Page 1


6KVGNHQVQ 0T   FRANKFURT, REICHSMÜNZSTÄTTE Friedrich I., 1152-1190. Brakteat. 0,84 g. Berger 2357; Hävernick 26; J. u. F. 9; Nau (Die Zeit der Staufer) 186.3; Slg. Bonhoff -; Slg. Hohenstaufenzeit -.


AUKTION 180 Romanische Kleinkunstwerke aus der Stauferzeit Ausgewählte Brakteaten aus dem Währungsraum der Wetterau in feinsten Erhaltungen

Numismatische Raritäten aus Mittelalter und Neuzeit ZEIT

Donnerstag, 27. Januar 2011 10.30 Uhr - 13.00 Uhr 14.00 Uhr - 18.30 Uhr

ORT

Estrel Hotel Berlin, Sonnenallee 225, 12057 Berlin, Saal C

AUKTIONS-TELEFON

+49 (0)30 68 31 25 390

AUKTIONS-FAX

+49 (0)30 68 31 25 311

Zeitplan/Timetable 10.30 UHR - 13.00 UHR

Nr. 1 bis Nr. 456 Ausgewählte Brakteaten, Neuzeit: Deutschland, Habsburgische Erblande

14.00 UHR - 15.30 UHR

Nr. 457 bis Nr. 707 Neuzeit: Europa, Übersee

15.30 UHR - 18.30 UHR

Nr. 1001 bis Nr. 1506 Goldprägungen, Russische Münzen und Medaillen


Sehr geehrte Münzfreunde/Dear Coin Collectors Ich wünsche Ihnen viel Freude bei der Lektüre unserer aktuellen Auktionskataloge und hoffe, dass Sie darin einige schöne Stücke für Ihre Sammlung finden. Bei Fragen hilft Ihnen unsere Kundenbetreuung gerne persönlich weiter. Wie gewohnt finden Sie die Hinweise „Wie biete ich richtig“ am Ende des Kataloges. I wish you a lot of pleasure with the new auction catalogues and I hope that you will find a few additional items for your collection. If you have any questions, our customer center will be glad to assist you. According to customs you may find the instructions “How to bid in our auctions” at the end of this catalogue. Mit herzlichen Grüßen/With warm regards

Fritz Rudolf Künker

Besichtigung/On View Besichtigungen des Auktionsgutes sind vom 3. – 21. Januar 2011 nach vorheriger Absprache in unseren Geschäftsräumen in Osnabrück möglich. Am Montag, den 24. Januar 2011 kann das Auktionsgut in unserem Büro im Kunsthaus Lempertz (Nikolaiviertel), Poststraße 22 in Berlin-Mitte, von 13.00 Uhr bis 18.00 Uhr und am Dienstag, den 25. Januar 2011 von 10.00 Uhr bis 18.00 Uhr besichtigt werden. Am Mittwoch, den 26. Januar 2011 findet die Besichtigung im Estrel Hotel Berlin, Sonnenallee 225, 12057 Berlin, Saal C, von 11.00 Uhr bis 18.00 Uhr statt. Eine Besichtigung am Auktionstag ist nicht möglich. The coins are on view at our premises in Osnabrück from January 3 – 21, 2011 by prior appointment. Viewing in Berlin is possible at our premises in Berlin-Mitte, Poststraße 22 (Kunsthaus Lempertz) on Monday, January 24, 2011 from 1.00 p. m. to 6.00 p. m. and on Tuesday, January 25, 2011 from 10.00 a. m. to 6.00 p. m. On Wednesday, January 26, 2011 viewing takes place at the Hotel Estrel, Sonnenallee 225, 12057 Berlin, Hall C, from 11.00 a. m. to 6.00 p. m. Viewing is not possible on the day of auction.

KUENKER.DE

Online-Katalog/Online Catalogue Betrachten Sie unsere Auktionskataloge im Internet! Unter www.kuenker.de und www.sixbid.com haben Sie die Möglichkeit, Abbildungen zu vergrößern, Ihre Gebote direkt abzugeben und die Ergebnisse der Auktionen abzurufen. Please browse our auction catalogues at www.kuenker.com or at www.sixbid.com! You will have the possibility to zoom all images, to place your bids and to view all auction results online. Association Internationale des Numismates Professionels (AINP) Verband der Deutschen Münzenhändler e.V.

2

TEL +49 (0)541 96 20 20, FAX +49 (0)541 96 20 222, SERVICE@KUENKER.DE, WWW.KUENKER.DE


Standorte/Locations Wir sind mittlerweile mit sechs eigenen Standorten in Deutschland und Europa vertreten. So können wir Ihnen unseren beliebten Künker-Service auch in Ihrer Nähe anbieten. Unsere Leistungen vor Ort: • Persönliche Beratung und Betreuung in Ihrer Nähe. • Sie können Ihre Münzen direkt einliefern oder verkaufen, ersteigerte Münzen abholen und sich nach Vereinbarung Einlieferungen auszahlen lassen. • Sie können sich von unserem Kooperationspartner auf den Künker-Auktionen vertreten lassen. We are now represented with six locations in Germany and Europe so that we can also provide you the best service in your vicinity. Our local services: • You always have a point of contact nearby. • You can directly consign or sell your coins, collect purchases and receive by appointment payment for consignments. • You can have our cooperation partner represent you at our auctions.

OSNABRÜCK

BERLIN

Fritz Rudolf Künker GmbH & Co. KG Gutenbergstraße 23, 49076 Osnabrück Tel. +49 (0)541 96 20 20 Fritz Rudolf Künker GmbH & Co. KG Poststraße 22, 10178 Berlin-Mitte, im Kunsthaus Lempertz Tel. +49 (0)30 247 248 91 Fritz Rudolf Künker GmbH & Co. KG Wollankstraße 117, 13187 Berlin-Pankow Tel. +49 (0)30 247 248 91

MÜNCHEN

Künker Numismatik AG Löwengrube 12, 80333 München Tel. +49 (0)89 242 198 38 Fritz Rudolf Künker GmbH & Co. KG Maximiliansplatz 12a, 80333 München Tel. +49 (0)89 242 16 990

ZÜRICH

Künker Zürich, c/o Hess-Divo AG Löwenstraße 55, 8001 Zürich, Schweiz Tel. +41 (0)44 225 40 90

ZNOJMO

Künker Znojmo, c/o Petr Kovaljov 17. Listopadu 18, 66902 Znojmo, Tschechische Republik Tel. +42 (0)603 81 10 31

MOSKAU

Künker Moskau, c/o Russian Coin Co. Ltd. 2/21 Makarenko St., 123001 Moskau, Russland Tel. +7 (495) 589 56 10

TEL +49 (0)541 96 20 20, FAX +49 (0)541 96 20 222, SERVICE@KUENKER.DE, WWW.KUENKER.DE

3


Was ist für Ihre schriftliche Auktionsteilnahme besonders wichtig?

DEUTSCH

• Bitte senden Sie uns Ihre Aufträge möglichst frühzeitig zu. Wenn uns Ihr Auftrag erst kurz vor der Auktion erreicht, können sich bei der Bearbeitung Fehler einschleichen. Das beiliegende Formular erleichtert Ihnen die Abgabe eines schriftlichen Gebots. Gerne nehmen wir Ihre Gebote per Post, Fax oder Email entgegen. • Wenn Sie noch nicht bei uns gekauft haben, bitten wir Sie, uns als Referenz eine Münzhandlung anzugeben, mit der Sie bereits in Geschäftsverbindung stehen. • Wir gewährleisten die Echtheit aller verkauften Objekte auch über die gesetzliche Frist hinaus.

Sie möchten telefonisch an der Auktion teilnehmen? Die telefonische Teilnahme an der Auktion ist bei uns selbstverständlich möglich. Wir rufen Sie während der Auktion gerne an und helfen Ihnen, die gewünschten Stücke zu ersteigern. Aus organisatorischen Gründen bitten wir Sie, die folgenden Punkte zu beachten:

Ulrich Künker Leiter Kundenbetreuung

• Telefonisches Bieten ist nur bei Losen mit einer Taxe von mind. € 500,– möglich. • Bitte teilen Sie uns mindestens 48 Stunden vor der Auktion mit, zu welchen Stücken Sie angerufen werden möchten. • Bitte achten Sie darauf, dass Sie erreichbar sind, wenn Ihre Stücke versteigert werden. Der Zeitplan in diesem Katalog hilft Ihnen dabei, den Zeitpunkt der Versteigerung abzuschätzen. • Für den Fall, dass wir Sie nicht erreichen können, bieten wir in Ihrem Namen bis zur Höhe Ihres schriftlichen Gebotes, mindestens aber bis zur Höhe des Schätzpreises. • Bitte beachten Sie, dass telefonisches Bieten eine unsichere Variante der Auktionsteilnahme sein kann. Wir können keine Garantie für das Zustandekommen der telefonischen Verbindung übernehmen. Wenn Sie sicher gehen wollen, besuchen Sie bitte unsere Auktion persönlich oder geben Sie uns ein schriftliches Gebot.

Was passiert nach der Auktion? Barbara Westmeyer deutschsprachige Kundenbetreuung

Telefon: +49 (0)541 96 20 20 Fax: +49 (0)541 96 20 222 Gebührenfrei: 0800 58 36 537 E-Mail: service@kuenker.de Internet: www.kuenker.de Montag – Donnerstag 8.30 – 17.00 Uhr Freitag 8.00 – 15.30 Uhr

4

• Der Versand der Auktionsware startet sofort nach Beendigung der Auktion und dauert in der Regel 8 Tage. • Alle Kunden, die an unserer Auktion schriftlich teilgenommen haben, erhalten innerhalb von 2 Wochen nach der Auktion unsere Ergebnisliste gratis. • Alle Ergebnisse sind spätestens einen Tag nach Auktionsende auf unserer Internetseite verfügbar.

Sie möchten Ihre Münzen in unsere Auktion einliefern? Sollten Sie sich zum Verkauf Ihrer Münzen entschlossen haben, kommen Sie zu uns. Seit 1985 beweisen wir mit derzeit 4 Auktionsterminen und ca. 15 Katalogen pro Jahr unsere Kompetenz und Zuverlässigkeit. Wichtige Informationen für Sie im Überblick: • Ihre Münzen werden von unseren Experten nach neuestem numismatischem Standard bestimmt und in hochwertigen Farbkatalogen präsentiert. • Wir verfügen mit mehr als 10.000 Kunden über eine der besten Kundendateien weltweit. Im Durchschnitt verkaufen wir mehr als 95 % der Stücke einer Auktion, nicht selten erzielen wir dabei Rekordzuschläge. Für nicht verkaufte Objekte werden keine Gebühren erhoben. • Ab der Übergabe an uns sind Ihre Münzen mit dem doppelten Schätzwert versichert. Unsere Kundenbetreuung bespricht gerne mit Ihnen wie Ihre Stücke sicher zu uns gelangen können. • Ihre Einlieferung wird Ihnen sofort nach der Übernahme quittiert. Spätestens 5 Wochen vor der Auktion erhalten Sie eine Auflistung Ihrer Stücke inkl. Katalognummern und Schätzpreisen. • Unmittelbar nach der Auktion erhalten Sie die Ergebnisliste und können dann alle erzielten Preise feststellen. Den Auktionserlös erhalten Sie innerhalb von 45 Tagen nach der Auktion.

TEL +49 (0)541 96 20 20, FAX +49 (0)541 96 20 222, SERVICE@KUENKER.DE, WWW.KUENKER.DE


Important facts for a written participation in the auction • Please send us your instructions as early as possible. The likelihood of errors occurring increases if we receive your instructions only shortly before the auction. The enclosed form should make it simple for you to submit a written bid, you may send your bids by mail, fax or e-mail. • If you are a new customer who has not yet purchased from us, we do request references. Please name a coin dealer with whom you have already done business. • The genuineness of all objects sold is warranted beyond the statutory length of time.

ENGLISH

Do you wish to participate by telephone? You are welcome to participate in our auction by telephone. We are glad to call you during the auction and to assist you in bidding for your items. Please take notice of the following conditions: • Telephone bidding is accepted exclusively on lot numbers with estimates at 500 Euro or above. • Please inform us at least 48 hours in advance if you wish to register for telephone bidding, even for single lots. We do need 48 hours to schedule all incoming requests. • Please be available, when your lots will be sold. The time schedule in the catalogue will help you to estimate the approximate time when your items are going to be sold. • Should you not be available by phone, we will bid on your behalf up to your submitted written limit or at least up to the estimate of the lot for which you requested to be called. • Please be aware that telephone bidding is a risky way of participation in our auction. We do not assume liability should the telephone line be interrupted or not be achieved. We advise you to attend the auction in person or to send written bids.

Nadine Zuber English, Deutsch

What occurs after the auction? • The shipment of all auction goods starts immediately after the completion of the entire auction week and it usually takes 8 days to be completed. • All auction results are available on our website one day after the end of the auction week. • All clients who submitted bids for the auction will automatically receive the list of auction results free of charge within two weeks after the end of auction.

Do you wish to consign your coins to our auction? Should you decide to sell your coins, we are ready to assist you. Since 1985 we have earned our bona fides in conducting over 4 auctions and in publishing 15 catalogues per year. In the following you will find the most important information on consigning: • We guarantee the professional handling of your consignment following the latest numismatic level of expertise including its presentation in colour catalogues of outstanding quality. • We possess one of the best customer lists worldwide. On average we sell more than 95 % of all items in our auction, and it is not unusual for us to achieve record hammer prices for lots submitted. Unsold items incur no fees. • Once the coins are consigned they are covered by our insurance at double the estimate. Upon consultation with our customer service we try to advise you on the safest way of shipping for your coins. • Your delivery will be confirmed in writing immediately on receipt. At least five weeks before the auction, you will receive an exact list of your objects with the relevant catalogue numbers and descriptions. • Within a week of the end of auction, you will receive a list of auction results in order to see what prices were reached for each individual lot. As a consignor, you will receive the auction proceeds within 45 days after the end of auction.

Marion Künker English, Deutsch

Phone: +49 (0)541 96 20 20 Fax: +49 (0)541 96 20 222 E-Mail: service@kuenker.de Website: www.kuenker.com Monday –Thursday 8.30 AM – 5 PM Friday 8 AM – 3.30 PM

TEL +49 (0)541 96 20 20, FAX +49 (0)541 96 20 222, SERVICE@KUENKER.DE, WWW.KUENKER.DE

5


Votre participation par écrit – Les points essentiels

FRANCAIS

• Veuillez nous faire parvenir vos ordres le plus tôt possible. Si vos ordres nous parviennent juste avant la vente aux enchères, des erreurs risquent d’être commises lors de leur traitement. Le formulaire ci-joint vous aidera à rédiger facilement votre offre. Vous pouvez nous envoyer vos ordres par la poste, par fax ou par e-mail. • Si vous n’avez encore fait aucune acquisition chez nous, nous vous prions de nous indiquer une ou deux références d’autres maisons numismatiques où vous avez déjà acheté. • L’authenticité des pièces vendues est garantie même au-delà des délais légaux.

Vous voulez participer par téléphone? La participation par téléphone est bien sûr possible. Nous vous appelons volontiers pour vous aider à acquérir les pièces voulues. Pour des raisons d´organisation veuillez noter les points suivants:

Alexandra Elflein, M. A. Français, Deutsch, English, Italiano

• La participation par téléphone est possible seulement pour les lots estimé à plus de 500 Euros chacun. • Veuillez nous informer au moins 48 heures avant la vente de la liste des pièces pour lesquelles vous voudriez être appelé. • Veuillez prendre soin d´être joignable quand vos pièces seront mises en vente. L’ordre de vente dans ce catalogue vous aidera à estimer l´heure de la vente. • Dans le cas où nous ne parviendrions pas à vous joindre, nous enchérirons pour vous jusqu’au montant que vous nous indiquez par écrit, égal ou supérieur au prix d’estimation. • La participation par téléphone présente des risques, et nous déclinons toute responsabilité dans le cas où la communication téléphonique serait interrompue, ou bien ne pourrait être établie.

Ce qui se passe après la vente Kmar Chachoua Français, Deutsch, English, Arabic

Tél. +49 (0)541 96 20 20 Facs. +49 (0)541 96 20 222 E-Mail: service@kuenker.de Site: www.kuenker.de Lundi à Jeudi de 8h30 à 17h00 Vendredi de 8h00 à 15h30

6

• L´expédition des biens va commencer immédiatement après la fin de la vente complète, et prend généralement 8 jours. • Tous les clients qui ont participé à l’une de nos ventes aux enchères recevront gratuitement une liste de résultats dans les deux semaines qui suivent. • Les résultats seront disponibles sur notre site internet, au plus tard un jour après la fin de la vente.

Vous voulez confier vos monnaies pour nos ventes aux enchères? Contactez nous si vous envisagez de vendre vos pièces. Notre compétence et fiabilité est prouvée depuis 1985 par actuellement 4 ventes aux enchères et environ 15 catalogues par an. Le plus important pour vous est que: • Vos pièces seront décrites par notre équipe d’experts selon les standards numismatiques les plus récents, et elles seront présentées dans des catalogues de haute qualité en couleurs. • Nous avons un des meilleurs fichiers-clientèle du monde avec plus de 10.000 clients. Nous vendons en moyenne plus de 95% de la vente aux enchères, et obtenons souvent des prix records. Les monnaies invendues n’encourent aucun frais. • Notre service clientèle est disponible pour vous conseiller pour l’envoi de vos pièces, et dès leur réception vos pièces seront assurées pour le double de la valeur d´estimation. • Vous recevrez une liste détaillée des pièces fournies au moment de la prise en charge puis, au plus tard cinq semaines avant la vente aux enchères, vous recevrez leur liste exacte avec les numéros de catalogue correspondants. • Immédiatement après la vente aux enchères, vous recevrez la liste des résultats et pourrez prendre connaissance des prix obtenus. Vous recevrez le produit de la vente dans les 45 jours après les enchères.

TEL +49 (0)541 96 20 20, FAX +49 (0)541 96 20 222, SERVICE@KUENKER.DE, WWW.KUENKER.DE


I punti piú importanti per la Sua partecipazione per iscritto • La preghiamo di farci pervenire i Suoi ordini al piú presto possibile. Se i Suoi ordini ci arrivano poco prima dell´inizio dell´asta possono verificarsi errori. Il formulario allegato Le faciliterá l´invio dei Suoi ordini per iscritto. Ci puó far pervenire i Suoi ordini per posta, per fax o per email. • Se non ha mai acquistato presso di noi, La preghiamo di volerci indicare a titolo di referenza il nome di uno o due commercianti numismatici presso i quali è giá cliente. • L’autenticità di tutti gli oggetti venduti viene garantita anche oltre i termini previsti dalla legge.

ITALIANO

Desidera partecipare telefonicamente alla nostra asta? La partecipazione telefonica è naturalmente da noi possibile. La chiameremo durante l´asta e La assisteremo volentieri per ottenere l´aggiudicazione dei pezzi desiderati. Per motivi di organizzazione La preghiamo di voler tenere conto dei seguenti punti: • La partecipazione telefonica è possibile solo per lotti stimati con almeno 500,– € l´uno. • La preghiamo di volerci comunicare almeno 48 ore prima dell´inizio dell´asta per quali pezzi desidera essere chiamato. • La preghiamo di aver cura di essere raggiungibile telefonicamente al momento in cui vengono messi all´asta i pezzi che Le interessano. Lo schema orario in catalogo La aiuterá a stimare a che ora verranno messi all´asta i pezzi che Le interessano. • Nel caso in cui non riuscissimo a contattarLa telefonicamente, provvederemo ad offrire a Suo nome fine all´importo massimo indicatoci per iscritto, in ogni caso offriremo a Suo nome come minimo il prezzo di stima. • La partecipazione telefonica è un modo incerto di partecipare alle aste. Non assumiamo nessuna responsabilità se per esempio la linea telefonica è occupata o interrotta o se Lei non sará raggiungibile per altri motivi.

Sonia Russo, M. A. Italiano, Deutsch, English, Español

Cosa succede dopo l´asta? • La spedizione del materiale d´asta comincia subito dopo la fine dell´intera asta e termina normalmente entro 8 giorni. • Tutti i clienti che hanno partecipato all´asta ricevono entro 2 settimane dopo l´asta la lista dei prezzi di realizzo. • I prezzi di realizzo sono visionabili sul nostro sito internet al piú tardi un giorno dopo la fine dell´intera asta.

Vuole consegnarci le Sue monete per una nostra asta? Ci contatti se ha deciso di vendere le Sue monete. Dal 1985 la nostra competenza ed affidabilità è dimostrata da attualmente 4 aste e circa 15 cataloghi all´anno. Quali sono i punti di maggior importanza per Lei:

Cristina Welzel Italiano, Deutsch, English, Français

Tel.: +49 (0)541 96 20 20 Fax: +49 (0)541 96 20 222 E-Mail: service@kuenker.de Internet: www.kuenker.de Lunedì a giovedì dalle 8.30 alle 17.00 Venerdì dalle 8.00 alle 15.30

• Le Sue monete vengono valutate dal nostro staff di esperti secondo i piú attuali standard numismatici e vengono presentati in cataloghi di alto valore a colori. • Con piú di 10.000 clienti disponiamo di una delle migliori banca dati clienti del mondo. In media vendiamo oltre il 95% del materiale d´asta realizzando spesso prezzi da record. Per i pezzi invenduti non ci sono nessune spese da pagare. • Dal momento della consegna le Sue monete sono assicurate per il doppio del valore di stima. Il nostro servizio clientela Le consiglierá volentieri come farci avere le Sue monete nel modo piú sicuro. • La Sua consegna Le verrá immediatamente quietanzata al momento della resa dei pezzi. Al piú tardi 5 settimane prima dell´asta riceverá una lista dettagliata dei Suoi pezzi con i numeri di catalogo ed i prezzi di stima. • Subito dopo l´asta riceverá la lista con i risultati d´asta dalla quale potrá subito controllare i prezzi realizzati. Riceverá l´importo di realizzo entro 45 giorni dopo la fine dell´asta.

TEL +49 (0)541 96 20 20, FAX +49 (0)541 96 20 222, SERVICE@KUENKER.DE, WWW.KUENKER.DE

7


Что особенно важно при заочном участии на аукционе?

RUSSKIJ

• Тщательно изучите наш каталог и запишите те лоты, которые Вас заинтересовали. Заполните приложенный формуляр и отправьте нам его заранее по почте, факсу или электронной почте. Мы обращаем внимание на то, что если Ваши ставки придут перед самым началом аукциона либо во время аукциона, то существует вероятность допуска ошибки в процессе обработки заказа. • Если Вы впервые принимаете участие в нашем аукционе, то мы рекомендуем Вам указать Ваш референц – аукционные дома, с которыми Вы уже сотрудничали. Или свяжитесь с нами по телефону +49(0)541 9620268. • Подлинность купленных на нашем аукционе лотов гарантируется нами на протяжении неограниченного времени.

Вы хотели бы принять участие на аукционе по телефону? У нас, конечно, есть возможность организовать Ваше телефонное участие на торгах, но мы бы хотели обратить внимание на следующие пункты: Anastasija Koepsell Russkij, Deutsch

• Участие в телефонных торгах возможно только для лотов со стартовой ценой свыше 500 евро. • Для участия в торгах по телефону просим Вас связаться с нами не позднее 48 часов до начала аукциона. • Мы хотим подчеркнуть, что телефонное участие на аукционе – не самый безопасный способ: в случае плохой связи, недоступности клиента во время торгов либо других технических проблем мы не несем ответственности.

Что происходит после окончания аукциона?

Dzmitry Nikulin Russkij, Deutsch, English

Телефон: +49 (0)541 96 20 20 Факс: +49 (0)541 96 20 222 E-Mail: service@kuenker.de интернет: www.kuenker.de понедельник – четверг 8.30 – 17.00 пятница 8 – 15.30

8

• Результаты аукционов доступны на нашем сайте на следующий день после окончания торгов. • Вы можете лично забрать приобретенные лоты. По окончании торгов мы готовим все необходимые документы на вывоз из Евросоюза. • Почтовые отправки в Россию ( Беларусь, Украину ) осуществляются по предварительной договоренности. Для связи с нами звоните по телефону +49 (0)541 9620268.

Вы хотели бы выставить Ваши предметы на аукцион? Более 160-ти успешно проведенных аукционов, тысячи участников, 4 аукциона в год - эти и другие преимущества, которые говорят в пользу выставления Ваших коллекций на аукцион Кюнкер: • Ваши монеты будут оценены нашими экспертами по самым новым нумизматическим стандартам и представлены в высококачественном цветном каталоге. • Более 10000 клиентов со всего мира оказывают нам свое доверие. В среднем мы продаем более 95% всех выставляемых предметов, при этом зачастую достигая рекордных сумм. • Все Ваши предметы, после передачи их нам, хранятся у нас до начала аукциона застрахованными. Не позднее 5-ти недель до начала аукциона Вы получите по почте подробное описание Ваших лотов с указаннами номерами в каталоге, а также их оценочной стоимостью. • Результаты аукционов также будут высланы Вам по почте после окончания торгов. В течение 45 дней после аукциона Вам будет выплачено Ваше вознаграждение.

TEL +49 (0)541 96 20 20, FAX +49 (0)541 96 20 222, SERVICE@KUENKER.DE, WWW.KUENKER.DE


INHALT AUKTION 180 Nr.

Seite

ROMANISCHE KLEINKUNSTWERKE AUS DER STAUFERZEIT AUSGEWÄHLTE BRAKTEATEN AUS DEM WÄHRUNGSRAUM DER WETTERAU IN FEINSTEN ERHALTUNGEN

1

-

18

12

-

-

21

-

Die Münzstätte Aschaffenburg der Erzbischöfe von Mainz

1

-

4

13

-

15

Die Reichsmünzstätte Frankfurt

5

-

11

15

-

17

Die Münzstätte der Abtei Fulda

12

17 18

Die Reichsmünzstätte Gelnhausen

13

-

14

Die gräfliche Münzstätte Münzenberg

15

-

17

Die Münzstätte der Abtei Seligenstadt NUMISMATISCHE RARITÄTEN AUS MITTELALTER UND NEUZEIT Deutschland Anhalt Augsburg Baden Bayern Brandenburg in Franken Brandenburg-Preußen Braunschweig und Lüneburg Bremen Breslau Corvey Deutscher Orden Dortmund Eichstätt Ellwangen Emden Erzgebirge Frankfurt Friedberg Fürstenberg Fulda Goslar Halberstadt Hatzfeld Henneberg Hessen Hohenlohe Hohenzollern Hohnstein Jever Jülich-Kleve-Berg

19

-

18

20 21

19

-

707

22

-

182

19 19 30 35 42 67 74 98 134 143

-

22 22

-

26 27 33 34 42 52

-

149

-

56

-

156 162

-

58

-

166

-

61

-

172

-

175 177 183 186

-

414 29 34 41 66 73 97 133 142 146 147 148 151 152 153 154 155 161 164 165 170 171 173 174 176 182 185 189 190 191 192

65

-

124 24 25 27 32 34 41 51 54 55 56 56 57 57 58 58 58 60 60 61 62 63 63 63 64 66 66 67 67 68 68 9


Nr. Kaufbeuren Kempten Köln Königsegg-Rothenfels Konstanz Landau Leiningen Leuchtenberg Lippe Löwenstein Lübeck Lüneburg Mainz Mansfeld Mecklenburg Mühlhausen in Thüringen Münster Nassau Neuenahr Nürnberg Öttingen Oldenburg Osnabrück Paderborn Pfalz Pommern Ravensberg Regensburg Reuss Rostock Sachsen, sächsische Herzogtümer Schlesien Schleswig-Holstein Schwäbisch Hall Schwarzburg Schwarzenberg Solms Speyer Stade Stolberg Stralsund Trier Ulm Waldeck Werden und Helmstedt Worms Württemberg Würzburg

10

193 195 197

-

204 206 208 210 212 216

-

222 225

-

229 233 235

-

239 241 250

-

255 261 271 273 360 367 369 371 374 379

-

393 397 399 402

-

405 410

-

Seite 194 196 198 199 200 201 202 203 205 207 209 211 215 219 220 221 224 227 228 232 234 237 238 240 249 253 254 260 270 272 359 366 368 370 373 378 388 389 390 391 392 396 398 401 403 404 409 414

69

-

72

-

73

-

76

-

78

-

81 84

-

86 87 89 90 111

-

115

-

118

-

121 123

-

68 69 70 70 70 71 71 71 71 72 73 73 74 75 75 76 77 77 78 79 79 80 80 81 83 85 86 87 89 90 110 112 112 113 113 114 116 117 117 117 118 119 119 120 120 121 122 124


Nr. Habsburgische Erblande-Österreich Tirol, Grafschaft Römisch-Deutsches Reich Kaiserreich Österreich Die Geistlichkeit in den Habsburgischen Erblanden Die österreichischen Standesherren Europäische Münzen und Medaillen Baltikum Belgien Dänemark Frankreich Griechenland Großbritannien Italien Jugoslawien Luxemburg Malta Niederlande Niederländische Gebiete in Übersee Norwegen Polen Schweden Schweiz Spanien Ungarn Münzen und Medaillen aus Übersee Argentinien Bolivien Brasilien China Japan Kambodscha Sierra Leone Uruguay Vereinigte Staaten von Amerika/USA Vietnam

Seite

415 415 419

-

456 418 447 448

125 125 126

-

133 126 131 131

449 455

-

454 456

132

-

133 133

457 457 476 481 488

-

134 134 136 137 139

-

521 529

-

146 147

-

559 563 565 584 646 670 683 686

-

688 475 480 487 519 520 528 555 556 557 558 562 564 583 645 669 682 685 688

154

-

156 160 171 175

-

179 136 137 138 145 146 147 153 153 154 154 155 155 159 171 175 178 178 179

689

-

179

-

690

-

694 696

-

700 704

-

707 689 692 693 695 697 698 699 703 706 707

182 179 179 180 180 181 181 181 181 182 182

Ein Stichwortverzeichnis finden Sie am Ende des Auktionskataloges 181.

11


BRAKTEATEN DER WETTERAU



41/#0+5%*'-.'+0-70569'4-'#75&'4 56#7('4<'+6 #75)'9*.6'$4#-6'#6'0#75&'/9*470)54#7/ &'49'66'4#7+0('+056'0'4*#.670)'0 &KG CNU 9GVVGTCW 9GFGTGKDC  DG\GKEJPGVG HTWEJVDCTG .CPFUEJCHV PÌTFNKEJ XQP (TCPMHWTV CO /CKP  

*GUUGP  YWTFG DGTGKVU XQP FGP 4ÌOGTP KP KJT *GTTUEJCHVUIGDKGV WPF KP FKG )TGP\\KGJWPI FGU .KOGU   GKPDG\QIGP#WHUKGHQNIVGPFKG#NCOCPPGPWPF'PFGFGU,CJTJWPFGTVUFKG(TCPMGP&KG-CTQNKPIGT MQPPVGP UKEJ KP FKGUGO )GDKGV DGK KJTGT *GTTUEJCHVUCWUÒDWPI CWH WOHCPITGKEJG -ÌPKIUIÒVGT WPF XQT   CNNGOCWHFKGPGWIGITÒPFGVGP4GKEJUMNÌUVGTXQP(WNFCWPF.QTUEJUVÒV\GP+PFGT5CNKGT\GKVIGIGP'PFG FGU,CJTJWPFGTVUIKPIFGTFKTGMVGRQNKVKUEJG'KPHNWUUFGU-ÌPKIVWOUKPFGT9GVVGTCWXQTÒDGTIGJGPF \WTÒEM&CU/CEJVXCMWWOHÒNNVGPXQTCNNGOFKG/CKP\GT'T\DKUEJÌHGFKGÒDGTWOHCPITGKEJG$GUKV\WP IGPKPFGO)GDKGVXGTHÒIVGP  +P FGT 5VCWHGT\GKV IGNCPI GU FWTEJ GKPG TKIQTQUG 6GTTKVQTKCNRQNKVKM DGIÒPUVKIV FWTEJ FCU #WUUVGTDGP   GKPKIGTCPU·UUKIGT)TCHGPHCOKNKGPGKPGFGO-ÌPKIVWOWPOKVVGNDCTWPVGTYQTHGPG.CPFUEJCHV\WUEJCHHGP ņ FKG VGTTC KORGTKK $GHÌTFGTV YWTFG FKG 'PVYKEMNWPI \WFGO FWTEJ NQ[CN \WO -ÌPKIVWO UVGJGPFG   #FGNU WPF /KPKUVGTKCNGPHCOKNKGP YKG FCU )GUEJNGEJV FGT /ÒP\GPDGTIGT FGTGP RT·EJVKIG YKG GKP   6KPVGPHCUU CWU FGT 'DGPG FGT 9GVVGTCW JGTCWUTCIGPFG $WTI FGP /KVVGNRWPMV GKPGU CWUIGFGJPVGP   *GTTUEJCHVUIGDKGVGU DKNFGVG <GPVTGP FGT *GTTUEJCHV -CKUGT (TKGFTKEJU + ō$CTDCTQUUCŋ     YWTFGP FKG PGW IGITÒPFGVGP D\Y KPVGPUKX IGHÌTFGTVGP 5V·FVG (TCPMHWTV )GNPJCWUGP 9GV\NCT WPF    (TKGFDGTI &GT TCUCPVG #WHUEJYWPI FGU 9KTVUEJCHVUTCWOU 9GVVGTCW WO  OCPKHGUVKGTV UKEJ PKEJV   \WNGV\V KP GKPGT WOHCPITGKEJGP /ÒP\RT·IWPI /KV FGO 'PFG FGT 5VCWHGTF[PCUVKG WPF FGO #WUUVGTDGP   FGT/ÒP\GPDGTIGTVTCVGPPGWGRQNKVKUEJG-T·HVGCWHFGP2NCPCNNGPXQTCPFKGGTUVCTMVGP5V·FVG  9CNVGT*·XGTPKEMJCVOKVUGKPGOGTUEJKGPGP5VCPFCTFYGTMYGNEJGUKONGV\VGP,CJTFWTEJ0KMNQV -NÒ­GPFQTH PGW CWHIGNGIV WPF MQOOGPVKGTV YQTFGP KUV FGO OKVVGNCNVGTNKEJGP /ÒP\YGUGP KP FGT    9GVVGTCW GKP WOHCUUGPFGU &GPMOCN IGUGV\V *·XGTPKEM 9 &CU ·NVGTG /ÒP\YGUGP FGT 9GVVGTCW DKU   \WO#WUICPIFGU,CJTJWPFGTVU/CTDWTICF.CJP &WTEJFKGFGVCKNTGKEJGP/ÒP\DKNFGTYKTF GKPG <GKV NGDGPFKI FKG \WTGEJV CNU ō$NÒVG FGT $TCMVGCVGPMWPUVŋ WPF ō)NCP\\GKV FGU FGWVUEJGP /KVVGN   CNVGTUŋ $GTIGT ( &KG OKVVGNCNVGTNKEJGP $TCMVGCVGP KO -GUVPGT/WUGWO *CPPQXGT *CPPQXGT    5   DG\GKEJPGV YGTFGP MCPP &KGUG ō-NGKPMWPUVYGTMG FGT 4QOCPKMŋ -NWIG $ 0WOKUOCVKM FGU   /KVVGNCNVGTU $GTNKP9KGP  5   HÒJTGP WPU FKGJCPFGNPFGP2TQVCIQPKUVGPFGT<GKVGKPFTWEMUXQNN XQT #WIGP ņ -CKUGT (TKGFTKEJ + WPF UGKPG )GOCJNKP $GCVTKZ )TCH -WPQ XQP /ÒP\GPDGTI WPF   'T\DKUEJQH -QPTCF XQP /CKP\ +P FGT JKGT \WT 8GTUVGKIGTWPI IGNCPIGPFGP 5COONWPI FGT OGKUVGPU   DGUVGTJCNVGPGP'ZGORNCTGFKGKO/CTMVCPIGDQVGPYWTFGPYKTFFKGMÒPUVNGTKUEJG$NÒVGFGT9GVVGTCWGT $TCMVGCVGP DGUQPFGTU FGWVNKEJ (ÒT FKG HTGWPFNKEJG $GTGKVUVGNNWPI FGT #DDKNFWPIGP FGT $WTI /ÒP\GP   DGTIFGT#DVGK5GNKIGPUVCFVWPFFGT2HCN\)GNPJCWUGPDGFCPMGPYKTWPUDGKFGT8GTYCNVWPI5VCCVNKEJG 5EJNÌUUGTWPF)·TVGPKP*GUUGP      &T5GDCUVKCP5VGKPDCEJ 

12


BRAKTEATEN DER WETTERAU

&+'/ª0<5666'#5%*#(('0$74) &'4'4<$+5%*¤('810/#+0< &KG #PH·PIG FGT CNCOCPPKUEJGP 5KGFNWPI #UEJCHHGPDWTI NKGIGP KO &WPMGN FGT )GUEJKEJVG XGTDQTIGP   &CU WO  IGITÒPFGVG 5VKHV 5V 2GVGT WPF #NGZCPFGT IGNCPIVG ÒDGT GKPG 5EJGPMWPI -CKUGT 1VVQU ++  

  KP FGP $GUKV\ FGU /CKP\GT 'T\DKUEJQHU 9KNNKIKU   'KPG  HGTVKIIGUVGNNVG /CKP   DTÒEMGWPFFKG'KPTKEJVWPIGKPGU/CTMVGUHÌTFGTVGPFCUYKTVUEJCHVNKEJG9CEJUVWOFGT5KGFNWPIFGTGP /CWGTTKPIOGJTHCEJGTYGKVGTVYGTFGPOWUUVG'KPG/ÒP\UV·VVGKP#UEJCHHGPDWTIYKTFGTUVOCNUKPGKPGO WO  CPIGHGTVKIVGP $GTKEJV GTY·JPV FGP FGT /CKP\GT 'T\DKUEJQH -QPTCF XQP 9KVVGNUDCEJ  

 WPF   CPHGTVKIGP NKG­ WO FKG FGT /CKP\GT -KTEJG KP UGKPGT #DYGUGPJGKV    GPVUVCPFGPGP 5EJ·FGP \W DG\KHHGTP $GTGKVU HÒT FCU ,CJT  KUV GKP /ÒP\OGKUVGT 9KNGOCPPWU   WTMWPFNKEJ ÒDGTNKGHGTV 9GPPINGKEJ MGKPGT FGT DGMCPPVGP $TCMVGCVGP FGP 0COGP FGT /ÒP\UV·VVG PGPPV   UQ MCPP OCP FQEJ FCXQP CWUIGJGP FCUU FKG )GRT·IG PCEJ 9GVVGTCWGT 5EJNCI OKV FGO 0COGP FGU   /CKP\GT'T\DKUEJQHUKP#UEJCHHGPDWTIGPVUVCPFGPUGKPOÒUUGP

1



%JTKUVKCPXQP$WEJ\WO\YGKVGP/CN$TCMVGCV#UEJCHHGPDWTII%4+56+#085/ ªDGT GKPGT /CWGT GKPCPFGT \WIGYCPFV FGT *GKNKIG /CTVKP N OKV 5EJYGTVUGKPGP/CPVGN\GTVGKNGPFT FGT'T\DKUEJQHOKV-TWOOUVCDWPVGTFGO$QIGPGKPPCEJNMPKGPFGT$GVVNGTOKV5VQEM\YKUEJGP\YGK 6ÒTOGP FCU )GUKEJV PCEJ QDGP FGO *GKNKIGP \WIGYCPFV $GTIGT p *·XGTPKEM  0CW &KG <GKV FGT   5VCWHGT p5NI$QPJQHHp5NI*QJGPUVCWHGP\GKVp  8QPITÌ­VGT5GNVGPJGKV8QT\ÒINKEJGU'ZGORNCTOKVHGKPGTFWPMNGT2CVKPC  'ZGORNCT FGT 5COONWPI *GTDGTV # %CJP #WMVKQP /ÒP\GP WPF /GFCKNNGP #)  $CUGN  0T   

*ÌEJUVYCJTUEJGKPNKEJ'ZGORNCTCWUFGO(WPFXQP.KEJVGPDGTI 

3:1

13


BRAKTEATEN DER WETTERAU

2 2:1



-QPTCF XQP 9KVVGNUDCEJ \WO \YGKVGP /CN  $TCMVGCV #UEJCHHGPDWTII%0#4Q 0Û4840#&GTJGKNKIG/CTVKPOKV2CNO\YGKIWPFUGIPGPFGT*CPFWPFFGT$KUEJQHOKV-TWOOUVCD WPF$WEJPGDGPGKPCPFGTXXKPFGT/KVVGGKP6WTO$GTIGT*·XGTPKEM0CW &KG<GKVFGT 5VCWHGT 5NI$QPJQHH5NI*QJGPUVCWHGP\GKVp5NI9CNVJGTp  5GJTUGNVGPKPFKGUGT'TJCNVWPI2TCEJVGZGORNCTOKVHGKPGT2CVKPCXQT\ÒINKEJp5VGORGNINCP\  'ZGORNCT CWU FGO  1FGPY·NFGT (WPF $GTNKPGT /ÒP\DN·VVGT  5   FGT #WMVKQP &T $WUUQ 2GWU   0CEJH(TCPMHWTV/CKP0TWPFFGT#WMVKQP5VGTPDGTI<ÒTKEJ0T  

-QPTCF XQP 9KVVGNUDCEJ \·JNV \W FGP DGFGWVGPFUVGP 4GKEJU WPF -KTEJGPRQNKVKMGTP FGT 5VCWHGT\GKV 0CEJ UGKPGO   5VWFKWOKP2CTKUYWTFGGT\WP·EJUV&QOJGTTKP5CN\DWTIDGXQTKJP-CKUGT(TKGFTKEJ+$CTDCTQUUC   CWHFGO-QP\KNXQP.QFK\WO'T\DKUEJQHXQP/CKP\GTJQD9GKNGTUKEJY·JTGPFFGU2CRUVUEJKUOCUCWHFKG 5GKVG #NGZCPFGTU +++   UVGNNVG GTUGV\VG KJP FGT -CKUGT  FWTEJ %JTKUVKCP XQP $WEJ   CNU   'T\DKUEJQHXQP/CKP\-QPTCFIKPIOKVFGO2CRUVKPU'ZKNPCEJ(TCPMTGKEJWPFYKTMVGKPFGPHQNIGPFGP,CJTGPCNU -CTFKPCNRTKGUVGT XQP 5 /CTEGNNWU -CTFKPCNDKUEJQH XQP 5 5CDKPC WPF -CTFKPCNNGICV DGXQT GT PCEJ FGO 6QFG   %JTKUVKCPUXQP$WEJPCEJ/CKP\\WTÒEMMGJTGPMQPPVG'TJKGNVHQTVCP6TGWG\W(TKGFTKEJ+WPF*GKPTKEJ8+ WPFPCJOCO&TKVVGP-TGW\\WIVGKN  -QPTCFUVCTDCO1MVQDGTKP4KGFHGNFDGK0GWUVCFVCPFGT #KUEJCWHFGO4ÒEMYGIXQO-TGW\\WIKP7PICTP5GKPG)GDGKPGYWTFGPKO/CKP\GT&QODGUVCVVGV

3 2:1



$TCMVGCV WO  #UEJCHHGPDWTI  I %804#&85 #4%*+ #84# / $TWUVDKNF FGU'T\DK UEJQHU JCNDT OKV -TWOOUVCD WPF UGIPGPFGT 4GEJVGP ÒDGT $QIGP FCTCWH %804#& \W FGP 5GKVGP LG   GKP*CNDDQIGPOKV6WTOIGD·WFG$GTIGTp*·XGTPKEMp0CW &KG<GKVFGT5VCWHGT p5NI$QPJQHHp 5NI*QJGPUVCWHGP\GKVp  8QPITÌ­VGT5GNVGPJGKV8QT\ÒINKEJGU2TCEJVGZGORNCTOKVGKPFTWEMUXQNNGO/ÒP\DKNF  'ZGORNCTCWUFGO$CTDCTQUUC(WPFWPFFGT#WMVKQP/ÒP\GPWPF/GFCKNNGP#)$CUGN0T 



(ÒTFKGUGP6[RXIN5VWORH)&GT-TGW\\WI-CKUGT$CTDCTQUUCU/ÒP\UEJ·V\GUGKPGT<GKV/ÒPEJGP5 0T

14


BRAKTEATEN DER WETTERAU

4 2:1



*·NDNKPI WO  #UEJCHHGPDWTI  I $TWUVDKNF FGU 'T\DKUEJQHU JCNDT OKV -TWOOUVCD WPF   UGIPGPFGT4GEJVGPÒDGT$QIGP\WFGP5GKVGPLGGKP*CNDDQIGPOKV6WTOIGD·WFG$GTIGTp*·XGTPKEMp 0CW &KG<GKVFGT5VCWHGT p5NI$QPJQHHp5NI*QJGPUVCWHGP\GKVp  8QPITÌ­VGT5GNVGPJGKV8QT\ÒINKEJCWUIGRT·IVGU2TCEJVGZGORNCT  'ZGORNCT CWU FGO $CTDCTQUUC(WPF (ÒT FKGUGP 6[R XIN 5VWORH ) &GT -TGW\\WI -CKUGT $CTDCTQUUCU /ÒP\   UEJ·V\GUGKPGT<GKV/ÒPEJGP50T

&+'4'+%*5/ª0<5666'(4#0-(746  JKGNV -CTN FGT )TQ­G   UGKPG DGTÒJOVG 4GKEJUU[PQFG XQP (TCPMHWTV CD CWH FGT FKG   ō-CTQNKPIKUEJG/ÒP\TGHQTOŋJÌEJUVYCJTUEJGKPNKEJKJTGP#PHCPIPCJO8QPFKGUGO&CVWOCPDKU\WO ,CJTNCUUGPUKEJGVYC-ÌPKIUDGUWEJGHÒT(TCPMHWTVDGNGIGPYGNEJGFKGITQ­G$GFGWVWPIFGT 5VCFVHÒTFCUFGWVUEJG-ÌPKIVWOFGU(TÒJWPF*QEJOKVVGNCNVGTUCPUEJCWNKEJXQT#WIGPHÒJTGP(ÒTFKG 5VCWHGTMCKUGT YCT (TCPMHWTV GKPGT FGT YKEJVKIUVGP #WHGPVJCNVUQTVG KO 4JGKP/CKP)GDKGV &KG UVCTMG   $GCPURTWEJWPI FGT (TCPMHWTVGT 2HCN\ FWTEJ FCU -ÌPKIVWO UGV\VG GKPG UQNKFG YKTVUEJCHVNKEJG )TWPFNCIG   XQTCWUFKGUKEJWPVGTFGP5VCWHGTPCWEJKPGKPGTDGGKPFTWEMGPFGP/ÒP\RT·IWPIOCPKHGUVKGTV7O YKTF GTUVOCNU FKG (TCPMHWTVGT /GUUG GTY·JPV WPF KO UQIGPCPPVGP 4GKEJUUVGWGTXGT\GKEJPKU XQP    \CJNVG(TCPMHWTVOKV/CTM OGJTCNUMI5KNDGT L·JTNKEJFGPJÌEJUVGP$GVTCICNNGTFQTVXGT\GKEJPG VGP5V·FVG

5

5 (2:1)

6 (2:1) 6



(TKGFTKEJ +  $TCMVGCV  I (4'&'4+%8Q  5 +/4'4# &GT -CKUGT VJTQPV X X OKV   .KNKGP\GRVGT WPF 4GKEJUCRHGN $GTIGT  *·XGTPKEM  C XCT , W (  C 0CW &KG <GKV FGT   5VCWHGT 5NI$QPJQHH FKGUGU'ZGORNCT 5NI*QJGPUVCWHGP\GKV  5GNVGPKPFKGUGT'TJCNVWPI8QT\ÒINKEJGU'ZGORNCTOKVFWPMNGT2CVKPC  'ZGORNCTFGT5NI$QPJQHH6GKN#WMVKQP&T$WUUQ2GWU0CEJH(TCPMHWTV/CKP0T



$TCMVGCVI(2'&'4+%8Q5+/4'#&GT-CKUGTVJTQPVXXOKV.KNKGP\GRVGTWPF4GKEJUCRHGN $GTIGT  *·XGTPKEM  D , W (  D 0CW &KG <GKV FGT 5VCWHGT   5NI $QPJQHH    5NI*QJGPUVCWHGP\GKV 5GJTUGNVGPKPFKGUGT'TJCNVWPI *GTTNKEJG2CVKPCMN6WUEJG\KHHGTCWHFGT4ÒEMUGKVGXQT\ÒINKEJ  'ZGORNCT FGU (WPFGU XQP .KEJVGPDGTI #WMVKQP .GQ *CODWTIGT  (TCPMHWTV/CKP  0T  WPF FGT   #WMVKQP)KG­GPGT/ÒP\JCPFNWPI)OD*/ÒPEJGP0T

15


BRAKTEATEN DER WETTERAU

7 2:1



$TCMVGCVI(4+&'4+%$TWUVDKNFFGU-CKUGTUXXOKV-TQPG<GRVGTWPF4GKEJUCRHGNWPVGT&TGK DQIGP FCTCWH /CWGT OKV <KPPGP WPF FTGK 6ÒTOGP $GTIGT  *·XGTPKEM  , W (    0CW &KG<GKVFGT5VCWHGT p5NI$QPJQHH FKGUGU'ZGORNCT 5NI*QJGPUVCWHGP\GKV  448QT\ÒINKEJGU2TCEJVGZGORNCTOKVJÒDUEJGT2CVKPC  'ZGORNCTFGT5NI$QPJQHH6GKN#WMVKQP&T$WUUQ2GWU0CEJH(TCPMHWTV/CKP0T

8 2:1



$TCMVGCV  I (4+&'4+% $TWUVDKNF FGU -CKUGTU X X OKV .KNKGP\GRVGT WPF 4GKEJUCRHGN WPVGT &TGK   DQIGPOKV<KPPGPWPFFTGK6ÒTOGPKO(GNF2WPMV-TGW\WPFHÒPH4KPIGN$GTIGT*·XGTPKEM ,W(0CW &KG<GKVFGT5VCWHGT 5NI$QPJQHHp5NI*QJGPUVCWHGP\GKVp  8QPITQ­GT5GNVGPJGKV *GTXQTTCIGPFCWUIGRT·IVGUXQT\ÒINKEJGU2TCEJVGZGORNCTOKVHCU\KPKGTGPFGO-CKUGTRQTVT·V  'ZGORNCTFGT#WMVKQP)KG­GPGT/ÒP\JCPFNWPI)OD*/ÒPEJGP0T





8INFGP-QOOGPVCTDGK2,QUGRJ'(GNNPGT&KGUGT$TCMVGCVKUVFGTUEJÌPUVGWPVGTCNNGP9GVVGTCWGTPFKGKPUIG UCOVWPVGTFGP$NGEJOÒP\GPGKPGPJGTXQTTCIGPFGP2NCV\GKPPGJOGP 5 

9 2:1



$TCMVGCVI-CKUGTVJTQPVXXOKV.KNKGP\GRVGTWPF4GKEJUCRHGNJKPVGT$CNWUVTCFG\WFGP5GKVGPLG GKP6WTOFCTÒDGTIG\CEMVGT$QIGP$GTIGT*·XGTPKEM,W(0CW &KG<GKVFGT5VCWHGT p 5NI$QPJQHH5NI*QJGPUVCWHGP\GKVp  8QPITQ­GT5GNVGPJGKV8QT\ÒINKEJGU2TCEJVGZGORNCTOKV\YGKMN6WUEJG\KHHGTPCWHFGT4ÒEMUGKVG  'ZGORNCTFGU(WPFGUXQP.KEJVGPDGTI#WMVKQP.GQ*CODWTIGT(TCPMHWTV/CKP0T

16


BRAKTEATEN DER WETTERAU

10

10 (2:1)



11

11 (2:1)

$TCMVGCV WO   I (4+&'4+%85 +/2'4#61 -CKUGT VJTQPV X X OKV .KNKGP\GRVGT WPF   4GKEJUCRHGN CWH OKV 6KGTMÌRHGP XGT\KGTVGO (CNVUVWJN $GTIGT p *·XGTPKEM  D , W (    0CW &KG<GKVFGT5VCWHGT p5NI$QPJQHHp5NI*QJGPUVCWHGP\GKVp  8QPITÌ­VGT5GNVGPJGKV8QT\ÒINKEJGU2TCEJVGZGORNCTXQPHGKPUVGO5VKN  'ZGORNCTCWUFGO$CTDCTQUUC(WPFWPFFGT#WMVKQP/ÒP\GPWPF/GFCKNNGP#)$CUGN0T



*GKPTKEJ8+$TCMVGCVI%'84#'.84+'*20+'4&GT-CKUGTOKV.KNKGP\GRVGT WPF 4GKEJUCRHGN UKV\V X X JKPVGT GKPGT .GKUVG DGKFGTUGKVU $ÌIGP OKV -WRRGNVÒTOGP $GTIGT    *·XGTPKEM,W(0CW &KG<GKVFGT5VCWHGT 5NI$QPJQHH  5GJTUGNVGPDGUQPFGTUKPFKGUGT'TJCNVWPI 8QT\ÒINKEJGU'ZGORNCTOKVDGGKPFTWEMGPFGT-CKUGTFCTUVGNNWPI  'ZGORNCTFGT#WMVKQP5VGTPDGTI<ÒTKEJ0T

&+'/ª0<5666'&'4#$6'+(7.&# 0CEJFGT8KVC5VWTOKFGU#DVGU'KIKN WO GTHQNIVGFKG)TÒPFWPIFGU-NQUVGTUCO/·T\FGU ,CJTGUFWTEJFGP*GKNKIGP$QPKHCVKWU7PVGTYKTVUEJCHVNKEJGP)GUKEJVURWPMVGPYCTFGT1TVCO-TGW \WPIURWPMV\YGKGTYKEJVKIGT(GTPUVTC­GPWPFFGTUEJKHHDCTGP(WNFCJGTXQTTCIGPFIGY·JNV(WNFCU4GKEJ VWO WPF UGKPG RGTUQPGNNGP 4GUUQWTEGP WO  \·JNVG FKG /ÌPEJUIGOGKPUEJCHV DGTGKVU OGJT CNU    /KVINKGFGT YCTGPFKG$CUKUHÒTUGKPGPWOHCPITGKEJGP-ÌPKIUFKGPUV UGTXKVKWOTGIKU 7PVGTFGP1VVQPGP GTYKGUGPUKEJFCU-NQUVGTWPFUGKPGDVGCNU*GNHGTWPF8GTOKVVNGTDGK\CJNTGKEJGP4QOTGKUGPWPFGTJKGN VGPKO)GIGP\WIYGKVTGKEJGPFG2TKXKNGIKGP*GKPTKEJ++  XGTNKGJ#DV4KEJCTF  KO ,CJTGGTUVOCNUFCU/ÒP\TGEJVCO1TV /)*&*++0T &KGUGU/ÒP\TGEJVYWTFGXQPCNNGP UCNKUEJGP*GTTUEJGTPDGUV·VKIVWPFY·JTGPFFGUIGUCOVGP/KVVGNCNVGTUCWEJKPWOHCPITGKEJGP'OKUUKQPGP CWUIGÒDV

12 2:1



#DV-QPTCF++$TCMVGCV(WNFCI%804#&85#$$#5%804##DVUKV\VXX OKV -TWOOUVCD WPF $WEJ CWH .GKUVG $GTIGT p )CGVVGPU  0CW &KG <GKV FGT 5VCWHGT  p   5NI$QPJQHHp5NI*QJGPUVCWHGP\GKVp  8QPITQ­GT5GNVGPJGKV$TGKVGUXQT\ÒINKEJCWUIGRT·IVGU2TCEJVGZGORNCT  'ZGORNCTCWUFGO$CTDCTQUUC(WPFWPFFGT#WMVKQP/ÒP\GPWPF/GFCKNNGP#)$CUGN0T

17


BRAKTEATEN DER WETTERAU

&+'4'+%*5/ª0<5666')'.0*#75'0

ITÒPFGVG-CKUGT(TKGFTKEJ+  FKGPQXCXKNNC)GNPJCWUGPCPFGTYKEJVKIGP*CPFGNUUVTC­G XQP (TCPMHWTV PCEJ 6JÒTKPIGP )GRNCPV YCT GKPG 8GTDKPFWPI CWU *CPFGNUUVCFV WPF GKPGT 2HCN\ CNU   MÌPKINKEJGO 5VÒV\RWPMV KP FGT UÒFÌUVNKEJGP 9GVVGTCW &KG -ÌPKIURHCN\ UEJGKPV DGTGKVU WO  \WO   )GNPJ·WUGT 4GKEJUVCI KP YGUGPVNKEJGP 6GKNGP HGTVKIIGUVGNNV YQTFGP \W UGKP +PUIGUCOV NCUUGP UKEJ   -ÌPKIUCWHGPVJCNVGHÒTFKG4GIKGTWPIU\GKVGP(TKGFTKEJU+WPF*GKPTKEJU8+DGNGIGP0CEJFGO'PFG FGT 5VCWHGTF[PCUVKG PCJO FKG YKTVUEJCHVNKEJG WPF TGKEJURQNKVKUEJG $GFGWVWPI FGT 5VCFV UEJPGNN CD WPF    XGTRH·PFGVG UKG -CTN 8+ CP FKG )TCHGP XQP 5EJYCT\DWTI 'KPG /ÒP\RT·IWPI KUV HÒT )GNPJCWUGP   \WGTUVFWTEJFGPWOIGUEJNCIGPGP$TCMVGCVGPOKVFGO$KNFFGT-CKUGTKP$GCVTKZWPFFGT.GIGPFG )'+.'0*75DGNGIV *·XGTPKEM 

13 2:1



(TKGFTKEJ +  $TCMVGCV WO   I (4+&'4+%  $TWUVDKNF -CKUGT $CTDCTQUUCU   OKV4GKEJUCRHGNWPF$TWUVDKNFFGT-CKUGTKP$GCVTKZPGDGPGKPCPFGTXXJKPVGTGKPGT.GKUVGKPFGT/KVVG .KNKGP\GRVGT $GTIGT  *·XGTPKEM  , W (  0CW &KG <GKV FGT 5VCWHGT     5NI$QPJQHH5NI*QJGPUVCWHGP\GKVp  44(GKPG2CVKPCYKP\5EJTÌVNKPIUTKUUGCO4CPFUGJTUEJÌPpXQT\ÒINKEJ  'ZGORNCTFGT5COONWPI8KTIKN/$TCPF6GKN#WMVKQP.GW<ÒTKEJ0T

14 2:1



$TCMVGCV   I (4+&  4+%85  / $TWUVDKNF -CKUGT $CTDCTQUUCU OKV .KNKGP\GRVGT WPF   $TWUVDKNF FGT -CKUGTKP $GCVTKZ OKV 4GKEJUCRHGN PGDGPGKPCPFGT X X JKPVGT GKPGT .GKUVG KP FGT /KVVG   -TGW\UVCD$GTIGT*·XGTPKEM,W(F0CW &KG<GKVFGT5VCWHGT p5NI$QPJQHH

FKGUGU'ZGORNCT 5NI*QJGPUVCWHGP\GKVp  5GJTUGNVGPDGUQPFGTUKPFKGUGT'TJCNVWPI8QT\ÒINKEJGU2TCEJVGZGORNCTOKVHGKPGT2CVKPC  'ZGORNCTFGT5NI$QPJQHH6GKN#WMVKQP&T$WUUQ2GWU0CEJH(TCPMHWTV/CKP0T

18


BRAKTEATEN DER WETTERAU

&+')4(.+%*'/ª0<5666'/ª0<'0$'4)

9QJN WPVGT )TCH -WPQ +   YWTFG FGT $CW FGT $WTI /ÒP\GPDGTI DGIQPPGP FKG WO    DG\WIUHGTVKI IGYGUGP UGKP MÌPPVG $GTGKVU UGKV  PGPPV UKEJ -WPQ KP FGP 7TMWPFGP ōXQP /ÒP\GP   DGTIŋPCEJFGOGTFKG$WTI#TPUDWTICNU5VCOOUKV\CWHIGIGDGPJCVVG&KG'TTKEJVWPIFGT$WTIMQPPVG UKEJGTNKEJ PWT OKV <WUVKOOWPI -CKUGT (TKGFTKEJ + GTHQNIGP FGO -WPQ \GKV UGKPGU .GDGPU VTGW FKGPVG   WPFFGPGTDGKUGKPGO#WUDCWFGT9GVVGTCW\WTVGTTCKORGTKKWPVGTUVÒV\VG0GDGPFGT9CTVDWTIKUVFKG $WTI/ÒP\GPDGTIJGWVGFKGDGFGWVGPFUVGCWUFGO*QEJOKVVGNCNVGTUVCOOGPFG$WTICPNCIG&GWVUEJNCPFU &CU 5KGIGNDKNF FGT )TCHGP XQP /ÒP\GPDGTI ņ GKP QFGT \YGK /KP\GPUVGPIGN ņ HKPFGV UKEJ CWEJ CWHFGP $TCMVGCVGP&CU/ÒP\TGEJVKUVFGP/ÒP\GPDGTIGTPFKGUKEJUGNDUVHCUVPKGCNU)TCHGPUQPFGTPOGKUVCNU OKPKUVGTKCNKUDG\GKEJPGVGPYCJTUEJGKPNKEJPKGOCNUQHHK\KGNNXGTNKGJGPYQTFGPUKGÒDVGPGUCDGTFGPPQEJ CWU 0GDGP FGT *CPFGNUPKGFGTNCUUWPI /ÒP\GPDGTI /+0%'0$'4% CWH GKPGO *·NDNKPI 7NTKEJU +    RT·IVGPFKG)TCHGPPQEJKPFGT/ÒP\UV·VVG#UUGPJGKO #5'0*'/%+8GDGPHCNNUCWHGKPGO *·NDNKPI7NTKEJU+  

15 2:1



-WPQ  $TCMVGCV  I $TWUVDKNF GKPGU 9GNVNKEJGP OKV 5EJKNF WPF IGUEJWNVGTVGO 5EJYGTV   TFCTÒDGT-NGGDNCVVDQIGPOKVFTGK6ÒTOGPWPF\YGK/KP\GPUVGPIGNP$GTIGT*·XGTPKEM0CW

&KG<GKVFGT5VCWHGT 5NI$QPJQHH5NI*QJGPUVCWHGP\GKV  5GJTUGNVGPDGUQPFGTUKPFKGUGT'TJCNVWPI8QT\ÒINKEJGU2TCEJVGZGORNCTOKVHGKPGT2CVKPC



'ZGORNCTFGU(WPFGUXQP.KEJVGPDGTIFGT#WMVKQP&T$WUUQ2GWU0CEJH(TCPMHWTV/CKP0TWPF FGT#WMVKQP5VGTPDGTI<ÒTKEJ0T  

(ÒT 4 )CGVVGPU YCT FGT XQTNKGIGPFG $TCMVGCV =? GKPGU FGT UEJÌPUVGPTQOCPKUEJGPMNGKPGP-WPUVYGTMGFKGFKG 5VGORGNUEJPGKFGMWPUV GT\GWIV JCV 5NI *QJGPUVCWHGP\GKV 5   )TCH -WPQ + XQP /ÒP\GPDGTI KUV FGT CO   J·WHKIUVGP KP FGP 7TMWPFGP -CKUGT *GKPTKEJU 8+   IGPCPPVG <GWIG YCU GKPGP *KPYGKU CWH UGKPG   $GFGWVWPIHÒTFKGTGIKGTGPFG5VCWHGTF[PCUVKGIKDV$GTGKVUWPVGT(TKGFTKEJ+$CTDCTQUUC  DGMNGKFGVGGT FCU *QHCOV FGU 4GKEJUM·OOGTGTU  GTJKGNV GT CNU $GNQJPWPI HÒT UGKPG &KGPUVG FKG *·NHVG FGT /ÒP\G \W   (TCPMHWTV+O6JTQPUVTGKVOKVFGP9GNHGPWPVGTUVÒV\VGGTFGPUVCWHKUEJGP-CPFKFCVGP2JKNKRRXQP5EJYCDGP   WPFXGTYÒUVGVGYQJNFKGJGUUKUEJGP$GUKV\WPIGPFGU.CPFITCHGP*GTOCPPXQP6JÒTKPIGP   FGT UKEJ HÒT FGP 9GNHGP 1VVQ +8   CWUIGURTQEJGP JCVVG -WPQU TKIQTQUG *CWUOCEJVRQNKVKM MQPPVG FCU   #WUUVGTDGPFGT/ÒP\GPDGTIGTKO/CPPGUUVCOOOKV-WPQU'PMGN7NTKEJ++PKEJVXGTJKPFGTP&CUTGKEJG'TDG YWTFGWPVGTUGKPGPUKGDGP5EJYGUVGTPCWHIGVGKNV

