Page 1


6KVGNHQVQ 0T  

RUSSLAND, KAISERREICH Katharina II., 1762-1796. Rubel 1791, St. Petersburg. Bitkin 254; Dav. 1686; Diakov 670 (R2).


AUKTION 178 Russische Münzen und Medaillen Russische Orden und Ehrenzeichen aus einer alten belgischen Sammlung ZEIT

Donnerstag, 30. September 2010 15.30 Uhr - 19.00 Uhr Freitag, 1. Oktober 2010 09.30 Uhr - 13.00 Uhr

ORT

Steigenberger Hotel Remarque Osnabrück, Natruper-Tor-Wall 1

AUKTIONS-TELEFON

+49 (0)541 60 96 633

AUKTIONS-FAX

+49 (0)541 60 96 634

AUKTIONEN 174-179, September/Oktober 2010 27. SEPTEMBER 2010 28./29. SEPTEMBER 2010

Auktion 174: Münzen aus der Welt der Antike Auktion 175: Münzen und Medaillen aus Mittelalter und Neuzeit

29. SEPTEMBER 2010

Auktion 176: Hamburg, Lübeck, Schleswig-Holstein, Wendischer Münzverein, Lauenburg, Dänemark Die Sammlung Siegfried Schierhorn

30. SEPTEMBER 2010

Auktion 177: Goldprägungen Deutsche Münzen ab 1871

30. SEPTEMBER 2010 1. OKTOBER 2010

Auktion 178: Russische Münzen und Medaillen Russische Orden und Ehrenzeichen aus einer alten belgischen Sammlung

1. OKTOBER 2010

Auktion 179: Papiergeld und Banknoten Monetäre Entwicklung in Papierform


Besichtigung/On View Das Auktionsgut kann nach vorheriger Vereinbarung besichtigt werden. Auction lots may be viewed by appointment only.

Online-Katalog/Online Catalogue Betrachten Sie unsere Auktionskataloge im Internet! Unter www.kuenker.de und www.sixbid.com haben Sie die Möglichkeit, Abbildungen zu vergrößern, Ihre Gebote direkt abzugeben und die Ergebnisse der Auktionen abzurufen.

KUENKER.DE

Please browse our auction catalogues at www.kuenker.com or at www.sixbid.com! You will have the possibility to zoom all images, to place your bids and to view all auction results online.

Standorte/Locations OSNABRÜCK

BERLIN

Fritz Rudolf Künker GmbH & Co. KG Gutenbergstraße 23, 49076 Osnabrück Tel. +49 (0)541 96 20 20 USt.-Id.-Nr. DE 256 270 181 Fritz Rudolf Künker GmbH & Co. KG Poststraße 22, 10178 Berlin-Mitte, im Kunsthaus Lempertz Wollankstraße 117, 13187 Berlin-Pankow Tel. +49 (0)30 247 248 91

MÜNCHEN

Fritz Rudolf Künker GmbH & Co. KG Maximiliansplatz 12a, 80333 München Tel. +49 (0) 89 242 16 990

ZÜRICH

Künker Zürich, c/o Hess-Divo AG Löwenstraße 55, 8001 Zürich, Schweiz

MOSKAU

Künker Moskau, c/o Russian Coin Co. Ltd. 2/21 Makarenko St., 123001 Moskau, Russland

Association Internationale des Numismates Professionels (AINP) Verband der Deutschen Münzenhändler e.V.

2

TEL +49 (0)541 96 20 20, FAX +49 (0)541 96 20 222, SERVICE@KUENKER.DE, WWW.KUENKER.DE


Zeitplan/Timetable Auktion 174 Münzen aus der Welt der Antike

Montag, 27. September 2010

10.30 Uhr - 13.00 Uhr Nr. 1 bis Nr. 485 Kelten, Griechen 14.00 Uhr - 18.00 Uhr Nr. 486 bis Nr. 1252 Römer, Völkerwanderung, Byzanz, Kreuzfahrer, Orienalen

Auktion 175 Münzen und Medaillen aus Mittelalter und Neuzeit

Dienstag, 28. September 2010

09.30 Uhr - 13.00 Uhr Nr. 2001 bis Nr. 2676 Europa: Albanien - Norwegen 14.00 Uhr - 19.00 Uhr Nr. 2677 bis Nr. 3652 Europa: Polen - Ungarn, Übersee, Habsburgische Erblande, Deutschland: Aachen - Brandenburg-Preußen Mittwoch, 29. September 2010

09.30 Uhr - 13.00 Uhr Nr. 3653 bis Nr. 4449 Deutschland: Braunschweig-Würzburg, Spezialsammlung Siebenjähriger Krieg, Medaillen, Prägewerkzeug, Münzschrank, Münzmandat, Münzlots

Auktion 176 Die Sammlung Siegfried Schierhorn

14.00 Uhr - 19.00 Uhr Nr. 5001 bis Nr. 5935

Auktion 177

Donnerstag, 30. September 2010

Goldprägungen

9.30 Uhr - 13.00 Uhr Nr. 6001 bis Nr. 6711

Deutsche Münzen ab 1871

14.00 Uhr - 15.30 Uhr Nr. 7001 bis Nr. 7379

Auktion 178 Russische Münzen und Medaillen

Russische Orden und Ehrenzeichen aus einer alten belgischen Sammlung

Auktion 179 Papiergeld und Banknoten Monetäre Entwicklung in Papierform

15.30 Uhr - 19.00 Uhr Nr. 8001 bis Nr. 8476 Kaiserreich: Wladislaw Sigismundowitsch - Nikolaus I. Freitag, 1. Oktober 2010

09.30 Uhr - 13.00 Uhr Nr. 8477 bis Nr. 8909 Kaiserreich: Alexander II. - Nikolaus II., russische Imitationen, Sowjetunion, Republik, Stadt Kaffa auf der Insel Krim, Nowgorod, Silberbarren, Orden und Ehrenzeichen 14.00 Uhr - 19.00 Uhr Nr. 9001 bis Nr. 9930 3


Was ist für Ihre schriftliche Auktionsteilnahme besonders wichtig?

DEUTSCH

• Bitte senden Sie uns Ihre Aufträge möglichst frühzeitig zu. Wenn uns Ihr Auftrag erst kurz vor der Auktion erreicht, können sich bei der Bearbeitung Fehler einschleichen. Das beiliegende Formular erleichtert Ihnen die Abgabe eines schriftlichen Gebots. Gerne nehmen wir Ihre Gebote per Post, Fax oder Email entgegen. • Wenn Sie noch nicht bei uns gekauft haben, bitten wir Sie, uns als Referenz eine Münzhandlung anzugeben, mit der Sie bereits in Geschäftsverbindung stehen. • Wir gewährleisten die Echtheit aller verkauften Objekte auch über die gesetzliche Frist hinaus.

Sie möchten telefonisch an der Auktion teilnehmen? Die telefonische Teilnahme an der Auktion ist bei uns selbstverständlich möglich. Wir rufen Sie während der Auktion gerne an und helfen Ihnen, die gewünschten Stücke zu ersteigern. Aus organisatorischen Gründen bitten wir Sie, die folgenden Punkte zu beachten:

Ulrich Künker Leiter Kundenbetreuung

• Telefonisches Bieten ist nur bei Losen mit einer Taxe von mind. € 500,– möglich. • Bitte teilen Sie uns mindestens 48 Stunden vor der Auktion mit, zu welchen Stücken Sie angerufen werden möchten. • Bitte achten Sie darauf, dass Sie erreichbar sind, wenn Ihre Stücke versteigert werden. Der Zeitplan in diesem Katalog hilft Ihnen dabei, den Zeitpunkt der Versteigerung abzuschätzen. • Für den Fall, dass wir Sie nicht erreichen können, bieten wir in Ihrem Namen bis zur Höhe Ihres schriftlichen Gebotes, mindestens aber bis zur Höhe des Schätzpreises. • Bitte beachten Sie, dass telefonisches Bieten eine unsichere Variante der Auktionsteilnahme sein kann. Wir können keine Garantie für das Zustandekommen der telefonischen Verbindung übernehmen. Wenn Sie sicher gehen wollen, besuchen Sie bitte unsere Auktion persönlich oder geben Sie uns ein schriftliches Gebot.

Was passiert nach der Auktion? Barbara Westmeyer deutschsprachige Kundenbetreuung

Telefon: +49 (0)541 96 20 20 Fax: +49 (0)541 96 20 222 Gebührenfrei: 0800 58 36 537 E-Mail: service@kuenker.de Internet: www.kuenker.de Montag – Donnerstag 8.30 – 17.00 Uhr Freitag 8.00 – 15.30 Uhr

4

• Der Versand der Auktionsware startet sofort nach Beendigung der Auktion und dauert in der Regel 8 Tage. • Alle Kunden, die an unserer Auktion schriftlich teilgenommen haben, erhalten innerhalb von 2 Wochen nach der Auktion unsere Ergebnisliste gratis. • Alle Ergebnisse sind spätestens einen Tag nach Auktionsende auf unserer Internetseite verfügbar.

Sie möchten Ihre Münzen in unsere Auktion einliefern? Sollten Sie sich zum Verkauf Ihrer Münzen entschlossen haben, kommen Sie zu uns. Seit 1985 beweisen wir mit derzeit 4 Auktionsterminen und ca. 15 Katalogen pro Jahr unsere Kompetenz und Zuverlässigkeit. Wichtige Informationen für Sie im Überblick: • Ihre Münzen werden von unseren Experten nach neuestem numismatischem Standard bestimmt und in hochwertigen Farbkatalogen präsentiert. • Wir verfügen mit mehr als 10.000 Kunden über eine der besten Kundendateien weltweit. Im Durchschnitt verkaufen wir mehr als 95 % der Stücke einer Auktion, nicht selten erzielen wir dabei Rekordzuschläge. Für nicht verkaufte Objekte werden keine Gebühren erhoben. • Ab der Übergabe an uns sind Ihre Münzen mit dem doppelten Schätzwert versichert. Unsere Kundenbetreuung bespricht gerne mit Ihnen wie Ihre Stücke sicher zu uns gelangen können. • Ihre Einlieferung wird Ihnen sofort nach der Übernahme quittiert. Spätestens 5 Wochen vor der Auktion erhalten Sie eine Auflistung Ihrer Stücke inkl. Katalognummern und Schätzpreisen. • Unmittelbar nach der Auktion erhalten Sie die Ergebnisliste und können dann alle erzielten Preise feststellen. Den Auktionserlös erhalten Sie innerhalb von 45 Tagen nach der Auktion.

TEL +49 (0)541 96 20 20, FAX +49 (0)541 96 20 222, SERVICE@KUENKER.DE, WWW.KUENKER.DE


Important facts for a written participation in the auction • Please send us your instructions as early as possible. The likelihood of errors occurring increases if we receive your instructions only shortly before the auction. The enclosed form should make it simple for you to submit a written bid, you may send your bids by mail, fax or e-mail. • If you are a new customer who has not yet purchased from us, we do request references. Please name a coin dealer with whom you have already done business. • The genuineness of all objects sold is warranted beyond the statutory length of time.

ENGLISH

Do you wish to participate by telephone? You are welcome to participate in our auction by telephone. We are glad to call you during the auction and to assist you in bidding for your items. Please take notice of the following conditions: • Telephone bidding is accepted exclusively on lot numbers with estimates at 500 Euro or above. • Please inform us at least 48 hours in advance if you wish to register for telephone bidding, even for single lots. We do need 48 hours to schedule all incoming requests. • Please be available, when your lots will be sold. The time schedule in the catalogue will help you to estimate the approximate time when your items are going to be sold. • Should you not be available by phone, we will bid on your behalf up to your submitted written limit or at least up to the estimate of the lot for which you requested to be called. • Please be aware that telephone bidding is a risky way of participation in our auction. We do not assume liability should the telephone line be interrupted or not be achieved. We advise you to attend the auction in person or to send written bids.

Nadine Zuber English, Deutsch

What occurs after the auction? • The shipment of all auction goods starts immediately after the completion of the entire auction week and it usually takes 8 days to be completed. • All auction results are available on our website one day after the end of the auction week. • All clients who submitted bids for the auction will automatically receive the list of auction results free of charge within two weeks after the end of auction.

Do you wish to consign your coins to our auction? Should you decide to sell your coins, we are ready to assist you. Since 1985 we have earned our bona fides in conducting over 4 auctions and in publishing 15 catalogues per year. In the following you will find the most important information on consigning: • We guarantee the professional handling of your consignment following the latest numismatic level of expertise including its presentation in colour catalogues of outstanding quality. • We possess one of the best customer lists worldwide. On average we sell more than 95 % of all items in our auction, and it is not unusual for us to achieve record hammer prices for lots submitted. Unsold items incur no fees. • Once the coins are consigned they are covered by our insurance at double the estimate. Upon consultation with our customer service we try to advise you on the safest way of shipping for your coins. • Your delivery will be confirmed in writing immediately on receipt. At least five weeks before the auction, you will receive an exact list of your objects with the relevant catalogue numbers and descriptions. • Within a week of the end of auction, you will receive a list of auction results in order to see what prices were reached for each individual lot. As a consignor, you will receive the auction proceeds within 45 days after the end of auction.

Marion Künker English, Deutsch

Phone: +49 (0)541 96 20 20 Fax: +49 (0)541 96 20 222 E-Mail: service@kuenker.de Website: www.kuenker.com Monday –Thursday 8.30 AM – 5 PM Friday 8 AM – 3.30 PM

TEL +49 (0)541 96 20 20, FAX +49 (0)541 96 20 222, SERVICE@KUENKER.DE, WWW.KUENKER.DE

5


Votre participation par écrit – Les points essentiels

FRANCAIS

• Veuillez nous faire parvenir vos ordres le plus tôt possible. Si vos ordres nous parviennent juste avant la vente aux enchères, des erreurs risquent d’être commises lors de leur traitement. Le formulaire ci-joint vous aidera à rédiger facilement votre offre. Vous pouvez nous envoyer vos ordres par la poste, par fax ou par e-mail. • Si vous n’avez encore fait aucune acquisition chez nous, nous vous prions de nous indiquer une ou deux références d’autres maisons numismatiques où vous avez déjà acheté. • L’authenticité des pièces vendues est garantie même au-delà des délais légaux.

Vous voulez participer par téléphone? La participation par téléphone est bien sûr possible. Nous vous appelons volontiers pour vous aider à acquérir les pièces voulues. Pour des raisons d´organisation veuillez noter les points suivants:

Alexandra Elflein, M. A. Français, Deutsch, English, Italiano

• La participation par téléphone est possible seulement pour les lots estimé à plus de 500 Euros chacun. • Veuillez nous informer au moins 48 heures avant la vente de la liste des pièces pour lesquelles vous voudriez être appelé. • Veuillez prendre soin d´être joignable quand vos pièces seront mises en vente. L’ordre de vente dans ce catalogue vous aidera à estimer l´heure de la vente. • Dans le cas où nous ne parviendrions pas à vous joindre, nous enchérirons pour vous jusqu’au montant que vous nous indiquez par écrit, égal ou supérieur au prix d’estimation. • La participation par téléphone présente des risques, et nous déclinons toute responsabilité dans le cas où la communication téléphonique serait interrompue, ou bien ne pourrait être établie.

Ce qui se passe après la vente Kmar Chachoua Français, Deutsch, English, Arabic

Tél. +49 (0)541 96 20 20 Facs. +49 (0)541 96 20 222 E-Mail: service@kuenker.de Site: www.kuenker.de Lundi à Jeudi de 8h30 à 17h00 Vendredi de 8h00 à 15h30

6

• L´expédition des biens va commencer immédiatement après la fin de la vente complète, et prend généralement 8 jours. • Tous les clients qui ont participé à l’une de nos ventes aux enchères recevront gratuitement une liste de résultats dans les deux semaines qui suivent. • Les résultats seront disponibles sur notre site internet, au plus tard un jour après la fin de la vente.

Vous voulez confier vos monnaies pour nos ventes aux enchères? Contactez nous si vous envisagez de vendre vos pièces. Notre compétence et fiabilité est prouvée depuis 1985 par actuellement 4 ventes aux enchères et environ 15 catalogues par an. Le plus important pour vous est que: • Vos pièces seront décrites par notre équipe d’experts selon les standards numismatiques les plus récents, et elles seront présentées dans des catalogues de haute qualité en couleurs. • Nous avons un des meilleurs fichiers-clientèle du monde avec plus de 10.000 clients. Nous vendons en moyenne plus de 95% de la vente aux enchères, et obtenons souvent des prix records. Les monnaies invendues n’encourent aucun frais. • Notre service clientèle est disponible pour vous conseiller pour l’envoi de vos pièces, et dès leur réception vos pièces seront assurées pour le double de la valeur d´estimation. • Vous recevrez une liste détaillée des pièces fournies au moment de la prise en charge puis, au plus tard cinq semaines avant la vente aux enchères, vous recevrez leur liste exacte avec les numéros de catalogue correspondants. • Immédiatement après la vente aux enchères, vous recevrez la liste des résultats et pourrez prendre connaissance des prix obtenus. Vous recevrez le produit de la vente dans les 45 jours après les enchères.

TEL +49 (0)541 96 20 20, FAX +49 (0)541 96 20 222, SERVICE@KUENKER.DE, WWW.KUENKER.DE


I punti piú importanti per la Sua partecipazione per iscritto • La preghiamo di farci pervenire i Suoi ordini al piú presto possibile. Se i Suoi ordini ci arrivano poco prima dell´inizio dell´asta possono verificarsi errori. Il formulario allegato Le faciliterá l´invio dei Suoi ordini per iscritto. Ci puó far pervenire i Suoi ordini per posta, per fax o per email. • Se non ha mai acquistato presso di noi, La preghiamo di volerci indicare a titolo di referenza il nome di uno o due commercianti numismatici presso i quali è giá cliente. • L’autenticità di tutti gli oggetti venduti viene garantita anche oltre i termini previsti dalla legge.

ITALIANO

Desidera partecipare telefonicamente alla nostra asta? La partecipazione telefonica è naturalmente da noi possibile. La chiameremo durante l´asta e La assisteremo volentieri per ottenere l´aggiudicazione dei pezzi desiderati. Per motivi di organizzazione La preghiamo di voler tenere conto dei seguenti punti: • La partecipazione telefonica è possibile solo per lotti stimati con almeno 500,– € l´uno. • La preghiamo di volerci comunicare almeno 48 ore prima dell´inizio dell´asta per quali pezzi desidera essere chiamato. • La preghiamo di aver cura di essere raggiungibile telefonicamente al momento in cui vengono messi all´asta i pezzi che Le interessano. Lo schema orario in catalogo La aiuterá a stimare a che ora verranno messi all´asta i pezzi che Le interessano. • Nel caso in cui non riuscissimo a contattarLa telefonicamente, provvederemo ad offrire a Suo nome fine all´importo massimo indicatoci per iscritto, in ogni caso offriremo a Suo nome come minimo il prezzo di stima. • La partecipazione telefonica è un modo incerto di partecipare alle aste. Non assumiamo nessuna responsabilità se per esempio la linea telefonica è occupata o interrotta o se Lei non sará raggiungibile per altri motivi.

Sonia Russo, M. A. Italiano, Deutsch, English, Español

Cosa succede dopo l´asta? • La spedizione del materiale d´asta comincia subito dopo la fine dell´intera asta e termina normalmente entro 8 giorni. • Tutti i clienti che hanno partecipato all´asta ricevono entro 2 settimane dopo l´asta la lista dei prezzi di realizzo. • I prezzi di realizzo sono visionabili sul nostro sito internet al piú tardi un giorno dopo la fine dell´intera asta.

Vuole consegnarci le Sue monete per una nostra asta? Ci contatti se ha deciso di vendere le Sue monete. Dal 1985 la nostra competenza ed affidabilità è dimostrata da attualmente 4 aste e circa 15 cataloghi all´anno. Quali sono i punti di maggior importanza per Lei:

Cristina Welzel Italiano, Deutsch, English, Français

Tel.: +49 (0)541 96 20 20 Fax: +49 (0)541 96 20 222 E-Mail: service@kuenker.de Internet: www.kuenker.de Lunedì a giovedì dalle 8.30 alle 17.00 Venerdì dalle 8.00 alle 15.30

• Le Sue monete vengono valutate dal nostro staff di esperti secondo i piú attuali standard numismatici e vengono presentati in cataloghi di alto valore a colori. • Con piú di 10.000 clienti disponiamo di una delle migliori banca dati clienti del mondo. In media vendiamo oltre il 95% del materiale d´asta realizzando spesso prezzi da record. Per i pezzi invenduti non ci sono nessune spese da pagare. • Dal momento della consegna le Sue monete sono assicurate per il doppio del valore di stima. Il nostro servizio clientela Le consiglierá volentieri come farci avere le Sue monete nel modo piú sicuro. • La Sua consegna Le verrá immediatamente quietanzata al momento della resa dei pezzi. Al piú tardi 5 settimane prima dell´asta riceverá una lista dettagliata dei Suoi pezzi con i numeri di catalogo ed i prezzi di stima. • Subito dopo l´asta riceverá la lista con i risultati d´asta dalla quale potrá subito controllare i prezzi realizzati. Riceverá l´importo di realizzo entro 45 giorni dopo la fine dell´asta.

TEL +49 (0)541 96 20 20, FAX +49 (0)541 96 20 222, SERVICE@KUENKER.DE, WWW.KUENKER.DE

7


Что особенно важно при заочном участии на аукционе?

RUSSKIJ

• Тщательно изучите наш каталог и запишите те лоты, которые Вас заинтересовали. Заполните приложенный формуляр и отправьте нам его заранее по почте, факсу или электронной почте. Мы обращаем внимание на то, что если Ваши ставки придут перед самым началом аукциона либо во время аукциона, то существует вероятность допуска ошибки в процессе обработки заказа. • Если Вы впервые принимаете участие в нашем аукционе, то мы рекомендуем Вам указать Ваш референц – аукционные дома, с которыми Вы уже сотрудничали. Или свяжитесь с нами по телефону +49(0)541 9620268. • Подлинность купленных на нашем аукционе лотов гарантируется нами на протяжении неограниченного времени.

Вы хотели бы принять участие на аукционе по телефону? У нас, конечно, есть возможность организовать Ваше телефонное участие на торгах, но мы бы хотели обратить внимание на следующие пункты: Anastasija Koepsell Russkij, Deutsch

• Участие в телефонных торгах возможно только для лотов со стартовой ценой свыше 500 евро. • Для участия в торгах по телефону просим Вас связаться с нами не позднее 48 часов до начала аукциона. • Мы хотим подчеркнуть, что телефонное участие на аукционе – не самый безопасный способ: в случае плохой связи, недоступности клиента во время торгов либо других технических проблем мы не несем ответственности.

Что происходит после окончания аукциона?

Dzmitry Nikulin Russkij, Deutsch, English

Телефон: +49 (0)541 96 20 20 Факс: +49 (0)541 96 20 222 E-Mail: service@kuenker.de интернет: www.kuenker.de понедельник – четверг 8.30 – 17.00 пятница 8 – 15.30

8

• Результаты аукционов доступны на нашем сайте на следующий день после окончания торгов. • Вы можете лично забрать приобретенные лоты. По окончании торгов мы готовим все необходимые документы на вывоз из Евросоюза. • Почтовые отправки в Россию ( Беларусь, Украину ) осуществляются по предварительной договоренности. Для связи с нами звоните по телефону +49 (0)541 9620268.

Вы хотели бы выставить Ваши предметы на аукцион? Более 160-ти успешно проведенных аукционов, тысячи участников, 4 аукциона в год - эти и другие преимущества, которые говорят в пользу выставления Ваших коллекций на аукцион Кюнкер: • Ваши монеты будут оценены нашими экспертами по самым новым нумизматическим стандартам и представлены в высококачественном цветном каталоге. • Более 10000 клиентов со всего мира оказывают нам свое доверие. В среднем мы продаем более 95% всех выставляемых предметов, при этом зачастую достигая рекордных сумм. • Все Ваши предметы, после передачи их нам, хранятся у нас до начала аукциона застрахованными. Не позднее 5-ти недель до начала аукциона Вы получите по почте подробное описание Ваших лотов с указаннами номерами в каталоге, а также их оценочной стоимостью. • Результаты аукционов также будут высланы Вам по почте после окончания торгов. В течение 45 дней после аукциона Вам будет выплачено Ваше вознаграждение.

TEL +49 (0)541 96 20 20, FAX +49 (0)541 96 20 222, SERVICE@KUENKER.DE, WWW.KUENKER.DE


INHALT AUKTION 178 Nr.

Seite

RUSSISCHE MÜNZEN UND MEDAILLEN

8001

-

8742

13

-

133

Kaiserreich

8001

-

8673

13

-

126

Zar Wladislaw Sigismundowitsch von Polen, 1610-1613 Eine Goldkopeke des Zaren Wladislaw Sigmundowitsch Zar Alexei Michailowitsch, 1645-1676 Eine Goldmünze des Zaren Alexei Michailowitsch Ein 1/4 Rubel des Zaren Alexei Michailowitsch Russische Gegenstempel von 1655 (Jefimki) auf europäischen Talern

8002

8004

-

-

Zar Feodor Alexiewitsch, 1676-1682 Ein Tscherwornez des Zaren Feodor Alexiewitsch

8001

13

8001

13

8012

13

-

15

8002

13

8003

13

8012

13

-

15

8013

15

8013

15 1

Zar Peter I., der Große, 1682-1725 Ein goldener Doppelrubel des Zaren Peter I. Silbermünzen des Moskauer Münzhofes Kadashevsky Silbermünzen des Roten Münzhofes in Moskau Fünf Sonnenrubel der Münzstätte St. Petersburg Kupfermünzen des Moskauer Münzhofes Naberezhny Medaillen des Zaren Peter I.

8014

-

8079 8014

15

-

30 15

8015

-

8033

16

-

20

8034

-

8047

20

-

22

8048

-

8052

22

-

23

8053 8059

-

8058 8079

24

-

23 30

Zarin Katharina I., 1725-1727 Silbermünzen des Roten Münzhofes in Moskau Silbermünzen der Münzstätte St. Petersburg Zwei Kupfer-5 Kopeken-Stücke der Zarin Katharina I.

8080

-

8089

30

-

32

8080

-

8083

30

-

31

8084

-

8087

31

-

32

8088

-

8089

8090

-

8100

32

-

33

8090

-

8095

32

-

33

Zar Peter II., 1727-1730 Silbermünzen des Moskauer Münzhofes Kadashevsky Eine Poltina der Münzstätte St. Petersburg Kupfermünzen des Moskauer Münzhofes Kadashevsky Zarin Anna, 1730-1740 Silbermünzen des Moskauer Münzhofes Kadashevsky

32

8096

33

8097 8101

-

8100 8123

33 34

-

34 37

8101

-

8111

34 -

36

9


Nr. Ein 1/4 Rubel des Roten Münzhofes in Moskau Zwei Rubel der Münzstätte St. Petersburg Kupfermünzen der Zarin Anna Zwei Medaillen der Zarin Anna Zar Ivan III., 1740-1741 Zwei Silbermünzen des Roten Münzhofes in Moskau Eine Kupferdenga der Münzstätte Ekaterinburg Zarin Elisabeth, 1741-1761 Zwei Goldmünzen der Zarin Elisabeth Silbermünzen des Roten Münzhofes in Moskau Silbermünzen der Münzstätte St. Petersburg Kupfermünzen der Zarin Elisabeth Prägungen für Livland und Estland Prägungen für Ostpreußen Medaillen der Zarin Elisabeth Zar Peter III., 1762 Ein Rubel des Roten Münzhofes in Moskau Silbermünzen der Münzstätte St. Petersburg Kupfermünzen des Zaren Peter III. Zarin Katharina II., 1762-1796 Goldmünzen der Münzstätte St. Petersburg Silbermünzen des Roten Münzhofes in Moskau Silbermünzen der Münzstätte St. Petersburg Kupfermünzen der Zarin Katharina II. Ein Novodel des Sestroretsk-Rubels der Zarin Katharina II. Kupferprägungen für Sibirien Eine Kupferprägung für Moldawien und Walachei Ein Kupfer 5-Kopeken-Stück aus der schwedischen Münzstätte Avesta Verdienstmedaillen der Zarin Katharina II. Medaillen der Zarin Katharina II.

10

Seite

8113 8115 8122

-

8112 8114 8121 8123

8124

-

8126

38

8124

-

8125

38

8126

38

36

8127

-

8194

8127

-

8128

8129

-

8136

39

-

40

8137

-

8159

40

-

44

8160 8177 8184 8191 -

8176 8183 8190 8194

44

-

48

-

47 47 48 49

8195

8201

50

-

51

-

39

-

-

36 36 37 37

49 39

8195

50 50 51

8196 8199

-

8198 8201

8202

-

8267

51

-

66

8202

-

8210

51

-

53

8211

-

8214

53

-

54

8215 8236

-

8235 8245

54 57

-

57 58

-

8246 8253

-

59 61

8247

8256 8259

-

60

8254

61

8255 8258 8267

61 63 66

62 63

-


Nr. Zar Paul I., 1796-1801 Silbermünzen der Münzstätte St. Petersburg Kupfermünzen des Zaren Paul I. Medaillen des Zaren Paul I.

Seite

8268

-

8290

66

-

69

8268 8281 8289

-

8280 8288 8290

66

-

67 68 69

8291 8291

-

8362 8292

69

-

81 69

8293 8315 8332 8334

-

8314 8331 8333 8339

69 72

-

74

-

71 74 74 75

8341

-

8340 8362

75

-

75 81

Zar Nikolaus I., 1825-1855 Zwei Goldmünzen des Zaren Nikolaus I. Platinmünzen des Zaren Nikolaus I. Silbermünzen des Zaren Nikolaus I. Silbermünzen der Münzstätte Warschau Kupfermünzen der Münzstätte Ekaterinburg Ein Kupfer-10 Kopeken-Stück der Münzstätte Suzun Kupfermünzen der Münzstätte St. Petersburg Kupfermünzen der Münzstätte Warschau Gedenkmünzen des Zaren Nikolaus I. Ein Novodel einer Probemünze des Zaren Nikolaus I. Prägungen für Georgien Prägungen für Polen Fünf Messing-Passiergewichte Medaillen des Zaren Nikolaus I.

8363 8363 8365 8374 8406 8411

-

8476 8364 8373 8405 8410 8422

81

-

81 83

-

87

-

Zar Alexander I., 1801-1825 Zwei Goldmünzen des Zaren Alexander I. Silbermünzen der Münzstätte St. Petersburg Kupfermünzen des Zaren Alexander I. Prägungen für Georgien Prägungen für Polen Eine Probeprägung der Münzprägemaschine von Ivan Nevedomsky Medaillen des Zaren Alexander I.

98 81 83 86 87 88

8423

89

8424

-

8427

89

8428 8430

-

8429 8432

89 90

8434 8439 8459 8464

-

8433 8438 8458 8463 8476

90 91

-

95

-

90 91 94 94 98

Zar Alexander II., 1855-1881 Goldmünzen des Zaren Alexander II. Silbermünzen des Zaren Alexander II. Kupfermünzen des Zaren Alexander II. Gedenkmünzen des Zaren Alexander II. Vier Novodels von Probemünzen des Zaren Alexander II. Prägungen für Finnland Medaillen des Zaren Alexander II.

8477 8477 8491 8518 8541

-

8562 8490 8517 8540 8544

99 99 100 103 105

-

109 100 102 105 106

8545 8549 8557

-

8548 8556 8562

106 107

-

106 107 109

Zar Alexander III., 1881-1894 Goldmünzen des Zaren Alexander III. Silbermünzen des Zaren Alexander III.

8563 8563 8571

-

8605 8570 8586

109 109 110

-

114 110 112 11


Nr. Kupfermünzen der Münzstätte St. Petersburg Gedenkmünzen des Zaren Alexander III. Eine Probeprägung aus der Münzstätte St. Petersburg Eine Prägung für Finnland Medaillen des Zaren Alexander III.

-

8589 8595

112 112

8598

-

8596 8597 8605

113 113 114

8606 8606 8618 8646

-

8650

-

8673 8617 8645 8648 8649 8656

8658

-

8657 8659

8660

-

8673

Zwei russische Imitationen niederländischer Ritterdukaten

8674

-

8675

Sowjetunion, 1917-1991

8676

-

8688

126

-

128

Russische Republik seit 1992 Lots und Sammlungen russischer Münzen und Medaillen

8689

-

8696

128

-

129

8697

-

8719

129

-

130

8720

-

8739

130

-

132

Zar Nikolaus II., 1894-1917 Goldmünzen des Zaren Nikolaus II. Silbermünzen des Zaren Nikolaus II. Kupfermünzen des Zaren Nikolaus II. Ein halber Imperial von 1895 Gedenkmünzen des Zaren Nikolaus II. Eine Probe-Kupfermünze der Münzstätte St. Petersburg Zwei Prägungen für Finnland Medaillen des Zaren Nikolaus II.

Bedeutende Serie von genuesischen Prägungen der Stadt Kaffa auf der Insel Krim

8587 8590

Seite

Nowgorod

-

115

-

116

-

121

-

126 115 119 120 120 122 122 122

122

-

126 126

8740

132

Zwei Silberbarren aus dem Mittelalter

8741

-

8742

132

-

133

RUSSISCHE ORDEN UND EHRENZEICHEN AUS EINER ALTEN BELGISCHEN SAMMLUNG

8743

-

8909

134

-

173

Russland Zarentum (bis 1917) Emirat Buchara Provisorische Regierung (1917-1918) Sowjetunion

8743 8743 8895 8900 8905

-

8906 8894 8899 8904 8906

134 134

-

172

-

173 171 171 173 173

Finnland

8907

173

Montenegro

8908

173

Türkei

8909

173

Ein Stichwortverzeichnis finden Sie am Ende des Auktionskataloges 177. 12

113


ALEXEI MICHAILOWITSCH

4755+5%*'/ª0<'070&/'&#+..'0

1,5:1

8001

1,5:1

<#49.#&+5.#95+)+5/70&19+65%*81021.'0 'KPG)QNFMQRGMGFGU<CTGP9NCFKUNCY5KIKUOWPFQYKVUEJ 

-QRGMGKP)QNFQ,/QUMCW0QXQFGNI(D-CKO-QRKEMK 4   )1.&8QPITQ­GT5GNVGPJGKV5GJTUEJÌP



'ZGORNCTFGT5COONWPI#PVQPKP2TQMQR6GKN#WMVKQP#WTGC0WOKUOCVKMC2TCI0T

1,5:1

8002

1,5:1

<#4#.':'+/+%*#+.19+65%* 'KPG)QNFOÒP\GFGU<CTGP#NGZGK/KEJCKNQYKVUEJ 

6UEJGTYQPG\I(D-CKO

)1.&8QPITQ­GT5GNVGPJGKV5GJTUEJÌP



'ZGORNCTFGT5COONWPI#PVQPKP2TQMQR6GKN#WMVKQP#WTGC0WOKUOCVKMC2TCI0T

8003

'KP4WDGNFGU<CTGP#NGZGK/KEJCKNQYKVUEJ 

4WDGNI-CKO

44(CUVUGJTUEJÌP



'ZGORNCTFGT5COONWPI#PVQPKP2TQMQR6GKN#WMVKQP#WTGC0WOKUOCVKMC2TCI0T

8004

4WUUKUEJG)GIGPUVGORGNXQP ,GHKOMK CWHGWTQR·KUEJGP6CNGTP 

,GHKOQM  ÒDGTRT·IV CWH GKPGO 4GKEJUVCNGT  XQP $TCWPUEJYGKI.ÒPGDWTI%GNNG (TKGFTKEJ   /ÒP\UV·VVG%NCWUVJCNI/KV\YGK)GIGPUVGORGNPCWHFGT4ÒEMUGKVG 5V)GQTIKO -CORHOKVFGO&TCEJGP ,CJTGU\CJN&CXp \W 9GNVGTp \W  445GJTUEJÌP  ,GHKOQM 2NWTCN ,GHKOMK  YCT FGT CWU FGT RQNPKUEJGP 5RTCEJG ,QCEJKOKM  CDIGNGKVGVG TWUUKUEJG #WUFTWEM HÒT   6CNGT &GT 0COG UVCOOV XQP FGP )WNFGPITQUEJGP FKG FKG )TCHGP XQP 5EJNKEM KP FGT DÌJOKUEJGP $GTIUVCFV 5V   ,QCEJKOUVCN JGTIGUVGNNV JCVVGP /CP XGTYGPFGVG KP FGP DGKFGP UNCYKUEJGP 5RTCEJGP CNUQ FGP GTUVGP 6GKN FGT WT   URTÒPINKEJGP0QOKPCNDG\GKEJPWPI,QCEJKOUVCNGTY·JTGPFKO&GWVUEJGPWPF'PINKUEJGP 6CNGT&QNNCT FGT \YGKVG6GKNIGY·JNVYWTFG+O,CJTYWTFGPKP4W­NCPFXGTUEJKGFGPGXQTCNNGOFGWVUEJGWPFPKGFGTN·PFKUEJG 6CNGTOKVGKPGO)GIGPUVGORGNXGTUGJGP&KGUG5VÒEMGYWTFGP,GHKOQMURTK\PCMQO IG\GKEJPGVGT,GHKOQM QFGT GKPHCEJMWT\,GHKOQMIGPCPPV&KGIGIGPIGUVGORGNVGP6CNGTMQPPVGPUKEJLGFQEJPKEJVKO<CJNWPIUXGTMGJTFWTEJUGV \GPWPFYWTFGPHÒTWPIÒNVKIGTMN·TV&CFKGOGKUVGP5VÒEMGYQJNGKPIGUEJOQN\GPYWTFGPUKPF,GHKOMKJGWVG TGEJVUGNVGPWPF\·JNGP\WFGPDGIGJTVGUVGP/ÒP\GP4W­NCPFU

13


ALEXEI MICHAILOWITSCH

8005

8006

8007



,GHKOQM  ÒDGTRT·IV CWH GKPGO 4GKEJUVCNGT  XQP $TCWPUEJYGKI9QNHGPDÒVVGN #WIWUV FGT   ,ÒPIGTG  /ÒP\UV·VVG <GNNGTHGNF  I /KV \YGK )GIGPUVGORGNP CWH FGT 8QTFGTUGKVG    5V)GQTIKO-CORHOKVFGO&TCEJGP ,CJTGU\CJN&CXp \W 9GNVGTp \W   4-N-TCV\GTUGJTUEJÌP 



,GHKOQM  ÒDGTRT·IV CWH GKPGO 4GKEJUVCNGT  XQP 0ÒTPDGTI OKV6KVGN(GTFKPCPFU++I /KV\YGK)GIGPUVGORGNPCWHFGT8QTFGTUGKVG 5V)GQTIKO-CORHOKVFGO&TCEJGP ,CJTGU\CJN &CXp \W -GNNPGTp \W  4-N-TCV\GTUGJTUEJÌP 



,GHKOQMÒDGTRT·IVCWHGKPGO2CVCIQPQ,XQP$TCDCPV#NDGTVWPF+UCDGNNCI /KV \YGK )GIGPUVGORGNP CWH FGT 4ÒEMUGKVG   5V )GQTI KO -CORH OKV FGO &TCEJGP   ,CJTGU\CJN   &CXp \W &GNOp \W  5GJTUEJÌP



8009

8008





14

8008

,GHKOQMÒDGTRT·IVCWHGKPGO4GKEJUVCNGTQ,XQP&GXGPVGTOKV6KVGN(GTFKPCPFU++I/KV \YGK)GIGPUVGORGNPCWHFGT8QTFGTUGKVG 5V)GQTIKO-CORHOKVFGO&TCEJGP ,CJTGU\CJN &CXp \W &GNOp \W4  5GJTUEJÌP



,GHKOQMÒDGTRT·IVCWHGKPGO4GKEJUVCNGTXQP7VTGEJVI/KV\YGK)GIGPUVGORGNPCWH FGT4ÒEMUGKVG 5V)GQTIKO-CORHOKVFGO&TCEJGP ,CJTGU\CJN&CXp \W &GNOp

\W  5GJTUEJÌP




PETER I.

8010

8011

8012



,GHKOQMÒDGTRT·IVCWHGKPGO4GKEJUVCNGTXQP9GUVHTKGUNCPFI/KV\YGK)GIGPUVGO RGNP CWH FGT 8QTFGTUGKVG   5V )GQTI KO -CORH OKV FGO &TCEJGP   ,CJTGU\CJN  &CX p \W    &GNOp \W  5GJTUEJÌP 



,GHKOQMÒDGTRT·IVCWHGKPGO4GKEJUVCNGTXQP<GGNCPFI/KV\YGK)GIGPUVGORGNPCWH FGT8QTFGTUGKVG 5V)GQTIKO-CORHOKVFGO&TCEJGP ,CJTGU\CJN&CXp \W &GNO p \W  /ÒP\GUEJÌPpUGJTUEJÌP)GIGPUVGORGNUGJTUEJÌP



,GHKOQMÒDGTRT·IVCWHGKPGO5RGEKGFCNGTXQP0QTYGIGP%JTKUVKCP+8/ÒP\ UV·VVG %JTKUVKCPKC  I /KV \YGK )GIGPUVGORGNP CWH FGT 8QTFGTUGKVG   5V )GQTI KO -CORH OKV   FGO&TCEJGP ,CJTGU\CJN#JNUVTÌOp \W &CXp \W  448QT\ÒINKEJ





8013

<#4('1&14#.':+'9+65%* 'KP6UEJGTYQPG\FGU<CTGP(GQFQT#NGZKGYKVUEJ 

6UEJGTYQPG\Q,0QXQFGNI$GKFGTUGKVUIGMTÌPVGT&QRRGNCFNGTCWHFGT$TWUV5V)GQTIUUEJKNF QDGP-TQPG(D FQTVCNU&WMCVDG\GKEJPGV -CKO )1.&448QT\ÒINKEJp5VGORGNINCP\



'ZGORNCTFGT5COONWPI#PVQPKP2TQMQR6GKN#WMVKQP#WTGC0WOKUOCVKMC2TCI0T

1,5:1

8014

1,5:1

<#42'6'4+&'4)4155' 'KPIQNFGPGT&QRRGNTWDGNFGU<CTGP2GVGT+ 

4WDGN/QUMCW4QVGT/ÒP\JQHI)GJCTPKUEJVGU$TWUVDKNFTOKV.QTDGGTMTCP\WPFWO IGNGIVGO/CPVGN5V#PFTGCUOKV*GKNKIGPUEJGKPUVGJVXXCWH5QEMGNFCU-TGW\JKPVGTUKEJJCNVGPF $KVMKP 4 &KCMQX(D )1.&4/KPLWUVKGTVHCUVXQT\ÒINKEJ  15


PETER I.

8015

1,5:1

1,5:1

5KNDGTOÒP\GPFGU/QUMCWGT/ÒP\JQHGU-CFCUJGXUM[ 

4WDGN/QUMCW/ÒP\JQH-CFCUJGXUM[I)GJCTPKUEJVGU$TWUVDKNFTOKV.QTDGGTMTCP\WPF WOIGNGIVGO /CPVGN)GMTÌPVGT &QRRGNCFNGT OKV <GRVGT WPF 4GKEJUCRHGN KP FGP (·PIGP QDGP -TQPG   $KVMKP 4 &CX&KCMQX 8QPITQ­GT5GNVGPJGKV8QT\ÒINKEJ  /KV'ZRGTVKUGXQP+IQT5EJKT[CMQX5VCCVNKEJGU*KUVQTKUEJGU/WUGWO/QUMCW

8016



8017

8018

4WDGN M[TKNNKUEJ /QUMCW/ÒP\JQH-CFCUJGXUM[I$KVMKP 4 &CX&KCMQX 44#VVTCMVKXGUUGJTUEJÌPGU'ZGORNCT



'ZGORNCTFGT5COONWPI#PVQPKP2TQMQR6GKN#WMVKQP#WTGC0WOKUOCVKMC2TCI0T



4WDGN M[TKNNKUEJ /QUMCW/ÒP\JQH-CFCUJGXUM[I$KVMKP 4 &CX&KCMQX 4*ÒDUEJG2CVKPCHCUVUGJTUEJÌP





4WDGN  M[TKNNKUEJ  /QUMCW /ÒP\JQH -CFCUJGXUM[  I $KVMKP  &CX  &KCMQX    (CUVUGJTUEJÌP



16


PETER I.

8019

8021

8020



4WDGN M[TKNNKUEJ /QUMCW/ÒP\JQH-CFCUJGXUM[I$KVMKP&CX&KCMQX  -N5EJTÌVNKPIUHGJNGTUGJTUEJÌP





4WDGN M[TKNNKUEJ /QUMCW/ÒP\JQH-CFCUJGXUM[I$KVMKP&CX&KCMQXXCT *ÒDUEJG2CVKPCUGJTUEJÌP





4WDGN M[TKNNKUEJ /QUMCW/ÒP\JQH-CFCUJGXUM[I$KVMKP&CX&KCMQXXCT -N4CPFXGTRT·IWPIUGJTUEJÌP



8022

1,5:1



1,5:1

4WDGN 2QNVKPC  M[TKNNKUEJ /QUMCW/ÒP\JQH-CFCUJGXUM[I)GJCTPKUEJVGU$TWUVDKNF T OKV .QTDGGTMTCP\ WPF WOIGNGIVGO /CPVGN)GMTÌPVGT &QRRGNCFNGT OKV <GRVGT WPF 4GKEJUCRHGN KP   FGP(·PIGPQDGP-TQPG$KVMKP 4 &KCMQX  8QPITÌ­VGT5GNVGPJGKV(GKPG2CVKPCYKP\)TCHHKVKMN2T·IGUEJY·EJGUGJTUEJÌP  17


PETER I.

8023

1,5:1



1,5:1

 4WDGN 2QNVKPC   M[TKNNKUEJ  /QUMCW /ÒP\JQH -CFCUJGXUM[  I $TWUVDKNF T OKV .QT   DGGTMTCP\ WPF WOIGNGIVGO /CPVGN)GMTÌPVGT &QRRGNCFNGT OKV <GRVGTWPF4GKEJUCRHGNKPFGP(·PIGP QDGP-TQPG$KVMKP 4 &KCMQX  445GJTCVVTCMVKXGU'ZGORNCTOKVJÒDUEJGT2CVKPCUGJTUEJÌPpXQT\ÒINKEJ 

8025

8024



4WDGN 2QNVKPC  M[TKNNKUEJ /QUMCW/ÒP\JQH-CFCUJGXUM[I$KVMKP 4 &KCMQX 45GJTUEJÌP





4WDGN 2QNVKPC  M[TKNNKUEJ /QUMCW/ÒP\JQH-CFCUJGXUM[I$KVMKP 4 &KCMQX 4)GTGKPKIVUGJTUEJÌP



8026

1,5:1



18

1,5:1

4WDGN 2QNVKPC  M[TKNNKUEJ /QUMCW/ÒP\JQH-CFCUJGXUM[I)GJCTPKUEJVGU$TWUVDKNFT OKV .QTDGGTMTCP\ WPF WOIGNGIVGO /CPVGN)GMTÌPVGT &QRRGNCFNGT OKV <GRVGT WPF 4GKEJUCRHGN KP   FGP(·PIGPQDGP-TQPG$KVMKP 4 &KCMQX 5GJTUGNVGPDGUQPFGTUKPFKGUGT'TJCNVWPI 5GJTCVVTCMVKXGU'ZGORNCTOKVJGTTNKEJGT2CVKPCUGJTUEJÌP 


PETER I.

8028

8027



4WDGN 2QNVKPC  M[TKNNKUEJ /QUMCW/ÒP\JQH-CFCUJGXUM[I)GJCTPKUEJVGU$TWUVDKNF T OKV .QTDGGTMTCP\ WPF WOIGNGIVGO /CPVGN)GMTÌPVGT &QRRGNCFNGT OKV <GRVGT WPF 4GKEJUCRHGN KP   FGP(·PIGPQDGP-TQPG$KVMKP 4 &KCMQX  44*ÒDUEJG2CVKPCYKP\5EJTÌVNKPIUHGJNGTUGJTUEJÌP 



 4WDGN 2QNVKPC   M[TKNNKUEJ  /QUMCW /ÒP\JQH -CFCUJGXUM[  I $KVMKP  XCT 4    &KCMQX 45GJTUEJÌP

8029



8029 1,5:1



4WDGN 2QNVKPC  M[TKNNKUEJ /QUMCW/ÒP\JQH-CFCUJGXUM[I)GJCTPKUEJVGU$TWUVDKNF T OKV .QTDGGTMTCP\ WPF WOIGNGIVGO /CPVGN)GMTÌPVGT &QRRGNCFNGT OKV <GRVGT WPF 4GKEJUCRHGN KP   FGP(·PIGPQDGP-TQPG$KVMKP 4 &KCMQXXCT  44(GKPG2CVKPCGVYCURQTÌUGT5EJTÌVNKPIUGJTUEJÌPpXQT\ÒINKEJ 

8030

1,5:1



1,5:1

4WDGN 2QNVKPC  M[TKNNKUEJ /QUMCW/ÒP\JQH-CFCUJGXUM[I)GJCTPKUEJVGU$TWUVDKNF T OKV .QTDGGTMTCP\ WPF WOIGNGIVGO /CPVGN)GMTÌPVGT &QRRGNCFNGT OKV <GRVGT WPF 4GKEJUCRHGN KP   FGP(·PIGPQDGP-TQPG$KVMKP 4 &KCMQX  W­GTUVUGNVGPKPFKGUGT'TJCNVWPI2TCEJVGZGORNCT -N2T·IGUEJY·EJGXQT\ÒINKEJp5VGORGNINCP\  19


PETER I.

8031

8032

8033



 4WDGN 2QNWRQNVKPPKM   M[TKNNKUEJ  /QUMCW /ÒP\JQH -CFCUJGXUM[ 0QXQFGN  I /KV   INCVVGO 4CPF )GJCTPKUEJVGU $TWUVDKNF T OKV .QTDGGTMTCP\ WPF WOIGNGIVGO /CPVGN)GMTÌPVGT &QR   RGNCFNGTOKV<GRVGTWPF4GKEJUCRHGNKPFGP(·PIGPQDGP-TQPG$KVMKP* 4 &KCMQX50 442TCEJVXQNNG2CVKPCUGJTCVVTCMVKXGUXQT\ÒINKEJGU'ZGORNCT 



 4WDGN 2QNWRQNVKPPKM   M[TKNNKUEJ  /QUMCW /ÒP\JQH -CFCUJGXUM[  I $KVMKP  4    &KCMQX 4)GTGKPKIVHCUVUGJTUEJÌP



 4WDGN 2QNWRQNVKPPKM   M[TKNNKUEJ  /QUMCW /ÒP\JQH -CFCUJGXUM[  I $KVMKP  4    &KCMQX 44#VVTCMVKXGUUGJTUEJÌPGU'ZGORNCT 

8034

8035



8036

5KNDGTOÒP\GPFGU4QVGP/ÒP\JQHGUKP/QUMCW 

4WDGN  M[TKNNKUEJ  /QUMCW 4QVGT /ÒP\JQH 0QXQFGN  I )GJCTPKUEJVGU $TWUVDKNF T    )GMTÌPVGT &QRRGNCFNGT OKV <GRVGT WPF 4GKEJUCRHGN KP FGP (·PIGP QDGP -TQPG $KVMKP *  4    &CX&KCMQX50  8QPITÌ­VGT5GNVGPJGKV*GTTNKEJG2CVKPCOKP,WUVKGTURWTGPXQT\ÒINKEJp5VGORGNINCP\  'ZGORNCTFGT5COONWPI#PVQPKP2TQMQR6GKN#WMVKQP#WTGC0WOKUOCVKMC2TCI0T



4WDGN  M[TKNNKUEJ  /QUMCW 4QVGT /ÒP\JQH 0QXQFGN  I )GJCTPKUEJVGU $TWUVDKNF T   )GMTÌPVGT &QRRGNCFNGT OKV <GRVGT WPF 4GKEJUCRHGN KP FGP (·PIGP QDGP -TQPG $KVMKP *  4    &CX&KCMQX50 8QPITÌ­VGT5GNVGPJGKV-CDKPGVVUVÒEMXQPHGKPUVGT'TJCNVWPI 2TCEJVXQNNG2CVKPC5VGORGNINCP\ 



4WDGN/QUMCW4QVGT/ÒP\JQHI)GJCTPKUEJVGU$TWUVDKNFTOKV.QTDGGTMTCP\WPFWOIG NGIVGO/CPVGN8KGTIGMTÌPVG/QPQITCOOGKPU-TGW\IGUVGNNVKPFGT/KVVGFKGIGVGKNVG,CJTGU\CJN $KVMKP&CX&KCMQXXCT  5GNVGPDGUQPFGTUKPFKGUGT'TJCNVWPI(GKPG2CVKPCNGKEJVG2T·IGUEJY·EJGXQT\ÒINKEJ

20




PETER I.

8037

8038

8039



4WDGN/QUMCW4QVGT/ÒP\JQHI$KVMKP&CX&KCMQX  5GNVGPKPFKGUGT'TJCNVWPI(GKPG2CVKPCUGJTCVVTCMVKXGUXQT\ÒINKEJGU'ZGORNCT





4WDGN/QUMCW4QVGT/ÒP\JQHI$KVMKPXCT&CX&KCMQX#  -N5EJTÌVNKPIUHGJNGTUGJTUEJÌP





4WDGN/QUMCW4QVGT/ÒP\JQHI$KVMKPXCT 4 &CX&KCMQX  45GJTUEJÌP



8040

8041



4WDGN 2QNVKPC  M[TKNNKUEJ /QUMCW4QVGT/ÒP\JQHI$KVMKP 4 &KCMQX  4(GKPG2CVKPCYKP\<CKPGPFGUGJTUEJÌP



 4WDGN 2QNVKPC   /QUMCW 4QVGT /ÒP\JQH  I )GJCTPKUEJVGU $TWUVDKNF T OKV .QTDGGT   MTCP\ WPF WOIGNGIVGO /CPVGN)GMTÌPVGT &QRRGNCFNGT OKV <GRVGT WPF 4GKEJUCRHGN KP FGP (·PIGP   QDGP-TQPG$KVMKPXCT 4 &KCMQXXCT  5GJTUGNVGPDGUQPFGTUKPFKGUGT'TJCNVWPI8QT\ÒINKEJ 

8042



8043



4WDGN 2QNVKPC /QUMCW4QVGT/ÒP\JQHI$KVMKPXCT 4 &KCMQXXCT  4)GTGKPKIVHCUVUGJTUEJÌP





4WDGN 2QNVKPC /QUMCW4QVGT/ÒP\JQHI$KVMKP 4 &KCMQX  5GJTUGNVGPDGUQPFGTUKPFKGUGT'TJCNVWPI*ÒDUEJG2CVKPCXQT\ÒINKEJ

 21


PETER I.

8044



4WDGN 2QNWRQNVKPPKM /QUMCW4QVGT/ÒP\JQHI$KVMKP 4 &KCMQX  44)GTGKPKIV5VGORGNHGJNGTHCUVUGJTUEJÌPUGJTUEJÌP



8047 8045

8046



)TKXPC M[TKNNKUEJ /QUMCW4QVGT/ÒP\JQHI$KVMKP&KCMQX

5GJTUEJÌP





-QRGMGP/QUMCW4QVGT/ÒP\JQHI$KVMKP 4 &KCMQX  445EJTÌVNKPIUHGJNGTCO4CPFUGJTUEJÌP





-QRGMGP #NV[P  M[TKNNKUEJ /QUMCW4QVGT/ÒP\JQHI$KVMKP&KCMQX  45GJTUEJÌP



8048

8049

8050

(ÒPH5QPPGPTWDGNFGT/ÒP\UV·VVG5V2GVGTUDWTI 

4WDGN5V2GVGTUDWTI5QPPGPTWDGNI$KVMKP&CX&KCMQX  *GPMGNURWT4GUVGCNVGT8GTIQNFWPIUGJTUEJÌP





4WDGN5V2GVGTUDWTI5QPPGPTWDGNI$KVMKP 4 &CX&KCMQX  4(CUVUGJTUEJÌP





4WDGN5V2GVGTUDWTI5QPPGPTWDGNI$KVMKP 4 &CX&KCMQX  4-N5EJTÌVNKPIUHGJNGTUGJTUEJÌP



22


PETER I.

8051

8053

8054

8052



4WDGN5V2GVGTUDWTI5QPPGPTWDGNI$KVMKP 4 &CX&KCMQX  44#VVTCMVKXGU'ZGORNCTOKVHGKPGT2CVKPCUGJTUEJÌP





4WDGN5V2GVGTUDWTI5QPPGPTWDGNI$KVMKP 4 &CX&KCMQX  4'VYCUDGTKGDGPYKP\5EJTÌVNKPIUTK­UGJTUEJÌP



-WRHGTOÒP\GPFGU/QUMCWGT/ÒP\JQHGU0CDGTG\JP[ 

-W&GPIC M[TKNNKUEJ /QUMCW/ÒP\JQH0CDGTG\JP[I$KVMKPHH&KCMQXHH  5GJTUEJÌP



-W-QRGMG ,CJTGU\CJN WPF /ÒP\UV·VVG PKEJV GTMGPPDCT  I 8GTRT·IWPI $KVMKP \W  HH   &KCMQX\WHH +PVGTGUUCPVG8GTRT·IWPI(CUVUGJTUEJÌP

8055

8056

8057

 

8058



-W-QRGMG  M[TKNNKUEJ  /QUMCW /ÒP\JQH 0CDGTG\JP[  I 8GTRT·IWPI $KVMKP \W    &KCMQX\WHH +PVGTGUUCPVG8GTRT·IWPI5GJTUEJÌP





-W-QRGMG  M[TKNNKUEJ  /QUMCW /ÒP\JQH 0CDGTG\JP[  I 8GTRT·IWPI  FG\GPVTKGTV   $KVMKPHH&KCMQXHH 5GJTUEJÌP





-W-QRGMG M[TKNNKUEJ /QUMCW/ÒP\JQH0CDGTG\JP[I8GTRT·IWPI$KVMKP\WHH &KCMQX\WHH +PVGTGUUCPVG8GTRT·IWPI5GJTUEJÌP





-W-QRGMG  M[TKNNKUEJ  /QUMCW /ÒP\JQH 0CDGTG\JP[  I 8GTRT·IWPI $KVMKP \W    &KCMQX\W +PVGTGUUCPVG8GTRT·IWPI5GJTUEJÌP

 23


PETER I.

8059

8060

8061

/GFCKNNGPFGU<CTGP2GVGT+ 

5KNDGTOGFCKNNGXQP6+YCPQHH UR·VGTG2T·IWPIWO CWHFKG'TQDGTWPIFGT(GUVWPI0[GPU MCPU CO  /CK )GJCTPKUEJVGU $TWUVDKNF T OKV .QTDGGTMTCP\ WPF WOIGNGIVGO /CPVGN#PUKEJV FGT   (GUVWPICWUFGT8QIGNRGTURGMVKXGKO8QTFGTITWPFNGJPVGKPTÌOKUEJGT-TKGIGTKPCPVKMGT4ÒUVWPIOKV .CP\GWPF(GUVWPIUUEJNÒUUGNPCEJNCPGKPGTCDIGDTQEJGPGP/CWGTOOI&KCMQX 4  44*GTTNKEJG2CVKPCXQT\ÒINKEJp5VGORGNINCP\  0CEJUGKPGO5KGIXQP5EJNÒUUGNDWTIFCWGTVGGUPQEJÒDGTGKPJCNDGU,CJTDKU<CT2GVGT+WPFUGKP)GPGTCNHGNFOCT UEJCNN$QTKU5LGTGOGVLGXXQTFKGCWHGKPGT.CPFURKV\GCPFGT/ÒPFWPIFGU(NWUUGU1EJVCKPFKG0GYC JGWVG 5VCFVIGDKGV XQP 5V 2GVGTUDWTI CPIGNGIVG(GUVWPI0[GPUMCPU\QI0CEJJGHVKIGOGKPYÌEJKIGP$GUEJW­OW­VGFGT UEJYGFKUEJG -QOOCPFCPV CO  /CK  MCRKVWNKGTGP WPF FGO <CTGP FGP <WICPI \WT 1UVUGG HTGKIGDGP &KG   4WUUGP \GTUVÌTVGP FKG (GUVWPI CO  /CK  XQNNUV·PFKI FKGUGU &CVWO KUV CWH FGT /GFCKNNG CPIGIGDGP  WPF   DGICPPGP CO  /CK  -KNQOGVGT HNW­CDY·TVU OKV 6CWUGPFGP XQP #TDGKVGTP FGP $CW PGWGT $GHGUVKIWPIUCPNCIGP   P·ONKEJFGTITQ­CTVKIGP2GVGTWPF2CWNUHGUVWPIFKGFGP-GTPFGTPGWGP*CWRVUVCFV5V2GVGTUDWTIDKNFGPUQNNVG



<KPPOGFCKNNG  WPUKIPKGTV UR·VGTG 2T·IWPI FGU  ,CJTJWPFGTVU  CWH FGP 5GGUKGI 4W­NCPFU ÒDGT   5EJYGFGPKO/ÒPFWPIUDGDKGVFGT0GYCKPFKG1UVUGGCO/CK)GJCTPKUEJVGU$TWUVDKNFTOKV.QT DGGTMTCP\ WPF WOIGNGIVGO /CPVGN<YGK UEJYGFKUEJG (TGICVVGP DGUEJKG­GP GKPG ITQ­G #P\CJN TWUUK   UEJGT 4WFGTDQQVG QDGP J·NV GKPG CWU 9QNMGP MQOOGPFG *CPF \YGK .QTDGGT\YGKIG ÒDGT GKPG -TQPG   OOI&KCMQX 5GJTUEJÌPpXQT\ÒINKEJ



7OFKGUEJYGFKUEJG(GUVWPI0[GPUMCPUXQPFGTTWUUKUEJGP$GNCIGTWPI\WGPVUGV\GPUGV\VGPUKEJPGWPUEJYGFKUEJG 5EJKHHG XQP 8KDQTI CWU KP $GYGIWPI &TGK NGKEJVGTG -TKGIUUEJKHHG UGIGNVGP KP FCU /ÒPFWPIUIGDKGV FGT 0GYC WPF   YWTFGP KP FGT 0CEJV \WO  /CK  XQP OGJT CNU JWPFGTV TWUUKUEJGP 4WFGTDQQVGP OKV LG  /CPP $GUCV\WPI   QJPG -CPQPGP  WO\KPIGNV 9·JTGPF GKPGU FGT UEJYGFKUEJGP 5EJKHHG UCPM WPF GKP YGKVGTGU XQP FGT GKIGPGP $GUCV   \WPIKPFKG.WHVIGURTGPIVYWTFGHKGNFCUFTKVVG5EJKHHFGP4WUUGPKPFKG*·PFG  1DYQJNFGT5KGIMGKPGCWUUEJNCIIGDGPFG$GFGWVWPIJCVVGYCTGUFQEJFGTGTUVG5GGUKGI2GVGTUIGIGPFKG5EJYG FGP&GT<CTGORHKPIFGPXQPKJOUGNDUVIGUVKHVGVGP5V#PFTGCUQTFGPWPFNKG­UR·VGTKP'TKPPGTWPICPFGP5KGIKP 5V2GVGTUDWTIFCU5EJNQ­-CVJCTKPGPJQHGTDCWGP#WHFGTXQTNKGIGPFGP/GFCKNNGJCVOCPFKGUEJYGFKUEJGP-TKGIU UEJKHHGKPIKICPVKUEJG(TGICVVGPXGTITÌ­GTV



<KPPOGFCKNNGXQP1-CNCUJPKMQX UR·VGTG2T·IWPIFGU,CJTJWPFGTVU CWHFKG'KPPCJOGXQP 0CTXC CO  #WIWUV )GJCTPKUEJVGU $TWUVDKNF T OKV .QTDGGTMTCP\ WPF WOIGNGIVGO /CPVGN#PUKEJV   FGTDGUEJQUUGPGP5VCFV0CTXCXQPFGTIGIGPÒDGTNKGIGPFGP5GKVGFGU(NWUUGU0CTXCNFKG(GUVWPI+YCP IQTQFOOI&KCMQX -N-QTTQUKQPUHNGEMGPXQT\ÒINKEJ 5GKV'PFG#RTKNDGNCIGTVGPTWUUKUEJG6TWRRGPFKG5VCFV0CTXC JGWVGFTKVVITÌ­VG5VCFV'UVNCPFUCPFGT)TGP\G \W4W­NCPF WPFFKGCWHFGTIGIGPÒDGTNKGIGPFGP5GKVGFGU(NWUUGU JGWVGKP4W­NCPFIGNGIGPG (GUVWPI+YCPIQTQF &KG5VCFVYWTFGJGHVKIDGUEJQUUGPCDGTUGNDUVPCEJFGO<CT2GVGT+XQPFGT'TQDGTWPI&QTRCVUCO,WNK\WTÒEM MGJTVG WPF CO  ,WNK  FGP UEJYGFKUEJGP -QOOCPFCPVGP &QTRCVU CNU )GHCPIGPGP RT·UGPVKGTVG YQNNVGP FKG   5EJYGFGP PKEJV MCRKVWNKGTGP #O  #WIWUV  HKGNGPFKG4WUUGPLGFQEJKPFKG5VCFVGKPWPFFGTUEJYGFKUEJG -QOOCPFCPV*GPPKPI4WFQNH*QTPOW­VGUKEJGTIGDGP'TUVGKPGMPCRRG9QEJGUR·VGTCO#WIWUVMCRK VWNKGTVGCWEJFKG)CTPKUQPFGT(GUVWPI+YCPIQTQF 

24




PETER I.

