Page 1


AUKTION 173 Orden und Ehrenzeichen aus verschiedenem Besitz

ZEIT

Freitag, 25. Juni 2010 10.00 Uhr - 13.00 Uhr 14.00 Uhr - 16.00 Uhr

ORT

Steigenberger Hotel Remarque Osnabrück, Natruper-Tor-Wall 1

AUKTIONS-TELEFON

+49 (0)541 60 96 633

AUKTIONS-FAX

+49 (0)541 60 96 634

AUKTIONEN 169-173, JUNI 2010 21. JUNI 2010

Auktion 169: Numismatische Bibliotheken Hanfried Bendig, Bremen, Bernard Poindessault, Paris, Teil 1 u. a.

22.-23. JUNI 2010

Auktion 170: Münzen und Medaillen aus Mittelalter und Neuzeit

23.-24. JUNI 2010

Auktion 171: Geprägtes Gold aus drei Jahrtausenden Deutsche Münzen ab 1871 Die Sammlung Prof. Nikolaus Otto u. a.

24. JUNI 2010

Auktion 172: Russische Münzen und Medaillen

25. JUNI 2010

Auktion 173: Orden und Ehrenzeichen aus verschiedenem Besitz


Besichtigung/On View Das Auktionsgut kann nach vorheriger Vereinbarung besichtigt werden. Auction lots may be viewed by appointment only.

Online-Katalog/Online Catalogue Betrachten Sie unsere Auktionskataloge im Internet! Unter www.kuenker.de und www.sixbid.com haben Sie die Möglichkeit, Abbildungen zu vergrößern, Ihre Gebote direkt abzugeben und die Ergebnisse der Auktionen abzurufen.

KUENKER.DE

Please browse our auction catalogues at www.kuenker.com or at www.sixbid.com! You will have the possibility to zoom all images, to place your bids and to view all auction results online.

Standorte/Locations OSNABRÜCK

BERLIN

Fritz Rudolf Künker GmbH & Co. KG Gutenbergstraße 23, 49076 Osnabrück Tel. +49 (0)541 96 20 20 USt.-Id.-Nr. DE 256 270 181 Fritz Rudolf Künker GmbH & Co. KG Poststraße 22, 10178 Berlin-Mitte, im Kunsthaus Lempertz Wollankstraße 117, 13187 Berlin-Pankow Tel. +49 (0)30 247 248 91

MÜNCHEN

Fritz Rudolf Künker GmbH & Co. KG Maximiliansplatz 12a, 80333 München Tel. +49 (0) 89 242 16 990

KONSTANZ

Künker Konstanz, c/o Phaleristischer Verlag Michael Autengruber Schulthaißstraße 10, 78462 Konstanz

ZÜRICH MOSKAU

Künker Zürich, c/o Hess-Divo AG Löwenstraße 55, 8001 Zürich, Schweiz Künker Moskau, c/o Russian Coin Co. Ltd. 2/21 Makarenko St., 123001 Moskau, Russland

Association Internationale des Numismates Professionels (AINP) Verband der Deutschen Münzenhändler e. V.

2

TEL +49 (0)541 96 20 20, FAX +49 (0)541 96 20 222, SERVICE@KUENKER.DE, WWW.KUENKER.DE


Zeitplan/Timetable Auktion 169 Numismatische Bibliotheken Hanfried Bendig, Bremen, Bernard Poindessault, Paris, Teil 1 u. a.

Montag, 21. Juni 2010

10.00 Uhr - 13.00 Uhr Nr. 1 bis Nr. 799 Bibliophile Werke, Monographien: Allgemeine Numismatik, Antike, Neuzeit: Balkan - Deutschland 14.00 Uhr - 19.00 Uhr Nr. 800 bis Nr. 2149 Neuzeit: Deutschland, Übersee, Medaillen, Orden, Papiergeld, Geschichte allgemein, Festschriften, Zeitschriften und Reihen, Auktionskataloge, Bibliographien

Auktion 170 Münzen und Medaillen aus Mittelalter und Neuzeit

Dienstag, 22. Juni 2010

10.00 Uhr - 13.00 Uhr Nr. 2501 bis Nr. 3106 Europa: Albanien - Polen 14.00 Uhr - 19.00 Uhr Nr. 3107 bis Nr. 4113 Europa: Portugal - Ungarn, Übersee, Habsburgische Erblande, Deutschland: Aachen - Öttingen Mittwoch, 23. Juni 2010

Auktion 171 Geprägtes Gold aus drei Jahrtausenden

10.00 Uhr - 13.00 Uhr Nr. 4114 bis Nr. 4708 Deutschland: Oldenburg - Zellerfeld, Medaillen, Papiergeld, Prägewerkzeuge, Lots 14.00 Uhr - 18.30 Uhr Nr. 5001 bis Nr. 5870 Donnerstag, 24. Juni 2010

Deutsche Münzen ab 1871 Die Sammlung Prof. Nikolaus Otto u. a.

10.00 Uhr - 13.00 Uhr Nr. 6001 bis Nr. 6561

Auktion 172 Russische Münzen und Medaillen

Auktion 173 Orden und Ehrenzeichen aus verschiedenem Besitz

14.00 Uhr - 18.30 Uhr Nr. 7001 bis Nr. 7683 Freitag, 25. Juni 2010

10.00 Uhr - 13.00 Uhr Nr. 8001 bis Nr. 8608 Deutsche Staaten, Deutsches Reich, Weimarer Republik, Drittes Reich, BRD, Europa: Albanien - Portugal 14.00 Uhr - 16.00 Uhr Nr. 8609 bis Nr. 9026 Europa: Rumänien - Vatikan, Übersee, Ordensschnallen, Miniaturenschnallen und -kettchen, Sammlung Verleihungsurkunden 3


Was ist für Ihre schriftliche Auktionsteilnahme besonders wichtig? DEUTSCH

• Bitte senden Sie uns Ihre Aufträge möglichst frühzeitig zu. Wenn uns Ihr Auftrag erst kurz vor der Auktion erreicht, können sich bei der Bearbeitung Fehler einschleichen. Das beiliegende Formular erleichtert Ihnen die Abgabe eines schriftlichen Gebots. Gerne nehmen wir Ihre Gebote per Post, Fax oder Email entgegen. • Wenn Sie noch nicht bei uns gekauft haben, bitten wir Sie, uns als Referenz eine Münzhandlung anzugeben, mit der Sie bereits in Geschäftsverbindung stehen. • Wir gewährleisten die Echtheit aller verkauften Objekte auch über die gesetzliche Frist hinaus.

Sie möchten telefonisch an der Auktion teilnehmen? Die telefonische Teilnahme an der Auktion ist bei uns selbstverständlich möglich. Wir rufen Sie während der Auktion gerne an und helfen Ihnen, die gewünschten Stücke zu ersteigern. Aus organisatorischen Gründen bitten wir Sie, die folgenden Punkte zu beachten:

Ulrich Künker Leiter Kundenbetreuung

• Telefonisches Bieten ist nur bei Losen mit einer Taxe von mind. € 500,– möglich. • Bitte teilen Sie uns mindestens 48 Stunden vor der Auktion mit, zu welchen Stücken Sie angerufen werden möchten. • Bitte achten Sie darauf, dass Sie erreichbar sind, wenn Ihre Stücke versteigert werden. Der Zeitplan in diesem Katalog hilft Ihnen dabei, den Zeitpunkt der Versteigerung abzuschätzen. • Für den Fall, dass wir Sie nicht erreichen können, bieten wir in Ihrem Namen bis zur Höhe Ihres schriftlichen Gebotes, mindestens aber bis zur Höhe des Schätzpreises. • Bitte beachten Sie, dass telefonisches Bieten eine unsichere Variante der Auktionsteilnahme sein kann. Wir können keine Garantie für das Zustandekommen der telefonischen Verbindung übernehmen. Wenn Sie sicher gehen wollen, besuchen Sie bitte unsere Auktion persönlich oder geben Sie uns ein schriftliches Gebot.

Was passiert nach der Auktion? Barbara Westmeyer deutschsprachige Kundenbetreuung

Telefon: +49 (0)541 96 20 20 Fax: +49 (0)541 96 20 222 Gebührenfrei: 0800 58 36 537 E-Mail: service@kuenker.de Internet: www.kuenker.de Montag – Donnerstag 8.30–17.00 Uhr Freitag 8.00–15.30 Uhr

4

• Der Versand der Auktionsware startet sofort nach Beendigung der Auktion und dauert in der Regel 8 Tage. • Alle Kunden, die an unserer Auktion schriftlich teilgenommen haben, erhalten innerhalb von 2 Wochen nach der Auktion unsere Ergebnisliste gratis. • Alle Ergebnisse sind spätestens einen Tag nach Auktionsende auf unserer Internetseite verfügbar.

Sie möchten Ihre Münzen in unsere Auktion einliefern? Sollten Sie sich zum Verkauf Ihrer Münzen entschlossen haben, kommen Sie zu uns. Seit 1985 beweisen wir mit derzeit 4 Auktionsterminen und ca. 15 Katalogen pro Jahr unsere Kompetenz und Zuverlässigkeit. Wichtige Informationen für Sie im Überblick: • Ihre Münzen werden von unseren Experten nach neuestem numismatischem Standard bestimmt und in hochwertigen Farbkatalogen präsentiert. • Wir verfügen mit mehr als 10.000 Kunden über eine der besten Kundendateien weltweit. Im Durchschnitt verkaufen wir mehr als 95 % der Stücke einer Auktion, nicht selten erzielen wir dabei Rekordzuschläge. Für nicht verkaufte Objekte werden keine Gebühren erhoben. • Ab der Übergabe an uns sind Ihre Münzen mit dem doppelten Schätzwert versichert. Unsere Kundenbetreuung bespricht gerne mit Ihnen wie Ihre Stücke sicher zu uns gelangen können. • Ihre Einlieferung wird Ihnen sofort nach der Übernahme quittiert. Spätestens 5 Wochen vor der Auktion erhalten Sie eine Auflistung Ihrer Stücke inkl. Katalognummern und Schätzpreisen. • Unmittelbar nach der Auktion erhalten Sie die Ergebnisliste und können dann alle erzielten Preise feststellen. Den Auktionserlös erhalten Sie innerhalb von 45 Tagen nach der Auktion.

TEL +49 (0)541 96 20 20, FAX +49 (0)541 96 20 222, SERVICE@KUENKER.DE, WWW.KUENKER.DE


Important facts for a written participation in the auction • Please send us your instructions as early as possible. The likelihood of errors occurring increases if we receive your instructions only shortly before the auction. The enclosed form should make it simple for you to submit a written bid, you may send your bids by mail, fax or e-mail. • If you are a new customer who has not yet purchased from us, we do request references. Please name a coin dealer with whom you have already done business. • The genuineness of all objects sold is warranted beyond the statutory length of time.

ENGLISH

Do you wish to participate by telephone? You are welcome to participate in our auction by telephone. We are glad to call you during the auction and to assist you in bidding for your items. Please take notice of the following conditions: • Telephone bidding is accepted exclusively on lot numbers with estimates at 500 Euro or above. • Please inform us at least 48 hours in advance if you wish to register for telephone bidding, even for single lots. We do need 48 hours to schedule all incoming requests. • Please be available, when your lots will be sold. The time schedule in the catalogue will help you to estimate the approximate time when your items are going to be sold. • Should you not be available by phone, we will bid on your behalf up to your submitted written limit or at least up to the estimate of the lot for which you requested to be called. • Please be aware that telephone bidding is a risky way of participation in our auction. We do not assume liability should the telephone line be interrupted or not be achieved. We advise you to attend the auction in person or to send written bids.

Nadine Zuber English, Deutsch

What occurs after the auction? • The shipment of all auction goods starts immediately after the completion of the entire auction week and it usually takes 8 days to be completed. • All auction results are available on our website one day after the end of the auction week. • All clients who submitted bids for the auction will automatically receive the list of auction results free of charge within two weeks after the end of auction.

Marion Künker English, Deutsch

Do you wish to consign your coins to our auction? Should you decide to sell your coins, we are ready to assist you. Since 1985 we have earned our bona fides in conducting over 4 auctions and in publishing 15 catalogues per year. In the following you will find the most important information on consigning: • We guarantee the professional handling of your consignment following the latest numismatic level of expertise including its presentation in colour catalogues of outstanding quality. • We possess one of the best customer lists worldwide. On average we sell more than 95 % of all items in our auction, and it is not unusual for us to achieve record hammer prices for lots submitted. Unsold items incur no fees. • Once the coins are consigned they are covered by our insurance at double the estimate. Upon consultation with our customer service we try to advise you on the safest way of shipping for your coins. • Your delivery will be confirmed in writing immediately on receipt. At least five weeks before the auction, you will receive an exact list of your objects with the relevant catalogue numbers and descriptions. • Within a week of the end of auction, you will receive a list of auction results in order to see what prices were reached for each individual lot. As a consignor, you will receive the auction proceeds within 45 days after the end of auction.

Phone: +49 (0)541 96 20 20 Fax: +49 (0)541 96 20 222 E-Mail: service@kuenker.de Website: www.kuenker.com Monday – Thursday 8.30 AM – 5 PM Friday 8 AM – 3.30 PM

TEL +49 (0)541 96 20 20, FAX +49 (0)541 96 20 222, SERVICE@KUENKER.DE, WWW.KUENKER.DE

5


Votre participation par écrit – Les points essentiels

FRANCAIS

• Veuillez nous faire parvenir vos ordres le plus tôt possible. Si vos ordres nous parviennent juste avant la vente aux enchères, des erreurs risquent d’être commises lors de leur traitement. Le formulaire ci-joint vous aidera à rédiger facilement votre offre. Vous pouvez nous envoyer vos ordres par la poste, par fax ou par e-mail. • Si vous n’avez encore fait aucune acquisition chez nous, nous vous prions de nous indiquer une ou deux références d’autres maisons numismatiques où vous avez déjà acheté. • L’authenticité des pièces vendues est garantie même au-delà des délais légaux.

Vous voulez participer par téléphone? La participation par téléphone est bien sûr possible. Nous vous appelons volontiers pour vous aider à acquérir les pièces voulues. Pour des raisons d´organisation veuillez noter les points suivants:

Alexandra Elflein, M. A. Français, Deutsch, English, Italiano

• La participation par téléphone est possible seulement pour les lots estimé à plus de 500 Euros chacun. • Veuillez nous informer au moins 48 heures avant la vente de la liste des pièces pour lesquelles vous voudriez être appelé. • Veuillez prendre soin d´être joignable quand vos pièces seront mises en vente. L’ordre de vente dans ce catalogue vous aidera à estimer l´heure de la vente. • Dans le cas où nous ne parviendrions pas à vous joindre, nous enchérirons pour vous jusqu’au montant que vous nous indiquez par écrit, égal ou supérieur au prix d’estimation. • La participation par téléphone présente des risques, et nous déclinons toute responsabilité dans le cas où la communication téléphonique serait interrompue, ou bien ne pourrait être établie.

Ce qui se passe après la vente Kmar Chachoua Français, Deutsch, English, Arabic

• L´expédition des biens va commencer immédiatement après la fin de la vente complète, et prend généralement 8 jours. • Tous les clients qui ont participé à l’une de nos ventes aux enchères recevront gratuitement une liste de résultats dans les deux semaines qui suivent. • Les résultats seront disponibles sur notre site internet, au plus tard un jour après la fin de la vente.

Vous voulez confier vos monnaies pour nos ventes aux enchères? Tél. +49 (0)541 96 20 20 Facs. +49 (0)541 96 20 222 E-Mail: service@kuenker.de Site: www.kuenker.de Lundi à Jeudi de 8h30 à 17h00 Vendredi de 8h00 à 15h30

6

Contactez nous si vous envisagez de vendre vos pièces. Notre compétence et fiabilité est prouvée depuis 1985 par actuellement 4 ventes aux enchères et environ 15 catalogues par an. Le plus important pour vous est que: • Vos pièces seront décrites par notre équipe d’experts selon les standards numismatiques les plus récents, et elles seront présentées dans des catalogues de haute qualité en couleurs. • Nous avons un des meilleurs fichiers-clientèle du monde avec plus de 10.000 clients. Nous vendons en moyenne plus de 95% de la vente aux enchères, et obtenons souvent des prix records. Les monnaies invendues n’encourent aucun frais. • Notre service clientèle est disponible pour vous conseiller pour l’envoi de vos pièces, et dès leur réception vos pièces seront assurées pour le double de la valeur d´estimation. • Vous recevrez une liste détaillée des pièces fournies au moment de la prise en charge puis, au plus tard cinq semaines avant la vente aux enchères, vous recevrez leur liste exacte avec les numéros de catalogue correspondants. • Immédiatement après la vente aux enchères, vous recevrez la liste des résultats et pourrez prendre connaissance des prix obtenus. Vous recevrez le produit de la vente dans les 45 jours après les enchères.

TEL +49 (0)541 96 20 20, FAX +49 (0)541 96 20 222, SERVICE@KUENKER.DE, WWW.KUENKER.DE


I punti piú importanti per la Sua partecipazione per iscritto • La preghiamo di farci pervenire i Suoi ordini al piú presto possibile. Se i Suoi ordini ci arrivano poco prima dell´inizio dell´asta possono verificarsi errori. Il formulario allegato Le faciliterá l´invio dei Suoi ordini per iscritto. Ci puó far pervenire i Suoi ordini per posta, per fax o per email. • Se non ha mai acquistato presso di noi, La preghiamo di volerci indicare a titolo di referenza il nome di uno o due commercianti numismatici presso i quali è giá cliente. • L’autenticità di tutti gli oggetti venduti viene garantita anche oltre i termini previsti dalla legge.

ITALIANO

Desidera partecipare telefonicamente alla nostra asta? La partecipazione telefonica è naturalmente da noi possibile. La chiameremo durante l´asta e La assisteremo volentieri per ottenere l´aggiudicazione dei pezzi desiderati. Per motivi di organizzazione La preghiamo di voler tenere conto dei seguenti punti: • La partecipazione telefonica è possibile solo per lotti stimati con almeno 500,– € l´uno. • La preghiamo di volerci comunicare almeno 48 ore prima dell´inizio dell´asta per quali pezzi desidera essere chiamato. • La preghiamo di aver cura di essere raggiungibile telefonicamente al momento in cui vengono messi all´asta i pezzi che Le interessano. Lo schema orario in catalogo La aiuterá a stimare a che ora verranno messi all´asta i pezzi che Le interessano. • Nel caso in cui non riuscissimo a contattarLa telefonicamente, provvederemo ad offrire a Suo nome fine all´importo massimo indicatoci per iscritto, in ogni caso offriremo a Suo nome come minimo il prezzo di stima. • La partecipazione telefonica è un modo incerto di partecipare alle aste. Non assumiamo nessuna responsabilità se per esempio la linea telefonica è occupata o interrotta o se Lei non sará raggiungibile per altri motivi.

Sonia Russo, M. A. Italiano, Deutsch, English, Español

Cosa succede dopo l´asta? • La spedizione del materiale d´asta comincia subito dopo la fine dell´intera asta e termina normalmente entro 8 giorni. • Tutti i clienti che hanno partecipato all´asta ricevono entro 2 settimane dopo l´asta la lista dei prezzi di realizzo. • I prezzi di realizzo sono visionabili sul nostro sito internet al piú tardi un giorno dopo la fine dell´intera asta.

Vuole consegnarci le Sue monete per una nostra asta? Ci contatti se ha deciso di vendere le Sue monete. Dal 1985 la nostra competenza ed affidabilità è dimostrata da attualmente 4 aste e circa 15 cataloghi all´anno. Quali sono i punti di maggior importanza per Lei: • Le Sue monete vengono valutate dal nostro staff di esperti secondo i piú attuali standard numismatici e vengono presentati in cataloghi di alto valore a colori. • Con piú di 10.000 clienti disponiamo di una delle migliori banca dati clienti del mondo. In media vendiamo oltre il 95% del materiale d´asta realizzando spesso prezzi da record. Per i pezzi invenduti non ci sono nessune spese da pagare. • Dal momento della consegna le Sue monete sono assicurate per il doppio del valore di stima. Il nostro servizio clientela Le consiglierá volentieri come farci avere le Sue monete nel modo piú sicuro. • La Sua consegna Le verrá immediatamente quietanzata al momento della resa dei pezzi. Al piú tardi 5 settimane prima dell´asta riceverá una lista dettagliata dei Suoi pezzi con i numeri di catalogo ed i prezzi di stima. • Subito dopo l´asta riceverá la lista con i risultati d´asta dalla quale potrá subito controllare i prezzi realizzati. Riceverá l´importo di realizzo entro 45 giorni dopo la fine dell´asta.

Cristina Welzel Italiano, Deutsch, English, Français

Tel.: +49 (0)541 96 20 20 Fax: +49 (0)541 96 20 222 E-Mail: service@kuenker.de Internet: www.kuenker.de Lunedì a giovedì dalle 8.30 alle 17.00 Venerdì dalle 8.00 alle 15.30

TEL +49 (0)541 96 20 20, FAX +49 (0)541 96 20 222, SERVICE@KUENKER.DE, WWW.KUENKER.DE

7


Что особенно важно при заочном участии на аукционе?

RUSSKIJ

• Тщательно изучите наш каталог и запишите те лоты, которые Вас заинтересовали. Заполните приложенный формуляр и отправьте нам его заранее по почте, факсу или электронной почте. Мы обращаем внимание на то, что если Ваши ставки придут перед самым началом аукциона либо во время аукциона, то существует вероятность допуска ошибки в процессе обработки заказа. • Если Вы впервые принимаете участие в нашем аукционе, то мы рекомендуем Вам указать Ваш референц – аукционные дома, с которыми Вы уже сотрудничали. Или свяжитесь с нами по телефону +49(0)541 9620268. • Подлинность купленных на нашем аукционе лотов гарантируется нами на протяжении неограниченного времени.