19


BRAKTEATEN DER WETTERAU

16

2:1



$TCMVGCV /ÒP\GPDGTI QFGT #UUGPJGKO )GOGKPUEJCHVURT·IWPI OKV (TKGFTKEJ +   I   $TWUVDKNFFGU-CKUGTUOKV4GKEJUCRHGNWPF$TWUVDKNFFGU)TCHGPOKV5EJYGTVPGDGPGKPCPFGTXXJKPVGT GKPGT .GKUVG KP FGT /KVVG .KNKGP\GRVGT QDGP \YGK -WIGNP $GTIGT p *·XGTPKEM  , W (    0CW &KG<GKVFGT5VCWHGT 5NI$QPJQHH FKGUGU'ZGORNCT 5NI*QJGPUVCWHGP\GKVp  8QPITQ­GT5GNVGPJGKV*ÒDUEJG2CVKPCMN6WUEJG\KHHGTCWHFGT4ÒEMUGKVGXQT\ÒINKEJ  'ZGORNCTFGT5NI$QPJQHH6GKN#WMVKQP&T$WUUQ2GWU0CEJH(TCPMHWTV/CKP0T





#WHITWPF FGT &CTUVGNNWPI FGU -CKUGTU CWH FKGUGO ·W­GTUV UGNVGPGP $TCMVGCVGP KUV KP FGT ·NVGTGP .KVGTCVWT  

XIN 2 ,QUGRJ' (GNNPGT 5   GKPG 2T·IWPI KP FGT 4GKEJUOÒP\UV·VVG (TCPMHWTV CPIGPQOOGP YQTFGP FKG FGP   )TCHGP KP UGKPGT (WPMVKQP CNU 4GKEJUM·OOGTGT \GKIV #WHITWPF UVKNKUVKUEJGT JPNKEJMGKVGP WPF FGT 6CVUCEJG FCUU   -WPQGTUVFKG*·NHVGFGU5EJNCIUEJCV\GUFGT(TCPMHWTVGT/ÒP\GGTJKGNVFGT$TCMVGCVCDGTDGTGKVUKPFGOWO XGTDQTIGPGP(WPFXQP.KEJVGPDGTI $WEJGPCW*&GT.KEJVGPDGTIGT$TCMVGCVGPHWPFGKP$GKVTCI\WT/ÒP\ MWPFG FGT 9GVVGTCW WPF 7OIGDWPI KP $N·VVGT HÒT /ÒP\HTGWPFG    5  0T   XQTMCO KUVGKPG 2T·IWPIKPGKPGTFGTIT·HNKEJGP/ÒP\UV·VVGP #UUGPJGKOQFGT/ÒP\GPDGTI YCJTUEJGKPNKEJGT XINFKG-QOOGPVCTG DGK*$WEJGPCW59*·XGTPKEM5WPF'0CW5 

17

2:1



$TCMVGCVI%28&014+18&4#40%8&$TWUVDKNFFGU)TCHGPXXOKV.KNKGWPF/KP\GP UVGPIGN JKPVGT GKPGO $QIGP $GTIGT p *·XGTPKEM  , W (  0CW &KG <GKV FGT 5VCWHGT  p   5NI$QPJQHHp5NI*QJGPUVCWHGP\GKVp  8QPITQ­GT5GNVGPJGKV-N-PKEMURWTUQPUVXQT\ÒINKEJCWUIGRT·IVGU2TCEJVGZGORNCT  'ZGORNCTCWUFGO$CTDCTQUUC(WPFWPFFGT#WMVKQP/ÒP\GPWPF/GFCKNNGP#)$CUGN0T

20


BRAKTEATEN DER WETTERAU

&+'/ª0<5666'&'4#$6'+5'.+)'056#&6

&KG GJGOCNU TGKEJUWPOKVVGNDCTG #DVGK 5GNKIGPUVCFV YWTFG  FWTEJ FGP 5CNKGT *GKPTKEJ +8     CPFCU'T\DKUVWO/CKP\ÒDGTIGDGP&KG5VCWHGTYKGFGTWOPCJOGPFCU-NQUVGTDKU\WO'PFGFGT &[PCUVKG XQP FGT /CKP\GT -KTEJG \WO .GJGP &CU  XGTNKGJGPG /ÒP\TGEJV UEJGKPV XQP FGP DVGP   VCVU·EJNKEJCWEJCWUIGÒDVYQTFGP\WUGKPYKGCWUGKPGO2TQVQMQNNÒDGTFKG*QJGKVUTGEJVGFGU4GKEJGU WPFFGU/CKP\GT'T\UVKHVUÒDGT5GNKIGPUVCFVXQO#WIWUVJGTXQTIGJV#WUFGP<GWIGPCWUUCIGP FKGUGU2TQVQMQNNUIGJVJGTXQTFCUUKPFGT/KVVGFGU,CJTJWPFGTVUGKP/ÒP\OGKUVGT*GTVYKEWUFKEVWU FG 0GUGNGPFG 2HGPPKIG KO 0COGP FGU #DVGU IGUEJNCIGP JCDGP UQNN /ÌINKEJGTYGKUG RT·IVG FKG #DVGK   CDGTUEJQPHTÒJGTYKGFCUHQNIGPFG'ZGORNCTGKPGU$TCMVGCVGPXGTOWVGPN·UUV 

18

2:1



7O$TCMVGCVI$TWUVDKNFFGU#DVGUXXOKV6QPUWTKPFGT4GEJVGP-TWOOUVCDKP FGT .KPMGP 2CNO\YGKI FCTÒDGT GKP XQP 5·WNGP IGVTCIGPGU &CEJ OKV DTGKVGO 6WTO $GTIGT    *·XGTPKEM0CW &KG<GKVFGT5VCWHGT 5NI$QPJQHHp5NI*QJGPUVCWHGP\GKV  5GJTUGNVGPDGUQPFGTUKPFKGUGT'TJCNVWPI 8QT\ÒINKEJGU2TCEJVGZGORNCTOKVMN6WUEJG\KHHGTCWHFGT4ÒEMUGKVG  'ZGORNCTFGU(WPFGUXQP.KEJVGPDGTI#WMVKQP.GQ*CODWTIGT(TCPMHWTV/CKP0T





#WHITWPFFGU(GJNGPUGKPGT/KVTCYKGUKGCWHFGP#UEJCHHGPDWTIGT)GRT·IGPFGT'T\DKUEJÌHGXQP/CKP\\WUGJGP KUV MCPP GU UKEJ DGK FGT CWH FKGUGO $TCMVGCVGP CDIGDKNFGVGP IGKUVNKEJGP 2GTUQP YQJN PWT WO GKPGP #DV JCPFGNP   #NU2T·IGUV·VVGMQOOVFCU-NQUVGT5GNKIGPUVCFVKP(TCIGFGO-CKUGT*GKPTKEJ+++  CO0QXGODGT FCU/ÒP\TGEJVDGUV·VKIVG /)*&*+++0T 'KPG·NVGTG8GTNGKJWPIUWTMWPFGGZKUVKGTVPKEJVJKGNV -CKUGT(TKGFTKEJ+$CTDCTQUUC  OKVUGKPGP5QJP*GKPTKEJGKPGP*QHVCIKP5GNKIGPUVCFVCD

21


ANHALT

07/+5/#6+5%*'4#4+66'0 #75/+66'.#.6'470&0'7<'+6

19

#0*#.6 #0*#.6<'4$56(ª456'067/ 

4WFQNH4GKEJUVCNGT<GTDUVCWHUGKPGP6QF&CX/CPPC 4#VVTCMVKXGU'ZGORNCTOKVJÒDUEJGT2CVKPCUGJTUEJÌP

 

4WFQNHYWTFGCNU5QJPXQP,QCEJKO'TPUVWPFUGKPGT\YGKVGP)GOCJNKP'NGQPQTGXQP9ÒTVVGODGTIIGDQTGP 'TXGTO·JNVGUKEJ\WGTUVOKV&QTQVJGC*GFYKIXQP$TCWPUEJYGKI6QEJVGTXQP*GT\QI*GKPTKEJ,WNKWUXQP$TCWP UEJYGKI.ÒPGDWTIWPFUR·VGTOKV/CIFCNGPG6QEJVGT,QJCPPU+++XQP1NFGPDWTI'TJCVVGKPUIGUCOVUGEJU-KPFGT

20

#0*#.6-¤6*'0(ª456'067/5'+6*'4<1)67/ 

*GKPTKEJ8GTGKPUFQRRGNVCNGT#-5&CX-CJPV6JWP 5GNVGPDGUQPFGTUKPFKGUGT'TJCNVWPI0WT'ZGORNCTGIGRT·IV 2TCEJVGZGORNCTXQT\ÒINKEJp5VGORGNINCP\

 

21

#0*#.6$'40$74)(ª456'067/5'+6*'4<1)67/  22

%JTKUVKCP++4GKEJUVCNGT&CX/CPP 45GJTCVVTCMVKXGU'ZGORNCTOKVJGTTNKEJGT2CVKPCXQT\ÒINKEJ

 


ANHALT

22

22 1,5:1



8KEVQT(TKGFTKEJ4GKEJUVCNGT*CT\IGTQFGI8+%6Û(4+&Û&Ü)Û2Û#0* Û&8:Û5Û#ÛÛ9Ü%#5%Û&Û$ÛÛ5Û)GJCTPKUEJVGU$TWUVDKNFNOKVWOIGNGIVGO/CPVGNWPF 1TFGPUUVGTPCWHFGT$TWUV0#%*&'/4'+%*5Û5%*41680&-140ÛÛ/KVFGO(ÒTUVGP JWV DGFGEMVGU \YÌNHHGNFKIGU 9CRRGP \W FGP 5GKVGP FKG IGVGKNVG 5KIPCVWT + *  5Ü ,QJCPP *GKPTKEJ   5KGIGN/ÒP\OGKUVGTKP*CT\IGTQFG &CX/CPP  8QPITQ­GT5GNVGPJGKV2TCEJVXQNNG2CVKPCUGJTCVVTCMVKXGUXQT\ÒINKEJGU'ZGORNCT  8KEVQT(TKGFTKEJ KP$GTPDWTIÓKP$GTPDWTIYCTFGT5QJPFGU(ÒTUVGP-CTN(TKGFTKEJCWU FGUUGP'JGOKV5QRJKG#NDGTVKPG6QEJVGTFGU)TCHGP)GQTI(TKGFTKEJ\W5QNOU5QPPGPYCNFG&GT2TKP\WPVGTPCJO UGKPG)TCPF6QWTPCEJ(TCPMTGKEJWPFHQNIVGUGKPGO8CVGTCNU(ÒTUVKO,CJT#NU4KVVOGKUVGTFGT RTGW­KUEJGP#TOGGGTJKGNVGTFGP1TFGPXQO5EJYCT\GP#FNGT$GUQPFGTGU+PVGTGUUG\GKIVG8KEVQT(TKGFTKEJ HÒTFGP$GTIDCWWPFFCU*ÒVVGPYGUGPUQDGUWEJVGGTQHVFKG)TWDGPKO*CT\5GKVYCTGTKPCNNGKPKIGO$GUKV\ FGT*CT\DGTIYGTMG

23

24

25



#NGZKWU(TKGFTKEJ%JTKUVKCP-QPX6CNGT#-5&CX-CJPV6JWP  5GNVGPKPFKGUGT'TJCNVWPI/KPLWUVKGTVXQT\ÒINKEJ





#NGZCPFGT%CTN8GTGKPUFQRRGNVCNGT#-5&CX-CJPV6JWP #VVTCMVKXGUXQT\ÒINKEJGU'ZGORNCT

 



8GTGKPUFQRRGNVCNGT#-5&CX-CJPV6JWP  5GJTUGNVGPKPFKGUGT'TJCNVWPI2TCEJVGZGORNCT(GKPG2CVKPC5VGORGNINCP\

 23


ANHALT

26

26

1,5:1

#0*#.6*#4<)'41&'(ª456'067/ 

9KNJGNO  4GKEJUVCNGT  #WUDGWVG FGT PGWGP CPJCNVKPKUEJGP $GTIYGTMG &CX    /CPPC/ÒUGNGT  442TCEJVGZGORNCT#WUFTWEMUXQNNG2CVKPCYKP\5EJTÌVNKPIUHGJNGTHCUV5VGORGNINCP\ 

27

28

29

#0*#.6&'55#7(ª456'067/5'+6*'4<1)67/ 

.GQRQNF(TKGFTKEJ8GTGKPUFQRRGNVCNGT#-5&CX-CJPV6JWP  8QT\ÒINKEJp5VGORGNINCP\





8GTGKPUFQRRGNVCNGT#-5&CX-CJPV6JWP 2TCEJVGZGORNCT(GKPG2CVKPC'TUVCDUEJNCIHCUV5VGORGNINCP\5VGORGNINCP\

 

#0*#.65%*#7/$74)(ª456'067/  24

%CTN .WFYKI  -QPX6CNGT  (TCPMHWTV #WUDGWVG FGU *QN\CRRGNGT $GTIYGTMU   &CX/CPP/ÒUGNGT 5EJÌPG2CVKPCXQT\ÒINKEJ 


AUGSBURG

31



56#&6

30

32

#7)5$74)

)WNFGPVCNGT -TGW\GT OKV6KVGN/CZKOKNKCPU++&CX(QTUVGT *ÒDUEJG2CVKPCMN5EJTÌVNKPIUHGJNGTUGJTUEJÌP

 



4GKEJUVCNGT  IGRT·IV WPVGT UEJYGFKUEJGT $GUGV\WPI FWTEJ )WUVCX ++ #FQNH #JNUVTÌO    &CX(QTUVGT 5GJTCVVTCMVKXGU'ZGORNCTOKVHGKPGT2CVKPCXQT\ÒINKEJ 



4GKEJUVCNGTOKV6KVGN(GTFKPCPFU+++&CX(QTUVGT

(GKPG2CVKPCXQT\ÒINKEJGU'ZGORNCT

 

34

33 (doppelt)



33 (doppelt)

&QRRGNVGT4GKEJUVCNGTOKV6KVGN-CTNU8+I&CX(QTUVGT 449KP\5EJTÌVNKPIUHGJNGTCO4CPFXQT\ÒINKEJp5VGORGNINCP\

 

&KG 5VGORGN \W FKGUGO RTCEJVXQNNGP &QRRGNVCNGT UEJPKVV ,QPCU 6JK¾DCWF   &GT 5EJYGK\GT 5VGORGN   UEJPGKFGT YWTFG XQP  DKU  XQP &CUUKGT KP )GPH CWUIGDKNFGV &CPCEJ CTDGKVGVG GT HÒT #RRGP\GNN $GTP   *QJGP\QNNGTP.W\GTP/QPVHQTV5V)CNNGPWPF9ÒTVVGODGTI+O,CJTYWTFGGTXQPFGT#WIUDWTIGT/ÒP\G CPIGUVGNNV WPF UEJPKVV FKG5VGORGN\W\CJNTGKEJGPTGRT·UGPVCVKXGP/ÒP\GPWPF/GFCKNNGPFGT5VCFV#WIUDWTICDGT CWEJ HTGOFGT 2T·IGJGTTGP FKG FGT #WIUDWTIGT /ÒP\UV·VVG 2T·IGCWHVT·IG GTVGKNVGP &CU XQTNKGIGPFG 5VÒEM IGJÌTV   FCOKV\WFGPGTUVGP#TDGKVGPFKG6JK¾DCWFKP#WIUDWTICWUHÒJTVG



4GKEJUVCNGTOKV6KVGNXQP(TCP\+&CX(QTUVGT

8QT\ÒINKEJ

 25


BADEN

36

35

35

$#&'0 $#&'0$#&'0/#4-)4#(5%*#(6 

9KNJGNO4GKEJUVCNGT$CFGP$CFGP&CX9KGNCPFV 4*ÒDUEJG2CVKPCXQT\ÒINKEJGU'ZGORNCT

 

$#&'0&74.#%*/#4-)4#(5%*#(65'+6-74(ª456'067/  5'+6)4155*'4<1)67/ 

-CTN(TKGFTKEJ-QPX6CNGT&WTNCEJ&CX9KGNCPFVC  4*ÒDUEJG2CVKPCXQT\ÒINKEJ

&KGUKUVFGTGTUVGDCFKUEJG-QPXGPVKQPUVCNGT

37

38



39



-CTN .GQRQNF (TKGFTKEJ  -TQPGPVCNGT  /ÒP\DGUWEJ #-5  &CX  -CJPV    6JWP 4(GKPG2CVKPCYKP\4CPFHGJNGTXQT\ÒINKEJp5VGORGNINCP\ 



-TQPGPVCNGT#-5&CX-CJPV6JWP  W­GTUVUGNVGPKPFKGUGT'TJCNVWPI-CDKPGVVUVÒEMOKVRTCEJVXQNNGT2CVKPC2QNKGTVG2NCVVG





8GTGKPUFQRRGNVCNGT#-5&CX-CJPV6JWP  5GNVGPGT,CJTICPI*ÒDUEJG2CVKPCXQT\ÒINKEJ



26


BAYERN

41

40

40



(TKGFTKEJ +  8GTGKPUFQRRGNVCNGT  2TKP\ WPF 4GIGPV #-5  &CX    -CJPVC6JWP 4#VVTCMVKXGUUGJTUEJÌPGU'ZGORNCT



)WNFGP Q , 2T·OKGPIWNFGP FGT )CTPKUQPUUEJWNG HÒT (NGK­ WPF 5KVVNKEJMGKV #WUHÒJTWPI OKV FGO   8QTFGTUGKVGPUVGORGN FGU )GFGPMIWNFGPU  CWH FCU  $CFKUEJG .CPFGUUEJKG­GP /KV INCVVGO 4CPF   I#-5p XIN ,p XIN 5VWV\OCPPp XIN 9KGNCPFV<GKV\XCT FQTV4CPF OKVXGTVKGHVGP8KGTGEMGP  8QPITÌ­VGT5GNVGPJGKV8GTOWVNKEJGKP\KIDGMCPPVGU'ZGORNCT (GKPG2CVKPCYKP\-TCV\GTXQT\ÒINKEJp5VGORGNINCP\ 



42

1,5:1

1,5:1

$#;'40 *'4<1)67/5'+6-74(ª456'067/5'+6-¤0+)4'+%* 

9KNJGNO+8WPF.WFYKI&KEMGT5EJCWVCNGTCWH6JGQFQ·NVGUVGT5QJPXQP*GT\QI 9KNJGNO +8  I É 6*'1& Û +..856 Û &8% Û $1+14 Û )8+.'./ Û 24+/1 )   &CU LWIGPFNKEJG $TWUVDKNF 6JGQFQU T OKV WOIGNGIVGT 1TFGPUMGVVG WPF $KPFG CWH FGO -QRH \W FGP   5GKVGPFKGIGVGKNVG,CJTGU\CJN+Û+05+)0ÛÛ38#66 ÛÛ#8+#4 Û6*'1&Û8KGTHGNFKIGU 9CRRGP CWH $NWOGPMTGW\ KP FGP 9KPMGNP FKG MNGKPGP5EJKNFGXQP¤UVGTTGKEJ$TCWPUEJYGKI-CV\GP GNPDQIGPWPF2HCN\$C[GTP*CWUGT9KVV 8QPITQ­GT5GNVGPJGKV #VVTCMVKXGUIWVCWUIGRT·IVGU'ZGORNCT4CPFWPF(GNFGTFGT8QTFGTUGKVGNGKEJVDGCTDGKVGVUGJTUEJÌP  'ZGORNCT FGT #WMVKQP/ÒP\GPWPF/GFCKNNGP#)$CUGN0TWPFFGT5RG\KCNUCOONWPI$C[GTPWPF FCU*CWU9KVVGNUDCEJ#WMVKQP(TKV\4WFQNH-ÒPMGT1UPCDTÒEM0T  

&GT CO  (GDTWCT  IGDQTGPG 6JGQFQ YCT FGT ·NVGUVG 5QJP *GT\QI 9KNJGNO +8 FGU 5VCPFJCHVGP WPF FGT   ,CMQD·C /CTKC XQP $CFGP 6JGQFQ YCT PCEJ FGO 2TKOQIGPKVWTIGUGV\ XQP  FGT P·EJUVG DC[GTKUEJG *GT\QI   GTUVCTDLGFQEJDGTGKVUCO,WNKKP9QNHTCVUJCWUGPKO#NVGTXQPPWTCEJV,CJTGP

27


BAYERN

43

44

44



#NDGTV8FGT)TQ­OÒVKIG)WNFGPVCNGT -TGW\GT /ÒPEJGPOKV6KVGN/CZKOKNK CPU++&CX*CJP -N5COONGTRWP\GKO4CPFUEJÌPG2CVKPCUGJTUEJÌP





/CZKOKNKCP+4GKEJUVCNGT/ÒPEJGP&CX*CJP 2TCEJVGZGORNCT*GTTNKEJG2CVKPCHCUV5VGORGNINCP\

 

45

46

47



4GKEJUVCNGT/ÒPEJGP&CX*CJP



4GKEJUVCNGT OKVÒDGTITQ­GT,CJTGU\CJNKO5VGORGNCWUIG·PFGTV /ÒPEJGP&CX# *CJP 2TCEJVGZGORNCT(CUV5VGORGNINCP\





4GKEJUVCNGT/ÒPEJGP/KVTÌOKUEJGT,CJTGU\CJN&CX*CJP *ÒDUEJG2CVKPCXQT\ÒINKEJp5VGORGNINCP\

 

28

9KP\4CPFHGJNGTXQT\ÒINKEJ




BAYERN

48



/CZKOKNKCP ++ 'OCPWGN  5KNDGTOGFCKNNG  WPUKIPKGTV IGHGTVKIV KO #WHVTCI XQP   ( -NGKPGTV <YGK 2CNOGP FKG FWTEJ GKPGP .QTDGGTMTCP\ OKVGKPCPFGT XGTDWPFGP UKPF FCTÒDGT \YGK   .QTDGGTMT·P\G OKV -CKUGTMTQPG WPF -WTJWV WPVGP -TQPG CWH &QTPGP\YGKIGP#FNGT WPF .ÌYG CNU   5VGTPDKNFN9QNMGPWPF*CNDOQPF/KV4CPFUEJTKHVÈ%105+.+#+756147/24+0%+27/.#74+ %1410#06  /#.# 6;4#00147/ %1057.6# 8'24'5 Û (-  Û  OO  I   5NI/QPVGPWQXQ9KVV 44*ÒDUEJG2CVKPCXQT\ÒINKEJ 

50

49

49



-CTN6JGQFQT-QPX6CNGT/ÒPEJGP&CX*CJP  8QT\ÒINKEJp5VGORGNINCP\



-QPX6CNGT/CPPJGKOHÒTFKG4JGKPRHCN\8CTKCPVGOKVQHHGPGO*CCT&CX*CCUC *CJPXCT 2TCEJVGZGORNCT5VGORGNINCP\

 

51



/CZKOKNKCP + +8  ,QUGRJ  -QPX6CNGT  8CTKCPVG QJPG /ÒP\OGKUVGT\GKEJGP   %& %CLGVCP&GUVQWEJGU CO*CNUCDUEJPKVVWPFFKG8QTFGTUGKVGPWOUEJTKHVNCWVGV&Û)Û/#:Û+15 Û%Û2Û4Û8Û$Û&Û5Û4Û2  Û#ÛÛ'.Û&Û+Û%ÛÛ/Û/KV.CWDTCPFI#-5 #POXCT&CXXCT-CJPV#5VWV\OCPP8#4D6JWP#POXCT   8QPITQ­GT5GNVGPJGKV#O4CPFNGKEJVLWUVKGTVXQT\ÒINKEJp5VGORGNINCP\  29


BAYERN

52

52 1,5:1



-QPX6CNGT Q ,   2TGKUVCNGT HÒT'T\KGJGTXQP9CKUGPMKPFGTP8CTKCPVGQJPG4CPFUEJTKHV #-5&CXp-CJPVC6JWPp 8QPITQ­GT5GNVGPJGKV'TUVCDUEJNCIXQT\ÒINKEJp5VGORGNINCP\ 

53

54

54



-QPX6CNGT/ÒPEJGP#-5*CJP  2TCEJVGZGORNCTOKVJGTTNKEJGT2CVKPC(CUV5VGORGNINCP\



-QPX6CNGT#-5&CX-CJPV6JWP

55

44/KPLWUVKGTVUGJTUEJÌP

 

56



.WFYKI+-QPX6CNGT8GTNGIWPIFGT.WFYKI/CZKOKNKCPU*QEJUEJWNGXQP.CPFUJWV PCEJ/ÒPEJGP#-5&CX-CJPV6JWP 2TCEJVGZGORNCT(GKPG2CVKPCHCUV5VGORGNINCP\

 



-QPX6CNGT  8GTNGIWPI FGT .WFYKI /CZKOKNKCPU*QEJUEJWNG XQP .CPFUJWV PCEJ /ÒPEJGP   #-5&CX-CJPV6JWP (GKPG2CVKPCHCUV5VGORGNINCP\



30


BAYERN

57

58

59



-QPX6CNGT  6JGTGUKGP1TFGP 2TQDG OKV IGTKHHGNVGO 4CPF  I #-5  &CX \W    -CJPVH6JWP\W 48QT\ÒINKEJp5VGORGNINCP\





-QPX6CNGT)GTGEJVWPF$GJCTTNKEJ#-5&CX-CJPV6JWP  2TCEJVGZGORNCTOKVJGTTNKEJGT2CVKPC(CUV5VGORGNINCP\





-QPX6CNGT<QNNXGTGKP#-5&CX-CJPV6JWP 2TCEJVGZGORNCT(GKPG2CVKPCHCUV5VGORGNINCP\

 

61

60

60



8GTGKPUFQRRGNVCNGT  8GTO·JNWPI FGU -TQPRTKP\GP /CZKOKNKCP OKV /CTKG XQP 2TGW­GP /KV   4CPFUEJTKHVmm&4';'+0*#.$)7.&'0mm8++'(/#-5D&CX-CJPVD 6JWP 2TCEJVGZGORNCT(GKPG2CVKPCHCUV5VGORGNINCP\



8GTGKPUFQRRGNVCNGTªDGTICDGFGT-TQPG/KV4CPFUEJTKHVmm&4';'+0*#.$)7.&'0mm 8++'(/#-5C&CX-CJPV6JWPXCT  &GTUGNVGPUVGDC[GTKUEJG)GUEJKEJVUFQRRGNVCNGT #VVTCMVKXGU'ZGORNCTOKVHGKPGT2CVKPCXQT\ÒINKEJ 



-ÌPKI .WFYKI + KUV GU \W XGTFCPMGP FC­ UKEJ FKG DC[GTKUEJG .CPFGUJCWRVUVCFV \W GKPGT DGFGWVGPFGP -WPUV   OGVTQRQNG GPVYKEMGNVG 'T XGTNGIVG FKG 7PKXGTUKV·V XQP .CPFUJWV PCEJ /ÒPEJGP WPF NKG­ FKG )N[RVQVJGM FKG #NVG   WPF 0GWG 2KPCMQVJGM WPF FKG 2TQR[N·GP GTTKEJVGP +O ,CJT  DGICPP .WFYKI+GKPG$G\KGJWPIOKVFGTKNNGIK VKOGP6QEJVGTGKPGUUEJQVVKUEJGP1HHK\KGTUWPFGKPGT-TGQNKPFKGPCEJKJTGTIGUEJGKVGTVGP'JGOKVGKPGOGPINKUEJGP 1HHK\KGT CNU URCPKUEJG 6·P\GTKP WPVGT FGO -ÒPUVNGTPCOGP .QNC /QPVG\ KP /ÒPEJGPCWHVTCV&KG6·P\GTKPIGYCPP \WPGJOGPF'KPHNW­CWHFGP-ÌPKIWPFYWTFG\WO5EJTGEMGPFGT$GXÌNMGTWPI\WT)T·HKPXQP.CPFUDGTI GTJQDGP #PHCPI /·T\  MCO GU KP FGT XQP FGT /QPVG\ DGIÒPUVKIVGP 5VWFGPVGPXGTDKPFWPI #NGOCPPKC \W   FGTCTVKIGP7PTWJGPFC­.WFYKI/KNKV·TGKPUGV\VGFKG7PKXGTUKV·VUEJNQ­WPFFKGDC[GTKUEJG2QORCFQWTXGTDCPPVG &CU)GTÒEJVKJTGT4ÒEMMGJTHÒJTVGKO<WUCOOGPJCPIOKVFGP/·T\GTGKIPKUUGP\WOQHHGPGP#WHUVCPFKP/ÒPEJGP WPF\YCPIFGP-ÌPKICO/·T\\WO4ÒEMVTKVVWPF\WTªDGTICDGFGT-TQPGCPUGKPGP5QJP/CZKOKNKCP++

31


BAYERN

62



/CZKOKNKCP++8GTGKPUFQRRGNVCNGT5VCPFDKNFXQP,QJCPP%JTKUVQRJ4KVVGTXQP)NWEM /KV4CPFUEJTKHVô8'4'+05/ª0<'ô8++'+0'(/#4-#-5C&CX-CJPV6JWP  449KP\-TCV\GTXQT\ÒINKEJ

63

64



65



8GTGKPUFQRRGNVCNGT  5VCPFDKNF XQP 4QNCPF FG .CVTG IGPCPPV 1TNCPFQ FK .CUUQ /KV 4CPFUEJTKHV   ô8'4'+05/ª0<'ô8++'+0'(/#4-#-5C&CX-CJPV6JWP  449KP\4CPFHGJNGTUGJTUEJÌP 



8GTGKPUFQRRGNVCNGT#-5&CX-CJPV6JWP  5GNVGPGT,CJTICPIKPCW­GTIGYÌJPNKEJGT'TJCNVWPI(GKPG2CVKPCXQT\ÒINKEJp5VGORGNINCP\





&QRRGNVGT8GTGKPUVCNGT#-5&CX-CJPV6JWP 4*ÒDUEJG2CVKPCCVVTCMVKXGUHCUVXQT\ÒINKEJGU'ZGORNCT

 

66

 32

.WFYKI++&QRRGNVGT8GTGKPUVCNGT#-5&CX-CJPV6JWP 44#VVTCMVKXGUHCUVXQT\ÒINKEJGU'ZGORNCT

 


BRANDENBURG IN FRANKEN

67

$4#0&'0$74)+0(4#0-'0 $4#0&'0$74)$#;4'76*/#4-)4#(5%*#(6 

)GQTI 9KNJGNO  4GKEJUVCNGTMNKRRG  CWH FCU 8QIGNUEJKG­GP KP $C[TGWVJ  I   )9/ KO5KGIGTMTCP\ <$#FNGTUVGJVXXCWHGKPGO5QEMGNUVWORHFGP-QRHPCEJQDGPIGUVTGEMV KO5EJPCDGNGKPGP5KGIGTMTCP\FCTWPVGT,CJTGU\CJNKPFGPUGKVNKEJGPWPFFGTWPVGTGP'EMG2WPM VQTPCOGPVG#WH GKPGT OKV 5VTGDGP CDIGUVÒV\VGP 5VCPIG GKP #FNGT OKV CWUIGDTGKVGVGP (NÒIGNP FCJKPVGT   FGT $TCPFGPDWTIGT 9GKJGT OKV MNGKPGT 5GGHGUVWPI 5EJCP\G  OKV (TGICVVG WPF GKPGO#FOKTCNUUEJKHH KO *KPVGTITWPF FCU 9GKJGTJCWU WPF FCU &QTH $KPFNCEJ (KUEJGT/CW¾  5NI 2GNV\GT p \W    FQTVCNU8KGTVGNVCNGTMNKRRG 5NI9KNO  8QPITÌ­VGT5GNVGPJGKV(GKPG2CVKPCXQT\ÒINKEJp5VGORGNINCP\  )GQTI9KNJGNOYCTFGTGKP\KIG5QJPXQP%JTKUVKCP'TPUVXQP$TCPFGPDWTI$C[TGWVJWPFFGUUGP)GOCJNKP5QRJKG .WKUG XQP 9ÒTVVGODGTI +P UGKPGT ,WIGPF CNU 'TDRTKP\ ITÒPFGVG GT FKG 8QTUVCFV5V)GQTIGPCO5GG'UJCPFGNVG UKEJ WO GKPG RNCPO·­KI CPIGNGIVG 5VCFV JGWVG 5VCFVVGKN XQP $C[TGWVJ  KO DCTQEMGP $CWUVKN OKV 1TFGPUUEJNQ­ CO   5GG #O MÒPUVNKEJ CPIGNGIVGP $TCPFGPDWTIGT 5GG $TCPFGPDWTIGT 9GKJGT  NGIVG GT GKPG 5EJCP\G CP WPF NKG­   5GGUEJNCEJVGP OKV TGEJV ITQ­GP 5EJKHHGP DKU \W  O .·PIG  CWHHÒJTGP YCU CWH FGT 4ÒEMUGKVG FGT XQTNKGIGPFGP   -NKRRGFCTIGUVGNNVKUV

68



69

70

(TKGFTKEJ%JTKUVKCP-QPX6CNGT$C[TGWVJCWHUGKPGP6QF&CX5NI9KNO  4*GTTNKEJG2CVKPCXQT\ÒINKEJ



$4#0&'0$74)#05$#%*/#4-)4#(5%*#(6 

%JTKUVKCP (TKGFTKEJ -CTN #NGZCPFGT  -QPX6CNGT  5EJYCDCEJ IGRT·IV CWH   FKG4GKUGFGU/CTMITCHGPPCEJ'PINCPF&CX5NI9KNO  *GTTNKEJG2CVKPCUGJTCVVTCMVKXGUXQT\ÒINKEJGU'ZGORNCT 



-QPX6CNGT5EJYCDCEJ2TQDGI&CX5NI9KNOp 8QPITÌ­VGT5GNVGPJGKV5GJTCVVTCMVKXGU'ZGORNCTOKVHGKPGT2CVKPCXQT\ÒINKEJ

  33


BRANDENBURG-PREUSSEN

71

72

73



-QPX6CNGT  5EJYCDCEJ CWH FKG 8GTGKPKIWPI FGT DGKFGP (ÒTUVGPVÒOGT &CX    5NI9KNO 5GJTCVVTCMVKXGU'ZGORNCTOKVCWUFTWEMUXQNNGT2CVKPCXQT\ÒINKEJp5VGORGNINCP\ 



-QPX6CNGT5EJYCDCEJ&CX5NI9KNO  2TCEJVGZGORNCTOKVHGKPGT6ÌPWPI(CUV5VGORGNINCP\





-QPX6CNGT5EJYCDCEJ&CX5NI9KNO  5GNVGPDGUQPFGTUKPFKGUGT'TJCNVWPI2TCEJVGZGORNCT'TUVCDUEJNCI5VGORGNINCP\



74

$4#0&'0$74)24'755'0 $4#0&'0$74)/#4-)4#(5%*#(65'+6&'/,#*4*70&'46  -74(ª456'067/ 

,QCEJKO +  6CNGT  (TCPMHWTV1FGT  I ë +1#%*+/ ë /#4%*+1 ë $4#0   ë 24+0 ë '.'%6 $TWUVDKNF T KP -WTQTPCV WPF OKV -WTJWV OKV FGT 4GEJVGP FCU <GRVGT UEJWNVGTPF   ë/10'ë01ë#4)'0ë24+0ë'.'%6ë$4#0&8KGTHGNFKIGU9CRRGPOKV/KVVGNUEJKNFFCTÒDGT FKG,CJTGU\CJN<$CJTH&CX-NWIGKP$0(6H5NI-KNNKUEJ  8QPITQ­GT5GNVGPJGKV9KP\5EJTÌVNKPIUHGJNGTCO4CPFUGJTUEJÌP  'ZGORNCT FGT #WMVKQP 9KPVGT  &ÒUUGNFQTH  0T  WPF FGT 5NI (TKV\QVVQ $CWUU #WMVKQP (TKV\ 4WFQNH   -ÒPMGT1UPCDTÒEM0T  

&GTGTUVGDTCPFGPDWTIKUEJG6CNGTWPFFCUYQJNUEJÌPUVGKO*CPFGNDGHKPFNKEJG'ZGORNCT 



+P#WUHÒJTWPIGKPGU.CPFVCIUDGUEJNWUUGUXGTHÒIVG,QCEJKO+CO,WNKFKGXQTN·WHKIG'KPUVGNNWPIFGT/ÒP\ RT·IWPI KP $TCPFGPDWTI WPF DGUKGIGNVG UQ FCU 'PFG FGT GTUVGP /ÒP\RGTKQFG &KG 6CNGTRT·IWPI KUV FKG   KPVGTGUUCPVGUVGWPFDGFGWVGPFUVG'TUEJGKPWPIFGTPWPDGIKPPGPFGP\YGKVGP/ÒP\RGTKQFGFKGUKEJPCEJYGKUNKEJCWH FKG ,CJTG  WPF  DGUEJT·PMV #WU FKGUGT <GKV UKPF KPUIGUCOV PWT UGJT YGPKIG 'ZGORNCTG DGMCPPV FCXQP   DGHKPFGPUKEJFKGOGKUVGPKP/WUGWOUDGUKV\1DYQJNFKG6CNGTU·OVNKEJMGKPGTNGK/ÒP\\GKEJGPHÒJTGPYGKUV$GTPF -NWIGOKVÒDGT\GWIGPFGP#TIWOGPVGPPCEJFC­\WOKPFGUVFKG6CNGTXQPKP(TCPMHWTV1FGTIGRT·IVYWTFGP .GV\VNKEJH·NNVFKG$KNCP\FGT/ÒP\RQNKVKM,QCEJKOU+GJGTPGICVKXCWU'UIGNCPIKJOPKEJVGKPGGKIGPG.CPFGUY·J TWPICWHFGT$CUKUXQP)TQ­UKNDGTOÒP\GP\WGVCDNKGTGP\WGKPGO/ÒP\XGTVTCIOKV5CEJUGPCNUDGFGWVGPFGO.KGHG TCPVGPXQP5KNDGTMCOGUPKEJV8QTFKGUGO*KPVGTITWPFKUVGUWOUQGTHTGWNKEJGTFC­ÒDGTJCWRVGKPKIG'ZGORNCTG FKGUGTDGOGTMGPUYGTVGPJKUVQTKUEJGP<GWIPKUUGCWUFGT4GHQTOCVKQPU\GKV\WWPUIGMQOOGPUKPF

34


BRANDENBURG-PREUSSEN

75



75

1,5:1

,QJCPP )GQTI   4GKEJUVCNGT  $GTNKP  I )GJCTPKUEJVGU *ÒHVDKNF T OKV FGT   4GEJVGP FCU <GRVGT UEJWNVGTPF FKG .KPMG CO 5EJYGTVITKHH \W FGP 5GKVGP FKG IGVGKNVG ,CJTGU\CJN     5GEJUHGNFKIGU 9CRRGP OKV /KVVGNUEJKNF \W FGP 5GKVGP LG GKPG 4QUGVVG QDGP KP FGT 7OUEJTKHV   FCU/ÒP\OGKUVGT\GKEJGPFGU%QPTCF5EJTGEM$CJTH  8QPITQ­GT5GNVGPJGKV5GJTUEJÌPpXQT\ÒINKEJ  0CEJFGO$TCPFGPDWTIPCEJFGO6QFFGU-WTHÒTUVGP,QCEJKO+)TQ­XCVGT,QJCPP)GQTIUKPFKG-WTOCTMWPVGT UGKPGO8CVGT-WTHÒTUV,QCEJKO++WPFFKG0GWOCTMWPVGTUGKPGO1PMGN/CTMITCH,QJCPPIGVGKNVYQTFGPYCTHKGN FKG*GTTUEJCHVKPFGT2GTUQP,QJCPP)GQTIUYKGFGT\WUCOOGPYGKN,QJCPPPWT\GJP6CIGPCEJ,QCEJKO++UVCTD QJPGGKPGPGTDDGTGEJVKIVGP0CEJMQOOGPJKPVGTNCUUGP\WJCDGP

76 77

77



4GKEJUVCNGT$GTNKP$CJTHC

8QPITQ­GT5GNVGPJGKV(CUVUGJTUEJÌP





)GQTI9KNJGNO4GKEJUVCNGT./$GTNKPI$CJTHC&CX  44*ÒDUEJG2CVKPCUGJTUEJÌP



78



(TKGFTKEJ 9KNJGNO FGT )TQ­G -WTHÒTUV  5KNDGTOGFCKNNG  XQP 6 4GWUU CWH FKG   4ÒEMMGJT FGU -WTHÒTUVGP XQP UGKPGO $GUWEJ KP 2TCI &GT IGJCTPKUEJVG -WTHÒTUV OKV JQJGO (GFGTJWV   TGKVGV T&KG )NÒEMUIÌVVKP OKV /GTMWTUVCD WPF (ÒNNJQTP UVGJV X X FGP -QRH PCEJ N IGYCPFV   OOI$TQEMOCPP  445GJTCVVTCMVKXGU'ZGORNCTOKVJGTTNKEJGT2CVKPCUGJTUEJÌPpXQT\ÒINKEJ  0CEJFGO9GUVH·NKUEJGP(TKGFGPGTJKGNV2TGW­GPCWUFGT6GKNWPI2QOOGTPUFCU)GDKGV*KPVGTRQOOGTP&KGUDG\ÒI NKEJICDGUOKV5EJYGFGPKOOGTYKGFGT#WUGKPCPFGTUGV\WPIGP&GUJCNDTGKUVGFGT-WTHÒTUV\WO-CKUGTPCEJ 2TCIYQKJOFKGUGTUGKPG7PVGTUVÒV\WPI\WUCIVG

35


BRANDENBURG-PREUSSEN

79



5KNDGTOGFCKNNG Q , XQT   XQP , *ÌJP WPF % /GNEJKQT CNU )GUEJGPM HÒT HTGOFG )GUCPFVG   +P GKPGT TGKEJ XGT\KGTVGP IGMTÌPVGP -CTVWUEJG FCU IGJCTPKUEJVG $TWUVDKNF HCUV X X OKV WOIGNGIVGO   /CPVGN&GTOKVFGO-WTJWVDGMTÌPVGDTCPFGPDWTIKUEJG#FNGTCWHFGT$TWUV<GRVGTUEJKNFWPFCWHFGP 5EJYKPIGPFKG9CRRGPFGTDTCPFGPDWTIKUEJGP.·PFGTOOI$TQEMOCPP  5GJTCVVTCMVKXGU'ZGORNCTOKVJÒDUEJGTCNVGT8GTIQNFWPIUGJTUEJÌPpXQT\ÒINKEJ  1GNTKEJ XGTOWVGV YQJN \W TGEJV FC­ FKG XQTNKGIGPFG /GFCKNNG XQT  CNUQ XQT 'TNCPIWPI FGT RTGW­KUEJGP   5QWXGT·PKV·V IGUEJCHHGP YQTFGP KUV &KG #WHHÒJTWPI CNNGT 6KVGN WPF 9CRRGP N·­V FGP 5EJNW­ \W FC­ UKG CNU   )GUEJGPMHÒTHTGOFG)GUCPFVGWPF9ÒTFGPVT·IGTFKGPVG

80



5KNDGTOGFCKNNGWPUKIPKGTVXGTOWVNKEJXQP).G[IGDGCWHFKG4ÒEMMGJTFGU-WTHÒTUVGPCWUFGO *GT\QIVWO 2TGW­GP IGYKFOGV XQP FGP O·TMKUEJGP 5V·PFGP &GT IGMTÌPVG WPF IGJCTPKUEJVG -WTHÒTUV   OKV WOIGNGIVGO /CPVGN WPF OKV <GRVGT KP FGT 4GEJVGP TGKVGV T$QTWUUKC OKV /CWGTMTQPG UKV\V X X   OKV-KPFCWHFGO5EJQ­WPFDNKEMV\WFGORTGW­KUEJGP#FNGTGORQTFGTGKPGP.QTDGGTMTCP\KO5EJPC DGNJ·NVOKVFGT4GEJVGPJ·NVUKGGKP5RTWEJDCPFOOI$TQEMOCPP  44#VVTCMVKXGU'ZGORNCTOKVJÒDUEJGT2CVKPCUGJTUEJÌP  &KGXQTNKGIGPFG/GFCKNNGHGKGTVFKG4ÒEMMGJTFGU-WTHÒTUVGPCWUFGO*GT\QIVWO2TGW­GPKPFKGDTCPFGPDWTIKUEJG *CWRVUVCFV $GTNKP (TKGFTKEJ 9KNJGNO YCT KO 5R·VUQOOGT  \WUCOOGP OKV UGKPGP DGKFGP·NVGUVGP5ÌJPGPWPF UGKPGTPGWXGTO·JNVGP)GOCJNKP&QTQVJGCXQP$GTNKPPCEJ-ÌPKIUDGTIIGTGKUVWOKOFQTVKIGP5EJNQ­CO2TGIGNHÒT N·PIGTG <GKV \W TGUKFKGTGP 9·JTGPF FKGUGU #WHGPVJCNVU YWTFG KO ,WPK  JKGT 2TKP\ 2JKNKRR 9KNJGNO CNU GTUVGU   -KPFCWUFGT\YGKVGP'JGFGU-WTHÒTUVGPIGDQTGP&KG2T·UGP\FGTMWTHÒTUVNKEJGP(COKNKGKO*GT\QIVWO2TGW­GP YCT \YGKHGNNQU GKP KPPGP WPF CW­GPRQNKVKUEJGU 5KIPCN &GT )TQ­G -WTHÒTUV JCVVGFKG5QWXGT·PKV·VFGU*GT\QIVWOU GTUV GKPKIG ,CJTG \WXQT KO  IGUEJNQUUGPGP (TKGFGP XQP 1NKXC GTTWPIGP WPF FKG *WNFKIWPI UGKVGPU FGT   RTGW­KUEJGP 5V·PFG GTUV IWV FTGK ,CJTG PCEJ PFGTWPI FKGUGT PGWGP XGTHCUUWPIUO·­KIGP 5KVWCVKQP KP -ÌPKIUDGTI   GPVIGIGPPGJOGPMÌPPGP)GTCFGCWEJCWUKPPGPRQNKVKUEJGP'TY·IWPIGPYCTUQOKVFGT#WHGPVJCNVKPFGTRTGW­KUEJGP *CWRVUVCFV UKPPXQNN \WOCN (TKGFTKEJ 9KNJGNO IGTCFG KP LGPGT <GKV IGIGPÒDGT FGP RTGW­KUEJGP 7PVGTVCPGP   KPUDGUQPFGTG UGKPG 5VGWGTRQNKVKM WPF UGKPGP 5VCCVUIGFCPMGP FGT OKV FGP VTCFKVKQPGNNGP UV·PFKUEJGP 2TKXKNGIKGP KP   OCPEJGTNGK*KPUKEJVMQNNKFKGTVGFWTEJ\WUGV\GPJCVVG5VGWGTNKEJG(QTFGTWPIGPJCVVGPDGTGKVUCWEJKPFGT/CTM $TCPFGPDWTI \W OCUUKXGP 2TQVGUVGP IGHÒJTV $GK FGT 4ÒEMMGJT FGU *GTTUEJGTU XQP UGKPGO OGJTOQPCVKIGP   RTGW­KUEJGP#WHGPVJCNVPCEJ$GTNKPKO,CJTGYCTFGT-QPHNKMVKPFGT/CTMYKGFGTDGKIGNGIVYQTFGPYCUUKEJ CWEJCWHFGOXQTNKGIGPFGP2T·UGPVUVÒEMKP$KNFWPF5EJTKHVYKFGTURKGIGNV

36


BRANDENBURG-PREUSSEN

81 (doppelt)



&QRRGNVGT 4GKEJUVCNGT  $GTNKP CWH FGP 5KGI FGT $TCPFGPDWTIGT DGK (GJTDGNNKP CO  ,WPK   I(4+&Ù9+.*Ù&Ù)Ú/#4Ú$45Ú4Û+Û#4%'.Ù $NCVV &GTIGJCTPKUEJVG-WTHÒTUV TGKVGV T OKV 5EJYGTV KP FGT GTJQDGPGP 4GEJVGP WPVGP GKP 6GKN FGU 5EJNCEJVHGNFGU N FTGK -CPQPGP T   +PHCPVGTKG CWH $TÒEMG CO 9CNFGUTCPF QDGP 5EJTKHVDCPF OKV 1$ 58$&+615 5'48#615+8568/    58'%14 ':'4%+68Û  /#4%*+# Û 21/'4#0+# Û 3  &8 +25' Û #.+$+ Û 1224'55+5 Û    #&'56Û8#56#06'2412'('*4$'..+08Û&+'Û+80Û#QÛÛ0#%651.1Û %8'38+6#68Ü581+/1Ü8'4151.#Û&'+Û12'Û(4'685Ú%“&+6Û(80&+65'26+ Û/'564'5Ú24“&10'55'26'/Û&+'$6'44+558+5'++%+6rr5Û&Û)r&CXp

\WFQTVCNUGKPHCEJGT4GKEJUVCNGT X5EJTp \WFQTVCNUGKPHCEJGTWPFFTGKHCEJGT4GKEJ UVCNGT  8QPCNNGTITÌ­VGT5GNVGPJGKV'KP\KIGUKO*CPFGNDGHKPFNKEJGU'ZGORNCT *GTTNKEJG2CVKPCMN5EJTÌVNKPIUHGJNGTKO(GNFFGT8QTFGTUGKVGCVVTCMVKXGUXQT\ÒINKEJGU'ZGORNCT  'ZGORNCTFGT#WMVKQP9KPVGT&ÒUUGNFQTH0T





0CEJFGO GKP UEJYGFKUEJGU *GGT #PHCPI  WPVGT (ÒJTWPI FGT )GDTÒFGT 9TCPIGN KP FKG PÌTFNKEJGP )GDKGVG   GKPIGHCNNGP YCT TGMTWVKGTVG FGT -WTHÒTUV LGFGP YCHHGPH·JKIGP /CPP WPF UVGNNVG UQ GKPG #TV .CPFUVWTO CWH   #O  ,WPK UVGNNVGP UKEJ FKG \CJNGPO·­KI YGKV ÒDGTNGIGPGP 5EJYGFGP \WT 5EJNCEJV FKG \YKUEJGP FGP &ÌTHGTP   .KPWO WPF *CEMGPDGTI UVCVVHCPF 0CEJ JGHVKIGP 4GKVGTIGHGEJVGP OW­VGP UKEJ FKG 5EJYGFGP \WTÒEM\KGJGP   5KGXGTNQTGPHCUVFKG*·NHVGKJTGU*GGTGU EC/CPP &KG9KTMWPIFGU5KGIGUIKPIYGKVÒDGTFCU/KNKV·TKUEJG JKPCWU$TCPFGPDWTI2TGW­GPJCVVGPWPGPFIÒNVKIUGKPGP2NCV\WPVGTFGPGWTQR·KUEJGP)TQ­O·EJVGPGKPIGPQOOGP (TKGFTKEJ 9KNJGNO YWTFG XQP PWP CP &GT )TQ­G -WTHÒTUV IGPCPPV GT NKG­ GKPG CW­GTIGYÌJPNKEJ WOHCPITGKEJG   WPFXKGNH·NVKIG5GTKGXQP/ÒP\GPWPF/GFCKNNGPCWHFGPDGFGWVGPFGP5KGIDGK(GJTDGNNKPRT·IGP

82



4GKEJUVCNGT  $GTNKP CWH FGP 5KGI FGT $TCPFGPDWTIGT DGK (GJTDGNNKP CO  ,WPK  I   &GTIGJCTPKUEJVG-WTHÒTUVTGKVGVTOKV5EJYGTVKPFGTGTJQDGPGP4GEJVGPWPVGPGKP6GKNFGU5EJNCEJV HGNFGU N FTGK -CPQPGP T +PHCPVGTKG CWH $TÒEMG CO 9CNFGUTCPF <GKNGP 5EJTKHV &CX    X5EJT -CDKPGVVUVÒEMXQPHGKPUVGT'TJCNVWPI 5EJCTHCWUIGRT·IVGU'ZGORNCTOKVJGTTNKEJGT2CVKPC5VGORGNINCP\ 

83



4GKEJUVCNGT  $GTNKP CWH FGP 5KGI FGT $TCPFGPDWTIGT DGK (GJTDGNNKP CO  ,WPK &CX    X5EJT 2TCEJVXQNNG2CVKPCYKP\4GUVGXQP6KPVGPUEJTKHVXQT\ÒINKEJp5VGORGNINCP\  37


BRANDENBURG-PREUSSEN

84



4GKEJUVCNGT$GTNKPCWHFGP5KGIDGK(GJTDGNNKPCO,WPK&CXX5EJT  5GNVGPDGUQPFGTUKPFKGUGT'TJCNVWPI-CDKPGVVUVÒEM2TCEJVXQNNG2CVKPCHCUV5VGORGNINCP\



85

24'755'0-¤0+)4'+%* 

(TKGFTKEJ +++  +  4GKEJUVCNGT  +2 0GWGPDWTI 0GWEJ³VGN  &6  &CX    */<pC/CTVKP  440WT'ZGORNCTGIGRT·IV/KPLWUVKGTVYKP\5EJTÌVNKPIUHGJNGTUGJTUEJÌP  &KG )TCHUEJCHV 0GWGPDWTI HTCP\ 0GWEJ³VGN  YWTFG KO  ,CJTJWPFGTV KP FCU -ÌPKITGKEJ $WTIWPF KPVGITKGTV WPF   MCO\WO&GWVUEJGP4GKEJIKPI0GWGPDWTIGKPGYKIGU$WTITGEJVOKV$GTPGKPWPVGTFGUUGP'KPHNW­KP HCUV CNNGP )GOGKPFGP FKG 4GHQTOCVKQP GKPIGHÒJTV YWTFG &KG FWTEJ FCU $WTITGEJV GTYQTDGPGP IT·HNKEJGP 4GEJVG   IKPIGP  FWTEJ 'TDUEJCHV CP FCU *CWU 1TN¾CPU.QPIWGXKNNG ÒDGT #O  ,WPK  GTNQUEJ FKG ÒDGT \YGK   ,CJTJWPFGTVGY·JTGPFG4GIGPVUEJCHVFGU*CWUGU1TN¾CPU.QPIWGXKNNGOKVFGO6QFFGTMKPFGTNQUGP(ÒTUVKP/CTKGFG 0GOQWTU 7PVGT FGP  $GYGTDGTP WO FKG HÒTUVNKEJG *GTTUEJCHV KP 0GWGPDWTI YWTFG PKEJV FGT XQP .QWKU :+8   HCXQTKUKGTVG2TKP\%QPVKIGY·JNVUQPFGTPFGTRTGW­KUEJG-ÌPKI(TKGFTKEJ+CWUFGO*CWUG*QJGP\QNNGTP5QJPFGT 2TKP\GUUKP.WKUG*GPTKGVVGXQP1TCPKGPWPFGKP\KIGT'TDGFGU*CWUGU1TCPKGP#O0QXGODGTGTHQNIVGPCEJ NCPIGP 8GTJCPFNWPIGP CP FGPGP UKEJ CWEJ FGT 2JKNQUQRJ )QVVHTKGF 9KNJGNO .GKDPK\ OKV GKPGT 5VCCVUUEJTKHV   DGVGKNKIVGFKGHÌTONKEJG#PGTMGPPWPIFGT4GEJVG(TKGFTKEJUWPFUGKPGT'TDGPCP0GWGPDWTIFKGMÒPHVKIFGP6KVGN UQWXGT·PGT (ÒTUV XQP 1TCPKGP 0GWEJ³VGN WPF 8CNCPIKP VTWIGP #WEJ (TKGFTKEJU GKPUVYGKNKIGT 9KFGTUCEJGT   .QWKU:+8XQP(TCPMTGKEJGTMCPPVGKJPKO(TKGFGPXQP7VTGEJVCNU(ÒTUVGPXQP0GWGPDWTICPWPFDGGPFGVG FCOKVFGP5VTGKVWOFKGRTGW­KUEJG'ZMNCXG&KGRTGW­KUEJGP-ÌPKIGUGV\GP)QWXGTPGWTGGKPFKGÒDGTFCU(ÒTUVGP VWO TGIKGTVGP &KGUG JCVVGP KJTGP 5KV\ KO 5EJNQ­ XQP 0GWGPDWTI QFGT $GTNKP IGY·JTVGP FGO (ÒTUVGPVWO CNNG   DKUJGTKIGP4GEJVGYKGCWEJ(TGKJGKVGPWPFOKUEJVGPUKEJ\WFGOPWTUGNVGPKPKPPGTG#PIGNGIGPJGKVGPGKP

86



38

(TKGFTKEJ 9KNJGNO +++  5KNDGTOGFCKNNG  XQP ( 9 .QQU CWH FCU L·JTKIG   $GUVGJGP FGU -ÌPKITGKEJU 2TGW­GP CO  ,CPWCT &KG $TWUVDKNFGT FGT GTUVGP HÒPH RTGW­KUEJGP-ÌPKIG PGDGPGKPCPFGT N&GT 5QPPGPIQVV KP 3WCFTKIC WOIGDGP XQP FGP *QTGP HQNIV #WTQTC WPF FGO   /QTIGPUVGTP T WPVGP UKV\V FCU RGTUQPKHK\KGTVG IGTÒUVGVG 2TGW­GP OKV (ÒNNJQTP WPF 9CRRGPUEJKNF   OOI/CTKGPD5QOOGT# *GTTNKEJG2CVKPCXQT\ÒINKEJp5VGORGNINCP\




BRANDENBURG-PREUSSEN

87



5KNDGTOGFCKNNGXQP(-ÌPKI9GTMUVCVV).QQUCWHFKG8GTO·JNWPIFGU-TQPRTKP\GP(TKGFTKEJ 9KNJGNO OKV 'NKUCDGVJ .WKUG XQP $C[GTP -ÌRHG FGU $TCWVRCCTGU PGDGPGKPCPFGT N*[OGP DGMT·P\V   $TCWVRCCT FCU UKEJ ÒDGT GKPGO #NVCT FKG *·PFG TGKEJV N RTGW­KUEJGT #FNGT T DC[GTKUEJGT .ÌYG   OOI/CTKGPD9KVV 2TCEJVXQNNG2CVKPCHCUV5VGORGNINCP\



88



5KNDGTOGFCKNNGXQP(-ÌPKI9GTMUVCVV).QQUCWHFKG8GTO·JNWPIFGU-TQPRTKP\GP(TKGFTKEJ 9KNJGNOOKV'NKUCDGVJ.WKUGXQP$C[GTP8CTKCPVGOKV8GT\KGTWPIGPKO#DUEJPKVVFGT4ÒEMUGKVG-ÌRHG FGU $TCWVRCCTGU PGDGPGKPCPFGT N*[OGP DGMT·P\V $TCWVRCCT FCU UKEJ ÒDGT GKPGO #NVCT FKG *·PFG   TGKEJVNRTGW­KUEJGT#FNGTTDC[GTKUEJGT.ÌYGOOI/CTKGPDp \W 9KVVp \W   2TCEJVXQNNG2CVKPCHCUV5VGORGNINCP\



89

1,5:1



1,5:1

8GTGKPUFQRRGNVCNGT  # 2TQDG OKV ITQ­GO #DUVCPF \YKUEJGP -QRH WPF /ÒP\\GKEJGP CWH FGT   8QTFGTUGKVG WPF MNGKPGT -TQPG WPF XGT·PFGTVGT 7OUEJTKHV CWH FGT 4ÒEMUGKVG <9'+ 6*#.'4  8++   '+0' (Ü /Ü /KV 4CPFUEJTKHV  I #-5  #PO &CX p \W   -CJPV  J 5VWV\OCPP    8#4C6JWPp \W  8QPITÌ­VGT5GNVGPJGKV8QT\ÒINKEJp5VGORGNINCP\  39


BRANDENBURG-PREUSSEN

90

91

92



(TKGFTKEJ9KNJGNO+88GTGKPUFQRRGNVCNGT##-5&CX-CJPV6JWP  5GNVGPGT,CJTICPI*GTTNKEJG2CVKPCUGJTUEJÌPpXQT\ÒINKEJ





&QRRGNVGT8GTGKPUVCNGT##-5&CX-CJPV6JWP

(CUVXQT\ÒINKEJ





9KNJGNO+&QRRGNVGT8GTGKPUVCNGT##-5&CX-CJPV6JWP  5GNVGPGT,CJTICPI*ÒDUEJG2CVKPCXQT\ÒINKEJ



93

94

95



&QRRGNVGT8GTGKPUVCNGT##-5&CX-CJPV6JWP

8QT\ÒINKEJ





&QRRGNVGT8GTGKPUVCNGT%#-5&CX-CJPV6JWP%  (GKPG2CVKPCHCUVXQT\ÒINKEJ





&QRRGNVGT8GTGKPUVCNGT##-5&CX-CJPV6JWP 5GNVGPGT,CJTICPI(GKPG2CVKPCMN4CPFHGJNGTXQT\ÒINKEJ

 

40


BRANDENBURG-PREUSSEN

97

96

96



5KNDGTOGFCKNNG  XQP ( 9 -WNNTKEJ WPF * 9GEMYGTVJ CWH FKG -CKUGTRTQMNCOCVKQP WPF FKG   4GKEJUITÒPFWPI-CKUGT9KNJGNO+UVGJVXXKP7PKHQTOWOIGDGPXQP\YÌNHFGWVUEJGP(ÒTUVGPKO #DUEJPKVV FTGK <GKNGP 5EJTKHV FCTÒDGT FKG ,CJTGU\CJN )GMTÌPVG,CJTGU\CJN\YKUEJGPIGDWP FGPGO2CNOWPF'KEJGP\YGKIOOI/CTKGPD5QOOGT-  42TCEJVGZGORNCT(CUV5VGORGNINCP\ 



9KNJGNO ++  5KNDGTOGFCKNNG  9GTMUVCVV /C[GT WPF 9KNJGNO 5VWVVICTV OQFGNNKGTV   XQP*&ÒTTKEJCWHFKG'KPYGKJWPIFGU4GKEJUVCIUIGD·WFGUKP$GTNKPCO&G\GODGT)GJCTPKUEJVGU $TWUVDKNFNOKVWOIGNGIVGO/CPVGN#PUKEJVFGU4GKEJUVCIUIGD·WFGUOOI/CTKGPD /ÒNNGT 449KP\4CPFHGJNGTYKP\-TCV\GTXQT\ÒINKEJ  41


BRAUNSCHWEIG UND LÜNEBURG

98

$4#705%*9'+)70&.ª0'$74) $4#705%*9'+)91.('0$ª66'.(ª456'067/ 

*GKPTKEJ,WNKWU4GKEJUVCNGT<GNNGTHGNFCWHFGP6QFUGKPGT/WVVGT*GFYKIXQP$TCP FGPDWTI&CX9GNVGT 5GJTUEJÌP



*GFYKI  /·T\   YCT FKG 6QEJVGT FGU -WTHÒTUVGP ,QCEJKO ++ XQP $TCPFGPDWTI WPF FGUUGP )GOCJNKP   *GFYKI 6QEJVGT FGU -ÌPKIU 5KIKUOWPF XQP 2QNGP &KG 8GTO·JNWPI OKV ,WNKWU XQP 9QNHGPDÒVVGN HCPF CO    (GDTWCT  KP $GTNKP UVCVV *GFYKI UVCTD CO  1MVQDGT  CWH 5EJNQ­ *GUUGP DGK $TCWPUEJYGKI WPF   YWTFGCO0QXGODGTKP9QNHGPDÒVVGNDGKIGUGV\V

99



.ÌUGT\W4GKEJUVCNGTP<GNNGTHGNF/KV9GTVRWP\GI&CX&WXG9GNVGT  44#VVTCMVKXGUUGJTUEJÌPGU'ZGORNCT



100

 42

.ÌUGT\W4GKEJUVCNGTP<GNNGTHGNF/KV9GTVRWP\GI&CX&WXG9GNVGT  8QPITQ­GT5GNVGPJGKV*GPMGNURWT8QTFGTUGKVGNGKEJVIGIN·VVGVUGJTUEJÌPpXQT\ÒINKEJ