8062

8063

8064



5KNDGTOGFCKNNGXQP1-CNCUJPKMQX UR·VGTG2T·IWPIFGU,CJTJWPFGTVU CWHFKG'KPPCJOGXQP 0CTXC CO  #WIWUV )GJCTPKUEJVGU $TWUVDKNF T OKV .QTDGGTMTCP\ WPF WOIGNGIVGO /CPVGN#PUKEJV   XQP 0CTXC WPF +YCPIQTQF OKV FGO (NW­ 0CTXC CWU FGT 8QIGNRGTURGMVKXG CWEJ FKG TWUUKUEJGP   $GHGUVKIWPIUCPNCIGPUKPFGTMGPPDCTOOI&KCMQX 4   8QPITQ­GT5GNVGPJGKV5VGORGNHGJNGTCO4CPFXQT\ÒINKEJ 



5KNDGTOGFCKNNG  XQP 6 +YCPQHH UR·VGTG 2T·IWPI WO   CWH FKG 'KPPCJOG XQP 0CTXC CO    #WIWUV )GJCTPKUEJVGU $TWUVDKNF T OKV .QTDGGTMTCP\ WPF WOIGNGIVGO /CPVGN#PUKEJV XQP 0CTXC   WPF+YCPIQTQFOKVFGO(NW­0CTXCCWUFGT8QIGNRGTURGMVKXGCWEJFKGTWUUKUEJGP$GHGUVKIWPIUCPNCIGP UKPFGTMGPPDCTOOI&KCMQX 4  44*GTTNKEJG2CVKPCHCUV5VGORGNINCP\ 



5KNDGTOGFCKNNG  XQP 6 +YCPQHH UR·VGTG 2T·IWPI WO   CWH FKG 'KPPCJOG XQP /KVCW CO   5GRVGODGT)GJCTPKUEJVGU$TWUVDKNFTOKV.QTDGGTMTCP\WPFWOIGNGIVGO/CPVGN#PUKEJVXQP/KVCW CWU FGT 8QIGNRGTURGMVKXG KO 8QTFGTITWPF T UKV\V FKG 5VCFVIÌVVKP PCEJ N FGP NKPMGP #TO CWH FGP   UEJYGFKUEJGP 9CRRGPUEJKNF IGNGJPV CWU FGT 4GEJVGP XGTNKGTV UKG GKP 5EJYGTV  OO  I   &KCMQX 4  442TCEJVGZGORNCT*GTTNKEJG2CVKPCHCUV5VGORGNINCP\  +O5QOOGTOCTUEJKGTVG2GVGTFGT)TQ­GOKVUGKPGT#TOGGXQP.KXNCPFCWUKP-WTNCPFGKPFGT)TQ­VGKNFGT UEJYGFKUEJGP 6TWRRGP \QI UKEJ PCEJ 4KIC \WTÒEM 0CEJ MPCRR FTGK 9QEJGP JGHVKIGT $GNCIGTWPI OW­VG UKEJ FGT   UEJYGFKUEJG -QOOCPFCPV FGT MWTN·PFKUEJGP *CWRVUVCFV /KVCW JGWVG ,GNICXC KP .GVVNCPF  CO  5GRVGODGT    GTIGDGP

8065



1XCNG $TQP\GOGFCKNNG  WPUKIPKGTV XGTOWVNKEJ XQP 6 +YCPQHH 6CRHGTMGKVUOGFCKNNG HÒT FKG 6GKN   PGJOGTFGT5EJNCEJVDGK-CNKUEJCO1MVQDGT)GJCTPKUEJVGU$TWUVDKNFTOKV.QTDGGTMTCP\WPF WOIGNGIVGO /CPVGN&GT IGJCTPKUEJVG <CT CWH GKPGO PCEJ XQTP URTKPIGPFGP 4Q­ QDGP J·NV GKP CWU   9QNMGPMQOOGPFGT#TOGKPGP-TCP\ÒDGTUGKP*CWRVKO*KPVGTITWPF5EJNCEJVU\GPGZOO I&KCMQX 2TCEJVGZGORNCT5R·VGTG2T·IWPIFGU,CJTWPFGTVU(CUV5VGORGNINCP\

 25


PETER I.

8066



$TQP\GOGFCKNNG  XQP 5 ,WFKP WPF , % ) ,CGIGT UR·VGTG 2T·IWPI FGU  ,CJTJWPFGTVU  CWH   UGKPGP 5KGI ÒDGT FKG 5EJYGFGP DGK 2QNVCYC CO  ,WPK PCEJ ITGIQTKCPKUEJGO -CNGPFGT CO  ,WNK    &GT<CTTGKVGVKPXQNNGT4ÒUVWPIPCEJNÒDGTGKPGPCO$QFGPNKGIGPFGP)GHCPIGPGPJKPYGIKO*KPVGT ITWPF 5EJNCEJVFCTUVGNNWPI WPF FKG DGHGUVKIVG 5VCFV*GTMWNGU OKV .ÌYGPHGNN WPF -GWNG UVGJV HCUV X X   CWH -TKGIUVTQRJ·GP WPF FGWVGV OKV FGT .KPMGP CWH FCU 5EJNCEJVHGNF FCU KP 8QIGNRGTURGMVKXG \YKUEJGP   FGT 5VCFV 2QNVCYC FGO (NW­ 9QTUMNC WPF FGO TWUUKUEJGP .CIGT FCTIGUVGNNV KUV  OO  I   &KCMQX 8QT\ÒINKEJ



&KG 8QTFGTUGKVGPWOUEJTKHV *+% *1014 +0 01$+5 +08+&+1585 '4+6  UVCOOV CWU FGP 6GZVGP 1XKFU WPF DG   FGWVGVUKPPIGO·­&KGUGT5KGIYKTF0GKFIGIGPWPUGT\GWIGP

8067



5KNDGTOGFCKNNG  XQP 5 ,WFKP CWH UGKPGP 5KGI ÒDGT FKG 5EJYGFGP DGK 2QNVCYC CO  ,WPK PCEJ   ITGIQTKCPKUEJGO -CNGPFGT CO  ,WNK  )GJCTPKUEJVGU $TWUVDKNF T OKV .QTDGGTMTCP\ WPF WOIGNGIVGO   /CPVGN&CTUVGNNWPI FGT 5EJNCEJV CWU FGT 8QIGNRGTURGMVKXG KO *KPVGTITWPF 5VCFVCPUKEJV XQP 2QNVCYC   OOI&KCMQX 8QPITQ­GT5GNVGPJGKV*GTTNKEJG2CVKPCXQT\ÒINKEJp5VGORGNINCP\ 

8068



5KNDGTOGFCKNNGXQP6+YCPQHH UR·VGTG2T·IWPIWO CWHFKG'KPPCJOGXQP'NDKPIFWTEJFKG TWUUKUEJG#TOGGCO,CPWCT)GJCTPKUEJVGU$TWUVDKNFTOKV.QTDGGTMTCP\WPFWOIGNGIVGO/CPVGN #PUKEJV FGT 5VCFV 'NDKPI CWU FGT 8QIGNRGTURGMVKXG KO 8QTFGTITWPF N FGT (NW­IQVV 'NDKPI OKV   3WGNNWTPG FGT GTUEJTQEMGP GKPGP TÌOKUEJGP 5QNFCVGP DGVTCEJVGV FGT GKPG $QODG WPF GKPG 5VWTONGKVGT   VT·IVOOI&KCMQX 4 &WVMQYUMK5WEJCPGM  442TCEJVXQNNG2CVKPC4GUVGCNVGT6KPVGPUEJTKHVHCUV5VGORGNINCP\  &KG5VCFV'NDKPI RQNPKUEJ'NDN±I YCTUGKVFGORQNPKUEJGP(GNF\WI-CTNU:++'PFGUEJYGFKUEJDGUGV\V+O ,CPWCTYWTFGFKG5VCFVXQPTWUUKUEJGP6TWRRGPWO\KPIGNVWPFCO,CPWCTMCRKVWNKGTVGFGTUEJYGFK UEJG-QOOCPFCPV&COKVYCTFKGNGV\VGUEJYGFKUEJG$CUVKQPCWHRQNPKUEJGO$QFGPIGDTQEJGP  &CU &CVWO FGT -CRKVWNCVKQP KUV CWH FGT XQTNKGIGPFGP 2T·IWPI  CNNGTFKPIU WPMQTTGMV  PCEJ FGO ITGIQTKCPKUEJGP   -CNGPFGTCPIGIGDGPMQTTGMVOÒ­VGGUFGT(GDTWCTUGKP

26


PETER I.

8069



5KNDGTOGFCKNNGXQP6+YCPQHH UR·VGTG2T·IWPIWO CWHFKG-CRKVWNCVKQPXQP4GXCN JGWVG 6CNNKPP 'UVNCPF  CO  5GRVGODGT )GJCTPKUEJVGU $TWUVDKNF T OKV .QTDGGTMTCP\ WPF WOIGNGIVGO   /CPVGN#PUKEJV XQP 4GXCN CWU FGT 8QIGNRGTURGMVKXG FCTÒDGT UEJYGDV GKP )GPKWU OKV 5EJYGTV WPF   5VCFVMTQPGOOI&KCMQX 4   442TCEJVGZGORNCT*GTTNKEJG2CVKPCHCUV5VGORGNINCP\  0CEJ FGT -CRKVWNCVKQP XQP #TGPUDWTI WPF FGT 'KPPCJOG FGT +PUGN ¤UGN FWTEJ FKG 4WUUGP YCT 4GXCN FKG JGWVKIG   GUVKUEJG*CWRVUVCFV6CNNKPP FKGNGV\VG(GUVWPIFKG5EJYGFGPKPFGP1UVUGGRTQXKP\GPDGJCWRVGVG0CEJFGOTWUUK UEJGP(GNF\WIFWTEJ.KXNCPFKO5R·VUQOOGTYCTGPFKG$GHGUVKIWPIGPPCEJ2N·PGPXQP'TKM&CJNDGTIWOHCU UGPFGTPGWGTVWPFGTYGKVGTVYQTFGPWPFCWEJFKG)CTPKUQPYWTFGCWHHCUV/CPPCWHIGUVQEMV&KG$GNCIGTWPI FGT 5VCFV FWTEJ TWUUKUEJG 6TWRRGP DGICPP /KVVG #WIWUV  KPUDGUQPFGTG YCTGP FKG 4GXCNGT XQP FGT FWTEJ FKG   4WUUGPXQTIGPQOOGPGP7ONGKVWPIGKPGUHÒTFGP$GVTKGDFGT/ÒJNGPWPFFKG8GTUQTIWPIOKV6TKPMYCUUGTYKEJVKIGP -CPCNU DGVTQHHGP #W­GTFGO YCT #PHCPI #WIWUV FKG 2GUV CWUIGDTQEJGP FGTGP 8GTDTGKVWPI UKEJ FWTEJ FGP <W\WI   XQP (NÒEJVNKPIGP WPF FKG FCTCWU TGUWNVKGTGPFG ªDGTDGXÌNMGTWPI PQEJ DGUEJNGWPKIVG &KG 5KVWCVKQP XGTUEJNGEJVGTVG   UKEJ FGTCTV FC­ FKG UEJYGFKUEJG (ÒJTWPI CO  5GRVGODGT  ÒDGT GKPG 2TQMNCOCVKQP 2GVGTU FGU )TQ­GP WPF   ÒDGTFKG-CRKVWNCVKQPDGTKGV5EJNKG­NKEJYWTFGCO5GRVGODGTFKG-CRKVWNCVKQPWPVGT\GKEJPGVWPFFKG5VCFVFGP 4WUUGP ÒDGTNCUUGP&KGUEJYGFKUEJGP5QNFCVGPUGIGNVGPÒDGTFKG1UVUGGKPFKG*GKOCV\WTÒEM7OFKG<GTUVÌTWPI FGT5VCFV\WXGTJKPFGTPÒDGTTGKEJVGFGT5VCFVTCVFGOTWUUKUEJGP)GPGTCN(ÒTUV/GPUEJKMQYGKP'JTGPIGUEJGPMKO 9GTVXQP&WMCVGP&KG4WUUGPJCVVGPPWPICP\.KXNCPFKPKJTGP$GUKV\IGDTCEJV5VQN\YKTFKPFGT4ÒEMUGK VGPWOUEJTKHV FGT XQTNKGIGPFGP /GFCKNNG XGTMÒPFGV 24#'&1/+0#06' 2'64+ 51.+1 4'8#.+# %'55+6    4GXCN DGWIVG UKEJ XQT FGO CNNGU DGJGTTUEJGPFGP 6JTQP 2GVGTU  &CU KO #DUEJPKVV FGT 4ÒEMUGKVG CPIGIGDGPG   &CVWO  ,WPK KUV  YKG UQ QHV DGK FGP /GFCKNNGP CWU FGT TWUUKUEJGP /GFCKNNGPUGTKG XQP 2JKNKRR *GKPTKEJ /ÒNNGT  

WPFFGPUR·VGTGP2T·IWPIGPXQP6KOQVGK+YCPQHH HGJNGTJCHV

8071

8070

8070



5KNDGTOGFCKNNG  XQP 6 +YCPQHH UR·VGTG 2T·IWPI WO   CWH FKG TWUUKUEJGP 'TQDGTWPIGP   KO ,CJT  )GJCTPKUEJVGU $TWUVDKNF T OKV .QTDGGTMTCP\ WPF WOIGNGIVGO /CPVGN*GTMWNGU OKV   .ÌYGPHGNN MPKGV X X WPF J·NV )NQDWU OKV FGT .CPFMCTVG XQP .KXNCPF CWHUGKPGP5EJWNVGTPKPFGTFKG 1TVG 0CTXC 4GXCN &QTRCV 2GTPCW 4KIC WPF #TGPUDWTI GKPIG\GKEJPGV UKPF  OO  I   &KCMQX 4  44*GTTNKEJG2CVKPC4GUVGCNVGT6KPVGPUEJTKHVHCUV5VGORGNINCP\ 



1XCNG5KNDGTOGFCKNNGWPUKIPKGTV UR·VGTG2T·IWPIFGU,CJTJWPFGTVU CWHUGKPG*GTTUEJCHVÒDGT XKGT /GGTG )GJCTPKUEJVGU $TWUVDKNF T OKV .QTDGGTMTCP\ WPF WOIGNGIVGO /CPVGN)GMTÌPVGT &QRRGN   CFNGTOKV<GRVGTWPF4GKEJUCRHGNKPFGP(·PIGPCWHFGT$TWUV5V)GQTIUUEJKNFWPVGPFKGIGVGKNVG,CJ TGU\CJNZOOI&KCMQX 4  448QT\ÒINKEJ  27


PETER I.

8072



8074

8073

5KNDGTOGFCKNNGXQP6+YCPQHH UR·VGTG2T·IWPIWO CWHUGKPG.CPFWPIKOHKPPKUEJGP’DQ CO#WIWUV PCEJITGIQTKCPKUEJGO-CNGPFGTCO5GRVGODGT )GJCTPKUEJVGU$TWUVDKNFTOKV.QT DGGTMTCP\WPFWOIGNGIVGO/CPVGN*GTMWNGUOKV.ÌYGPHGNNWPF-GWNG <CT2GVGT+ YKTFXQP0GRVWP CWU GKPGT XQP \YGK2HGTFGPIG\QIGPGPWPFOKVFGOTWUUKUEJGP&QRRGNCFNGTIGUEJOÒEMVGP/WUEJGNCP .CPFIGHÒJTVOOI&KCMQX 4  44(GKPG2CVKPCXQT\ÒINKEJp5VGORGNINCP\



0CEJFGOFKG5EJYGFGPDGTGKVUKO/CK*GNUKPMKFGP4WUUGPÒDGTNCUUGPOW­VGPGTTGKEJVGFKGTWUUKUEJG(NQVVG KO#WIWUVFKGFCOCNUDGFGWVGPFUVGHKPPKUEJG5VCFV’DQ HKPPKUEJ6WTMW FGTGP$GXÌNMGTWPIDGTGKVUXQTFGPJGTCP PCJGPFGP 4WUUGP IGHNQJGP YCT <CT 2GVGT + IKPI OKV UGKPGP 6TWRRGP CO  #WIWUV CWH FGT /GFCKNNG KUV PCEJ   ITGIQTKCPKUEJGO-CNGPFGTFGT5GRVGODGTCPIGIGDGP CP.CPFWPFNKG­FKG5VCFVRNÒPFGTP&KG$ÒEJGTFGT IGITÒPFGVGP 7PKXGTUKV·V YWTFGP PCEJ 5V 2GVGTUDWTI OKVIGHÒJTV WPF DKNFGVGP FQTV FGP )TWPFUVQEM FGT ÌHHGPVNKEJGP   $KDNKQVJGM



5KNDGTOGFCKNNGXQP6+YCPQHHWPF5,WFKP UR·VGTG2T·IWPIWO CWHFKG-CRKVWNCVKQPFGT UÒFQUVHKPPKUEJGP (GUVWPI 5CXQPNKPPC UEJYGFKUEJ 0[UNQVV  CO  ,WNK )GJCTPKUEJVGU $TWUVDKNFTOKV .QTDGGTMTCP\ WPF WOIGNGIVGO/CPVGN#PUKEJVFGTCWH+PUGNPKPOGJTGTGP5GGPCPIGNGIVGP5VCFV0[U NQVVWPFFGT(GUVWPI5CPMV1NQHUDQTICWUFGT8QIGNRGTURGMVKXGFGT$GUEJW­FGT(GUVWPIXQPTWUUKUEJGP 5VGNNWPIGPKUVUKEJVDCTKO8QTFGTITWPFNCIGTVFKG5VCFVIÌVVKPCWHGKPGT3WGNNWTPGWPFJ·NVFGPTWUUKUEJGP 5EJKNFOOI&KCMQX 4  44*GTTNKEJG2CVKPCXQT\ÒINKEJp5VGORGNINCP\ 



5KNDGTOGFCKNNGXQP5,WFKP UR·VGTG2T·IWPIFGU,CJTJWPFGTVU CWHFCU-QOOCPFQFGU<CTGP ÒDGTFCU/CPÌXGTFGTXKGTCNNKKGTVGP(NQVVGP 4W­NCPF&·PGOCTM'PINCPF*QNNCPF DGKFGTF·PKUEJGP +PUGN $QTPJQNO XQO  DKU#WIWUV$ÒUVGFGU<CTGPTCWHGKPGO2QUVCOGPVFCJKPVGT9CHHGPFGT -TKGIUOCTKPG0GRVWP OKV &TGK\CEM CP FGO FKG TWUUKUEJG (CJPG DGHGUVKIV KUV YKTF KP GKPGT -WVUEJG   XQP\YGK2HGTFGPPCEJTFWTEJFCUVQUGPFG/GGTIG\QIGPCPFGT-WVUEJGUKPFFKG(CJPGPXQP&·PG OCTM'PINCPFWPF*QNNCPFDGHGUVKIVOOI&KCMQX 4   8QPITQ­GT5GNVGPJGKV5GJTUEJÌPpXQT\ÒINKEJ  <CT 2GVGT + YQNNVG PCEJ UGKPGP 5KGIGP DGK 2QNVCYC WPF XQT *CPMQ )CPIWV  PCEJ 5EJYGFGP GKPOCTUEJKGTGP WO   UGKPGP 4KXCNGP -CTN :++ GPFIÒNVKI \W DGUKGIGP +O ,WPK  DGUEJNQ­ GT OKV FGO F·PKUEJGP -ÌPKI (TGFGTKM +8   FGPIGOGKPUCOGP'KPOCTUEJKP5EJQPGP 5M¹PG &KGDGKFGPJQHHVGPFC­FKG(NQVVGPFGTCNNKKGTVGP'PIN·PFGTWPF *QNN·PFGT FGP *CHGPXQP-CTNUMTQPCFKG$CUKUFGTUEJYGFKUEJGP-TKGIUOCTKPGDNQEMKGTGPYÒTFGP&KGXKGTCNNK KGTVGP(NQVVGPXGTCPUVCNVGVGP#PHCPI#WIWUVGKPITQ­CPIGNGIVGU/CPÌXGTDGKFGT+PUGN$QTPJQNOFCUXQP<CT 2GVGT + RGTUÌPNKEJ IGNGKVGV YWTFG 5QYQJN DGK FGP 'PIN·PFGTP WPF *QNN·PFGTP CNU CWEJ DGK FGP &·PGP YWEJUGP   LGFQEJ $GFGPMGP WPF /K­VTCWGP IGIGP FKG TCUCPV YCEJUGPFG /CEJV FGU <CTGP KO 1UVUGGTCWO &KG IGOGKPUCOG   (NQVVGPCMVKQPDNKGDCWHFCU/CPÌXGTDGUEJT·PMV  &GT /CEJVCPURTWEJ FGU <CTGP FGT FGP 8GTDÒPFGVGP WPJGKONKEJ YWTFG KUV CWEJ CWH FGT XQTNKGIGPFGP /GFCKNNG   GTMGPPDCT&KGM[TKNNKUEJG4ÒEMUGKVGPWOUEJTKHVDGFGWVGV'THÒJTV$GHGJNÒDGTFKGXKGT=(NQVVGP?DGK$QTPJQNO

28


PETER I.

8075

8076

8076



5KNDGTOGFCKNNG  XQP 6 +YCPQHH UR·VGTG 2T·IWPI WO   CWH FKG 'KPTKEJVWPI FGT -QNNGIKGP   )GJCTPKUEJVGU $TWUVDKNF T OKV .QTDGGTMTCP\ WPF WOIGNGIVGO /CPVGN#FNGT KO *QTUV OKV UGKPGP ,WP   IGP UVTGEMV UKEJ FGT 5QPPG GPVIGIGP NKPMU XGTFQTTVGT TGEJVU DNÒJGPFGT $CWO  OO  I   &KCMQX 4  442TCEJVGZGORNCT*GTTNKEJG2CVKPCHCUV5VGORGNINCP\ 



5KNDGTOGFCKNNGWPUKIPKGTV XGTOWVNKEJUR·VGTG2T·IWPIFGU,CJTJWPFGTVU CWHFGP(TKGFGPXQP 0[UVCF\YKUEJGP5EJYGFGPWPF4W­NCPFXQO#WIWUV&KG#TEJG0QCJCWH5GGFCTÒDGTHNKGIVGKPG 6CWDGNOKV¤N\YGKIKO5EJPCDGNKO*KPVGTITWPFXGTDKPFGVGKP4GIGPDQIGPFKG5V·FVG5V2GVGTUDWTI WPF5VQEMJQNO<GKNGP5EJTKHVOOI&KCMQX 4   44*ÒDUEJG2CVKPCHCUVXQT\ÒINKEJ



8077

1,5:1



1,5:1

4WDGNHÌTOKIG 5KNDGTOGFCKNNG  WPUKIPKGTV CWH FGP (TKGFGP XQP 0[UVCF \YKUEJGP 5EJYGFGP WPF   4W­NCPFXQO#WIWUV&KG#TEJG0QCJCWH5GGFCTÒDGTHNKGIVGKPG6CWDGNOKV¤N\YGKIKO 5EJPCDGN KO *KPVGTITWPF XGTDKPFGV GKP 4GIGPDQIGP FKG 5V·FVG 5V 2GVGTUDWTI WPF 5VQEMJQNO   <GKNGP5EJTKHVOOI$KVMKP/XCT 4 &KCMQX 4   8QPITÌ­VGT5GNVGPJGKV*GTTNKEJG2CVKPCHCUVXQT\ÒINKEJ  29


KATHARINA I.

8078



)QNFOGFCKNNGXQP1-CNCUJPKMQX UR·VGTG2T·IWPIFGU,CJTJWPFGTVU CWHFKG-TÌPWPIUGKPGT  )GOCJNKP -CVJCTKPC $GKFGT $TWUVDKNFGT PGDGPGKPCPFGT T&GT <CT UVGJV PCEJ T WPF UGV\V UGKPGT   )GOCJNKPFKG-TQPGCWHOOI&KCMQX  )1.&8QPITQ­GT5GNVGPJGKV-N4CPFHGJNGTDGTKGDGPXQT\ÒINKEJ 

8079



$TQP\GOGFCKNNG  XQP 5,WFKPCWHUGKPGP6QF)GJCTPKUEJVGU$TWUVDKNFTOKV.QTDGGTMTCP\&KG RGTUQPKHK\KGTVG'YKIMGKVVT·IVFGP<CTGP\WO*KOOGNGORQTWPVGPNFKGCO/GGTGUWHGTUKV\GPFG4WU UKC PGDGP KJT GKP 5EJGOGN OKV -TÌPWPIUKPUKIPKGP T #VVTKDWVG FGT-WPUV9KUUGPUEJCHVWPF+PFWUVTKG CWH FGO /GGT 5GIGNUEJKHH WPF )CNGGTG KO *KPVGTITWPF N WPVGTIGJGPFG 5QPPG  OO  I   &KCMQX (CUVXQT\ÒINKEJ



8080

8080 1,5:1

<#4+0-#6*#4+0#+ 5KNDGTOÒP\GPFGU4QVGP/ÒP\JQHGUKP/QUMCW 

30

4WDGN/QUMCW4QVGT/ÒP\JQHI$KVMKP&CX&KCMQX  5GNVGPKPFKGUGT'TJCNVWPI *ÒDUEJG2CVKPC+PXGPVCTPWOOGT 6KPVGPUEJTKHV KO(GNFFGT8QTFGTUGKVGXQT\ÒINKEJ




KATHARINA I.

8081

8083

8082



4WDGN/QUMCW4QVGT/ÒP\JQHI$KVMKP&CX&KCMQX

 5GJTUEJÌPpXQT\ÒINKEJ





4WDGN/QUMCW4QVGT/ÒP\JQHI$KVMKP&CX&KCMQX  *GPMGNURWTUGJTUEJÌP





4WDGN 2QNVKPC /QUMCW4QVGT/ÒP\JQHI$KVMKP&KCMQX  5GNVGPDGUQPFGTUKPFKGUGT'TJCNVWPI(GKPG2CVKPCHCUVXQT\ÒINKEJ



8084

1,5:1

1,5:1

5KNDGTOÒP\GPFGT/ÒP\UV·VVG5V2GVGTUDWTI 

4WDGN  5V 2GVGTUDWTI 5QIGPCPPVGT 6TCWGTTWDGN  I $TWUVDKNF N OKV WOIGNGIVGO /CPVGN   )GMTÌPVGT&QRRGNCFNGTOKV<GRVGTWPF4GKEJUCRHGNKPFGP(·PIGPQDGP-TQPG$KVMKP 4 &CX &KCMQX 5GJTUGNVGPDGUQPFGTUKPFKGUGT'TJCNVWPI*ÒDUEJG2CVKPCDGTKGDGPXQT\ÒINKEJ  31


PETER II.

8086

8085

8085



4WDGN5V2GVGTUDWTII$KVMKP&CX&KCMQXXCT  4GRCTCVWTUVGNNGKO(GNFFGT4ÒEMUGKVGUGJTUEJÌP



4WDGN5V2GVGTUDWTII$KVMKP 4 &CX&KCMQX

 44)GTGKPKIVUGJTUEJÌP

 

8087

8089

8088



-QRGMGP )TKXPC 5V2GVGTUDWTII$KVMKPXCT 4 &KCMQXXCT  44)GTGKPKIVYKP\-TCV\GTUGJTUEJÌP



<YGK-WRHGT-QRGMGP5VÒEMGFGT<CTKP-CVJCTKPC+ 

-W-QRGMGP !,CJTGU\CJNWPFGWVNKEJ /QUMCW/ÒP\JQH-CFCUJGXUM[I8GTRT·IWPI $KVMKP\WHH&KCMQXHH +PVGTGUUCPVG8GTRT·IWPI'VYCU)TÒPURCPUGJTUEJÌP





-W -QRGMGP  /QUMCW /ÒP\JQH 0CDGTG\JP[  I 8GTRT·IWPI $KVMKP \W  HH   &KCMQXHH +PVGTGUUCPVG8GTRT·IWPI5GJTUEJÌP



8091

8090

<#42'6'4++ 5KNDGTOÒP\GPFGU/QUMCWGT/ÒP\JQHGU-CFCUJGXUM[ 

4WDGN/QUMCW/ÒP\JQH-CFCUJGXUM[I$KVMKPXCT&CX&KCMQX  5GJTUEJÌP



4WDGN/QUMCW/ÒP\JQH-CFCUJGXUM[I$KVMKP&CX&KCMQX

32

 (CUVUGJTUEJÌP

 


PETER II.

8092

8093

8094



4WDGN/QUMCW/ÒP\JQH-CFCUJGXUM[I$KVMKP 4 &CX&KCMQX  5GNVGPG8CTKCPVG#VVTCMVKXGU'ZGORNCTUGJTUEJÌPpXQT\ÒINKEJ





4WDGN/QUMCW/ÒP\JQH-CFCUJGXUM[I$KVMKP 4 &CX&KCMQX  5GJTUEJÌP





4WDGN/QUMCW/ÒP\JQH-CFCUJGXUM[I$KVMKP&CX&KCMQX  5EJÌPpUGJTUEJÌP



8096

8095

8096



4WDGN/QUMCW/ÒP\JQH-CFCUJGXUM[I$KVMKPXCT&CX&KCMQX  5GJTUEJÌP



4WDGN 2QNVKPC 5V2GVGTUDWTII/KVFGO/ÒP\\GKEJGPCWHDGKFGP5GKVGP$KVMKP

4 &KCMQX 44)GTGKPKIVFG\GPVTKGTVUGJTUEJÌP



'KPG2QNVKPCFGT/ÒP\UV·VVG5V2GVGTUDWTI

8098

8097



8098

-WRHGTOÒP\GPFGU/QUMCWGT/ÒP\JQHGU-CFCUJGXUM[ 

-W -QRGMGP  /QUMCW /ÒP\JQH -CFCUJGXUM[  I 8GTRT·IWPI $KVMKP \W  XCT   &KCMQX\WXCT +PVGTGUUCPVG8GTRT·IWPI5GJTUEJÌP



-W-QRGMG/QUMCW/ÒP\JQH-CFCUJGXUM[I$KVMKPHHXCT&KCMQXHHXCT  5GJTUEJÌP

  33


ANNA

8100

8099 1,5:1



-W-QRGMG/QUMCW/ÒP\JQH-CFCUJGXUM[I$KVMKP&KCMQX

5GJTUEJÌP





-W-QRGMG/QUMCW/ÒP\JQH-CFCUJGXUM[I$KVMKPXCT&KCMQXXCT  5GJTUGNVGPKPFKGUGT'TJCNVWPI8QT\ÒINKEJp5VGORGNINCP\



8101

<#4+0#00# 5KNDGTOÒP\GPFGU/QUMCWGT/ÒP\JQHGU-CFCUJGXUM[ 

4WDGN/QUMCW/ÒP\JQH-CFCUJGXUM[I$KVMKP 4 &CX&KCMQX  45GJTUEJÌP

8102

8103



8104



4WDGN/QUMCW/ÒP\JQH-CFCUJGXUM[I$KVMKPHHXCT&CX&KCMQXXCT  5EJTÌVNKPIUHGJNGTUGJTUEJÌPpXQT\ÒINKEJ





4WDGN/QUMCW/ÒP\JQH-CFCUJGXUM[I$KVMKPXCT&CX&KCMQXXCT  5GJTUEJÌP





4WDGN/QUMCW/ÒP\JQH-CFCUJGXUM[I$KVMKPXCT&CX&KCMQXXCT  5GJTUEJÌP



34


ANNA

8106

8105

8107



4WDGN/QUMCW/ÒP\JQH-CFCUJGXUM[I$KVMKP&CX&KCMQXXCT  (GKPG2CVKPCUGJTUEJÌP





4WDGN/QUMCW/ÒP\JQH-CFCUJGXUM[I$KVMKP&CX&KCMQX  'VYCUIGTGKPKIVUGJTUEJÌP





4WDGN/QUMCW/ÒP\JQH-CFCUJGXUM[I$KVMKP&CX&KCMQX

5GJTUEJÌP





4WDGN 2QNVKPC /QUMCW/ÒP\JQH-CFCUJGXUM[I$KVMKP&KCMQX  #VVTCMVKXGU'ZGORNCTOKVJÒDUEJGT2CVKPCHCUVXQT\ÒINKEJ





4WDGN 2QNVKPC /QUMCW/ÒP\JQH-CFCUJGXUM[I$KVMKP&KCMQX  )GTGKPKIVMN5EJTÌVNKPIUHGJNGTUGJTUEJÌP



8108

8109

8110

8110 1,5:1



 4WDGN 2QNVKPC   /QUMCW /ÒP\JQH -CFCUJGXUM[  I )GMTÌPVGU $TWUVDKNFTOKVWOIG NGIVGO 1TFGPUDCPF QJPG 2GTNGP CWH FGT $TWUV)GMTÌPVGT &QRRGNCFNGT OKV <GRVGT WPF 4GKEJUCRHGN   KP FGP (·PIGP CWH FGT $TWUV 5V )GQTIUUEJKNF WOJGT FKG -GVVG FGU #PFTGCUQTFGPU QDGP -TQPG   $KVMKP 4 &KCMQX 8QPITQ­GT5GNVGPJGKV(GKPG2CVKPCUGJTUEJÌP  35


ANNA

8112



8111

8112

-QRGMGP )TKXGPPKM /QUMCW/ÒP\JQH-CFCUJGXUM[I$KVMKP 4 &KCMQX  4)GTGKPKIVUGJTUEJÌP



'KP4WDGNFGU4QVGP/ÒP\JQHGUKP/QUMCW 

4WDGN 2QNWRQNVKPPKM /QUMCW4QVGT/ÒP\JQHI$KVMKP 4 &KCMQX  44)GTGKPKIVHCUVUGJTUEJÌP



8113

8114

8114

<YGK4WDGNFGT/ÒP\UV·VVG5V2GVGTUDWTI 

4WDGN5V2GVGTUDWTI0QXQFGNI/KV4KHHGNTCPF)GMTÌPVGU$TWUVDKNFTOKVWOIGNGIVGO /CPVGN)GMTÌPVGT &QRRGNCFNGT OKV <GRVGT WPF 4GKEJUCRHGN KP FGP (·PIGP CWH FGT $TWUV 5V )GQTIU   UEJKNF WOJGT FKG -GVVG FGU #PFTGCUQTFGPU QDGP -TQPG $KVMKP *  4  &CX \W  &KCMQX   50XCT CPFGTG4KHHGNWPI  8QPITQ­GT5GNVGPJGKV*GTTNKEJG2CVKPCXQT\ÒINKEJ5VGORGNINCP\  'ZGORNCTFGT5COONWPI#PVQPKP2TQMQR6GKN#WMVKQP#WTGC0WOKUOCVKMC2TCI0T



4WDGN5V2GVGTUDWTII$KVMKPXCT 4 &CX&KCMQXXCT  45EJTÌVNKPIUHGJNGTUGJTUEJÌP



8115

8116

8117

-WRHGTOÒP\GPFGT<CTKP#PPC 

-W2QNWUEJMC/QUMCW4QVGT/ÒP\JQHIªDGTRT·IVCWHGKPGT-W-QRGMG2GVGTU++$KVMKP &KCMQX 5GNVGPKPFKGUGT'TJCNVWPI8QT\ÒINKEJp5VGORGNINCP\





-W&GPIC/QUMCW9KPFOÒJNGCO,CW\CI8GTRT·IWPI$KVMKP\WHH&KCMQX\WHH +PVGTGUUCPVG8GTRT·IWPI(CUVUGJTUEJÌP





-W&GPIC/QUMCW9KPFOÒJNGCO,CW\CI8GTRT·IWPI$KVMKP\W&KCMQX\WHH  +PVGTGUUCPVG8GTRT·IWPI(CUVUGJTUEJÌP



36


ANNA

8118

8120

8119

8121



-W&GPIC/QUMCW9KPFOÒJNGCO,CW\CI8GTRT·IWPI$KVMKP\W&KCMQX\W  +PVGTGUUCPVG8GTRT·IWPI5GJTUEJÌP





-W2QNWUEJMC  /QUMCW 9KPFOÒJNG CO ,CW\C  I 8GTRT·IWPI $KVMKP \W  HH   &KCMQXHH +PVGTGUUCPVG8GTRT·IWPI5GJTUEJÌP





-W2QNWUEJMC  /QUMCW 9KPFOÒJNG CO ,CW\C  I 8GTRT·IWPI $KVMKP \W  HH   &KCMQXHH +PVGTGUUCPVG8GTRT·IWPI5GJTUEJÌP





-W&GPIC'MCVGTKPDWTII8GTRT·IWPI$KVMKP\WHH&KCMQX\WH  +PVGTGUUCPVG8GTRT·IWPI(CUVUGJTUEJÌP



&KG<WYGKUWPI\WT/ÒP\UV·VVG'MCVGTKPDWTIKUVPKEJVIGUKEJGTV

8122

<YGK/GFCKNNGPFGT<CTKP#PPC 

5KNDGTOGFCKNNG  XQP ( /CTVGCW CWH FGP (TKGFGP XQP $GNITCF \YKUEJGP ¤UVGTTGKEJ WPF 4W­NCPF   OKVFGT6ÒTMGK$TWUVDKNF.WFYKIU:8XQP(TCPMTGKEJT&KG2GTUQPKHKMCVKQP(TCPMTGKEJUVJTQPVXX WPFPKOOVXQPFTGKYGKDNKEJGPCPVKMIGMNGKFGVGP)GUVCNVGPOKVFGP5EJKNFGP¤UVGTTGKEJU4W­NCPFUD\Y FGT6ÒTMGKLGGKPGP.QTDGGT\YGKIGPVIGIGPOOI&KCMQX 4 2CZKP0WOOKUp 44*GTTNKEJG2CVKPCXQT\ÒINKEJ 

8123



5KNDGTOGFCKNNGWPUKIPKGTVCWHKJTGP6QFCO1MVQDGT)GMTÌPVGU$TWUVDKNFTOKVWOIGNGIVGO /CPVGN KO #DUEJPKVV FTGK <GKNGP 5EJTKHV&KG -CKUGTKP UEJYGDV CWH GKPGT 9QNMG KP FGP *KOOGN WPF   MTÌPV FCDGK FGP XQP FGT 4WUUKC GORQT IGJCNVGPGP MNGKPGP +QCPP #PVQPQYKVUEJ <CT +XCP +++  QDGP   UVTCJNGPFG5QPPGOOI&KCMQX 4  44*ÒDUEJG2CVKPCUGJTUEJÌP  37


IVAN III.

8124

1,5:1

1,5:1

<#4+8#0+++ <YGK5KNDGTOÒP\GPFGU4QVGP/ÒP\JQHGUKP/QUMCW 

4WDGN/QUMCW4QVGT/ÒP\JQHI$TWUVDKNFTOKV.QTDGGTMTCP\WOIGNGIVGO/CPVGNWPF #PFTGCUQTFGP)GMTÌPVGT &QRRGNCFNGT OKV <GRVGT WPF 4GKEJUCRHGN KP FGP (·PIGP CWH FGT $TWUV   5V)GQTIUUEJKNFWOJGTFKG-GVVGFGU#PFTGCUQTFGPUQDGP-TQPG$KVMKP 4 &CX&KCMQX  445GJTCVVTCMVKXGU'ZGORNCTOKVJÒDUEJGT2CVKPCUGJTUEJÌPUGJTUEJÌPpXQT\ÒINKEJ 

8125

3:1



3:1

-QRGMGP )TKXGPPKM /QUMCW4QVGT/ÒP\JQHI$TWUVDKNFTOKV.QTDGGTMTCP\WOIG NGIVGO/CPVGNWPF#PFTGCUQTFGP)GMTÌPVGOKV.QTDGGT\YGKIGPXGT\KGTVG-CTVWUEJGFCTKP\YGK<GKNGP 5EJTKHVÒDGT,CJTGU\CJN$KVMKP 4 &KCMQX  W­GTUVUGNVGPKPFKGUGT'TJCNVWPI2TCEJVGZGORNCT(CUV5VGORGNINCP\



8126

'KPG-WRHGTFGPICFGT/ÒP\UV·VVG'MCVGTKPDWTI  38

-W&GPIC'MCVGTKPDWTII$KVMKP 4 &KCMQX

5GJTUEJÌP




ELISABETH

8127

1,5:1

1,5:1

<#4+0'.+5#$'6* <YGK)QNFOÒP\GPFGT<CTKP'NKUCDGVJ 

 4WDGN  /QUMCW 4QVGT /ÒP\JQH  I )GMTÌPVGU $TWUVDKNF T OKV WOIGNGIVGO /CPVGN   8KGTIGMTÌPVG9CRRGPKPU-TGW\IGUVGNNVKPFGT/KVVG#FNGTUEJKNFKPFGP9KPMGNPFKGIGVGKNVG,CJTGU \CJN$KVMKP 4 &KCMQX 4 (D  )1.&44-N5EJTÌVNKPIUHGJNGTXQT\ÒINKEJ 

1,5:1



8128

1,5:1

4WDGN5V2GVGTUDWTII$KVMKP 4 &KCMQX 4 (D  )1.&44#VVTCMVKXGU'ZGORNCTUGJTUEJÌPpXQT\ÒINKEJ



8130

8129

8129

5KNDGTOÒP\GPFGU4QVGP/ÒP\JQHGUKP/QUMCW 

4WDGN/QUMCW4QVGT/ÒP\JQHI$KVMKP 4 &CX&KCMQX  44-N2T·IGUEJY·EJGUGJTUEJÌP





4WDGN/QUMCW4QVGT/ÒP\JQHI$KVMKP 4 &CX&KCMQX  44-TCV\GTKO(GNFFGT8QTFGTUGKVGMN4CPFHGJNGTHCUVXQT\ÒINKEJ

 39


ELISABETH

8132

8131



8133

4WDGN/QUMCW4QVGT/ÒP\JQHI$KVMKP&CX&KCMQX  5GJTUGNVGPKPFKGUGT'TJCNVWPI2TCEJVGZGORNCT -N5EJTÌVNKPIUHGJNGTKO4CPFDGTGKEJXQT\ÒINKEJp5VGORGNINCP\5VGORGNINCP\





4WDGN/QUMCW4QVGT/ÒP\JQHI$KVMKP&CX&KCMQX  *ÒDUEJG2CVKPCUGJTUEJÌP





4WDGN/QUMCW4QVGT/ÒP\JQHI$KVMKP&CX&KCMQX



8135

5GJTUEJÌP

8135

8134



4WDGN 2QNVKPC /QUMCW4QVGT/ÒP\JQHI$KVMKP 4 &KCMQX  4(GKPG2CVKPCYKP\-TCV\GTUGJTUEJÌPpXQT\ÒINKEJ





-QRGMGP )TKXGPPKM /QUMCW4QVGT/ÒP\JQHI$KVMKPXCT&KCMQXXCT 4  <CRQPKGTVXQT\ÒINKEJ



8136

8137



8137

-QRGMGP )TKXGPPKM /QUMCW4QVGT/ÒP\JQHI$KVMKP 4 &KCMQX  W­GTUVUGNVGPKPFKGUGT'TJCNVWPI(CUV5VGORGNINCP\



5KNDGTOÒP\GPFGT/ÒP\UV·VVG5V2GVGTUDWTI  40

4WDGN5V2GVGTUDWTII$KVMKPXCT&CX&KCMQX  5GJTUGNVGPKPFKGUGT'TJCNVWPI2TCEJVGZGORNCT8QT\ÒINKEJp5VGORGNINCP\




ELISABETH

8138

8139

8140



4WDGN5V2GVGTUDWTII$KVMKPXCT&CX&KCMQXXCT

8QT\ÒINKEJ





4WDGN5V2GVGTUDWTII$KVMKPXCT&CX&KCMQXXCT  -N5EJTÌVNKPIUHGJNGTUGJTUEJÌP





4WDGN5V2GVGTUDWTII$KVMKPXCT&CX&KCMQXXCT  9KP\5EJTÌVNKPIUHGJNGTUGJTUEJÌP



8141

1,5:1



1,5:1

4WDGN5V2GVGTUDWTII&GWVNKEJÒDGTRT·IVCWHGKPGO4WDGNXQP+XCP+++)GMTÌPVGU $TWUVDKNF T OKV WOIGNGIVGO /CPVGN)GMTÌPVGT &QRRGNCFNGT OKV <GRVGT WPF 4GKEJUCRHGN KP FGP   (·PIGP CWH FGT $TWUV 5V )GQTIUUEJKNF WOJGT FKG -GVVG FGU #PFTGCUQTFGPUQDGP-TQPG$KVMKP &CX&KCMQX 2TCEJVGZGORNCTOKVJGTTNKEJGT2CVKPC8QT\ÒINKEJp5VGORGNINCP\  41


ELISABETH

8142

8143

8144



4WDGN5V2GVGTUDWTII&GWVNKEJÒDGTRT·IVCWHGKPGO4WDGNXQP+XCP+++$KVMKP &CX&KCMQX #VVTCMVKXGU'ZGORNCTOKVHGKPGT2CVKPCUGJTUEJÌPpXQT\ÒINKEJ



4WDGN5V2GVGTUDWTII$KVMKPXCT&CX&KCMQX  5GJTUGNVGPKPFKGUGT'TJCNVWPI2TCEJVGZGORNCT8QT\ÒINKEJXQT\ÒINKEJp5VGORGNINCP\





4WDGN5V2GVGTUDWTII$KVMKPXCT&CX&KCMQX



8145

8146

5GJTUEJÌP



8147



4WDGN5V2GVGTUDWTII$KVMKP&CX&KCMQX  5GNVGPKPFKGUGT'TJCNVWPI2TCEJVGZGORNCT8QT\ÒINKEJp5VGORGNINCP\



4WDGN5V2GVGTUDWTII$KVMKP&CX&KCMQX

8QT\ÒINKEJ





4WDGN5V2GVGTUDWTII$KVMKP&CX&KCMQX  5GJTUGNVGPKPFKGUGT'TJCNVWPI2TCEJVGZGORNCT8QT\ÒINKEJp5VGORGNINCP\



42




ELISABETH

8148

8149

8150



4WDGN5V2GVGTUDWTII$KVMKP&CX&KCMQX



4WDGN 5V2GVGTUDWTI5QIGPCPPVGT5EQVV4WDGNI$KVMKP&CX&KCMQX 5GNVGPKPFKGUGT'TJCNVWPI2TCEJVGZGORNCT9KP\5EJTÌVNKPIUHGJNGTXQT\ÒINKEJp5VGORGNINCP\ 



4WDGN 5V2GVGTUDWTI5QIGPCPPVGT5EQVV4WDGNI$KVMKP&CX&KCMQX 9KP\-TCV\GTXQT\ÒINKEJ

8151

8152

5GJTUEJÌP





8153



4WDGN 5V2GVGTUDWTI5QIGPCPPVGT5EQVV4WDGNI$KVMKP&CX&KCMQX 5GJTUEJÌP



4WDGN5V2GVGTUDWTII$KVMKP&CX&KCMQX 4   5GNVGPKPFKGUGT'TJCNVWPI2TCEJVGZGORNCT8QT\ÒINKEJp5VGORGNINCP\



4WDGN  5V 2GVGTUDWTI  I )GMTÌPVGU $TWUVDKNF T OKV WOIGNGIVGO /CPVGN)GMTÌPVGT   &QRRGNCFNGTOKV<GRVGTWPF4GKEJUCRHGNKPFGP(·PIGPCWHFGT$TWUV5V)GQTIUUEJKNFWOJGTFKG-GVVG FGU#PFTGCUQTFGPUQDGP-TQPG$KVMKP 4 &CX&KCMQX  5GNVGPDGUQPFGTUKPFKGUGT'TJCNVWPI2TCEJVGZGORNCT8QT\ÒINKEJp5VGORGNINCP\ 

 

43


ELISABETH

8155

8154

8157

8156



4WDGN 2QNVKPC 5V2GVGTUDWTII$KVMKP 4 &KCMQX 4   4(GKPG2CVKPCUGJTUEJÌP





4WDGN 2QNVKPC 5V2GVGTUDWTII$KVMKP 4 &KCMQX  5GNVGPDGUQPFGTUKPFKGUGT'TJCNVWPI(GKPG2CVKPCHCUVXQT\ÒINKEJ





4WDGN 2QNVKPC 5V2GVGTUDWTII$KVMKP 4 &KCMQX  5GJTUGNVGPDGUQPFGTUKPFKGUGT'TJCNVWPI-N5EJTÌVNKPIUHGJNGTXQT\ÒINKEJ





4WDGN 2QNVKPC 5V2GVGTUDWTII$KVMKP 4 &KCMQX 4   5GJTUGNVGPKPFKGUGT'TJCNVWPI9KP\5EJTÌVNKPIUHGJNGTHCUVXQT\ÒINKEJ



8159

8158

8158



4WDGN 2QNVKPC 5V2GVGTUDWTII$KVMKP 4 &KCMQX 4 XCT  44-N4CPFHGJNGTUGJTUEJÌP





-QRGMGP5V2GVGTUDWTII$KVMKP 4 &KCMQX



8160

4(GKPG2CVKPCXQT\ÒINKEJ

8161

-WRHGTOÒP\GPFGT<CTKP'NKUCDGVJ 

-W&GPIC/QUMCW4QVGT/ÒP\JQHI8GTRT·IWPI$KVMKP\W&KCMQX\W  +PVGTGUUCPVG8GTRT·IWPI5GJTUEJÌP





-W&GPIC'MCVGTKPDWTII8GTRT·IWPI$KVMKP\W&KCMQX\W  +PVGTGUUCPVG8GTRT·IWPI5GJTUEJÌP



&KG<WYGKUWPI\WT/ÒP\UV·VVG'MCVGTKPDWTIKUVPKEJVIGUKEJGTV

44


ELISABETH

8164

8163

8162



-W&GPIC'MCVGTKPDWTII8GTRT·IWPI$KVMKP\W&KCMQX\W  +PVGTGUUCPVG8GTRT·IWPI5GJTUEJÌP &KG<WYGKUWPI\WT/ÒP\UV·VVG'MCVGTKPDWTIKUVPKEJVIGUKEJGTV



-W&GPIC'MCVGTKPDWTII8GTRT·IWPI$KVMKP\W&KCMQX\W  +PVGTGUUCPVG8GTRT·IWPI5GJTUEJÌP

&KG<WYGKUWPI\WT/ÒP\UV·VVG'MCVGTKPDWTIKUVPKEJVIGUKEJGTV



-W&GPIC  'MCVGTKPDWTI  I 8GTRT·IWPI 8QTFGTUGKVG  KPMWUG 4ÒEMUGKVG $KVMKP \W    &KCMQX\W +PVGTGUUCPVG8GTRT·IWPI5GJTUEJÌP



 

&KG<WYGKUWPI\WT/ÒP\UV·VVG'MCVGTKPDWTIKUVPKEJVIGUKEJGTV

8166

8165



8165

-W-QRGMGP'MCVGTKPDWTII8GTRT·IWPI$KVMKP\W&KCMQX\W  +PVGTGUUCPVG8GTRT·IWPI5GJTUEJÌP



&KG<WYGKUWPI\WT/ÒP\UV·VVG'MCVGTKPDWTIKUVPKEJVIGUKEJGTV



-W-QRGMGP'MCVGTKPDWTII8GTRT·IWPI$KVMKP\WHH&KCMQX\W  4+PVGTGUUCPVG8GTRT·IWPI(CUVUGJTUEJÌP

8167





8168

-W-QRGMGP'MCVGTKPDWTII8GTRT·IWPI$KVMKP\W&KCMQX\W  +PVGTGUUCPVG8GTRT·IWPI(CUVUGJTUEJÌP



&KG<WYGKUWPI\WT/ÒP\UV·VVG'MCVGTKPDWTIKUVPKEJVIGUKEJGTV



-W-QRGMGP'MCVGTKPDWTII8GTRT·IWPI8GTOWVNKEJÒDGTRT·IVCWHGKPGT-W-QRGMG CWUFGT/ÒP\UV·VVG5V2GVGTUDWTI$KVMKP\W&KCMQX\W  +PVGTGUUCPVG8GTRT·IWPI(CUVUGJTUEJÌP &KG<WYGKUWPI\WT/ÒP\UV·VVG'MCVGTKPDWTIKUVPKEJVIGUKEJGTV

 45


ELISABETH

8170

8169



-W-QRGMGP'MCVGTKPDWTII8GTRT·IWPI5KEJVDCTÒDGTRT·IVCWHGKPGO-W-QRGMGP 5VÒEMXQP2GVGT++QFGT-CVJCTKPC+$KVMKP\W&KCMQX\W  +PVGTGUUCPVG8GTRT·IWPI5GJTUEJÌP



-W-QRGMGP'MCVGTKPDWTII8GTRT·IWPI$KVMKP\W&KCMQX\W  +PVGTGUUCPVG8GTRT·IWPI5GJTUEJÌP



&KG<WYGKUWPI\WT/ÒP\UV·VVG'MCVGTKPDWTIKUVPKEJVIGUKEJGTV



&KG<WYGKUWPI\WT/ÒP\UV·VVG'MCVGTKPDWTIKUVPKEJVIGUKEJGTV

8171



8172

-W-QRGMGP'MCVGTKPDWTII8GTRT·IWPI$KVMKP\W&KCMQX\W  +PVGTGUUCPVG8GTRT·IWPI(CUVUGJTUEJÌP



-W-QRGMGP'MCVGTKPDWTII8GTRT·IWPI$KVMKP\W&KCMQX\W  +PVGTGUUCPVG8GTRT·IWPI(CUVUGJTUEJÌP



&KG<WYGKUWPI\WT/ÒP\UV·VVG'MCVGTKPDWTIKUVPKEJVIGUKEJGTV



&KG<WYGKUWPI\WT/ÒP\UV·VVG'MCVGTKPDWTIKUVPKEJVIGUKEJGTV

8173 8174



8175

-W-QRGMG!!  'MCVGTKPDWTII8GTRT·IWPI$KVMKP\WHH&KCMQX\W  +PVGTGUUCPVG8GTRT·IWPI(CUVUGJTUEJÌP



-W&GPIC'MCVGTKPDWTII8GTRT·IWPI$KVMKP\W&KCMQX\W  +PVGTGUUCPVG8GTRT·IWPI5GJTUEJÌP



-W&GPIC'MCVGTKPDWTII8GTRT·IWPI$KVMKP\W&KCMQX\W  +PVGTGUUCPVG8GTRT·IWPI5GJTUEJÌP



&KG<WYGKUWPI\WT/ÒP\UV·VVG'MCVGTKPDWTIKUVPKEJVIGUKEJGTV



&KG<WYGKUWPI\WT/ÒP\UV·VVG'MCVGTKPDWTIKUVPKEJVIGUKEJGTV



&KG<WYGKUWPI\WT/ÒP\UV·VVG'MCVGTKPDWTIKUVPKEJVIGUKEJGTV

46


ELISABETH

8177



8176

8178

-W-QRGMG  5V 2GVGTUDWTI  I 5KEJVDCT ÒDGTRT·IV CWH GKPGO -W -QRGMGP5VÒEM XQP   2GVGT++QFGT-CVJCTKPC+$KVMKP 4 &KCMQX 4ªDGTRT·IWPIUURWTGPUGJTUEJÌP



2T·IWPIGPHÒT.KXNCPFWPF'UVNCPF 

.KXQPCKUG 4WDGN \W  -QRGMGP   /QUMCW 4QVGT /ÒP\JQH IGRT·IV HÒT .KXNCPF WPF 'UVNCPF   I$KVMKP 4 &CX&KCMQX 4  44'VYCURQTÌUGT5EJTÌVNKPIUGJTUEJÌP   DGVGKNKIVG UKEJ <CTKP 'NKUCDGVJ CP GKPGT IGUCOVGWTQR·KUEJGP -QCNKVKQP IGIGP (TKGFTKEJ ++ XQP 2TGW­GP 5KG   UEJKEMVG 6TWRRGP KP FKG DCNVKUEJGP 2TQXKP\GP FGTGP JGTTUEJGPFG 1DGTUEJKEJV ITÌ­VGPVGKNU FGWVUEJ YCT /KV FGO   XQTNKGIGPFGP.KXQPCKUGYQNNVG'NKUCDGVJFKGKPFGP2TQXKP\GPI·PIKIGP/ÒP\GPGTUGV\GP



.KXQPCKUG 4WDGN \W  -QRGMGP   /QUMCW 4QVGT /ÒP\JQH IGRT·IV HÒT .KXNCPF WPF 'UVNCPF   I$KVMKP 4 &CX&KCMQX 4  45EJCTHIGTGKPKIVMN-TCV\GTUGJTUEJÌP 

8179

8180

8180



 .KXQPCKUG  4WDGN \W  -QRGMGP   /QUMCW 4QVGT /ÒP\JQH IGRT·IV HÒT .KXNCPF WPF   'UVNCPFI$KVMKPNGKEJVXCT 4 &KCMQX 4  4)GTGKPKIVUEJÌPpUGJTUEJÌP





 .KXQPCKUG  4WDGN \W  -QRGMGP   /QUMCW 4QVGT /ÒP\JQH IGRT·IV HÒT .KXNCPF WPF   'UVNCPFI$KVMKPNGKEJVXCT&KCMQX 4  5EJÌPpUGJTUEJÌP



8181

8182

8183



 -QRGMGP  ,CJTGU\CJN KO 5VGORGN CWU  IG·PFGTV  /QUMCW 4QVGT /ÒP\JQH IGRT·IV HÒT   .KXNCPFWPF'UVNCPFI$KVMKP&KCMQX 4  5GJTUEJÌP





-QRGMGP/QUMCW4QVGT/ÒP\JQHIGRT·IVHÒT.KXNCPFWPF'UVNCPFI$KVMKP&KCMQX  4  <CRQPKGTVUGJTUEJÌPpXQT\ÒINKEJ





 -QRGMGP  /QUMCW 4QVGT /ÒP\JQH IGRT·IV HÒT .KXNCPF WPF 'UVNCPFI$KVMKP 4  &KCMQX 4  5GJTUGNVGPDGUQPFGTUKPFKGUGT'TJCNVWPI5GJTUEJÌPXQT\ÒINKEJ

 47


ELISABETH

8185

8184

2T·IWPIGPHÒT1UVRTGW­GP 

 6CNGT  -ÌPKIUDGTI IGRT·IV HÒT 1UVRTGW­GP WPVGT TWUUKUEJGT $GUCV\WPI  I $KVMKP   

4 &KCMQX 4 1NF# 5GNVGPKPFKGUGT'TJCNVWPI(GKPG2CVKPCGVYCU$GNCIXQT\ÒINKEJ





6CNGT-ÌPKIUDGTIIGRT·IVHÒT1UVRTGW­GPWPVGTTWUUKUEJGT$GUCV\WPII$KVMKP 4  &KCMQX1NFC 5GJTUEJÌPpXQT\ÒINKEJ



8186

8187

8188

8189

8190



)TÌUEJGT-ÌPKIUDGTIIGRT·IVHÒT1UVRTGW­GPWPVGTTWUUKUEJGT$GUCV\WPII$KVMKPXCT &KCMQXXCT1NFC 5GNVGPKPFKGUGT'TJCNVWPI(GKPG2CVKPCXQT\ÒINKEJ





)TÌUEJGT-ÌPKIUDGTIIGRT·IVHÒT1UVRTGW­GPWPVGTTWUUKUEJGT$GUCV\WPII$KVMKPXCT &KCMQXXCT1NFC 5GJTUEJÌPpXQT\ÒINKEJ





)TÌUEJGT-ÌPKIUDGTIIGRT·IVHÒT1UVRTGW­GPWPVGTTWUUKUEJGT$GUCV\WPII$KVMKPXCT &KCMQXXCT1NFC 5GJTUEJÌP





)TÌUEJGT/QUMCW4QVGT/ÒP\JQHIGRT·IVHÒT1UVRTGW­GPWPVGTTWUUKUEJGT$GUCV\WPII $KVMKP 4 &KCMQX 4 1NF 5GJTUEJÌP





)TÌUEJGT/QUMCW4QVGT/ÒP\JQHIGRT·IVHÒT1UVRTGW­GPWPVGTTWUUKUEJGT$GUCV\WPII $KVMKP 4 &KCMQX 4 1NF (CUVUGJTUEJÌP



8191

/GFCKNNGPFGT<CTKP'NKUCDGVJ 

48

5KNDGTOGFCKNNGWPUKIPKGTV XGTOWVNKEJUR·VGTG2T·IWPIFGU,CJTJWPFGTVU CWHFGP(TKGFGPXQP ’DQ HKPPKUEJ 6WTMW  OKV FGP 5EJYGFGP )GMTÌPVGU $TWUVDKNF T OKV WOIGNGIVGO /CPVGN.CPFUEJCHV   OKV FGO (NW­ -KOKU\G FCTÒDGT JCNVGP \YGK CWU 9QNMGP MQOOGPFG *·PFG GKPGP -TCP\ FCTKP FGT   IGMTÌPVG TWUUKUEJG &QRRGNCFNGT ÒDGT FGP 9CRRGPUEJKNFGP XQP 5EJYGFGP WPF 5EJNGUYKI  OO   I&KCMQXXCT WPDGMCPPVGT4ÒEMUGKVGPUVGORGN 2CZKP0WOOKU  8QPITQ­GT5GNVGPJGKV2TCEJVXQNNG2CVKPCYKP\-TCV\GTXQT\ÒINKEJGU'ZGORNCT 


ELISABETH

8192



5KNDGTOGFCKNNGWPUKIPKGTVCWHFGP(TKGFGPXQP’DQ HKPPKUEJ6WTMW OKVFGP5EJYGFGP)GMTÌP VGU $TWUVDKNF T OKV WOIGNGIVGO /CPVGN.CPFUEJCHV OKV FGO (NW­ -KOKU\G FCTÒDGT JCNVGP \YGK CWU   9QNMGP MQOOGPFG *·PFG GKPGP -TCP\ FCTKP FGT IGMTÌPVG TWUUKUEJG &QRRGNCFNGT ÒDGT FGP 9CRRGP   UEJKNFGPXQP5EJYGFGPWPF5EJNGUYKIOOI&KCMQX 4 2CZKP0WOOKUp  44*GTTNKEJG2CVKPCYKP\4CPFHGJNGTHCUVXQT\ÒINKEJXQT\ÒINKEJ 

8193



5KNDGTOGFCKNNGXQP6+YCPQHH UR·VGTG2T·IWPIWO CWHFKGHKPCP\KGNNG9KGFGTJGTUVGNNWPI FGT 5VCCVUMCUUG )GMTÌPVGU $TWUVDKNF T OKV WOIGNGIVGO /CPVGN&CU CNNGIQTKUEJG 9QJNYQNNGP CNU   YGKDNKEJG )GUVCNV FCTIGUVGNNV \ÒPFGV OKV GKPGT (CEMGN $ÒEJGT WPF 2CRKGTG CPWPFTGKEJVGKPGOXQTKJT MPKGPFGP$CWGTP(TÒEJVGOOI&KCMQX 4  44*ÒDUEJG2CVKPCXQT\ÒINKEJ 

8194



5KNDGTOGFCKNNG  XQP 8 -NKOGPVQX CWH KJTGP 6QF CO  &G\GODGT )GMTÌPVGU $TWUVDKNF T OKV   WOIGNGIVGO/CPVGN&KG<CTKPUEJYGDVCWH9QNMGPWPFFGWVGVOKVFGT4GEJVGPCWHGKP2QUVCOGPVCWH FGOGKP<GRVGTWPFGKPIGMTÌPVGT5EJKNFOKVFGO/QPQITCOOKJTGU0CEJHQNIGTU<CT2GVGT+++NKGIGP ÒDGT FGO *CWRV FGT <CTKP UVTCJNGPFGT 5VGTPGPMTCP\ KO 8QTFGTITWPF T UVGJGP \YGK )GPKGP OKV FGO   TWUUKUEJGP9CRRGPOOI&KCMQX 4   8QPITQ­GT5GNVGPJGKV-N4CPFHGJNGTHCUVXQT\ÒINKEJ  49


PETER III.

8195

<#42'6'4+++ 'KPGPRGTHGMVGTJCNVGPGP#NDGTVWUVCNGT2GVGTUCNU)TQ­JGT\QIXQP4W­NCPFCWUFGT5COONWPI5KGIHTKGF5EJKGTJQTP HKPFGP5KGKP-CVCNQIWPVGT0T 'KP4WDGNFGU4QVGP/ÒP\JQHGUKP/QUMCW 

4WDGN/QUMCW4QVGT/ÒP\JQHI$KVMKP 4 &CX&KCMQX

4(CUVUGJTUEJÌP



8196

1,5:1

1,5:1

5KNDGTOÒP\GPFGT/ÒP\UV·VVG5V2GVGTUDWTI 

4WDGN  5V 2GVGTUDWTI  I )GJCTPKUEJVGU $TWUVDKNF T OKV WOIGNGIVGO /CPVGN)GMTÌPVGT   &QRRGNCFNGTOKV<GRVGTWPF4GKEJUCRHGNKPFGP(·PIGPCWHFGT$TWUV5V)GQTIUUEJKNFWOJGTFKG-GVVG FGU#PFTGCUQTFGPUQDGP-TQPG$KVMKP&CX&KCMQX 4   #VVTCMVKXGU'ZGORNCTOKVJÒDUEJGT2CVKPCXQT\ÒINKEJ 

8197

8198



4WDGN5V2GVGTUDWTII$KVMKP&CX&KCMQX 4   5GJTCVVTCMVKXGU'ZGORNCTOKVJGTTNKEJGT2CVKPCUGJTUEJÌPpXQT\ÒINKEJ



4WDGN5V2GVGTUDWTII$KVMKP&CX&KCMQX 4 

50

5EJÌPpUGJTUEJÌP

 


KATHARINA II.

8199

8200

8201

-WRHGTOÒP\GPFGU<CTGP2GVGT+++ 

-W -QRGMGP  WPDGUVKOOVG /ÒP\UV·VVG  I ªDGTRT·IV CWH GKPGO -W -QRGMGP5VÒEM   XQP'NKUCDGVJ$KVMKP 4 &KCMQXHHXCT 5GJTUEJÌP



-W -QRGMGP  WPDGUVKOOVG /ÒP\UV·VVG  I ªDGTRT·IV CWH GKPGO -W -QRGMGP5VÒEM   XQP'NKUCDGVJ$KVMKP 4 &KCMQX 4  4'VYCU)TÒPURCPHCUVUGJTUEJÌP 



-W-QRGMGPWPDGUVKOOVG/ÒP\UV·VVGIªDGTRT·IVCWHGKPGO-W-QRGMGP5VÒEMXQP 'NKUCDGVJ$KVMKPHH&KCMQXHH (CUVUGJTUEJÌP





8202

1,5:1

1,5:1

<#4+0-#6*#4+0#++ )QNFOÒP\GPFGT/ÒP\UV·VVG5V2GVGTUDWTI 

4WDGN5V2GVGTUDWTII)GMTÌPVGU$TWUVDKNFTOKVWOIGNGIVGO/CPVGN8KGTIGMTÌPVG 9CRRGPKPU-TGW\IGUVGNNVKPFGT/KVVG#FNGTUEJKNFKPFGP9KPMGNPFKGIGVGKNVG,CJTGU\CJN $KVMKPNGKEJVXCT 4 &KCMQXNGKEJVXCT(DC  )1.&4#VVTCMVKXGU'ZGORNCTUGJTUEJÌP

 51


KATHARINA II.

