUVKGTVHCUVXQT\ÒINKEJ



5#%*5'0-¤0+)4'+%*  266

(TKGFTKEJ#WIWUV+-QPX6CNGT5)*#-5,  5GJTUGNVGPKPFKGUGT'TJCNVWPI2TCEJVGZGORNCT/KPLWUVKGTV5VGORGNINCP\




SACHSEN

3134

3133



-QPX6CNGT5)*#-5,



-QPX6CNGT+)5#WUDGWVG#-5&CX-CJPV6JWP

3135

3134

2TCEJVGZGORNCT(GKPG2CVKPCHCUV5VGORGNINCP\  4/KPLWUVKGTVXQT\ÒINKEJ

3136

 

3137



-QPX6CNGT  ,CJTGU\CJN KO 5VGORGN CWU  IG·PFGTV  +)5 #WUDGWVG #-5  &CX    -CJPV6JWP 4(GKPG2CVKPCOKPLWUVKGTVXQT\ÒINKEJ





-QPX6CNGT5CWHUGKPGP6QF#WUDGWVG#-5&CX-CJPV6JWP  40WT'ZGORNCTGIGRT·IV(GKPG2CVKPCHCUVXQT\ÒINKEJ





#PVQP  $TQP\GOGFCKNNG  XQP -TÒIGT CWH FGP  )GDWTVUVCI XQP -CTN #WIWUV   $ÌVVKIGT-QRH$ÌVVKIGTUN2JKNQUQRJUKV\VCWHGKPGT5·WNGPCEJNWPFDGVTCEJVGVGKPGP5QEMGNOKVGKPGT 5RJKPZOO5NI/GTUGD 8QT\ÒINKEJ



3139

3138

3139



-QPX6CNGT58GTHCUUWPI#-5&CX-CJPV6JWP  -CDKPGVVUVÒEM*GTTNKEJG2CVKPCRQNKGTVG2NCVVG





(TKGFTKEJ#WIWUV++5KNDGTOGFCKNNGXQP#(CEKWUCWHFKG8GTUCOONWPIFGWV UEJGT0CVWTHQTUEJGTWPFT\VGKP,GPC-[DGNGWPF*[IKGKCUVGJGPPGDGPGKPCPFGTXXKPGKPGT.ÌYGP SWCFTKIC5GEJU <GKNGP 5EJTKHV  OO  I 5NI $TGVVJCWGT  5NI /GTUGD XIN   

FQTVKP$TQP\G  (GKPG2CVKPCYKP\4CPFHGJNGTXQT\ÒINKEJp5VGORGNINCP\

 267


SACHSEN

3140

3140

3141



-QPX6CNGT)#-5&CX-CJPV6JWP  5GNVGPDGUQPFGTUKPFKGUGT'TJCNVWPI*GTTNKEJG2CVKPCHCUV5VGORGNINCP\





'KPUGKVKIG-WRHGTRTQDGFGU4ÒEMUGKVGPUVGORGNUOKVWPXQNNUV·PFKIGT,CJTGU\CJNFGU\YKUEJGP IGRT·IVGP6CNGTUI/KVINCVVGO4CPF#-5#PO FQTVCNU5KNDGTRTQDG &CX\W -CJPVM FQTVCNU5KNDGTRTQDG 5VWV\OCPPp6JWP\W 8QPITQ­GT5GNVGPJGKV8QT\ÒINKEJ



3142

  

3143

3144

,QJCPP8GTGKPUFQRRGNVCNGT(#-5&CX-CJPV6JWP 8QT\ÒINKEJ &QRRGNVGT8GTGKPUVCNGT(#-5&CX-CJPV6JWP (CUVXQT\ÒINKEJ &QRRGNVGT8GTGKPUVCNGT(#-5&CX-CJPV6JWP 8QT\ÒINKEJp5VGORGNINCP\

  

3145



#NDGTV  5KNDGTPG 8GTFKGPUVOGFCKNNG Q , IGUVKHVGV   XQP / $CTFWNGEM HÒT 6TGWG KP   FGT #TDGKV -QRH T8KGT <GKNGP 5EJTKHV WOJGT 'KEJGPMTCP\  OO  I $CTFWNGEM    *ÒDUEJG2CVKPCXQT\ÒINKEJ



.1655#%*5'0-74(ª456'067/70&-¤0+)4'+%* 

268

#WIWUV6CNGT&TGUFGP &CX %JTKUVKCP++,QJCPP)GQTI+WPF#WIWUV4GKEJUVCNGT &TGUFGP &CX   ,QJCPP )GQTI + 4GKEJUVCNGT  &TGUFGP &CX   WPF4GKEJUVCNGT &TGUFGP &CX ,QJCPP)GQTI+86CNGTMNKRRGPCEJ.GKR\KIGT(W­&TGUFGPCWHFGP'OR HCPIFGU*QUGPDCPFQTFGPU &CX  5VÒEM/KVMN(GJNGTPOGKUVUGJTUEJÌP




SACHSEN 

#WIWUV4GKEJUVCNGT&TGUFGP &CX %JTKUVKCP++,QJCPP)GQTI+WPF#WIWUV  4GKEJUVCNGT  &TGUFGP &CX   (TKGFTKEJ #WIWUV +  #WIWUV FGT   5VCTMG   6CNGT  &TGUFGP &CX   :CXGT  -QPX6CNGT  &TGUFGP  

&CX  5VÒEM5GJTUEJÌP



3149

3148

3148

5#%*5'0<'+6<*'4<1)67/ 

/QTKV\ 9KNJGNO  Ó 5KNDGTOGFCKNNGXQP,4CPKUEJCWHUGKPGP)GDWTVUVCICO  /·T\ )GJCTPKUEJVGU $TWUVDKNF T OKV WOIGNGIVGO /CPVGN <GKNGP 5EJTKHV 5EJT·IGT -GTDTCPF   OOI5NI/GTUGDp6GPV\GN6CHGN85  44*GTTNKEJG2CVKPCMN4CPFHGJNGTUGJTCVVTCMVKXGUXQT\ÒINKEJGU'ZGORNCT 

5#%*5'0*'4<1)67/ 'TPGUVKPGTPCEJFGO8GTNWUVFGT-WTYÒTFG  

,QJCPP(TKGFTKEJ+FGT)TQ­OÒVKIGCNU*GT\QI6CNGT5CCNHGNFOKV6KVGN-CTNU8 &CX5EJPGG *ÒDUEJG2CVKPCCVVTCMVKXGUUGJTUEJÌPGU'ZGORNCT



3150

3152







3151

,QJCPP9KNJGNO5EJTGEMGPDGTIGT5CCNHGNF-QRRG9CNFGF

3152

5GJTUEJÌP



5#%*5'0%1$74)'+5'0#%**'4<1)67/

,QJCPP %CUKOKT WPF ,QJCPP 'TPUV  -KRRGT -TGW\GT &TGKD·V\PGT   'KUGPCEJ   -Q\KPQYUMK1VVQ4W­ FQTVPWTCNU<GKEJPWPICDIGDKNFGV   8QPITÌ­VGT5GNVGPJGKV2T·IGUEJY·EJGUGJTUEJÌP



4GKEJUVCNGT5CCNHGNF&KG4ÒEMUGKVGPWOUEJTKHVNCWVGV.#Ú)6*8/#4/+5%1/'6Û 4#&Ü+04#8&CX-Q\KPQYUMK1VVQ4W­p \W 5EJPGG  5GNVGPG8CTKCPVG'VYCU$GNCIUGJTUEJÌP



&CUXQTNKGIGPFG5VÒEMYKTFCWEJCNU5RTWEJQFGT'KPVTCEJVUVCNGTDG\GKEJPGV

269


SACHSEN

3153



3154

3155

,QJCPP'TPUV4GKEJUVCNGT%QDWTICWHUGKPGP6QF&CX-Q\KPQYUMK1VVQ4W­ 5EJPGG *ÒDUEJG2CVKPCYKP\<CKPGPFGUGJTUEJÌP



5#%*5'0#.6'0$74)*'4<1)67/ 

,QJCPP2JKNKRR(TKGFTKEJ,QJCPP9KNJGNOWPF(TKGFTKEJ9KNJGNO++4GKEJUVCNGT 5CCNHGNF-GTPDCEJ 5GNVGPKPFKGUGT'TJCNVWPI*GTTNKEJG2CVKPCXQT\ÒINKEJ





4GKEJUVCNGT5CCNHGNF&CX-GTPDCEJ5EJPGG



3157

3156

5GJTUEJÌP

3158



-KRRGT-TGW\GT#NNUVGFVOKV6KVGN(GTFKPCPFU++$QTPGOCPP  8QPITQ­GT5GNVGPJGKV5GJTUEJÌP





4GKEJUVCNGT5CCNHGNF&CX-GTPDCEJ5EJPGG

-N2T·IGUEJY·EJGXQT\ÒINKEJ





4GKEJUVCNGT5CCNHGNF&CX-GTPDCEJ5EJPGG  9KP\5EJTÌVNKPIUHGJNGTCO4CPFUGJTUEJÌP



270


SACHSEN

3160



3161

3159

4GKEJUVCNGT5CCNHGNF&CX#-GTPDCEJ5EJPGG  -N5EJTÌVNKPIUHGJNGTCO4CPFYKP\-TCV\GTUGJTUEJÌP



5#%*5'09'+/#4*'4<1)67/#$5#%*5'09'+/#4'+5'0#%* 

(TKGFTKEJ9KNJGNOWPF,QJCPP4GKEJUVCNGT5CCNHGNF&CX5EJPGG  5GJTUEJÌP





4GKEJUVCNGT5CCNHGNF&CX5EJPGG



*ÒDUEJG2CVKPCUGJTUEJÌP

3162

3163



4GKEJUVCNGT5CCNHGNF-QRRG



,QJCPP'TPUVWPFUGKPGUKGDGP$TÒFGT4GKEJUVCNGT5CCNHGNF&CX5EJPGG 5GJTUEJÌP

3164





4*ÒDUEJG2CVKPCUGJTUEJÌP

3165

 

3164

,QJCPP 'TPUV WPF UGKPG UGEJU $TÒFGT  -KRRGT5GEJUD·V\PGT FQRRGNVGT 5EJTGEMGPDGTIGT    9GKOCT$QTPGOCPPHHXCT5NI-TCC\XCT5NI/GTUGDXCT  5EJTÌVNKPIUHGJNGTCO4CPFXQT\ÒINKEJ



9KNJGNO 'TPUV  4GKEJUVCNGT  +NOGPCW CWH UGKPGP )GDWTVUVCI WPF FKG 5VKHVWPI HÒT   -KTEJGPWPF5EJWNFKGPGT5VGORGNXQP%JTKUVKCP9GTOWVJ&CX5EJPGG  4(NGEMKIG2CVKPCXQT\ÒINKEJ

 271


SACHSEN

3166







3168

3167

 4GKEJUVCNGT  9GKOCT CWH UGKPGP )GDWTVUVCI WPF FKG 5VKHVWPI HÒT -KTEJGP WPF 5EJWNFKGPGT   5VGORGNUEJPGKFGT%JT9GTOWVJ-QRRGC  4#VVTCMVKXGU'ZGORNCTOKVJGTTNKEJGT2CVKPCMN2T·IGUEJY·EJGXQT\ÒINKEJ



%CTN#WIWUV5KNDGTOGFCKNNGXQP,.5VQEMOCTCWHFKG)GDWTVUGKPGT6QEJVGT.WKUG #WIWUVG #OCNKG &CU 0GWIGDQTGPG NKGIV CWH GKPGO -KUUGP KP .CPFUEJCHV N CWHIGJGPFG 5QPPG&CU   'NVGTPRCCT UVGJV KP GKPGT .CPFUEJCHV WPF TGKEJV UKEJ FKG *·PFG  OO  I (TGFG  5NI   /GTUGD *ÒDUEJG2CVKPCXQT\ÒINKEJ



5KNDGTOGFCKNNG  IGRT·IV   XQP & ( QFGT ( 9 .QQU 9GKOCTGT 2T·OKGPOGFCKNNG 5QIG   PCPPVG ,CJTJWPFGTVOGFCKNNG (ÒPH <GKNGP 5EJTKHV WOJGT 'KEJGPMTCP\5KGDGP <GKNGP 5EJTKHV WOJGT   .QTDGGTMTCP\OOI(TGFG5QOOGT#  0WT'ZGORNCTGIGRT·IV*ÒDUEJG2CVKPCXQT\ÒINKEJ



3169

3170

3171



-QPX6CNGT/KV\YGK$CPFGPFGPCWHFGT4ÒEMUGKVGDTGKVGTGO2CNO\YGKIWPFXKGT(TÒEJVGPCO .QTDGGT\YGKI#-5&CX-CJPVF6JWP 2TCEJVXQNNG2CVKPCXQT\ÒINKEJ





-QPX6CNGT&GO8CVGTNCPFG/KVHGKPINKGFTKIGTGO.CWDTCPF#-5&CX-CJPVC 6JWP 2TCEJVGZGORNCT(GKPG6ÌPWPIHCUV5VGORGNINCP\





-QPX6CNGT&GO8CVGTNCPFG/KVHGKPINKGFTKIGTGO.CWDTCPF#-5&CX-CJPVC 6JWP (GKPG2CVKPCMN5EJTÌVNKPIUHGJNGTKO4CPFXQT\ÒINKEJ



272


SACHSEN

3172







3174

3173

5KNDGTOGFCKNNGQ,  XQP*($TCPFVCWHFGPL·JTKIGP#WHGPVJCNVXQP,QJCPP9QNHCPI XQP)QGVJGKP9GKOCT&KG$TWUVDKNFGTFGU*GT\QIUWPFUGKPGT)GOCJNKP.WKUG6QEJVGTFGU.CPFITC HGP.WFYKI+:XQP*GUUGP&CTOUVCFVPGDGPGKPCPFGTT$TWUVDKNF)QGVJGUKPCPVKMGO)GYCPFNOKV .QTDGGTMTCP\/KV4CPFUEJTKHVOOI(ÌTUEJPGT(TGFG.GJPGTV  *ÒDUEJG2CVKPCYKP\4CPFHGJNGTXQT\ÒINKEJ



5KNDGTOGFCKNNG  XQP * ( $TCPFV CWH UGKP L·JTKIG 4GIKGTWPIULWDKN·WO -QRH T WOJGT .QT   DGGTMTCP\&GT5QPPGPIQVVH·JTVKPGKPGT3WCFTKICKO#DUEJPKVVFTGK<GKNGP5EJTKHVWOJGT-TCP\CWU 5VGTP\GKEJGPOOI(TGFG.GJPGTV  *ÒDUEJG2CVKPCYKP\4CPFHGJNGTXQT\ÒINKEJHCUV5VGORGNINCP\



%CTN (TKGFTKEJ  5KNDGTOGFCKNNG Q , WPUKIPKGTV 8GTFKGPUVOGFCKNNG -QRH N<YGK <GKNGP   5EJTKHVWOJGT'KEJGPMTCP\OOI(TGFGp5NI/GTUGDXIN FQTVKP$TQP\G   7PTGIGNO·­KIG2CVKPCYKP\-TCV\GTXQT\ÒINKEJ



3175

3176





3176

5KNDGTOGFCKNNGWPUKIPKGTVXQP#(CEKWUCWHFCUL·JTKIG&KGPUVLWDKN·WOFGU9GKOCTGT5VCCVU OKPKUVGTU %CTN 9KNJGNO XQP (TKVUEJ $TWUVDKNF FGU 5VCCVUOKPKUVGTU T&TGK <GKNGP 5EJTKHV WOJGT 'K   EJGPMTCP\OOI(TGFG *GTTNKEJG2CVKPCXQT\ÒINKEJp5VGORGNINCP\



5KNDGTOGFCKNNGWPUKIPKGTVXQP#(CEKWUCWHFCUL·JTKIG&KGPUVLWDKN·WOFGU9GKOCTGT5VCCVU OKPKUVGTU %CTN 9KNJGNO XQP (TKVUEJ $TWUVDKNF FGU 5VCCVUOKPKUVGTU T&TGK <GKNGP 5EJTKHV WOJGT 'K   EJGPMTCP\OOI(TGFG 5GJTUEJÌPpXQT\ÒINKEJ

 273


SACHSEN

3178 3177

3177





5KNDGTOGFCKNNG  XQP ( *GNHTKEJV CWH FCU L·JTKIG $GUVGJGP FGU )[OPCUKWOU KP 'KUGPCEJ&KG $TWUVDKNFGT %CTN (TKGFTKEJU WPF ,QJCPP (TKGFTKEJU PGDGPGKPCPFGT N5KGDGP <GKNGP 5EJTKHV  OO   I(TGFGp5NI/GTUGD 2TCEJVXQNNG2CVKPCXQT\ÒINKEJp5VGORGNINCP\



5#%*5'0)16*#*'4<1)67/#$5#%*5'0)16*##.6'0$74)

(TKGFTKEJ+OKVUGKPGP$TÒFGTP6CNGT)QVJC&CX5VGIWYGKV  44#VVTCMVKXGUHCUVXQT\ÒINKEJGU'ZGORNCT



3180

3179





3179

(TKGFTKEJ + CNNGKP   HCEJGT (GKPUKNDGTVCNGT PCEJ \KPPCKUEJGO (W­ Q , )QVJC   &CX5EJPGG5VGIWYGKV FQTVCNU(GKPUKNDGTUEJCWVCNGT   4#VVTCMVKXGU'ZGORNCTOKVJGTTNKEJGT2CVKPCNGKEJVG2T·IGUEJY·EJGHCUVXQT\ÒINKEJ



(TKGFTKEJ +++  4GKEJUVCNGT  'KUGPCEJ CWH FKG ,CJTHGKGT FGU 4GNKIKQPUHTKGFGPU   &CX5EJPGG  5NI9JKVKPI  (GKPG6ÌPWPIOKP,WUVKGTURWTGPXQT\ÒINKEJp5VGORGNINCP\ 

3181



274

5KNDGTOGFCKNNG  XQP $ &WXKXKGT CWH UGKPGP 6QF $ÒUVG N OKV *CCTDCPF&GT (ÒTUV UKV\V PCEJ N   KPCPVKMGO)GYCPFFKG4GEJVGCWUIGUVTGEMVFCXQT2CNOGOKVFGOU·EJUKUEJGP9CRRGPFCTWPVGT(CU EGU \W FGP 5GKVGP NKGIGP *GNO WPF 5EJYGTV CWH FGO $QFGP  OO  I 5NI /GTUGD   

FQTVKP$TQP\GOKVHCNUEJGT4ÒEMUGKVGPDGUEJTGKDWPI   44*ÒDUEJG2CVKPCYKP\-TCV\GTHCUVXQT\ÒINKEJ




SAYN

3182



3183

5#%*5'0/'+0+0)'0*'4<1)67/810$+55#%*5'0  %1$74)/'+0+0)'0 $GTPJCTF)TQUEJGP)TQDG

48QT\ÒINKEJ



5#%*5'05##.('.&*'4<1)67/#$5#%*5'0%1$74)5##.('.& 

,QJCPP'TPUV8+++)TQUEJGP5CCNHGNFCWHUGKPGP6QF-Q\KPQYUMK1VVQ4W­ 8QT\ÒINKEJ



3185

3184

3184



'TPUV+-QPX6CNGT/KV4CPFUEJTKHV'+052'%+'56*#.'4#-5&CX -CJPV6JWP 9KP\5EJTÌVNKPIUHGJNGTUGJTUEJÌPpXQT\ÒINKEJ





-TGW\GTHÒT%QDWTI#-5,



48QT\ÒINKEJp5VGORGNINCP\

3186

3188

3188



 -TGW\GT  HÒT %QDWTI 8CTKCPVGOKV%1$74))16*#KPFGT8QTFGTUGKVGPWOUEJTKHV#-5 #PO, /KPLWUVKGTVXQT\ÒINKEJp5VGORGNINCP\



5#%*5'0%1$74)70&)16*#*'4<1)67/ 

.QV -W*GNNGT    2HGPPKI  -W*GNNGT     -TGW\GT     -Q\KPQYUMK1VVQ4W­DC&C\W $TQP\GOGFCKNNG  XQP *GNHTKEJV CWH FKG 8GTO·JNWPI XQP *GT\QI 'TPUV OKV /CTKC #PVQKPGVVG XQP   9ÒTVVGODGTI-NGKP4CHHC5NI/GTUGD  5VÒEM#W­GTIGYÌJPNKEJG5GTKGKPRTCEJVXQNNGP'TJCNVWPIGP 8QT\ÒINKEJp5VGORGNINCP\



5#;0 5#;09+66)'056'+0*1*'056'+0)4#(5%*#(6 

)WUVCX6CNGT'NNTKEJ&CX/,8  -N5VGORGNHGJNGTCO4CPFXQT\ÒINKEJ

 275


SCHLESIEN

3190 3189

3189



-TGW\GT 6CNGT $GTNGDWTI&CX/,8  9KP\5EJTÌVNKPIUHGJNGTHCUVXQT\ÒINKEJ



5%*#7/$74).+22' 5%*#7/$74).+22')4#(5%*#(65'+6(ª456'067/ 

#FQNH)GQTI8GTGKPUVCNGT#-5&CX-CJPV6JWP  (GKPG2CVKPCXQT\ÒINKEJp5VGORGNINCP\



3191 3192

3192

5%*.'5+'0 .+')0+6<$4+')*'4<1)67/ 

)GQTI4WFQNHCNNGKP-KRRGT-TGW\GTWPDGMCPPVG/ÒP\UV·VVG(W55NI -TCC\p 5GJTUEJÌP





)GQTI .WFYKI WPF %JTKUVKCP  4GKEJUVCNGT  $TKGI /KV IGTCFGO 9CRRGPUEJKNF WPF   QJPG/ÒP\OGKUVGT\GKEJGP'9CWHFGT4ÒEMUGKVG&CX#XCT(W5XCT  (CUUWPIUURWTGPUGJTUEJÌP



3194 3193

3193

,)'40&14(*'4<1)67/ 

)GQTI(TKGFTKEJ&QRRGNVGT4GKEJUVCNGT,·IGTPFQTH&CX(W5 4#VVTCMVKXGU'ZGORNCTOKVJÒDUEJGT2CVKPCYKP\4CPFHGJNGTUGJTUEJÌPpXQT\ÒINKEJ



5%*.'5+5%*'56&6' 

5EJYGKFPKV\-KRRGT-TGW\GTOKV6KVGN(GTFKPCPFU++(W55NI-TCC\p  44-N2T·IGUEJY·EJGCO4CPFUGJTUEJÌP



.165  276

-QPXQNWVXQP\WOGKUVUEJNGUKUEJGP-NGKPOÒP\GPFGU,CJTJWPFGTVUXQO-TGW\GTDKU\W-TGW \GT+PVGTGUUCPVGU.QVDKVVGDGUKEJVKIGP 5VÒEM5EJÌPpUGJTUEJÌP




SCHONGAU

3196

3197

3197

5%*.'59+)*1.56'+0 -¤0+).+%*&0+5%*'4#06'+. 