Вы хотели бы принять участие на аукционе по телефону? У нас, конечно, есть возможность организовать Ваше телефонное участие на торгах, но мы бы хотели обратить внимание на следующие пункты:

Anastasija Koepsell Russkij, Deutsch

• Участие в телефонных торгах возможно только для лотов со стартовой ценой свыше 500 евро. • Для участия в торгах по телефону просим Вас связаться с нами не позднее 48 часов до начала аукциона. • Мы хотим подчеркнуть, что телефонное участие на аукционе – не самый безопасный способ: в случае плохой связи, недоступности клиента во время торгов либо других технических проблем мы не несем ответственности.

Что происходит после окончания аукциона?

Dzmitry Nikulin Russkij, Deutsch, English

• Результаты аукционов доступны на нашем сайте на следующий день после окончания торгов. • Вы можете лично забрать приобретенные лоты. По окончании торгов мы готовим все необходимые документы на вывоз из Евросоюза. • Почтовые отправки в Россию ( Беларусь, Украину ) осуществляются по предварительной договоренности. Для связи с нами звоните по телефону +49 (0)541 9620268.

Вы хотели бы выставить Ваши предметы на аукцион? Более 160-ти успешно проведенных аукционов, тысячи участников, 4 аукциона в год - эти и другие преимущества, которые говорят в пользу выставления Ваших коллекций на аукцион Кюнкер: Телефон: +49 (0)541 96 20 20 Факс: +49 (0)541 96 20 222 E-Mail: service@kuenker.de интернет: www.kuenker.de понедельник – четверг 8.30–17.00 пятница 8–15.30

8

• Ваши монеты будут оценены нашими экспертами по самым новым нумизматическим стандартам и представлены в высококачественном цветном каталоге. • Более 10000 клиентов со всего мира оказывают нам свое доверие. В среднем мы продаем более 95% всех выставляемых предметов, при этом зачастую достигая рекордных сумм. • Все Ваши предметы, после передачи их нам, хранятся у нас до начала аукциона застрахованными. Не позднее 5-ти недель до начала аукциона Вы получите по почте подробное описание Ваших лотов с указаннами номерами в каталоге, а также их оценочной стоимостью. • Результаты аукционов также будут высланы Вам по почте после окончания торгов. В течение 45 дней после аукциона Вам будет выплачено Ваше вознаграждение.

TEL +49 (0)541 96 20 20, FAX +49 (0)541 96 20 222, SERVICE@KUENKER.DE, WWW.KUENKER.DE


INHALT AUKTION 173 ORDEN UND EHRENZEICHEN Deutsche Staaten Anhalt Baden Bayern Braunschweig Hannover Hessen Hohenlohe Hohenzollern Lippe, Schaumburg-Lippe Mecklenburg-Schwerin Nassau Oldenburg Preußen Reuß Sachsen, sächsische Herzogtümer Schwarzburg-Rudolstadt Waldeck Württemberg Deutsches Reich 1871-1918 Weimarer Republik 1919-1933 Drittes Reich 1933-1945 Bundesrepublik Deutschland seit 1949 Feuerwehr Rotes Kreuz Eisenbahn Ordenschnallen Miniaturenschnallen und -kettchen Konvolute Unbekannte Auszeichnung Albanien Belgien Bulgarien Fürstentum (1878-1908) Zarentum (1908-1944) Bulgarische Volksfrontregierung (1944-1946) Abzeichen Dänemark Finnland Frankreich Zweites Kaiserreich (1852-1870) Dritte bis fünfte Republik Griechenland Vereinigtes Königreich von Großbritannien und Nordirland Internationale und Gesellschaftsorden Island Königreich (1922-1944)

8001 8001 8001 8004 8008

Nr. -

8027 8030 8032 8034 8037 8042 8045

-

8048

-

8094

-

8106 8108 8116

-

8125 8141

-

8146

-

8149 8153 8156

-

8162 8176 8176 8251

-

8419 8424 8453 8492 8505 8505 8507

-

8423 8452 8491 8504 8511 8506 8511 8512

8513 8529 8551 8551

-

8528 8550 8552 8552

9026 8115 8003 8007 8025 8026 8029 8031 8033 8036 8041 8044 8046 8047 8092 8093 8104 8105 8107 8115 8123 8124 8140 8159 8145 8147 8148 8152 8155 8159 8160 8161 8175 8452 8250 8418

Seite 194 38 13 15 16 16 19 19 19 20 20 20 21 21 22 22 23 23 23 32 32 32 35 35 36 36 38 38 39 39 40 42 42 47 44 44 45 45 46 46 47 47 47 47 48 49 50 106 50 67 68 102 13 13

102 104 107 112 114

-

114

-

115 118

-

103 106 112 114 115 114 115 115 117 122 122 122

9


Italien Königreich Beider Sizilien Königliche Familie Bourbon - Beide Sizilien Königreich (1861-1946) Lettland Litauen Malteserorden Montenegro Niederlande Norwegen Österreich Kaiserreich (1804-1918) Erste Republik (1918-1934) Zweite Republik (seit 1949) Polen Konvolut von fünf verschiedenen polnischen Orden, Ehren- und Abzeichen Russisches Königreich (1831-1917) Erste Republik (1918-1939) Volksrepublik (1944-1989) Dritte Republik (seit 1989) Portugal Königreich (bis 1910) Republik (seit 1910) Rumänien Königreich (1881-1947) Sozialistische Republik (1965-1989) Russland Zarentum (bis 1917) Zarentum-Abzeichen Sowjetunion Literatur Schweden Miniaturen Serbien und Jugoslawien Fürstentum und Königreich (1817/1867-1918) Jugoslawien, Königreich (1918-1941/1945) Jugoslawien, Föderalistische Volksrepublik (1945-1963) Spanien Regierung Isabellas II. (1833/1843-1868) Fünftes Königreich (1874-1931) Spanischer Staat Regierung von Francisco Franco (1936-1975) Inoffizielle Auszeichnung Tschechoslowakei Erste Republik (1918-1939/46) Volksrepublik (1946-1960) Ungarn Königreich (1922-1944) Bürgerliche Republik (1944-1949) Exil (1949-1989) Volksrepublik (1949-1989) 10

8598

Nr. - 8558 8553 8554 - 8558 - 8560 - 8562 - 8566 - 8568 - 8571 - 8575 - 8597 - 8594 - 8596 8597 - 8606

Seite 124 123 123 123 124 124 124 125 125 126 126 127 127 130 127 129 129 130 130 130 131

8599 8601 8604

-

8607

-

8609 8609 8626 8646 8646 8671 8679

-

8683 8716 8737

-

8598 8600 8603 8605 8606 8608 8607 8608 8645 8625 8645 8682 8670 8678 8681 8682 8736 8736 8761

130 130 131 131 131 132 132 132 141 137 141 149 147 148 149 149 157 157 162

8737 8756

-

8755 8759

8760 8762

-

8763

-

8761 8768 8762 8764

8765

-

8769 8769 8775 8777 8777

-

8782

-

8553

8555 8559 8561 8563 8567 8569 8572 8576 8576 8595

8767 8768 8776 8774 8776 8787 8779 8780 8781 8787

123

130

-

134 134 137 142 142

-

149 155 158

-

158

-

163

-

163

-

164 164

-

165 165

-

161 162 162 164 163 163

164 164 165 165 165 166 166 166 166 166


Kirchenstaat, heiliger Stuhl und Vatikan Orden Ritterorden vom heiligen Grab von Jerusalem Vatikan-Ehrenzeichen Ägypten Äthiopien Chile China Kaiserreich (bis 1912) Volksrepublik (seit 1949) Ecuador Japan Kanada Korea Kuba Mongolei Union Myanmar (Burma) Thailand Türkei Tunesien Vereinigte Staaten von Amerika (U. S. A.) Ordensschnallen-International Miniaturschnallen und –KettchenInternational Konvolute-International Sammlung Verleihungsurkunden und Dokumente

8788

Nr. - 8798 8788

8789 8797 8799

-

8803

-

8806 8815

-

8820 8822

-

8827 8837

-

8846 8852

-

8796 8798 8800 8801 8802 8804 8803 8804 8805 8814 8818 8819 8821 8825 8826 8836 8844 8845 8851 8853

8854 8858

-

8857 8862

8863

-

9026

166

Seite 169 166

167

-

170

-

174 175

-

176 177

-

169 169 169 169 169 170 170 170 170 171 172 172 173 173 173 175 176 176 177 178 178 179

179

-

194

___________________________

Abbildungen sind, sofern nicht anders angegeben, auf 3/4 Größe verkleinert. Erhaltungsangaben und das Literaturverzeichnis finden Sie am Ende des Kataloges.

Hinweis: Am Donnerstag, den 24. Juni 2010 findet nach Ende der Versteigerung ein Vortrag von Herrn Michael Autengruber zum Thema " Anmerkungen zum Sammeln von Orden und Ehrenzeichen am Beispiel bulgarischer Auszeichnungen" statt. Vor dem Hintergrund und anhand von Beispielen der in der 173. Auktion angebotenen, umfangreichen Sammlung von bulgarischen Orden und Ehrenzeichen wird grundsätzlich in das Sammeln von Orden und Ehrenzeichen eingeführt werden, besonders auch im Hinblick auf Gemeinsamkeiten wie auch Unterschiede zur Numismatik. Der Vortrag richtet sich somit nicht nur an die Sammler von Orden und Ehrenzeichen, sondern auch und gerade an Numismatiker, Sammler wie Händler, und an alle grundsätzlich an diesem Thema Interessierten.

11


5GJTIGGJTVGT-WPFG   YKTHTGWGPWPUUGJT+JPGPYKGFGT\WOIGYQJPVGP6GTOKPGKPGPWOHCPITGKEJGP-CVCNQIOKVÒDGT .QUGP 1TFGP 'JTGP\GKEJGP WPF 7TMWPFGP CWU &GWVUEJNCPF 'WTQRC WPF FGT ICP\GP 9GNV CWU   XGTUEJKGFGPGO$GUKV\XQTNGIGP\WMÌPPGP   <WP·EJUVIGNCPIGPÒDGTFGWVUEJG1TFGPWPF'JTGP\GKEJGPXQOPGWP\GJPVGP,CJTJWPFGTVDKUKPFKG )GIGPYCTV \WO #WHTWH 5EJYGTRWPMV FGT GWTQR·KUEJGP #WU\GKEJPWPIGP DKNFGV GKPG WOHCPITGKEJG   5COONWPI 1TFGP WPF 'JTGP\GKEJGP FGU (ÒTUVGPVWOU WPF <CTGPTGKEJU $WNICTKGP OKV ÒDGT    'KP\GNRQUKVKQPGP FCTWPVGT GKPG ICP\G 4GKJG CP 5GNVGPJGKVGP WPF 4CTKV·VGP &KG $GUEJTGKDWPI FKGUGT   5COONWPIGTHQNIVGWPVGT8GTYGPFWPIFGTIGUCOVGPTGNGXCPVGP(CEJNKVGTCVWT#WHITWPFYGKVGTGTGKIGPGT KPVGPUKXGT(QTUEJWPIGPMÌPPGPJKGTOGJTGTGPGWG'TMGPPVPKUUG\WOGTUVGP/CNXGTÌHHGPVNKEJVYGTFGP  9GKVGTG 5EJYGTRWPMVG DKNFGP 5COONWPIGP F·PKUEJGT TWO·PKUEJGT WPF TWUUKUEJGT 1TFGP 'JTGP WPF   #D\GKEJGPOKVLGYGKNUEC.QVUIGHQNIVXQPGKPGT5COONWPIUEJYGFKUEJGT#WU\GKEJPWPIGPOKVÒDGT  2QUKVKQPGP #DGT CWEJ $GNIKGP (TCPMTGKEJ )TQ­DTKVCPPKGP ¤UVGTTGKEJ 2QNGP 5GTDKGP WPF   ,WIQUNCYKGP 5RCPKGP FKG 6UEJGEJQUNQYCMGK 7PICTP WPF FGT *GKNKIG 5VWJN 8CVKMCP  UKPF W C OKV   LGYGKNUOGJTGTGP2QUKVKQPGPXGTVTGVGPIGHQNIVXQPGKPGT4GKJGÒDGTUGGKUEJGT#WU\GKEJPWPIGP   &GP #DUEJNW­ DKNFGV GKPG 5COONWPI XQP ÒDGT  .QVU FGWVUEJGT WPF GWTQR·KUEJGT 8GTNGKJWPIU   WTMWPFGPXQPVGKNYGKUGDGFGWVGPFGP$GNKGJGPGPWPFOKVVGKNUDGFGWVGPFGP#WVQITCRJGP   &GT -CVCNQI YWTFG YKGFGT WPVGT YKUUGPUEJCHVNKEJGP )GUKEJVURWPMVGP GTUVGNNV YKG FKG \CJNTGKEJGP   #POGTMWPIGP WPVGTJCND FGT GKIGPVNKEJGP $GUEJTGKDWPI FGU LGYGKNKIGP .QVU DGNGIGP +P FKGUGO   <WUCOOGPJCPI FCPMG KEJ DGUQPFGTU *GTTP 2TQH &T &T ) #PFTGCU 6COOCPP $CUGN  CWH FGUUGP   WOHCPITGKEJG(QTUEJWPIUCTDGKVGPYKTYKGFGTQHV\WTÒEMITGKHGPFWTHVGP   #P FKGUGT 5VGNNG OÌEJVG YKT PQEJ CWH GKPGP 8QTVTCI CO 8QTCDGPF FGT #WMVKQP OKV FGO 6KVGN   ō#POGTMWPIGP \WO 5COOGNP XQP 1TFGP WPF 'JTGP\GKEJGP CO $GKURKGN DWNICTKUEJGT    #WU\GKEJPWPIGPŋ JKPYGKUGP &GT 7PVGT\GKEJPGPFG YKTF CPJCPF XQP $GKURKGNGP CWU FGT JKGT   CPIGDQVGPGP5COONWPIITWPFU·V\NKEJKPFCU5COOGNPXQP1TFGPWPF'JTGP\GKEJGPGKPHÒJTGPDGUQPFGTU CWEJ KO *KPDNKEM CWH )GOGKPUCOMGKVGP WPF 7PVGTUEJKGFG \WT 0WOKUOCVKM &GT 8QTVTCI TKEJVGV UKEJ   UQOKV PKEJV PWT CP FKG 5COONGT XQP 1TFGP WPF 'JTGP\GKEJGP UQPFGTP CWEJ WPF IGTCFG CP   0WOKUOCVKMGT5COONGTYKG*·PFNGTWPFCPCNNGITWPFU·V\NKEJCPFKGUGO6JGOC+PVGTGUUKGTVGP   9KTYÒPUEJGP+JPGPUGJTIGGJTVGT-WPFGXKGN(TGWFGDGKO5VWFKWOFKGUGU-CVCNQIGUWPFYKTYÒTFGP WPUUGJTHTGWGPYGPPFKGJKGTCPIGDQVGPGP1DLGMVG+JT+PVGTGUUGHKPFGPYÒTFGP   /KEJCGN#WVGPITWDGT     #PQVGVQQWTPQPIGTOCPURGCMKPIENKGPVU  +H[QWYQWNFNKMGVQWUGCVTCPUNCVKQPOCEJKPGHQTVJGECVCNQIWGVGZVGURNGCUGTGHGTVQVJGYQTFXGTUKQP RQUVGFQPYYYMWGPMGTEQO. 

12


DEUTSCHE STAATEN

14&'070&'*4'0<'+%*'0

8001

&'765%*'56##6'0 #0*#.6+5%*' (ª456'06ª/'4 )'/'+05#/ $+5   70& #0*#.6   *'4<1)67/   

*GT\QINKEJ #PJCNVKUEJGT *CWUQTFGP #NDTGEJV FGU $·TGP -QOOCPFGWT D\Y -QOVWT CD     <GKEJGP$TQP\G  XGTIQNFGVI QJPG$CPFTKPI OKVGTI·P\VGO$CPFTKPIKP5KNDGTXGTIQNFGVCO UR·VGTGP*CNUDCPF)-1'- ++



<YGKHGNUHTGKGU\GKVIGPÌUUKUEJGU1TKIKPKCNGZGORNCT5EJCTHGPDGTIUEJTGKDV KP5$5 JKGT\Wō&CU1TFGPU\GKEJGP DGUVGJVKPFGT4GIGNCWUXGTIQNFGVGT$TQP\Gŋ7PFYGKVGTō'UYWTFGPKPGVYC-QOOCPFGWTD\Y-QOVWT\GKEJGP XGTNKGJGP9GIGPFGT9KGFGTXGTNGKJWPITGOKVVKGTVGT1TFGPU\GKEJGPKUVCWEJJKGTXQPGKPGTFGWVNKEJIGTKPIGTGP<CJN JGTIGUVGNNVGT5VÒEMGCWU\WIGJGPŋ  )GUVKHVGVCO0QXGODGTXQPFGP*GT\ÌIGP*GKPTKEJXQP#PJCNV-ÌVJGP#NGZCPFGT%CTNXQP#PJCNV$GTP DWTIWPF.GQRQNF +8 (TKGFTKEJXQP#PJCNV&GUUCWCNUIGOGKPUCOGT*CWUQTFGPKPFTGK-NCUUGPOKVGKPGTCHHKNK KGTVGP \YGKUVWHKIGP 8GTFKGPUVOGFCKNNG GTHWJT GT 'TYGKVGTWPIGP   WPF  9GKVGTG PFGTWPIGP WPF   *KP\WHÒIWPIGPYWTFGPWPFXQTIGPQOOGPUQFC­FGT1TFGP CWUHQNIGPFGP-NCUUGPDGUVCPF)TQ­MTGW\ CNU*ÌJGTUVWHWPIOKV$TKNNCPVGP 2TKP\GUUKPPGP1TFGP-QOVWTWPF  -NCUUG 4KVVGT  WPF  -NCUUG WPF FKG )QNFGPG WPF 5KNDGTPG 8GTFKGPUVOGFCKNNG YQDGK LGFG -NCUUG OKV CNU   *ÌJGTUVWHWPI QFGTQJPG-TQPGXGTNKGJGPYGTFGPMQPPVG5·OVNKEJG-NCUUGPMQPPVGPCWEJOKV5EJYGTVGTPXGTNKGJGP YGTFGP 5GKV FGO 7PVGTICPI FGT /QPCTEJKG KO 0QXGODGT  YKTF FGT 1TFGP KP FGT (COKNKG FGT 2TKP\GP XQP   #PJCNVCNU*CWUQTFGPYGKVGTIGVTCIGP

8002

8003

(ª456'067/ $+5 70&*'4<1)67/  #0*#.6-¤6*'0 

1TFGPFGU8GTFKGPUVGU&GMQTCVKQPFGT-NCUUG4GMQPUVTWMVKQPCWUFGPGT,CJTGP5KNDGTXGT IQNFGVWPFGOCKNNKGTV ++



&CU'ZGORNCTYWTFGKPFGPGT,CJTGPPCEJFGT$GUEJTGKDWPIFGT.KUVG0TFGT(KTOC4QDGTV$CNN0CEJHKP $GTNKP XQO 1MVQDGT  \KVKGTV XQP 5EJCTHGPDGTI KP 5$ 5  OKV XGTVCWUEJVGP (CTDGP FGT /GFCKNNQPU CPIGHGT   VKIV&GPPQEJGKPJGTXQTTCIGPFGU'TUCV\GZGORNCTHÒTGKPKO1TKIKPCNPKEJV\WDGUEJCHHGPFGU5VÒEM



8GTFKGPUVQTFGP HÒT 9KUUGPUEJCHV WPF -WPUV  /QFGNN GKPMNCUUKI OKV <CEMGP CO 4CPF      #PHGTVKIWPICWUFGPGT,CJTGP5KNDGT  XGTIQNFGVCO$CPF ++



5GJT UEJÌPGU 'TUCV\GZGORNCT CWU FGP GT ,CJTGP FKGUGT KO 1TKIKPCN PKEJV J·WHKIGP#WU\GKEJPWPI5EJCTHGPDGTI UEJTGKDV KP 5$ 5   JKGT\W ō&KG #WU\GKEJPWPI DGUVGJV CWU GKPGT JQEJQXCNGP /GFCKNNG CWU IQNFRNCVVKGTVGT D\Y   XGTIQNFGVGT $TQP\Gŋ 7PF YGKVGT 5   ō+PUIGUCOV YWTFGP GVYC  1TFGPU\GKEJGP XGTNKGJGP 7PF    1TFGPUKPJCDGTUKPFPCOGPVNKEJDGMCPPVŋ