BRAUNSCHWEIG UND LÜNEBURG

101



.ÌUGT\W4GKEJUVCNGTP<GNNGTHGNF/KV9GTVRWP\GI&CX&WXG9GNVGT #VVTCMVKXGUUGJTUEJÌPGU'ZGORNCTOKVUEJÌPGT2CVKPC

 

102



4GKEJUVCNGT<GNNGTHGNFCWHUGKPGP6QF&CX#9GNVGT #VVTCMVKXGUUGJTUEJÌPGU'ZGORNCTOKVJÒDUEJGT2CVKPC

 

103



(TKGFTKEJ 7NTKEJ  .ÌUGT \W  4GKEJUVCNGTP  )QUNCT QFGT <GNNGTHGNF /KV 9GTVRWP\G    I &GT IGJCTPKUEJVG *GT\QI TGKVGV T OKV YGJGPFGO 7OJCPI KP FGT 4GEJVGP -QOOCPFQUVCD    (ÒPHHCEJDGJGNOVGUHGNFKIGU9CRRGP\WFGP5GKVGP\YGKYKNFG/·PPGTCNU5EJKNFJCNVGTFKGLGGKPGP $CWOUVCOOPGDGPUKEJJCNVGP&CX&WXG9GNVGT  5EJÌPG2CVKPCMN5EJTÌVNKPIUHGJNGTXQT\ÒINKEJ  43


BRAUNSCHWEIG UND LÜNEBURG

104



.ÌUGT \W  4GKEJUVCNGTP  <GNNGTHGNF /ÒP\OGKUVGT *CPU .CHHGTU /KV 9GTVRWP\G  I &GT   IGJCTPKUEJVG*GT\QITGKVGVTOKVJQJGO*WVWPFYGJGPFGO7OJCPIKPFGT4GEJVGP-QOOCPFQUVCD (ÒPHHCEJDGJGNOVGUHGNFKIGU9CRRGP\WFGP5GKVGP\YGKYKNFG/·PPGTCNU5EJKNFJCNVGTFKGLGGKPGP $CWOUEJT·IXQTUKEJJCNVGP&CX&WXG9GNVGT  44*GPMGNURWT(GNFGTCNVIGIN·VVGVHCUVXQT\ÒINKEJ 

106



105

107

.ÌUGT\W4GKEJUVCNGTPQ,  #PFTGCUDGTI#WUDGWVGRT·IWPI5QIGPCPPVGT)NÒEMUNÌUGT/KV IGRT·IVGT9GTV\CJNI&CX&WXG+/ÒUGNGTF9GNVGT #VVTCMVKXGU'ZGORNCTOKVJGTTNKEJGT2CVKPCYKP\2T·IGUEJY·EJGXQT\ÒINKEJ

 

5KGJG CWEJ /ÒUGNGT $CPF +++  <WYGKUWPI FQTV PCEJ $TCWPUEJYGKI.ÒPGDWTI%GNNG WPVGT %JTKUVKCP $KUEJQH   XQP/KPFGP



#WIWUVFGT,ÒPIGTG4GKEJUVCNGT<GNNGTHGNF&CX9GNVGT

8QT\ÒINKEJ





4GKEJUVCNGT<GNNGTHGNF)NQEMGPVCNGT&CX%9GNVGT #VVTCMVKXGU'ZGORNCTUGJTUEJÌPpXQT\ÒINKEJ

 

44


BRAUNSCHWEIG UND LÜNEBURG

108



.ÌUGT\W4GKEJUVCNGTP<GNNGTHGNF1JPG9GTVRWP\GI&CX&WXG9GNVGT  8QT\ÒINKEJGU'ZGORNCTOKVHGKPGT2CVKPC



109

110

110



4GKEJUVCNGT<GNNGTHGNF&CX9GNVGT 5GJTUGNVGPDGUQPFGTUKPFKGUGT'TJCNVWPI 5EJCTHCWUIGRT·IVGU'ZGORNCTOKVHGKPGT2CVKPCXQT\ÒINKEJ



4GKEJUVCNGT<GNNGTHGNFCWHUGKPGP6QF&CX9GNVGT0CEJVTCI 8QT\ÒINKEJGU'ZGORNCTOKVHGKPGT2CVKPC

  

111



4WFQNH #WIWUV  4GKEJUVCNGT  %NCWUVJCN CWH FKG 'TQDGTWPI FGT 5VCFV $TCWPUEJYGKI   &CX9GNVGT 45EJCTHCWUIGRT·IVGU'ZGORNCTOKVRTCEJVXQNNGT2CVKPCXQT\ÒINKEJ  45


BRAUNSCHWEIG UND LÜNEBURG

112



.ÌUGT\W4GKEJUVCNGTP<GNNGTHGNF#WUDGWVGFGT)TWDG.CWVGPVJCNU)NÒEM/KV9GTVRWP\GI &CX&WXG/ÒUGNGT9GNVGT 4#VVTCMVKXGU'ZGORNCTOKVHGKPGT2CVKPCUGJTUEJÌP

 

113



#PVQP7NTKEJHCEJGT4GKEJUVCNGTQ,  $TCWPUEJYGKICWHUGKPGPªDGTVTKVV\WT MCVJQNKUEJGP-KTEJGI#0610+757.4+%Ù&Ù)Ù&7:Ü$4Ù'6.70'$Ù)GJCTPKUEJVGU $TWUVDKNF T OKV WOIGNGIVGO /CPVGN5'/2'4 +&'/ (GNU KO /GGT KO #DUEJPKVV %1056#06'4   &CX#PO9GNVGT0CEJVTCI$  8QPITQ­GT5GNVGPJGKV(GKPG2CVKPCHCUVXQT\ÒINKEJGU'ZGORNCT  7OUGKPG'ZRCPUKQPURN·PGXQTCP\WVTGKDGPWPFUGKPG8GTDKPFWPI\WOÌUVGTTGKEJKUEJGP-CKUGTJCWU\WHGUVKIGPMQP XGTVKGTVG#PVQP7NTKEJJGKONKEJ\WOMCVJQNKUEJGP)NCWDGP'TUVKOHQNIGPFGP,CJTNGIVGGTKO$CODGTIGT&QO XQTFGO/CKP\GT-WTHÒTUVGPGKPÌHHGPVNKEJGU)NCWDGPUDGMGPPVPKUCD5GKPGP7PVGTVCPGPUKEJGTVGGT4GNKIKQPUHTGKJGKV \W<WT4GEJVHGTVKIWPIUGKPGU)NCWDGPUYGEJUGNUXGTÌHHGPVNKEJVGGTFKG5EJTKHV(ÒPH\KI$GYGIITÒPFG

114



46

4GKEJUVCNGT$TCWPUEJYGKICWHUGKPGP6QF&CX9GNVGT  5GNVGPDGUQPFGTUKPFKGUGT'TJCNVWPI*GTTNKEJG2CVKPCXQT\ÒINKEJp5VGORGNINCP\




BRAUNSCHWEIG UND LÜNEBURG

116

115

115



.WFYKI4WFQNHUGKVKP$NCPMGPDWTI4GKEJUVCNGT<GNNGTHGNF&CX  9GNVGT 5GJTUEJÌPpXQT\ÒINKEJ





-CTN+4GKEJUVCNGT<GNNGTHGNF&CX9GNVGT 44-CDKPGVVUVÒEM2TCEJVXQNNG2CVKPCHCUV5VGORGNINCP\

 

117

117 1,5:1



4GKEJUVCNGT  <GNNGTHGNF #WUDGWVG FGT )TWDG %TQPGPDWTIU )NÒEM &CX  /ÒUGNGT    9GNVGT -CDKPGVVUVÒEM2TCEJVXQNNG2CVKPCHCUV5VGORGNINCP\ 

118



4GKEJUVCNGT  <GNNGTHGNF #WUDGWVG FGT )TWDG *GT\QI (TKGFTKEJ #WIWUV $NG[HGNF &CX  /Ò   UGNGT9GNVGT 9KP\5EJTÌVNKPIUHGJNGTXQT\ÒINKEJ

 47


BRAUNSCHWEIG UND LÜNEBURG

119

119 1,5:1



-CTN ++  7PVGT 8QTOWPFUEJCHV -ÌPKI )GQTIU +8 XQP )TQ­DTKVCPPKGP    -QPX6CNGT 5RGEKGUVCNGT %X%#-5&CX-CJPV6JWP  8QPITQ­GT5GNVGPJGKV2TCEJVGZGORNCT(GKPG2CVKPC5VGORGNINCP\  *GT\QI -CTN YWTFG CNU 5QJP (TKGFTKEJ 9KNJGNOU CO  KP $TCWPUEJYGKI IGDQTGP 0CEJFGO UGKP 8CVGT    DGK 9CVGTNQQ IGHCNNGP YCT MCO FGT HCUV L·JTKIG WPVGT 8QTOWPFUEJCHV UGKPGU 1PMGNU )GQTI +8  OKPFGT   L·JTKI \WT 4GIKGTWPI 8QT FGT <GKV HÒT OÒPFKI GTMN·TV YWTFG -CTN YGIGP UGKPGT /K­TGIKGTWPI  FWTEJ   GKPGP8QNMUCWHUVCPFXGTVTKGDGP9GIGPUGKPGU4GKEJVWOUYWTFGGTKO8QNMUOWPFURÌVVKUEJFGT&KCOCPVGPJGT\QI IGPCPPV&GTJKGTCPIGDQVGPG5RGEKGUVCNGTYKTFPWTUGJTUGNVGPCWHFGO/CTMVCPIGDQVGP

120

1,5:1

1,5:1



9KNJGNO6CNGT%X%2TQDGOKVXGT·PFGTVGO2QTVT·VCWHFGT8QTFGTUGKVGWPF9CRRGP KP 1TFGPUMGVVG CWH FGT 4ÒEMUGKVG /KV 4CPFUEJTKHV  I #-5  &CX p \W   -CJPV  #   5VWV\OCPP6JWPp \W  8QPITÌ­VGT5GNVGPJGKV8GTOWVNKEJPWT'ZGORNCTGIGRT·IV 9KP\5EJTÌVNKPIUHGJNGTXQT\ÒINKEJp5VGORGNINCP\  'ZGORNCTFGT#WMVKQP&T$WUUQ2GWU0CEJH(TCPMHWTV0T

121

 48

8GTGKPUFQRRGNVCNGT%X%#-5&CX-CJPV6JWP 48QT\ÒINKEJXQT\ÒINKEJp5VGORGNINCP\

 


BRAUNSCHWEIG UND LÜNEBURG

122

123 122



8GTGKPUFQRRGNVCNGT%X%#-5&CX-CJPV6JWP  5GNVGPGT,CJTICPI8QT\ÒINKEJp5VGORGNINCP\





6CNGT$#-5&CX-CJPV6JWP  5GJTUGNVGPKPFKGUGT'TJCNVWPI2TCEJVGZGORNCT(GKPG2CVKPC5VGORGNINCP\



124

125

$4#705%*9'+).ª0'$74)%'..'(ª456'067/ 

%JTKUVKCP$KUEJQHXQP/KPFGP4GKEJUVCNGT%NCWUVJCN&CX9GNVGT #VVTCMVKXGUHCUVXQT\ÒINKEJGU'ZGORNCTOKVHGKPGT2CVKPC

 



(TKGFTKEJ4GKEJUVCNGT%NCWUVJCN&CX9GNVGT  5GNVGPKPFKGUGT'TJCNVWPI#WUFTWEMUXQNNG2CVKPCXQT\ÒINKEJ



126



%JTKUVKCP .WFYKI  .ÌUGT \W  4GKEJUVCNGTP  %NCWUVJCN /KV 9GTVRWP\G  I   )GMTÌPVGU /QPQITCOO KP .QTDGGTMTCP\ WOIGDGP XQP  MNGKPGP IGMTÌPVGP 9CRRGP WPVGP FKG 5K   IPCVWT .9   .KRRQNF 9GHGT /ÒP\OGKUVGT KP %NCWUVJCN  4Q­ URTKPIV N ÒDGT $GTI   YGTMUNCPFUEJCHVFCTÒDGTJ·NVGKPGCWU9QNMGPMQOOGPFG*CPFGKPGP.QTDGGTMTCP\&CX&WXG++ 9GNVGT 44#VVTCMVKXGUUGJTUEJÌPGU'ZGORNCT  49


BRAUNSCHWEIG UND LÜNEBURG

127

$4#705%*9'+)%#.'0$'4)*#0018'4#$-74(ª456'067/  *#0018'4#$-¤0+)4'+%**#0018'4 

,QJCPP(TKGFTKEJ4GKEJUVCNGT%NCWUVJCN&CX9GNVGT (CUVXQT\ÒINKEJ



128



.ÌUGT \W   4GKEJUVCNGTP  %NCWUVJCN CWH UGKPGP 6QF /KV 9GTVRWP\G  I &CX    &WXG$9GNVGT 445GJTUEJÌP 

129



'TPUV #WIWUV  UGKV  $KUEJQH XQP 1UPCDTÒEM .ÌUGT \W  4GKEJUVCNGTP    <GNNGTHGNF CWH UGKPGP 4GIKGTWPIUCPVTKVV WPF FKG *WNFKIWPI KP *CPPQXGT /KV 9GTVRWP\G  I   &CX&WXG9GNVGT *ÒDUEJG2CVKPCCVVTCMVKXGUXQT\ÒINKEJGU'ZGORNCT  'TPUV#WIWUV 0QXGODGTCWH5EJNQ­*GT\DGTIÓ,CPWCTCWH5EJNQ­*GTTGPJCWUGP)GO·­FGT KO 9GUVH·NKUEJGP (TKGFGP XGTGKPDCTVGP CDYGEJUGNPFGP #DHQNIG XQP RTQVGUVCPVKUEJGP WPF MCVJQNKUEJGP $KUEJÌHGP   YWTFGGTGXCPIGNKUEJGT(ÒTUVDKUEJQHXQP1UPCDTÒEM0CEJFGO6QFUGKPGU$TWFGTU,QJCPP(TKGFTKEJFGTQJPG O·PPNKEJG0CEJMQOOGPIGUVQTDGPYCTÒDGTPCJOGTFKG4GIKGTWPIWPFXGTNGIVGUGKPG4GUKFGP\XQPFGOXQP KJO GTDCWVGP 5EJNQ­ KP 1UPCDTÒEM PCEJ *CPPQXGT 'THÒJTVGPCEJJGHVKIGP#WUGKPCPFGTUGV\WPIGPOKVFGT(COKNKG FCU'TUVIGDWTVUTGEJVGKPWPFGTJKGNVFKGPGWPVG-WTYÒTFG

50


BRAUNSCHWEIG UND LÜNEBURG

130



.ÌUGT \W   4GKEJUVCNGTP  <GNNGTHGNF #WUDGWVG FGT *CT\GT )TWDGP /KV 9GTVRWP\G  I   &CX&WXG$/ÒUGNGT9GNVGT  5GJTCVVTCMVKXGU'ZGORNCTOKVJGTTNKEJGT2CVKPCXQT\ÒINKEJ 

131

131 1,5:1



)GQTI+-ÌPKIXQP)TQ­DTKVCPPKGP4GKEJUVCNGT%NCWUVJCN&CX9GNVGT  2TCEJVGZGORNCTOKVHGKPGT2CVKPC8QT\ÒINKEJp5VGORGNINCP\ 

132

133

133



'TPUV#WIWUV6CNGT##-5&CX-CJPV6JWP  2TCEJVGZGORNCT(CUV5VGORGNINCP\



)GQTI88GTGKPUFQRRGNVCNGT$/ÒP\DGUWEJCO/CK#-5&CX -CJPV6JWP 4(CUV5VGORGNINCP\ 



51


BREMEN

134

'4<$+567/ 

$4'/'0

*GKPTKEJ+++*GT\QIXQP5CEJUGP.CWGPDWTI4GKEJUVCNGT 5EJKNNKPI $TGOGP OKV6KVGN4WFQNHU++&CX,WPIM 5GJTUGNVGPKPFKGUGT'TJCNVWPI *GTTNKEJG2CVKPCMN5EJTÌVNKPIUHGJNGTKO4CPFDGTGKEJXQT\ÒINKEJ 

135



(TKGFTKEJ XQP &·PGOCTM  4GKEJUVCNGT  $TGOGTXÌTFG  I )GJCTPKUEJVGU   *ÒHVDKNFTOKVWOIGJ·PIVGT(GNFDKPFGFKGOKV5RKV\GPXGT\KGTVKUVCPFGT5GKVGFGU*CCTGUGKPJGTCD J·PIGPFGT <QRH \W FGP 5GKVGP &1/+075  2418+&'$+6Ü)GMTÌPVGU OKV (TCV\GP XGT\KGTVGU   UGEJUHGNFKIGU 9CRRGP OKV FTGKHGNFKIGO /KVVGNUEJKNF WPVGP \W FGP 5GKVGP FKG 5KIPCVWT 2  6  

2GVGT 6KORH /ÒP\OGKUVGT KP $TGOGTXÌTFG   QDGP PGDGP FGT -TQPG FKG IGVGKNVG ,CJTGU\CJN   &CX*GFG,WPIM.CPIG  8QPITQ­GT5GNVGPJGKV#VVTCMVKXGU'ZGORNCTOKVHGKPGT2CVKPCUGJTUEJÌP  +O4CJOGPFGTCWHFKGPQTFFGWVUEJGP$KUVÒOGTCWUITGKHGPFGP6GTTKVQTKCNRQNKVKMUGKPGU8CVGTU-ÌPKI%JTKUVKCP+8 XQP&·PGOCTMYWTFG(TKGFTKEJ-QCFLWVQTKP$TGOGPKP8GTFGPWPFKP*CNDGTUVCFVYWTFGGT 'T\DKUEJQHXQP$TGOGP$KUEJQHXQP8GTFGP8GTFGPWPF*CNDGTUVCFVUQYKG5EJNGUYKI*QNUVGKPYGTFGPPGDGP $TGOGP CWEJ CWUFTÒEMNKEJ KP FGT 6KVWNCVWT FKGUGU ·W­GTUV UGNVGPGP 6CNGTU IGPCPPV 'U IGNCPI (TKGFTKEJ \WP·EJUV   UGKPG $KUVÒOGT YGKVIGJGPF CWU FGO MCVCUVTQRJCNGP &TGK­KIL·JTKIGP -TKGI JGTCWU\WJCNVGP +O ,CJT  XGTNQT GT   LGFQEJDGKFG5VKHVGFWTEJFGP(TKGFGPXQP$TÌOUGDTQ JGWVG6GKNXQP-CTNUMTQPC CP5EJYGFGP+O9GUVH·NKUEJGP (TKGFGP XQP  YWTFGP DGKFG $KUVÒOGT U·MWNCTKUKGTV WPFCNU*GT\QIVWO$TGOGPWPF8GTFGPFGOUEJYGFKUEJGP -ÌPKI WPVGTUVGNNV FGT FCFWTEJ 5KV\ WPF 5VKOOG KO FGWVUEJGP 4GKEJUVCI GTNCPIVG (TKGFTKEJ VTCV PCEJ FGO 6QF   %JTKUVKCPU +8 CO  (GDTWCT  FKG 0CEJHQNIG CWH FGP F·PKUEJGP 6JTQP CNU (TKGFTKEJ +++ CP &GT JKGT   CPIGDQVGPG 4GKEJUVCNGT FGT KP $TGOGTXÌTFG FGO /KVVGNRWPMV WPF $KUEJQHUUKV\ FGU 'T\DKUVWOU $TGOGP GPVUVCPF   \GKIV FKG GPIG 8GTDKPFWPI \YKUEJGP FGT PQTFFGWVUEJGP WPF UMCPFKPCXKUEJGP )GUEJKEJVG WPF \·JNV \W FGP ITQ­GP   5GNVGPJGKVGPCWUFGT<GKVFGU)TQ­GP-TKGIGU

136

56#&6 

52

6CNGTOKV6KVGN-CTNU8IÊ/10'6#g018#g4'+28$g$4'/'05+5VCFVYCRRGP FCTÒDGT ,CJTGU\CJNg %#41.85 g 8 g 41/# g +/2 g 5'/ g #8) )GMTÌPVGT &QRRGNCFNGT   &CX,WPIM  8QPITQ­GT5GNVGPJGKV*ÒDUEJG2CVKPCMN4CPFHGJNGTCVVTCMVKXGUUGJTUEJÌPGU'ZGORNCT 


BREMEN

137

137 1,5:1



4GKEJUVCNGTOKV6KVGN4WFQNHU++I<YGK.ÌYGPJCNVGPFCUIGMTÌPVGQXCNG5VCFVYCRRGP )GMTÌPVGT&QRRGNCFNGTOKV4GKEJUCRHGNCWHFGT$TWUV&CX,WPIM  8QPITQ­GT5GNVGPJGKV#VVTCMVKXGU'ZGORNCTOKVJÒDUEJGT2CVKPCUGJTUEJÌPpXQT\ÒINKEJ



138



4GKEJUVCNGTOKV6KVGN(GTFKPCPFU++&CX,WPIM 4-N2T·IGUEJY·EJGXQT\ÒINKEJp5VGORGNINCP\

 

139



4GKEJUVCNGTOKV6KVGN(GTFKPCPFU+++&CX,WPIM 2TCEJVXQNNG2CVKPCUGJTCVVTCMVKXGUXQT\ÒINKEJGU'ZGORNCT

 

140 (doppelt)



&QRRGNVGT 4GKEJUVCNGT  ,CJTGU\CJN KO 5VGORGN CWUIG·PFGTV OKV6KVGN.GQRQNFU+I <YGK .ÌYGP JCNVGP FCU IGMTÌPVG QXCNG 5VCFVYCRRGP KO #DUEJPKVV ,CJTGU\CJN WPF 5KIPCVWT Û 6 Û + Û  

6JQOCU +UGPDGKP /ÒP\OGKUVGT KP $TGOGP  )GMTÌPVGT &QRRGNCFNGT OKV 4GKEJUCRHGN CWH   FGT$TWUV&CX,WPIMNGKEJVXCT 5GJTUGNVGPDGUQPFGTUKPFKGUGT'TJCNVWPI 2TCEJVGZGORNCTOKVJGTTNKEJGT2CVKPCXQT\ÒINKEJp5VGORGNINCP\  53


BREMEN

141



4GKEJUVCNGTMNKRRG  OKV 6KVGN -CTNU 8++  <YGK .ÌYGP JCNVGP FCU IGMTÌPVG QXCNG 5VCFVYCR   RGPKO#DUEJPKVVFKG,CJTGU\CJNKP8GT\KGTWPIFCTWPVGTFKG5KIPCVWT/( /CTVKP(KUEJGT/ÒP\OGKUVGT KP $TGOGP  )GMTÌPGT &QRRGNCFNGT OKV <GRVGT 5EJYGTV WPF 4GKEJUCRHGN KP FGP (·PIGP   &CX#PO,WPIM 8QPITÌ­VGT5GNVGPJGKV2TCEJVGZGORNCTOKVJGTTNKEJGT2CVKPC &KG'EMGPFGT-NKRRGCW­GTJCNDFGU5VGORGNUNGKEJVIGIN·VVGVXQT\ÒINKEJp5VGORGNINCP\ 

142

1,5:1

1,5:1

$4'/'070&8'4&'0*'4<1)67/706'45%*9'&'0 

-CTN:+4GKEJUVCNGT5VCFGI$TWUVDKNFTOKVWOIGNGIVGO/CPVGNFCTWPVGT FKG 5KIPCVWT ,%# ,QJCPP %JTKUVKCP #TGPUDWTI /ÒP\OGKUVGT KP 5VCFG  )GMTÌPVGU OGJT   HGNFKIGU9CRRGPXQP\YGK.ÌYGPIGJCNVGP#JNUVTÌO&CX  5GJTUGNVGPDGUQPFGTUKPFKGUGT'TJCNVWPI8QT\ÒINKEJ  &KG 5GNDUV·PFKIMGKV FGU 'T\DKUVWOU $TGOGP GPFGVG KO L·JTKIGP -TKGI  FWTEJ F·PKUEJG #FOKPKUVTCVKQP   WPF  FWTEJ UEJYGFKUEJG $GUGV\WPI &GT UEJYGFKUEJG $GUKV\ $TGOGPU UQYKG FGU $KUVWOU 8GTFGP YWTFG KO   9GUVH·NKUEJGP (TKGFGP XQP  CPGTMCPPV INGKEJ\GKVKI YWTFGP FKG DGKFGP -KTEJGPIGDKGVG KP FCU *GT\QIVWO   $TGOGP WPF 8GTFGP WOIGYCPFGNV 'TUV KO 0QTFKUEJGP -TKGI   GTQDGTVGP F·PKUEJG 6TWRRGP FKG   PÌTFNKEJGP.CPFGUVGKNGY·JTGPF*CPPQXGT8GTFGPDGUGV\VGFCU*GT\QIVWOMCWHVGWPF,CJTGUR·VGTFKG UEJYGFKUEJGP4GEJVGOKV/KNNKQP6CNGTCDHCPF

54


BRESLAU

143 (vierfach)

$+567/ 

$4'5.#7

-CTN(GTFKPCPFXQP2QNGP&KEMGTXKGTHCEJGT4GKEJUVCNGTI%#4e('4&e 2 2 e '6 e 5 e '25 e 884#6 e $TWUVDKNF HCUV X X FCTWPVGT FKG ,CJTGU\CJN  Û1/0+5   216'56#5 # &'1'56e&KGQXCNGP9CRRGPUEJKNFGXQP8CUCWPF$TGUNCWFC\YKUEJGP<GRVGTWPF -TWOOUVCDIGMTGW\VQDGPUVTCJNGPFGU)QVVGUCWIG&CX(W5  8QPITQ­GT5GNVGPJGKV(GKPG2CVKPCCVVTCMVKXGUUGJTUEJÌPGU'ZGORNCT  $GTGKVUCO&G\GODGTYWTFGFGTUGEJUL·JTKIGRQNPKUEJG2TKP\-CTN(GTFKPCPF 5QJP5KIKUOWPFU+++ \WO -QCFLWVQT FGU $KUVWOU $TGUNCW GTPCPPV &KGU IGUEJCJ XQT CNNGO FWTEJ 'KPHNW­ XQP JCDUDWTIKUEJGT 5GKVG WO GKPG   RQNPKUEJG 2CTVGKPCJOG IGIGP FKG UEJNGUKUEJGP 5V·PFG JGTDGK\WHÒJTGP FKG FGP *CDUDWTIGTP CNU QDGTUVG UEJNGUKUEJG   .GJPUJGTTP UV·PFKI 5EJYKGTKIMGKVGP DGTGKVGVGP  YWTFG FKG 0CEJHQNIGFGU9CUCRTKP\GPCNU$KUEJQHIGIGPFGP 9KFGTUVCPF FGU &QOMCRKVGNU FWTEJIGUGV\V -CTN (GTFKPCPF JKGNV UKEJ Y·JTGPF UGKPGT IGUCOVGP 4GIKGTWPIU\GKV PWT   UGNVGPKP$TGUNCWCWH/KVFGPDGKFGP9CRRGPCWHFGT4ÒEMUGKVGUQNNCWHFKGUGPXKGTHCEJGP4GKEJUVCNGTFKG&QRRGN JGTTUEJCHVFGT9CUCKP5EJYGFGPWPF2QNGPJGTXQTIGJQDGPYGTFGP

144



145

146

(TCP\.WFYKIXQP0GWDWTI4GKEJUVCNGT0GKUUG&CX(W5 4*ÒDUEJG2CVKPCCVVTCMVKXGUHCUVXQT\ÒINKEJGU'ZGORNCT

 

56#&6 

6CNGT&CX(W5 5GJTCVVTCMVKXGU'ZGORNCTOKVJÒDUEJGT2CVKPCUGJTUEJÌPpXQT\ÒINKEJ

 



4GKEJUVCNGTOKV6KVGN(GTFKPCPFU+++&CXp(W5  5GJTUGNVGPDGUQPFGTUKPFKGUGT'TJCNVWPI2TCEJVXQNNG2CVKPCXQT\ÒINKEJ

 55


DORTMUND

147

#$6'+ 

%148';

(NQTGP\ XQP FGT 8GNFG  4GKEJUVCNGT  $TCWPUEJYGKI CWH UGKPGP  )GDWTVUVCI   &CX+NKUEJ5EJYGFG#C 44#VVTCMVKXGU'ZGORNCTOKVJÒDUEJGT2CVKPCUGJTUEJÌP  6GKNGFGT+PUEJTKHVGPCWHFGT4ÒEMUGKVGGPVJCNVGPFKG,CJTGU\CJNCNU%JTQPQITCOO

148

&'765%*'414&'0 &'765%*'414&'0+0/'4)'06*'+/ 

%CTN#NGZCPFGTXQP.QVJTKPIGP-QPX6CNGT9GTVJGKO&CX2TQMKUEJ (GKPG2CVKPCJGTTNKEJGT2T·IGINCP\XQT\ÒINKEJp5VGORGNINCP\

 

149

1,5:1

1,5:1

56#&6 

56

&146/70&

4GKEJUVCNGT  OKV 6KVGN (GTFKPCPFU +  I Ù /10'6# Ù 018# Ù %+8+6#6+5 Û +/2' Ù   64'/1 Ú )GMTÌPVGT #FNGT FGP -QRH PCEJ N IGYCPFVÙ ('4&+0#0&+ Ù +/2'4#61 Ù 5'/2'4Ù #8))GMTÌPVGUWPFIGJCTPKUEJVGU*ÒHVDKNFFGU-CKUGTUTOKVFGT4GEJVGPFCU<GRVGTUEJWNVGTPFFKG .KPMGCO5EJYGTVITKHH\WFGP5GKVGPFKGIGVGKNVG,CJTGU\CJN$GTIJCWU&CX  8QPITÌ­VGT5GNVGPJGKV*ÒDUEJG2CVKPCYKP\5EJTÌVNKPIUHGJNGTCVVTCMVKXGUUGJTUEJÌPGU'ZGORNCT 


EICHSTÄTT

150



4GKEJUVCNGTOKV6KVGN(GTFKPCPFU++$GTIJCWU&CX 49KP\5EJTÌVNKPIUHGJNGTUGJTUEJÌP

 

151



#EJVGEMKIG FQRRGNVG 4GKEJUVCNGTMNKRRG  OKV 6KVGN -CTNU 8++ CWH UGKPG *WNFKIWPI  I   /10 Û *1/#) Ú %+8+6 Û + Û 64'/10 Ü Í #FNGT FGP -QRH PCEJ N IGYCPFV \W FGP 5GKVGP FKG   5KIPCVWT)Û*Û )GTJCTF*ÒNU5VGORGNUEJPGKFGTKP-ÌNP KO#DUEJPKVV&1/Û%105Û 015Û+0ÛÛÛ2#%'ÛÛ%#4Û8++Û&Ú)Û41/Û+/2Û5Û#Û$Û4Û)GJCTPKUEJVGU $TWUVDKNF T OKV .QTDGGTMTCP\ WOIGNGIVGO /CPVGN WPF FGT -GVVG FGU 1TFGPU XQO )QNFGPGP 8NKGU   $GTIJCWU#PO&CX$  8QPITÌ­VGT5GNVGPJGKV*ÒDUEJG2CVKPCCVVTCMVKXGUXQT\ÒINKEJGU'ZGORNCT 

152

'+%*5666 $+567/ 

5GFKUXCMCP\&QRRGNVGT-QPX6CNGT0ÒTPDGTII%CJP&CX<GRGTPKEM  2TCEJVGZGORNCTXQPHGKPUVGT'TJCNVWPI*GTTNKEJG2CVKPC5VGORGNINCP\

 57


FRANKFURT

153

(ª456241256'+ 

155

154

'..9#0)'0

#PVQP+IPC\XQP(WIIGT)NÌVV-QPX6CNGT-QDNGP\&CX/C[GT  5GNVGPDGUQPFGTUKPFKGUGT'TJCNVWPI*GTTNKEJG2CVKPCXQT\ÒINKEJ5VGORGNINCP\

56#&6



'/&'0



4GKEJUVCNGTOKV6KVGN.GQRQNFU+&CX-P[RJp 8QPITÌ­VGT5GNVGPJGKV.GKEJVG-QTTQUKQPUURWTGPUGJTUEJÌPpXQT\ÒINKEJ

 



5KNDGTOGFCKNNGQ, WO WPUKIPKGTVXQP*KGTQP[OWU/CIFGDWTIGTCWH,QCDU*KPVGTNKUVWPFFKG )GHCPIGPPCJOG %JTKUVK ,QCD GTUVKEJV FGP #OCUC Y·JTGPF FGT 7OCTOWPI&KG )GHCPIGPPCJOG   %JTKUVKOOI-CV\ 44)GRT·IVGU1TKIKPCN*ÒDUEJG2CVKPCXQT\ÒINKEJ 

'4<)'$+4)'

156 (doppelt)

56#&6 

(4#0-(746

&QRRGNVGT 4GKEJUVCNGT  OKV 6KVGN /CZKOKNKCPU ++  I d /10'6# g 01 g 4'+2 g   (4#0%1(14&+“ -TGW\ KP FGP 9KPMGNP LG \YGK *CNDDÌIGP OKV LG GKPGT .KNKG KP FGT /KVVG TWPFGT   5EJKNFOKVFGOIGMTÌPVGP(TCPMHWTVGT#FNGTFGP-QRHPCEJNIGYCPFV/#:+g++g41/#g+/2g 5'/2g#8)+<)GMTÌPVGT&QRRGNCFNGT&CX,W(  8QPCNNGTITÌ­VGT5GNVGPJGKVDGMCPPVGU'ZGORNCT *ÒDUEJG2CVKPCMN5EJTÌVNKPIUHGJNGTUGJTUEJÌP  'ZGORNCTFGT#WMVKQP5RKPM5QP<ÒTKEJ0TWPFFGT5NI9KNN[(WEJU

58


FRANKFURT

157



5KNDGTOGFCKNNG  XQP , .KPM *GKFGNDGTI 5VCFVCPUKEJV XQP 5CEJUGPJCWUGP XQP 9GUVGP FCTÒDGT   UEJYGDV #FNGT OKV &QPPGTMGKN KP 9QNMGP+P GKPGT OKV (TÒEJVGP XGT\KGTVGP -CTVWUEJG FGT MCKUGTNKEJG   &QRRGNCFNGTOKV5EJYGTV<GRVGTWPF4GKEJUCRHGNKPFGP(·PIGPQDGPJCNVGP\YGK'PIGNOKV2CNO\YGK IGP GKPG -TQPG ÒDGT FGP &QRRGNCFNGT WPVGP GKPG OKV 2CNO\YGKIGP XGT\KGTVG 6CHGN OKV FGT ,CJTGU\CJN   WPF FGT 5KIPCVWT  c + Û . c ,QJCPPGU .KPM 5VGORGNUEJPGKFGT KP *GKFGNDGTI    OO   I,W( 44(GKPG2CVKPCYKP\4CPFHGJNGTHCUVXQT\ÒINKEJ 

158

158 1,5:1



4GKEJUVCNGT  CWH FKG -TÌPWPI -CTNU 8+ \WO TÌOKUEJGP -CKUGT  I 38+5 *#% +/2'4++   %1410#  &+)0+14 6' ! 7OUEJTKHV GPVJ·NV FKG ,CJTGU\CJN CNU %JTQPQITCOO  )GJCTPKUEJVGU   $TWUVDKNF-CTNU8+TOKVWOIGNGIVGO/CPVGNWPFFGT-GVVGFGU1TFGPUXQO)QNFGPGP8NKGUQDGPJ·NV GKPG CWU 9QNMGP MQOOGPFG *CPF FKG -CKUGTMTQPG ÒDGT UGKP *CWRV8+8#6  %#41.85 5':685    +/2'4#614 %#'5#4  #8)85685  2+85 ('.+:  .'121.&+ /#)0+ (+.+85  '6 +25'   /#)085'.'%685'6%1410#685*+%(4#0%1(846+#&/1'08/#001Û FCTWPVGT FKG 5KIPCVWT + Û + Û ( Û ,QJCPP ,GTGOKCU (TG[VCI /ÒP\OGKUVGT KP (TCPMHWTV     &CX(ÌTUEJPGT,W( 8QPITQ­GT5GNVGPJGKV8QT\ÒINKEJ  'ZGORNCTFGT5NI4WNCPF#WMVKQP..*CODWTIGT(TCPMHWTV/CKP0TWPFFGT5NI9KNN[(WEJU

159



4GKEJUVCNGT5EJKG­RT·OKGCWUIGIGDGPY·JTGPFFGU5VÒEMUEJKG­GPUCPN·­NKEJFGU)GDWTVUVCIGUXQP .GQRQNF+&CX,W( 448QT\ÒINKEJ

 59


FRIEDBERG

160

161

161



8GTGKPUFQRRGNVCNGT Q , <YKVVGTRT·IWPI XQO 8QTFGTUGKVGPUVGORGN FGT 2T·IWPI XQP   

6JWP  -CJPV   WPF FGO 8QTFGTUGKVGPUVGORGN FGT 2T·IWPI XQP  6JWP    -CJPV /KV4CPFUEJTKHV#-5p&CX#PO-CJPV#6JWP#  8QPITÌ­VGT5GNVGPJGKV/KP4CPFHGJNGTXQT\ÒINKEJ 



8GTGKPUFQRRGNVCNGT#-5&CX-CJPV6JWP *GTTNKEJG2CVKPCXQT\ÒINKEJp5VGORGNINCP\

162

4'+%*5$74)

163

 

164

(4+'&$'4)



%QPTCF.ÌY\W5VGKPHWTV4GKEJUVCNGT(TKGFDGTIOKV6KVGN(GTFKPCPFU++&CX .GLGWPG 4*ÒDUEJG2CVKPCNGKEJVLWUVKGTVUGJTUEJÌP



*CPU 'KVGN &KGFG ++ \WO (ÒTUVGPUVGKP  4GKEJUVCNGT  %NCWUVJCN OKV 6KVGN XQP   (TCP\+&CX.GLGWPG #VVTCMVKXGU'ZGORNCTOKVJÒDUEJGT2CVKPCXQT\ÒINKEJ 



,QJCPP /CTKC 4WFQNRJ XQP 9CNFDQVV$CUUGPJGKO  -QPX6CNGT  OKV 6KVGN XQP   (TCP\++&CX-CJPV6JWP 9KP\4CPFHGJNGTOKPLWUVKGTVXQT\ÒINKEJ

60






FULDA

165

(ª456'067/ 

(ª456'0$'4)

,QUGRJ /CTKC $GPGFKEV  -QPX6CNGT  5VWVVICTV #WUDGWVG FGT )TWDG (TKGFTKEJ   %JTKUVKCPDGK5EJCRDCEJ&CX&QNNKPIGT/ÒUGNGT  40WT'ZGORNCTGIGRT·IV5GJTCVVTCMVKXGU'ZGORNCTOKVJÒDUEJGT2CVKPCXQT\ÒINKEJ  &KG5VGORGN\WFGOXQTNKGIGPFGP5VÒEMYWTFGPXQPFGOMWTRH·N\KUEJGP/GFCKNNGWT,*$QNVUEJCWUGTKP/CPPJGKO IGUEJPKVVGP &KG 7OUEJTKHV FGT 8QTFGTUGKVG +15 GRJ  / CTKC  $ GPGFKEV  (7456 <7 (7456'0$'4) . CPFITCH     + P  & GT  $ CCT  7 PF  < W  56 ÒJNKPIGP  * GTT  < W  *#75'0 + O  -+0< KIGT  6*#. IKDV FGO <GKVIGKUV   GPVURTGEJGPF UGKPG XQNNUV·PFKIG 6KVWNCVWT YKGFGT &KG YGJGPFG (CJPG CWH FGO 9GVVGTUEJCEJV FGT 4ÒEMUGKVG UQNN   PCEJFGO8QTDKNFFGU*CT\GUWPFUGKPGT$GTIVCNGTCPFGWVGPFC­FKG)TWDGKP#WUDGWVGUVGJV

166 (doppelt)

#$6'+5'+6$+567/ 

(7.&#

$CNVJCUCT XQP &GTPDCEJ  &QRRGNVG4GKEJUVCNGTMNKRRGOKV6KVGN4WFQNHU++I Û $#.6*#5#4 Û & Ù ) Ù #$$#5 Û (8.&'05 Û & Ù #8)  #4 <YGKHCEJ DGJGNOVGU XKGTHGNFKIGU   9CRRGPÚ 48&1.( Ù ++ Û 41/ Ù +/2'4# Ù #8) Ù 2 Ü ( Ù & Ú  Û )GMTÌPVGT &QRRGNCFNGT   CWHFGT$TWUV4GKEJUCRHGN&CX)GJTNKPI'TFOCPPp  8QPCNNGTITÌ­VGT5GNVGPJGKV'KP\KIGUKO*CPFGNDGHKPFNKEJGU'ZGORNCT (GKPG2CVKPCUGJTUEJÌP  'ZGORNCTFGT5NI<QDGN#WMVKQP#FQNRJ'%CJP(TCPMHWTV/CKP0T





$CNVJCUCT XQP &GTPDCEJ IGPCPPV )TCWN  KP 9KGUGPHGNF*GUUGP Ó KP (WNFC YCT $GPGFKMVKPGT FGU   -NQUVGTU (WNFC WPF (ÒTUVCDV XQP (WNFC  UQYKG  &KG XQP &GTPDCEJ IGPCPPV )TCWN GKPG   0GDGPNKPKG FGU UGKV  KO 4CWO )KG­GP*GTDQTP PCEJYGKUDCTGP 4KVVGTIGUEJNGEJVGU XQP &GTPDCEJ FCU \WO   JGUUKUEJGP 7TCFGN \·JNVG UKPFUGKV/KVVGFGU,CJTJWPFGTVU)GHQNIUNGWVGFGTVJÒTKPIKUEJJGUUKUEJGP.CPFITCHGP &GT L·JTKIG NWVJGTKUEJ IGVCWHVG $CNVJCUCT YWTFG PCEJ FGO 6QF UGKPGU 8CVGTU XQP UGKPGT /WVVGT \WT YGKVGTGP   'T\KGJWPIWPF#WUDKNFWPI\WKJTGO$TWFGTFGO#DV9KNJGNO*CTVOCPP-NCWGTXQPWPF\W9QJTCKPU5VKHVUMCRKVGN PCEJ (WNFC IGIGDGP &QTV YWTFG GT XQP UGKPGT /WVVGT IGVTGPPV UVTGPI MCVJQNKUEJ GT\QIGP &KGUGU XGTOWVNKEJ   VTCWOCVKUEJG 'TNGDPKU 6QF FGU 8CVGTU WPF 6TGPPWPI XQP UGKPGT /WVVGT  JCV UGKPG 2GTUÌPNKEJMGKV GPVUEJGKFGPF   IGRT·IV WPF YCJTUEJGKPNKEJ OKV \W UGKPGO (CPCVKUOWU DGKO 8QTIGJGP IGIGP #PFGTUIN·WDKIG WPF *GZGP   DGKIGVTCIGP0CEJFGOGTCO/·T\KP9ÒT\DWTI\WO2TKGUVGTIGYGKJVYQTFGPYCTYWTFGGTCO,CPWCT KO#NVGTXQP,CJTGPCNU0CEJHQNIGTUGKPGU1PMGNU\WO(ÒTUVCDVXQP(WNFCIGY·JNV5GKPG9CJNYWTFGXQP 2KWU8DGUV·VKIV5QHQTVDGICPPGTOKVFGT)GIGPTGHQTOCVKQPWPFIKPITKIQTQUIGIGP#PFGTUIN·WDKIGXQT#NNGFKG PKEJV \WO MCVJQNKUEJGP )NCWDGP \WTÒEMMGJTGP YQNNVGPOW­VGPFCU)GDKGVFGT4GKEJUCDVGK(WNFCXGTNCUUGP&COKV DTCEJVGGT$ÒTIGTWPF4KVVGTUEJCHVIGIGPUKEJCWHOW­VGGTKP*COOGNDWTICWH&TWEMFGT4JÌPGT4KVVGTUEJCHV FGU $KUEJQHU XQP 9ÒT\DWTI WPF FGU 5VKHVUMCRKVGNU CDFCPMGP YKFGTTKGH CDGT UQHQTV CNU GT CW­GT .CPFGU YCT 'TUV    MQPPVG GT OKV 7PVGTUVÒV\WPI FGU -CKUGTU WPF FGU 2CRUVGU YKGFGT CNU .CPFGUJGTT PCEJ (WNFC \WTÒEMMGJTGP   0CEJFGO GT UGKPG 5VGNNWPIKP(WNFCYKGFGTGTJCNVGPJCVVGHÒJTVGGTGKPGJCTVG4GMCVJQNKUKGTWPIURQNKVKMFWTEJ WPF QTFPGVG DTWVCNG *GZGPXGTHQNIWPIGP CP +P FGP FTGK ,CJTGP UGKPGT 4GIKGTWPIU\GKV  YWTFGP GVYC    CPIGDNKEJG*GZGPWPF*GZGPOGKUVGTIGHQNVGTVWPFCPUEJNKG­GPFJKPIGTKEJVGV&CU8GTOÌIGPUGKPGT1RHGT\QIGTHÒT UKEJGKP

61


FULDA

168

167

167



$GTPJCTF )WUVCX XQP $CFGP&WTNCEJ  4GKEJUVCNGT  CWH UGKPG 9CJN \WO #DV XQP   (WNFC&CX)GJTNKPI'TFOCPPp 442TCEJVGZGORNCT8QT\Ã&#x2019;INKEJp5VGORGNINCP\ 



4GKEJUVCNGTCWHUGKPG9CJN\WO#DVXQP(WNFC&CX)GJTNKPI'TFOCPPp 42TCEJVXQNNG2CVKPCXQT\Ã&#x2019;INKEJp5VGORGNINCP\

169

 

169 1,5:1



2NCEKFWU XQP &TQUVG  5EJCWVCNGT  5VGORGN XQP 2 * /Ã&#x2019;NNGT #WIUDWTI  I   &CX(QTUVGT)GJTNKPI'TFOCPPp 5GJTUGNVGPDGUQPFGTUKPFKGUGT'TJCNVWPI 5GJTCVVTCMVKXGU'ZGORNCTOKVHGKPGT2CVKPCXQT\Ã&#x2019;INKEJXQT\Ã&#x2019;INKEJp5VGORGNINCP\ 

170

 62

#FCNDGTV +++ XQP *CTUVCNN  -QPX6CNGT  (WNFC -QPVTKDWVKQP $WEJQPKC    &CX 2TCEJVGZGORNCT/KPLWUVKGTV5VGORGNINCP\




HATZFELD

171

56#&6 

173

)15.#4

4GKEJUVCNGTOKV6KVGN,QUGHU+$WEM$ÒVVPGT-NWIG#C&CX# 48QT\ÒINKEJGU'ZGORNCTOKVHGKPGT2CVKPC

$+567/ 

172

 

*#.$'456#&6

#NDTGEJV8XQP$TCPFGPDWTI6CNGT$GUUGT$T·OGT$ÒTIGT&CX  5GNVGPKPFKGUGT'TJCNVWPI2TCEJVXQNNG2CVKPCXQT\ÒINKEJ



56#&6 

4GKEJUVCNGT$GUUGT$T·OGT$ÒTIGT&CX  5GJTUGNVGPDGUQPFGTUKPFKGUGT'TJCNVWPI8QT\ÒINKEJ

174



174 1,5:1

)4#(5%*#(6 

*#6<('.&

5GDCUVKCP + XQP *CV\HGNF9KNFGPDWTI-TQVVQTH  6CNGT  IGRT·IV  WPVGT )TCH   *GTOCPP 0ÒTPDGTIOKV6KVGN4WFQNHU++I5VGORGNUEJPGKFGT%JT/QNNGT7PVGP Û5'$#56Ù#*#6<('.&6Û01Ù&Ù+9+.&'0$L%4166ÙQDGP48&1.2*Ù++Ù&Ù)Ù4Ù + Ù 5 Ù # Ù $TWUVDKNF X X KP XGT\KGTVGO /CPVGN*1015  '6  8+4685 &KG 2GTUQPKHKMCVKQPGP XQP   'JTG WPF 6CRHGTMGKV UVGJGP UKEJ IGIGPÒDGT WPF UKPF FWTEJ GKPG -GVVG OKV FGO IGMTÌPVGP *CV\HGNFGT   9CRRGPUEJKNFXGTDWPFGPWPVGP,CJTGU\CJN&CX/,8*5NI'TNCPIGT  442TCEJVGZGORNCT*GTTNKEJG2CVKPCYKP\5EJTÌVNKPIUHGJNGTXQT\ÒINKEJp5VGORGNINCP\  63


HENNEBERG

175

*'00'$'4) *'00'$'4))4#(5%*#(6 

9KNJGNO84GKEJUVCNGT5EJNGWUKPIGPOKV6KVGN-CTNU8&CX*GWUE 44#VVTCMVKXGU'ZGORNCTOKVJGTTNKEJGT2CVKPCUGJTUEJÌP 

176

1,5:1



1,5:1

5·EJUKEJGT #PVGKN ,QJCPP )GQTI + XQP 5CEJUGP  4GKEJUVCNGT  5EJNGWUKPIGP   I,1*#0Ù)'14)Ù&Ù)Ù'.'%Ù'6Ù4'.Ù&8%&KG9CRRGPFGU-WTHÒTUVGPVWOUWPF FGU *GT\QIVWOU 5CEJUGP PGDGPGKPCPFGT FCTWPVGT FGT 5EJKNF XQP %NGXG FC\YKUEJGP FKG 5KIPCVWT 5  

/ÒP\UV·VVGP\GKEJGP HÒT 5EJNGWUKPIGP  WPVGP FKG IGVGKNVG ,CJTGU\CJN    QDGP 4GKEJUCRHGN   É 5#:10+“ Ù /10'6# Ù *'00'$'4)+ Ù *GPPGDGTIGT 9CRRGP KP XGT\KGTVGT -CTVWUEJG   N5COONGTRWP\G*&CXp5EJPGG 8QPITQ­GT5GNVGPJGKVXGTOWVNKEJ7PKMWO -N5COONGTRWP\GUGJTUEJÌPGU'ZGORNCTOKV2CVKPC  'ZGORNCTFGT5COONWPI*QTPWPFFGT5COONWPI&T)-TWI#WMVKQP5EJWNVGPWPF%Q)OD*(TCPMHWTV 0T  

*GPPGDGTIYCTGKPGHT·PMKUEJG)TCHUEJCHV\YKUEJGPFGO6JÒTKPIGT9CNFWPF/CKPWPFWOHC­VG)GDKGVGFGT4JÌP FGU)TCDHGNFGUWPFFGT*C­DGTIG5KGGZKUVKGTVGXQO'PFGFGU,CJTJWPFGTVUDKU+JTGITÌ­VG#WUFGJPWPI GTUVTGEMVGUKEJKP1UV9GUV4KEJVWPIXQPFGPJGWVKIGP.CPFMTGKUGP%QDWTIWPF5QPPGPDGTIDKUPCEJ$CF5CN\WPIGP KP0QTF5ÒF4KEJVWPITGKEJVGUKGXQP+NOGPCWDKU/CKPDGTIXQTFKG6QTG5EJYGKPHWTVU  &GT-CJNCGT8GTVTCI\YKUEJGP*GPPGDGTIWPFFGP9GVVKPGTPUCJFKGªDGTPCJOG*GPPGDGTIUFWTEJ5CEJUGPDGK MKPFGTNQUGO#DNGDGPFGT*GPPGDGTIGT.KPKGXQT&KGUGT(CNNVTCVGKP&KG*GTTUEJCHV5EJOCNMCNFGPIGTKGVCDGT CPFKG.CPFITCHUEJCHV*GUUGP-CUUGN5CEJUGPMQPPVGUGKPG/CEJVPCEJ(TCPMGPCWUFGJPGPPCEJFGO#WUUVGTDGP FGT IGHÒTUVGVGP )TCHGP XQP *GPPGDGTI MCOGP  FGT JGPPGDGTIKUEJGP $GUKV\WPIGP CP FKG 'TPGUVKPGT FKG CDGT   \WP·EJUV OKV FGP ÒDTKIGP  FGT #NDGTVKPGT KP IGOGKPUCOGT8GTYCNVWPIOKV5KV\KP/GKPKPIGPDNKGDGP&CUKEJ 'TPGUVKPGTWPF#NDGTVKPGTPKEJVÒDGTFKG'TDUEJCHVGKPKIGPMQPPVGPYWTFGFKG)TCHUEJCHVCWHIGNÌUV

64


HESSEN

177

177 1,5:1

*'55'0 *'55'0-#55'..#0&)4#(5%*#(65'+6-74(ª456'067/ 

9KNJGNO +  -QPX6CNGT  YQJN UR·VGTG 2T·IWPI XQP FGP 1TKIKPCNUVGORGNP  /KV   INCVVGO4CPF#-5XCT&CXXCT-CJPVC6JWPXCT  442TCEJVXQNNG2CVKPCYKP\5EJTÌVNKPIUHGJNGTCO4CPFXQT\ÒINKEJp5VGORGNINCP\ 

178

180

179



6CNGT#-5&CX-CJPV6JWP W­GTUVUGNVGPKPFKGUGT'TJCNVWPI9KP\5EJTÌVNKPIUHGJNGTCO4CPFHCUV5VGORGNINCP\



9KNJGNO++WPF(TKGFTKEJ9KNJGNO8GTGKPUFQRRGNVCNGT#-5&CX-CJPV 6JWP 5GNVGPKPFKGUGT'TJCNVWPI/KPRQTÌUGT5EJTÌVNKPIHCUV5VGORGNINCP\

  

*'55'0&#4/56#&6.#0&)4#(5%*#(65'+6)4155*'4<1)67/ 

'TPUV.WFYKI4GKEJUVCNGT+VVGT+VVGTGT#WUDGWVGI&CX/ÒUGNGT 5EJÒV\ 5GNVGPDGUQPFGTUKPFKGUGT'TJCNVWPI*ÒDUEJG2CVKPCXQT\ÒINKEJp5VGORGNINCP\



#TVJWT5EJÒV\&KGJGUUKUEJGP/ÒP\GPFGU*CWUGU$TCDCPVUEJTGKDVJKGT\W&KG+VVGTVCNGTUKPFMGKPG#WUDGWVGOÒP\GP UKGUVCOOGPPKEJVCWUFGT#WUDGWVGFGO-WRHGTUQPFGTPCWUHTGOFGO5KNDGT5KGYWTFGPOKVFGO'TVTCIFGU -WRHGTDGTIDCWUIGRT·IVGVYC5VÒEMWPFYCTGP\WT$GINGKEJWPIFGU<GJPVGPWPF\WT$GFKGPWPIFGT-WZG XQTIGUGJGP+JT(GKPIGJCNVNKGIVOKVJÌJGTCNUDGKFGP)GRT·IGPPCEJFGO4GKEJUVCNGTHW­OKVUQFC­UKG RTCMVKUEJPKEJVKPFGP8GTMGJTMCOGPYQHÒTUKGLCCWEJPKEJVXQTIGUGJGPYCTGPFGTITÌ­VG6GKNYWTFGYQJNYKGFGT GKPIGUEJOQN\GP

65


HOHENLOHE

181

182

182



.WFYKI+++8GTGKPUFQRRGNVCNGT#-5&CX-CJPV6JWP 42TCEJVXQNNG2CVKPCXQT\ÒINKEJp5VGORGNINCP\



5KNDGTOGFCKNNG  XQP % 5EJPKV\URCJP CWH FKG 5KNDGTJQEJ\GKV OKV /CVJKNFG -CTQNKPG XQP $C[GTP   $GKFGT $ÒUVGP PGDGPGKPCPFGT T$TGPPGPFGT #NVCT T GKP IGHÒIGNVGT )GPWKU KP FGT CWUIGUVTGEMVGP   4GEJVGP -TCP\ KP FGT .KPMGP (CEMGN N YGKDNKEJG )GUVCNV FKG OKV GKPGO 5VKHV CWH GKPG 6CHGN \GKIV   FCTWPVGT#OQTWPF.ÌYGOOI5EJÒV\  2TCEJVGZGORNCTXQPRQNKGTVGP5VGORGNP5VGORGNINCP\ 

183

184

 

185

*1*'0.1*' *1*'0.1*'0'7'056'+0¤*4+0)'0)4#(5%*#(65'+6(ª456'067/ 

,QJCPP (TKGFTKEJ FGT NVGTG  4GKEJUVCNGT  #WIUDWTI #NDTGEJV  &CX    (QTUVGT #VVTCMVKXGU'ZGORNCTOKVHGKPGT2CVKPCHCUVXQT\ÒINKEJ 



.WFYKI(TKGFTKEJ-CTN-QPX6CNGT0ÒTPDGTI#NDTGEJV&CX  0WT'ZGORNCTGIGRT·IVªDNKEJGTWPDGFGWVGPFGT5VGORGNTK­XQT\ÒINKEJp5VGORGNINCP\



.WFYKI  4GKEJUVCNGT  0ÒTPDGTI CWH FGP  ,CJTGUVCI FGT .CPFGUVGKNWPI #NDTGEJV   &CX -CDKPGVVUVÒEM2TCEJVXQNNG2CVKPCXQT\ÒINKEJp5VGORGNINCP\ 



*1*'0.1*'.#0)'0$74))4#(5%*#(65'+6(ª456'067/

66


HOHNSTEIN

186

187

188

*1*'0<1..'40 *1*'0<1..'40*'%*+0)'0(ª456'067/ 

(TKGFTKEJ 9KNJGNO %QPUVCPVKP  8GTGKPUFQRRGNVCNGT  #-5  &CX  -CJPV    6JWP 40WT'ZGORNCTGIGRT·IV(CUVXQT\ÒINKEJ 



%CTN8GTGKPUFQRRGNVCNGT#-5&CX-CJPV6JWP



8GTGKPUFQRRGNVCNGT1JPG5VGTPPCEJ%108'06+10KPFGT4CPFUEJTKHV#-5&CX-CJPV 6JWP 40WT'ZGORNCTGIGRT·IV#VVTCMVKXGUXQT\ÒINKEJGU'ZGORNCT

*1*'0<1..'405+)/#4+0)'0(ª456'067/

189



1,5:1

5GJTUEJÌP

 

189

%CTN#PVQP)WNFGPQ,<YKVVGTRT·IWPIXQO8QTFGTUGKVGPUVGORGNFGT2T·IWPIXQP%CTN  #-5  ,  C  WPF FGO 8QTFGTUGKVGPUVGORGN FGT 2T·IWPI XQP %CTN #PVQP   

#-5, /KVINCVVGO4CPFI#-5p,5+5VWV\OCPPD8#4D  8QPITQ­GT5GNVGPJGKV8QT\ÒINKEJ 

190

)4#(5%*#(6 

*1*056'+0

8QNMOCT9QNHICPI4GKEJUVCNGT'NNTKEJ#WUDGWVGFGT)TWDG5V#PFTGCU&CX /ÒUGNGT5EJWNVGPC 5GNVGPKPFKGUGT'TJCNVWPI8QT\ÒINKEJGU'ZGORNCTOKVHGKPGT6ÌPWPI

 67


KAUFBEUREN

192

191

*'445%*#(6 

,'8'4

(TKGFGTKMG #WIWUVG 5QRJKG XQP #PJCNV<GTDUV  4GKEJUVCNGT RTGW­  5KNDGTJÒVVG   &CX/CPP/GT\FQTH 0WT'ZGORNCTGIGRT·IV 7PIGYÌJPNKEJUEJCTHCWUIGRT·IVGU'ZGORNCTYKP\5EJTÌVNKPIUHGJNGTXQT\ÒINKEJ  'TUVYWTFGCWHFGT5KNDGTJÒVVGDGK*CT\IGTQFGHÒT#PJCNV$GTPDWTIGKPG/ÒP\UV·VVGGTTKEJVGV*KGTNKG­(TKGFG TKMG#WIWUVG5QRJKGXQP#PJCNV<GTDUV#FOKPKUVTCVQTKPHÒT<CT2CWN+XQP4W­NCPFFKG/ÒP\GPHÒT,GXGTRT·IGP FCKP<GTDUVMGKPG/ÒP\UV·VVGOGJT\WT8GTHÒIWPIUVCPF

,ª.+%*-.'8'$'4) $'4)*'4<1)67/5'+6)4155*'4<1)67/ 

/CZKOKNKCP ,QUGRJ XQP $C[GTP  6CNGT  .CPFOÒP\G #-5  &CX  -CJPV    6JWP #VVTCMVKXGUÒDGTFWTEJUEJPKVVNKEJGTJCNVGPGU'ZGORNCTHCUVXQT\ÒINKEJ



193



56#&6

6CNGTOKV6KVGN-CTNU8&CX0CW

194



68

-#7($'74'0 5GNVGPKPFKGUGT'TJCNVWPI8QT\ÒINKEJ

1,5:1



194

6CNGT  OKV 6KVGN -CTNU 8  I <YGKHGNFKIGU 9CRRGP WOJGT \YGK\GKNKIG 7OUEJTKHV  

/ÒP\\GKEJGPFGU*CPU#RHGNHGNFGT 58$Û8/$4#Û#.#48/Û68#4Ù#$5%1Ù/' Û  Û /1 Ù 01 Ù %+8+6#6+5 Û -#8($'+4'05+5 Û )GMTÌPVGU WPF IGJCTPKUEJVGU *ÒHVDKNF FGU   -CKUGTU T OKV FGT 4GEJVGP FCU <GRVGT UEJWNVGTPF FKG .KPMG CO 5EJYGTVITKHH WOJGT \YGK\GKNKIG   7OUEJTKHVf4'&&+6'Û38Û58Û%“5#4+5Û%“Û'6Û3Û&'Û&'1%#41.85Û8Û41Û +/2Û5'Û.&CX0CW 8QPITQ­GT5GNVGPJGKV#VVTCMVKXGUUGJTUEJÌPGU'ZGORNCT 


KÖLN

196

195

56#&6

195

-'/26'0



6CNGTOKV6KVGN-CTNU8&CX*CGTVNGXCT 5GJTUGNVGPKPFKGUGT'TJCNVWPI9KP\2T·IGUEJY·EJGXQT\ÒINKEJp5VGORGNINCP\

 



4GKEJUVCNGTOKV6KVGN(GTFKPCPFU++I)GMTÌPVGT9CRRGPUEJKNFFCTKP&QRRGNCFNGTWOJGT FKG 5EJKNFG XQP $WTIWPF ¤UVGTTGKEJ WPF 6KTQN FC\YKUEJGP XKGT (GWGTGKUGP)GJCTPKUEJVGU *ÒHVDKNF   (GTFKPCPFU++JCNDTOKV.QTDGGTMTCP\WPFITQ­GT*CNUMTCWUGOKVFGT4GEJVGPFCU<GRVGTUEJWNVGTPF KPFGT.KPMGP4GKEJUCRHGN&CX*CGTVNG  5GJTUGNVGPDGUQPFGTUKPFKGUGT'TJCNVWPI2TCEJVXQNNG2CVKPCXQT\ÒINKEJGU'ZGORNCT 