(TKGFTKEJ 8+  5RGEKGUVCNGT  #NVQPC &CX  FQTV WPVGT &·PGOCTM  *GFG  &   .CPIGp 2CVKPCXQT\ÒINKEJp5VGORGNINCP\



*1.56'+0).ª%-5$74)*'4<1)67/ 

%JTKUVKCP  4GKEJUVCNGT  )NÒEMUDWTI CWH FGP 6QF UGKPGT )GOCJNKP 5KD[NNC 7TUWNC   I)GMTÌPVGU&QRRGNYCRRGPÒDGT<GKNGP5EJTKHV<YGK'PIGNHÒJTGPFKGCWH9QNMGPUVGJGPFG *GT\QIKP\WO*KOOGNQDGP'PIGNOKV<YGKIWPF-TCP\WPVGTUVTCJNGPFGO0COGP,GJQXCUFCTKPFCU .COO)QVVGUOKV(CJPGWPVGP6QVGPIGTKRRGOKV-TGW\&CXp.CPIG  *ÒDUEJG2CVKPCYKP\5EJTÌVNKPIUHGJNGTCO4CPFUGJTUEJÌP  %JTKUVKCP*GT\QIXQP*QNUVGKP)NÒEMUDWTIYWTFGCO,WPKCNUFTKVVGT5QJPFGU*GT\QIU2JKNKRRWPFUGKPGT )GOCJNKP5QRJKG*GFYKIXQP5CEJUGP.CWGPDWTIIGDQTGP+O,CJTGGTDVGGTCNUGKP\KIGTÒDGTNGDGPFGT5QJP FCU*GT\QIVWOWPFYWTFGCNUIWVGT*CWUJGTTXQPUCPHVGT)GOÒVUCTVIGTÒJOV'TXGTO·JNVGUKEJCO5GRVGODGT OKV5KD[NNC7TUWNC6QEJVGTFGU*GT\QIU#WIWUVXQP$TCWPUEJYGKI9QNHGPDÒVVGN5KGYWTFGIGDQTGPWPF UVCTD5KGICNVCNUGKPGIGNGJTVGWPFIQVVGUHÒTEJVKIG&COGWPFYCTFGTNCVGKPKUEJGP5RTCEJGO·EJVKI*GT\QI %JTKUVKCP JGKTCVGVG  GKP \YGKVGU /CN UGKPG %QWUKPG #IPGU *GFYKI 6QEJVGT FGU *GT\QIU ,QCEJKO 'TPUV XQP   *QNUVGKP2NÌP'TUVCTDUEJNKG­NKEJCO0QXGODGTWPFYWTFGKP)NÒEMUDWTIDGKIGUGV\V

3201 3198

3199

3200

5%*10)#7 *'4<1).+%*$#;'4+5%*'/ª0<5666' 

-QPTCFKP$TCMVGCVI)GMTÌPVGU$TWUVDKNFXXWOJGT4CPMGP$GTIGT)GD JCTV5VGKPJKNDGT 5GJTUEJÌP





.WFYKI ++ XQP $C[GTP  $TCMVGCV  I )GMTÌPVG $ÒUVG X X OKV 5EJYGTV WPF 2CNO   \YGKI$GTIGT)GDJCTV5VGKPJKNDGT 5GJTUEJÌP





$TCMVGCVI)GMTÌPVG$ÒUVGXX\YKUEJGP\YGK4KPIGNPKPDGKFGP*·PFGPLGGKP6WTO$GTIGT )GDJCTV5VGKPJKNDGT (CUVXQT\ÒINKEJ



56#&6 

*GNNGTQ, ,CJTJWPFGTV 5VGKPJKNDGT

45GJTUEJÌP



&KG<WYGKUWPIFGUXQTNKGIGPFGP'ZGORNCTUKUVPKEJV\YGKHGNUHTGKIGUKEJGTV

277


SCHWÄBISCHER BUND

3202

5%*9$+5%*)/ª0&

56#&6 

2TCIGT )TQUEJGP Q , FGU DÌJOKUEJGP -ÌPKIU 9GP\GN +++ +8   OKV )GIGPUVGORGN XQP   5EJY·DKUEJ)OÒPFCWHFGT4ÒEMUGKVG'KPJQTP&CTWPVGT)GIGPUVGORGNXQP7NO5VCFVYCRRGP IGVGKN VGTURCPKUEJGT5EJKNF -TWU[5WPF7  4)GIGPUVGORGNHCUVUGJTUEJÌP/ÒP\GHCUVUGJTUEJÌP



5%*9$+5%**#..

56#&6 

3203

2TCIGT )TQUEJGP Q , OKV )GIGPUVGORGN XQP 5EJY·DKUEJ *CNN CWH FGT 4ÒEMUGKVG *CPF CWH -TGW\   -TWU[5 )GIGPUVGORGNHCUVUGJTUEJÌP/ÒP\GUGJTUEJÌP



3205 3204



3204

-QPX6CNGT0ÒTPDGTIOKV6KVGNXQP(TCP\+4CHH

 (GKPG2CVKPCXQT\ÒINKEJp5VGORGNINCP\



5%*9$+5%*'4$70& 

2TCIGT )TQUEJGP Q , FGU DÌJOKUEJGP -ÌPKIU 9GP\GN +++ +8   OKV )GIGPUVGORGN FGU   UEJY·DKUEJGP$WPFGUCWHFGT8QTFGTUGKVG#FNGT-TWU[5  )GIGPUVGORGNHCUVUGJTUEJÌP/ÒP\GUEJÌP

3206

3207



3208



2TCIGT )TQUEJGP Q , FGU DÌJOKUEJGP -ÌPKIU 9GP\GN +++ +8   OKV )GIGPUVGORGN FGU   UEJY·DKUEJGP$WPFGUCWHFGT8QTFGTUGKVG(ÒPH\CEMKIGT5VGTP7OUGKVKI)GIGPUVGORGNXQP7NO5VCFV YCRRGP IGVGKNVGTURCPKUEJGT5EJKNF -TWU[5WPF7  )GIGPUVGORGNHCUVUGJTUEJÌP/ÒP\GUEJÌP





2TCIGT)TQUEJGPQ,FGUDÌJOKUEJGP-ÌPKIU9GP\GN+++ +8 OKV)GIGPUVGORGNFGUUEJY·DKUEJGP $WPFGU CWH FGT 8QTFGTUGKVG (ÒPH\CEMKIGT 5VGTP WPF )GIGPUVGORGN XQP 7NO CWH FGT 4ÒEMUGKVG 5VCFV   YCRRGP IGVGKNVGTURCPKUEJGT5EJKNF -TWU[5WPF7  )GIGPUVGORGNHCUVUGJTUEJÌP/ÒP\GHCUVUGJTUEJÌP



2TCIGT )TQUEJGP Q , FGU DÌJOKUEJGP -ÌPKIU 9GP\GN +++ +8   OKV )GIGPUVGORGN FGU   UEJY·DKUEJGP$WPFGUCWHFGT8QTFGTUGKVG(ÒPH\CEMKIGT5VGTP&CTWPVGT)GIGPUVGORGNXQP7NO5VCFV YCRRGP IGVGKNVGTURCPKUEJGT5EJKNF -TWU[5WPF7  )GIGPUVGORGNUGJTUEJÌP/ÒP\GHCUVUGJTUEJÌP





278


SCHWARZENBERG

3210

5%*9#4<$74) 5%*9#4<$74))4#(5%*#(6 

)ÒPVJGT:.+XQP#TPUVCFVWPF,QJCPP)ÒPVJGTXQP5QPFGTUJCWUGP5RKV\ITQUEJGPQ, #TPUVCFV(KUEJGT&C\W)ÒPVJGT:.+XQP#TPUVCFVCNNGKP)TQUEJGPQ,#TPUVCFV(KUEJGT 5VÒEM.GKEJVIGYGNNVUGJTUEJÌP



5%*9#4<$74)510&'45*#75'0)4#(5%*#(65'+6(ª456'067/ 

)GOGKPUEJCHVNKEJ OKV 5EJYCT\DWTI4WFQNUVCFV  4GKEJUVCNGT  'THWTV 5V /CTVKPUVC   NGT&CX#(KUEJGTE #VVTCMVKXGU'ZGORNCTOKVJÒDUEJGT2CVKPCUGJTUEJÌP

3212

3211





)ÒPVJGT(TKGFTKEJ%CTN++8GTGKPUVCNGT#-5&CX-CJPV6JWP 9KP\-TCV\GTXQT\ÒINKEJp5VGORGNINCP\



5%*9#4<$74)47&1.56#&6)4#(5%*#(65'+6(ª456'067/ 

#NDGTV8GTGKPUVCNGT#-5&CX-CJPV6JWP  -CDKPGVVUVÒEM2TCEJVXQNNG2CVKPCRQNKGTVG2NCVVG 2TQQH



3213

3214

3214



8GTGKPUVCNGT#-5&CX-CJPV6JWP  9KP\-QTTQUKQPUHNGEMXQT\ÒINKEJp5VGORGNINCP\

(ª456'0 



5%*9#4<'0$'4)

(GTFKPCPF 9KNJGNO 'WUGDKWU  4GKEJUVCNGT  -TGOPKV\ CWH UGKPG *QEJ\GKV OKV/CTKC #PPC'TDKPFGT.CPFITCHUEJCHV5WN\ -NGVVICW &CX6CPPKEJ  2CVKPCYKP\4CPFHGJNGTUGJTUEJÌP

 279


SOLMS



3217

3215

3216

,QJCPP0GRQOWM-TGW\GT9KGP6CPPKEJ

(CUVXQT\ÒINKEJ



5+0&'.(+0)'0 /ª0<5666'&'556+(6570&&'481)6'+ 

#PQP[O$TCMVGCVI5VCFVOCWGTOKVFTGK5RKV\VÒTOGP$GTIGTp-NGKP7NOGT %%  442T·IGUEJY·EJGUEJÌPpUGJTUEJÌP



&KG <WYGKUWPI KUV CWHITWPF FGU UEJNGEJVGP 'TJCNVWPIU\WUVCPFGU FGT /ÒP\GPKEJV\YGKHGNUHTGKIGUKEJGTVGUUEJGKPV UKEJLGFQEJOKVITQ­GT9CJTUEJGKPNKEJMGKVWOFGPDGK-NGKP7NOGTWPVGTFGT0TXGT\GKEJPGVGP6[R\WJCPFGNP &CU <KGTMTGW\ WPF FKG $GK\GKEJGP WPVGTJCND FGT 5VCFVOCWGT UKPF DGFKPIV FWTEJ FKG 2T·IGUEJY·EJG CWH FKGUGO   'ZGORNCTPKEJV\WGTMGPPGP



$TCMVGCVI.ÌYGUEJTGKVGVPCEJTWPVGTFTGKVÒTOKIGO6QTIGD·WFG$GTIGTp-NGKP7NOGT %% p

XIN  7PGFKGTV5EJTÌVNKPIUTK­UGJTUEJÌP

3219

3218



3220

51./5 51./5$4#70('.5)4#(5%*#(6 

9KNJGNO/QTKV\-TGW\GT$GKNUVGKP,QUGRJD

445GJTUEJÌP



51./5*1*'051./5)4#(5%*#(6 

2JKNKRR 4GKPJCTF +  4GKEJUVCNGT  9QNHGPDÒVVGN 5QIGPCPPVGT *CJPTGKVCNGT 8CTKCPVG   OKV.KNKGPCPFGPDGKFGP'EMGPFGU5EJKNFGU&CX$,QUGRJ  44-N5COONGTRWP\GCWHFGT8QTFGTUGKVG YKP\5EJTÌVNKPIUTKUUGHGKPG6ÌPWPIUGJTUEJÌPpXQT\ÒINKEJ  )TCH 2JKNKRR 4GKPJCTF  ,WNK  Ó ,WPK  VTCV  KP F·PKUEJG &KGPUVG #NU 5VCVVJCNVGT FGU -ÌPKIU   %JTKUVKCP +8 XQP &·PGOCTM PCJO GT KO UGNDGP ,CJT 9QNHGPDÒVVGN GKP WPF NKG­ KP FGT JGT\QINKEJGP /ÒP\UV·VVG   9QNHGPDÒVVGN)QNFWPF5KNDGTOÒP\GPRT·IGP&GT0COG*CJPTGKVCNGTGPVUVCPFCWUGKPGT#PURKGNWPICWHFCU9QTV 8+%#4++ 8KECTKWU 5VGNNXGTVTGVGT  KP FGT 8QTFGTUGKVGPWOUEJTKHV FC 2JKNKRR 4GKPJCTF UGKPG 8QNNOCEJV FCFWTEJ   OK­DTCWEJV JCVVG FC­ GT FCU 5KNDGTIGUEJKTT FGU *GT\QIU WPF FCU FWTEJ $TCPFUEJCV\WPI FGU .CPFGU IGYQPPGPG   5KNDGTKPLGPG6CNGTXGTOÒP\VG*CJPTGKYWTFGP·ONKEJKO8QNMUOWPFGKP/CPPIGPCPPVFGTXQPUGKPGT(TCWKP FGTGJGNKEJGP6TGWGDGVTQIGPYKTF

 280

4GKEJUVCNGT  9QNHGPDÒVVGN 5QIGPCPPVGT *CJPTGKVCNGT8CTKCPVGOKV$ÒIGNPCPFGT-TQPGFGU/Q PQITCOOU&CX&,QUGRJ 449KP\5EJTÌVNKPIUHGJNGTUGJTUEJÌP 


SOLMS

3221

3222



.WFYKI-TGW\GT )WNFGP *QJGPUQNOU&CX,QUGRJ

45GJTUEJÌP





-TGW\GT )WNFGP *QJGPUQNOU&CX,QUGRJHHXCT  449KP\5EJTÌVNKPIUHGJNGTUGJTUEJÌP





-TGW\GT )WNFGP *QJGPUQNOU&CX



5VÒEM5GJTUEJÌPWPFHCUVUGJTUEJÌP

3226

3225

3224



-TGW\GT )WNFGP *QJGPUQNOU&CX,QUGRJ



-TGW\GT )WNFGP Q,*QJGPUQNOU&CX#,QUGRJ

445GJTUEJÌP



445EJÌPpUGJTUEJÌP



51./54¤&'.*'+/)4#(5%*#(6 

,QJCPP #WIWUV CNNGKP   -TGW\GT )WNFGP   ,CJTGU\CJN KO 5VGORGN CWU  IG·P   FGTV 4ÌFGNJGKO&CX,QUGRJ 445GJTUEJÌPGU'ZGORNCTOKVFWPMNGT2CVKPC

3227



-TGW\GT )WNFGP 4ÌFGNJGKO&CX,QUGRJ



3228

445EJTÌVNKPIUTK­HCUVUGJTUEJÌP



#NDGTV1VVQ4GKEJUVCNGT.CWDCEJOKV6KVGN(GTFKPCPFU++,QUGRJ  8QPITQ­GT5GNVGPJGKV-N5EJTÌVNKPIUHGJNGTUGJTUEJÌP



51./5.#7$#%*)4#(5%*#(6 

281


STOLBERG

3229



3230

3231

%JTKUVKCP #WIWUV  5KNDGTOGFCKNNG  XQP 5VQEMOCTCWHFGP6QFUGKPGU$TWFGTU(TKGF TKEJ /CIPWU )GJCTPKUEJVGU $TWUVDKNF T OKV WOIGNGIVGO /CPVGN8KGTHCEJ DGJGNOVGU 9CRRGP XQP   5QNOU/KP\GPDGTI9KNFGPHGNUWPF5QPPGPYCNFGOOI,QUGRJ  8QPITQ­GT5GNVGPJGKV5VCTMG4CPFXGTRT·IWPIUGJTUEJÌP





5KNDGTOGFCKNNGXQP,)*GNFCWHFGP6QFUGKPGT5EJYGUVGT/CTKG5QRJKG9KNJGNOKPG)GOCJNKP -CTN %JTKUVKCP 'TFOCPPU XQP 9ÒTVVGODGTI1GNU CO /·T\$TWUVDKNFNOKV9KVYGPUEJNGKGT#EJV <GKNGP 5EJTKHV \YKUEJGP )KTNCPFGP QDGP -TQPG CWH GKPGO -KUUGP  OO  I ( W 5    ,QUGRJ 48QT\ÒINKEJGU'ZGORNCTOKVHGKPGT6ÌPWPI





-QPX6CNGT9GTVJGKOCWHFCUIT·HNKEJYGVVGTCWKUEJG&KTGMVQTKWO/KV4CPFUEJTKHV&CX ,QUGRJC 5GJTUEJÌPpXQT\ÒINKEJ



3233

3232

3234



-QPX6CNGT9GTVJGKOCWHFCU,CIFUEJNQ­5QTIGPNQU&CX,QUGRJ  2CVKPCUGJTUEJÌPpXQT\ÒINKEJ



 -TGW\GT  9GTVJGKO CWH FKG )GDWTV UGKPGT 'PMGN 9KNJGNO .WFYKI %JTKUVKCP WPF (TKGFTKEJ   9KNJGNO,QUGRJ 44(GKPG6ÌPWPIXQT\ÒINKEJ

 

561.$'4) 561.$'4))'/'+05%*#(6.+%*  282

.WFYKI ++ #NDTGEJV )GQTI %JTKUVQH + WPF 9QNH 'TPUV  4GKEJUVCNGT  5VQNDGTI   &CX(TKGFGTKEJXCT 45GJTUEJÌP




STRAUBING

3235

564#.570&

56#&6 

5KNDGTOGFCKNNGXQP2*/ÒNNGTCWHFKG4ÒEMMGJTFGUUEJYGFKUEJGP-ÌPKIU-CTN:++CWUFGO VÒTMKUEJGP'ZKNWPFUGKPG#PMWPHVKP5VTCNUWPFCO0QXGODGT PCEJITGIQTKCPKUEJGO-CNGPFGT CO  0QXGODGT  )GJCTPKUEJVGU $TWUVDKNF T OKV WOIGNGIVGO /CPVGN WPF .ÌYGPMQRHUEJWNVGT-CTN   :++UVGJVCPGKPGOTWPFGP#NVCTCPFGOGKPGMPKGPFGYGKDNKEJG(KIWT FCURGTUQPKHK\KGTVG5EJYGFGP  GKP4CWEJQRHGTFCTDTKPIVQDGPJ·NVGKP)GPKWUGKPGP2CNO\YGKIÒDGTFGPUEJYGFKUEJGP-ÌPKIWPF\GKIV \WO*KOOGNOOI'PFTW­GKV(QTUVGT*KNFGDTCPF+5  445GJTCVVTCMVKXGU'ZGORNCTOKVJÒDUEJGT2CVKPCXQT\ÒINKEJ  0CEJFGO UKEJ FKG *QHHPWPIGP FGU UEJYGFKUEJGP -ÌPKIU -CTN :++ CWH GKP $ÒPFPKU OKV FGT 6ÒTMGK PKEJV GTHÒNNV   JCVVGPXGTNKG­GTOKVUGKPGP.GWVGPUEJNKG­NKEJCO5GRVGODGTUGKPKPFGT0·JGXQP#FTKCPQRGN VÒTMKUEJ 'FKTPG IGNGIGPGU'ZKN&GOQVKMCWPFGKNVGKP4KEJVWPI0QTFGP+P2KVGUVK KPFGTTWO·PKUEJGP9CNCEJGKECMO YGUVNKEJ XQP $WMCTGUV  VTGPPVG UKEJ-CTN:++XQPUGKPGT/CPPUEJCHVWPFGKNVGWPVGTFGO&GEMPCOGP%CTN(TKUM PWTXQP\YGK1HHK\KGTGPDGINGKVGVÒDGT*GTOCPPUVCFV9KGP4GIGPUDWTI0ÒTPDGTIWPF-CUUGNPCEJ5VTCNUWPFYQ GTCO0QXGODGTGKPVTCH&KG4ÒEMUGKVGPWOUEJTKHVGTN·WVGTV4'&&+675'1+52#64+#/51.#674#$ 14+5  <WTÒEMIGIGDGP XQO 1TKGPV URGPFGV GT UGKPGO 8CVGTNCPF 6TQUV  #WH FGO #NVCT YKTF HÒT FKG UKEJGTG   4ÒEMTGKUGIGFCPMV(14680“4'&8%+ &GT5EJKEMUCNUIÌVVKPFGTINÒEMNKEJGP4ÒEMMGJT 