13


DEUTSCHE STAATEN

8004 1:1

14


DEUTSCHE STAATEN /#4-)4#(5%*#(6 $+5 -74(ª456'067/  70&  )4155*'4<1)67/  $#&'0 

)TQ­JGT\QINKEJGT *CWUQTFGP FGT 6TGWG  /QFGNN UGKV   1TFGPUUGV DGUVGJGPF CWU -NGKPQF   #WUHÒJTWPIXQPECDKU OKVIQNFHCTDGPGO8QTFGTUGKVGPOGFCKNNQP )QNFVNYHGKPUVITCXKGTV \KUGNKGTVWPFRQNKGTVGOCKNNKGTVICWHFGT4ÒEMUGKVGFGUQDGTGP-TGW\CTOUMCWOUKEJVDCTG'OCKN NGTGRCTCVWTQJPG5EJWNVGTDCPFWPF$TWUVUVGTP#WUHÒJTWPIXQPECDKU OKVIQNFHCTDGPGO PKEJV GOCKNNKGTVGO /GFCKNNQPJKPVGTITWPF  5KNDGT #WHNCIGP )QNF VNY ITCXKGTV \KUGNKGTV WPF RQNKGTV   GOCKNNKGTVI#WHNCIGPOKV0KGVGPDGHGUVKIVCP0CFGNKOQTKIKPCNGP8GTNGKJWPIUGVWKOKVGVYCU XGTDNCUUVGOIQNFHCTDGPGO/QPQITCOO)TQ­JGT\QI(TKGFTKEJU+KOQTKIKPCNGPCNVGPDNCWGPªDGTMCTVQP OKV<GVVGNOKVIGFTWEMVGT#WHUEJTKHV*CWUQTFGPF6TGWG)-1'-  5VÒEM4++  0CEJ-NGPCW KP)-5HH KUVFCU-NGKPQFFGT(KTOC.WFYKI2CCT\W\WUEJTGKDGPFKG\WOGTUVGP/CNCNU )QNFCTDGKVGT IGPCPPV XQP  DKU  ITQ­JGT\QINKEJ DCFKUEJGT *QHLWYGNKGT YCT &GT $TWUVUVGTP UVGJV KP FGT   #PHGTVKIWPIUVTCFKVKQPXQP,QUGRJ<WDGTFGTXQPDKUCNU*QHLWYGNKGTHKTOKGTVKUVLGFQEJPKEJVUKIPKGTV'U JCPFGNVUKEJUQOKVYQJNGDGPHCNNUWOGKPG#PHGTVKIWPIFGT9GTMUVCVVXQP.WFYKI2CCT  &GT 1TFGPUUGV UVCOOV CWU 5EJYGFGP XQP GKPGO UEJYGFKUEJGP +PJCDGT FGU *QEJCFGNU FGT CWEJ 6T·IGT FGT -GVVG   \WO*CWUQTFGPFGT6TGWGWPFUR·VGTFGT-GVVG\WO1TFGP$GTVJQNFU+YCT  #WU #PNC­ FGT 8GTO·JNWPI FGU UEJYGFKUEJGP 6JTQPHQNIGTU 2TKP\ )WUVCX #FQNH XQP 5EJYGFGP   FGU   UR·VGTGP-ÌPKIU)WUVCX8 XQPDKU OKV2TKP\GUUKP8KMVQTKCXQP$CFGP  6QEJVGTXQP)TQ­ JGT\QI(TKGFTKEJ+XQP$CFGP  WPF)TQ­JGT\QIKP.WKUG  CO5GRVGODGTKP-CTNU TWJG GTJKGNVGP FKG UEJYGFKUEJGP 2TKP\GP )WUVCX #FQNH 1UECT *GT\QI XQP )QVNCPF CD  )TCH XQP 9KUDQTI      %CTN *GT\QI XQP 8·UVGTIÌVNCPF   WPF 'WIGP *GT\QI XQP 0·TMG    UQYKG FGT   UEJYGFKUEJG#W­GPOKPKUVGT%CTN(TGKJGTT*QEJUEJKNF  FGP1TFGP  &GTGKPMNCUUKIG*CWUQTFGPYWTFGCO,WPKFWTEJ/CTMITCH-CTN+++9KNJGNOXQP$CFGP&WTNCEJIGUVKHVGV  YWTFG FGT 1TFGPUUVGTP IGUEJCHHGP  YWTFG FGT 1TFGP XQO -WTHÒTUVGPVWO ÒDGTPQOOGP \WP·EJUV   \YGKMNCUUKI )TQ­MTGW\ WPF -QOOCPFGWT   XQO )TQ­JGT\QIVWO ÒDGTPQOOGP CD  HQTOCN FTGKMNCUUKI  

4KVVGTMTGW\ FCU PKG CWUIGIGDGP YWTFG  CD  YKGFGT GKPMNCUUKI  YWTFG FCU 2TKP\GUUKPGPMTGW\ IGUVKHVGV   5GKVFGO'PFGFGU)TQ­JGT\QIVWOUGZKUVKGTVGTCNU*CWUQTFGPYGKVGT 8IN#FNGT.CTU&KG1TFGPUUVKHVWPIGPFGT /CMTITCHGPXQP$CFGP1HHGPDCEJ5HH 

8005



8006

)TQ­JGT\QINKEJGT1TFGPXQO<·JTKPIGT.ÌYGP/QFGNN EC #WUHÒJTWPI XQP,Q UGRJ <WDGT  EC   4KVVGTMTGW\ D\Y 4KVVGTMTGW\  -NCUUG CD   )QNFVNYGOCKNNKGTV HGKPUVG'OCKNNGOCNGTGK)NCUUVGKPG$CPFTKPIGTI·P\VCOCNVGPIGVTCIGPGP$CPF)-1'-  4++



#WHITWPF FGT -QODKPCVKQP FKGUGT /GFCKNNQP/CNGTGK XIN )- 5 ++  OKV FGT HNCEJGP JQTK\QPVCN CPIGDTCEJVGP   ¤UGN·­VUKEJFKGUGU'ZGORNCTGKPFGWVKICWUFGT9GTMUVCVVXQP,QUGRJ<WDGTKFGPVKHK\KGTGPFGTNCWV-NGPCWXQP DKUEC+PUKIPKGPFGU1TFGPUXQO<·JTKPIGT.ÌYGPJGTIGUVGNNVJCV  &GT\WP·EJUVFTGKMNCUUKIG )TQ­MTGW\-QOOCPFGWTWPF4KVVGT 1TFGPYWTFGCO,CPWCTXQP'TDITQ­JGT \QI %CTN PCOGPU )TQ­JGT\QI %CTN (TKGFTKEJ XQP $CFGP IGUVKHVGV 'TYGKVGTWPIGP 'TI·P\WPIGP WPF 8GT·PFGTWPIGP   GTHQNIVGPWPF/KVFGO7PVGTICPIFGT/QPCT EJKGKO0QXGODGTGTNQUEJCWEJFGT1TFGP



8GTFKGPUVOGFCKNNGHÒT8QTIGUGV\VGWPFMNGKPGTG8GTFKGPUVGD\Y%KXKNXGTFKGPUVOGFCKNNG   D\Y)TQ­JGT\QINKEJG8GTFKGPUVOGFCKNNG  /QFGNN OKVFGO2QTVTCKV)TQ­JGT\QI.GQ RQNFU 5KNDGTPG8GTFKGPUVOGFCKNNG#WUHÒJTWPIOKV8QTFGTUGKVGP5VGORGN N·PIGTG7O UEJTKHV WPF4ÒEMUGKVGPUVGORGN 2WPMVGFGUªCO4CPF 5KNDGTCWHFGO*CNUCDUEJPKVV5VGORGNUEJPGK FGTUKIPCVWTō-#%*'.ŋQJPG$CPF1'-9< ++



.CWV8QNNG 81..5 YWTFGFKGUG/GFCKNNGOCNKPFGP,CJTGPXQPDKUXGTNKGJGP5EJQPWPVGT /CTMITCH -CTN (TKGFTKEJ TGI   UKPF 8GTFKGPUVOGFCKNNGP QJPG 8QTJCPFGPUGKP XQP FKGUDG\ÒINKEJGP 5VCVW   VGP XGTNKGJGP YQTFGP 7O FKG 9GPFG \WO  ,CJTJWPFGTV DKNFGVG UKEJ GKPG &TGKUVWHKIMGKV ITQ­G WPF MNGKPG IQN   FGPGUKNDGTPG FGT#WU\GKEJPWPIJGTCWU#D)TQ­JGT\QI-CTN TGI GTJKGNVGPFKG/GFCKNNGPLGYGKNUFCU 2QTVTCKVFGU*GTTUEJGTU'TUVCO5GRVGODGTGTNKG­)TQ­JGT\QI(TKGFTKEJ+FKG5VCVWVGPHÒTFKG8GTNGKJWPI FGT )TQ­JGT\QINKEJGP 8GTFKGPUV WPF 4GVVWPIUOGFCKNNGP FKG KO 4GIKGTWPIUDNCVV 0T .8+ XQP  5GKVG    XGTÌHHGPVNKEJVYWTFGP#DFGOINGKEJGP,CJTMQPPVGPFKG/GFCKNNGPHÒT-TKGIUXGTFKGPUVCWEJCO$CPFFGU/KNV·TK UEJGP %CTN (TKGFTKEJ8GTFKGPUV1TFGPU D\Y FGT /GFCKNNG XGTNKGJGP YGTFGP /KV FGT #DUEJCHHWPI FGT /QPCTEJKG   KO0QXGODGTGPFGVGCWEJFKG8GTNGKJWPIFGT8GTFKGPUVOGFCKNNGP

15


DEUTSCHE STAATEN

8007

8008



8009

8GTFKGPUVOGFCKNNGHÒT8QTIGUGV\VGWPFMNGKPGTG8GTFKGPUVGD\Y%KXKNXGTFKGPUVOGFCKNNG   D\Y )TQ­JGT\QINKEJG 8GTFKGPUVOGFCKNNG    /QFGNN OKV FGO LÒPIGTGP 2QTVTCKV )TQ­   JGT\QI(TKGFTKEJ+ #WUHÒJTWPI OKVFGTGVYCUN·PIGTGP7OUEJTKHVCWHFGT4ÒEMUGKVG  5KNDGTPG8GTFKGPUVOGFCKNNG5KNDGTKO*CNUCDUEJPKVV5VGORGNUEJPGKFGTUKIPCVWTō.-ŋ4CPF MGTDGQJPG$CPF1'-9< 4++



.CWV8QNNG 81..5 YWTFGFKGUG/GFCKNNGOCNKPFGP,CJTGPXQPDKUXGTNKGJGP

-74(ª456'067/ $+5 70&-¤0+)4'+%*  $#;'40 

/KNKV·T/CZ,QUGRJ1TFGP-TGW\FGT4KVVGT#PHGTVKIWPICWUFGPGT,CJTGP)QNFIW­GOCKNNKGTV IQJPG0WOOGTKGTWPIKO$CPFTKPICO$CPF ++



&GT FTGKMNCUUKIG 8GTFKGPUVQTFGP HÒT OKNKV·TKUEJG 6CRHGTMGKV YWTFG  XQP -ÌPKI /CZKOKNKCP + ,QUGRJ OKV #T   OGGDGHGJNXQO/·T\WPVGT4ÒEMFCVKGTWPICWHFGP,CPWCT KP#PNGJPWPICPFCUUGKVDGUVGJGP FGP %JWTRHCN\DC[GTKUEJGP 'JTGP\GKEJGPU  IGUVKHVGV /KV UGKPGT 8GTNGKJWPI YCT FGT RGTUÌPNKEJG #FGN OKV FGT $G   \GKEJPWPI4KVVGTXQPXGTDWPFGP/KVFGT#DFCPMWPI-ÌPKI.WFYKIU+++KO0QXGODGTYWTFGPFKG8GTNGKJWP IGP GKPIGUVGNNV 8IN -TCOGT 4WFQNH XQP WPF 9CNFGPHGNU 1VVQ (TGKJGTT XQP 8KTVWVK RTQ 2CVTKC  &GT MÌPKINKEJ   DC[GTKUEJG /KNKV·T/CZ,QUGRJ1TFGP  -TKGIUVCVGP WPF 'JTGPDWEJ    /ÒPEJGP  5  HH 7PF   -NKGVOCPP-WTV)$C[GTP/KNKV·T/CZ,QUGRJ1TFGP+P1TFGPU.GZKMQP$CPF$GTNKPQ, 



/KNKV·T8GTFKGPUVQTFGP-TGW\-NCUUGOKV5EJYGTVGTP#PHGTVKIWPIFGT(KTOC,CEQD.GUGTKP5VTCW DKPI 5KNDGT /GFCKNNQPU )QNF GOCKNNKGTV OGJTGTG 5EJ·FGP KP FGT DNCWGP 'OCKNNG XQP 8QTFGT WPF   4ÒEMUGKVG KP FGT #ITCHHG RWP\KGTV ōŋ WPF ō,.ŋ CO MWT\GP CNVGP $CPF )-  1'-     +++p+8



&GT \WP·EJUV HÒPHMNCUUKIG 1TFGP OKV CHHKNKKGTVGO /KNKV·T8GTFKGPUVMTGW\ YWTFG XQP -ÌPKI .WFYKI ++ CO  ,WNK   IGUVKHVGV'TGTHWJTKO.CWHGUGKPGU$GUVGJGPUOGJTGTG8GT·PFGTWPIGPWPF'TYGKVGTWPIGP     WPF   #D  DGUVCPF GT CWU  -NCUUGP FKG OGKUV KP OGJTGTG )TCFG WPVGTVGKNV UKPF  

)TQ­MTGW\-NCUUG-NCUUGOKVWPFQJPG5VGTP1HHK\KGTUMTGW\4KVVGTWPF-NCUUGOKVWPFQJPG-TQPG  WPF FGO CHHKNKKGTVGP FTGKMNCUUKIGP /KNKV·T8GTFKGPUVMTGW\ OKV WPF QJPG -TQPG #D  MQPPVGP CNNG -NCUUGP OKV   5EJYGTVGTPWPFCDCWEJFKG-NCUUGWPFFCU)TQ­MTGW\CNU*ÌJGTUVWHWPIOKVFGT-TQPGXGTNKGJGPYGT FGP/KVFGO6JTQPXGT\KEJV-ÌPKI.WFYKIU+++KO0QXGODGTGTNQUEJCWEJFGT1TFGP

8010







 16

8011

8013

/KNKV·T8GTFKGPUVQTFGP /KNKV·T8GTFKGPUVMTGW\  /QFGNN GKPMNCUUKI    5KNDGT /GFCKN   NQPU )QNF GOCKNNKGTV 'OCKNNGTGRCTCVWT CWH FGT 8QTFGTUGKVG FGU NKPMGP -TGW\CTOU WPF 'OCKNNGUEJCFGP   CWH FGT 4ÒEMUGKVG FGU WPVGTGP -TGW\CTOU QJPG *GTUVGNNGTRWP\GP CO PGWGP $CPF )-    1'- ++p++++++



/KNKV·T8GTFKGPUVQTFGP/KNKV·T8GTFKGPUVMTGW\/QFGNN  -TGW\-NCUUGOKV5EJYGT VGTP #PHGTVKIWPI XQP &GUEJNGT KP /ÒPEJGP #NRCMC 0GWUKNDGT  XGTUKNDGTV CWH FGT 4ÒEMUGKVG GKPGT   5EJYGTVURKV\G*GTUVGNNGT\GKEJGP&COCNVGPMNGKPGP&TGKGEMUDCPF)-1'- ++



/KNKV·T8GTFKGPUVQTFGP/KNKV·T8GTFKGPUVMTGW\/QFGNN  -QPXQNWVXQPFTGK8GTFKGPUV MTGW\GP  -NCUUG OKV 5EJYGTVGTP CP $·PFGTP D\Y CP 6TCIGUEJPCNNG GKPGU KO 'VWK &C\W <YGK   5EJYCT\G8GTYWPFGVGPCD\GKEJGPPQTOCNGWPFFWTEJDTQEJGPG#WUHÒJTWPI 5VÒEM++



'NKUCDGVJGP1TFGP -TGW\ FGT 1TFGPUDGCOVGP #PHGTVKIWPI CWU FGP GT ,CJTGP )QNF GOCKNNKGTV   IOKPQDGTHN·EJNKEJGT'OCKNNGEJKRCWHFGT4ÒEMUGKVGHGKPG'OCKNNGOCNGTGKCO$CPF ++




DEUTSCHE STAATEN

8014 1:1



.WFYKIUOGFCKNNG HÒT 9KUUGPUEJCHV WPF -WPUV )QNFGPG /GFCKNNG )QNF  I OKV $CPF  OKV   5VGORGNUEJPGKFGTUKIPCVWT , 4+'5 CWH FGT 4ÒEMUGKVG 81+)6 CO QTKIKPCNGP $CPF KO QTKIKPCNGP   8GTNGKJWPIUGVWK FGT (KTOC 3WGNNJQTUV KP /ÒPEJGP OKV IQNFHCTDGPGO /QPQITCOO -ÌPKI .WFYKIU ++   1'- 44+  9GIGP FGT UVTGPIGP 4ÒEMICDGRHNKEJV PCEJ #DNGDGP FGU $GNKGJGPGP WPF KO QTKIKPCNGP 8GTNGKJWPIUGVWK DGUQPFGTU   UGNVGP  &KG/GFCKNNGKUVCO#WIWUVXQP-ÌPKI.WFYKI++IGUVKHVGVYQTFGP#WHITWPFFGU'VWKUFGT(KTOC3WGNN JQTUVFKGNCWV-NGPCW KP)-.5++ DKUGZKUVKGTVGOKVFGO/QPQITCOO-ÌPKI.WFYKIU++ FGTCO ,WPKXGTUVQTDGPKUV FÒTHVGGUUKEJJKGTDGKWOGKPG8GTNGKJWPIFWTEJ.WFYKI++CWUFGO<GKVTCWOXQPDKU JCPFGNP

8015





8016

8018 8017

/KNKV·T8GTFKGPUVOGFCKNNG  /QFGNN OKV 2QTVTCKV XQP -ÌPKI /CZKOKNKCP + ,QUGRJ       #WUICDG OKV5VGORGNUEJPGKFGTUKIPCVWT,4+'5EC 5KNDGTPG/KNKV·T8GTFKGPUVOGFCKNNG5KN DGT OKV QTKIKPCNGO CNVGO XGTP·JVGO $CPF OKV 6TCIGMPQRH KO QTKIKPCNGP GVYCU DGTKGDGPGP 8GTNGK   JWPIUGVWKOKVUKNDGTHCTDGPGT#WHUEJTKHVOKVDGUEJ·FKIVGO8GTUEJNW­1'- ++



/KNKV·T8GTFKGPUVOGFCKNNG  /QFGNN OKV 2QTVTCKV XQP -ÌPKI /CZKOKNKCP + ,QUGRJ       #WUICDG OKV 5VGORGNUEJPGKFGTUKIPCVWT ,4+'5  EC   5KNDGTPG /KNKV·T8GTFKGPUVOGFCKNNG   5KNDGTOKVGTI·P\VGO$CPFTKPIOKVQTKIKPCNGOCNVGOWPXGTP·JVGO$CPF1'- +p++



6CFGNNQUG'TJCNVWPI





/KNKV·T8GTFKGPUVOGFCKNNG  /QFGNN OKV 2QTVTCKV XQP -ÌPKI /CZKOKNKCP + ,QUGRJ      5RCPIGPRT·IWPI PCEJ   QJPG 5VGORGNUEJPGKFGTUKIPCVWT 5KNDGT \WUCOOGP OKV '- ++  CP   <YGKGT1TFGPUUEJPCNNGCP0CFGN 5VÒEM++



/KNKV·T8GTFKGPUVOGFCKNNG  /QFGNN OKV 2QTVTCKV XQP -ÌPKI /CZKOKNKCP + ,QUGRJ      /KPKCVWTFGT5KNDGTPGP/KNKV·T8GTFKGPUVOGFCKNNG5KNDGTCO5EJNGKHEJGP ++

 17


DEUTSCHE STAATEN

8019

8020



8020

/KNKV·T&GPM\GKEJGP HÒT FKG ,CJTG  WPF  HÒT 1HHK\KGTG WPF /CPPUEJCHVGP $TQP\G VNY   FWPMGNITÒPNCEMKGTVCOCNVGP\GKVIGPÌUUKUEJGP1TKIKPCNDCPFKOPGWGP'VWK1'- ++



*ÒDUEJG'TJCNVWPIOKV1TKIKPCNDCPFPKEJVJ·WHKI\WHKPFGP



$C[GTKUEJGU(NWI\GWIUHÒJTGT#D\GKEJGP'KPHCEJG*QJNRT·IWPICWU'KUGPDNGEJXGTUKNDGTV4QUVURWTGP OKVMWT\GO0CFGNU[UVGO1'- ++



8021



&GWVUEJGT-TKGIGTDWPF/ÒPEJGP/GFCKNNGHÒTL·JTKIG8GTGKPU\WIGJÌTKIMGKV5KNDGTCWHFGT4ÒEM UGKVG6T·IGTITCXWTō/+%*$'6<ŋQJPG$CPFTKPIWPFQJPG$CPF\WUCOOGPOKV'JTGPIG UEJGPM\WTL·JTKIGP'TKPPGTWPIUHGKGTFGU-TKGIGUXQPXGTUKNDGTVOKV6T·IGTPCOG ō/+%*#'.$'6<ŋKOQTKIKPCNGP'VWK 5VÒEM++



/KEJCGN$GV\YCT8GVGTCPFGU&GWVUEJ(TCP\ÌUKUEJGP-TKGIGU

8022 1:1



'JTGPOGFCKNNG +P 6TGWG (GUV HÒT $C[GTKUEJG 5EJÒV\GPIGUGNNUEJCHVGP 5KNDGTPG /GFCKNNG PKEJV VTCI   DCTG #WUHÒJTWPI &WTEJOGUUGT  OO 5KNDGT OKV 5VGORGNUEJPGKFGTUKIPCVWT ō#5%*#4((ŋ OKP   4CPFFGNNGKODTCWPGP'VWK)$* 44++ &KG'JTGPOGFCKNNGYWTFGXQP2TKP\TGIGPV.WKVRQNFXQP$C[GTP  2TQVGMVQTFGT$C[GTKUEJGP5EJÒV \GPIGUGNNUEJCHVGPIGUVKHVGV.CWV)GDJCTFV KP)$*5 UKPFDKUKPUIGUCOVPWT5KNDGTOGFCKNNGPOKVWPF QJPG¤UGIGRT·IVYQTFGP&KGVTCIDCTG#WUHÒJTWPIFGT/GFCKNNGYWTFGCPGKPGOYGK­DNCWGP$CPFXGTNKGJGP