197

'4<$+567/ 

-¤.0

-NGOGPU #WIWUV XQP $C[GTP  #WUDGWVGVCNGT  %JTQPQITCOO  $QPP QFGT -QDNGP\   $GTIVCNGTIGRT·IVCWUYGUVH·NKUEJGO(GKPUKNDGTCWHFKG'TPGWGTWPIFGT$GTIYGTMGWPFFKG9KGFGTCWH PCJOGFGU4COUDGEMGT$GTIDCWUIÛ%.G/GPU#8I8UV8U$C8CT+ºGVÛ$TWUVDKNFTOKVWOIG NGIVGO/CPVGNWPF\YGK1TFGPUMTGW\GPFCTWPVGTFKG5KIPCVWT')Û(Û ')GTXCKU5VGORGNUEJPGKFGT KP -QDNGP\  9GUVRJC.+º &8: +8TG +PUVC 8TCDCV <YGK *ÒIGN OKV LG GKPGO 5VQNNGPOWPF   NQEJÒDGTFGONKPMGP*ÒIGN)GYKVVGTYQNMGPOKV\YGK$NKV\GPWPFGKPGOCWHIGUEJNCIGPGP$WEJOKVFGP $WEJUVCDGP$1CWHFGOTGEJVGP*ÒIGNUVTCJNGPFG5QPPGÒDGT(ÌTFGTJCURGNOKV-TWIFCTÒDGTCWHIG UEJNCIGPGU $WEJ OKV FGT 5EJTKHV $'4)  14&0 FCJKPVGT 5EJYGTV WPF 2CNO\YGKI IGMTGW\V FCTÒDGT   -TQPG\WFGP5GKVGPLGFTGK/GVCNN\GKEJGPXQTFGO5VQNNGPOWPFNQEJGKP-CTTGPN·WHGTKO8QTFGTITWPF NXKGT2GTUQPGPOKVGTJQDGPGP#TOGPKPFGT/KVVGXKGTUR·PPKIGT'T\MCTTGPUQYKGGKP-CTTGPN·WHGTT \YGK -PCRRGP DGKO 'T\MNCWDGP CP FGT 5EJGKFGDCPM KO #DUEJPKVV #4)'06 Û 274 Û ' Û (1&    9'562Û&CX/ÒUGNGT0QUUC  8QPITQ­GT5GNVGPJGKV(GKPG2CVKPCCVVTCMVKXGUXQT\ÒINKEJGU'ZGORNCT  6TCFKVKQPGNN UQNN FGT 'TNC­ GKPGT PGWGP $GTIQTFPWPI FGT #PNC­ FKGUGT 2T·IWPI UGKP  FKG #WHUEJTKHV CWH FGT 6CHGN   ÒDGTFGOTGEJVGP$GTIMÌPPVGFKGUPCJGNGIGP'UKUVCDGTMGKPGPGWG$GTIQTFPWPIGTNCUUGPYQTFGPUQPFGTPGUICNV FKG CNVG XQP  DKU  YGKVGT 4KEJVKIGT KUV YQJN FC­ %NGOGPU #WIWUV HÒT GKPGP GTPGWGTVGP $GVTKGD FGT   $GTIYGTMGUQTIVG5QGTUEJGKPVNKPMUGKP\GTUVÌTVGU$GTIYGTMXQPFGOFKG$GTINGWVGHNÒEJVGPY·JTGPFTGEJVUGKP DNÒJGPFGU $GTIYGTM FCTIGUVGNNV KUV XQP FGO FCU 'T\ CDIGHCJTGP YKTF 'U YCTGP \YGK )TWDGP  $CUVGPDGTI WPF   &ÌTGPDGTI\WFKGUGT<GKVKP$NÒVG

69


KONSTANZ

198

56#&6 

6CNGTQ, WO &TGKMÌPKIUVCNGTI&KG*GKNKIGP&TGK-ÌPKIGUVGJGPPGDGPGKPCPFGTXX KP KJTGP *·PFGP LG GKP .KNKGPUVCD WPF GKP )GUEJGPM KO 8QTFGTITWPF FCU -ÌNPGT 5VCFVYCRRGP   #EJV2GTUQPGPUVGJGPXXKPGKPGO5EJKHHCWHDGYGIVGP9GNNGP&CXp0QUUC  44*GTTNKEJG2CVKPCUGJTUEJÌPpXQT\ÒINKEJ 

#WHFGT4ÒEMUGKVGFGUXQTNKGIGPFGP5VÒEMGUUVGJVKPFGT/KVVGFKGJGKNKIG7TUWNCOKVIGHCNVGVGP*·PFGPKPFGT$TWUV UVGEMV GKP 2HGKN CPKJTGTNKPMGP5GKVGKUV2TKP\VJGTKWUGKPG-NCRROÒV\GCWHFGO-QRHFKG*·PFGCWHFGT$TWUV ÒDGT GKPGO 2CNO\YGKI IGMTGW\V &KG 2GTUQP\WT4GEJVGP7TUWNCUVT·IVFKGR·RUVNKEJGFTGKHCEJG-TQPGWPFJ·NVKP FGTNKPMGP*CPFGKPGP&QRRGNMTGW\UVCD&GT.GIGPFGPCEJUQNNFKGUFGTJGKNKIG%[TKCMWUUGKPFKG)GUEJKEJVGYGK­ PKEJVU XQP GKPGO UQNEJGP 2CRUV #P FGP 'EMGP DGHKPFGV UKEJ LG GKPG ,WPIHTCW CWU FGO )GHQNIG KP FGP   <YKUEJGPT·WOGPUKPFPQEJFTGK-ÌRHGUKEJVDCT

199

(ª456'067/ 

-¤0+)5'))416*'0('.5

(TCP\ *WIQ  WPF UGKPG $TÒFGT 4GKEJUVCNGT  9KGP CWH FKG DTÒFGTNKEJG 'KPVTCEJV    I &KG $TWUVDKNFGT FGT XKGT $TÒFGT GKPCPFGT IGIGPÒDGT9CRRGP WPF  <GKNGP 5EJTKHV   /KV4CPFUEJTKHV $NWOGPQTPCOGPV 8+)14'Û%“5Û24+8+.Û $NWOGPQTPCOGPV &'Û:8Û1%6Û /Û&Û%Û.Û::8Û$KPFGT&CX  -CDKPGVVUVÒEM2TCEJVXQNNG2CVKPC'TUVCDUEJNCIHCUV5VGORGNINCP\5VGORGNINCP\  &KG4CPFUEJTKHVFGUXQTNKGIGPFGP6CNGTUPKOOV$G\WICWHFCUXQP-CKUGT.GQRQNF+CO1MVQDGTGTVGKNVG /ÒP\RTKXKNGIKWO

200 (doppelt)

56#&6 

-1056#0<

&QRRGNVCNGT&QRRGNVGT4GIKOGPVUVCNGTI&CX0CW 449KP\5EJTÌVNKPIUHGJNGTUGJTUEJÌP

4GIKOGPVUVCNGT UKPF 5EJCWVCNGT XQP UEJY·DKUEJGP5V·FVGPFKGPKEJVKOOGTKO4GKEJUVCNGTIGYKEJVIGRT·IVYWTFGP +JTG8QTFGTUGKVG\GKIVFKG5VCFVCPUKEJVWPFFKG4ÒEMUGKVGFCU5VCFVTGIKOGPVFCUFKG4GIKGTWPIUIGYCNVKPFGT5VCFV JCVVG

70

 


LIPPE

202

201

56#&6 

.#0&#7

$GNCIGTWPI FWTEJ FKG HTCP\ÌUKUEJGP 6TWRRGP 'KPUGKVKIG -NKRRG \W  )WNFGP WPF  -TGW\GT    I$TCWUG/CPUHGNF6HXCT&CX-NGKP4CHH 5GJTUEJÌPpXQT\ÒINKEJ  9·JTGPF FGT XKGTVGP $GNCIGTWPI .CPFCWU YCT 2TKP\ -CTN #NGZCPFGT FGT UR·VGTG *GT\QI XQP 9ÒTVVGODGTI   (GUVWPIUMQOOCPFCPV 7O FGO Y·JTGPF FGT $GNCIGTWPI CWHIGVTGVGPGP )GNFOCPIGN \W DGIGIPGP NKG­ -CTN   #NGZCPFGTUGKPIQNFGPGUWPFUKNDGTPGU6CHGNIGUEJKTTGKPUEJOGN\GPWPFFCTCWU0QVOÒP\GPUEJNCIGP

.'+0+0)'0 .'+0+0)'0&#)5$74))4#(5%*#(6 

,QJCPP .WFYKI  4GKEJUVCNGT  *GKFGUJGKO !  OKV 6KVGN (GTFKPCPFU ++ &CX    ,QUGRJ 44-N<CKPGPFGMN5EJTÌVNKPIUHGJNGTUGJTUEJÌP 

203

.#0&)4#(5%*#(6 

204

205

.'7%*6'0$'4)

)GQTI+++6CNGT2HTGKOFOKV6KVGN-CTNU8/KVCWUIGUEJTKGDGPGT,CJTGU\CJNKPFGT 4ÒEMUGKVGPWOUEJTKHV&CX(TKGFNND #VVTCMVKXGUHCUVXQT\ÒINKEJGU'ZGORNCT



.+22' )4#(5%*#(65'+6(ª456'067/ 

5KOQP#WIWUV-QPX6CNGT&GVOQNFCWHUGKPGP)GDWTVUVCICO,WPK&CX )TQVG 4(GKPG2CVKPC,WUVKGTURWTGPKO4CPFDGTGKEJXQT\ÒINKEJ



&CUXQTNKGIGPFG5VÒEMKUVFGTGKP\KIGLGOCNUPCEJFGO-QPXGPVKQPUHW­CWUIGDTCEJVGNKRRKUEJG6CNGT'TGPVURTKEJV CNNGTFKPIUPKEJVICP\FGP8QTUEJTKHVGPFCFKG9GTVCPICDGHGJNV



2CWN#NGZCPFGT.GQRQNF8GTGKPUFQRRGNVCNGT#-5&CX-CJPV6JWP  (CUVXQT\ÒINKEJXQT\ÒINKEJ

 71


LÜBECK

206

.¤9'056'+0 .¤9'056'+09'46*'+/8+40'$74)(ª456'067/ 

'WEJCTKWU-CUKOKT4GKEJUVCNGT9GTVJGKO&CX9KDGN 442TCEJVXQNNG2CVKPCXQT\ÒINKEJp5VGORGNINCP\

#WHFKGXKGNHCEJCNU8GTUÌJPWPIUQFGT8GTGKPKIWPIUVCNGTDG\GKEJPGVGP)GRT·IGVTKHHVFKGUG$G\GKEJPWPIÒDGTJCWRV PKEJV \W 'U UKPF 2T·IWPIGP KO <WUCOOGPJCPI OKV FGP#WUGKPCPFGTUGV\WPIGP\YKUEJGPFGPDGKFGP.ÌYGPUVGKPGT .KPKGP8KTPGDWTIFKGWPUGTGP6CNGTRT·IGPNKG­WPF4QEJGHQTV#WHUEJTKHVWPF&CTUVGNNWPIYGKUGPCWHFKGUGP-QP VGZVJKP/'%10+70%6+15'48#6 FGT<WUCOOGPJCNVFKGPVOKT KO)GIGPUCV\FC\W&7/5%+0&+674 (4#0)14 FWTEJFCU#WUGKPCPFGTTGK­GPYGTFGKEJ\GTDTQEJGP &GTFWTEJ8GTUV·TMWPIWPF-TQPG\WUCOOGP IGJCNVGPG $CWO D\Y FGT XQP *·PFGP 9KNNMÒT  CWUGKPCPFGTIGTKUUGPG $CWO KP FGT 8QTFGTUGKVGPFCTUVGNNWPI FKGUGU   5VÒEMGU\GKIGPFKG(QNIGPXQP'KPKIMGKVD\Y<YKGVTCEJV  9·JTGPF FGU L·JTKIGP -TKGIGU YCTFKGLÒPIGTG.KPKG4QEJGHQTVYKGFGTMCVJQNKUEJIGYQTFGPY·JTGPFFKG·NVGTG .KPKG8KTPGDWTIGXCPIGNKUEJDNKGD+O8GTNCWHFGU-TKGIGUMQPPVGUKEJFKG.KPKG4QEJGHQTVKPFGP$GUKV\FGTICP\GP *GTTUEJCHV DTKPIGP +O 9GUVH·NKUEJGP (TKGFGP GTJKGNV FKG ·NVGTG 8KTPGDWTIGT .KPKG KJTG $GUKV\WPIGP \WTÒEM   0WP YWTFGP CO 4GKEJUMCOOGTIGTKEJV KP 9GV\NCT WPF CO 4GKEJUJQHTCV KP 9KGP \CJNNQUG 'KPICDGP IGOCEJV UQYKG   OGJTGTG MCKUGTNKEJG -QOOKUUKQPGP DGOÒJV &KG MCVJQNKUEJG .KPKG 4QEJGHQTV YQNNVG FCU -QPFQOKPKWO ÒDGT   9GTVJGKOCPFGOFKG4GKEJUVCPFUEJCHVJKPIDGGPFGPWPFFKG)TCHUEJCHVVGKNGP&KGGXCPIGNKUEJG.KPKG8KTPGDWTI YCT JKPIGIGP DGUVTGDV FKG $GUVKOOWPIGP FGU 9GUVH·NKUEJGP (TKGFGPU DGK\WDGJCNVGP &QTV YCT DGUVKOOV YQTFGP   FC­ FKG )TCHUEJCHV WPIGVGKNV DNGKDV WPF FCU ,CJT  CNU 5VKEJLCJT HÒT 4GNKIKQPUCPIGNGIGPJGKVGP IKNV YCU FGP   8KTPGDWTIGTP KJTGP $GUKV\UVCPF UKEJGTVG +O ,CJT  CNU WPUGT 6CNGT IGRT·IV YWTFG NKGH FGT 2TQ\G­ PQEJ  

UKGJGCWEJ-ÌNPGT/ÒP\DGNWUVKIWPI85HH 

 

207



,QJCPP.WFYKI8QNTCF-QPX6CNGT9GTVJGKO&CX9KDGN  5GJTUGNVGPKPFKGUGT'TJCNVWPI*GTTNKEJG2CVKPCXQT\ÒINKEJp5VGORGNINCP\



208

56#&6  72

.ª$'%-

$TGKVGT6CNGTQ,  OKVFGO#D\GKEJGPFGU$ÒTIGTOGKUVGTU)QVVJCTFXQP*ÌXGNPI $GJTGPUD&CX 42TCEJVXQNNG2CVKPCXQT\ÒINKEJGU'ZGORNCT




MAINZ

210



209

211 (doppelt)

4GKEJUVCNGTOKV6KVGN-CTNU8+$GJTGPU&CX,  442TCEJVGZGORNCTOKVHGKPGT6ÌPWPI(CUV5VGORGNINCP\

56#&6



.ª0'$74)



$TGKVGT4GKEJUVCNGTQ, WO I/KV/ÒP\OGKUVGT\GKEJGP<CKPJCMGPCWH-TGW\ *GPPKPI *CPUGP /ÒP\OGKUVGT KP .ÒPGDWTI   $CJTH p \W  FQTV CNU FQRRGNVGT 5EJCWVCNGT    &CX5EJPGG  5GJTUGNVGPKPFKGUGT'TJCNVWPI5GJTCVVTCMVKXGU'ZGORNCTOKVJGTTNKEJGT2CVKPCXQT\ÒINKEJ 



&QRRGNVGT 4GKEJUVCNGT Q , WO    I /KV /ÒP\OGKUVGT\GKEJGP  <CKPJCMGP CWH -TGW\  

*GPPKPI*CPUGP/ÒP\OGKUVGTKP.ÒPGDWTI $CJTHC&CX5EJPGG  4(GKPG2CVKPCHCUVXQT\ÒINKEJ 

212

'4<$+567/ 

/#+0<

#PUGNO(TCP\XQP+PIGNJGKO4GKEJUVCNGTQ,  /CKP\CWHFGP(TKGFGPXQP0KLOGIGP &CX2CZKP0WOOKU5NI9CNVJGT  5GJTUGNVGPDGUQPFGTUKPFKGUGT'TJCNVWPI#WUFTWEMUXQNNG2CVKPCXQT\ÒINKEJ



#PUGNO(TCP\YWTFGCO#RTKN\WO$KUEJQHMQPUGFKGTV5GKPXQTTCPIKIGURQNKVKUEJGU<KGNYCTFKG'KPF·O OWPI FGU *GIGOQPKCNUVTGDGPU .WFYKI :+8 XQP (TCPMTGKEJ #NU FGUUGP 6TWRRGP VTQV\ FGT FWTEJ #PUGNO   DGVTKGDGPGP2QNKVKMFGU)NGKEJIGYKEJVUCWH/CKP\OCTUEJKGTVGPÒDGTNKG­GTKJPGPMCORHNQUFKGDGHGUVKIVG5VCFV WPF HNÒEJVGVG PCEJ 'THWTV #NU /CKP\ GKP ,CJT UR·VGT FWTEJ GKP  /CPP \·JNGPFGU 4GKEJUJGGT DGHTGKVYWTFG YCTFKG5VCFVFWTEJFKGUEJYGTGP$QODCTFGOGPVUITÌ­VGPVGKNUXGTYÒUVGV#PUGNO(TCP\MTÌPVGFGP4ÌOKUEJGP -ÌPKIWPFUR·VGTGP-CKUGT,QUGRJ+WPFYKTMVGCPFGTGTTKEJVGVGP-WTYÒTFGHÒT*CPPQXGTOKV

73


MAINZ

213 (doppelt)



&QRRGNVGT 4GKEJUVCNGT  /CKP\  I $TWUVDKNF T KP IGKUVNKEJGO 1TPCV FCTWPVGT #TCDGUMGP   &TGKHCEJDGJGNOVGUXKGTHGNFKIGU9CRRGP /CKP\+PIGNJGKO ÒDGTFGP*GNOGP-WTJWVOKV4CF/KVTC OKV-TGW\WPF-NGKPQFXQP+PIGNJGKOPGDGPFGP*GNOGP5EJYGTVWPF*KTVGPUVCD&CXp XIN  2T#NGZ5NI9CNVJGT FKGUGU'ZGORNCT   445EJCTHCWUIGRT·IVGU'ZGORNCTOKVJQJGO4GNKGHXQT\ÒINKEJ  'ZGORNCTFGT5NI9CNVJGT#WMVKQP&T$WUUQ2GWU0CEJH(TCPMHWTV/CKP0T





&CUXQTNKGIGPFGDCTQEMG5EJCWUVÒEM\GKEJPGVUKEJFWTEJGKPUVCTMGTJCDGPGU2QTV·VCWU

214

1,5:1



1,5:1

,QJCPP(TKGFTKEJ-CTNXQP1UVGKP5EJCWVCNGTIó+1#0Ù(4+&Ù%#41.Ù &Ü)Ü#Ù'Ù/1)Ù5Ü4Ü+Ü2Ü)Ü#Ù%#0%Ù24Ü'$TWUVDKNFTOKVWOIGNGIVGO*GTOGNKP OCPVGNÆ &1%' /' (#%'4' 81.706#6'/ 67#/ 37+# &'75 /'75 '5 )GMTÌPVGU XKGT   HGNFKIGU9CRRGPCWH9CRRGPOCPVGNFCJKPVGT5EJYGTVWPF-TWOOUVCDIGMTGW\VWPVGP\WFGP5GKVGPFKG IGVGKNVG,CJTGU\CJN&CXp5NI9CNVJGT  8QPITÌ­VGT5GNVGPJGKV-CDKPGVVUVÒEM(GKPG2CVKPCXQT\ÒINKEJp5VGORGNINCP\ 

215



(TKGFTKEJ -CTN ,QUGRJ XQP 'TVJCN  -QPX6CNGT  /CKP\ CWH FGP 'PVUCV\ FGT XQP   FGP (TCP\QUGP DGNCIGTVGP 5VCFV FWTEJ FGP MCKUGTNKEJGP (GNFOCTUEJCNN )TCH %NGTHC[V &CX    5NI9CNVJGT 4#VVTCMVKXGU'ZGORNCTOKVJGTTNKEJGT2CVKPCXQT\ÒINKEJp5VGORGNINCP\  +PFGT·NVGTGPPWOKUOCVKUEJGP.KVGTCVWTWPFKO/ÒP\JCPFGNYKTFFGTXQTNKGIGPFG6[RWUCNU<YKVVGTRT·IWPIIGHÒJTV 'DGTJCTF .KPM KP )GNFIGUEJKEJVNKEJG 0CEJTKEJVGP  ,I    MQPPVG PCEJYGKUGP FC­ GU UKEJ UVCVV   FGUUGPWOGKPGPTGIWN·TGP/CKP\GT-QPXGPVKQPUVCNGTJCPFGNVFGTCPN·­NKEJFGT$GHTGKWPIFGT5VCFVJGTCWUIGIGDGP YWTFGOÌINKEJGTYGKUGCNU2T·OKGWPF#PFGPMGPHÒTFCUCO'PVUCV\DGVGKNKIVG/KNKV·T

74


MECKLENBURG

217

216

/#05('.&)4#(5%*#(6 

218

/#05('.&

)ÒPVJGT+8'TPUV++*Q[GT8+)GDJCTF8++WPF#NDTGEJV8++6CNGT'KUNGDGP &CX6QTPCWK 5GJTUGNVGPDGUQPFGTUKPFKGUGT'TJCNVWPI#VVTCMVKXGU'ZGORNCTHCUVXQT\ÒINKEJ

 

/#05('.&$14056'&6)4#(5%*#(6 



9QNHICPI+++WPF,QJCPP)GQTI++4GKEJUVCNGT'KUNGDGP&CX6QTPCWE 5GNVGPKPFKGUGT'TJCNVWPI *ÒDUEJG2CVKPCUEJCTHCWUIGRT·IVGUXQT\ÒINKEJGU'ZGORNCT



*GKPTKEJ(ÒTUVXQP(QPFK4GKEJUVCNGT'KUNGDGP&CX6QTPCWF 2TCEJVXQNNG2CVKPCOKPLWUVKGTVXQT\ÒINKEJp5VGORGNINCP\

 

220

219

219

/#05('.&*+06'4146+5%*'.+0+')4#(5%*#(6 

%JTKUVKCP(TKGFTKEJ4GKEJUVCNGT'KUNGDGP&CX#6QTPCWEXCT  5GNVGPKPFKGUGT'TJCNVWPI*ÒDUEJG2CVKPCUEJCTHCWUIGRT·IVGUXQT\ÒINKEJGU'ZGORNCT



/'%-.'0$74) /'%-.'0$74))ª56419*'4<1)67/ 

,QJCPP#NDTGEJV++4GKEJUVCNGT)PQKGP-WP\GN#D 44*GTTNKEJG2CVKPCYKP\5EJTÌVNKPIUHGJNGTCO4CPFHCUVXQT\ÒINKEJGU'ZGORNCT

  75


MÜNSTER

221

56#&6 

/ª*.*#75'0+06*ª4+0)'0

4GKEJUVCNGT )TQUEJGP OKV6KVGN.GQRQNFU+$GJT&CX

445GJTUEJÌP



222

$+567/ 

/ª056'4

5GFKUXCMCP\  4GKEJUVCNGT  /ÒPUVGT OKV 6KVGN .GQRQNFU + &CX  5EJWN\G  D   <GRGTPKEM *ÒDUEJG2CVKPCNGKEJVRQTÌUGT5EJTÌVNKPIUGJTUEJÌPpXQT\ÒINKEJ



223

223 1,5:1



(TKGFTKEJ %JTKUVKCP XQP 2NGVVGPDGTI  4GKEJUVCNGT  /ÒPUVGT  I $TWUVDKNF T   KPIGKUVNKEJGO1TPCVOKV%CNQVVGWPFWOIGNGIVGO-TGW\)GMTÌPVGUQXCNGU9CRRGPFCJKPVGT-TWOO UVCDWPF5EJYGTVIGMTGW\V\WFGP5GKVGPFKGIGVGKNVG5KIPCVWT+1 ,QJCPP1FGPFCJN/ÒP\OGKUVGTKP /ÒPUVGT &CX5EJWN\GC  44-CDKPGVVUVÒEM2TCEJVXQNNG2CVKPCXQT\ÒINKEJp5VGORGNINCP\  #O,WNKY·JNVGFCUOÒPUVGTUEJG&QOMCRKVGNFGPCO#WIWUVCWH5EJNQ­.GPJCWUGPCPFGT.GPPG IGDQTGPGP &QOFGEJCPVGP(TKGFTKEJ%JTKUVKCP(TGKJGTTXQP2NGVVGPDGTI.GPJCWUGP\WOPGWGP$KUEJQHWPF.CPFGU JGTTP&KGUGTVTCVUEJQPCEJV6CIGPCEJUGKPGT9CJNFKG4GIKGTWPICPPCEJFGOGTFGO&QOMCRKVGNFGUUGP4GEJV CWH GKPG 5GFKUXCMCP\ XQP OKPFGUVGPU GKPGO ,CJT WPF UGEJU 9QEJGP HÒT  6CNGT CDIGMCWHV JCVVG (TKGFTKEJ   %JTKUVKCP KUV DKU JGWVG CNU (TKGFGPUHÒTUV DGMCPPV IGDNKGDGP <YCT YCT GT OKV UGKPGP 6TWRRGP  CP FGO   4GKEJUMTKGIIGIGP(TCPMTGKEJUQYKGCO6ÒTMGPMTKGIKP7PICTPDGVGKNKIVCPUQPUVGPIGNCPIGUKJOCDGTGKPGYGKVGTG $GJGNNKIWPIFGU(ÒTUVDKUVWOUFWTEJMTKGIGTKUEJG#WUGKPCPFGTUGV\WPIGP\WXGTOGKFGP)TQ­G8GTFKGPUVGGTYCTDGT UKEJ CWEJ CWH KPPGPRQNKVKUEJGO )GDKGV 'T QTFPGVG FKG (KPCP\GP FGU .CPFGU WPF TGQTICPKUKGTVG FKG IGKUVNKEJG WPF   YGNVNKEJG8GTYCNVWPI¤HHGPVNKEJG$CWOC­PCJOGPYKGFGT#WUDCWXQP9GIGP5VTC­GPWPF$TÒEMGP\WT8GTDGUUGTWPI FGU 2QUVYGUGPU FKG 'TYGKVGTWPI FGT 5EJKHHCJTVUXGTDKPFWPIGP UQYKG FKG 'TTKEJVWPI XQP 4GRT·UGPVCVKQPUDCWVGP  

\$5EJNQ­0QTFMKTEJGP UQTIVGPHÒTGKPGPDGUEJGKFGPGPYKTVUEJCHVNKEJGP9QJNUVCPFKO.CPFG

76


NASSAU

224

224 1,5:1



5GFKUXCMCP\4GKEJUVCNGT#WIUDWTI&CX5EJWN\G<GRGTPKEM  -CDKPGVVUVÒEM(GKPG2CVKPC5VGORGNINCP\

226

225

0#55#7*'4<1)67/  



0#55#7

(TKGFTKEJ9KNJGNO\W9GKNDWTI-QPX6CNGT#-5,-CJPV6JWP 4.GKEJVLWUVKGTVXQT\ÒINKEJ  -QPX6CNGT#-5&CX-CJPV6JWP  /KPLWUVKGTVXQT\ÒINKEJXQT\ÒINKEJp5VGORGNINCP\ 

227

1,5:1



1,5:1

-QPX6CNGT  CWH FGP /ÒP\DGUWEJ KP 'JTGPDTGKVUVGKP <YKVVGTRT·IWPI XQO 8QTFGTUGKVGPUVGORGN   FGT2T·IWPIFGT.KPKG7UKPIGP(TKGFTKEJ#WIWUV 6JWP WPFFGO8QTFGTUGKVGPUVGORGN FGT 2T·IWPI FGT .KPKG 9GKNDWTI (TKGFTKEJ 9KNJGNO  6JWP   /KV INCVVGO 4CPF   I#-5p&CXp+UGPDGEMD-CJPV5VWV\OCPP6JWP FQTVHCNUEJG#DDKNFWPI   8QPITÌ­VGT5GNVGPJGKV'TUVCDUEJNCIHCUV5VGORGNINCP\  77


NEUENAHR

228

)4#(5%*#(6 

0'7'0#*4

#FQNRJHCEJG4GKEJUVCNGTMNKRRG9GTNI/ÒP\OGKUVGT)KNNGUXQP5KDWTI r/1g01g#&1.2*g%1g#g08'0#4g'6g.+/2)GJCTPKUEJVGU*ÒHVDKNFNKPFGT4GEJ VGP -QOOCPFQUVCD&'1 Ú '6 Û 24+0  %+2+ Û 5'4 Û (+& &TGKHCEJ DGJGNOVGU XKGTHGNFKIGU 9CRRGP   XQP0GWGPCJT.KODWTIOKV/KVVGNUEJKNFXQP*GRRGPFQTHQDGPFKGCDIGMÒT\VGWPFIGVGKNVG,CJTGU\CJNg &CXp0QUUp5NI2KGRGTp5NI8KGNJCDGT /QGTUKP0WOOKU p5NI9G[ICPFp  7PGFKGTVGU7PKMWOXQPHGKPGT'TJCNVWPIWPFITÌ­VGOJKUVQTKUEJGP+PVGTGUUG 2TCEJVXQNNG2CVKPCUGJTCVVTCMVKXGUXQT\ÒINKEJGU'ZGORNCT  'ZGORNCTFGT#WMVKQP/ÒP\GPWPF/GFCKNNGP#)$CUGN0T





$GTPJCTF 5EJWNVG DGOGTMVG KO #WMVKQPUMCVCNQI XQP  \WO JKUVQTKUEJGP *KPVGTITWPF FKGUGU -CDKPGVVUVÒEMU   #NU FGT -ÌNPGT 'T\DKUEJQH )GDJCTF 6TWEJUG­ XQP 9CNFDWTI CO  &G\GODGT  \WO TGHQTOKGTVGP )NCWDGP   ÒDGTVTCV WPF CO  (GDTWCT  FKG )T·HKP #IPGU XQP /CPUHGNF JGKTCVGVG MCO GU \W MTKGIGTKUEJGP 7PTWJGP KO   5VKHV WPF KO *GT\QIVWO 9GUVHCNGP OKV FGO PGW IGY·JNVGP 'T\DKUEJQH *GT\QI 'TPUV XQP $C[GTP #WH FGT 5GKVG   )GDJCTFU JCVVG UGKP GDGPHCNNU RTQVGUVCPVKUEJGT (TGWPF )TCH #FQNRJ XQP0GWGPCJTFCUOKNKV·TKUEJG-QOOCPFQ+O /CK  \QI GT KP FCU5EJNQ­9GTN#O#WIWUVFGUUGNDGP,CJTGUYWTFGPUGKPG/KVVGNMPCRRWPFGTDGHCJN CNNGU -KTEJGPUKNDGT WPF )QNF FGO 4KEJVGT 'DGTJCTF XQP FGT 4GEMG KP 9GTN CWU\WJ·PFKIGP YGNEJGU FCPP VTQV\   IGIGPVGKNKIGP8GTURTGEJGPU\GTUEJNCIGPWPFXGTOÒP\VYWTFG8QPFKGUGT9GTNGT2T·IWPI)GDJCTFUCWUFGO,CJTG IKDVGUGKPIGPCWGU)GIGPUVÒEM\WWPUGTGT-NKRRGFCUKPFGT#WMVKQP#'%CJP0TXQTMCO 0QUUPQEJPKEJVDGMCPPVYCTWPFXQP-TWU[ÒDGTUGJGPYQTFGPKUV&CPWPDGKFG5VÒEMGPKEJVPWTUVKNKUVKUEJXÌNNKI GKPJGKVNKEJ UKPF UQPFGTP CWEJ OKV FGPUGNDGP 2WP\GP IGCTDGKVGV UKPF MCPP MGKP <YGKHGN DGUVGJGP FC­ FKGUGU   JQEJDGFGWVGPFG 5VÒEM KO ,CJT  CWH $GVTGKDGP )GDJCTFU XQP /CPUHGNF CWU 9GTNGT -KTEJGPUKNDGT KP 9GTN HÒT   UGKPGP(TGWPFWPF(GNFJGTTP#FQNRJXQP0GWGPCJT\W2TQRCICPFC\YGEMGPIGRT·IVYWTFG#PFGTG2T·IWPIGPFKGUGU )TCHGP UKPF PKEJV DGMCPPV YKG CWEJ MGKP PQTOCNGT TWPFGT 6CNGT FKGUGU 6[RU 6JGQTGVKUEJ Y·TGP CDGT UQNEJG   FGPMDCT FGPP #FQNRJ YCT XGTJGKTCVGV OKV 9CNDWTIKU FGT 'TDKP WPF 5EJYGUVGT FGU NGV\VGP )TCHGP XQP /ÌTU   *GTOCPP  <WFGP9GTNGT2T·IWPIGP)GDJCTFUXQP/CPUHGNFWPFFGPQDGPKPCNNGT-ÒT\GIGUEJKNFGTVGP'TGKIPKUUGPXIN0QUU $F+++5HH0QUU,ÒNKEJ/ÌTUWPF#NRGP5HWPF-TWU[&KG/ÒP\GPXQP9GTN5HH

229

56#&6  78

0ª40$'4)

)WNFGPVCNGT -TGW\GT OKV6KVGN4WFQNHU++&CX-GNNPGT

5GJTUEJÌP




ÖTTINGEN

232

231

230



-QPX6CNGT  OKV 6KVGN ,QUGHU ++ 1JPG 5KIPCVWT 1':.'+0 CO #TOCDUEJPKVV &CX    -GNNPGTXCT -CDKPGVVUVÒEM(GKPG2CVKPC'TUVCDUEJNCIHCUV5VGORGNINCP\ 



-QPX6CNGTOKV6KVGN,QUGHU++&CX-GNNPGT

4#VVTCMVKXGUUGJTUEJÌPGU'ZGORNCT





-QPX6CNGTOKV6KVGN(4#0<&'4<9'+6'&'765%*'4-#+5'4&CX-GNNPGT  2TCEJVGZGORNCT'TUVCDUEJNCIHCUV5VGORGNINCP\



233

¤66+0)'0)4#(5%*#(6 

1,5:1

233

¤66+0)'0

)QVVHTKGF-KRRGT-TGW\GTOKV6KVGN(GTFKPCPFU++.ÌHHGNJQN\XCT  8QPITÌ­VGT5GNVGPJGKV-N5EJTÌVNKPIUHGJNGTCO4CPFUGJTUEJÌPpXQT\ÒINKEJ



'ZGORNCTFGT5NI*QJGPMWDKP#WMVKQP.CP\)TC\0T

234

¤66+0)'09#..'456'+0)4#(5%*#(65'+6(ª456'067/ 

+IPC\4GKEJUVCNGT#WIUDWTI$NWOGPVCNGT&CX(QTUVGT.ÌHHGNJQN\ 2TCEJVXQNNG2CVKPCHGKPGT2T·IGINCP\XQT\ÒINKEJp5VGORGNINCP\

  79


OSNABRÜCK

236

235

237

1.&'0$74) )4#(5%*#(65'+6*'4<1)67/#$)4155*'4<1)67/ 

#PVQP )ÒPVJGT  4GKEJUVCNGT  ,GXGT CWH FGP  )GDWTVUVCI FGU )TCHGP  /ÒP\   RGTKQFG/ÒP\OGKUVGT&CXKF<KGIGPJQTP  I5EJOCNGU$TWUVDKNFTOKVNCPIGOCWH FGO -TCIGP NKGIGPFGP *CCT WPF XGT\KGTVGO 9GJTIGJGPM&TGKHCEJ DGJGNOVGU XKGTHGNFKIGU 9CRRGP   WOJGTFGT9CJNURTWEJ#7:+.+7//'7/#&1/+01$GPFKI&CX-CNXGNCIG6TKRRNGT 5GNVGPDGUQPFGTUKPFKGUGT'TJCNVWPI*ÒDUEJG2CVKPCCVVTCMVKXGUXQT\ÒINKEJGU'ZGORNCT 



2CWN (TKGFTKEJ #WIWUV  8GTGKPUFQRRGNVCNGT  HÒT FCU (ÒTUVGPVWO $KTMGPHGNF #-5    &CX-CJPV6JWP -CDKPGVVUVÒEM2TCEJVXQNNG2CVKPCHCUV5VGORGNINCP\ 



8GTGKPUFQRRGNVCNGTHÒTFCU(ÒTUVGPVWO$KTMGPHGNF#-5&CX-CJPV6JWP  5GJTUEJÌPpXQT\ÒINKEJ

238



238 1,5:1

$+567/  80

150#$4ª%-

5GFKUXCMCP\4GKEJUVCNGT*CPPQXGT&CX-GPPGRQJND<GRGTPKEM  2TCEJVGZGORNCT#WUFTWEMUXQNNG2CVKPCNGKEJVG2T·IGUEJY·EJGXQT\ÒINKEJp5VGORGNINCP\




PFALZ

239

$+567/

240

2#&'4$140



5GFKUXCMCP\4GKEJUVCNGT%NCWUVJCN&CX5EJYGFG#C<GRGTPKEM 2TCEJVXQNNG2CVKPCXQT\ÒINKEJp5VGORGNINCP\

 



9KNJGNO#PVQPXQPFGT#UUGDWTI-QPX6CNGT0GWJCWU&CX5EJYGFG#C *GTTNKEJG2CVKPCXQT\ÒINKEJp5VGORGNINCP\



241

2(#.<-74(ª456'067/

242

243

2(#.<



-CTN.WFYKI4GKEJUVCNGT*GKFGNDGTICWHFCU8KMCTKCV&CX5NI/GOOGUJ 2TCEJVGZGORNCTOKVCWUFTWEMUXQNNGT2CVKPC8QT\ÒINKEJp5VGORGNINCP\





4GKEJUVCNGT*GKFGNDGTI&CX5NI/GOOGUJ 42TCEJVXQNNG2CVKPCXQT\ÒINKEJXQT\ÒINKEJp5VGORGNINCP\

 



4GKEJUVCNGT  *GKFGNDGTI CWH FKG 8GTO·JNWPI UGKPGU 5QJPGU -CTN OKV 9KNJGNOKPG 'TPGUVKPG XQP   &·PGOCTMCO5GRVGODGTKP*GKFGNDGTII&KG$TWUVDKNFGTFGU$TCWVRCCTGUGKPCPFGTIGIGP ÒDGT8KGT <GKNGP 5EJTKHV FCTWPVGT ,CJTGU\CJN WPF FKG 5KIPCVWT +. ,QJCPP .KPEM  &CX    5NI/GOOGUJ 8QPITQ­GT5GNVGPJGKV 5GJTCVVTCMVKXGU'ZGORNCTOKVHGKPGT2CVKPCXQT\ÒINKEJ  9KNJGNOKPG 'TPGUVKPG YCT FKG FTKVVG 6QEJVGT FGU -ÌPKIU (TKGFTKEJ +++ XQP &·PGOCTM WPF 0QTYGIGP WPF FGUUGP   )GOCJNKP5QRJKC#OCNKC6QEJVGTFGU*GT\QIU)GQTIXQP$TCWPUEJYGKI.ÒPGDWTI%CNGPDGTI5KGXGTNQDVGUKEJCO #RTKNKP-QRGPJCIGPOKVFGO-WTRTKP\GP-CTNXQPFGT2HCN\WPFJGKTCVGVGKJPCO5GRVGODGTKP *GKFGNDGTI &CU 2CCT YCT UKEJ XQP #PHCPI CP PKEJV \WIGPGKIV WPF FKG 'JG DNKGD MKPFGTNQU -CTN HQNIVG CO   #WIWUVUGKPGO8CVGT-CTN.WFYKICNU-WTHÒTUVCWHFGP6JTQPUVCTDLGFQEJPCEJPKEJVGKPOCNHÒPH,CJTGP 4GIGPVUEJCHVWPFNKG­9KNJGNOKPG'TPGUVKPGCNU9KVYG\WTÒEM9GIGPHGJNGPFGT'TDGPUVCTDFKG.KPKG5KOOGTPCWU WPFFKG-WTRHCN\HKGNCPFKGMCVJQNKUEJGP0GWDWTIGT

81


PFALZ

244



-CTN 2JKNKRR   HCEJGT 4GKEJUVCNGT  /CPPJGKO CWH FCU 8KMCTKCV )GJCTPKUEJVGU   $TWUVDKNFFGUL·JTKIGP-WTHÒTUVGPTOKVWOIGNGIVGT-GVVGFGU1TFGPUXQO)QNFGPGP8NKGU&QRRGN CFNGT OKV FGP FTGK RH·N\KUEJGP 9CRRGPUEJKNFGP CWH FGT $TWUV FCTÒDGT -WTJWV WPVGT FGP 5EJKNFGP FKG   -GVVGPFGU5V*WDGTVWUQTFGPUWPFFGU1TFGPUXQO)QNFGPGP8NKGU+P752NCUVKMJQNFGTFGT0)%OKV FGT$GYGTVWPI/5&CX*CCU5NI/GOOGUJ  8QPITQ­GT5GNVGPJGKV2TCEJVXQNNG2CVKPCXQT\ÒINKEJp5VGORGNINCP\ 

245

245 1,5:1



-CTN6JGQFQT4GKEJUVCNGT/CPPJGKOCWHFCU8KMCTKCVI&Ù)Û%Û6*Û % Û 2 Û 4 Û 5 Û 4 Û + Û # Û 6 Û  Û '. Û 2418 Û  Û 8+%#4+75 )GJCTPKUEJVGU $TWUVDKNF T OKV   WOIGNGIVGO /CPVGN WPF FGO $CPF FGU *WDGTVWUQTFGPU+0 Û 2#46 Û 4*'0+ Û 57'8 Û '6 Û +74 Û   (4#0%10 Û  &QRRGNCFNGT OKV FGO FTGKHGNFKIGP RH·N\KUEJGP 9CRRGP CWH FGT $TWUV FCTÒDGT   -WTJWV WOJGT FKG -GVVG FGU *WDGTVWUQTFGPU &CX  *CCU  5NI /GOOGUJ  FKGUGU   'ZGORNCT  8QPITÌ­VGT5GNVGPJGKV0WT'ZGORNCTGIGRT·IV 2TCEJVXQNNG2CVKPCYKP\-TCV\GTXQT\ÒINKEJp5VGORGNINCP\  'ZGORNCTFGT5NI#NHTGF0QUU#WMVKQP&T$WUUQ2GWU(TCPMHWTV/CKP0TWPFFGT5NI/GOOGU JGKOGT#WMVKQP/ÒP\\GPVTWO-ÌNP0T

246

 82

2(#.<5+//'40

246 1,5:1

,QJCPP++6CNGT5KOOGTP&CX5NI/GOOGUJ

445GJTUEJÌP




PFALZ

247

2(#.<<9'+$4ª%-'0*'4<1)67/ 

,QJCPP++4GKEJUVCNGT*GKFGNDGTICWHFCU8KMCTKCVI)GJCTPKUEJVGU$TWUVDKNF T OKV WOIGNGIVGO /CPVGN)GMTÌPVGT &QRRGNCFNGT CWH FGT $TWUV FTGKHGNFKIGU 9CRRGP &CX    5NI/GOOGUJXCT 44#VVTCMVKXGU'ZGORNCTOKVJÒDUEJGT2CVKPCUGJTUEJÌPpXQT\ÒINKEJ  #O,CPWCTYCT-CKUGT4WFQNH++KP2TCIIGUVQTDGP#NU#FOKPKUVTCVQTFGT2HCN\HKGN*GT\QI,QJCPP++PWP CWEJFKG4GKEJUXGTYGUWPIKPFGP)GDKGVGPFGUHT·PMKUEJGP4GEJVU\W'TNKG­UQHQTVFKG8KMCTKCVURCVGPVGCPUEJNCIGP &KGU VCV \WT UGNDGP <GKV LGFQEJ CWEJ UGKP 1JGKO2JKNKRR.WFYKIXQP0GWDWTIIGO·­UGKPGOFWTEJFKG)QNFGPG $WNNG DGUVGJGPFGP #PURTWEJ CWH FKG #FOKPKUVTCVKQP FGT -WTRHCN\ &CU 4GKEJUMCOOGTIGTKEJV KP 5RG[GT VTWI   $GFGPMGP DG\ÒINKEJ FGT #PGTMGPPWPI WPF CWEJ $C[GTP GTJQD 'KPURTWEJ IGIGP FKG #WUÒDWPI FGU 8KMCTKCVU 'U   DGICPP GKPG (GJFG FCTÒDGT QD FKG -WTYÒTFG OKV FGO TJGKPKUEJGP 2HCN\ITCHGPCOV QFGT OKV FGT DC[GTKUEJGP   *GT\QIUYÒTFG XGTDWPFGP UGK ,QJCPP ++ YW­VG UKEJ CDGT IGIGP FKG PGWDWTIKUEJGP #PURTÒEJG \W DGJCWRVGP WPF   ÒDVG CNU 8GTVTGVGT FGU RH·N\KUEJGP -WTHÒTUVGP UGKP #OV CWU KPFGO GT OKV FGO -WTRTKP\GP \WT -CKUGTYCJN PCEJ   (TCPMHWTV IKPI UKEJ CP FGT #WUJCPFNWPI FGT 9CJNMCRKVWNCVKQP DGVGKNKIVG WPF CO  ,WPK FGP ·NVGUVGP $TWFGT   4WFQNHU++/CVVJKCU\WO-CKUGTY·JNVGWPFDGKFGO-TÌPWPIU\GTGOQPKGNNFKGÒDGTPQOOGPG(WPMVKQPCWUÒDVG

248



%JTKUVKCP+8-QPX6CNGT<YGKDTÒEMGP&CX5NI/GOOGUJ  5GJTUEJÌP



249

2(#.<8'.&'0< 

.GQRQNF .WFYKI  4GKEJUVCNGT  9GKPDWTI QFGT .ÒV\GNUVGKP  I a .'121.&•   .8&18+%•&Ù)Ù%Ù2Ù4Ù&Ù$ÙÛ%1/Ù8'.&'06+“)GJCTPKUEJVGU$TWUVDKNFTOKVWO IGNGIVGO /CPVGN WPF *CNUVWEJa 8'4$8/ 8GT\KGTWPI  &1/+0+ 8GT\KGTWPI  /#0'6  

8GT\KGTWPI +0 8GT\KGTWPI “6'408/Û<YGKHCEJDGJGNOVGUXKGTHGNFKIGU9CRRGPFGT-WTRHCN\OKV /KVVGNUEJKNFXQP8GNFGP\QDGP\WFGP5GKVGPFKGIGVGKNVG,CJTGU\CJNWPVGPFKGIGVGKNVG5KIPCVWT $/ ,QJCPP$TGVVOCEJGT &CX#PO0QUU5NI/GOOGUJ  8QPITQ­GT5GNVGPJGKV-CDKPGVVUVÒEMXQPHGKPUVGT'TJCNVWPI *GTTNKEJG2CVKPCOKPLWUVKGTV5VGORGNINCP\  .GQRQNF .WFYKI YCT FCU LÒPIUVG FGT  -KPFGT )GQTI )WUVCXU XQP 8GNFGP\ CWU FGT \YGKVGP 'JG OKV /CTKC   'NKUCDGVJXQP<YGKDTÒEMGP/KV.GQRQNF.WFYKIUVCTDFKG.KPKG8GNFGP\CWU

83


POMMERN

250

21//'40*'4<1)67/ 

21//'40

$QIKUNCY:+85EJCWVCNGT5VGVVKPCWHFKG$GKUGV\WPIFGUNGV\VGPRQOOGTUEJGP *GT\QIU $QIKUNCY :+8 CO  /CK  )GMTÌPVGT )TGKH UVGJV N CWH GKPGO $CWOUVCOO CWH FGP   CWUIGDTGKVGVGP(NÒIGNPDGHKPFGPUKEJ\GJPRQOOGTUEJG9CRRGPN6QVGPMQRHWPF\YGK<YGKIGOKVFGO IGMTÌPVGPUEJYGFKUEJGP9CRRGPWPFFGOOKV-WTJWVDGFGEMVGP$TCPFGPDWTIGT5EJKNFQDGPUVTCJNGPFG 5QPPG WPVGT FGO $CWOUVCOO FKG /ÒP\OGKUVGTUKIPCVWT )6  )QVVHTKGF 6CDDGTV  <GKNGP 5EJTKHV   WOJGT FTGKHCEJGT 5EJTKHVMTGKU  OO  I &CX p *KNFGDTCPF + 5   FQTV FKGUGU   'ZGORNCTGTY·JPV *KNFKUEJ 8QPITQ­GT5GNVGPJGKV*GTTNKEJG2CVKPCXQT\ÒINKEJ  1JPG0CEJMQOOGPUVCTD$QIKUNCY:+8CO/·T\CWHUGKPGO5EJNQ­KP5VGVVKP5GKP5CTIUVCPF,CJTG NCPIÒDGTFGT'TFGFCKJPPKGOCPFUVCPFGUIGO·­DGKUGV\GPYQNNVG'TUVPCEJFGO2QOOGTPKO9GUVH·NKUEJGP (TKGFGP \WO 6GKN 5EJYGFGP WPF \WO 6GKN $TCPFGPDWTI\WIGURTQEJGPYQTFGPYCTWPFFKGFCPPHQNIGPFGP)TGP\ UVTGKVKIMGKVGP DGKIGNGIV YWTFGP DGICPPGP \YKUEJGP FGP $GCWHVTCIVGP FGU -WTHÒTUVGP (TKGFTKEJ 9KNJGNO XQP   $TCPFGPDWTI WPF FGT HÒT 8QTRQOOGTP GKPIGUGV\VGP UEJYGFKUEJGP 4GIKGTWPI 8GTJCPFNWPIGP ÒDGT FKG $GKUGV\WPI   FGUNGV\VGP2QOOGTPJGT\QIU&GTFCPP\WP·EJUVXQTIGUGJGPG6GTOKPFGT&G\GODGTOW­VGLGFQEJYGIGP FGT KO .CPFG ITCUUKGTGPFGP 2GUV XGTUEJQDGP WPF FKG $GGTFKIWPI UEJNKG­NKEJ CWH FGP  /CK  HGUVIGUGV\V   YGTFGP<WFGPXKGNUGKVKIGP8QTDGTGKVWPIGPCPN·­NKEJFGU$GIT·DPKUUGUIGJÌTVGFKG*GTUVGNNWPIXQP)GFGPMOÒP\GP &KGRTWPMXQNNGP$GUVCVVWPIUHGKGTNKEJMGKVGPHÒTFGPNGV\VGP2QOOGTPJGT\QI$QIKUNCY:+8YWTFGPXQPFGTUEJYGFK UEJGP-ÌPKIKP%JTKUVKPCWPFFGODTCPFGPDWTIKUEJGP-WTHÒTUVGP(TKGFTKEJ9KNJGNOIGOGKPUCOQTICPKUKGTVWPFDG\CJNV

251 (3-fach)

21//'4056'66+0*'4<1)67/ 

2JKNKRR ++  &TGKHCEJGT 4GKEJUVCNGT  5VGVVKP CWH FCU 4GHQTOCVKQPULWDKN·WO  I   2'4+'4#6²'6+08'0685'56ÉÉ/CTVKP.WVJGTMPKGVPCEJNWPFUVÒV\VUKEJOKVFGOTGEJVGP #TO CWH GKPGP #NVCT KP GKPGT -KTEJG KP FGT .KPMGP 'XCPIGNKWO+08'0+ 38'/ &+.+)+6 #0+/#   /'#  $NWOGPTCPMG  'KP 2TKGUVGT UVGJV PCEJ T IGDGWIV KP GKPGT -KTEJG WPF J·NV GKP $WEJ OKV FGT   #WHUEJTKHV)'5'<KPFGP*·PFGPFCTWPVGT6TWJGOKVFGT#WHUEJTKHV#001+8$'.&CX *KNFKUEJ5NI9JKVKPIp 8QPCNNGTITÌ­VGT5GNVGPJGKV8GTOWVNKEJDGMCPPVGU'ZGORNCT *GTTNKEJG2CVKPCMN4CPFHGJNGTUGJTCVVTCMVKXGUHCUVXQT\ÒINKEJGU'ZGORNCT  +PFGT5NI2QIIGYCTFKGUGT6[RPWTCNU&QRRGNVCNGTXQTJCPFGP 0T  



2JKNKRRYWTFGCO,WNKKP0GWGPMCORFGOUR·VGTGP(TCP\DWTIKP8QTRQOOGTPCNU·NVGUVGT5QJP*GT\QI $QIKUNCYU:+++WPFFGUUGPGTUVGT)GOCJNKP%NCTCXQP$TCWPUEJYGKIIGDQTGP'TYWEJUKP$CTVJFGTMNGKPGP4GUK FGP\ UGKPGU 8CVGTU CWH 2JKNKRR IGPQ­ CNU -KPF WPF ,WIGPFNKEJGT FKG FCOCNU ÒDNKEJG $KNFWPI GKPGU FGWVUEJGP   (ÒTUVGPUQJPUFGT5R·VTGPCKUUCPEGFQEJIKPIGPUGKPGMÒPUVNGTKUEJGPWPFYKUUGPUEJCHVNKEJGP+PVGTGUUGPDCNFÒDGTFCU IGYÌJPNKEJG/C­JKPCWU$GTGKVUOKV\YÌNH,CJTGPDGUC­GTGKPGGKIGPG5COONWPIXQP$ÒEJGTPWPF$KNFGTP)GO·­ FGP5KVVGPUGKPGT<GKVWPVGTPCJOGT\CJNTGKEJG-CXCNKGTUVQWTGPFKGKJPKPXKGNGGWTQR·KUEJG.·PFGTWPFFKGFQTVKIGP (ÒTUVGPJÌHG HÒJTVGP 'KPGP \YGKL·JTKIGP #WHGPVJCNV KP +VCNKGP OW­VG GT UEJNKG­NKEJ  XQT\GKVKI CDDTGEJGP FC   UGKPG /WVVGT UEJYGT GTMTCPMV YCT  YWTFG UGKP 8CVGT PCEJ FGO 6QF *GT\QI $CTPKOU : :++  TGIKGTGPFGT   *GT\QIKO6GKNJGT\QIVWO2QOOGTP5VGVVKPWPFÒDGTVTWI2JKNKRRFKG5VCVVJCNVGTUEJCHV0CEJFGO$QIKUNCY:+++KO ,CJT  IGUVQTDGP YCT ÒDGTPCJO 2JKNKRR FKG 4GIKGTWPI KO 5VGVVKPGT *GT\QIVWO GKIGPUV·PFKI +O ,CJT    JGKTCVGVG GT 5QRJKC XQP 5EJNGUYKI*QNUVGKP5QPFGTDWTI &KG 'JG DNKGD CNNGTFKPIU YKG CNNG CPFGTGP FGT NGV\VGP   )GPGTCVKQPFGTRQOOGTUEJGP*GT\ÌIGMKPFGTNQU0CEJFGO6QFXQP2JKNKRRU$TWFGT$QIKUNCY:+8FGONGV\VGP O·PPNKEJGP#PIGJÌTKIGPGTNQUEJFCU)TGKHGPJCWUKO,CJTG

84


POMMERN

252

91.)#5656#&6 

7PVGT5EJYGFGP)WUVCX++#FQNH$TGKVGTFTGKHCEJGT4GKEJUVCNGTCWHFKGªDGTHÒJ TWPI UGKPGT )GDGKPG PCEJ 5EJYGFGP  I )756#875 #&1.2*75 /#)075 &'+ )4#6+#   57'%14 )16*14 '6 8#0&#.14 4': #7)75675 GVV &GT -ÌPKI KP XQNNGO 1TPCV NKGIV CWHIG   DCJTV UGKPG 5GGNG YKTF XQP \YGK 'PIGNP \WO UVTCJNGPFGP 0COGP ,GJQXCU IGVTCIGP KP GKPGO 5VTCJN   '7)' 5'48' (+&'.+5 KO *KPVGTITWPF 5EJNCEJVHGNF FCTÒDGT 8'. /14677/ (7)+706&7:   ).14+15 Û 24+0% Ù 2+75 Ù *'415 +08+%6 Ù8+%614+0%1/2#4#$Ù64+7/2*Ù('.+: )'4/ Ù .+$'4#614 Ù #   Ù )WUVCX #FQNH UKV\V PCEJ N KP 6TKWORJYCIGP FGTXQPFTGK2GICUK IG\QIGP YKTF WPF YKTF DGMT·P\V XQP FGP 2GTUQPKHKMCVKQPGP FGT 4GNKIKQPWPFFGT)GTGEJVKIMGKVQDGP '6 8+6# '6 /146'  64+7/2*1  +O .GDGP YKG KO 6QFG VTKWORJKGTG KEJ  #JNUVTÌO  4    &CX FQTVWPVGT'THWTV  448QT\ÒINKEJGU2TCEJVGZGORNCTOKVJGTTNKEJGT2CVKPC  &GTNCVGKPKUEJG5RTWEJCWHFGT4ÒEMUGKVGFKGUGUWPFFGUHQNIGPFGP5VÒEMGUDG\KGJVUKEJFCTCWHFC­)WUVCX#FQNHKP FGT 5EJNCEJV XQP .ÒV\GP CO  HKGN FKG 5EJYGFGP CDGT VTQV\FGO QFGT IGTCFG FGUYGIGP UKGIVGP 0CEJ   UGKPGO 6QFG YWTFG FGT -ÌPKI PCEJ 9QNICUV IGDTCEJV YQ FGT .GKEJPCO GKP JCNDGU ,CJT DNKGD 'TUV #PHCPI ,WNK    YWTFG GT PCEJ GKPGT HGKGTNKEJGP 2TQ\GUUKQP CWH GKP 5EJKHH IGDTCEJV WPF PCEJ 0[MÌRKPI ÒDGTHÒJTV <W FKGUGT   )GNGIGPJGKVUKPF5EJCWUVÒEMGYKGFKGJKGTXQTNKGIGPFGPIGRT·IVYQTFGP

253

1,5:1



1,5:1

&KEMGT4GKEJUVCNGTCWHFKGªDGTHÒJTWPIUGKPGT)GDGKPGPCEJ5EJYGFGP#JNUVTÌO&CX

FQTVWPVGT'THWTV  44#VVTCMVKXGU'ZGORNCTOKVHGKPGT2CVKPCHCUVXQT\ÒINKEJ

 85


REGENSBURG

254

)4#(5%*#(6 

4#8'05$'4)

9QNHICPI9KNJGNOXQP2HCN\0GWDWTI4GKEJUVCNGT$KGNGHGNFIr91.()Ú 9+.Ú&)Û%Û2#Ú4*'Û&Û$#Û+8.Û%.+Û'6Û/1)GJCTPKUEJVGU$TWUVDKNFTOKVWOIGNGIVGO /CPVGNWPFFGT-GVVGFGU1TFGPUXQO)QNFGPGP8NKGUWOJGT+0&'1/'#%1051.#%Ç8'.Ç 52 Ç /#4 Ç 4#  '6 Ç /145 Ç &1 +0 4# « 5KIPCVWT FGU ,QDUV -QEJ /ÒP\OGKUVGT KP $KGNGHGNF     /KV (ÒTUVGPJWV DGFGEMVGU CEJVHGNFKIGU 9CRRGP OKV /KVVGNUEJKNF WOJGT FKG -GVVG FGU   1TFGPUXQO)QNFGPGP8NKGUQDGP\WFGP5GKVGPFKGIGVGKNVG,CJTGU\CJN<&CX5VCPIG 8QPITÌ­VGT5GNVGPJGKV 5GJTCVVTCMVKXGU'ZGORNCTOKVJÒDUEJGT2CVKPCUGJTUEJÌPpXQT\ÒINKEJ 

255

56#&6

256 (doppelt)

257

4')'05$74)



4GKEJUVCNGTOKV6KVGN(GTFKPCPFU+++$GEMGPD&CX 4*ÒDUEJG2CVKPCYKP\<CKPGPFGXQT\ÒINKEJ



&QRRGNVGT 4GKEJUVCNGTQ,  OKV6KVGN,QUGHU+I5VGORGNUEJPGKFGT,QJCPP2KEJNGT 5VCFVUEJNÒUUGN KP DCTQEMGT )TQVGUMGPMCTVWUEJG WPVGP DGKFGTUGKVU /ÒP\OGKUVGT\GKEJGP (NÒIGN ,QJCPP   /KEJCGN (GFGTGT /ÒP\OGKUVGT KP 4GIGPUDWTI  )GMTÌPVGT &QRRGNCFNGT OKV $·PFGTP CPFGT -TQPGWPFFGOJGT\HÌTOKIGPÌUVGTTGKEJKUEJGP5EJKNFCWHFGT$TWUV$GEMGPD&CX  8QPITQ­GT5GNVGPJGKV5GJTCVVTCMVKXGU'ZGORNCTOKVJGTTNKEJGT2CVKPCXQT\ÒINKEJ 



4GKEJUVCNGTQ,  OKV6KVGN-CTNU8+$GEMGPD&CX 2TCEJVXQNNG2CVKPCXQT\ÒINKEJp5VGORGNINCP\

86

 

 


REUSS

258 (vierfach)



&KEMGTXKGTHCEJGT4GKEJUVCNGTOKV6KVGN-CTNU8+#DUEJNCIXQPFGP5VGORGNPFGU4CVJCWUVCNGTU  I 5VGORGNUEJPGKFGT %JTKUVQRJ &CPKGN 1GZNGKP 2'4 %#41.8/ 2128.1 4'&+'05 2#:   +84# 68'684 FCU %JTQPQITCOO GTIKDV FKG ,CJTGU\CJN   #PUKEJV FGU 4CVJCWUGU KO #DUEJPKVV   %84+# 4#6+5$ WPF FKG 5KIPCVWT ¤  (%#41.85 8+ Û & Ü  ) Û 41/ Û +/2 Û 5'/2 Û #8) Û   )GJCTPKUEJVGU $TWUVDKNF -CTNU 8+ T OKV .QTDGGTMTCP\ WPF WOIGNGIVGO /CPVGN CO #TOCDUEJPKVV FKG   5KIPCVWT%&¤$GEMGPD&CXp  8QPCNNGTITÌ­VGT5GNVGPJGKV2TCEJVGZGORNCTOKVJGTTNKEJGT6ÌPWPI -N4CPFHGJNGTXQT\ÒINKEJp5VGORGNINCP\ 

259

260

260



4GKEJUVCNGTQ, WO OKV6KVGN-CTNU8++$GEMGPD&CX 4-CDKPGVVUVÒEM2TCEJVXQNNG2CVKPCMN5VGORGNHGJNGTHCUV5VGORGNINCP\

 



-QPX6CNGTOKV6KVGNXQP(TCP\+$GEMGPD&CX 2TCEJVGZGORNCT*GTTNKEJG2CVKPCXQT\ÒINKEJp5VGORGNINCP\

 

261

4'755 4'7551$'4)4'+<)4#(5%*#(65'+6(ª456'067/ 

*GKPTKEJ:+-QPX6CNGT5CCNHGNF&CX5EJOKFV-PCD  2TCEJVGZGORNCT8QT\ÒINKEJp5VGORGNINCP\

 87


REUSS

263

262

264



*GKPTKEJ :+++  -QPX6CNGT  4ÒEMUGKVGPUVGORGN XQP ,QJCPP 8GKV &ÌNN #-5    8CTKCPVG&CX-CJPV6JWP W­GTUVUGNVGPDGUQPFGTUKPFKGUGT'TJCNVWPI 0WT'ZGORNCTGIGRT·IV'TUVCDUEJNCIHCUV5VGORGNINCP\ 



-QPX6CNGT#-5&CX-CJPV6JWP  440WT'ZGORNCTGIGRT·IV/KPDGTKGDGPXQT\ÒINKEJ





-QPX6CNGT#-5&CX-CJPV6JWP  440WT'ZGORNCTGIGRT·IV5GJTUEJÌPpXQT\ÒINKEJ



265

266

267



-QPX6CNGT#-5&CX-CJPV6JWP *GTTNKEJG2CVKPCXQT\ÒINKEJp5VGORGNINCP\





*GKPTKEJ::8GTGKPUFQRRGNVCNGT#-5&CX-CJPV6JWP  5GJTUEJÌPpXQT\ÒINKEJ



4'7555%*.'+<)4#(5%*#(65'+6(ª456'067/  88

*GKPTKEJ.:++8GTGKPUFQRRGNVCNGT#-5&CX-CJPV6JWP  0WT'ZGORNCTGIGRT·IV*GTTNKEJG2CVKPCXQT\ÒINKEJp5VGORGNINCP\




ROSTOCK

268

269

270



8GTGKPUFQRRGNVCNGTL·JTKIGU4GIKGTWPIULWDKN·WO#-5&CX-CJPV6JWP  40WT'ZGORNCTGIGRT·IV8QT\ÒINKEJp5VGORGNINCP\





8GTGKPUFQRRGNVCNGT#-5&CX-CJPV6JWP  0WT'ZGORNCTGIGRT·IV2TCEJVGZGORNCT(GKPG2CVKPCHCUV5VGORGNINCP\





8GTGKPUFQRRGNVCNGT#-5&CX-CJPV6JWP 0WT'ZGORNCTGIGRT·IV2TCEJVXQNNG2CVKPCXQT\ÒINKEJ

 