3237

3236

3236



7PVGT5EJYGFGP-CTN:++5KNDGTOGFCKNNGXQP&)XQP*CEJVGP*CODWTIPCEJ GKPGO'PVYWTHXQP*CPUXQP$QRHKPIGPCWHFKG4ÒEMMGJTFGUUEJYGFKUEJGP-ÌPKIU-CTN:++CWUFGO VÒTMKUEJGP'ZKNWPFUGKPG#PMWPHVKP5VTCNUWPFCO0QXGODGT PCEJITGIQTKCPKUEJGO-CNGPFGT CO0QXGODGT (COCOKV6TQORGVGWPF8KMVQTKCOKV2CNO\YGKIJCNVGPGKPGP.QTDGGTMTCP\OKVFGO $TWUVDKNF FGU UEJYGFKUEJGP -ÌPKIU -CTN :++'KP 6GKN FGU 6KGTMTGKUGU CWH FGO\YKUEJGP5VGTPGPFKG <GKEJGPFGU5VGKPDQEMUFGU.ÌYGPFGT,WPIHTCWWPFFGU9KFFGTU\WUGJGPUKPFWPVGP5QPPGPCWHICPI ÒDGTFGO'TFDCNN/KV4CPFUEJTKHVOOI'PFTW­GKV*KNFGDTCPF+5  8QPITQ­GT5GNVGPJGKV(GKPG2CVKPCXQT\ÒINKEJGU'ZGORNCT



0CEJFGO UKEJ FKG *QHHPWPIGP FGU UEJYGFKUEJGP -ÌPKIU -CTN :++ CWH GKP $ÒPFPKU OKV FGT 6ÒTMGK PKEJV GTHÒNNV   JCVVGPXGTNKG­GTOKVUGKPGP.GWVGPUEJNKG­NKEJCO5GRVGODGTUGKPKPFGT0·JGXQP#FTKCPQRGN VÒTMKUEJ 'FKTPG IGNGIGPGU'ZKN&GOQVKMCWPFGKNVGKP4KEJVWPI0QTFGP+P2KVGUVK KPFGTTWO·PKUEJGP9CNCEJGKECMO YGUVNKEJ XQP $WMCTGUV  VTGPPVG UKEJ-CTN:++XQPUGKPGT/CPPUEJCHVWPFGKNVGWPVGTFGO&GEMPCOGP%CTN(TKUM PWTXQP\YGK1HHK\KGTGPDGINGKVGVÒDGT*GTOCPPUVCFV9KGP4GIGPUDWTI0ÒTPDGTIWPF-CUUGNPCEJ5VTCNUWPFYQ GTCO0QXGODGTGKPVTCH

56#&6 

564#7$+0)

2TCIGT )TQUEJGP Q , FGU DÌJOKUEJGP -ÌPKIU 9GP\GN +++ +8   OKV )GIGPUVGORGN XQP   5VTCWDKPICWHFGT4ÒEMUGKVG2HNWI-TWU[5 44)GIGPUVGORGNHCUVUGJTUEJÌP/ÒP\GUEJÌP

 283


ÜBERLINGEN

3238



3240

64+'4

'4<$+567/

5GFKUXCMCP\4GKEJUVCNGTX5EJT<GRGTPKEM

5GJTUEJÌPpXQT\ÒINKEJ

*WIQ +  2HGPPKI  I &TGK 6ÒTOG ÒDGT 4CWVG FCTKP -TGW\ 5NI $QPJQHH XIN    *ÌEJUVYCJTUEJGKPNKEJWPGFKGTVG8CTKCPVG&WPMNG2CVKPCMPCRRGT5EJTÌVNKPIHCUVUGJTUEJÌP

&KG <WYGKUWPIFGUXQTNKGIGPFGP'ZGORNCTUKUVPKEJV\YGKHGNUHTGKIGUKEJGTV&CU/ÒP\DKNF·JPGNVLGFQEJUVCTMFGP XQP'0CW <GKVFGT5VCWHGT$F++6HHH PCEJ6ÒDKPIGPIGNGIVGP)GRT·IGP.GFKINKEJFCU$GK\GKEJGPKUV CPFGTUCPUVGNNGGKPGU4KPIGNUGTUEJGKPVJKGTGKPINGKEJCTOKIGU-TGW\



ª$'4.+0)'0

56#&6 



6ª$+0)'0

)4#(5%*#(6 

3239

5EJKNNKPIQ, PCEJ /QPGVC2CTXC 4KPIGTG/ÒP\ .GDGME0CW  4.GKEJVG2T·IGUEJY·EJGHCUVUGJTUEJÌP

0CEJFGO#WUUEJGKFGPCWUFGO4KGFNKPIGT8GTVTCIRT·IVGOCPKPªDGTNKPIGP5EJKNNKPIG2HGPPKIGWPF*GNNGT PCEJ 4KGFNKPIGT 6[R CDGT \W IGTKPIGTGO 5EJTQV WPF -QTP &KGUG /ÒP\GP YWTFGP /QPGVC 2CTXC 4KPIGTG   /ÒP\QFGT-WP\GPOÒP\IGPCPPV

3241

3242



3243



'KPUGKVKIGT 2HGPPKI Q , PCEJ   8GTYKNFGTVGT 5VGORGNUEJPKVV OKV UVCTM JGTCWUIGCTDGKVGVGO   5EJYCP\FGU.ÌYGP%CJPH.GDGM\W0CW .GKEJVG2T·IGUEJY·EJGUGJTUEJÌP





'KPUGKVKIGT 2HGPPKI Q , PCEJ   )TQDGT 5VGORGNUEJPKVV OKV YGPKIGT ITQ­GP 2GTNGP %CJP  H   .GDGM\W0CW .GKEJVG2T·IGUEJY·EJGUGJTUEJÌP





'KPUGKVKIGT2HGPPKIQ, PCEJ (GKPGT5VGORGNUEJPKVVOKV\CJNTGKEJGP2GTNGPKO2GTNMTGKU%CJP H.GDGM\W0CW .GKEJVG2T·IGUEJY·EJGUGJTUEJÌP



3244

3245

3246



'KPUGKVKIGT2HGPPKIQ, PCEJ %CJPH.GDGM\W0CW  .GKEJVG2T·IGUEJY·EJGUGJTUEJÌP





'KPUGKVKIGT2HGPPKIQ, PCEJ %CJPH.GDGM\WWPF5#DD0CW  .GKEJVG2T·IGUEJY·EJGUGJTUEJÌP





'KPUGKVKIGT2HGPPKIQ, PCEJ %CJPH.GDGMWPF5#DD0CW  .GKEJVG2T·IGUEJY·EJGUGJTUEJÌP



)GRT·IVPCEJFGO#WUVTKVVFGT5VCFVCWUFGO8GTVTCIXQP4KGFNKPIGPKO,CJTG&COKVYWTFGFKGGKPJGKVNKEJG 9·JTWPIKO$QFGPUGGTCWOGTUVOCNUFWTEJDTQEJGP

284


ULM

1,5:1

3247

7./

4'+%*5/ª0<5666' 

1,5:1

3248

 ,CJTJWPFGTV $TCMVGCV XGTOWVNKEJ WO   I 5VCFVOCWGT FCTÒDGT IGMTÌPVGT D·TVKIGT   -QRH N \YKUEJGP \YGK 6ÒTOGP WPVGP OGPUEJNKEJG )GUVCNV X X OKV (NÒIGNP $GTIGT p -NGKP7NOGT  

%% p XIN  8QPITQ­GT5GNVGPJGKV)GYGNNVUQPUVHCUVXQT\ÒINKEJ



&KGUGTGZVTGOUGNVGPG$TCMVGCV·JPGNVFGOXQP7NTKEJ-NGKPWPF4CKPGT7NOGT %QPEQTFCPVKCG%QPUVCPVKGPUGU WPVGT 0TXGT\GKEJPGVGP7NOGT2HGPPKI9KTJCDGPFKGXQTNKGIGPFG2T·IWPIFCJGTGDGPHCNNU7NO\WIGQTFPGV



(TKGFTKEJ++$TCMVGCVWOIªDGTGKPGT$CNWUVTCFGGKP6WTO&TGKGEM(CJPG WPFGKPPCEJNIGTKEJVGVGU$TWUVDKNFWPVGTFGT$CNWUVTCFGGKP4KPIGN$GTIGTp-NGKP7NOGT %%  44.GKEJVIGYGNNVUQPUVIWVCWUIGRT·IVGUUGJTUEJÌPGU'ZGORNCT



7NTKEJ -NGKP WPF 4CKPGT 7NOGT %QPEQTFCPVKCG %QPUVCPVKGPUGU  MCVCNQIKUKGTGP FKGUGP ·W­GTUV UGNVGPGP $TCMVGCVGP   WPVGT FGP WPDGUVKOOVGP F[PCUVKUEJGP WPF TGKEJUXÌIVKUEJGP/ÒP\UV·VVGP9KTQTFPGPFKGUGKO9·JTWPIUIGDKGVFGU -QPUVCP\GT2HGPPKIUGPVUVCPFGPG2T·IWPIXGTUWEJUYGKUGFGT4GKEJUOÒP\UV·VVG7NO\W

3249

3251

3250

3252

56#&6 

2TCIGT)TQUEJGPQ,OKV)GIGPUVGORGNXQP7NOCWHFGT4ÒEMUGKVG5VCFVYCRRGP IGVGKNVGTURCPKUEJGT 5EJKNF -TWU[70CW )GIGPUVGORGNUGJTUEJÌP/ÒP\GUEJÌP





2TCIGT)TQUEJGPQ,OKV)GIGPUVGORGNXQP7NOCWHFGT8QTFGTUGKVG5VCFVYCRRGP IGVGKNVGTURCPKUEJGT 5EJKNF -TWU[70CW )GIGPUVGORGNUGJTUEJÌP/ÒP\GUEJÌPOKV5EJTÌVNKPIUTK­





2TCIGT)TQUEJGPQ,OKV)GIGPUVGORGNXQP7NOCWHFGT4ÒEMUGKVG5VCFVYCRRGP IGVGKNVGTURCPKUEJGT 5EJKNF -TWU[70CW )GIGPUVGORGNHCUVUGJTUEJÌP/ÒP\GUEJÌP





2TCIGT)TQUEJGPQ,OKV)GIGPUVGORGNXQP7NOCWHFGT8QTFGTUGKVG5VCFVYCRRGP IGVGKNVGTURCPKUEJGT 5EJKNF -TWU[70CW )GIGPUVGORGNUGJTUEJÌP/ÒP\GUEJÌP



3253

3254



*GNNGTQ, PCEJ 0CW



4GKEJUVCNGTOKV6KVGN(GTFKPCPFU++&CX0CW

3254

4(CUVUGJTUEJÌP



(CUUWPIUURWTGPUGJTUEJÌP

 285


WESTFALEN

3256

3255



3255

4GKEJUVCNGTOKV6KVGN(GTFKPCPFU++&CXXCT0CW  44#VVTCMVKXGUUGJTUEJÌPGU'ZGORNCT



9#..'056'+0 

#NDTGEJV*GT\QIXQP(TKGFNCPF-TGW\GT )TQUEJGP 5CICP0QJGLNQX±2T±VQX± 5GJTUEJÌP



3257

9'4&'070&*'./56'&6

#$6'+ 

*WIQ 2TGWV·WU   5EJKNNKPI Q , OKV 6KVGN XQP /CVVJKCU )TQVG  C FQTV CNU 5EJKNNKPI   DG\GKEJPGV  45GJTUEJÌP



3259

3258

-¤0+)4'+%* 

3258

9'56(#.'0

*KGTQP[OWU0CRQNGQP5KNDGTOGFCKNNGXQP$#PFTKGWWPF0)$TGPGV9GTMUVCVV &8&GPQPCWHFKG'TTKEJVWPIFGU-ÌPKITGKEJGU9GUVHCNGP$ÒUVGTOKV.QTDGGTMTCP\7PDGMNGKFGVGT /CPP OKV .QTDGGTMTCP\ UVGJV PCEJ T WPF J·NV FCU YGUVH·NKUEJG 4Q­  OO  I 5NI ,WNKWU   <GKV\ *ÒDUEJG2CVKPCXQT\ÒINKEJ %GPVKOGU%#-5, (GKPG2CVKPCXQT\ÒINKEJp5VGORGNINCP\

 



.QVU  6CNGT  %  %  %  %  %  % #-5  Z   Z   Z    , Z  Z  Z &C\W6CNGT /CTKGPITQUEJGP $#-5,  5VÒEM5GJTUEJÌPpXQT\ÒINKEJ





5KNDGTOGFCKNNG  XQP $ #PFTKGW 9GTMUVCVV & 8 &GPQP CWH FGP /ÒP\DGUWEJ FGU MÌPKINKEJGP   2CCTGUKP2CTKU&C\WGKPYGKVGTGU'ZGORNCTKP$TQP\GCWHFGPUGNDGP#PNC­$TQP\GOGFCKNNGXQP $ #PFTKGW CWH UGKPG 8GTO·JNWPI OKV -CVJCTKPG 6QEJVGT -ÌPKI (TKGFTKEJU XQP 9ÒTVVGODGTI   $TQP\GOGFCKNNG  XQP $ #PFTKGW 9GTMUVCVV & 8 &GPQP CWH FKG 'TTKEJVWPI FGU -ÌPKITGKEJGU   9GUVHCNGP$TQP\GOGFCKNNGXQP##DTCOUQPCWHFKG)NGKEJDGTGEJVKIWPIFGT,WFGPKP9GUVHCNGP 5VÒEM4CPFHGJNGT Z XQT\ÒINKEJ





286


WISMAR

3262

3263

3263

56#&6

9+5/#4



9KVVGPQ, CDEC -WP\GN.IXCT

45GJTUEJÌP



 4GKEJUVCNGT  5EJKNNKPI   OKV 6KVGN 4WFQNHU ++ -WP\GN XIN  FQTV CPFGTG 7OUEJTKHV WPF   OKV/ÒP\OGKUVGT\GKEJGP,/  8QPITQ­GT5GNVGPJGKV.GKEJVG(CUUWPIUURWTGPHCUVUGJTUEJÌP

 

3264



&QRRGNUEJKNNKPI  6CNGT   FGT 5VCFV 5VCFG OKV 6KVGN XQP /CVVJKCU WPF OKV )GIGPUVGORGN XQP   9KUOCT  CWHFGT8QTFGTUGKVG9CRRGP-WP\GN5p 445GJTUEJÌP



3265



5KNDGTOGFCKNNGQ,  XQP,*GTEWNGUCWHFKG'TQDGTWPIFGT5VCFVFWTEJFKG&·PGPCO&G \GODGTWPFFGPHGKGTNKEJGP'KP\WIFGUF·PKUEJGP-ÌPKIURCCTGUKPFKG5VCFVCO&G\GODGT&KG *ÒHVDKNFGT FGU -ÌPKIU %JTKUVKCP 8 XQP &·PGOCTM OKV (GNFDKPFG WPF 'NGHCPVGPQTFGP WPF UGKPGT )G   OCJNKP %JCTNQVVG #OCNKG XQP *GUUGP-CUUGN UKEJ WOCTOGPF PGDGPGKPCPFGT T&GT -ÌPKI ICNQRRKGTV   KP XQNNGT 4ÒUVWPI OKV *GNO -QOOCPFQUVCD WPF 'NGHCPVQTFGP PCEJ T FKG 2HGTFGFGEMG VT·IV FCU IG   MTÌPVG/QPQITCOO%JTKUVKCPUKO*KPVGTITWPFGKPG/GPIG5QNFCVGPCO*QTK\QPVFKG5VCFVCPUKEJVXQP 9KUOCTOOI)CNUVGT)TKOO FQTV,*ÌJPCNU/GFCKNNGWTCPIGIGDGP 1UUDCJT 8QPITQ­GT5GNVGPJGKV#VVTCMVKXGU'ZGORNCTOKVJGTTNKEJGT2CVKPCUGJTUEJÌP  0CEJFGT0KGFGTNCIGFGT5EJYGFGPDGK(GJTDGNNKPCO,WPKUEJNQ­UKEJCWEJ%JTKUVKCP8XQP&·PGOCTM

  QHHGP FGP )GIPGTP 5EJYGFGPU CP 'T YQNNVG IGOGKPUCO OKV (TKGFTKEJ 9KNJGNO FGO )TQ­GP   -WTHÒTUVGP FKG 5EJYGFGP CWU KJTGP FGWVUEJGP $GUKV\WPIGP XGTVTGKDGP &KG DGKFGP 8GTDÒPFGVGP VTCHGP UKEJ KO   1MVQDGTXQT5VTCNUWPFDGUEJNQUUGPCDGT\WP·EJUVFGP#WHUEJWDGKPGT$GNCIGTWPIFGTXQTRQOOGTUEJGP5VCFV &GT F·PKUEJG -ÌPKI \QI FCTCWHJKP PCEJ 9KUOCT YQ 5EJYGFGP UGKPGP ITÌ­VGP WPF CNU #WUICPIURWPMV HÒT GKPGP   #PITKHH CWH &·PGOCTM CO DGUVGP IGGKIPGVUVGP *CHGP CP FGT FGWVUEJGP 1UVUGGMÒUVG DGUC­ #O  1MVQDGT    DGICPP FGT $GUEJW­ WPF FKG $GNCIGTWPI FGT 5VCFV FKG WPVGT FGO -QOOCPFQ FGU UEJYGFKUEJGP )GPGTCNNGWVPCPVU   )WUVCX 9TCPIGN UVCPF &KG HÒT FKG 8GTVGKFKIWPI FGT OGEMNGPDWTIKUEJGP 5VCFV DGUQPFGTU YKEJVKIG WPF CWH FGT   5VCFVCPUKEJV FGT XQTNKGIGPFGP /GFCKNNG KO 8QTFGTITWPF IWV GTMGPPDCTG +PUGNHGUVWPI 9CNHKUEJ HKGN DGTGKVU CO    0QXGODGT  KP F·PKUEJG *·PFG 6TQV\ VCRHGTGT 8GTVGKFKIWPI IGNCPI FGP &·PGP WPVGT (ÒJTWPI FGU   )GPGTCNNGWVPCPVU0KGNU4QUGPMTCPV\CO&G\GODGTUEJNKG­NKEJFGT5VWTOCWHFKG5VCFV9TCPIGNMCRKVWNKGTVG CO&G\GODGT

287


WÜRTTEMBERG

3266

3267

3267

-¤0+).+%*'/ª0<5666' 

914/5

*GKPTKEJ+++2HGPPKII)GMTÌPVGU$TWUVDKNFXXOKV4GKEJUCRHGNWPF-TGW\UVCD -TGW\GKPG-WIGNKPLGFGO9KPMGNKOGTUVGP9KPMGNFCU<GKEJGPXQP9QTOU,QUGRJ  4ªDNKEJG2T·IGUEJY·EJGUEJÌP



8IN FGP -QOOGPVCT DGK -NWIG $ &GWVUEJG /ÒP\IGUEJKEJVG XQP FGT UR·VGP -CTQNKPIGT\GKV DKU \WO 'PFG FGT   5CNKGT 5KIOCTKPIGP  5  *ÌEJUV KPVGTGUUCPV KUV FKG 'PVYKEMNWPI KP FGP FTGK OKV FGP $KUEJÌHGP IGVGKNVGP   /ÒP\UV·VVGP FGU -ÌPKIVWOU =? )GIGPÒDGT GKPGT TGNCVKX FÒTHVKIGP /CKP\GT2T·IWPIHCNNGPFKGQRWNGPVGPWPFXQT CNNGOUVKNKUVKUEJCWUIG\GKEJPGVGP/ÒP\TGKJGPKP9QTOUWPF5RG[GTCWH