8203

1,5:1



1,5:1

4WDGN5V2GVGTUDWTII)GMTÌPVGU$TWUVDKNFTOKVWOIGNGIVGO/CPVGN8KGTIGMTÌPVG 9CRRGPKPU-TGW\IGUVGNNVKPFGT/KVVG#FNGTUEJKNFKPFGP9KPMGNPFKGIGVGKNVG,CJTGU\CJN $KVMKP 4 &KCMQX 4 (DC )1.&4#VVTCMVKXGU'ZGORNCTHCUVXQT\ÒINKEJ



8204

1,5:1



1,5:1

4WDGN5V2GVGTUDWTII)GMTÌPVGU$TWUVDKNFTOKVWOIGNGIVGO/CPVGN8KGTIGMTÌPVG 9CRRGPKPU-TGW\IGUVGNNVKPFGT/KVVG#FNGTUEJKNFKPFGP9KPMGNPFKGIGVGKNVG,CJTGU\CJN $KVMKP 4 &KCMQX 4 (DC )1.&48QT\ÒINKEJ



8205

1,5:1



52

1,5:1

4WDGN5V2GVGTUDWTII)GMTÌPVGU$TWUVDKNFTOKVWOIGNGIVGO/CPVGN8KGTIGMTÌPVG 9CRRGPKPU-TGW\IGUVGNNVKPFGT/KVVG#FNGTUEJKNFKPFGP9KPMGNPFKGIGVGKNVG,CJTGU\CJN $KVMKP&KCMQX(DD )1.&45GJTCVVTCMVKXGU'ZGORNCTXQT\ÒINKEJp5VGORGNINCP\ 


KATHARINA II.

8206

8207





8207

4WDGN5V2GVGTUDWTII)GMTÌPVGU$TWUVDKNFTOKVWOIGNGIVGO/CPVGN8KGTIGMTÌPVG 9CRRGPKPU-TGW\IGUVGNNVKPFGT/KVVG#FNGTUEJKNFKPFGP9KPMGNPFKGIGVGKNVG,CJTGU\CJN $KVMKP&KCMQX(DD )1.&49KP\4CPFHGJNGTUGJTUEJÌP



4WDGN5V2GVGTUDWTII$KVMKP 4 &KCMQX 4 (DC )1.&45GJTUEJÌP



8208 1,5:1

1,5:1



4WDGN5V2GVGTUDWTII$KVMKP 4 &KCMQX 4 (DD  )1.&5GNVGPDGUQPFGTUKPFKGUGT'TJCNVWPI8QT\ÒINKEJ



8210

8209 1,5:1



4WDGN5V2GVGTUDWTII$KVMKP 4 &KCMQX 4 (D  )1.&45GJTUEJÌP





4WDGN5V2GVGTUDWTII$KVMKP 4 &KCMQX(D  )1.&49KP\5EJTÌVNKPIUHGJNGTUGJTUEJÌP



8212

8213

8211

8211

5KNDGTOÒP\GPFGU4QVGP/ÒP\JQHGUKP/QUMCW 

4WDGN/QUMCW4QVGT/ÒP\JQHI$KVMKP&CX&KCMQX  *GTTNKEJG2CVKPCXQT\ÒINKEJ





4WDGN 2QNWRQNVKPPKM /QUMCW4QVGT/ÒP\JQHI$KVMKP&KCMQX

5GJTUEJÌP





-QRGMGP/QUMCW4QVGT/ÒP\JQHI$KVMKP&KCMQX  9KP\5EJTÌVNKPIUHGJNGTXQT\ÒINKEJ

 53


KATHARINA II.

8214

8215



8215

-QRGMGP )TKXGPPKM /QUMCW4QVGT/ÒP\JQHI$KVMKP&KCMQX

5GJTUEJÌP



4WDGN5V2GVGTUDWTII$KVMKP&CX&KCMQX  9KP\5EJTÌVNKPIUHGJNGTCO4CPFXQT\ÒINKEJ



5KNDGTOÒP\GPFGT/ÒP\UV·VVG5V2GVGTUDWTI 

8216

8217

8218



4WDGN5V2GVGTUDWTII$KVMKP&CX&KCMQX

(GKPG2CVKPCXQT\ÒINKEJ





4WDGN5V2GVGTUDWTII$KVMKP&CX&KCMQX  2TCEJVGZGORNCT9KP\5EJTÌVNKPIUHGJNGTHCUV5VGORGNINCP\





4WDGN5V2GVGTUDWTII$KVMKP&CX&KCMQX  *ÒDUEJG2CVKPCUGJTUEJÌPpXQT\ÒINKEJ



8219

8220



4WDGN5V2GVGTUDWTII$KVMKP&CX&KCMQX

(CUVXQT\ÒINKEJ





4WDGN5V2GVGTUDWTII$KVMKP&CX&KCMQX  /KPTCWJG5VGNNGKO(GNFFGT8QTFGTUGKVGXQT\ÒINKEJ5VGORGNINCP\



54


KATHARINA II.

8222

8221



4WDGN5V2GVGTUDWTII$KVMKP&CX&KCMQX  2TCEJVGZGORNCT(GKPG2CVKPCXQT\ÒINKEJp5VGORGNINCP\





4WDGN5V2GVGTUDWTII$KVMKP&CX&KCMQX  #VVTCMVKXGU'ZGORNCTOKVHGKPGT2CVKPCMN2T·IGUEJY·EJGXQT\ÒINKEJ



8223

8224

8225



4WDGN5V2GVGTUDWTII$KVMKP&CX&KCMQX  *ÒDUEJG2CVKPCMN5EJTÌVNKPIUHGJNGTUGJTUEJÌP



4WDGN5V2GVGTUDWTII$KVMKP&CX&KCMQX



4WDGN5V2GVGTUDWTII$KVMKP 4 &CX&KCMQX 4 

8226



 'VYCU)TÒPURCPUGJTUEJÌP

1,5:1

4(CUVUGJTUEJÌP

  

8226

4WDGN  5V 2GVGTUDWTI  I )GMTÌPVGU $TWUVDKNF T OKV WOIGNGIVGO /CPVGN)GMTÌPVGT   &QRRGNCFNGTOKV<GRVGTWPF4GKEJUCRHGNKPFGP(·PIGPCWHFGT$TWUV5V)GQTIUUEJKNFWOJGTFKG-GVVG FGU#PFTGCUQTFGPUQDGP-TQPG$KVMKP&CX&KCMQX 4   W­GTUVUGNVGPKPFKGUGT'TJCNVWPI-CDKPGVVUVÒEMOKVHGKPGT2CVKPC5VGORGNINCP\  55


KATHARINA II.

8228

8227



4WDGN 2QNVKPC 5V2GVGTUDWTII$KVMKP&KCMQX 4  4<CRQPKGTVUGJTUEJÌP





4WDGN 2QNVKPC 5V2GVGTUDWTII$KVMKP&KCMQX 4   W­GTUVUGNVGPKPFKGUGT'TJCNVWPI-CDKPGVVUVÒEMOKVHGKPGT2CVKPC(CUV5VGORGNINCP\



8229

8230



4WDGN 2QNVKPC 5V2GVGTUDWTII$KVMKP&KCMQX 4   5GJTUGNVGPKPFKGUGT'TJCNVWPI2TCEJVGZGORNCTOKVHGKPGT2CVKPC8QT\ÒINKEJp5VGORGNINCP\





4WDGN 2QNVKPC 5V2GVGTUDWTII$KVMKP 4 &KCMQX 4   44*ÒDUEJG2CVKPCMN-TCV\GTKO(GNFFGT4ÒEMUGKVGUGJTUEJÌPpXQT\ÒINKEJ



8231

1,5:1

1,5:1



 4WDGN 2QNVKPC   5V 2GVGTUDWTI  I )GMTÌPVGU $TWUVDKNF T OKV WOIGNGIVGO /CPVGN   )GMTÌPVGT &QRRGNCFNGT OKV <GRVGT WPF 4GKEJUCRHGN KP FGP (·PIGP CWH FGT $TWUV 5V )GQTIUUEJKNF   WOJGTFKG-GVVGFGU#PFTGCUQTFGPUQDGP-TQPG$KVMKP 4 &KCMQX 4   W­GTUVUGNVGPKPFKGUGT'TJCNVWPI2TCEJVGZGORNCT*GTTNKEJG2CVKPCHCUV5VGORGNINCP\ 

8232

8233



-QRGMGP5V2GVGTUDWTII$KVMKP&KCMQX

5GJTUEJÌP





-QRGMGP5V2GVGTUDWTII$KVMKP 4 &KCMQX 4   4*GTTNKEJG2CVKPCMN-TCV\GTHCUV5VGORGNINCP\



56


KATHARINA II.

8234

1,5:1



1,5:1

-QRGMGP5V2GVGTUDWTII$KVMKP&KCMQX 4   *GTTNKEJG2CVKPC-TCV\GTKO(GNFFGT8QTFGTUGKVGHCUV5VGORGNINCP\



8235

1,5:1

1,5:1



-QRGMGP )TKXGPPKM 5V2GVGTUDWTII$KVMKP&KCMQX

8236

8237

(CUV5VGORGNINCP\



8238

-WRHGTOÒP\GPFGT<CTKP-CVJCTKPC++ 

-W -QRGMGP  5V 2GVGTUDWTI  I ªDGTRT·IV CWH GKPGO -W -QRGMGP5VÒEM XQP 2GVGT   +++$KVMKP 4 &KCMQX 5GJTUEJÌP



-W-QRGMGP'MCVGTKPDWTII8GTRT·IWPI$KVMKP\W&KCMQX\W  +PVGTGUUCPVG8GTRT·IWPI5GJTUEJÌP





-W-QRGMGPQ,  'MCVGTKPDWTII8GTRT·IWPI4ÒEMUGKVGKPMWUG8QTFGTUGKVG $KVMKP\WHH&KCMQX\W +PVGTGUUCPVG8GTRT·IWPI5GJTUEJÌP





57


KATHARINA II.

8239



-W-QRGMGP'MCVGTKPDWTII8GTRT·IWPI$KVMKP\W&KCMQX\W  +PVGTGUUCPVG8GTRT·IWPI5GJTUEJÌP



-W-QRGMGP'MCVGTKPDWTIIWPFI$KVMKP Z &KCMQX Z   5VÒEM5GJTUEJÌP



&KG<WYGKUWPI\WT/ÒP\UV·VVG'MCVGTKPDWTIKUVPKEJVIGUKEJGTV



8242

8241



-W&GPIC! CD 'MCVGTKPDWTII8GTRT·IWPI$KVMKP\WHH&KCMQX\W  +PVGTGUUCPVG8GTRT·IWPI(CUVUGJTUEJÌP





-W&GPIC'MCVGTKPDWTII$KVMKP&KCMQX

(CUVXQT\ÒINKEJ



445GJTUEJÌP



-W2QNWUEJMC5W\WP -QN[XCP I$KVMKP 4 &KCMQX 4   44'VYCUTCWJUGJTUEJÌP



1,5:1



1,5:1

-W2QNWUEJMC'MCVGTKPDWTII$KVMKP 4 &KCMQX 4 

1,5:1



8243

8244

1,5:1

8245

 58

-W-QRGMGP#PPKPUMQ[GI$KVMKP&KCMQX

8QT\ÒINKEJ




KATHARINA II.

8246

'KP0QXQFGNFGU5GUVTQTGVUM4WDGNUFGT<CTKP-CVJCTKPC++ 

-W4WDGN5GUVTQTGVUM0QXQFGNI5QIGPCPPVGT5GUVTQTGVUM4WDGN)GMTÌPVGT&QRRGN CFNGT OKV <GRVGT WPF 4GKEJUCRHGN KP FGP (·PIGP CWH FGT $TWUV 5EJKNF OKV FGT ,CJTGU\CJN  QDGP   -TQPG WOJGT .QTDGGTMTCP\9GTVCPICDG KP \YGK <GKNGP QDGP -TQPG WOJGT .QTDGGTMTCP\ /KV   4CPFUEJTKHV$KVMKP* 4  8QPITÌ­VGT5GNVGPJGKV(CUVXQT\ÒINKEJ  /KV'ZRGTVKUGFGU5YGFKUJEQOOKVVGGCICKPUVEQKPHQTIGTKGUCDIG\GKEJPGVCOXQP$($TGMMG





&KGUG KORQUCPVG -WRHGTOÒP\G FKG OGJT CNU GKP -KNQITCOO YKGIV JCV KJTGP 7TURTWPI KP GKPGO /ÒP\IGUGV\ FGT   <CTKP-CVJCTKPC++XQP'UUQNNVGP-WRHGTTWDGNJGTIGUVGNNVYGTFGP\WT'KPNÌUWPIFGTKPFGP,CJTGPDKU  CWUIGIGDGPGP 2CRKGTIGNFGU &KGUG 2CRKGT#UUKIPCVGP FKG HÒT FGP 5VCCV GKPGP \KPUNQUGP -TGFKV DGFGWVGVGP   UQNNVGPFKGMCRKVCNKPVGPUKXG-TKGIUHÒJTWPIFGTUVTGKVDCTGP<CTKPHKPCP\KGTGP+PUIGUCOVYWTFGKPFTGK,CJTGP2CRKGT IGNFHÒTGKPGP0GPPYGTVXQPOGJTCNUGKPGT/KNNKQP4WDGNGOKVVKGTV&KG5EJGKPGYCTGPCWUUEJNKG­NKEJGKPNÌUDCTKP -WRHGTOÒP\GPFKGFGUJCNDKPGKPGTITQ­GP5WOOGDGTGKVIGUVGNNVYGTFGPOW­VGP'UGTUEJKGPFGP$GCOVGPGKPGT UGKVUIÒPUVKIGTGKPGGKP\KIGUEJYGTG4WDGN-WRHGTOÒP\G\WRTQFW\KGTGPCNU5VÒEMFGUFCOCNUITÌ­VGP-WRHGT PQOKPCNU \W  -QRGMGP #PFGTGTUGKVU JQHHVG OCP YQJN CWEJ FC­ FCU 2WDNKMWO YGIGP FGU WPRTCMVKUEJGP (QTOCVU   WPF)GYKEJVUFGTPGWGP-WRHGTTWDGNYGPKIGT)GDTCWEJXQPFGT'KPNÌUWPIUOÌINKEJMGKVFGT5EJGKPGOCEJGPYÒTFG 

&KG*GTUVGNNWPIFKGKPFGTPCJG5V2GVGTUDWTIIGNGIGPGP9CHHGPHCDTKMXQP5GUVTQTGVUMUVCVVHKPFGPUQNNVGUVGNNVGUKEJ LGFQEJPCEJMWT\GT<GKVCNUWPOÌINKEJJGTCWU&KG5EJTÌVNKPIGUQNNVGPCWUITQ­GP-WRHGT\CKPGPOCUEJKPGNNJGTCWU IGU·IVYGTFGP'KPGGKIGPU\WFKGUGO<YGEMMQPUVTWKGTVG/CUEJKPGJCVVG5·IGPFKGLGYGKNUOKV9CUUGTIGMÒJNV YGTFGPOW­VGP$GTGKVUDGKFGPGTUVGP8GTUWEJGPYCTGPFKG5·IGPVTQV\-ÒJNWPIUQÒDGTJKV\VFC­FKG5EJTÌVNKPIG WPOÌINKEJG(QTOGPCWHYKGUGP#WEJCPFGTG/GVJQFGPUEJNWIGPHGJNQFGTGTYKGUGPUKEJCNUYGUGPVNKEJVGWTGTCNUFKG 2TQFWMVKQP GKPGT GPVURTGEJGPFGP /GPIG XQP (ÒPHMQRGMGPUVÒEMGP 0CEJ CEJV ,CJTGP OKV FKXGTUGP 'ZRGTKOGPVGP   YWTFGFCU2TQLGMVCWHIGIGDGPWPFFKG5VGORGNCPFKG/ÒP\UV·VVG5V2GVGTUDWTICDIGIGDGP1HHGPDCTYWTFGPPWT FTGK2TQDGP 1TKIKPCNG CPFGPTWUUKUEJGP5GPCVCDIGNKGHGTVXQPFGPGPUKEJJGWVGGKPGKPFGT'TGOKVCIGDGHKPFGV  

+O,CJTYKGUFGTTWUUKUEJG(KPCP\OKPKUVGT-CPMJTKPFKG/ÒP\UV·VVG5V2GVGTUDWTICPXQPFGP1TKIKPCNUVGO RGNP FGU XQP FGP ITQ­GP 5COONGTP FGU  ,CJTJWPFGTVU DGTGKVU UGJT DGIGJTVGP 5GUVTQTGVUM-WRHGTTWDGNU GKPKIG   0QXQFGNU CP\WHGTVKIGP &C FGT 4KPI OKV FGT 4CPFUEJTKHV XGTNQTGP IGICPIGP YCT YWTFG DGUEJNQUUGP \YGK PGWG   4KPIGJGT\WUVGNNGP0CEJFGP(QTUEJWPIGPXQP$GTPJCTF($TGMMGCWHFGPGPFKGUG#WUHÒJTWPIGPDGTWJGPYWTFGP \YKUEJGP  WPF  KPUIGUCOV  DKU  0QXQFGNU FGU UEJYGTGP -WRHGTTWDGNU JGTIGUVGNNV +P 2TKXCVDGUKV\   YCTGP $TGMMG NGFKINKEJ  'ZGORNCTG DGMCPPV 9KT HTGWGP WPU +JPGP GKPG FGT DGTÒJOVGUVGP TWUUKUEJGP 4CTKV·VGP   CPDKGVGP\WMÌPPGPFKGINGKEJ\GKVKI\WFGPKPVGTGUUCPVGUVGP2J·PQOGPGPFGTGWTQR·KUEJGP)GNFIGUEJKEJVG\·JNV

59


KATHARINA II.

8247

8248

8249

-WRHGTRT·IWPIGPHÒT5KDKTKGP 

-W -QRGMGP  5W\WP -QN[XCP  HÒT 5KDKTKGP 0QXQFGN  I $KVMKP *  4    &KCMQX0 4  449KP\-TCV\GTXQT\ÒINKEJ 



-W-QRGMGP5W\WP -QN[XCP HÒT5KDKTKGPI$KVMKP 4 &KCMQX 4   4(CUVUGJTUEJÌP



-W -QRGMGP  !  5W\WP -QN[XCP  HÒT 5KDKTKGP  I 8GTRT·IWPI $KVMKP \W    &KCMQX\W +PVGTGUUCPVG8GTRT·IWPI5GJTUEJÌP 



8250

8251

8251



-W-QRGMGP5W\WP -QN[XCP HÒT5KDKTKGPI$KVMKP&KCMQX  5GJTUEJÌPpXQT\ÒINKEJ





-W-QRGMGP5W\WP -QN[XCP HÒT5KDKTKGPI$KVMKP 4 &KCMQX  48QT\ÒINKEJ



60


KATHARINA II.

8252



-W-QRGMGP5W\WP -QN[XCP HÒT5KDKTKGPI$KVMKP 4 &KCMQX  45GJTUEJÌPpXQT\ÒINKEJ

8254

8253





-W-QRGMGP5W\WP -QN[XCP HÒT5KDKTKGPI$KVMKP&KCMQX

5GJTUEJÌP



'KPG-WRHGTRT·IWPIHÒT/QNFCYKGPWPFFKG9CNCEJGK 

-W2CTC  &GPICU   5CFQIWTC IGRT·IV Y·JTGPF FGT TWUUKUEJGP $GUGV\WPI /QNFCYKGPU WPF FGT   9CNCEJGKY·JTGPFFGUVÒTMKUEJTWUUKUEJGP-TKGIGUJGTIGUVGNNVCWU-CPQPGPDTQP\GI8GTRT·IWPI 4ÒEMUGKVGKPMWUG8QTFGTUGKVG$KVMKP\W&KCMQX\W +PVGTGUUCPVG8GTRT·IWPI5GJTUEJÌP



9·JTGPF FGU TWUUKUEJVÒTMKUEJGP -TKGIGU  XGTFT·PIVGP FKG TWUUKUEJGP 5VTGKVMT·HVG FKG 6ÒTMGP CWU FGO   OQNFCYKUEJGP)GDKGVWPFFGT9CNCEJGK(ÒTFKGPWPGTHQTFGTNKEJG/ÒP\RT·IWPIXGTYGPFGVGOCPFCU/GVCNNGTDGW VGVGTVÒTMKUEJGT)GUEJÒV\G

8255

'KP-WRHGT-QRGMGP5VÒEMFGTUEJYGFKUEJGP/ÒP\UV·VVG#XGUVC 

-W -QRGMGP  5EJYGFKUEJG 2T·IWPI CWU FGT /ÒP\UV·VVG #XGUVC  I #JNUVTÌO  C   $KVMKP 4 &KCMQX 4 5/* 445GJTUEJÌP  $GK FGO XQTNKGIGPFGP UGJT UGNVGPGP -WRHGTUVÒEM JCPFGNV GU UKEJ WO GKPG UEJYGFKUEJG -TKGIURT·IWPI CWU FGO   TWUUKUEJUEJYGFKUEJGP -TKGI XQP  )WUVCX +++ NKG­ KP UGKPGT /ÒP\UV·VVG #XGUVC  -QRGMGP5VÒEMG JGT   UVGNNGPOKVFGPGPUGKPG6TWRRGPKPFGP)TGP\TGIKQPGPTWUUKUEJG#TDGKVGTDG\CJNGPMQPPVGP&CDGKDGJCWRVGVGPFKG 5EJYGFGPFCUUUKGFKG-WRHGTOÒP\GPXQPTWUUKUEJGP5EJKHHGPGTDGWVGVJ·VVGP6CVU·EJNKEJYCTGPFKGUEJYGFKUEJGP  -QRGMGP5VÒEMG HÒT FCU CNNIGOGKPG 2WDNKMWO MCWO XQP FGP TWUUKUEJGP \W WPVGTUEJGKFGP 8GTINGKEJV OCP FKG   TWUUKUEJGP OKV FGP UEJYGFKUEJGP 2T·IWPIGP UQ H·NNV LGFQEJ UQHQTV FGT IGTCFG CWHTGEJVG 5VKN FGT <KHHGTP DGK FGP   2T·IWPIGPCWU#XGUVCCWH#NNGUEJYGFKUEJGP-QRGMGP5VÒEMGYWTFGPKP#XGUVCJGTIGUVGNNV&COKVUKGKO TWUUKUEJGP <CJNWPIUXGTMGJT PKEJV UQHQTV CWHHKGNGP RT·IVG OCP FKG 5VÒEMG OKV XGTUEJKGFGPGP ,CJTGU\CJNGP       &KGUG -TKGIURT·IWPI IGJÌTV \W FGP IGNFIGUEJKEJVNKEJ DGUQPFGTU KPVGTGUUCPVGP 'TUEJGKPWPIGP WPF \W   FGPIGUWEJVGP5GNVGPJGKVGPFGTTWUUKUEJGPWPFUEJYGFKUEJGP0WOKUOCVKM

61


KATHARINA II.

8256

8GTFKGPUVOGFCKNNGPFGT<CTKP-CVJCTKPC++ 

5KNDGTOGFCKNNGQ, WO XQP,$)CUU2T·OKGFGT.KDGTCNGP¤MQPQOKUEJGP)GUGNNUEJCHVXGT NKGJGP HÒT 8GTFKGPUVG WO FKG .CPFYKTVUEJCHV )GMTÌPVGU $TWUVDKNF T OKV WOIGNGIVGO /CPVGN%GTGU   UKV\V X X CWH )GVTGKFGICTDGP XQT GKPGO 2CNODCWO KP FGT GTJQDGPGP 4GEJVGP -TCP\ KO NKPMGP #TO   %CFWEGWUKO*KPVGTITWPFNGKPRHNÒIGPFGT$CWGTOOI&KCMQX 4   44*GTTNKEJG2CVKPCYKP\4CPFHGJNGTUGJTUEJÌPpXQT\ÒINKEJ 

8257



62

5KNDGTOGFCKNNG Q , WO   XQP # -NGRKMQY WPF / -WEJMKP PCEJ FGT 8QTNCIG XQP , $ )CUU   2T·OKG FGT .KDGTCNGP ¤MQPQOKUEJGP )GUGNNUEJCHV XGTNKGJGP HÒT 8GTFKGPUVG WO FKG .CPFYKTVUEJCHV   )GMTÌPVGU $TWUVDKNF T OKV WOIGNGIVGO /CPVGN%GTGU UKV\V X X CWH )GVTGKFGICTDGP XQT GKPGO 2CNO   DCWO KP FGT GTJQDGPGP 4GEJVGP -TCP\ KO NKPMGP #TO %CFWEGWU KO *KPVGTITWPF N GKP RHNÒIGPFGT   $CWGTOOI&KCMQX 4  44*GTTNKEJG2CVKPCXQT\ÒINKEJ 


KATHARINA II.

8258



5KNDGTOGFCKNNG Q , WO   XQP # -NGRKMQY WPF / -WEJMKP PCEJ FGT 8QTNCIG XQP , $ )CUU   2T·OKG FGT .KDGTCNGP ¤MQPQOKUEJGP )GUGNNUEJCHV XGTNKGJGP HÒT 8GTFKGPUVG WO FKG .CPFYKTVUEJCHV   )GMTÌPVGU $TWUVDKNF T OKV WOIGNGIVGO /CPVGN%GTGU UKV\V X X CWH )GVTGKFGICTDGP XQT GKPGO 2CNO   DCWO KP FGT GTJQDGPGP 4GEJVGP -TCP\ KO NKPMGP #TO %CFWEGWU KO *KPVGTITWPF N GKP RHNÒIGPFGT   $CWGTOOI&KCMQX 4   449KP\4CPFHGJNGTYKP\&TWEMUVGNNGCVVTCMVKXGUXQT\ÒINKEJGU'ZGORNCT 

8259

/GFCKNNGPFGT<CTKP-CVJCTKPC++ 

<KPPOGFCKNNG  XQP , $ )CUU CWH FKG 5VKHVWPI FGU 5V )GQTIUQTFGPU )GJCTPKUEJVGU $TWUVDKNF   -CVJCTKPCU CNU RGTUQPKHK\KGTVG /KPGTXC N OKV (GFGTJGNO WPF WOIGNGIVGO /CPVGN5VTCJNGPFGT 1TFGP   WOJGT1TFGPUDCPFOKV.QTDGGT\YGKIGPOOI&KCMQX -N(NGEMGPXQT\ÒINKEJ



63


KATHARINA II.

8260



5KNDGTOGFCKNNG  XQP 5 ,WFKP WPF , % ) ,CGIGT UR·VGTG 2T·IWPI WO   CWH FCU L·JTKIG   ,WDKN·WOFGT#MCFGOKGFGT9KUUGPUEJCHVGP)GMTÌPVGU$TWUVDKNFTOKV.QTDGGTMTCP\WPFWOIGNGIVGO /CPVGN'PIGN UEJYGDV X X CWH 9QNMGP WPF DGMT·P\V GKPGP 5EJKNF OKV FGO /QPQITCOO -CVJCTKPCU   ++ FGT CP GKPGT 5·WNG NGJPV CP FGTGP 5QEMGN KUV FCU/QPQITCOO2GVGTU+CPIGDTCEJVTUVGJGPFTGK -KPFGTFKGFGO'PIGNYGKVGTG$NWOGPHÒTFGP-TCP\CPTGKEJGPXQTKJPGPDGHKPFGPUKEJ#VVTKDWVGFGT 9KUUGPUEJCHVGPOOI&KCMQX 4   8QPITQ­GT5GNVGPJGKV*GTTNKEJG2CVKPCXQT\ÒINKEJ 

8261



5KNDGTOGFCKNNG  XQP # XCP $CGTNN CWH FKG -QPXGPVKQP ÒDGT DGYCHHPGVG 5GGPGWVTCNKV·V \YKUEJGP   4W­NCPF5EJYGFGP&·PGOCTMWPFFGP0KGFGTNCPFGP\WO5EJWV\FGU5GGJCPFGNUKO5QOOGT'KP IGJCTPKUEJVGT#TOJ·NVGKP5EJYGTVWPFGKPG-GVVGOKVFGOTWUUKUEJGP5EJKNFUQYKGGKPGYGKVGTG-GVVG OKV FGP 5EJKNFGP XQP &·PGOCTM 5EJYGFGP WPF FGP 0KGFGTNCPFGP5VTCJNGPFGU )QVVGUCWIG ÒDGT \GJP   <GKNGPPKGFGTN·PFKUEJGT5EJTKHVOOI&KCMQX 4   4/KPIGYGNNVXQT\ÒINKEJGU'ZGORNCTOKVHGKPGT6ÌPWPI



8262



5KNDGTOGFCKNNGXQP,$)CUUCWHFKG'TTKEJVWPIFGT4GKVGTUVCVWG2GVGTU+CWHFGO5V2GVGTUDWT IGT&GMCDTKUVGPRNCV\CO#WIWUV$TWUVDKNFNOKV.QTDGGTMTCP\WOIGNGIVGO/CPVGNWPF#PFTGCUQT FGP#PUKEJVFGT4GKVGTUVCVWGCWHGKPGO(GNUGPOOI&KCMQX 4   44#VVTCMVKXGU'ZGORNCTOKVJÒDUEJGT2CVKPCUGJTUEJÌPpXQT\ÒINKEJ ,CJTGPCEJUGKPGT6JTQPDGUVGKIWPINKG­<CTKP-CVJCTKPC++HÒT<CT2GVGT+FGP)TQ­GPCWHFGO5V2GVGTUDWT IGT &GMCDTKUVGPRNCV\GKP6QPPGPUEJYGTGU&GPMOCNCWHGKPGO(GNUDNQEMGTTKEJVGPHÒTFCUFGTHTCP\ÌUKUEJG $KNFJCWGT 'VKGPPG/CWTKEG (CNEQPGV \YÌNH ,CJTG DGPÌVKIVG &CU/QPWOGPV\GKIVFGP<CTGP\W2HGTFFCUOKVFGP *KPVGTJWHGP GKPG 5EJNCPIG FKG (GKPFG FGU <CTGP KPUDGUQPFGTG 5EJYGFGP  \GTVTKVV *GWVG \·JNV FCU &GPMOCN FCU   #NGZCPFGT 2WUEJMKP CNU 'JGTPGT 4GKVGT FWTEJ FCU ÒDGTHNWVGVG 5V 2GVGTUDWTI TGKVGPNKG­\WFGPDGFGWVGPFGP5G JGPUYÒTFKIMGKVGPFGT5VCFV

64




KATHARINA II.

8263

8264





-NKRRGPHÌTOKIG5KNDGTOGFCKNNGWPUKIPKGTV2T·UGP\\GKEJGPFGT-CKUGTNKEJGP#MCFGOKGFGT9KUUGP UEJCHVGP 5VTCJNGPFGU /QPQITCOO KP \YGK \WUCOOGPIGDWPFGPGP .QTDGGT\YGKIGP$WEJ CWH 5QEMGN   FCTCWH'WNGCWH)NQDWUXQTFGO)NQDWU%CFWEGWU5EJNÒUUGNWPF.GKGTZOOI &KCMQX 4  4*ÒDUEJG2CVKPCHGKPGT5VGORGNHGJNGTHCUVXQT\ÒINKEJ



5KNDGTOGFCKNNGQ,  XQP,#DTCJCOCWHFKG'KPPCJOGXQP1VEJCMQX$TWUVDKNFFGUTWUUKUEJGP (GNFOCTUEJCNNU )TGIQT #NGZCPFTQYKVUEJ 2QVGOMKP T OKV .QTDGGTMTCP\ WPF WOIGNGIVGO /CPVGN#P   UKEJVFGT(GUVWPIÒDGTFGOOKVVNGTGP6WTOYGJVFKG(CJPGOKVFGO/QPQITCOOFGT<CTKPOO I&KCMQX 4 *QHHOCPP 445GJTUEJÌP  'ZGORNCTFGT5COONWPI#PVQPKP2TQMQR6GKN#WMVKQP#WTGC0WOKUOCVKMC2TCI0T



8265



5KNDGTOGFCKNNG  XQP 6 +YCPQHH (ÒT 6CRHGTMGKV KP HKPPKUEJGP )GY·UUGTP )GMTÌPVGU $TWUVDKNF T   OKV WOIGNGIVGO /CPVGN5GEJU <GKNGP 5EJTKHV  OO  I $KVMKP /  4  &KCMQX   

4  4*GPMGNURWTHCUVUGJTUEJÌP



8266



5KNDGTOGFCKNNGXQP%.GDGTGEJVWPF5,WFKPCWHFGP(TKGFGPOKVFGT6ÒTMGKCO&G\GODGT )GMTÌPVGU $TWUVDKNF T OKV .QTDGGTMTCP\ WPF WOIGNGIVGO /CPVGN.CPFUEJCHV FCTKP 5QEMGN CP FGO   GKP 9CRRGPUEJKNF WPF GKPG CWHIGTQNNVG .CPFMCTVG NGJPGP FCTCWH .QTDGGT WPF 2CNO\YGKI  OO   I&KCMQXXCT 4FQTVCPFGTG5KIPCVWTFGU/GFCKNNGWTU.GDGTGEJV   8QPITQ­GT5GNVGPJGKV*GTTNKEJG2CVKPCMN4CPFHGJNGTHCUVXQT\ÒINKEJ  65


PAUL I.

8267



5KNDGTOGFCKNNGXQP%.GDGTGEJVWPF5,WFKPCWHFGP(TKGFGPOKVFGT6ÒTMGKCO&G\GODGT )GMTÌPVGU $TWUVDKNF T OKV .QTDGGTMTCP\ WPF WOIGNGIVGO /CPVGN.CPFUEJCHV FCTKP 5QEMGN CP FGO   GKP 9CRRGPUEJKNF WPF GKPG CWHIGTQNNVG .CPFMCTVG NGJPGP FCTCWH .QTDGGT WPF 2CNO\YGKI  OO   I&KCMQXXCT 4FQTVCPFGTG5KIPCVWTFGU/GFCKNNGWTU.GDGTGEJV   8QPITQ­GT5GNVGPJGKV #VVTCMVKXGU'ZGORNCTOKVJÒDUEJGT2CVKPCYKP\4CPFHGJNGTUGJTUEJÌPpXQT\ÒINKEJ 

8268

<#42#7.+ 5KNDGTOÒP\GPFGT/ÒP\UV·VVG5V2GVGTUDWTI 

4WDGN5V2GVGTUDWTII8KGTIGMTÌPVG/QPQITCOOGKPU-TGW\IGUVGNNVKPFGT/KVVGTÌOK UEJG<KHHGT+8GT\KGTVG6CHGNOKVXKGT<GKNGP5EJTKHV$KVMKP 4 &CX  5GJTUGNVGPDGUQPFGTUKPFKGUGT'TJCNVWPI*ÒDUEJG2CVKPCXQT\ÒINKEJ



8269



66

4WDGN5V2GVGTUDWTII8KGTIGMTÌPVG/QPQITCOOGKPU-TGW\IGUVGNNVKPFGT/KVVGTÌOK UEJG<KHHGT+8GT\KGTVG6CHGNOKVXKGT<GKNGP5EJTKHV$KVMKP 4 &CX  44)GTGKPKIVOKPLWUVKGTVYKP\5EJTÌVNKPIUHGJNGTXQT\ÒINKEJ




PAUL I.

8270

1,5:1



-QRGMGP5V2GVGTUDWTII$KVMKP 4   4#VVTCMVKXGUHCUVXQT\ÒINKEJGU'ZGORNCTOKVHGKPGT2CVKPCXQT\ÒINKEJ

8271

  

8272

9KP\)TCHHKVKXQT\ÒINKEJ 5GJTUEJÌP 9KP\4CPFHGJNGTUGJTUEJÌP

8276

8275

4WDGN 2QNWRQNVKPPKM 5V2GVGTUDWTII$KVMKP 4  4WDGN 2QNWRQNVKPPKM 5V2GVGTUDWTII$KVMKP 4  4WDGN 2QNWRQNVKPPKM 5V2GVGTUDWTII$KVMKP 4  4WDGN 2QNWRQNVKPPKM 5V2GVGTUDWTII$KVMKP 4 

8278

8279



8273

4WDGN5V2GVGTUDWTII$KVMKP&CX 4WDGN5V2GVGTUDWTII$KVMKP&CX 4WDGN5V2GVGTUDWTII$KVMKP&CX

8274

   

1,5:1

  

8277

4-N-TCV\GTUGJTUEJÌP 4*GTTNKEJG2CVKPCXQT\ÒINKEJ 4*ÒDUEJG2CVKPCXQT\ÒINKEJ 4<CRQPKGTVUGJTUEJÌP

   

8280



-QRGMGP ,CJTGU\CJNKO5VGORGNCWUIG·PFGTV 5V2GVGTUDWTII$KVMKP  <CRQPKGTVUGJTUEJÌP



 

-QRGMGP5V2GVGTUDWTII$KVMKP -QRGMGP5V2GVGTUDWTII$KVMKP

 

<CRQPKGTVUGJTUEJÌPpXQT\ÒINKEJ 5GJTUEJÌP

67


PAUL I.

8282

8281

8281

-WRHGTOÒP\GPFGU<CTGP2CWN+ 

-W-QRGMGP'MCVGTKPDWTIIªDGTRT·IVKO,CJTKO#WHVTCIXQP<CT2CWN+ $KVMKP 4 &KCMQX 4FQTVWPVGT-CVJCTKPC++  44ªDGTRT·IWPIUURWTGPUGJTUEJÌP



-CVJCTKPC ++ DGUEJNQ­ KP KJTGO NGV\VGP 4GIKGTWPIULCJT  GKPG IGYCNVKIG /ÒP\TGHQTO &KG -WRHGTOÒP\GP \W    -QRGMGPYWTFGPWOCDIGYGTVGVKPFGOUKGOKVPGWGP5VGORGNPOKVFGO9GTV-QRGMGPWPFFGT,CJTGU\CJN ÒDGTRT·IVYWTFGP0CEJFGO6QF-CVJCTKPCUCO0QXGODGTUVQRRVG<CT2CWN+FKGUG#MVKQPWPXGT \ÒINKEJ WPF NKG­ FKG ÒDGTRT·IVGP /ÒP\GP KO ,CJT  YKGFGTWO OKV FGP CNVGP 5VGORGNP WPF FGT WTURTÒPINKEJGP   ,CJTGU\CJN ÒDGTRT·IGP &CU -QRGMGP5VÒEMFCUKPUGKPGO'PVUVGJWPIULCJTHÒTGKPKIG/QPCVG\WGKPGO -QRGMGP5VÒEMIGYQTFGPYCTIGJÌTVUQOKV\WFGPPWOKUOCVKUEJDGUQPFGTUKPVGTGUUCPVGP'TUEJGKPWPIGPFGTTWUUK UEJGP/ÒP\IGUEJKEJVG



-W&GPIC'MCVGTKPDWTII$KVMKP 4 

4-N5EJTÌVNKPIUHGJNGTUGJTUEJÌP



8283

8285



8285

8284

-W&GPIC'MCVGTKPDWTII8GTRT·IWPI$KVMKP\W  +PVGTGUUCPVG8GTRT·IWPI)GNQEJVUGJTUEJÌP





-W2QNWUEJMC'MCVGTKPDWTII$KVMKP

8QT\ÒINKEJ





-W-QRGMGP5W\WP -QN[XCP I$KVMKP

(CUVXQT\ÒINKEJ



&KG<WYGKUWPI\WT/ÒP\UV·VVG'MCVGTKPDWTIKUVPKEJVIGUKEJGTV

8287 8286

8288



-W2QNWUEJMC5W\WP -QN[XCP I$KVMKP 4 

44'VYCUTCWJUGJTUEJÌP





-W2QNWUEJMC5W\WP -QN[XCP I$KVMKP 4 

44'VYCUTCWJUGJTUEJÌP





-W2QNWUEJMC5W\WP -QN[XCP I$KVMKP 4 

445GJTUEJÌPpXQT\ÒINKEJ



68


ALEXANDER I.

8289

8290

/GFCKNNGPFGU<CTGP2CWN+ 



5KNDGTOGFCKNNG Q ,   WPUKIPKGTV 2T·OKG FGT -CKUGTNKEJGP #MCFGOKG FGT 9KUUGPUEJCHVGP   )GMTÌPVGU/QPQITCOO$WEJCWH5QEMGNFCTCWH'WNGCWH)NQDWUXQTFGO)NQDWU%CFWEGWU5EJNÒU UGNWPF.GKGTOOI&KCMQX 4  448QT\ÒINKEJGU'ZGORNCTOKVHGKPGT6ÌPWPI



5KNDGTOGFCKNNG  XQP ) )WKNNGOCTF WPF ( 5VWEMJCTFV CWH FKG ,CJTJWPFGTVYGPFG &TGK MNGGDNCVV   HÌTOKI CPIGQTFPGVG /GFCKNNQPU OKV FGP $TWUVDKNFGTP XQP -CVJCTKPC++XQP4W­NCPF(TKGFTKEJ++XQP 2TGW­GP WPF ,QUGRJ ++XQP¤UVGTTGKEJ)GPKWUUVGJVPCEJTWPFGPV\ÒPFGVOKVGKPGT(CEMGNGKP(GWGT CWH GKPGO #NVCT KO #DUEJPKVV FTGK <GKNGP 5EJTKHV WPF ,CJTGU\CJN  OO  I &KCMQX   

4 5VTQVJQVVGp 48QT\ÒINKEJ



8291

2:1

2:1

<#4#.':#0&'4+ <YGK)QNFOÒP\GPFGU<CTGP#NGZCPFGT+ 

4WDGN5V2GVGTUDWTII8KGTIGMTÌPVG9CRRGPKPU-TGW\IGUVGNNVKPFGT/KVVG#FNGTUEJKNF (ÒPH<GKNGP5EJTKHV\WFGP5GKVGP.QTDGGTWPF'KEJGP\YGKIQDGP-TQPG$KVMKP(D5EJN )1.&449KP\4CPFHGJNGTCVVTCMVKXGUUGJTUEJÌPGU'ZGORNCT 

8293



8292

8293

4WDGN5V2GVGTUDWTII$KVMKP(D5EJN

)1.&5GJTUEJÌP



4)GTGKPKIVMN-TCV\GTUGJTUEJÌP



5KNDGTOÒP\GPFGT/ÒP\UV·VVG5V2GVGTUDWTI 

4WDGN 2QNVKPC 5V2GVGTUDWTII$KVMKP 4 

8294

8295



4WDGN 2QNWRQNVKPPKM 5V2GVGTUDWTII$KVMKP 4 

4)GTGKPKIVUGJTUEJÌP





4WDGN 2QNWRQNVKPPKM 5V2GVGTUDWTII$KVMKP 4 

45EJÌPpUGJTUEJÌP

 69


ALEXANDER I.

8296

 

8297

-QRGMGP5V2GVGTUDWTII$KVMKP 4  -QRGMGP5V2GVGTUDWTII$KVMKP 4 

45GJTUEJÌP 45GJTUEJÌP

 

8298

1,5:1



1,5:1

4WDGN5V2GVGTUDWTII$KVMKP 4 &CX

8299 1,5:1



8QPITQ­GT5GNVGPJGKV8QT\ÒINKEJ

1,5:1

-QRGMGP5V2GVGTUDWTII$KVMKP 4   5GNVGPDGUQPFGTUKPFKGUGT'TJCNVWPI8QT\ÒINKEJ

8300

8301





8302

 

4WDGN5V2GVGTUDWTII$KVMKP&CX 4WDGN5V2GVGTUDWTII$KVMKP&CX

8QT\ÒINKEJ *ÒDUEJG2CVKPCMN-TCV\GTXQT\ÒINKEJ

 



4WDGN5V2GVGTUDWTII$KVMKP&CX  9KP\*GPMGNURWT ! YKP\5EJTÌVNKPIUHGJNGTHCUVXQT\ÒINKEJ



70


ALEXANDER I.

8304

8303



4WDGN5V2GVGTUDWTII$KVMKP&CX  9KP\5VGORGNHGJNGTXQT\ÒINKEJp5VGORGNINCP\





4WDGN5V2GVGTUDWTIII$KVMKP&CX



(CUVXQT\ÒINKEJ

8305

 

8306

4WDGN5V2GVGTUDWTII$KVMKP&CX 4WDGN5V2GVGTUDWTII$KVMKP&CX

9KP\-TCV\GTXQT\ÒINKEJp5VGORGNINCP\ *GTTNKEJG2CVKPCUGJTUEJÌPpXQT\ÒINKEJ

 

8309 8308

8307



4WDGN 2QNVKPC 5V2GVGTUDWTII$KVMKP  #VVTCMVKXGU'ZGORNCTOKVHGKPGT2CVKPCXQT\ÒINKEJ



-QRGMGP5V2GVGTUDWTII$KVMKP

(CUVXQT\ÒINKEJ





-QRGMGP5V2GVGTUDWTII$KVMKP  5GNVGPKPFKGUGT'TJCNVWPI*GTTNKEJG2CVKPCXQT\ÒINKEJ



1,5:1

8310



1,5:1



-QRGMGP5V2GVGTUDWTI/KVINCVVGO4CPFI$KVMKP 4   8QPITQ­GT5GNVGPJGKV*ÒDUEJG2CVKPCUGJTUEJÌP



-QRGMGP5V2GVGTUDWTII$KVMKP

*GTTNKEJG2CVKPCXQT\ÒINKEJ





-QRGMGP5V2GVGTUDWTII$KVMKP  5GJTUGNVGPKPFKGUGT'TJCNVWPI2TCEJVGZGORNCT*GTTNKEJG2CVKPC5VGORGNINCP\





-QRGMGP5V2GVGTUDWTII$KVMKP  2TCEJVGZGORNCT*GTTNKEJG2CVKPCXQT\ÒINKEJp5VGORGNINCP\





 -QRGMGP  5V 2GVGTUDWTI +P 752NCUVKMJQNFGT FGT +%) OKV FGT $GYGTVWPI #7 $KVMKP (CUVXQT\ÒINKEJ

8311

8312



8313

 71


ALEXANDER I.

8315

8316

8317

-WRHGTOÒP\GPFGU<CTGP#NGZCPFGT+ 

-W-QRGMGP'MCVGTKPDWTII$KVMKP

&WPMNG2CVKPCXQT\ÒINKEJp5VGORGNINCP\





-W-QRGMGP'MCVGTKPDWTII$KVMKP  5GNVGPKPFKGUGT'TJCNVWPI2TCEJVGZGORNCT(CUV5VGORGNINCP\





-W-QRGMGP'MCVGTKPDWTII$KVMKP

8319

8318

9KP\5EJTÌVNKPIUHGJNGTXQT\ÒINKEJ



8320



-W-QRGMGP'MCVGTKPDWTII$KVMKP

8QT\ÒINKEJ





-W-QRGMGP'MCVGTKPDWTII$KVMKP

5GJTUEJÌPpXQT\ÒINKEJ





-W-QRGMGP'MCVGTKPDWTII$KVMKP

-N4CPFHGJNGTUGJTUEJÌPpXQT\ÒINKEJ



72


ALEXANDER I.

8321

8323

8322

8324



-W-QRGMGP'MCVGTKPDWTII$KVMKP

(CUVXQT\ÒINKEJ





-W-QRGMGP'MCVGTKPDWTII$KVMKP

5GJTUEJÌP





-W-QRGMGP'MCVGTKPDWTII$KVMKP

*ÒDUEJG2CVKPCXQT\ÒINKEJ





-W-QRGMGP'MCVGTKPDWTII8GTRT·IWPI$KVMKP\W  +PVGTGUUCPVG8GTRT·IWPI(CUVUGJTUEJÌP



8326

8325

8325



-W-QRGMGP5W\WP -QN[XCP I$KVMKP  #VVTCMVKXGU'ZGORNCTUGJTUEJÌPpXQT\ÒINKEJ



-W&GPIC5W\WP -QN[XCP I$KVMKP 4 

 44'VYCUTCWJMN4CPFHGJNGTUGJTUEJÌP

 

8328

8327

8329



-W-QRGMG5W\WP -QN[XCP I$KVMKP

8QT\ÒINKEJ





-W&GPIC5W\WP -QN[XCP 0QXQFGNI$KVMKP* 4   449KP\-TCV\GTHCUV5VGORGNINCP\





-W-QRGMG+\JQTCI$KVMKP

8QT\ÒINKEJ

 73


ALEXANDER I.

8330

1,5:1

1,5:1



-W-QRGMGP'MCVGTKPDWTI2TQDGOKVINCVVGO4CPFI$KVMKP 4   8QPITÌ­VGT5GNVGPJGKV(CUV5VGORGNINCP\



8331 8332



8333

-W&GPIC'MCVGTKPDWTI2TQDGOKVIGTKHHGNVGO4CPFI$KVMKP 4   8QPITÌ­VGT5GNVGPJGKV#VVTCMVKXGU'ZGORNCTUGJTUEJÌP



2T·IWPIGPHÒT)GQTIKGP 

#DC\K -QRGMGP 6KHNKUHÒT)GQTIKGPI$KVMKP

5GJTUEJÌP





-W2WNK $KUVK 6KHNKUHÒT)GQTIKGPI$KVMKP 4   44.GKEJVG-QTTQUKQPUURWTGPUGJTUEJÌP



8334 1,5:1

1,5:1

2T·IWPIGPHÒT2QNGP 

<NQV[EJ9CTUEJCWHÒT2QNGPI$KVMKP 4 (D FQTVWPVGT2QNGP 5EJN FQTV WPVGT2QNGP  )1.&4#VVTCMVKXGU'ZGORNCTUGJTUEJÌPUGJTUEJÌPpXQT\ÒINKEJ

1,5:1

 74

8335



1,5:1

<NQV[EJ9CTUEJCWHÒT2QNGPI$KVMKP 4 (D FQTVWPVGT2QNGP 5EJN FQTV WPVGT2QNGP  )1.&4#VVTCMVKXGUHCUVXQT\ÒINKEJGU'ZGORNCT




ALEXANDER I.

8336

8338

8337

8339



<NQV[EJ9CTUEJCWHÒT2QNGPI$KVMKP

5GJTUEJÌPpXQT\ÒINKEJ





<NQVG9CTUEJCWHÒT2QNGPI$KVMKP  (GKPG2CVKPCOKP5EJTÌVNKPIUHGJNGTUGJTUEJÌP





<NQV[9CTUEJCWHÒT2QNGPI$KVMKP

(GKPG2CVKPCUGJTUEJÌPpXQT\ÒINKEJ





<NQV[9CTUEJCWHÒT2QNGPI$KVMKP

45GJTUEJÌPXQT\ÒINKEJ



1,5:1

8340

1,5:1

'KPG2TQDGRT·IWPIFGT/ÒP\RT·IGOCUEJKPGXQP+XCP0GXGFQOUM[ 

-W,GVQP\W-QRGMGP5V2GVGTUDWTII8GTUWEJURT·IWPIFGTCWVQOCVKUEJGP/ÒP\RT·IG OCUEJKPGXQP+XCP0GXGFQOUM[$KVMKP 4  8QPITQ­GT5GNVGPJGKV5GJTUEJÌPpXQT\ÒINKEJ



8342

8341

8341

/GFCKNNGPFGU<CTGP#NGZCPFGT+ 



5KNDGTOGFCKNNG  XQP # #DTCOUQP CWH UGKPGP 4GIKGTWPIUCPVTKVV CO  /·T\ PCEJ ITGIQTKCPK   UEJGO-CNGPFGTCO/·T\ 7PKHQTOKGTVGU$TWUVDKNFT*GTMWNGUOKV.ÌYGPHGNNWPF4WFGTUVGJVX X WPF NGIV UGKPGP #TO WO FKG 5EJWNVGT FGT PGDGP KJO UVGJGPFGP /KPGTXC FKG GKPG .CP\G WPF GKPGP   5EJKNFOKVFGO/QPQITCOO-CVJCTKPCU++J·NVOOI&KCMQX*QHHOCPP  4*GTTNKEJG2CVKPCMN-TCV\GTXQT\ÒINKEJ



5KNDGTOGFCKNNG ,CJT  XQP 2 , 6KQNKGT CWH FGP (TKGFGP WPF FKG (TGWPFUEJCHV OKV (TCPMTGKEJ   5GEJU <GKNGP 5EJTKHV WPVGT FGO #DUEJPKVVUDCNMGP &CVWO WPF /GFCKNNGWTUUKIPCVWT&GT ICNNKUEJG *CJP   UVGJVCWHGKPGT5CPFWJTWOJGT.QTDGGT\YGKIGKO*KPVGTITWPF5VTCJNGPOOI&KCMQXp

\WFQTVOKV5EJNCPIGPTKPICWHFGT4ÒEMUGKVG 5NI,WNKWU  448QT\ÒINKEJGU'ZGORNCTOKVHGKPGT6ÌPWPI  75


ALEXANDER I.

8343



5KNDGTOGFCKNNGXQP%.GDGTGEJVCWHFGP)TCHGP0KMQNCK2GVTQYKVUEJ5EJGTGOGVGYIGUVKHVGVXQO 5GPCVHÒTFKG'TTKEJVWPIGKPGU*QURKVCNUKP/QUMCW7PKHQTOKGTVGU$TWUVDKNFFGU)TCHGPNOKVWOIGNGI VGO1TFGPUDCPF&KGRGTUQPKHK\KGTVG)PCFGOKV2CNO\YGKIUVGJVXXWPFÒDGTTGKEJVGKPGTNUKV\GPFGP /WVVGT FKG KJT -KPF UVKNNV GKP JTGPDÒPFGN T UKV\V GKP ·NVGTGT /CPP OKV -TÒEMUVQEM FGO UKG GKPG   5EJCNG FKG XQP GKPGT 5EJNCPIG WOYWPFGP KUV GPVIGIGPJ·NV KO *KPVGTITWPF #PUKEJV FGU *QURKVCNU   OOI&KCMQX 4 5NI$TGVVCWGTp  8QPITÌ­VGT5GNVGPJGKV(GKPG2CVKPCYKP\-TCV\GTXQT\ÒINKEJGU'ZGORNCT 

8344

8345

8345



5KNDGTOGFCKNNG  XQP % .GDGTGEJV CWH FKG )TÒPFWPI FGT 0GWGP$ÌTUGKP5V2GVGTUDWTI7PKHQT OKGTVGU$TWUVDKNFT#PUKEJVFGTPGWGTDCWVGP$ÌTUGOKVFGO(NW­0GYCKO8QTFGTITWPFOO I&KCMQX 4   8QPITQ­GT5GNVGPJGKV*ÒDUEJG2CVKPCYKP\4CPFHGJNGTMN-TCV\GTHCUVXQT\ÒINKEJ 



5KNDGTOGFCKNNGXQP%.GDGTGEJVWPF%/GKUPGTCWHFKG'TTKEJVWPIFGU&GPMOCNU\WT,CJT HGKGT FGU 5KGIGU DGK 2QNVCYC $ÒUVG 2GVGTU + FGU )TQ­GP T OKV .QTDGGTMTCP\#PUKEJV FGU &GPMOCNU   OOI&KCMQX 4   8QPITQ­GT5GNVGPJGKV*ÒDUEJG2CVKPCYKP\4CPFHGJNGTUGJTUEJÌPpXQT\ÒINKEJ 

76


ALEXANDER I.

8347

8346





'KPUGKVKIG $TQP\GOGFCKNNG  XQP + 5JKNQX 2TQDGCDUEJNCI HÒT GKPG 8GTFKGPUVOGFCKNNG $ÒUVG T   OOI&KCMQXp \W   8QPITQ­GT5GNVGPJGKV-N6WUEJG\KHHGTCWHFGT4ÒEMUGKVGUGJTUEJÌPpXQT\ÒINKEJ



5KNDGTOGFCKNNGXQP%.GDGTGEJVCWHFKGªDGTVTCIWPIXQP2TKXKNGIKGPCPFKGHKPPKUEJG7PKXGTUKV·V ’DQ 6WTMW  $ÒUVG T9GKDNKEJG )GUVCNV UKV\V PCEJ T WPF URKGNV .GKGT FGP TGEJVGP #TO CWH GKPG   9CUUGTWTPG IGNGJPV KO *KPVGTITWPF CWHIGJGPFG 5QPPG T )GD·WFGCPUKEJV FGT 7PKXGTUKV·V XQP ’DQ   OOI&KCMQX 4   44+PFGMQTCVKXGO\GKVIGPÌUUKUEJGP'VWK(GKPG6ÌPWPIYKP\-TCV\GTXQT\ÒINKEJ 

8349

8348





8348

6TCIDCTGU$TQP\G-NGTKMGTMTGW\ XGTNKGJGPCD WPUKIPKGTVHÒT2TKGUVGTFGTTWUUKUEJQTVJQFQ ZGPWPFRTQVGUVCPVKUEJGP-KTEJGFKGY·JTGPFFGURCVTKQVKUEJGP-TKGIGUIGIGP(TCPMTGKEJDKU'PFG KO #OV YCTGP +P FGT /KVVG FGT 8QTFGTUGKVG KUV GKP UVTCJNGPFGU )QVVGUCWIG FCTIGUVGNNV FCTWPVGT   ,CJTGUCPICDG FKG 4ÒEMUGKVG \GKIV XKGT <GKNGP 5EJTKHV WOJGT 5VTCJNGP  Z  OO  I   &KCMQX 4  48QT\ÒINKEJ



<KPPLGVQP  XQP , 6 5VGVVPGT CWH FKG 8ÌNMGTUEJNCEJV DGK .GKR\KI &KG WPKHQTOKGTVGP $TWUVDKNFGT   FGU -CKUGTU (TCP\ + XQP ¤UVGTTGKEJ WPF FGU <CTGP #NGZCPFGT + XQP 4W­NCPF GKPCPFGT IGIGPÒDGT   5VCFVCPUKEJV XQP .GKR\KIKO8QTFGTITWPF5EJNCEJVU\GPGQDGPUEJYGDVFGTIGMTÌPVG#FNGTOKV<GRVGT WPF4GKEJUCRHGNKPFGP(·PIGPOOI&KCMQX  (GKPG6ÌPWPI6WUEJG\KHHGTCWHFGT4ÒEMUGKVGHCUV5VGORGNINCP\

 77


ALEXANDER I.

8350



5KNDGTOGFCKNNG  IGHGTVKIV XQP <CTKP /CTKC (GQFQTQYPC CWH #NGZCPFGT + $ÒUVG FGU <CTGP T OKV   .QTDGGTMTCP\ CO *CNUCDUEJPKVV FKG 5KIPCVWT FGT <CTKP#NVCT OKV \YGK <GKNGP 5EJTKHV CWH FTGK 5VWHGP   CWH FGO #NVCT NKGIGP -TQPG <GRVGT WPF 4GKEJUCRHGN CWH GKPGO -KUUGP CWH FGP 5VWHGP NKGIGP FTGK    KPGKPCPFGT XGTUEJNWPIGPG -T·P\G QDGP )QVVGUCWIG KP UVTCJNGPFGO 4KPI  OO  I   &KCMQXXCT 4 -NGKP4CHH 8QPITQ­GT5GNVGPJGKV*ÒDUEJG2CVKPCUGJTUEJÌP  <CT#NGZCPFGT+2CYNQYKVUEJ  YCTFGT5QJPFGU<CTGP2CWN+  WPFUGKPGT\YGKVGP)GOCJ NKP/CTKC(GQFQTQYPCIGDQTGPG5QRJKC&QTQVJGC#WIWUVC.WKUCXQP9ÒTVVGODGTI5GKPG/WVVGT/CTKCNKGDVGFKG -ÒPUVG WPF OCNVG UGNDUV #SWCTGNNDKNFGT GPVYCTH )GOOGP WPF 5EJOWEMUVÒEMG CWU 'NHGPDGKP FKG UKG IGTPG CP   (TGWPFG WPF )·UVG XGTUEJGPMVG &CTÒDGT JKPCWU KPVGTGUUKGTVG UKG UKEJ HÒT /WUKM .KVGTCVWT WPF )CTVGPDCWMWPUV   #WEJFKGXQTNKGIGPFG/GFCKNNGUVCOOVCWUFGT*CPFFGT<CTKPXQPFGTDGTKEJVGVYKTFUKGJCDGUKEJIGTPGOKVFGO 5EJPGKFGP WPF )TCXKGTGP XQP 'FGNUVGKPGP WPF /GFCKNNGPUVGORGNP DGUEJ·HVKIV XIN -NGKP4CHH &KG 9ÒTVVGODGTIK   UEJGP /GFCKNNGP  5  WPF (QTTGT ++ 5  +++ 5   6TQV\FGO HCPF UKG PQEJ IGPÒIGPF <GKV   UKEJHÒTFGP#WUDCWXQP$KNFWPIUWPF9QJNV·VKIMGKVUGKPTKEJVWPIGPKO<CTGPTGKEJGKP\WUGV\GPCWUFGPGPUR·VGTFCU UQIGPCPPVG4GUUQTVFGT#PUVCNVGPFGT<CTKP/CTKCJGTXQTIKPI

8352

8351





6TCIDCTG 5KNDGTOGFCKNNG  WPUKIPKGTV 4WUUKUEJG /KNKV·TXGTFKGPUVOGFCKNNG CWH FKG 'KPPCJOG XQP   2CTKU $ÒUVG T OKV .QTDGGTMTCP\ FCTÒDGT UVTCJNGPFGU )QVVGUCWIG(ÒPH <GKNGP 5EJTKHV WOJGT .QT   DGGTMTCP\OOI&KCMQX 4FQTVQJPG¤UG 5NI,WNKWU  44*GTTNKEJG2CVKPCXQT\ÒINKEJ



-NGKPGVTCIDCTG5KNDGTOGFCKNNGWPUKIPKGTV4WUUKUEJG/KNKV·TXGTFKGPUVOGFCKNNGCWHFKG'KPPCJOG XQP 2CTKU $ÒUVG T OKV .QTDGGTMTCP\ FCTÒDGT UVTCJNGPFGU )QVVGUCWIG(ÒPH <GKNGP 5EJTKHV WOJGT   .QTDGGTMTCP\OOI&KCMQXp XIN 5NI,WNKWU  8QPITQ­GT5GNVGPJGKV*ÒDUEJG2CVKPCHCUVXQT\ÒINKEJ 

8353



78

5KNDGTOGFCKNNG  XQP 2 , 6KQNKGT (TCP\ÌUKUEJG 2TQDGRT·IWPIGKPGU(TCPE5VÒEMGUIGHGTVKIV\W 'JTGP#NGZCPFGTU+XQP4W­NCPFCWHITWPFUGKPGU-CORHGUIGIGP0CRQN¾QP+/QPQITCOOFGU<CTGP FCTWPVGT 2#4+5 WPF FKG /GFCKNNGWTUUKIPCVWT)NQDWU FCTCWH FTGK .KNKGP  OO  I &KCMQX    4 /C\CTFC 4  4*GPMGNURWTUGJTUEJÌPpXQT\ÒINKEJ




ALEXANDER I.

8354



$TQP\GOGFCKNNGQ, WO OKV5KIPCVWT+/CWHFGP)GPGTCNFGTTWUUKUEJGP#TOGGWPF#VCOCP FGT &QPMQUCMGP )TCH /CVYGL +YCPQYKVUEJ 2NCVQY 7PKHQTOKGTVGU $TWUVDKNF FGU )GPGTCNU N8KGT   <GKNGP5EJTKHVOOI$TCOUGP&KCMQXp5NI,WNKWU  *ÒDUEJG2CVKPCXQT\ÒINKEJ



)TCH/CVYGL+YCPQYKVUEJ2NCVQYYWTFGCO#WIWUV PCEJITGIQTKCPKUEJGO-CNGPFGTCO#WIWUV  CO &QP <WHNW­ FGU #UQYUEJGP /GGTGU  IGDQTGP 2NCVQY FGT CWU GKPHCEJGP 8GTJ·NVPKUUGP UVCOOVG VTCV  KP   FCU-QUCMGPJGGTGKPWPFM·ORHVGIGIGPFKG6ÒTMGP'T\GKEJPGVGUKEJKO4WUUKUEJ¤UVGTTGKEJKUEJGP6ÒTMGP MTKGI ņ DGKFGT'KPPCJOGXQP1VUEJCMQYXQT#MMGTOCPWPF$GPFGTCWU(ÒTUGKPGP/WVDGK FGT'TUVÒTOWPI+UOCLKNUKO,CJTYWTFGGTOKVFGO)GQTIUQTFGPFGMQTKGTVYWTFGGTXQP<CT#NGZCPFGT +\WO)GPGTCNNGWVPCPVWPF#VCOCPFGT&QPMQUCMGPGTPCPPV2NCVQYM·ORHVGFCPPKPFGP0CRQNGQPKUEJGP-TKGIGP \WP·EJUVDKUIGIGPFKG(TCP\QUGP+OCPUEJNKG­GPFGP(GNF\WIIGIGPFKG6ÒTMGKPCJOGTFKG5VCFV *KTUQYCWPFJCVVGITQ­GP#PVGKNCPFGP5KGIGPDGK4CUUGYCVWPF-CNKRGVTK+O(GNF\WIXQPDGHGJNKIVGGTPCEJ FGT<GTUVÌTWPI/QUMCWU&QPMQUCMGPTGIKOGPVGT,·IGTTGIKOGPVGTWPFTGKVGPFG$CVVGTKGPFKGUVGVUFKG8QTJWV WPFFKG0CEJJWVFGT4WUUGPDKNFGVGPWPFXGTHQNIVGFGPCD\KGJGPFGP(GKPFOKVUGKPGP-QUCMGPFKGOGJTCNU )GHCPIGPGWPF-CPQPGPGKPDTCEJVGP9·JTGPFFGT(GNF\ÒIGGTYCTDUKEJ2NCVQYOKVUGKPGP-QUCMGP KP 'WTQRC ITQ­G 2QRWNCTKV·V 0CEJ ªDGTUEJTGKVWPI FGT )TGP\G DGHTGKVG GT FKG RTGW­KUEJGP 5V·FVG /CTKGPYGTFGT   /CTKGPDWTI&KTUEJCWWPF'NDKPIUEJNWI)GPGTCN.GH½DXTGCO/CKDGK#NVGPDWTIWPFXGTHQNIVGPCEJFGT 5EJNCEJVDGK.GKR\KIFGP(GKPFDKUCPFGP4JGKP+P(TCPMTGKEJUGNDUVUKGIVGGTDGK.CQPPCJO0GOQWTUKO5VWTO CPITKHHDGUGV\VG#TEKUWPF8GTUCKNNGUWPFTÒEMVGUEJNKG­NKEJOKVFGP#NNKKGTVGPKP2CTKUGKP#O1MVQDGT YWTFG2NCVQYKPFGP)TCHGPUVCPFGTJQDGP'TUVCTD,CPWCTCO&QPWPFYWTFGKP0QYQVUEJGTMCUUMDGITC DGPYQOCPKJOGKP&GPMOCNGTTKEJVGVG

8355



5KNDGTOGFCKNNG  XQP , .ÌUEJ CWH FGP $GUWEJ FGU <CTGP KP /ÒPEJGP $ÒUVG T5KGDGP <GKNGP   5EJTKHVFC\YKUEJGP#DUEJPKVVUNKPKGOOI&KCMQX 4 9KVV  44(CUVXQT\ÒINKEJ



8356



8GTUKNDGTVG$TQP\GOGFCKNNGXQP##%CSW¾2TGKUOGFCKNNGFGU.C\CTGXUM[+PUVKVWVUHÒTXQTFGT CUKCVKUEJG5RTCEJGPXGTNKGJGPCP5VWFGPVGP&KGWPKHQTOKGTVGP$TWUVDKNFGTFGT)TÒPFGT)TCH+XCPWPF )TCH ,QCMKO .C\CTGXKEJU .C\CTGXU PGDGPGKPCPFGT N5VTC­GPCPUKEJV KP /QUMCW OKVFGO+PUVKVWVNWPF FGTCTOGPKUEJGP-KTEJGT/KV4CPFITCXWT%7+84'OOI&KCMQX 4   5GJTUEJÌPpXQT\ÒINKEJ

 79


ALEXANDER I.