271

271 1,5:1

56#&6 

41561%-

4GKEJUVCNGT 5EJKNNKPI OKV6KVGN4WFQNHU++CWHFKG6CWHGFGU2TKP\GP,QJCPP%JTKUVQRJXQP /GEMNGPDWTI)ÒUVTQYCO(GDTWCTIÊÙ/10Ù01Ù4156ÙÙ+0Ù28$Ù.“6+6Ù Ù('$ÙÙ$GJGNOVGU5VCFVYCRRGPOKVLGHÒPH(CJPGPCPFGP$ÒHHGNJÌTPGTP48&1.Ù++Ù&Ù) Ù 41/ Ù +/ Ù 5'/ Ù #8)85 Ù 2 Ù ( Ù & )GMTÌPVGT &QRRGNCFNGT CWH FGT $TWUV 4GKEJUCRHGN FCTKP   9GTV\CJN&CX-WP\GN#C 442TCEJVXQNNG2CVKPCMN5VGORGNHGJNGTXQT\ÒINKEJ  'ZGORNCT FGT #WMVKQP -ÌNPGT /ÒP\MCDKPGVV  -ÌNP  0T  WPF FGT #WMVKQP (TKV\ 4WFQNH -ÒPMGT    1UPCDTÒEM0T  

,QJCPP %JTKUVQRJ YCT FGT ·NVGUVG 5QJP FGU *GT\QIU #NDTGEJV ++ XQP /GEMNGPDWTI)ÒUVTQY WPF FGUUGP GTUVGT   )GOCJNKP/CTICTGVJG'NKUCDGVJXQP/GEMNGPDWTI

89


SACHSEN

272



$TGKVGT FQRRGNVGT 4GKEJUVCNGT  CWH FKG)GDWTVWPF6CWHGFGU2TKP\GP%JTKUVKCPXQP/GEMNGPDWTI 5EJYGTKP I/10Û018Û41561%*Û#&Û.')Û+/2Û+0Û28$.Û2418Û.“6+6Û $GJGNOVGU5VCFVYCRRGPOKVLGHÒPH(CJPGPCPFGP$ÒHHGNJÌTPGTPÙ3Ù(Ù(Ù3Ù5+6Û+..8564+5 24+0%Û#&1.2*+Û(4+&'4+%+Û(+.+85Ü24+/1)'0+685Û0#5%+684Û+Û&'%'/$Ù #0 Ù / Ù &% Ù ::+++ Û '6 Û 5#  %41 Û (106' Û 4'0#5  %+684 Û :++: Û +#08# Ú  #0 Û   ::+8 Ü 8+8#6 Û FCTWPVGT FKG 5KIPCVWT Ù *& Ù XGTDWPFGP *CPU &GVNQHH /ÒP\OGKUVGT KP 4QUVQEM    \YKUEJGP#TCDGUMGP&CX-WP\GN#D  8QPITQ­GT5GNVGPJGKV(CUVXQT\ÒINKEJGU'ZGORNCTOKVHGKPGT2CVKPC 

273

273

1,5:1

5#%*5'0 5#%*5'0-74(ª456'067/ 

(TKGFTKEJ+++FGT9GKUG$TGKVGT)WNFGPITQUEJGPQ, PCEJ OKV6KVGN/CZKOKNKCPU+ CWHFKG)GPGTCNUVCVVJCNVGTYÒTFGI5VGORGNXQP7NTKEJ7TUGPVJCNGTF(4+&³´Ú&8:Û5#:´

9CRRGP '.'%6´Û+/2'4 9CRRGP 38'Û.1%8/Ù6'0 9CRRGP '5Ù)'0'4#´ 9CRRGP  )GJCTPKUEJVGU $TWUVDKNF T OKV &TCJVJCWDG CWH FGO *CTPKUEJ KUV *5 Ù /#4++ \W NGUGP/#:+    /+.+#085 8GT\KGTWPI 41/#0148/ 8GT\KGTWPI 4':Ûg5'/2'4f#7)856 8GT\KGTWPI  4GKEJUCFNGTOKV$TWUVUEJKNF&CXXIN5EJPGG  44'PVHGTPVG6WUEJG\KHHGTCWHFGT8QTFGTUGKVG UGJTCVVTCMVKXGU'ZGORNCTOKVRTCEJVXQNNGT2CVKPCXQT\ÒINKEJ  &KGUG RTCEJVXQNNG 4GPCKUUCPEGRT·IWPI DG\KGJV UKEJ CWH FKG )GPGTCNUVCVVJCNVGTYÒTFG FKG FGO -WTHÒTUVGP CO   #WIWUVXQP-ÌPKI/CZKOKNKCP+CWHFGO4GKEJUVCIXQP-QPUVCP\ÒDGTVTCIGPYQTFGPYCT0CEJFGO/CZK OKNKCP+XQPUGKPGTCO(GDTWCTKP6TKGPVGTHQNIVGP9CJN\WOTÌOKUEJGP-CKUGT\WTÒEMIGMGJTVYCTGTNQUEJ FCU5VCVVJCNVGTCOV(TKGFTKEJUFGU9GKUGP+JOYWTFGCDGTGJTGPJCNDGTIGUVCVVGVFGP6KVGNFGU)GPGTCNUVCVVJCNVGTUCWH .GDGPU\GKV\WHÒJTGP&GTXQTNKGIGPFG)WNFGPITQUEJGPIGJÌTVKPGKPG5GTKGXQPTGRT·UGPVCVKXGP2T·IWPIGPFKGFCU #OVJGTXQTJGDGP  /KVFGP5VGORGNPFKGUGU)WNFKPGTUUQNNVGPWTURTÒPINKEJ&QRRGNUVÒEMGIGRT·IVYGTFGP-CKUGT/CZKOKNKCPJCVVGCWEJ FQRRGNVG )WNFGPITQUEJGP WPF )QNFCDUEJN·IG KP #WHVTCI IGIGDGP 'U N·­V UKEJ JGWVG PKEJV OGJT HGUVUVGNNGP QD FKG   GKPHCEJGP)WNFKPGTKPFGT/ÒP\UV·VVG*CNNIGRT·IVYWTFGPQFGTKP&TGUFGPPCEJUR·VGTGTHQNIVGTªDGTUGPFWPIFGT 5VGORGNPCEJ5CEJUGP

90


SACHSEN

274

275 (1 1/2-fach)

275 (1 1/2-fach)



,QJCPP  6CNGT Q , <YKEMCW  I $TWUVDKNF T OKV /ÒV\G OKV FGT 4GEJVGP FCU   5EJYGTV UEJWNVGTPF8KGTHGNFKIGU 9CRRGP OKV /KVVGNUEJKNF 8CTKCPVG OKV MNGKPGO $TWUVDKNF WPF QJPG   FGPKPPGTGP<KGTMTGKUCWHFGT4ÒEMUGKVG&CX5EJPGG$#  W­GTUVUGNVGPKPFKGUGT'TJCNVWPI2TCEJVXQNNG2CVKPCXQT\ÒINKEJGU'ZGORNCT 



)GQTICNU*GT\QIHCEJGT6CNGT#PPCDGTII&CX5EJPGG 5GJTUGNVGPDGUQPFGTUKPFKGUGT'TJCNVWPI 5GJTCVVTCMVKXGU'ZGORNCTOKVJGTTNKEJGT2CVKPCYKP\4CPFHGJNGTHCUVXQT\ÒINKEJ

.CWV 6GPV\GN UVGJV FKGUG UGJT UGNVGPG 2T·IWPI OÌINKEJGTYGKUG KO <WUCOOGPJCPI OKV FGT *QEJ\GKV UGKPGU 8CVGTU   ,QJCPP(TKGFTKEJKP6QTICW&KGJQEJTGNKGHKGTVG/ÒP\GOKVFGT#NVGTUCPICDG'6#6+558'.8+ KO#NVGTXQP ,CJTGP YWTFGXGTOWVNKEJCNU)GUEJGPMXGTVGKNV

277 (doppelt)

276

 

278



,QJCPP(TKGFTKEJFGT)TQ­OÒVKIG&QRRGNVGT4GKEJUVCNGT$WEJJQN\CWHFKG'KPNÌ UWPIFGT$WTIITCHUEJCHV/CIFGDWTII&CX5EJPGG 445GJTUEJÌPpXQT\ÒINKEJ 



,QJCPP(TKGFTKEJFGT)TQ­OÒVKIGWPF)GQTI6CNGT#PPCDGTI&CX5EJPGG  9KP\5EJTÌVNKPIUHGJNGTUGJTUEJÌP





,QJCPP(TKGFTKEJFGT)TQ­OÒVKIGWPF/QTKV\6CNGT$WEJJQN\&CX5EJPGG  5GJTCVVTCMVKXGU'ZGORNCTOKVCWUFTWEMUXQNNGT2CVKPCUGJTUEJÌPpXQT\ÒINKEJ

 91


SACHSEN

279



,QJCPP (TKGFTKEJ FGT )TQ­OÒVKIG WPF 2JKNKRR FGT )TQ­OÒVKIG XQP *GUUGP    6CNGT)QUNCT5EJOCNMCNFKUEJGT$WPFGUVCNGT&CX5EJPGG5EJÒV\XCT  W­GTUVUGNVGPKPFKGUGT'TJCNVWPI2TCEJVGZGORNCT 9KP\5EJTÌVNKPIUHGJNGTXQT\ÒINKEJp5VGORGNINCP\ 

280

281

282



#WIWUV6CNGT5EJPGGDGTI&CX5EJPGG 5GNVGPKPFKGUGT'TJCNVWPI2TCEJVXQNNG2CVKPCHCUVXQT\ÒINKEJ

 



4GKEJUVCNGT&TGUFGPCWHUGKPGP6QF&CX5EJPGG  5GNVGPDGUQPFGTUKPFKGUGT'TJCNVWPI#VVTCMVKXGUHCUVXQT\ÒINKEJGU'ZGORNCT





%JTKUVKCP ++ ,QJCPP )GQTI + WPF #WIWUV  4GKEJUVCNGT  &TGUFGP &CX  #   5EJPGG (CUVXQT\ÒINKEJ



283 (dreifach)



92

,QJCPP )GQTI + WPF #WIWUV  &TGKHCEJGT 4GKEJUVCNGT  &TGUFGP CWH FCU 8KMCTKCV    I *ÒHVDKNF T KP -WTQTPCV OKV GTJQDGPGO 5EJYGTV KP FGT 4GEJVGP8GT\KGTVGU OGJTHGNFKIGU   9CRRGP\WFGP5GKVGPFKGIGVGKNVG,CJTGU\CJN&CXp \WHH 5EJPGG  8QPITÌ­VGT5GNVGPJGKV)TCHHKVKKO(GNFFGT8QTFGTUGKVGUGJTUEJÌP 


SACHSEN

284 (dreifach)



&KEMGTFTGKHCEJGT4GKEJUVCNGT&TGUFGPI)GJCTPKUEJVGU*ÒHVDKNF,QJCPP)GQTIUTOKVFGT 4GEJVGPFCU5EJYGTVUEJWNVGTPFKPFGT.KPMGP*GNOFCTWPVGT9CRRGPUEJKNF\WFGP5GKVGPFKGIGVGKNVG ,CJTGU\CJN)GJCTPKUEJVGU $TWUVDKNF #WIWUVU T OKV WOIGNGIVGO /CPVGN WOJGT 5EJTKHVMTGKU CW­GP   -TGKUCWU9CRRGPUEJKNFGP&CX5EJPGG  8QPITQ­GT5GNVGPJGKV/KPDGTKGDGPUGJTUEJÌPpXQT\ÒINKEJ 

285



&KEMGT 4GKEJUVCNGT  &TGUFGP  I )GRT·IV OKV FGP 5VGORGNP FGU  4GKEJUVCNGTU   %NCW­-CJPV&CXp5EJPGGp 445GJTCVVTCMVKXGU'ZGORNCTOKVJÒDUEJGT2CVKPCUGJTUEJÌP 

286 (vierfach)



&KEMGT XKGTHCEJGT 4GKEJUVCNGT  &TGUFGP  I)GJCTPKUEJVGU*ÒHVDKNF,QJCPP)GQTIUTOKV FGT 4GEJVGP FCU 5EJYGTV UEJWNVGTPF KP FGT .KPMGP *GNO FCTWPVGT 9CRRGPUEJKNF \W FGP 5GKVGP FKG   IGVGKNVG ,CJTGU\CJN)GJCTPKUEJVGU $TWUVDKNF #WIWUVU T OKV WOIGNGIVGO /CPVGN WOJGT 5EJTKHVMTGKU   CW­GP-TGKUCWU9CRRGPUEJKNFGP&CX5EJPGG  8QPITQ­GT5GNVGPJGKV/KP4CPFHGJNGTUGJTUEJÌPpXQT\ÒINKEJ 

287



4GKEJUVCNGTMNKRRG  &TGUFGP CWH FCU #TODTWUVUEJKG­GP DGK FGT 6CWHG FGU 2TKP\GP %JTKUVKCP   5QJP,QJCPP)GQTIU+&CX5EJPGG  5GJTCVVTCMVKXGU'ZGORNCTOKVJGTTNKEJGT2CVKPCXQT\ÒINKEJ  93


SACHSEN

288

288

1,5:1



,QJCPP )GQTI +  -KRRGT )TQUEJGP  <YKEMCW 2TQDG  I /ÒP\OGKUVGT   #FCO 2TGNNJQHH 8GT\KGTVGU OKV -WTJWV DGFGEMVGU 9CRRGP&TGK 9CRRGPUEJKNFG KPU &TGKGEM IGUVGNNV   FCUQDGTG\YKUEJGPFGTIGVGKNVGP,CJTGU\CJNWPVGP/ÒP\\GKEJGP#PMGTQDGPKPFGT7OUEJTKHV FTGK5EJY·PG4CJPGPHÒJTGT-TWIC 7PKMWO(GKPG2CVKPCOKP$GNCITGUVGXQT\ÒINKEJ  'ZGORNCTFGT5NI*-GTPDCEJ#WMVKQP-TKEJGNFQTH$GTNKP0T





&CUXQTNKGIGPFG'ZGORNCTKUVGTUVOCNKIKP&TGUFPKUEJG)GNGJTVG#P\GKIGP5RCNVGDGUEJTKGDGPYQTFGP

289



-KRRGT)TQUEJGP0GWUVCFVCPFGT1TNC+++5QTVG4CJPGPHÒJTGT-TWI  5GJTUGNVGPDGUQPFGTUKPFKGUGT'TJCNVWPI-CDKPGVVUVÒEM 2TCEJVXQNNG2CVKPCHCUV5VGORGNINCP\



290 (dreifach)



94

&KEMGTFTGKHCEJGT4GKEJUVCNGT&TGUFGPI&KEMCDUEJNCIXQPFGP5VGORGNPFGU4GKEJUVCNGTU 8CTKCPVG OKV CPNKGIGPFGT (GNFDKPFG “ +1*#0 Ù )'14) Ù & Ù ) Ù &8: 5#: Ù +8. Û %.+8 Û  '6   /106+Ù)GJCTPKUEJVGU*ÒHVDKNFTOKVFGT4GEJVGPFCU5EJYGTVUEJWNVGTPFKPFGT.KPMGP*GNO5# Û41/Û+/2Û#4%*+/Û'6'.'%6Û 5GEJUHCEJDGJGNOVGUOGJTHGNFKIGU9CRRGP\WFGP 5GKVGPFKGIGVGKNVG5KIPCVWT*+ *CPU,CMQD/ÒP\OGKUVGTKP&TGUFGP %NCW­-CJPV &CXp \W 5EJPGGp \W   8QPITQ­GT5GNVGPJGKV(GKPG2CVKPCMN5VGORGNHGJNGTCO4CPFUGJTUEJÌP 


SACHSEN

291 (doppelt)



&QRRGNVG 4GKEJUVCNGTMNKRRG  &TGUFGP CWH FKG 8GTO·JNWPI UGKPGT 6QEJVGT /CTKC 'NKUCDGVJ OKV   (TKGFTKEJ8++XQP*QNUVGKP)QVVQTRI&CX5EJPGG  448QT\ÒINKEJGU'ZGORNCTOKVHGKPGT6ÌPWPI 

292

292 1,5:1



4GKEJUVCNGT&TGUFGP&CX5EJPGG 2TCEJVGZGORNCT5EJCTHCWUIGRT·IVHCUV5VGORGNINCP\

 

293 (dreifach)



$TGKVGTFTGKHCEJGT4GKEJUVCNGT&TGUFGPCWHFGP9GUVH·NKUEJGP(TKGFGPI&GTIGJCTPKUEJVG -WTHÒTUVUVGJVXXCWHIGHNKGUVGO$QFGPOKVFGT4GEJVGPFCU5EJYGTVUEJWNVGTPFFKG.KPMGNGJPVCWH GKPGO6KUEJFCTCWH*GNO*GNOÒDGT\YGK9CRRGPWOJGT9CRRGPMTGKU&CX5EJPGG 44*ÒDUEJG2CVKPCUGJTCVVTCMVKXGUXQT\ÒINKEJGU'ZGORNCT

  95


SACHSEN

294 (dreifach)



,QJCPP )GQTI ++  $TGKVGT FTGKHCEJGT 4GKEJUVCNGT  &TGUFGP CWH FCU 8KMCTKCV   I&GTIGJCTPKUEJVG-WTHÒTUVKP-WTQTPCVTGKVGVTOKVFGT4GEJVGPFCU5EJYGTVUEJWNVGTPFFCT WPVGT4GKEJUCRHGNÒDGT\YGKHGNFKIGO9CRRGP<GKNGP5EJTKHV&CX5EJPGG  8QPITQ­GT5GNVGPJGKV-N5EJTÌVNKPIUHGJNGTHCUVXQT\ÒINKEJ 

295 (doppelt)



$TGKVGTFQRRGNVGT4GKEJUVCNGT&TGUFGPCWHFCU8KMCTKCVI&CX5EJPGG 449KP\*GPMGNURWTFGPPQEJUGJTCVVTCMVKXGUHCUVXQT\ÒINKEJGU'ZGORNCTOKVHGKPGT2CVKPC

 

296 (dreifach)



96

&KEMGTFTGKHCEJGT4GKEJUVCNGT&TGUFGPCWHFCU8KMCTKCVI&KEMCDUEJNCIXQPFGP5VGORGNP FGU4GKEJUVCNGTU&KG7OUEJTKHVDGIKPPVQDGPTGEJVU&GTIGJCTPKUEJVG-WTHÒTUVKP-WTQTPCVTGKVGVTOKV FGT 4GEJVGP FCU 5EJYGTV UEJWNVGTPF FCTWPVGT XGT\KGTVGU MWTU·EJUKUEJGU 9CRRGP <GKNGP 5EJTKHV   %NCW­-CJPV&CXp5EJPGG  8QPITQ­GT5GNVGPJGKV#VVTCMVKXGU'ZGORNCTOKVHGKPGT2CVKPCUGJTUEJÌPpXQT\ÒINKEJ 


SACHSEN

297

297 1,5:1



4GKEJUVCNGT&TGUFGP'TDN·PFKUEJGT*CNDVCNGT%NCW­-CJPV 8QPITQ­GT5GNVGPJGKV*GTTNKEJG2CVKPCUGJTUEJÌPpXQT\ÒINKEJ

 

298



$TGKVGT FQRRGNVGT 4GKEJUVCNGT  &TGUFGP CWH FKG )TWPFUVGKPNGIWPI FGT -CRGNNG KP FGT/QTKV\DWTI I&CX5EJPGG  5GJTCVVTCMVKXGU'ZGORNCTOKVRTCEJVXQNNGT2CVKPCXQT\ÒINKEJp5VGORGNINCP\ 

299 (doppelt)



1,5:1 299 (doppelt)

&QRRGNVGT9GEJUGNVCNGT&TGUFGPI&CX5EJPGG 8QPITÌ­VGT5GNVGPJGKV #VVTCMVKXGU'ZGORNCTOKVHGKPGT2CVKPCYKP\4CPFHGJNGTUGJTUEJÌPpXQT\ÒINKEJ

 97


SACHSEN

300 (vierfach)



8KGTHCEJG6CNGTMNKRRGPCEJ\KPPCKUEJGO(W­&TGUFGPCWHFKG'TÌHHPWPIFGUPGWGP5EJKG­JCWUGU I+1*Û)'14)Û++Û&)Û&7:Û5#:Û+7.Ù%.+8Ù/106Û'.'%6Û)GJCT PKUEJVGU $TWUVDKNF T OKV WOIGNGIVGO /CPVGN KP FGP 'EMGP LG GKP 9CRRGPUEJKNF$'; Û '+0 Û    9';*70) Û &'5 Û  %*74( Ù 0'7'4$#7  6'0 Û 5%*+5*#75'5 Û  +0 Û &4'5&'0 Û    /&%.::8+++   GKPRWP\KGTV  Û 6*#. Ù WOJGT .QTDGGT WPF 2CNO\YGKI KP FGP 'EMGP LG GKP   9CRRGPUEJKNF&CX5EJPGG  8QPCNNGTITÌ­VGT5GNVGPJGKV'KP\KIDGMCPPVGU'ZGORNCT5GJTUEJÌPpXQT\ÒINKEJ  5GKV #PHCPI FGU  ,CJTJWPFGTVU JCVVGP UKEJ 5EJÒV\GPYGVVDGYGTDG CNU OC­IGDNKEJGT $GUVCPFVGKN FGU .GDGPU CO   &TGUFPGT *QH GVCDNKGTV &KGUG OKV FGT #TODTWUV WPF FGO 5VCJNDQIGP UQYKG OKV (GWGTYCHHGP CWUIGVTCIGPGP   JÌHKUEJGP .WUVUEJKG­GP HCPFGP KJT 8QTDKNF KO TGKEJGP (GUVDTCWEJVWO FGU UV·FVKUEJGP 5EJÒV\GPYGUGPU $GUQPFGTG   #VVTCMVKQPGPFGT9GVVM·ORHGYCTGPHGUVNKEJG)GNCIG6CP\XGTIPÒIGP5EJCWM·ORHGGVE&CUJQJG+PVGTGUUG,QJCPP )GQTIU ++ CP FKGUGP .WUVUEJKG­GP QHHGPDCTV UKEJ XQT CNNGO KP FGO CO  ,WNK  DGIQPPGPGP 0GWDCW FGU   MWTHÒTUVNKEJGP 5EJKG­JCWUGU YGNEJGU  KO 4CJOGP FGT &WTEJNCWEJKIUVGP <WUCOOGPMWPHV OKV \CJNTGKEJGP   9GVVUEJKG­GPGKPIGYGKJVYWTFGYQTCWHFKGXQTNKGIGPFGXKGTHCEJG6CNGTMNKRRG$G\WIPKOOV

301

302

303



(TKGFTKEJ#WIWUV+ #WIWUVFGT5VCTMG 4GKEJUVCNGT&TGUFGP&CX5EJPGG  (GKPG2CVKPCUGJTUEJÌPpXQT\ÒINKEJ





4GKEJUVCNGT&TGUFGP&CX5EJPGG

48QT\ÒINKEJ





4GKEJUVCNGT&TGUFGP&CX5EJPGG 445GJTCVVTCMVKXGU'ZGORNCTOKVJGTTNKEJGT2CVKPCXQT\ÒINKEJ

 

98


SACHSEN

305

304

304



6CNGTMNKRRGPCEJ.GKR\KIGT(W­&TGUFGPCWHFCU8QIGNUEJKG­GP\W'JTGPFGT.CPFUV·PFG&CX 5EJPGG 44*GTTNKEJG2CVKPCXQT\ÒINKEJ





6CNGT&TGUFGP&CX-CJPV 4#VVTCMVKXGU'ZGORNCTOKVJÒDUEJGT2CVKPCYKP\5EJTÌVNKPIUHGJNGTHCUVXQT\ÒINKEJ

 

306



5KNDGTOGFCKNNGWPUKIPKGTV5VCOODCWOOGFCKNNGKO)GYKEJVXQP4GKEJUVCNGTP$TWUVDKNF(TKGFTKEJ #WIWUVU+TWOIGDGPXQPFGPCEJV$TWUVDKNFGTPFGT-WTHÒTUVGPFGTCNDGTVKPKUEJGP.KPKG-WTYCRRGP WOJGT FKG UGEJU $TWUVDKNFGT FGT -WTHÒTUVGP FGT GTPGUVKPKUEJGP .KPKG /KV 4CPFRWP\G ,5  OO   I5NI/GTUGD FQTVKP$TQP\G  44-N5VGORGNHGJNGTMN-TCV\GTHCUVXQT\ÒINKEJ 

308 307

307



4GKEJUVCNGT&TGUFGPCWHFCU8KMCTKCV&CX5EJPGG 2TCEJVXQNNG2CVKPCUGJTCVVTCMVKXGUXQT\ÒINKEJGU'ZGORNCT

 



4GKEJUVCNGT&TGUFGPCWHFCU8KMCTKCV-CJPV



*ÒDUEJG2CVKPCXQT\ÒINKEJGU'ZGORNCT

99


SACHSEN

309

309 1,5:1



5GEJUGEMKIG4GKEJUVCNGTMNKRRG&TGUFGPXQPFGT5EJPGRRGT)GUGNNUEJCHVCWHFCU5EJKG­GPCPN·­ NKEJ FGT 8GTO·JNWPI FGU -WTRTKP\GP #WIWUV UR·VGT -WTHÒTUV (TKGFTKEJ #WIWUV ++  OKV 'T\JGT\QIKP   /CTKC ,QUGRJC XQP ¤UVGTTGKEJ  I )GMTÌPVGU /QPQITCOO \YKUEJGP 2CNO\YGKIGP5RTWEJDCPF   ÒDGTUGEJUUVGTPHÌTOKICPIGQTFPGVGP$QN\GP&CX5EJPGG  8QPITQ­GT5GNVGPJGKV2TCEJVGZGORNCT8QT\ÒINKEJp5VGORGNINCP\  /CTKC,QUGRJCYCTGKPG6QEJVGT-CKUGT,QUGHU+WPFFGUUGP)GOCJNKP#OCNKC9KNJGNOKPGXQP$TCWPUEJYGKI%CNGP DGTIJGKTCVGVGUKGKP9KGP(TKGFTKEJ#WIWUV++XQP5CEJUGPFGP5QJP#WIWUVUFGU5VCTMGPYGNEJGTDGTGKVU  KP $QNQIPC \WO MCVJQNKUEJGP )NCWDGP MQPXGTVKGTV YCT WO YKG UGKP 8CVGT CNU #PY·TVGT HÒT FKG RQNPKUEJG   -TQPGKP(TCIG\WMQOOGP&KG*GKTCVOKV/CTKC,QUGRJCGTUEJKGPFGOU·EJUKUEJGP-ÌPKI\YGEMO·­KIFCOKVUKEJ 5CEJUGP IGIGP FCU KOOGT UV·TMGT YGTFGPFG 2TGW­GP DGUUGT DGJCWRVGP MQPPVG #WU FGT 'JG UVCOOVGP KPUIGUCOV   HÒPH\GJP-KPFGTXQPFGPGPGNHFCU-KPFGUCNVGTÒDGTNGDVGP

310

311

312



4GKEJUVCNGT&TGUFGPCWHFKG8GTO·JNWPIUGKPGU5QJPGU-WTRTKP\#WIWUVOKV'T\JGT\QIKP/CTKC ,QUGRJCXQP¤UVGTTGKEJ&CX5EJPGG #VVTCMVKXGU'ZGORNCTOKVHGKPGT2CVKPCYKP\4CPFHGJNGTHCUVXQT\ÒINKEJ

 



 4GKEJUVCNGT  &TGUFGP CWH FKG 8GTO·JNWPI UGKPGU 5QJPGU -WTRTKP\ #WIWUV OKV 'T\JGT\QIKP   /CTKC,QUGRJCXQP¤UVGTTGKEJ-CJPV *ÒDUEJG2CVKPCXQT\ÒINKEJGU'ZGORNCT





4GKEJUVCNGT&TGUFGP&CX5EJPGG #VVTCMVKXGU'ZGORNCTOKVJÒDUEJGT2CVKPCUGJTUEJÌP

100

 


SACHSEN

313

314

315



(TKGFTKEJ#WIWUV++4GKEJUVCNGT&TGUFGP&CX5EJPGG *ÒDUEJG2CVKPCUGJTUEJÌPpXQT\ÒINKEJ

 



4GKEJUVCNGT&TGUFGP&CX5EJPGG (GKPG2CVKPCYKP\2T·IGUEJY·EJGCVVTCMVKXGUHCUVXQT\ÒINKEJGU'ZGORNCT

 



4GKEJUVCNGT&TGUFGP#WUDGWVG&CX/ÒUGNGT5EJPGG  442TCEJVGZGORNCT*GTTNKEJG2CVKPC4CPFHGJNGTUGJTUEJÌP



316



-QPX6CNGT.GKR\KI-QJN

8QPITQ­GT5GNVGPJGKV5GJTUEJÌP



317



:CXGT5KNDGTOGFCKNNGXQP-9*ÌEMPGTCWHFKG)TWPFUVGKPNGIWPIFGT-TGW\MKTEJG KP&TGUFGP<GKNGP5EJTKHV#PUKEJVFGT-KTEJGOOI5NI/GTUGD   44*ÒDUEJG2CVKPCXQT\ÒINKEJGU'ZGORNCT

 101


SACHSEN

318



320

319

-QPX6CNGT&TGUFGP2T·OKGFGT$GTICMCFGOKG(TGKDGTI&CX/ÒUGNGT5EJPGG 42TCEJVGZGORNCT*GTTNKEJG2CVKPCHCUV5VGORGNINCP\





-QPX6CNGT&TGUFGP&CX5EJPGG

8QT\ÒINKEJp5VGORGNINCP\





(TKGFTKEJ#WIWUV+++ + -QPX6CNGT.GKR\KI$WEM  8QPITQ­GT5GNVGPJGKV*ÒDUEJG2CVKPCMN-TCV\GTUGJTUEJÌP



321





 102

322

323

-QPX6CNGT&TGUFGP(NGK­VCNGT6[ROKVMNGKPGT.QEMG)GJCTPKUEJVGU$TWUVDKNFTOKVWOIG NGIVGO /CPVGN/KV FGO -WTJWV DGNGIVGU 9CRRGP WOJGT .QTDGGT\YGKIG +P 752NCUVKMJQNFGT FGT   0)%OKVFGT$GYGTVWPI/5&CX5EJPGG  8QPITQ­GT5GNVGPJGKV2TCEJVGZGORNCTXQPRQNKGTVGP5VGORGNPXQT\ÒINKEJp5VGORGNINCP\ 

5#%*5'0-¤0+)4'+%*

(TKGFTKEJ#WIWUV+-QPX6CNGT5)*2TQDGOKVNGKEJVIGÌHHPGVGO/WPFI #-5&CXp-CJPVp5VWV\OCPP2+6JWPp  8QPITQ­GT5GNVGPJGKV(GKPG2CVKPC'TUVCDUEJNCIYKP\5EJTÌVNKPIUHGJNGTHCUV5VGORGNINCP\  -QPX6CNGT+)55EJNCHTQEMVCNGT#-5&CX#-CJPV6JWP  44/KPLWUVKGTVXQT\ÒINKEJ




SACHSEN

324



(TKGFTKEJ #WIWUV ++  8GTGKPUFQRRGNVCNGT  ( 2T·OKG FGT #MCFGOKG HÒT (QTUV WPF   .CPFYKTVGKP6JCTCPFV#-5&CX-CJPV6JWP  8QPITQ­GT5GNVGPJGKV0WT'ZGORNCTGIGRT·IV(CUV5VGORGNINCP\ 

326

325

325





,QJCPP  5KNDGTOGFCKNNG \W GKPGO FQRRGNVGP 8GTGKPUVCNGT  XQP ) , $WUEJPKEM WPF   # 5VCPIGT CWH FCU L·JTKIG $GUVGJGP FGT $GTICMCFGOKG (TGKDGTI $TWUVDKNFGT ,QJCPPU WPF :CXGTU   PGDGPGKPCPFGT N#NNGIQTKUEJG (TCWGPIGUVCNV 5KPPDKNF FGT $GTICMCFGOKG WPF FGT 9KUUGPUEJCHV UKV\V   \YKUEJGP \YGK ,ÒPINKPIGP FGT NKPMG CNU $GTIOCPP FGT TGEJVG CNU *ÒVVGPOCPP IGMNGKFGV  OO   I#-5D/ÒUGNGT 40WT'ZGORNCTGIGRT·IV(GKPG2CVKPCXQT\ÒINKEJp5VGORGNINCP\

 

8GTGKPUVCNGT$(TKGFGPUVCNGT#-5&CX-CJPV6JWP -CDKPGVVUVÒEM2TCEJVXQNNG2CVKPCRQNKGTVG2NCVVG

 

327

5#%*5'0<'+6<*'4<1)67/ 

/QTKV\  4GKEJUVCNGT  CWH FGP $CW FGU 5EJNQUUGU /QTKV\DWTI KP <GKV\ &CX    5EJPGG 44-CDKPGVVUVÒEM2TCEJVXQNNG2CVKPCHCUV5VGORGNINCP\  -WTUCEJUGPGTNKVVGTJGDNKEJGVGTTKVQTKCNG8GTNWUVGCNU-WTHÒTUV,QJCPP)GQTI+FWTEJUGKP6GUVCOGPVUGKPGLÒPIGTGP 5ÌJPG#WIWUV%JTKUVKCPWPF/QTKV\OKVWOHCPITGKEJGP)GDKGVGPCWUUVCVVGVGWPFFGT·NVGUVG5QJP,QJCPP)GQTI++ FKGU KO *CWRVXGTINGKEJ \W &TGUFGP CO  #RTKN  CPGTMCPPVG 5Q GPVUVCPFGP FKG FTGK MWTU·EJUKUEJGP   0GDGPNKPKGP 5CEJUGP9GK­GPHGNU 5CEJUGP/GTUGDWTI WPF 5CEJUGP<GKV\ &CU *GT\QIVWO 5CEJUGP<GKV\ WOHC­VG   CW­GT FGO XQTJGTKIGP 5VKHV 0CWODWTI<GKV\ FGP 8QIVN·PFKUEJGP WPF 0GWUV·FVGT -TGKU 6CWVGPDWTI WPF FGP   CNDGTVKPKUEJGP #PVGKN CP *GPPGDGTI &GT GTUVG *GT\QI NKG­ FKG CWHYGPFKIG /QTKV\DWTI GTDCWGP YQTCWH FKG JKGT   CPIGDQVGPG2T·IWPI$G\WIPKOOV

103


SACHSEN

328

5#%*5'0*'4<1)67/ 'TPGUVKPGTPCEJFGO8GTNWUVFGT-WTYÒTFG  

,QJCPP(TKGFTKEJ+FGT)TQ­OÒVKIGCNU*GT\QI6CNGT5CCNHGNFOKV6KVGN-CTNU8 &CX5EJPGG *ÒDUEJG2CVKPCUGJTUEJÌPpXQT\ÒINKEJ

329



1,5:1



329

 6CNGT  5CCNHGNF OKV 6KVGN -CTNU 8  I $TWUVDKNF N FCTWPVGT \YGK CPGKPCPFGTIGNGJPVG   9CRRGPUEJKNFG)GMTÌPVGT&QRRGNCFNGTCWHFGT$TWUV4GKEJUCRHGN-QRRGD  8QPITQ­GT5GNVGPJGKV(GKPG2CVKPCYKP\4CPFHGJNGTUGJTUEJÌPpXQT\ÒINKEJ  +PVGTGUUCPVKUVFKGFGWVNKEJGTMGPPDCTG0CTDGFKGUKEJWPVGTFGO#WIGFGU*GT\QIUDGHKPFGV&KGUG9WPFGUQNNGT UKEJKPFGT5EJNCEJVDGK/ÒJNDGTIY·JTGPFFGU5EJOCNMCNFKUEJGP-TKGIGUCPFGT5GKVGFGT2TQVGUVCPVGPIGIGP -CKUGT-CTN8\WIG\QIGPJCDGP6GPV\GNGTY·JPVFTGK<GWIGPFKGUGU'TGKIPKUUGUPCEJFGTGP#WUUCIGPUKEJFGT -WTHÒTUVVCRHGTIGYGJTGVWPFFCTÒDGTGKPG9WPFGKONKPMGP$CEMGPDGMQOOGPWPFICP\WPFICTOKV$NWVDG UEJYGK­VYCT

330



,QJCPP(TKGFTKEJ++4GKEJUVCNGT5CCNHGNF)GOGKPUEJCHVURT·IWPIOKVUGKPGO$TWFGT ,QJCPP9KNJGNOXQP5CEJUGP9GKOCT&CX5EJPGG 5GNVGPDGUQPFGTUKPFKGUGT'TJCNVWPI5CWDGTCWUIGRT·IVGU'ZGORNCTOKVHGKPGT2CVKPCXQT\ÒINKEJ

 

331 (doppelt)

5#%*5'0%1$74)'+5'0#%**'4<1)67/ 

104

,QJCPP%CUKOKTWPF,QJCPP'TPUV&KEMGTFQRRGNVGT4GKEJUVCNGT%QDWTII &KG IGJCTPKUEJVGP $TWUVDKNFGT GKPCPFGT IGIGPÒDGT6WPKGTTGKVGT TGKVGV N \W FGP 5GKVGP LG GKP MNGKPGU   9CRRGP WPF FKG IGVGKNVG ,CJTGU\CJN WOJGT 9CRRGPMTCP\ &CX  -Q\KPQYUMK1VVQ4W­    5EJPGG 8QPITQ­GT5GNVGPJGKVXGTOWVNKEJGKP\KIDGMCPPVGU'ZGORNCT 9KP\5COONGT\GKEJGPKO4CPFUGJTUEJÌP 


SACHSEN

332



333

334

4GKEJUVCNGT5CCNHGNF&CX-Q\KPQYUMK1VVQ4W­5EJPGG #VVTCMVKXGUHCUVXQT\ÒINKEJGU'ZGORNCT

 

5#%*5'0#.6'0$74)*'4<1)67/ 

(TKGFTKEJ9KNJGNO++4GKEJUVCNGT5CCNHGNF&CX-GTPDCEJ5EJPGG 5EJÌPG2CVKPCUGJTUEJÌPpXQT\ÒINKEJ



,QUGH8GTGKPUFQRRGNVCNGT#-5&CX-CJPV6JWP  (GKPG2CVKPCXQT\ÒINKEJ

335



336

 

337

8GTGKPUFQRRGNVCNGT#-5&CX-CJPV6JWP  0WT'ZGORNCTGIGRT·IV8QT\ÒINKEJ





8GTGKPUFQRRGNVCNGT#-5&CX-CJPV6JWP





)GQTI8GTGKPUFQRRGNVCNGT+P752NCUVKMJQNFGTFGT#0#OKVFGT$GYGTVWPI/5 #-5&CX-CJPV6JWP 8QT\ÒINKEJ

8QT\ÒINKEJ

 105


SACHSEN

338

339

339

5#%*5'09'+/#4*'4<1)67/ 

(TKGFTKEJ9KNJGNOWPF,QJCPP4GKEJUVCNGT5CCNHGNF&CX5EJPGG  4-N4CPFHGJNGTUGJTUEJÌP



9KNJGNO  4GKEJUVCNGT  9GKOCT CWH FGP 6QF UGKPGU $TWFGTU (TKGFTKEJ &CX    5NI/GTUGD 445EJCTHCWUIGRT·IVGU'ZGORNCTOKVHGKPGT2CVKPCXQT\ÒINKEJp5VGORGNINCP\ 

341



340



342

,QJCPP 'TPUV  4GKEJUVCNGT  9GKOCT CWH FGP 6QF UGKPGT )GOCJNKP %JTKUVKCPG   'NKUCDGVJXQP5EJNGUYKI*QNUVGKP5QPFGTDWTI&CX.CPIG5EJPGG  44(GKPG2CVKPCUGJTUEJÌPpXQT\ÒINKEJ 

%JTKUVKCPG 'NKUCDGVJ YCT FKG 6QEJVGT FGU *GT\QIU ,QJCPP %JTKUVKCP XQP *QNUVGKP5QPFGTDWTI WPF FKG 'PMGNKP XQP   *GT\QI#NGZCPFGT5KGYWTFGCO,WPKIGDQTGPWPFJGKTCVGVGCO#WIWUV,QJCPP'TPUVFGPNVGTGP *GT\QI XQP 5CEJUGP9GKOCT 5KG UVCTD CO  ,WPK  &KG 2T·IWPIGP CWH KJTGP 6QF YWTFGP XQP ,QJCPP   %JTKUVQRJ&ÒTTIGRT·IVFGTXQP/ÒP\OGKUVGTKP9GKOCTYCT



%CTN(TKGFTKEJ8GTGKPUFQRRGNVCNGT#-5&CX-CJPV6JWP *GTTNKEJG2CVKPCMN4CPFHGJNGTXQT\ÒINKEJ

 



%CTN#NGZCPFGT8GTGKPUFQRRGNVCNGT#-5&CX-CJPV6JWP *ÒDUEJG2CVKPCYKP\4CPFHGJNGTXQT\ÒINKEJ

 

106


SACHSEN

343

343 1,5:1

5#%*5'0,'0#*'4<1)67/ 

$GTPJCTF  4GKEJUVCNGT  'KUNGDGP  I )GJCTPKUEJVGU $TWUVDKNF T OKV *CNUVWEJ   WPF WOIGNGIVGO /CPVGN)GMTÌPVGU OGJTHGNFKIGU 9CRRGP \W FGP 5GKVGP 2CNO WPF .QTDGGT\YGKI   QDGP PGDGP FGT -TQPG FKG IGVGKNVG ,CJTGU\CJN QDGP PGDGP FGO 9CRRGP FKG 5KIPCVWT #$  -  

#PVQP$GTPJCTF-QDWTIGT/ÒP\OGKUVGTKP'KUNGDGP &CX5EJPGG  8QPITQ­GT5GNVGPJGKV*GTTNKEJG2CVKPCXQT\ÒINKEJ 

344

5#%*5'0)16*#*'4<1)67/#$5#%*5'0)16*##.6'0$74) 

'TPUV FGT (TQOOG  4GKEJUVCNGT  )QVJC CWH UGKPGP 6QF &CX  5EJPGG    5VGIWYGKV  5GJTUGNVGPDGUQPFGTUKPFKGUGT'TJCNVWPI*GTTNKEJG2CVKPCYKP\5EJTÌVNKPIUHGJNGTXQT\ÒINKEJ 

345 (1 1/2-fach)

345 (1 1/2-fach) 1,5:1



(TKGFTKEJ++HCEJGT4GKEJUVCNGT)QVJC(COKNKGPVCNGTI(4+&'4+%85 ++ Ü & Ü ) Ü &8: Ü 5#:1)16*#085 WPVGP DQIKI .KNKG  %#4+ )'0+614+5 +/#)1 .KNKG    )GJCTPKUEJVG $ÒUVG T FCTWPVGT 5KIPCVWT - Û , % -QEJ /GFCKNNGWT KP )QVJC      5'26'0#4+85 (4#648/ '6 &8%8/ 5#:10+“ &KG GKPCPFGT \WIGYCPFVGP $ÒUVGP FGT UKGDGP   2TKP\GPOKVKJTGP0COGPKPQXCNGPXQP2CNO\YGKIGPIGTCJOVGP/GFCKNNQPUKPFGT/KVVGFKG$ÒUVGFGU ·NVGUVGP 2TKP\GP WPF UR·VGTGP *GT\QIU (TKGFTKEJ +++ WPVGP m  m &CX  #PO 5EJPGG    5VGIWYGKV 44*ÒDUEJG2CVKPCXQT\ÒINKEJ  107


SACHSEN

347

346



346

(TKGFTKEJ+++-QPX6CNGT)QVJC&CX#5EJPGG5VGIWYGKV  2TCEJVGZGORNCTOKVHGKPGT6ÌPWPI5VGORGNINCP\



5#%*5'0/'+0+0)'0*'4<1)67/810$+55#%*5'0  %1$74)/'+0+0)'0 

$GTPJCTF 'TKEJ (TGWPF  -QPX6CNGT Q ,   CWH FGP 6QF UGKPGU 8CVGTU *GT\QI   )GQTICO9GKJPCEJVUHGUV#-5C&CX-CJPV6JWP 4(GKPG2CVKPCXQT\ÒINKEJ 

348

349

350



8GTGKPUFQRRGNVCNGT#-5&CX-CJPV6JWP *GTTNKEJG2CVKPCYKP\5EJTÌVNKPIUHGJNGTCO4CPFXQT\ÒINKEJp5VGORGNINCP\

 



8GTGKPUFQRRGNVCNGT#-5&CX-CJPV6JWP



8QT\ÒINKEJ

5#%*5'0*+.&$74)*#75'0*'4<1)67/ 

,QUGH(TKGFTKEJ8QTOWPFHÒT(TKGFTKEJ-QPX6CNGTQ,  *KNFDWTIJCWUGP CWHUGKPGP6QF&CX*QNNOCPP5EJPGG 5GNVGPKPFKGUGT'TJCNVWPI*GTTNKEJG2CVKPCUGJTCVVTCMVKXGUXQT\ÒINKEJGU'ZGORNCT 2TKP\,QUGRJ(TKGFTKEJTGIKGTVGUGKVFGO0QXGODGTCNU8QTOWPFHÒTFGP'TDRTKP\GP(TKGFTKEJ#WEJPCEJ FGT 8QNNL·JTKIMGKV FGU 6JTQPHQNIGTU YWTFG FKG 8QTOWPFUEJCHV CWHTGEJV GTJCNVGP YGKN UKEJ ,QUGRJ (TKGFTKEJ CNU   H·JKIGT4GIGPVDGY·JTVJCVVG'TUVPCEJFGO6QFFGU8QTOWPFUVTCV(TKGFTKEJCO#RTKNFKG4GIGPVUEJCHV FGU*GT\QIVWOUCP

108

 


SACHSEN

352

353

351 (doppelt)

5#%*5'05##.('.&*'4<1)67/#$5#%*5'0%1$74)5##.('.& 

,QJCPP'TPUV8+++&QRRGNVGT4GKEJUVCNGT5CCNHGNFI&Ù)Ù+1*#00'5 '40'5675 Û 8+++ Û &7: 5#:10+“ “ )GJCTPKUEJVGU $TWUVDKNF T FKG NKPMG *CPF NKGIV CWH GKPGO   *GNOOKV)KVVGTXKUKGTWPF(GFGTUEJOWEM+7.+“Û%.+8+“Û'6Û/106+7/5GEJUHCEJDGJGNOVGU 9CRRGPQDGP\WFGP5GKVGPFKGIGVGKNVG,CJTGU\CJNÛÛ&CX5EJPGG  8QPITÌ­VGT5GNVGPJGKV(GKPG2CVKPCUGJTUEJÌP 



4GKEJUVCNGT  5CCNHGNF #WUDGWVG FGT 5CCNHGNFGT )TWDGP &CX  -Q\KPQYUMK1VVQ4W­    /ÒUGNGTC5EJPGG 448QT\ÒINKEJGU2TCEJVGZGORNCTOKVJGTTNKEJGT2CVKPC 



4GKEJUVCNGT  5CCNHGNF #WUDGWVG FGT 5CCNHGNFGT )TWDGP &CX  -Q\KPQYUMK1VVQ4W­    /ÒUGNGT5EJPGG 445GJTCVVTCMVKXGUXQT\ÒINKEJGU'ZGORNCT 

354

1,5:1

1,5:1

5#%*5'0%1$74)70&)16*#*'4<1)67/ 

'TPUV+-QPX6CNGT#-5&CXp-CJPV6JWP  8QPITQ­GT5GNVGPJGKV-N(NGEMXQT\ÒINKEJ

 109


SACHSEN

355

356

357



8GTGKPUFQRRGNVCNGT#-5&CX-CJPV6JWP *GTTNKEJG2CVKPCXQT\Ã&#x2019;INKEJp5VGORGNINCP\

 



8GTGKPUFQRRGNVCNGT#-5&CX-CJPV6JWP

8QT\Ã&#x2019;INKEJ





8GTGKPUFQRRGNVCNGT#-5&CX-CJPV6JWP *GTTNKEJG2CVKPCXQT\Ã&#x2019;INKEJp5VGORGNINCP\

 

358



'TPUV++8GTGKPUFQRRGNVCNGT#-5&CX-CJPV6JWP  8QT\Ã&#x2019;INKEJ



359

1,5:1

 110

1,5:1

8GTGKPUVCNGT#-5&CX-CJPV6JWP -CDKPGVVUVÃ&#x2019;EM2TCEJVXQNNG2CVKPC5VGORGNINCP\

 


SCHLESIEN

361

362

360

5%*.'5+'0 .+')0+6<$4+')*'4<1)67/ 

,QJCPP%JTKUVKCPWPF)GQTI4WFQNH4GKEJUVCNGT4GKEJGPUVGKP&CX(W5 5GJTUGNVGPKPFKGUGT'TJCNVWPI 9KP\5EJTÌVNKPIUHGJNGTCO4CPFCVVTCMVKXGUXQT\ÒINKEJGU'ZGORNCT





)GQTI.WFYKIWPF%JTKUVKCP4GKEJUVCNGT$TKGI&CX(W5 45GJTCVVTCMVKXGU'ZGORNCTOKVRTCEJVXQNNGT2CVKPCXQT\ÒINKEJ

 



)GQTI+++4GKEJUVCNGT$TKGI&CX(W5  5GJTUGNVGPDGUQPFGTUKPFKGUGT'TJCNVWPI 5GJTCVVTCMVKXGU'ZGORNCTOKVHGKPGT2CVKPCXQT\ÒINKEJ



364

363





363

%JTKUVKCP4GKEJUVCNGT$TKGI&CX(W5  5GJTUGNVGPDGUQPFGTUKPFKGUGT'TJCNVWPI 5GJTCVVTCMVKXGU'ZGORNCTOKVJGTTNKEJGT2CVKPCXQT\ÒINKEJ



4GKEJUVCNGT$TKGI(W5  5GJTUGNVGPDGUQPFGTUKPFKGUGT'TJCNVWPI*GTTNKEJG2CVKPCXQT\ÒINKEJ

 111


SCHLESWIG-HOLSTEIN

365

366 (doppelt)

366 (doppelt)

,)'40&14(*'4<1)67/ 

)GQTI(TKGFTKEJ6CNGT,·IGTPFQTH&CX(W5  4*ÒDUEJG2CVKPCUGJTUEJÌP





&QRRGNVGT4GKEJUVCNGT,·IGTPFQTHI&CX(W5 44(GKPG2CVKPC\YGKYKP\2WP\GPKO4CPFCVVTCMVKXGUXQT\ÒINKEJGU'ZGORNCT

 

367

367 1,5:1

5%*.'59+)*1.56'+0 -¤0+).+%*&0+5%*'4#06'+. 

%JTKUVKCP 8++  5RGEKGUVCNGT 4GVJYKUEJ&CX FQTVWPVGT&·PGOCTM *GFG .CPIGp 8QPITQ­GT5GNVGPJGKV0WT'ZGORNCTGIGRT·IV 5GJTCVVTCMVKXGU'ZGORNCTOKVJÒDUEJGT2CVKPCUGJTUEJÌPpXQT\ÒINKEJXQT\ÒINKEJ 

368

 112

#NDGTVWUVCNGT#NVQPC&CX*GFG$.CPIGp 4#VVTCMVKXGU'ZGORNCTOKVJÒDUEJGT2CVKPCUGJTUEJÌP

 


SCHWARZBURG

370

369

 

369

5%*9$+5%**#..

56#&6

6CNGTOKV6KVGN-CTNU8&CX#4CHH

5GJTUGNVGPKPFKGUGT'TJCNVWPI8QT\ÒINKEJ



4GKEJUVCNGT0ÒTPDGTIOKV6KVGN-CTNU8++&CX#4CHH 4-CDKPGVVUVÒEM2TCEJVXQNNG2CVKPCHCUV5VGORGNINCP\

 

371

372

373

5%*9#4<$74) 5%*9#4<$74)#4056#&6)4#(5%*#(6 

#PVQP)ÒPVJGT++4GKEJUVCNGT#TPUVCFV&CX(KUEJGT  448QT\ÒINKEJGU2TCEJVGZGORNCT



5%*9#4<$74)510&'45*#75'0)4#(5%*#(65'+6(ª456'067/ 

)ÒPVJGT(TKGFTKEJ%CTN++8GTGKPUFQRRGNVCNGT#-5&CX-CJPV6JWP  0WT'ZGORNCTGIGRT·IV2TCEJVGZGORNCT*GTTNKEJG2CVKPCHCUV5VGORGNINCP\



5%*9#4<$74)47&1.56#&6)4#(5%*#(65'+6(ª456'067/ 

(TKGFTKEJ)ÒPVJGT8GTGKPUFQRRGNVCNGT#-5&CX-CJPV6JWP (GKPG2CVKPCXQT\ÒINKEJp5VGORGNINCP\

  113


SCHWARZENBERG

376

375

374

(ª456'0

5%*9#4<'0$'4)



(GTFKPCPF9KNJGNO'WUGDKWU4GKEJUVCNGT9KGPCWHUGKPG*QEJ\GKVOKV/CTKC#PPC 'TDKPFGT.CPFITCHUEJCHV5WN\ -NGVVICW &CX6CPPKEJ (CUVXQT\ÒINKEJ





4GKEJUVCNGT  -TGOPKV\ CWH UGKPG *QEJ\GKV OKV /CTKC #PPC 'TDKP FGT .CPFITCHUEJCHV 5WN\  

-NGVVICW &CX6CPPKEJ 5GJTUEJÌPpXQT\ÒINKEJ





4GKEJUVCNGT0ÒTPDGTI&CX6CPPKEJ

44*GTTNKEJG2CVKPCOKPLWUVKGTVXQT\ÒINKEJ



378

377

377



#FCO(TCP\4GKEJUVCNGT ,CJTGU\CJNKO5VGORGNCWUIG·PFGTV 9KGP#WUDGWVG &CX/ÒUGNGT6CPPKEJ 442TCEJVGZGORNCT(GKPG2CVKPCXQT\ÒINKEJp5VGORGNINCP\





,QJCPP0GRQOWM-QPX6CNGT9KGP&CX6CPPKEJ  2TCEJVGZGORNCT8QT\ÒINKEJp5VGORGNINCP\



114


SOLMS

379

380

51./5.+%*)4#(5%*#(6

380

51./5



'TPUV++-NKRRG\W-TGW\GTP5ÌFGNOKV6KVGNXQP/CVVJKCU,QUGRJ  8QPITQ­GT5GNVGPJGKV5GJTUEJÌP





2JKNKRR4GKEJUVCNGT.KEJOKV6KVGN(GTFKPCPFU++,QUGRJ  8QPITQ­GT5GNVGPJGKV5GJTUEJÌPGU'ZGORNCTOKVUEJÌPGT6ÌPWPI



)TCH2JKNKRRIGJÌTVG\WLGPGPMNGKPGTGP.CPFGUJGTTGPFKGKPFGTITQ­GP-KRRGT\GKVIGTKPIJCNVKIG/ÒP\GPCWURT·IGP NKG­GPWOUKGWPCWHH·NNKIKPFGP)GNFXGTMGJTITÌ­GTGT*CPFGNUUV·FVGGKP\WUEJNGWUGP5QXGTDQVFKG5VCFV(TCPMHWTV FKGDGUQPFGTUFKG5QNOUGT)TCHGPFGT-KRRGTGKXGTF·EJVKIGCO1MVQDGT\YGKXGTUEJKGFGPG6CNGT2JKNKRRU QDYQJN UKG  CP \KGONKEJ XGTUVGEMVGT 5VGNNG  FKG MQTTGMVG 9GTVCPICDG +8 (.  )WNFGP  WPF ++ (.  )WNFGP    VTWIGP &GT JKGT CPIGDQVGPG *CNDVCNGT XQP  FGT CNU 9GTV\CJN WPIGYÌJPNKEJGTYGKUG FGP 6GKNYGTV FGU 6CNGTU  

 \GKIVKUVYKGFKGOGKUVGP2T·IWPIGPPCEJFGO'PFGFGT-KRRGT\GKVYKGFGTIWVJCNVKICWUIGDTCEJV'T\·JNV \WFGPITQ­GP4CTKV·VGPFGTJGUUKUEJGP0WOKUOCVKM

381

51./5*1*'051./5)4#(5%*#(6 

2JKNKRR 4GKPJCTF +  4GKEJUVCNGT  9QNHGPDÒVVGN 5QIGPCPPVGT *CJPTGKVCNGT   &CX#,QUGRJ 449KP\5EJTÌVNKPIUTKUUGHGKPG6ÌPWPIUGJTUEJÌPpXQT\ÒINKEJ 

)TCH 2JKNKRR 4GKPJCTF  ,WNK  Ó ,WPK  VTCV  KP F·PKUEJG &KGPUVG #NU 5VCVVJCNVGT FGU -ÌPKIU   %JTKUVKCP +8 XQP &·PGOCTM PCJO GT KO UGNDGP ,CJT 9QNHGPDÒVVGN GKP WPF NKG­ KP FGT JGT\QINKEJGP /ÒP\UV·VVG   9QNHGPDÒVVGN )QNF WPF 5KNDGTOÒP\GP RT·IGP &GT 0COG *CJPTGKVCNGT GPVUVCPF CWU GKPGT #PURKGNWPI CWH   FCU 9QTV 8+%#4++ 8KECTKWU 5VGNNXGTVTGVGT  KP FGT 8QTFGTUGKVGPWOUEJTKHVFC2JKNKRR4GKPJCTFUGKPG8QNNOCEJV FCFWTEJ OK­DTCWEJV JCVVG FC­ GT FCU 5KNDGTIGUEJKTT FGU *GT\QIU WPF FCU FWTEJ $TCPFUEJCV\WPI FGU .CPFGU   IGYQPPGPG 5KNDGT KP LGPG 6CNGT XGTOÒP\VG *CJPTGK YWTFG P·ONKEJ KO 8QNMUOWPF GKP /CPP IGPCPPV FGT XQP   UGKPGT(TCWKPFGTGJGNKEJGP6TGWGDGVTQIGPYKTF

382



4GKEJUVCNGT9QNHGPDÒVVGN5QIGPCPPVGT*CJPTGKVCNGT&CX,QUGRJ 44-N5EJTÌVNKPIUTK­YKP\5VKHVUNQEJHCUVUGJTUEJÌP

  115


SOLMS

383

385

384



.WFYKI-TGW\GT )WNFGP *QJGPUQNOU&CX,QUGRJC 44-N5EJTÌVNKPIUHGJNGTCO4CPFUGJTUEJÌP

 



-TGW\GT )WNFGP Q,*QJGPUQNOUOKV)GIGPUVGORGNFGU(T·PMKUEJGP-TGKUGUCWHFGT8QTFGTUGKVG 0ÒDGTXGTUEJNWPIGPGO/QPQITCOO(%&CX#,QUGRJ 44/ÒP\GHCUVUGJTUEJÌP)GIGPUVGORGNUGJTUEJÌP

 

51./5)4'+('056'+0)4#(5%*#(6 

9KNJGNO/QTKV\)WNFGPWPDGUVKOOVG/ÒP\UV·VVG&CXp,QUGRJ 8QPITQ­GT5GNVGPJGKV(GKPG6ÌPWPIMN5VGORGNHGJNGTCVVTCMVKXGUHCUVXQT\ÒINKEJGU'ZGORNCT

386

387

 

388

51./5.#7$#%*)4#(5%*#(6 

#NDGTV1VVQ4GKEJUVCNGT.CWDCEJOKV6KVGN(GTFKPCPFU++&CX,QUGRJ  44ªDNKEJGTMN5VGORGNHGJNGTOKPLWUVKGTVUGJTUEJÌP



%JTKUVKCP #WIWUV  4GKEJUVCNGT  0ÒTPDGTI CWH FGP 6QF UGKPGT FTKVVGP )GOCJNKP   &QTQVJGC 9KNJGNOKPG 6QEJVGT FGU 5CEJUGP9GK­GPHGNUKUEJGP *QH WPF -COOGTTCVU 'TPUV <CEJCTKCU   $ÌVVKEJGT&CX,QUGRJ 2TCEJVGZGORNCTOKVCWUFTWEMUXQNNGT2CVKPC(CUV5VGORGNINCP\ 



-QPX6CNGT9GTVJGKOCWHFCUIT·HNKEJYGVVGTCWKUEJG&KTGMVQTKWO&CX,QUGRJD 4*ÒDUEJG2CVKPCOKPLWUVKGTVXQT\ÒINKEJGU'ZGORNCT

116



 


STOLBERG

390

$+567/ 

389

391

52';'4

&COKCP *WIQ XQP 5EJÌPDQTP  UGKV  -QCFLWVQT 5KNDGTOGFCKNNG  XQP ) 9   8GUVPGT 0ÒTPDGTI CWH UGKPG 9CJN \WO $KUEJQH XQP 5RG[GT $TWUVDKNF T KP IGKUVNKEJGO 1TPCV   )GMTÌPVGT .ÌYG NKGIV PCEJ N WPF J·NV 9CRRGPUEJKNF N GKPG YGKDNKEJG )GUVCNV KP 9QNMGP KO *KPVGT   ITWPF-KTEJGPCPUKEJVOOI$GTPJGKOGT'JTGPFD  8QPITQ­GT5GNVGPJGKV9KP\4CPFHGJNGTUGJTUEJÌPpXQT\ÒINKEJ  &KG -CTTKGTG XQP &COKCP *WIQ XQP 5EJÌPDQTP YCT DGOGTMGPUYGTV XKGNUGKVKI 0CEJ 5VWFKGP KP 4QO .GKFGP WPF   .GWXGPWPF/KNKV·TFKGPUVCNU1HHK\KGTKPFGT4GKEJUCTOGGVTCVGTKPFGP&GWVUEJGP1TFGPGKP8QPDKU  DGOÒJVG GT UKEJ CNU 4GKEJUMQOOKUUCT WO FKG 8GTGKPJGKVNKEJWPI FGT *CODWTIGT 4GEJVUXGTJ·NVPKUUG FCPCEJ   YKTMVGGTDKUCNUMCKUGTNKEJGT)GUCPFVGTKP$GTNKPWPFYCTXQPDKU2T·UKFGPVFGU\WT$GGPFKIWPIFGU 0QTFKUEJGP-TKGIGU\WUCOOGPIGVTGVGPGP$TCWPUEJYGKIGT-QPITGUUGU-CKUGT-CTN8+MQPPVGVTQV\9KFGTUVCP FGUFGU2CRUVGUFKG'TPGPPWPI&COKCP*WIQU\WO-CTFKPCNFWTEJUGV\GPYWTFGFGTHT·PMKUEJG#FGNKIG\WO -QCFLWVQT FGU 5RG[GTGT $KUEJQHU GTPCPPV  YWTFG &COKCP *WIQ $KUEJQH XQP 5RG[GT  CWEJ $KUEJQH XQP   -QPUVCP\'TXGTNGIVGFKG4GUKFGP\XQP5RG[GTPCEJ$TWEJUCNKPFCUXQPKJOPGWGTDCWVG5EJNQ­&GT$KUEJQH MQPPVGFWTEJUGKPGIGUEJKEMVG9KTVUEJCHVURQNKVKMWPFUQTIH·NVKIG(KPCP\XGTYCNVWPIUQYQJNUGKPMQUVURKGNKIGU$CWRTQ ITCOOHKPCP\KGTGPCNUCWEJGKPGDGFGWVGPFG)GNFTGUGTXGXQP/KNNKQPGP)WNFGPCWHDCWGP

56#&6 

56#&'

4GKEJUVCNGT  5EJKNNKPI   OKV 6KVGN (GTFKPCPFU ++ 8CTKCPVG OKV XGTMGJTVGT 9GTV\CJN < KO   4GKEJUCRHGN$CJTHE&CX#  4#VVTCMVKXGU'ZGORNCTOKVJÒDUEJGT2CVKPCUGJTUEJÌPpXQT\ÒINKEJ 