56#&6 

5KNDGTOGFCKNNGWPUKIPKGTVCWHFKG)TWPFUVGKPNGIWPIFGUPGWGP-TCPMGPWPF9CKUGPJCWUGU5VCFV CPUKEJV XQP FGT 4JGKPUGKVG KO #DUEJPKVV 9CRRGP XQP \YGK IGHNÒIGNVGP .ÌYGP IGJCNVGP)GD·WFGCP   UKEJVOOI,QUGRJ5NI$TGVVCWGT 44*ÒDUEJG2CVKPCXQT\ÒINKEJ

3269

3268



3270

9ª466'/$'4) 9ª466'/$'4)*'4<1)67/5'+6-¤0+)4'+%* 

'DGTJCTF+++FGT/KNFG*GNNGTQ, IGRT·IVPCEJFGO-KTEJJGKOGT8GTVTCIXQP  5VWVVICTVQFGT)ÌRRKPIGP-NGKP4CHH 44(CUVUGJTUEJÌP





*GNNGTQ, IGRT·IVPCEJFGO8GTVTCIXQP 5VWVVICTV-NGKP4CHH





*GNNGT Q , IGRT·IV PCEJ FGO 8GTVTCI XQP   5VWVVICTV 'KP \YGKVGU 'ZGORNCT XQP XCTKKGTGPFGP   5VGORGNP-NGKP4CHH 44(CUVUGJTUEJÌP

3271

3272

3273

44(CUVUGJTUEJÌP



3274



.WFYKI+5EJKNNKPIQ, PCEJ 5VWVVICTV-NGKP4CHH  4.GKEJVG-PKEMURWTHCUVUGJTUEJÌP





5EJKNNKPIQ, PCEJ 5VWVVICTV-NGKP4CHH

4(CUVUGJTUEJÌP





5EJKNNKPIQ, PCEJ 5VWVVICTV-NGKP4CHHC

4-N-TCV\GTHCUVUGJTUEJÌP





5EJKNNKPIQ, PCEJ 5VWVVICTV-NGKP4CHHXCT

4(CUVUGJTUEJÌP



288


WÜRTTEMBERG

3275

   

5EJKNNKPIQ, PCEJ 5VWVVICTV-NGKP4CHH 4(CUVUGJTUEJÌP 5EJKNNKPIQ, PCEJ 5VWVVICTV-NGKP4CHH 4.GKEJVFG\GPVTKGTVHCUVUGJTUEJÌP 5EJKNNKPIQ, PCEJ 5VWVVICTV-NGKP4CHHXCT 4ÒEMUGKVG  45GJTUEJÌP 5EJKNNKPIQ, PCEJ 5VWVVICTV-NGKP4CHH 4(CUVUGJTUEJÌP

3279

   

3278

3277

3276

3280

3281

3282

5EJKNNKPIQ, PCEJ 5VWVVICTV-NGKP4CHHXCT 4ÒEMUGKVGC  5EJKNNKPIQ, PCEJ 5VWVVICTV-NGKP4CHH 5EJKNNKPIQ, PCEJ 5VWVVICTV-NGKP4CHHXCT 5EJKNNKPIQ, PCEJ 5VWVVICTV-NGKP4CHH

3283

3284

3285

3286

   

4(CUVUGJTUEJÌP 4(CUVUGJTUEJÌP 45GJTUEJÌP 4(CUVUGJTUEJÌP

3287

   

3288

   

'KPUGKVKIGT2HGPPKIQ, PCEJ 5VWVVICTV-NGKP4CHH .GKEJVG2T·IGUEJY·EJGUGJTUEJÌP 'KPUGKVKIGT2HGPPKIQ, PCEJ 5VWVVICTV-NGKP4CHH 49KP\5EJTÌVNKPIUTK­UGJTUEJÌP 'KPUGKVKIGT2HGPPKIQ, PCEJ 5VWVVICTV-NGKP4CHH /KP2T·IGUEJY·EJGXQT\ÒINKEJ 'KPUGKVKIGT2HGPPKIQ, PCEJ 5VWVVICTV-NGKP4CHHC 4/KP2T·IGUEJY·EJGXQT\ÒINKEJ

   



7NTKEJ8FGT8KGNIGNKGDVG'KPUGKVKIGT2HGPPKIQ,  5VWVVICTV-NGKP4CHH  5GJTUEJÌP





'KPUGKVKIGT2HGPPKIQ,  5VWVVICTV-NGKP4CHH



3289

3290

-N2T·IGUEJY·EJGUGJTUEJÌP

3291



'DGTJCTF8KO$CTV'KPUGKVKIGT2HGPPKIQ,  6ÒDKPIGP-NGKP4CHH  44/KP2T·IGUEJY·EJGUQPUVHGKPCWUIGRT·IVGUXQT\ÒINKEJGU'ZGORNCT





7NTKEJ8'DGTJCTF8WPF%JTKUVQRJXQP$CFGP5EJKNNKPIQ,  6ÒDKPIGP5VGO RGNUEJPGKFGT*CPU9[FGPDGKP-NGKP4CHH 449KP\5EJTÌVNKPIUHGJNGTCO4CPFUGJTUEJÌP



8IN FGP -QOOGPVCT DGK -NGKP4CHH 5  8QP FGP )GOGKPUEJCHVUUEJKNNKPIGP KUV FGT 6[R OKV FGT IQVKUEJGP   &TGKRC­XGT\KGTWPI KP FGP /ÒP\MCDKPGVVGP WPF ITQ­GP 2TKXCVUCOONWPIGP YGUGPVNKEJ UGNVGPGT XGTVTGVGP &KG   8GTOWVWPINKGIVPCJGFC­GUUKEJFCDGKWOFKGLGPKIGP5EJKNNKPIGJCPFGNVFKGHÒT$CFGPDGUVKOOVYCTGP



'DGTJCTF+++'KPUGKVKIGT2HGPPKIQ,5EJÒUUGNRHGPPKI-NGKP4CHH  -PKEMURWTYKP\5EJTÌVNKPIUHGJNGTCO4CPFHCUVXQT\ÒINKEJ

 289


WÜRTTEMBERG

3293

3292

3294



9KNJGNO+-TGW\GT#-5, (GKPG2CVKPCOKPLWUVKGTVHCUV5VGORGNINCP\





-TQPGPVCNGT  *CPFGNUHTGKJGKV &KG 8QTFGTUGKVGPWOUEJTKHV DGIKPPV CO JKPVGTGP 6GKN FGU *CNUCD   UEJPKVVGU#-5&CX-CJPVC6JWP 8QT\ÒINKEJp5VGORGNINCP\





8GTGKPUFQRRGNVCNGT  8GTO·JNWPI FGU -TQPRTKP\GP -CTN OKV 1NIC )TQ­HÒTUVKP XQP 4W­NCPF /KV   4CPFUEJTKHV 8'4'+05/ª0<' 8++'+0'(/#4-#-5&CX-CJPVC6JWP 5GJTUEJÌPpXQT\ÒINKEJ



3295

3296

3297



-CTN8GTGKPUVCNGT/KVJGTCDJ·PIGPFGO)GYGKJ#-5#PO&CX-CJPV 6JWP 4(CUVUGJTUEJÌPUGJTUEJÌP





&QRRGNVGT8GTGKPUVCNGT7NOGT/ÒPUVGT#-5&CX-CJPV6JWP  8QT\ÒINKEJp5VGORGNINCP\



9ª466'/$'4)1'.5*'4<1)67/  290

-CTN%JTKUVKCP'TFOCPP4GKEJUVCNGTRTGW­-$$TGUNCW&CX(W5 .GKEJVG*KV\GURWTXQT\ÒINKEJ




WÜRZBURG

3300

3299

3298

3302

3301

9ª4<$74)

$+567/ 

'ODTKEJQ*CNDDTCMVGCVI$TWUVDKNFTOKV/KVTC&TGKVÒTOKIGU)GD·WFG'JYCNF 442T·IGUEJY·EJGHCUVUGJTUEJÌP





*GKPTKEJ++XQP5VÒJNKPIGP&GPCTI$TWUVDKNFNOKV/KVTCFCXQT-TWOOUVCDOKV CPJ·PIGPFGT(CJPG&TGKVÒTOKIGU)GD·WFG'JYCNF  .GKEJVFG\GPVTKGTVWPFÒDNKEJG2T·IGUEJY·EJGHCUVUGJTUEJÌP





&GPCTI$TWUVDKNFXXOKV-TWOOUVCDWPF$WEJ&TGKVÒTOKIGU)GD·WFG'JYCNF  42T·IGUEJY·EJGHCUVUGJTUEJÌP





&GPCTI$TWUVDKNFXXOKV-TWOOUVCDWPF$WEJ&TGKVÒTOKIGU)GD·WFG'JYCNF  42T·IGUEJY·EJGHCUVUGJTUEJÌP





4GIKPJCTFXQP#DGPDGTI&GPCT2T·IWPICWHMNGKPGOFKEMGP5EJTÌVNKPII$KUEJQH VJTQPV X X OKV -TWOOUVCD WPF $WEJ/KVTKGTVGU $TWUVDKNF OKV (CJPG WPF 2CNO\YGKI PCEJ N WPVGT   FTGKDQIKIGT#TEJKVGMVWT'JYCNF 4.GKEJVFG\GPVTKGTVUGJTUEJÌP



3303

3304

3305

3306



)QVVHTKGF + XQP 5RKV\DGTI*GNHGPUVGKP  &GPCT  I /KVTKGTVGU $TWUVDKNF X X OKV   -TWOOUVCDWPF2CNO\YGKI$TWPQOQPQITCOO'JYCNF 4.GKEJVFG\GPVTKGTVUGJTUEJÌP





&GPCT  I /KVTKGTVGU $TWUVDKNF X X OKV -TWOOUVCD WPF $WEJ -TGW\ T KO (GNF&TGKVÒTOKIGU   )GD·WFGÒDGT$QIGPKO6QT-TGW\UVCD'JYCNF 42T·IGUEJY·EJGHCUVUGJTUEJÌP





&GPCTI/KVTKGTVGU$TWUVDKNFXXOKV-TWOOUVCDWPF2CNO\YGKI$TWPQOQPQITCOO'JYCNF 45GJTUEJÌP





1VVQ + XQP .QDFGDWTI  &GPCT  I $TWUVDKNF X X OKV $WEJ WPF -TWOOUVCD&TGK   VÒTOKIGU)GD·WFGÒDGT$QIGPFCTKP-QRH\YKUEJGP\YGK-TGW\GP'JYCNFXCT  2T·IGUEJY·EJGHCUVUGJTUEJÌP



3307

3308

3309



*GTOCPP+XQP.QDFGDWTI&GPCTI$TWUVDKNFXXOKV5EJYGTVWPF$WEJ$TWPQ OQPQITCOO'JYCNF 4.GKEJVG2T·IGUEJY·EJGHCUVUGJTUEJÌP





$GTVJQNF XQP 5VGTPDGTI  2HGPPKI  I $TWUVDKNF X X OKV 5EJYGTV WPF -TWOOUVCD   )GD·WFGÒDGT&TGKDQIGPFCTKP4QUGVVG'JYCNF  5GNVGPKPFKGUGT'TJCNVWPI-N5EJTÌVNKPIUTK­CO4CPFXQT\ÒINKEJ



#PQP[O,CJTJWPFGTV'KPUGKVKIGT2HGPPKII$TWPQOQPQITCOO'JYCNF





8QT\ÒINKEJ

291


WÜRZBURG



3313

3312

3311

3310

#NDTGEJV )TCH XQP 9GTVJGKO CNU 5VKHVURHNGIGT  'KPUGKVKIGT 2HGPPKI  I   'JYCNF 45GJTUEJÌP





'KPUGKVKIGT2HGPPKII'JYCNF

49KP\4CPFHGJNGTWPF2T·IGUEJY·EJGUQPUVUGJTUEJÌP





5KIOWPFXQP5CEJUGP5EJKNNKPIQ, PCEJFGT%QPXGPVKQPXQP 'JYCNF  445EJTÌVNKPIUCWUDTWEJCO4CPFHCUVUGJTUEJÌP





,QJCPP +++ XQP )TWODCEJ  'KPUGKVKIGT 2HGPPKI Q , PCEJ   -QPXGPVKQPURT·IWPI  

 CWHGEMKIGO5EJTÌVNKPI'JYCNF &WPMNG6ÌPWPI2T·IGUEJY·EJGUGJTUEJÌP



+P FGT 4GIKUVTCVWT FGU /CIKUVGTU (TKGU *QJGP JGK­V GU &GU XQNIGPFGP ,CTU   YCTF ITCXG #NDTGEJV XQP   9GTVJCKO FQOJGT \W RHNGIGT FGU UVKHVU 9KV\DWTI IGOCEJV WPF CPIGPQOOGP &GTUGNDKIG RHNGIGT JCV CPIGHCPIGP   RHGPKPI\WOWP\GP&KGYCTGPIGDTGIVOKVFGOUEJKNVGWPFRCPKGTFGUJGTV\QIVWODU\W(TCPMGP 'JYCNF5 

3315

3314

3314



7PVGT UEJYGFKUEJGT $GUCV\WPI #ZGN 1ZGPUVKGTPC  4GKEJUVCNGT Q ,   9ÒT\   DWTII+Û&Ü&Ù#:'.Û1:'056+'40#Û.Û$Û+-Û&Û+Û(Û6Û'Û4Û58Ü%Û .')Ü+Ü)Ü5Ù(ę&Ü'8Ü&+4Û$TWUVDKNFHCUVXXOKVWOIGNGIVGO/CPVGN5RKV\GPMTCIGPWPF 1TFGP FCTWPVGT UGKP 9CRRGPUEJKNF DGFGEMV XQP GKPGT (TGKJGTTGPMTQPG41$14' Û &+8+01 Ü %1   410#6858+0%+6Û.'1&GTIGMTÌPVGUEJYGFKUEJG.ÌYGUEJTGKVGVNOKV-TQPGWPF5EJYGTVQDGP FGTUVTCJNGPFG0COG,GJQXCU#JNUVTÌO 4 &CX*GNOUEJTQVVp  8QPITQ­GT5GNVGPJGKV2TCEJVGZGORNCTOKVHGKPGT6ÌPWPI8QT\ÒINKEJp5VGORGNINCP\ 



,QJCPP2JKNKRRXQP5EJÌPDQTP4GKEJUVCNGT&CX*GNOUEJTQVV  4-N5EJTÌVNKPIUHGJNGTCO4CPFUGJTUEJÌP

3317 3316



3316

#FCO (TKGFTKEJ XQP 5GKPUJGKO   -QPX6CNGT  9ÒT\DWTI *GNOUEJTQVV    8QT\ÒINKEJ



-KRRGT-TGW\GTXQP*GPPGDGTI5·EJUKUEJGT#PVGKN,QJCPP)GQTI+XQP5CEJUGP WPDGMCPPVG /ÒP\UV·VVG OKV )GIGPUVGORGN XQP 9ÒT\DWTI CWH FGT8QTFGTUGKVG9CRRGPWPF,CJTGU\CJN 4CJPGPHÒJTGT-TWIp \W  5GJTUEJÌP



56#&6 

292




MEDAILLEN

/'&#+..'0

3318

3319

3319

/'&#+..'0810-#4.)1'6< 

5KNDGTOGFCKNNGCWHFGP-CTFKPCN/KEJCGN(CWNJCDGT$TWUVDKNF(CWNJCDGTUN5V%QTDKCPWUXX KO#DUEJPKVVFTGK9CRRGPOOI-KGPCUV 8QT\ÒINKEJ





5KNDGTOGFCKNNG  CWH FKG 'KIGPUVCCVNKEJMGKV $C[GTPU KO &GWVUEJGP 4GKEJ )GMTÌPVG /CFQPPC OKV   <GRVGT KP FGT 4GEJVGP WPF FGO -KPF CWH FGO 5EJQ­ UKV\V X X CWH 9QNMGP<YGK .ÌYGP JCNVGP FCU   IGMTÌPVGXKGTHGNFKIGDC[GTKUEJG9CRRGP/KV4CPFITCXWT$#;'4*#726/ª0<#/6('+05+. $'4OOI-KGPCUV (GKPG2CVKPCOKP4CPFHGJNGTHCUV5VGORGNINCP\



/'&#+..'0.165 

#NNIGOGKP &KXGTUG /GFCKNNGP FGU  ,CJTJWPFGTVU CWH XGTUEJKGFGPG 6JGOGP WPF #PN·UUG W C   XQP$TCPFGPDWTI2TGW­GP-ÌNP(TCPMTGKEJGVE 5VÒEM5GJTUEJÌPpXQT\ÒINKEJ





&KXGTUGFGWVUEJGWPFCWUN·PFKUEJG/GFCKNNGPFGU,CJTJWPFGTVUFCTWPVGTKPVGTGUUCPVG5VÒEMGKPVGKN YGKUGJÒDUEJGP'TJCNVWPIGP*QEJKPVGTGUUCPVGU.QVDKVVGDGUKEJVKIGP 5VÒEM5GJTUEJÌPpXQT\ÒINKEJ





&KXGTUG /GFCKNNGP WPF 'JTGP\GKEJGP FGU  ,CJTJWPFGTVU W C XQP #NVFGWVUEJNCPF *CDUDWTI   (TCPMTGKEJ8CVKMCPGVE+PVGTGUUCPVGU.QVDKVVGDGUKEJVKIGP  5VÒEM6GKNYGKUGKP1TKIKPCNGVWKUOGKUVXQT\ÒINKEJ



-NGKPG 5COONWPI XQP 5KNDGT WPF $TQP\GOGFCKNNGP  ,CJTJWPFGTVU FCTWPVGT 5GTKGP XQP (TCPM   TGKEJ#NVFGWVUEJNCPFUQYKG\CJNTGKEJG'KUGPDCJPOGFCKNNGP+PVGTGUUCPVGU.QVDKVVGDGUKEJVKIGP  5VÒEM5GJTUEJÌPpXQT\ÒINKEJ





(TCPMTGKEJ$TQP\G5RQVVOGFCKNNG2QNGP<KPPOGFCKNNG2TGW­GP5KNDGTOGFCKNNG5CEJ UGP%QDWTI)QVJC5KNDGTOGFCKNNG 5VÒEM5GJTUEJÌPpXQT\ÒINKEJ





-NGKPG5COONWPIXQP5EJÒV\GPOGFCKNNGPFGU,CJTJWPFGTVUFCTWPVGTDGUUGTG5VÒEMG*QEJKPVG TGUUCPVGU.QVDKVVGDGUKEJVKIGP 5VÒEM5·OVNKEJG5VÒEMGOKVRTCEJVXQNNGT2CVKPCOGKUVXQT\ÒINKEJ





)TQ­GU -QPXQNWV XQP /GFCKNNGP #D\GKEJGP WPF GKPKIGP /ÒP\GP JCWRVU·EJNKEJ FGU  WPF  ,CJT   JWPFGTVU FCTWPVGT \CJNTGKEJG 5VÒEMG XQP 2QNGP 7PVGT FGP /ÒP\GP DGHKPFGP UKEJ GKPKIG 5VÒEMG XQP   4W­NCPFWPF(KPPNCPF EC5VÒEM(CUVUGJTUEJÌPp5VGORGNINCP\



#NVFGWVUEJNCPF $TCWPUEJYGKI%CNGPDGTI*CPPQXGT 5KNDGTOGFCKNNG Q , WO   *KNFGUJGKO   $TQP\GMNKRRG UR·VGTG2T·IWPIFGU,CJTJWPFGTVU /ÒPUVGT5KNDGTOGFCKNNGQ,  9GUV HCNGP'KPUGKVKIGUQXCNGU$TQP\GMNKUEJGGQ,+PVGTGUUCPVGU.QVDKVVGDGUKEJVKIGP  5VÒEM5GJTUEJÌPpXQT\ÒINKEJ





&KXGTUG CNVFGWVUEJG /GFCKNNGP FGU  ,CJTJWPFGTVU CWH XGTUEJKGFGPG #PN·UUG WPF 2GTUQPGP W C   $KUOCTM5EJKNNGT9GNVMTKGIGVE+PVGTGUUCPVGU.QVDKVVGDGUKEJVKIGP 5VÒEM5GJTUEJÌPWPFDGUUGT





#PJCNV $TQP\GOGFCKNNG  CWH FKG 6KGTUEJCW KP &GUUCW *CPPQXGT 5KNDGTOGFCKNNG  CWH FKG   UKNDGTPG*QEJ\GKV*GPPGDGTI-W/GFCKNNG4GHQTOCVKQPULWDKN·WO4GW­$TQP\GOGFCKNNG CWH FCU L·JTKIG 4GIKGTWPIULWDKN·WO 5CEJUGP%QDWTI)QVJC 5KNDGTOGFCKNNG  5CEJUGP/GKPKP   IGP$TQP\GOGFCKNNGCWHFCU4GIKGTWPIULWDKN·WO5CEJUGP9GKOCT$TQP\GOGFCKNNG4GHQT OCVKQPULWDKN·WO7HJQXGP5KNDGTOGFCKNNG&C\WGKPGWPDGUVKOOVG5KNDGTOGFCKNNG  5VÒEM/GKUVXQT\ÒINKEJ