18




DEUTSCHE STAATEN

8023

8024 8025

8026



5EJKG­RTGKU FGT -ÌPKINKEJ $C[GTKUEJGP 7PVGTQHHK\KGTU5EJWNG KP (ÒTUVGPHGNFDTWEM /GFCKNNG FGU ++   5EJKG­RTGKUGU&WTEJOGUUGTOO5KNDGTKOIQNFHCTDGPDGFTWEMVGP'VWK ++





#D\GKEJGPFGT(GNFCTVKNNGTKUVGPFGU$G\KTMU5QPVJQHGP$TQP\GXGTUKNDGTVCWHFGT4ÒEMUGKVG*GTUVGN NGTDG\GKEJPWPIFGT(KTOC)WUVCX&GUEJNGTKP/ÒPEJGPCP0CFGN ++





)GFGPMCD\GKEJGP \WO L·JTKIGP ,WDKN·WO FGT -ÌPKIN 2TKX (GWGT5EJÒV\GP )GUGNNUEJCHV \W   #KEJCEJ $TQP\G XGTUKNDGTV CWH FGT 4ÒEMUGKVG *GTUVGNNGTDG\GKEJPWPI FGT (KTOC 2QGNNCVJ KP 5EJTQDGP   JCWUGPCP6TCIGURCPIG 4++



*'4<1)67/$4#705%*9'+) $+5  

*GT\QINKEJ$TCWPUEJYGKIKUEJGT1TFGP*GKPTKEJUFGU.ÌYGP-NGKPQFFGT-NCUUG#PHGTVKIWPICWU FGPGT,CJTGP5KNDGTIW­XGTIQNFGVWPFGOCKNNKGTVICWHFGO4CPFFGT#ITCHHG/CTMGō*+ŋWPF XGTUEJNCIGPG5KNDGTRWP\GōŋCOMWT\GPCNVGP*CNUDCPFCDUEJPKVV ++



8027 1:1

-74(ª456'067/ $+5 70&-¤0+)4'+%*  *#0018'4 

)WGNRJGP1TFGP4KVVGTMTGW\OKV5EJYGTVGTP)QNFVNYGOCKNNKGTVIOGJTGTGYKP\KIG'OCKNNG DGUEJ·FKIWPIGP KO TÒEMUGKVKIGP /GFCKNNQP\GPVTWO CO UEJOCNGP CNVGP $CPFUVÒEM )-    1'- ++p  .CWV-NGPCW KP)-5++ YWTFGPXQPDKUCP*CPPQXGTCPGTECWPFCP#WUN·PFGTECWPF XQPDKUCP*CPPQXGTCPGTECWPFCP#WUN·PFGTEC4KVVGTMTGW\GOKV5EJYGTVGTPXGTNKGJGP  +P (QNIG FGT 'TJGDWPI FGU -WTHÒTUVGPVWOU *CPPQXGT \WO -ÌPKITGKEJ XQO 2TKP\TGIGPVGP )GQTI PCOGPU UGKPGU   8CVGTU-ÌPKI)GQTI+++XQP)TQ­DTKVCPPKGP+TNCPFWPF*CPPQXGTCO#WIWUVCNUFTGKMNCUUKIGT<KXKNWPF /KNKV·T8GTFKGPUVQTFGPIGUVKHVGVYCTGT\WP·EJUVGKP1TFGPKPPGTJCNDFGUDTKVKUEJGP1TFGPU[UVGOU&WTEJFCU'PFG FGT 2GTUQPCNWPKQP \YKUEJGP )TQ­DTKVCPPKGPWPF*CPPQXGTYWTFGGTWPVGT-ÌPKI'TPUV#WIWUVXQP*CPPQXGT GKP TGKP JCPPQXGTCPKUEJGT 1TFGP FGT KP FGT (QNIG\GKV OGJTHCEJG PFGTWPIGP GTHWJT  KPHQNIG FGT #PPGZKQP   *CPPQXGTUFWTEJ2TGW­GPYWTFGFGTKP\YKUEJGPXKGTMNCUUKIG FGHCEVQHÒPHMNCUUKIG 1TFGPCWHIGJQDGP 8INCWEJ 6JKGU#PFTGCUWPF*CRMG9KNJGNO1TFGPWPF'JTGP\GKEJGPFGU-ÌPKITGKEJGU*CPPQXGT*CODWTI 

19


DEUTSCHE STAATEN

8028



8029

'TPUV #WIWUV1TFGP  #WUHÒJTWPI OKV IGUEJNQUUGPGP JGTCNFKUEJGP -ÌPKIUMTQPGP WPF UQIGP *GT   \QIUJÒVGP\YKUEJGPFGP-TGW\CTOGP 4KVVGTMTGW\-NCUUG5KNDGTGOCKNNKGTVOKP$GUEJ·FKIWPIGPCWH 8QTFGTWPF4ÒEMUGKVGFGTWPVGTGPNKPMGP-TGW\CTOURKV\GCOPGWGP$CPF)-1'- ++



-NGPCWIKDV KP)-5++ HÒTFKG,CJTGXQPDKU8GTNGKJWPIGPFGU4KVVGTMTGW\GU-NCUUGCP



8GTFKGPUVMTGW\FGU*CPPQXGTUEJGP.CPFGU-TKGIGTXGTDCPFGU5KNDGTVNYGOCKNNKGTVHGKPUVG'OCKN NGOCNGTGKCOCNVGPMNGKPGP&TGKGEMUDCPF 44++



8030

8031 8033

.#0&)4#(5%*#(6 $+5 70&)4155*'4<1)67/   *'55'0 &#4/56#&6 70&$'+4*'+0 

)TQ­JGT\QINKEJ *GUUKUEJGT 8GTFKGPUV1TFGP 2JKNKRRU FGU )TQ­OÒVJKIGP D\Y )TQ­JGT\QINKEJ   *GUUKUEJGT2JKNKRRU1TFGP CD /QFGNN OKVFGT$ÒUVGFGU.CPFITCHGP2JKNKRR  4KVVGTMTGW\D\Y4KVVGTMTGW\-NCUUG UGKV )QNFGOCKNNKGTVFKG$ÒUVGVNYCPIGNCWHGP'OCKNNG UEJCFGP KO .ÌYGP FGU 4ÒEMUGKVGPOGFCKNNQPU CP QTKIKPCNGT ITQ­GT 'KPGT$QIGPDCPF1TFGPUUEJPCNNG   1'- ++++p



)GUVKHVGVCO/CKXQP)TQ­JGT\QI.WFYKI++CNUXKGTMNCUUKIGT8GTFKGPUVQTFGP )TQ­MTGW\-QOVWTGWPF -NCUUG4KVVGT YWTFGFGT1TFGPITWPFNGIGPFKPUGKPGT)GUVCNVWPIXGT·PFGTVWPFKPFGP,CJTGP  WPF  GTHQNIVGP YGKVGTG 8GT·PFGTWPIGP  DGUVCPF FGT 1TFGP CWU KPUIGUCOV UGEJU -NCUUGP  

)TQ­MTGW\-QOVWTWPF-NCUUG'JTGPMTGW\4KVVGTWPF-NCUUG WPFGKPGOCHHKNKKGTVGP5KNDGTPGP-TGW\ FKG CNNG CW­GT FGO 'JTGPMTGW\ CNU *ÌJGTUVWHWPI OKV -TQPG XGTNKGJGP YGTFGP MQPPVGP 5·OVNKEJG -NCUUGP MQPPVGP   CWEJ OKV 5EJYGTVGTP XGTNKGJGP YGTFGP /KV FGO 7PVGTICPI FGT /QPCTEJKG KO 0QXGODGT  GTNQUEJ CWEJ FGT   1TFGP

.#0&)4#(5%*#(6 $+570&$+5 70&-74(ª456'067/ 

 *'55'0 -#55'.  

*CWU1TFGPXQO)QNFGPGP.ÌYGP/QFGNNOKVTÒEMUGKVKIGT,CJTGU\CJN-NGKPQFZOO .ÌYG KP UGJT RNCUVKUEJGT #WUHÒJTWPI 5KNDGTIW­ XGTIQNFGV  I QJPG $CPFTKPI  OKV $CPFTKPI CWU   $TQP\GKOUEJYGFKUEJGP5VKNCOPGWGP*CNUDCPFCDUEJPKVV1'- ++



(ª456'06ª/'4 $+5 *1*'0.1*'70&(ª456.+%*'(#/+.+'0  810*1*'0.1*' 5'+6  

*CWUQTFGPXQPFGT)QNFGPGP(NCOOG.CPIGU*CNUDCPFOQFGTPG#PHGTVKIWPIMQPHGMVKQPKGTV



*CWUWPF4KVVGT1TFGPXQO2JÌPKZ-QOOCPFGWTMTGW\#PHGTVKIWPICWUFGPGT,CJTGP)QNF IW­ GOCKNNKGTV  I \YGK MCWO UKEJVDCTG 'OCKNNGTGRCTCVWTGP CWHFGT8QTFGTUGKVGFGUTGEJVGP-TGW \CTOU'OCKNNGOCNGTGKCO$CPFCDUEJPKVV ++

20

+p++






DEUTSCHE STAATEN

8034 1:1



(ª456'06ª/'4 $+5 *1*'0<1..'4070&(ª456.+%*'(#/+.+'  810*1*'0<1..'40 5+)/#4+0)'05'+6 

(ÒTUVNKEJGT*CWUQTFGPXQP*QJGP\QNNGTP/QFGNN  'JTGPMTGW\-NCUUG)QNFGOCKN NKGTVIHGKPUVG'OCKNNGOCNGTGKQJPG$CPF1'- 44++

&KG-TGW\GUKPFNCWV.KPMWPF)CWIIGN KP.0-5H XQPDKUXQPFGT(KTOC*QUUCWGTKP$GTNKPWPF XQP  DKU  XQP FGT (KTOC % / 9GKUJCWRV 5ÌJPG KP *CPCW CPIGHGTVKIV YQTFGP &KG #WVQTGP PGPPGP KP   .0-5 GKPG<CJNXQPPWT8GTNGKJWPIGPFGU'JTGPMTGW\GU-NCUUGFGU/QFGNNU XQPDKU 

8035



8036



8037

(ÒTUVNKEJGT *CWUQTFGP XQP *QJGP\QNNGTP  /QFGNN UGKV   'JTGPMTGW\  -NCUUG 5KNDGT VNY   GOCKNNKGTVOKP'OCKNNGEJKRUKO5EJTKHVTKPIFGUTÒEMUGKVKIGP/GFCKNNQPUCO$CPF1'- ++



#PHGTVKIWPI CWU FGT GTUVGP *·NHVG FGU <YCP\KIUVGP ,CJTJWPFGTVU .KPM WPF )CWIIGN IGDGP KP .0- 5 H  HQN   IGPFG8GTNGKJWPIU\CJNGPCPXQPDKUXQPDKUXQPDKUXQP DKUWPFXQPDKU



%CTN#PVQP'TKPPGTWPIUOGFCKNNG  )QNFGPG /GFCKNNG 5KNDGT XGTIQNFGV GVYCU CPIGNCWHGP OKV   1TKIKPCNDCPFKOQTKIKPCNGPOKVIQNFHCTDGPGT-TQPGDGFTWEMVGP8GTNGKJWPIUGVWKFGU*QHLWYGNKGTU,) <KOOGTGT5QJPKP5KIOCTKPIGP1'- 4++

+OQTKIKPCNGP8GTNGKJWPIUGVWKPKEJVJ·WHKI\WHKPFGP.CWV.KPMWPF)CWIIGN KP.0-5H UKPFKPUIGUCOVPWT )QNFGPG/GFCKNNGPXGTIGDGPYQTFGPFCXQPCPFKG2TKP\GPWPF2TKP\GUUKPPGPFGU(ÒTUVNKEJGP*CWUGU*QJGP \QNNGTPWPFFKGFKTGMVG0CEJMQOOGPUEJCHVFGU(ÒTUVGP%CTN#PVQPCPFKG2TKP\GPWPF2TKP\GUUKPPGPFGU2TGW­K UEJGP -ÌPKIUJCWUGU UQHGTP UKG FCU  .GDGPULCJT ÒDGTUEJTKVVGP JCDGP  CP FKG YKEJVKIUVGP 0GHHGP WPF 0KEJVGP   %CTN#PVQPUCEJVCPFKG/KVINKGFGTFGU)TQ­JGT\QINKEJ$CFKUEJGP*CWUGUWPFHÒPHCPYGKVGTGHÒTUVNKEJG2GTUQPGP



(ª456'067/.+22' &'6/1.&$+5  

(ÒTUVNKEJ.KRRKUEJGT*CWUQTFGP/QFGNN CWHFGT4ÒEMUGKVG/QPQITCOOō.ŋ #PHGTVK IWPI CWU FGP GT ,CJTGP OKV GKPVGKNKIGO 4ÒEMUGKVGPOGFCKNNQP  5KNDGT OCUUKX  XGTIQNFGV WPF   GOCKNNKGTVICO$CPF ++

&CU 'JTGPMTGW\ YWTFG CO  1MVQDGT  XQP .GQRQNF +++ (ÒTUV \W .KRRG   WPF #FQNRJ + )GQTI   (ÒTUV\W5EJCWODWTI.KRRG  CNUIGOGKPUCOGT*CWUQTFGPOKV5VGTPWPF%QTFQPHÒTDGKFG.CPFGUJGTTGP -NCUUGPWPFCNUCHHKNKKGTVGT\YGKUVWHKIGT8GTFKGPUVOGFCKNNGIGUVKHVGV#O#RTKNGTHQNIVGFKG7ODGPGPPWPIFGT 8GTFKGPUVOGFCKNNG KP 'JTGP\GKEJGP 8QO  5GRVGODGT  DKU  0QXGODGT  YWTFG FKG  -NCUUG KP \YGK   5VWHGP OKVWPFQJPG-TQPG XGTNKGJGP#O0QXGODGTYWTFGPYGKVGTGPFGTWPIGPFGMTGVKGTVFKGDKUJGTKIG  -NCUUG OKV -TQPG YWTFG  -NCUUG PGW IGUVKHVGV YWTFG GKPG  -NCUUG OKV 'KEJGPNCWD FKG DKUJGTKIG  -NCUUG   QJPG -TQPG YWTFG  -NCUUG FKG DKUJGTKIG  -NCUUG YWTFG  WPF FKG DKUJGTKIG  YWTFG  #PUVGNNG FGT 'JTGP   \GKEJGPYWTFGGKP\YGKUVWHKIGU8GTFKGPUVMTGW\GKPIGHÒJTV(ÒT#WU\GKEJPWPIKO-TKGIYWTFGPFKG'JTGP MTGW\GOKV5EJYGTVGTP FWTEJFKG/KVVG XGTNKGJGP+PFGP,CJTGPWPFGTHQNIVGP8GTNGKJWPIGPFGTWPF FGT-NCUUGOKV5EJYGTVGTPCO4KPI#O#RTKNYWTFGWPVGT9CNFGOCT(ÒTUV\WT.KRRG  FGT UEJCWODWTIKUEJNKRRKUEJG *CWUQTFGP CDIGVTGPPV FCU DKUJGTKIG /QPQITCOO FGT 4ÒEMUGKVG .# FWTEJ . GTUGV\V FKG   DKUJGTKIG -NCUUGPGKPVGKNWPI =5VGTP WPF %QTFQP HÒT FGP (ÒTUVGP  -NCUUGP YQDGK FKG  -NCUUG KP \YGK )TCFGP   XGTNKGJGPYWTFG OKVWPFQJPG'KEJGPNCWD WPFUVWHKIGU8GTFKGPUVMTGW\ KP)QNFWPF5KNDGT ?#O/CK YWTFGP FKG +PUKIPKGP HÒT FKG (ÒTUVKP GKPIGHÒJTV WPF CO  /CK  CWEJ FKG  -NCUUG KP \YGK )TCFG WPVGTVGKNV  

OKVWPFQJPG'KEJGPNCWD UQYKGGKP\YKUEJGPFGT-NCUUGWPFFGO)QNFGPGP8GTFKGPUVMTGW\CPIGUKGFGNVGU<KXKN 'JTGPMTGW\#O/CKYWTFGFGT8GTNGKJWPIFGU5VGTPUPGDUV%QTFQPCWEJCPHTGOFG5QWXGT·PGWPF2TKP \GPUQWXGT·PGT*·WUGTGTOÌINKEJV#O/CKYWTFGCP5VGNNGFGTDKUJGTKIGP-NCUUGOKV'KEJGPNCWDFCU 1HHK\KGTUGJTGPMTGW\ IGUVKHVGV WPF CO  ,WPK FGU INGKEJGP ,CJTGU FCU <KXKN'JTGPMTGW\ KP 'JTGPMTGW\  -NCUUG    #DVGKNWPI WODGPCPPV /KV FGT #DUEJCHHWPI FGT /QPCTEJKG KO 0QXGODGT  YWTFGP CWEJ FKG 8GTNGKJWPIGP FGU   1TFGPUGKPIGUVGNNVCNNGTFKPIUNGDVFGT1TFGPCNUTGKPGT*CWUQTFGPYGKVGT



21


DEUTSCHE STAATEN

8039 8040 8038

(ª456.+%*'(#/+.+'<74.+22' 5'+6  



(ÒTUVNKEJ .KRRKUEJGT *CWUQTFGP  /QFGNN OKV CDIGTWPFGVGP 5VGTPURKV\GP 4ÒEMUGKVGPOGFCKNNQP   OGJTVGKNKIPCEJ 'JTGPMTGW\-NCUUG#PHGTVKIWPIPCEJ5KNDGTXGTIQNFGVWPFGOCKNNKGTV OKVUEJOCNGO*CNUDCPF ++



(ÒTUVNKEJGU8GTFKGPUVMTGW\FGT.KRRKUEJGP4QUG-TGW\+-NCUUG5KNDGTXGTIQNFGVWPFGOCKNNKGTVCP 0CFGNFCTCWH*GTUVGNNGTDG\GKEJPWPIFGT(KTOC%(4QVJGKP9KGP 4++



&CU8GTFKGPUVMTGW\YWTFGPCEJIGUVKHVGVWPFPWTUGJTMWT\KPYGPKIGP'ZGORNCTGPXGTNKGJGPDKUFKGUXQPFGT 1TFGPUMCP\NGKKO2T·UKFKCNCOVWPVGTUCIVYWTFG



(ÒTUVNKEJGU8GTFKGPUVMTGW\FGT.KRRKUEJGP4QUG-TGW\++-NCUUG5KNDGTXGTIQNFGVWPFGOCKNNKGTVKO $CPFTKPI*GTUVGNNGTRWP\G%(4FGT(KTOC%(4QVJGKP9KGPCO$CPF 4++



8041 8043

8044

8042

(ª456'067/5%*#7/$74).+22' $+5  

(ÒTUVNKEJ5EJCWODWTI.KRRKUEJGT*CWUQTFGP/QFGNN UGKV -TGW\-NCUUG#XGTU/GFCKN NQPOKVTQVGOCKNNKGTVGO(GNF)QNFJQJNIGHGTVKIVVNYITCXKGTVGOCKNNKGTVI4ÒEMUGKVGPOGFCKN NQPOÌINKEJGTYGKUGPCEJGOCKNNKGTV YGNNKI CO$CPF1'- ++



*'4<1)67/ $+5 70&)4155*'4<1)67/   /'%-.'0$74)5%*9'4+0 

)TGKHGP1TFGP-QOVWTMTGW\#WUHÒJTWPIOKVOGJTVGKNKIGO/GFCKNNQP5KNDGTXGTIQNFGVWPFGOCKNNKGTV COPGWGP*CNUDCPFCDUEJPKVV1'- ++





)TGKHGP1TFGP4KVVGTMTGW\OKV-TQPG#PHGTVKIWPICWUFGPGT,CJTGP UQIGP)TGKHOKV'UGNUQJ TGP 5KNDGTXGTIQNFGVWPFGOCKNNKGTVCO$CPF ++





)TGKHGP1TFGP 4KVVGTMTGW\ #WUHÒJTWPI OKV OGJTVGKNKIGO /GFCKNNQP 5KNDGT XGTIQNFGV WPFGOCKNNKGTV COCNVGPMNGKPGP&TGKGEMUDCPF1'- ++



22


DEUTSCHE STAATEN

8045 1:1

(ª456'067/0#55#775+0)'0  70&*'4<1)67/0#55#7 

  

*GT\QINKEJ0CUUCWKUEJGT/KNKV·TWPF<KXKN8GTFKGPUV1TFGP#FQNRJUXQP0CUUCW/QFGNN   4KVVGTMTGW\ZOO)QNFJQJNIGHGTVKIVITCXKGTVGOCKNNKGTVICOCNVGP$CPFFGU <KXKN8GTFKGPUVQTFGPUXQO0KGFGTN·PFKUEJGP.ÌYGP1'- 44+p++