8358

8357



8359

-NGKPG5KNDGTOGFCKNNGQ,  XQP&(QFGT(9.QQUCWH/KEJGN$$CTENC[FG6QNN[  Ó TWUUKUEJGT )GPGTCN WPF -TKGIUOKPKUVGT $ÒUVG FGU (GNFJGTTP N(COKNKGPYCRRGP XQP 1TFGPU   MGVVG WOIGDGP CWH IGMTÌPVGO *GTOGNKP OOI&KCMQXp*%\5QOOGT# 8QPITQ­GT5GNVGPJGKV2TCEJVXQNNG2CVKPCXQT\ÒINKEJ



/GUUKPILGVQPQ,OKV5KIPCVWT.CWHFGPTWUUKUEJGP)GPGTCN$CTENC[FG6QNN[7PKHQTOKGTVGU$TWUV DKNF N&GT WPKHQTOKGTVG )GPGTCN TGKVGV T OKV 5EJYGTV KP FGT GTJQDGPGP 4GEJVGP  OO  I   &KCMQXp (CUV5VGORGNINCP\



-W/CTMGFGU-QJNGDGTIYGTMUKP0K\JPKL+UGVUMI/KV)GIGPUVGORGN5VGTPCWH8QTFGT WPF4ÒEMUGKVGUQYKGFGOIGMTÌPVGPTWUUKUEJGP&QRRGNCFNGTCWHFGT4ÒEMUGKVG 445GJTUEJÌP



&KGXQTNKGIGPFG/GFCKNNGYWTFGFGO(GNFJGTTPDGKUGKPGT4ÒEMMGJTXQPFGOUKGITGKEJGP(GNF\WIIGIGP0CRQNGQP XQPFGT5VCFV9CTUEJCWÒDGTTGKEJV





8360



5KNDGTOGFCKNNGQ,XQP)5VWEMJCTV2T·OKGFGT-WPUVCMCFGOKG9CTUEJCW$ÒUVGTOKV.QTDGGTMTCP\ &TGKYGKDNKEJG)GUVCNVGPOKV#VVTKDWVGPFGT-WPUVOOI&KCMQX 4   49KP\-TCV\GTXQT\ÒINKEJ



8361

 80

5KNDGTOGFCKNNG  XQP # -NGRKMQY CWH UGKPGP 6QF $ÒUVG T OKV .QTDGGTMTCP\WOJGT5EJNCPIGP TKPI5VTCJNGPFGU)QVVGUCWIGOOI&KCMQX 4  448QT\ÒINKEJ 


NIKOLAUS I.

8362



$TQP\GOGFCKNNGXQP#-NGRKMQYCWHUGKPGP6QF$ÒUVGTOKV.QTDGGTMTCP\WOJGT5EJNCPIGP TKPI5VTCJNGPFGU)QVVGUCWIGOOI&KCMQX *GTTNKEJG2CVKPCXQT\ÒINKEJ



8364

8363

<#40+-1.#75+ <YGK)QNFOÒP\GPFGU<CTGP0KMQNCWU+ 

4WDGN5V2GVGTUDWTII$KVMKP(D5EJN

)1.&8QT\ÒINKEJ





4WDGN5V2GVGTUDWTII$KVMKP(D5EJN

)1.&(CUVXQT\ÒINKEJ



8365 Pt

1,5:1

1,5:1

2NCVKPOÒP\GPFGU<CTGP0KMQNCWU+ 

4WDGN2NCVKP5V2GVGTUDWTII)GMTÌPVGT&QRRGNCFNGTOKV<GRVGTWPF4GKEJUCRHGNKPFGP (·PIGP CWH FGT $TWUV 5V )GQTIUUEJKNF WOJGT FKG -GVVG FGU #PFTGCUQTFGPU CWH FGP (NÒIGNP LG FTGK   YGKVGTG9CRRGPUEJKNFGQDGP-TQPG5EJTKHVOKV9GTVWPF,CJTGUCPICDG$KVMKP(D5EJN 2.#6+0440WT'ZGORNCTGIGRT·IV-N4CPFHGJNGTXQT\ÒINKEJ  81


NIKOLAUS I.

8366 Pt

1,5:1



1,5:1

 4WDGN 2NCVKP  5V 2GVGTUDWTI 0QXQFGN!  I )GMTÌPVGT &QRRGNCFNGT OKV <GRVGT WPF   4GKEJUCRHGNKPFGP(·PIGPCWHFGT$TWUV5V)GQTIUUEJKNFWOJGTFKG-GVVGFGU#PFTGCUQTFGPUCWHFGP CWUIGDTGKVGVGP (NÒIGNP LG FTGK 9CRRGPUEJKNFG5EJTKHV OKV 9GTV WPF ,CJTGUCPICDG $KVMKP  4    (D5EJN 2.#6+0440WT'ZGORNCTGIGRT·IV 2T·IWPIOKVNGKEJVXGTWPTGKPKIVGP5VGORGNPMN-TCV\GTKO(GNFXQT\ÒINKEJ 

8367 Pt

1,5:1



1,5:1

4WDGN2NCVKP5V2GVGTUDWTI0QXQFGN!IHGKP$KVMKP 4 (D5EJN  2.#6+09KP\4CPFHGJNGTXQT\ÒINKEJ



8368 Pt

1,5:1



82

1,5:1

4WDGN2NCVKP5V2GVGTUDWTII$KVMKP 4 (D5EJN  2.#6+040WT'ZGORNCTGIGRT·IV -N4CPFHGJNGTFGPPQEJUGJTCVVTCMVKXGU'ZGORNCTOKVHGKPGT6ÌPWPIHCUV5VGORGNINCP\ 


NIKOLAUS I.

8369 Pt

8370 Pt

8371 Pt

8372 Pt



4WDGN2NCVKP5V2GVGTUDWTII$KVMKP 4 (D5EJN  2.#6+0/GJTGTG4CPFHGJNGTUGJTUEJÌP





4WDGN2NCVKP5V2GVGTUDWTII$KVMKP 4 (D5EJN  2.#6+0-N)TCHHKVKUGJTUEJÌP





4WDGN2NCVKP5V2GVGTUDWTII$KVMKP 4 (D5EJN  2.#6+0-N4CPFHGJNGTUGJTUEJÌP





4WDGN2NCVKP5V2GVGTUDWTII$KVMKP 4 (D5EJN  2.#6+09KP\4CPFHGJNGTUGJTUEJÌP



8373 Pt 1,5:1



1,5:1

4WDGN2NCVKP5V2GVGTUDWTII$KVMKP 4 (D5EJN

 2.#6+048QT\ÒINKEJ



8374

8375

8375

5KNDGTOÒP\GPFGU<CTGP0KMQNCWU+



-QRGMGP5V2GVGTUDWTII$KVMKP 4 



4WDGN5V2GVGTUDWTI+P752NCUVKMJQNFGTFGT0)%OKVFGT$GYGTVWPI/5$KVMKP&CX (CUV5VGORGNINCP\

8376

 

4WDGN5V2GVGTUDWTII$KVMKP&CX 4WDGN5V2GVGTUDWTII$KVMKP&CX

48QT\ÒINKEJ

 

8377

*GTTNKEJG2CVKPCHCUV5VGORGNINCP\ 8QT\ÒINKEJ

  83


NIKOLAUS I.

8379

8378

8381

   

8380

8381

-QRGMGP5V2GVGTUDWTII$KVMKP -QRGMGP5V2GVGTUDWTII$KVMKP -QRGMGP5V2GVGTUDWTII$KVMKP 4WDGN5V2GVGTUDWTII$KVMKP&CX

*GTTNKEJG2CVKPCXQT\ÒINKEJp5VGORGNINCP\ *GTTNKEJG2CVKPCUGJTUEJÌP 5GJTUEJÌPpXQT\ÒINKEJ 9KP\5VGORGNHGJNGTXQT\ÒINKEJ

   

8382

1,5:1



4WDGN5V2GVGTUDWTII$KVMKP&CX  5GJTUGNVGPKPFKGUGT'TJCNVWPI(GKPG2CVKPCRQNKGTVG2NCVVGOKPDGTÒJTV

8383

   84

1,5:1

8384

4WDGN5V2GVGTUDWTII$KVMKP&CX 4WDGN5V2GVGTUDWTII$KVMKP&CX 4WDGN5V2GVGTUDWTII$KVMKP&CX



8385

8QT\ÒINKEJ (GKPG2CVKPCHCUVXQT\ÒINKEJ 8QT\ÒINKEJ

  


NIKOLAUS I.

8386

 

8387

4WDGN5V2GVGTUDWTII$KVMKP&CX 4WDGN5V2GVGTUDWTII$KVMKP&CX

(CUVXQT\Ã&#x2019;INKEJ 8QT\Ã&#x2019;INKEJ

 

8389

8388



4WDGN5V2GVGTUDWTII$KVMKP&CX  2TCEJVGZGORNCT*GTTNKEJG2CVKPCHCUV5VGORGNINCP\



4WDGN5V2GVGTUDWTII$KVMKP&CX



8QT\Ã&#x2019;INKEJ





4WDGN5V2GVGTUDWTII$KVMKP&CX  2TCEJVGZGORNCTXQPRQNKGTVGP5VGORGNP(CUV5VGORGNINCP\





4WDGN5V2GVGTUDWTII$KVMKP&CX



8390

8391

8393

8392

 

(CUVXQT\Ã&#x2019;INKEJ

4WDGN5V2GVGTUDWTII$KVMKP&CX 4WDGN5V2GVGTUDWTII$KVMKP&CX

8394

8395

48QT\Ã&#x2019;INKEJ 8QT\Ã&#x2019;INKEJ

 

8394



4WDGN 2QNVKPC 5V2GVGTUDWTII$KVMKP

8QT\Ã&#x2019;INKEJ





-QRGMGP5V2GVGTUDWTII$KVMKP  2TCEJVGZGORNCT*GTTNKEJG2CVKPCYKP\-TCV\GTRQNKGTVG2NCVVG

 85


NIKOLAUS I.

8396

1,5:1



1,5:1

-QRGMGP5V2GVGTUDWTII$KVMKP 4   5GNVGPDGUQPFGTUKPFKGUGT'TJCNVWPI2TCEJVGZGORNCT *GTTNKEJG2CVKPCYKP\-TCV\GTRQNKGTVG2NCVVG

8397

8398

8399



8400



-QRGMGPQ, CD 5V2GVGTUDWTII8GTRT·IWPI4ÒEMUGKVGKPMWUG8QTFGTUGKVG$KV MKP\WHH +PVGTGUUCPVG8GTRT·IWPI(CUVUGJTUEJÌP





-QRGMGP5V2GVGTUDWTII$KVMKP

*GTTNKEJG2CVKPCXQT\ÒINKEJp5VGORGNINCP\





-QRGMGP5V2GVGTUDWTII$KVMKP

*ÒDUEJG2CVKPCXQT\ÒINKEJ





-QRGMGP5V2GVGTUDWTII$KVMKP  5GNVGPKPFKGUGT'TJCNVWPI2TCEJVGZGORNCT*GTTNKEJG2CVKPCHCUV5VGORGNINCP\



8401

1,5:1



1,5:1

-QRGMGP5V2GVGTUDWTII$KVMKP 4   5GNVGPDGUQPFGTUKPFKGUGT'TJCNVWPI2TCEJVGZGORNCT *GTTNKEJG2CVKPCYKP\-TCV\GTRQNKGTVG2NCVVG

8402

8403

8404



8405



-QRGMGP5V2GVGTUDWTII$KVMKP

*GTTNKEJG2CVKPCXQT\ÒINKEJp5VGORGNINCP\





-QRGMGP5V2GVGTUDWTII$KVMKP

*ÒDUEJG2CVKPCXQT\ÒINKEJ





-QRGMGP5V2GVGTUDWTII$KVMKP  #VVTCMVKXGU'ZGORNCTOKVJÒDUEJGT2CVKPCXQT\ÒINKEJXQT\ÒINKEJp5VGORGNINCP\





-QRGMGP5V2GVGTUDWTII$KVMKP  2TCEJVGZGORNCT*GTTNKEJG2CVKPC'TUVCDUEJNCIHCUV5VGORGNINCP\



86


NIKOLAUS I.

8406

8407

5KNDGTOÒP\GPFGT/ÒP\UV·VVG9CTUEJCW 

4WDGN9CTUEJCW+P752NCUVKMJQNFGTFGT0)%OKVFGT$GYGTVWPI/5$KVMKP&CX 5GJTUGNVGPKPFKGUGT'TJCNVWPI8QT\ÒINKEJp5VGORGNINCP\





4WDGN9CTUEJCWI$KVMKP&CX



8408

 

(CUVXQT\ÒINKEJ

8409

4WDGN9CTUEJCWI$KVMKP&CX 4WDGN9CTUEJCWI$KVMKP&CX

*ÒDUEJG2CVKPCHCUVXQT\ÒINKEJ (CUVXQT\ÒINKEJ

 

8410 1,5:1



-QRGMGP9CTUEJCWI$KVMKP 4 

8412

  

1,5:1

8411

-WRHGTOÒP\GPFGT/ÒP\UV·VVG'MCVGTKPDWTI -W&GPIC'MCVGTKPDWTII$KVMKP -W-QRGMGP'MCVGTKPDWTII$KVMKP -W-QRGMGP'MCVGTKPDWTII$KVMKP

8QPITQ­GT5GNVGPJGKV5GJTUEJÌP



8413

4-N5EJTÌVNKPIUHGJNGTHCUVXQT\ÒINKEJ 8QT\ÒINKEJ (CUVXQT\ÒINKEJ

   87


NIKOLAUS I.

8415

8414



-W-QRGMGP'MCVGTKPDWTII8GTRT·IWPI$KVMKP\W  +PVGTGUUCPVG8GTRT·IWPI5GJTUEJÌP



-W-QRGMGP'MCVGTKPDWTII$KVMKP

8416



5GJTUEJÌPpXQT\ÒINKEJ

8418

8417

 

8419

-W-QRGMG Q ,   'MCVGTKPDWTI  I 8GTRT·IWPI 4ÒEMUGKVG  KPMWUG 8QTFGTUGKVG   $KVMKP\W +PVGTGUUCPVG8GTRT·IWPI5GJTUEJÌP



&KG<WYGKUWPI\WT/ÒP\UV·VVG'MCVGTKPDWTIKUVPKEJVIGUKEJGTV



-W-QRGMG'MCVGTKPDWTII$KVMKP

9KP\5EJTÌVNKPIUHGJNGTXQT\ÒINKEJ



-W-QRGMGQ,  'MCVGTKPDWTII8GTRT·IWPI4ÒEMUGKVGKPMWUG8QTFGTUGKVG $KVMKP\WHH +PVGTGUUCPVG8GTRT·IWPI5GJTUEJÌP

 

&KG<WYGKUWPI\WT/ÒP\UV·VVG'MCVGTKPDWTIKUVPKEJVIGUKEJGTV



-W-QRGMG'MCVGTKPDWTII&KEMCDUEJNCI$KVMKP\W

5GJTUEJÌP



8422

8420

8421



-W-QRGMGP'MCVGTKPDWTII$KVMKP



-W-QRGMGP'MCVGTKPDWTII8GTRT·IWPI8QTFGTUGKVGKPMWUG4ÒEMUGKVG$KVMKP +PVGTGUUCPVG8GTRT·IWPI5GJTUEJÌP





-W&GPG\JMC'MCVGTKPDWTII8GTRT·IWPI8QTFGTUGKVG+PMWUG4ÒEMUGKVG$KVMKP\W QFGT #NGZCPFGT++  +PVGTGUUCPVG8GTRT·IWPI5GJTUEJÌP



88

(CUVXQT\ÒINKEJ




NIKOLAUS I.

8424 8423



8423

'KP-WRHGT-QRGMGP5VÒEMFGT/ÒP\UV·VVG5W\WP

-W-QRGMGP5W\WP -QN[XCP I$KVMKP 4 

445EJTÌVNKPIUHGJNGTUGJTUEJÌP



-WRHGTOÒP\GPFGT/ÒP\UV·VVG5V2GVGTUDWTI 

-W-QRGMGP5V2GVGTUDWTII8GTRT·IWPI8QTFGTUGKVGKPMWUG4ÒEMUGKVG$KVMKP\W +PVGTGUUCPVG8GTRT·IWPI5GJTUEJÌP

8426

8425



8427



-W-QRGMG5V2GVGTUDWTII$KVMKP

(CUVXQT\ÒINKEJ



-W-QRGMG5V2GVGTUDWTII8GTRT·IWPI8QTFGTUGKVGKPMWUG4ÒEMUGKVG$KVMKP\W +PVGTGUUCPVG8GTRT·IWPI5GJTUEJÌP



-W-QRGMG5V2GVGTUDWTII$KVMKP

8QT\ÒINKEJ

  

8428

1,5:1

1,5:1



-WRHGTOÒP\GPFGT/ÒP\UV·VVG9CTUEJCW

-W-QRGMGP9CTUEJCWI$KVMKP 4 

8QPITQ­GT5GNVGPJGKV8QT\ÒINKEJ



48QT\ÒINKEJ



8429



-W-QRGMGP9CTUEJCWI$KVMKP 4 

89


NIKOLAUS I.

8431

8430

)GFGPMOÒP\GPFGU<CTGP0KMQNCWU+ 

4WDGN5V2GVGTUDWTI&GPMOCNHÒT#NGZCPFGT+I$KVMKP 4 &CX  2TCEJVXQNNG2CVKPCXQT\ÒINKEJ



4WDGN5V2GVGTUDWTI&GPMOCNHÒT#NGZCPFGT+I$KVMKP 4 &CX

 8QT\ÒINKEJ

 

8432

1,5:1

1,5:1



4WDGN  XQP * )WDG CWH FKG 8GTO·JNWPI UGKPGU 5QJPGU )TQ­HÒTUV #NGZCPFGT 0KMQNCLGYKVUEJ   UR·VGT <CT #NGZCPFGT ++ OKV /CTKC XQP *GUUGP&CTOUVCFV 6QEJVGT .WFYKIU ++  I $KVMKP   

4 &CX# 442TCEJVGZGORNCT8QT\ÒINKEJp5VGORGNINCP\CWURQNKGTVGT2NCVVG 

8433

8434

8435

'KP0QXQFGNGKPGT2TQDGOÒP\GFGU<CTGP0KMQNCWU+ 

-W-QRGMG5V2GVGTUDWTI0QXQFGNFGT2TQDGOKVINCVVGO4CPFI$KVMKP*  44(CUV5VGORGNINCP\



2T·IWPIGPHÒT)GQTIKGP 

#DC\K -QRGMGP 6KHNKUHÒT)GQTIKGPI$KVMKP



#DC\K -QRGMGP 6KHNKUHÒT)GQTIKGPI$KVMKP 4 

90

5EJÌPpUGJTUEJÌP



(CUVUGJTUEJÌP




NIKOLAUS I.

8438

8437

8436



#DC\K -QRGMGP 6KHNKUHÒT)GQTIKGPI$KVMKP 4 

4(CUVUGJTUEJÌP





#DC\K -QRGMGP 6KHNKUHÒT)GQTIKGPI$KVMKP 4 

45GJTUEJÌP





#DC\K -QRGMGP 6KHNKUHÒT)GQTIKGPI$KVMKP 4 

45GJTUEJÌP



8439

1,5:1

1,5:1

2T·IWPIGPHÒT2QNGP 

 <NQV[EJ  9CTUEJCW HÒT 2QNGP  I $ÒUVG FGU <CTGP #NGZCPFGT + T OKV .QTDGGTMTCP\   )GMTÌPVGT &QRRGNCFNGT OKV <GRVGT 5EJYGTV WPF 4GKEJUCRHGN KP FGP(·PIGPCWHFGT$TWUV#FNGTUEJKNF CWHIGMTÌPVGO*GTOGNKPQDGP-TQPG$KVMKP 4 &CX FQTVWPVGT2QNGP   8QPITQ­GT5GNVGPJGKV*GTTNKEJG2CVKPCYKP\4CPFHGJNGTXQT\ÒINKEJ 

8441

8440



<NQV[EJ9CTUEJCWHÒT2QNGPI$KVMKP



<NQVG9CTUEJCWHÒT2QNGPI$KVMKP

*GTTNKEJG2CVKPCHCUVXQT\ÒINKEJ



5GJTUEJÌPpXQT\ÒINKEJ



8442 1,5:1



1,5:1

<NQV[9CTUEJCWHÒT2QNGPI$KVMKP  5GJTUGNVGPKPFKGUGT'TJCNVWPI*GTTNKEJG2CVKPCXQT\ÒINKEJp5VGORGNINCP\

 91


NIKOLAUS I.

8443

8444

8445

8445



 4WDGN  <NQV[EJ   5V 2GVGTUDWTI HÒT 2QNGP  I $KVMKP  4  (D  FQTV WPVGT   2QNGP 5EJN FQTVWPVGT2QNGP  )1.&4(CUVUGJTUEJÌP



 4WDGN  <NQV[EJ   5V 2GVGTUDWTI HÒT 2QNGP  I $KVMKP  4  (D  FQTV WPVGT   2QNGP 5EJN FQTVWPVGT2QNGP  )1.&45GJTUEJÌP 



4WDGN <NQV[EJ 5V2GVGTUDWTIHÒT2QNGPI$KVMKP&CX

8QT\ÒINKEJ





8446

1,5:1



1,5:1

4WDGN <NQV[EJ 5V2GVGTUDWTIHÒT2QNGPI$KVMKP&CX  W­GTUVUGNVGPKPFKGUGT'TJCNVWPI*GTTNKEJG2CVKPCRQNKGTVG2NCVVGOKPDGTÒJTV

8447



8448



4WDGN <NQV[EJ 5V2GVGTUDWTIHÒT2QNGPI$KVMKP&CX  (GKPG2CVKPCGVYCU$GNCIXQT\ÒINKEJ





4WDGN <NQV[EJ 5V2GVGTUDWTIHÒT2QNGPI$KVMKP&CX  8QT\ÒINKEJGU'ZGORNCTXQPRQNKGTVGP5VGORGNP



92


NIKOLAUS I.

8449

1,5:1



1,5:1

  4WDGN  <NQV[EJ   5V 2GVGTUDWTI HÒT 2QNGP  I $KVMKP  &CX    -CDKPGVVUVÒEM2TCEJVXQNNG2CVKPCRQNKGTVG2NCVVGOKPDGTÒJTV 

8450

8451

8452



4WDGN <NQV[EJ 9CTUEJCWHÒT2QNGPI$KVMKP 4 &CX  4*GTTNKEJG2CVKPCUGJTUEJÌPpXQT\ÒINKEJ





4WDGN <NQV[EJ 9CTUEJCWHÒT2QNGPI$KVMKP&CX

5GJTUEJÌP





4WDGN <NQV[EJ 9CTUEJCWHÒT2QNGPI$KVMKP 4 &CX  5GNVGPGT,CJTICPI5GJTUEJÌP



8453



-QRGMGP <NQVG 9CTUEJCWHÒT2QNGPI$KVMKP  /KPLWUVKGTVUGJTUEJÌPpXQT\ÒINKEJ

 93


NIKOLAUS I.

8455

8454

ex 8456



)TQU\[9CTUEJCWHÒT2QNGPI$KVMKP  2TCEJVGZGORNCT*GTTNKEJG2CVKPCHCUV5VGORGNINCP\





)TQU\[9CTUEJCWHÒT2QNGPI$KVMKP





)TQU\[9CTUEJCWHÒT2QNGPI&C\W)TQU\[9CTUEJCWHÒT2QNGP$KVMKP 5VÒEM8QT\ÒINKEJp5VGORGNINCP\

*GTTNKEJG2CVKPCXQT\ÒINKEJ



8458

8457



-QRGMGP )TQU\[ 9CTUEJCWHÒT2QNGPI$KVMKP FQTVHCNUEJDGUEJTKGDGP   *GTTNKEJG2CVKPCXQT\ÒINKEJ





-QRGMGP )TQU\[ 9CTUEJCWHÒT2QNGPI$KVMKP  5GNVGPKPFKGUGT'TJCNVWPI*GTTNKEJG2CVKPCXQT\ÒINKEJ



8459

8460

8461

8462

8463

(ÒPH/GUUKPI2CUUKGTIGYKEJVG 









94

2QNPKUEJGU 2CUUKGTIGYKEJV Q ,   HÒT GKPGP &WMCVGP /GUUKPI  I )GMTÌPVGT TWUUKUEJGT   &QRRGNCFNGT OKV 5EJYGTV WPF 4GKEJUCRHGN KP FGP (·PIGP CWH FGT $TWUV #FNGTUEJKNF CWH IGMTÌPVGO   9CRRGPOCPVGNQDGP-TQPG9GTVKP\YGK<GKNGPÒDGT<YGKIGP$KVMKP6GYGUKP.6GYGU &KG UVCCVNKEJGP )QNFOÒP\IGYKEJVG /C­ WPF )GYKEJV <GKVUEJTKHV HÒT /GVTQNQIKG 0T  5GRVGODGT    445EJTÌVNKPIUTK­UGJTUEJÌPpXQT\ÒINKEJ



2QNPKUEJGU2CUUKGTIGYKEJVQ,  HÒTGKPGP(TKGFTKEJUF QT/GUUKPII)GMTÌPVGTTWUUKUEJGT &QRRGNCFNGT OKV 5EJYGTV WPF 4GKEJUCRHGN KP FGP (·PIGP CWH FGT $TWUV #FNGTUEJKNF CWH IGMTÌPVGO   9CRRGPOCPVGNQDGP-TQPG9GTVKPFTGK<GKNGP$KVMKP6GYGUKP.6GYGU&KGUVCCVNKEJGP )QNFOÒP\IGYKEJVG/C­WPF)GYKEJV<GKVUEJTKHVHÒT/GVTQNQIKG0T5GRVGODGT  448QT\ÒINKEJ



2QNPKUEJGU2CUUKGTIGYKEJVHÒT<NQV[EJ/GUUKPII)GMTÌPVGTTWUUKUEJGT&QRRGNCFNGTOKV 5EJYGTVWPF4GKEJUCRHGNKPFGP(·PIGPCWHFGT$TWUV#FNGTUEJKNFCWHIGMTÌPVGO9CRRGPOCPVGNQDGP -TQPG9GTV WPF ,CJT KP XKGT <GKNGP $KVMKP  6GYGU  KP . 6GYGU &KG UVCCVNKEJGP )QNF   OÒP\IGYKEJVG/C­WPF)GYKEJV<GKVUEJTKHVHÒT/GVTQNQIKG0T5GRVGODGT  44-NGKPGT-TCV\GTXQT\ÒINKEJ



2QNPKUEJGU2CUUKGTIGYKEJVHÒT<NQV[EJ/GUUKPII)GMTÌPVGTTWUUKUEJGT&QRRGNCFNGTOKV 5EJYGTVWPF4GKEJUCRHGNKPFGP(·PIGPCWHFGT$TWUV#FNGTUEJKNFCWHIGMTÌPVGO9CRRGPOCPVGNQDGP -TQPG9GTVWPF,CJTKPXKGT<GKNGP$KVMKP6GYGUKP.6GYGU&KGUVCCVNKEJGP)QNFOÒP\ IGYKEJVG/C­WPF)GYKEJV<GKVUEJTKHVHÒT/GVTQNQIKG0T5GRVGODGT 448QT\ÒINKEJ



2QNPKUEJGU 2CUUKGTIGYKEJV Q ,   HÒT GKPGP  +ORGTKCN /GUUKPI  I )GMTÌPVGT TWUUKUEJGT   &QRRGNCFNGT OKV 5EJYGTV WPF 4GKEJUCRHGN KP FGP (·PIGP CWH FGT $TWUV #FNGTUEJKNF CWH IGMTÌPVGO   9CRRGPOCPVGNQDGP-TQPG9GTVKPHÒPH<GKNGP$KVMKP6GYGUKP.6GYGU&KGUVCCVNKEJGP )QNFOÒP\IGYKEJVG/C­WPF)GYKEJV<GKVUEJTKHVHÒT/GVTQNQIKG0T5GRVGODGT  445GJTUEJÌP




NIKOLAUS I.

8464 Pt

1,5:1

1,5:1

/GFCKNNGPFGU<CTGP0KMQNCWU+ 

2NCVKPLGVQP  WPUKIPKGTV CWH UGKPG -TÌPWPI KP /QUMCW )GMTÌPVGU /QPQITCOO<YGK <GKNGP   5EJTKHVQDGP-TQPGWPVGP,CJTGU\CJNOOI&KCMQX 4   2.#6+08QPITQ­GT5GNVGPJGKV2QNKGTVG2NCVVGOKPDGTÒJTV 

8465

1,5:1

1,5:1



)QNFOGFCKNNG \W  &WMCVGP  WPUKIPKGTV &GOKFQX2TGKUOGFCKNNG XGTNKGJGP HÒT YKUUGPUEJCHVNKEJG   #TDGKVGP 5EJTKHV '81%#6+5  24#'/++ &'/+&18+#0+  #4$+64+5  #%#&'/+#  r QDGP   'WNGOKV2CNO\YGKI5EJTKHVr#007#::8/+..+#47$#5524#'/++5.+66'4#4++5 2#7.75&'/+&18&7/8+8+6'6::8#007.64#&'57+5&'56+0#6&+':8++ #24/&%%%:::+rWOJGT.QTDGGTWPF'KEJGPMTCP\OOI&KCMQX  )1.&8QPITÌ­VGT5GNVGPJGKV9KP\4CPFHGJNGTXQT\ÒINKEJp5VGORGNINCP\  &CU XQTNKGIGPFG 'ZGORNCT KP )QNF YWTFG OÌINKEJGTYGKUG CP #PCVQNG 0KMQNCGYKVUEJ &GOKFQX FGP $TWFGT FGU   5VKHVGTUXGTNKGJGPFGTFGP&GOKFQX2TGKUHÒTUGKPGIGQITCHKUEJGP(QTUEJWPIGPGTJKGNV

8466



<KPPOGFCKNNGWPUKIPKGTV<YKVVGTRT·IWPICWHFKG6TWRRGPUEJCWDGK-CNKUEJ$ÒUVG%NGOGPU9GP \GNU (ÒTUV XQP/GVVGTPKEJ.GKVGTFGU9KGPGT-QPITGUUGUT'KPTWUUKUEJGTWPFGKPRTGW ­KUEJGT5QNFCVOKVKJTGP(CJPGPUVGJGPPGDGPGKPCPFGTDGKFGUKPFCPVKMIGMNGKFGVKO*KPVGTITWPF<GNV NCIGTOOI&KCMQXp 4ÒEMUGKVG  8QT\ÒINKEJ

 95


NIKOLAUS I.

8467



5KNDGTPG5WKVGPOGFCKNNGXQP#-NGRKMQYWPF#.[CNKPCWHFKG0CRQNGQPKUEJGP-TKGIGWPFFKG 'KPPCJOGXQP2CTKU$TWUVDKNF#NGZCPFGTU+NKPCPVKMGT4ÒUVWPIOKV*GNO5RGGTWPF5EJKNF )GJCTPKUEJVGT-TKGIGTUVGJVHCUVXXKPFGT4GEJVGP(CJPGKPFGT.KPMGPGKP.QTDGGT\YGKIFGPGTFGT XQT KJO MPKGPFGP 5VCFVIÌVVKP GPVIGIGPJ·NV \YKUEJGP KJPGP CO $QFGP NKGIV GKP -KUUGP OKV FGP 5VCFV   UEJNÒUUGNPKO*KPVGTITWPF5EJNCEJVHGNFOOI&KCMQX 4   *ÒDUEJG2CVKPCYKP\4CPFHGJNGTXQT\ÒINKEJ



8468



$TQP\GOGFCKNNGQ, WO WPUKIPKGTV2TGKUOGFCKNNGFGTVGEJPQNQIKUEJGP7PKXGTUKV·VKP5V2GVGTU DWTI XGTNKGJGP CP 5VWFGPVGP $ÒUVG N&TGK <GKNGP 5EJTKHV ÒDGT #DUEJPKVVUNKPKG WOJGT GDGPHCNNU   5EJTKHVWPF'KEJGPMTCP\OOI&KCMQX 2TCEJVGZGORNCT(CUV5VGORGNINCP\



8469



96

4GEJVGEMKIG 5KNDGTRNCMGVVG  XQP * )WDG CWH FKG 'TÌHHPWPI FGU /QUMCWGT 6TKWORJDQIGPU KP   5V2GVGTUDWTI#PUKEJVFGU6TKWORJDQIGPU<GJP<GKNGP5EJTKHV\WFGP5GKVGPLGGKPG6TQRJ·GZ OOI&KCMQX 4   +P5KNDGT·W­GTUVUGNVGP*GTTNKEJG2CVKPCXQT\ÒINKEJp5VGORGNINCP\ 


NIKOLAUS I.

8470



5KNDGTOGFCKNNGXQP27VMKPCWHFGPGTUVGP5RCVGPUVKEJ\WO$CWFGT%JTKUV'TNÌUGT-CVJGFTCNGKP /QUMCW5VTCJNGPFGU)QVVGUCWIG#PUKEJVFGT-KTEJGOOI&KCMQX 4   8QPITQ­GT5GNVGPJGKV*GTTNKEJG2CVKPCXQT\ÒINKEJp5VGORGNINCP\



&GT #PNC­ HÒT FGP $CW FGT %JTKUV'TNÌUGT-CVJGFTCNG YCT FGT 5KGI 4W­NCPFU ÒDGT 0CRQN¾QP $QPCRCTVG KO UQIG   PCPPVGP8CVGTN·PFKUEJGP-TKGIXQP&KG)TWPFUVGKPNGIWPIHÒTFKGTWUUKUEJQTVJQFQZG-KTEJGGTHQNIVGKO5GR VGODGT  &KG HGKGTNKEJG 'KPYGKJWPI YCT WTURTÒPINKEJ HÒT FCU ,CJT  IGRNCPV FC FKG -CVJGFTCNG DGTGKVU   YGKVIGJGPFHGTVKIIGUVGNNVYCTCNNGTFKPIUXGTJKPFGTVGFKG'TOQTFWPIFGU<CTGP#NGZCPFGT++KO/·T\FKG<GTGOQ PKG 5EJNKG­NKEJ HCPF FKG 'KPYGKJWPI OKV GKPGO (GWGTYGTM WPF FGO )NQEMGPIGN·WV U·OVNKEJGT /QUMCWGT -KTEJGP   \WUCOOGPOKVFGT-TÌPWPI#NGZCPFGTU+++CO/CKUVCVV

8471

8472

8473



5KNDGTOGFCKNNG\WGKPGO4WDGNXQP*)WDGCWHFKG8GTO·JNWPIUGKPGU5QJPGU)TQ­HÒTUV#NGZ CPFGT0KMQNCLGYKVUEJUR·VGT<CT#NGZCPFGT++OKV/CTKCXQP*GUUGP&CTOUVCFV6QEJVGT.WFYKIU++ $GKFGT $ÒUVGP PGDGPGKPCPFGT N#OQT WPF 2U[EJG NGJPGP CP GKPGT IGMTÌPVGP -CTVWUEJG FCTKP /QPQ   ITCOO#/%COO+P752NCUVKMJQNFGTFGT0)%OKVFGT$GYGTVWPI/5$KVMKP/

4 &CXXIN#&KCMQX 4 5EJÒV\ 448QT\ÒINKEJ 



5KNDGTOGFCKNNG  WPUKIPKGTV -ÒTCUUKGTVCNGT IGHGTVKIV CWH UGKP L·JTKIGU ,WDKN·WO CNU %JGH FGU   RTGW­KUEJGP-ÒTCUUKGT4GIKOGPVU)GMTÌPVGU/QPQITCOOÒDGT\YGK<GKNGP5EJTKHV&KG,CJTGU\CJNGP ºWOJGT.QTDGGTMTCP\OOI&KCMQX 4 /CTKGPD  4(GKPG2CVKPCXQT\ÒINKEJGU'ZGORNCT



5KNDGTOGFCKNNG  WPUKIPKGTV -ÒTCUUKGTVCNGT IGHGTVKIV CWH UGKP L·JTKIGU ,WDKN·WO CNU %JGH FGU   RTGW­KUEJGP-ÒTCUUKGT4GIKOGPVU)GMTÌPVGU/QPQITCOOÒDGT\YGK<GKNGP5EJTKHV&KG,CJTGU\CJNGP ºWOJGT.QTDGGTMTCP\OOI&KCMQX 4 /CTKGPD  4(GKPG2CVKPCXQT\ÒINKEJGU'ZGORNCT





97


NIKOLAUS I.

8474



6TCIDCTG GKPUGKVKIG 'KUGPIW­OGFCKNNG Q , WPUKIPKGTV CWH UGKPG )GOCJNKP #NGZCPFTC (GQFQTQYPC  

(TKGFGTKMG .WKUG %JCTNQVVG 9KNJGNOKPG 6QEJVGT (TKGFTKEJ 9KNJGNOU +++ XQP 2TGW­GP  ,WIGPFNKEJGU   $TWUVDKNFFGT<CTKPTOKVWOIGNGIVGO/CPVGNOOI&KCMQXp 8QT\ÒINKEJ



8475



#EJVGEMKIG5KNDGTOGFCKNNGQ,WPUKIPKGTVCWHFGP2TKP\GP#PFTGL-KTKNNQYKVUEJ4CUQWOQHHUM[  5V2GVGTUDWTIÓ9KGP<YGKO·PPNKEJG)GUVCNVGPJCNVGPDGJGNOVGP#FNGTUEJKNFWOIGDGPXQPFGT -GVVG FGU #PFTGCUQTFGPU KO *KPVGTITWPF IGMTÌPVGT 9CRRGPOCPVGN WPVGP 5EJTKHVDCPF'KPG <GKNG   5EJTKHVZZZOOI&KCMQXp 448QT\ÒINKEJ



8476



6TCIDCTG5KNDGTOGFCKNNGQ, IGUVKHVGV XQP#.[CNKP2T·OKGHÒTFKG2QEMGPKORHWPIXGTNKGJGP CP +ORH·T\VG )GMTÌPVGU $TWUVDKNF FGT <CTKP -CVJCTKPC ++ T OKV WOIGNGIVGO /CPVGN*[IKGKCUVGJVX XWPFJ·NVDGUEJÒV\GPFKJTG#TOGÒDGTUKGDGP-KPFGTFKGWOUKGXGTUCOOGNVUKPFOOI &KCMQX 4 5NI$TGVVCWGTXIN FQTVKP$TQP\G   44*ÒDUEJG2CVKPCMN4CPFHGJNGTUGJTUEJÌPpXQT\ÒINKEJ +O,CJTGNWF-CVJCTKPC++FGPGPINKUEJGP#T\V6JQOCU&KOUFCNGFGTGKP$WEJÒDGTFKG2QEMGPUEJWV\ KORHWPIXGTHC­VJCVVGPCEJ5V2GVGTUDWTIGKPWOFKG9KTMUCOMGKVUGKPGT+ORHOGVJQFGCOGKIGPGP.GKD\WVGUVGP YCUIGIGPFGP9KNNGPKJTGTT\VGIGUEJCJ#O1MVQDGTPCJO&KOUFCNGFKG+ORHWPIXQTKPFGOGTFGP #TO FGT <CTKP OKV GKPGT RQEMGPKPHK\KGTVGP .CP\GVVG TKV\VG 'U MCO \W MGKPGTNGK -QORNKMCVKQPGP CWEJ PKEJV DGK   KJTGO5QJP2CWN2GVTQYKVUEJ UR·VGT<CT2CWN+ FGTGDGPHCNNUIGKORHVYQTFGPYCT&WTEJFKGUGUOWVKIG$GKURKGN XGTJCNH-CVJCTKPCFGT2QEMGPUEJWV\KORHWPIKP4W­NCPF\WO&WTEJDTWEJ  <CT 0KMQNCWU + FGT FKG #WUICDG XQP 2T·OKGPOGFCKNNGP HÒT FKG 2QEMGPKORHWPI CP T\VGXGTCPNC­VGGJTVOKVFGT 8QTFGTUGKVGPFCTUVGNNWPIFKGUGT2T·IWPIGPFKGVCRHGTG<CTKP  &KCMQXHÒJTVFKGUG2T·OKGPOGFCKNNGPCWEJ\WU·V\NKEJWPVGTFGT4GIGPVUEJCHV-CVJCTKPCU++CWH UKGJG0THH  XGTNKGJGPYWTFGPUKGLGFQEJGTUVWPVGT0KMQNCWU+

98




ALEXANDER II.

8477

8478

<#4#.':#0&'4++ )QNFOÃ&#x2019;P\GPFGU<CTGP#NGZCPFGT++ 

4WDGN5V2GVGTUDWTII$KVMKP(D5EJN

)1.&8QT\Ã&#x2019;INKEJ





4WDGN5V2GVGTUDWTII$KVMKP(D5EJN

)1.&8QT\Ã&#x2019;INKEJ



8480

8479

8481

8482



 4WDGN  5V 2GVGTUDWTI +P 752NCUVKMJQNFGT FGT 2%)5 OKV FGT $GYGTVWPI /5  $KVMKP    (D5EJN )1.&8QT\Ã&#x2019;INKEJ





4WDGN5V2GVGTUDWTII$KVMKP(D5EJN  )1.&9KP\4CPFHGJNGTXQT\Ã&#x2019;INKEJ





4WDGN5V2GVGTUDWTII$KVMKP(D5EJN

)1.&8QT\Ã&#x2019;INKEJ





4WDGN5V2GVGTUDWTII$KVMKP(D5EJN

)1.&8QT\Ã&#x2019;INKEJ



8483

8484

8485

8486



4WDGN5V2GVGTUDWTII$KVMKP(D5EJN

)1.&8QT\Ã&#x2019;INKEJ





4WDGN5V2GVGTUDWTII$KVMKP(D5EJN

)1.&8QT\Ã&#x2019;INKEJ





4WDGN5V2GVGTUDWTII$KVMKP(D5EJN

)1.&8QT\Ã&#x2019;INKEJ





4WDGN5V2GVGTUDWTII$KVMKP(D5EJN

)1.&'VYCU$GNCIXQT\Ã&#x2019;INKEJ



8487

8488



4WDGN5V2GVGTUDWTII$KVMKP(D5EJN

)1.&8QT\Ã&#x2019;INKEJ





4WDGN5V2GVGTUDWTII$KVMKP(D5EJN

)1.&(CUVXQT\Ã&#x2019;INKEJ

 99


ALEXANDER II.

1,5:1



1,5:1

4WDGN5V2GVGTUDWTII$KVMKP(D5EJN  )1.&4'VYCUDGTKGDGPXQT\ÒINKEJ

1,5:1



8489

8490



1,5:1

4WDGN5V2GVGTUDWTII$KVMKP(D5EJN  )1.&49KP\-TCV\GTXQT\ÒINKEJ



8491

1,5:1

1,5:1

5KNDGTOÒP\GPFGU<CTGP#NGZCPFGT++ 

4WDGN5V2GVGTUDWTII$KVMKP&CXXIN  W­GTUVUGNVGPKPFKGUGT'TJCNVWPI-CDKPGVVUVÒEMXQPHGKPUVGT'TJCNVWPI 2TCEJVXQNNG2CVKPCRQNKGTVG2NCVVG

8492



8493



4WDGN5V2GVGTUDWTII$KVMKP&CX FQTVWPVGT0KMQNCWU+   9KP\4CPFHGJNGTXQT\ÒINKEJCWURQNKGTVGT2NCVVG





4WDGN5V2GVGTUDWTII$KVMKP&CX FQTVWPVGT0KMQNCWU+   (GKPG2CVKPCXQT\ÒINKEJ



100


ALEXANDER II.

8494

8495



4WDGN5V2GVGTUDWTII$KVMKP&CX FQTVWPVGT0KMQNCWU+   (GKPG2CVKPCHCUVXQT\ÒINKEJ





4WDGN5V2GVGTUDWTII$KVMKP 4 &CX FQTVWPVGT0KMQNCWU+   4(GKPG2CVKPCHCUVXQT\ÒINKEJ



8497

8498

8496

8499

8500



-QRGMGP5V2GVGTUDWTII$KVMKP

*ÒDUEJG2CVKPCXQT\ÒINKEJp5VGORGNINCP\





-QRGMGP5V2GVGTUDWTII$KVMKP  2TCEJVGZGORNCT*GTTNKEJG2CVKPCHCUV5VGORGNINCP\



  

-QRGMGP5V2GVGTUDWTII$KVMKP 2TCEJVGZGORNCT*GTTNKEJG2CVKPC5VGORGNINCP\ -QRGMGP5V2GVGTUDWTII$KVMKP *GTTNKEJG2CVKPCXQT\ÒINKEJp5VGORGNINCP\ -QRGMGP5V2GVGTUDWTII$KVMKP 4  48QT\ÒINKEJ

  

8501

8502



4WDGN5V2GVGTUDWTII$KVMKP&CX  5GNVGPGT,CJTICPI*ÒDUEJG2CVKPCHCUVXQT\ÒINKEJ





4WDGN5V2GVGTUDWTII$KVMKP&CX

5GJTUEJÌP



8503

8504



4WDGN5V2GVGTUDWTII$KVMKP&CX

5GJTUEJÌPpXQT\ÒINKEJ





4WDGN5V2GVGTUDWTII$KVMKP&CX  *ÒDUEJG2CVKPCYKP\-TCV\GTHCUVXQT\ÒINKEJ

 101


ALEXANDER II.

8506

8505

8505



4WDGN5V2GVGTUDWTII$KVMKP&CX



4WDGN 2QNVKPC 5V2GVGTUDWTII$KVMKP 4 

8QT\ÒINKEJ



5GNVGPGT,CJTICPI8QT\ÒINKEJ



8507

8508



4WDGN 2QNVKPC 5V2GVGTUDWTII$KVMKP 4 

45GJTUEJÌP





4WDGN 2QNVKPC 5V2GVGTUDWTII$KVMKP

(CUVXQT\ÒINKEJ



8510

8511

8512

8509

8509



4WDGN 2QNVKPC 5V2GVGTUDWTII$KVMKP



-QRGMGP5V2GVGTUDWTII$KVMKP 4 



-QRGMGP5V2GVGTUDWTII$KVMKP



-QRGMGP5V2GVGTUDWTII$KVMKP

8513

8515

8514



-QRGMGP5V2GVGTUDWTII$KVMKP



-QRGMGP5V2GVGTUDWTII$KVMKP 4 



8QT\ÒINKEJ



48QT\ÒINKEJ



2TCEJVGZGORNCT(CUV5VGORGNINCP\



*GTTNKEJG2CVKPCXQT\ÒINKEJ



8516

8517

*GTTNKEJG2CVKPCXQT\ÒINKEJp5VGORGNINCP\



445GJTUEJÌP



-QRGMGP5V2GVGTUDWTII$KVMKP

2TCEJVGZGORNCT5VGORGNINCP\





-QRGMGP5V2GVGTUDWTII$KVMKP

2TCEJVGZGORNCT(GKPG2CVKPCHCUV5VGORGNINCP\





-QRGMGP2CTKUQFGT5VTC­DWTII$KVMKP

102

(GKPG2CVKPC5VGORGNINCP\




ALEXANDER II.

8518

8519

8520

8521

-WRHGTOÒP\GPFGU<CTGP#NGZCPFGT++ 

-W-QRGMGP'MCVGTKPDWTII$KVMKP

8QT\ÒINKEJ





-W-QRGMGP'MCVGTKPDWTII$KVMKP

9KP\5EJTÌVNKPIUHGJNGTXQT\ÒINKEJ





-W-QRGMGP'MCVGTKPDWTII8GTRT·IWPI$KVMKP\W  +PVGTGUUCPVG8GTRT·IWPI5GJTUEJÌP





-W-QRGMGP'MCVGTKPDWTII8GTRT·IWPI8QTFGTUGKVGKPMWUG4ÒEMUGKVG$KVMKP\W +PVGTGUUCPVG8GTRT·IWPI5GJTUEJÌP



8522

8523



-W-QRGMGP'MCVGTKPDWTII8GTRT·IWPI8QTFGTUGKVGKPMWUG4ÒEMUGKVG$KVMKP\W +PVGTGUUCPVG8GTRT·IWPI5GJTUEJÌP





-W-QRGMGP!  'MCVGTKPDWTII8GTRT·IWPI$KVMKP\WHH  +PVGTGUUCPVG8GTRT·IWPI(CUVUGJTUEJÌP



8524

8525



-W-QRGMGP!!  'MCVGTKPDWTII8GTRT·IWPI4ÒEMUGKVGKPMWUG8QTFGTUGKVG $KVMKP\WHH +PVGTGUUCPVG8GTRT·IWPI5GJTUEJÌPpXQT\ÒINKEJ





-W-QRGMGP'MCVGTKPDWTII8GTRT·IWPI8QTFGTUGKVGKPMWUG4ÒEMUGKVG$KVMKP\W +PVGTGUUCPVG8GTRT·IWPI5EJÌPpUGJTUEJÌP

 103


ALEXANDER II.

8526

8527

8528

8529



-W-QRGMGP'MCVGTKPDWTII$KVMKP



-W-QRGMGP'MCVGTKPDWTII8GTRT·IWPI8QTFGTUGKVGKPMWUG4ÒEMUGKVG$KVMKP\W +PVGTGUUCPVG8GTRT·IWPI5EJÌPpUGJTUEJÌP

2QTÌUGT5EJTÌVNKPIXQT\ÒINKEJ

 



-W-QRGMGP'MCVGTKPDWTII8GTRT·IWPI8QTFGTUGKVGKPMWUG4ÒEMUGKVG$KVMKP\W +PVGTGUUCPVG8GTRT·IWPI5GJTUEJÌP





-W-QRGMGP'MCVGTKPDWTII8GTRT·IWPI$KVMKP\W  +PVGTGUUCPVG8GTRT·IWPI9KP\5EJTÌVNKPIUTK­UGJTUEJÌP



8532

8531

8530



-W-QRGMGPQ,  'MCVGTKPDWTII8GTRT·IWPI4ÒEMUGKVGKPMWUG8QTFGTUGKVG $KVMKP\WHH +PVGTGUUCPVG8GTRT·IWPI5GJTUEJÌP



&KG<WYGKUWPI\WT/ÒP\UV·VVG'MCVGTKPDWTIKUVPKEJVIGUKEJGTV



-W -QRGMGP Q , CD   'MCVGTKPDWTI  I 8GTRT·IWPI 4ÒEMUGKVG  KPMWUG 8QTFGTUGKVG   $KVMKP\WHH +PVGTGUUCPVG8GTRT·IWPI5GJTUEJÌP



&KG<WYGKUWPI\WT/ÒP\UV·VVG'MCVGTKPDWTIKUVPKEJVIGUKEJGTV



-W-QRGMG'MCVGTKPDWTII8GTRT·IWPI$KVMKP\W  +PVGTGUUCPVG8GTRT·IWPI5GJTUEJÌP

1,5:1

 104

8533



1,5:1

-W-QRGMG'MCVGTKPDWTII$KVMKP 4   8QPITQ­GT5GNVGPJGKV8QT\ÒINKEJp5VGORGNINCP\




ALEXANDER II.

1,5:1

8535

1,5:1

8534

8534



-W&GPG\JMC'MCVGTKPDWTII$KVMKP

8QT\ÒINKEJp5VGORGNINCP\





-W2QNWUEJMC'MCVGTKPDWTII$KVMKP  5GNVGPKPFKGUGT'TJCNVWPI8QT\ÒINKEJp5VGORGNINCP\



8536

8537



-W-QRGMGP'MCVGTKPDWTII$KVMKP 4   5GNVGPDGUQPFGTUKPFKGUGT'TJCNVWPI8QT\ÒINKEJ





-W-QRGMGP'MCVGTKPDWTII8GTRT·IWPI$KVMKP\W  +PVGTGUUCPVG8GTRT·IWPI(CUVUGJTUEJÌP



8539

8538



-W-QRGMGP'MCVGTKPDWTII8GTRT·IWPI$KVMKP\W  +PVGTGUUCPVG8GTRT·IWPI5GJTUEJÌP





-W-QRGMGP9CTUEJCWI$KVMKP

8QT\ÒINKEJ



8QT\ÒINKEJ





4WDGN5V2GVGTUDWTI&GPMOCNHÒT0KMQNCWU+I$KVMKP 4 &CX  5GNVGPDGUQPFGTUKPFKGUGT'TJCNVWPI2QNKGTVG2NCVVGOKPDGTKGDGP





4WDGN5V2GVGTUDWTI&GPMOCNHÒT0KMQNCWU+I$KVMKP&CX  5GJTUEJÌPpXQT\ÒINKEJ



1,5:1



8540

1,5:1

-W&GPG\JMC9CTUEJCWI$KVMKP

8541

8542

)GFGPMOÒP\GPFGU<CTGP#NGZCPFGT++

105


ALEXANDER II.

8543

8544



4WDGN5V2GVGTUDWTI&GPMOCNHÒT0KMQNCWU+I$KVMKP&CX  5GJTUEJÌPpXQT\ÒINKEJ





4WDGN5V2GVGTUDWTI&GPMOCNHÒT0KMQNCWU+I$KVMKP&CX



8545

8546

5GJTUEJÌP

8547

8548

8KGT0QXQFGNUXQP2TQDGOÒP\GPFGU<CTGP#NGZCPFGT++ 

-QRGMGP$TÒUUGN0QXQFGNFGT2TQDGKP-WRHGT<KPPI$KVMKP* 4   44(CUV5VGORGNINCP\





-QRGMGP$TÒUUGN0QXQFGNFGT2TQDGKP-WRHGT0KEMGN<KPPI$KVMKP* 4   44(CUV5VGORGNINCP\





-QRGMGP$TÒUUGN0QXQFGNFGT2TQDGKP-WRHGT0KEMGN<KPPI$KVMKP* 4   44(CUV5VGORGNINCP\





-QRGMGP$TÒUUGN0QXQFGNFGT2TQDGKP-WRHGT0KEMGN<KPPI$KVMKP* 4   44(CUV5VGORGNINCP\



'ZGORNCTFGT5COONWPI#PVQPKP2TQMQR6GKN#WMVKQP#WTGC0WOKUOCVKMC2TCI0T

'ZGORNCTFGT5COONWPI#PVQPKP2TQMQR6GKN#WMVKQP#WTGC0WOKUOCVKMC2TCI0T

8549 8550

8551

2T·IWPIGPHÒT(KPPNCPF 

/CTMMCC*GNUKPMKHÒT(KPPNCPFI$KVMKP(D FQTVWPVGT(KPPNCPF 5EJN FQTV WPVGT(KPPNCPF  )1.&8QT\ÒINKEJ





/CTMMC*GNUKPMKHÒT(KPPNCPFI$KVMKP

(GKPG2CVKPCXQT\ÒINKEJ





/CTMMC*GNUKPMKHÒT(KPPNCPFI$KVMKP  #VVTCMVKXGU'ZGORNCTOKVHGKPGT2CVKPCXQT\ÒINKEJ



106


ALEXANDER II.

8552 1,5:1



1,5:1

/CTMMC*GNUKPMKHÃ&#x2019;T(KPPNCPFI$KVMKP  5GJTUGNVGPKPFKGUGT'TJCNVWPI2QNKGTVG2NCVVGOKPDGTÃ&#x2019;JTV

8555

8553

8554



8556

8554



2GPPK·*GNUKPMKHÃ&#x2019;T(KPPNCPFI$KVMKP

(GKPG2CVKPCXQT\Ã&#x2019;INKEJp5VGORGNINCP\





-W2GPPK·*GNUKPMKHÃ&#x2019;T(KPPNCPFI$KVMKP

8QT\Ã&#x2019;INKEJp5VGORGNINCP\





-W2GPPK·*GNUKPMKHÃ&#x2019;T(KPPNCPFI$KVMKP  5GJTUGNVGPKPFKGUGT'TJCNVWPI*Ã&#x2019;DUEJG-WRHGTRCVKPCHCUV5VGORGNINCP\





-W2GPPK·*GNUKPMKHÃ&#x2019;T(KPPNCPFI$KVMKP  *Ã&#x2019;DUEJG2CVKPCXQT\Ã&#x2019;INKEJp5VGORGNINCP\CWURQNKGTVGT2NCVVG



8557

/GFCKNNGPFGU<CTGP#NGZCPFGT++ 

5KNDGTOGFCKNNG  XQP # .[CNKP WPF 8 #NGZGGX CWH FKG 'KPYGKJWPI FGT 5V +UCCMU-CVJGFTCNG KP   5V2GVGTUDWTI/GFCKNNQPFCTKPFCUIGJCTPKUEJVG$TWUVDKNF2GVGTU+TOKV.QTDGGTMTCP\WPFWOIGNGIVGO /CPVGN WOJGT HÃ&#x2019;PH YGKVGTG /GFCKNNQPU OKV FGP $TWUVDKNFGTP D\Y $Ã&#x2019;UVGP XQP -CVJCTKPC ++ 2CWN +   #NGZCPFGT + 0KMQNCWU + WPF #NGZCPFGT ++ FC\YKUEJGP .QTDGGT WPF 'KEJGP\YGKIG#PUKEJV FGT   -CVJGFTCNGOOI&KCMQX 4   8QPITQ­GT5GNVGPJGKV4GUVGCNVGT8GTIQNFWPIXQT\Ã&#x2019;INKEJ  107


ALEXANDER II.

8558 8559





8559

$TQP\GOGFCKNNG  XQP + %JWMOCUQX CWH FKG ,CJTHGKGT FGU TWUUKUEJGP 4GKEJGU /GFCKNNQP   FCTKP $ÒUVG N WOJGT (CJPGP OKV 5EJTKHV WPVGP -TÌPWPIUKPUKIPKGP9CRRGP WOIGDGP XQP FGT -GVVG   FGU#PFTGCUQTFGPUCWH9CRRGPOCPVGNOOI8GTRT·IWPI&KCMQX\W  +PVGTGUUCPVG8GTRT·IWPI5GJTUEJÌP



$TQP\GOGFCKNNG  XQP 8 #NGZGGX WPF + %JWMOCUQXCWHFKG,CJTHGKGTFGU/QUMCWGT(KPFGN JCWUGU$ÒUVGP#NGZCPFGTU++WPFUGKPGT)GOCJNKP/CTKC#NGZCPFTQYPC /CTKCXQP*GUUGP&CTOUVCFV 6QEJVGT .WFYKIU ++  PGDGPGKPCPFGT T QDGP UVTCJNGPFGU -TGW\9GKDNKEJG )GUVCNV UKV\V PCEJ TWPF   UVKNNV GKP -KPF KP FGT GTJQDGPGP 4GEJVGP J·NV UKG GKP HNCOOGPFGU *GT\ \W FGP 5GKVGP \YGK YGKVGTG   -KPFGT KO *KPVGTITWPF #PUKEJV FGU (KPFGNJCWUGU QDGP UVTCJNGPFGU &TGKGEM  OO  I   &KCMQX5EJÒV\$T 8QT\ÒINKEJ



8560



$TQP\GOGFCKNNG  XQP .GC #JNDQTP CWH FKG .Q[CNKV·V FGT HKPPKUEJGP $GXÌNMGTWPI PCEJ FGT RQNPK   UEJGP 4GXQNWVKQP WPF FKG 8QNMUXGTUCOONWPI XQP 2QTXQQ $ÒUVG T(ÒPH <GKNGP 5EJTKHV FC\YKUEJGP   #DUEJPKVVUNKPKGWOJGT'KEJGPMTCP\OOI&KCMQX  2TCEJVGZGORNCT(CUV5VGORGNINCP\



8561



108

8GTUKNDGTVG $TQP\GOGFCKNNG  XQP 8 #NGZGGX WPF 2 /GUEJGT[CMQX CWH FKG ,CJTHGKGT FGT   5VKHVWPIFGU5V)GQTIU1TFGPU$TWUVDKNFGTFGT<CTKP-CVJCTKPC++WPFFGU<CTGP#NGZCPFGT++PGDGP GKPCPFGTN&CTUVGNNWPIFGU5V)GQTIU1TFGPUOOI&KCMQX  9KP\4CPFHGJNGTUGJTUEJÌPpXQT\ÒINKEJ




ALEXANDER III.

8562



5KNDGTOGFCKNNG  XQP . 5VGKPOCP WPF # )TKNKEJGU CWH FCU L·JTKIG &KGPUVLWDKN·WO FGU TWUUK   UEJGP)GPGTCNU#NGZCPFGT#NGZGGXKEJ$CTCPVUQX7PKHQTOKGTVGU$TWUVDKNFFGU)GPGTCNUHCUVXX(Ã&#x2019;PH <GKNGP5EJTKHVWOJGT'KEJGPWPF.QTDGGT\YGKIFCTCWH#VVTKDWVGFGT#TVKNNGTKGOOI &KCMQX 4  8QPITQ­GT5GNVGPJGKV-CDKPGVVUVÃ&#x2019;EM2TCEJVXQNNG2CVKPCHCUV5VGORGNINCP\ 

8563

8564

<#4#.':#0&'4+++ )QNFOÃ&#x2019;P\GPFGU<CTGP#NGZCPFGT+++ 

4WDGN5V2GVGTUDWTII$KVMKP(D5EJN  )1.&9KP\4CPFHGJNGTXQT\Ã&#x2019;INKEJ





 4WDGN  5V 2GVGTUDWTI +P 752NCUVKMJQNFGT FGT 0)% OKV FGT $GYGTVWPI #7  $KVMKP    (D5EJN )1.&(CUVXQT\Ã&#x2019;INKEJXQT\Ã&#x2019;INKEJ



1,5:1



8565

1,5:1

4WDGN5V2GVGTUDWTII$KVMKP(D5EJN  )1.&5GNVGPDGUQPFGTUKPFKGUGT'TJCNVWPI8QT\Ã&#x2019;INKEJp5VGORGNINCP\



8566

1,5:1



1,5:1

4WDGN5V2GVGTUDWTII$KVMKP 4 (D5EJN  )1.&44-N4CPFHGJNGTHCUVXQT\Ã&#x2019;INKEJ

 109


ALEXANDER III.

8567 1,5:1

1,5:1



4WDGN5V2GVGTUDWTII$KVMKP(D5EJN  )1.&440WT'ZGORNCTGIGRT·IV-N5EJTÌVNKPIUHGJNGTUGJTUEJÌPpXQT\ÒINKEJ

8568

  

8570

8569

4WDGN5V2GVGTUDWTII$KVMKP(D5EJN 4WDGN5V2GVGTUDWTII$KVMKP(D5EJN 4WDGN5V2GVGTUDWTII$KVMKP(D5EJN

8571



)1.&5GJTUEJÌPpXQT\ÒINKEJ )1.&8QT\ÒINKEJp5VGORGNINCP\ )1.&8QT\ÒINKEJ

  

8573

8572

5KNDGTOÒP\GPFGU<CTGP#NGZCPFGT+++ 

4WDGN5V2GVGTUDWTII$KVMKP&CX FQTVWPVGT#NGZCPFGT++   5GJTUGNVGPKPFKGUGT'TJCNVWPI2TCEJVGZGORNCT(CUV5VGORGNINCP\

 

4WDGN5V2GVGTUDWTII$KVMKP&CX 4WDGN5V2GVGTUDWTII$KVMKP&CX



8QT\ÒINKEJ 5GJTUEJÌP

 



4WDGN5V2GVGTUDWTII$KVMKP&CX  5GNVGPKPFKGUGT'TJCNVWPI*GTTNKEJG2CVKPCXQT\ÒINKEJp5VGORGNINCP\





4WDGN5V2GVGTUDWTII$KVMKP&CX

8574

110

8575

9KP\4CPFHGJNGTUGJTUEJÌPpXQT\ÒINKEJ




ALEXANDER III.