293


PAPIERGELDSAMMLUNG HERBERT SIRB

&+'2#2+'4)'.&5#//.70)*'4$'465+4$ *GTDGTV5KTDņ'KP5COONGTCWU.GKFGPUEJCHV   &GT ITQ­G 'ZRTGUUKQPKUV /CTE %JCICNN UQNN GKPOCN IGUCIV   JCDGP&GPGEJVGP5COONGTGTMGPPVOCPPKEJVCPFGOYCUGT JCVUQPFGTPCPFGOYQTÒDGTGTUKEJHTGWGPYÒTFG*·VVGGT *GTDGTV 5KTD MGPPGPIGNGTPV UQ J·VVG GT KP KJO INGKEJ GKPGP   GEJVGP 5COONGT GTMCPPV FGT FKGUGO *QDD[ OKV GKPGT .GKFGP   UEJCHVPCEJIKPIFKGUGNVGP\WHKPFGPKUV  *GTDGTV 5KTD YWTFG CO  ,WPK  KP $TÒZ IGDQTGP FCU   JGWVG\WT6UEJGEJKUEJGP4GRWDNKMIGJÌTVWPFFGP0COGP/QUV VT·IV 'T DGUWEJVG FCU FQTVKIG )[OPCUKWO WPF UVTGDVG FGO   #DKVWT \W CNU GT KP FGP NGV\VGP 6CIGP FGU -TKGIGU GKPIG\QIGP   YWTFG WPF UEJNKG­NKEJ OKV  ,CJTGP KP -TKGIUIGHCPIGPUEJCHV   IGTKGV  0CEJUGKPGT'PVNCUUWPICWUFGT)GHCPIGPUEJCHVHQNIVGGTUGKPGT (COKNKG FKG \YKUEJGP\GKVNKEJ PCEJ /GGTCPG KP 5CEJUGP WO   IGUKGFGNVYCT/GGTCPGNKGIVCO0QTFYGUVTCPFFGU'T\IGDKTIK UEJGP $GEMGPU WPF YKTF YGIGP FGT XKGNGP 5VGKIWPIGPCWEJCNU FCU 5CP (TCPEKUEQ 5CEJUGPU DG\GKEJPGV <W &&4<GKVGP   HCPFGP JKGT TGIGNO·­KI 4CFTGPPGP UVCVV DGK FGPGP DGUQPFGTU   FKG5VGKNG9CPFXQPCNNGP4CFHCJTGTPIGHÒTEJVGVYCT  'KP YGKVGTGU -GPP\GKEJGP FGT 5VCFV YCTGP FKG XKGNGP 6GZVKN   DGVTKGDG5QYCTGUPKEJVXGTYWPFGTNKEJFCUU*GTDGTV5KTDKO $GVTKGDUVGKN /GGTCPG FGU 8'$ /ÌDGNUVQHHYGDGTGK *QJGPUVGKP   'TPUVVJCN GKPG #WUDKNFWPI CNU 6GZVKNHCEJCTDGKVGT CDUQNXKGTVG   'KPKIG,CJTGUR·VGTYWTFGGT/GKUVGTFGT6GZVKNKPFWUVTKG5GNDUVFKU\KRNKPWPF<KGNUVTGDKIMGKVYCTGP\YGK FGT 'KIGPUEJCHVGP FKG *GTDGTV 5KTD DGUQPFGTU CWU\GKEJPGVGP UQ FCUU GT KO 8'$ DKU \WO 2QUVGP FGU   UVGNNXGTVTGVGPFGP$GVTKGDUNGKVGTUCWHUVKGI  5GKPGTUVGU*QDD[YCT\WP·EJUVHÒTXKGNG,CJTGFCU6KUEJVGPPKU5RKGN/KVEC,CJTGPDTCEJLGFQEJFCU 5COOGNHKGDGTFWTEJWPFKPPGTJCNDMÒT\GUVGT<GKVYWTFGGT\WO$GUKV\GTINGKEJOGJTGTGTDGVT·EJVNKEJGT 5COONWPIGP#O#PHCPIUVCPFGP$TKGHOCTMGPWPF-NGKPOÒP\GPFGPGPUKEJYGKVGTG)GRT·IGWPFGKPG WOHCPITGKEJG -QNNGMVKQP 0QVIGNF JKP\WIGUGNNVGP &CPGDGP HCPFGP WPVGT CPFGTGO 4GUGTXKUVGPMTÒIG WPF   #PUKEJVUMCTVGPFCU+PVGTGUUGFGU5COONGTU  &KG .GKFGPUEJCHV *GTDGTV 5KTDU IKPI UQYGKV FCUU GT \W &&4<GKVGP CP HCUV LGFGO 9QEJGPGPFG \W   5COONGTDÌTUGP KP FGT 4GIKQP IGHCJTGP KUV 1HV YWTFG GT FCDGK XQP UGKPGT (COKNKG QFGT (TGWPFGP   DGINGKVGV  0CEJFGT9GPFGMQPPVGPFKG5COONWPIGPWO)QNFWPF5KNDGTOÒP\GPGTI·P\VYGTFGPWPFFKG4GKUGP \W $ÌTUGP HÒJTVGP KJP DKU PCEJ 9ÒT\DWTI 0ÒTPDGTI 7UGFQO WPF KP XKGNG CPFGTG 5V·FVG 0CEJ FGT   4ÒEMMGJTXQPUQNEJGP4GKUGPYCTPKEJVUGNVGPFKGICP\G9QJPWPIOKV)GNFUEJGKPGPCWUIGNGIVWPFFKG -KPFGTOW­VGPOKVJGNHGPFKGUG\WUQTVKGTGPWPF&WDNGVVGP\WHKPFGP  *GTDGTV 5KTD YKFOGVG UGKPG MQORNGVVG (TGK\GKV FGO 5COOGNP 0CEJ 'KPVTKVV KP FGP 8QTTWJGUVCPF OKV    ,CJTGP GTTGKEJVG FCU 5COOGNHKGDGT UGKPGP *ÌEJUVUVCPF 5COONGT UKPF INÒEMNKEJG /GPUEJGP UCIVG   ,QJCPP 9QNHICPI XQP )QGVJG FGTGKPUV 0KEJV PWT WPVGT FKGUGO #URGMV JCV *GTDGTV 5KTD FGT CO    0QXGODGT  UVCTD XKGNG INÒEMNKEJG ,CJTG GTNGDV &KG (COKNKG YÒTFG UKEJ FCJGT HTGWGP YGPP   FKGUG OKV XKGN .KGDG WPF <GKV \WUCOOGPIGVTCIGPGP 5COONWPIGP KP FKG *·PFG XQP GDGPUQ   NGKFGPUEJCHVNKEJGP5COONGTPMQOOGPYÒTFGPYKG*GTDGTV5KTDGKPGTIGYGUGPKUV  

294

&KGJKGT\WT8GTUVGKIGTWPIMQOOGPFGKPKJTGO<WUVCPFWPXGT·PFGTVDGNCUUGPG5COONWPI\GKIVGKPGP GKPFTWEMUXQNNGP 3WGTUEJPKVV FWTEJ FKG FGWVUEJG 2CRKGTIGNFIGUEJKEJVG FGU  ,CJTJWPFGTVU 5KG KUV FCU   4GUWNVCVLCJTGNCPIGT5COONGTV·VKIMGKVWPFKPKJTGO-QORNGVVKGTWPIUITCFUGJTYGKVHQTVIGUEJTKVVGP&GP 5EJYGTRWPMVDKNFGP\YGKHGNUHTGKFKG0QVIGNFCWUICDGPFGT<GKVT·WOGDKU$GUQPFGTGU#WIGP OGTMYWTFGCWHFKG5GTKGPWPF8GTMGJTUCWUICDGPIGNGIV*KGTUKPFWP\·JNKIGUGNVGPGWPFUGJTUGNVGPG 5EJGKPG \WUCOOGPIGVTCIGP XKGNG FCXQP KP CWUIG\GKEJPGVGT 3WCNKV·V 'KPGP MNGKPGP 'KPDNKEM IGDGP FKG   #WU\ÒIGCWHFGP(QVQVCHGNP&KG8GTMGJTUCWUICDGPUKPFOKVMPCRR5EJGKPGPXGTVTGVGPFKG5GTKGP UEJGKPG UQICT OKV ÒDGT  'ZGORNCTGP &KG )TQ­IGNFUEJGKPG XQP FGPGP ÒDGT  5VÒEM KP FGT   5COONWPI GPVJCNVGP UKPF YWTFGP XQTYKGIGPF OKV TGIKQPCNGO $G\WI IGUCOOGNV 'U XGTYWPFGTV CNUQ   PKEJV FC­ HCUV FKG *·NHVG FGT #WUICDGP CWU FGP $GTGKEJGP 5CEJUGP WPF 6JÒTKPIGP UVCOOV 8QP FGP   YGKVGTGP 0QVIGNFGRQEJGP UKPF W C XGTVTGVGP &CU GT 0QVIGNF OKV ÒDGT  5VÒEM FCU )GNF FGT   -TKGIUIGHCPIGPGPNCIGT OKV EC  5VÒEM FCU 0QVIGNF FGT 4GKEJUDCJP WPF 4GKEJURQUV OKV EC    5VÒEMFCUYGTVDGUV·PFKIG0QVIGNFOKVEC5VÒEMFCUDGUQPFGTG0QVIGNF 5VQHH.GFGTGVE OKVEC 5VÒEMWPFFCU0QVIGNFOKVEC#WUICDGP#WEJKPFKGUGPMNGKPGTGP#DVGKNWPIGPUKPF QHVOCNU PKEJV J·WHKIG 5EJGKPG \W HKPFGP 'KPG YGKVGTG )TWRRKGTWPI DKNFGP FKG 5EJGKPG FGU FGWVUEJGP   4GKEJGUWPFUGKPGT0GDGPIGDKGVGDKU\WFGP#WUICDGPFGTDGKFGPFGWVUEJGP5VCCVGPPCEJFGO\YGKVGP 9GNVMTKGI 'TI·P\V YKTF FKG 5COONWPI FWTEJ 9GNVDCPMPQVGP EC  5VÒEM  WPF CWUN·PFKUEJGO 0QV   IGNF*KGTHKPFGPUKEJÒDGT'ZGORNCTGXQTYKGIGPFXQP¤UVGTTGKEJ7PICTP4GEJPGVOCPFKGYGKV ÒDGT  &WDNGVVGP JKP\W YGTFGP KP FKGUGT ITQ­CTVKIGP 5COONWPI OGJT CNU  5EJGKPG   CPIGDQVGP 'KP 1DLGMV FCU UKEJ JGTXQTTCIGPF \WO #WH WPF #WUDCW FKGUGU KPVGTGUUCPVGP 5COOGN   IGDKGVGUGKIPGVGKPG$GUKEJVKIWPIUQNNVGWPDGFKPIVGTHQNIGP  ªDGT5EJGKPGKPWPVGTUEJKGFNKEJGP'TJCNVWPIGP 


PAPIERGELDSAMMLUNG HERBERT SIRB

295


PAPIERGELDSAMMLUNG HERBERT SIRB

296


PAPIERGELDSAMMLUNG HERBERT SIRB

297


MÜNZWAAGEN

/ª0<9##)'0

3331

$'4)*'4<1)67/ 

&'765%*'44#7/

,QJCPP %CURCT /KVVGNUVGPUEJGKF .GPPGR  Ó -NGKPG /ÒP\YCCIG Q , WO     &WPMGN IGDGK\VGT TGEJVGEMKIGT *QN\MCUVGP OKV GKPGT /GUUKPIUEJNKG­G /C­G  Z  Z  OO &CU   /GKUVGTGVKMGVVHÒNNVFCUIGUCOVG&GEMGNKPPGTGCWUWPFVT·IVWPVGPTGEJVUFGP$TCPFUVGORGN+756+'46 FCTÒDGTFTGK-TQPGP9CCIGCWU5VCJNOKV\YGKTWPFGP/GUUKPIYCCIUEJCNGPCPDTCWPGP DGUEJ·FKIVGP  $·PFGTPSWCFTCVKUEJG)GYKEJVGKP.CIGP FKGQDGTGPOKV)TKHHUV·DEJGP FCXQPOKVFGODGT IKUEJGP .ÌYGP IGRWP\V UQYKG  #WUINGKEJUIGYKEJVG )GYKEJVG VGKNYGKUG PKEJV \WIGJÌTKI  ªDGT FGP   )TWDGP0QOKPCNDG\GKEJPWPIKPTQVGT(CTDG 5GJTUEJÌP



,QJCPP %CURCT /KVVGNUVGPUEJGKF NGTPVG DGK UGKPGO 1PMGN ,QJCPP 2GVGT $TCU U GNOCPP )QNFYCCIGPHGTVKIGT KP   9KKEJNKPIUJCWUGPFCU*CPFYGTM5GKP5QJP2GVGT%CURCTIGDIGUVKP&ÒUUGNFQTHHÒJTVG FCU )GUEJ·HV UGKPGU8CVGTUHQTVWPFXGTYGPFGVGKPUGKPGP'VKMGVVGPFGP8QTPCOGPUGKPGU8CVGTU&CFWTEJKUVGKPG 6TGPPWPI PWT DGK UR·VGTGP 9CCIGP OÌINKEJ 2GVGT %CURCT /KVVGNUVGPUEJGKF YWTFG  CNU 'KEJUCOVUCEJXGT   UV·PFKIGTDGUV·VKIVXGTNGIVGGTUGKP)GUEJ·HVXQP.GPPGRPCEJ&ÒUUGNFQTH

3332

/#4-)4#(5%*#(6 

,QJCPP 2GVGT 2QRRGPDGTI KO #OV$NCPEMGPUVGKPDGK5RTQEMJÌXGNIGVCWHV /ÒP\YCCIG Q, WO &WPMGNIGDGK\VGTTGEJVGEMKIGT-CUVGPCWU#JQTPJQN\OKV/GUUKPIUEJNKG­GP/C­G ZZOO&CU/GKUVGTGVKMGVVHÒNNVFCUIGUCOVG&GEMGNKPPGTGCWUWPFVT·IVKPFGTWPVGTGPNKPMGP WPF TGEJVGP 'EMG FGP $TCPFUVGORGN +756+46+22$ , QJCPP  2 GVGT  2 QRRGP  $ GTI  FCTÒDGT   -TQPG9CCIGCWU5VCJN 6TQRHGTHGJNV OKV5EJYCPGPJCNUGPFGPWPFOKVTWPFGP/GUUKPIYCCIUEJCNGP CP ITÒPGP DGUEJ·FKIVGP  $·PFGTP  )GYKEJVG OKV )TKHHUV·DEJGP FCXQP UKPF  QTKIKPCN XQP2QRRGP DGTI 4GUV CWU DGTIKUEJGP 9CCIGP UQYKG  #UUIGYKEJVG FCXQP  PKEJV QTKIKPCN ªDGT FGP )TWDGP   0QOKPCNDG\GKEJPWPIKPTQVGT(CTDG (CUVUGJTUEJÌP ,QJCPP 2GVGT 2QRRGPDGTI 1DGTUVG &CUDGTI IGP 2QRRGPDGTI  KO #OV $NCPMGPUVGKP DGK 5RTQEMJÌXGN YWTFG CO    IGVCWHV #NU )QNFYCCIGPHGTVTKIGT YCT GT XQP  DKU  V·VKI 'T YCT GKP $TWFGT FGT )QNFYCCIGP   HGTVKIGT %CURCT &KGFGTKEJ IGD   &KGFGTKEJ 2GVGT IGVCWHV  IGUV   WPF 2GVGT %CURCT  

IGVCWHV IGUV 0WT,QJCPP2GVGTWPF&KGFGTKEJ2GVGTUKPFCNNGKPGCNU*GTUVGNNGTXQP9CCIGP CWH'VKMGVVGPIGPCPPVUQPUVVTGVGPFKG$TÒFGTIGOGKPUCOCNU*GTUVGNNGTCWH

298




MÜNZWAAGEN

0ª40$'4)56#&6 

3333

2CWNWU&GKPGTVÓ/ÒP\YCCIGQ,/GJTHCEJIGUEJYWPIGPGTJCNDQXCNGTOKVIGRWP\VGO.GFGT DG\QIGPGT*QN\MCUVGPCWHFGO&GEMGNTGKEJQTPCOGPVCNXGT\KGTV XQP4QMQMQ8GT\KGTWPIGPWOIGDGPGT CEJVUVTCJNKIGT 5VGTP OKV 4GUVGP XQP ITÒPGT WPF YGK­GT #WUOCNWPI  OKV GKPGT /GUUKPIUEJNKG­G KPPGP   OKVTQVGO9CUEJNGFGTCWUIGUEJNCIGP/C­GZZOO9CCIGCWU5VCJNOKVGKPGTTWPFGPWPF GKPGT FTGKGEMKIGP 9CCIUEJCNG CP ITÒPGP $·PFGTP <ÒPINGKP DGUEJ·FKIV   TWPFG /GUUKPIIGYKEJVG  

VGKNYGKUGGTI·P\V OKV)TKHHUV·DEJGPUQYKG#WUINGKEJUIGYKEJVG  #W­GPGVYCUDGUVQ­GPKPPGPNGKEJVG#DTKGDUVGNNGPCO.GFGTUGJTUEJÌP



2CWNWU&GKPGTVYCTUGKV/GKUVGT

3334

24'755'0 

0KEJV KFGPVKHK\KGTDCTGT /GKUVGT $GTNKPGT /ÒP\YCCIG Q , WO   *CNDQXCNGT -CUVGP OKV GKPGT   8QTFGTUEJNKG­G FKGINGKEJ\GKVKICNU2KP\GVVGIGPWV\VYGTFGPMCPP OKVFWPMGNDTCWPGOWPFOKVHNQTCNGP /QVKXGPIGRT·IVGO.GFGTÒDGT\WIKPPGPOKVJGNNGO.GFGTCWUIGUEJNCIGP/C­GZZOO 9CCIG CWU /GUUKPI OKV HNCEJGP 'PFGP WPF  TWPFGP /GUUKPIYCCIUEJCNGPCPITÒPGP$·PFGTP/KV TWPFGP)GYKEJVGPOKV)TKHHUV·DEJGP %#4.&GTI·P\V   #W­GPDGUVQ­GPWPFHNGEMKIKPPGPFCU9CUEJNGFGTUEJOWV\KI

 299


MÜNZWAAGEN

3335



$GTNKPGT /ÒP\YCCIG Q , WO   4GEJVGEMKIGT *QN\MCUVGP OKV \YGK 8QTFGTUEJNKG­GP CW­GP OKV   DTCWPGO .GFGTÒDGT\WI WPF OKV )QNFTCPF XGT\KGTV KPPGP OKV TQVGO .GKPGP CWUIGUEJNCIGP /C­G    Z  Z  OO 9CCIG CWU /GUUKPI OKV HNCEJGP 'PFGP WPF  TWPFGP /GUUKPIYCCIUEJCNGP CP ITÒPGP   $·PFGTP/KVTWPFGP)GYKEJVGPOKV)TKHHUV·DEJGP %#4.&GTI·P\V   #W­GPDGUVQ­GPWPFHNGEMKIKPPGPGVYCUHNQEMKICDIGTKGDGPUGJTUEJÌP



3336

014&&'765%*.#0& 

300

0KEJVKFGPVKHK\KGTDCTGT/GKUVGT/ÒP\YCCIGQ, WO 4GEJVGEMKIGTOKVVGNDTCWPGT*QN\MCUVGP OKV \YGK /GUUKPIUEJNKG­GP /C­G  Z  Z  OO 1JPG /GKUVGTGVKMGVV 9CCIG CWU /GUUKPI OKV   HNCEJGP 'PFGP WPF  TWPFGP /GUUKPIYCCIUEJCNGP CP QNKXHCTDGPGP $·PFGTP /KV  SWCFTCVKUEJGP )G   YKEJVGPOKV)TKHHUV·DEJGP FCXQPGTI·P\V WPF#WUINGKEJUIGYKEJVG 8QT\ÒINKEJ




MÜNZWAAGEN

3337

&'765%*'54'+%* 

#NGZ $GTPUVGKP  %Q $GTNKP 2CVGPV)QNFOÒP\YCCIG Q , KP 6CUEJGPCWUHÒJTWPI HÒT  WPF    )QNFOCTM&GTNCPIG$CNMGPFGT9CCIGFKGPVCNU)GIGPIGYKEJVFGTMWT\G$CNMGPGPVJ·NV\YGK8GTVKG HWPIGPHÒTWPF)QNFOCTMUVÒEMG+PFGT/KVVGGKP/GUUKPIUVKHV\WOJCNVGPFCOKVFKG9CCIGHTGK URKGNV)GUCOVN·PIGOO&KG$GTNKPGT9CCIGPHCDTKM#NGZ$GTPUVGKP %0CEJVGVE YWTFG CO   KO (KTOGPTGIKUVGT GKPIGVTCIGP &KG 9CCIGP YWTFGP KP GKPGT 2CRRUEJCEJVGN FKG OKV   HCTDKIGT.GKPYCPFDGMNGDVKUVWPFFGTGP'VKMGVVUVGVUFCUINGKEJG/WUVGTJCVCWUIGNKGHGTV/KVDGKNKGIGP FGT)GDTCWEJUCPYGKUWPI 8QT\ÒINKEJ