5EJQQU IKDV KP 51 5  #PO   HÒT FCU 4KVVGTMTGW\ QJPG WPF OKV 5EJYGTVGTP XQP  DKU  KPUIGUCOV   8GTNGKJWPIGPCP<KGJVOCPJKGXQPFKGXQP4QUGPYCNF KP1//5HH GKP\GNPDGNGIVGPXGTNKGJGPGP 8GTNGKJWPIGPOKV5EJYGTVGTPCDUQXGTDNGKDVGKPG8GTNGKJWPIU\CJNXQPPWT4KVVGTMTGW\GP QJPG5EJYGTVGT  XQPDKU

8046

8047

8048



/GFCKNNGHÒT8GTFKGPUVGWOFKG.CPFYKTVUEJCHV5KNDGTIWUU  OKV)TCXGWTPCOGPō<1../#00ŋ OGJTGTG 4GRCTCVWTGP 5EJ·FGP WPF 4CFFGNNGP UVCTM IGVTCIGP PCEJVT·INKEJ IGJGPMGNV OKV $CPF QFGT   -GVVGPTKPI 44+8



*'4<1)67/ $+5 70&)4155*'4<1)67/  1.&'0$74) 

*CWWPF8GTFKGPUV1TFGPFGU*GT\QIU2GVGT(TKGFTKEJ.WFYKI-NGKPMTGW\D\Y CD 4KVVGT MTGW\-NCUUG)QNF DKU JQJNIGHGTVKIVVNYITCXKGTVWPF\KUGNKGTVGOCKNNKGTVIHGKPUVG 'OCKNNGOCNGTGKCOPGWGP$CPF1'- ++



$G[TGK­HÒJTV KP$;15HWPF5 CWUFC­NCWV4GEJPWPIUWPF$GUVCPFUXGT\GKEJPKUUGPFGU1TFGPUTGPV OGKUVGTU XQP  DKU GKPUEJNKG­NKEJ  KPUIGUCOV  -NGKPMTGW\G DKU   D\Y 4KVVGTMTGW\G  -NCUUG CD    IGNKGHGTVYQTFGPUKPFYQXQPLGFQEJXQPCP'ZGORNCTGKPXGTIQNFGVGO5KNDGTCWUIGHÒJTVYCTGPUQ FC­XQPDKU GKPUEJNKG­NKEJ -NGKPMTGW\GD\Y4KVVGTMTGW\G-NCUUGIGNKGHGTVYQTFGPUKPF8QP DKUUKPF8GTNGKJWPIGPFGU-NGKPMTGW\GUD\YFGU4KVVGTMTGW\GU-NCUUGWPF8GTNGKJWPIGPKPUIG UCOVCNUQXGTNGKJWPIGPGTHQNIV

-¤0+)4'+%*24'755'0   

*QJGT1TFGPXQO5EJYCT\GP#FNGT1TFGPMTGW\#PHGTVKIWPICWUFGPGT,CJTGP5KNDGTXGTIQNFGV WPFGOCKNNKGTVCO5EJWNVGTDCPF ++

 23


DEUTSCHE STAATEN

8049

8050



*QJGT 1TFGP XQO 5EJYCT\GP #FNGT )GUVKEMVGT $TWUVUVGTP 5EJCDTCEMGPUVGTP  Z  OO   5KNDGTNCCPQJPG#DFGEMRCRKGTCWHFGT4ÒEMUGKVG-NGDGTGUVG ++





1TFGP2QWTNGO¾TKVG'KPUGKVKIG5COONGTCPHGTVKIWPIFGU)TQ­MTGW\GU5KNDGTXGTIQNFGVWPFGOCKNNKGTV CO*CNUDCPFCDUEJPKVV ++



5GJT UEJÌPGU 'TUCV\GZGORNCT CWU FGP GT ,CJTGP FKGUGT KO 1TKIKPCN PKEJV DGUEJCHHDCTGP  XQP -ÌPKI 9KN   JGNO+IGUVKHVGVGPWPFCNU)TQ­MTGW\DG\GKEJPGVGP-NCUUGFKGKPUIGUCOVPWTHÒPHOCNXGTNKGJGPYWTFG -TQPRTKP\ (TKGFTKEJWPF2TKP\(TKGFTKEJ-CTNXQP2TGW­GP-ÌPKI9KNJGNO+<CT#NGZCPFGT++XQP4W­NCPFWPF )GPGTCNHGNFOCTUEJCNNXQP/QNVMG 

8051



8052

8053

1TFGP2QWTNGO¾TKVGNVGTG<YGKVCPHGTVKIWPIFGU4KVVGTMTGW\GU5KNDGT )W­! VNYITCXKGTVXGTIQN FGVWPFGOCKNNKGTVICWHFGO4CPFFGU6TCIGUGIOGPVUOGJTHCEJRWP\KGTV 5KNDGTRWP\G*GT UVGNNGTRWP\Gō%(4ŋFGT(KTOC4QVJGKP9KGPWPFÌUVGTTGKEJKUEJGō6WMCP2WP\GŋCDHÒTGT5KNDGT  CO·NVGTGPLGFQEJPGWMQPHGMVKQPKGTVGP*CNUDCPF ++





1TFGP2QWTNGO¾TKVG<YGKUGKVKIGOQFGTPG5COONGTCPHGTVKIWPIFGU4KVVGTMTGW\GU$WPVOGVCNNXGTIQN FGVWPFGOCKNNKGTVCO\WO&TGKGEMUDCPFFTCRKGTVGP*CNUDCPFCDUEJPKVV ++





1TFGP2QWTNGO¾TKVG'KPUGKVKIGOQFGTPG5COONGTCPHGTVKIWPIFGU4KVVGTMTGW\GU$WPVOGVCNNXGTIQNFGV WPFGOCKNNKGTVCWHFGT4ÒEMUGKVG)GU)GUEJOKV*CNUDCPFCDUEJPKVVKO'VWKFGT(KTOC4QVJGKP9KGP ++



1TFGP 2QWT NG O¾TKVG -QPXQNWV XQP FTGK GKP WPF DGKFUGKVKIGP OQFGTPGP 5COONGTCPHGTVKIWPIGP FGU   4KVVGTMTGW\GU$WPVOGVCNNXGTIQNFGVWPFGOCKNNKGTV\YGKCP$CPFCDUEJPKVVGP ++





24


DEUTSCHE STAATEN

8055 1:1



4QVGT#FNGT1TFGP/QFGNN OKV\KGIGNTQVGO#FNGT -TGW\-NCUUG)QNFGOCKNNKGTV IHGKPUVG'OCKNNGOCNGTGKCWHFGO<[NKPFGT*GTUVGNNGTDG\GKEJPWPIō*5ŋFGT(KTOC*WODGTV WPF5ÌJPGKP$GTNKPKO4CPFGKPGU-TGW\CTOU2TÒHURWTFGT$CPFTKPIKPFGTHÒTFKG5VÒEMGFGT(KTOC *WODGTVV[RKUEJGPTWPFGP(QTOQJPG$CPF1'-24-C +p++  'ZVTGOUGNVGPGUHTÒJGU'ZGORNCTFGU/QFGNNUKPCDUQNWVGO$GUV\WUVCPFFCUPCEJ#PICDGPXQP&T2GVGTU5CW GTYCNF \YKUEJGP  WPF  CPIGHGTVKIV YQTFGP KUV FC *WODGTV  5ÌJPG PWT DKU \W FKGUGO ,CJT IGCTDGKVGV   JCDGP  7TURTÒPINKEJ  XQP 'TDRTKP\ )GQTI 9KNJGNO XQP $TCPFGPDWTI$C[TGWVJ CNU GKPMNCUUKIGT 1TFGP FG NC 5KPEGTKV¾   IGUVKHVGVYWTFGGTPCEJªDGTPCJOGFGT/CTMITCHUEJCHVFWTEJ2TGW­GPÒDGTPQOOGPWPFKO(QNIGPFGPUWM\GU UKXG FWTEJ \CJNTGKEJG PFGTWPIGP 'TI·P\WPIGP WPF 'TYGKVGTWPIGP GTJGDNKEJ CWUIGDCWV 'T XGTHÒIVG CO 5EJNW­   ÒDGT UGEJU -NCUUGP -GVVG )TQ­MTGW\  DKU  -NCUUG  XQP FGPGP FKG \YGKVG KP \YGK 5VWHGP WPVGTVGKNV YCT  OKV   GKPGT CHHKNKKGTVGP /GFCKNNG XQP FGPGP FKG +PUKIPKGP OKV \CJNTGKEJGP $GK\GKEJGP 5EJYGTVGT 5EJYGTVGT CO 4KPI   $TKNNCPVGP -TQPG 'KEJGPNCWD ,WDKN·WOU\CJN ,QJCPPKVGTMTGW\ 5EJYGTV WPF 5\GRVGT 'OCKNNGDCPF FGU -TQPGPQT   FGPU -QODKPCVKQPGP OÌINKEJ  XGTNKGJGP YGTFGP MQPPVGP YCU \W GKPGT IGTCFG\W WPÒDGTUKEJVNKEJGP #TVGPXKGNHCNV   HÒJTVG/KVFGO'PFGFGT/QPCTEJKGKUVCWEJFGT1TFGPWPVGTIGICPIGP

8057







8058 8056 Rv.

4QVGT #FNGT1TFGP  /QFGNN OKV \KGIGNTQVGO #FNGT    -TGW\  -NCUUG 5KNDGT     XGTIQNFGV VNY GOCKNNKGTV 'OCKNNGOCNGTGK GKPKIG QDGTHN·EJNKEJG 'OCKNNGEJKRU CWH FGO 4GXGTU   /GFCKNNQPHGKPG)QNFUVCWD'OCKNNGOCNGTGKCWHFGO4CPFFGUWPVGTGP-TGW\CTOURWP\KGTVōŋQJPG *GTUVGNNGTOCTMGCO·NVGTGPLGFQEJPKEJV\GKVIGPÌUUKUEJGP*CNUDCPF1'-24-D ++



4QVGT#FNGT1TFGP/QFGNN OKV\KGIGNTQVGO#FNGT -TGW\-NCUUG#WUHÒJTWPI

OKV IGMÌTPVGP -TGW\CTOGP    5KNDGT VNY GOCKNNKGTV 'OCKNNGOCNGTGK CWH FGO 4CPF FGU   WPVGTGP-TGW\CTOU4KV\OCTMGō9ŋCOCNVGP$CPF1'-24-C ++



4QVGT#FNGT1TFGP/QFGNN OKV\KGIGNTQVGO#FNGT -TGW\-NCUUG#WUHÒJTWPI

OKVIGMÌTPVGP-TGW\CTOGP 5KNDGTVNYGOCKNNKGTV'OCKNNGOCNGTGK'OCKNNGEJKRCWHFGO 4CPFFGUWPVGTGP-TGW\CTOU4KV\OCTMGō0ŋCOCNVGPMNGKPGP&TGKGEMUDCPF1'-24-C ++p+++

 25


DEUTSCHE STAATEN



8061

8060

8059

-ÌPKINKEJGT-TQPGP1TFGP/QFGNN OKVITQ­GTRTGW­KUEJGT-ÌPKIUMTQPGKO8QTFGTUGKVGPOGFCKNNQP UGKVEC -TGW\-NCUUG#PHGTVKIWPICWUFGPGT,CJTGP5KNDGTXGTIQNFGVWPFGOCKNNKGTV I QJPG4KPI CWHFGO4CPFFGUWPVGTGP-TGW\CTOU4KV\OCTMGō9ŋWPF2WP\GōŋCOPGWGP 5EJWNVGTDCPF ++



8QP-ÌPKI9KNJGNO+CWU#PNC­UGKPGT-TÌPWPICO1MVQDGTIGUVKHVGV.CWV*ÒUMGP KP*25  GTHWJT FKG -TQPG KO XQTFGTUGKVKIGP /GFCKNNQP  GKPG GTUVG PFGTWPI XQP GKPGT CNNIGOGKPGP JGTCNFKUEJGP   -ÌPKIUMTQPGKPGKPGōMNGKPGŋRTGW­KUEJG-ÌPKIUMTQPG WPFECGKPG\YGKVG XQPFGTōMNGKPGPŋKPFKGōITQ­Gŋ RTGW­KUEJG -ÌPKIUMTQPG 'T XGTHÒIVG ÒDGT XKGT -NCUUGP XQP FGPGPFKG\YGKVGKP\YGK5VWHGP OKVWPFQJPG$TWUV UVGTP  WPVGTVGKNV YCT OKV GKPGT CHHKNKKGTVGP 8GTFKGPUVOGFCKNNG UGKV   &KG +PUKIPKGP MQPPVGP OKV \CJNTGKEJGP   $GK\GKEJGP 5EJYGTVGT 5EJYGTVGT CO 4KPI 'KEJGPNCWD $TKNNCPVGP ,WDKN·WOU\CJN )GPHGT -TGW\ 'OCKNNGDCPF FGU   4QVGP #FNGT1TFGPU  -QODKPCVKQPGP OÌINKEJ  XGTNKGJGP YGTFGP YCU ·JPNKEJ YKG DGKO 4QVGP #FNGT1TFGP \W   GKPGT ITQ­GP #TVGPXKGNHCNV HÒJTVG/KVFGO'PFGFGT/QPCTEJKGKO0QXGODGTKUVCWEJFKGUGT1TFGPWPVGTIG ICPIGP



-ÌPKINKEJGT-TQPGP1TFGP/QFGNN OKVITQ­GTRTGW­KUEJGT-ÌPKIUMTQPGKO8QTFGTUGKVGPOGFCKNNQP UGKVEC -TGW\-NCUUG)QNFGOCKNNKGTVICWHFGO<[NKPFGT*GTUVGNNGTRWP\Gō%ŋQFGTō)ŋ COPGWGP*CNUDCPFCDUEJPKVV1'-24-C ++



'ZGORNCTGKPGUYQJNUGNVGPGP*GTUVGNNGTUKPJGTXQTTCIGPFGO'TJCNVWPIU\WUVCPF



-ÌPKINKEJGT-TQPGP1TFGP/QFGNN OKVITQ­GTRTGW­KUEJGT-ÌPKIUMTQPGKO8QTFGTUGKVGPOGFCKNNQP  UGKV EC   -TGW\  -NCUUG OKV 5EJYGTVGTP  5KNDGT   XGTIQNFGV WPF GOCKNNKGTV  I MCWO   UKEJVDCTG 'OCKNNGEJKRU KO TÒEMUGKVKIGP /GFCKNNQPTKPI 5EJYGTVGT IGNÌVGV CWH FGO 4CPF FGU WPVGTGP   -TGW\CTOU2WP\GP9WPFVNYUVCTMCPIGNCWHGPCOCNVGP*CNUDCPFCDUEJPKVV1'-24- D ++

8062





8063

-ÌPKINKEJGT-TQPGP1TFGP/QFGNN OKVITQ­GTRTGW­KUEJGT-ÌPKIUMTQPGKO8QTFGTUGKVGPOGFCKNNQP UGKVEC -TGW\-NCUUG#PHGTVKIWPIFGT(KTOC9CIPGTKP$GTNKP)QNFGOCKNNKGTVICWH FGO4CPFFGUWPVGTGP-TGW\CTOU4KV\OCTMGō9ŋCOCNVGP1TKIKPCNDCPFKOQTKIKPCNGPUEJYCT\GP8GT NGKJWPIUGVWKOKVIQNFHCTDGPGO/QPQITCOO1'-24-C ++



-ÌPKINKEJGT *CWUQTFGP XQP *QJGP\QNNGTP -TGW\ FGT 4KVVGT OKV 5EJYGTVGTP 5KNDGT XGTIQNFGV WPF   GOCKNNKGTVCWHFGO4CPFFGUWPVGTGP-TGW\CTOGU4KV\OCTMGō(4ŋHÒT(TKGFN·PFGTKP$GTNKPWPF5KNDGT RWP\GōŋCOCNVGP$CPF1'-24-D ++



&GT 1TFGP YWTFG CO  &G\GODGT  CNU IGOGKPUCOGT 1TFGP FGT DGKFGP HÒTUVNKEJGP *·WUGT XQP *QJGP\QNNGTP   XQP(ÒTUV(TKGFTKEJ9KNJGO%QPUVCPVKPXQP*QJGP\QNNGTP*GEJKPIGPWPF(ÒTUV%CTNXQP*QJGP\QNNGTP5KIOCTKPIGP IGUVKHVGV+P(QNIGFGU5VCCVUXGTVTCIGU\YKUEJGPFGO-ÌPKITGKEJ2TGW­GPWPFFGPDGKFGPJQJGP\QNNGTUEJGP(ÒTUVGP VÒOGTPXQO&G\GODGTKPFGOFKGªDGTICDGFGTDGKFGPNGV\VGTGPCP2TGW­GPIGTGIGNVYQTFGPYCTUVKHVGVG -ÌPKI (TKGFTKEJ 9KNJGNO +8 XQP 2TGW­GP CO  ,CPWCT  FGP -ÌPKINKEJGP *CWUQTFGP KP \YGK #DVGKNWPIGP  

#DVGKNWPI-TGW\G#DVGKNWPI#FNGT OKVLGYGKNUFTGK-NCUUGP )TQ­MQOVWT-QOVWTWPF4KVVGT YQ\WPQEJGKP

26




DEUTSCHE STAATEN 5KNDGTPGU-TGW\D\YGKP5KNDGTPGT#FNGTJKP\WMCOFKGCNU-NCUUGCDCNUō+PJCDGTŋDG\GKEJPGVYWTFGP+P FGP 5VKHVWPIUUVCVWVGP YCT \WFGO PQEJ CNU GKPOCN \W XGTNGKJGPFG #WU\GKEJPWPI FKG *QJGP\QNNGTUEJG &GPMOÒP\G   XQTIGUGJGPō\WT$GNQJPWPIHÒTFKGLGPKIGPYGNEJGKPFGPXGTUEJKGFGPGPKO,CJTGWPFXQTIG HCNNGPGP)GHGEJVGPKJTG6TGWGDGYCJTVJCDGPŋYWTFGPCNUDGUQPFGTG1TFGPUMNCUUG\WO)TQ­MQOVWTCPCEJV UVTCJNKIGT WPF \WO -QOVWT GKP UGEJUUVTCJNKIGT $TWUVUVGTP IGUVKHVGV  GTHQNIVG HÒT CNNG -NCUUGP FGT GTUVGP #DVGK   NWPI FKG 5VKHVWPI FGT 5EJYGTVGT HÒT 8GTFKGPUVG XQT FGO (GKPF  WPF FGT 5EJYGTVGT CO 4KPI #NU DGUQPFGTGT )PC   FGPGTYGKU MQPPVGP FKG +PUKIPKGP FGT )TQ­MQOVWTG FGT  #DVGKNWPI KP $TKNNCPVGP XGTNKGJGP YGTFGP +P FGT \YGKVGP   *·NHVGFGU'TUVGP9GNVMTKGIU CD FKGPVGFCU4KVVGTMTGW\OKV5EJYGTVGTPCNUDGUQPFGTG6CRHGTMGKVUCWU\GKEJPWPI WPFCNU8QTTCWUUGV\WPIHÒTGKPGUR·VGTG8GTNGKJWPIFGU1TFGPUō2QWTNGO¾TKVGŋ-CKUGT9KNJGNO++JCVPCEJ KPUGKPGO'ZKNDGKFG#DVGKNWPIGPDKU\WUGKPGO6QFYGKVGTXGTNKGJGP

8064



8065

-ÌPKINKEJGT*CWUQTFGPXQP*QJGP\QNNGTP#FNGTFGT)TQ­MQOVWTGWPF-QOVWTG#PHGTVKIWPICWUFGP GT,CJTGP5KNDGTXGTIQNFGVWPFGOCKNNKGTVCWHFGT4ÒEMUGKVGFGU5EJTKHVDCPFGU4KV\OCTMGō9ŋCO *CNUDCPF ++



5GJTUEJÌPGU'TUCV\GZGORNCTCWUFGPGT,CJTGPFKGUGTKO1TKIKPCNPWTUGJTUEJYGTDGUEJCHHDCTGP-NCUUGFKGKP PWTYGPKIGP'ZGORNCTGPXGTNKGJGPYQTFGPKUV



-ÌPKINKEJGT*CWUQTFGPXQP*QJGP\QNNGTP#FNGTFGT)TQ­MQOVWTGWPF-QOVWTG#PHGTVKIWPICWUFGP GT,CJTGP5KNDGTXGTIQNFGVWPFGOCKNNKGTVQJPG*GTUVGNNGTRWP\GPCO\WT5EJNGKHGIGHCNVGVGPPGWGP *CNUDCPFCDUEJPKVV ++



5GJTUEJÌPGU'TUCV\GZGORNCTCWUFGPGT,CJTGPFKGUGTKO1TKIKPCNPWTUGJTUEJYGTDGUEJCHHDCTGP-NCUUGFKGKP PWTYGPKIGP'ZGORNCTGPXGTNKGJGPYQTFGPKUV

8066



8067

8068 Rv.

-ÌPKINKEJGT *CWUQTFGP XQP *QJGP\QNNGTP #FNGT FGT 4KVVGT GKPHCEJG #PHGTVKIWPI CWU FGP GT   ,CJTGP5KNDGTXGTIQNFGVWPFGOCKNNKGTVCONCPIGP$CPF ++



0GVVGU 'TUCV\GZGORNCT CWU FGP GT ,CJTGP FKGUGT KO 1TKIKPCN PWT UGJT UEJYGT DGUEJCHHDCTGP -NCUUG FKG KP PWT   YGPKIGP'ZGORNCTGPXGTNKGJGPYQTFGPKUV