8576

1,5:1



1,5:1

4WDGN5V2GVGTUDWTII$KVMKP 4 &CX  5GNVGPGT,CJTICPIKPCW­GTIGYÌJPNKEJGT3WCNKV·V2TCEJVGZGORNCT5VGORGNINCP\

8577

 

8578

4WDGN5V2GVGTUDWTII$KVMKP&CX 4WDGN5V2GVGTUDWTII$KVMKP&CX

8579

 



5GJTUEJÌP 5GJTUEJÌP

 

9KP\4CPFHGJNGTHCUVXQT\ÒINKEJ 9KP\4CPFHGJNGTUGJTUEJÌP

 

8580

4WDGN5V2GVGTUDWTII$KVMKP&CX 4WDGN5V2GVGTUDWTII$KVMKP&CX

8582 8581

  

-QRGMGP5V2GVGTUDWTII$KVMKP 4  -QRGMGP5V2GVGTUDWTII$KVMKP -QRGMGP5V2GVGTUDWTII$KVMKP

8583

4#VVTCMVKXGUXQT\ÒINKEJGU'ZGORNCT *ÒDUEJG2CVKPCUGJTUEJÌP 2TCEJVGZGORNCT5VGORGNINCP\

   111


ALEXANDER III.

8584

8585

8586



-QRGMGP5V2GVGTUDWTII$KVMKP

2TCEJVGZGORNCT*GTTNKEJG2CVKPC5VGORGNINCP\





-QRGMGP5V2GVGTUDWTII$KVMKP  5GNVGPG8CTKCPVG2TCEJVGZGORNCT(CUV5VGORGNINCP\





-QRGMGP5V2GVGTUDWTII$KVMKP

2TCEJVGZGORNCT5VGORGNINCP\



8589

8587

8588

-WRHGTOÒP\GPFGT/ÒP\UV·VVG5V2GVGTUDWTI 

-W-QRGMGPQ,5V2GVGTUDWTII8GTRT·IWPI4ÒEMUGKVGKPMWUG8QTFGTUGKVG$KVMKP\W +PVGTGUUCPVG8GTRT·IWPI5GJTUEJÌP



-W-QRGMGPQ,5V2GVGTUDWTII8GTRT·IWPI4ÒEMUGKVGKPMWUG8QTFGTUGKVG$KVMKP\W +PVGTGUUCPVG8GTRT·IWPI(CUVUGJTUEJÌP



-W-QRGMG5V2GVGTUDWTII$KVMKP

8QT\ÒINKEJ





4WDGN5V2GVGTUDWTICWHUGKPG-TÌPWPII$KVMKP&CX  *ÒDUEJG2CVKPCXQT\ÒINKEJ





4WDGN5V2GVGTUDWTICWHUGKPG-TÌPWPII$KVMKP&CX

8QT\ÒINKEJ





4WDGN5V2GVGTUDWTICWHUGKPG-TÌPWPII$KVMKP&CX  (CUVXQT\ÒINKEJXQT\ÒINKEJ





4WDGN5V2GVGTUDWTICWHUGKPG-TÌPWPII$KVMKP&CX

(CUVXQT\ÒINKEJ





4WDGN5V2GVGTUDWTICWHUGKPG-TÌPWPII$KVMKP&CX  5GJTUEJÌPpXQT\ÒINKEJXQT\ÒINKEJ





4WDGN5V2GVGTUDWTICWHUGKPG-TÌPWPII$KVMKP&CX



&KG<WYGKUWPI\W#NGZCPFGT+++KUVPKEJVIGUKEJGTV



&KG<WYGKUWPI\W#NGZCPFGT+++KUVPKEJVIGUKEJGTV



8590

8591

)GFGPMOÒP\GPFGU<CTGP#NGZCPFGT+++

8592

112

8593

5GJTUEJÌPpXQT\ÒINKEJ


ALEXANDER III.

8596

1,5:1

1,5:1

'KPG2TQDGRT·IWPIFGT/ÒP\UV·VVG5V2GVGTUDWTI 

-QRGMGP5V2GVGTUDWTI2TQDGKP0KEMGNI$KVMKP 4 

 448QT\ÒINKEJp5VGORGNINCP\

'ZGORNCTFGT5COONWPI#PVQPKP2TQMQR6GKN#WMVKQP#WTGC0WOKUOCVKMC2TCI0T



8597

8598



8598

'KPG2T·IWPIHÒT(KPPNCPF

2GPPK·*GNUKPMKHÒT(KPPNCPFI$KVMKP

*ÒDUEJG2CVKPCXQT\ÒINKEJ



/GFCKNNGPFGU<CTGP#NGZCPFGT+++ 

8GTIQNFGVG$TQP\GOGFCKNNGOKVFGP5KIPCVWTGP'9WPF*2CWHUGKPG-TÌPWPIKP/QUMCW &KG $ÒUVGP XQP #NGZCPFGT +++ WPF UGKPGT )GOCJNKP /CTKC (GFQTQYPC PGDGPGKPCPFGT T ÒDGT   XGTDWPFGPGP.QTDGGT\YGKIGPQDGPUVTCJNGPFGU)QVVGUCWIG)GMTÌPVGYGKDNKEJG)GUVCNVVJTQPVXXOKV <GRVGT5EJKNFWPF4GKEJUCRHGNOOI&KCMQX 4  48QT\ÒINKEJ #NGZCPFGT +++ YCT FGT \YGKVG 5QJP #NGZCPFGTU ++   WPF FGUUGP GTUVGT )GOCJNKP /CTKG XQP *GUUGP   &CTOUVCFV &KG 'TOQTFWPI FGU 8CVGTU CO  /·T\  FWTEJ GKP 5RTGPIUVQHHCVVGPVCV FGT CPCTEJKUVKUEJGP   1TICPKUCVKQP0CTQFPCLC9QNLC 8QNMUYKNNG DGGKPFTWEMVGFGPLWPIGP<CTGPPCEJJCNVKI'T\QIOKVUGKPGT(COKNKG KP GKP IWV DGYCEJVGU *QEJUKEJGTJGKVUUEJNQ­ KP FGP 2GVGTUDWTIGT 8QTQTV )CVUEJKPC WPF ITÒPFGVG  FGP   5KEJGTJGKVUFKGPUV1EJTCPPQLG1VFGNGPKGFGTFKG#WHICDGPGKPGTRQNKVKUEJGP)GJGKORQNK\GKYCJTPCJO#PUVCVVFKG RQNKVKUEJG -TKUG FGU .CPFGU \W GPVUEJ·THGP WPF UQOKV NCPIHTKUVKI GKPGT 4GXQNWVKQP XQT\WDGWIGP JQD GT PCEJ WPF   PCEJ CNNG .KDGTCNKUKGTWPIUXQTUVÌ­G UGKPGU 8CVGTUCWHWPFDGHCJNFKG&GRQTVCVKQP\CJNTGKEJGT-TKVKMGTPCEJ5KDKTKGP 9·JTGPF UGKPGT 4GIKGTWPIU\GKV GTNGDVG 4WUUNCPF FKG +PFWUVTKCNKUKGTWPI FGTGP UKEJVDCTGU 'TIGDPKU FGT $CW FGT   6TCPUUKDKTKUEJGP'KUGPDCJPKUV



8599

8600





8600

5KNDGTLGVQPWPUKIPKGTVXQP#)TKNKEJGUCWHUGKPG-TÌPWPIKP/QUMCW)GMTÌPVGU/QPQITCOO &TGK<GKNGP5EJTKHVQDGP-TQPGOOI&KCMQX  2TCEJVXQNNG2CVKPCXQT\ÒINKEJp5VGORGNINCP\



6TCIDCTG UKNDGTPG 8GTFKGPUVOGFCKNNG Q , XQP # )TKNKEJGU $ÒUVG T5EJPWTMTGKU WOJGT 5EJTKHV KP   XKGTHCEJGO.KPKGPMTGKUOOI&KCMQX FQTVQJPG6TCIGÌUG4   8QPITQ­GT5GNVGPJGKV*ÒDUEJG2CVKPCYKP\4CPFHGJNGTYKP\-TCV\GTXQT\ÒINKEJ

 113


ALEXANDER III.

8601



5KNDGTOGFCKNNGWPUKIPKGTVXQP58C\JGPKP2T·OKGFGT+PVGTPCVKQPCNGP#WUUVGNNWPIHÒT1DUVCPDCW KP5V2GVGTUDWTI5EJTKHVVCHGNFCTÒDGTXGTUEJKGFGPG1DUVUQTVGPWPVGP\YGKIGMTGW\VG.QTDGGT\YGKIG )·TVPGTUVGJVPCEJNWPFIT·DVOKVGKPGO5RCVGPGKP.QEJWOGKPGPLWPIGP$CWOGKP\WRHNCP\GPXQT KJO UKV\V GKPG YGKDNKEJG )GUVCNV OKV -KPF FCU GKPGP #RHGN KP FGT NKPMGP *CPF J·NV OKV KJTGT .KPMGP   TGKEJVUKGFGO)·TVPGTFGPLWPIGP$CWOWOJGT·NVGTG1DUVD·WOGOOI&KCMQX

4  442TCEJVXQNNG2CVKPCXQT\ÒINKEJ 

8602

8603









114

8604

8603

5KNDGTPG8GTFKGPUVOGFCKNNGQ, IGUVKHVGV XQP.5VGKPOCPXGTNKGJGPHÒT4GVVWPICWU.GDGPUIG HCJT$ÒUVGTCO*CNUCDUEJPKVVFKG5VGORGNUEJPGKFGTUKIPCVWT&TGK<GKNGP5EJTKHVFCTWPVGT#DUEJPKVVU NKPKGOOI&KCMQXp XINFQTVOKVFGT5VGORGNUEJPGKFGTUKIPCVWTWPVGTFGT$ÒUVG  5GJTUEJÌP



5KNDGTOGFCKNNG Q , XQP 8 0KMQPQX 2T·OKG FGT /·FEJGPUEJWNG HÒT FGP GTHQNITGKEJGP #DUEJNW­   $TWUVDKNFFGT<CTKP/CTKC(GQFQTQYPCT/KPGTXCOKV.QTDGGTMTCP\KPFGT4GEJVGPWPF¤NNCORGKPFGT GTJQDGPGP .KPMGP UVGJV X X WOIGDGP XQP #VVTKDWVGPFGT9KUUGPUEJCHVGPFKGCWHFGO$QFGPNKGIGP OOI&KCMQXXCT 4FQTVOKV5VGORGNUEJPGKFGTUKIPCVWTCWH8QTFGTWPF4ÒEM UGKVG  42TCEJVGZGORNCT+P1TKIKPCNGVWK DGUEJ·FKIV 5VGORGNINCP\



6TCIDCTG 5KNDGTOGFCKNNG  WPUKIPKGTV XQP # )TKNKEJGU CWH UGKPGP 6QF XGTNKGJGP CP 2TKGUVGT   HÒJTGPFG1HHK\KGTGWPFTCPIJÌJGTG$GCOVGFKGWPVGT#NGZCPFGT+++IGFKGPVJCDGP-QRHTN.QTDGGT \YGKI&KG 4GIKGTWPIUFCVGP  QDGP -TQPG WPVGP -TGW\  OO  I &KCMQX    8QT\ÒINKEJ



6TCIDCTG UKNDGTPG 8GTFKGPUVOGFCKNNG  WPUKIPKGTV XQP # )TKNKEJGU CWH UGKPGP 6QF XGTNKGJGP   CP2TKGUVGTHÒJTGPFG1HHK\KGTGWPFTCPIJÌJGTG$GCOVGFKGWPVGT#NGZCPFGT+++IGFKGPVJCDGP$ÒUVGT N .QTDGGT\YGKI&KG 4GIKGTWPIUFCVGP  QDGP -TQPG WPVGP -TGW\  OO  I   &C\WGKPG/KPKCVWTOGFCKNNG\WO#PUVGEMGP&KCMQX 5VÒEM5GJTUEJÌP




NIKOLAUS II.

8607

8606

<#40+-1.#75++ )QNFOÒP\GPFGU<CTGP0KMQNCWU++ 

4WDGN5V2GVGTUDWTII$KVMKP 4 (D5EJN



4WDGN5V2GVGTUDWTII$KVMKPXCT(D5EJN

8608

8609

8610

 )1.&5GJTUEJÌPpXQT\ÒINKEJ



)1.&8QT\ÒINKEJ



8612

8611



4WDGN5V2GVGTUDWTII$KVMKPXCT(D5EJN  )1.&5GJTUEJÌPpXQT\ÒINKEJ





4WDGN5V2GVGTUDWTII$KVMKPXCT(D5EJN  )1.&-N-TCV\GTUGJTUEJÌPpXQT\ÒINKEJ





4WDGN5V2GVGTUDWTII$KVMKP(D5EJN

)1.&8QT\ÒINKEJ





4WDGN5V2GVGTUDWTII$KVMKP(D5EJN )1.&8QT\ÒINKEJp5VGORGNINCP\





4WDGN5V2GVGTUDWTII$KVMKP 4 (D5EJN  )1.&45GJTUEJÌPpXQT\ÒINKEJXQT\ÒINKEJ



8613

8614

8615

8616

8617



4WDGN5V2GVGTUDWTII$KVMKP(D5EJN

)1.&8QT\ÒINKEJ





4WDGN5V2GVGTUDWTII$KVMKP(D5EJN

)1.&5GJTUEJÌP





4WDGN5V2GVGTUDWTII$KVMKP(D5EJN

)1.&5GJTUEJÌPpXQT\ÒINKEJ





4WDGN5V2GVGTUDWTII$KVMKP(D5EJN  )1.&2TCEJVGZGORNCT(CUV5VGORGNINCP\





4WDGN5V2GVGTUDWTII$KVMKP 4 (D5EJN  )1.&5GNVGPGT,CJTICPI8QT\ÒINKEJ

 115


NIKOLAUS II.

8618

8619

5KNDGTOÒP\GPFGU<CTGP0KMQNCWU++ 

4WDGN5V2GVGTUDWTII$KVMKP&CX  2TCEJVGZGORNCT/KP4CPFHGJNGTHCUV5VGORGNINCP\





4WDGN5V2GVGTUDWTII$KVMKP&CX

8QT\ÒINKEJ





4WDGN5V2GVGTUDWTIIWPFI$KVMKP&CX Z   5VÒEM-N-TCV\GTGVYCUHNGEMKIHCUVXQT\ÒINKEJ



8621

8622

8623



4WDGN5V2GVGTUDWTII$KVMKP&CX

9KP\-TCV\GTXQT\ÒINKEJ





4WDGN5V2GVGTUDWTII$KVMKP&CX  2TCEJVGZGORNCT9KP\-TCV\GTRQNKGTVG2NCVVG 6KP[UETCVEJGU2TQQH





4WDGN5V2GVGTUDWTII$KVMKP&CX  2TCEJVGZGORNCT*GTTNKEJG2CVKPCHCUV5VGORGNINCP\



8624

1,5:1

 116

1,5:1

4WDGN5V2GVGTUDWTII$KVMKP 4 &CX  5GNVGPGT,CJTICPIKPCW­GTIGYÌJPNKEJGT3WCNKV·V2QNKGTVG2NCVVG




NIKOLAUS II.

8625



4WDGN5V2GVGTUDWTII$KVMKP 4 &CX

5GNVGPGT,CJTICPI(CUVUGJTUEJÌP



8626

1,5:1



1,5:1

4WDGN5V2GVGTUDWTII$KVMKP 4 &CX  5GNVGPGT,CJTICPIKPCW­GTIGYÌJPNKEJGT'TJCNVWPI-CDKPGVVUVÒEM2QNKGTVG2NCVVG 2TQQH

8627

 

4WDGN5V2GVGTUDWTII$KVMKP 4 &CXp \W  4WDGN5V2GVGTUDWTII$KVMKP 4 &CX

8629



8628

5GNVGPGT,CJTICPI5GJTUEJÌP 5GNVGPGT,CJTICPI5GJTUEJÌP

 

8630



4WDGN5V2GVGTUDWTII$KVMKP 4 &CXp \W   5GNVGPGT,CJTICPI#VVTCMVKXGU'ZGORNCTOKVHGKPGT2CVKPCXQT\ÒINKEJ





4WDGN5V2GVGTUDWTII$KVMKP&CX



-N4CPFHGJNGTHCUV5VGORGNINCP\

117


NIKOLAUS II.

8631

8632



4WDGN5V2GVGTUDWTII$KVMKP&CX

9KP\4CPFHGJNGTHCUVXQT\ÒINKEJ





4WDGN5V2GVGTUDWTII$KVMKP 4 &CX  $GUUGTGT,CJTICPI(GKPG2CVKPCUGJTUEJÌPpXQT\ÒINKEJ



8633

1,5:1

1,5:1



-QRGMGP5V2GVGTUDWTII$KVMKP 4   44*GTTNKEJG2CVKPCMN4CPFHGJNGTRQNKGTVG2NCVVG



8634

1,5:1



1,5:1

-QRGMGP5V2GVGTUDWTII$KVMKP 4   8QPITÌ­VGT5GNVGPJGKV*ÒDUEJG2CVKPCXQT\ÒINKEJGU'ZGORNCTXQPRQNKGTVGP5VGORGNP



8635 1,5:1

 118

1,5:1

-QRGMGP5V2GVGTUDWTII$KVMKP 4   8QPITQ­GT5GNVGPJGKVDGUQPFGTUKPFKGUGT'TJCNVWPI*GTTNKEJG2CVKPCRQNKGTVG2NCVVG




NIKOLAUS II.

8637

8636

8638

8639



-QRGMGP5V2GVGTUDWTII$KVMKP  2TCEJVGZGORNCT*GTTNKEJG2CVKPCHCUV5VGORGNINCP\





-QRGMGP5V2GVGTUDWTII$KVMKP  2TCEJVGZGORNCT*GTTNKEJG2CVKPCHCUV5VGORGNINCP\



 

-QRGMGP5V2GVGTUDWTII$KVMKP -QRGMGP5V2GVGTUDWTII$KVMKP

8641

2TCEJVGZGORNCT(CUV5VGORGNINCP\ *GTTNKEJG2CVKPCXQT\ÒINKEJp5VGORGNINCP\

8642

8640

 

-QRGMGP5V2GVGTUDWTII$KVMKP 4  -QRGMGP5V2GVGTUDWTII$KVMKP 4 



 -QRGMGP  5V 2GVGTUDWTI +P752NCUVKMJQNFGTFGT0)%OKVFGT$GYGTVWPI2($KVMKP 2TCEJVGZGORNCT2QNKGTVG2NCVVG

8643

 

442TCEJVGZGORNCT(CUV5VGORGNINCP\ 4(CUV5VGORGNINCP\

  

8644



4WDGN2CTKUI$KVMKP&CX

8QT\ÒINKEJ



4WDGN  2CTKU OKV \YGK TGEJVGEMKIGP )GIGPUVGORGNP Z XQP   CWHFGT8QTFGTUGKVGI $KVMKP FQTVQJPG)GIGPUVGORGN &CX FQTVQJPG)GIGPUVGORGN  445GJTUEJÌP

8645

 

8645 1,5:1



4WDGN$TÒUUGN2TQDGI$KVMKP 4 &CX\W  8QPITÌ­VGT5GNVGPJGKV5EJÌPpUGJTUEJÌP

 119


NIKOLAUS II.

8646

8647

 

-WRHGTOÒP\GPFGU<CTGP0KMQNCWU++

-W-QRGMGP5V2GVGTUDWTII$KVMKP -W-QRGMG5V2GVGTUDWTII$KVMKP

1,5:1



8648

8647

-N4CPFHGJNGTXQT\ÒINKEJ (CUV5VGORGNINCP\

 

1,5:1

-W-QRGMG5V2GVGTUDWTII$KVMKP 4   5GNVGPDGUQPFGTUKPFKGUGT'TJCNVWPI2QNKGTVG2NCVVG



3:1

8649

8649

'KPJCNDGT+ORGTKCNXQP 

120

 4WDGN  +ORGTKCN   5V 2GVGTUDWTI  I $ÒUVG N)GMTÌPVGT &QRRGNCFNGT OKV <GRVGT WPF   4GKEJUCRHGNKPFGP(·PIGPCWHFGT$TWUV5V)GQTIUUEJKNFWOJGTFKG-GVVGFGU#PFTGCUQTFGPUCWHFGP (NÒIGNP LG XKGT YGKVGTG 9CRRGPUEJKNFG QDGP -TQPG /KV 4CPFUEJTKHV $KVMKP  4  (D    5EJN )1.&8QPITÌ­VGT5GNVGPJGKV0WT'ZGORNCTGIGRT·IV2TCEJVGZGORNCT 8QT\ÒINKEJp5VGORGNINCP\ 


NIKOLAUS II.

8650

8651

)GFGPMOÒP\GPFGU<CTGP0KMQNCWU++ 

4WDGN5V2GVGTUDWTICWHUGKPG-TÌPWPII$KVMKP&CX

(CUVXQT\ÒINKEJ





4WDGN5V2GVGTUDWTICWHUGKPG-TÌPWPII$KVMKP&CX

5GJTUEJÌP



8652

1,5:1



1,5:1

4WDGN5V2GVGTUDWTI&GPMOCNHÒT#NGZCPFGT+++I$KVMKP 4 &CX  4-CDKPGVVUVÒEM2TCEJVXQNNG2CVKPCXQT\ÒINKEJp5VGORGNINCP\

8653

8654



8655



4WDGN5V2GVGTUDWTI&GPMOCNHÒT#NGZCPFGT+++I$KVMKP 4 &CX  4-N5EJTÌVNKPIUHGJNGTCO4CPFGVYCUDGTKGDGPUGJTUEJÌPpXQT\ÒINKEJ



4WDGN5V2GVGTUDWTICWHFKG,CJTHGKGTFGU5KGIGUÒDGT0CRQN¾QPI$KVMKP&CX <CRQPKGTVMN4CPFHGJNGTXQT\ÒINKEJ





4WDGN5V2GVGTUDWTICWHFKG,CJTHGKGTFGU5KGIGUÒDGT0CRQN¾QPI$KVMKP&CX 5GJTUEJÌP





121


NIKOLAUS II.

8656

1,5:1

1,5:1



4WDGN  5V 2GVGTUDWTI )CPIWV4WDGN IGRT·IV CWH FKG ,CJTHGKGT FGU 5GGUKGIGU DGK *CPIÌ  

)CPIWV ÒDGTFKG5EJYGFGPI$KVMKP 4 &CX  442TCEJVGZGORNCT(CUV5VGORGNINCP\  +P FGT 5GGUEJNCEJV XQP *CPIÌ HKPPKUEJ *CPMQ  YWTFG FGT UEJYGFKUEJG #FOKTCN 'JTGPUMLÌNF XQP TWUUKUEJGP   5GGUVTGKVMT·HVGPIGHCPIGPIGPQOOGP

8657 1,5:1

1,5:1

'KPG2TQDG-WRHGTOÒP\GFGT/ÒP\UV·VVG5V2GVGTUDWTI 

-W-QRGMGP5V2GVGTUDWTI2TQDGI$KVMKP 4   8QPITQ­GT5GNVGPJGKV5VGORGNINCP\



8659

8658

<YGK2T·IWPIGPHÒT(KPPNCPF 

 /CTMMCC  *GNUKPMK HÒT (KPPNCPF  I $KVMKP  (D  FQTV WPVGT (KPPNCPF  5EJN   

FQTVWPVGT(KPPNCPF  )1.&(CUV5VGORGNINCP\





/CTMMCC*GNUKPMKHÒT(KPPNCPFI$KVMKP 4 (D FQTVWPVGT(KPPNCPF 5EJN

FQTVWPVGT(KPPNCPF  )1.&5GNVGPGT,CJTICPI(CUV5VGORGNINCP\



8660

/GFCKNNGPFGU<CTGP0KMQNCWU++ 

122

5KNDGTOGFCKNNG Q , WO   XQP # 4KXGF CWH FKG HTCP\ÌUKUEJTWUUKUEJG (TGWPFUEJCHV 9GKDNKEJGU   $TWUVDKNF KP TWUUKUEJGT -NGKFWPI HCUV X X FGP -QRH PCEJ N IGYCPFV.GGTGU /GFCKNNQP N <YGKIT YGKDNKEJG )GUVCNV OKV .QTDGGT\YGKI WPF -TCP\  OO  I &KCMQX p \W  4 FQTV   CPFGTGT&WTEJOGUUGT  44#VVTCMVKXGU'ZGORNCTOKVJÒDUEJGT2CVKPCXQT\ÒINKEJ




NIKOLAUS II.

8661



4GEJVGEMKIG 5KNDGTRNCMGVVG  XQP / .CODGTV CWH FGP $GUWEJ FGU <CTGP WPF UGKPGT )GOCJNKP   #NGZCPFTC (GQFQTQYPC KO 5EJNQ­ XQP 8GTUCKNNGU CO  1MVQDGT )GHNÃ&#x2019;IGNVGT )GPKWU UKV\V PCEJ TWPF J·NV GKP 5EJKNF KP FGT .KPMGP FCTCWH FKG +PKVKCNGP 4( KO *KPVGTITWPF 5QPPGPCWHICPI OKV 5EJTKHV\WI   4755+'#PUKEJVFGU5EJNQUUGUOKVFGO#RQNNQ$TWPPGPQDGPHÃ&#x2019;PH<GKNGP5EJTKHVZOO I&KCMQX 4  44#VVTCMVKXGU'ZGORNCTOKVJÃ&#x2019;DUEJGT2CVKPCXQT\Ã&#x2019;INKEJ



8662



5KNDGTOGFCKNNG  XQP # )TKNKEJGU CWH FKG +PFWUVTKG WPF -WPUVCWUUVGNNWPI KP 0K\JP[ 0QYIQTQF   -QRHN4WUUKCUVGJVXXOKV2CNO\YGKIKPFGT4GEJVGPOKVFGT.KPMGPDGMT·P\VUKGGKPGO·PPNKEJG WPF GKPG YGKDNKEJG )GUVCNV FKG XQT KJT MPKGP KO *KPVGTITWPF #PUKEJV FGU #WUUVGNNWPIUIGD·WFGU   OOI&KCMQX 4  49KP\4CPFHGJNGTHCUVXQT\Ã&#x2019;INKEJ



8663



$TQP\GOGFCKNNQP  XQP # )TKNKEJGU CWH FCU PGWGTTKEJVGVG &GPMOCN #NGZCPFGTU ++ GTDCWV     -QRH #NGZCPFGTU ++ N#PUKEJV FGU &GPMOCNU  OO  I &KCMQX  4    8QT\Ã&#x2019;INKEJ

 123


NIKOLAUS II.

8664



5KNDGTOGFCKNNGXQP0&OKVTKGXCWHFKG,CJTHGKGTFGU-CXCNNGTKGTGIKOGPVUXQPFGT)CTFGFGT -CKUGTKP/CTKC(GQFQTQYPC/GFCKNNQPFCTKPFCUIGJCTPKUEJVG$TWUVDKNF2GVGTU+NOKV.QTDGGTMTCP\ WPFWOIGNGIVGO/CPVGNWOJGTHÒPHYGKVGTG/GFCKNNQPUOKVFGP$ÒUVGPXQP0KMQNCWU++#NGZCPFGT+ 2CWN + /CTKC 2CXNQXPC WPF #NGZCPFTC (GQFQTQYPC FC\YKUEJGP .QTDGGT WPF 'KEJGP\YGKIG QDGP   IGMTÌPVGT&QRRGNCFNGT)GMTÌPVGT&QRRGNCFNGTOKV<GRVGTWPF4GKEJUCRHGNKPFGP(·PIGPCWHFGT$TWUV FGTITKGEJKUEJG9CRRGPUEJKNFWPVGP5VCPFCTVGP6TQOOGNPWPF2QUCWPGP/KV4CPFITCXWTOO I&KCMQX 4  44*ÒDUEJG2CVKPCYKP\4CPFHGJNGTXQT\ÒINKEJ 

8666

8665





124

8665

8GTUKNDGTVG $TQP\GOGFCKNNG  XQP ( 4C\WOP[ CWH FKG )TWPFUVGKPNGIWPI FGT 2CTKUGT $TÒEMG   #NGZCPFTG +++ FWTEJ <CT 0KMQNCWU ++ WPF <CTKP #NGZCPFTC (GQFQTQYPC CPN·­NKEJ FGT 2CTKUGT 9GNV   CWUUVGNNWPI  &TGK CPVKM IGMNGKFGVG YGKDNKEJG )GUVCNVGP UVGJGP WPVGT FGO 2QTVT·V #NGZCPFGTU +++   9GKDNKEJG)GUVCNVWPFGKP-KPFOKVGKPGO5EJTKHVDCPFNKGIGPCPGKPGO$CWOKO*KPVGTITWPF#PUKEJV FGT$TÒEMGWPVGP<GKNGP5EJTKHV/KV4CPFITCXWT$410<'OOI&KCMQX 4  8QT\ÒINKEJ



5KNDGTOGFCKNNGQ, WOITCXKGTV WPUKIPKGTVXQP#8CU[WVKPUM[2T·OKGFGU(KPCP\OKPK UVGTKWOU XGTNKGJGP HÒT (NGK­ WPF 5QTIHCNV -QRH N5KGDGP <GKNGP 5EJTKHV WOJGT 'KEJGPMTCP\ /KV   4CPFITCXWT FCTKPGPVJCNVGPFKG,CJTGU\CJN OOI&KCMQX 4   44-N4CPFHGJNGTHCUVXQT\ÒINKEJ




NIKOLAUS II.

8667



$TQP\GOGFCKNNG Q , WO   WPUKIPKGTV XQP#8CU[WVKPUM[WPF52QIQPQX2T·OKGFGU(KPCP\ OKPKUVGTKWOU XGTNKGJGP HÒT (NGK­ WPF 5QTIHCNV -QRH N5KGDGP <GKNGP 5EJTKHV WOJGT 'KEJGPMTCP\   OOI&KCMQX 8QT\ÒINKEJ



8668



6TCIDCTG UKNDGTPG 8GTFKGPUVOGFCKNNG Q , WO   WPUKIPKGTV XQP # 8CU[WVKPUM[ WPF -NGPQX   (NGK­RT·OKG HÒT -CWHNGWVG #TDGKVGT $CWGTP 7PVGTQHHK\KGTG WPF -KTEJGPRHNGIGT FKG FGT 4GIKGTWPI   &KGPUVG GTDTCEJV JCVVGP -QRH N5EJTKHV PGDGP XGTUEJNWPIGPGP .QTDGGT 2CNO WPF 'KEJGP\YGKIGP   OOI&KCMQX 4  44-N-TCV\GTXQT\ÒINKEJ

8669



8670



6TCIDCTG IQNFGPG 8GTFKGPUVOGFCKNNG Q ,   WPUKIPKGTV XQP # 8CU[WVKPUM[ (NGK­RT·OKG HÒT   -CWHNGWVG #TDGKVGT $CWGTP 7PVGTQHHK\KGTG WPF -KTEJGPRHNGIGT FKG FGT 4GIKGTWPI &KGPUVG GTDTCEJV   JCVVGP-QRHN5EJTKHVPGDGPXGTUEJNWPIGPGP.QTDGGT2CNOWPF'KEJGP\YGKIGPOOI &KCMQX 4  )1.&48QT\ÒINKEJ 



6TCIDCTGIQNFGPG8GTFKGPUVOGFCKNNGQ,WPUKIPKGTVXQP#8CU[WVKPUM[(NGK­RT·OKGHÒT-CWHNGWVG #TDGKVGT$CWGTP7PVGTQHHK\KGTGWPF-KTEJGPRHNGIGTFKGFGT4GIKGTWPI&KGPUVGGTDTCEJVJCVVGP-QRHN 5EJTKHVPGDGPXGTUEJNWPIGPGP.QTDGGT2CNOWPF'KEJGP\YGKIGPOOI&KCMQX 4  )1.&4+P\GKVIGPÌUUKUEJGO'VWK#PTQVpYGK­GO$CPFXQT\ÒINKEJ  125


SOWJETUNION

8671

1,5:1



1,5:1

6TCIDCTGIQNFGPG6CRHGTMGKVUOGFCKNNG-NCUUGQ,WPUKIPKGTV$ÒUVGN&TGK<GKNGP5EJTKHVFC\YK UEJGP#DUEJPKVVUNKPKGWPF)TCXWT0QOOI&KCMQX 4   )1.&8QPCNNGTITÌ­VGT5GNVGPJGKV5GJTUEJÌPpXQT\ÒINKEJ

8672



8673



6TCIDCTGUKNDGTPG6CRHGTMGKVUOGFCKNNG-NCUUGQ,WPUKIPKGTV$ÒUVGN&TGK<GKNGP5EJTKHVFC\YK UEJGP#DUEJPKVVUNKPKGWPF)TCXWT0QOOI&KCMQX 4  5GJTUEJÌP





6TCIDCTGUKNDGTPG6CRHGTMGKVUOGFCKNNG-NCUUGQ,WPUKIPKGTV$ÒUVGN&TGK<GKNGP5EJTKHVFC\YK UEJGP#DUEJPKVVUNKPKGWPF)TCXWT0QOOI&KCMQX 4   5GJTUEJÌPpXQT\ÒINKEJ



8675

8674

<9'+4755+5%*'+/+6#6+10'0 0+'&'4.0&+5%*'44+66'4&7-#6'0 

&WMCV5V2GVGTUDWTII+OKVCVKQPGKPGUPKGFGTN·PFKUEJGP4KVVGTFWMCVGP$KVMKP(D 5EJNp )1.&-TCV\GTHCUVXQT\ÒINKEJ





&WMCV5V2GVGTUDWTII+OKVCVKQPGKPGUPKGFGTN·PFKUEJGP4KVVGTFWMCVGP$KVMKP(D 5EJNp )1.&8QT\ÒINKEJ



8676

519,'670+10  126

-QRGMGP;GQ

-N-TCV\GTRQNKGTVG2NCVVG




SOWJETUNION

8677 (1:2)



5GV XQP  /GK­PGT 2QT\GNNCPOGFCKNNGP  XQP ' )TQ­GT CWH FKG ,CJTHGKGT FGT 0QXGODGT   TGXQNWVKQP *COOGTWPF5KEJGNIGMTGW\VQDGP5QYLGVUVGTP4QVCTOKUVGPDGKO5VWTOCWHFGP9KPVGT RCNCUV KP 5V 2GVGTUDWTI   5VCCVUYCRRGP FGT 5QYLGVWPKQP&GT 4QVG 2NCV\ OKV FGT $CUKNKWUMCVJGFTCNG   WPFFGO-TGON&WTEJOGUUGTDGKFGT/GFCKNNGPECOO9GKIGNV  5VÒEM5VGORGNINCP\



8678

2:1

2:1



-QRGMGP2TQDGI-CKO2  8QPITQ­GT5GNVGPJGKV/KPDGCTDGKVGVYKP\4CPFHGJNGTHCUVXQT\ÒINKEJ



/ÒP\UCV\DGUVGJGPFCWUWPF-QRGMGP

ex 8680

8681

5VÒEM8QT\ÒINKEJp5VGORGNINCP\

8682

 

8684



5GTKGXQP)QNFOGFCKNNGP\WWPF&WMCVGPQ,  WPUKIPKGTVCWHFGP)GDWTVUVCIFGU TWUUKUEJGP5VCCVUITÒPFGTU9NCFKOKT+NLKVUEJ.GPKP 5KODKTUMÓ)QTMKLDGK/QUMCW9CRRGP \YKUEJGPIGDÒPFGNVGPJTGPWPVGP6CHGNOKV\YGK<GKNGP5EJTKHV$TWUVDKNF.GPKPUJCNDN OO I OOI OOI  5VÒEM)1.&+P1TKIKPCNGVWKU2QNKGTVG2NCVVG

 

4WDGN 6UEJGTYQPG\ .GPKPITCFI(GKPIQNF(D5EJN 4WDGN 6UEJGTYQPG\ /QUMCWI(GKPIQNF(D5EJN



5GTKGXQP4WDGN 6UEJGTYQPG\ FGT,CJTI·PIG Z +PUIGUCOVI(GKP IQNF(D Z 5EJN  5VÒEM)1.&+P1TKIKPCNGVWK8QT\ÒINKEJWPFDGUUGT

)1.&5VGORGNINCP\ )1.&5VGORGNINCP\

   



4WDGN/QUMCW5QRJKGP-CVJGFTCNGKP0QYIQTQFI(GKPIQNF(D5EJN  )1.&2QNKGTVG2NCVVG





4WDGN/QUMCW5QRJKGP-CVJGFTCNGKP0QYIQTQFI(GKPIQNF(D5EJN  )1.&2QNKGTVG2NCVVG

 127


SOWJETUNION

8687

8686

8688 Pd

8688 Pd



 4WDGN  /QUMCW /CTK·*KOOGNHCJTVU-CVJGFTCNG FGU -TGON KP /QUMCW  I (GKPIQNF   (D5EJN )1.&2QNKGTVG2NCVVG





4WDGN/QUMCW-KTEJGXQOJGKNKIGP'T\GPIGN)CDTKGNKP/QUMCWI(GKPIQNF(D 5EJN )1.&2QNKGTVG2NCVVGOKPDGTÒJTV





4WDGN.GPKPITCF4WUUKUEJGU$CNNGVVIHGKP(D$5EJN  2#..#&+7/5VGORGNINCP\



8689

8692

8690 Pt

8691

4'27$.+-5'+6 

4WDGN/QUMCW.CPFUKV\2CUMQX 2CUEJMQY KP/QUMCWI(GKPIQNF(D5EJN )1.&2QNKGTVG2NCVVG





 4WDGN 2NCVKP  5V 2GVGTUDWTI  ,CJTG 1N[ORKUEJG 5RKGNG FGT 0GW\GKV  &TGUUWTTGKVGP   IHGKP(D5EJN 2.#6+02QNKGTVG2NCVVGOKPDGTÒJTV





'KPUGKVKIGU5KNDGTMNKUEJGGKP4WDGN)TÌ­GQ,  $CNNGVV6·P\GTKP#PPC2CYNQYC 2QNKGTVG2NCVVG





4WDGN5V2GVGTUDWTI$CKMCNVWPPGNI(GKPIQNF(D5EJN  )1.&2QNKGTVG2NCVVG



8693 (1:2)

 128

4WDGN/QUMCW<QDGNWPF5VCFVCPUKEJVI(GKPUKNDGT;GQ  40WT'ZGORNCTGIGRT·IV2QNKGTVG2NCVVG




LOTS UND SAMMLUNGEN

ex 8695

8694

8696



4WDGN5V2GVGTUDWTI(GNFOCTUEJCNN5WXQTQXI(GKPIQNF(D  )1.&440WT'ZGORNCTGIGRT·IV2QNKGTVG2NCVVG





4WDGN5EJPGGNGQRCTF+PUIGUCOVI(GKPIQNF(D  5VÒEM)1.&2QNKGTVG2NCVVG





 4WDGN  /QUMCW 5KDKTKGP  I (GKPIQNF 44 PWT  'ZGORNCTG IGRT·IV  (D    &C\W4WDGN5KDKTKGP;GQ )1.&2QNKGTVG2NCVVG



.16570&5#//.70)'0 4755+5%*'4/ª0<'070&/'&#+..'0 

-CVJCTKPC ++  (CUV MQORNGVVG 5GTKG FGT -W -QRGMGP FGT /ÒP\UV·VVG 'MCVGTKPDWTI    OKV #WUPCJOG FGT ,CJTI·PIG  WPF  &KG ,CJTI·PIG  WPF  UKPF FQRRGNV   XQTJCPFGP 5VÒEM5GJTUEJÌPWPFDGUUGT





-W-QRGMGP5W\WP -QN[XCP HÒT5KDKTKGP$KVMKP  5VÒEM4CPFHGJNGT Z UGJTUEJÌP





-W -QRGMGP  'MCVGTKPDWTI $KVMKP  &C\W 'NKUCDGVJ  -W -QRGMGP    /QUMCW4QVGT/ÒP\JQH Z $KVMKP 5VÒEM5GJTUEJÌPpXQT\ÒINKEJ





#NGZCPFGT+++-QRGMGP-QRGMGPCNNG/ÒP\UV·VVG5V2GVGTU DWTI&C\W#NGZCPFGT++-QRGMGP-QRGMGPDGKFG/ÒP\UV·VVG5V2GVGTUDWTI#NNGKP 752NCUVKMJQNFGTFGT0)%OKVFGP$GYGTVWPIGP/5  /5 Z WPF/5    5VÒEM(CUV5VGORGNINCP\





0KMQNCWU++4WDGN Z 4WDGN4WDGN Z  Z   Z  Z +PUIGUCOVI(GKPIQNF&C\W/KPKCVWTIQNFOGFCKNNGP  5VÒEM)1.&/GKUVUGJTUEJÌP 



4WDGN Z  Z  4QOCPQX -QRGMGP Z  Z &C\W#NGZCP FGT+++-QRGMGP5QYLGVWPKQP4WDGN Z  5VÒEM5EJÌPpXQT\ÒINKEJ





-QRGMGP-QRGMGPCNNG/ÒP\UV·VVG5V2GVGTUDWTI&C\W#NGZCPFGT++ -QRGMGP5V2GVGTUDWTI 5VÒEM8QT\ÒINKEJ





#NNIGOGKP&KXGTUG6TQRHMQRGMGPFGU,CJTJWPFGTVU



7OHCPITGKEJG 5COONWPI XQP /ÒP\GP FGU <GKVTCWOGU  XQP FGT -W -QRGMG DKU \WO    4WDGN FCTWPVGT \CJNTGKEJG 5VÒEMG KP JÒDUEJGP 3WCNKV·VGP *QEJKPVGTGUUCPVGU 1DLGMV DKVVG   DGUKEJVKIGP 5VÒEM5GJTUEJÌPpHCUV5VGORGNINCP\ 



5COONWPI TWUUKUEJGT /ÒP\GP FGU  ,CJTJWPFGTVU XQP FGT -W -QRGMG DKU \W  4WDGNP   FCTWPVGTXKGNGUGNVGPG5VÒEMGWC4WDGN +XCP+++   $QTQFKPQ&GPMOCN  &GPMOCNHÒT0KMQNCWU+  -TÌPWPI  &GPMOCNHÒT#NGZ CPFGT ++  2QNVKPC    2GVGT +++  GVE 'KP JQEJKPVGTGUUCPVGU 1DLGMV FCU PGDGP XKGNGP   5GNVGPJGKVGP CWEJ GKPKIG 0QXQFGNU UQYKG 5COONGTH·NUEJWPIGP GPVJ·NV &KG 5COONWPI UQNNVG WPDGFKPIV   DGUKEJVKIVYGTFGPWPFYKTFQJPGLGINKEJGU1DNKIQCPIGDQVGP 5VÒEM+P#NDGP (CUVU·OVNKEJG5VÒEMGIGTGKPKIVWPF\CRQPKGTVGKPKIGOKV(GJNGTPUEJÌPpXQT\ÒINKEJ 

5VÒEM5GJTUEJÌP



129


PRÄGUNGEN DER STADT KAFFA 

-NGKPG 5COONWPI XQP TWUUKUEJGP/ÒP\GPFGU<GKVTCWOUXQPFGT-W-QRGMGDKU\WO 4WDGNWC4WDGN &GPMOCNHÒT0KMQNCWU+   Z  Z  Z 2QNVKPCGVE*QEJKPVGTGU UCPVGU.QVDKVVGDGUKEJVKIGP 5VÒEM6GKNYGKUGOKV(GJNGTPUEJÌPpXQT\ÒINKEJ





7OHCPITGKEJG 5COONWPI XQP /ÒP\GP FGU  ,CJTJWPFGTVU XQP FGT -W -QRGMG DKU \WO   4WDGNFCTWPVGTCWEJDGUUGTG6[RGPWPF,CJTI·PIG+PVGTGUUCPVGU1DLGMVDKVVGDGUKEJVKIGP  5VÒEM5EJÌPpUGJTUEJÌP 



&KXGTUG/ÒP\GPWPF/CTMGPFGU,CJTJWPFGTVUXQPFGT-W-QRGMGDKU\WO4WDGNWC4WDGN -QRGMGP $KVMKP FKXGTUG9GTVOCTMGPOKVTWUUKUEJGP)GIGPUVGO RGNPGVE+PVGTGUUCPVGU.QVDKVVGDGUKEJVKIGP 5VÒEM5EJÌPpUGJTUEJÌP





-QPXQNWVXQP/GFCKNNGPFGU,CJTJWPFGTVUFCTWPVGTGKPKIG5KNDGTOGFCKNNGPUQYKGUGNVGPG5VÒEMG *QEJKPVGTGUUCPVGU.QVDKVVGDGUKEJVKIGP 5VÒEM<WO6GKNOKV(GJNGTPUEJÌPpXQT\ÒINKEJ





-NGKPG 5COONWPI XQP TWUUKUEJGP /ÒP\GP WPF /GFCKNNGP FGU  ,CJTJWPFGTVU W C GKPG $TQP\G   OGFCKNNG XQP 0KMQNCWU +   &C\W  RQNPKUEJG 2T·IWPIGP W C  <NQV[EJ   WPF GKPG   RTGW­KUEJG$TQP\GOGFCKNNG %QNQODG[  5VÒEM6GKNYGKUGOKV(GJNGTPUEJÌPpXQT\ÒINKEJ





4WDGN -TÌPWPI <NQV[EJ 4WDGN /9FC\W YGKVGTG-NGKPOÒP\GP+PVGTGUUCPVGU.QVDKVVGDGUKEJVKIGP 5VÒEM/GKUVUGJTUEJÌP





 4WDGN    -QRGMGP ! ,CJTGU\CJN WPFGWVNKEJ    )TKXGPPKM     -QRGMGP Z  5VÒEM5EJÌPpUGJTUEJÌP





4WDGN   4WDGN 2QNVKPC    -QRGMGP   -QRGMGP   CNNG /ÒP\UV·VVG   5V2GVGTUDWTI 5VÒEM/KVMN(GJNGTPOGKUVUGJTUEJÌP





4WDGN-QRGMGP-QRGMGP-QRGMGP-QRGMGP Z   Z -W-QRGMGP 5VÒEM5GJTUEJÌPpXQT\ÒINKEJ





-NGKPGU-QPXQNWVXQPTWUUKUEJGP-WRHGTOÒP\GPFGU,CJTJWPFGTVUXQPFGT-W-QRGMGDKU \WO-W-QRGMGP5VÒEM+PVGTGUUCPVGU.QVOKVVGKNYGKUGJÒDUEJGP'TJCNVWPIGPDKVVGDGUKEJVKIGP  5VÒEM/GKUVUGJTUEJÌP





&KXGTUG -WRHGTOÒP\GP FGU  ,CJTJWPFGTVU XQP FGT &GPIC DKU \W  -QRGMGP FCTWPVGT DGUUGTG   6[RGPWPF,CJTI·PIG+PVGTGUUCPVGU.QVDKVVGDGUKEJVKIGP 5VÒEM/GKUVUGJTUEJÌP





.QVXQP0QVOÒP\GPFGU,CJTJWPFGTVU-W-QRGMG-W-QRGMG  5VÒEM5GJTUEJÌP





&KXGTUG-WWPF/GUUKPIOÒP\GPWCHÒT$WMJCTCWPF-JYCTK\O %JQTGUO   5VÒEM/GKUVUGJTUEJÌP



$'&'76'0&'5'4+'810)'07'5+5%*'024)70)'0 &'456#&6-#((##7(&'4+05'.-4+/

8720



-CHHC 5VCFV WPVGT FGT -QPVTQNNG )GPWCU EC  Õ#URGT Q , PCEJ    I   %1/80' Û +#08' Û +0 Û %#(' +O 0COGP XQP 6KOWT 3WVNWIJ -JCP   .WPCTFK %   4GVQYUMK2N+ /KVXQNNUV·PFKINGUDCTGT.GIGPFG8QPITQ­GT5GNVGPJGKV5GJTUEJÌPGU'ZGORNCT



ex 8721



 130

Õ#URGT/KVFGP0COGPXGTUEJKGFGPGTVCTVCTKUEJGT-JCPG WC&CYNCV$KTFK*CLLK)KTC[+ WPF/CJOWF .WPCTFK% Z %%%%%% Z %  Z % 5VÒEM6GKNYGKUGUGNVGP5EJÌPpUGJTUEJÌP



Õ#URGT  I /KV FGO 0COGP /WJCOCF -JCPU  &C\W Õ#URGT  I /KV FGO   0COGP&CYNCV$KTFK-JCPU.WPCTFK%WPF% 5VÒEM5GJTUEJÌP




PRÄGUNGEN DER STADT KAFFA

8723



8725

8724

Õ#URGTI/KVFGO0COGP*CLLK)KTC[+-JCPUWPFFGT7OUEJTKHV %Û%44'Û + Û 4)  -QPUWN )KQXCPPK .QTGP\Q FGNNC )CDGNNC !  .WPCTFK %  4GVQYUMK 2N +8 XIN   p 5GNVGPKPFKGUGT'TJCNVWPI5GJTUEJÌPpXQT\ÒINKEJ





Õ#URGTI/KVFGO0COGP*CLLK)KTC[+-JCPUWPFFGT7OUEJTKHV Û%Û%#('Û DÛ+Û -QPUWN2CQNQ+ORGTKCNG! .WPCTFK%4GVQYUMK2N8XINHH 5GJTUEJÌP





“(CNU  I -CUVGNN XQP )GPWC \W FGP 5GKVGP %  #  4  #6COIC 5[ODQN .WPCTFK %    4GVQYUMK2N8+ 45EJÌPpUGJTUEJÌP



8726



8728

8727

“(CNUI Û%Û=#Û?(=(?#Û;Û;-CUVGNNXQP)GPWCFCTKP&TGKRWPMV6COIC5[ODQNFCTKP 5VGTP.WPCTFK%4GVQYUMK2N8+XCT  #W­GTIGYÌJPNKEJIWVCWUIGRT·IVHÒTFKGUGP6[RUGJTUEJÌP





“(CNU  I  Ù % Ù # Ù ( Ù ( Ù # Û ; Û ; -CUVGNN XQP )GPWC6COIC 5[ODQN CW­GP 5VGTPGP   MTCP\.WPCTFK%4GVQYUMK2N8+ 8QNNUV·PFKICWUIGRT·IVGT5EJTÌVNKPIIWVGUUGJTUEJÌP





Õ#URGTI Û&Û)Û%#4#Û)-CUVGNNXQP)GPWC/CNVGUGTMTGW\KPFGP9KPMGNP%# (#.WPCTFKp4GVQYUMKp 8QPITÌ­VGT5GNVGPJGKV#VVTCMVKXGUUGJTUEJÌPGU'ZGORNCT



&KG XQTNKGIGPFG 2T·IWPI GPVUVCPF PCEJ FGT ªDGTICDG FGT 5VCFV WPF FGT -QNQPKG CP FKG $CPEQ FK 5CP )KQTIKQ   5KGRT·UGPVKGTVMGKPGTNGKVCTVCTKUEJG0COGPQFGT5[ODQNG*KPVGTFGP$WEJUVCDGP&WPF)CO$GIKPPFGT 8QTFGTUGKVGPNGIGPFGMÌPPVGUKEJCWEJFGT0COGGKPGUWPDGMCPPVGP-QPUWNUXGTDGTIGP

8729

1,5:1



1,5:1

“(CNU “&QRRGNHCNU! I&GT*GKNKIG)GQTITGKVGVPCEJNWPFVÌVGVFGP&TCEJGPOKVGKPGT.CP\G 6COIC 5[ODQN CW­GP 5VGTPGPMTCP\ .WPCTFK %  FQTV PWT CNU “p(CNU  4GVQYUMK 2N 8+  FQTV   PWTCNU“p(CNU  8QPITÌ­VGT5GNVGPJGKV(CUVUGJTUEJÌP



&KG&CTUVGNNWPIFGT8QTFGTUGKVGMÌPPVGKP8GTDKPFWPIOKVFGTªDGTICDGFGT8GTYCNVWPIFGTIGPWGUKUEJGP-QNQPKG CPFKG$CPEQFK5CP)KQTIKQUVGJGP&KG8GTYGPFWPIFGU6COIC5[ODQNUMÌPPVGFCTCWHUEJNKG­GPNCUUGP FCUUFKGUGT6[RCO#PHCPIFGT2T·IWPIUVGJV

8730

8731

8732



“(CNUI&GT*GKNKIG)GQTITGKVGVPCEJNWPFVÌVGVFGP&TCEJGPOKVGKPGT.CP\G6COIC5[O DQN.WPCTFK%4GVQYUMK2N8+ 45EJÌPpUGJTUEJÌP





Õ#URGT +O 0COGP XQP 7NWIJ /WJCOOCF -JCP   I 6COIC 5[ODQN-CUVGNN XQP   )GPWC.WPCTFK%D4GVQYUMK2N8+5EJNWODGTIGTXIN2N:8++HH  442T·IGUEJY·EJGUGJTUEJÌP



9CJTUEJGKPNKEJPCJOFKGCNU5EJYCT\GT6QFQFGT2GUVDG\GKEJPGVG5GWEJGXQP-CHHCCWUKJTGP9GI GPVNCPIFGT*CPFGNUYGIGFGT)GPWGUGT-QNQPKGP



“(CNUI.WPCTFK% FQTVKP5KNDGT 4GVQYUMK2N8+

45EJÌPpUGJTUEJÌP

 131


SILBERBARREN

8734

8733

8736



“(CNUI.WPCTFK% FQTVKP5KNDGT 4GVQYUMK2N8+  8QPITQ­GT5GNVGPJGKV4CPFCWUIGDTQEJGPUGJTUEJÌP





Õ#URGT.WPCTFK%4GVQYUMK2N8+

44#VVTCMVKXGUHCUVUGJTUEJÌPGU'ZGORNCT





“(CNUIWPFI.WPCTFK% FQTVKP5KNDGT 4GVQYUMKXIN2N8+WPF  5VÒEM5EJÌPpUGJTUEJÌP





“(CNUIIWPFI.WPCTFK% FQTVKP5KNDGT 4GVQYUMKXIN2N8+WPF  5VÒEM5EJÌPpUGJTUEJÌP



8739 8740

8737



“(CNUI.WPCTFK% FQTVKP5KNDGT 4GVQYUMKXIN5#PO

&WPMGNITÒPG2CVKPCUEJÌP





“(CNU  I WPF  I /ÌINKEJGTYGKUG MQOOV CWEJ GKPG CPFGTG IGPWGUKUEJG /ÒP\UV·VVG CO   5EJYCT\GP/GGTHÒTFKG2T·IWPIKP(TCIG.WPCTFKp4GVQYUMKp 5VÒEM5EJÌPpUGJTUEJÌP





“(CNU/KVWPDGMCPPVGO)GIGPUVGORGN UGEJUUVTCJNKIGT5VGTP IIWPFI.WPCTFKp 4GVQYUMKp 5VÒEM45EJÌPpUGJTUEJÌP



019)141& 

5VCFV &GPIC WO   I <YGK )GUVCNVGP8KGT <GKNGP 5EJTKHV 5RCUUMK &CU TWUUKUEJG   /ÒP\U[UVGO5#DDXCT *ÒDUEJG2CVKPCUGJTUEJÌP



8741

<9'+5+.$'4$#44'0#75&'//+66'.#.6'4 

$CTTGP \W   5QNQVPKMK UQIGPCPPVG -KGYGT )TKXPC EC  ,CJTJWPFGTV  .·PINKEJUGEJU   GEMKIG(QTOZOOI 445GJTUEJÌPGUWPFJKUVQTKUEJKPVGTGUUCPVGU1DLGMV  &CU TWUUKUEJG /KVVGNCNVGT KUV XQO  DKU  ,CJTJWPFGTV QJPG PGPPGPUYGTVG /ÒP\RT·IWPI IGDNKGDGP #NU <CJ   NWPIUOKVVGNFKGPVGKPFKGUGT<GKV5KNDGTKP$CTTGPHQTOFGUUGP*CWRVV[RGPFKG-KGYGTWPF0QYIQTQFGT)TKXPCU UKPF 9·JTGPF FKG 0QYIQTQFGT $CTTGP GKPG N·PINKEJG 5VCDHQTO CWHYGKUGP UKPF FKG -KGYGT 'ZGORNCTGFWTEJGKPG FGWVNKEJIGFTWPIGPGTGUGEJUGEMKIG(QTOIGMGPP\GKEJPGV+JT)GYKEJVKUVFGO$[\CPVKPKUEJGPGPVNGJPVWPFNKGIVWO FKG  I YCU   5QNQVPKMK   I  GPVURTKEJV +JTG 1DGTHN·EJG \GKIV GKPG FGWVNKEJG $NCUGPDKNFWPI WPF   YKTMV FCFWTEJ UGJT TCWJ &KGU N·UUV 4ÒEMUEJNÒUUG CWH FGP )W­XQTICPI \W DGK FGO YQJN (QTOGP CWU 6QP \WO   'KPUCV\ MCOGP FKG PQEJ GKPGP JQJGP (GWEJVKIMGKVUIGJCNV DGUC­GP CNUQ PKEJV XQNNUV·PFKI CWUIGVTQEMPGV YCTGP   'KPKIG )TKXPCU YGKUGP )GIGPUVGORGN CWH CPFGTG \GKIGP .KPKGPOCTMKGTWPIGP WPF 4KV\WPIGP CWH KJTGT 1DGTHN·EJG   YGNEJGUKGHÒTFGP7ONCWHKPGKPGODGUVKOOVGP(ÒTUVGPVWO\WN·UUKIOCEJVGP&C$CTTGPKPFGTXQTNKGIGPFGP(QTO PWTHÒTUGJTITQ­G)GNF\CJNWPIGPXGTYGPFGVYGTFGPMQPPVGPTWJVGPUKGYCJTUEJGKPNKEJGJGTKPFGP5EJCV\MCOOGTP FGT JGTTUEJGPFGP 1DGTUEJKEJV CNU FC­ UKG CWH FGP CNNV·INKEJGP /·TMVGP CP\WVTGHHGP YCTGP &GUJCND IGJÌTGP UKG   JGWVG \W FGP ITQ­GP 5GNVGPJGKVGP FGT TWUUKUEJGP )GNFIGUEJKEJVG <W FGP 5KNDGTDCTTGP FGT OÒP\NQUGP <GKV XIN   -CKO 4 &KG CNVTWUUKUEJG /ÒP\IGUEJKEJVG WPF FKG 2T·IWPIGP XQP  *CIGP  5  WPF    5RCUUMK+)&CUTWUUKUEJG/ÒP\U[UVGO$GTNKP5 

132


SILBERBARREN

8742



$CTTGP UQIGPCPPVG -KGYGT )TKXPC EC  ,CJTJWPFGTV  .·PINKEJUGEJUGEMKIG (QTO OKV CDIG   RNCVVGVGO'PFGZOOI  44*QEJKPVGTGUUCPVGU1DLGMVKPUGJTUEJÌPGT3WCNKV·V  /ÌINKEJGTYGKUG JCPFGNV GU UKEJ DGK FGO XQTNKGIGPFGP 1DLGMV WO GKPGP FGT XQP 5RCUUMK CNU 6UEJGTPKIQYGT DG   \GKEJPGVGP$CTTGP&KGUG1DLGMVGUVGNNGPGKPG/KUEJHQTOCWU-KGYGT)TKXPC UGEJUGEMKIG(QTO WPF0QYIQTQFGT )TKXPC JQJGU )GYKEJV  FCT 5KG YWTFGP XGTOWVNKEJ KP FGT \YGKVGP *·NHVG FGU  ,CJTJWPFGTVU KO (ÒTUVGPVWO   9QNP[JGTIGUVGNNV 5RCUUMK+)&CUTWUUKUEJG/ÒP\U[UVGO$GTNKP5 

133


RUSSISCHE ORDEN UND EHRENZEICHEN

4755+5%*'14&'070&'*4'0<'+%*'0 #75'+0'4#.6'0$'.)+5%*'05#//.70)

8743

<#4'067/ $+5 14&'0 

-CKUGTNKEJGT 1TFGP FGU JN #RQUVGNU #PFTGCU FGU 'TUVDGTWHGPGP =Îðäåí èìïåð±òîðñêèé Ñâÿòîãî   Àïîñòîëà Àíäðåÿ Ïåðâîçâàííîãî?$TWUVUVGTP/QFGNN OKV&QRRGNCFNGTOKVCWHIGNGIVGO#PFTGCU MTGW\  &WTEJOGUUGT  OO 5KNDGT VNY XGTIQNFGV /GFCKNNQPCWHNCIGP )QNF WPF 5KNDGT XGTIQNFGV   VNYGOCKNNKGTVOGJTGTG·NVGTGQDGTHN·EJNKEJG#DURNKVVGTWPIGPKPFGTDNCWGP'OCKNNGFGU/GFCKNNQPTKPIU CWH FGT 4ÒEMUGKVG GKPGU 5VTCJNGPDÒPFGNU RWP\KGTV  UQPUV MGKPGTNGK 2WP\GP UKEJVDCT CP YQJN UR·VGT   GTI·P\VGT IGNQEMGTVGT /GUUKPIUEJTCWDG OKV /GUUKPIUEJTCWDUEJGKDG WPF 7PVGTNCIUUEJGKDG KP $TQP\G   XGTUKNDGTV447<- 44++  'UJCPFGNVUKEJJKGTDGKOÌINKEJGTYGKUGWOGKPGPCNVTGUVCWTKGTVGPWPFTGRCTKGTVGP$TWUVUVGTP

  &GTGKPMNCUUKIGJÌEJUVGTWUUKUEJG1TFGPYWTFGXQP<CT2GVGT+#NGZGLGYKVUEJ FGT)TQ­Gņ OKV7MCU XQO  0QXGODGT  IGUVKHVGV 'T YWTFG FGO GTUVGP XQP %JTKUVWU DGTWHGPGP #RQUVGN #PFTGCU IGYKFOGV FGO   2CVTQP4W­NCPFU'TUVCO#RTKNFGO6CIUGKPGT-TÌPWPIYWTFGPXQP<CT2CWN+2GVTQYKVUEJ   FKG1TFGPUUVCVWVGPCRRTQDKGTV#NUDGUQPFGTGT)PCFGPGTYGKUFGU<CTGPMQPPVGFGT1TFGPKP$TKNNCPVGPXGTNKGJGP YGTFGP5GKVFGO#WIWUVMQPPVGPIGO·­GKPGTLGYGKNKIGPRGTUÌPNKEJGP'PVUEJGKFWPIFGU<CTGP4KVVGTFGU 5V #PFTGCU1TFGPU FKG FGP GPVURTGEJGPFGP 1TFGP PQEJ PKEJV GTJCNVGP JCVVGP INGKEJ\GKVKI OKV FKGUGO CWEJ FGP   5V#NGZCPFGT0GYUM[1TFGPWPFFKG-NCUUGFGU5V#PPGP1TFGPUGTJCNVGP#DFGO&G\GODGTMQPPVG FGT9GK­G#FNGT1TFGPWPFCDECCWEJFKG-NCUUGFGU5V5VCPKUNCWU1TFGPUFC\WXGTNKGJGPYGTFGP5EJQP CD FGO  /CK  YCT FKG #WUICDG FGT -QNNCPG FGU 5V #PFTGCU1TFGPU CWEJ CP #WUN·PFGT OÌINKEJ #O   1MVQDGTGTHQNIVGCWEJFKG)GPGJOKIWPIFGT$TWUVUVGTPGHÒT0KEJV%JTKUVGP   YWTFGFKG8GTNGKJWPIXQP$TWUVUVGTPGPKP/GVCNNQHHK\KGNNIGPGJOKIV/KVMCKUGTNKEJGO7MCU<CT#NGZCPFGT++ 0KMQNCLGYKVUEJ   XQO  #WIWUV  YWTFGP IGMTGW\VG 5EJYGTVGT CWH FGP +PUKIPKGP HÒT 8GTNGKJWPIGP   HÒT6CRHGTMGKVKO-CORHIGPGJOKIV&KG8GTNGKJWPIGPFGU1TFGPUINKGFGTPUKEJCWHYKGHQNIVXQPDKU 8GTNGKJWPIGPXQPDKU8GTNGKJWPIGPWPFXQPDKUWPIGH·JT8GTNGKJWPIGP   8QP FGT 2TQXKUQTKUEJGP 4GIKGTWPI  ÒDGTPQOOGP LGFQEJ PKG XGTNKGJGP YWTFG GT XQP FGP $QNUEJGYKMK CDIG   UEJCHHVCNNGTFKPIUCNU*CWUQTFGPGKPGU<YGKIGUFGTMCKUGTNKEJGP(COKNKG4QOCPQYYGKVGTXGTNKGJGP#WU#PNC­FGU FTGKJWPFGTVUVGP 5VKHVWPIULWDKN·WOU GTPGWGTVG FGT TWUUKUEJG 2T·UKFGPV $QTKU 0 ,GN\KP FGP 1TFGP OKV 7MCU 0T    XQO,WNK