3338

51056+)'9##)'0 &'765%*.#0& 

-QTPYCCIGQ, ,CJTJWPFGTV <YGK\[NKPFTKUEJG/GUUKPIIGH·­G&WTEJOGUUGTEO.·PIGKO \WUCOOGPIGUVGEMVGP<WUVCPFEO,GFGU)GH·­VT·IVCPFGP5GKVGPLGCWHIGPKGVGVG¤UGPCPFGPGP ITÒPIGNDG5EJPÒTGDGHGUVKIVUKPFFKGCPFGP'PFGP\WUCOOGPIGDWPFGPWPFOKVLGGKPGO/GUUKPIJCMGP HÒTFGPXQTJCPFGPGP/GUUKPIYCCIGDCNMGPXGTUGJGPUKPF+PGKPGO5VQHHDGWVGNDGHKPFGPUKEJ/GUUKPI IGYKEJVGOKVFGP9GTVCPICDGPWPF&C\WMQOOVGKP'KPHÒNNVTKEJVGTCWU/GUUKPI OKVOGEJCPKUEJGT$QFGPURGTTG 8QT\ÒINKEJ

 301


MÜNZGEFÄSSE

'+05#6<)'9+%*6'70&)'9+%*6'

3339

&'765%*.#0& 

.QV XQP  'KPUCV\IGYKEJVGP  2HWPF 2TGW­GP 'KEJCOV &TKGUGP OKV  1TKIKPCN WPF  PCEJIGNGIVGP   'KPU·V\GP2HWPF9KGPOKV1TKIKPCN'KPU·V\GP10%'5(TCPMTGKEJ,CJTJWPFGTVMQO RNGVVOKV'KPU·V\GP 5VÒEM5GJTUEJÌP



/ª0<)'(55'

3340

/ª0<$'%*'4 

302

5KNDGTPGT /ÒP\DGEJGT YCJTUEJGKPNKEJ IGHGTVKIV KP FGT  *·NHVG FGU  ,CJTJWPFGTVU &GT CWH FTGK   OWUEJGNCTVKIGP(Ò­GPUVGJGPFG5KNDGTDGEJGTKUVOKV\CJNTGKEJGP$NWOGPQTPCOGPVGPXGT\KGTVWPFUQYQJN $GEJGTCNUCWEJ*GPMGNUKPFOKVJÒDUEJIGUEJYWPIGPGO$NCVVYGTMIGUEJOÒEMV+O-QTRWUGKPIGNCUUGP KUVGKP6CNGTXQP9CNNGPUVGKP &CX CWUFGO,CJT#WHFGT$GEJGTWPVGTUGKVGDGHKPFGPUKEJFKG *GTUVGNNGTRWP\GP #DPGJOGPFGT/QPFOKV)GUKEJV-TQPG4CWVGFCTKP$CWO UQYKGGKP(GKPIGJCNVU UVGORGNOKVFGO9GTV*ÌJGECEO&WTEJOGUUGTEO)GYKEJVI  5GJTUEJÌPG#TDGKV 


MÜNZTELLER

3341

/ª0<6'..'4 

$TGOGP&GMQTCVKXGTUKNDGTPGT/ÒP\VGNNGTIGHGTVKIVWO+PFGPOKV(KUEJOQVKXGPTGKEJXGT\KGTVGP 4CPF UQYKG FGP OKV GKPGO &TGKOCUVGT XGT\KGTVGP 6GNNGTDQFGP UKPF KPUIGUCOV  $TGOGT /ÒP\GP FGU    ,CJTJWPFGTVU GKPIGNCUUGP #WH FGT 4ÒEMUGKVG DGHKPFGV UKEJ FGT GT 5KNDGTUVGORGN UQYKG FCU   /GKUVGT\GKEJGP$5EJNÒUUGN.&WTEJOGUUGTEO)GYKEJVI 8QT\ÒINKEJG#TDGKV 

303


LOTS

#..)'/'+0

.165



7OHCPITGKEJGU -QPXQNWV XQP FGWVUEJGP JCDUDWTIKUEJGP WPF CWUN·PFKUEJGP /ÒP\GP FGU  ,CJT   JWPFGTVUXQO2HGPPKIDKU\WO&QRRGNVCNGTFCTWPVGTCWEJDGUUGTG6[RGP*QEJKPVGTGUUCPVGU.QVDKVVG DGUKEJVKIGP 5VÒEM6GKNYGKUGOKV(GJNGTPUEJÌPpXQT\ÒINKEJ 



7OHCPITGKEJG 5COONWPI XQP 5KNDGTOÒP\GP \WO 6JGOC /CTKPG 5GGHCJTV WPF FGTGP )GUEJKEJVG W C   XQP %JKPC -WDC /GZKMQ 2QTVWICN 4WUUNCPF 7PICTP GVE &GU YGKVGTGP GPVJCNVGP UKPF XKGT MNGKPG   1TFPGT FKG FGVCKNNKGTVG +PHQTOCVKQPUDN·VVGT \W FGP GKP\GNPGP 2T·IWPIGP GPVJCNVGP +PVGTGUUCPVGU 1DLGMV   OKVXKGNGPJÒDUEJGP/QVKXGPDKVVGDGUKEJVKIGP 5VÒEM+P*QN\UEJCVWNNGP2QNKGTVG2NCVVG 



5KNDGTOÒP\GPFGU,CJTJWPFGTVUXQP(TCPMTGKEJ 'EW#(TCPEU#0#(TCPEU #0 :+ 3 WPF #0  #  +VCNKGP W C -ÌPKITGKEJ  .KTG  / WPF %KUCNRKPG 4GRWDNKM  5QNFK   #0+: 2QNGP2TGW­GP5EJYGFGPWPF$QNKXKGP 5VÒEM(CUVUGJTUEJÌPpHCUVXQT\ÒINKEJ





&KXGTUG FGWVUEJG WPF CWUN·PFKUEJG /ÒP\GP WPF /GFCKNNGP FGU  ,CJTJWPFGTVU XQO 2HGPPKI DKU   \WT6CNGTRT·IWPIFCTWPVGTDGUUGTG6[RGP*QEJKPVGTGUUCPVGU.QVDKVVGDGUKEJVKIGP  5VÒEM+P/ÒP\MQHHGT'KPKIGOKVMN(GJNGTPUEJÌPpXQT\ÒINKEJ 

#.6&'765%*.#0& 

#NNIGOGKP &KXGTUG CNVFGWVUEJG WPF CWUN·PFKUEJG /ÒP\GP WPF /GFCKNNGP FGU  ,CJTJWPFGTVU   FCTWPVGTDGUUGTG6[RGP*QEJKPVGTGUUCPVGU.QVDKVVGDGUKEJVKIGP  5VÒEM6GKNYGKUGOKV(GJNGTPUEJÌPpXQT\ÒINKEJ 



&KXGTUG FGWVUEJG WPF CWUN·PFKUEJG5KNDGTOÒP\GPWPFOGFCKNNGPFGU,CJTJWPFGTVUWC#WIU DWTI 6CNGT   $CODGTI 6CNGT  (TCPMHWTV &QRRGNVCNGT  /CPUHGNF 6CNGT    4QVVYGKN)W­OGFCKNNGQ, UQIGP$WPFGUVCNGT GVE*QEJKPVGTGUUCPVGU.QVDKVVGDGUKEJVKIGP  5VÒEM6GKNYGKUGOKV(GJNGTPOGKUVUGJTUEJÌP



$C[GTP/CZKOKNKCP+++,QUGRJ-QPX6CNGT/ÒPEJGP &CX /CZKOKNKCP++  &QRRGNIWNFGP  /CTKGPU·WNG &CX   9ÒTVVGODGTI 9KNJGNO ++    /CTM 5KNDGTJQEJ\GKV,C &CP\KI)WNFGP ,& &C\W-CKUGTTGKEJ¤UVGTTGKEJ (TCP\+-QPX6CNGT%2TCI&CX  5VÒEM-N4CPFHGJNGT Z UGJTUEJÌPWPFDGUUGT



$TCWPUEJYGKI WPF .ÒPGDWTI %JTKUVKCP .WFYKI  4GKEJUVCNGT  %NCWUVJCN &CX    9GNVGT   #WIWUV  4GKEJUVCNGT  &TGUFGP &CX  5EJPGG   %JTKUVKCP ++   ,QJCPP)GQTI+WPF#WIWUV4GKEJUVCNGT&TGUFGP,QJCPP)GQTI+ 4GKEJUVCNGT&TGUFGP &CX5EJPGG-GKNKV\-CJPV &C\W4&4'T\JGT\QI(GTFK PCPF)WNFGPVCNGT -TGW\GT /ÒP\UV·VVGXGTOWVNKEJ/ÒJNCW &CX 2CTKUXQP .QFTQP4GKEJUVCNGTCWHFKG&QOYGKJG <ÌVVN   5VÒEM<WO6GKNOKVMN(GJNGTPOGKUVUGJTUEJÌP









7OHCPITGKEJGU -QPXQNWV XQP /ÒP\GP FGT5V·FVG4QUVQEM9KUOCTWPF5VTCNUWPFFGU,CJTJWP FGTVUXQO2HGPPKIDKU\WO6CNGTFCTWPVGTGKPKIGDGUUGTG5VÒEMG&C\WGKPKIGYGKVGTGCNVFGWVUEJG /ÒP\GP*QEJKPVGTGUUCPVGU.QVDKVVGDGUKEJVKIGP 5VÒEM/GKUVUGJTUEJÌP 



&KXGTUG CNVFGWVUEJG WPF JCDUDWTIKUEJG /ÒP\GP FGU  ,CJTJWPFGTVU XQO 2HGPPKI DKU \WO 6CNGT   FCTWPVGT5GTKGPXQP$TGOGPWPF*CODWTI+PVGTGUUCPVGU.QVDKVVGDGUKEJVKIGP  5VÒEM+P#NDGP/GKUVUGJTUEJÌP



-NGKPG5COONWPIXQPCNVFGWVUEJGP/ÒP\GPOKV)GIGPUVGORGNPWCXQP$TCPFGPDWTI2TGW­GP.KPFCW

)GIGPUVGORGN FTGKDN·VVTKIGT .KPFGPDCWO  /CIFGDWTI  )TQUEJGP  OKV )GIGPUVGORGN 4QUG    /CPUHGNF  6CNGT  OKV )GIGPUVGORGN 4QUG  2CFGTDQTP Z  2QOOGTP &QRRGNUEJKNNKPI OKV   )GIGPUVGORGNXQP5VTCNUWPFWPF6CNGTOKVUEJYGFKUEJGP)GIGPUVGORGNPZ 8GTFGP -W)TQVGP OKV)GIGPUVGORGNFGU&QOMCRKVGNU GVE*QEJKPVGTGUUCPVGU.QVDKVVGDGUKEJVKIGP  5VÒEM5EJÌPpUGJTUEJÌP







&KXGTUG/ÒP\GPFGU,CJTJWPFGTVUWCXQP*CDUDWTI(TCPMTGKEJ+VCNKGP5EJYGK\5RCPKGP 7PICTPªDGTUGGGVEFCTWPVGTGKPKIG6CNGTRT·IWPIGP*QEJKPVGTGUUCPVGU.QVDKVVGDGUKEJVKIGP  5VÒEM5EJÌPpXQT\ÒINKEJ 



$C[GTP -QPX6CNGT  -ÌPKIUVCNGT  )GUEJKEJVUVCNGT  *CPFGNUXGTVTCI  $TCWPUEJYGKI   .ÒPGDWTI 9CJTJGKVUVCNGT  4GKEJUVCNGT  4Q­  5CEJUGP -QPX6CNGT  #WUDGWVGVCNGT    6QF 5KGIGUVCNGT&C\WYGKVGTG6CNGTVGKNUVÒEMGFGU,CJTJWPFGTVU+PVGTGUUCPVGU.QV DKVVGDGUKEJVKIGP 5VÒEM/GKUVUGJTUEJÌP

304




LOTS 

-NGKPG 5COONWPI CNVFGWVUEJGT /ÒP\GP FGU,CJTJWPFGTVUXQO-W2HGPPKIDKU\WO8GTGKPUVC NGT FCTWPVGT \CJNTGKEJG DGUUGTG 6[RGP UQYKG GKPKIG JÒDUEJG 3WCNKV·VGP *QEJKPVGTGUUCPVGU .QV DKVVG   DGUKEJVKIGP 5VÒEM9GPKIGOKVMN(GJNGTPHCUVUGJTUEJÌPpHCUV5VGORGNINCP\ 



-NGKPG 5COONWPI XQP /ÒP\GP FGU  ,CJTJWPFGTVU XQO 2HGPPKI DKU \WO  6CNGT FCTWPVGT   DGUUGTG 6[RGP \ $ $KUVWO 5RG[GT  6CNGT  CWH FKG (GUVWPI KP 7FGPJGKO IGTKPI GTJCNVGP    *QEJKPVGTGUUCPVGU.QVDKVVGDGUKEJVKIGP 5VÒEM6GKNYGKUGOKVMN(GJNGTPUEJÌPpUGJTUEJÌP 



&KXGTUGCNVFGWVUEJG/ÒP\GPFGU,CJTJWPFGTVUXQO2HGPPKIDKU\WO8GTGKPUVCNGT&C\WGKPKIG WPF/CTMUVÒEMGFGU-CKUGTTGKEJU+PVGTGUUCPVGU.QVDKVVGDGUKEJVKIGP  5VÒEM+P#NDWO5EJÌPpUGJTUEJÌP



&KXGTUG/ÒP\GPFGU,CJTJWPFGTVUXQO-W2HGPPKIDKU\WO8GTGKPUFQRRGNVCNGTFCTWPVGT5GTKG FGU-ÌPKITGKEJU*CPPQXGTWPF2TGW­GP&CU.QVGPVJ·NV6CNGTRT·IWPIGPUQYKG6GKNUVÒEMGKP 6CNGTITÌ­G*QEJKPVGTGUUCPVGU.QVOKV5GNVGPJGKVGPDKVVGDGUKEJVKIGP  5VÒEM9GPKIGOKVMN(GJNGTPUEJÌPpXQT\ÒINKEJ







&KXGTUGCNVFGWVUEJGWPFGWTQR·KUEJG6CNGTFGU,CJTJWPFGTVUWCXQP#WIUDWTI$C[GTP'KEJ UV·VV (TCPMHWTV 2TGW­GP 5CEJUGP *CDUDWTI GVE &C\W \YGK F·PKUEJG -TQPGP5VÒEMG UQYKG GKP    6CNGTXQP9GUVHCNGP+PVGTGUUCPVGU.QVDKVVGDGUKEJVKIGP  5VÒEM6GKNYGKUGOKVMN(GJNGTPUGJTUEJÌPWPFDGUUGT 



#PJCNV6CNGT8GTGKPUVCNGT/GEMNGPDWTI5VTGNKV\8GTGKPUVCNGT5CEJUGP-QPX6CNGT  5 5EJYCT\DWTI5QPFGTUJCWUGP 8GTGKPUVCNGT  &C\W 5GEJU CNVFGWVUEJG -NGKPOÒP\GP XQO   -W5VÒDGTDKU\WO6CNGT 5VÒEM/GKUVUGJTUEJÌP





&KXGTUG CNVFGWVUEJG /ÒP\GPWPF/GFCKNNGPFGU,CJTJWPFGTVUFCTWPVGTDGUUGTG5VÒEMG+PVGTGU UCPVGU.QVDKVVGDGUKEJVKIGP 5VÒEM/GKUVUGJTUEJÌP





$C[GTP /CFQPPGPVCNGT    5CEJUGP -QPX6CNGT   8GTHCUUWPI  5VQNDGTI    6CNGT  9ÒTVVGODGTI 5KGIGUVCNGT  ¤UVGTTGKEJ 6CNGT  $WPFGUUEJKG­GP  .KGEJVGP   UVGKP-TQPGP5EJYGFGP4KIUFCNGT5EJYGK\5EJÒV\GPVCNGT .WICPQ &C\W2TGW ­GP 8GTIQNFGVG -WRHGTOGFCKNNG  CWH FKG #PYGUGPJGKV KP &ÒUUGNFQTH +PVGTGUUCPVGU .QV DKVVG DG   UKEJVKIGP 5VÒEM5GJTUEJÌPpXQT\ÒINKEJ



$C[GTP 8GTGKPUVCNGT  6JWP   $TCPFGPDWTI2TGW­GP 6CNGT  # 6JWP   8GTGKPUVCNGT    # #WH FGP 5KGI 6JWP   (TCPMHWTV8GTGKPUVCNGT 6JWP 5CEJUGP&QRRGNVGT8GT GKPUVCNGT )QNFGPG*QEJ\GKV6JWP 6CNGT( #WHUGKPGP6QF#-5 5CEJUGP #NVGPDWTI8GTGKPUVCNGT 6JWP$ 5EJYCT\DWTI8GTGKPUVCNGT 6JWP 9ÒTVVGODGTI 8GTGKPUVCNGT 5KGI6JWP  5VÒEM(CUVXQT\ÒINKEJpHCUV5VGORGNINCP\



0ÒTPDGTI -QPX6CNGT  OKV 6KVGN(TCP\+ &CX (TCPMHWTV-QPX6CNGT -QPVTKDW VKQP&CX &C\W5EJYGK\<ÒTKEJ$CV\GP 0GWVCNGT  &CX   5VÒEM5GJTUEJÌPpXQT\ÒINKEJ



/CTKC6JGTGUKC4GKEJUVCNGT-$-TGOPKV\ '[RGNVCWGTC (TCP\++-TQPGPVCNGT% 2TCI &CX (TCP\+-QPX6CNGT#9KGP &CX (TCP\,QUGH+&QRRGNIWNFGP# 9KGPCWHUGKPG8GTO·JNWPIOKV'NKUCDGVJXQP$C[GTP &CX 8GTGKPUVCNGT##DGKFG /ÒP\UV·VVG9KGP &CX  5VÒEM5GJTUEJÌPXQT\ÒINKEJpHCUV5VGORGNINCP\



$C[GTP -QPX6CNGT  /ÒPEJGP &CX   &QRRGNIWNFGP  6JWP   8GTGKPUVCNGT   

6JWP   2TGW­GP 8GTGKPUFQRRGNVCNGT  # 6JWP   8GTGKPUVCNGT  # -TÌPWPI 6JWP    5CEJUGP-QPX6CNGT 6JWP -QPX6CNGT5 6JWP 8GTGKPUFQRRGNVCNGT ( 6JWP(  5VÒEM5GJTUEJÌPWPFDGUUGT





$TCWPUEJYGKI9QNHGPDÒVVGN 4GKEJUVCNGT  5CEJUGP -QPX6CNGT  0KGFGTNCPFG)GNFGTP    .ÌYGPVCNGT0KGFGTNCPFG9GUVHTKGUNCPF4GKEJUVCNGT 5VÒEM5GJTUEJÌP





&KXGTUG6CNGTFGU,CJTJWPFGTVUWC%QTXG[4GKEJUVCNGT/CPUHGNF6CNGT5CEJUGP 4GKEJUVCNGTCWHFCU8KMCTKCVGVE*QEJKPVGTGUUCPVGU.QVDKVVGDGUKEJVKIGP  5VÒEM/GKUVUGJTUEJÌP





&KXGTUG 2QT\GNNCPOÒP\GP WPF /GFCKNNGP \WOGKUV FGT /CPWHCMVWT /GKUUGP &C\W  YGUVH·NKUEJG 0QV   OÒP\GP 5VÒEM/GKUVXQT\ÒINKEJ





&KXGTUG /ÒP\GP FGU ,CJTJWPFGTVUFCTWPVGT\CJNTGKEJG6CNGTWPF&QRRGNVCNGT 5VÒEM WC 5CEJUGP%QDWTI)QVJC -QPX6CNGT  6JWP   *QEJKPVGTGUUCPVGU 1DLGMV OKV DGUUGTGP 6[RGP   DKVVGDGUKEJVKIGP 5VÒEM5EJÌPpHCUVXQT\ÒINKEJ 









305


LOTS 

5COONWPI XQP -NGKPOÒP\GP FGT FGWVUEJGP 5VCCVGP WPF ¤UVGTTGKEJU FGU  WPF  ,CJTJWPFGTVU KP   OGKUV JGTXQTTCIGPFGP 'TJCNVWPIGP CW­GTFGO GKPKIG FGWVUEJG -NGKPOÒP\GP PCEJ  CWEJ 2TQDGP    UQYKG (GJNRT·IWPIGP FC\W TWUUKUEJG 6TQRHMQRGMGP WPF  6CNGT XQP 5EJYGFGP 5GJT KPVGTGUUCPVGU   .QV 5VÒEM+P#NDWO/GKUVXQT\ÒINKEJWPFDGUUGT 