561.$'4) 561.$'4)561.$'4)70&561.$'4)4155.#)4#(5%*#(6'0 

%JTKUVQH (TKGFTKEJ WPF ,QUV %JTKUVKCP  4GKEJUVCNGT  5VQNDGTI CWH FGP \YGKVGP 6GK   NWPIUXGTVTCIFGT$TÒFGTCDIGUEJNQUUGPCO,WNK&CX(TKGFGTKEJ 8QT\ÒINKEJ  117


TRIER

392

56#&6 

564#.570&

4GKEJUVCNGT  5EJKNNKPI   ,CJTGU\CJN KO 5VGORGN CWU  IG·PFGTV  OKV 6KVGN (GTFKPCPFU ++   $TCVTKPIXIN&CX 8QPCNNGTITÌ­VGT5GNVGPJGKV5GJTUEJÌPpXQT\ÒINKEJ 

393

'4<$+567/ 

64+'4

,QJCPP 8++ XQP 5EJÌPGPDGTI  4GKEJUVCNGT  -QDNGP\  I k +1#0 Û & Ù ) Ú   #425Û64'8'4'0Û'.'%Ú&GT#RQUVGN2GVTWUUEJTGKVGVNKPFGT4GEJVGP5EJNÒUUGNWPVGTFGO NKPMGP#TO$WEJÛ/10'Û018#ÛÛÛÛ#4)'0Ù%10(.88KGTHGNFKIGU9CRRGPFCT ÒDGT /KVTC FCJKPVGT -TWOOUVCD WPF 5EJYGTV IGMTGW\V \W FGP 5GKVGP FKG IGVGKNVG ,CJTGU\CJN      &CXX5EJTXCT  8QPITQ­GT5GNVGPJGKV5GJTCVVTCMVKXGU'ZGORNCTOKVJGTTNKEJGT2CVKPCHCUVXQT\ÒINKEJ  &GT /ÒP\JGTT FKGUGT UGNVGPGP 2T·IWPI FGUUGP (COKNKG XQP FGO YGUVNKEJ XQP $KPIGP IGNGIGPGP 1TV 5EJÌPGDGTI   UVCOOVG YWTFG CO  ,WNK  XQO 6TKGTGT &QOMCRKVGN \WO 'T\DKUEJQH IGY·JNV #O  ,CPWCT  GTJKGNV   ,QJCPP8++FKGR·RUVNKEJG$GUV·VKIWPIWPFCO#WIWUVGORHKPIGTFKG$KUEJQHUYGKJG&GT'T\DKUEJQHYCT MT·PMNKEJWPF\ÌIGTNKEJWPFUGKPG4GIKGTWPIU\GKVYCTYGPKIINÒEMNKEJ5KGYCT\WFGOÒDGTUEJCVVGVFWTEJ-TKGIGCP FGP)TGP\GPFGU'T\UVKHVUFWTEJOKNKV·TKUEJG&WTEJ\ÒIGFWTEJ/K­GTPVGPFWTEJ4·WDGTDCPFGPWPFFWTEJFKG2GUV 5EJNKOOG#WUOC­GPCJOKPFGP,CJTGPFKG*GZGPJ[UVGTKGDGUQPFGTUKPFGT7OIGDWPI6TKGTUCPYQKP FKGUGT <GKV EC  *GZGPXGTDTGPPWPIGP UVCVVHCPFGP 5GKV  YWTFGP CWEJ 2TQVGUVCPVGP OKV DTWVCNGP /GVJQFGP   XGTHQNIV&GTTGRT·UGPVCVKXG4GKEJUVCNGTFGTFGP#RQUVGN2GVTWU\GKIVKUVGKPGKPFTWEMUXQNNGUJKUVQTKUEJGU&QMWOGPV GKPGTFGTDGFGWVGPFGP-KTEJGPHÒTUVGP\WT<GKVFGT)GIGPTGHQTOCVKQP

394



118

-CTN-CURCTXQPFGT.G[GP4GKEJUVCNGT-QDNGP\#WUDGWVGFGT8KNNOCTGT)TWDGP Iq%#41.%#52#4Û&Ú)Ú#4%*+'2Û64'8+4Û24+0%Û'.'%6Û#&/+Û248//KV -WTJWV DGFGEMVGU QXCNGU 9CRRGP XQP 6TKGT WPF XQP FGT .G[GP CNU /KVVGNUEJKNF 2TÒO FCJKPVGT   -TWOOUVCD WPF 5EJYGTV IGMTGW\Vk k k &108/ Û &'+ Û ': Û (1&+0+5 Û 8+../#4+'05+$85 Û   #001Û/&%.8++/CFQPPCOKV<GRVGTKPFGT4GEJVGPWPFFGO-KPFCWHFGONKPMGP#TOUVGJVXX CWH/QPFUKEJGNWOJGT5VTCJNGPMTCP\&CX/ÒUGNGTX5EJTE  8QPITQ­GT5GNVGPJGKV5GJTCVVTCMVKXGU'ZGORNCTOKVJGTTNKEJGT2CVKPCUGJTUEJÌPpXQT\ÒINKEJ 


ULM

396

395

395



,QJCPP2JKNKRRXQP9CNFGTFQTHH-QPX6CNGT-QDNGP\&CXX5EJT *GTTNKEJG2CVKPCXQT\ÒINKEJp5VGORGNINCP\



%NGOGPU 9GP\GN XQP 5CEJUGP  -QPX6CNGT  -QDNGP\ -QPVTKDWVKQP &CX  #   X5EJTC (GKPG2CVKPCOKPLWUVKGTVXQT\ÒINKEJp5VGORGNINCP\ 

397

56#&6 

1,5:1

 

397

7./

5EJCWVCNGT#WIUDWTI4GIKOGPVUVCNGTI(QTUVGT0CW 445EJCTHCWUIGRT·IVGU'ZGORNCTOKVHGKPGT2CVKPCXQT\ÒINKEJ

0CW UEJTGKDV \W FGO )GYKEJV FGU XQTNKGIGPFGP 5VÒEMGU &KG )GYKEJVG UKPF XÌNNKI WPTGIGNO·­KI YGFGT KO   PQTOCNGP6CNGTPQEJ*CNDVCNGTIGYKEJVUQFC­FKG$G\GKEJPWPI4GIKOGPVUVCNGTUKEJNGFKINKEJCWHFCUVCNGTHÌTOKIG # W U UGJGPDG\KGJVPKEJVCWHKTIGPFGKPG$G\KGJWPI\WO6CNGTCNU0QOKPCN&CJGTKUVCWEJFKG$G\GKEJPWPI 4GIKOGPVUJCNDVCNGTHÒTFKGNGKEJVGTGP5VÒEMGPKEJV\WVTGHHGPFUQPFGTPKTTGHÒJTGPF

 

398



4GKEJUVCNGTOKV6KVGN(GTFKPCPFU+++&CX0CW

48QT\ÒINKEJ

 119


WERDEN UND HELMSTEDT

399

401

400

9#.&'%- )4#(5%*#(65'+6(ª456'067/ 

)GQTI-QPX6CNGT#-5&CX-CJPV6JWP  2TCEJVGZGORNCT(GKPG2CVKPCHCUV5VGORGNINCP\





)GQTI*GKPTKEJ8GTGKPUFQRRGNVCNGT#-5&CX-CJPV6JWP  (CUVXQT\ÒINKEJ





)GQTI8KEVQT8GTGKPUFQRRGNVCNGT#-5&CX-CJPV6JWP 2TCEJVXQNNG2CVKPCXQT\ÒINKEJp5VGORGNINCP\

 

402

403

403

#$6'+

9'4&'070&*'./56'&6



$GPGFKMVXQP)GKUOCT4GKEJUVCNGT-ÌNP&CX)TQVG 442TCEJVXQNNG2CVKPCUGJTUEJÌPpXQT\ÒINKEJ

 



#PUGNOXQP5QPKWU4GKEJUVCNGT$TCWPUEJYGKI&CX)TQVG *ÒDUEJG2CVKPCÒDNKEJGT5VGORGNHGJNGTCO4CPFHCUVXQT\ÒINKEJ

 

120


WÜRTTEMBERG

404

404 1,5:1

56#&6 

914/5

4GKEJUVCNGT&CX,QUGRJD 8QPITQ­GT5GNVGPJGKV#VVTCMVKXGU'ZGORNCTOKVJÒDUEJGT2CVKPCXQT\ÒINKEJ

 

405

9ª466'/$'4) 9ª466'/$'4)*'4<1)67/5'+6-¤0+)4'+%* 

-CTN'WIGP-QPX6CNGT5VWVVICTV&CX-NGKP4CHH 5GJTCVVTCMVKXGU'ZGORNCTOKVCWUFTWEMUXQNNGT2CVKPCXQT\ÒINKEJ

 

406

2:1



2:1

9KNJGNO +  )WNFGP  /ÒP\DGUWEJ FGT -ÌPKIKP WPF FGT MÌPKINKEJGP 2TKP\GUUKPPGP   /KVINCVVGO4CPF#-5,  440WT'ZGORNCTGIGRT·IV2TCEJVGZGORNCTOKVJÒDUEJGT2CVKPCHCUV5VGORGNINCP\  121


WÜRTTEMBERG

407 (doppelt)

409

408

9ª466'/$'4)1'.5*'4<1)67/ 

5[NXKWU(TKGFTKEJ&QRRGNVGT4GKEJUVCNGT1GNUI/ÒP\OGKUVGT5COWGN2HCJNGT )GJCTPKUEJVGU $TWUVDKNF T OKV ITQ­GT #NNQPIGRGTÒEMG WPF WOIGNGIVGO /CPVGN8KGTHCEJ DGJGNOVGU   QXCNGUXKGTHGNFKIGU9CRRGPOKV/KVVGNUEJKNF&CX(W5  442CVKPCMN*GPMGNURWTWPF(GNFGTNGKEJVDGCTDGKVGVHCUVXQT\ÒINKEJGU'ZGORNCT  &GT5VKHVGTFGT.KPKG9ÒTVVGODGTI1GNUGKPGU<YGKIGUFGT9GKNVKPIKUEJGP.KPKGYCT*GT\QI5[NXKWU0KOTQFGKP 5QJPFGU*GT\QIU,WNKWU(TKGFTKEJXQP9ÒTVVGODGTI9GKNVKPIGP'TXGTO·JNVGUKEJOKV'NKUCDGVJ/CTKCFGT GKP\KIGP6QEJVGT-CTN(TKGFTKEJUFGUNGV\VGP*GT\QIUXQP/ÒPUVGTDGTI1GNUKP5EJNGUKGPWPFGTDVGPCEJFGOXKGT 9QEJGP UR·VGT GTHQNIVGP 6QF UGKPGU 5EJYKGIGTXCVGTU FCU (ÒTUVGPVWO 1GNU PGDUV FGP *GTTUEJCHVGP 5VGTPDGTI KP   /·JTGP WPF /GF\KDQT KP 5EJNGUKGP 'T UVCTD  WPF JKPVGTNKG­ XKGT 5ÌJPG ÒDGT FKG UGKPG 9KVYG FKG   8QTOWPFUEJCHV DKU \WO ,CJTG HÒJTVG+P\YKUEJGPYCTFGT·NVGUVGFGT5ÌJPGIGUVQTDGPWPFFKGFTGKCPFGTGP 5[NXKWU(TKGFTKEJ%JTKUVKCP7NTKEJWPF,WNKWU5KIKUOWPFVGKNVGPPWP.CPFWPF4GIKGTWPIKPFKGFTGK.KPKGP1GNU $GTPUVCFV WPF ,WNKWUDWTI *GT\QI 5[NXKWU (TKGFTKEJ XGTO·JNVG UKEJ  OKV 'NGQPQTG %JCTNQVVG 6QEJVGT FGU   *GT\QIU)GQTI++XQP9ÒTVVGODGTI/ÌORGNICTV5[NXKWU(TKGFTKEJUVCTDMKPFGTNQUWPFGKPGPGWG6GKNWPIFGT *GT\QIVÒOGT KP \YGK *·NHVGP YWTFG XQTIGPQOOGP #WH FGO UGJT UGNVGPGP &QRRGNVCNGT FGT FGP *GT\QI KP GKPGT   IGYCNVKIGP HÒT FKG <GKV V[RKUEJGP 2GTÒEMG \GKIV YGTFGP KP FGT 6KVWNCVWT CWEJ CWUFTÒEMNKEJ FKG *GTTUEJCHVGP   5VGTPDGTIWPF/GF\KDQTJGTXQTIGJQDGP



4GKEJUVCNGT1GNU&CX(W5 4*GTTNKEJG2CVKPCUGJTCVVTCMVKXGUXQT\ÒINKEJGU'ZGORNCT



%JTKUVKCP7NTKEJ5KNDGTOGFCKNNGQ, WO XQP,0GKFJCTFVXGTOWVNKEJCWHUGKPGP 4GIKGTWPIUCPVTKVV%*4+56+#0Ü8.4Ü&Ü)Ü&7:Ü9Ü6Ü+Ü5Ü1Ü$Ü)GJCTPKUEJVGU$TWUV DKNFTOKVNCPIGO*CCTWPFWOIGNGIVGO/CPVGNFCTWPVGTFKG5KIPCVWT,0 ,QJCPP0GKFJCTFV5VGORGN UEJPGKFGTKP1GNU 6#0&'/Ü#PGKPGOJQJGPWPFUVGKNGP(GNUGPMNGVVGTVFGT*GT\QIPCEJ QDGPCO(W­FGU(GNUGPUNKGIVUGKP*GT\QIUJWVTKO*KPVGTITWPFFKG5VCFVCPUKEJVXQP1GNUOO I'DPGT(W5  8QPCNNGTITÌ­VGT5GNVGPJGKV9KP\4CPFHGJNGTCVVTCMVKXGUUGJTUEJÌPGU'ZGORNCT  &GT /GFCKNNGWT FKGUGU JQEJKPVGTGUUCPVGP5VÒEMGUYCT,QJCPP0GKFJCTFVCWU0ÒTPDGTIFGT\WO*QHOGFCKNNGWTFGT 1GNUGT*GT\ÌIGGTPCPPVYQTFGPYCTWPFFQTVDKU\WUGKPGO6QFNGDVG'UJCPFGNVUKEJJKGTDGKXGTOWVNKEJWO FCUGTUVG2QTVT·VFGULWPIGP*GT\QIUCWHGKPGT/ÒP\GD\Y/GFCKNNG#WHFGT4ÒEMUGKVGKUVFKG#PUKEJVFGTUEJNGUK UEJGP 5VCFV 1GNU WPF GKPG #NNGIQTKG \W UGJGP KP FGT FGT *GT\QI GKPGP (GNU DGUVGKIV WPF UGKPGP *GT\QIUJWV FCU   5[ODQN UGKPGT /CEJV  CO (W­G FGU $GTIGU \WTÒEMN·­V &KG 7OUEJTKHV 6#0&'/  'PFNKEJ  WPVGTUVTGKEJV FKGUG   5[ODQNKM&KGJKGTCPIGDQVGPG/GFCKNNGKUVPCEJWPUGTGP4GEJGTEJGPUGKV,CJT\GJPVGPPKEJVOGJTKO/CTMVXQTIG MQOOGPWPF\·JNV\WFGPITQ­GP4CTKV·VGPWPVGTFGPUEJNGUKUEJGP/GFCKNNGP

122

 


WÜRZBURG

410

$+567/ 

9ª4<$74)

(TKGFTKEJXQP9KTUDGTI)WNFGPVCNGT -TGW\GT 9ÒT\DWTIOKV6KVGN/CZKOKNKCPU++ &CX*GNOUEJTQVV #VVTCMVKXGU'ZGORNCTOKVHGKPGT2CVKPCHCUVXQT\ÒINKEJ



411

1,5:1



1,5:1

7PVGT UEJYGFKUEJGT $GUCV\WPI #ZGN 1ZGPUVKGTPC  4GKEJUVCNGT Q ,   9ÒT\   DWTII+Û&Ü&Ù#:'.Û1:'056+'40#Û.Û$Û+-Û&Û+Û(Û6Û'Û4Û5Û8Û%Û .')Ü+Ü)Ü5Ù(ę&Ü'8Ü&+4Û$TWUVDKNFHCUVXXOKVWOIGNGIVGO/CPVGN5RKV\GPMTCIGPWPF 1TFGP FCTWPVGT UGKP 9CRRGPUEJKNF DGFGEMV XQP GKPGT (TGKJGTTGPMTQPG41$14' Û &+8+01 Ü   %1410#685 8+0%+6 Û .'1 &GT IGMTÌPVG UEJYGFKUEJG .ÌYG UEJTGKVGV PCEJ N OKV -TQPG WPF   5EJYGTVQDGPFGTUVTCJNGPFG0COG,GJQXCU#JNUVTÌO 4 &CX*GNOUEJTQVVp  8QPITQ­GT5GNVGPJGKV*GTTNKEJG2CVKPCOKPLWUVKGTVUGJTCVVTCMVKXGUXQT\ÒINKEJGU'ZGORNCT  #ZGN)WUVCHUUQP1ZGPUVKGTPCYWTFGCO,WPKCWHFGT+PUGN(¹PÌDGK7RRUCNCIGDQTGP0CEJUGKPGO5VWFKWO KP&GWVUEJNCPF 4QUVQEM9KVVGPDGTI,GPC OCEJVGGTGKPGUVGKNGRQNKVKUEJG-CTTKGTGWPFYWTFGDGTGKVUCNU5VWFGPV KO,CJTKPFGPUEJYGFKUEJGP4GKEJUTCVDGTWHGP5EJQPCO,CPWCTYWTFGGTXQP-ÌPKI)WUVCX++#FQNH KO #NVGT XQP PWT  ,CJTGP \WO UEJYGFKUEJGP 4GKEJUMCP\NGT GTPCPPV WPF PCJO WOHCUUGPFG \WMWPHVUYGKUGPFG   8GTYCNVWPIUTGHQTOGP KP #PITKHH 0GDGP FKGUGP CFOKPKUVTCVKXGP .GKUVWPIGP GT\KGNVG #ZGN 1ZGPUVKGTPC CWEJ CNU   &KRNQOCV CW­GTQTFGPVNKEJG 'THQNIG 5Q YCT GT OC­IGDNKEJ CP FGP (TKGFGPUUEJNÒUUGP XQP -P·TGF OKV &·PGOCTM  

  5VQNDQYQ OKV 4W­NCPF   #NVOCTM OKV 2QNGP   $TÌOUGDTQ OKV &·PGOCTM   UQYKG CO   9GUVH·NKUEJGP (TKGFGP XQP  DGVGKNKIV 0CEJ FGO 6QF )WUVCXU ++ #FQNH CWH FGO 5EJNCEJVHGNF DGK .ÒV\GP CO    0QXGODGT  ÒDGTPCJO 4GKEJUMCP\NGT #ZGN 1ZGPUVKGTPC UQHQTV FKG 4GIKGTWPI HÒT FKG GTUV UGEJUL·JTKIG   6JTQPHQNIGTKP %JTKUVKPC +O ,CJT  UEJNQ­ 1ZGPUVKGTPC \YKUEJGP 5EJYGFGP WPF FGP 'XCPIGNKUEJGP 5V·PFGP   &GWVUEJNCPFUFGP*GKNDTQPPGT$WPFCNUFGUUGP#PHÒJTGTGTCWHFGOXQTNKGIGPFGP6CNGTCWUFTÒEMNKEJIGPCPPVYKTF #WEJPCEJFGT8QNNL·JTKIMGKVFGT-ÌPKIKPDNKGD1ZGPUVKGTPCDKU\WUGKPGO6QFCO#WIWUVKP5VQEMJQNOKP #OV WPF 9ÒTFGP 'KPGP DGUQPFGTU GKPFTWEMUXQNNGP $GNGI HÒT FKG -QORGVGP\ WPF FCU #PUGJGP FCU FGT   4GKEJUMCP\NGT DGUC­ KUV FGT JKGT \WT 8GTUVGKIGTWPI IGNCPIGPFG UGJT UGNVGPG 6CNGT FGT MGKPGP TGIKGTGPFGP   /QPCTEJGPUQPFGTPGKPGP2QNKVKMGT\GKIV&KGUKUVGKPOCNKIKPFGT/ÒP\IGUEJKEJVGFGTHTÒJGPGWTQR·KUEJGP0GW\GKV &KG 6KVWNCVWT #ZGN 1ZGPUVKGTPCU NCWVGV + NNWUVTKUUKOWU  & QOKPWU  & QOKPWU  #:'. KWU  1:'056+'40# . KDGT    $ CTQ  + P  - KOKVQ  & QOKPWU  + P  ( KJQNO  6 KFÌ  ' SWGU  4 GIPK  58 GEKCG  % CPEGNNCTKWU  .') CVWU  + P    ) GTOCPKC 5 WRTGOWU (1'& GTKU '8 CPIGNKEK &+4 GEVQT  &GTJÌEJUVDGTÒJOVG*GTT*GTT#ZGN1ZGPUVKGTPC (TGKJGTT\W-KOKVQ*GTT\W(KJQNO WPF 6KFÌ4KVVGT-CP\NGTFGU-ÌPKITGKEJGU5EJYGFGPJÌEJUVGT)GUCPFVGTKP &GWVUEJNCPF#PHÒJTGTFGU'XCPIGNKUEJGP$WPFGU &KG4ÒEMUGKVGPNGIGPFGDGOGTMV\WOFCTIGUVGNNVGPUEJYGFKUEJGP .ÌYGP41$14'&+8+01%1410#6858+0%+6.'1 /KVIÌVVNKEJGT-TCHVIGMTÌPVUKGIVFGT.ÌYG 

123


WÜRZBURG

412

412 1,5:1



2GVGT2JKNKRRXQP&GTPDCEJ4GKEJUVCNGTQ,9ÒT\DWTII$TWUVDKNFTKPIGKUVNK EJGO1TPCVJKPVGTIGMTÌPVGOXKGTHGNFKIGP9CRRGPOKV/KVVGNUEJKNFFCJKPVGT5EJYGTVWPF-TWOOUVCD IGMTGW\V/CFQPPC OKV <GRVGT KP FGT 4GEJVGP WPF FGO -KPF CWH FGO NKPMGP #TO UVGJV X X CWH   /QPFUKEJGN&CX*GNOUEJTQVV  8QPITQ­GT5GNVGPJGKV*GTTNKEJG2CVKPCMN<CKPGPFGªDGTRT·IWPIUURWTGPXQT\ÒINKEJ 

413

413 1,5:1



,QJCPP)QVVHTKGFXQP)WVVGPDGTI4GKEJUVCNGT9ÒT\DWTI&CX*GNOUEJTQVV  2TCEJVGZGORNCT*ÒDUEJG2CVKPCHCUV5VGORGNINCP\



414

 124

%JTKUVQRJ (TCP\ XQP *WVVGP   4GKEJUVCNGT  <YKVVGTRT·IWPI OKV FGT ,CJTGU\CJN   CWHDGKFGP5GKVGP*GNOUEJTQVV 2TCEJVXQNNG2CVKPCXQT\ÒINKEJp5VGORGNINCP\ 


RÖMISCH-DEUTSCHES REICH

*#$5$74)+5%*''4$.#0&'¤56'44'+%*

415

6+41.)4#(5%*#(6 

'T\JGT\QI 5KIKUOWPF FGT /ÒP\TGKEJG  2HWPFPGT Q , *CNN  I 5VGORGNUEJPGKFGT   9GP\GN -TÌPFN )GMTÌPVGU WPF IGJCTPKUEJVGU $TWUVDKNF FGU 'T\JGT\QIU T)GMTÌPVGT #FNGT OKV 9CR   RGPCWHFGT$TWUV/6  8QPITQ­GT5GNVGPJGKV5GJTCVVTCMVKXGU'ZGORNCTOKVJÒDUEJGT2CVKPCUGJTUEJÌP  'T\JGT\QI 5KIKUOWPF  +PPUDTWEM Ó +PPUDTWEM YCT FGT 5QJP (TKGFTKEJU +8 FGT FWTEJ   RGTOCPGPVG)GNFPQVFGP$GKPCOGPOKVFGTNGGTGP6CUEJGGTJKGNV'TUVYWTFG5KIKUOWPFCWUFGT8QTOWPF UEJCHV -CKUGT (TKGFTKEJU +++ GPVNCUUGP 5GKV FGO  &G\GODGT HÒJTVG GT FGP 6KVGN 'T\JGT\QI 'T UEJNQ­ FKG   /ÒP\UV·VVGKP/GTCPWPFGTÌHHPGVGFKG/ÒP\UV·VVG*CNNDGK+PPUDTWEMFKGUKEJTCUEJ\WGKPGTFGTOQFGTPUVGPWPF RTQFWMVKXUVGP /ÒP\UV·VVGP YGNVYGKV GPVYKEMGNP UQNNVG &WTEJ FKG TGKEJGP 5KNDGTDGTIYGTMG 6KTQNU XQT CNNGO KP   5EJYC\ YWTFGUGKPGWOHCUUGPFG)GNFTGHQTOGTOÌINKEJVFKGKJOFGP$GKPCOGPFGT/ÒP\TGKEJGGKPDTCEJVG#O /·T\ÒDGTNKG­GT6KTQNWPFFKG8QTNCPFGUGKPGO8GVVGT/CZKOKNKCP+

416 (Taler)

1,5:1



1,5:1

&KEMVCNGT XQP FGP 5VGORGNP FGU  )WNFKPGTU  *CNN  I 5VGORGNUEJPGKFGT9GP\GN-TÌPFN ÛÙdSIGISIIVnDVSdARChIDVXdAVSTRIedÙ)GMTÌPVGUWPFIGJCTPKUEJVGU$TWUVDKNFFGU 'T\JGT\QIUTOKVFGT4GEJVGPFCU<GRVGTUEJWNVGTPFFKG.KPMGCO5EJYGTVITKHH4KVVGTOKV(CJPGTGKVGVT FCTWPVGTFKG,CJTGU\CJN+WOJGT9CRRGP/6XIN 8QPITÌ­VGT5GNVGPJGKV5GJTUEJÌP 

$GKFKGUGT2T·IWPIJCPFGNVGUUKEJWOFKGGTUVGGWTQR·KUEJG)TQ­UKNDGTOÒP\GFKGFGP$GIKPPFGTPWOKUOCVKUEJGP 0GW\GKV OCTMKGTV 5KG YCT FKG 8QTUVWHG \W FGP GTUVOCNU  IGRT·IVGP 6CNGTP FKG KJTGP 0COGP CNNGTFKPIU GTUV   #PHCPI FGU  ,CJTJWPFGTVU FWTEJ FKG KO DÌJOKUEJGP ,QCEJKOUVCN IGRT·IVGP /ÒP\GP GTJKGNVGP 8QT  JCVVG   5KIKUOWPF KP ITQ­GT #P\CJN )QNFIWNFGP JGTUVGNNGP NCUUGP WO FGP UVGKIGPFGP $GFCTH PCEJ GKPGO JQEJYGTVKIGP   0QOKPCN \W FGEMGP &C 6KTQN MGKPG GKIGPGP )QNFXQTMQOOGP JCVVG YCT FKG )QNFRT·IWPI LGFQEJ MCWO NQJPGPF   *KPIGIGP YCT FKG 5KNDGTCWUDGWVG KP 5EJYC\ CW­GTQTFGPVNKEJ ITQ­ 5Q GPVUVCPF FKG +FGG FGT #WURT·IWPI ITQ­GT   5KNDGTOÒP\GP&KGUG2T·IWPIKUVUQOKVGKP5EJNÒUUGNUVÒEMFGTGWTQR·KUEJGP)GNFIGUEJKEJVG

417



)WNFKPGT*CNNI5VGORGNUEJPGKFGT9GP\GN-TÌPFN/6XCT  4(GKPG2CVKPCUGJTUEJÌP

 125


RÖMISCH-DEUTSCHES REICH

418



)WNFKPGT*CNNI5VGORGNUEJPGKFGT9GP\GN-TÌPFN&CX/68QINJ++++8  444CPFDGCTDGKVGVFGPPQEJUGJTCVVTCMVKXGU'ZGORNCTOKVHGKPGT2CVKPCUGJTUEJÌP

419

420



421

4¤/+5%*&'765%*'54'+%* 

(GTFKPCPF +  6CNGT Q ,   ,QCEJKOUVCN /ÒP\OGKUVGT /CTVKP -GORH   &CX&KGVKMGT*CNCEMC8QINJ -N5EJTÌVNKPIUHGJNGTUGJTUEJÌP



6CNGT  ,QCEJKOUVCN /ÒP\OGKUVGT 4WRRTGEJV 2WGNNCEJGT &CX  &KGVKMGT  *CNCEMC    8QINJ8+ 5GJTUGNVGPKPFKGUGT'TJCNVWPI2TCEJVGZGORNCT(CUV5VGORGNINCP\ 



/CZKOKNKCP ++  )WNFGPVCNGT  -TGW\GT   2TCI /ÒP\OGKUVGT *CPU *CTFGT   &CX&KGVKMGT*CNCEMC8QINJ++ 44*ÒDUEJG2CVKPCUGJTUEJÌP 



422

 126

)WNFGPVCNGT -TGW\GT 9KGP&CX8QINJ++ 445GJTCVVTCMVKXGU'ZGORNCTOKVHGKPGT6ÌPWPIUGJTUEJÌP

 


RÖMISCH-DEUTSCHES REICH

424

423 (doppelt)

425



'T\JGT\QI (GTFKPCPF  &QRRGNVGT 4GKEJUVCNGT Q , RQUVJWOG 2T·IWPI   *CNN   I'KUGPUEJPGKFGT2GVGT*CTVGPDGEM&CX/6 5VGORGN   *GTTNKEJG2CVKPCXQT\ÒINKEJ 



4WFQNH++4GKEJUVCNGT0$0CI[D±P[C&CX8QINJ+ 44*GTTNKEJG2CVKPCUGJTCVVTCMVKXGUHCUVXQT\ÒINKEJGU'ZGORNCT



'T\JGT\QI/CZKOKNKCPCNU.CPFGUHÒTUVXQP6KTQN4GKEJUVCNGT'PUKUJGKO&CX 8QINJ+ -N4CPFHGJNGTUGJTUEJÌP

426



427

  

428

/CVVJKCU4GKEJUVCNGTQ,2TCI&TGKMCKUGTVCNGT&CX&KGVKMGT*CNCEMC #DD6[RC8QINJ++ 4#VVTCMVKXGUUGJTUEJÌPGU'ZGORNCT

+P UGKPGO #WHUCV\ ÒDGT FKG UQIGPCPPVGP &TGKMCKUGTRT·IWPIGP J·NV FGT #WVQT +XQ *CNCEMC FKG #WURT·IWPI FKGUGU   6[RUPQEJWPVGT-CKUGT4WFQNH++HÒTUGJTYCJTUEJGKPNKEJ





4GKEJUVCNGT  2TCI /ÒP\OGKUVGT $GPGFKMV *WGDOGT &CX  &KGVKMGT  *CNCEMC    8QINJ+ 4(GKPG2CVKPCUGJTUEJÌPpXQT\ÒINKEJ 



4GKEJUVCNGT  2TCI /ÒP\OGKUVGT $GPGFKMV *WGDOGT &CX  &KGVKMGT  *CNCEMC    8QINJ++ 42CVKPCUGJTUEJÌPpXQT\ÒINKEJ  127


RÖMISCH-DEUTSCHES REICH

429

431

430



4GKEJUVCNGT-$-TGOPKV\&CX8QINJ+++

8QT\ÒINKEJ





(GTFKPCPF++4GKEJUVCNGT)TC\&CX8QINJ8+++ 8QT\ÒINKEJGU2TCEJVGZGORNCTOKVHGKPGT6ÌPWPI

 



(TKGFTKEJXQPFGT2HCN\ FGT9KPVGTMÌPKI -KRRGT-TGW\GT2TCI/ÒP\OGKUVGT 2CXGN5MT¾VC5QVPQXUM[&KGVKMGT*CNCEMC  5GJTUGNVGPKPFKGUGT'TJCNVWPI*GTTNKEJG2CVKPCXQT\ÒINKEJ



432

433

434



'T\JGT\QI.GQRQNF84GKEJUVCNGT*CNN&CX/6XCT8QINJ++  -CDKPGVVUVÒEM2TCEJVXQNNG2CVKPCHCUV5VGORGNINCP\



4GKEJUVCNGT'PUKUJGKO&CX8QINJ+8 5GNVGPKPFKGUGT'TJCNVWPI(GKPG2CVKPCXQT\ÒINKEJp5VGORGNINCP\



'T\JGT\QI(GTFKPCPF-CTN4GKEJUVCNGT*CNN&CX/68QINJ+  5GNVGPGT,CJTICPI8QT\ÒINKEJ

128

   


RÖMISCH-DEUTSCHES REICH

435 (doppelt)

437

436



&QRRGNVGT4GKEJUVCNGTQ,  *CNNI&CX/6 8QT\ÒINKEJGU'ZGORNCTOKVHGKPGT2CVKPC

 



(GTFKPCPF+++4GKEJUVCNGT)TC\&CX8QINJ+ 8QT\ÒINKEJGU2TCEJVGZGORNCTOKVHGKPGT2CVKPC

 



.GQRQNF+4GKEJUVCNGT ,CJTGU\CJNKO5VGORGNCWUIG·PFGTV -$-TGOPKV\ *GTKPGM 44#VVTCMVKXGU'ZGORNCTOKVJÒDUEJGT2CVKPCUGJTUEJÌP



438

439

439



4GKEJUVCNGT*CNN&CX/68QINJ+ 5GNVGPKPFKGUGT'TJCNVWPI*GTTNKEJG2CVKPCHCUV5VGORGNINCP\

 



$TGKVGTFQRRGNVGT4GKEJUVCNGT)TC\I&CX*GTKPGM *ÒDUEJG2CVKPCXQT\ÒINKEJ

 129


RÖMISCH-DEUTSCHES REICH

441

440

442



4GKEJUVCNGT*CNN+P752NCUVKMJQNFGTFGT0)%OKVFGT$GYGTVWPI/5&CX/6 8QINJ++ 2TCEJVGZGORNCT(CUV5VGORGNINCP\



5KNDGTPGU 5VCOODCWOOGFCKNNQPQ,  XQP/$TWPPGTCWHFKG-TÌPWPIUGKPGU5QJPGU,QUGH+ \WO TÌOKUEJGP -ÌPKI KP #WIUDWTI )GMTÌPVGU $TWUVDKNF ,QUGHU + HCUV X X WOJGT XQP 5RTWEJDCPF   WOYWPFGPGT .QTDGGTMTCP\5VCOODCWO KP FGT /KVVG /GFCKNNQP OKV FGO $TWUVDKNF .GQRQNFU T CWH   FGP<YGKIGPMNGKPGTG/GFCKNNQPUOKVFGP$TWUVDKNFGTPFGTJCDUDWTIKUEJGP-CKUGT/KV4CPFUEJTKHV È(14680#6# 0181 )#8&' )'4/#0+# 4')' +56' 6885 %85615 8.614 +5 *156+5   '4+6OOI(QTUVGTp5NI*QTUM[5NI,WNKWU5NI/QPVGPWQXQp  44#VVTCMVKXGUXQT\ÒINKEJGU'ZGORNCTOKVHGKPGT6ÌPWPI  ,QUGH+4GKEJUVCNGT*CNN&CX/68QINJ+ 8QT\ÒINKEJ 





443

 130

4GKEJUVCNGT$TGUNCW&CX(W58QINJ+8  5GJTUGNVGPDGUQPFGTUKPFKGUGT'TJCNVWPI(GKPG2CVKPCXQT\ÒINKEJ




KAISERREICH ÖSTERREICH

446

445

444



-CTN 8+  4GKEJUVCNGT  ,CJTGU\CJN KO 5VGORGN CWU  IG·PFGTV  *CNN &CX    /68QINJ++ 9KP\4CPFHGJNGTXQT\ÒINKEJGU'ZGORNCTOKVHGKPGT6ÌPWPI





4GKEJUVCNGT*CNN&CX/68QINJ+++ 2TCEJVGZGORNCT*GTTNKEJG2CVKPCHCUV5VGORGNINCP\

 



/CTKC6JGTGUKC4GKEJUVCNGT9KGP&CX'[RGNVCWGT 4(GKPG2CVKPCXQT\ÒINKEJ5VGORGNINCP\

 

$GK FKGUGT 2T·IWPI JCPFGNV GU UKEJ WO FGP GTUVGP 9KGPGT 6CNGT XQP /CTKC 6JGTGUKC FGT FCJGT CWEJ #PVTKVVUVCNGT   IGPCPPVYKTF

447



$GNIKUEJGT#WHUVCPF.KQPF #TIGPV$TÒUUGN&CX, 8QT\ÒINKEJGU2TCEJVGZGORNCTOKVHGKPGT2CVKPC

448

1,5:1

 

448

-#+5'44'+%*¤56'44'+%* 

(TCP\ ,QUGH +  6CNGT  9KGP )GFGPMVCNGT IGRT·IV \WT 'TÌHHPWPI FGU %CTN.WFYKI   *CWUGUCWHFGT4CZCNRG&CX,6JWP  440WT'ZGORNCTGIGRT·IV-CDKPGVVUVÒEM2TCEJVXQNNG2CVKPCHCUV5VGORGNINCP\  131


GEISTLICHKEIT

449

451

450

&+')'+56.+%*-'+6+0&'0*#$5$74)+5%*'0'4$.#0&'0 )#456'0#$6'+ 

4QOCP 4CWUEJGT  4GKEJUVCNGT  CWH UGKP L·JTKIGU 2TKGUVGTLWDKN·WO IGYKFOGV   XQPFGT5VCFVWPFFGTDGTITGEJVNKEJGP)GYGTMUEJCHVFGT5VG[GTGT'KUGPYGTMG&CX/ÒUGNGT 44#VVTCMVKXGU'ZGORNCTOKVJÒDUEJGT2CVKPCYKP\5EJTÌVNKPIUHGJNGTXQT\ÒINKEJ  &KG4ÒEMUGKVGGPVJ·NVFKG,CJTGU\CJNCNU%JTQPQITCOO





&KGKOJGWVKIGP1DGTÌUVGTTGKEJIGNGIGPG#DVGK)CTUVGPYCTUGKVGKP$GPGFKMVKPGTMNQUVGT7PVGTFGOGTUVGP#DV $GTVJQNF PCJO FCU -NQUVGT GKPGP DGCEJVNKEJGP IGKUVKIGP WPF YKTVUEJCHVNKEJGP #WHUEJYWPI +O (TÒJLCJT  GPV   UEJNQ­ OCP UKEJ \WO VQVCNGP #DTK­ FGT OKVVGNCNVGTNKEJGP )GD·WFG 0QEJ KO UGNDGP ,CJT YWTFG WPVGT #DV 4QOCP   4CWUEJGT FGT )TWPFUVGKP \WO XÌNNKIGP0GWDCWXQP-KTEJGWPF-NQUVGTKPDCTQEMGO5VKNIGNGIV5GKVYGTFGP FKG)GD·WFGFGTGJGOCNKIGP#DVGKCNU5VTCHXQNN\WIUCPUVCNVIGPWV\V&KG,WUVK\CPUVCNV)CTUVGPIGJÌTV\WFGPYGPKIGP )GH·PIPKUUGPKP¤UVGTTGKEJKPFGPGPFKGNGDGPUNCPIG(TGKJGKVUUVTCHGXQNN\QIGPYKTF

1./ª6<$+567/5'+6'4<$+567/ 

-CTN+++XQP.QVJTKPIGP4GKEJUVCNGT&CX5WEJQOGN8KFGOCP  5GJTUEJÌPpXQT\ÒINKEJ



5#.<$74)'4<$+567/ 

/CVVJ·WU .CPI XQP 9GNNGPDWTI  &QRRGNVGT )WNFKPGT  CWH FKG 'KPYGKJWPI FGT   4CFKCPCMCRGNNG KP 9GNNGPDWTI  I $TWUVDKNF N OKV $KTGVV \W FGP 5GKVGP FKG IGVGKNVG ,CJTGU   \CJN / Û & Û  Û : Û : Û + Û&KG JGKNKIG 4CFKCPC UVGJV JCNDN WPF YKTF XQP \YGK 9ÌNHGP CPIGHCNNGP   KO*KPVGTITWPF.CPFUEJCHVOKV$·WOGPWPF5EJNQ­9GNNGPDWTI&CX<ÌVVN  45GJTCVVTCMVKXGU'ZGORNCTOKVCWUFTWEMUXQNNGT2CVKPCYKP\4CPFHGJNGTXQT\ÒINKEJ  <WT <GKV FGT 4GIKGTWPI FGU 'T\DKUEJQHU 9QNHJCTV XQP #WIUDWTI  UVCPF DGK FGO FCOCNKIGP $GUKV\GT FGU   5EJNQUUGU9GNNGPDWTICWUFGO)GUEJNGEJVGFGT2QTVPGTFKG,WPIHTCW4CFKCPCXQPCPFGTGP4CFGOWPFIGPCPPVCNU 8KGJOCIFKO&KGPUVG5KGRHNGIVG#WUU·V\KIGWPF$NCVVGTPMTCPMGKOPCJGP5KGEJGPJCWUGWPFVTWIKJPGPXQO/WPFG CDIGURCTVG/KNEJ$WVVGTWPF$TQV\W$GKGKPGT$GIGIPWPICWHFGO9GIGFCJKPXQO5EJNQ­JGTTPCPIGJCNVGPICD UKGCWH$GHTCIGPYCUUKGHQTVVTCIGKO5EJTGEMGPCPFC­UKG\WT5·WDGTWPIFGT5KGEJGP9CUUGT-COOWPF5GKHG \WFGPUGNDGPVTCIG#NUKJTPWP2QTVPGTFCU5EJCHHCWUFGP*·PFGPTK­HCPFGPUKEJYKTMNKEJPWTFKGUG5CEJGPXQT KP YGNEJG /KNEJ WPF $WVVGT KP YWPFGTDCTGT 9GKUG XGTYCPFGNV YQTFGP YCTGP <WT 5VTCHG HÒT FKG0QVNÒIGUEJKEMVG )QVVCDGT\YGK9ÌNHGFKG4CFKCPCCWHFGO*GKOYGIÒDGTHKGNGP#TI\GTHNGKUEJVYWTFGUKGKPFCU5EJNQ­IGDTCEJV YQUKGPCEJFTGK6CIGPUVCTD

132


STANDESHERREN

452

453

454



/KEJCGNXQP-ÒGPDWTI)WNFKPGT&CX<ÌVVN

5GJTUEJÌP





5KIKUOWPF+++XQP5EJTCVVGPDCEJ-QPX6CNGT&CX<ÌVVN  (CUVXQT\ÒINKEJ





-QPX6CNGT/KV4CPFUEJTKHV&CX<ÌVVN



5GJTUEJÌPpXQT\ÒINKEJ

455

&+'¤56'44'+%*+5%*'056#0&'5*'44'0 524+0<'056'+0)4#('0 

,QJCPP'JTGPTGKEJ6CNGT#WIUDWTI&CX(QTUVGT*QN\OCKT 2TCEJVXQNNG2CVKPCUGJTCVVTCMVKXGUXQT\ÒINKEJGU'ZGORNCT

 

456 (doppelt)

64#76510)4#('05'+6(ª456'0 

2CWN5KZVWUXQP(CNMGPUVGKP&QRRGNVGT4GKEJUVCNGTI&CX*QN\OCKT5 8QPITQ­GT5GNVGPJGKV*ÒDUEJG2CVKPCMN*GPMGNURWTUGJTUEJÌPpXQT\ÒINKEJ

 133


BALTIKUM

'7412+5%*'/ª0<'070&/'&#+..'0

457

'56.#0&4'8#. 

459

458

$#.6+-7/

7PVGT5EJYGFGP'TKM:+8/CTM (GTFKPI #JNUVTÌO0GWOCPPC  ªDGTFWTEJUEJPKVVNKEJGTJCNVGP(GKPG6ÌPWPIMN2T·IGUEJY·EJGHCUVXQT\ÒINKEJ



.'66.#0&4+)#56#&6 

7PVGT2QNGP5VGRJCP$CVJQT[)TÌUEJGT+IGT4G 4 -QRKEMKXCT 4   445GJTUEJÌP





)TQUEJGP-QRKEMK 4 

45GJTUEJÌP



)TQUEJGP/KVFGO(COKNKGPYCRRGP$CVJQT[WPVGTFGT$ÒUVG-QRKEMK 4   8QPITÌ­VGT5GNVGPJGKV-N2T·IGUEJY·EJGUGJTUEJÌP



460

1,5:1



1,5:1

461

462



)TÌUEJGT+IGT4C 4 -QRKEMKXCT 4 



)TÌUEJGT+IGT4C 4 -QRKEMK 4 

463

5GJTUEJÌP



5GJTUEJÌPpXQT\ÒINKEJ



464



)TQUEJGP-QRKEMKXCT 4 

-N<CKPGPFGUGJTUEJÌP





)TQUEJGP-QRKEMKXCT 4 

44#VVTCMVKXGU'ZGORNCTUGJTUEJÌPpXQT\ÒINKEJ



134


BALTIKUM

465



466

)TÌUEJGT+IGT4CD 4 -QRKEMKXCT 4 

8QT\ÒINKEJ



5VGRJCP$CVJQT[XQP2QNGP)TÌUEJGT8KNPKWU+IGT8CXCT 4   -QRKEMK 4  445GJTUEJÌP



.+6#7'0 

467

468



)TÌUEJGT  8KNPKWU /KV WPXQNNUV·PFKIGT ,CJTGU\CJN CWH FGT 4ÒEMUGKVG +IGT 8 D XCT 4    -QRKEMKXCT 4  45GJTUEJÌP





)TÌUEJGT8KNPKWU+IGT8FGXCT 4 -QRKEMKXCT 4  2TCEJVXQNNG2CVKPCUGJTUEJÌPpXQT\ÒINKEJ

 

469

1,5:1



1,5:1

)TQUEJGP8KNPKWU-QRKEMK 4 

8QPITQ­GT5GNVGPJGKV2T·IGUEJY·EJGUGJTUEJÌP



470

1,5:1

1,5:1



)TQUEJGP  8KNPKWU /KV /ÒP\\GKEJGP FTGKUVKGNKIGU $NCVV ÒDGT FGP 9CRRGP KP FGT 4ÒEMUGKVGPFCT   UVGNNWPI-QRKEMKXCT 4  8QPITQ­GT5GNVGPJGKV5GJTUEJÌP 

471

 

)TÌUEJGT8KNPKWU+IGT8FXCT 4 -QRKEMKXCT 4  )TÌUEJGT8KNPKWU+IGT8EXCT 4 -QRKEMKXCT 4 

472

45GJTUEJÌP 445GJTUEJÌP

  135


BELGIEN

473

1,5:1

1,5:1



)TÌUEJGT  8KNPKWU /KV /ÒP\\GKEJGP $NCVV ÒDGT FGO (COKNKGPYCRRGP KP FGT4ÒEMUGKVGPFCTUVGN NWPI+IGT8D 4 -QRKEMK 4  8QPITQ­GT5GNVGPJGKV5GJTUEJÌP 



)TÌUEJGT8KNPKWU+IGT8D 4 -QRKEMKXCT 4  9KP\5EJTÌVNKPIUHGJNGTUGJTUEJÌP

 

475

1,5:1



1,5:1

)TÌUEJGT8KNPKWU/KV/ÒP\\GKEJGP$NCVVKO<GPVTWOFGT4ÒEMUGKVGPFCTUVGNNWPI-QRKEMK 4   8QPITQ­GT5GNVGPJGKV5GJTUEJÌP

476

$4#$#06



478 (4 Florins)

477

$'.)+'0



2JKNKRR++XQP5RCPKGP'EW2JKNKRRG#PVYGTRGP&CX&GNOC 4   5GJTUEJÌP





'EW2JKNKRRG#PVYGTRGP&CX&GNO 4 





#NDGTVWPF+UCDGNNC(NQTKPU 5QNU #PVYGTRGPI$GKFGT$TWUVDKNFGTOKV ITQ­GP *CNUMTCWUGPGKPCPFGTIGIGPÒDGT)GMTÌPVGUXKGTHGNFKIGU9CRRGPWOJGTFKG-GVVGFGU1TFGPU XQO)QNFGPGP8NKGU\WFGP5GKVGPFGT-TQPGFKGIGVGKNVG,CJTGU\CJN++&CX#&GNOC 4   44*ÒDUEJG2CVKPCYKP\4CPFHGJNGTUGJTUEJÌP

136

5GJTUEJÌP




DÄNEMARK

480

479



0#/74

2JKNKRR++XQP5RCPKGP'EW2JKNKRRG&CX&GNO 4 

-¤0+)4'+%*$'.)+'0 

 44(CUVUGJTUEJÌP

.GQRQNF+(TCPEU$TÒUUGNCWHFKG8GTO·JNWPIFGU6JTQPHQNIGTU.GQRQNF UR·VGT .GQRQNF++ OKV2TKP\GUUKP/CTKG*GPTKGVVGXQP¤UVGTTGKEJ&CX/QTKP/  8QT\ÒINKEJp5VGORGNINCP\





481

-¤0+)4'+%* 

&0'/#4-

(TGFGTKM +++  1XCNG 5KNDGTOGFCKNNG  XQP 5 &CFNGT CWH UGKPG -TÌPWPI CO   0QXGODGTWPFCWHFGP(TKGFGPUGZGMWVKQPUMQPITG­KP0ÒTPDGTI)GJCTPKUEJVGU$TWUVDKNF JCNDT OKV WOIGNGIVGO /CPVGN WPF 'NGHCPVGPQTFGP WOJGT TGKEJ XGT\KGTVG )KTNCPFG CWU <YGKIGP WPF   2WVVGP&GT RGTUQPKHK\KGTVG (TKGFG OKV GKPGO 6WEJ NGKEJV DGFGEMV UKV\V X X CWH 2QUVCOGPV OKV $WEJ   WPF 2CNO\YGKI KP FGT .KPMGP KP FGT GTJQDGPGP 4GEJVGP GKP UVTCJNGPFGU 5QPPGPIGUKEJV FKG (Ò­G CWH   GKPG'TFMWIGNIGUGV\VZOOI&GVJ1TF)CNUVGT/CW¾2CZKP0WO OKU  442TCEJVXQNNGU2QTVT·VJGTTNKEJG2CVKPCMN5COONGTRWP\GKO4CPFXQT\ÒINKEJGU'ZGORNCT 

482



5KNDGTOGFCKNNG Q , WPUKIPKGTV XQP , *GTEWNGU CWH FCU QNFGPDWTIKUEJG -ÌPKIUJCWU )GJCTPKUEJVGU   $TWUVDKNF T OKV .QTDGGTMTCP\ WPF WOIGNGIVGO /CPVGN5KGDGP IGMTÌPVG -CTVWUEJGP OKV FGP 2QTVT·VU   FGT HTÒJGTGP *GTTUEJGT FGU *CWUGU 1NFGPDWTI KP FGT /KVVG XKGT <GKNGP 5EJTKHV  OO  I   )CNUVGT 8QPITQ­GT5GNVGPJGKV 5GJTCVVTCMVKXGU'ZGORNCTOKVRTCEJVXQNNGT2CVKPCYKP\4CPFHGJNGTXQT\ÒINKEJ  137


DÄNEMARK

483







484

485

486

%JTKUVKCP86TCIDCTGQXCNG5KNDGTJQJNIW­OGFCKNNGQ, WO OKV5KIPCVWT*.6 CWH FGP 6JTQPYGEJUGN )GJCTPKUEJVGU $TWUVDKNF T OKV .QTDGGTMTCP\ WPF WOIGNGIVGO /CPVGN   )GJCTPKUEJVGU$TWUVDKNF(TGFGTKMU+++TOKV.QTDGGTMTCP\WPFWOIGNGIVGO/CPVGNZOO I)CNUVGT 48QT\ÒINKEJ



6TCIDCTGQXCNG5KNDGTJQJNIW­OGFCKNNGQ,  OKV5KIPCVWT*.6CWHFGP(TKGFGPXQP-QRGP JCIGP \YKUEJGP &·PGOCTM WPF 5EJYGFGP KO ,CJT  )GJCTPKUEJVGU $TWUVDKNF T OKV .QTDGGTMTCP\   WPF WOIGNGIVGO /CPVGN&KG UEJYGFKUEJG *CPF ITGKHV PCEJ FGT F·PKUEJGP -TQPG WPF YKTF XQP   IÌVVNKEJGT*CPFOKVGKPGO5EJYGTVCDIGUEJNCIGPZOOI)CNUVGT2CZKP 0WOOKU 4ÒEMUGKVG  4-N&TWEMUVGNNGXQT\ÒINKEJ



6TCIDCTGQXCNG5KNDGTJQJNIW­OGFCKNNGQ, WO OKV5KIPCVWT*.6CWHFKG8GTGKVGNWPIFGT 'TQDGTWPI -QRGPJCIGPU KO ,CJT  WPF FKG 8GTNGKJWPI FGU PGWGP 5VCFVYCRRGPU CO  ,WPK   )GJCTPKUEJVGU $TWUVDKNF T OKV .QTDGGTMTCP\ WPF WOIGNGIVGO /CPVGN<YGK .ÌYGP JCNVGP FCU PGWG   FTGKHCEJ DGJGNOVG 5VCFVYCRRGP KO #DUEJPKVV 9CHHGP WPF 9GTM\GWI \WT 'TTKEJVWPI XQP 5EJCP\GP   CPNCIGPZI)CNUVGT  445GJTCVVTCMVKXGUXQT\ÒINKEJGU'ZGORNCTOKVJGTTNKEJGT6ÌPWPI  (ÒT FKG VCRHGTG 8GTVGKFKIWPI FGT 5VCFV WPF FKG -ÌPKIUVTGWG GTJKGNV FKG F·PKUEJG *CWRVUVCFV -QRGPJCIGP XQP   (TGFGTKM+++PGDGPYGKVGTGP2TKXKNGIKGPCWEJGKPPGWGU5VCFVYCRRGPFCUFGT$ÒTIGTUEJCHVCO,WPKXGTNKG JGPYWTFG#WEJFKGUG/GFCKNNGYWTFGYQJNXQO/CIKUVTCVCPFKG8GTVGKFKIGTFGT5VCFVCWUIGIGDGP



6TCIDCTGQXCNG5KNDGTJQJNIW­OGFCKNNGQ, WO OKV5KIPCVWT*.6CWHUGKPG-TKGIUGTHQNIG )GJCTPKUEJVGU $TWUVDKNF T OKV .QTDGGTMTCP\ WPF WOIGNGIVGO /CPVGN.ÌYG UVGJV N OKV GTJQDGPGO   5EJYGTV WPF 5EJKNF OKV FGT +PKVKCNG %JTKUVKCPU 8 CWH 9CHHGPJCWHGP QDGP FKG 9CRRGP XQP&·PGOCTM WPF0QTYGIGPZOOI)CNUVGT  449KP\4CPFHGJNGTWPF&TWEMUVGNNGHCUVXQT\ÒINKEJ 

487

 138

(TGFGTKM8++4KIUFCNGT-QRGPJCIGP&CX*GFG#  -CDKPGVVUVÒEMXQPHGKPUVGT'TJCNVWPI*GTTNKEJG2CVKPC5VGORGNINCP\




FRANKREICH

489

488 (Piéfort)

488 (Piéfort)

-¤0+)4'+%*

(4#0-4'+%*



*GPTK +8  2K¾HQTV &KEMCDUEJNCI  GKPGU (TCPEU  # 2CTKU  I )GJCTPKUEJVGU   $TWUVDKNF T OKV .QTDGGTMTCP\$NWOGPMTGW\ KO <GPVTWO * /KV 4CPFUEJTKHV Û 2'4'00+6#6+ É   24+0%+2+5É)#..+“ÛÛ4'56+68614+5Û%KCPK&WRNGUU[p  44-N4CPFHGJNGTUGJTUEJÌP 



.QWKU:+++'EWF CTIGPV#2CTKU&CX&WRNGUU[)CFQWT[  5GJTUGNVGPKPFKGUGT'TJCNVWPI 2TCEJVXQNNG2CVKPCYKP\5EJTÌVNKPIUHGJNGTXQT\ÒINKEJp5VGORGNINCP\

490

491



492



.QWKU:+8'EW¯NCO½EJGNQPIWG)2QKVKGTU&CX&WRNGUU[)CFQWT[  2TCEJVGZGORNCT(CUV5VGORGNINCP\



'EW¯NCO½EJGNQPIWG#2CTKU&CX&WRNGUU[)CFQWT[ 8QT\ÒINKEJGU'ZGORNCTOKVHGKPGT6ÌPWPI

 



'EWCWZJWKV.4GPPGU4¾HQTOCVKQP&CX&WRNGUU[#)CFQWT[  5GJTUGNVGPKPFKGUGT'TJCNVWPI8QT\ÒINKEJGU'ZGORNCTOKVHGKPGT6ÌPWPI





139


FRANKREICH

493

493 1,5:1



'EWCWZVTQKUEQWTQPPGU#2CTKU&CX&WRNGUU[)CFQWT[  5GNVGPKPFKGUGT'TJCNVWPI8QT\ÒINKEJ

494

495



496



.QWKU:8.QWKUF CTIGPV 'EWFG(TCPEG 9.KNNG4¾HQTOCVKQP&WRNGUU[# )CFQWT[ 2TCEJVXQNNG2CVKPCXQT\ÒINKEJp5VGORGNINCP\





'EWFG(TCPEG#2CTKU4¾HQTOCVKQP&CX&WRNGUU[)CFQWT[  9KP\-TCV\GTXQT\ÒINKEJ





'EWCWZJWKV.9.KNNG&CX&WRNGUU[)CFQWT[ 4#WUFTWEMUXQNNG2CVKPCOKP,WUVKGTURWTGPXQT\ÒINKEJp5VGORGNINCP\

 

497

 140

'EWCWZTCOGCWZF QNKXKGT#2CTKU&CX&WRNGUU[)CFQWT[ 8QT\ÒINKEJGU'ZGORNCTOKVHGKPGT6ÌPWPI

 


FRANKREICH

498



'EWCWDCPFGCW60CPVGU&CX&WRNGUU[)CFQWT[

,WUVKGTVXQT\ÒINKEJ

499



499 1,5:1



.QWKU :8+  'EW CWZ TCOGCWZ F QNKXKGT  /# /CTUGKNNG &CX  &WRNGUU[    )CFQWT[ 2TCEJVGZGORNCT#WUFTWEMUXQNNG2CVKPCYKP\-TCV\GTHCUV5VGORGNINCP\ 

500

501

502



%QPUVKVWVKQP'EWEQPUVKVWVKQPPGN#2CTKU&CX&WRNGUU[)CFQWT[ (GKPG6ÌPWPIYKP\,WUVKGTURWTGPXQT\ÒINKEJp5VGORGNINCP\

 



'EWEQPUVKVWVKQPPGN#2CTKU&CX&WRNGUU[)CFQWT[ 2TCEJVGZGORNCT/KP,WUVKGTURWTGP5VGORGNINCP\

 



%QPXGPVKQP.KXTGU#0++#2CTKU&CX)CFQWT[/C\CTF  *ÒDUEJG2CVKPCXQT\ÒINKEJ

 141


FRANKREICH

503

504

505



%QPUWNCV(TCPEU#0  #2CTKU&CX)CFQWT[C/C\CTF *GTTNKEJG2CVKPCYKP\2T·IGUEJY·EJGXQT\ÒINKEJ



(TCPEU#0:+  #2CTKU&CX)CFQWT[/C\CTF



%JCTNGU :   (TCPEU  2CTKU 2TQDG KP 5KNDGT IGRT·IV CWH FGP $GUWEJ FGU -ÌPKIU   (TCP\ + XQP 5K\KNKGP WPF FGUUGP )GOCJNKP -ÌPKIKP /CTKC +UCDGNNC KP FGT 2CTKUGT /ÒP\G  I   /C\CTF 45VGORGNINCP\

 -N4CPFHGJNGTXQT\ÒINKEJ

  



506



*GPTK8*GT\QIXQP$QTFGCWZ2TGVGPFGPV

Ó (TCPEU/C\CTF  8QT\ÒINKEJp5VGORGNINCP\

&KGUGUGJTUGNVGPG(TCPEU2TQDG\GKIV*GPTK%JCTNGUFG$QWTDQP)TCHXQP%JCODQTFFGPNGV\VGP8GTVTGVGTFGT ·NVGTGP.KPKGFGT$QWTDQPGPFGTUGKVFGT,WNKTGXQNWVKQPKP¤UVGTTGKEJNGDVG0CEJFGOGTDGTGKVUPCEJFGO6QF -CTNU:XQPFGTNGIKVKOKUVKUEJGP2CTVGK\WO-ÌPKI*GPTK8GTMN·TVYQTFGPYCTXGTUWEJVGPFKG/QPCTEJKUVGP  PCEJ FGT 'PVNCUUWPI 0CRQN¾QPU +++ GTPGWV FGP IWVOÒVKIGP CDGT PKEJV ÒDGTO·­KI KPVGNNKIGPVGP )TCHGP \WO   -ÌPKI \W GTJGDGP #NU KJP  CWEJ UGKP -QPMWTTGPVFCU1DGTJCWRVFGTDQWTDQPKUEJGP.KPKG1TN¾CPUFGT)TCH XQP 2CTKU CNU 6JTQPHQNIGT CPGTMCPPVG YGKIGTVG UKEJ *GPTK FKG 6TKMQNQTG WPF FKG 8GTHCUUWPI CP\WPGJOGP WPF   DGYKTMVGFCOKVFCUGPFIÒNVKIG5EJGKVGTPFGT/QPCTEJKGKP(TCPMTGKEJ

507

 142

1,5:1



507

0CRQN¾QP+++(TCPEU#2CTKU&CX)CFQWT[/C\CTF  2TCEJVGZGORNCT*GTTNKEJG2CVKPCHCUV5VGORGNINCP\5VGORGNINCP\




FRANKREICH

508

1,5:1



1,5:1

 4GRWDNKM   (TCPEU  # 2CTKU  I /ÒP\OGKUVGT # &WRT¾ .QTDGGT\YGKI     .+$'46——)#.+6—(4#6'40+6—&KG2GTUQPKHKMCVKQPGPXQP(TGKJGKVWPF)NGKEJJGKVTGKEJGPGKPCPFGT FKG *·PFG FCJKPVGT UVGJV *GTMWNGU X X OKV .ÌYGPHGNN KO #DUEJPKVV /ÒP\OGKUVGTUKIPCVWT \YKUEJGP   \YGK HÒPUVTCJNKIGP 5VGTPGP4'27$.+37'  (4#0%#+5' n 9GTV WPF ,CJT KP FTGK <GKNGP WOJGT   -TCP\CWU.QTDGGTWPF'KEJGP\YGKIGP&CXp)CFQWT[C/C\CTF  440WT'ZGORNCTGIGRT·IV 2TCEJVGZGORNCTXQPRQNKGTVGP5VGORGNPWPFOKVHGKPGT2CVKPC 2TQQH  &CUXQTNKGIGPFG(TCPEU5VÒEMYWTFGCPN·­NKEJFGT9GNVCWUUVGNNWPIKP2CTKUIGRT·IVFKG\WO)GFGPMGPFGT ,CJTHGKGTFGT(TCP\ÌUKUEJGP4GXQNWVKQPUVCVVHCPF&KG9GNVCWUUVGNNWPIYWTFGXQO/CKDKU\WO1MVQDGT  CWH FGO %JCOR FG /CTU CWUIGTKEJVGV WPF YCT CWEJ #PNC­ \WO $CW FGU 'KHHGNVWTOU FGT KP FGT <GKV XQO    ,CPWCT  DKU \WO  /·T\XQPFGT(KTOC)WUVCXG'KHHGN%KGFWTEJIGHÒJTVYWTFG&CU&GPMOCN UVKG­CWHGPQTOGU+PVGTGUUG+PFGPNGV\VGP/QPCVGPFGU,CJTGUDGUKEJVKIVGPHCUV/KNNKQPGP/GPUEJGPFKGUG #VVTCMVKQP UQ FC­ FGT )TQ­VGKN FGT $CWMQUVGP FKG UKEJ HCUV CWH  /KNNKQPGP (TCPEU DGNKGHGP FWTEJ FKG   'KPVTKVVUIGNFGTYKGFGTCWUIGINKEJGPYGTFGPMQPPVG9GKVGTG#VVTCMVKQPGPFGT9GNVCWUUVGNNWPIYCTGPWCFKGO NCPIG WPF  O DTGKVG /CUEJKPGPJCNNG XQP %JCTNGU .QWKU (GTFKPCPF &WVGTV FGT 2CNCKU FGT 5EJÌPGP -ÒPUVG XQP   ,GCP %COKNNG (QTOKI¾ FGT +PFWUVTKGRCNCUV XQP ,QUGRJ $QWXCTF OKV GKPGT ITQ­GP \GPVTCNGP -WRRGN GKPG   4GMQPUVTWMVKQPFGT$CUVKNNGUQYKGFKGGPQTOGTHQNITGKEJG9KNF9GUV5JQYXQP$WHHCNQ$KNN