134


RUSSISCHE ORDEN UND EHRENZEICHEN

8744



-CKUGTNKEJGT 1TFGP FGU JN #RQUVGNU #PFTGCU FGU 'TUVDGTWHGPGP =Îðäåí èìïåð±òîðñêèé Ñâÿòîãî   Àïîñòîëà Àíäðåÿ Ïåðâîçâàííîãî? $TWUVUVGTP OKV 5EJYGTVGTP &WTEJOGUUGT  OO 5KNDGT VNY   XGTIQNFGV /GFCKNNQPCWHNCIGP 4ÌVNKEJ WPF )GND)QNF VNY GOCKNNKGTV FKG 5EJYGTVGT 4ÌVNKEJ)QNFIG   RT·IVLGYGKNUOKVFGO5VGTPMQTRWUXGTNÌVGVCWHFGT4ÒEMUGKVG&QRRGNCFNGTRWP\GFGT*QHNKGHGTCPVGPXQP DKU*GTUVGNNGTDG\GKEJPWPIFGT(KTOC-GKDGNKP5V2GVGTUDWTIWPF5V2GVGTUDWTIGT<QNQV PKMK5KNDGTRWP\GXQPDKUCP0CFGN447#<- 444+++  /KVMCKUGTNKEJGO7MCU<CT#NGZCPFGT++0KMQNCLGYKVUEJ  XQO#WIWUVYWTFGPIGMTGW\VG5EJYGTVGT CWHFGP+PUKIPKGPHÒT8GTNGKJWPIGPHÒT6CRHGTMGKVKO-CORHIGPGJOKIV   .CWV5JKUJMQX KP5-85 ICDGUPWT\YGK8GTNGKJWPIGPFGU#PFTGCUQTFGPUOKV5EJYGTVGTPWPF\YCTCO 5GRVGODGTCP(ÒTUV#+$CTLCVKPUMKWPFQJPG&CVWOUCPICDGCP1VVQ(ÒTUV$KUOCTEM#NNGTFKPIUJCVNGV\GTGT NCWV#TPFVWPF/ÒNNGT9WUVGTYKV\ KP#405WPF5HH CO,WPKXQP<CT#NGZCPFGT++FGP5V#P FTGCU1TFGPOKVFGT-QNNCPGWPFCO#WIWUVGDGPHCNNUXQP<CT#NGZCPFGT++FGP5V#PFTGCU1TFGPKP$TKN NCPVGPCDGTPKGOCNUFGP5V#PFTGCU1TFGPOKV5EJYGTVGTPGTJCNVGP'UKUVLGFQEJYCJTUEJGKPNKEJFC­GUYGKVGTG 8GTNGKJWPIGPFGU5V#PFTGCU1TFGPUOKV5EJYGTVGTPIGIGDGPJCDGPMCPPFGPP5JKUJMQXDKNFGV KP5H CNNGKPG FTGKXGTUEJKGFGPG$TWUVUVGTPGCD   /KV1VVQ5COWGN-GKDGN  DGVTCVNCWV6COOCPP KP6425HH FCUGTUVG/KVINKGFGKPGTICP\GP)QNF UEJOKGFG&[PCUVKGFKGTWUUKUEJG$ÒJPGFGTUGNDUVCDGTPQEJMGKPG1TFGPHGTVKIVG5GKP0GHHG,QJCPP9KNJGNO   GTJKGNVKP0CEJHQNIGXQP'OOCPWGN)GQTIXQP2CPPCUEJ\WUCOOGPOKV9KNJGNO-·OOGTGTXQO1TFGPU MCRKVGNFGP#WHVTCI\WT*GTUVGNNWPICNNGTTWUUKUEJGP1TFGP5GKP5QJP,WNKWU +XCP 'FWCTF-GKDGN  NGTPVG DGKUGKPGO8CVGTWPFYWTFG/GKUVGT0CEJFGUUGP6QFÒDGTPCJOGTUEJNKG­NKEJFKG(KTOCWPFYWTFGFCOKV 'ZMNWUKXNKGHGTCPV FGU 1TFGPUMCRKVGNU #NDGTV -QPUVCPVKP -GKDGN   KUV  KP FCU )GUEJ·HV UGKPG 8CVGTU   GKPIGVTGVGPWPFJCVGUPCEJFGUUGP6QFÒDGTPQOOGP8QPDKUJCVVGGTCNUQHHK\KGNNGT1TFGPULWYGNKGT GKPGP'ZMNWUKXXGTVTCIOKVFGO1TFGPUMCRKVGN&CFGT8GTVTCIXQP#NDGTV-GKDGNOKVFGO1TFGPUMCRKVGNPKEJV GTPGWGTVYWTFGNKGHGTVGGTFQTVJKPPWTDKU

135


RUSSISCHE ORDEN UND EHRENZEICHEN

8745



-CKUGTNKEJGT 1TFGP FGU JGKNKIGP (ÒTUVGP #NGZCPFGT 0GYUM[ =Îðäåí èìïåð±òîðñêèé Ñâÿàòîãî   Êíÿçÿ Àëåêñàíäðà Íåâñêîãî?$TWUVUVGTP KPQHHK\KGNNG/GVCNNCWUHÒJTWPIDKU &WTEJOGUUGT OO5KNDGTVNYXGTIQNFGV/GFCKNNQPCWHNCIGP)QNFITCXKGTVVNYGOCKNNKGTVMGKPGTNGK2WP\GPUKEJVDCT CP5EJTCWDGOKVMNGKPGT5EJTCWDUEJGKDGWPF7PVGTNCIUUEJGKDGFKGUGOKV/GKUVGTOCTMG(*447 <- 44++  (TÒJGT$TWUVUVGTPOKVDGUQPFGTUHGKPCWUIGCTDGKVGVGP/GFCKNNQPCWHNCIGP

  &KG/GKUVGTOCTMG(*KPNCVGKPKUEJGP$WEJUVCDGPYKTFXQP6COOCPP KP6425 OGJTGTGPOÌINKEJGP/GKUVGTP \WIGQTFPGVUQ(TCPV\(TGFTKM*GPV\KWU V·VKIXQPDKU %JTKUVKCP(TKGFTKEJ*ÌRRPGT V·VKIXQPDKU  WPF1NQH(TGFTKM*GKUMCKP V·VKIXQPDKU 'TUGNDUVHCXQTKUKGTVCDGT(TGFTKEM#FQNH*QNUVGPKWU IGD CO&G\GODGTKP5LWPFG¹)QNFUEJOKGFOGKUVGTKP<CTUMQG5GNQFCPCEJKP5V2GVGTDWTIFQTV.GJTOGKUVGT XQP#NGZCPFGT'6KNNCPFGTKP;CTQUNCXN CNU+PJCDGTFKGUGT/GKUVGTOCTMG   &GTGKPMNCUUKIG1TFGPYWTFGXQP<CTKP-CVJCTKPC+#NGZGKLGYPC  OKV7MCUXQO/CKIGUVKHVGV 'TYWTFGPCEJ#NGZCPFGT,CTQUNCYKVUEJ0GYUMK(ÒTUVXQP0QYIQTQFWPF)TQ­HÒTUVXQP9NCFKOKT  DG PCPPV'TUVCO#RTKNFGO6CIUGKPGT-TÌPWPIYWTFGPXQP<CT2CWN+2GVTQYKVUEJ  FKG1TFGPU UVCVWVGPCRRTQDKGTV#NUDGUQPFGTGT)PCFGPGTYGKUFGU<CTGPMQPPVGFGT1TFGPKP$TKNNCPVGPXGTNKGJGPYGTFGPYQDGK CWHFGP$TWUVUVGTPGPÒDGTFGP/GFCKNNQPUGKPGMCKUGTNKEJG-TQPGCPIGDTCEJVYWTFG5GKVFGO#WIWUVMQPPVGP IGO·­GKPGTLGYGKNKIGPRGTUÌPNKEJGP'PVUEJGKFWPIFGU<CTGP4KVVGTFGU5V#PFTGCU1TFGPUFKGFGP5V#NGZCPFGT 0GYUM[1TFGP PQEJ PKEJV GTJCNVGP JCVVGP FKGUGP INGKEJ\GKVKI OKVLGPGOGTJCNVGP#O#WIWUVYWTFGPFKG -NGKPQFG WPF CO  1MVQDGT  FKG $TWUVUVGTPG HÒT 0KEJV%JTKUVGP  FKG 8GTNGKJWPI XQP $TWUVUVGTPGP KP   /GVCNN QHHK\KGNN IGPGJOKIV /KV MCKUGTNKEJGO 7MCU <CT #NGZCPFGT ++ 0KMQNCLGYKVUEJ   XQO  #WIWUV    YWTFGP IGMTGW\VG 5EJYGTVGT CWH FGP +PUKIPKGP HÒT 8GTNGKJWPIGP HÒT 6CRHGTMGKV KO -CORH IGPGJOKIV   /KV#DUEJCHHWPIFGT/QPCTEJKGXGTUEJYCPFCWEJFGT1TFGP   +PIGYKUUGT9GKUGYWTFGFKG6TCFKVKQPFGU1TFGPUCWEJKPFGTUR·VGTGP5QYLGVWPKQPHQTVIGHÒJTVFCOKV&GMTGVFGU 2T·UKFKWOUFGU1DGTUVGP5QYLGVUFGT7F554XQO,WNKGKP#NGZCPFGT0GYUM[1TFGP=Îðäåí Àëåêñàíäðà Íåâñêîãî? IGUVKHVGV YWTFG FGT HÒT ÒDGTTCIGPFG -CORHGUHÒJTWPI WPF RGTUÌPNKEJG 6CRHGTMGKV Y·JTGPF FGU )TQ­GP   8CVGTN·PFKUEJGP-TKGIGUXQPDKUUQYQJNCP'KP\GNRGTUQPGPYKGCWEJCPICP\G'KPJGKVGPXGTNKGJGPYGTFGP MQPPVG   &GT XQP 2T·UKFGPV $QTKU 0 ,GN\KPOKV7MCUXQO/·T\IGUVKHVGVGXKGTMNCUUKIG1TFGP(ÒT8GTFKGPUVGWPF FCU  8CVGTNCPF =Îðäåí "Çà Çàñëóãè ïåðåä Îòå÷åñòâîì"? PCJO GKPKIG )GUVCNVWPIUGNGOGPVG TQVG (CTDG FGU   -TGW\GUWPFFGU$CPFGU&QRRGNCFNGTWPF1TFGPUOQVVQ FGU\CTKUVKUEJGP5V#NGZCPFGT0GYUMK1TFGPUYKGFGTCWH

136


RUSSISCHE ORDEN UND EHRENZEICHEN

8746 (3/4 Größe)



-CKUGTNKEJGT 1TFGP FGU JGKNKIGP (ÒTUVGP #NGZCPFGT 0GYUM[ =Îðäåí èìïåð±òîðñêèé Ñâÿàòîãî   Êíÿçÿ Àëåêñàíäðà Íåâñêîãî?$TWUVUVGTP&WTEJOGUUGTOO5KNDGTVNYXGTIQNFGVVNYGOCKNNKGTV CWH FGT 4ÒEMUGKVG &QRRGNCFNGTRWP\G FGT *QHNKGHGTCPVGP XQP  DKU  *GTUVGNNGTDG\GKEJPWPI FGT   (KTOC -GKDGN KP 5V 2GVGTUDWTI WPF 5V 2GVGTUDWTIGT  <QNQVPKMK 5KNDGTRWP\G XQP  DKU  CP   0CFGN FKGUG GDGPHCNNU OKV &QRRGNCFNGTRWP\G FGT *QHNKGHGTCPVGP XQP  DKU  WPF *GTUVGNNGTDG   \GKEJPWPIFGT(KTOC-GKDGNUQYKG5V2GVGTUDWTIGT5VCFVRWP\GXQPDKU447<- 4++ 

8747 (3/4 Größe)



-CKUGTNKEJGT WPF -ÌPKINKEJGT 1TFGP XQO 9GK­GP #FNGT =Îðäåí èìïåð±òîðñêèé è êîðîë¾âñêèé   Áåëîãî Îðëà?$TWUVUVGTP&WTEJOGUUGTOO5KNDGTXGTIQNFGVVNYGOCKNNKGTVCWHFGT4ÒEMUGKVG &QRRGNCFNGTRWP\GFGT*QHNKGHGTCPVGPXQPDKU*GTUVGNNGTDG\GKEJPWPIFGT(KTOC-GKDGNKP5V 2GVGTUDWTIWPF5V2GVGTUDWTIGT<QNQVPKMK5KNDGTRWP\GXQPDKUCP0CFGNFKGUGGDGPHCNNU OKV &QRRGNCFNGTRWP\G FGT *QHNKGHGTCPVGP XQP  DKU  *GTUVGNNGTDG\GKEJPWPI FGT (KTOC -GKDGN   WPF5V2GVGTUDWTIGT<QNQVPKMK5KNDGTRWP\GXQPDKU447<- 4++  &GTGKPGT.GIGPFGPCEJXQORQNPKUEJGP-ÌPKI9NCFKUNCY+.QMKGVGM  IGUVKHVGVG1TFGPYWTFGKO 0QXGODGT  XQP -ÌPKI #WIWUV ++ FGO 5VCTMGP -WTHÒTUV XQP 5CEJUGP   KP GKPGT -NCUUG GTPGWGTV   8QP <CT 0KMQNCWU + 2CYNQYKVUEJ   YWTFG GT OKV 7MCU XQO  0QXGODGT  WPVGT FKG TWUUKUEJGP   1TFGP CWHIGPQOOGP 5GKV FKGUGO <GKVRWPMV MQPPVGP IGO·­GKPGTLGYGKNKIGPRGTUÌPNKEJGP'PVUEJGKFWPIFGU<CTGP 4KVVGT FGU 5V #PFTGCU1TFGPU FKG FGP 9GK­GP #FNGT1TFGP PQEJ PKEJV GTJCNVGP JCVVGP FKGUGP INGKEJ\GKVKI OKV   LGPGOGTJCNVGP#O#WIWUVYWTFGPFKG1TFGPUKPUKIPKGPUQYKGFKG-NGKPQFGWPFCO1MVQDGTFKG $TWUVUVGTPG HÒT 0KEJV%JTKUVGP IGPGJOKIV /KV MCKUGTNKEJGO 7MCU <CT #NGZCPFGT ++ 0KMQNCLGYKVUEJ     XQO  #WIWUV  YWTFGP IGMTGW\VG 5EJYGTVGT CWH FGP +PUKIPKGP HÒT 8GTNGKJWPIGP HÒT 6CRHGTMGKV KO -CORH   IGPGJOKIV 0CEJFGO FGT 1TFGP  XQP FGT 2TQXKUQTKUEJGP 4GIKGTWPI ÒDGTPQOOGP YQTFGP YCT YWTFG GT XQP   FGP$QNUEJGYKMKCDIGUEJCHHV   CNUJÌEJUVGT1TFGPFGT4GRWDNKM2QNGPGTPGWGTVYWTFGGTXQPFGT8QNMUTGRWDNKMCDIGUEJCHHVLGFQEJXQP FGT RQNPKUEJGP 'ZKNTGIKGTWPI KP .QPFQP DKU  YGKVGT XGTNKGJGP  YWTFG GT YKGFGT CNU JÌEJUVGT 1TFGP FGT   RQNPKUEJGP4GRWDNKMGTPGWGTV

137


RUSSISCHE ORDEN UND EHRENZEICHEN

8748 (3/4 Größe)



-CKUGTNKEJGT WPF -ÌPKINKEJGT 1TFGP XQO 9GK­GP #FNGT =Îðäåí èìïåð±òîðñêèé è êîðîë¾âñêèé   Áåëîãî Îðëà?$TWUVUVGTP&WTEJOGUUGTOO5KNDGTXGTIQNFGVVNYGOCKNNKGTVCWHFGT4ÒEMUGKVG /GKUVGTOCTMG ÈË *GTUVGNNGTDG\GKEJPWPI ÝÄÓÀÐÄÚ FGT (KTOC 'FWCTF KP 5V2GVGTUDWTIWPF5V 2GVGTUDWTIGT  <QNQVPKMK -QMQUEJPKM5KNDGTRWP\G XQP  DKU  KP \YGK 5VTCJNGPURKV\GP   LGYGKNUGKPG-QMQUEJPKM2WP\GXQPDKUCP0CFGNFKGUGOKVHTCP\ÌUKUEJGT'KPHWJTRWP\G XQPDKU 5EJYCPGPRWP\G 447<- 44++  5VCTM IGYÌNDVGT $TWUVUVGTP KP GKPGT HÒT FKG (KTOC 'FWCTF V[RKUEJGP #PHGTVKIWPI &KG /GKUVGTOCTMG ÈËKUVNCWV 6COOCPP KP6425 GKPGODKUJGTPKEJVKFGPVKHK\KGTVGP9GTMOGKUVGTFGT(KTOC'FWCTF\W\WQTFPGPWPFMCPPXQP DKUPCEJIGYKGUGPYGTFGP   &KG(KTOC'FWCTFYWTFGWOXQP'FWCTF(GTPCPFQYKEJ&KGVYCNFIGITÒPFGV#DYCTGTQHHK\KGNNGT.KGHGTCPV FGU1TFGPUMCRKVGNUWPFNKGHGTVGFGPITÌ­VGP#PVGKNTWUUKUEJGT1TFGP0CEJUGKPGO6QFHÒJTVGUGKPG9KVYG8CT XCTC2GVTQYPC&KGVYCNFFKG(KTOC YQJNDKU YGKVGT

8749 (3/4 Größe)



-CKUGTNKEJGT 1TFGP FGU JGKNKIGP )TQ­O·TV[TGTU )GQTI FGU 5KGITGKEJGP =Îðäåí èìïåð±òîðñêèé   Ñâÿàòîãî Âåëèêîìó÷åíèêà è Ïîáåäîíîñöà Ãåîðãèÿ? -TGW\  -NCUUG HTCP\ÌUKUEJG #PHGTVKIWPI   PCEJ OKV-WIGNÌUG ZOO5KNDGTXGTIQNFGVGOCKNNKGTV'OCKNNGOCNGTGKCOCNVGPRGPVCIQ PCNIGP·JVGP$CPF ++ &GT XKGTMNCUUKIG /KNKV·T8GTFKGPUVQTFGP YWTFG CO  0QXGODGT  XQP <CTKP -CVJCTKPC ++ FGT )TQ­GP      IGUVKHVGVFKG5VCVWVGPCOINGKEJGP6CICRRTQDKGTV'TYWTFGFGOKPFGT1UVYKGCWEJKPFGT9GUVMKTEJG INGKEJGTOC­GP XGTGJTVGP JGKNKIGP )GQTI 2CVTQP FGU 4KVVGTVWOU WPF FGT 5QNFCVGP IYKFOGV 'KIGPVNKEJ CNU TGKPGT   1TFGPHÒTRGTUÌPNKEJG6CRHGTMGKVIGFCEJVMQPPVGFKG-NCUUGCWEJPCEJ&KGPUVLCJTGPCP#TOGG1HHK\KGTGQFGT PCEJ  'KPU·V\GP -CORCIPG ņ CD   'KPU·V\G  CWH 5GG CP /CTKPG1HHK\KGTG XGTNKGJGP YGTFGP #D    YWTFGGKPUQNEJGT8GTNGKJWPIUITWPFCWHFGP-TGW\CTOGPCPIGIGDGP   9·JTGPFFGT4GIKGTWPIU\GKV<CT2CWNU+2GVTQYKVUEJ  PKEJVXGTNKGJGPYWTFGGTXQPUGKPGO0CEJHQNIGT #NGZCPFGT + 2CYNQYKVUEJ   CO  &G\GODGT  GTPGWGTV #O  &G\GODGT  GTJKGNV FGT   1TFGP PGWG 5VCVWVGP FKG FKG 8GTNGKJWPIUDGFKPIWPIGP UGJT URG\KHK\KGTVGP #O  #WIWUV  YWTFGP FKG -TGW\G   WPF CO  1MVQDGT  FKG $TWUVUVGTPG HÒT 0KEJV%JTKUVGP  FKG 8GTNGKJWPI XQP $TWUVUVGTPGP KP /GVCNN   QHHK\KGNNIGPGJOKIV/KV7MCUXQO/CKQTFPGVG<CT#NGZCPFGT++0KMQNCLGYKVUEJ  CPFC­FGT 1TFGPHQTVCPPWTPQEJHÒTGTYKGUGPG6CRHGTMGKVXQTFGO(GKPFXGTNKGJGPYGTFGPUQNNVG#NNGTFKPIUUGV\VGUKEJFGT $TCWEJ KJP SWCUK CNU &KGPUVCWU\GKEJPWPI \W XGTNGKJGP DKU EC  HQTV #O  #WIWUV  GTJKGNV FGT   1TFGPPGWG5VCVWVGP   0CEJFGOFKGRTQXKUQTKUEJGP4GIKGTWPIFGP1TFGPÒDGTPQOOGPJCVVGYWTFGFKGUGTXQPFGP$QNUEJGYKMK CDIGUEJCHHV'KPKIG)GPGT·NGFGTUQIGPCPPVGPYGK­GP#TOGGXGTNKGJGPFKGUGPLGFQEJY·JTGPFFGU$ÒTIGTMTKGIGU DKUKPFKGHTÒJGPGT,CJTGYGKVGT 

138




RUSSISCHE ORDEN UND EHRENZEICHEN &GO 1TFGP CHHKNKKGTV YCT FCU OKV /CPKHGUV <CT #NGZCPFGTU + 2GVTQYKVUEJ XQO  (GDTWCT  IGUVKHVGVG   GKPMNCUUKIG 'JTGP\GKEJGP FGU /KNKV·TKUEJGP 1TFGPU #O  #WIWUV  YWTFG FCU -TGW\ HÒT 0KEJV%JTKUVGP   IGPGJOKIV /KV MCKUGTNKEJGO 7MCU <CT #NGZCPFGTU ++ XQO  /·T\  YWTFG FCU 'JTGP\GKEJGP KP  -NCUUGP   WPVGTVGKNV /KV FGP PGWGP 1TFGPUUVCVWVGP XQO  #WIWUV  GTJKGNV FCU 'JTGP\GKEJGP FGP 0COGP 5V )GQTIU   -TGW\0CEJFGOGUFKGRTQXKUQTKUEJG4GIKGTWPIÒDGTPQOOGPJCVVGYWTFGFCU'JTGP\GKEJGPXQPFGP $QNUEJGYKMK CDIGUEJCHHV 'KPKIG )GPGT·NG FGT UQIGPCPPVGP 9GK­GP #TOGG XGTNKGJGP GU LGFQEJ DKU KP FKG HTÒJGP   GT,CJTGYGKVGT   /KV FGP PGWGP 1TFGPUUVCVWVGP YWTFG CWEJ FKG XQP <CT #NGZCPFGT ++  IGUVKHVGVG WPF CO  #WIWUV CWH XKGT   -NCUUGPGTYGKVGTVG6CRHGTMGKVUOGFCKNNGOKVFGTPGWGP$G\GKEJPWPI5V)GQTIU/GFCKNNGHÒT6CRHGTMGKVFGO1TFGP CHHKNKKGTV 'DGPHCNNU  XQP FGT 2TQXKUQTKUEJGP 4GIKGTWPI ÒDGTPQOOGP KUV UKG XQP FGP $QNUEJGYKMK    CDIGUEJCHHV YQTFGP 5KG YWTFG CDGT Y·JTGPF FGU $ÒTIGTMTKGIGU XQP GKPKIGP )GPGT·NGP FGT UQIGPCPPVGP 9GK­GP   #TOGGDKUKPFKGHTÒJGPGT,CJTGYGKVGTXGTNKGJGP   #NUGKP\KIG\CTKUVKUEJG#WU\GKEJPWPIGPFWTHVGPKPFGT7F554FCU5V)GQTIU-TGW\WPFFKG5V)GQTIU/GFCKNNGHÒT 6CRHGTMGKVKPKJTGPLGYGKNKIGP-NCUUGPYGKVGTIGVTCIGPYGTFGP   &KG6TCFKVKQPFGU5V)GQTI1TFGPUYWTFGKPIGYKUUGT9GKUGKPFGTUR·VGTGP5QYLGVWPKQPFWTEJFGPFTGKMNCUUKIGP 4WJOGU1TFGP=Îðäåí Ñëàâü³?HQTVIGHÒJTVFGTOKV&GMTGVFGU2T·UKFKWOUFGU1DGTUVGP5QYLGVUFGT7F554XQO  0QXGODGT  IGUVKHVGV YWTFG &GT 1TFGP FGT CO $CPF FGU 5V )GQTI1TFGPU IGVTCIGP YWTFG MQPPVG HÒT   RGTUÌPNKEJG6CRHGTMGKVY·JTGPFFGU)TQ­GP8CVGTN·PFKUEJGP-TKGIGUXQPDKUXGTNKGJGPYGTFGP

8750 (3/4 Größe)



5V )GQTIU-TGW\ #WUICDG HÒT FKG 2TGW­KUEJGP #NNKKGTVGP  5KNDGT CWH FGT 4ÒEMUGKVG 6T·IGT   PWOOGT0OKVUR·VGTGO$CPFFGU5V)GQTIU1TFGPU447 ++



<CT0KMQNCWU+2CYNQYKVUEJ  UVKHVGVGFCU-TGW\KO,WNKCWU#PNC­FGT'PVJÒNNWPIFGU&GPMOCNUHÒT FKG 5EJNCEJV XQP $QTQFKPQ  5GRVGODGT   WPF XGTNKGJ GU CP CNNG PQEJ NGDGPFGP RTGW­KUEJGP 8GVGTCPGP FGT   5EJNCEJVGP\YKUEJGPWPF

8751 (3/4 Größe)



5V )GQTIU-TGW\  /QFGNN   -TGW\  -NCUUG 5KNDGT CWH FGT4ÒEMUGKVG6T·IGTPWOOGT 0QOKV$CPF447 ++



8752 (3/4 Größe)



5V )GQTIU-TGW\ (TCP\ÌUKUEJG #PHGTVKIWPI QJPG -NCUUGPCPICDG WPF QJPG 0WOOGTKGTWPI 5KNDGT   /GFCKNNQPUUGRCTCVIGRT·IVCO$CPF ++



#PHGTVKIWPICWUFGT<GKVFGU'TUVGP9GNVMTKGIUQFGTMWT\FCPCEJ

139


RUSSISCHE ORDEN UND EHRENZEICHEN

8753



-CKUGTNKEJGT 1TFGP FGU JGKNKIGP #RQUVGNINGKEJGP (ÒTUVGP 9NCFKOKT =Îðäåí èìïåð±òîðñêèé   Ñâÿàòîãî Ðàâíîàïîñòîëüíîãî Êíÿçÿ Âëàäèìèðà? $TWUVUVGTP &WTEJOGUUGT  OO 5KNDGT VNY   XGTIQNFGV VNY GOCKNNKGTV /KVVGNOGFCKNNQP#WHNCIG )QNF ITCXKGTV CWH FGT 4ÒEMUGKVG &QRRGNCFNGTRWP\G   FGT*QHNKGHGTCPVGPXQPDKU*GTUVGNNGTDG\GKEJPWPIFGT(KTOC-GKDGNKP5V2GVGTUDWTIWPF5V 2GVGTUDWTIGT  <QNQVPKMK 5KNDGTRWP\G XQP  DKU  CP 0CFGN FKGUG GDGPHCNNU OKV *GTUVGNNGTDG   \GKEJPWPIFGT(KTOC-GKDGNWPF5V2GVGTUDWTIGT<QNQVPKMK5KNDGTRWP\GXQPDKU447 <- 44++  &GTXKGTMNCUUKIG8GTFKGPUVQTFGPYWTFGCO5GRVGODGTXQP<CTKP-CVJCTKPC++ FGT)TQ­GP  IGUVKHVGVFKG5VCVWVGPCOINGKEJGP6CICRRTQDKGTV'TYWTFGPCEJFGO(ÒTUVGP9NCFKOKT+5YLCVQUNCYKVUEJFGO #RQUVGNINGKEJGPXQP-KGY  DGPCPPVQTFPGVG-CVJCTKPC++CPFC­FKG-NCUUGFGU1TFGPUCWEJ PCEJ  &KGPUVLCJTGP CP #TOGG1HHK\KGTG XGTNKGJGP YGTFGP MQPPVG YQDGK GKP UQNEJGT 8GTNGKJWPIUITWPF CWH FGP   -TGW\CTOGP CP\WIGDGP YCT #D FGO  0QXGODGT  GTJKGNV FKG  -NCUUG FKG HÒT 6CRHGTMGKV KO -CORH   XGTNKGJGPYWTFGGKPG$CPFUEJNGKHG   9·JTGPFFGT4GIKGTWPIU\GKV<CT2CWNU+2GVTQYKVUEJ  PKEJVXGTNKGJGPYWTFGGTXQPUGKPGO0CEJHQNIGT #NGZCPFGT+2CYNQYKVUEJ  CO&G\GODGTGTPGWGTV#O#WIWUVYWTFGPFKG-TGW\GWPF CO  1MVQDGT  FKG $TWUVUVGTPG HÒT 0KEJV%JTKUVGP IGPGJOKIV #O  ,WNK  GTJKGNV FGT 1TFGP PGWG   5VCVWVGP&GPGP\WHQNIGMQPPVGFKG-NCUUGCWEJPCEJ&KGPUVLCJTGPCP#TOGG1HHK\KGTGQFGTPCEJ'KPU·V\GP

-CORCIPG D\Y'KPU·V\GPCWH5GGCP/CTKPG1HHK\KGTGXGTNKGJGPYGTFGPYQDGKFGTLGYGKNKIG8GTNGKJWPIU ITWPFCWHFGP-TGW\CTOGPCP\WIGDGPYCT   YWTFGFKG8GTNGKJWPIXQP$TWUVUVGTPGPKP/GVCNNQHHK\KGNNIGPGJOKIV/KVMCKUGTNKEJGO7MCU<CT#NGZCPFGTU++ 0KMQNCLGYKVUEJ   XQO  #WIWUV  YWTFGP IGMTGW\VG 5EJYGTVGT CWH FGP +PUKIPKGP HÒT 8GTNGKJWPIGP   HÒT6CRHGTMGKVKO-CORH\WIGNCUUGP   /KV#DUEJCHHWPIFGT/QPCTEJKGXGTUEJYCPFCWEJFGT1TFGP

140


RUSSISCHE ORDEN UND EHRENZEICHEN

8754



-CKUGTNKEJGT 1TFGP FGU JGKNKIGP #RQUVGNINGKEJGP (ÒTUVGP 9NCFKOKT =Îðäåí èìïåð±òîðñêèé   Ñâÿàòîãî Ðàâíîàïîñòîëüíîãî Êíÿçÿ Âëàäèìèðà?-TGW\FGTWPF-NCUUGZOO)QNF GOCKNNKGTVI'OCKNNGOCNGTGKCWHFGP4ÒEMUGKVGPFGT#TOG<CRRQPNCEMKPFGT¤UG/GKUVGTOCTMG Ä1 HÒT &KOKVTK +XCPQXKVUEJ 1UKRQX KP 5V 2GVGTUDWTI WPF  <QNQVPKMK -QMQUEJPKM)QNFRWP\G XQP   DKUOKVFGO2TQDKGTOGKUVGT\GKEJGPßËHÒT;CMQX.[CRWPQXCOYQJNGTI·P\VGP$CPFTKPI QJPG$CPF447<- 4++  .CWV6COOCPP KP6425H KUVFKG(KTOC&KOKVTK+YCPQYKVUEJ1UKRQYXQTIGITÒPFGVYQTFGPWPFCTDGKVGVG YQJNDKU\WO'PFGFGU'TUVGP9GNVMTKGIGU;CMQX.[CRWPQXYCTCNU2TQDKGTOGKUVGTPWTXQPDKUV·VKIYCU FGO\WHQNIGFGT'PVUVGJWPIU\GKVFKGUGU-TGW\GUGPVURTKEJV

8755



-CKUGTNKEJGT 1TFGP FGU JGKNKIGP #RQUVGNINGKEJGP (ÒTUVGP 9NCFKOKT =Îðäåí èìïåð±òîðñêèé   Ñâÿàòîãî Ðàâíîàïîñòîëüíîãî Êíÿçÿ Âëàäèìèðà? -TGW\  -NCUUG  Z  OO )QNF GOCKNNKGTV   I OKV$CPF 'OCKNNGOCNGTGKFKGUGGVYCUDGTKGDGPKPFGT¤UGOGJTHCEJWPNGUGTNKEJRWP\KGTVCO GTI·P\VGP$CPFTKPICORGPVCIQPCNIGP·JVGP$CPF447<- ++  NVGTG#WUHÒJTWPICWUFGO\YGKVGP&TKVVGNFGU,CJTJWPFGTVUOKVUVCTMIGYÌNDVGP-TGW\CTOHN·EJGP

8756



-CKUGTNKEJGT 1TFGP FGU JGKNKIGP #RQUVGNINGKEJGP (ÒTUVGP 9NCFKOKT =Îðäåí èìïåð±òîðñêèé   Ñâÿàòîãî Ðàâíîàïîñòîëüíîãî Êíÿçÿ Âëàäèìèðà? -TGW\  -NCUUG OKV 5EJYGTVGTP  Z  OO   )QNFGOCKNNKGTVI'OCKNNGOCNGTGKCWHFGT4ÒEMUGKVGFGUQDGTGP-TGW\CTOUWPVGTFGT'OCKNNG/GK UVGTOCTMGÂÄHÒT8CTXCTC2GVTQYPC&KGVYCNFWPFCWHFGT4ÒEMUGKVGFGUWPVGTGP-TGW\CTOUWPVGTFGT 'OCKNNG *GTUVGNNGTDG\GKEJPWPI ÝÄÓÀÐÄÚ HÒT FKG (KTOC 'FWCTF KP 5V 2GVGTUDWTI CWH FGT ¤UG    <QNQVPKMK-QMQUEJPKM)QNFRWP\GXQPDKUOKVGTI·P\VGO#PJ·PIGTKP)QNFQJPG$CPF 447<- ++  6COOCPPHÒJTVKP642 CWH5 CWUFC­8CTXCTC2GVTQYPC&KGVYCNF9KVYGXQP'FWCTF(GTPCPFQYKVUEJ&KGVYCNF FKG(KTOC'FWCTFPCEJFGUUGP6QFÒDGTPQOOGPJCVGTYCTD&KOKVTK+YCPQYKVUEJ1UKRQYFKG#MVKGPOGJT JGKVFGTPWPOGJTKPGKPG#MVKGPIGUGNNUEJCHVWOIGYCPFGNVGP(KTOCFKGLGFQEJDKU\WO'PFGFGU'TUVGP9GNVMTKGIU WPVGTFGO0COGP'FWCTFHKTOKGTVG

141


RUSSISCHE ORDEN UND EHRENZEICHEN

8757



-CKUGTNKEJGT 1TFGP FGU JGKNKIGP #RQUVGNINGKEJGP (ÒTUVGP 9NCFKOKT =Îðäåí èìïåð±òîðñêèé   Ñâÿàòîãî Ðàâíîàïîñòîëüíîãî Êíÿçÿ Âëàäèìèðà?-TGW\-NCUUGOKV5EJYGTVGTPZOO )QNFGOCKNNKGTVI OKV$CPFUEJNGKHG 'OCKNNGOCNGTGKFKG-TGW\CTOHN·EJGPYQJNOKV<CRRQPNCEMKP FGT ¤UG OGJTHCEJ WPNGUGTNKEJ RWP\KGTV CO GTI·P\VGP $CPFTKPI OKV QTKIKPCNGT CNVGT $CPFUEJNGKHG HÒT   /KNKV·TXGTFKGPUV447<- ++ 

8758



-CKUGTNKEJGT1TFGPFGTJGKNKIGP#PPC=Îðäåí èìïåð±òîðñêèé Ñâÿòîé Àííü³?/QFGNN CD  -TGW\ FGT  -NCUUG  Z  OO )QNF GOCKNNKGTV  I 'OCKNNGOCNGTGK CWH FGT 4ÒEMUGKVG FGU   QDGTGP -TGW\CTOU WPVGT FGT 'OCKNNG &QRRGNCFNGTRWP\G FGT *QHNKGHGTCPVGP XQP  DKU  WPF CWH   FGT 4ÒEMUGKVG FGU WPVGTGP -TGW\CTOU WPVGT FGT 'OCKNNG /GKUVGTOCTMG #- HÒT #NDGTV -GKDGN KP 5V   2GVGTUDWTICWHFGT¤UG5V2GVGTUDWTIGT<QNQVPKMK)QNFRWP\GXQPDKUCO$CPFTKPIQJPG 5EJWNVGTDCPF447<- 44++  #WHITWPFFGT-QODKPCVKQPFGT/GKUVGTOCTMG#-WPFFGT5V2GVGTUDWTIGT)QNFRWP\GXQPDKUN·­VUKEJ FGT*GTUVGNNWPIU\GKVTCWO\YKUEJGPWPFGKPITGP\GP   #NDGTV -QPUVCPVKP -GKDGN   KUV  NCWV 6COOCP KP 642 5   KP FCU )GUEJ·HV UGKPGU 8CVGTU ,WNKWU  

+XCP  'FWCTF -GKDGN   GKPIGVTGVGP WPF JCV GU PCEJ FGUUGP 6QF  ÒDGTPQOOGP 8QP  DKU    JCVVGGTCNUQHHK\KGNNGT1TFGPULWYGNKGTGKPGP'ZMNWUKXXGTVTCIOKVFGO1TFGPUMCRKVGN   #NUGKPMNCUUKIGT1TFGPYWTFGGTCO(GDTWCTXQP%CTN(TKGFTKEJ*GT\QIXQP*QNUVGKP)QVVQTR   \WO )GFGPMGP CP UGKPG XGTUVQTDGPG )GOCJNKP #PPC 2GVTQYPC GKPGT 6QEJVGT <CT 2GVGTU FGU )TQ­GP IGUVKHVGV  

/QFGNN 'TYWTFGFGTJGKNKIGP#PPCFKGKPGKPKIGPCRQMT[RJGP'XCPIGNKGPCNU/WVVGTFGT)QVVGUOWVVGT/CTKC IGPCPPVKUVIGYKFOGV#WHFGO'TDYGIIGNCPIVGGTÒDGT%CTN(TKGFTKEJU5QJP*GT\QI%CTN2GVGT(TKGFTKEJXQP *QNUVGKP)QVVQTR FGO UR·VGTGP <CTGP 2GVGT +++   PCEJ 4W­NCPF YQ GT CWEJ PCEJ FGO 8GT\KEJV   -CVJCTKPCU++ HÒTKJTGP5QJP2CWN CWHFCU*GT\QIVWO*QNUVGKP)QVVQTRKO,CJTXGTDNKGD   /KV FGT #RRTQDCVKQP PGWGT 1TFGPUUVCVWVGP CO  #RTKN  FGO 6CI UGKPGT -TÌPWPI FWTEJ <CT 2CWN +   2GVTQYKVUEJ  YWTFGGTCNUGTUVGTXQPFCCPTWUUKUEJGT1TFGPCWHFTGK-NCUUGPGTYGKVGTV /QFGNN 5GKV FGO#WIWUVMQPPVGPIGO·­GKPGTLGYGKNKIGPRGTUÌPNKEJGP'PVUEJGKFWPIFGU<CTGP4KVVGTFGU5V#PFTGCU 1TFGPU FKG FGP 5V #PPC1TFGP PQEJ PKEJV GTJCNVGP JCVVGP FKGUGPINGKEJ\GKVKIOKVLGPGOGTJCNVGP+O5GRVGODGT YWTFGFKGDKUJGTKIG-NCUUG FGTDGTGKVUOKV7MCUXQO0QXGODGTIGUVKHVGVG5V#PPC5·DGN KPFKG  -NCUUG WOIGYCPFGNV WPF GKP -TGW\  -NCUUG IGUVKHVGV #WU FGT  -NCUUG FGO 5V #PPC5·DGN FGT CNU   #WU\GKEJPWPIHÒT&KGPUVLCJTGCP7PVGTQHHK\KGTGWPF/CPPUEJCHVGPIGFCEJVYCTUR·VGTCDGTCWEJCNU6CRHGTMGKVU #WU\GKEJPWPIXGTYGPFGVYWTFGIKPIUR·VGTFCU5V#PPC'JTGP\GKEJGPJGTXQT    YWTFG FKG )GUVCNVWPI FGT +PUKIPKGP XGT·PFGTV  /QFGNN  WPF OKV 7MCU <CT 0KMQNCWU + 2CYNQYKVUEJ   XQO,WPKGTJKGNVFKGFTKVVG-NCUUGHÒT/KNKV·TXGTFKGPUVGKPGCWHFGO$CPFCPIGDTCEJVG5EJNGKHG/KV FGPPGWGP5VCVWVGPXQPYWTFGKPFGTWPF-NCUUGCNUDGUQPFGTGT)PCFGPGTYGKUFKG-TQPGÒDGTFGO-TGW\ XGTNKGJGP DKU #O#WIWUVYWTFGPFKG-NGKPQFGWPFCO1MVQDGTFKG$TWUVUVGTPGHÒT0KEJV %JTKUVGPIGPGJOKIV#O,WNKGTJKGNVFGT1TFGPPGWG5VCVWVGPYWTFGFKG8GTNGKJWPIXQP$TWUVUVGTPGP KP/GVCNNQHHK\KGNNIGPGJOKIV/KVMCKUGTNKEJGO7MCU<CT#NGZCPFGT++0KMQNCLGYKVUEJ  XQO#WIWUV YWTFGPIGMTGW\VG5EJYGTVGTCWHFGP+PUKIPKGPHÒT8GTNGKJWPIGPHÒT6CRHGTMGKVKO-CORHIGPGJOKIV   <YCT JÌTVG OKV FGO 7PVGTICPI FGU <CTGPVWOU  CWEJ FGT 1TFGP CWH \W DGUVGJGP YWTFG CDGT Y·JTGPF FGU   $ÒTIGTMTKGIGU XQP GKPKIGP )GPGT·NGP FGT UQIGPCPPVGP 9GK­GP #TOGG DKU KP FKG HTÒJGP GT ,CJTG YGKVGT   XGTNKGJGP

142


RUSSISCHE ORDEN UND EHRENZEICHEN

8759

8759 8759



-CKUGTNKEJGT1TFGPFGTJGKNKIGP#PPC=Îðäåí èìïåð±òîðñêèé Ñâÿòîé Àííü³?/QFGNN CD  -TGW\ FGT  -NCUUG  Z  OO )QNF GOCKNNKGTV  I 'OCKNNGOCNGTGK CWH FGT 4ÒEMUGKVG FGU   QDGTGP -TGW\CTOU WPVGT FGT 'OCKNNG /GKUVGTOCTMG ÍË   WPF CWH FGT4ÒEMUGKVGFGUWPVGTGP-TGW \CTOU WPVGT FGT 'OCKNNG *GTUVGNNGTDG\GKEJPWPI ÝÄÓÀÐÄÚ HÒT FKG (KTOC 'FWCTF KP 5V 2GVGTUDWTI   CWHFGT¤UG<QNQVPKMK-QMQUEJPKM)QNFRWP\GXQPDKUCO$CPFTKPIQJPG5EJWNVGTDCPF 447<- 44++  &KG/GKUVGTOCTMGÍËKUVGKPGODKUJGTPKEJVKFGPVKHK\KGTVGP/GKUVGTFGT(KTOC'FWCTF\W\WQTFPGP

8760



-CKUGTNKEJGT1TFGPFGTJGKNKIGP#PPC=Îðäåí èìïåð±òîðñêèé Ñâÿòîé Àííü³?/QFGNN CD  $TWUVUVGTP&WTEJOGUUGTOO5KNDGTVNYXGTIQNFGVVNYGOCKNNKGTVCWHFGT4ÒEMUGKVG&QRRGNCF NGTRWP\G FGT *QHNKGHGTCPVGP XQP  DKU  *GTUVGNNGTDG\GKEJPWPI FGT (KTOC -GKDGN KP 5V 2GVGTU   DWTI WPF 5V 2GVGTUDWTIGT  <QNQVPKMK 5KNDGTRWP\G XQP  DKU  CP 0CFGN FKGUG GDGPHCNNU OKV   &QRRGNCFNGTRWP\G FGT *QHNKGHGTCPVGP XQP  DKU  *GTUVGNNGTDG\GKEJPWPI FGT (KTOC -GKDGN WPF   5V2GVGTUDWTIGT5VCFVRWP\G447<- 4++  143


RUSSISCHE ORDEN UND EHRENZEICHEN

8761



-CKUGTNKEJGT1TFGPFGTJGKNKIGP#PPC=Îðäåí èìïåð±òîðñêèé Ñâÿòîé Àííü³?/QFGNN CD  $TWUVUVGTP &WTEJOGUUGT  OO 5KNDGT XGTIQNFGV VNY GOCKNNKGTV CWH FGT 4ÒEMUGKVG /GKUVGTOCTMG   ÈË*GTUVGNNGTDG\GKEJPWPIÝÄÓÀÐÄÚFGT(KTOC'FWCTFKP5V2GVGTUDWTIWPF5V2GVGTUDWTIGT <QNQVPKMK -QMQUEJPKM5KNDGTRWP\G XQP  DKU  OKV FGO 2TQDKGTOGKUVGT\GKEJGP #2 HÒT #   4KMJVGT KP XKGT 5VTCJNGPURKV\GP LGYGKNU GKPG -QMQUEJPKM2WP\G XQP  DKU  CP 0CFGN FKGUG   GDGPHCNNUOKV-QMQUEJPKM2WP\GXQPDKU447<- 4++  5VCTM IGYÌNDVGT $TWUVUVGTP KP GKPGT HÒT FKG (KTOC 'FWCTF V[RKUEJGP #PHGTVKIWPI &KG /GKUVGTOCTMG ÈËKUVNCWV 6COOCPP KP6425 GKPGODKUJGTPKEJVKFGPVKHK\KGTVGP9GTMOGKUVGTFGT(KTOC'FWCTF\W\WQTFPGPWPFMCPPXQP DKUPCEJIGYKGUGPYGTFGP#4KMMJVGTYCTCNU2TQDKGTOGKUVGTPWTXQPDKUV·VKI

8762



144

-CKUGTNKEJGT1TFGPFGTJGKNKIGP#PPC=Îðäåí èìïåð±òîðñêèé Ñâÿòîé Àííü³?/QFGNN CD  -TGW\ FGT  -NCUUG  Z  OO )QNF GOCKNNKGTV  I OKV $CPF  'OCKNNGOCNGTGK CWH FGT   4ÒEMUGKVG FGU QDGTGP -TGW\CTOU WPVGT FGT 'OCKNNG &QRRGNCFNGTRWP\G FGT *QHNKGHGTCPVGP XQP  DKU    WPF CWH FGT 4ÒEMUGKVG FGU WPVGTGP -TGW\CTOU WPVGT FGT 'OCKNNG /GKUVGTOCTMG #- HÒT #NDGTV   -GKDGNKP5V2GVGTUDWTICWHFGT¤UG5V2GVGTUDWTIGT<QNQVPKMK)QNFRWP\GXQPDKUCO $CPFTKPICO\WUCOOGPIGP·JVGP*CNUDCPFUVÒEMKOQTKIKPCNGPOKVIQNFHCTDGPGT$G\GKEJPWPIDGFTWEM VGP8GTNGKJWPIUGVWK447<- ++ 


RUSSISCHE ORDEN UND EHRENZEICHEN

8763



-CKUGTNKEJGT1TFGPFGTJGKNKIGP#PPC=Îðäåí èìïåð±òîðñêèé Ñâÿòîé Àííü³?/QFGNN CD  -TGW\FGT-NCUUGZOO)QNFGOCKNNKGTVI'OCKNNGOCNGTGK8QTFGTUGKVGPOGFCKNNQP FTGJDCT CWH FGT 4ÒEMUGKVG FGU QDGTGP -TGW\CTOU WPVGT FGT 'OCKNNG /GKUVGTOCTMG ÂÄ HÒT 8CTXCTC   2GVTQYPC &KGVYCNF WPF CWH FGT 4ÒEMUGKVG FGU WPVGTGP -TGW\CTOU WPVGT FGT 'OCKNNG *GTUVGNNGTDG\GKEJ   PWPIÝÄÓÀÐÄÚHÒTFKG(KTOC'FWCTFKP5V2GVGTUDWTICWHFGT¤UG5V2GVGTUDWTIGT<QNQVPKMK -QMQUEJPKM)QNFRWP\GXQPDKUCO$CPFTKPIFCTCWH-QMQUEJPKM2WP\GXQPDKU COQTKIKPCNGPCNVGP*CNUDCPFUCDUEJPKVV447<- 4++ 

8764



-CKUGTNKEJGTWPF-ÌPKINKEJGT1TFGPXQOJGKNKIGP5VCPKUNCWU=Îðäåí èìïåð±òîðñêèé èêîðîë¾âñêèé  Ñâÿòîãî Ñòàíèñëàâà?/QFGNN  -TGW\FGT-NCUUG#WUHÒJTWPI  Z  OO )QNF GOCKNNKGTV  I 'OCKNNGOCNGTGK CWH FGT 4ÒEMUGKVG FGU QDGTGP -TGW\CTOU   &QRRGNCFNGTRWP\G FGT *QHNKGHGTCPVGP XQP  DKUWPFCWHFGT4ÒEMUGKVGFGUWPVGTGP-TGW\CTOU /GKUVGTOCTMG9-HÒT,QJCPP9KNJGNO-GKDGNKP5V2GVGTUDWTICWHFGT¤UG<QNQVPKMK)QNFRWP\G WPF,CJTGURWP\GCO$CPFTKPIOKVCNVGT5EJWNVGTDCPFUEJNGKHG447<- 44++  ,QJCPP9KNJGNO-GKDGN  GTJKGNVKP0CEJHQNIGXQP'OOCPWGN)GQTIXQP2CPPCUEJ\WUCOOGPOKV 9KNJGNO -·OOGTGT XQO 1TFGPUMCRKVGN FGP #WHVTCI \WT *GTUVGNNWPI CNNGT TWUUKUEJGP 1TFGP FGP GT DKU \WUGKPGO 6QFCWUHÒJTVG   &GTFTGKMNCUUKIG CD&G\GODGTXKGTMNCUUKIG MÌPKINKEJRQNPKUEJG1TFGPXQOJN5VCPKUNCWUYWTFGCO/CK  XQP -ÌPKI 5VCPKUNCY ++ #WIWUV 2QPKCVQYUMK   IGUVKHVGV  /QFGNN  WPF FGO RQNPKUEJGP 0CVKQPCN   JGKNKIGP 5VCPKUNCWU $KUEJQH XQP -TCMCW  MCPQPKUKGTV   IGYKFOGV &WTEJ FKG PGWGP 5VCVWVGP XQO    0QXGODGT  YWTFG GT XQP <CT 0KMQNCWU+2CYNQYKVUEJ  WPVGTFKGMCKUGTNKEJTWUUKUEJGP1TFGP CWHIGPQOOGP /QFGNN    <YKUEJGP  WPF  YKGUGP FKG QHHK\KGNN XGTNKGJGPGP -TGW\G #FNGT OKV YGKV CWUIGDTGKVGVGP 5EJYKPIGP CWH  

/QFGNN#WUHÒJTWPI FKGKPQHHK\KGNNUQICTDKUKPFKGGT,CJTGJGTIGUVGNNVYWTFGPJCDGPFKGFCOCNU QHHK\KGNNGP1TFGPULWYGNKGTG-GKDGN-·OOGTGT+PUKIPKGPOKVPCEJQDGPIGTKEJVGVGP#FNGT5EJYKPIGPIGPGJOKIV   #NU DGUQPFGTGT )PCFGPGTYGKU MQPPVGP FKG  WPF  -NCUUG XQP  DKU  OKV MCKUGTNKEJGT -TQPG XGTNKGJGP   YGTFGP/KVFGPPGWGP5VCVWVGPXQPYWTFGFKG-NCUUGCDIGUEJCHHV#O#WIWUVYWTFGPFKG-TGW\G WPF CO  1MVQDGT  FKG $TWUVUVGTPG HÒT 0KEJV%JTKUVGP IGPGJOKIV  YWTFG FKG 8GTNGKJWPI XQP   $TWUVUVGTPGP KP /GVCNN QHHK\KGNN IGPGJOKIV /KV MCKUGTNKEJGO 7MCU <CT #NGZCPFGT ++ 0KMQNCLGYKVUEJ     XQO  #WIWUV  YWTFGP IGMTGW\VG 5EJYGTVGT CWH FGP +PUKIPKGP HÒT 8GTNGKJWPIGP HÒT 6CRHGTMGKV KO -CORH   IGPGJOKIV#O#RTKNGTJKGNVFKGFTKVVG-NCUUGHÒT/KNKV·TXGTFKGPUVGKPGCWHFGO$CPFCPIGDTCEJVG5EJNGKHG #DWPIGH·JTFGOINGKEJGP,CJTMQPPVGPIGO·­GKPGTLGYGKNKIGPRGTUÌPNKEJGP'PVUEJGKFWPIFGU<CTGP4KVVGTFGU5V #PFTGCU1TFGPUFKGFGP5V5VCPKUNCWU1TFGPPQEJPKEJVGTJCNVGPJCVVGPFKGUGPINGKEJ\GKVKIOKVLGPGOGTJCNVGP   0CEJFGO GT  XQP FGT 2TQXKUQTKUEJGP 4GIKGTWPI ÒDGTPQOOGP YQTFGP YCT  /QFGNN  YWTFG GT XQP FGP   $QNUEJGYKMK  CDIGUEJCHHV  YWTFG FGT 1TFGP KP 2QNGP CNU JCNDQHHK\KGNNGT 1TFGP WPVGT FGO 2CVTQPCV FGT   MCVJQNKUEJGP-KTEJGYKGFGTDGNGDV

145


RUSSISCHE ORDEN UND EHRENZEICHEN

8765 (3/4 Größe)



-CKUGTNKEJGT WPF -ÌPKINKEJGT 1TFGP XQO JGKNKIGP 5VCPKUNCWU =Îðäåí èìïåð±òîðñêèé è   êîðîë¾âñêèé Ñâÿòîãî Ñòàíèñëàâà?  /QFGNN   -TGW\ FGT  -NCUUG  #WUHÒJTWPI  

   Z  OO )QNF GOCKNNKGTV  I 'OCKNNGOCNGTGK CWH FGT 4ÒEMUGKVG FGU QDGTGP   -TGW\CTOU&QRRGNCFNGTRWP\GFGT*QHNKGHGTCPVGPXQPDKUWPFCWHFGT4ÒEMUGKVGFGUWPVGTGP -TGW\CTOU /GKUVGTOCTMG #- HÒT #NDGTV -GKDGN KP 5V 2GVGTUDWTI CWH FGT ¤UG  <QNQVPKMK YQJN   -QMQUEJPKM  )QNFRWP\G YQJN XQP  DKU   CO $CPFTKPI QJPG 5EJWNVGTDCPF 447  <-    4++  #WHITWPFFGT-QODKPCVKQPFGT/GKUVGTOCTMG#-WPFFGTPWTVGKNYGKUGGTMGPPDCTGP)QNFRWP\GDGKFGTGUUKEJ LGFQEJWOGKPG-QMQUJPKM)QNFRWP\GXQPDKUJCPFGNPFÒTHVGN·­VUKEJFGT*GTUVGNNWPIU\GKVTCWO\YKUEJGP WPFGKPITGP\GPFC#NDGTV-GKDGNPWTDKU\WO,CJTGQHHK\KGNNGT.KGHGTCPVFGT1TFGPUMCP\NGKYCT

8766



146

-CKUGTNKEJGT WPF -ÌPKINKEJGT 1TFGP XQO JGKNKIGP 5VCPKUNCWU =Îðäåí èìïåð±òîðñêèé è   êîðîë¾âñêèé Ñâÿòîãî Ñòàíèñëàâà?/QFGNN  $TWUVUVGTP&WTEJOGUUGTOO5KNDGT VNY XGTIQNFGV VNY GOCKNNKGTV CWH FGT 4ÒEMUGKVG &QRRGNCFNGTRWP\G FGT *QHNKGHGTCPVGP XQP  DKU    *GTUVGNNGTDG\GKEJPWPI FGT (KTOC-GKDGNKP5V2GVGTUDWTIWPF5V2GVGTUDWTIGT<QNQVPKMK5KN DGTRWP\G XQP  DKU  CP 0CFGN FKGUG GDGPHCNNU OKV &QRRGNCFNGTRWP\G FGT *QHNKGHGTCPVGP XQP   DKU*GTUVGNNGTDG\GKEJPWPIFGT(KTOC-GKDGNWPF5V2GVGTUDWTIGT5VCFVRWP\G447<-  4++ 


RUSSISCHE ORDEN UND EHRENZEICHEN

8767 (3/4 Größe)



-CKUGTNKEJGT WPF -ÌPKINKEJGT 1TFGP XQO JGKNKIGP 5VCPKUNCWU =Îðäåí èìïåð±òîðñêèé è   êîðîë¾âñêèé Ñâÿòîãî Ñòàíèñëàâà?  /QFGNN   $TWUVUVGTP &WTEJOGUUGT  OO 5KN   DGTVNYXGTIQNFGVVNYGOCKNNKGTVCWHFGT4ÒEMUGKVG/GKUVGTOCTMGÈ#HÒT+XCP#NGMUGGYKVUEJ#NGM UGGYKP/QUMCWWPF/QUMCWGT<QNQVPKMK5KNDGTRW\GXQPOKVFGO2TQDKGTOGKUVGT\GKEJGP$% HÒT 8KMVQT 5CXKPMQX CP 5EJTCWDG OKV 5EJTCWD WPF 7PVGTNCIUUEJGKDG NGV\VGTG GDGPHCNNU OKV 4ÒEMUGKVG   /GKUVGTOCTMGÈ#HÒT+XCP#NGMUGGYKVUEJ#NGMUGGYKP/QUMCWWPF/QUMCWGT<QNQVPKMK5KNDGTRW\G XQPOKVFGO2TQDKGTOGKUVGT\GKEJGP$%HÒT8KMVQT5CXKPMQY447<- 4++  +XCP#NGZGLGYKVUEJ#NGZGLGYGTÌHHPGVGNCWV6COOCPP KP6425 KP/QUMCWGKPG,WYGNKGTHCDTKMFKGYQJNDKU DGUVCPFJCVVGTGT$GUEJ·HVKIVG8KMVQT5CXKPMQXYCTXQPDKU2TQDKGTOGKUVGTKP/QUMCW

8768



-CKUGTNKEJGT WPF -ÌPKINKEJGT 1TFGP XQO JGKNKIGP 5VCPKUNCWU =Îðäåí èìïåð±òîðñêèé è   êîðîë¾âñêèé Ñâÿòîãî Ñòàíèñëàâà?/QFGNN  $TWUVUVGTP&WTEJOGUUGTOO5KNDGT VNY XGTIQNFGV VNY GOCKNNKGTV CWH FGT 4ÒEMUGKVG /GKUVGTOCTMG ÈË *GTUVGNNGTDG\GKEJPWPI   ÝÄÓÀÐÄÚFGT(KTOC'FWCTFKP5V2GVGTUDWTIWPF5V2GVGTUDWTIGT<QNQVPKMK-QMQUEJPKM5KNDGT RWP\G XQP  DKU  KP \YGK 5VTCJNGPURKV\GP LGYGKNU GKPG -QMQUEJPKM2WP\G  DKU    CP 0CFGN GDGPHCNNU OKV -QMQUEJPKM2WP\G XQP  DKU  447  <-    4++  5VCTMIGYÌNDVGT$TWUVUVGTPKPGKPGTHÒTFKG(KTOC'FWCTFV[RKUEJGP#PHGTVKIWPI

147


RUSSISCHE ORDEN UND EHRENZEICHEN

8769 (3/4 Größe)



8769 (3/4 Größe)

-CKUGTNKEJGT WPF -ÌPKINKEJGT 1TFGP XQO JGKNKIGP 5VCPKUNCWU =Îðäåí èìïåð±òîðñêèé è   êîðîë¾âñêèé Ñâÿòîãî Ñòàíèñëàâà?/QFGNN  $TWUVUVGTP&WTEJOGUUGTOO5KNDGT VNYXGTIQNFGVVNYGOCKNNKGTVOKPQDGTHN·EJNKEJG#DURNKVVGTWPIGPKPFGTITÒPG'OCKNNGCWHFGT4ÒEM UGKVG /GKUVGTOCTMG ÂÄ HÒT 8CTXCTC 2GVTQYPC &KGVYCNF *GTUVGNNGTDG\GKEJPWPI ÝÄÓÀÐÄÚ FGT   (KTOC'FWCTFKP5V2GVGTUDWTIWPF5V2GVGTUDWTIGT<QNQVPKMK-QMQUEJPKM5KNDGTRWP\GXQPDKU  KP \YGK 5VTCJNGPURKV\GP LGYGKNU GKPG -QMQUEJPKM2WP\G XQPDKUCP0CFGN GDGPHCNNUOKV-QMQUEJPKM2WP\GXQPDKU447<- 4++ 

8770



-CKUGTNKEJGT WPF -ÌPKINKEJGT 1TFGP XQO JGKNKIGP 5VCPKUNCWU =Îðäåí èìïåð±òîðñêèé è   êîðîë¾âñêèé Ñâÿòîãî Ñòàíèñëàâà?  /QFGNN   $TWUVUVGTP OKV 5EJYGTVGTP ÒDGT FGO   /GFCKNNQP &WTEJOGUUGT  OO 5KNDGT VNY XGTIQNFGV /GFCKNNQPCWHNCIGPVNY)QNFIGIQUUGPVNY GOCKNNKGTVFKGIGMTGW\VGP5EJYGTVGTCPFGT-TGW\WPIUUVGNNGCWHFGP5VGTPMQTRWUIGPKGVGV PKEJVXGTNÌVGV  CWHFGT4ÒEMUGKVG/GKUVGTOCTMGÏÑHÒT2CXGN5C\KMQYKP/QUMCWWPF5V2GVGTUDWTIGT  <QNQV PKMK-QMQUEJPKM5KNDGTRW\GXQPDKUCP5EJTCWDGOKV5EJTCWDLGFQEJQJPG7PVGTNCIU UEJGKDG447<- 4++  'KPYKFGTURTÒEJNKEJGU'ZGORNCTFCUGUUVCVWVGPIGO·­PKEJVIGIGDGPJCDGPMCPPDGKFGOUKEJFKG/GKUVGTOCTMG CWU /QUMCW  WPF FKG 5V 2GVGTUDWTIGT 5KNDGTRWP\G \W YKGFGTURTGEJGP UEJGKPGP #WEJ FKG /QPQITCOO WPF /QVVQ   #WHNCIGP KO /GFCKNNQP UEJGKPGP FC CWIGPUEJGKPNKEJ IGIQUUGP PKEJV QTKIKPCN \W UGKP &GO GPVIGIGP UEJGKPGP FKG   IGMTGW\VGP 5EJYGTVGT FC IGRT·IV WPF XGTPKGVGV WPF PKEJV YKG DGK FGP FGWVUEJGP 8GTH·NUEJWPIGP CWU FGO NGV\VGP   &TKVVGNFGU<YCP\KIUVGP,CJTJWPFGTVUIGIQUUGPWPFXGTNÌVGV YKTMNKEJQTKIKPCN\WUGKP5QOKVMÌPPVGGUUKEJYQOÌINKEJ WOGKPCWUVNYQTKIKPCNGP6GKNGPXGTUEJKGFGP7TURTWPIUTGUVCWTKGTVGU'ZGORNCTJCPFGNP   2CXGN)QNFWPF5KNDGTUEJOKGFGOGKUVGTWPF5GTIGL5C\KMQXJCDGPNCWV6COOCPP KP6425H FCU)GUEJ·HV KJTGU8CVGTU+IPCVK[2CYNQYKVUEJ5C\KMQY IGUV ÒDGTPQOOGPWPFPGDGP,WYGNKGTU)QNFWPF5KNDGTUEJOKGFG CTDGKVGPCWEJGKPG4GKJGXQP1TFGPUKPUKIPKGPJGTIGUVGNNV&KG(KTOCUQNNDKUDGUVCPFGPJCDGP

148


RUSSISCHE ORDEN UND EHRENZEICHEN

8771 (3/4 Größe)



8771 (3/4 Größe)

-CKUGTNKEJGT WPF -ÌPKINKEJGT 1TFGP XQO JGKNKIGP 5VCPKUNCWU =Îðäåí èìïåð±òîðñêèé è   êîðîë¾âñêèé Ñâÿòîãî Ñòàíèñëàâà?/QFGNN  $TWUVUVGTPHÒT0KEJV%JTKUVGP&WTEJOGU UGTOO5KNDGTVNYXGTIQNFGVVNYGOCKNNKGTVCWHFGT4ÒEMUGKVG&QRRGNCFNGTRWP\GFGT*QHNKGHG TCPVGPXQPDKU*GTUVGNNGTDG\GKEJPWPIFGT(KTOC-GKDGNKP5V2GVGTUDWTIWPF5V2GVGTUDWT IGT<QNQVPKMK5KNDGTRWP\GXQPDKUCP0CFGNFKGUGCPFGT8GTNÌVWPIGVYCUCPIGTKUUGPOKV &QRRGNCFNGTRWP\G FGT *QHNKGHGTCPVGP XQP  DKU  *GTUVGNNGTDG\GKEJPWPI FGT (KTOC -GKDGN WPF   5V2GVGTUDWTIGT5VCFVRWP\G447$<- 44++  )GO·­#PQTFPWPI<CT0KMQNCWU+2CYNQYKVUEJ  XQO1MVQDGTYWTFGPFKG$TWUVUVGTPGHÒT0KEJV %JTKUVGPIGPGJOKIVDGKFGPGPFCU/QPITCOOFGUJGKNKIGP5VCPKUNCWU55FWTEJGKPGP<CTGPCFNGTGTUGV\VYWTFG

8772 (3/4 Größe)



8772 (3/4 Größe)

-CKUGTNKEJGT WPF -ÌPKINKEJGT 1TFGP XQO JGKNKIGP 5VCPKUNCWU =Îðäåí èìïåð±òîðñêèé è   êîðîë¾âñêèé Ñâÿòîãî Ñòàíèñëàâà?/QFGNN  $TWUVUVGTPHÒT0KEJV%JTKUVGP&WTEJOGU UGTOO5KNDGTVNYXGTIQNFGVVNYGOCKNNKGTVCWHFGT4ÒEMUGKVG&QRRGNCFNGTRWP\GFGT*QHNKGHG TCPVGP XQP  DKU  *GTUVGNNGTDG\GKEJPWPI FGT (KTOC -GKDGN KP 5V2GVGTUDWTIWPF<QNQVPKMK -QMQUEJPKM5KNDGTRWP\GXQPDKUOKVFGO2TQDKGTOGKUVGT\GKEJGPßËHÒT;CMQX.[CRWPQX CP 0CFGN FKGUG GDGPHCNNU OKV &QRRGNCFNGTRWP\G FGT *QHNKGHGTCPVGP XQP  DKU  *GTUVGNNGTDG   \GKEJPWPIFGT(KTOC-GKDGNWPF-QMQUEJPKM2WP\GXQPDKU447$<- 44++  ;CMQX .[CRWPQX YCT CNU 2TQDKGTOGKUVGT PWT XQP  DKU  V·VKI YCU FGO\WHQNIG FGT 'PVUVGJWPIU\GKV FKGUGU   $TWUVUVGTPUGPVURTKEJV