&KXGTUGCNVFGWVUEJG)TQUEJGPFGU,CJTJWPFGTVU+PVGTGUUCPVGU.QVDKVVGDGUKEJVKIGP  5VÒEM5GJTUEJÌP





&KXGTUG CNVFGWVUEJG -NGKPOÒP\GP FGU  ,CJTJWPFGTVU XQO 2HGPPKI DKU \WO  6CNGT &C\W   TWUUKUEJG-NGKPOÒP\GPWPFGKPJCDUDWTIKUEJGT,GVQP+PVGTGUUCPVGU.QVDKVVGDGUKEJVKIGP  5VÒEM/GKUVUGJTUEJÌP



#PJCNV<GTDUV%CTN9KNJGNO6CNGT<GTDUV &CX $TCWPUEJYGKI.ÒPGDWTI%GNNG)GQTI 9KNJGNO  /CTKGPITQUEJGP  %GNNG &CX   $TCWPUEJYGKI%CNGPDGTI*CPPQXGT ,QJCPP   (TKGFTKEJ  6CNGT  *CPPQXGT &CX   /CIFGDWTI #WIWUV XQP 5CEJUGP9GKUUGPHGNU    6CNGT*CNNG &CX  5VÒEM5GJTUEJÌPpXQT\ÒINKEJ



#WIUDWTI4GKEJUVCNGTOKV6KVGN(GTFKPCPFU+++ &CX $TCWPUEJYGKI*CTDWTI4GKEJUVCNGT  &CX   0ÒTPDGTI -QPX6CNGT  OKV 6KVGN ,QUGHU ++ &CX   5CEJUGP $TGKVGT   4GKEJUVCNGTCWHFGP6QFXQP%JTKUVKCP++ &CX WPF6CNGTPCEJ9GEJUGNVCNGTHW­CWH FGP 6QF ,QJCPP )GQTIU ++ &CX   $CUGN 6CNGT Q , &CX   5CN\DWTI -QPX6CNGT   

&CX  5VÒEM/KVMNGKPGP(GJNGTPOGKUVUGJTUEJÌP



$C[GTP 8GTGKPUVCNGT 5KGI 6JWP $TCWPUEJYGKI%CNGPDGTI*CPPQXGT&QRRGNVGT8GTGKPUVC NGT  6JWP   *CPPQXGT 5VCFV 6CNGT·JPNKEJG (GKPUKNDGTOGFCKNNG   &GWVUEJGU $WPFGU   UEJKG­GP 6JWP   2TGW­GP 8GTGKPUVCNGT  6QF 6JWP   ¤UVGTTGKEJ (GKPVCNGT  +++   &GWVUEJGU$WPFGUUEJKG­GPKP9KGP 6JWP  5VÒEM/GKUVXQT\ÒINKEJ



#PJCNV 6CNGT  #WUDGWVG  *CODWTI 4GKEJUVCNGT  OKV 6KVGN -CTNU 8+ .ÒDGEM 6CNGT    5EJKNNKPI 0CUUCW8GTGKPUVCNGT 4GIKGTWPIULWDKN·WO 4GW­8GTGKPUVCNGT 5CEJUGP -QPX6CNGT  -QPX6CNGT  6QF  6CNGT  ( /ÒP\DGUWEJ  9CNFGEM WPF 2[T   OQPV8GTGKPUVCNGT9ÒTVVGODGTI8GTGKPUVCNGT&C\W(TCPMTGKEJ(TCPEU#  5VÒEM/GKUVUGJTUEJÌP





-NGKPG5COONWPIXQP6CNGTPFGU,CJTJWPFGTVUXQP$CFGPDKU9ÒTVVGODGTI*QEJKPVGTGUUCPVGU.QV OKVDGUUGTGP6[RGPDKVVGDGUKEJVKIGP 5VÒEM5GJTUEJÌPWPFDGUUGT





-NGKPG 5COONWPI UÒFFGWVUEJGT 6CNGT WPF 6GKNUVÒEMG FGU  WPF  ,CJTJWPFGTVU XQP #WIUDWTI   0ÒTPDGTI WPF 4GIGPUDWTI CW­GTFGO GKP  &WMCV XQP 4GIGPUDWTI GKP 2CNODCWOIWNFGP  XQP   $TCWPUEJYGKI%CNGPDGTI*CPPQXGTUQYKGFKXGTUGOQFGTPG/ÒP\GPWPF<KPPCDIÒUUG  5VÒEM/GKUVUGJTUEJÌP 



-NGKPG 5COONWPI XQP 5EJÒUUGNRHGPPKIGP FGU  ,CJTJWPFGTVU W C XQP (TKGFDGTI *CPCW -ÌNP   /CKP\0CUUCW2HCN\5CNO5RG[GT9CNFGEM9QTOUGVE*QEJKPVGTGUUCPVGU.QVDKVVGDGUKEJVKIGP  5VÒEM5EJÌPpUGJTUEJÌP













/KVVGNCNVGT -QPXQNWV XQP OKVVGNCNVGTNKEJGP &GPCTGP FGU  ,CJTJWPFGTVU +PVGTGUUCPVGU .QV DKVVG DG   UKEJVKIGP 5VÒEM/GKUVUGJTUEJÌP 

#75.#0& 

#NNIGOGKP -NGKPG 5COONWPI XQP \WOGKUV GWTQR·KUEJGP /ÒP\GP FGU  ,CJTJWPFGTVU FCTWPVGT   \CJNTGKEJG6CNGTRT·IWPIGPWCXQP*CDUDWTI)TQ­DTKVCPPKGPWPF(TCPMTGKEJ+PVGTGUUCPVGU.QVDKVVG DGUKEJVKIGP 5VÒEM/GKUVUGJTUEJÌP 



&KXGTUG/ÒP\GPFGU,CJTJWPFGTVUWC+VCNKGP/CNVC0KGFGTNCPFG5KGDGPDÒTIGPGVEFCTWPVGT Z6CNGTRT·IWPIGP+PVGTGUUCPVGU.QVDKVVGDGUKEJVKIGP 5VÒEM5VGORGNINCP\





&KXGTUG2TQDGPXQP/CTQEEQ(TCPEU(TCPE#*KP#NWOKPKWOWPF(TCPEU#*KP 5KNDGT&C\WYGKVGTG2TQDGPXQP6WPGUKGP(TCPEUKP5KNDGT  5VÒEM6GKNYGKUGOKVMN(GJNGTPOGKUVUGJTUEJÌP



5COONWPIXQPFKXGTUGP5KNDGTWPF$TQP\GOÒP\GPFGUKUNCOKUEJGPWPFKPFKUEJGP4CWOGU&KG5COO NWPIWOHC­VFKXGTUG'RQEJGPWPF,CJTJWPFGTVG+PVGTGUUCPVGU.QVDKVVGDGUKEJVKIGP  EC5VÒEM5EJÌPpUGJTUEJÌP







306

5COONWPIXQP-WRHGTOÒP\GPFGU,CJTJWPFGTVUOKV5EJYGTRWPMV)TQ­DTKVCPPKGP WC)KDTCN VCT)WGTPUG[+UNGQH/CP WPF+TNCPF&C\WGKPKIGKVCNKGPKUEJGWPFHTCP\ÌUKUEJG-WRHGTOÒP\GPUQYKG YGPKIG 5KNDGTOÒP\GP *QEJKPVGTGUUCPVGU .QV OKV 5GNVGPJGKVGP WPF JÒDUEJGP 3WCNKV·VGP DKVVG DGUKEJVK   IGP 5VÒEM5GJTUEJÌPpHCUV5VGORGNINCP\ 


Bei uns sind Sie goldrichtig!

• Über 35 Jahre Erfahrung im Gold- und Münzenhandel • Faire und objektive Bewertung Ihrer Goldmünzen • Barankauf von Goldmünzen zu tagesaktuellen Preisen • Große Auswahl interessanter Goldmünzen • Vertrauen Sie Europas führendem Auktionshaus für Münzen und Medaillen

Sie möchten Ihre Münzen veräußern? 0800 5836537 (gebührenfrei) Fritz Rudolf Künker GmbH & Co. KG Gutenbergstraße 23 · 49076 Osnabrück · Germany Tel. +49 (0)541 96 20 20 · Fax +49 (0)541 96 20 222 www.kuenker.de · service@kuenker.de Osnabrück · Berlin · München · Zürich · Moskau


Einladung zu Einlieferungen für unsere Frühjahrsauktionen Möbel, Porzellan, Fayence, Silber, Schmuck Gemälde, Zeichnungen, Skulpturen 15.–19. Jh. Zeitgenössische Kunst, Moderne Kunst, Design Photographie, Asiatische Kunst, Tribal Art

Bedeutender Zeremonienstab aus dem Besitz der Großherzöge von Oldenburg (Detail). Ehemals Lübecker Domschatz, datiert 1458 Silber, teils vergoldet, L 146 cm. Verkauft für: e 312.000,-

LEMPERTZ gegründet 1845

Neumarkt   Köln Tel.   ⁄    -  Fax -  Poststraße   Berlin Tel.  ⁄     -  Fax -  St.-Anna-Platz   München Tel.  ⁄     info@Lempertz.com www.Lempertz.com


Künker eAuctions

Künker eAuctions

Unsere eAuctions umfassen circa 250 Losnummern. In einem festgelegten Zeitraum von 14 Tagen haben Sie die Möglichkeit, online auf die für Sie interessanten Münzen und Medaillen zu bieten. Die einzelnen Losnummern laufen zeitlich versetzt aus. Selbstverständlich werden Sie über Ihren aktuellen Gebotsstatus laufend per Email informiert und können Ihre Gebote bei Bedarf bis zur letzten Sekunde erhöhen.

Our eAuctions contain 250 lots. During a fixed period of 14 days you have the opportunity to submit your bids online on your favourite coins and medals.

Weitere Informationen und die nächsten Termine zu den Künker eAuctions finden Sie unter:

You may find further information and the next dates of the Künker eAuctions here:

www.kuenker.de

www.kuenker.com

Each lot will expire at different times. Certainly you will be informed constantly by email about the current status of your bids so that you permanent have the possibility – if necessary – to raise your bids till the end of the eAuction.

Fritz Rudolf Künker GmbH & Co. KG Gutenbergstraße 23 · 49076 Osnabrück · Germany Tel. +49 (0)541 96 20 20 · Fax +49 (0)541 96 20 222 www.kuenker.de · service@kuenker.de Osnabrück · Berlin · München · Zürich


Leitfaden zur erfolgreichen schriftlichen Auktionsteilnahme • • • • •

Studieren Sie den Katalog sorgfältig und notieren Sie alle Lose, die interessant für Sie sind. Legen Sie für jedes Los Ihr persönliches Limit fest, das Sie maximal zu zahlen bereit sind. Füllen Sie das beiliegende Formular aus (siehe unten) und tragen Sie für jedes Los Ihr Höchstgebot ein. Schicken Sie uns Ihren Auftrag frühzeitig. Bei gleich hohen Geboten erhält das zuerst eingegangene Gebot den Zuschlag. Sie haben interessante Lose für insgesamt € 10.000,– gefunden, möchten jedoch nur € 2.000,– ausgeben. Kein Problem: Sie geben als Gesamtlimit (ohne Aufgeld) € 2.000,– an. • Wenn Sie Fragen haben: Die MitarbeiterInnen unserer Kundenbetreuung sind für Sie da: Telefon 0800 583 65 37 (gebührenfrei). • Wenn Sie telefonisch an unseren Auktionen teilnehmen möchten, ist das ab einer Schätzung von € 500,– pro Los möglich. Bitte teilen Sie uns diesen Wunsch mindestens einen Werktag vor Beginn der Versteigerung schriftlich mit.

Musterauftrag für schriftliche Gebote Name, Adresse, Telefon Ihre vollständige Anschrift ist wichtig, damit wir Ihren Auktionsauftrag annehmen und bearbeiten können. Ihre Telefonnummer brauchen wir, um Sie bei Rückfragen zu Ihren Geboten schnell erreichen zu können.

Ihre Kundennummer Die Angabe Ihrer Kundennummer unterstützt uns bei der Bearbeitung Ihres Auktionsauftrages. Viele Vorarbeiten für die Auktion werden dadurch einfacher und es werden Fehler vermieden.

Losnummern und Gebote Listen Sie alle Lose, für die Sie sich interessieren, mit ihrer Katalognummer auf und legen Sie für sich selbst fest, wie viel Sie bereit sind, für jedes einzelne Los zu bieten.

Ihr Limit pro Einzellos An dieser Stelle geben Sie an, was Sie für jedes einzelne Stück maximal bereit sind auszugeben.

„Oder“-Gebote Wenn Sie sich für mehrere Münzen interessieren, aber nur ein Stück davon erwerben wollen, können Sie Ihre Gebote einfach mit einem „Oder“ verbinden. Wichtig: bei den „Oder“Geboten können Sie nicht auf frühere Katalognummern zurückgreifen (z. B. 2890 oder 1558), da die Nr. 1558 dann bereits versteigert ist. Unterschreiben Sie Ihren Auktionsauftrag ... ... nachdem Sie Ihre Angaben noch einmal überprüft haben. Ihre Unterschrift ist wichtig, denn damit bestätigen Sie uns, dass sie tatsächlich teilnehmen wollen.

Überschreitung Ihrer Limits pro Einzellos In der Praxis zeigt sich, dass oft mehrere Bieter mit ihren Geboten dicht beieinander liegen. Deshalb empfiehlt es sich, an dieser Stelle einer geringfügigen Überschreitung Ihrer Gebote zuzustimmen. Dadurch erhöhen sich Ihre Chancen, im Wettbewerb mit anderen den Zuschlag zu erhalten.

Begrenzung Ihres Gesamtlimits Hier können sie die Gesamtsumme Ihrer Gebote begrenzen und festlegen, was Sie insgesamt maximal bereit sind auszugeben. Aufgeld und Mehrwertsteuer kommen später noch hinzu.

TEL +49 (0)541 96 20 20, FAX +49 (0)541 96 20 222, SERVICE@KUENKER.DE, WWW.KUENKER.DE


Wie entsteht der Preis einer Auktion? Der im Auktionskatalog angegebene Preis ist ein Schätzpreis, der durch unsere Experten festgelegt wurde. Das Mindestgebot liegt bei 80 % dieses Wertes. Die Zuschlagpreise sind oft deutlich höher als die Schätzpreise. Als Auktionshaus müssen wir bereits vor der Auktion alle schriftlichen Gebote koordinieren. Folgende Beispiele sind im Bietverfahren möglich: Beispiel 1 (Schätzpreis: € 1.000,–) Es liegt kein schriftlicher Auftrag vor: Der Auktionator ruft das Los in der Auktion mit € 800,– aus. Wenn im Saal nur ein Bieter darauf ein Gebot abgibt, erhält der Saalbieter den Zuschlag für € 800,–.

Beispiel 3 (Schätzpreis: € 1.000,–) Es liegt dem Auktionator nur ein schriftliches Gebot von € 850,– vor: Das Los wird in der Auktion mit € 800,– ausgerufen. Falls kein Bieter im Saal ein Gegenangebot abgibt, erhält der schriftliche Bieter den Zuschlag bei € 800,–.

Beispiel 2 (Schätzpreis: € 1.000,–) Es liegen dem Auktionator drei schriftliche Gebote vor:

Beispiel 4 (Schätzpreis: € 1.000,–) Es liegt dem Auktionator nur ein schriftliches Gebot von € 1.200,– vor: Der Auktionator ruft das Los mit € 800,– aus. Gibt es im Saal keinen Gegenbieter, erhält der schriftliche Bieter den Zuschlag bei € 800,–. Falls es im Saal Gegenbieter gibt, bietet der Auktionator für seinen schriftlichen Bieter bis maximal € 1.200,– und erteilt einem Gegenbieter im Saal erst bei mehr als € 1.200,– den Zuschlag.

Bieter 1: Limit € 2.900,– Bieter 2: Limit € 1.800,– Bieter 3: Limit € 800,– Nach der Versteigerungsordnung muss der Auktionator im Interesse von Bieter 1 und 2 angemessen überbieten (um ca. 5 bis 10 %). Der Ausrufpreis in der Auktion beträgt daher im Interesse von Bieter 1 € 1.900,– (obwohl die Schätzung € 1.000,– beträgt). Falls keine höheren Gebote aus dem Saal erfolgen, erhält Bieter 1 den Zuschlag für € 1.900,–. Das Höchstangebot von € 2.900,– musste nicht ausgeschöpft werden.

Beispiel 5 (Schätzpreis: € 1.000,–) Es liegen drei Gebote von je € 975,– vor: Um Missverständnisse zu vermeiden, überzieht der Auktionator das zuerst eingegangene Gebot geringfügig und erteilt den Zuschlag bei € 1.000,–.

Antworten auf Fragen, die uns oft gestellt werden • Zuschlagpreis/Aufgeld: Wir berechnen als Auktionshaus ein Aufgeld von 15 % auf den Zuschlagpreis, dazu kommt die gesetzliche Mehrwertsteuer. Beispiel 1

Zuschlagpreis Aufgeld 15 % Versandkosten, z. B. * MwSt. 7 % Rechnungs-Betrag

€ € € € €

100,00 15,00 5,90 8,46 129,36

Beispiel 2

Zuschlagpreis Aufgeld 15 % Versandkosten, z. B. * MwSt. 7 % Rechnungs-Betrag

€ 1.000,00 € 150,00 € 5,90 € 80,91 € 1.236,81

• Mehrwertsteuer: üblicherweise in Deutschland 7 %, seit dem 01.01.2000 sind viele Goldmünzen, die nach 1800 geprägt wurden, steuerfrei. Bei Fragen zu der MwSt.-Berechnung rufen Sie uns an, gebührenfrei unter: 0800 583 65 37. • Rücklosverkauf: Alle Lose, die in der Auktion nicht verkauft wurden, können Sie innerhalb von vier Wochen nach der Versteigerung zu 80 % des Schätzpreises (zzgl. Aufgeld und Mehrwertsteuer) erwerben. Achtung: Viele Rücklose sind schnell vergriffen. • Unser Spezialservice: Alle Bieter erhalten gratis die Ergebnisliste innerhalb von zwei Wochen nach der Auktion. Im Internet können Sie die Ergebnisliste der Auktion sofort nach der Auktion unter www.kuenker.de einsehen. * Die Kosten für Versand und Versicherung werden nach Aufwand berechnet.

Besuchen Sie uns doch einmal persönlich auf der Auktion! • Wir freuen uns sehr, wenn Sie persönlich nach Osnabrück kommen möchten. Das Flair einer Auktion und die Stimmung im Auktionssaal sind ein besonderes Erlebnis für Sie als Sammler. Osnabrück ist außerdem immer eine Reise wert und die persönliche Betreuung durch unsere Mitarbeiter wissen immer mehr Kunden zu schätzen. • Bitte rufen Sie uns rechtzeitig an, damit wir Ihnen Tipps für die Anreise geben und Ihnen ein Hotelzimmer reservieren können. Sie erreichen uns gebührenfrei unter: 0800 583 65 37. • Als erfolgreicher Bieter können Sie Ihre neu erworbenen Stücke gleich persönlich mit nach Hause nehmen. Als guter Kunde unseres Hauses haben Sie 20 Tage Zahlungsziel nach der Auktion.