-ÌPKINKEJGT *CWUQTFGP XQP *QJGP\QNNGTP #FNGT FGT +PJCDGT #PHGTVKIWPI CWU FGP GT ,CJTGP   5KNDGTIWUUVNYGOCKNNKGTVCO$CPFKPGKPGOQTKIKPCNGPUEJYCT\GP8GTNGKJWPIUGVWK ++





-ÌPKINKEJGT *CWUQTFGP XQP *QJGP\QNNGTP #FNGT FGT +PJCDGT #PHGTVKIWPI CWU FGP GT ,CJTGP   5KNDGTIWUUVNYGOCKNNKGTVCO$CPF ++



27


DEUTSCHE STAATEN

8070 1:1 8069 1:1



$CNNG[$TCPFGPDWTI4KVVGTNKEJGP1TFGPU5V,QJCPPKUXQO5RKVCN\W,GTWUCNGO ,QJCPPKVGTQTFGP  -TGW\ FGT -QOOGPFCVQTGP WPF 'JTGPMQOOGPFCVQTGP )QNF IGRTÒHV  GOCKNNKGTV OKP %JKR KP GKPGT   -TGW\CTOURKV\GIQJPGLGINKEJG2WP\KGTWPIQFGT*GTUVGNNGTMGPP\GKEJPWPIQJPG*CNUDCPF  44++ 

'ZGORNCTCWUWPUGTGT#WMVKQP1TFGPWPF'JTGP\GKEJGPCO1MVQDGT0T  +PGEJVIQNFGPGT#WUHÒJTWPIUGJTUGNVGP'PVYGFGTJCPFGNVGUUKEJJKGTDGKWOGKPGUEJYGFKUEJGQFGTPKGFGTN·PFKUEJG #PHGTVKIWPIFCFGTGP1TFGPUTKVVGTDKUD\YFKG+PUKIPKGPFGT$CNNG[$TCPFGPDWTIVTWIGPQFGTWOGKPG FGWVUEJG#PHGTVKIWPIXQPPCEJCNUQOÌINKEJGTYGKUGCWUFGT<GKVFGT9GKOCTGT4GRWDNKM GTD\YGT ,CJTG   /KV &CVWO XQO  1MVQDGT  GTTKEJVGVG -ÌPKI (TKGFTKEJ 9KNJGNO +8 CWU FGO DKUJGTKIGP -ÌPKINKEJ 2TGW­K   UEJGP ,QJCPPKVGTQTFGP YKGFGT FKG $CNNG[ $TCPFGPDWTI FGU ,QJCPPKVGTQTFGPU CD  WPVGT FGT .GKVWPI GKPGU *GT   TGPOGKUVGTU WPF VGKNVG FGTGP 4KVVGT KP FTGK 5VWHGP GKP -QOVWTG CD  -QOOGPFCVQTGP WPF 'JTGPMQOOGPFCVQ   TGP  4GEJVUTKVVGT WPF 'JTGPTKVVGT  YWTFG FKG 5VWHG FGT 'JTGPOKVINKGFGT GKIGHÒJTV WPF  NKG­ UKEJ -ÌPKI   9KNJGNO ++ GKPG GKIGPG 2TQVGMVQTFGMQTCVKQP CPHGTVKIGP 6TQV\ \CJNTGKEJGT $GUEJT·PMWPIGP DGUVGJV FGT 1TFGP CWEJ   Y·JTGPF FGU &TKVVGP 4GKEJGU  IGPGJOKIVG $WPFGURT·UKFGPV 6JGQFQT *GWUU FKG $CNNG[ $TCPFGPDWTI FGU   ,QJCPPKVGTQTFGPU WPF CO  ,WPK IGPGJOKIVG GT FKG HQNIGPFGP 1TFGPUKPUKIPKGP *GTTGPOGKUVGTMTGW\ -TGW\ FGT   'JTGPOKVINKGFGT-QOGPFCVQTGPMTGW\4GEJVUTKVVGTMTGW\WPF'JTGPTKVVGTMTGW\



$CNNG[$TCPFGPDWTI4KVVGTNKEJGP1TFGPU5V,QJCPPKUXQO5RKVCN\W,GTWUCNGO ,QJCPPKVGTQTFGP  -TGW\ FGT 4GEJVUTKVVGT )QNF IGRTÒHV  VNY ITCXKGTV WPF \KUGNKGTV GOCKNNKGTV  I OKP *CCTTK­ KP   GKPGO-TGW\CTOCWHFGO4CPFFGUWPVGTGPITCXKGTVGU*GTUVGNNGT\GKEJGPō(ŋCOPGWGP$CPFCDUEJPKVV 1'-24-C ++



8071 1:1



.WKUGP1TFGP  #DVGKNWPI 1TFGPUMTGW\ OKV FGP ,CJTGU\CJNGP   Z  OO )QNF   GOCKNNKGTVI OKV5EJNGKHG CPQTKIKPCNGTCNVGTGVYCUCWUIGDNGKEJVGT&COGPUEJNGKHG1'- 24- 4++  <YGKHGNUHTGKGU\GKVIGPÌUUKUEJGU1TKIKPCNGZGORNCTYQJNCWUFGT/KVVGFGU0GWP\GJPVGP,CJTJWPFGTVU

28


DEUTSCHE STAATEN

8072 1:1



&QOMCRKVGN \W $TCPFGPDWTI CP FGT *CXGN *CNUMTGW\ FGT YGNVNKEJGP 'JTGP&QOJGTTGP UGKV     ZOO$TQP\GXGTIQNFGVWPFGOCKNNKGTVCO*CNUDCPFCDUEJPKVV*2 44++



+O,CJTGNKGHGTVGFKG(KTOC-NKGVOCPPKP$GTNKPCWH$GUVGNNWPIFGU'JTGPFQOJGTTP&T(GTFKPCPF(TKGFGPUDWTI GKPG5GTKGPGWCPIGHGTVKIVGT&QOJGTTGPMTGW\GPCEJFGO8QTDKNFFGTCNVGPXQP(TKGFTKEJFGO)TQ­GPIGUVKH VGVGP+PUKIPKGP&KGUGYCTGPHQTVCP\WT8GTICDGCPFKGYGNVNKEJGP'JTGPFQOJGTTPDGUVKOOV'KPRTQOKPGPVGT'JTGP FQOJGTTKUVFGTGJGOCNKIG1DGTMQUKUVQTKCNTCVFGT'XCPIGNKUEJGP-KTEJGKP$GTNKPWPFGJGOCNKIG/KPKUVGTRT·UKFGPVFGU .CPFGU$TCPFGPDWTI&T/CPHTGF5VQNRG 8INCWEJ(GFGT-NCWU#WU\GKEJPWPIGPFGTGXCPIGNKUEJGP-KTEJGXQP DKUJGWVGFCTIGUVGNNVCO$GKURKGNFGU&QOUVKHVGU$TCPFGPDWTI+P255HH-NKGVOCPPWPF0GWDGEMGT &QOMCRKVGN \W $TCPFGPDWTI +P 1TFGPUNGZKMQP  1JPG 1TV WPF QJPG ,CJT )TKV\PGT /CZKOKNKCP  &QOMCRKVGN   $TCPFGPDWTI +P &KG #NVRTGW­KUEJGP CWHIGJQDGPGP &QO-QNNGIKCVG FGTGP KPPGTG 8GTHCUUWPI WPF KJTG 1TFGP WPF   'JTGP\GKEJGP1UPCDTÒEM 

8073 1:1



9CNRWTIKWU&COGPUVKHV \W 5QGUV KP 9GUVHCNGP -TGW\ FGT 5VKHVUFCOGP  /QFGNN  Z  OO   )QNFGOCKNNKGTVI OKV&COGPUEJNGKHG HGKPUVG'OCKNNKGOCNGTGKCWHFGO4CPFFGUWPVGTGP-TGW \CTOU 4KV\OCTMG ō'ŋ -TQPG UVCTT OKV FGO -TGW\ XGTDWPFGP CP FGT QTKIKPCNGP \GKVIGPÌUUKUEJGP &C   OGPUEJNGKHG*2 44+  'ZGORNCTCWUWPUGTGT#WMVKQP1TFGPWPF'JTGP\GKEJGPCO1MVQDGT0T  5VKHVUFGMQTCVKQPXQPITQ­GT5GNVGPJGKVKPGKPGTJGTXQTTCIGPFGP#PHGTVKIWPIUSWCNKV·VYQJNCWUFGT\YGKVGP*·NHVGFGU 0GWP\GJPVGP ,CJTJWPFGTVU WPF KP GKPGT CDUQNWV JGTXQTTCIGPFGP 'TJCNVWPI  0CEJ )TKV\PGT )TKV\PGT /CZKOKNKCP   *CPFDWEJFGTKO&GWVUEJGP4GKEJGKP¤UVGTTGKEJ7PICTP&·PGOCTM5EJYGFGPWPFFGP4WUUKUEJGP1UVUGGRTQXKP \GP DGUVGJGPFGP &COGPUVKHVGT WPF KO 4CPIG INGKEJUVGJGPFGT 9QJNV·VKIMGKVUCPUVCNVGP PGDUV FGP 1TFGPU\GKEJGP FGT   'TUVGTGP (TCPMHWTV C /  5 HH  CNU (TCWGPMNQUVGT DGTGKVU  IGITÒPFGV YWTFG GU KP (QNIG FGT 4GHQT   OCVKQP KO  ,CJTJWPFGTV KP GKP IGOKUEJV MQPHGUUKQPGNNGU HTGKYGNVNKEJGU CFNKIGU &COGPUVKHV WOIGYCPFGNV FCU KP   (QNIG GKPGU &GMTGVU -CKUGT 0CRQNGQPU + XQO  &G\GODGT   CO  ,CPWCT  CWHIGJQDGP YWTFG 0CEJ   FGT 4ÒEMMGJT 9GUVHCNGPU WPVGT FKG -TQPG 2TGW­GPU YWTFG FCU 5VKHV PGW IGITÒPFGV /KV -CDKPGVVU1TFGT XQO    ,CPWCT  JCVVG -ÌPKI (TKGFTKEJ ++ FGT )TQ­G  XQP 2TGW­GP FGO 5VKHV DGTGKVU 5VKHVUFGMQTCVKQPGP XGTNKGJGP   DGUVGJGPF CWU -TGW\ WPF $TWUVUVGTP /KV FGT 0GWITÒPFWPI CNU GXCPIGNKUEJGU &COGPUVKHV GTJKGNV GU CWEJ PGW   IGUVCNVGVG5VKHVUFGMQTCVKQPGP

29


DEUTSCHE STAATEN

8075



8076

8077 1:1

#NNIGOGKPGU'JTGP\GKEJGP-NCUUG/QFGNN  5KNDGTOKVQTKIKPCNGOCNVGO$CPFKO QTKIKPCNGPUEJYCT\GP8GTNGKJWPIUGVWK&C\W%JCTNQVVGPMTGW\FGU-ÌPKITGKEJU9ÒTVVGODGTI5KNDGTCO $CPF1'- ++





4QVG-TGW\/GFCKNNG4QVG-TGW\/GFCKNNG-NCUUG5VGEMMTGW\#PHGTVKIWPICWUFGPGT,CJTGP

CWUGKPGO5VÒEMIGHGTVKIV 5KNDGTXGTIQNFGVWPFGOCKNNKGTVCP0CFGN ++





¤NDGTI-TGW\ #PHGTVKIWPI CWU FGP GT ,CJTGP 5KNDGT XGTIQNFGV WPF GOCKNNKGTV OGJTGTG 5RTÒPIG   WPF%JKRUKPFGTYGK­GP'OCKNNGCO$CPF ++p





5EJÒV\GPOGFCKNNG &'/ $'56'0 5%*ª6<'0 -ÌPKI (TKGFTKEJ 9KNJGNOU +8 5KNDGTPG /GFCKNNG   &WTEJOGUUGTOO5KNDGTKO*CNUCDUEJPKVV5VGORGNUEJPGKFGTUKIPCVWTō.'55'-ŋCOXGTH·TDVGPCNVGP $CPF ++



8078



'KUGTPGU -TGW\ #WUICDG  -TGW\  -NCUUG XGTNKGJGPGU 1TKIKPCNGZGORNCT IGUEJY·T\VGT 'KUGP   MGTPOKV5KNDGT\CTIGCOCNVGPQTKIKPCNGP&TGKGEMUDCPFHÒT-·ORHGTOKVCWHIGNGIVGT'KEJGPNCWDURCPIG 5KNDGTCP6TCIGMPQRHOKV/KPKCVWTCP6TCIGMPQRH1'-24- 5VÒEM++ &CU 'KUGTPG -TGW\ YWTFG CWH RGTUÌPNKEJG +PKVKCVKXG CO  /·T\  XQP -ÌPKI (TKGFTKEJ 9KNJGNO +++ KP FTGK   -NCUUGP 'KUGTPGU -TGW\  -NCUUG 'KUGTPGU -TGW\  -NCUUG )TQ­MTGW\ FGU 'KUGTPGP -TGW\GU  CNU -TKGIU'JTGP   \GKEJGP KODGUVGJGPFGP8GTVGKFKIWPIUHCNN HÒTFCU8GTFKGPUVYGNEJGUKPFGOLGV\VCWUDTGEJGPFGP-TKGIGGPVYGFGT KO YKTMNKEJGP -CORH OKV FGO (GKPFG QFGT CW­GTFGO KO (GNFG QFGT FCJGKO LGFQEJ KP $G\KGJWPI CWH FKGUGP   ITQ­GP-CORHWO(TGKJGKVWPF5GNDUVUV·PFKIMGKVGTYQTDGPYKTFXGTNKGJGP 5VKHVWPIUWTMWPFG 'UUQNNVGPCEJFGOCWU FTÒEMNKEJGP 9KNNGP FGU -ÌPKIU KP FGT  WPF  -NCUUG QJPG #PUGJGP XQP 2GTUQP WPF *GTMWPHV CP LGFGP /CPP   XGTNKGJGP YGTFGP FGT UKEJ FGUUGP CNU YÒTFKI GTYKGU +P FGT (QNIG\GKV YWTFG FCU 'KUGTPG -TGW\ \WO 5[ODQN FGT   $GHTGKWPIUMTKGIGWPFGTTGKEJVGGKPJQJGU#PUGJGP+P(QNIGFGT-TKGIUGTMN·TWPI(TCPMTGKEJUCP2TGW­GPCO,WNK  GTPGWGTVG -ÌPKI 9KNJGNO +XQP2TGW­GPFCU'KUGTPGU-TGW\YGPKIG6CIGUR·VGTTÒEMFCVKGTVCWHFGP6CIFGT -TKGIUGTMN·TWPI (TCPMTGKEJU =8IN CWEJ W X C 5EJPGKFGT .QWKU &KG 2TGW­KUEJGP 1TFGP 'JTGP\GKEJGP WPF   #WU\GKEJPWPIGP&CU$WEJXQO'KUGTPGP-TGW\G$GTNKP*ÒVVG9GTPGT1VVQ&KG)GUEJKEJVGFGU'KUGTPGP -TGW\GU WPF UGKPG $GFGWVWPI HÒT FCU RTGW­KUEJG WPF FGWVUEJG #WU\GKEJPWPIUYGUGP XQP  DKU \WT )GIGPYCTV   $QPP   0KOOGTIWV ,ÌTI *I  &CU 'KUGTPG -TGW\  .ÒFGPUEJGKF   )GK­NGT *CTCNF &CU   'KUGTPG-TGW\XQPDKUJGWVG0QTFGTUVGFV$QYGP8'6JG2TWUUKCPCPF)GTOCP+TQP%TQUU#WH NCIG QJPG 1TV WPF QJPG ,CJT  2TGXKVGTC 5VGRJGP 6JQOCU 6JG +TQP 6KOG  # *KUVQT[ QH 6JG +TQP %TQUU   #WHNCIG?

30




DEUTSCHE STAATEN

8079



'KUGTPGU -TGW\ #WICDG  )TQ­MTGW\ FGU 'KUGTPGP -TGW\GU QTKIKPCNIGVTGWG FTGKVGKNKIG #WUUVGN   NWPIU#PHGTVKIWPI 'KUGPMGTP OCIPGVKUEJ  IGUEJY·T\V WPF PCEJNCEMKGTV 5KNDGT\CTIG OKV CNVGO $CPF   UVÒEM ++



*GTXQTTCIGPFGU CNVGU 'TUCV\GZGORNCT HÒT GKP KO 1TKIKPCN PKEJV \W DGUEJCHHGPFGU 5VÒEM FCU Y·JTGPF FGU 'TUVGP   9GNVMTKGIGU PWT XKGT OCN XGTNKGJGP YQTFGP KUV CO  CP )GPGTCNHGNFOCTUEJCNN 2CWN XQP *KPFGPDWTI CO    CP )GPGTCNHGNFOCTUEJCNN XQP /CEMGPUGP CO  CP )GPGTCNHGNFOCTUEJCNN 2TKP\ .GQRQNF XQP   $C[GTPWPFCOCP)GPGTCNHGNF\GWIOGKUVGT'TKEJ.WFGPFQTHH 

8080





'KUGTPGU -TGW\ #WICDG  'KUGTPGU -TGW\ + -NCUUG HNCEJG #WUHÒJTWPI 'KUGPMGTP IGUEJY·T\V   5KNDGT\CTIGCWHFGT4ÒEMUGKVGRWP\KGTVō91ŋCP0CFGNKOQTKIKPCNGPUKNDGTPDGFTWEMVGP8GTNGKJWPIU GVWK1'-C ++



'KUGTPGU -TGW\ #WICDG  'KUGTPGU -TGW\ + -NCUUG HNCEJG #WUHÒJTWPI 'KUGPMGTP IGUEJY·T\V   5KNDGT\CTIGCWHFGT4ÒEMUGKVGRWP\KGTVō-1ŋCP0CFGN1'-24-C ++p+++



ex 8082



8081

8083 Rv.

'KUGTPGU -TGW\ #WICDG  'KUGTPGU -TGW\ + -NCUUG HNCEJG #WUHÒJTWPI 'KUGPMGTP IGUEJY·T\V   5KNDGT\CTIGCWHFGT4ÒEMUGKVGCNVG)TCXWTō&1.+0#2#5.#)(#.6'6ŋCP0CFGNFKGUG RWP\KGTV59FGT(KTOC5[9CIPGTKP$GTNKP&C\W&GWVUEJG'JTGPFGPMOÒP\GFGU9GNVMTKGIGUFGU 1TFGPUTCVGU FGT &GWVUEJGP 'JTGPNGIKQP CO $CPF OKV CWHIGNGIVGO -CORHCD\GKEJGP WPF -TKGIUFGPM   OÒP\GFGU&GWVUEJGP4GKEJUMTKGIGTDWPFGU-[HHJ·WUGTQJPG$CPF1'-24-C 5VÒEM++



#WHITWPFFGT)TCXWTKPUEJYGFKUEJGT5RTCEJG FKGCWHFGO5EJNCEJVHGNFDGFGWVGV KUVCP\WPGJOGPFC­GUUKEJJKGT DGKWOGKPG8GTNGKJWPIXQO,WPKCPFGT(TQPVCPFGPUEJYGFKUEJGP5VCCVUCPIGJÌTKIGP&QNKPC (TGKYKNNKIGT QFGT-TKGIUDGQDCEJVGT JCPFGNV



'KUGTPGU-TGW\#WICDG'KUGTPGU-TGW\+-NCUUGIGYÌNDVG#WUHÒJTWPI'KUGPMGTPIGUEJY·T\V 5KNDGT\CTIGCWHFGT4ÒEMUGKVGPGWG)TCXWTō#&1.(4+0-'4ŋCP\YGK5EJTCWDGPFCXQPGKPG OKV 5EJTCWDUEJGKDG /KV 5RGPFGP7TMWPFG 0T    FGU $WPFGU FGU 'KUGTPGP -TGW\GU &GWVUEJGT   2CVTKQVGPKP#OGTKMCHÒT#FQNH4KPMGTFCVKGTVIGHCNVGV1'-24-E 5VÒEM++



*ÌEJUVKPVGTGUUCPVGU \GKVIGUEJKEJVNKEJGU 'PUGODNG \WT 5[ORCVJKG FGWVUEJUV·OOKIGT #OGTKMCPGT HÒT FCU &GWVUEJG   4GKEJ\W$GIKPPFGU'TUVGP9GNVMTKGIGU

31


DEUTSCHE STAATEN

8084

8089 Rv.

8086

8085



'KUGTPGU -TGW\ #WICDG  'KUGTPGU -TGW\ + -NCUUG HNCEJG #WUHÒJTWPI 'KUGPMGTP IGUEJY·T\V   5KNDGT\CTIGCP0CFGNFKGUGRWP\KGTV-#)1'-24-C ++





'KUGTPGU-TGW\#WICDG'KUGTPGU-TGW\+-NCUUGIGYÌNDVG#WUHÒJTWPI'KUGPMGTPIGUEJY·T\V <CTIGXGTUKNDGTVCP0CFGNKO1TKIKPCNGVWK1'-24-D ++





-TKGIUFGPMOÒP\G  /KPKCVWT FGT #WUHÒJTWPI OKV TWPFGP -TGW\CTOGPFGP CP UKNDGTPGT 6TCIG   URCPIGCOMWT\GP1TKIKPCNDCPFUVÒEM 4++





-QPXQNWV XQP UKGDGP -TKGIUFGPMOÒP\GP WPF -TKGIUGTKPPGTWPIUFGPMOÒP\GP FGT -TKGIG  DKU   &CTWPVGTWPF#WUHÒJTWPIGPOKVIGTCFGP-TGW\CTOGPFGP$TQP\G KPWPVGTUEJKGFNKEJGP'TJCNVWPIGPLGYGKNUCP$·PFGTP 5VÒEM++++p+++