149


RUSSISCHE ORDEN UND EHRENZEICHEN

8773



-CKUGTNKEJGT WPF -ÌPKINKEJGT 1TFGP XQO JGKNKIGP 5VCPKUNCWU =Îðäåí èìïåð±òîðñêèé è   êîðîë¾âñêèé Ñâÿòîãî Ñòàíèñëàâà?  /QFGNN   -TGW\ FGT  -NCUUG  #WUHÒJTWPI  

 ZOO)QNFGOCKNNKGTVI'OCKNNGOCNGTGKOKP#WUDTÒEJGKPFGTITÒPGP 'OCKNNG CWH FGT 4ÒEMUGKVG FGU QDGTGP -TGW\CTOU &QRRGNCFNGTRWP\G FGT *QHNKGHGTCPVGP XQP  DKU   WPFCWHFGT4ÒEMUGKVGFGUWPVGTGP-TGW\CTOU/GKUVGTOCTMG#-HÒT#NDGTV-GKDGNKP5V2GVGTU DWTICWHFGT¤UG5V2GVGTUDWTIGT<QNQVPKMK)QNFRWP\GXQPDKUCO$CPFTKPIFKGUGTOKV 5V2GVGTUDWTIGT5VCFVRWP\GCO*CNUDCPFCDUEJPKVV447<- ++ 

8774



150

-CKUGTNKEJGT WPF -ÌPKINKEJGT 1TFGP XQO JGKNKIGP 5VCPKUNCWU =Îðäåí èìïåð±òîðñêèé è   êîðîë¾âñêèé Ñâÿòîãî Ñòàíèñëàâà?  /QFGNN   -TGW\ FGT  -NCUUG  #WUHÒJTWPI  

 ZOO)QNFGOCKNNKGTVI'OCKNNGOCNGTGKOKPMCWOUKEJVDCTG#WUDTÒEJG KPFGTITÒPGP'OCKNNGTÒEMUGKVKIGU/GFCKNNQPGVYCUXGTFTGJVCWHFGT4ÒEMUGKVGFGUQDGTGP-TGW\CTOU /GKUVGTOCTMGÂÄHÒT8CTXCTC2GVTQYPC&KGVYCNFWPFCWHFGT4ÒEMUGKVGFGUWPVGTGP-TGW\CTOU*GT UVGNNGTDG\GKEJPWPIÝÄÓÀÐÄÚHÒTFKG(KTOC'FWCTFKP5V2GVGTUDWTICWHFGT¤UG5V2GVGTUDWTIGT  <QNQVPKMK -QMQUEJPKM)QNFRWP\G XQP  DKU  CWH FGT 4ÒEMUGKVG FGT DGKFGP $ÌIGPFGT YCCITGEJVGP #TOG LGYGKNU -QMQUEJPKM2WP\G XQP  DKU  CO $CPFTKPI FCTCWH GDGPHCNNU   -QMQUEJPKM2WP\G XQP  DKU  CO QTKIKPCNGP CNVGP *CNUDCPFCDUEJPKVV KO QTKIKPCNGP OKV   IQNFHCTDGPGO<CTGPCFNGTDGFTWEMVGP8GTNGKJWPIUGVWK447<- ++ 


RUSSISCHE ORDEN UND EHRENZEICHEN

8775



-CKUGTNKEJGT WPF -ÌPKINKEJGT 1TFGP XQO JGKNKIGP 5VCPKUNCWU =Îðäåí èìïåð±òîðñêèé è   êîðîë¾âñêèé Ñâÿòîãî Ñòàíèñëàâà?  /QFGNN   -TGW\ FGT  -NCUUG  #WUHÒJTWPI  

 KPQHHK\KGNNGPKEJVUVCVWVGPIGO·­G#PHGTVKIWPIOKTTÒEMUGKVKIGOCKNNKGTVGP-TGW\CTOGP ZOO)QNFGOCKNNKGTVI8QTFGTUGKVGP/QPQITCOOKP)QNFGOCKNNKGTVCWHFCU/GFCKNNQPHGNF CWHIGUGV\VOKVDTGKVGO/GFCKNNQPTKPIFKG&QRRGNCFNGTFWTEJ<WUCOOGPNÌVGPDGKFUGKVKICWUIGHÒJTVFKG 4ÒEMUGKVGP FGT -TGW\CTOG GDGPHCNNU GOCKNNKGTV GKP -TGW\CTOTCPF OKV NGKEJVGT &GNNG UVCTM IGYÌNDVGU   4ÒEMUGKVGPOGFCKNNQP OKV )QNFUVCWDOCNGTGK KP FGT ¤UG /GKUVGTOCTMG È.Ê HÒT +XCP -TWVKMQY KP   /QUMCW WPF 5V 2GVGTUDWTIGT  <QNQVPKMK -QMQUEJPKM)QNFRWP\G XQP  DKU  CWH FGT   4ÒEMUGKVGFGTDGKFGP$ÌIGPFGTYCCITGEJVGP#TOGWPFKO<[NKPFGTLGYGKNU-QMQUEJPKM2WP\GXQP DKUCO$CPFTKPIFKGUGTGDGPHCNNUOKV-QMQUEJPKM2WP\GXQPDKUCOQTKIK PCNGPCNVGP*CNUDCPF447<-XCT ++  5GJTKPVGTGUUCPVGWPFSWCNKV·VUXQNNCWUIGHÒJTVGUGNVGPG#PHGTVKIWPIU8CTKCPVG+XCPWPF2GVGT-KTKNNQYKVUEJ-TWVKMQY JCVVGPNCWV6COOCPP KP6425 KP/QUMCWGKPG(CDTKMHÒT)QNFWPF5KNDGTYCTGPXQPECDKUPCEJ DGUEJ·HVKIVGFCU7PVGTPGJOGP*CPFYGTMGTWPF.GJTNKPIG

8776



-CKUGTNKEJGT WPF -ÌPKINKEJGT 1TFGP XQO JGKNKIGP 5VCPKUNCWU =Îðäåí èìïåð±òîðñêèé è   êîðîë¾âñêèé Ñâÿòîãî Ñòàíèñëàâà?  /QFGNN   -TGW\ FGT  -NCUUG  #WUHÒJTWPI  

 ZOO)QNFGOCKNNKGTVI'OCKNNGOCNGTGKOKPMCWOUKEJVDCTG#WUDTÒEJG KPFGTITÒPGP'OCKNNGCWHFGT4ÒEMUGKVG/GKUVGTOCTMGÈËWPF*GTUVGNNGTDG\GKEJPWPIÝÄÓÀÐÄÚ FGT(KTOC'FWCTFKP5V2GVGTUDWTICWHFGT¤UG5V2GVGTUDWTIGT<QNQVPKMK-QMQUEJPKM)QNFRWP\G XQP  DKU  CWH FGT 4ÒEMUGKVG FGT DGKFGP $ÌIGP FGT YCCITGEJVGP #TOG LGYGKNU -Q   MQUEJPKM2WP\GXQPDKUCO$CPFTKPIFKGUGTGDGPHCNNUOKV-QMQUEJPKM2WP\GXQP DKUOKVCNVGO$QIGPDCPFUEJYGFKUEJGT0·JCTVKOQTKIKPCNGPOKVIQNFHCTDGPGT$G\GKEJPWPI WPF<CTGPCFNGTDGFTWEMVGP8GTNGKJWPIUGVWKFCTCWHJCPFUEJTKHVNKEJG$G\GKEJPWPI.'55+0)447 <- ++ 

151


RUSSISCHE ORDEN UND EHRENZEICHEN

8777



-CKUGTNKEJGT WPF -ÌPKINKEJGT 1TFGP XQO JGKNKIGP 5VCPKUNCWU =Îðäåí èìïåð±òîðñêèé è   êîðîë¾âñêèé Ñâÿòîãî Ñòàíèñëàâà?  /QFGNN   -TGW\ FGT  -NCUUG  #WUHÒJTWPI  

   Z  OO )QNF GOCKNNKGTV  I 'OCKNNGOCNGTGK #WUDTÒEJG KP FGT ITÒPGP   'OCKNNGCWHFGT4ÒEMUGKVGFGUQDGTGP-TGW\CTOU/GKUVGTOCTMGÂÄHÒT8CTXCTC2GVTQYPC&KGVYCNF WPFCWHFGT4ÒEMUGKVGFGUWPVGTGP-TGW\CTOU*GTUVGNNGTDG\GKEJPWPIÝÄÓÀÐÄÚHÒTFKG(KTOC'FWCTF KP5V2GVGTUDWTICWHFGT¤UG<QNQVPKMK-QMQUEJPKM)QNFRWP\GXQPDKUWPFUGRCTCVG -QMQUEJPKM2WP\G XQP  DKU  CO $CPFTKPI FCTCWH -QMQUEJPKM2WP\G XQP  DKU   QJPG$CPFKOQTKIKPCNGPOKVIQNFHCTDGPGT$G\GKEJPWPIDGFTWEMVGPKO5EJCTPKGTTGRCTKGT VGP8GTNGKJWPIUGVWK447<- 4++ 



-CKUGTNKEJGT WPF -ÌPKINKEJGT 1TFGP XQO JGKNKIGP 5VCPKUNCWU =Îðäåí èìïåð±òîðñêèé è   êîðîë¾âñêèé Ñâÿòîãî Ñòàíèñëàâà?/QFGNN  QTKIKPCNGUNGGTGU QJPGFCU-TGW\ 'VWK \WO-TGW\FGT-NCUUG#WUHÒJTWPI  OKVIQNFHCTDGPIGFTWEMVGO<CTGPCFNGT ++



*GTXQTTCIGPFGT<WUVCPF

8779 (3/4 Größe)



8780

1TFGP 8KTVWVK /KNKVCTK =1TFGT 8KTVWVK /KNKVCTK?  /QFGNN OKV FGT ,CJTGU\CJN   -TGW\   -NCUUGZOO5KNDGTCOPGWIGHCNVGVGPRGPVCIQPCNGP$CPF447<- ++



&GT 1TFGP IGJV CWH GKPG XQP -ÌPKI 5VCPKUNCY ++ #WIWUV 2QPKCVQYUMK   CO  ,WPK  IGUVKHVGVGP   \YGKMNCUUKIGP )QNF WPF 5KNDGT  /KNKV·T8GTFKGPUVOGFCKNNG  /QFGNN  \WTÒEM FKGDGTGKVUKO#WIWUVFGUINGKEJGP ,CJTGUKPGKPGPHÒPHMNCUUKIGP1TFGP /QFGNN WOIGYCPFGNVYQTFGPYCT&KGUGTYWTFGDGTGKVUCO#WIWUV YKGFGTCDIGUEJCHHVCO0QXGODGTYKGFGTGTTKEJVGVWPFCO,CPWCTCWH$GVTGKDGP<CTKP-CVJCTKPC++ FGT)TQ­GPGTPGWVCDIGUEJCHHV#O&G\GODGTYWTFGFGT1TFGPXQO-ÌPKI(TKGFTKEJ#WIWUVXQP5CEJUGP WPF)TQ­JGT\QIXQP9CTUEJCWYKGFGTGTTKEJVGV /QFGNN #WEJKOUQIGP-QPITG­2QNGPWPVGTFGT4GIKGTWPIFGU <CT0KMQNCWU+2CYNQYKVUEJ  CNURQNPKUEJGT-ÌPKIDGUVCPFFGT1TFGPYGKVGT0CEJFGT0KGFGTUEJNCIWPI FGU 2QNPKUEJGP #WHUVCPFGU  PCJO <CT 0KMQNCWU +FGP1TFGPWPVGTFKGTWUUKUEJGP1TFGPCWH /QFGNN FKG 8GTNGKJWPILGFQEJDCNFFCTCWHGKPIGUVGNNV'TUVPCEJ)TÒPFWPIFGT4GRWDNKM2QNGPYWTFGFGT1TFGPXQORQNPKUEJGP 5GLOCO#WIWUVYKGFGTGTTKEJVGV /QFGNN FGTKPFKGUGT(QTOCWEJXQPFGTRQNPKUEJGP'ZKN4GIKGTWPIKP .QPFQP DKU XGTNKGJGPYWTFG#O#WIWUVGTPGWGTVGKJPFCUXQPFGT5QYLGVWPKQPIGUVÒV\VG0CVKQPCN -QOKVGGHÒTFKG$GHTGKWPI2QNGPU /QFGNN +PNGKEJVXGT·PFGTVGT(QTOÒDGTPCJOKJPFCPPCWEJFKG8QNMUTGRWDNKM 2QNGP /QFGNN #WEJPCEJFGO5VWT\FGU-QOOWPKUVKUEJGP4GIKOGUÒDGTPCJOFKG4GRWDNKM2QNGPFGP1TFGPKP FGT(QTOXQP /QFGNN 

<#4'067/ $+5 '*4'0<'+%*'0 

/GFCKNNG(ÒT'KHGT=Ìåäàë "Çà Óñåðä³å"?/QFGNN OKVFGO2QTVTCKV<CT0KMQNCWU+ #WUICDG

2QTVTCKVOKV5EJPWTTDCTVXKGTUVWHKI -NGKPG5KNDGTPG/GFCKNNG5KNDGTOKV5VGORGNUEJPGK FGTUKIPCVWT #Ë KO *CNUCDUEJPKVV CO PGW RGPVCIQPCN IGHCNVGVGP $CPF FGU 5V #PPGP1TFGPU447 % ++ &KGWTURTÒPINKEJ\YGKUVWHKIG )QNFWPF5KNDGT /GFCKNNGYWTFGKO&G\GODGTXQP<CT#NGZCPFGT+2CYNQYKVUEJ

 IGUVKHVGV /QFGNN WPFMCOKP\YGK#WUHÒJTWPIGP OKVMÒT\GTGOWPFN·PIGTGO6KVGN\WT8GTNGKJWPI  GTJKGNVUKGFCU2QTVTCKV<CT0KMQNCWU+2CYNQYKVUEJ   /QFGNN WPFOKV7MCUXQO,CPWCT YWTFG UKG XKGTUVWHKI )TQ­G WPF -NGKPG )QNFGPG /GFCKNNG )TQ­G WPF -NGKPG 5KNDGTPG /GFCKNNG   YWTFG FCU   2QTVTCKVGTPGWVIG·PFGTV /QFGNN #D\GKIVGFCU2QTVTCKV<CT#NGZCPFGT++0KMQNCLGYKVUEJ  \W P·EJUVPCEJNKPMU #WUICDG WPFCDPCEJTGEJVU #WUICDG GTJKGNVUKGFCU2QTVTCKV<CT#NGZCPFGTU+++ 0KMQNCLGYKVUEJ   /QFGNN CWUIGIGDGPOKV\YGKXGTUEJKGFGPGP5VGORGNUEJPGKFGTUKIPCVWTGP WPF #WUICDG UEJNKG­NKEJYWTFGFKGICP\G/GFCKNNGWPVGT<CT0KMQNCWU++#NGZCPFTQYKVUEJ  PGWIGUVCN VGV /QFGNN /KV#DUEJCHHWPIFGT/QPCTEJKGYWTFGCWEJFKG8GTNGKJWPIFGT/GFCKNNGGKPIGUVGNNV

152




RUSSISCHE ORDEN UND EHRENZEICHEN

8781





8782

/GFCKNNG (ÒT 'KHGT =Ìåäàë "Çà Óñåðä³å"?  /QFGNN OKV FGO 2QTVTCKV <CT #NGZCPFGTU ++     #WUICDG -QRHPCEJNKPMU -NGKPG5KNDGTPG/GFCKNNG5KNDGTOKV5VGORGNUEJPGKFGTUKIPCVWT "Ã.Ã." KO *CNUCDUEJPKVV OKV PGW RGPVCIQPCN IGHCNVGVGP $CPF FGU 5V #PPGP1TFGPU CP UQYLGVKUEJGT   2GPVCIQPCNDCPFURCPIG447# ++



/GFCKNNG (ÒT 'KHGT =Ìåäàë "Çà Óñåðä³å"?  /QFGNN OKV FGO 2QTVTCKV <CT #NGZCPFGTU ++     #WUICDG -QRHPCEJNKPMU -NGKPG5KNDGTPG/GFCKNNG5KNDGTOKV5VGORGNUEJPGKFGTUKIPCVWT "Ã.Ã."KO*CNUCDUEJPKVV¤UGGPVHGTPVUVCTMIGVTCIGP447# +++



8784

8783





8783

/GFCKNNG (ÒT 'KHGT =Ìåäàë "Çà Óñåðä³å"?  /QFGNN OKV FGO 2QTVTCKV <CT #NGZCPFGTU ++     #WUICDG -QRHPCEJTGEJVU )TQ­G5KNDGTPG/GFCKNNG5KNDGTOKV5VGORGNUEJPGKFGTUKIPCVWT "Ï.Ì."KO*CNUCDUEJPKVV4CPFFGNNGCOQTKIKPCNGP*CNUDCPFFGU5V5VCPKUNCWU1TFGPU447$ ++



/GFCKNNG (ÒT 'KHGT =Ìåäàë "Çà Óñåðä³å"?  /QFGNN OKV FGO 2QTVTCKV <CT #NGZCPFGTU ++     #WUICDG -QRH PCEJ TGEJVU    -NGKPG 5KNDGTPG /GFCKNNG 5KNDGT QJPG 5VGORGNUEJPGKFGTUK   IPCVWTCOPGWRGPVCIQPCNIGHCNVGVGP$CPFFGU5V#PPGP1TFGPU447% ++



8785



/GFCKNNG(ÒT'KHGT=Ìåäàë "Çà Óñåðä³å"?/QFGNN OKVFGO2QTVTCKV<CT#NGZCPFGTU+++  #WUICDG OKV5VGORGNUEJPGKFGTUKIPCVWT"ÀÃ." )TQ­G5KNDGTPG/GFCKNNG5KNDGTOKV5VGORGN UEJPGKFGTUKIPCVWT "ÀÃ." KO *CNUCDUEJPKVV CO QTKIKPCNGP *CNUDCPF FGU 5V 5VCPKUNCWU1TFGPU 447   $ ++

 153


RUSSISCHE ORDEN UND EHRENZEICHEN

8787 8786





8786

/GFCKNNG(ÒT'KHGT=Ìåäàë "Çà Óñåðä³å"?/QFGNN OKVFGO2QTVTCKV<CT#NGZCPFGTU+++    #WUICDG OKV 5VGORGNUEJPGKFGTUKIPCVWT "ÀÃ."  -NGKPG 5KNDGTPG /GFCKNNG 5KNDGT OKV 5VGO   RGNUEJPGKFGTUKIPCVWT"ÀÃ."KO*CNUCDUEJPKVVCOPGWRGPVCIQPCNIGHCNVGVGP$CPFFGU5V#PPGP1TFGPU 447% ++



/GFCKNNG (ÒT 'KHGT =Ìåäàë "Çà Óñåðä³å"?  /QFGNN OKV FGO 2QTVTCKV <CT 0KMQNCWU ++       -NGKPG )QNFGPG /GFCKNNG )QNF &WTEJOGUUGT  OO  I CO QTKIKPCNGP CNVGP GVYCU \GT   UEJNKUUGPGP$CPFFGU5V#PPGP1TFGPUOKV6TCIGURCPIGUEJYGFKUEJGT#TV447# )1.&++ 

8788

8789

8789



/GFCKNNG (ÒT 'KHGT =Ìåäàë "Çà Óñåðä³å"?  /QFGNN OKV FGO 2QTVTCKV <CT 0KMQNCWU ++       -NGKPG )QNFGPG /GFCKNNG )QNF &WTEJOGUUGT  OO    I OKV 4CPFMTCV\GTP QJPG   $CPFTKPIWPFQJPG$CPF447#XCT )1.&++ 



/GFCKNNG (ÒT 'KHGT =Ìåäàë "Çà Óñåðä³å"?  /QFGNN OKV FGO 2QTVTCKV <CT 0KMQNCWU ++      )TQ­G5KNDGTPG/GFCKNNG5KNDGTQJPG$CPFTKPIWPFQJPG$CPF447 ++

8790





154



8791

/GFCKNNG (ÒT 'KHGT =Ìåäàë "Çà Óñåðä³å"?  /QFGNN OKV FGO 2QTVTCKV <CT 0KMQNCWU ++       -NGKPG 5KNDGTPG /GFCKNNG 5KNDGT OKV PGW RGPVCIQPCN IGHCNVGVGP $CPF FGU 5V )GQTI1TFGPU CP   UQYLGVKUEJGT2GPVCIQPCNDCPFURCPIG447# ++



/GFCKNNG (ÒT 'KHGT =Ìåäàë "Çà Óñåðä³å"?  /QFGNN OKV FGO 2QTVTCKV <CT 0KMQNCWU ++       -NGKPG 5KNDGTPG /GFCKNNG 5KNDGT CP CNVGT &COGPUEJNGKHG CWU FGO $CPF FGU 5V 5VCPKUNCWU   1TFGPU447# ++




RUSSISCHE ORDEN UND EHRENZEICHEN

8793

8792



8792

/GFCKNNG(ÒT6CRHGTMGKV=Ìåäàë "Çà Õðàáðîñòü"?/QFGNN OKVFGO2QTVTCKV<CT0KMQNCWU+ #WUICDG -QRHQJPG5EJPWTTDCTV CNVG<YGKVCPHGTVKIWPIFGT)QNFGPGP/GFCKNNG5KNDGTIW­

  CNV XGTIQNFGV 8GTIQNFWPI VNY DGTKGDGP UVCTM IGVTCIGP CO PGWGP $CPFTKPI OKV NCPIGO PGWGP   $CPFCDUEJPKVVFGU5V)GQTI1TFGPU +++



&KGWTURTÒPINKEJ\YGKUVWHKIG )QNFWPF5KNDGT /GFCKNNGYWTFGKO/CKXQP<CT#NGZCPFGT+2CYNQYKVUEJ   IGUVKHVGV /QFGNN GTJKGNVUKGFCU2QTVTCKVXQP<CT0KMQNCWU+2CYNQYKVUEJ   /QFGNN  WPFYWTFGUKGXKGTUVWHKI )TQ­GWPF-NGKPG)QNFGPG/GFCKNNG)TQ­GWPF-NGKPG5KNDGTPG/GFCKNNG 



/GFCKNNGHÒTWPVCFGNKIGP&KGPUVKPFGT2QNK\GK/QFGNN OKVFGO2QTVTCKV<CT#NGZCPFGTU+++   &WTEJOGUUGT  OO 5KNDGT CO PGW RGPVCIQPCN IGHCNVGVGP $CPF FGU 5V #PPGP1TFGPU   447# ++



&KG GKPMNCUUKIG /GFCKNNG YWTFG XQP <CT #NGZCPFGT ++ 0KMQNCLGYKVUEJ   OKV 7MCU XQO  &G\GODGT   IGUVKHVGVGTJKGNVFCU2QTVTCKVXQP<CT#NGZCPFGT+++0KMQNCLGYKVUEJ  WPFFCULGPKIGXQP <CT0KMQNCWU++#NGZCPFTQYKVUEJ  0CEJFGOFKG/QPCTEJKGCDIGUEJCHHVYQTFGPYCTXGTUEJYCPFCWEJ FKG/GFCKNNG

8794

8795

8795



/GFCKNNGHÒTWPVCFGNKIGP&KGPUVKPFGT2QNK\GK/QFGNN OKVFGO2QTVTCKV<CT0KMQNCWU++  OKVGTI·P\VGO$CPFTKPIQJPG$CPF447 ++





/GFCKNNG CWH FKG 5EJNCEJV DGK 2QNVCYC +PQHHK\KGNNG 5KNDGTPG /GFCKNNG 5KNDGTIW­   &WTEJOGUUGT   OOIUVCTMIGVTCIGPQJPG$CPF ++



+PFGT5EJNCEJVDGK2QNVCYCY·JTGPFFGU)TQ­GP0QTFKUEJGP-TKGIGUXQPDKUDGUKGIVG<CT2GVGT+FGT )TQ­G  FKGUEJYGFKUEJG#TOGGWPVGT-ÌPKI%CTN:++  

155


RUSSISCHE ORDEN UND EHRENZEICHEN

8797 8796

8796



/GFCKNNG CWH FKG 5EJNCEJV DGK 2QNVCYC +PQHHK\KGNNG $TQP\GPG /GFCKNNG FCVKGTV  $TQP\G &WTEJ   OGUUGTOOIKO4CPFRWP\KGTVIGVTCIGPQJPG$CPF ++





/GFCKNNG HÒT FKG 5EJNCEJV DGK -WPGTUFQTH 8QP 6KOQVGK +YCPQHH #WUHÒJTWPI OKV CPIGRT·IVGT ¤UG   5KNDGT&WTEJOGUUGTOOUVCTMIGVTCIGPCOYGUGPVNKEJUR·VGTGP$CPF447 +++



+PFGT5EJNCEJVXQP-WPGTUFQTH JGWVG-WPQYKEGKP2QNGP Y·JTGPFFGU5KGDGPL·JTKIGP-TKGIGUXQPDKU DGUKGIVGFKGTWUUKUEJÌUVGTTGKEJKUEJG#TOGGCO#WIWUVFKGRTGW­KUEJG#TOGGWPVGT(TKGFTKEJ++FGO)TQ­GP &KG/GFCKNNGYWTFGCPCNNG1HHK\KGTG7PVGTQHHK\KGTGWPF5QNFCVGPFGTTGIWN·TGPTWUUKUEJGP6TWRRGPCWUIGIGDGPFKG CMVKXCPFGT5EJNCEJVVGKNIGPQOOGPJCVVGP

8798

8799

8800



/GFCKNNG HÒT FKG 5EJNCEJV DGK -WPGTUFQTH 8QP 6KOQVGK +YCPQHH #WUHÒJTWPI OKV CPIGNÌVGVGT ¤UG   5KNDGT&WTEJOGUUGTOOIGVTCIGPCOYGUGPVNKEJUR·VGTGP$CPF447 ++





6TCIDCTG/GFCKNNGCWHFKG'TPGPPWPIFGUGJGOCNKIGPTWUUKUEJGP)TQ­MCP\NGTU#NGZGL2GVTQYKVUEJ )TCH$GUVWVUEJGY4[WOKP\WO(GNFOCTUEJCNN)QNFGPG'TKPPGTWPIUOGFCKNNG&WTEJOGUUGTOO 5KNDGTOKV-ÌTFGNWPIWOIGDGPWPFIGJGPMGNVXGTIQNFGVIUVCTMIGVTCIGPQJPG$CPF +++++



#NGZGL2GVTQYKVUEJ)TCH$GUVWVUEJGY4[WOKP  YWTFGWPOKVVGNDCTPCEJFGT6JTQPDGUVGKIWPI CO&G \GODGT FGT<CTKP'NKUCDGVJ2GVTQYPC  \WO8K\G-CP\NGTDGTWHGPWPFCO,WNK\WOTWUUK UEJGP)TQ­MCP\NGTGTPCPPV+PFKGUGT2QUKVKQPDGUVKOOVGGTOC­IGDNKEJ,CJTGNCPIGFKGIGUCOVGTWUUKUEJG#W­GP RQNKVKM+O#RTKNIGUVÒT\VWPFCWHUGKPG)ÒVGTKP)QTGVQXQKP8GTDCPPWPIIGUEJKEMVYWTFGGTXQP<CTKP-CVJC TKPC++FGT)TQ­GP  YKGFGT\WTÒEMIGJQNVWPF\WO(GNFOCTUEJCNNGTPCPPVQJPGLGFQEJYGKVGTGKPG YKEJVKIGRQNKVKUEJG4QNNG\WURKGNGP#WU#PNC­UGKPGT'TPGPPWPIYWTFGFKGUG/GFCKNNGCPUGKPG)GHQNIUNGWVGCWUIGIG DGP



/GFCKNNGHÒTFKG5EJNCEJVXQP-CIWNCO,WNK8QP6KOQVGK+YCPQHHMNGKPGTG#WUHÒJTWPIHÒT 5QNFCVGP&WTEJOGUUGTOO5KNDGTIGVTCIGPCOUR·VGTGP$CPF447# +++++ &KG/GFCKNNGYWTFGOKV7MCUXQO5GRVGODGTXQP<CTKP-CVJCTKPC++FGT)TQ­GP  IGUVKHVGVWPF CPTWUUKUEJGF·PKUEJGWPFMQUCMKUEJG5QNFCVGP FKGMNGKPGTG WPF7PVGTQHHK\KGTG FKGITÌ­GTG CWUIGIGDGPFKGCMVKXCP FGT5EJNCEJVVGKNIGPQOOGPJCVVGP+PFKGUGTYKEJVKIUVGP5EJNCEJVFGU4WUUKUEJ6ÒTMKUEJGP-TKGIGUXQPDKU DGUKGIVGPFKG4WUUGPCO,WNKGKPGITQ­GQUOCPKUEJVCVCTKUEJGªDGTOCEJV

156




RUSSISCHE ORDEN UND EHRENZEICHEN

8802

8801



/GFCKNNGHÒTFKG5GGUEJNCEJVXQP%JGUOCXQODKU,WNK8QP6KOQVGK+YCPQHHITÌ­GTG#WU HÒJTWPIHÒT7PVGTQHHK\KGTG&WTEJOGUUGTOO5KNDGTCOUR·VGTGP$CPF447 ++



&KG/GFCKNNGYWTFGOKV7MCUXQO5GRVGODGTXQP<CTKP-CVJCTKPC++FGT)TQ­GP  IGUVKHVGVWPF CP TWUUKUEJG 5GGNGWVG WPF 5QNFCVGP FKG MNGKPGTG  WPF 7PVGTQHHK\KGTG FKG ITÌ­GTG  CWUIGIGDGP FKG CMVKX CP FGT   5EJNCEJVVGKNIGPQOOGPJCVVGP+PFKGUGT5EJNCEJVFGU4WUUKUEJ6ÒTMKUEJGP-TKGIGUXQPDKUDGUKGIVGPFKG 4WUUGPCODKU,WNKFKG\CJNGPO·­KIÒDGTNGIGPGQUOCPKUEJG(NQVVG



/GFCKNNGHÒTFKG)GHGEJVGXQP1UEJCMQYXQODKU,WPK8QP6KOQVGK+YCPQHH&WTEJOGU UGTOO5KNDGTCOUR·VGTGP$CPF447 ++



&KG/GFCKNNGYWTFGXQP<CTKP-CVJCTKPC++FGT)TQ­GP  IGUVKHVGVWPFCPTWUUKUEJG5GGNGWVGCWUIGIG DGPFKGCMVKXCPFGT5EJNCEJVVGKNIGPQOOGPJCVVGP+POGJTGTGP5GG)GHGEJVGPFGU4WUUKUEJ6ÒTMKUEJGP-TKGIGUXQP DKUYKFGTUVCPFFKGTWUUKUEJG/CTKPGFGTQUOCPKUEJGP(NQVVG

8804

8803



8805

8803

-TGW\HÒTFKG'KPPCJOGFGT(GUVWPI+UOCKNCO&G\GODGT5R·VGTGT$TQP\G#DUEJNCIFGU )QNFGPGP-TGW\GUZOO$TQP\GQJPG$CPF ++



-TGW\WPF/GFCKNNGYWTFGPXQP<CTKP-CVJCTKPC++FGT)TQ­GP  OKV7MCUXQO/·T\IGUVKHVGV WPFCPFKG6GKNPGJOGT -TGW\HÒTFKG1HHK\KGTG/GFCKNNGHÒTFKG7PVGTQHHK\KGTGWPF/CPPUEJCHVGP CWUIGIGDGPFKG CMVKXCPFGT'TUVÒTOWPIFGTQUOCPKUEJGP(GUVWPI+UOCKNY·JTGPFFGU4WUUKUEJ6ÒTMKUEJGP-TKGIGUXQPDKU VGKNIGPQOOGPJCVVGP



/GFCKNNGHÒTFKG'KPPCJOGXQP2CTKU5KNDGTCOPGWRGPVCIQPCNIGHCNVGVGP$CPF447

++



&KG/GFCKNNGYWTFGXQP<CT#NGZCPFGT+2CYNQYKVUEJ  OKV7MCUXQO#WIWUVIGUVKHVGVWPFCP CNNG #TOGG#PIGJÌTKIG FKG CMVKX CO (GNF\WI PCEJ (TCPMTGKEJ #PHCPI  WPF CP FGT 'KPPCJOG XQP 2CTKU CO   /·T\VGKNIGPQOOGPJCVVGP



/GFCKNNGHÒTFGP4WUUKUEJ6ÒTMKUEJGP-TKGIXQPDKU5KNDGTCOPGWRGPVCIQPCNIGHCNVGVGP $CPFFGU5V)GQTIU1TFGPU447 ++



&KG/GFCKNNGYWTFGXQP<CT0KMQNCWU+2CYNQYKVUEJ  OKV7MCUXQO1MVQDGTIGUVKHVGVWPFCPCNNG #PIGJÌTKIGPXQP#TOGGWPF/CTKPGXGTNKGJGPFKGCMVKXCO-TKGIVGKNIGPQOOGPJCVVGP

157


RUSSISCHE ORDEN UND EHRENZEICHEN

8807

8806



&CPMOGFCKNNG HÒT FKG 9KGFGT'TTKEJVWPI FGU 9KPVGTRCNCUVGU KP 5V 2GVGTUDWTI PCEJ FGO $TCPF   XQO  &G\GODGT  )QNFGPG /GFCKNNG &WTEJOGUUGT  OO 5KNDGT XGTIQNFGV IGVTCIGP QJPG   $CPF ++



#O  &G\GODGT  DTCPPVG FGT 9KPVGTRCNCUV KP FGT 'TGOKVCIG KP 5V 2GVGTUDWTI DGK GKPGO FTGK­KI 5VWPFGP   Y·JTGPFGP (GWGT XÌNNKI CWU 0CEJFGO <CT 0KMQNCWU FGP 9KGFGTCWHDCW CPIGQTFPGV JCVVG YWTFGP FKG #TDGKVGP \W   1UVGTPCDIGUEJNQUUGP#WUFKGUGO#PNC­GTJKGNVGPFKGHÒTFGP9KGFGTCWHDCW8GTCPVYQTVNKEJGPFKGUG/GFCKNNG



/GFCKNNG HÒT FKG $GHTKGFWPI XQP 7PICTP WPF 5KGDGPDÒTIGP  WPF  5KNDGT CO QTKIKPCNGP   CNVGP$CPFFGU5V)GQTIU1TFGPU447 ++



0CEJFGOKO#RTKNKP7PICTPGKP#WHUVCPFIGIGPFKGÌUVGTTGKEJKUEJG*GTTUEJCHVCWUIGDTQEJGPWPF7PICTP\WT 4GRWDNKMCWUIGTWHGPYQTFGPYCTUCJUKEJFGTÌUVGTTGKEJKUEJG-CKUGT(TCP\,QUGRJ+  IG\YWPIGP<CT 0KMQNCWU+WO'PVUGPFWPIXQPKP2QNGPUVCVKQPKGTVGPTWUUKUEJGP6TWRRGPPCEJ7PICTP\WT7PVGTUVÒV\WPI\WDKVVGP #O  #WIWUV  MCRKVWNKGTVGP FKG 7PICTP DGK 8KN±IQU KP 9GUV5KGDGPDÒTIGP XQT FGP 4WUUGP &KG /GFCKNNG   YWTFGXQP<CT0KMQNCWU+OKV7MCUXQO,CPWCTIGUVKHVGVWPFCPCNNG#PIGJÌTKIGPFGTTWUUKUEJGP#TOGG XGTNKGJGPFKGCMVKXCPFGT0KGFGTYGTHWPIFGU#WHUVCPFGUVGKNIGPQOOGPJCVVGP

8808

8809



7PDGMCPPVG /GFCKNNG 975 <CT 0KMQNCWU + $TQP\G XGTIQNFGV CO PGW RGPVCIQPCN IGHCNVGVGP   $CPF ++





/GFCKNNGHÒTFKG7PVGTYGTHWPIXQP6UEJGVUEJGPKGPWPF&CIJGUCPDKU5KNDGTQJPG$CP FTKPIWPFQJPG$CPF447 ++



&KG/GFCKNNGYWTFGXQP<CT#NGZCPFGT++0KMQNCLGYKVUEJ  OKV7MCUXQO,WNKIGUVKHVGVWPFCPCNNG #PIGJÌTKIGPFGT#TOGGFKGCMVKXCO(GNF\WIKO-CWMCUWUXQPDKUVGKNIGPQOOGPJCVVGPXGTNKGJGP

8810 8811



8811

/GFCKNNGHÒT8GTFKGPUVGWOFKG#WHJGDWPIFGT.GKDGKIGPUEJCHV5KNDGTPG/GFCKNNG5KNDGTQJPG $CPFTKPIWPFQJPG$CPF447 ++



&KG\YGKUVWHKIG/GFCKNNG )QNFWPF5KNDGT YWTFGXQP<CT#NGZCPFGT++0KMQNCLGYKVUEJ  OKV7MCUXQO (GDTWCTIGUVKHVGV5KGYWTFGKP)QNFCP)GPGTCNIQWXGTPGWTGWPF)QWXGTPGWTGKP5KNDGTCPFKG/KVINKGFGT FGT4GHQTO-QOKVGGUWPFCP/KVCTDGKVGTDGKFGT8QTDGTGKVWPIFGT#WHJGDWPIXGTNKGJGPPCEJFGOFGT<CTOKV7MCU XQO(GDTWCTFKG.GKDGKIGPUEJCHVKOIGUCOVGP4WUUKUEJGP4GKEJCWHIGJQDGPJCVVG



-TGW\ HÒT FGP 'KPUCV\ KO -CWMCUWU UQIGP -CWMCUWU-TGW\  -TGW\ KP $TQP\G $TQP\G VNY   XGTUKNDGTVVNYIGUEJY·T\VCP0CFGN447$ ++ &CU -TGW\ YWTFG XQP <CT #NGZCPFGT ++ 0KMQNCLGYKVUEJ   KO ,WNK  IGUVKHVGV WPF CP CNNG /KNKV·T   CPIGJÌTKIGPFKGCMVKXCPFGP(GNF\ÒIGPVGKNIGPQOOGPJCVVGPXGTNKGJGP

158




RUSSISCHE ORDEN UND EHRENZEICHEN

8812





8813

/GFCKNNGHÒTFKG'TQDGTWPIFGU-JCPCVUXQP-JKXC5KNDGTQJPG$CPF447

++

&KG/GFCKNNGYWTFGXQP<CT#NGZCPFGT++0KMQNCLGYKVUEJ  OKV7MCUXQO,WNKIGUVKHVGVWPFCP CNNG#PIGJÌTKIGPFGT#TOGGFKGCMVKXCO(GNF\WIIGIGPFCU-JCPCVXQP-JKXC KOJGWVKIGP7UDGMKUVCPWPF6WTMOG PKUVCP  KO ,CJTG  VGKNIGPQOOGP JCVVGP KP (QNIG FGUUGP FCU -JCPCV GKP 8CUCNNGPUVCCV FGU 4WUUKUEJGP 4GKEJGU   YWTFG

/GFCKNNG HÒT FGP 4WUUKUEJ6ÒTMKUEJGP -TKGI XQPDKU/GFCKNNGKPJGNNGT$TQP\GCOPGW RGPVCIQPCNIGHCNVGVGP$CPF447 ++





&KGFTGKUVWHKIG/GFCKNNG 5KNDGTJGNNGWPFFWPMNG$TQP\G YWTFGXQP<CT#NGZCPFGT++0KMQNCLGYKVUEJ   OKV7MCUXQO#RTKNIGUVKHVGV5KGYWTFGKP5KNDGTCPCNNG#PIGJÌTKIGPFGT4WUUKUEJGP#TOGGXGTNKGJGPFKGCP FGT8GTVGKFKIWPIFGU2CUUGUDGK5EJKRMCCODKU#WIWUVWPFGTPGWVXQODKU5GRVGODGTUQYKGCPFGT $NQEMCFGXQP$C[C\GVWPFCPFGT'TUVÒTOWPIFGT(GUVWPIXQP-CTUVGKNIGPQOOGPJCVVGP+PJGNNGT$TQP\GGTJKGNVGPUKG 6GKNPGJOGTCPFGP5EJNCEJVGPWPF)GHGEJVGPFGT-CWMCUKUEJGP(TQPVQFGTKO5EJYCT\GP/GGTWPFKPFWPMNGT$TQP\G CNNGFKGLGPKIGP/KNKV·TCPIGJÌTKIGPFKGPKEJVCPGKPGT5EJNCEJVVGKNIGPQOOGPJCVVGP  

&GT 4WUUKUEJ6ÒTMKUEJG -TKGI XQP  DKU  HÒJTVG \WT 'TTKEJVWPI FGU (ÒTUVGPVWO $WNICTKGP WPF \W FGUUGP   #PGTMGPPWPICWHFGO$GTNKPGT-QPITG­XQP

8814



8815

/GFCKNNG HÒT FKG 'TUVÒTOWPI XQP )GQM6GRG  5KNDGTPG /GFCKNNG 5KNDGT CO PGW RGPVCIQPCN   IGHCNVGVGP$CPFFGU5V)GQTIU1TFGPU447 ++



&KG\YGKUVWHKIG/GFCKNNG 5KNDGTWPF$TQP\G YWTFGXQP<CT#NGZCPFGT++0KMQNCLGYKVUEJ  OKV7MCUXQO (GDTWCTIGUVKHVGV+P5KNDGTYWTFGUKGCPCNNG/KNKV·TCPIGJÌTKIGPXGTNKGJGPFKGCMVKXCPFGT'TUVÒTOWPIFGT VWTMOGPKUEJGP (GUVWPI XQP )GQM6GRG CO  ,CPWCT VGKNIGPQOOGPJCVVGPWPFKP$TQP\GCPCNNGUQPUVKIGP /KNKV·TCPIGJÌTKIGPFKGCO(GNF\WIXQPDKUKPFCU)GDKGVÌUVNKEJFGU-CURKUEJGP/GGTGUVGKNIGPQOOGP JCVVGP



-TÌPWPIUOGFCKNNG <CT #NGZCPFGTU +++  $TQP\G &WTEJOGUUGT  OO CO PGW RGPVCIQPCN   IGHCNVGVGP$CPF447 ++



&KG/GFCKNNG\WT'TKPPGTWPICPFKG-TÌPWPI<CT#NGZCPFGTU+++0KMQNCLGYKVUEJ  CO/CKKP FGT7URGPUM[-CVJGFTCNGKP/QUMCWYWTFGOKV7MCUXQO0QXGODGTIGUVKHVGV

8816



8817

/GFCKNNG\WT'TKPPGTWPICPFKG4GIKGTWPI<CT#NGZCPFGTU+++XQPDKU5KNDGTOKV$CP FTKPIQJPG$CPF447 ++



&KG/GFCKNNGYWTFGXQP<CT0KMQNCWU++#NGZCPFTQYKVUEJ  OKV7MCUXQO/CKIGUVKHVGV



/GFCKNNGHÒTFGP4WUUKUEJ,CRCPKUEJGP-TKGIXQPDKU/GFCKNNGKPJGNNGT$TQP\GCOPGW IGHCNVGVGPRGPVCIQPCNGP$CPF447 ++



&KGFTGKUVWHKIG/GFCKNNG 5KNDGTJGNNGWPFFWPMNG$TQP\G YWTFGXQP<CT0KMQNCWU++#NGZCPFTQYKVUEJ   OKV7MCUXQO,CPWCTIGUVKHVGV5KGYWTFGKP5KNDGTCPCNNG2GTUQPGP OKNKV·TKUEJGWPF\KXKNG XGTNKGJGPFKG Y·JTGPFFGT$GNCIGTWPIXQP2QTV#TVJWTXQO/CKDKU&G\GODGTFQTVUVCVKQPKGTVYCTGP+PJGNNGT$TQP\GGTJKGNVGP UKGFKGCMVKXGPOKNKV·TKUEJGPWPF\KXKNGP6GKNPGJOGTCO-TKGIWPFKPFWPMNGT$TQP\GCNNG#PIGJÌTKIGPFGUOGFK\KPK UEJGPWPFIGKUVNKEJGP2GTUQPCNUFKGKPFGT-TKGIU\QPGGKPIGUGV\VYCTGP

159


RUSSISCHE ORDEN UND EHRENZEICHEN

8818



'TKPPGTWPIUOGFCKNNG \WO L·JTKIGP ,WDKN·WO FGT &[PCUVKG 4QOCPQY  $TQP\G CO PGW   IGHCNVGVGPRGPVCIQPCNGP$CPF447 ++

&KG/GFCKNNGYWTFGXQP<CT0KMQNCWU++#NGZCPFTQYKVUEJ  OKV7MCUXQO(GDTWCTIGUVKHVGVWPF YWTFGCPCNNG6GKNPGJOGTFGT,WDKN·WOUHGKGTNKEJMGKVGPUQYKGCPCNNGCO(GDTWCTKO5VCCVUFKGPUVDGHKPFNKEJGP /KNKV·TWPF<KXKNRGTUQPGPXGTNKGJGP



8819 (3/4 Größe)

8820

<#4'067/ $+5 #$<'+%*'0 

-COOGTJGTTGPUEJNÒUUGN 'ZGORNCT CWU FGT 4GIKGTWPIU\GKV <CT #NGZCPFGTU +++   \YKUEJGP   WPF$TQP\GIW­XGTIQNFGVQJPG5EJNGKHG&9'5WPVGPXCT ++





)TCFWKGTWPIU#D\GKEJGP FGT 0KMQNCLGYUM[#MCFGOKG FGU )GPGTCNUVCDU 5KNDGT CWH FGT 4ÒEMUGKVG   FGT5EJNGKHGPD·PFGT/GKUVGTOCTMG$2<QNQVPKMK-QMQUEJPKM5KNDGTRWP\GXQPDKU WPF-QMQUEJPKM2WP\GCP5EJTCWDGQJPG5EJTCWDUEJGKDG2$ ++



8821



8822

)TCFWKGTWPIU#D\GKEJGP FGT /KEJCKNQYUM[ #TVKNNGTKG#MCFGOKG 5KNDGT CWH FGT 4ÒEMUGKVG FGT   5EJNGKHGPD·PFGT/GKUVGTOCTMG"ÄÎ"HÒT&KOKVTK+YCPQYKVUEJ1UKRQYKP5V2GVGTUDWTIWPF<QNQVPKMK -QMQUEJPKM5KNDGTRWP\G XQP  DKU  CP 5EJTCWDG OKV /WVVGT WPF 7PVGTNCIUUEJGKDG   2$ ++



#D\GKEJGPHÒT5CPKV·VUQHHK\KGTGOKVOGFK\KPKUEJGO&QMVQTITCF5KNDGTVGKNYXGTIQNFGVGKP$NCVVFGT NKPMGP5EJNCPIGP$GHGUVKIWPICDIGDTQEJGPCP5EJTCWDGOKV7PVGTNCIUUEJGKDGFKGUGOKV/GKUVGTOCTMG "ÈÍ" QFGT "*È" WPF -QMQUEJPKM5KNDGTRWP\G XQP  DKU  QJPG 5EJTCWDUEJGKDG   2$ ++



&CU#D\GKEJGPYWTFGCO,WPKIGPGJOKIV



&CU#D\GKEJGPYWTFGCO(GDTWCTIGPGJOKIV

160


RUSSISCHE ORDEN UND EHRENZEICHEN

8826 8825

8823



8824

)TCFWKGTWPIU#D\GKEJGP FGT /KNKV·TKUEJGP 5EJWNG HÒT 'NGMVTQVGEJPKM HÒT 1HHK\KGTG $TQP\G XGTUKN   DGTVVNYXGTIQNFGVCP5EJTCWDGOKV5EJTCWDWPF7PVGTNCIUUEJGKDG2$ ++



&CU#D\GKEJGPYWTFGCO,WPKIGPGJOKIV



)TCFWKGTWPIU#D\GKEJGP HÒT 8GTOGUUWPIU+PIGPKGWTG 5KNDGT VNY XGTIQNFGV #WHNCIG NQEMGT CP   5EJTCWDGOKV5EJTCWDUEJGKDGFKGUGOKV*GTUVGNNGTDG\GKEJPWPIFGT(KTOC"Ê.È.Áîêú"KP/QUMCW ++





)TCFWKGTWPIU#D\GKEJGP FGT /KNKV·T5EJWNG XQP -CUCP $TQP\G XGTIQNFGV VNY GOCKNNKGTV /QPQ   ITCOO WPF -TQPGPCWHNCIG HGJNGP CWH FGT 4ÒEMUGKVG PWOOGTKGTV  CP 5EJTCWDG OKV 5EJTCWD   UEJGKDGFKGUGOKV*GTUVGNNGTDG\GKEJPWPIFGT(KTOC"Ê.È.Áîêú"KP/QUMCW2$ ++



&CU#D\GKEJGPYWTFGCO(GDTWCTIGPGJOKIV



,WDKN·WOU)TCFWKGTWPIU#D\GKEJGP FGT 2CYNQYUM[ /KNKV·T5EJWNG KP 5V 2GVGTUDWTI $TQP\G XGT   IQNFGVCP5EJTCWDGOKV5EJTCWDUEJGKDG2$ ++



&CU#D\GKEJGPYWTFGCO&G\GODGTIGPGJOKIV

8829 8827



8828

)TCFWKGTWPIU#D\GKEJGP FGT #NGZCPFTQYUM[ /KNKV·T5EJWNG KP /QUMCW $TQP\G XGTIQNFGV WPF   GOCKNNKGTVCP5EJTCWDGOKV5EJTCWDUEJGKDG2$ ++



&CU#D\GKEJGPYWTFGCO1MVQDGTIGPGJOKIV



)TCFWKGTWPIU#D\GKEJGP FGT #NGZGLGYUM[ /KNKV·T5EJWNG KP /QUMCW 5KNDGT VNY XGTIQNFGV WPF   GOCKNNKGTVCWHFGT4ÒEMUGKVG<QNQVPKMK-QMQUEJPKM2WP\GXQPDKUCWHFGT4ÒEMUGKVG FGT -TQPG PWOOGTKGTV CP5EJTCWDGOKV5EJTCWDUEJGKDGFKGUGOKV-QMQUEJPKM5KNDGTRWP\GXQP DKUWPF*GTUVGNNGTDG\GKEJPWPIFGT(KTOC"Ê.Áîêú"KP/QUMCW2$ ++



&CU#D\GKEJGPYWTFGCO1MVQDGTIGPGJOKIV



)TCFWKGTWPIU#D\GKEJGP FGT #NGZGLGYUM[ /KNKV·T5EJWNG KP /QUMCW $TQP\G VNY XGTIQNFGV WPF   GOCKNNKGTV OGJTGTG 'OCKNNGCDURNKVVGTWPIGP CWH FGT 4ÒEMUGKVG FGT -TQPG PWOOGTKGTV  CP   5EJTCWDGOKV/WVVGTWPF7PVGTNCIUUEJGKDGFKGUGOKV*GTUVGNNGTDG\GKEJPWPIFGT(KTOC"Ê.È.Áîêú"KP /QUMCW2$ +++++

 161


RUSSISCHE ORDEN UND EHRENZEICHEN

8831

8830



8832

8833

)TCFWKGTWPIU#D\GKEJGP FGT -CXCNNGTKG5EJWNG KP 0KMQNCLGY $TQP\G XGTIQNFGV VNY XGTUKNDGTV WPF   GOCKNNKGTV CP 5EJTCWDG OKV 5EJTCWD WPF 7PVGTNCIUUEJGKDG FCTCWH -QMQUEJPKM2WP\G XQP  DKU   2$ ++



&CU#D\GKEJGPYWTFGCO,WPKIGPGJOKIV



)TCFWKGTWPIU#D\GKEJGPFGT-QPUVCPVKPQYUM[#TVKNNGTKG5EJWNGKP5V2GVGTUDWTI$TQP\GXGTIQNFGV WPF GOCKNNKGTV OGJTGTG #DURNKVVGTWPIGP KPFGT'OCKNNGFGU.QTDGGTMTCP\GUCP5EJTCWDGOKV5EJTCWD UEJGKDG2$ ++



&CU#D\GKEJGPYWTFGCO&G\GODGTIGPGJOKIV



)TCFWKGTWPIU#D\GKEJGPFGT-QPUVCPVKPQYUM[#TVKNNGTKG5EJWNGKP5V2GVGTUDWTI$TQP\GXGTIQNFGV WPFGOCKNNKGTVOKP#DURNKVVGTWPIGPKPFGT'OCKNNGFGU.QTDGGTMTCP\GUCP0CFGN2$ ++





)TCFWKGTWPIU#D\GKEJGPFGT/KEJCKNQYUM[#TVKNNGTKG5EJWNGKP5V2GVGTUDWTI$TQP\GXGTIQNFGVVNY XGTUKNDGTVCP5EJTCWDGOKV5EJTCWDUEJGKDGFCTCWH*GTUVGNNGTDG\GKEJPWPIFGT(KTOC"Ç.ÊÎÐÒÌÀÍÚ" 2$ ++



&CU#D\GKEJGPYWTFGCO/·T\IGPGJOKIV

8834



8835

8836

)TCFWKGTWPIU#D\GKEJGPWPF-CVGIQTKGFGU-CKUGTNKEJGP#NGZCPFGT.[EGWOKP<CTUMQG5GNQ 5KNDGTVNYHGKPUV\KUGNKGTVWPFITCXKGTVVNYXGTIQNFGVOKV/GKUVGTOCTMG"Ã.Ï."WPF5V2GVGTUDWTIGT <QNQVPKMK5KNDGTRWP\GXQPDKUCP5EJTCWDGOKV5EJTCWDWPF7PVGTNCIUUEJGKDGFKGUGOKV /GKUVGTOCTMG"Ã.Ï."WPF5V2GVGTUDWTIGT5VCFVRWP\G2$ ++



$GUQPFGTUHGKPG*GTUVGNNWPIUSWCNKV·V&CU#D\GKEJGPYWTFGCO,WNKIGPGJOKIV#WHITWPFXQP'KPHÒJTWPIU FCVWOWPF5KNDGTRWP\GN·­VUKEJFGT*GTUVGNNWPIU\GKVTCWOCWHWPFGKPITGP\GP



)TCFWKGTWPIU#D\GKEJGPWPF-CVGIQTKGFGU-CKUGTNKEJGP#NGZCPFGT.[EGWOKP<CTUMQG5GNQ $TQP\GVNYXGTUKNDGTVWPFVNYXGTIQNFGVCP5EJTCWDGOKV5EJTCWDWPF7PVGTNCIUUEJGKDG2$ ++





,WDKN·WOU#D\GKEJGP  HÒT FKG )TCFWKGTVGP FGU -CKUGTNKEJGP #NGZCPFGT .[EGWO KP <CTUMQG   5GNQ$TQP\GOKV4GUVXGTUKNDGTWPIVNYGOCKNNKGTVMNGKPGT'OCKNNGCWUDTWEJNKPMUPGDGPFGT-TQPGCP 5EJTCWDGOKV5EJTCWDUEJGKDG2$ ++



&CU#D\GKEJGPYWTFGCO1MVQDGTIGPGJOKIV

162


RUSSISCHE ORDEN UND EHRENZEICHEN

8837

8839

8838

8840



#D\GKEJGP FGT -CKUGTNKEJ 4WUUKUEJGP )GUGNNUEJCHV \WT 4GVVWPI 'TVTKPMGPFGT 5KNDGTPGU #D\GKEJGP   5KNDGTGOCKNNKGTVCP5EJTCWDGOKV5EJTCWDUEJGKDGFKGUGOKV2WP\G"ÊÏÓ"WPF-QMQUEJPKM2WP\GXQP DKU2$D ++



&CU#D\GKEJGPYWTFGCO/·T\IGPGJOKIV







#D\GKEJGP FGT )GUGNNUEJCHV \WT 7PVGTUVÒV\WPI FGT +PXCNKFGP KO -CWMCUWU )QNFGPGU #D\GKEJGP   $TQP\GXGTIQNFGVVNYGOCKNNKGTVQDGTHN·EJNKEJG'OCKNNGEJKRUCP5EJTCWDGOKV5EJTCWDWPF7PVGTNCIU UEJGKDGFKGUGOKV*GTUVGNNGTDG\GKEJPWPIFGT(KTOC"Ñ. Ã. ÑÒÅÏÀÍÎÂÚ"KP6KHNKU2$C ++



#D\GKEJGP FGT )GUGNNUEJCHV \WT 7PVGTUVÒV\WPI FGT +PXCNKFGP KO -CWMCUWU 5KNDGTPGU #D\GKEJGP   5KNDGTVNYGOCKNNKGTVCWHFGT4ÒEMUGKVG/GKUVGTOCTMG%%WPF<QNQVPKMK-QMQUEJPKM5KNDGTRWP\G OKV Q XQP  DKU  CP 5EJTCWDG OKV 5EJTCWD WPF 7PVGTNCIUUEJGKDG FKGUG GDGPHCNNU OKV   /GKUVGTOCTMG%%WPF-QMQUEJPKM2WP\GXQPDKU2$D ++



#D\GKEJGP \WO 'KPJWPFGTVL·JTKIGP ,WDKN·WO FGU 8GTVGKFKIWPIU/KPKUVGTKWOU  $TQP\G VNY   5KNDGT VNY GOCKNNKGTV OKP 'OCKNNGEJKRU 'OCKNNGOCNGTGK CP 5EJTCWDG OKV 5EJTCWD WPF 7PVGTNCIU   UEJGKDG2$ ++



8841



8842

8843

#D\GKEJGP \WO 'KPJWPFGTVL·JTKIGP ,WDKN·WO FGU 8GTVGKFKIWPIU/KPKUVGTKWOU  $TQP\G VNY   5KNDGTVNYGOCKNNKGTV'OCKNNGOCNGTGKGKPGFGT,WDKN·WOU\CJNHGJNVCP5EJTCWDGOKV5EJTCWDWPF 7PVGTNCIUUEJGKDG2$ ++



&CU#D\GKEJGPYWTFGCO/CKIGPGJOKIV



#D\GKEJGPFGU(KPCP\OKPKUVGTKWOUHÒT8GTFKGPUVG5KNDGTVNYUEJYCEJXGTIQNFGVCWHFGT4ÒEMUGKVG FGT 5EJNGKHGPGPFGP /GKUVGTOCTMG "ÂÄ" HÒT 8CTXCTC 2GVTQYPC &KGVYCNF WPF  <QNQVPKMK-QMQUEJPKM 5KNDGTRWP\GXQPDKUOKV9KFOWPIUITCXWT#'ÁàëàáCíîâúCP5EJTCWDGOKV 5EJTCWD WPF 7PVGTNCIUUEJGKDG GTUVGTG OKV -QMQUEJPKM2WP\G XQP  DKU  NGV\VGTG OKV   *GTUVGNNGTDG\GKEJPWPI "ÝÄÓÀÐÄÚ" HÒT FKG (KTOC 'FWCTF KP 5V 2GVGTUDWTI /GKUVGTOCTMG "ÂÄ" HÒT   8CTXCTC2GVTQYPC&KGVYCNFWPF-QMQUEJPKM2WP\GXQPDKU2$ ++



&CU#D\GKEJGPYWTFGCO5GRVGODGTIGPGJOKIV



#D\GKEJGP\WO(ÒPH\KIL·JTKIGP$GUVGJGPFGT5GOUVYQ $TQP\GVNYGOCKNNKGTVOKP'OCKNNG EJKRUCP5EJTCWDGOKV5EJTCWDUEJGKDG2$ ++



&CU#D\GKEJGPYWTFGCO,CPWCTIGPGJOKIV5GOUVYQ\WFGWVUEJ.CPFUVCPFKUVFKG$G\GKEJPWPIHÒTNQMCNG 5GNDUVXGTYCNVWPIUGKPJGKVGPCWH-TGKUWPF)QWXGTPGWTUGDGPGFKGKO<WUCOOGPJCPIOKVFGPNKDGTCNGP4GHQTOGP WPFKP(QNIGFGT$CWGTPDGHTGKWPIWPVGT<CT#NGZCPFGT++IGPGJOKIVYWTFGP+O<WIGFGTTGXQNWVKQP·TGP7OY·N\WP IGPUKPFFKG5GOUVYQU#PHCPI<WIWO<WIGPVOCEJVGVWPFUEJNKG­NKEJCWHIGNÌUVYQTFGP

163


RUSSISCHE ORDEN UND EHRENZEICHEN

8845

8844



8846

#D\GKEJGP FGU &KGPUVGU HÒT FKG $GUEJCHHWPI XQP /KNKV·TRHGTFGP #D\GKEJGP HÒT .GKVGT 5KNDGT VNY   GOCKNNKGTV$TQP\GXGTIQNFGVCWH$CPFUEJNGKHGCWHIGNGIVCP0CFGN.$ ++



&CU#D\GKEJGPYWTFGCO(GDTWCTIGPGJOKIV



#D\GKEJGPFGU&KGPUVGUHÒTFKG$GUEJCHHWPIXQP/KNKV·TRHGTFGP #D\GKEJGPHÒT/KVCTDGKVGT$TQP\G XGTIQNFGVVNYGOCKNNKGTVCP0CFGN2$ ++





#D\GKEJGP HÒT RN·FKGTGPFG 4GEJVUCPY·NVG XQT JÌJGTGP )GTKEJVGP 5KNDGT CWH FGT 4ÒEMUGKVG FGT   5EJNGKHGPD·PFGT/GKUVGTOCTMG"ÈÀ"HÒT+YCP#NGZGLGYKVUEJ#NGZGLGYKP/QUMCWOKV5V2GVGTUDWTIGT  <QNQVPKMK -QMQUEJPKM5KNDGTRWP\G XQP  DKU  CP 5EJTCWDG OKV 5EJTCWDUEJGKDG   2$ ++



8847



'JTGP\GKEJGP XQO 4QVGP -TGW\ #WHÒJTWPI HÒT *GTTGP $TQP\G XGTIQNFGV WPF GOCKNNKGTV CP 0CFGN   2$ ++



&CU'JTGP\GKEJGPKUVCO,WPKIGUVKHVGVYQTFGP

8849 8848



#WU\GKEJPWPIHÒTNCPIL·JTKIGP&KGPUVDGKFGT0KMQNCLGYUM['KUGPDCJP#D\GKEJGPHÒT::8&KGPUV LCJTG$TQP\GXGTIQNFGVVNYXGTUKNDGTVOKV$CPFFGU5V9NCFKOKT1TFGPUWPVGTNGIVCWHFGT4ÒEMUGKVG ITCXKGTVG6T·IGTPWOOGT0QCP5EJTCWDGOKV5EJTCWDUEJGKDGFCTCWH*GTUVGNNGTDG\GKEJPWPIFGT (KTOC"Ç. ÊÎÐÒÌÀÍÚ"2$C ++



&CU#D\GKEJGPYWTFGCO0QXGODGTIGUVKHVGV



#D\GKEJGP HÒT 8GTFKGPUVG DGK FGT 'TUEJNKG­WPI XQP 0GWNCPF LGUGKVU FGU7TCNU $TQP\GVNYXGTUKN DGTVVNYXGTIQNFGVWPFGOCKNNKGTVCP5EJTCWDGOKV5EJTCWDUEJGKDG2$ ++ &CU#D\GKEJGPYWTFGCO1MVQDGTIGPGJOKIV

164




RUSSISCHE ORDEN UND EHRENZEICHEN

8851

8850

8852



'KPNC­#D\GKEJGP \W FGP -TÌPWPIUHGKGTNKEJMGKVGP <CT 0KMQNCWU ++ CO  /CK  KP FGT 7U   RGPUM[-CVJGFTCNGFGU/QUMCWGT-TGONU5KNDGTCP0CFGNQJPG$CPFUEJNGKHG2$ ++



0CEJFGO6QF<CT#NGZCPFGTU+++0KMQNCLGYKVUEJCO1MVQDGTDGUVKGIUGKP5QJP0KMQNCWU++#NGZCPFTQ YKVUEJ  FGP6JTQP&KGHGKGTNKEJG-TÌPWPIFGU<CTGPWPFUGKPGT)GOCJNKP#NGZCPFTC(GQFQTQYPCIGDQ TGPG2TKP\GUUKP#NKZXQP*GUUGP  HCPFCNNGTFKPIUGTUVCO/CKVTCFKVKQPUIGO·­KPFGT7URGPUM[ -CVJGFTCNGFGU/QUMCWGT-TGONUUVCVV



#D\GKEJGP FGT 0QTFCOGTKMCPKUEJ4WUUKUEJGP $TWFGTUEJCHV KP 2GVTQITCF #D\GKEJGP  -NCUUG HÒT   NGDGPUNCPIG/KVINKGFGTFGT$TWFGTUEJCHV5KNDGTVNYXGTIQNFGVWPFGOCKNNKGTV'OCKNNGOCNGTGKCWHFGT 4ÒEMUGKVG /GKUVGTOCTMG "ÀÁ" QFGT "ÄÁ" OKV 5V 2GVGTUDWTIGT  <QNQVPKMK -QMQUEJPKM5KNDGTRWP\G   XQPDKUWPF-QMQUEJPKM2WP\GXQPDKUCP0CFGNFKGUGOKV/GKUVGT OCTMG"À"QFGT"Ä"WPF-QMQUEJPKM2WP\GXQPDKU2$ ++



&CU#D\GKEJGPYWTFGCO,CPWCTIGPGJOKIV



#D\GKEJGPHÒTFKG/KVINKGFGTFGURGTUÌPNKEJGP&KGPUVGUHÒT5GKPG/CLGUV·VY·JTGPFFGT4GIKGTWPI <CT#NGZCPFGTU+++#D\GKEJGPHÒTPKGFTKIGTG4·PIG5KNDGTCPOÌINKEJGTYGKUGGTI·P\VGT5EJTCWDGOKV UR·VGTGT5EJTCWDUEJGKDGFGU/QUMCWGT/ÒP\JQHU2$ ++



&CU#D\GKEJGPYWTFGCO&G\GODGTIGPGJOKIV

8853



8854

8855

#D\GKEJGP HÒT FCU XGTGKPKIVG )CTFG$CVCKNNQP $TQP\G VNY GOCKNNKGTV OKP 'OCKNNGCWUDTÒEJG CP   5EJTCWDGOKV5EJTCWDWPF7PVGTNCIUUEJGKDG2$ ++