509

1,5:1



1,5:1

(TCPEU2TQDG 'UUCK XQP14QV[6[R5GOGWUG5KNDGTI9GKDNKEJG#NNGIQTKGPCEJN DGKO 5·GP KO *KPVGTITWPF CWHIGJGPFG 5QPPG9GTVCPICDG ÒDGT GKPGO )GDKPFG CWU 'KEJG 1NKXG   )GVTGKFGWPF/QJP/KV4CPFUEJTKHViiiii&+'7i2416')'i.#i(4#0%')CFQWT[p /C\CTFXCT 8QPITQ­GT5GNVGPJGKV8QPHGKPGT'TJCNVWPIOCVVKGTVG2T·IWPI /CVV2TQQH  143


FRANKREICH

510

#461+5  

511

512

(4#0-4'+%*('1&#.'5

2JKNKRRG++XQP5RCPKGP'EW2JKNKRRG#TTCU&CX&GNO 4  444CPFHGJNGT (GKNURWTGP UGJTUEJÌP 'EW2JKNKRRG#TTCU&GNO 4  445EJTÌVNKPIUHGJNGTUGJTUEJÌP

  

&1/$'5 

#PPG /CTKG .QWKUG F 1TN¾CPU  'EW F CTIGPV  6T¾XQWZ /KV FGO 2QTVTCKV KJTGU   8CVGTU)CUVQP&CX&KXQ 445GJTUEJÌPpXQT\ÒINKEJ 

$GTGKVUY·JTGPFFGT8QTOWPFUEJCHVUTGIKGTWPI)CUVQPUHÒTUGKPG6QEJVGT#PPG/CTKG.QWKUG  DGOÒJVG FKGUGT UKEJ UGKPG /ÒP\GP FGP MÌPKINKEJ HTCP\ÌUKUEJGP 2T·IWPIGP JPNKEJMGKV \W XGTNGKJGP WO KJTGP 7ONCWH KP   ICP\ (TCPMTGKEJ \W GTNGKEJVGTP &KGU HÒJTVG PCVWTIGO·­ \WT 8GT·TIGTWPI UGKPGU ·NVGTGP $TWFGTU .QWKU :+++ WPF   UGKPGU 0GHHGP .QWKU :+8 )CUVQPU 6QEJVGT #PPG /CTKG .QWKUG YÒPUEJVG CWEJ PCEJ KJTGO 4GIKGTWPIUCPVTKVV FCU   2QTV·VKJTGU8CVGTUCWHFGP/ÒP\GPXQP&QODGU

513

514

514

(4#0-4'+%*'.5#55 /74$#%*70&.ª&'45#$6'+ 

,QJCPP 4WFQNH 5VÌT XQP 5VÌTGPDGTI  6CNGT  5V #OCTKP OKV 6KVGN -CTNU 8   &CX&KXQ 44*ÒDUEJG2CVKPCCVVTCMVKXGUUGJTUEJÌPGU'ZGORNCT 



6CNGT5V#OCTKPOKV6KVGN-CTNU8&CX&KXQ 44*ÒDUEJG2CVKPCYKP\5EJTÌVNKPIUHGJNGTCO4CPFUGJTUEJÌP

144

 


FRANKREICH

516

515

515



,QJCPP7NTKEJXQP4CKVGPCW)WNFGPVCNGT -TGW\GT 5V#OCTKPOKV6KVGN/CZK OKNKCPU++&CX&KXQ 4*ÒDUEJG2CVKPCNGKEJVG2T·IGUEJY·EJGXQT\ÒINKEJ





.GQRQNFXQP¤UVGTTGKEJCNU#FOKPKUVTCVQT6CNGTQ,'PUKUJGKO&KXQXCT 8QT\ÒINKEJGU'ZGORNCTOKVUEJÌPGT2CVKPC

 

517 (2 1/2-fach)

564#55$74)$+567/ 

.GQRQNF8'T\JGT\QIXQP¤UVGTTGKEJHCEJGT4GKEJUVCNGT'PUKUJGKOI .'121.&85 Ù & Ù ) Ù #4%*+& Ù #8564 Ù &8: Ù $84)80& ´ '285 Ù #4)' Ù ' Ù 2#55   $TWUVDKNFTKPIGKUVNKEJGO1TPCVÉ#001Ù/Û&Û%Û:Û:++++Ù&'0ÛÛ;80+ÛÉ)GMTÌP VGUHÒPHHGNFKIGU9CRRGPOKV/KVVGNUEJKNF&CXp'PIGN.GJT  8QPCNNGTITÌ­VGT5GNVGPJGKV8GTOWVNKEJDGMCPPVGU'ZGORNCT #VVTCMVKXGU'ZGORNCTOKVHGKPGT2CVKPCYKP\4CPFHGJNGTYKP\5EJTÌVNKPIUHGJNGTUGJTUEJÌP  'ZGORNCTFGT5COONWPI9WPFGTN[#WMVKQP..*CODWTIGT(TCPMHWTV/CKP0T





&CU 5VÒEM HGJNV KP U·OVNKEJGP DGFGWVGPFGP 5COONWPIGP JCDUDWTIKUEJGT WPF GNU·UUKUEJGT /ÒP\GP 'PIGN WPF.GJT MCPPVGPNGFKINKEJFCU'ZGORNCTFGT5NI'TP¾ I 

518

519

(4#0-4'+%*-1.10+'0 (4#0<¤5+5%*+0&1%*+0# 

2KCUVGT&CX.GEQORVG

(CUV5VGORGNINCP\





2KCUVGT&CX.GEQORVG

8QT\ÒINKEJp5VGORGNINCP\

 145


GROSSBRITANNIEN

520

1,5:1

1,5:1

)4+'%*'0.#0& 

%QPUVCPVKP++&TCEJOG2TQDGKP5KNDGTOKVIGTKHHGNVGO4CPFI-/2P  44.GKEJVG2T·IGUEJY·EJGKO·W­GTGP4CPFDGTGKEJHCUV5VGORGNINCP\



521

522

522

)4155$4+6#00+'0 8'4'+0+)6'5-¤0+)4'+%* 

1NKXGT %TQOYGNN   %TQYP  .QPFQP 6QYGT OKPV  /KV 4CPFUEJTKHV   5GCD[# 4#VVTCMVKXGU'ZGORNCTOKVJÒDUEJGT2CVKPCUGJTUEJÌP 



)GQTIG+5KNDGTOGFCKNNGXQP)98GUVPGTCWHFKGGTHQNITGKEJG5GGUEJNCEJVIGIGP FKG5RCPKGTDGK5[TCMWU#FNGTDGM·ORHV4CDGPKP.CPFUEJCHV&CTUVGNNWPIFGT5GGUEJNCEJVNFCU7HGT \YKUEJGP/GUUKPCWPF5[TCMWUOOI$GTPJGKOGT'KOGTp*CYMKPURN%:.+++ 442TCEJVGZGORNCT(GKPG2CVKPCXQT\ÒINKEJp5VGORGNINCP\

 

524

523

523



8KEVQTKC  %TQYP  .QPFQP /KV INCVVGO 4CPF &CX \W  FKGUGT ,CJTICPI HGJNV    5GCD[ 44-CDKPGVVUVÒEM2TCEJVXQNNG2CVKPCRQNKGTVG2NCVVG 2TQQH 



%TQYP.QPFQP/KVINCVVGO4CPF5GCD[ 44-CDKPGVVUVÒEM2TCEJVXQNNG2CVKPCRQNKGTVG2NCVVG 2TQQH

146

 


ITALIEN

526

525



5JKNNKPI.QPFQP/KVINCVVGO4CPF5GCD[ 4-CDKPGVVUVÒEM2TCEJVXQNNG2CVKPCRQNKGTVG2NCVVG 2TQQH

 



2GPEG.QPFQP/KVINCVVGO4CPF5GCD[ -CDKPGVVUVÒEM2TCEJVXQNNG2CVKPCRQNKGTVG2NCVVG 2TQQH

 

528

527

527

+4.#0& 

)GQTIG +++   5JKNNKPIU 6QMGP $CPM &QNNCT   5QJQ $KTOKPIJCO  &CX    5GCD[ -CDKPGVVUVÒEM2TCEJVXQNNG2CVKPCHCUV5VGORGNINCP\CWURQNKGTVGT2NCVVG 2TQQH 



5VTCKVU5GVVNGOGPVU /CNC[UKC &QNNCT&CX-/

$4+6+5%*'-1.10+'0

(CUV5VGORGNINCP\



529

530

 

-+4%*'056##68#6+-#0

530

+6#.+'0

7TDCP8+++6GUVQPG#++4QO/WPVQPK8CT+ 5EJTÌVNKPIUHGJNGTXQT\ÒINKEJ +PPQEGP\:+2KCUVTC#8++  4QO&CX#/WPVQPK 8QT\ÒINKEJ

  147


ITALIEN

531

532

533



+PPQEGP\ :++  2KCUVTC # 8+++ 4QO &GT 'ORHCPI FGU /CPPC KP FGT 9Ã&#x2019;UVG   &CX/WPVQPK 42TCEJVXQNNG2CVKPCYKP\-TCV\GTXQT\Ã&#x2019;INKEJGU'ZGORNCT 



%NGOGPU:+2KCUVTC#++4QO&CX/WPVQPK

(CUV5VGORGNINCP\





5GFKUXCMCP\5EWFQTQOCPQ4QO&CX/WPVQPK 48QT\Ã&#x2019;INKEJGU'ZGORNCTOKVHGKPGT2CVKPC

 

534

535

536



2KWU8++5EWFQ#:8+++$$QNQIPC&CX2CICPK

 8QT\Ã&#x2019;INKEJp5VGORGNINCP\





5GFKUXCMCP\5EWFQ$$QNQIPC2CICPK 2TCEJVGZGORNCT#WUFTWEMUXQNNG2CVKPCHCUV5VGORGNINCP\

 



.GQ:++5EWFQ#001+++44QO&CX2CICPKC  5GNVGPKPFKGUGT'TJCNVWPI#VVTCMVKXGU'ZGORNCTOKVJGTTNKEJGT2CVKPCXQT\Ã&#x2019;INKEJp5VGORGNINCP\



148


ITALIEN

537

.7%%# 

'NKUC$QPCRCTVGWPF(GNKZ$CEKQEEJK(TCPEJK(NQTGP\&CX2CICPK  2TCEJVGZGORNCTOKVHGKPGT6ÌPWPI-N-TCV\GTCWHFGT4ÒEMUGKVGXQT\ÒINKEJp5VGORGNINCP\



538

/#+.#0& 

2JKNKRR +8 XQP 5RCPKGP   &WECVQPK   I 2*+.+2285 Û ++++ Û 4': Û   *+52#0+#4 ÛÈ)GJCTPKUEJVGU$TWUVDKNFTOKV5VTCJNGPMTQPGWPF.ÌYGPMQRHCWHFGT5EJWNVGTWPVGP FKG ,CJTGU\CJN Û  Û/'&+1.#0+  &8: Û '6 Û % Û )GMTÌPVGU XKGTHGNFKIGU 9CRRGP   %TKRRC 4 &CX 8QPITQ­GT5GNVGPJGKV (GKPG2CVKPCYKP\5EJTÌVNKPIUHGJNGTCVVTCMVKXGUHCUVXQT\ÒINKEJGU'ZGORNCT  2JKNKRR+8YWTFGCO#RTKNKP8CNNCFQNKFIGDQTGP'TYCTCNU(GNKRG+8-ÌPKIXQP5RCPKGPCNU(KNKRRQ+++ -ÌPKI XQP 0GCRGN WPF 5K\KNKGP UQYKG XQP 5CTFKPKGP WPF CNU (KNKRG +++ FGT NGV\VG JCDUDWTIKUEJG *GTTUEJGT ÒDGT   2QTVWICN#O5GRVGODGTXGTUVCTDGTKP/CFTKF

539

/1&'0# 

(TCPEGUEQ+F 'UVG&WECVQPGQ,IÛ(4#0%+5%85Û+Û/86Û4')='6?Û%Û &8:Û8+++)GJCTPKUEJVGU$TWUVDKNFTOKVWOIGNGIVGO/CPVGN.ÌYGPMQRHCWHFGT5EJWNVGTWPF/ÒJN UVGKPMTCIGPÛ010Û#.+1Û5+&'4'Û5GIGNUEJKHHCWHJQJGT5GGKO#DUEJPKVVFKG5KIPCVWTÛ+Û6Û

/ÒP\OGKUVGT,QUGHHQ6GUGQ &CX8CTGUK 4   8QPITQ­GT5GNVGPJGKV*GTTNKEJG2CVKPCCVVTCMVKXGUUGJTUEJÌPGU'ZGORNCT  (TCPEGUEQ+F 'UVGYWTFGCO5GRVGODGTKP/QFGPCCNU5QJPXQP#NHQPUQ+++F 'UVGWPFUGKPGT)GOCJNKP +UCDGNNCXQP5CXQ[GPIGDQTGP+O#WIWUVHQNIVGGTUGKPGO8CVGTPCEJFGUUGP6JTQPXGT\KEJV8QPFKGUGO6CI CPWPVGTPCJO(TCPEGUEQOKV'KPHCNNUTGKEJVWOWPF%JCTCMVGTUV·TMGITQ­G#PUVTGPIWPIGPWOFKGXGTNQTGPGP.·PFG TGKGP UGKPGT 8QTHCJTGP \WTÒEM\WGTQDGTP +P FGT MQORNK\KGTVGP UKEJ UV·PFKI YCPFGNPFGP RQNKVKUEJGP 5\GPG FGT   FCOCNKIGP <GKV XGTDÒPFGVG GT UKEJ \WP·EJUV OKV 5RCPKGP DGXQT GT UKEJ CWH FKG VTCFKVKQPGNNG 9KGFGTGKPHÒJTWPI FGT   #NNKCP\OKV(TCPMTGKEJDGUCPP'TXGTUVCTDPCEJGKPGT/CNCTKCGTMTCPMWPICO1MVQDGTKP5CPVJKC8GTEGNNK

149


ITALIEN

541

540

0'#2'.70&5+<+.+'0 

(GTFKPCPF+8 + XQP$QWTDQP2GTKQFG2KCUVTC )TCPC 0GCRGN&CX 2CPPWVK4KEEKQ 2TCEJVGZGORNCT(CUV5VGORGNINCP\



,QCEJKO/WTCV-ÌPKIXQP0GCRGN%CTNKPK 2KCUVTC 0GCRGN&CX2CICPK #WUFTWEMUXQNNG2CVKPCYKP\4CPFHGJNGTXQT\ÒINKEJ 



542

2#4/# 

4CPWEEKQ (CTPGUG +   &WECVQPK   I d 4#+0 d (#40 d 2#4 d '6 d   2.#%d&8:d++++)GJCTPKUEJVGU$TWUVDKNFNOKVWOIGNGIVGO/CPVGNÛ38'5+6#/ÚÛdÛdÛ dÛÚ/'4+6+5Û/CTUWPF2CNNCUUVGJGPGKPCPFGTIGIGPÒDGTWPFJCNVGPGKPG-TQPGÒDGTFTGK.KNKGP KO#DUEJPKVV.Û+Û5 .5.GNKQ5ECLQNK/ÒP\OGKUVGTKP2CTOC &CX8CTGUK  4  8QPITQ­GT5GNVGPJGKV#VVTCMVKXGUUGJTUEJÌPGU'ZGORNCT  4CPWEEKQ+(CTPGUG /·T\Ó/·T\YCTFGT5QJPFGUURCPKUEJGP*GGTHÒJTGTU#NGUUCPFTQ(CT PGUG*GT\QIXQP2CTOCWPF2KCEGP\C/KVFGO6QFUGKPGU8CVGTUCO&G\GODGTGTDVGGTFGUUGP*GT\QIVÒ OGTNKG­LGFQEJYGKVGTJKP/ÒP\GPOKVFGUUGP0COGPWPF2QTVT·VRT·IGP'TUVCDRT·IVG4CPWEEKQCWUUEJNKG­ NKEJKPGKIGPGO0COGP

543



1FQCTFQ(CTPGUG&WECVQPKIÛ 8GT\KGTWPI Û1&1#4&85Û(#40Û2#4 Û '6 Û 2.# Û &8: Û 8 Û )GJCTPKUEJVGU $TWUVDKNF T OKV WOIGNGIVGO /CPVGNÙ /..' Ù %.;2'+ Ù   2'0&'06 .KNKG  /CFQPPC UKV\V X X CWH FGO TGEJVGP #TO J·NV UKG GKP -KPF FCTÒDGT JCNVGP \YGK   'PIGN GKPG -TQPG KO *KPVGTITWPF \YGK 2CNOGP KO #DUEJPKVV Û # Û  Û # Û &CX  8CTGUK    4  8QPITQ­GT5GNVGPJGKV5GJTCVVTCMVKXGU'ZGORNCTOKVJÒDUEJGT2CVKPCUGJTUEJÌP  1FQCTFQ (CTPGUG  #RTKN  KP 2CTOC Ó 5GRVGODGT  KP 2KCEGP\C YCT FGT 5QJP FGU *GT\QIU   4CPWEEKQ + (CTPGUG XQP 2CTOC WPF 2KCEGP\C 1FQCTFQ JGKTCVGVG CO  1MVQDGT  /CTIJGTKVC /GFKEK  

Ó6QEJVGTFGU)TQ­JGT\QIU%QUKOQ++FGT6QUMCPC#WUFGT'JGIKPIGPKPUIGUCOVCEJV -KPFGTJGTXQT

150


ITALIEN

544 (2 Scudi)

2+#%'0<# 

#NGUUCPFTQ (CTPGUG +++   5EWFK   I #.':#0&'4 &TGKGEM  (#40  

&TGKGEM  &8: &TGKGEM  +++ &TGKGEM  2.#% &TGKGEM  2#4 &TGKGEM  '6 &TGKGEM  % &TGKGEM   

.KNKG  &TGKGEM  $TWUVDKNF TOKVWOIGNGIVGO/CPVGNWPFFGT-GVVGFGU1TFGPUXQO)QNFGPGP8NKGU 2.#%'06+# &TGKGEM 41/#014 &TGKGEM %1.10+# &TGKGEM  .KNKG  &TGKGEM &KG2GTUQPKHKMC VKQPXQP2KCEGP\CUVGJVXXKPCPVKMGT4ÒUVWPIKPFGT4GEJVGP.KNKGKPFGT.KPMGP(ÒNNJQTPT9ÌNHKP WPF5VCFVYCRRGPNNCIGTVFGT(NW­IQVV2QPCEJTKO#DUEJPKVVÛ#ÛÛ%Û&CX8CTGUK  4  8QPITQ­GT5GNVGPJGKV*ÒDUEJG2CVKPCCVVTCMVKXGUUGJTUEJÌPGU'ZGORNCT 

545 (3 Scudi)



5EWFK2QUVJWOG2T·IWPII#.':#0&'4 &TGKGEM (#40 &TGKGEM &8: &TGKGEM  +++ &TGKGEM  2.#% &TGKGEM  2#4 &TGKGEM  '6 &TGKGEM  % &TGKGEM  .KNKG  &TGKGEM  $TWUVDKNF T   OKV WOIGNGIVGO /CPVGN WPF FGT -GVVG FGU 1TFGPU XQO )QNFGPGP 8NKGU2.#%'06+# &TGKGEM    41/#014 &TGKGEM  %1.10+# &TGKGEM  .KNKG  &TGKGEM  &KG 2GTUQPKHKMCVKQP XQP 2KCEGP\C UVGJV   X X KP CPVKMGT 4ÒUVWPI KP FGT 4GEJVGP .KNKG KP FGT .KPMGP (ÒNNJQTP T 5VCFVYCRRGP N NCIGTV FGT   (NW­IQVV2QPCEJTKO#DUEJPKVVŐ2ŐŐ2Ő&CX8CTGUK 4   8QPITQ­GT5GNVGPJGKV-N4CPFHGJNGTYKP\&TWEMUVGNNGUGJTUEJÌP 

546

410%1 

0CRQNGQPG5RKPQNC5EWFQIf0'#21.+1Ù52+0ÙÛ/#4Ù41%*“Û (14 f &GT )TCH UVGJV JCNDT KP XQNNGT 4ÒUVWPI KP FGT 4GEJVGP 5VQEM KP FGT GTJQDGPGP .KPMGP GKPG   $NWOGf'6f5Ù41/Ù+/2Ù%1/Ù410%*+f&Ù'6f%Ùf)GMTÌPVGT&QRRGNCFNGT CWHFGT$TWUVIGMTÌPVGU9CRRGP&CX)CODGTKPK +OKVC\KQPK 8CTGUK 4   8QPITÌ­VGT5GNVGPJGKV8QT\ÒINKEJGU2TCEJVGZGORNCTOKVJÒDUEJGT2CVKPC  &KG(COKNKG5RKPQNC\·JNVG\WFGPXKGTXQTPGJOUVGP(COKNKGPCWU)GPWC PGDGPFGP&QTKC(KGUEJKWPF)TKOCNFK  +O,CJTJWPFGTVGTYCTDGPFKG5RKPQNCFGPECMOPÌTFNKEJKPFGP$GTIGPFGU#RRGPKPIGNGIGPGP1TV4QPEQ KO 6CN FGT 5ETKXKC +O ,CJT  GTJKGNV /CTSWKU /CTMITCH  0CRQNGQPG 5RKPQNC XQP -CKUGT (GTFKPCPF +++ FCU   /ÒP\TGEJV &GT /CTSWKU YCTVGVG PKEJV NCPIG OKV FGT #WUÒDWPI FGU PGW GTNCPIVGP 2TKXKNGIU 0CEJ GKPGT 'OKUUKQP   KO,CJTYWTFGPYGKVGTG5VÒEMGCWUIGIGDGP&GTXQTNKGIGPFGGZVTGOUGNVGPG6CNGTXQPKOKVKGTVFGP KP$ÌJOGPIGRT·IVGP6CNGT-CKUGT(GTFKPCPFU++CWHFGOFGT/ÒP\JGTTUVGJGPFKO*CTPKUEJFCTIGUVGNNVKUV5VCVV <GRVGTWPF4GKEJUCRHGNJ·NVFGTKVCNKGPKUEJG/CTSWKUCWHUGKPGO6CNGTGKPGP5VCDWPFGKPG$NWOG

151


ITALIEN

547

549

615%#0#

548



%QUKOQ+++/GFKEK2KCUVTC(NQTGP\&CX)CNGQVVK8++

8QT\ÒINKEJ





%CTNQ .WFQXKEQ FK $QTDQPG -ÌPKI XQP 6QUECPC WPF UGKPG /WVVGT /CTKC .WKIKC    (TCPEGUEQPG &GPC (NQTGP\&CX2CICPK  5GNVGPKPFKGUGT'TJCNVWPI2TCEJVGZGORNCT(CUV5VGORGNINCP\ 



.GQRQNFQ++FK.QTGPC(TCPEGUEQPG(NQTGP\2CICPK -CDKPGVVUVÒEM*GTTNKEJG2CVKPCHCUV5VGORGNINCP\

 

550

8'0'&+) 

/CTE #PVQPKQ )KWUVKPKCP  1XCNGU 5KNDGTOGFCKNNQP  WPUKIPKGTV XQP ) *CWVUEJ   0ÒTPDGTI CWH FKG 5KGIG XQP /QTGC IGIGP FKG 6ÒTMGP &GT T VJTQPGPFG &QIG WOIGDGP XQP UGKPGO   )GHQNIG PKOOV XQP FGP XQT KJO MPKGPFGP $TÒFGTP /WUVCHC WPF *CUUCP 2CUEJC KJTG 7PVGTYGTHWPI   GPVIGIGP#WHTGEJV UVGJGPFGT IGHNÒIGNVGT .ÌYG N OKV 5EJYGTV WPF &GNHKP /KV 4CPFUEJTKHV   È 5'4'0+55+/+ .'10+5 #.#6+  51.1 5#.137' 674%#47/ 8+%614+5  64+7/2*#.'   (.14+.')+7/ÜÈZOOI5NI,WNKWU8QNVQNKPC  445GJTCVVTCMVKXGU'ZGORNCTOKVHGKPGT6ÌPWPIXQT\ÒINKEJp5VGORGNINCP\  /CTE#PVQPKQ)KWUVKPKCP /·T\Ó/·T\YCTFGT&QIGXQP8GPGFKI5GKPGMWT\G4GIKG TWPIU\GKV YCT IGMGPP\GKEJPGV FWTEJ GKPG (QNIG XQP ÒRRKIGP WPF XGTUEJYGPFGTKUEJGP (GUVGP (ÒT )KWUVKPKCP YCT   LGFGT#PNC­IWVHÒTGKP(GUVFCUOKVGKPGO6G&GWO EJTKUVNKEJGT.QDIGUCPI KPFGT-KTEJGDGICPPWPFOKVGKPGO $CPMGVVHQTVIGUGV\VYWTFGFCUGTGDGPHCNNUOKVGKPGO6G&GWOGKPNGKVGVGYCUKJODCNFFGP5RKV\PCOGPKNFQIGFGN 6G&GWOGKPDTCEJVG0CEJUGKPGTHGKGTNKEJGP+PVJTQPKUCVKQPHGKGTVGOCPFKG5KGIG8GPGFKIUIGIGPFKG6ÒTMGPOKV &CPMIQVVGUFKGPUVGP(GUVGP6·P\GPWPF5VCFVDGNGWEJVWPIGP

152


JUGOSLAWIEN

552

551

551

-¤0+)4'+%*+6#.+'0 

0CRQNGQP.KTG ,CJTGU\CJNKO5VGORGNCWUIG·PFGTV //CKNCPF2CICPKE 8QT\ÒINKEJGU'ZGORNCTOKVHGKPGT6ÌPWPI



.KTG//CKNCPF&CX2CICPKC  5GJTUGNVGPKPFKGUGT'TJCNVWPI2TCEJVGZGORNCT2QNKGTVG2NCVVGOKPDGTÒJTV

553

554

 

555



8KEVQT'OCPWGN++.KTG//CKNCPF&CX2CICPK  8QT\ÒINKEJp5VGORGNINCP\



 

7ODGTVQ+.KTG44QO&CX2CICPK 8KEVQT'OCPWGN+++.KTG#8+44QO2CICPK

 

(CUV5VGORGNINCP\ 5VGORGNINCP\

556

-¤0+)4'+%* 

,7)15.#9+'0

#NGZCPFGT +   &KPCTC  $GNITCF+P752NCUVKMJQNFGTFGT0)%OKVFGT$GYGTVWPI 2(&CX 5GJTUGNVGPKPFKGUGT'TJCNVWPI*ÒDUEJG2CVKPCRQNKGTVG2NCVVG  153


NIEDERLANDE

557

558

558

.7:'/$74) *'4<1)67/ 6GKNFGT5RCPKUEJGP0KGFGTNCPFG  

2JKNKRR++XQP5RCPKGP'EW2JKNKRRG.WZGODWTI&GNO 4 2TQDUV.p 8QPITÌ­VGT5GNVGPJGKV5GJTUEJÌP

,1*#00+6'414&'0 



/#.6#

(GTFKPCPFXQP*QORGUEJ6CTK&CX4GUVGNNK -N5EJTÌVNKPIUHGJNGTXQT\ÒINKEJGU'ZGORNCTOKVHGKPGT6ÌPWPI

 

559

560

560

0+'&'4.#0&' &'8'06'4%#/2'070&<91..' 

 154

)GOGKPUEJCHVNKEJ 6CNGT Q ,    I ¥ &#8'064+' ¥ %#/2'05+5 ¥ 91..'05+5   &KG FTGK XGTDWPFGPGP 9CRRGP XQP &GXGPVGT %CORGP WPF <YQNNG MNGGDNCVVHÌTOKI CPIGQTFPGV   f/1 f01 f64+8f%+8+6f+/2'4+#f5V.GDWKPWUUVGJVHCUVXXOKV-TGW\HCJPGKPFGT 4GEJVGPWPF$WEJKPFGT.KPMGP&CX&GNO 4   8QPITÌ­VGT5GNVGPJGKV#VVTCMVKXGU'ZGORNCTOKVHGKPGT2CVKPCUGJTUEJÌP 

(4+'5.#0&

2TQXKP\#FNGTVCNGT&CX&GNO

4-N2T·IGUEJY·EJGUGJTUEJÌP




NIEDERLANDE

561

562

764'%*6 

2TQXKP\2JKNKRR++XQP5RCPKGP2JKNKRRUVCNGT&CX&GNO 4  -N)TCHHKVQCWHFGT8QTFGTUGKVGUGJTUEJÌP



2TQXKP\5KNDGTFWMCV'PMJWK\GP&CX&GNO 4 

9'56(4+'5.#0&

45GJTUEJÌP

  

563

1,5:1

1,5:1

0+'&'4.0&+5%*')'$+'6'+0ª$'45'' -1/2#0+'8#08'44' 

8GTGGPKIFG#OUVGTFCOUEJG%QORCIPKG&CCNFGT\W4GCNGU&QTFTGEJVI/ÒP\OGKUVGT ,CEQD,CPU\PFG,QPIG+05+)0+#Û*1..#0&+“Û)GMTÌPVGU9CRRGPXQP*QNNCPF\WFGP5GKVGPLG YGKNUFKG9GTV\CJN++++QDGPFKGIGVGKNVG,CJTGU\CJN++É'6Ü%+8+6#6+5Û#/56'4&#/'05+5Ü <YGK.ÌYGPJCNVGPFCUIGMTÌPVG9CRRGPXQP#OUVGTFCO&CX&GNO 4 5EJQNVGP  8QPITQ­GT5GNVGPJGKV5GJTCVVTCMVKXGU'ZGORNCTOKVJÒDUEJGT2CVKPCUGJTUEJÌP 

564

8'4'+0+)6'156+0&+5%*'-1/2#0+' 

9GUVHTKGUNCPF&WMCVQP*QQTP&CX&GNO5EJQNVGPC 2TCEJVGZGORNCT*GTTNKEJG2CVKPCXQT\ÒINKEJp5VGORGNINCP\

  155


NORWEGEN

1,5:1

-¤0+)4'+%* 

565

1,5:1

0149')'0

*CMQP 8  2GPPKPI Q , WPDGUVKOOVG /ÒP\UV·VVG  I 9CRRGP.KNKGPMTGW\ 5EJKXG   5MCCTG 44&WPMNG2CVKPCUGJTUEJÌP 

566

567

567





%JTKUVKCP+85RGEKGFCNGT%JTKUVKCPKC#JNUVTÌO&CX  5GNVGPDGUQPFGTUKPFKGUGT'TJCNVWPI 5GJTCVVTCMVKXGUUEJCTHCWUIGRT·IVGU'ZGORNCTXQT\ÒINKEJ



5RGEKGFCNGT%JTKUVKCPKCI)GMTÌPVGUWPFIGJCTPKUEJVGU$TWUVDKNFTOKVWOIGNGIVGT(GNF DKPFG)GMTÌPVGT .ÌYG N OKV IGDQIGPGT *GNNGDCTFG \W FGP 5GKVGP      WPVGP FKG 5KIPCVWT 2)  

2GVGT)TÒPGT/ÒP\OGKUVGTKP%JTKUVKCPKC #JNUVTÌO&CX  5GJTUGNVGPKPFKGUGT'TJCNVWPI#VVTCMVKXGUXQT\ÒINKEJGU'ZGORNCTOKVHGKPGT2CVKPC 

568



156

(TGFGTKM+++5RGEKGFCNGT%JTKUVKCPKCI)GMTÌPVGU$TWUVDKNFTOKVWOIGNGIVGT (GNFDKPFG)GMTÌPVGT .ÌYG N OKV IGDQIGPGT *GNNGDCTFG WPVGP FKG 5KIPCVWT () (TGFGTKM )TÒPGT   /ÒP\OGKUVGTKP%JTKUVKCPKC #JNUVTÌO&CX  5GJTUGNVGPKPFKGUGT'TJCNVWPI2TCEJVGZGORNCTOKVJGTTNKEJGT2CVKPC 8QT\ÒINKEJp5VGORGNINCP\ 


NORWEGEN

569



5RGEKGFCNGT%JTKUVKCPKCIÛ(4+&'4+%75Ù+++Ù&Ù)Ù&#0Ù014Ù8#0Ù)16Ù 4': Û )GMTÌPVGU WPF IGJCTPKUEJVGU $TWUVDKNF T OKV WOIGNGIVGT (GNFDKPFGÛ 2418+&'$+6 Û  Û   &1/+075 Û )GMTÌPVGT .ÌYG N OKV IGDQIGPGT *GNNGDCTFG WPVGP FKG 5KIPCVWT () (TGFGTKM )TÒPGT   /ÒP\OGKUVGTKP%JTKUVKCPKC WOJGTIGMTGW\VG.QTDGGT\YGKIGFCTWPVGTFKG,CJTGU\CJNÛÛ #JNUVTÌO&CX 5GJTUGNVGPDGUQPFGTUKPFKGUGT'TJCNVWPI 5GJTCVVTCMVKXGUXQT\ÒINKEJGU'ZGORNCTOKVHGKPGT6ÌPWPI 

570

571 (doppelt)

571 (doppelt)



%JTKUVKCP8-TQPG /CTM %JTKUVKCPKC#JNUVTÌO#&CX  ªDGTFWTEJUEJPKVVNKEJGTJCNVGP(GKPG6ÌPWPIHCUVXQT\ÒINKEJ





5RGEKGFCNGT%JTKUVKCPKCI#JNUVTÌO 7PKM &CX  8QPCNNGTITÌ­VGT5GNVGPJGKV9CJTUEJGKPNKEJDGMCPPVGU'ZGORNCT5EJÌP



572

573

572



5KNDGTOGFCKNNGWPUKIPKGTVCWHUGKPG4GKUGPCEJ0QTYGIGP5GEJU<GKNGP5EJTKHVWOJGT.QTDGGT MTCP\5VTCJNGPFG 5QPPG ÒDGT PQTYGIKUEJGT .CPFUEJCHV OKV (NW­ FCTCWH $QQV  OO  I   )CNUVGT 8QPITÌ­VGT5GNVGPJGKV#VVTCMVKXGUUGJTUEJÌPGU'ZGORNCTOKVHGKPGT2CVKPC 



5RGEKGFCNGT  -QPIUDGTI #WUDGWVG  I $TWUVDKNF T OKV WOIGNGIVGO /CPVGN)GMTÌPVGU   9CRRGP OKV /KVVGNUEJKNF WOJGT FCU $CPF FGU 'NGHCPVGPQTFGPU WPVGP FKG 5KIPCVWT *%/ *GPPKPI   %JTKUVQRJ /G[GT /ÒP\OGKUVGT KP -QPIUDGTI   /KV 4CPFUEJTKHV *COOGT WPF 5EJN·IGN   IGMTGW\V  *“% $14'#5 %;/$41 ('46 140#/'06# .#$147/ #JNUVTÌO  # 7PKM    &CX/ÒUGNGT FQTVWPVGT&·PGOCTM   8QPCNNGTITÌ­VGT5GNVGPJGKV0GDGPFGO5VÒEMKO-ÌPKINKEJ&·PKUEJGP/ÒP\MCDKPGVV FCUDGMCPPVGWPFGKP\KIG'ZGORNCTKP2TKXCVDGUKV\ #VVTCMVKXGUXQT\ÒINKEJGU'ZGORNCT  157


NORWEGEN

575

574

576



5RGEKGFCNGT-QPIUDGTI#WUDGWVGI$TWUVDKNFTOKVWOIGNGIVGO/CPVGNWPF'NGHCPVGPQT FGP)GMTÌPVGU 9CRRGP OKV /KVVGNUEJKNF WOJGT FCU $CPF FGU 'NGHCPVGPQTFGPU WPVGP FKG 5KIPCVWT   *%/ *GPPKPI%JTKUVQRJ/G[GT/ÒP\OGKUVGTKP-QPIUDGTI /KV4CPFUEJTKHV *COOGT WPF5EJN·IGNIGMTGW\V &#00'4-10)+5014&5-'(+'.&'5.+)'(47)6'4*#4+8“.&' #JNUVTÌO%&CX/ÒUGNGT FQTVWPVGT&·PGOCTM   44#VVTCMVKXGUXQT\ÒINKEJGU'ZGORNCT 



(TGFGTKM+85KNDGTOGFCKNNGXQP2$GTICWHFGP6QF-CTNU:++XQTFGTPQTYGIK UEJGP (GUVWPI (TGFGTKMUVGP CO  0QXGODGT PCEJ ITGIQTKCPKUEJGO -CNGPFGT CO  &G\GODGT    .CPFUEJCHV OKV FGT PQTYGIKUEJGP (GUVWPI (TGFGTKMUVGP XQP FGT CWU GKP 5EJW­ CDIGHGWGTV YKTF KO   8QTFGTITWPF NKGIV FGT VQVG UEJYGFKUEJG XQT FGO PQTYGIKUEJGP .ÌYGP#EJV <GKNGP F·PKUEJG 5EJTKHV   OOI)CNUVGT 8QPITQ­GT5GNVGPJGKV0WT'ZGORNCTGIGRT·IV #VVTCMVKXGU'ZGORNCTOKVHGKPGT6ÌPWPIYKP\4CPFHGJNGTUGJTUEJÌPpXQT\ÒINKEJ  &KGF·PKUEJG4ÒEMUGKVGPKPUEJTKHVFKGUGT·W­GTUVUGNVGPGP/GFCKNNGNCWVGV&GTUEJYGFKUEJG.ÌYGH·NNVFGOPQTYGIK UEJGP.ÌYGPXQTFKG(Ò­G&CDGKJCVGTUGKP.GDGPXGTNQTGPWPFNGV\VGTGT$NWVXGTIQUUGP



-TQPG /CTM -QPIUDGTI#JNUVTÌO&CX 5GJTUGNVGPKPFKGUGT'TJCNVWPI5EJCTHCWUIGRT·IVGUXQT\ÒINKEJGU'ZGORNCTOKVHGKPGT6ÌPWPI

 

577



158

%JTKUVKCP8+5KNDGTOGFCKNNGQ,  XQP,%*GFNKPIGTWPF)99CJNCWHFKG 4GKUGFGU-ÌPKIURCCTGUPCEJ-QPIUDGTI\WT$GUKEJVKIWPIFGT-QPIUDGTIGT5KNDGTOKPGP&KG$TWUVDKNFGT FGU-ÌPKIURCCTGUPGDGPGKPCPFGTTFCTWPVGTFKG5KIPCVWTXQP,%*GFNKPIGT&CU-ÌPKIURCCTH·JTVN KPGKPGO\YGKUR·PPKIGP2CTCFGYCIGPKO*KPVGTITWPFIGDKTIKIG9CNFNCPFUEJCHVKO8QTFGTITWPFNXKGT $GTINGWVGKPGKPGO)TCDGPKO#DUEJPKVVXKGT<GKNGP5EJTKHVOOI)CNUVGT/ÒUGNGT  FQTVWPVGT&·PGOCTM   8QPITQ­GT5GNVGPJGKV(GKPG2CVKPCMN4CPFHGJNGTWPF-TCV\GTUGJTUEJÌPpXQT\ÒINKEJ 


NORWEGEN

578



5KNDGTOGFCKNNGXQP,%*GFNKPIGTWPF2$GTICWHFGP$GUWEJFGU-ÌPKIURCCTGUKPFGP-QPIU DGTIGT5KNDGTOKPGP&KG$TWUVDKNFGTFGU-ÌPKIURCCTGUPGDGPGKPCPFGTTFCTWPVGTFKG5KIPCVWTXQP,% *GFNKPIGT&CU RGTUQPKHK\KGTVG -QPIUDGTI OKV -TQPG /GTMWTUVCD WPF (ÒNNJQTP UKV\V PCEJ N CWH FGO   PQTYGIKUEJGP .ÌYGP KO *KPVGTITWPF #PUKEJV FGT 5KNDGTOKPGP QDGP UVTCJNGPFG 5QPPG KO #DUEJPKVV   FTGK <GKNGP 5EJTKHV WPF FKG 5KIPCVWT XQP 2 $GTI  OO  I)CNUVGT/ÒUGNGT

FQTVWPVGT&·PGOCTM   8QPITQ­GT5GNVGPJGKV#VVTCMVKXGUHCUVXQT\ÒINKEJGU'ZGORNCTOKVHGKPGT2CVKPC 

580

579



(TGFGTKM8/CTM 4KMUFCNGT -QRGPJCIGP4GKUGVCNGT#JNUVTÌO#&CX

FQTVWPVGT&·PGOCTM  44-N5EJTÌVNKPIUHGJNGTJÒDUEJG2CVKPCXQT\ÒINKEJ



%JTKUVKCP8++5RGEKGFCNGT-QPIUDGTI#JNUVTÌO 4*GTTNKEJG2CVKPCYKP\5EJTÌVNKPIUHGJNGTXQT\ÒINKEJ



5RGEKGFCNGT-QPIUDGTI#JNUVTÌO 5GJTUGNVGPKPFKGUGT'TJCNVWPI #VVTCMVKXGU'ZGORNCTOKVHGKPGT6ÌPWPIYKP\5VGORGNHGJNGTXQT\ÒINKEJ



-CTN:+8,QJCP5MKNNKPI-QPIUDGTI#JNUVTÌO#  4(GKPG6ÌPWPIHCUVXQT\ÒINKEJ



 

582

581

583



1,5:1

 

583

5RGEKGFCNGT 5MKNNKPI -QPIUDGTI#JNUVTÌO 44(GKPG6ÌPWPIYKP\5EJTÌVNKPIUHGJNGTHCUVXQT\ÒINKEJ

  159


POLEN

584

585

21.'0

-¤0+)4'+%* 

5VGRJCP$CVJQT[)TÌUEJGT1NMWU\+IGT1C 4 -QRKEMKCXCT 4  44-N2T·IGUEJY·EJGUGJTUEJÌPpXQT\ÒINKEJ





)TQUEJGP1NMWU\-QRKEMKCXCT 4 

445GJTUEJÌP





)TQUEJGP1NMWU\-QRKEMKCXCT 4 

445GJTUEJÌP





)TÌUEJGT1NMWU\+IGT1D 4 -QRKEMK 4  8QPITQ­GT5GNVGPJGKV#VVTCMVKXGUUGJTUEJÌPGU'ZGORNCT

 

587

586

588

1,5:1

1,5:1



)TÌUEJGT1NMWU\+IGT1C 4 -QRKEMKXCT 4   8QPITQ­GT5GNVGPJGKV5GJTUEJÌP

589



590



)TÌUEJGT1NMWU\+IGT1E 4 -QRKEMKXCT 4   8QPITQ­GT5GNVGPJGKV5GJTUEJÌP





)TÌUEJGT1NMWU\+IGT1XCT 4 -QRKEMK 4 XCT 8QPITÌ­VGT5GNVGPJGKV4GRCTKGTVGT5EJTÌVNKPIUHGJNGTCO4CPFUGJTUEJÌP

 

591

1,5:1

 160

1,5:1

)TÌUEJGT/ÒP\\GKEJGP(KUEJ1NMWU\+IGT1DXCT 4 -QRKEMK 4   8QPITQ­GT5GNVGPJGKV#VVTCMVKXGUHCUVXQT\ÒINKEJGU'ZGORNCT




POLEN

1,5:1



592

1,5:1

)TÌUEJGT/ÒP\\GKEJGP5EJKNFOKV(KUEJ1NMWU\+IGT1D 4 -QRKEMK 4   8QPITQ­GT5GNVGPJGKV9KP\5EJTÌVNKPIUHGJNGTCO4CPFUGJTUEJÌP



593

1,5:1



1,5:1

)TÌUEJGT/ÒP\\GKEJGP(KUEJ1NMWU\/KV/ÒP\\GKEJGP(KUEJCWHDGKFGP5GKVGP+IGT1C 4  -QRKEMKXCT 4  8QPITÌ­VGT5GNVGPJGKV5GJTUEJÌP

594 1,5:1



595



1,5:1

)TQUEJGP2<1NMWU\-QRKEMK 4  8QPITQ­GT5GNVGPJGKV#VVTCMVKXGU'ZGORNCTUGJTUEJÌP

1,5:1



 

1,5:1

)TQUEJGP  1NMWU\ /KV /ÒP\\GKEJGP FTGKUVKGNKIGU $NCVV WPVGT FGP 9CRRGP KP FGT 4ÒEMUGKVGPFCT   UVGNNWPI-QRKEMK 4  8QPITQ­GT5GNVGPJGKV5GJTUEJÌPpXQT\ÒINKEJ 

596

597

598



)TÌUEJGT1NMWU\+IGT1DXCT 4 -QRKEMKCXCT 4 

445GJTUEJÌP





)TÌUEJGT1NMWU\+IGT1EXCT 4 -QRKEMKCXCT 4 

45GJTUEJÌPpXQT\ÒINKEJ





)TÌUEJGT1NMWU\+IGT1IXCT 4 -QRKEMKCXCT 4  48QT\ÒINKEJGU'ZGORNCTOKVHGKPGT6ÌPWPI

  161


POLEN

1,5:1



599

1,5:1

)TÌUEJGT1NMWU\$TWUVDKNFKP-QTFGNMTGKU+IGT1EXCT 4 -QRKEMK 4   8QPITQ­GT5GNVGPJGKV#VVTCMVKXGUUGJTUEJÌPGU'ZGORNCT

601

600

602

  

)TÌUEJGT1NMWU\+IGT1J 4 -QRKEMKXCT 4  )TÌUEJGT1NMWU\+IGT1RXCT 4 -QRKEMKXCT 4  )TÌUEJGT1NMWU\+IGT1DXCT 4 -QRKEMKXCT 4 



)TÌUEJGT+&1NMWU\+IGT1FXCT 4 -QRKEMK 4 



)TÌUEJGT)*+&1NMWU\8CTKCPVGOKV-TQPGÒDGTFGO(COKNKGPYCRRGP$CVJQT[+IGT1 CXCT 4 -QRKEMKXCT 4  5GJTUEJÌP

603

1,5:1



   162

5GJTUEJÌPpXQT\ÒINKEJ 5GJTUEJÌPpXQT\ÒINKEJ 5GJTUEJÌP

  

5GJTUEJÌP



604

605

607

)TÌUEJGT+&1NMWU\+IGT1CXCT 4 -QRKEMK 4  )TÌUEJGT)*+&1NMWU\+IGT1D 4 -QRKEMK 4  )TÌUEJGT0*+&1NMWU\+IGT1CXCT 4 -QRKEMK 4 



1,5:1

)TÌUEJGT+&1NMWU\+IGT1XCT 4 -QRKEMKCXCT 4  8QPITQ­GT5GNVGPJGKV#VVTCMVKXGUUGJTUEJÌPGU'ZGORNCT

606



 

608

445GJTUEJÌP 5GJTUEJÌP 5GJTUEJÌP

  


POLEN

609



4GKEJUVCNGT0$0CI[D±P[C&CX#-QRKEMK 4  4<CKPGPFGHCUVXQT\ÒINKEJGU'ZGORNCTOKVUEJÌPGT6ÌPWPI

610

 

611



)TÌUEJGT0*+&1NMWU\8CTKCPVGQJPG-TGW\CWHFGT-TQPG+IGT1CXCT 4 -QRKEMK XCT 4  (GKPG2CVKPCXQT\ÒINKEJ





)TÌUEJGT0*+&1NMWU\8CTKCPVGQJPG-TGW\CWHFGT-TQPGWPFOKV-TQPGCWHFGO(COKNK GPYCRRGP$CVJQT[+IGT1CXCT 4 -QRKEMKXCT 4  5GJTUEJÌP



612



5KIKUOWPF+++)TÌUEJGT/CTKGPDWTI)TQ­GT-QRH-QRKEMKZ 4   445GJTUEJÌP

613

614



615



4GKEJUVCNGT++$TQODGTI&CX-QRKEMK 4  5GJTCVVTCMVKXGU'ZGORNCTOKVJÒDUEJGT2CVKPCXQT\ÒINKEJ

 



4GKEJUVCNGT++$TQODGTI&CX-QRKEMK 4 

5GJTUEJÌP





4GKEJUVCNGT++$TQODGTI&CX-QRKEMK 4  -N4CPFHGJNGTMN5EJTÌVNKPIUHGJNGTHCUVXQT\ÒINKEJ

  163


POLEN

616



,QJCPP +++ 5QDKGUMK  5KNDGTOGFCKNNG  XQP , 0GKFJCTF CWH FGP 'PVUCV\ XQP 9KGP   #TOCVWTGP FCTÒDGT 2CNO WPF .QTDGGT\YGKI IGMTGW\V FCTKP UKV\V -CKUGT .GQRQNF + X X CWH GKPGO   4Q­ FCU XQP GKPGO CWH FGO )GUKEJV NKGIGPFGP *CNDOQPF CDURTKPIV5EJNCEJVU\GPG KO *KPVGTITWPF   5VCFVCPUKEJVXQP9KGPFKGXQPGKPGTCWU9QNMGPMQOOGPFGP*CPFOKVFTGK-GVVGPIGJCNVGPYKTFQDGP HÒPH/GFCKNNQPUOKVFGP$TWUVDKNFGTPFGT$GHTGKGT9KGPUOOI*%\*KTUEJ 5NI/QPVGPWQXQp 442TCEJVXQNNG2CVKPCXQT\ÒINKEJGU'ZGORNCT 

617

617



1,5:1

#WIWUV ++ FGT 5VCTMG  5KNDGTOGFCKNNG  XQP / * 1OGKU CWH UGKPG -TÌPWPI \WO   -ÌPKI XQP 2QNGP )GJCTPKUEJVGU $TWUVDKNF T OKV .QTDGGTMTCP\ WPF WOIGNGIVGO /CPVGN)GMTÌPVGU   9CRRGP KP XGT\KGTVGT -CTVWUEJG FCTWPVGT \YGK IGMTGW\VG 2CNO\YGKIG  OO  I *%\ p  

XINFQTVCPFGTG8QTFGTUGKVG 5NI/GTUGD  8QPITQ­GT5GNVGPJGKV*GTTNKEJG2CVKPCXQT\ÒINKEJGU'ZGORNCT  #WIWUV++IGPCPPV#WIWUVFGT5VCTMG /CKKP&TGUFGPÓ(GDTWCTKP9CTUEJCWYCTGKPCWUFGT CNDGTVKPKUEJGP .KPKG FGU (ÒTUVGPIGUEJNGEJVU FGT 9GVVKPGT UVCOOGPFGT -WTHÒTUV XQP 5CEJUGP CNU (TKGFTKEJ #WIWUV   +  &KG 'TNCPIWPI FGT RQNPKUEJGP -ÌPKIUYÒTFG GTHÒNNVG FGP 9WPUEJ PCEJ RQNKVKUEJGT 5QWXGT·PKV·V 'KP YGKVGTGU   YKEJVKIGU/QVKXDKNFGVGPFKG4CPIWPF<GTGOQPKCNHTCIGPFKG\WLGPGT<GKVFKG/CEJVUVGNNWPICP\GKIVGPWPFFCJGT WPOKVVGNDCTG RQNKVKUEJG $GFGWVWPI JCVVGP &GT 'TYGTD FGT RQNPKUEJGP -ÌPKIUMTQPG UVGNNVG FCJGT GKPG 2TGUVKIGHTCIG   GTUVGP4CPIGUHÒT-WTHÒTUV(TKGFTKEJ#WIWUVFCTFGPPPWTOKVGKPGT-ÌPKIUMTQPGMQPPVGGKPFGWVUEJGT(ÒTUVUGKPG UQWXGT·PG5VGNNWPICWUFTÒEMGPWPFFCOKVXQPFGPGWTQR·KUEJGP/·EJVGPCNUINGKEJTCPIKICM\GRVKGTVYGTFGP

618

 164

4GKEJUVCNGT.GKR\KI&CX-QRKEMK 4  49KP\5EJTÌVNKPIUHGJNGTMN-TCV\GTUGJTUEJÌP

 


POLEN

619



1,5:1

619

4GKEJUVCNGTQ,  &TGUFGPCWHFKG4GUVCWTCVKQPFGURQNPKUEJGP1TFGPUFGU9GK­GP#FNGTUI 5QIGPCPPVGT1TFGPUVCNGTI“&Û)Û(4+&'4+%85#8)856854':21.10Û'6'.'%6Û 5#:10 )GJCTPKUEJVGU $TWUVDKNF T OKV .QTDGGTMTCP\ WOIGNGIVGO /CPVGN WPF 1TFGPUDCPF   4'56#84#614 14&+0+5 #38+.“ 21.10+%“ &GT 1TFGP FGU 9GK­GP #FNGTU CP $CPF KP FGT   /KVVG1TFGPUUVGTPOKV-TGW\WPFFGT#WHUEJTKHV241(+&'4')''6.')'&CXp-QRKEMK

4 5EJPGG5NI/GTUGD  8QPITQ­GT5GNVGPJGKV8QT\ÒINKEJGU2TCEJVGZGORNCTOKVHGKPGT6ÌPWPI  &GT1TFGPFGU9GK­GP#FNGTUYWTFGXQPFGOKP$GFT·PIPKUIGTCVGPGP-ÌPKI#WIWUVFGO5VCTMGPPCEJFGO 8QTDKNFFGU5EJYCT\GP#FNGTQTFGPUIGITÒPFGV0CEJFGOGTXQO5EJYGFGPMÌPKI-CTN:++\WO8GT\KEJVCWH FGPRQNPKUEJGP6JTQPIG\YWPIGPYQTFGPYCTWPFPCEJ&TGUFGPHNKGJGPOW­VGMCOGUKO,CJTFCTCWH\W8GTJCPF NWPIGPKP6[MQEKPGKPGO5EJNQ­KOFCOCNKIGP/KVVGNRQNGP6GKNPGJOGTYCTGP<CT2GVGT+XQP4W­NCPFWPFGKPG )TWRRGRQNPKUEJGT)GIPGT-CTNU:++<WT$GNQJPWPIUGKPGT#PJ·PIGTUVKHVGVG#WIWUVFGT5VCTMGFKGGTUVG/GFCKNNG FGU 9GK­GP #FNGTU FKG CP CEJV 2GTUQPGP FCTWPVGT XKGT RQNPKUEJG /CIPCVGP FTGK TWUUKUEJG (GNFOCTUEJ·NNG WPF   GKPGP#VCOCPFGT-QUCMGPCWUIGVGKNVYWTFG  &CUGTUVG1TFGPU\GKEJGPFGU9GK­GP#FNGTUYCTGKPQXCNGU/GFCKNNQP'UYCTTQVGOCKNNKGTVDGUC­CWHFGT8QTFGT UGKVG GKPG #DDKNFWPI FGU RQNPKUEJGP #FNGTU WPF FKG +PUEJTKHV 2TQ HKFG TGIG GV NGIG (ÒT )NCWDGP -ÌPKI WPF   )GUGV\ WPFCWHFGT4ÒEMUGKVGFCUMÌPKINKEJG/QPQITCOO#4 #WIWUVWU4GZ#WIWUVFGT5VCTMG FCUXQPGKPGO ITÒPGP.QTDGGTMTCP\WOIGDGPYCT&CU/GFCKNNQPYWTFGCPGKPGOUEJOCNGPDNCWGP$CPFWOFGP*CNUIGVTCIGP

620



5VCPKUNCWU + .GU\E\[PUMK  $TGVVUVGKP CWU FWPMNGO #JQTPJQN\ Q , IGHGTVKIV KP   0ÒTPDGTIXGTOWVNKEJXQP/$TWPPGT \W#PHCPIFGU,CJTJWPFGTVU &GT-ÌPKITGKVGVNOKV5·DGN KP FGT GTJQDGPGP 4GEJVGP KO*KPVGTITWPF5QNFCVGP#WHJTGPDÒPFGNUEJNCHGPFGT.ÌYGTNRKEMGP FGT*CJPCPJTGPDÒPFGNTDTGPPGPFG$WTIGPCO4JGKPOO*KOOGNJGDGT  5GJTUEJÌP

 165


POLEN

621



#WIWUV +++  5KNDGTOGFCKNNG  XQP * 2 )TQ­MWTV CWH UGKPG -TÌPWPI \WO -ÌPKI   )GJCTPKUEJVGU$TWUVDKNFTOKVWOIGNGIVGO/CPVGN-TÌPWPIUU\GPGOOI*%\ 5NI/GTUGD 2TCEJVGZGORNCT*GTTNKEJG2CVKPCXQT\ÒINKEJp5VGORGNINCP\  (TKGFTKEJ#WIWUV++ 1MVQDGTKP&TGUFGPÓ1MVQDGTKP&TGUFGP5QJP#WIWUVUFGU5VCTMGPWPF %JTKUVKCPG 'DGTJCTFKPG XQP $TCPFGPDWTI$C[TGWVJ YCT UGKV  -WTHÒTUV XQP 5CEJUGP WPF CNU #WIWUV +++ CWEJ   -ÌPKIXQP2QNGPWPF)TQ­JGT\QIXQP.KVCWGP'THÒJTVGPCEJFGO6QFUGKPGU8CVGTUCNUYGVVKPKUEJGT*GTTUEJGT FKG 2GTUQPCNWPKQP 5CEJUGP2QNGP HQTV &GT KP 2QNGP CWEJ CNU #WIWUV FGT 5CEJUG #WIWUV 5CU  DGMCPPVG 4GIGPV   IGJÌTVG\WFGPITÌ­VGP-WPUVO·\GPGPUGKPGT<GKV7TURTÒPINKEJYWTFGCPIGPQOOGPFC­GTUKEJYGPKIWO2QNKVKM IGMÒOOGTV JCDG PGWGTG RQNPKUEJG (QTUEJWPIGP DGNGIGP LGFQEJ FCU )GIGPVGKN &GT -WTHÒTUV YWTFG OKV   7PVGTUVÒV\WPI XQP ¤UVGTTGKEJ WPF 4W­NCPF IGIGP FGP -CPFKFCVGP XQP 5EJYGFGP WPF (TCPMTGKEJ 5VCPKUNCWU +   .GU\E\[PUMK \WO -ÌPKI XQP 2QNGP IGY·JNV YCU FGP 2QNPKUEJGP 6JTQPHQNIGMTKGI CWUNÌUVG #WIWUV +++ YWTFG CO   ,CPWCTIGMTÌPVWPFDGJCWRVGVGFKG-TQPGKO(TKGFGPXQP9KGP

622



5KNDGTOGFCKNNG  XQP * ( 9GTOWVJ CWH FCU 8KMCTKCV &GT IGJCTPKUEJVG -WTHÒTUV TGKVGV T OKV   .QTDGGTMTCP\KPFGT4GEJVGP5EJYGTV$CTQEMGT6KUEJFCTCWHGKPCWHIGUEJNCIGPGU$WEJFCTÒDGTGKPG CWU9QNMGPMQOOGPFG*CPFOKV5EJYGTVOOI*%\ FQTVKP$TQP\G   44*GTTNKEJG2CVKPCUGJTCVVTCMVKXGUXQT\ÒINKEJGU'ZGORNCT 

623



166

5KNDGTOGFCKNNG  XQP * ( 9GTOWVJ CWH FCU(GUVFGU1TFGPUXQO9GK­GP#FNGT)GJCTPKUEJVGU $TWUVDKNFTOKVWOIGNGIVGO/CPVGN$CTQEMGT6KUEJFCTCWHFKG-GVVGFGU1TFGPUXQO9GK­GP#FNGT OOI*%\ 48QT\ÒINKEJ 


POLEN

625

624

626



5KNDGTOGFCKNNG  XQP * ( 9GTOWVJ CWH FCU(GUVFGU1TFGPUXQO9GK­GP#FNGT)GJCTPKUEJVGU $TWUVDKNFTOKVWOIGNGIVGO/CPVGN$CTQEMGT6KUEJFCTCWHFKG-GVVGFGU1TFGPUXQO9GK­GP#FNGT OOI*%\ 48QT\ÒINKEJ 



5KNDGTOGFCKNNG  XQP # 8GUVPGT CWHFKG8GTO·JNWPIUGKPGT6QEJVGT/CTKC#PPCOKV/CZKOKNKCP +++ ,QUGRJ XQP $C[GTP $TWUVDKNFGT FGU 2CCTGUGKPCPFGTIGIGPÒDGT*[OGPUVGJVHCUVXXOKV(CEMGN KP FGT GTJQDGPGP .KPMGP WPF J·NV OKV FGT 4GEJVGP \YGK 9CRRGP FKG CWH GKPGO #NVCT UVGJGP   OOI$GTPJGKOGT*%\9KVV 44*GTTNKEJG2CVKPCXQT\ÒINKEJ 



5KNDGTOGFCKNNGXQP,.1GZNGKPCWHFKG8GTO·JNWPIUGKPGT6QEJVGT/CTKC#PPCOKV/CZKOKNKCP +++ ,QUGRJ XQP $C[GTP $TWUVDKNFGT FGU 2CCTGU GKPCPFGT IGIGPÒDGT8KGT <GKNGP 5EJTKHV KPGKPGO4CJ OGP FGT QDGP KP \YGK KPGKPCPFGTITGKHGPFGP *·PFGP GPFGV WPF FGT XQO $CPF FGU )GQTIUQTFGPU WO   YWPFGPKUVOOI*%\9KVV -CDKPGVVUVÒEM2TCEJVXQNNG2CVKPC5VGORGNINCP\

 

627



5KNDGTOGFCKNNGXQP(9&WDWVCWHFKG)GDWTVUGKPGU'PMGNU(TKGFTKEJ#WIWUV UR·VGT-WTHÒTUV (TKGFTKEJ#WIWUV+++D\Y-ÌPKI(TKGFTKEJ#WIWUV+XQP5CEJUGP $ÒUVGTOKVWOIGNGIVGO/CPVGN 9GKDNKEJG)GUVCNVOKVGKPGO0GWIGDQTGPGPCWHFGO#TOUVGJVPCEJTXQTGKPGO)GPKWUFGTKJTGKPGP ¤N\YGKIGPVIGIGPJ·NVOOI*%\  8QPITQ­GT5GNVGPJGKV2TCEJVXQNNG2CVKPCMN5VGORGNHGJNGTXQT\ÒINKEJ  167


POLEN

629

628

628



$CPEQ6CNGT.GKR\KI&CX-QRKEMK 4 XCT5EJPGG  5GNVGPG8CTKCPVG5GJTUEJÌP





$CPEQVCNGT.GKR\KI-QRKEMK 4  8QPITQ­GT5GNVGPJGKV'VYCUDGTKGDGPUGJTUEJÌPpXQT\ÒINKEJ

 

630

631



$CPEQ6CNGT.GKR\KI&CX-QRKEMK 4 5EJPGG 5GNVGPKPFKGUGT'TJCNVWPI5EJÌPG2CVKPCHCUVXQT\ÒINKEJGU'ZGORNCT



5KNDGTOGFCKNNG Q ,   XQP ( # 5EJGIC CWH FKG 8GTO·JNWPI UGKPGU 5QJPGU (TKGFTKEJ %JTKUVKCP   OKV/CTKC#PVQPKC6QEJVGTFGUDC[TKUEJGP-WTHÒTUVGP-CTN#NDTGEJV)GJCTPKUEJVGU$TWUVDKNF(TKGFTKEJ %JTKUVKCPUT$TWUVDKNF/CTKC#PVQPKCUNOKVWOIGNGIVGO/CPVGNOOI)TQVGOG[GT *%\9KVV 448QT\ÒINKEJp5VGORGNINCP\ /CTKC#PVQPKCYWTFGCO,WNKIGDQTGPWPFXGTO·JNVGUKEJOKV(TKGFTKEJ%JTKUVKCP FGO5QJP #WIWUVU +++ 5KG UVCTD CO  #RTKN  #WHITWPF FGT 2QTVT·VFCTUVGNNWPI XQP (TKGFTKEJ %JTKUVKCP QTFPGV )TQVG   OG[GTFKGXQTNKGIGPFG/GFCKNNGKPFKG<GKVWOGKP