-QPXQNWVXQPUKGDGP-TKGIUFGPMOÒP\GPWPF-TKGIUFGPMMTGW\GPFGT-TKGIGWPF&CTWPVGT #NUGPWPF&ÒRRGNMTGW\G8GTUEJKGFGPG/GVCNNGKPWPVGTUEJKGFNKEJGP'TJCNVWPIGPLGYGKNUCP$·PFGTP 5VÒEM++



-WTJGUUKUEJG,WDKN·WOUFGPMOÒP\G#WUICDGOKV&CVWO018'/$'4IGRT·IVGU 'ZGORNCT  $TQP\GCOCNVGP1TKIKPCNDCPF1'-24- ++







8091 8090

8093



#D\GKEJGP\WT'KPJWPFGTVLCJTHGKGTFGU$GUVGJGPUFGU)CTFG)TGPCFKGT4GIKOGPVU-CKUGT#NGZCP FGTXQP4W­NCPF0TKO,CJT$TQP\GIW­XGTIQNFGVTÒEMUGKVKIG0CFGNCDIGDTQEJGP 4+++8





#D\GKEJGPFGU$TCPFGPDWTIKUEJGP7NCPGP4GIKOGPVU-CKUGT#NGZCPFGT++XQP4W­NCPF0T 8GTIQNFGVCP0CFGN ++





-QPXQNWV XQP  QHHK\KGNNGP WPF KPQHHK\KGNNGP #W\GKEJPWPIGP &CTWPVGT 'KUGTPGU -TGW\ ++ -NCUUG      WPF -TKGIGT8GTFKGPUVOGFCKNNG 8GTUEJKGFGPG /GVCNNG KP WPVGTUEJKGFNKEJGP 'TJCNVWPIGP VGKNU   CP$·PFGTP 5VÒEM++



(ª456'06ª/'44'755)'/'+05#/ 

(ÒTUVNKEJ4GW­KUEJGU'JTGPMTGW\-TGW\-NCUUG#PHGTVKIWPICWUFGPGT,CJTGP5KNDGTXGTIQN FGV CWEJFKG/GFCKNNQPCWHNCIGP WPFGOCKNNKGTVCWHLGGKPGO-TGW\CTOFGT8QTFGTWPFFGT4ÒEMUGKVG 'OCKNNGUEJCFGPCO*CNUDCPF ++ (ÒTUV*GKPTKEJ:+84GW­LÒPIGTG.KPKGUVKHVGVGFGP\WP·EJUVFTGKMNCUUKIGP1TFGPCO/CKWPFGTYGKVGTVG KJPWCWOGKPGYGKVGTG-NCUUGWPFGKPGCHHKNKKGTVGUKNDGTPG8GTFKGPUVOGFCKNNG FKGIQNFGPG8GTFKGPUVOGFCKNNG YWTFG  GKPIGHÒJTV   ÒDGTPCJO GT CNU 4GIKGTWPIUXGTYGUGT FGU (ÒTUVGPVWOU 4GW­ ·NVGTG .KPKG FGP 1TFGP   CWEJ HÒT FKGUGU (ÒTUVGPVWO  YWTFG FGT 1TFGP HÒT 4GW­ LÒPIGTG.KPKGUGEJUMNCUUKIWPFHÒT4GW­·NVGTG .KPKG LGYGKNU OKV OGJTGTGP 'TYGKVGTWPIGP  YWTFG FCU -TKGIUDCPF GKPIGHÒJTV &GT 1TFGP ÒDGTNGDVG FGP 7P   VGTICPIFGT/QPCTEJKGCNU*CWUQTFGPFGTHÒTUVNKEJGP(COKNKG

32




DEUTSCHE STAATEN

8094

8095

-74(ª456'067/ $+5 70&-¤0+)4'+%*  5#%*5'0 

4KVVGTNKEJGT /KNKV·T1TFGP 5CPEVK *GPTKEK   D\Y %JWTHÒTUVNKEJ5·EJUKUEJGT /KNKV·T1TFGP   5CPEVK*GPTKEK  D\Y-WTHÒTUVNKEJ  D\Y-ÌPKINKEJ UGKV 5·EJUKUEJGT/KNKV·T 5V*GKPTKEJU1TFGP/QFGNN UGKV 4KVVGTMTGW\#WUHÒJTWPI  5KNDGTXGTIQNFGV GOCKNNKGTVHGKPG'OCKNNGOCNGTGKCOCNVGP1TKIKPCNDCPF)$1'- ++



#WHITWPFFGT#WUHÒJTWPIFGT'OCKNNGOCNGTGK XIN9$ N·­VUKEJFCU'ZGORNCTFGO*GTUVGNNGT)*1UCPIKP &TGUFGP\WQTFPGP



-ÌPKINKEJ 5·EJUKUEJGT <KXKN8GTFKGPUVQTFGP   D\Y -ÌPKINKEJ 5·EJUKUEJGT 8GTFKGPUV   1TFGP  /QFGNN  #WUHÒJTWPI OKVIGRT·IVGO9CRRGPUEJKNFCD  4KVVGTMTGW\  -NCUUG OKV 5EJYGTVGTP 5KNDGT XGTIQNFGV WPF GOCKNNKGTV  I CO CNVGP 1TKIKPCNDCPF   )$1'- ++



9GDGT #TPQNF WPF -GKN IGDGP KP9$5 GKPG#P\CJNXQP8GTNGKJWPIGPHÒTFGP<GKVTCWOXQPDKU CP)GDCWGT KP)$5 LGFQEJPWTHÒTFGP<GKVTCWOXQPDKU  &GT 1TFGP YWTFG CO  ,WPK  XQP -ÌPKI (TKGFTKEJ #WIWUV + CNU FTGKMNCUUKIGT 1TFGP OKV CHHKNKKGTVGT /GFCKNNG   IGUVKHVGV 'T GTHWJT KO .CWHG UGKPGU $GUVGJGPU OGJTGTG 8GT·PFGTWPIGP WPF 'TYGKVGTWPIGP =    

5VKHVWPI FGT 5EJYGTVGT    WPF  /QFGNNYGEJUGN ? #D  DGUVCPF GT CWU  -NCUUGP )TQ­MTGW\   -QOVWTG  WPF  -NCUUG 4KVVGT  WPF  -NCUUG  WPF FGO CHHKNKKGTVGP 8GTFKGPUVMTGW\ /KV FGO 6JTQPXGT\KEJV   -ÌPKI(TKGFTKEJ#WIWUVU+++KO0QXGODGTGTNQUEJCWEJFGT1TFGP

8096 1:1



-ÌPKINKEJ5·EJUKUEJGT#NDTGEJVUQTFGP/QFGNN OKVFGO2QTVTCKVXQP-WTHÒTUV,QJCPP FGO$GUV·PFKIGPOKVFGTUQIGP$·EMGTOÒV\G -QOVWTMTGW\)QNFGOCKNNKGTVIQJPG$CPFTKPI \WUCOOGP OKV QTKIKPCNGO MWT\GP *CNUDCPFCDUEJPKVV KO IQNFGP DGFTWEMVGP QTKIKPCNGP 8GTNGKJWPIUGVWK   FGT(KTOC)#5EJCTHHGPDGTIKP&TGUFGP1'- ++  33


DEUTSCHE STAATEN )GUVKHVGVCO&G\GODGTXQP-ÌPKI(TKGFTKEJ#WIWUV++CNU\WP·EJUVHÒPHMNCUUKIGTCNNIGOGKPGT8GTFKGPUVQT FGP   5VKHVWPI FGT 5EJYGTVGT  WPF  GTHQNIVGP 8GT·PFGTWPIGP WPF 'TYGKVGTWPIGP  YWTFG OKV   FGO 'TNC­ PGWGT 1TFGPUUVCVWVGP FCU 2QTVTCKV CWH FGO 8QTFGTUGKVGPOGFCKNNQP IG·PFGTV 9GKVGTG 'TYGKVGTWPIGP   GTHQNIVGPWPF5GKVGTHQNIVGFKG*GTUVGNNWPIFGT+PUKIPKGPKPXGTIQNFGVGO5KNDGT0CEJ FGTNGV\VGPYGUGPVNKEJGPPFGTWPIWOHC­VGFGT1TFGPKPUIGUCOV)TCFG=)TQ­MTGW\OKVIQNFGPGO5VGTPWPF UKNDGTPGT-TQPG)TQ­MTGW\OKVIQNFGPGO$TWUVUVGTPCOITÒPGP$CPFFGU*CWUQTFGPUFGT4CWVGPMTQPGOKVYGK­GP 5GKVGPUVTGKHGP)TQ­MTGW\OKVIQNFGPGO$TWUVUVGTP)TQ­MTGW\OKV$TKNNCPVGP)TQ­MTGW\-QOVWTWPF-NCUUG 1HHK\KGT4KVVGTMTGW\-NCUUGOKV-TQPG4KVVGTMTGW\WPF-NCUUG?WPFFCUCHHKNKKGTVG#NDTGEJVUMTGW\/KVFGO 6JTQPXGT\KEJV-ÌPKI(TKGFTKEJ#WIWUVU+++KO0QXGODGTGTNQUEJCWEJFGT1TFGP

8100

8098 8102

8103

8097

8101

8099













-ÌPKINKEJ5·EJUKUEJGT#NDTGEJVUQTFGP/QFGNN OKVFGO2QTVTCKVXQP*GT\QI#NDTGEJV+++ FGO$GJGT\VGP #WUHÒJTWPI #WUHÒJTWPIKP5KNDGTXGTIQNFGVOKVUGRCTCVGP/GFCKNNQP TKPIGP -QOVWTMTGW\5KNDGTXGTIQNFGVWPFGOCKNNKGTVCWHFGOWPVGTGP4CPF2WP\Gō5ŋHÒT5KNDGT4ÒEM UGKVGPOGFCKNNQPHGJNVQJPG$CPF)$1'- ++



-ÌPKINKEJ5·EJUKUEJGT#NDTGEJVUQTFGP/QFGNN OKVFGO2QTVTCKVXQP*GT\QI#NDTGEJV+++ FGO$GJGT\VGP #WUHÒJTWPI #WUHÒJTWPIKP5KNDGTXGTIQNFGVOKVUGRCTCVGP/GFCKNNQP TKPIGP 4KVVGTMTGW\-NCUUGOKV-TQPG5KNDGTXGTIQNFGVWPFGOCKNNKGTVCWHFGOWPVGTGP4CPF2WP\G ō5ŋHÒT5KNDGTCOPGWGP$CPF)$1'- ++



-ÌPKINKEJ5·EJUKUEJGT#NDTGEJVUQTFGP/QFGNN OKVFGO2QTVTCKVXQP*GT\QI#NDTGEJV+++ FGO$GJGT\VGP #WUHÒJTWPI #WUHÒJTWPIKP5KNDGTXGTIQNFGVOKVUGRCTCVGP/GFCKNNQP TKPIGP 4KVVGTMTGW\-NCUUGOKV5EJYGTVGTP5KNDGTXGTIQNFGVWPFGOCKNNKGTVQDGTHN·EJNKEJGT'OCKNNG EJKRCWHFGOTGEJVGP-TGW\CTOFKG5EJYGTVGTGKPUGKVKICWUIGRT·IVCOCNVGPCWUIGDNKEJGPGPRGPVCIQPCN IGP·JVGP1TKIKPCNDCPF)$1'- ++p+++



-ÌPKINKEJ5·EJUKUEJGT#NDTGEJVUQTFGP/QFGNN OKVFGO2QTVTCKVXQP*GT\QI#NDTGEJV+++ FGO$GJGT\VGP #WUHÒJTWPI #WUHÒJTWPIKP5KNDGTXGTIQNFGVOKVGKPVGKNKIGP/GFCKNNQP HGNFGTP 4KVVGTMTGW\-NCUUGOKV5EJYGTVGTP5KNDGTXGTIQNFGVWPFGOCKNNKGTVFKG5EJYGTVGTGKPUGKVKI CWUIGRT·IVCO$CPF)$1'- ++



-ÌPKINKEJ5·EJUKUEJGT#NDTGEJVUQTFGP/QFGNN OKVFGO2QTVTCKVXQP*GT\QI#NDTGEJV+++ FGO$GJGT\VGP #WUHÒJTWPI #WUHÒJTWPIKP5KNDGTXGTIQNFGVOKVGKPVGKNKIGP/GFCKNNQP HGNFGTP 4KVVGTMTGW\-NCUUGOKV5EJYGTVGTP5KNDGTXGTIQNFGVWPFGOCKNNKGTVFKG5EJYGTVGTGKPUGKVKI CWUIGRT·IVCOCNVGP$CPF)$1'- ++



7PDGMCPPVGU#D\GKEJGPō&ŋ$TQP\GXGTIQNFGVWPFGOCKNNKGTVCP0CFGN

++



*'4<1)67/ $+5 70&)4155*'4<1)67/  5#%*5'0 

9'+/#4'+5'0#%*$+5  

)TQ­JGT\QINKEJ5·EJUKUEJGT*CWUQTFGPFGT9CEJUCOMGKVQFGTXQO9GK­GP(CNMGP4KVVGTMTGW\ -NCUUGOKV5EJYGTVGTP5KNDGTGOCKNNKGTVCOCNVGP$CPF1'- ++ *GTHWTVJ IKDV KP -*- 5   HÒT FGP <GKVTCWO XQP  DKU   8GTNGKJWPIGP CP 5VCCVUCPIGJÌTKIG XQP   5CEJUGP9GKOCTWPFCP#WUN·PFGTCP  )GUVKHVGV CO  #WIWUV  FWTEJ *GT\QI 'TPUV #WIWUV XQP 5CEJUGP9GKOCT YWTFG GT CO  1MVQDGT  CNU   FTGKMNCUUKIGT CNNIGOGKPGT 8GTFKGPUVQTFGP GTPGWGTV   WPF  GTHQNIVGP 'TYGKVGTWPIGP  YWTFG FCU   )TQ­MTGW\CWHIGVGKNVKP+PUKIPKGPHÒT8GTFKGPUVGWOFCUITQ­JGT\QINKEJG*CWUWPFUQNEJGHÒTCNNIGOGKPG8GTFKGPUVG 9GKVGTG8GT·PFGTWPIGPGTHQNIVGPWPF

34




DEUTSCHE STAATEN

8105

8104 1:1

8104 1:1

5%*5+5%*'*'4<1)6ª/'4)'/'+05#/ 

*GT\QINKEJ 5CEJUGP'TPGUVKPKUEJGT *CWUQTFGP  /QFGNN   -QOVWTMTGW\ )QNF VNY   ITCXKGTVWPF\KUGNKGTVGOCKNNKGTVICOPGWGP*CNUDCPFCDUEJPKVV1'- ++  &KGUG#WUHÒJTWPIGPDGKFGPGPFKG5EJY·P\GFGT.ÌYGP\YKUEJGPFGP-TGW\CTOGPCPFKGUGPHGUVIGNÌVGVUKPFYGTFGP KP#$ 5 FGO*QHLWYGNKGT'DGJCTFVKP#NVGPDWTI\WIGUEJTKGDGP  )GUVKHVGV CO  &G\GODGT  CNUIGOGKPUCOGT\WP·EJUVXKGTMNCUUKIGT*CWUQTFGP OKVCHHKNKKGTVGO8GTFKGPUVMTGW\ WPF 8GTFKGPUVOGFCKNNG  XQP (TKGFTKEJ *GT\QI XQP 5CEJUGP#NVGPDWTI 'TPUV *GT\QI XQP 5CEJUGP%QDWTI WPF    )QVJCWPF$GTPJCTF'TKEJ(TGWPF*GT\QIXQP5CEJUGP/GKPKPIGPKP#PNGJPWPICPFGPXQP*GT\QI(TKGF TKEJ XQP 5CEJUGP%QDWTI IGUVKHVGVGP 1TFGP FGT &GWVUEJGP 4GFNKEJMGKV (ÒT 8GTFKGPUVG KO -TKGI GTHQNIVG FKG   8GTNGKJWPI OKV IGMTGW\VGP 5EJYGTVGTP  GTHQNIVG GKPG 8GTGKPJGKVNKEJWPI FGT +PUKIPKGP W C FWTEJ FKG 'PVHGT   PWPIFGT/QPQITCOOGFGTXGTNGKJGPFGP*GT\ÌIGCWHFGOQDGTGP-TGW\CTOFKG7PVGTVGKNWPIFGT4KVVGTKPWPF  -NCUUG WPF FKG 5VKHVWPI FGT )QNFGPGP 8GTFKGPUVOGFCKNNG UQYKG FGT 1TFGPUMGVVG  /QFGNN   YWTFGP FKG   +PUKIPKGP OKV ,CJTGU\CJNGP ōŋ ōŋ ōŋ ōŋ ōŋ  WPF  FKG $CPFURCPIGP OKV WPF QJPG   5EJYGTVGTHÒTFKG)QNFGPGPWPF5KNDGTPGP8GTFKGPUVOGFCKNNGPIGUVKHVGV$KU\WO'PFGFGT/QPCTEJKGICDGU+PUKIPKGP OKV5EJYGTVGTPKP\YGK#WUHÒJTWPIGPOKVōTÌOKUEJGPŋ IGTCFGP WPFOKVōHTCP\ÌUKUEJGPŋ IGUEJYWPIGPGP 2CTKGT UVCPIGP FGT 5EJYGTVGT +P #$ UVGJV JKGT\W CWH 5  ō$KU \WO JGWVKIGP 6CI KUV FKG 7TUCEJG HÒT FKG 7TUCEJGP   FGT5EJYGTVGTUVÒEMGOKVIGTCFGP2CTKGTUVCPIGPQFGTIGUEJYWPIGPGP2CTKGTUVCPIGPPKEJVGKPFGWVKIIGMN·TV<WO6GKN YKTF FKG /GKPWPI XGTVTGVGP FCUU IGUEJYWPIGPG 2CTKGTUVCPIGP #NVGPDWTIGT 8GTNGKJWPIGP WPF IGTCFG 2CTKGTUVCPIGP   )QVJCGTD\Y/GKPKIGT8GTNGKJWPIGPUKPF&KGUN·UUVUKEJYGFGTFWTEJ#MVGPPQEJ.KVGTCVWTDGNGIGPQDYQJNDKUJGT CWHIGVCWEJVG\YGKHGNUHTGKG#NVGPDWTIGT5VÒEMGFGU5'*1KOOGTOKVIGUEJYWPIGPGP2CTKGTUVCPIGPXGTUGJGPYCTGP &KGU IKNV HÒT CNNG 5VWHGP XQO 8GTFKGPUVMTGW\ OKV5EJYGTVGTPDKU\WO)TQ­MTGW\OKV5EJYGTVGTPŋ#WEJPCEJFGO 'PFG FGT /QPCTEJKG XGTNKGJ *GT\QI %CTN 'FWCTF XQP 5CEJUGP%QDWTI WPF )QVJC FGP 1TFGP DKU  YGKVGT +P   FKGUGO,CJTUVKHVGVGGTPQEJFKG5EJYGTVGTCO4KPI\WCNNGP-NCUUGP/KV4GKEJUXGTQTFPWPIXQO0QXGODGT YWTFGPFKG8GTNGKJWPIGPHÒTCDIGUEJNQUUGPGTMN·TV&KG8GTNGKJWPIGPKP5CEJUGP#NVGPDWTIWPF5CEJUGP/GKPWPIGP YCTGPUEJQPOKVFGO'PFGFGT/QPCTEJKGKPFKGUGP5VCCVGPKO,CJTGGKPIGUVGNNVYQTFGP

(ª456'067/5%*9#4<$74)47&1.56#&6 $+5  

(ÒTUVNKEJ 5EJYCT\DWTIKUEJGU 'JTGPMTGW\ -TGW\  -NCUUG )QNF VNY ITCXKGTV WPF \KUGNKGTV GOCKN   NKGTVICONCPIGP$CPF1'- 4+p++



0KOOGTIWVIKD KP0+5 XQPDKUGKPG<CJNXQP8GTNGKJWPIGPCP

35


DEUTSCHE STAATEN

8107

8108 1:1

8106

8108 1:1

8'4'+0+)6'5 5'+6 (ª456'067/9#.&'%-70&2;4/106 $+5  

(ÒTUVNKEJ9CNFGEMKUEJGU8GTFKGPUVMTGW\8GTFKGPUVMTGW\-NCUUG#PHGTVKIWPICWUFGPGT,CJTGP 5KNDGTXGTIQNFGVWPFGOCKNNKGTVICOPGWGP*CNUDCPF ++





/KNKV·T8GTFKGPUVMTGW\-TGW\-NCUUG5KNDGTXGTIQNFGV8GTIQNFWPIVNYXGTICPIGP8QTFGTUGKVGP OGFCKNNQP )QNF GOCKNNKGTV  I CWH FGT 4ÒEMUGKVG FGU WPVGTGP -TGW\CTOU MNGKPGT 'OCKNNGEJKR CO   UR·VGTGP$CPF1'- ++



)CTCPVKGVGU\GKVIGPÌUUKUEJGU1TKIKPCN.CWV'HNGT KP'(95 YWTFGPXQPDKUKPUIGUCOV'ZGO RNCTGXGTNKGJGPYQXQPPCEJFGO6QFFGU+PJCDGTU\WTÒEMIGIGDGPYQTFGPUKPF

*'4<1)67/ $+5 -74(ª456'067/  70&-¤0+)4'+%* 

 9ª466'/$'4) 