TEL +49 (0)541 96 20 20, FAX +49 (0)541 96 20 222, SERVICE@KUENKER.DE, WWW.KUENKER.DE


Versteigerungsbedingungen Die Versteigerung erfolgt im Auftrag und für Rechnung der Eigentümer unter Einhaltung der sich aus der Versteigerungsordnung (BGB1 I 1976, 1346) ergebenden und für Kommissionäre geltenden gesetzlichen Bestimmungen des BGB und HGB gegen Barzahlung des Kaufpreises in €-Währung. Durch Abgabe eines Gebotes werden die Versteigerungsbedingungen anerkannt, dies gilt auch für die schriftlichen Gebote. Der Zuschlagpreis ist Nettopreis im Sinne des Umsatzsteuergesetzes und bildet die Berechnungsgrundlage für das vom Käufer zu zahlende Aufgeld in Höhe von 15 %. Auf den daraus entstehenden Gesamtpreis (Zuschlag + Aufgeld) wird die jeweils gültige Umsatzsteuer erhoben, soweit dies gesetzlich vorgeschrieben ist. Ausländischen Käufern aus Ländern der europäischen Gemeinschaft wird die in Deutschland gültige Umsatzsteuer berechnet. Anderen ausländischen Käufern (aus Drittländern) wird, sofern die Münzen durch uns exportiert werden, ein Aufgeld von 15 % netto auf den Zuschlagpreis berechnet; sie erhalten die Lieferung nur gegen Zahlung des Kaufpreises in €-Währung, bankspesenfrei. Ausländischen Münzhändlern aus Ländern der europäischen Gemeinschaft wird bei Nachweis der Umsatzsteuer-Identifi kationsnummer (§ 27 a USTG) und der sonstigen Voraussetzungen gemäß § 4 Nr. 1 b USTG in Verbindung mit § 6 a USTG die Lieferung ohne Umsatzsteuer berechnet. Sofern nichts anderes vereinbart wird, ist die Zahlung der Auktionsrechnung bei anwesenden Käufern sofort, bei schriftlichen Bietern spätestens 20 Tage nach Erhalt fällig. Bei Zahlungsverzug werden Zinsen von 1 % pro Monat berechnet. Wird die Zahlung nicht sofort an den Versteigerer geleistet oder die Abnahme der zugeschlagenen Sache verweigert, so findet die Übergabe der Sache an den Ersteigerer nicht statt. Der Ersteigerer verliert vielmehr seine Rechte aus dem Zuschlag, und die Sache kann auf seine Kosten erneut versteigert werden. In diesem Fall haftet der Ersteigerer für den Ausfall, dagegen hat er auf den Mehrerlös keinen Anspruch. Der Zuschlag erfolgt nach dreimaligem Ausruf des höchsten Gebotes und verpflichtet zur Abnahme und Zahlung. Bei Meinungsverschiedenheiten über den Zuschlag wird die Nummer noch einmal ausgerufen. Der Versteigerer ist berechtigt, Nummern zu vereinigen oder zu trennen. Eine Vorausnahme von Nummern erfolgt nicht. Der Zutritt zur Versteigerung ist nur Interessenten gestattet, die einen Katalog besitzen. Die Mindeststeigerungsstufen für das Bietungsverfahren betragen: Gebote

Mindeststeigerungsstufe

Schriftliche Aufträge werden von uns ohne Auftragsprovision gewissenhaft ausgeführt. Aufträge von uns unbekannten Sammlern können nur ausgeführt werden, wenn ein Depot hinterlegt wird oder Referenzen benannt werden. Schriftliche Gebote können nur bis 24 Stunden vor Auktionsbeginn verbindlich berücksichtigt werden. Im Bedarfsfall ist der Auktionator berechtigt, die Limits um 3 – 5 % zu überschreiten. Bei mehreren gleichhohen Geboten erhält das zuerst eingegangene den Zuschlag. Unlimitierte Aufträge haben keinen Anspruch auf unbedingte Ausführung. Telefonisches Bieten ist nur in Ausnahmefällen möglich. Telefonische Bieter müssen sich mindestens einen Werktag vor der Auktion voranmelden. Der Versand geht zu Lasten und auf Risiko des Ersteigerers bzw. Empfängers. Das Auktionsgut bleibt bis zur vollständigen Bezahlung aller Forderungen aus Anlass der Versteigerung Eigentum des Verkäufers. Ist der Käufer Vollkaufmann, so ist Osnabrück als Gerichtsstand vereinbart. Für das Mahnverfahren gilt die Zuständigkeit des Amtsgerichts Osnabrück auch in allen anderen Fällen als vereinbart. Ansonsten ist es Osnabrück nur, wenn nur die Firma Fritz Rudolf Künker GmbH & Co. KG ihren allgemeinen Gerichtsstand in der BRD hat, oder wenn alle Ansprüche im Wege des Mahnverfahrens geltend gemacht werden, oder wenn die im Klageweg in Anspruch zu nehmende Vertragspartei nach Vertragsabschluss ihren gewöhnlichen Aufenthaltsort aus dem Geltungsbereich der BRD verlegt hat, oder ihr Wohnsitz oder gewöhnlicher Aufenthaltsort zum Zeitpunkt der Klage nicht bekannt ist. Die Beschreibung im Katalog ist gewissenhaft durchgeführt. Sie begründet jedoch keine Rechts- oder Sachmängelhaftung gemäß §§ 434, 459 ff BGB. Die Angabe der Erhaltung ist streng nach den im deutschen Münzhandel üblichen Erhaltungseinstufungen vorgenommen und gilt als persönliche Beurteilung. Bei der Auktion anwesende Käufer kaufen grundsätzlich „wie besehen“. Da durch Vorbesichtigung Gelegenheit gegeben ist, sich vom Erhaltungszustand des Versteigerungsgutes zu überzeugen, können nach erfolgtem Zuschlag Reklamationen nur bei irrtümlich übersehener Henkel- oder Fassungsspur oder gestopftem Loch berücksichtigt werden. Bei Losen mit mehreren Stücken sind die Stückzahlen nur Circa-Angaben, irrtümliche Zuschreibungen sind im Einzelfall nicht ausgeschlossen. Diese Lose sind nach erfolgtem Zuschlag von jeder Reklamation ausgeschlossen. Der Versteigerer kann bei eventuellen Meinungsverschiedenheiten bzw. Beanstandungen einen vereidigten Sachverständigen seiner Wahl (die Kosten trägt der unterliegende Teil) beauftragen. Eventuelle Beanstandungen können nur innerhalb von 8 Tagen nach der Auktion bzw. nach Erhalt der ersteigerten Stücke berücksichtigt werden. Die Echtheit der Stücke wird bis zur Höhe des Kaufpreises garantiert. Die beigedruckten Preise sind Schätzpreise, die unter- oder überschritten werden können. Aufträge, die unter 80 % des Schätzpreises liegen, können nicht bearbeitet werden.

bis zu

€ 100,–

€ 5,–

bis zu

€ 200,–

€ 10,–

bis zu

€ 500,–

€ 20,–

bis zu

€ 1.000,–

€ 50,–

bis zu

€ 2.000,–

€ 100,–

Soweit nicht anders vermerkt, gelten im übrigen die allgemeinen Versteigerungsbestimmungen und – auch im Verhältnis zu ausländischen Kunden – gilt Deutsches Recht.

bis zu

€ 5.000,–

€ 200,–

Die Ergebnisliste erscheint sofort nach der Auktion.

bis zu

€ 10.000,–

€ 500,–

bis zu

€ 20.000,–

€ 1.000,–

bis zu

€ 50.000,–

€ 2.000,–

bis zu

€ 100.000,–

€ 5.000,–

ab

€ 100.000,–

€ 10.000,–

Ausländische Kunden kaufen nach den Devisen-, Zoll- und Steuerbestimmungen ihres Landes. Versandformalitäten werden vom Versteigerer erledigt.

Die Versteigerer:

Fritz Rudolf Künker Dr. Andreas Kaiser Arne Kirsch Oliver Köpp

TEL +49 (0)541 96 20 20, FAX +49 (0)541 96 20 222, SERVICE@KUENKER.DE, WWW.KUENKER.DE


Terms and Conditions of Auction The auction is conducted on behalf and for the account of the appropriate proprietors of the goods and is subject to the federal Auction Regulation (Versteigerungsordnung, BGB1 I 1976, 1346) published in the Federal Law Gazette Vol. I, 1976, 1346 and the relevant provisions for factors in accordance with the German Civil Code (BGB) and Commercial Code (HGB). Payment of the hammer-price has to be made in cash and in Euro. The submission of an offer implies the express acknowledgement of these Terms and Conditions of Auction; the same applies to the submission of an offer in writing. The hammer-price is exclusive of applicable German VAT according to the prevailing VAT-legislation and represents the basis for calculating the surcharge of 15 percent payable by the purchaser. The total price so calculated (hammer-price plus surcharge) is subject to the VAT (value added tax = Mehrwertsteuer), which is payable additionally. Purchasers from abroad will be charged a surcharge of 15 percent net on the hammerprice, provided the export of the coins is undertaken by the auctioneer. Buyers in European Community (EEC) countries (other than Germany) will be charged value added tax at the rates prevailing in Germany. Dealers from EEC countries (other than Germany) will receive goods free of tax upon presentation of their VAT ID number, and upon fulfillment of the other conditions set forth in Paragraph 4, Nr. 1 b, and Paragraph 6 a of the German Turnover Tax Law Buyers from other countries are not charged value added tax. Delivery will be made against payment in Euro with no bank charges to the auctioneer. Unless mutually agreed otherwise, payment of the auction bill from purchasers present at the auction is due immediately. From purchasers who have submitted a bid in writing, payment is due within 20 days after receipt of the goods. Defaulted payments shall bear an interest charge of 1 % per month in the amount in default. Should payment to the auctioneer not be made immediately or should the acceptance of the awarded item be refused, such item shall not be handed over to the purchaser. Instead the purchaser shall forfeit all right and title in and to such item from the award and the item may again be put to auction at this buyer’s cost. In this event the buyer shall be liable for any shortfall, while he shall have no right or claim towards any excess proceeds. An item will be knocked down after the highest bid has been called three times. The award shall be a binding commitment and liability on the part of the bidder to take acceptance and delivery of the item or items so awarded. In the event of any dispute with regard to the award the lot will be put up again for bidding. The auctioneer reserves the right to combine or to separate lots. Lots will not be called out of sequence. Access to the auction will only be permitted to interested persons who are in possession of the catalogue.

lot, the bid first received by the auctioneer shall be given the award. Unlimited bids shall not oblige the auctioneer to consider, accept or carry out such order. Telephone bidding is generally an option for lots of substantial value only. The registration is required at the latest a day before auction. Shipment (by mail or otherwise) of the goods shall be for the sole cost and risk of the purchaser or recipient, respectively. The auctioned goods remain the sole and exclusive property of the vendor until full payment and settlement of any and all dues and claims in connection with the auction. In the event the purchaser is a merchant (in the sense of the German commercial laws) Osnabrück shall be the agreed and exclusive place of jurisdiction. The competence of the District Court (Amtsgericht) of Osnabrück is agreed in respect of summary proceedings for the collection of defaulted payments (Mahnverfahren) as well as in any and all other cases. Should the purchaser not be a merchant Osnabrück shall be the place of jurisdiction with the District Court of Osnabrück’s competence, if only the auctioneer has his ordinary legal domicile in the Federal Republic of Germany or if claims are made by way of summary proceedings of collection (Mahnverfahren) or if the defendant has moved his ordinary legal domicile outside the jurisdiction of the Federal Republic of Germany or if the legal domicile of the defendant is unknown to the auctioneer at the time of filing a suit. To the exclusion of any other legislation German law, as in force at the time, shall be applied for the settlement of any and all legal or judicial matters. The specifications and descriptions in the catalogue have been prepared diligently and in good faith, however, do not constitute the acceptance by the auctioneer of any warranty or liability in respect of defect in material or title. The state of preservation of items is strictly assessed in accordance with the grades accepted by the German coin trade and only represents an individual and personal assessment. Purchasers present at the auction acquire items strictly on the basis of “as is where is” and “as inspected”. In view of the opportunity of prior inspection to ascertain the state and condition of the auction lots, complaints and objections made after the sale will only be considered, if by obvious error or mistake loop or traces or mountings, traces of trimmings or settings, or the plugging of a hole (eyelet) have remained unnoticed. If and when auctioned in lots, the quantities of individual pieces given, only represent an approximate figure. An error in the allocation of individual pieces to a certain lot cannot be excluded. Such lots are, therefore, excluded from any complaints or objections after the lot is knocked down. In the event of disputes or complaints as to the quality of an item the auctioneer may call upon a generally sworn expert of the trade, which the auctioneer may choose at his sole discretion, for assessment and the rendering of a decision as to the justification of such dispute or complaint. The costs of such expert shall be borne by the party loosing the dispute according to the expert’s decision. Complaints or objections, if justified, will only be considered if made and received by the auctioneer within 8 days after the auction or after receiving the lots, respectively.

The minimum rates of increase for the bidding procedure are: offers up to up to up to up to up to up to up to up to up to up to above

€ 100.– € 200.– € 500.– € 1,000.– € 2,000.– € 5,000.– € 10,000.– € 20,000.– € 50,000.– € 100,000.– € 100,000.–

minimum increase rate € 5.– € 10.– € 20.– € 50.– € 100.– € 200.– € 500.– € 1,000.– € 2,000.– € 5,000.– € 10,000.–

Orders submitted in writing will be carried out diligently and without charge of an extra commission. Orders from collectors unknown to the auctioneer can only be accepted and carried out if a deposit or references to the satisfaction on the auctioneer are given. To be bindingly accepted, written bids need to be received at least 24 hours before auction. If necessary, the auctioneer is allowed to increase the bids by 3 – 5 %. Should several bids be obtained in writing bidding the same price or prices for a given

The authenticity of the coins is warranted up to the total purchase price. The prices set out in the catalogue are estimates only, which may be exceeded or undercut. Orders for less than 80 per cent of the estimated price cannot be accepted. Purchasers from abroad will have to observe all applicable laws and regulations in respect of foreign exchange, customs duties and taxation of their country. The auctioneer will only discharge such formalities, which have to be observed, in the Federal Republic of Germany in connection with the export of the purchased item(s). Unless stipulated otherwise herein, the general rules regulations for auctions applicable in Germany shall govern any transaction in respect of the auction; German Law shall also be applicable in relation to purchasers from abroad. Only the German text has legal force. The prices realized will be published in the form of a list immediately after the auction. The auctioneers:

Fritz Rudolf Künker Dr. Andreas Kaiser Arne Kirsch Oliver Köpp

TEL +49 (0)541 96 20 20, FAX +49 (0)541 96 20 222, SERVICE@KUENKER.DE, WWW.KUENKER.DE


Numismatische Ausdrücke/Numismatic Terms/Expressions Numismatiques/ Termini di Numismatica/Нумизматические Термины DEUTSCH

ENGLISH

FRANCAIS

ITALIANO

RUSSKIJ

Abschlag Am Rand Berieben Blei Dezentriert Doppelschlag Einfassung Einseitig Emailliert Erhaltung Etwas Exemplar Fassungsspuren Fehlprägung

struck at the rim/border slightly polished lead uncentered double struck frame uniface enamelled condition/preservation slightly specimen, copy trace of mounting mis-strike

frappe en tranche frotté plomb décentré double frappe encadrement uniface émaillé conservation un peu exemplaire traces de monture défaut de frappe

coniazione al bordo trattato piombo non centrato ribattitura cornice uniface smaltato conservazione un poco esemplare tracce di montatura difetto di coniazione

Feld(er) Fundexemplar Gedenkmünze Geglättet Gelocht Geprägt Gewellt Goldpatina Henkelspur Hübsch Jahrh. = Jahrhundert Kl. = klein Korrosionsspuren Kratzer Kupfer Legierung Leicht(e) l. = links Min. = minimal Nachahmung Prachtexemplar Prägeschwäche Randdelle Randfehler Randschrift r. = rechts Rückseite

field(s) specimen from a hoard commemorative coin tooled holed minted bent golden patina mount mark attractive century small traces of corrosion scratch(es) copper alloy slightly left minimal imitation attractive, perfect piece weakly struck edge nick edge faults lettered edge to right reverse

champ exemplaire de trouvaille monnaie commémorative retouché troué frappé ondulé patine dorée trace de monture joli siècle petit traces de corrosion rayure cuivre alliage légèrement gauche minime imitation pièce magnifique de frappe faible défaut sur la tranche erreur sur la tranche tranche inscrite droite revers

campo da tesoretto moneta commemorativa liscio bucato coniato ondolato patina d´oro tracce di appicagnolo carino secolo piccolo segni di corrosione graffio(i) rame lega leggero sinistra minimamente contraffazione esemplare magnifico conio stanco ammaccatura al bordo errore nel bordo inscrizione sul bordo destra rovescio

оттиск на гурте потертая свинец ассиметричный двойной чекан кайма односторонняя эмалированная сохранность слегка экземпляр следы обработки ошибка в процессе чеканки поле экземпляр памятная монета отглаженная проколатая отчеканенная волнистая золотая патина следы от ушка красивая столетие маленький следы коррозии царапина медь сплав легкий слева минимальный имитация превосходный экземпляр издержкн при чеканкe вмятина на гурте ошибка на гурте гуртовая надпись справа реверс

TEL +49 (0)541 96 20 20, FAX +49 (0)541 96 20 222, SERVICE@KUENKER.DE, WWW.KUENKER.DE


DEUTSCH

ENGLISH

FRANCAIS

ITALIANO

RUSSKIJ

Schriftspuren

traces of inscription

traces de légende

tracce di leggenda

Schrötling Schrötlingsfehler Schwach ausgeprägt Selten in dieser Erhaltung

flan flan defect weakly struck rare in this condition

flan flan défectueux de frappe faible rare en cet état

tondello errore di tondello conio stanco conservazione rara

Seltener Jahrgang Stempel Stempelfehler Überdurchschnittlich erhalten Überprägt Unediert Unikum Vergoldet Von allergrößter Seltenheit Vorderseite Winz.= winzig Zain Zierrand Zinn ziseliert

rare year die(s) mistake in the die extraordinary condition

année rare coin erreur de frappe conservation extraordinaire

overstruck unpublished unique specimen gilt extremely rare averse tiny flan ornamental border tin chased

surfrappé inédit unique doré de toute rareté en face petit flan tranche ornée étain ciselé

annata rara conio errore di conio conservazione estraordinaria ribattuto inedito pezzo unico dorato di estrema raritá diritto veramente piccolo tondello taglio ornato stagno cesellato

следы предыдущей надписи заготовка брак заготовки слабо отчеканeна редкая в такой сохранности редкий год штамп ошибка штампа сохранность выше среднего перечекан неопубликованная монета уникальная позолоченная наиредчайшая аверс незначительный заготовка декоративный гурт цинк гравированный

Erhaltungsgrade/Grading Terms/Degrès de Conservation/Gradi di Conservazione/ Шкала сохранности DEUTSCH

ENGLISH

FRANCAIS

ITALIANO

RUSSKIJ

Polierte Platte Stempelglanz Vorzüglich Sehr schön Schön Gering erhalten

Proof Uncirculated Extremely fine Very fine Fine Very good

Flan bruni Fleur de coin Superbe Très beau Beau Très bien conservé

Fondo specchio Fior di conio Splendido Bellissimo Molto Bello Bello

полированная превосходная отличная очень хорошая хорошая удовлетворительная

Seltenheitsgrade/Rarity Terms/Degrés de Rareté/Grado di Raritá/ Шкала редкости DEUTSCH

ENGLISH

FRANCAIS

ITALIANO

RUSSKIJ

R = Selten RR = Sehr selten Von großer Seltenheit Von größter Seltenheit Von allergrößter Seltenheit Uneditiert

R = Rare RR = Very rare Very rare Extremely rare Extremely rare Unpublished

Rare Très rare De grande rareté Extrêmement rare De la plus extrême rareté Inédit

raro molto raro di grande raritá di grandissima raritá di estrema raritá inedito

редкая очень редкая большой редкости наибольшей редкости наиредчайшая ранее не описанная

TEL +49 (0)541 96 20 20, FAX +49 (0)541 96 20 222, SERVICE@KUENKER.DE, WWW.KUENKER.DE


IMPRESSUM NUMISMATISCHE BEARBEITUNG FOTOS LAYOUT DRUCK

Alexandra Spreu, Dr. Sebastian Steinbach, Jens Ulrich Thormann M. A., Eva Weber, Manuela Weiß Lübke & Wiedemann, Stuttgart danner pc - gesteuerte systeme waiblingen meister print und media, Kassel Jeglicher Nachdruck, auch auszugsweise, bedarf der Genehmigung des Auktionshauses

ZAHLUNGEN AUS DEM INLAND Deutsche Bank Osnabrück Commerzbank Osnabrück Sparkasse Osnabrück Volksbank eG Bad Laer-Borgloh-Hilter-Melle Bankhaus Lampe KG, Bielefeld Postbank Hannover HypoVereinsbank München WestLB Dortmund Paypal

(BLZ 265 700 90) Konto-Nummer 0 177 006 (BLZ 265 800 70) Konto-Nummer 780 520 200 (BLZ 265 501 05) Konto-Nummer 247 320 (BLZ 265 624 90) Konto-Nummer 1 200 222 400 (BLZ 480 201 51) Konto-Nummer 174 076 (BLZ 250 100 30) Konto-Nummer 2900 60-308 (BLZ 700 202 70) Konto-Nummer 24 17 952 (BLZ 440 500 00) Konto-Nummer 1128 842 paypal@kuenker.de, Service charge: 3,5 %

ZAHLUNGEN AUS DEM AUSLAND FOREIGN PAYMENTS Deutsche Bank Osnabrück Sparkasse Osnabrück Postbank Hannover Credit Suisse Credit Cards Paypal

IBAN: DE11 2657 0090 0017 7006 00 Swift-Code: DEUTDE3B265 IBAN: DE50 2655 0105 0000 2473 20 Swift-Code: NOLADE22XXX IBAN: DE73 2501 0030 0290 0603 08 Swift-Code: PBNKDEFF IBAN: CH43 0483 5177 3509 0200 0 Swift-Code: CRESCHZZ80A We do accept VISA and MASTERCARD, Service charge: 4,5 % paypal@kuenker.de, Service charge: 3,5 %

ZAHLUNGEN INNERHALB RUSSLANDS PAYMENTS WITHIN RUSSIA Deutsche Bank Moskau ʽʽʽΗʪ̸̨̜̖ʥ̡̦̌Η

ИНН 7728717332; КПП 772801001 Получатель: ЗАО "Кюнкер" счет №: 40702810500000000825; БИК: 044525101 корсчет №: 30101810100000000101

Auktion 183  

Fritz Rudolf Künker Gmbh & Co. KG, Auktion 183, 14. - 18. März 2011 in Osnabrück, Münzen und Medaillen aus Mittelalter und Neuzeit