 



5KNDGTOGFCKNNG Q ,   XQP ( # 5EJGIC CWH FKG 8GTO·JNWPI UGKPGT 6QEJVGT /CTKC #PPC OKV  /CZKOKNKCP +++ ,QUGRJ XQP $C[GTP )GJCTPKUEJVGU $TWUVDKNF /CZKOKNKCP +++ ,QUGRJU T $TWUVDKNF   /CTKC#PPCUNOKVWOIGNGIVGO/CPVGNOOI)TQVGOG[GT*%\9KVV 448QT\ÒINKEJ  /CTKC #PPC YWTFG CO  #WIWUV  IGDQTGP WPF XGTO·JNVG UKEJ  OKV /CZKOKNKCP +++ ,QUGH XQP $C[GTP  

FGO5QJP-CTN#NDGTVU5KGUVCTDCO(GDTWCT#WHITWPFFGT2QTVT·VFCTUVGNNWPIXQP/CZKOKNKCP+++ ,QUGHQTFPGV)TQVGOG[GTFKGXQTNKGIGPFG/GFCKNNGKPFKG<GKVWOGKP

168

632


POLEN

633

634

634





5KNDGTOGFCKNNG Q ,   XQP ( # 5EJGIC CWH FKG 8GTO·JNWPI UGKPGT 6QEJVGT /CTKC #PPC OKV   /CZKOKNKCP+++,QUGRJXQP$C[GTP)GJCTPKUEJVGU$TWUVDKNF/CZKOKNKCP+++,QUGRJUTOKVWOIGNGIVGO /CPVGN$TWUVDKNF /CTKC #PPCU N OKV WOIGNGIVGO /CPVGN  OO  I )TQVGOG[GT    *%\9KVV 448QT\ÒINKEJ



5VCPKUNCWU#WIWUV5KNDGTOGFCKNNGXQP,)*QNV\JG[CWHFKGRQNPKUEJG8GTHCUUWPI XQO/CK$ÒUVGTOKV.QTDGGTMTCP\WPFWOIGNGIVGO1TFGP)GHNÒIGNVGT)GPKWUUVGJVPCEJN KP FGT CWUIGUVTGEMVGP 4GEJVGP J·NV GT GKPG (TGKJGKVUOÒV\G FCTWPVGT IGMTÌPVGT )NQDWU OKV RQNPKUEJGP   5VCFVYCRRGPWPF%JTKUVWUOQPQITCOOOOI*%\  8QPITQ­GT5GNVGPJGKV-CDKPGVVUVÒEM2TCEJVXQNNG2CVKPCXQT\ÒINKEJp5VGORGNINCP\ 

635



6CNCT  -QPHÌFGTCVKQPUVCNGT CWH FKG 6CTIQYKV\GT-QPHÌFGTCVKQPFGURQNPKUEJGP#FGNU&CX -QRKEMK 4  442TCEJVGZGORNCT8QT\ÒINKEJ  5VCPKUNCWU #WIWUV YCT U·EJUKUEJGT )GUCPFVGT CO *QH FGT <CTKP 'NKUCDGVJ KP 5V 2GVGTUDWTI YQ GT FKG )WPUV FGT   )TQ­HÒTUVKP WPF UR·VGTGP <CTKP -CVJCTKPC ++ GTYCTD 0CEJ FGO 6QF FGU U·EJUKUEJRQNPKUEJGP -ÌPKIU #WIWUV +++   UGV\VGFKG<CTKPKJTGP.KGDJCDGTDGKFGT-ÌPKIUYCJNXQO5GRVGODGTFWTEJFGTCO0QXGODGT\WO -ÌPKI 5VCPKUNCWU ++ #WIWUV IGMTÌPV YWTFG 0CEJ FGT *KPPCJOG FGT GTUVGP RQNPKUEJGP 6GKNWPIXGTUWEJVGGT OKVWOHCUUGPFGP5VCCVUTGHQTOGPWPFIWVGP$G\KGJWPIGP\W4W­NCPFGKPGIWVG4GIKGTWPI\WHÒJTGP*ÌJGRWPMVFGT 4GHQTORQNKVKMYCTFKG8GTHCUUWPIXQO/CKFKGFGT<CTKP-CVJCTKPCLGFQEJ\WTGXQNWVKQP·TGTUEJKGP&KG <CTKP DKNFGVG  OKV 4GCMVKQP·TGP FKG IGIGP FKG 8GTHCUUWPI IGTKEJVGVG -QPHÌFGTCVKQP XQP 6CTIQYKV\  WPF   GT\YCPI CWEJ FGP $GKVTKVV XQP 5VCPKUNCWU QDYQJN FKGUGT CO <WUVCPFGMQOOGP FGT 8GTHCUUWPI DGFGWVGPFGP #PVGKN   JCVVG &GT FCTCWHJKP GPVHNCOOGPFG $ÒTIGTMTKGI HÒJTVG \WT \YGKVGP RQNPKUEJGP 6GKNWPI  FKG FGP RQNPKUEJGP   5VCCV CWH GKPG RTCMVKUEJ PKEJV OGJT ÒDGTNGDGPUH·JKIG )TÌ­G \WUCOOGPUEJTWORHGP NKG­ 0CEJ YGKVGTGP #WHUV·PFGP   XGTUEJYCPF2QNGPOKVFGTFTKVVGP6GKNWPIXQNNMQOOGPXQPFGT.CPFMCTVGWPF5VCPKUNCWU2QPKCVQYUMKFCPMVG CD &GT )GFGPMVCNGT CWH FKG -QPHÌFGTCVKQP XQP 6CTIQYKV\ GTKPPGTV CP GKPGP FGT YKEJVKIUVGP WPF PGICVKXUVGP   /QOGPVGFGTRQNPKUEJGP)GUEJKEJVGWPF\·JNV\WFGP4CTKV·VGPFGTRQNPKUEJGP0WOKUOCVKM

636

637



4GRWDNKM)TQU\[9KGP-QRKEMK  5GJTUGNVGPDGUQPFGTUKPFKGUGT'TJCNVWPI+P22PWT'ZGORNCTGIGRT·IV2QNKGTVG2NCVVG





<NQV[.QPFQP+P752NCUVKMJQNFGTFGT0)%OKVFGT$GYGTVWPI52'%+/'0-QRKEMK 4  44(CUV5VGORGNINCP\

 169


POLEN

639

638



<NQV[EJ.QPFQP+P752NCUVKMJQNFGTFGT0)%OKVFGT$GYGTVWPI2(&CX-QRKEMK  442QNKGTVG2NCVVG





<NQV[EJ.QPFQP+P752NCUVKMJQNFGTFGT0)%OKVFGT$GYGTVWPI2(-QRKEMK  442QNKGTVG2NCVVG



640



-NKRRG\W<NQV[EJ9CTUEJCW2TQDGOKVINCVVGO4CPFI2CTEJKOQYKE\2  8QPITQ­GT5GNVGPJGKV2TCEJVGZGORNCT5VGORGNINCP\

643

642

641

1,5:1



1,5:1

&#0<+) 

5VCFV )TQUEJGP  IGRT·IV Y·JTGPF FGT $GNCIGTWPI FGT 5VCFV \WT <GKV FGU $ÒTIGTCWHUVCPFU    /KV/ÒP\\GKEJGP&QJNGCWHFGT9CRRGPUGKVG$TCWUG/CPUHGNF6H&WVMQYUMK5WEJCPGME -QRKEMKXCT 4  44.GKEJVG-QTTQUKQPUURWTGPUGJTUEJÌP





)TQUEJGP  IGRT·IV Y·JTGPF FGT $GNCIGTWPI FGT 5VCFV \WT <GKV FGU $ÒTIGTCWHUVCPFU    /KV /ÒP\\GKEJGP &QJNG CWH DGKFGP 5GKVGP 8CTKCPVG OKV FGT &QJNG \WT NKPMGP 5GKVG FGU $TWUVDKNFGU   $TCWUG/CPUHGNFp \W6H &WVMQYUMK5WEJCPGMXCT-QRKEMKXCT 4   8QPITQ­GT5GNVGPJGKV-N2T·IGUEJY·EJGUGJTUEJÌP 



)TQUEJGPOKV6KVGN5VGRJCP$CVJQT[U  &WVMQYUMK5WEJCPGM-QRKEMK 4   42TCEJVGZGORNCTXQPHGKPUVGT'TJCNVWPI5VGORGNINCP\

170




SCHWEDEN

645

644

644



4GKEJUVCNGT  OKV6KVGN9NCFKUNCYU+8  &CX&WVMQYUMK5WEJCPGM++-Q RKEMK 4  *ร’DUEJG2CVKPC5EJTรŒVNKPIUHGJNGTUGJTUEJรŒP 



4GKEJUVCNGTOKV6KVGN,QJCPP-CUKOKTU  &CX&WVMQYUMK5WEJCPGM+CXCT -QRKEMK 4  45GJTUEJรŒP



646

-ยค0+)4'+%*  



5%*9'&'0

/ร’P\GPFGTUEJYGFKUEJGP$GUKV\WPIGPHKPFGP5KGWPVGTFGP0TPWPF 'TKM :+8   /CTM  5VQEMJQNO  I /KV CDIGMร’T\VGT ,CJTGU\CJN <   '4+%85ยบ:++++ยบ)ยบ58'ยบ)16ยบ8#0ยบ3<ยบ4':ร“)GMTรŒPVGUQXCNGUXKGTHGNFKIGU9CRRGPOKV /KVVGNUEJKNFโ€ก &'85 ยบ &#6 ยบ %8+ ยบ 88.6 ยบ < #PUKEJV FGU 5EJยทTGPICTVGPU #JNUVTรŒO p  

XIN  8QPCNNGTITรŒยญVGT5GNVGPJGKV9QJNWPGFKGTV#VVTCMVKXGUHCUVXQT\ร’INKEJGU'ZGORNCT  'UYKTFFKUMWVKGTVQDGUUKEJDGKFGTCWHFKGUGTWPFFGTPCEJHQNIGPFGP/ร’P\G\WUGJGPFGP-ร’UVGPNCPFUEJCHVWOFGP 5VQEMJQNOGTQFGTFGP)รŒVGDQTIGT FCOCNUยNXUDQTI 5EJยทTGPICTVGPJCPFGNV&KGJKGTXQTNKGIGPFGYQJNWPGFKGTVG 8CTKCPVGFGU/CTM5Vร’EMUOKVCDIGMร’T\VGT,CJTGU\CJNHGJNVGKPCNNGPDGFGWVGPFGP5COONWPIGPUEJYGFKUEJGT/ร’P \GP \$#PVGNN'MUVTรŒO5VKGTPUVGFV5XGPUUQP$QPFG YKGCWEJKO-รŒPKINKEJGP/ร’P\MCDKPGVVKP5VQEMJQNO

647



  /CTM  5VQEMJQNO  I )GMTรŒPVGU QXCNGU XKGTHGNFKIGU 9CRRGP OKV /KVVGNUEJKNF#P   UKEJVFGU5EJยทTGPICTVGPU#JNUVTรŒO  ยWยญGTUVUGNVGPDGUQPFGTUKPFKGUGT'TJCNVWPI(GKPG2CVKPCXQT\ร’INKEJ  171


SCHWEDEN

650

648

649



/CTM5VQEMJQNO#JNUVTÌOD  W­GTUVUGNVGPDGUQPFGTUKPFKGUGT'TJCNVWPI5GJTUEJÌPpXQT\ÒINKEJ



,QJCPP+++&CNGT5VQEMJQNO#JNUVTÌO&CX 5GNVGPDGUQPFGTUKPFKGUGT'TJCNVWPI 5GJTCVVTCMVKXGU'ZGORNCTOKVJÒDUEJGT2CVKPCUGJTUEJÌPpXQT\ÒINKEJ



  

-CTN +:    4KMUFCNGT  5VQEMJQNO  I &GT IGMTÌPVG WPF IGJCTPKUEJVG   -ÌPKIUVGJVPCEJNKPFGT4GEJVGPGTJQDGPGU5EJYGTVKPFGT.KPMGP4GKEJUCRHGNWPVGPFTGK9CRRGP QDGP FGT UVTCJNGPFG 0COG ,GJQXCU%JTKUVWU UVGJV X X OKV 5VTCJNGPMTCP\ WPF UGIPGPFGT 4GEJVGP KP   FGT.KPMGP4GKEJUCRHGN#JNUVTÌO&CX  5GJTUGNVGPDGUQPFGTUKPFKGUGT'TJCNVWPI(GKPG2CVKPCYKP\-TCV\GTXQT\ÒINKEJ 

651 652



652

)WUVCX++#FQNH4KMUFCNGT5VQEMJQNOCWHUGKPG*QEJ\GKVOKV/CTKC'NGQPQTC XQP $TCPFGPDWTI CO  0QXGODGT WPF KJTG -TÌPWPI \WT UEJYGFKUEJGP -ÌPKIKP CO  0QXGODGT   #JNUVTÌO 44*ÒDUEJG2CVKPCXQT\ÒINKEJ  )WUVCX++#FQNHXGTNQDVGUKEJKO(TÒJNKPIKP$GTNKPOKV/CTKC'NGQPQTCFGT5EJYGUVGTFGU-WTHÒTUVGP)GQTI 9KNJGNO XQP $TCPFGPDWTI +O *GTDUV  YWTFG /CTKC 'NGQPQTC XQO UEJYGFKUEJGP 4GKEJUMCP\NGT #ZGN 1ZGP   UVKGTPC CDIGJQNV WPF TGKUVGOKVKJTGT/WVVGTWPFYGKVGTGP8GTYCPFVGPPCEJ9KUOCTXQPYQUKGGKPGUEJYGFKUEJG (NQVVG PCEJ -CNOCT DTCEJVG &QTV YWTFG UKG CO  1MVQDGT  XQP )WUVCX ++ #FQNH GORHCPIGP #O   0QXGODGTJKGNVFCU2CCTHGKGTNKEJ'KP\WIKPFKGUEJYGFKUEJG*CWRVUVCFVFKG-TÌPWPIFGT-ÌPKIKPHCPFCO 0QXGODGTUVCVV7TURTÒPINKEJUQNNVGFKG-TÌPWPIGKPGP6CIHTÒJGTUVCVVHKPFGPFKGUGU&CVWOKUVCWEJCWH FGTXQTNKGIGPFGP/ÒP\G\WNGUGPFKG5VGORGNYWTFGPPKEJVOGJTIG·PFGTV



172

8GTIQNFGVG5KNDGTOGFCKNNGXGTOWVNKEJXQP*4KGIGT$TGUNCWCWH)WUVCX++#FQNH+O8QTFGT ITWPFFTGKIGMTÌPVG$GTIGCWUFGOOKVVNGTGPY·EJUVGKP2CNOWPF.QTDGGTMTCP\OKVFGO$TWUVDKNFFGU -ÌPKIU \W FGP 5GKVGP N GKPG *CHGPUVCFV OKV 5EJKHHGP T #TOCVWTGP)GMTÌPVG .KICVWT 45 \W FGP   5GKVGPFKG,CJTGU\CJNWOJGTHÒPH.QTDGGTMT·P\GOKVFGP$TWUVDKNFGTPFGT-ÌPKIG)WUVCX8CUC 'TKM:+8,QJCPP+++5KIKUOWPF+++WPF-CTN+:KPFGP9KPMGNPLGGKP5VGTPOOI *KNFGDTCPF + 5   PWT 8QTFGTUGKVG  5NI 5EJWNV\G #WMVKQP #FQNRJ *GUU 0CEJHQNIGT    (TCPMHWTV/CKP0T 8QPITQ­GT5GNVGPJGKV)GUVQRHVGU.QEJWPFCNVXGTIQNFGV4CPFHGJNGTUGJTUEJÌP

 


SCHWEDEN

653



%JTKUVKPC4KMUFCNGT5VQEMJQNO5KIPCVWT#)WPVGP\WFGP5GKVGP#JNUVTÌOE  -N2WP\GKO4CPFHGKPG2CVKPCOKP5EJTÌVNKPIUHGJNGTHCUVXQT\ÒINKEJ 

654

655

656



-CTN:)WUVCX/CTM5VQEMJQNO#JNUVTÌOXCT 7PIGYÌJPNKEJUEJCTHCWUIGRT·IVGU'ZGORNCTGVYCU)TÒPURCPXQT\ÒINKEJ

 



(TKGFTKEJ+4KMUFCNGT5VQEMJQNO/KV4CPFUEJTKHV#JNUVTÌO&CX5/* -CDKPGVVUVÒEM*GTTNKEJG6ÌPWPIHCUV5VGORGNINCP\





4KMUFCNGT5VQEMJQNO#JNUVTÌO5/*  5GJTUGNVGPKPFKGUGT'TJCNVWPI2TCEJVGZGORNCT(GKPG2CVKPCHCUV5VGORGNINCP\



658

657

657



4KMUFCNGT5VQEMJQNO/KV4CPFUEJTKHV#JNUVTÌO&CX5/*  5GNVGPKPFKGUGT'TJCNVWPI8QT\ÒINKEJ





4KMUFCNGT5VQEMJQNO#JNUVTÌO5/*  5GJTUGNVGPKPFKGUGT'TJCNVWPI-CDKPGVVUVÒEM*GTTNKEJG2CVKPCHCUV5VGORGNINCP\

 173


SCHWEDEN

660

659

661



)WUVCX+++4KMUFCNGT &CNGT5KNXGTO[PV 5VQEMJQNO#JNUVTÌO5/* (GKPG2CVKPCOKPLWUVKGTVXQT\ÒINKEJp5VGORGNINCP\

 



4KMUFCNGT5VQEMJQNO#JNUVTÌOC&CX5/*

(GKPG2CVKPCXQT\ÒINKEJ





4KMUFCNGT5VQEMJQNO#JNUVTÌO&CX5/*

(GKPG6ÌPWPIXQT\ÒINKEJ



663

662

662



)WUVCX+8#FQNH4KMUFCNGT5VQEMJQNO#JNUVTÌO&CX5/*  2TCEJVGZGORNCT(GKPG2CVKPCHCUV5VGORGNINCP\





-CTN:+++4KMUFCNGT5VQEMJQNO#JNUVTÌO5/*  5GJTUGNVGPKPFKGUGT'TJCNVWPI2TCEJVGZGORNCT(GKPG2CVKPCXQT\ÒINKEJp5VGORGNINCP\



664

 174

-CTN:+8,QJCPP4KMUFCNGT5VQEMJQNO/KVXGTVKGHVGT4CPFUEJTKHV#JNUVTÌOC 8QT\ÒINKEJ




SCHWEIZ

665

665

666



4KMUFCNGT5VQEMJQNO#JNUVTÌO



4KMUFCNGT5VQEMJQNO#JNUVTÌO&CX

667

8QT\ÒINKEJp5VGORGNINCP\



2TCEJVGZGORNCT(CUV5VGORGNINCP\



668

669



1UMCT+4KMUFCNGT5VQEMJQNO#JNUVTÌO&CX (GKPG2CVKPCXQT\ÒINKEJp5VGORGNINCP\

 



-CTN:84KMUFCNGT5VQEMJQNO#JNUVTÌO

8QT\ÒINKEJp5VGORGNINCP\





4KMUFCNGT5VQEMJQNO#JNUVTÌOC&CX 2TCEJVGZGORNCT(GKPG2CVKPCHCUV5VGORGNINCP\

 

670

##4)#7 

671

5%*9'+<

-CPVQP(TCPMGP#CTCW&6&CX

(GKPG2CVKPC5VGORGNINCP\



#22'0<'..#755'44*1&'0 

-CPVQP(TCPMGP 0GWVCNGT $GTP&6&CX 0WT'ZGORNCTGIGRT·IV-CDKPGVVUVÒEMXQPHGKPUVGT'TJCNVWPI 2TCEJVXQNNG2CVKPC'TUVCDUEJNCI5VGORGNINCP\

  175


SCHWEIZ

672

$#5'. 

5VCFV&QRRGNVCNGTQ, 'PFGFGU,CJTJWPFGTVU I5VCFVYCRRGPKP<KGTGKPHCUUWPIWOIGDGP XQP CEJV MNGKPGP 8QIVGKYCRRGPUEJKNFGP FC\YKUEJGP $NWOGPXGT\KGTWPIGP&QRRGNCFNGT KP <KGTGKPHCU   UWPI&6&CXWPF 2TCEJVGZGORNCTOKVHGKPGT2CVKPC (CUV5VGORGNINCP\ 

673

$'40 

5VCFV )WNFKPGT   I $·T UEJTGKVGV N FCTÒDGT &QRRGNCFNGT QDGP *CNDMTGKU OKV FGP UKGDGP   8QIVGKYCRRGP 0KGFGTUKOOGPVCN (TWVKIGP $WTIFQTH 6JWP .CWRGP 1DGTUKOOGPVCN WPF #GUEJK    CW­GP YGKVGTG  9CRRGPUEJKNFG #CTDGTI .GP\DWTI $TWII #CTCW <QHKPIGP 1DGTJCUNK 7PVGTUGGP   +PVGTNCMGP6TCEJUGNYCNF/WTVGP*WVVYKN#CTDWTI'TNCEJ#CTYCPIGP1TDG)TCPFUQP$KRR9CP IGP $ÒTGP WPF 0KFCW 5V 8KPEGPVKWU UVGJV PCEJ N OKV $WEJ KP FGT 4GEJVGP WPF 2CNO\YGKI KP FGT   .KPMGPWOJGTOKV.KNKGPXGT\KGTVGT$QIGPMTGKU&CX*/<pD  44*GTTNKEJG2CVKPCHGKPGT2T·IGINCP\UGJTUEJÌPpXQT\ÒINKEJ 

674



176

 6CNGT   I )GRT·IV OKV FGP 5VGORGNPFGU6CNGTU&CUIGMTÌPVG4GKEJUYCRRGPWPF\YGK $GTPGT 9CRRGP KPU &TGKGEM IGUVGNNV WOJGT OKV $N·VVGTP XGT\KGTVGT &TGKRC­4GKEJUCFNGT KP 2GTNMTGKU   WOJGT  9CRRGPUEJKNFG #CTYCPIGP 'TNCEJ 5KIPCW 5VKHV <QHKPIGP %CUVGNGP )TCPFUQP 1TDG   5EJYCT\GPDWTI .CPFUJWV #KING 6TCEJUGNYCNF WPF *WVVYKN  CW­GP YGKVGTG  9CRRGPUEJKNFG  

5VCFV<QHKPIGP#CTCW$TWII.GP\DWTI$ÒTGP0KFCW#CTDGTI$KRR9CPIGP#CTDWTI7PVGTUGGP +PVGTNCMGP #GUEJK (TWVKIGP 9GKUUGPDWTI 1GTUKOOGPVCN 1DGTJCUNK .CWRGP $WTIFQTH WPF 6JWP    */<p \WpE  5GJTUGNVGPDGUQPFGTUKPFKGUGT'TJCNVWPI *GTTNKEJG2CVKPCYKP\5EJTÌVNKPIUHGJNGTCO4CPFUGJTCVVTCMVKXGUXQT\ÒINKEJGU'ZGORNCT 


SCHWEIZ

675



6CNGT\W$CV\GP&6E&CX

676



2TCEJVGZGORNCTOKVHGKPGT6ÌPWPI5VGORGNINCP\

677



678

6CNGT\W$CV\GP&6&CX$ 2TCEJVGZGORNCT*GTTNKEJG2CVKPCHCUV5VGORGNINCP\

 

5%*#((*#75'0 

5VCFV6CNGT&CX*/<pD 5GNVGPKPFKGUGT'TJCNVWPI#WUFTWEMUXQNNG2CVKPCXQT\ÒINKEJ

 

51.16*740 

5VCFV6CNGTQ,&CX% FKGUGU'ZGORNCT */<p 4#VVTCMVKXGU'ZGORNCTOKVJÒDUEJGT2CVKPCUGJTUEJÌPpXQT\ÒINKEJ

 

679



-CPVQP(TCPMGP 0GWVCNGT 5QNQVJWTP&6&CX  40WT'ZGORNCTGIGRT·IV-CDKPGVVUVÒEMXQPHGKPUVGT'TJCNVWPI 2TCEJVXQNNG2CVKPC5VGORGNINCP\

 177


SPANIEN

680

681

682

6'55+0 

-CPVQP(TCPMGP 0GWVCNGT $GTP&6C&CX  2TCEJVGZGORNCTOKVHGKPGT6ÌPWPI(CUV5VGORGNINCP\



5VCFV6CNGT&6P&CX



(TCPMGP#2CTKU&CX&KXQ

<ª4+%*

-¤0+)4'+%* 

8QT\ÒINKEJGU'ZGORNCTOKVHGKPGT2CVKPC



2TCEJVGZGORNCT5VGORGNINCP\



'+&)'0155'05%*#(6

683



684

685

52#0+'0

(GNKRG++4GCNGU5GIQXKC%CNKEÉ&CX 9KP\<CKPGPFGUGJTUEJÌPpXQT\ÒINKEJ

 



(GTPCPFQ8++4GCNGU5%05GXKNNC%CNKEÉ&CX





4GRWDNKM2GUGVCU%CTVCIGPCCWHFKG4GXQNWVKQP$TCWUG/CPUHGNFp%CNKEÉ &CX (CUVXQT\ÒINKEJ

8QT\ÒINKEJ

%CTVCIGPCKUVGKPG*CHGPUVCFVKPFGTURCPKUEJGP2TQXKP\/WTEKCWPFJCVFGPDGFGWVGPFUVGP-TKGIUJCHGPFGU.CPFGU +O,CJTGDTCEJJKGTGKPHÌFGTCNKUVKUEJGT#WHUVCPFCWUGTUVKO,CPWCTMQPPVGPFKG4GIKGTWPIUVTWRRGPFKG 5VCFV\WTÒEMGTQDGTP

178




BOLIVIEN

686

687

688

70)#40 5+'$'0$ª4)'0(ª456'0 

,QJCPP++5KIKUOWPF'KPUGKVKIGT0QVVCNGT&CX4GUEJ -N5EJTÌVNKPIUHGJNGTUGJTUEJÌP

 



)CDTKGN$CVJQT[4GKEJUVCNGT&CX4GUEJHHXCT 44(GKPG2CVKPCNGKEJVG)N·VVWPIUURWTGPUGJTUEJÌP

 



/KEJCGN#RCHK4GKEJUVCNGT#+9GK­GPDWTI&CX4GUEJ 44-N5EJTÌVNKPIUHGJNGTCO4CPFUGJTUEJÌP

 

/ª0<'070&/'&#+..'0#75ª$'45''

689

#4)'06+0+'0 

.C4KQLC2TQXKP\4GCNGU4.C4KQLC-/

690

691

*ÒDUEJG2CVKPCXQT\ÒINKEJ



692

$1.+8+'0 

4GRWDNKM%GPVCXQU9KGP-/  5GJTUGNVGPDGUQPFGTUKPFKGUGT'TJCNVWPI2QNKGTVG2NCVVG



 

%GPVCXQU9KGP-/ %GPVCXQU9KGP-/

 

5GJTUGNVGPDGUQPFGTUKPFKGUGT'TJCNVWPI2QNKGTVG2NCVVG 5GJTUGNVGPDGUQPFGTUKPFKGUGT'TJCNVWPI2QNKGTVG2NCVVG

179


CHINA

693

$4#5+.+'0 

4GRWDNKMUGKV4GKU-/  5GNVGPKPFKGUGT'TJCNVWPI2TCEJVGZGORNCT(CUV5VGORGNINCP\



1,5:1

694

%*+0# 

*UWCPI 6WPI   &QNNCT Q ,   6KGPVUKP 2TQDG KP 5KNDGT  I /KV 5KIPCVWT   )+14)+CWHFGT4ÒEMUGKVG&CXp XIN -CPPp XIN .KP)YQ/KPI  8QPITÌ­VGT5GNVGPJGKV(CUV5VGORGNINCP\ 

695

1,5:1

 180

1,5:1

4GRWDNKM%GPVU,CJT  #9KGP-CPP;GQ  5GJTUGNVGPKPFKGUGT'TJCNVWPI2QNKGTVG2NCVVG




URUGUAY

697

696

,#2#0 

/WVUWJKVQ$QGMK)KP 6TCFG&QNNCT ,CJT/GKLKTC  &CX,CEQDU8GTOGWNG4 8QT\ÒINKEJ



;GP,CJT/GKLKTC  1UCMC&CX,CEQDU8GTOGWNG3

8QT\ÒINKEJp5VGORGNINCP\

 

698

-#/$1&5%*# -¤0+)4'+%* 

0QTQFQO+(TCPEU2TQDGKP5KNDGTI/KVINCVVGO4CPF5VGORGNUEJPGKFGT % 9WTFGPJGTCWUIGIGDGPWPFIGRT·IVKP$TÒUUGNXQPFGP)GDTÒFGTP/GPPKI-QRHN&GT'T\GPIGN /KEJCGNDG\YKPIVFGP5CVCP.GEQORVG 44*GTTNKEJG2CVKPCCVVTCMVKXGUXQT\ÒINKEJGU'ZGORNCT



699

5+'44#.'10' 

$TKVKUEJG-QNQPKG)GQTIG+++&QNNCT&CX

4(GKPG2CVKPCHCUVXQT\ÒINKEJ



702 701

700 703

747)7#; 

4GRWDNKMUGKV%GPVGUKOQU#9KGP-/  5GJTUGNVGPDGUQPFGTUKPFKGUGT'TJCNVWPI2QNKGTVG2NCVVG



 

%GPVGUKOQU#9KGP-/ %GPVGUKOQU#9KGP-/

5GJTUGNVGPDGUQPFGTUKPFKGUGT'TJCNVWPI2QNKGTVG2NCVVG 5GJTUGNVGPKPFKGUGT'TJCNVWPI2QNKGTVG2NCVVG

 



%GPVGUKOQ#9KGP-/ 5GJTUGNVGPDGUQPFGTUKPFKGUGT'TJCNVWPI(GKPG2CVKPCOKPDGTÒJTVRQNKGTVG2NCVVG

  181


VIETNAM

704

1,5:1

1,5:1

8'4'+0+)6'56##6'0810#/'4+-#75# 

(ÌFGTCVKQP5KNDGTOGFCKNNGXQP229GTPGTCWHFKGHTCP\ÌUKUEJGP-QNQPKGPKP#OGTKMC/GT MWTUVGJVXXFKGTGEJVG*CPFCPU1JTIGNGIVKO*KPVGTITWPFGKPGKTKUEJGWPFHTCP\ÌUKUEJG(TGICVVG CWH5GG0QTFCOGTKMCPKUEJGT+PFKCPGTMTKGIGTUVGJTTOKV(GFGTDWUEJ2HGKNWPF$QIGP\WUGKPGP(Ò­GP GKP#NNKICVQTXQTKJOUKV\VGKPGIGMTÌPVGYGKDNKEJG)GUVCNVOKV<GRVGTKOTGEJVGP#TOOKVFGT.KPMGP J·NV UKG GKPGP /KPKCVWTVGORGN GORQT KO *KPVGTITWPF /GGT  OO  I 'KOGT    5NI'TNCPIGTp 8QPITQ­GT5GNVGPJGKV(GKPG2CVKPCXQT\ÒINKEJp5VGORGNINCP\ 

706

705

705



5KNXGT&QNNCT2JKNCFGNRJKC&TCRGFDWUVV[RG5VCT4GXGTUG;GQ5

5GJTUEJÌP





%GPVU &QNNCT 2JKNCFGNRJKC.KDGTV[%CRRGF$WUVV[RG;GQ5  8QT\ÒINKEJp5VGORGNINCP\



707

#00#/  182

8+'60#/

/KPJ/CPI6KGP 2KCUVGT ,CJT  &CX5EJTQGFGT  *ÒDUEJG2CVKPCXQT\ÒINKEJ




Pieter Brueghel d. Ä., Nachfolger. Der Alchemist. Öl auf Holz, 68,8 x 96 cm. Verkauft für: e 1.680.000,-

Einladung zu Einlieferungen für unsere Frühjahrsauktionen 2011 Möbel, Porzellan, Fayence, Silber, Schmuck, Design Gemälde, Zeichnungen, Skulpturen 15.–19. Jh. Zeitgenössische Kunst Moderne Kunst Photographie Asiatische Kunst Präkolumbische Kunst

L E M PE RTZ Neumarkt 3 50667 Köln Poststraße 22 10178 Berlin St.-Anna-Platz 3 80538 München www.Lempertz.com

Tel. 02 21 ⁄ 92 57 29 - 0 Fax - 6 Tel. 030 ⁄ 27 87 60 8 - 0 Fax - 6 Tel. 089 ⁄ 98 10 77 67 Fax 21 01 96 95 info@Lempertz.com


Leitfaden zur erfolgreichen schriftlichen Auktionsteilnahme • • • • •

Studieren Sie den Katalog sorgfältig und notieren Sie alle Lose, die interessant für Sie sind. Legen Sie für jedes Los Ihr persönliches Limit fest, das Sie maximal zu zahlen bereit sind. Füllen Sie das beiliegende Formular aus (siehe unten) und tragen Sie für jedes Los Ihr Höchstgebot ein. Schicken Sie uns Ihren Auftrag frühzeitig. Bei gleich hohen Geboten erhält das zuerst eingegangene Gebot den Zuschlag. Sie haben interessante Lose für insgesamt € 10.000,– gefunden, möchten jedoch nur € 2.000,– ausgeben. Kein Problem: Sie geben als Gesamtlimit (ohne Aufgeld) € 2.000,– an. • Wenn Sie Fragen haben: Die MitarbeiterInnen unserer Kundenbetreuung sind für Sie da: Telefon 0800 583 65 37 (gebührenfrei). • Wenn Sie telefonisch an unseren Auktionen teilnehmen möchten, ist das ab einer Schätzung von € 500,– pro Los möglich. Bitte teilen Sie uns diesen Wunsch mindestens einen Werktag vor Beginn der Versteigerung schriftlich mit.

Musterauftrag für schriftliche Gebote Name, Adresse, Telefon Ihre vollständige Anschrift ist wichtig, damit wir Ihren Auktionsauftrag annehmen und bearbeiten können. Ihre Telefonnummer brauchen wir, um Sie bei Rückfragen zu Ihren Geboten schnell erreichen zu können.

Ihre Kundennummer Die Angabe Ihrer Kundennummer unterstützt uns bei der Bearbeitung Ihres Auktionsauftrages. Viele Vorarbeiten für die Auktion werden dadurch einfacher und es werden Fehler vermieden.

Losnummern und Gebote Listen Sie alle Lose, für die Sie sich interessieren, mit ihrer Katalognummer auf und legen Sie für sich selbst fest, wie viel Sie bereit sind, für jedes einzelne Los zu bieten.

Ihr Limit pro Einzellos An dieser Stelle geben Sie an, was Sie für jedes einzelne Stück maximal bereit sind auszugeben.

„Oder“-Gebote Wenn Sie sich für mehrere Münzen interessieren, aber nur ein Stück davon erwerben wollen, können Sie Ihre Gebote einfach mit einem „Oder“ verbinden. Wichtig: bei den „Oder“Geboten können Sie nicht auf frühere Katalognummern zurückgreifen (z. B. 2890 oder 1558), da die Nr. 1558 dann bereits versteigert ist. Unterschreiben Sie Ihren Auktionsauftrag ... ... nachdem Sie Ihre Angaben noch einmal überprüft haben. Ihre Unterschrift ist wichtig, denn damit bestätigen Sie uns, dass sie tatsächlich teilnehmen wollen.

Überschreitung Ihrer Limits pro Einzellos In der Praxis zeigt sich, dass oft mehrere Bieter mit ihren Geboten dicht beieinander liegen. Deshalb empfiehlt es sich, an dieser Stelle einer geringfügigen Überschreitung Ihrer Gebote zuzustimmen. Dadurch erhöhen sich Ihre Chancen, im Wettbewerb mit anderen den Zuschlag zu erhalten.

Begrenzung Ihres Gesamtlimits Hier können sie die Gesamtsumme Ihrer Gebote begrenzen und festlegen, was Sie insgesamt maximal bereit sind auszugeben. Aufgeld und Mehrwertsteuer kommen später noch hinzu.

TEL +49 (0)541 96 20 20, FAX +49 (0)541 96 20 222, SERVICE@KUENKER.DE, WWW.KUENKER.DE


Wie entsteht der Preis einer Auktion? Der im Auktionskatalog angegebene Preis ist ein Schätzpreis, der durch unsere Experten festgelegt wurde. Das Mindestgebot liegt bei 80 % dieses Wertes. Die Zuschlagpreise sind oft deutlich höher als die Schätzpreise. Als Auktionshaus müssen wir bereits vor der Auktion alle schriftlichen Gebote koordinieren. Folgende Beispiele sind im Bietverfahren möglich: Beispiel 1 (Schätzpreis: € 1.000,–) Es liegt kein schriftlicher Auftrag vor: Der Auktionator ruft das Los in der Auktion mit € 800,– aus. Wenn im Saal nur ein Bieter darauf ein Gebot abgibt, erhält der Saalbieter den Zuschlag für € 800,–.

Beispiel 3 (Schätzpreis: € 1.000,–) Es liegt dem Auktionator nur ein schriftliches Gebot von € 850,– vor: Das Los wird in der Auktion mit € 800,– ausgerufen. Falls kein Bieter im Saal ein Gegenangebot abgibt, erhält der schriftliche Bieter den Zuschlag bei € 800,–.

Beispiel 2 (Schätzpreis: € 1.000,–) Es liegen dem Auktionator drei schriftliche Gebote vor:

Beispiel 4 (Schätzpreis: € 1.000,–) Es liegt dem Auktionator nur ein schriftliches Gebot von € 1.200,– vor: Der Auktionator ruft das Los mit € 800,– aus. Gibt es im Saal keinen Gegenbieter, erhält der schriftliche Bieter den Zuschlag bei € 800,–. Falls es im Saal Gegenbieter gibt, bietet der Auktionator für seinen schriftlichen Bieter bis maximal € 1.200,– und erteilt einem Gegenbieter im Saal erst bei mehr als € 1.200,– den Zuschlag.

Bieter 1: Limit € 2.900,– Bieter 2: Limit € 1.800,– Bieter 3: Limit € 800,– Nach der Versteigerungsordnung muss der Auktionator im Interesse von Bieter 1 und 2 angemessen überbieten (um ca. 5 bis 10 %). Der Ausrufpreis in der Auktion beträgt daher im Interesse von Bieter 1 € 1.900,– (obwohl die Schätzung € 1.000,– beträgt). Falls keine höheren Gebote aus dem Saal erfolgen, erhält Bieter 1 den Zuschlag für € 1.900,–. Das Höchstangebot von € 2.900,– musste nicht ausgeschöpft werden.

Beispiel 5 (Schätzpreis: € 1.000,–) Es liegen drei Gebote von je € 975,– vor: Um Missverständnisse zu vermeiden, überzieht der Auktionator das zuerst eingegangene Gebot geringfügig und erteilt den Zuschlag bei € 1.000,–.

Antworten auf Fragen, die uns oft gestellt werden • Zuschlagpreis/Aufgeld: Wir berechnen als Auktionshaus ein Aufgeld von 15 % auf den Zuschlagpreis, dazu kommt die gesetzliche Mehrwertsteuer. Beispiel 1

Zuschlagpreis Aufgeld 15 % Versandkosten, z. B. * MwSt. 7 % Rechnungs-Betrag

€ € € € €

100,00 15,00 5,90 8,46 129,36

Beispiel 2

Zuschlagpreis Aufgeld 15 % Versandkosten, z. B. * MwSt. 7 % Rechnungs-Betrag

€ 1.000,00 € 150,00 € 5,90 € 80,91 € 1.236,81

• Mehrwertsteuer: üblicherweise in Deutschland 7 %, seit dem 01.01.2000 sind viele Goldmünzen, die nach 1800 geprägt wurden, steuerfrei. Bei Fragen zu der MwSt.-Berechnung rufen Sie uns an, gebührenfrei unter: 0800 583 65 37. • Rücklosverkauf: Alle Lose, die in der Auktion nicht verkauft wurden, können Sie innerhalb von vier Wochen nach der Versteigerung zu 80 % des Schätzpreises (zzgl. Aufgeld und Mehrwertsteuer) erwerben. Achtung: Viele Rücklose sind schnell vergriffen. • Unser Spezialservice: Alle Bieter erhalten gratis die Ergebnisliste innerhalb von zwei Wochen nach der Auktion. Im Internet können Sie die Ergebnisliste der Auktion sofort nach der Auktion unter www.kuenker.de einsehen. * Die Kosten für Versand und Versicherung werden nach Aufwand berechnet.

Besuchen Sie uns doch einmal persönlich auf der Auktion! • Wir freuen uns sehr, wenn Sie persönlich nach Osnabrück kommen möchten. Das Flair einer Auktion und die Stimmung im Auktionssaal sind ein besonderes Erlebnis für Sie als Sammler. Osnabrück ist außerdem immer eine Reise wert und die persönliche Betreuung durch unsere Mitarbeiter wissen immer mehr Kunden zu schätzen. • Bitte rufen Sie uns rechtzeitig an, damit wir Ihnen Tipps für die Anreise geben und Ihnen ein Hotelzimmer reservieren können. Sie erreichen uns gebührenfrei unter: 0800 583 65 37. • Als erfolgreicher Bieter können Sie Ihre neu erworbenen Stücke gleich persönlich mit nach Hause nehmen. Als guter Kunde unseres Hauses haben Sie 20 Tage Zahlungsziel nach der Auktion.

TEL +49 (0)541 96 20 20, FAX +49 (0)541 96 20 222, SERVICE@KUENKER.DE, WWW.KUENKER.DE


Versteigerungsbedingungen Die Versteigerung erfolgt im Auftrag und für Rechnung der Eigentümer unter Einhaltung der sich aus der Versteigerungsordnung (BGB1 I 1976, 1346) ergebenden und für Kommissionäre geltenden gesetzlichen Bestimmungen des BGB und HGB gegen Barzahlung des Kaufpreises in €-Währung. Durch Abgabe eines Gebotes werden die Versteigerungsbedingungen anerkannt, dies gilt auch für die schriftlichen Gebote. Der Zuschlagpreis ist Nettopreis im Sinne des Umsatzsteuergesetzes und bildet die Berechnungsgrundlage für das vom Käufer zu zahlende Aufgeld in Höhe von 15 %. Auf den daraus entstehenden Gesamtpreis (Zuschlag + Aufgeld) wird die jeweils gültige Umsatzsteuer erhoben, soweit dies gesetzlich vorgeschrieben ist. Ausländischen Käufern aus Ländern der europäischen Gemeinschaft wird die in Deutschland gültige Umsatzsteuer berechnet. Anderen ausländischen Käufern (aus Drittländern) wird, sofern die Münzen durch uns exportiert werden, ein Aufgeld von 15 % netto auf den Zuschlagpreis berechnet; sie erhalten die Lieferung nur gegen Zahlung des Kaufpreises in €-Währung, bankspesenfrei. Ausländischen Münzhändlern aus Ländern der europäischen Gemeinschaft wird bei Nachweis der Umsatzsteuer-Identifi kationsnummer (§ 27 a USTG) und der sonstigen Voraussetzungen gemäß § 4 Nr. 1 b USTG in Verbindung mit § 6 a USTG die Lieferung ohne Umsatzsteuer berechnet. Sofern nichts anderes vereinbart wird, ist die Zahlung der Auktionsrechnung bei anwesenden Käufern sofort, bei schriftlichen Bietern spätestens 20 Tage nach Erhalt fällig. Bei Zahlungsverzug werden Zinsen von 1 % pro Monat berechnet. Wird die Zahlung nicht sofort an den Versteigerer geleistet oder die Abnahme der zugeschlagenen Sache verweigert, so findet die Übergabe der Sache an den Ersteigerer nicht statt. Der Ersteigerer verliert vielmehr seine Rechte aus dem Zuschlag, und die Sache kann auf seine Kosten erneut versteigert werden. In diesem Fall haftet der Ersteigerer für den Ausfall, dagegen hat er auf den Mehrerlös keinen Anspruch. Der Zuschlag erfolgt nach dreimaligem Ausruf des höchsten Gebotes und verpflichtet zur Abnahme und Zahlung. Bei Meinungsverschiedenheiten über den Zuschlag wird die Nummer noch einmal ausgerufen. Der Versteigerer ist berechtigt, Nummern zu vereinigen oder zu trennen. Eine Vorausnahme von Nummern erfolgt nicht. Der Zutritt zur Versteigerung ist nur Interessenten gestattet, die einen Katalog besitzen. Die Mindeststeigerungsstufen für das Bietungsverfahren betragen: Gebote

Mindeststeigerungsstufe

Schriftliche Aufträge werden von uns ohne Auftragsprovision gewissenhaft ausgeführt. Aufträge von uns unbekannten Sammlern können nur ausgeführt werden, wenn ein Depot hinterlegt wird oder Referenzen benannt werden. Schriftliche Gebote können nur bis 24 Stunden vor Auktionsbeginn verbindlich berücksichtigt werden. Im Bedarfsfall ist der Auktionator berechtigt, die Limits um 3 – 5 % zu überschreiten. Bei mehreren gleichhohen Geboten erhält das zuerst eingegangene den Zuschlag. Unlimitierte Aufträge haben keinen Anspruch auf unbedingte Ausführung. Telefonisches Bieten ist nur in Ausnahmefällen möglich. Telefonische Bieter müssen sich mindestens einen Werktag vor der Auktion voranmelden. Der Versand geht zu Lasten und auf Risiko des Ersteigerers bzw. Empfängers. Das Auktionsgut bleibt bis zur vollständigen Bezahlung aller Forderungen aus Anlass der Versteigerung Eigentum des Verkäufers. Ist der Käufer Vollkaufmann, so ist Osnabrück als Gerichtsstand vereinbart. Für das Mahnverfahren gilt die Zuständigkeit des Amtsgerichts Osnabrück auch in allen anderen Fällen als vereinbart. Ansonsten ist es Osnabrück nur, wenn nur die Firma Fritz Rudolf Künker GmbH & Co. KG ihren allgemeinen Gerichtsstand in der BRD hat, oder wenn alle Ansprüche im Wege des Mahnverfahrens geltend gemacht werden, oder wenn die im Klageweg in Anspruch zu nehmende Vertragspartei nach Vertragsabschluss ihren gewöhnlichen Aufenthaltsort aus dem Geltungsbereich der BRD verlegt hat, oder ihr Wohnsitz oder gewöhnlicher Aufenthaltsort zum Zeitpunkt der Klage nicht bekannt ist. Die Beschreibung im Katalog ist gewissenhaft durchgeführt. Sie begründet jedoch keine Rechts- oder Sachmängelhaftung gemäß §§ 434, 459 ff BGB. Die Angabe der Erhaltung ist streng nach den im deutschen Münzhandel üblichen Erhaltungseinstufungen vorgenommen und gilt als persönliche Beurteilung. Bei der Auktion anwesende Käufer kaufen grundsätzlich „wie besehen“. Da durch Vorbesichtigung Gelegenheit gegeben ist, sich vom Erhaltungszustand des Versteigerungsgutes zu überzeugen, können nach erfolgtem Zuschlag Reklamationen nur bei irrtümlich übersehener Henkel- oder Fassungsspur oder gestopftem Loch berücksichtigt werden. Bei Losen mit mehreren Stücken sind die Stückzahlen nur Circa-Angaben, irrtümliche Zuschreibungen sind im Einzelfall nicht ausgeschlossen. Diese Lose sind nach erfolgtem Zuschlag von jeder Reklamation ausgeschlossen. Der Versteigerer kann bei eventuellen Meinungsverschiedenheiten bzw. Beanstandungen einen vereidigten Sachverständigen seiner Wahl (die Kosten trägt der unterliegende Teil) beauftragen. Eventuelle Beanstandungen können nur innerhalb von 8 Tagen nach der Auktion bzw. nach Erhalt der ersteigerten Stücke berücksichtigt werden. Die Echtheit der Stücke wird bis zur Höhe des Kaufpreises garantiert. Die beigedruckten Preise sind Schätzpreise, die unter- oder überschritten werden können. Aufträge, die unter 80 % des Schätzpreises liegen, können nicht bearbeitet werden.

bis zu

€ 100,–

€ 5,–

bis zu

€ 200,–

€ 10,–

bis zu

€ 500,–

€ 20,–

bis zu

€ 1.000,–

€ 50,–

bis zu

€ 2.000,–

€ 100,–

Soweit nicht anders vermerkt, gelten im übrigen die allgemeinen Versteigerungsbestimmungen und – auch im Verhältnis zu ausländischen Kunden – gilt Deutsches Recht.

bis zu

€ 5.000,–

€ 200,–

Die Ergebnisliste erscheint sofort nach der Auktion.

bis zu

€ 10.000,–

€ 500,–

bis zu

€ 20.000,–

€ 1.000,–

bis zu

€ 50.000,–

€ 2.000,–

bis zu

€ 100.000,–

€ 5.000,–

ab

€ 100.000,–

€ 10.000,–

Ausländische Kunden kaufen nach den Devisen-, Zoll- und Steuerbestimmungen ihres Landes. Versandformalitäten werden vom Versteigerer erledigt.

Die Versteigerer:

Fritz Rudolf Künker Dr. Andreas Kaiser Arne Kirsch Oliver Köpp

TEL +49 (0)541 96 20 20, FAX +49 (0)541 96 20 222, SERVICE@KUENKER.DE, WWW.KUENKER.DE


Terms and Conditions of Auction The auction is conducted on behalf and for the account of the appropriate proprietors of the goods and is subject to the federal Auction Regulation (Versteigerungsordnung, BGB1 I 1976, 1346) published in the Federal Law Gazette Vol. I, 1976, 1346 and the relevant provisions for factors in accordance with the German Civil Code (BGB) and Commercial Code (HGB). Payment of the hammer-price has to be made in cash and in Euro. The submission of an offer implies the express acknowledgement of these Terms and Conditions of Auction; the same applies to the submission of an offer in writing. The hammer-price is exclusive of applicable German VAT according to the prevailing VAT-legislation and represents the basis for calculating the surcharge of 15 percent payable by the purchaser. The total price so calculated (hammer-price plus surcharge) is subject to the VAT (value added tax = Mehrwertsteuer), which is payable additionally. Purchasers from abroad will be charged a surcharge of 15 percent net on the hammerprice, provided the export of the coins is undertaken by the auctioneer. Buyers in European Community (EEC) countries (other than Germany) will be charged value added tax at the rates prevailing in Germany. Dealers from EEC countries (other than Germany) will receive goods free of tax upon presentation of their VAT ID number, and upon fulfillment of the other conditions set forth in Paragraph 4, Nr. 1 b, and Paragraph 6 a of the German Turnover Tax Law Buyers from other countries are not charged value added tax. Delivery will be made against payment in Euro with no bank charges to the auctioneer. Unless mutually agreed otherwise, payment of the auction bill from purchasers present at the auction is due immediately. From purchasers who have submitted a bid in writing, payment is due within 20 days after receipt of the goods. Defaulted payments shall bear an interest charge of 1 % per month in the amount in default. Should payment to the auctioneer not be made immediately or should the acceptance of the awarded item be refused, such item shall not be handed over to the purchaser. Instead the purchaser shall forfeit all right and title in and to such item from the award and the item may again be put to auction at this buyer’s cost. In this event the buyer shall be liable for any shortfall, while he shall have no right or claim towards any excess proceeds. An item will be knocked down after the highest bid has been called three times. The award shall be a binding commitment and liability on the part of the bidder to take acceptance and delivery of the item or items so awarded. In the event of any dispute with regard to the award the lot will be put up again for bidding. The auctioneer reserves the right to combine or to separate lots. Lots will not be called out of sequence. Access to the auction will only be permitted to interested persons who are in possession of the catalogue.

lot, the bid first received by the auctioneer shall be given the award. Unlimited bids shall not oblige the auctioneer to consider, accept or carry out such order. Telephone bidding is generally an option for lots of substantial value only. The registration is required at the latest a day before auction. Shipment (by mail or otherwise) of the goods shall be for the sole cost and risk of the purchaser or recipient, respectively. The auctioned goods remain the sole and exclusive property of the vendor until full payment and settlement of any and all dues and claims in connection with the auction. In the event the purchaser is a merchant (in the sense of the German commercial laws) Osnabrück shall be the agreed and exclusive place of jurisdiction. The competence of the District Court (Amtsgericht) of Osnabrück is agreed in respect of summary proceedings for the collection of defaulted payments (Mahnverfahren) as well as in any and all other cases. Should the purchaser not be a merchant Osnabrück shall be the place of jurisdiction with the District Court of Osnabrück’s competence, if only the auctioneer has his ordinary legal domicile in the Federal Republic of Germany or if claims are made by way of summary proceedings of collection (Mahnverfahren) or if the defendant has moved his ordinary legal domicile outside the jurisdiction of the Federal Republic of Germany or if the legal domicile of the defendant is unknown to the auctioneer at the time of filing a suit. To the exclusion of any other legislation German law, as in force at the time, shall be applied for the settlement of any and all legal or judicial matters. The specifications and descriptions in the catalogue have been prepared diligently and in good faith, however, do not constitute the acceptance by the auctioneer of any warranty or liability in respect of defect in material or title. The state of preservation of items is strictly assessed in accordance with the grades accepted by the German coin trade and only represents an individual and personal assessment. Purchasers present at the auction acquire items strictly on the basis of “as is where is” and “as inspected”. In view of the opportunity of prior inspection to ascertain the state and condition of the auction lots, complaints and objections made after the sale will only be considered, if by obvious error or mistake loop or traces or mountings, traces of trimmings or settings, or the plugging of a hole (eyelet) have remained unnoticed. If and when auctioned in lots, the quantities of individual pieces given, only represent an approximate figure. An error in the allocation of individual pieces to a certain lot cannot be excluded. Such lots are, therefore, excluded from any complaints or objections after the lot is knocked down. In the event of disputes or complaints as to the quality of an item the auctioneer may call upon a generally sworn expert of the trade, which the auctioneer may choose at his sole discretion, for assessment and the rendering of a decision as to the justification of such dispute or complaint. The costs of such expert shall be borne by the party loosing the dispute according to the expert’s decision. Complaints or objections, if justified, will only be considered if made and received by the auctioneer within 8 days after the auction or after receiving the lots, respectively.

The minimum rates of increase for the bidding procedure are: offers up to up to up to up to up to up to up to up to up to up to above

€ 100.– € 200.– € 500.– € 1,000.– € 2,000.– € 5,000.– € 10,000.– € 20,000.– € 50,000.– € 100,000.– € 100,000.–

minimum increase rate € 5.– € 10.– € 20.– € 50.– € 100.– € 200.– € 500.– € 1,000.– € 2,000.– € 5,000.– € 10,000.–

Orders submitted in writing will be carried out diligently and without charge of an extra commission. Orders from collectors unknown to the auctioneer can only be accepted and carried out if a deposit or references to the satisfaction on the auctioneer are given. To be bindingly accepted, written bids need to be received at least 24 hours before auction. If necessary, the auctioneer is allowed to increase the bids by 3 – 5 %. Should several bids be obtained in writing bidding the same price or prices for a given

The authenticity of the coins is warranted up to the total purchase price. The prices set out in the catalogue are estimates only, which may be exceeded or undercut. Orders for less than 80 per cent of the estimated price cannot be accepted. Purchasers from abroad will have to observe all applicable laws and regulations in respect of foreign exchange, customs duties and taxation of their country. The auctioneer will only discharge such formalities, which have to be observed, in the Federal Republic of Germany in connection with the export of the purchased item(s). Unless stipulated otherwise herein, the general rules regulations for auctions applicable in Germany shall govern any transaction in respect of the auction; German Law shall also be applicable in relation to purchasers from abroad. Only the German text has legal force. The prices realized will be published in the form of a list immediately after the auction. The auctioneers:

Fritz Rudolf Künker Dr. Andreas Kaiser Arne Kirsch Oliver Köpp

TEL +49 (0)541 96 20 20, FAX +49 (0)541 96 20 222, SERVICE@KUENKER.DE, WWW.KUENKER.DE


Numismatische Ausdrücke/Numismatic Terms/Expressions Numismatiques/ Termini di Numismatica/Нумизматические Термины DEUTSCH

ENGLISH

FRANCAIS

ITALIANO

RUSSKIJ

Abschlag Am Rand Berieben Blei Dezentriert Doppelschlag Einfassung Einseitig Emailliert Erhaltung Etwas Exemplar Fassungsspuren Fehlprägung

struck at the rim/border slightly polished lead uncentered double struck frame uniface enamelled condition/preservation slightly specimen, copy trace of mounting mis-strike

frappe en tranche frotté plomb décentré double frappe encadrement uniface émaillé conservation un peu exemplaire traces de monture défaut de frappe

coniazione al bordo trattato piombo non centrato ribattitura cornice uniface smaltato conservazione un poco esemplare tracce di montatura difetto di coniazione

Feld(er) Fundexemplar Gedenkmünze Geglättet Gelocht Geprägt Gewellt Goldpatina Henkelspur Hübsch Jahrh. = Jahrhundert Kl. = klein Korrosionsspuren Kratzer Kupfer Legierung Leicht(e) l. = links Min. = minimal Nachahmung Prachtexemplar Prägeschwäche Randdelle Randfehler Randschrift r. = rechts Rückseite

field(s) specimen from a hoard commemorative coin tooled holed minted bent golden patina mount mark attractive century small traces of corrosion scratch(es) copper alloy slightly left minimal imitation attractive, perfect piece weakly struck edge nick edge faults lettered edge to right reverse

champ exemplaire de trouvaille monnaie commémorative retouché troué frappé ondulé patine dorée trace de monture joli siècle petit traces de corrosion rayure cuivre alliage légèrement gauche minime imitation pièce magnifique de frappe faible défaut sur la tranche erreur sur la tranche tranche inscrite droite revers

campo da tesoretto moneta commemorativa liscio bucato coniato ondolato patina d´oro tracce di appicagnolo carino secolo piccolo segni di corrosione graffio(i) rame lega leggero sinistra minimamente contraffazione esemplare magnifico conio stanco ammaccatura al bordo errore nel bordo inscrizione sul bordo destra rovescio

оттиск на гурте потертая свинец ассиметричный двойной чекан кайма односторонняя эмалированная сохранность слегка экземпляр следы обработки ошибка в процессе чеканки поле экземпляр памятная монета отглаженная проколатая отчеканенная волнистая золотая патина следы от ушка красивая столетие маленький следы коррозии царапина медь сплав легкий слева минимальный имитация превосходный экземпляр издержкн при чеканкe вмятина на гурте ошибка на гурте гуртовая надпись справа реверс

TEL +49 (0)541 96 20 20, FAX +49 (0)541 96 20 222, SERVICE@KUENKER.DE, WWW.KUENKER.DE


DEUTSCH

ENGLISH

FRANCAIS

ITALIANO

RUSSKIJ

Schriftspuren

traces of inscription

traces de légende

tracce di leggenda

Schrötling Schrötlingsfehler Schwach ausgeprägt Selten in dieser Erhaltung

flan flan defect weakly struck rare in this condition

flan flan défectueux de frappe faible rare en cet état

tondello errore di tondello conio stanco conservazione rara

Seltener Jahrgang Stempel Stempelfehler Überdurchschnittlich erhalten Überprägt Unediert Unikum Vergoldet Von allergrößter Seltenheit Vorderseite Winz.= winzig Zain Zierrand Zinn ziseliert

rare year die(s) mistake in the die extraordinary condition

année rare coin erreur de frappe conservation extraordinaire

overstruck unpublished unique specimen gilt extremely rare averse tiny flan ornamental border tin chased

surfrappé inédit unique doré de toute rareté en face petit flan tranche ornée étain ciselé

annata rara conio errore di conio conservazione estraordinaria ribattuto inedito pezzo unico dorato di estrema raritá diritto veramente piccolo tondello taglio ornato stagno cesellato

следы предыдущей надписи заготовка брак заготовки слабо отчеканeна редкая в такой сохранности редкий год штамп ошибка штампа сохранность выше среднего перечекан неопубликованная монета уникальная позолоченная наиредчайшая аверс незначительный заготовка декоративный гурт цинк гравированный

Erhaltungsgrade/Grading Terms/Degrès de Conservation/Gradi di Conservazione/ Шкала сохранности DEUTSCH

ENGLISH

FRANCAIS

ITALIANO

RUSSKIJ

Polierte Platte Stempelglanz Vorzüglich Sehr schön Schön Gering erhalten

Proof Uncirculated Extremely fine Very fine Fine Very good

Flan bruni Fleur de coin Superbe Très beau Beau Très bien conservé

Fondo specchio Fior di conio Splendido Bellissimo Molto Bello Bello

полированная превосходная отличная очень хорошая хорошая удовлетворительная

Seltenheitsgrade/Rarity Terms/Degrés de Rareté/Grado di Raritá/ Шкала редкости DEUTSCH

ENGLISH

FRANCAIS

ITALIANO

RUSSKIJ

R = Selten RR = Sehr selten Von großer Seltenheit Von größter Seltenheit Von allergrößter Seltenheit Uneditiert

R = Rare RR = Very rare Very rare Extremely rare Extremely rare Unpublished

Rare Très rare De grande rareté Extrêmement rare De la plus extrême rareté Inédit

raro molto raro di grande raritá di grandissima raritá di estrema raritá inedito

редкая очень редкая большой редкости наибольшей редкости наиредчайшая ранее не описанная

TEL +49 (0)541 96 20 20, FAX +49 (0)541 96 20 222, SERVICE@KUENKER.DE, WWW.KUENKER.DE


IMPRESSUM NUMISMATISCHE BEARBEITUNG FOTOS LAYOUT DRUCK

Alexandra Spreu, Dr. Sebastian Steinbach, Jens Ulrich Thormann M. A., Eva Weber, Manuela Weiß Lübke & Wiedemann, Stuttgart danner pc - gesteuerte systeme waiblingen meister print und media, Kassel Jeglicher Nachdruck, auch auszugsweise, bedarf der Genehmigung des Auktionshauses

ZAHLUNGEN AUS DEM INLAND Deutsche Bank Osnabrück Dresdner Bank Osnabrück Sparkasse Osnabrück Volksbank eG Bad Laer-Borgloh-Hilter-Melle Bankhaus Lampe KG, Bielefeld Postbank Hannover HypoVereinsbank München WestLB Dortmund Paypal

(BLZ 265 700 90) Konto-Nummer 0 177 006 (BLZ 265 800 70) Konto-Nummer 780 520 200 (BLZ 265 501 05) Konto-Nummer 247 320 (BLZ 265 624 90) Konto-Nummer 1 200 222 400 (BLZ 480 201 51) Konto-Nummer 174 076 (BLZ 250 100 30) Konto-Nummer 2900 60-308 (BLZ 700 202 70) Konto-Nummer 24 17 952 (BLZ 440 500 00) Konto-Nummer 1128 842 paypal@kuenker.de, Service charge: 3,5 %

ZAHLUNGEN AUS DEM AUSLAND FOREIGN PAYMENTS Deutsche Bank Osnabrück Sparkasse Osnabrück Postbank Hannover Credit Suisse Credit Cards Paypal

IBAN: DE11 2657 0090 0017 7006 00 Swift-Code: DEUTDE3B265 IBAN: DE50 2655 0105 0000 2473 20 Swift-Code: NOLADE22XXX IBAN: DE73 2501 0030 0290 0603 08 Swift-Code: PBNKDEFF IBAN: CH43 0483 5177 3509 0200 0 Swift-Code: CRESCHZZ80A We do accept VISA and MASTERCARD, Service charge: 4,5 % paypal@kuenker.de, Service charge: 3,5 %

ZAHLUNGEN INNERHALB RUSSLANDS PAYMENTS WITHIN RUSSIA Deutsche Bank Moskau ʽʽʽΗʪ̸̨̜̖ʥ̡̦̌Η

ИНН 7728717332; КПП 772801001 Получатель: ЗАО "Кюнкер" счет №: 40702810500000000825; БИК: 044525101 корсчет №: 30101810100000000101

Auktion 180  

Auktion 180

Read more
Read more
Similar to
Popular now
Just for you