&CU#D\GKEJGPYWTFGIGPGJOKIV



#D\GKEJGPFGU.GKDICTFG5GOGQPQYUM[4GIKOGPVU$TQP\GGOCKNNKGTVOGJTGTG*CCTTKUUGWPF'OCKN NGEJKRU CP 5EJTCWDG OKV 5EJTCWD WPF 7PVGTNCIUUEJGKDG FCTCWH *GTUVGNNGTDG\GKEJPWPI FGT (KTOC    "Ç.ÊÎÐÒÌÀÍÚ"2$ +++++  &CU#D\GKEJGPYWTFGCO,WNKIGPGJOKIV



#D\GKEJGP FGU .GKDICTFG +UOCKNQYUM[4GIKOGPVU $TQP\G XGTIQNFGV VNY GOCKNNKGTV GKPKIG 'OCKN   NGCWUDTÒEJG-TGW\EJGPFGT-TQPGGVYCUXGTDQIGPCP5EJTCWDGOKV5EJTCWDUEJGKDG2$ ++



&CU#D\GKEJGPYWTFGCO/·T\IGPGJOKIV

165


RUSSISCHE ORDEN UND EHRENZEICHEN

8856



8857

8858

#D\GKEJGP FGU .GKDICTFG ;GIGTUM[4GIKOGPVU $TQP\G VNY XGTUKNDGTV WPF GOCKNNKGTV CWH FGT 4ÒEM   UGKVG KP \YGK -TGW\GEMGP RWP\KGTV  WPF  CP 5EJTCWDG OKV YQJN UR·VGTGT 5EJTCWDUEJGKDG FGU   /ÒP\JQHUKP/QUMCW2$ ++



&CU#D\GKEJGPYWTFGCO,WPKIGPGJOKIV



#D\GKEJGP FGU .GKDICTFG ;GIGTUM[4GIKOGPVU $TQP\G VNY XGTUKNDGTVWPFGOCKNNKGTVQDGTHN·EJNKEJGT 'OCKNNGEJKRCP5EJTCWDGOKV5EJTCWDWPF7PVGTNCIUUEJGKDG2$ ++





#D\GKEJGP FGU .GKDICTFG /QUMQYUM[ 4GIKOGPVU $TQP\G VNY GOCKNNKGTV CP 5EJTCWDUEJGKDG 2$    ++



&CU#D\GKEJGPYWTFGCO#RTKNIGPGJOKIV

8859



8860 8861

8862

#D\GKEJGPFGU.GKDICTFG5EJÒV\GP4GIKOGPVU5GKPGT*QJGKV5KNDGTVNYXGTIQNFGVWPFGOCKNNKGTV CWHFGT4ÒEMUGKVG/GKUVGTOCTMG"ÏÑ"HÒT2CYGN5C\KMQYKP/QUMCW<QNQVPKMK-QMQUEJPKM5KNDGT RWP\G XQP  DKU  WPF -QMQUEJPKM2WP\G XQP  DKU  CP 5EJTCWDG OKV   5EJTCWDUEJGKDG2$ ++



&CU#D\GKEJGPYWTFGCO/·T\IGPGJOKIV



#D\GKEJGPFGU.GKDICTFG-QUCMGP4GIKOGPVU5GKPGT/CLGUV·V$TQP\GXGTIQNFGVWPFGOCKNNKGTVOKP 'OCKNNGCWUDTÒEJG 5KNDGT XGTIQNFGV CWH FGT 4ÒEMUGKVG /GKUVGTOCTMG "ËÏ" WPF  <QNQVPKMK -Q   MQUEJPKM5KNDGTRWP\GXQPDKUCP5EJTCWDGQJPG5EJTCWDUEJGKDG2$ ++



&CU#D\GKEJGPYWTFGCO5GRVGODGTIGPGJOKIV



#D\GKEJGP FGT  .GKDICTFG #TVKNNGTKG$TKICFG $TQP\G XGTIQNFGV 5KNDGT CP 5EJTCWDG OKV 5EJTCWD   UEJGKDG2$ ++



&CU#D\GKEJGPYWTFGCO,WPKIGPGJOKIV



#D\GKEJGP FGU  4QUVQYGT )TGPCFKGT4GIKOGPVU FGU )TQ­HÒTUVGP /KEJCGN #NGZCPFTQYKVUEJ   $TQP\GXGTIQNFGVVNYGOCKNNKGTVCP5EJTCWDGOKV5EJTCWDUEJGKDG2$ ++ &CU#D\GKEJGPYWTFGCO/·T\IGPGJOKIV

166




RUSSISCHE ORDEN UND EHRENZEICHEN

8864

8865

8866

8863



#D\GKEJGPFGU4GIKOGPVU5GKPGT-CKUGTNKEJGP*QJGKV)TQ­HÃ&#x2019;TUV-QPUVCPVKP-QPUVCPVKPQYKVUEJ \W6KHNKU$TQP\GCP5EJTCWDGOKV5EJTCWDUEJGKDG2$ ++



&CU#D\GKEJGPYWTFGCO,CPWCTIGPGJOKIV



#D\GKEJGP FGU  1NQPGVU +PHCPVGTKG4GIKOGPVU $TQP\G XGTIQNFGV GOCKNNKGTV CNVG 'OCKNNGTGRCTCVWT   CWHGKPGO-TGW\CTOCP5EJTCWDGQJPG5EJTCWDUEJGKDG2$ ++



&CU#D\GKEJGPYWTFGCO&G\GODGTIGPGJOKIV



#D\GKEJGPFGU#NGZQRQNUM+PHCPVGTKG4GIKOGPVU5KNDGTCP5EJTCWDGOKV5EJTCWDWPF7PVGTNCIU UEJGKDG2$ ++



&CU#D\GKEJGPYWTFGCO,WPKIGPGJOKIV



#D\GKEJGPFGU5GXUM+PHCPVGTKG4GIKOGPVUFGU)GPGTCNU)TCH-COGPUM[$TQP\GGOCKNNKGTVCP 5EJTCWDGOKV5EJTCWDUEJGKDG2$ ++



&CU#D\GKEJGPYWTFGCO(GDTWCTIGPGJOKIV

8867



8868

8870 8869

#D\GKEJGPFGU1EJQVUM+PHCPVGTKG4GIKOGPVU$TQP\GXGTIQNFGVVNYXGTUKNDGTVVNYGOCKNNKGTVCP 5EJTCWDGQJPG5EJTCWDUEJGKDG2$ ++



&CU#D\GKEJGPYWTFGCO/·T\IGPGJOKIV



#D\GKEJGP FGU  .KVQYUM[ +PHCPVGTKG4GIKOGPVU 5GKPGT -CKUGTNKEJGP *QJGKV FGU <CTGYKVUEJ   $TQP\GCP5EJTCWDGOKV5EJTCWDUEJGKDG2$ ++



&CU#D\GKEJGPYWTFGCO5GRVGODGTIGPGJOKIV



#D\GKEJGPFGU9QN[PUM[+PHCPVGTKG4GIKOGPVU$TQP\GVNYXGTUKNDGTVCP5EJTCWDGOKV5EJTCWD UEJGKDG2$ +++++



&CU#D\GKEJGPYWTFGCO#WIWUVIGPGJOKIV



#D\GKEJGP FGU  5EJKVQOKT +PHCPVGTKG4GIKOGPVU 5GKPGT -CKUGTNKEJGP *QJGKV FGU )TQ­HÃ&#x2019;TUVGP   0KMQNCK 0KMQNCLGYKVUEJ $TQP\G VNY XGTUKNDGTV VNY XGTIQNFGV WPF GOCKNNKGTV CP 5EJTCWDG OKV   5EJTCWDUEJGKDG2$ ++



&CU#D\GKEJGPYWTFGCO1MVQDGTIGPGJOKIV

167


RUSSISCHE ORDEN UND EHRENZEICHEN

8872

8873

8874

8871



#D\GKEJGP FGU  1UVTQY +PHCPVGTKG4GIKOGPVU 8GTUKNDGTV CP 5EJTCWDG OKV 5EJTCWD WPF 7PVGT   NCIUUEJGKDG2$ ++



&CU#D\GKEJGPYWTFGCO,CPWCTIGPGJOKIV



#D\GKEJGP FGU  1TGPDWTI +PHCPVGTKG4GIKOGPVU 8GTUKNDGTV CP 5EJTCWDG QJPG 5EJTCWDUEJGKDG   2$ ++



&CU#D\GKEJGPYWTFGCO/·T\IGPGJOKIV



#D\GKEJGP FGU  $GPFGTUM[ +PHCPVGTKG4GIKOGPVU 5KNDGT OKV 4GUVXGTIQNFWPI CP 5EJTCWDG OKV   5EJTCWDUEJGKDG*GTUVGNNGTDG\GKEJPWPI"ÝÄÓÀÐÄÚ"FGT(KTOC'FWCTFKP5V2GVGTUDWTI2$ ++



#D\GKEJGPFGU9CTUEJCWGT+PHCPVGTKG4GIKOGPVU$TQP\GCP5EJTCWDGOKV5EJTCWDUEJGKDG2$  ++



&CU#D\GKEJGPYWTFGCO/·T\IGPGJOKIV



&CU#D\GKEJGPYWTFGCO/·T\IGPGJOKIV

8875



8876

8877

8878

#D\GKEJGP FGU  .GUPCLC +PHGPVGTKG4GIKOGPVU $TQP\G XGTIQNFGV WPF GOCKNNKGTV ITQ­HN·EJKIG   GKPHCEJG'OCKNNGTGRCTCVWTCP5EJTCWDG2$ +++



&CU#D\GKEJGPYWTFGCO/CKIGPGJOKIV



#D\GKEJGPFGU5EJÒV\GP4GIKOGPVU$TQP\GCP5EJTCWDGOKV5EJTCWDUEJGKDG2$

++



&CU#D\GKEJGPYWTFGCO,WPKIGPGJOKIV





#D\GKEJGP FGU  0KUEJPK0QYIQTQF &TCIQPGT4GIKOGPVU 5GKPGT /CLGUV·V $TQP\G XGTIQNFGV   VNY IGUEJY·T\V WPF VNY GOCKNNKGTV CP 5EJTCWDUEJGKDG FCTCWH *GTUVGNNGTDG\GKEJPWPI FGT (KTOC   "Ç.ÊÎÐÒÌÀÍÚ"2$ ++



#D\GKEJGPFGU5WO[*WUCTGP4GIKOGPVU5GKPGT/CLGUV·V-ÌPKI(TGFGTKM8+++XQP&·PGOCTM 5KNDGTVNYXGTIQNFGVCWHFGT4ÒEMUGKVG5V2GVGTUDWTIGT<QNQVPKMK5KNDGTRWP\GXQPDKU CP5EJTCWDGOKV5EJTCWDUEJGKDGFCTCWHXGTUEJNCIGPG/GKUVGTOCTMGOKV#!2$ ++



&CU#D\GKEJGPYWTFGCO&G\GODGTIGPGJOKIV

168


RUSSISCHE ORDEN UND EHRENZEICHEN

8881 8879 8882

8880



#D\GKEJGP FGU +UKWO*WUCTGP4GIKOGPVU5GKPGT-ÌPKINKEJGP*QJGKVFGU2TKP\GP*GKPTKEJXQP 2TGW­GP5KNDGTVNYXGTIQNFGVCP5EJTCWDGOKV5EJTCWDUEJGKDG2$ ++



&CU#D\GKEJGPKUVCO#WIWUVIGPGJOKIVYQTFGP



#D\GKEJGPHÒTFKG$GUCV\WPIFGU(GUVWPI5YGDQTI$TQP\GXGTIQNFGVVNYXGTUKNDGTVVNYGOCKNNKGTV OKP 'OCKNNGEJKRU CP 5EJTCWDG OKV 5EJTCWD WPF 7PVGTNCIUUEJGKDG FCTCWH *GTUVGNNGTDG\GKEJPWPI FGT   (KTOC"Ç. ÊÎÐÒÌÀÍÚ"2$ ++



&CU#D\GKEJGPKUVCO/·T\IGPGJOKIVYQTFGP



#D\GKEJGPFGT)GH·PIPKU9CEJG5KNDGTVNYXGTIQNFGVWPFGOCKNNKGTV'OCKNNGEJKRUCWHFGT4ÒEMUGKVG /GKUVGTOCTMG"ÂÄ"HÒT8CTXCTC2GVTQYPC&KGVYCNFWPF<QNQVPKMK-QMQUEJPKM5KNDGTRWP\GXQP DKU  CP 5EJTCWDG OKV 5EJTCWD WPF 7PVGTNCIUUEJGKDG FCTCWH /GKUVGTOCTMG "ÂÄ" WPF   5V2GVGTUDWTIGT<QNQVPKMK-QMQUEJPKM5KNDGTRWP\GXQPDKU2$ ++



&CU#D\GKEJGPKUVCO/·T\IGPGJOKIVYQTFGP



#D\GKEJGP \WO  ,CJTGUVCI FGT 7PVGTYGTHWPI FGU ¤UVNKEJGP -CWMCUWU $TQP\G XGTIQNFGV VNY   GOCKNNKGTVCP5EJTCWDGOKV/WVVGTWPF7PVGTNCIUUEJGKDG2$ ++



&CU#D\GKEJGPKUVCO#WIWUVIGPGJOKIVYQTFGP

8885

8883

8886 8884



5EJCTHUEJÒV\GP#D\GKEJGP #D\GKEJGP  )TCFGU $TQP\G XGTIQNFGV WPF VNY GOCKNNKGTV CP 5EJTCWDG   OKV5EJTCWDUEJGKDG2$C ++



&CUWTURTÒPINKEJGKPUVWHKIG#D\GKEJGPKUVCO/CKIGUVKHVGVWPFCO#WIWUVCWHFTGK5VWHGPGTYGKVGTV YQTFGP



-TCHVHCJTGT#D\GKEJGP$TQP\GCP5EJTCWDGQJPG5EJTCWDUEJGKDG

++





7PDGMCPPVGU #D\GKEJGP $TQP\G GOCKNNKGTV OKP *CCTTKUUG OKV $CPFTQUGVVG FGU 5V )GQTIU1TFGPU   WPVGTNGIVCP5EJTCWDGOKV5EJTCWDUEJGKDG ++





7PDGMCPPVGU #D\GKEJGP 5KNDGT VNY GOCKNNKGTV ITÌ­GTGT 'OCKNNGEJKR $TQP\G CP 5EJTCWDG OKV   5EJTCWDUEJGKDG ++

 169


RUSSISCHE ORDEN UND EHRENZEICHEN

8889 8888 8887



7PDGMCPPVGU#D\GKEJGP5KNDGTCP5EJTCWDGOKV5EJTCWDUEJGKDG

++



7PDGMCPPVGU#D\GKEJGP$TQP\GVNYXGTUKNDGTVVNYGOCKNNKGTV'OCKNNGEJKRUCP5EJTCWDGOKV5EJTCWD UEJGKDG ++

 

<#4'067/ $+5 ņ,'6105 

7PDGMCPPVGT,GVQPOKVFGO9CRRGPXQP5V2GVGTUDWTI5KNDGTGOCKNNKGTVCO4KPI

8890

++



8891



,GVQPFGT(GWGTYGJTXQP5V2GVGTUDWTI5KNDGTVNYXGTIQNFGVWPFGOCKNNKGTV)QNFCWHFGT4ÒEMUGKVG 9KFOWPIUITCXWT:++Ï. Ä. / Êó÷èíñê³éCO4KPI ++





,GVQPFGT5EJCDKPMQ'KUGPDCJPNKPKG)QNFGOCKNNKGTV5KNDGTICO4KPIFKGUGTOKVWPNGUGTNKEJGT /GKUVGTOCTMGWPF5V2GVGTUDWTIGT<QNQVPKMK)QNFRWP\GXQPDKU ++



8892

8893



,GVQP\WT,CJTHGKGTFGT&[PCUVKG4QOCPQY5KNDGT2QT\GNNCP2QT\GNNCPOCNGTGKCO4KPI FKGUGTOKVWPNGUGTNKEJGT/GKUVGTOCTMGWPF-QMQUEJPKM2WP\GXQPDKU ++





'TKPPGTWPIULGVQPCPFGP$CWFGT6TQKUMCIQ$TÒEMGXQPDKU)QNFVNYGOCKNNKGTVI 5VCFVYCRRGP XQP 5V 2GVGTUDWTI WPF 2CTKU OKV ITCXKGTVGO 6T·IGTPCOGP/#4%$'40#4&KPFGT ¤UG  <QNQVPKMK )QNFRWP\G OKV FGO 2TQDKGTOGKUVGT\GKEJGP ßË HÒT ;CMQX .[CRWPQX CO 4KPI   FKGUGTOKV/GKUVGTOCTMG'5HÒT'FWCTF9KNJGNO5EJTCOOKP5V2GVGTUDWTI ++



'FWCTF9KNJGNO5EJTCOOJCVXQTHÒTFKG(KTOC(CDGTI¾KP5V2GVGTUDWTIIGCTDGKVGV

170


RUSSISCHE ORDEN UND EHRENZEICHEN

8894



,GVQPFGT1NQPGUMCLC'KUGPDCJPNKPKG5KNDGT)QNFVNYGOCKNNKGTVI'OCKNNGOCNGTGKQDGTHN·EJ NKEJG'OCKNNGEJKRUKPFGT¤UG/GKUVGTOCTMG6-<QNQVPKMK-QMQUEJPKM5KNDGTRWP\GXQPDKU WPF-QMQUEJPKM2WP\GXQPDKUCO4KPI ++

8895



8896

<#4'067/ $+5 Å&#x2020;'/+4#6$7%*#4# 

8GTFKGPUVOGFCKNNG (Ã&#x2019;T 'KHGT WPF 8GTFKGPUV -NGKPG )QNFGPG /GFCKNNG GKPJGKOKUEJG #PHGTVKIWPI   5KNDGTXGTIQNFGVWPFGOCKNNKGTVOKP'OCKNNGCWUDTÃ&#x2019;EJGQJPG$CPF ++





8GTFKGPUVOGFCKNNG (Ã&#x2019;T 'KHGT WPF 8GTFKGPUV -NGKPG )QNFGPG /GFCKNNG GKPJGKOKUEJG #PHGTVKIWPI   5KNDGTXGTIQNFGVWPFGOCKNNKGTVGKPKIG'OCKNNGCWUDTÃ&#x2019;EJGQJPG$CPF +++++



8898

8897 8899



8GTFKGPUVOGFCKNNG (Ã&#x2019;T 'KHGT WPF 8GTFKGPUV 5KNDGTPG /GFCKNNG GKPJGKOKUEJG #PHGTVKIWPI 5KNDGT   GOCKNNKGTVQJPG$CPF ++





8GTFKGPUVOGFCKNNG (Ã&#x2019;T 'KHGT WPF 8GTFKGPUV 5KNDGTPG /GFCKNNG GKPJGKOKUEJG #PHGTVKIWPI 5KNDGT   QJPG'OCKNNGQJPG$CPF ++





/KNKV·T8GTFKGPUVOGFCKNNG 5KNDGTPG /GFCKNNG 5KNDGT \CJNTGKEJG 'OCKNNGCWUDTÃ&#x2019;EJG CO PGWGP YQJN   PKEJVMQTTGMVGP$CPF ++

 171


RUSSISCHE ORDEN UND EHRENZEICHEN

8900

2418+514+5%*'4')+'470)   

1TFGP FGU JGKNKIGP )TQ­O·TV[TGTU )GQTI FGU 5KGITGKEJGP =Îðäåí Ñâÿàòîãî Âåëèêîìó÷åíèêà è   Ïîáåäîíîñöà Ãåîðãèÿ?$TWUVUVGTP/QFGNN ņQJPG-TQPGKO/GFCKNNQPTKPIFGU$TWUVUVGTPU  #PHGTVKIWPI PCEJ  &WTEJOGUUGT  OO 5KNDGT XGTIQNFGV VNY GOCKNNKGTV CP 0CFGN FKGUG OKV   HTCP\ÌUKUEJGT'KPHWJTRWP\GXQPDKU 5EJYCPGPRWP\G  4++



5GJTSWCNKV·VUXQNNG#PHGTVKIWPICWUFGOFTKVVGP8KGTVGNFGU<YCP\KIUVGP,CJTJWPFGTVU&GT5V)GQTIU1TFGPKUVKPFGT WPF-NCUUG HÒTFKGUVCVWVGPIGO·­GKP$TWUVUVGTPXQTIGUGJGPYCT XQPFGT2TQXKUQTKUEJGP4GIKGTWPIPKEJVXGTNKG JGPYQTFGP

8901

8902

8903



5V )GQTIU/GFCKNNG HÒT 6CRHGTMGKV  /QFGNN   /GFCKNNG  -NCUUG CWH FGT 4ÒEMUGKVG   <GKEJGPōÁ.Ì.ŋHÒTWPGFNGU/GVCNNWPF6T·IGTPWOOGTō0QŋQJPG$CPF ++



/GFCKNNGHÒT-·ORHGTHÒT8CVGTNCPFWPF(TGKJGKV1JPG$CPFTKPIWPFQJPG$CPF



/GFCKNNGFGT6TGWGP(TQPVHÒT6CRHGTMGKV#PUR·VGTGT2GPVCIQPCN$CPFURCPIGOKVFGO$CPFFGU5V )GQTIU1TFGPU ++

172

++

  


RUSSISCHE ORDEN UND EHRENZEICHEN

8904



#D\GKEJGP FGU .GVVKUEJGP 5EJÒV\GP4GIKOGPVU 9QJN #WUICDG WPVGT FGT 2TQXKUQTKUEJGP 4GIKGTWPI   5KNDGT OKV 4GUVXGTIQNFWPI CP 5EJTCWDG OKV 5EJTCWD WPF 7PVGTNCIUUEJGKDG CWH GTUVGTGT -QMQUEJPKM   2WP\GXQPDKUCWHNGV\GTGT/GKUVGTOCTMGÂÄHÒT8CTXCTC2GVTQYPC&KGVYCNF*GT UVGNNGTDG\GKEJPWPI ÝÄÓÀÐÄÚ HÒT FKG (KTOC 'FWCTF KP 5V 2GVGTUDWTI WPF -QMQUEJPKM2WP\G XQP   DKU2$XCT ++ &CU#D\GKEJGPYWTFGCO&G\GODGTIGPGJOKIV



8907 (Rv. Detail) 8905 8907

519,'670+10 



'JTGP\GKEJGPFGT)GUGNNUEJCHVFGTHTGKYKNNKIGP.WHVHNQVVGÄîáðîëåò5KNDGTYQJN)QNFVNYGOCKN NKGTVCWHFGT8QTFGTUGKVG/GKUVGTOCTMGÏÂ2GVTQITCFGTD\Y.GPKPITCFGT<QNQVPKMK-QMQUEJPKM 5KNDGTRWP\GXQPDKUWPF-QMQUEJPKM2WP\GXQPDKUCWHFGT4ÒEMUGKVG PWOOGTKGTV 0  CP5EJTCWDGOKV5EJTCWDWPF7PVGTNCIUUEJGKDGGTUVGTGOKV-QMQUEJPKM2WP\G XQPDKUNGV\VGTGOKVWPNGUGTNKEJGT/GKUVGTOCTMG ++



#D\GKEJGP FGT )GUGNNUEJCHV FGT HTGKYKNNKIGP .WHVHNQVVG Äîáðîëåò $TQP\G GOCKNNKGTV CP 5EJTCWDG   OKV5EJTCWDUEJGKDG ++



(+00.#0& 

#D\GKEJGPFGT<GPVTCNGP(KPPKUEJGP*CPFGNUMCOOGT#D\GKEJGPHÒTL·JTKIG/KVCTDGKV/QFGNN

OKV TÌOKUEJGP <KHHGTP  5KNDGT CWH FGT 4ÒEMUGKVG OGJTHCEJ RWP\KGTVWC*GTUVGNNGTOCTMG#6FGT (KTOC6KNNCPFGTKP*GNUKPMK5KNDGTRWP\G*WPF,CJTGURWP\G-HÒTOKVUVCTMIGVTCIGPGT $CPFUEJNGKHGCP0CFGN ++

8908



8909

/106'0')41 

/GFCKNNGHÒT'KHGT)QNFGPG/GFCKNNG$TQP\GXGTIQNFGVCO$CPF

++



6ª4-'+ņ15/#0+5%*'54'+%* 

1UOCPKUEJG -TKO-TKGIUOGFCKNNG #WUICDG HÒT FKG DTKVKUEJGP 6TWRRGP OKV%4+/'# 5KNDGTCO QTKIKPCNGPCNVGPGVYCU\GTUEJNKUUGPGP$CPF/;$54 ++ &KG/GFCKNNGYWTFGXQPFGTQUOCPKUEJGP4GIKGTWPIIGUVKHVGVWPFKPFTGK#WUICDGP DTKVKUEJG%4+/'#HTCP \ÌUKUEJG.#%4+/''WPFRKGOQPVGUKUEJUCTFKPKUEJG.#%4+/'# XGTNKGJGP'KP)TQ­VGKNFGTDTKVKUEJGP#WUIC DGPIKPINCWV5QW[TKU4QNNCPF KP545 DGKO7PVGTICPIFGT2101/#XGTNQTGPUQFC­XKGNG$TKVGPFKGRKG OQPVGUKUEJUCTFKPKUEJG#WUICDGXGTNKGJGPDGMCOGP



173


MEINE TEILNAHME ALS SCHRIFTLICHER BIETER 1. 2. 3. 4. 5. 6. 7.

Studieren Sie den Katalog sorgfältig und notieren Sie alle Lose, die interessant für Sie sind. Legen Sie für jedes Los Ihr persönliches Limit fest, das Sie maximal zu zahlen bereit sind. Füllen Sie das beiliegende Formular aus (siehe rechte Seite) und tragen Sie für jedes Los Ihr Höchstgebot ein. Schicken Sie uns Ihren Auftrag frühzeitig. Bei gleich hohen Geboten erhält das zuerst eingegangene Gebot den Zuschlag. Sie haben interessante Lose für insgesamt € 10.000,-- gefunden, möchten jedoch nur € 2.000,-- ausgeben. Kein Problem: Sie geben als Gesamtlimit (ohne Aufgeld) € 2.000,-- an. Wenn Sie Fragen haben: Die MitarbeiterInnen unserer Kundenbetreuung sind für Sie da. Tel. 08 00-58 36 537 (gebührenfrei). Wenn Sie telefonisch an unseren Auktionen teilnehmen möchten, ist das ab einer Schätzung von € 500,- pro Los möglich. Bitte teilen Sie uns diesen Wunsch mindestens einen Werktag vor Beginn der Versteigerung schriftlich mit.

MEINE PERSÖNLICHE TEILNAHME IN OSNABRÜCK 1.

2. 3.

Wir freuen uns sehr, wenn Sie persönlich nach Osnabrück kommen möchten. Das Flair einer Auktion und die Stimmung im Auktionssaal sind ein besonderes Erlebnis für Sie als Sammler. Osnabrück ist außerdem immer eine Reise wert und die persönliche Betreuung durch unsere Mitarbeiter wissen immer mehr Kunden zu schätzen. Bitte rufen Sie uns rechtzeitig an, damit wir Ihnen Tipps für die Anreise geben und Ihnen ein Hotelzimmer reservieren können. Sie erreichen uns gebührenfrei unter: 08 00-58 36 537. Als erfolgreicher Bieter können Sie Ihre neu erworbenen Stücke gleich persönlich mit nach Hause nehmen. Als guter Kunde unseres Hauses haben Sie 20 Tage Zahlungsziel nach der Auktion.

WIE ENTSTEHT DER PREIS EINER AUKTION? 1. 2.

Der im Auktionskatalog angegebene Preis ist ein Schätzpreis, der durch unsere Experten festgelegt wurde. Das Mindestgebot liegt bei 80% dieses Wertes. Die Zuschlagpreise sind oft deutlich höher als die Schätzpreise. Als Auktionshaus müssen wir bereits vor der Auktion alle schriftlichen Gebote koordinieren. Folgende Beispiele sind im Bietverfahren möglich:

Beispiel 1 (Schätzpreis: € 1.000,--) Es liegt kein schriftlicher Auftrag vor: der Auktionator ruft das Los in der Auktion mit € 800,-- aus. Wenn im Saal nur ein Bieter darauf ein Gebot abgibt, erhält der Saalbieter den Zuschlag für € 800,--.

Beispiel 3 (Schätzpreis: € 1.000,--) Es liegt dem Auktionator nur ein schriftliches Gebot von € 850,-- vor: das Los wird in der Auktion mit € 800,-ausgerufen. Falls kein Bieter im Saal ein Gegenangebot abgibt, erhält der schriftliche Bieter den Zuschlag bei € 800,--.

Beispiel 2 (Schätzpreis: € 1.000,--) Es liegen dem Auktionator drei schriftliche Gebote vor:

Beispiel 4: (Schätzpreis: € 1.000,--) Es liegt dem Auktionator nur ein schriftliches Gebot von € 1.200,-- vor: der Auktionator ruft das Los mit € 800,-- aus. Gibt es im Saal keinen Gegenbieter, erhält der schriftliche Bieter den Zuschlag bei € 800,--. Falls es im Saal Gegenbieter gibt, bietet der Auktionator für seinen schriftlichen Bieter bis maximal € 1.200,-- und erteilt einem Gegenbieter im Saal erst bei mehr als € 1.200,-- den Zuschlag.

Bieter 1: Limit € 2.900,-Bieter 2: Limit € 1.800,-Bieter 3: Limit: € 800,-Nach der Versteigerungsordnung muss der Auktionator im Interesse von Bieter 1 und 2 angemessen überbieten (um ca. 5 bis 10%). Der Ausrufpreis in der Auktion beträgt daher im Interesse von Bieter 1, € 1.900,-- (obwohl die Schätzung € 1.000,-- beträgt). Falls keine höheren Gebote aus dem Saal erfolgen, erhält Bieter 1 den Zuschlag für € 1.900,--. Das Höchstangebot von € 2.900,-- musste nicht ausgeschöpft werden.

Beispiel 5 (Schätzpreis: € 1.000,--) Es liegen drei Gebote von je € 975,-- vor: um Missverständnisse zu vermeiden, überzieht der Auktionator das zuerst eingegangene Gebot geringfügig und erteilt den Zuschlag bei € 1.000,--.


MUSTERAUKTIONSAUFTRAG FÜR SCHRIFTLICHE BIETER 1. Name, Adresse, Telefon: Ihre vollständige Anschrift ist wichtig, damit wir Ihren Auktionsauftrag annehmen und bearbeiten können. Ihre Telefonnummer brauchen wir, um Sie bei Rückfragen zu Ihren Geboten schnell erreichen zu können.

5. Ihre Kundennummer Die Angabe Ihrer Kundennummer unterstützt uns bei der Bearbeitung Ihres Auktionsauftrages. Viele Vorarbeiten für die Auktion werden dadurch einfacher und es werden Fehler vermieden.

2. Losnummern und Gebote Listen Sie alle Lose, für die Sie sich interessieren, mit ihrer Katalognummer auf und legen Sie für sich selbst fest, wie viel Sie bereit sind für jedes einzelne Los zu bieten.

6. Ihr Limit pro Einzellos An dieser Stelle geben Sie an, was Sie für jedes einzelne Stück maximal bereit sind auszugeben.

3. „Oder“-Gebote Wenn Sie sich für mehrere Münzen interessieren, aber nur ein Stück davon erwerben wollen, können Sie Ihre Gebote einfach mit einem „oder“ verbinden. Wichtig: bei den „oder“-Geboten können Sie nicht auf frühere Katalognummern zurückgreifen (z.B. 2890 oder 1558), da die Nr. 1558 dann bereits versteigert ist. 4. Unterschreiben Sie Ihren Auktionsauftrag . . .nachdem Sie Ihre Angaben noch einmal überprüft haben. Ihre Unterschrift ist wichtig, denn damit bestätigen Sie uns, dass sie tatsächlich teilnehmen wollen.

7. Überschreitung Ihrer Limits pro Einzellos In der Praxis zeigt sich, daß oft mehrere Bieter mit ihren Geboten dicht beieinander liegen. Deshalb empfiehlt es sich, an dieser Stelle einer geringfügigen Überschreitung Ihrer Gebote zuzustimmen. Dadurch erhöhen sich Ihre Chancen, im Wettbewerb mit anderen den Zuschlag zu erhalten. 8. Begrenzung Ihres Gesamtlimits Hier können sie die Gesamtsumme Ihrer Gebote begrenzen und festlegen, was Sie insgesamt maximal bereit sind auszugeben. Aufgeld und Mehrwertsteuer kommen später noch hinzu.

ANTWORTEN AUF FRAGEN, DIE UNS OFT GESTELLT WERDEN 1.

Zuschlagpreis/Aufgeld: Wir berechnen als Auktionshaus ein Aufgeld von 15% auf den Zuschlagpreis, dazu kommt die gesetzliche Mehrwertsteuer. Beispiel 2: Zuschlagpreis: € 1.000,-€ 100,-Aufgeld 15% € 150,-€ 15,00 Versandkosten, z. B.* € 5,90 € 5,90 MwSt. 7% € 80,91 € 8,46 ______ ________ Rg.-Betrag € 1.236,81 Rg.-Betrag € 129,36 Mehrwertsteuer: üblicherweise in Deutschland 7%, seit dem 01.01.2000 sind viele Goldmünzen, die nach 1800 geprägt wurden, steuerfrei. Bei Fragen zu der MWSt-Berechnung rufen Sie uns an, gebührenfrei unter: 08 00-58 36 537. Rücklosverkauf: Alle Lose, die in der Auktion nicht verkauft wurden, können Sie innerhalb von vier Wochen nach der Versteigerung zu 80% des Schätzpreises (zzgl. Aufgeld und Mehrwertsteuer) erwerben. Achtung: Viele Rücklose sind schnell vergriffen. Unser Spezialservice: Alle Bieter erhalten gratis die Ergebnisliste innerhalb von zwei Wochen nach der Auktion. Im Internet können Sie die Ergebnisliste der Auktion sofort nach der Auktion unter www.kuenker.de einsehen. Beispiel 1:

2. 3.

4.

Zuschlagpreis Aufgeld 15%: Versandkosten, z. B.* MwSt. 7%

* Die Kosten für Versand und Versicherung werden nach Aufwand berechnet.


ВАЖНАЯ ИНФОРМАЦИЯ ОБ УЧАСТИИ В АУКЦИОНЕ 1. 2. 3. 4. 5. 6. 7. 8.

Наши аукционные правила и условия Вы можете найти в конце каталога. Мы просим Вас присылать Ваши ставки заранее. В противном случае вероятность ошибки при обработке заказа, присланного перед самым аукционом, возрастает. Приложенный образец заполнения письменного заказа поможет Вам при отправлении Ваших письменных ставок. Ставки можно отправить как по почте, так и по факсу : +49 (0)541–96 20 222 круглосуточно. Успешные заказы будут обрабатываться в порядке их поступления к нам. Все участники, которым не удалось что-либо купить на аукционе, будут также проинформированы после аукциона. Если Вы впервые принимаете участие в нашем аукционе, то мы рекомендуем Вам сообщить нам Ваш референц – аукционные дома, с которыми Вы уже сотрудничали. Или свяжитесь с нами по телефону. Мы гарантируем подлинность всех предметов, проданных на нашем аукционе, в течении неограниченного времени. Все участники нашего аукциона получают в течении 2-ух недель результаты торгов бесплатно. У Вас есть вопросы по определенной монете? Вы хотели бы лично принять участие в аукционе? У Вас возникли другие вопросы? Звоните нам по телефону +49 (0)541-96 20 268, и мы будем рады Вам помочь.

МОЕ ЗАОЧНОЕ УЧАСТИЕ В АУКЦИОНЕ 1. 2. 3. 4. 5. 6.

Тщательно изучите наш каталог и запишите те лоты, которые Вас заинтересовали. Определите для Себя ту максимальную сумму, которую Вы готовы заплатить за каждый лот. Заполните приложенный формуляр. Отправьте нам Ваш заказ заранее. При 2-ух и более равных ставок на один и тот же лот преимущество получает ставка, пришедшая к нам первой ( ранее других). Если стоимость выбранных Вами лотов составляет например 10000 евро, а Вы могли бы потратить только 2000 евро, то в этом случае укажите Ваш общий лимит в размере 2000 евро. Если у Вас возникли вопросы по заполнению формуляра, звоните нам по телефону +49 (0)541-96 20 268. Наши сотрудники будут рады Вам помочь.

МОЕ ЛИЧНОЕ УЧАСТИЕ В ОСНАБРЮКЕ 1. 2. 3.

Мы будем рады Вашему личному присутствию в Оснабрюке. Атмосфера, которая стоит во время аукционных торгов в зале, особенная и непередаваемая. Для получения более подробной информации по Вашей поездке в Оснабрюк, в частности, бронирования номеров в гостинице, мы просим Вас заранее связаться с нами по телефону: +49 (0)541-96 20 268. Приобретенные на аукционе лоты Вы можете лично забрать после окончания торгов. Наши постоянные клиенты осуществляют оплату в течение 20 дней после получения счета. Участвующие в аукционе впервые осуществляют 100%-ую предоплату.

УЧАСТИЕ ПО ИНТЕРНЕТУ Все каталоги доступны для просмотра на нашем сайте в интернете по адресу www.kuenker.de. На сайте Вы можете выбрать интересующие Вас лоты и отправить Ваши ставки на нашу электронную почту service@kuenker.de. Если у Вас возникнут дополнительные вопросы, мы просим Вас связаться с нами по телефону +49 (0)5 41-96 20 268.

УЧАСТИЕ ПО ТЕЛЕФОНУ Для участия в торгах по телефону просим Вас связаться с нами не позднее 48 часов до начала аукциона. Условием проведения телефонных торгов является письменное подтверждение ставки, равной как минимум стартовой цене. Участие в телефонных торгах возможно только для лотов со стартовой ценой свыше 500 евро. Для получения дополнительной информации и регистрации на аукционе звоните Анастасии Кепселль до аукциона по телефону +49 (0)5 41-96 20 268 и во время аукциона по телефону, указанному на первой странице каталога.


КАК ОБРАЗОВЫВАЕТСЯ ЦЕНА НА АУКЦИОНЕ? 1. 2.

Все лоты в нашем каталоге были предварительно оценены нашими экпертами. Минимальная ставка составляет 80% от оценочной стоимости лота. Конечные цены зачастую намного превышают оценочные. Ваши письменные ( заочные ) ставки должны быть обязательно обработаны нашими сотрудниками до начала аукциона. Рассмотрим несколько возможных примеров: Пример 1 ( Оценочная стоимость: € 1.000,-- ) Пример 3 (Оценочная стоимость: € 1.000,-- ) Заочных ставок нет. Аукционатор начинает торги с У аукционатора имеется только 1 заочная ставка в €800,--. Если в зале только один человек, размере € 850,--. Аукционатор начнет торги с желающий приобрести этот лот, то соответственно € 800,--. Если среди очных участников никто не он получит его за €800,--. даст более высокую ставку, то заочный участник получит этот лот за €800,-Пример 2 ( Оценочная стоимость: € 1.000,-- ) У аукционатора имеются 3 заочные ставки: Заочный участник 1 : Лимит € 2.900,-Заочный участник 2 : Лимит € 1.800,-Заочный участник 3 : Лимит € 800,-По правилам аукциона аукционатор в интересах заочного участника 1 и 2 должен повышать ставку равномерно ( приблизительно на 5 – 10% ). Поэтому в нашем случае в интересах заочного участника 1 аукционатор начнет торги с € 1900,-( хотя оценочная стоимость составляет €1000,--). Если среди очных участников никто не даст более высокую ставку, то заочный участник 1 получит этот лот за €1900,--. Его лимит в €2900,-- ни в коем случае не будет исчерпан.

Пример 4 (Оценочная стоимость: € 1.000,-- ) У аукционатора имеется только 1 заочная ставка в размере €1200,--. Аукционатор начнет торги с €800,--. Если среди очных участников никто не даст более высокую ставку, то заочный участник получит этот лот за €800,--. Если же в зале очный участник согласен на более высокую ставку ( больше €800,-- ), то в этом случае аукционатор в интересах заочного участника имеет право тоговаться до €1200,--. Следовательно только при ставке, превышающей €1200,--, данный лот получит очный участник в зале. Пример 5 (Оценочная стоимость: € 1.000,-- ) У аукционатора имеются 3 заочные ставки, каждая в размере €975,--. Среди очных участников интереса к лоту не имеется. В этом случае чтобы избежать недоразумений, аукционатор имеет право ненамного повысить лимит и сделать ставку равной €1000,--. Данный лот за €1000,-- получит тот заочный участник, чей письменный формуляр мы получили раньше всего.

КАК Я МОГУ ПОЛУЧИТЬ ПРИОБРЕТЕННЫЕ ЛОТЫ? Вывоз приобретенных на аукционе предметов осуществляется одним из следующих способов по Вашему выбору: • Вы можете лично забрать Ваши лоты. По окончании торгов мы готовим все необходимые документы на вывоз из Германии. При вывозе за пределы Евросоюза, НДС Вам возвращается. • Почтовые отправки в Россию ( Беларусь, Украину ) приобретенных Вами лотов осуществляются по предварительной договоренности. Для связи с нами звоните нам по телефону +49 (0)541-96 20 268.

С 1971 года имя Кюнкер является гарантией надежности и компетентности. Мы не станем изменять нашим принципам и в будущем. Спасибо Вам за Ваше доверие, которое является не только самым сильным стимулом в нашей работе, но и наилучшей ее оценкой. Я желаю Вам успехов на нашем аукционе!

Фриц-Рудольф Кюнкер


VERSTEIGERUNGSBEDINGUNGEN Die Versteigerung erfolgt im Auftrag und für Rechnung der Eigentümer unter Einhaltung der sich aus der Versteigerungsordnung (BGB1 I 1976, 1346) ergebenden und für Kommissionäre geltenden gesetzlichen Bestimmungen des BGB und HGB gegen Barzahlung des Kaufpreises in € - Währung. Durch Abgabe eines Gebotes werden die Versteigerungsbedingungen anerkannt, dies gilt auch für die schriftlichen Gebote. Der Zuschlagpreis ist Nettopreis im Sinne des Umsatzsteuergesetzes und bildet die Berechnungsgrundlage für das vom Käufer zu zahlende Aufgeld in Höhe von 15 %. Auf den daraus entstehenden Gesamtpreis (Zuschlag + Aufgeld) wird die jeweils gültige Umsatzsteuer erhoben, soweit dies gesetzlich vorgeschrieben ist. Ausländischen Käufern aus Ländern der europäischen Gemeinschaft wird die in Deutschlang gültige Umsatzsteuer berechnet. Anderen ausländischen Käufern (aus Drittländern) wird, sofern die Münzen durch uns exportiert werden, ein Aufgeld von 15 % netto auf den Zuschlagpreis berechnet; sie erhalten die Lieferung nur gegen Zahlung des Kaufpreises in € - Währung, bankspesenfrei. Ausländischen Münzhändlern aus Ländern der europäischen Gemeinschaft wird bei Nachweis der Umsatzsteuer-Identifikationsnummer (§ 27 a UStG) und der sonstigen Voraussetzungen gemäß § 4 Nr. 1 b UStG in Verbindung mit § 6 a UStG die Lieferung ohne Umsatzsteuer berechnet. Sofern nichts anderes vereinbart wird, ist die Zahlung der Auktionsrechnung bei anwesenden Käufern sofort, bei schriftlichen Bietern spätestens 20 Tage nach Erhalt fällig. Bei Zahlungsverzug werden Zinsen von 1 % pro Monat berechnet. Wird die Zahlung nicht sofort an den Versteigerer geleistet oder die Abnahme der zugeschlagenen Sache verweigert, so findet die Übergabe der Sache an den Ersteigerer nicht statt. Der Ersteigerer verliert vielmehr seine Rechte aus dem Zuschlag, und die Sache kann auf seine Kosten erneut versteigert werden. In diesem Fall haftet der Ersteigerer für den Ausfall, dagegen hat er auf den Mehrerlös keinen Anspruch. Der Zuschlag erfolgt nach dreimaligem Ausruf des höchsten Gebotes und verpflichtet zur Abnahme und Zahlung. Bei Meinungsverschiedenheiten über den Zuschlag wird die Nummer noch einmal ausgerufen. Der Versteigerer ist berechtigt, Nummern zu vereinigen oder zu trennen. Eine Vorausnahme von Nummern erfolgt nicht. Der Zutritt zur Versteigerung ist nur Interessenten gestattet, die einen Katalog besitzen.

Schriftliche Aufträge werden von uns ohne Auftragsprovision gewissenhaft ausgeführt. Aufträge von uns unbekannten Sammlern können nur ausgeführt werden, wenn ein Depot hinterlegt wird oder Referenzen benannt werden. Schriftliche Gebote können nur bis 24 Stunden vor Auktionsbeginn verbindlich berücksichtigt werden. Im Bedarfsfall ist der Auktionator berechtigt, die Limits um 3 – 5 % zu überschreiten. Bei mehreren gleichhohen Geboten erhält das zuerst eingegangene den Zuschlag. Unlimitierte Aufträge haben keinen Anspruch auf unbedingte Ausführung. Telefonisches Bieten ist nur in Ausnahmefällen möglich. Telefonische Bieter müssen sich mindestens einen Werktag vor der Auktion voranmelden. Der Versand geht zu Lasten und auf Risiko des Ersteigerers bzw. Empfängers. Das Auktionsgut bleibt bis zur vollständigen Bezahlung aller Forderungen aus Anlaß der Versteigerung Eigentum des Verkäufers. Ist der Käufer Vollkaufmann, so ist Osnabrück als Gerichtsstand vereinbart. Für das Mahnverfahren gilt die Zuständigkeit des Amtsgerichts Osnabrück auch in allen anderen Fällen als vereinbart. Ansonsten ist es Osnabrück nur, wenn nur die Firma Fritz Rudolf Künker GmbH & Co. KG ihren allgemeinen Gerichtsstand in der BRD hat, oder wenn alle Ansprüche im Wege des Mahnverfahrens geltend gemacht werden, oder wenn die im Klageweg in Anspruch zu nehmende Vertragspartei nach Vertragsabschluß ihren gewöhnlichen Aufenthaltsort aus dem Geltungsbereich der BRD verlegt hat, oder ihr Wohnsitz oder gewöhnlicher Aufenthaltsort zum Zeitpunkt der Klage nicht bekannt ist. Die Beschreibung im Katalog ist gewissenhaft durchgeführt. Sie begründet jedoch keine Rechts- oder Sachmängelhaftung gemäß §§ 434, 459 ff BGB. Die Angabe der Erhaltung ist streng nach den im deutschen Münzhandel üblichen Erhaltungseinstufungen vorgenommen und gilt als persönliche Beurteilung. Bei der Auktion anwesende Käufer kaufen grundsätzlich „wie besehen“. Da durch Vorbesichtigung Gelegenheit gegeben ist, sich vom Erhaltungszustand des Versteigerungsgutes zu überzeugen, können nach erfolgtem Zuschlag Reklamationen nur bei irrtümlich übersehener Henkel- oder Fassungsspur oder gestopftem Loch berücksichtigt werden. Bei Losen mit mehreren Stücken sind die Stückzahlen nur Circa-Angaben, irrtümliche Zuschreibungen sind im Einzelfall nicht ausgeschlossen. Diese Lose sind nach erfolgtem Zuschlag von jeder Reklamation ausgeschlossen. Der Versteigerer kann bei eventuellen Meinungsverschiedenheiten bzw. Beanstandungen einen vereidigten Sachverständiger seiner Wahl (die Kosten trägt der unterliegende Teil) beauftragen. Eventuelle Beanstandungen können nur innerhalb von 8 Tagen nach der Auktion bzw. nach Erhalt der ersteigerten Stücke berücksichtigt werden.

Die Mindeststeigerungsstufen für das Bietungsverfahren betragen:

Mindestangebote

Mindeststeigerungsstufe

Wenn Sie in unserer Auktion erworbene Münzen an einen Grading Service in den USA verschicken möchten, übernehmen wir keine Garantie, daß die Münzen dort angenommen oder entsprechend unserer Bewertung eingestuft werden.

bis zu

€ 100,--

€ 5,--

bis zu

€ 200,--

€ 10,--

bis zu

€ 500,--

€ 20,--

bis zu

€ 1.000,--

€ 50,--

bis zu

€ 2.000,--

€ 100,--

bis zu

€ 5.000,--

€ 200,--

bis zu

€ 10.000,--

€ 500,--

Soweit nicht anders vermerkt, gelten im übrigen die allgemeinen Versteigerungsbestimmungen und – auch im Verhältnis zu ausländischen Kunden – gilt Deutsches Recht.

bis zu

€ 20.000,--

€ 1.000,--

Die Ergebnisliste erscheint sofort nach der Auktion.

bis zu

€ 50.000,--

€ 2.000,--

DIE VERSTEIGERER:

ab

€ 50.000,--

€ 5.000,--

Die Echtheit der Stücke wird bis zur Höhe des Kaufpreises garantiert. Die beigedruckten Preise sind Schätzpreise, die unter- oder überschritten werden können. Aufträge, die unter 80 % des Schätzpreises liegen, können nicht bearbeitet werden. Ausländische Kunden kaufen nach den Devisen-, Zoll- und Steuerbestimmungen ihres Landes. Versandformalitäten werden vom Versteigerer erledigt.

FRITZ RUDOLF KÜNKER DR. ANDREAS KAISER ARNE KIRSCH OLIVER KÖPP


TERMS AND CONDITIONS OF AUCTION The auction is conducted on behalf and for the account of the appropiate proprietors of the goods and is subject to the federal Auction Regulation (Versteigerungsordnung, BGB1 I 1976, 1346) published in the Federal Law GazetteVol. I, 1976, 1346 and the relevant provisions for factors in accordance with the German Cicil Code (BGB) and Commercial Code (HGB). Payment of the hammer-price has to be made in cash and in Euro. The submission of an offer implies the express acknowledgement of these Terms and Conditions of Auction; the same applies to the submission of an offer in writing. The hammer-price is exclusive of applicable German VAT according to the prevailing VAT – legislation and represents the basis for calculating the surcharge of 15 percent payable by the puchaser. The total price so calculated (hammerprice plus surcharge) is subject to the VAT (value added tax=Mehrwertsteuer), which is payabel additionally. Purchasers from abroad will be charged a surcharge of 15 per cent net on the hammer-price, provided the export of the coins is undertaken by the auctioneer. Buyers in European Community (EEC) countries (other than Germany) will be charged Value Added Tax at the rates prevailing in Germany. Dealers from EEC countries (other than Germany) will receive goods free of tax upon presentation of their VAT I.D. number, and upon fulfillment of the other conditions set forth in Paragraph 4, Nr. 1 b, and Paragraph 6 a of the GermanTurnover Tax Law Buyers from other countries are not charged Value Added Tax. Delivery will be made against payment in Euro with no bank charges to the auctioneer. Unless mutually agreed otherwise, payment of the auction bill from purchasers present at the auction is due immediately. From purchaser who have submitted a bid in writing, payment is due within 20 days after receipt of the goods. Defaulted payments shall bear an interest charge of 1 % per month in the amount in default. Should payment to the auctioneer not be made immediately or should the acceptance of the awarded item be refused, such item shall not be handed overt to the purchaser. Instead the purchaser shall forfeit all right and title in and to such item from the award and the item may again be put to auction at this buyer’s cost. In this event the buyer shall be liable for any shortfall, while he shall have no right or claim towards any excess proceeds. An item will be knocked down after the highest bid has been called three times. The award shall be a binding commitment and liability on the part of the bidder to take acceptance and delivery of the item or items so awarded. In the event of any dispute with regard to the award the lot will be put up again for bidding. The auctioneer reserves the right to combine or to seperate lots. Lots will not be called out of sequence. Access to the auction will only be permitted to interested persons who are in possession of the catalogue.

same price or prices for a given lot, the bid first received by the auctioneer shall be given the award. Unlimited bids shall not oblige the auctioneer to consider, accept or carry out such order. Telephone bidding is generally an option for lots of substantial value only. The registration is required at the latest a day before auction. Shipment (by mail or otherwise) of the goods shall be for the sole cost and risk of the purchaser or receipient, resp. The auctioned goods remain the sole and exclusiv property of the vendor until full payment and settlement of any and all dues and claims in connection with the auction. In the event the purchaser is a merchant (in the sense of the German commercial laws) Osnabrück shall be the agreed and exclusive place of jurisdiction. The competence of the District Court (Amtsgericht) of Osnabrück is agreed in respect of summary proceedings for the collection of defaulted payments (Mahnverfahren) as well as in any and all other cases. Should the purchaser not be a merchant Osnabrück shall be the place of jurisdiction with the District Court of Osnabrück’s competence, if only the auctioneer has his ordinary legal domicil in the Federal Republic of Germany or if claims are made by way of summary proceedings of collection (Mahnverfahren) or if the defendant has moved his ordinary legal domicil outside the jurisdiction of the Federal Republik of Germany or if the legal domicil of the defendant is unknown to the auctioneer at the time of filing a suit. To the exclusion of any other legislation German law, as in force at the time, shall be applied for the settlement of any and all legal or judicial matters. The specifications and descriptions in the catalogue have been prepared diligently and in good faith do, however, not constitute the acceptance by the auctioneer of any warranty or liability in respect of defect in material or title. The state of preservation of items is strictly assessed in accordance with the grades accepted by the German coin trade and only represents an individual and personal assessment. Purchasers present at the auction acquire items strictly on the basis of “as is where is” and “as inspected”. In view of the opportunity of prior inspection to ascertain the state and condition of the auction lots, complaints and objections made after the sale will only be considered, if by obvious error or mistake loop or traces or moutings, traces of trimmings or settings, or the plugging of a hole (eyelet) have remained unnoticed. If and when auctioned in lots, the quantities of individual pieces given, only represent an approximate figure. An error in the allocation of indivdual pieces to a certain lot cannot be excluded. Such lots are, therefore, excluded from any complaintes or objections after the lot is knocked down. In the event of disputes or complaints as to the quality of an item the auctioneer may call upon a gernerally sworn expert of the trade, which the auctioneer may choose at his sole discretin, for assessment an the rendering of a decision as to the justification of such dispute or complaint. The costs of such expert shall be borne by the party loosing the dispute according to the expert’s decision. Complaints or objections, if justified, will only be considered if made and received by the auctioneer within 8 days after the auction or after receipt the lots, respectively.

The minimum rates of increase for the bidding procedure are: for minimum offers

minimum increase rate

up to

€ 100,--

€ 5,--

up to

€ 200,--

€ 10,--

up to

€ 500,--

€ 20,--

up to

€ 1.000,--

€ 50,--

up to

€ 2.000,--

€ 100,--

up to

€ 5.000,--

€ 200,--

up to

€ 10.000,--

€ 500,--

up to

€ 20.000,--

€ 1.000,--

up to

€ 50.000,--

€ 2.000,--

above

€ 50.000,--

€ 5.000,--

Orders submitted in writing will be carried out diligently and without charge of an extra commission. Orders from collectors unknown to the auctioneer can only be accepted and carried out if a deposit or references to the satisfaction on the auctioneer are given. To be bindingly accepted, written bids need to be received at least 24 hours before auction. If necessary, the auctioneer is allowed to increase the bids by 3-5%. Should several bids be obtained in writing bidding the

If a coin that is sold by us is sent to a grading service ("slabbing"), we do not guarantee that the coin will be slabbed (nor that it will be slapped at any particular grade or with any particular comments); however, we always warranty that each coin or numismatic item we sell will be genuine. The authenticity of the coins is warranted. Warranted up to the total purchase price. The prices set out in the catalogue are estimates only, which may bei exceeded or undercut. Orders for less than 80 per cent of the estimated price cannot accepted. Purchasers from abroad will have to observe all applicable laws and regulations in respect of foreign exchange, customs duties and taxation of their country. The auctioneer will only discharge such formalities, which have to be observed, in the Federal Republic of Germany in connection with the export of the purchased item(s). Unless stipulated otherwise herein, the general rules regulations for auctions applicable in Germany shall govern any transaction in respect of the auction; German Law shall also be applicable in relation to purchasers form abroad. Only the German text has legal forde. The prices realized will be published in the form of a list immediately after the auction.

THE AUCTIONEERS:

FRITZ RUDOLF KÜNKER DR. ANDREAS KAISER ARNE KIRSCH OLIVER KÖPP


NUMISMATISCHE AUSDRÜCKE EXPRESSIONS NUMISMATIQUES NUMISMATIC TERMS TERMINI DI NUMISMATICA НУМИЗМАТИЧЕСКИЕ ТЕРМИНЫ

DEUTSCH

ENGLISCH

FRANÇAIS

ITALIANO

RUSSISCH

Abschlag Am Rand Berieben Blei Dezentriert Doppelschlag Einfassung Einseitig Emailliert Erhaltung Etwas Exemplar Fassungsspuren Fehlprägung

struck at the rim/border slightly polished lead uncentered double struck frame uniface enamelled condition/preservation slightly specimen, copy trace of mounting mis-strike

frappe en tranche frotté plomb décentré double frappe encadrement uniface émaillé conservation un peu exemplaire traces de monture défaut de frappe

coniazione al bordo trattato piombo non centrato ribattitura cornice uniface smaltato conservazione un poco esemplare tracce di montatura difetto di coniazione

Feld(er) Fundexemplar Gedenkmünze Geglättet Gelocht Geprägt Gewellt Goldpatina Henkelspur Hübsch Jahrh. = Jahrhundert Kl. = klein Korrosionsspuren Kratzer Kupfer Legierung Leicht(e) l. = links Min. = minimal Nachahmung Prachtexemplar

field(s) specimen from a hoard commemorative coin tooled holed minted bent golden patina mount mark attractive century small traces of corrosion scratch(es) copper alloy slightly left minimal imitation attractive, perfect piece

champ exemplaire de trouvaille monnaie commémorative retouché troué frappé ondulé patine dorée Trace de monture Joli Siècle Petit Traces de corrosion rayure cuivre alliage légèrement gauche minime imitation Pièce magnifique

campo da tesoretto moneta commemorativa liscio bucato coniato ondolato patina d´oro Tracce di appicagnolo carino secolo piccolo segni di corrosione graffio(i) rame lega leggero sinistra minimamente contraffazzione esemplare magnifico

Prägeschwäche Randdelle Randfehler Randschrift r. = rechts Rückseite Schriftspuren

weakly struck edge nick edge faults lettered edge to right reverse traces of inscription

de frappe faible défaut sur la tranche erreur sur la tranche tranche inscrite droite Revers Traces de légende

conio stanco ammaccatura al bordo errore nel bordo inscrizione sul bordo destra rovescio tracce di leggenda

Schrötling Schrötlingsfehler Schwach ausgeprägt Selten in dieser Erhaltung

flan flan defect weakly struck rare in this condition

Flan flan défectueux de frappe faible rare en cet état

tondello errore di tondello conio stanco conservazione rara

Seltener Jahrgang Stempel Stempelfehler Überdurchschnittlich erhalten Überprägt Unediert

rare year die(s) mistake in the die extraordinary condition

Année rare Coin erreur de frappe conservation extraordinaire

annata rara conio errore di conio conservazione estraordinaria

ОТТИСК НА ГУРТЕ ПОТЕРТАЯ СВИНЕЦ АССИМЕТРИЧНЫЙ ДВОЙНОЙ ЧЕКАН КАЙМА ОДНОСТОРОННЯЯ ЭМАЛИРОВАННАЯ СОХРАННОСТЬ СЛЕГКА ЭКЗЕМПЛЯР СЛЕДЫ ОБРАБОТКИ ОШИБКА В ПРОЦЕССЕ ЧЕКАНКИ ПОЛЕ ЭКЗЕМПЛЯР ПАМЯТНАЯ МОНЕТА ОТГЛАЖЕННАЯ ПРОКОЛАТАЯ ОТЧЕКАНЕННАЯ ВОЛНИСТАЯ ЗОЛОТАЯ ПАТИНА СЛЕДЫ ОТ УШКА КРАСИВАЯ СТОЛЕТИЕ МАЛЕНЬКИЙ СЛЕДЫ КОРРОЗИИ ЦАРАПИНА МЕДЬ СПЛАВ ЛЕГКИЙ СЛЕВА МИНИМАЛЬНЫЙ ИМИТАЦИЯ ПРЕВОСХОДНЫЙ ЭКЗЕМПЛЯР ИЗДЕРЖКН ПРИ ЧЕКАНКE ВМЯТИНА НА ГУРТЕ ОШИБКА НА ГУРТЕ ГУРТОВАЯ НАДПИСЬ СПРАВА РЕВЕРС СЛЕДЫ ПРЕДЫДУЩЕЙ НАДПИСИ ЗАГОТОВКА БРАК ЗАГОТОВКИ СЛАБО ОТЧЕКАНEНА РЕДКАЯ В ТАКОЙ СОХРАННОСТИ РЕДКИЙ ГОД ШТАМП ОШИБКА ШТАМПА СОХРАННОСТЬ ВЫШЕ СРЕДНЕГО

overstruck unpublished

surfrappé inédit

ribattuto inedito

Unikum Vergoldet Von allergrößter Seltenheit Vorderseite Winz.= winzig Zain Zierrand Zinn ziseliert

unique specimen gilt extremely rare head tiny flan ornamental border tin chased

unique Doré de toute rareté en face Petit flan tranche ornée étain ciselé

pezzo unico dorato di estrema raritá diritto veramente piccolo tondello taglio ornato stagno cesellato

ПЕРЕЧЕКАН НЕОПУБЛИКОВАННАЯ МОНЕТА УНИКАЛЬНАЯ ПОЗОЛОЧЕННАЯ НАИРЕДЧАЙШАЯ АВЕРС НЕЗНАЧИТЕЛЬНЫЙ ЗАГОТОВКА ДЕКОРАТИВНЫЙ ГУРТ ЦИНК ГРАВИРОВАННЫЙ


Künker eAuctions

Künker eAuctions

Unsere eAuctions umfassen circa 250 Losnummern. In einem festgelegten Zeitraum von 14 Tagen haben Sie die Möglichkeit, online auf die für Sie interessanten Münzen und Medaillen zu bieten. Die einzelnen Losnummern laufen zeitlich versetzt aus. Selbstverständlich werden Sie über Ihren aktuellen Gebotsstatus laufend per Email informiert und können Ihre Gebote bei Bedarf bis zur letzten Sekunde erhöhen.

Our eAuctions contain 250 lots. During a fixed period of 14 days you have the opportunity to submit your bids online on your favourite coins and medals.

Weitere Informationen und die nächsten Termine zu den Künker eAuctions finden Sie unter:

You may find further information and the next dates of the Künker eAuctions here:

www.kuenker.de

www.kuenker.com

Each lot will expire at different times. Certainly you will be informed constantly by email about the current status of your bids so that you permanent have the possibility – if necessary – to raise your bids till the end of the eAuction.

Fritz Rudolf Künker GmbH & Co. KG Gutenbergstraße 23 · 49076 Osnabrück · Germany Tel. +49 (0)541 96 20 20 · Fax +49 (0)541 96 20 222 www.kuenker.de · service@kuenker.de Osnabrück · Berlin · München · Zürich


IMPRESSUM NUMISMATISCHE BEARBEITUNG

FOTOS LAYOUT DRUCK

Michael Autengruber, Alexandra Spreu, Dr. Sebastian Steinbach, Jens Ulrich Thormann M. A., Eva Weber, Manuela Weiß Lübke & Wiedemann, Stuttgart danner pc - gesteuerte systeme waiblingen meister print und media, Kassel Jeglicher Nachdruck, auch auszugsweise, bedarf der Genehmigung des Auktionshauses

ZAHLUNGEN AUS DEM INLAND Deutsche Bank Osnabrück Dresdner Bank Osnabrück Sparkasse Osnabrück Volksbank eG Bad Laer-Borgloh-Hilter-Melle Bankhaus Lampe KG, Bielefeld Postbank Hannover HypoVereinsbank München WestLB Dortmund Paypal

(BLZ 265 700 90) Konto-Nummer 0 177 006 (BLZ 265 800 70) Konto-Nummer 780 520 200 (BLZ 265 501 05) Konto-Nummer 247 320 (BLZ 265 624 90) Konto-Nummer 1 200 222 400 (BLZ 480 201 51) Konto-Nummer 174 076 (BLZ 250 100 30) Konto-Nummer 2900 60-308 (BLZ 700 202 70) Konto-Nummer 24 17 952 (BLZ 440 500 00) Konto-Nummer 1128 842 paypal@kuenker.de, Service charge: 3,5 %

ZAHLUNGEN AUS DEM AUSLAND - FOREIGN PAYMENTS Deutsche Bank Osnabrück Sparkasse Osnabrück Postbank Hannover Credit Suisse Credit Cards Paypal

IBAN: DE11 2657 0090 0017 7006 00 Swift-Code: DEUTDE3B265 IBAN: DE50 2655 0105 0000 2473 20 Swift-Code: NOLADE22XXX IBAN: DE73 2501 0030 0290 0603 08 Swift-Code: PBNKDEFF IBAN: CH43 0483 5177 3509 0200 0 Swift-Code: CRESCHZZ80A We do accept VISA and MASTERCARD, Service charge: 4,5 % paypal@kuenker.de, Service charge: 3,5 %

ZAHLUNGEN INNERHALB RUSSLANDS - PAYMENTS WITHIN RUSSIA Deutsche Bank Moskau ʽʽʽΗʪ̸̨̜̖ʥ̡̦̌Η

ИНН 7728717332; КПП 772801001 Получатель: ЗАО "Кюнкер" счет №: 40702810500000000825; БИК: 044525101 корсчет №: 30101810100000000101

ERHALTUNGS- UND SELTENHEITSGRADE ERHALTUNGSGRADE GRADING TERMS DEGRÉS DE CONSERVATION GRADI DI CONSERVAZIONE

SELTENHEITSGRADE

Polierte Platte Proof Flan bruni Fondo specchio

Stempelglanz Uncirculated Fleur de coin Fior di conio

Vorzüglich Extremely fine Superbe Splendido

Sehr schön Very fine Très beau Bellissimo

Schön Fine Beau Molto Bello

Gering erhalten Very good Très bien conservé Bello

R = Selten

RR = Sehr selten

Von großer Seltenheit

Von größter Seltenheit

Von allergrößter Seltenheit

Unediert

Auktion 178  

Auktion 178

Read more
Read more
Similar to
Popular now
Just for you