1TFGPFGT9ÒTVVGODGTIKUEJGP-TQPG-TGW\FGT'JTGPTKVVGT  )QNFGOCKNNKGTVICWH FGT 4ÒEMUGKVG *GTUVGNNGTDG\GKEJPWPI ō(1'*4ŋ CP 0CFGN FKGUG 5KNDGT XGTIQNFGV KO QTKIKPCNGP TQVGP   8GTNGKJWPIUGVWKFGT(KTOC'FWCTF(QGJTKP5VWVVICTV1'- 4+p++  #WHITWPFFGTUGJTUR·VGP'KPHÒJTWPIFKGUGT-NCUUGKUVGKPGTGNCVKXIGTKPIG8GTNGKJWPIU\CJNGEJVIQNFGPGT'ZGORNCTG CP\WPGJOGP 5KEJGT YKTF FKG KP -ÒT\G GTUEJGKPGPFG FKGUDG\ÒINKEJG /QPQITCRJKG XQP &T 7NTKEJ -NGKP WPF #NDGTV   4CHH &KG 9ÒTVVGODGTIKUEJGP /GFCKNNGP UGKV   'KPUEJNKG­NKEJ FGT 1TFGP WPF 'JTGP\GKEJGP  FGWVNKEJ 5VGNNWPI   JKGT\WDG\KGJGP  'FWCTF(QGJTNKGHGTVGNCWV8QNNOGT 8QNNOGT/CVVJKCU&GT-ÌPKINKEJYÒTVVGODGTIKUEJG*QHLWYGNKGT'FWCTF(QGJT +P 1' XQO (GDTWCT  5 HH  UGKV  YÒTVVGODGTIKUEJG 1TFGP WPF 'JTGP\GKEJGP YWTFG  \WO   *QHLWYGNKGTGTPCPPVWPFNKGHGTVGDKUKPFGP'TUVGP9GNVMTKGIJKPGKPCNUGTPCEJWPFPCEJXQO-ÌPKINKEJGP/ÒP\COV CNU.KGHGTCPVCDIGNÌUVYWTFG

8109 1:1



36

1TFGP FGT 9ÒTVVGODGTIKUEJGP -TQPG 4KVVGTMTGW\ OKV 5EJYGTVGTP   )QNF GOCKNNKGTV   #WUHÒJTWPIOKVUVCTTOQPVKGTVGP5EJYGTVGTP)QNFGOCKNNKGTVI OKV$CPF OKP'OCKNNGTGRCTCVWT KPGKPGT-TGW\CTOURKV\G$CPFTKPIGTI·P\VCO$CPF1'- 4++ 


DEUTSCHE STAATEN

8110

8110 8111 1:1



*GT\QINKEJ   D\Y -ÌPKINKEJ   9ÒTVVGODGTIKUEJGT /KNKV·T8GTFKGPUVQTFGP     /QFGNN OKV /QPQITCOO ō9-ŋ CWH FGO 4GXGTU/GFCKNNQP -TGW\ QJPG -TQPG      4KVVGTMTGW\5KNDGTXGTIQNFGVWPFGOCKNNKGTVCOQTKIKPCNGP$CPF1'- +p++ 



-ÌPKINKEJ9ÒTVVGODGTIKUEJGT (TKGFTKEJU1TFGP  /QFGNN OGJTMNCUUKI    \YGKVG XQNW   OKPÌUGTG#WUHÒJTWPI-QOVWTMTGW\)QNFGOCKNNKGTVIō(ŋ#WHNCIGPHGKPUV\KUGNKGTVOKVMWT\GO IGVTCIGPGP *CNUDCPFUVÒEM KO QTKIKPCNGP JGTXQTTCIGPF GTJCNVGPGP 8GTNGKJWPIUGVWK FGT (KTOC 'FWCTF   (QGJTKP5VWVVICTV1'- +p++  #WHITWPFFGTUGJTHGKPGP<KUGNKGTWPIFGTō(ŋ#WHNCIGPJCPFGNVGUUKEJJKGTDGKWOGKPGHTÒJG#PHGTVKIWPIFGT(KTOC (QGJTXQO#PHCPIFGUNGV\VGP3WCTVCNUFGU0GWP\GJPVGP,CJTJWPFGTVU  &GT \WP·EJUV GKPMNCUUKIG 1TFGP YWTFG CO ,CPWCTXQP-ÌPKI9KNJGNO+XQP9ÒTVVGODGTI  KP 'TKPPGTWPICPUGKPGP8CVGT-ÌPKI(TKGFTKEJ+  IGUVKHVGVYWTFGFGT1TFGPCWHXKGT-NCUUGPGTYGK VGTV /QFGNN )TQ­MTGW\-QOVWTWPF-NCUUGWPF4KVVGTGTHQNIVGFKG7PVGTVGKNWPIFGT4KVVGTKPGKPG GTUVG WPF GKPG \YGKVG -NCUUG <WFGO YWTFGP HÒT FKG -TGW\G CNNGT -NCUUGP FKG 5EJYGTVGT IGUVKHVGV  GTJKGNVGP   CWEJFKG1TFGPUUVGTPGFKG5EJYGTVGT&KG)QNFGPG8GTFKGPUVOGFCKNNGYWTFGIGUVKHVGVWPFFCU)TQ­MTGW\ OKV-TQPG/KVFGT#DUEJCHHWPIFGT/QPCTEJKGKO0QXGODGTGTNQUEJCWEJFGT1TFGP

8112





8113

8114

-ÌPKINKEJ9ÒTVVGODGTIKUEJGT (TKGFTKEJU1TFGP  /QFGNN OGJTMNCUUKI    \YGKVG XQNW   OKPÌUGTG #WUHÒJTWPI 4KVVGTMTGW\  -NCUUG #PHGTVKIWPI FGU -ÌPKINKEJGP/ÒP\COVUKP5VWVVICTV\YK UEJGPWPF5KNDGTXGTIQNFGVWPFGOCKNNKGTVMCWOUKEJVDCTG'OCKNNGTGRCTCVWTKPGKPGT'EMGFGT 4ÒEMUGKVGFGUQDGTGP-TGW\CTOUCONCPIGPCNVGP1TKIKPCNDCPF1'- ++



-ÌPKINKEJ9ÒTVVGODGTIKUEJGT (TKGFTKEJU1TFGP  /QFGNN OGJTMNCUUKI    \YGKVG XQNW   OKPÌUGTG #WUHÒJTWPI 4KVVGTMTGW\  -NCUUG OKV 5EJYGTVGTP  )QNFGOCKNNKGTVIFKG ō(ŋ#WHNCIGP WPF FKG UVCTT CPIGNÌVGVGP 5EJYGTVGT 5KNDGT XGTIQNFGV FGT WTURTÒPINKEJG $CPFTKPI FWTEJ   \YGK4KPIGGTUGV\VCOCNVGP$CPF1'- ++



'UJCPFGNVUKEJJKGTDGKWOGKPFWTEJFKG(KTOC(QGJTY·JTGPFFGU'TUVGP9GNVMTKGIGUPCEJIGTÒUVGVGUPCEJ#DNGDGP FGU GTUVGP $GNKGJGPGP TGVQWTPKGTVGU 'ZGORNCT WTURTÒPINKEJ ·NVGTGT #PHGTVKIWPI +O 8GTNCWH FKGUGT 0CEJTÒUVWPI   YWTFGPFKGOÌINKEJGTYGKUGXGTNQTGPIGICPIGPGPQFGTDGUEJ·FKIVGP(/QPQITCOOGFWTEJUQNEJGKP5KNDGTXGTIQNFGV GTUGV\V



-ÌPKINKEJ9ÒTVVGODGTIKUEJGT (TKGFTKEJU1TFGP  /QFGNN OGJTMNCUUKI    \YGKVG XQNW   OKPÌUGTG#WUHÒJTWPI4KVVGTMTGW\-NCUUGOKV5EJYGTVGTP  #PHGTVKIWPIFGU-ÌPKINKEJGP /ÒP\COVUKP5VWVVICTV\YKUEJGPWPF5KNDGTXGTIQNFGVWPFGOCKNNKGTV'OCKNNGEJKRKPGKPGO WPF 'OCKNNGURTWPI KO CPFGTGP /GFCKNNQP OKV GTI·P\VGO $CPFTKPI CO &TGKGEMUDCPF 1'-    ++p+++

 37


DEUTSCHES REICH 1871-1918

8116

8117

8115 Rv.



(CJPGPOGFCKNNGHÒT-TKGIGTXGTGKPG$TQP\GXGTUKNDGTVQJPG$CPF1'-

4++



)GUVKHVGVCO0QXGODGTFWTEJ-ÌPKI9KNJGNO++XQP9ÒTVVGODGTI  WPFDKUCPYÒTVVGO DGTIKUEJG-TKGIGTXGTGKPGXGTNKGJGPFKGKJTL·JTKIGU$GUVGJGPHGKGTVGP

&'765%*'54'+%* 

,GTWUCNGOMTGW\  1TKIKPCNGZGORNCT 5KNDGT XGTIQNFGV WPF GOCKNNKGTV  I OKV $CPF   OO   UVCTMCO$CPF0/1'- 44++



)CTCPVKGTVGU \GKVIGPÌUUKUEJGU 1TKIKPCNGZGORNCT YKG FGT 8GTINGKEJ OKV FGT HQNIGPFGP 2QUKVKQP FGWVNKEJ DGYGKUV #NU   UQNEJGUPWTUGJTUGNVGP\WHKPFGP  .CWV0KOOGTIWV KP0+5\KVKGTVPCEJ/KTDCEJ&CUFGWVUEJG-CKUGTRCCTKO*GKNKIGP.CPFGKO*GTDUV $GTNKP   PCJOGP KPUIGUCOV  2GTUQPGP CP FKGUGT 4GKUG VGKN YQXQP  CNU QHHK\KGNNG 6GKNPGJOGT ICNVGP 1D   LGFQEJCNNGFKGUG6GKNPGJOGTFCU,GTWUCNGOMTGW\GTJCNVGPJCDGPMQPPVGDKUJGTPKEJVHGUVIGUVGNNVYGTFGP



,GTWUCNGOMTGW\#PHGTVKIWPICWUFGPGT,CJTGP5KNDGTXGTIQNFGVWPFGOCKNNKGTVI OKV $CPF OOUVCTMCO$CPF ++





-QPXQNWV XQP XKGT (GNF\WIU/GFCKNNGP %JKPC&GPMOÒP\G 5ÒFYGUVCHTKMC&GPMOÒP\G   WPF -QNQ   PKCN&GPMOÒP\GLGYGKNUHÒT-QODCVVCPVGP$TQP\GKPWPVGTUEJKGFNKEJGP'TJCNVWPIGPCP$·PFGTP  5VÒEM++



8119

8120



#D\GKEJGP HÒT /KNKV·T(NWI\GWIÒJTGT /GUUUKPIDNGEJ XGTUKNDGTV CP 0CFGN KO CNVGP 'VWK 0/   1'- ++





#D\GKEJGP HÒT /KNKV·T(NWI\GWIÒJTGT /GUUUKPIDNGEJ XGTUKNDGTV CP 0CFGN KO CNVGP 'VWK 0/   1'- ++



38


DEUTSCHES REICH 1871-1918

8121 1:1



5EJKG­RTGKUOGFCKNNG FGU FGWVUEJÌUVGTTGKEJKUEJGP .CPFUVWTO 5EJKG­MWTUGU KP 5QPVJQHGP5KN DGTQJPG$CPF ++





/GFCKNNG CWH FGP 4ÒEMVTKVV FGU 4GKEJUMCP\NGTU (ÒTUV 1VVQ XQP $KUOCTEM 0KEJV VTCIDCT XQP 9   /C[GT &WTEJOGUUGT  OO 5KNDGT \YGK 'ZGORNCTG \WUCOOGP OKV &CPMUEJTGKDGP FGU (ÒTUVGP   FCVKGTV (TKGFTKEJUTWJ  #RTKN  1TKIKPCNWPVGTUEJTKHV \YGKOCN IGHCNVGV KO OQFGTPGP $KNFGT   TCJOGP 5VÒEM++



*ÒDUEJGU'PUGODNG

8123 1:1



/GFCKNNG CWH FGP 4ÒEMVTKVV FGU 4GKEJUMCP\NGTU (ÒTUV 1VVQ XQP $KUOCTEM 0KEJV VTCIDCT XQP 9   /C[GT&WTEJOGUUGTOO5KNDGT +p++



8124 1:1

&'765%*'54'+%* 51)'09'+/#4'44'27$.+-  

-CORHYCIGP#D\GKEJGP /GUUKPIDNGEJ JQJN IGRT·IV WPF XGTDÌFGV XGTUKNDGTV CP 0CFGN KO PGWGP   'VWK0/D1'- 4++  #NU1TKIKPCNUGNVGP\WHKPFGP

39


DEUTSCHES REICH 1933-1945

&'765%*'54'+%* 51)'0&4+66'54'+%*  5QNCPIGUKEJ-WPFGWPF8GTM·WHGTPKEJVIGIGPVGKNKI·W­GTPXGTUKEJGTPUKGFCUUUKG)GIGPUV·PFG WPF $ÒEJGT CWU FGT <GKV FGU &GWVUEJGP 4GKEJGU XQP  DKU  PWT \W <YGEMGP FGT   UVCCVUDÒTIGTNKEJGP#WHMN·TWPIFGT#DYGJTXGTHCUUWPIUYKFTKIGT$GUVTGDWPIGPFGT-WPUVQFGTFGT 9KUUGPUEJCHV FGT (QTUEJWPI QFGT FGT .GJTG FGT $GTKEJVGTUVCVVWPI ÒDGT 8QTI·PIG FGU   <GKVIGUEJGJGPU QFGT FGT )GUEJKEJVG QFGT ·JPNKEJGP <YGEMGP GTYGTDGP &KGUG )GIGPUV·PFG WPF   $ÒEJGTYGTFGPITWPFU·V\NKEJPWTWPVGTFKGUGP8QTCWUUGV\WPIGPCPIGDQVGPWPFCDIGIGDGP   5QOKV UVGNNV FGT 'TYGTD XQP )GIGPUV·PFGP WPF $ÒEJGTP CWU FKGUGT <GKV WPVGT FGP QDGP   CWHIGHÒJTVGP 8QTCWUUGV\WPIGP IGO·­ FGT hh C #DU  D\Y  #DU  5V)$ MGKPGP   5VTCHVCVDGUVCPF KO 5KPPG FGU h C #DU  5V)$ FCT 7PVGT FKGUGP 7OUV·PFGP KUV GU CNUQ   ITWPFU·V\NKEJ GTNCWDV 1TFGP WPF 'JTGP\GKEJGP FKG KP h#DU)GUGV\ÒDGT6KVGN1TFGPWPF 'JTGP\GKEJGP PKEJV CWHIGHÒJTV UKPF UQYKG #D\GKEJGP OKV PCVKQPCNUQ\KCNKUVKUEJGP 'ODNGOGP \W   XGTMCWHGPWPF\WGTYGTDGPWPFFKGUGPVIGIGPFGP$GUVKOOWPIGPFGUh#DU)GUGV\ÒDGT6KVGN 1TFGPWPF'JTGP\GKEJGP   &GUJCND JCV FGT $WPFGUOKPKUVGT FGT ,WUVK\ OKV 5EJTGKDGP  ++  XQO    FGOUGKPGT\GKVKIGP8QTUKV\GPFGPFGU$WPFGUFGWVUEJGT1TFGPUUCOONGTG8CWUFTÒEMNKEJGTMN·TV FCUU FGT 'TYGTD XQP 1TFGP WPF 'JTGP\GKEJGP CWU FGT <GKV FGU UQIGPCPPVGP ō&TKVVGP 4GKEJGUŋ   FWTEJ GTPUVJCHVG WPF QTICPKUKGTVG 5COONGT OKV FGO <KGN FKGUGP )GIGPUVCPF KP GKPG 5COONWPI   GKP\WHÒIGPMGKPGP5VTCHVCVDGUVCPFKO5KPPGFGU)GUGV\GUFCTUVGNNV



8GTFKGPUVQTFGPXQO&GWVUEJGP#FNGT DKU D\Y&GWVUEJGT#FNGTQTFGP/KPKCVWTFGU1TFGPU MTGW\GU#WUHÒJTWPIOKV#ITCHHG5KNDGTXGTIQNFGVWPFGOCKNNKGTVCO$·PFEJGP 4++





1TFGP FGU 'KUGTPGP -TGW\GU   'KUGTPGU -TGW\  + -NCUUG HNCEJG #WUHÒJTWPI 'KUGPMGTP   IGUEJY·T\VVNYPCEJNCEMKGTVXGTUKNDGTVCP0CFGNFKGUGOKV*GTUVGNNGTRWP\Gō.ŋ0/  ++p+++



1TFGPFGU'KUGTPGP-TGW\GU  -QPXQNWVXQP'KUGTPGP-TGW\GP++-NCUUGLGYGKNU'KUGP MGTPIGUEJY·T\V<CTIGXGTUKNDGTVGKPGUKO4KPIRWP\KGTVLGYGKNUCP$·PFGTP0/  5VÒEM++



1TFGPFGU'KUGTPGP-TGW\GU  9KGFGTJQNWPIUURCPIG\WO'KUGTPGP-TGW\++-NCUUG #WUHÒJTWPI OKVTWPFGP5GKVGPT·PFGTPXQP XGTUKNDGTVOKVXKGTHNCEJGP5RNKPVGPCWHIGNGIVCWH $CPF\WO'-++0/C 4++



1TFGPFGU'KUGTPGP-TGW\GU  9KGFGTJQNWPIUURCPIG\WO'KUGTPGP-TGW\++-NCUUG  #WUHÒJTWPI OKV IGTCFGP 5GKVGPT·PFGTP XQP   XGTUKNDGTV OKV XKGT HNCEJGP 5RNKPVGP 0/   D ++



1TFGPFGU-TKGIUXGTFKGPUVMTGW\GU  -TKGIUXGTFKGPUVMTGW\+-NCUUGOKV5EJYGTVGTP$WPVOGVCNN XGTUKNDGTV OKV DTGKVGT IGTCFGT URKV\GT 0CFGN KO QTKIKPCNGP UKNDGTP DGFTWEMVGP 8GTNGKJWPIUGVWK 0/    ++





1TFGPFGU-TKGIUXGTFKGPUVMTGW\GU  -TKGIUXGTFKGPUVMTGW\+-NCUUGOKV5EJYGTVGTP$WPVOGVCNN XGTUKNDGTVOKVDTGKVGTIGTCFGTURKV\GT0CFGNFKGUGRWP\KGTV0/ ++





8GTYWPFGVGPCD\GKEJGP  #WUICDG  #D\GKEJGP KP )QNF /GUUKPIDNGEJ JQJN IGRT·IV   WPF   XGTIQNFGV QJPG *GTUVGNNGTRWP\GP CP 0CFGN \WUCOOGP OKV $GUKV\<GWIPKU HÒT OCNKIG 8GTYWPFWPI   HÒTFGP1DGTIGHTGKVGP1VVQ.ÒEMXQPFGT#WHMN·TWPIU'TUCV\#DVGKNWPIKP5VQNRFCVKGTV(NGPUDWTI COOKV1TKIKPCNWPVGTUEJTKHVGKPGU1DGTUVCT\VGUIGHCNVGV ++











&T-NKGVOCPPUEJTGKDVJKGT\W KP-.5 ō7TURTÒPINKEJFJDKUGVYCYWTFGFCU#D\GKEJGPKP5EJYCT\ JQJN IGRTG­V Y·JTGPF FKG #D\GKEJGP KP 5KNDGT WPF )QNF OCUUKX JGTIGUVGNNV YWTFGP 5GKV  CDGT WPF \YCT DKU   'PFGFGU-TKGIGUUKPFCWEJFKGUKNDGTPGPWPFIQNFGPGP#D\GKEJGPVGKNYGKUGJQJNIGRTG­VIGNKGHGTVYQTFGPŋ

40


DEUTSCHES REICH 1933-1945

ex 8133 1:1



&GWVUEJGU 4GKVGTCD\GKEJGP 4GKVGTCD\GKEJGP KP $TQP\G CWH FGT 4ÒEMUGKVG *GTUVGNNGTDG\GKEJPWPI FGT   (KTOC.%JT.CWGTKP0ÒTPDGTIWPF$GTNKPCP0CFGN\WUCOOGPOKV/KPKCVWTPCFGN0/$E 5VÒEM++



#WU\GKEJPWPIUPCEJNC­ GKPGU FGWVUEJGP 5QNFCVGP $GUVGJGPF CWU  #WU\GKEJPWPIGP   0CJMCORH   URCPIGKP$TQP\G<KPMCWUHÒJTWPIXQTFGTUGKVKIG$TQP\KGTWPIHCUVXQNNUV·PFKIXGTICPIGPCWHFGT4ÒEM UGKVG*GTUVGNNGTDG\GKEJPWPIō%9'2''-*#75$'4.+0ŋWPFō(..ŋKP-TGKUGPCP0CFGN 'KUGTPGU -TGW\(TQPVHGTVKIWPIFGU'-+CWUGKPGO'-++FWTEJCWHFGT4ÒEMUGKVGCPIGNÌVGVG¤UGP 5KNDGT PGU +PHCPVGTKG5VWTOCD\GKEJGP <KPMCWUHÒJTWPI CP 0CFGN   5EJYCT\GU 8GTYWPFGVGPCD\GKEJGP CP   0CFGN 5VÒEM++



#WU\GKEJPWPIUPCEJNC­ GKPGU FGWVUEJGP 5QNFCVGP 1TFGPUUEJPCNNG OKV  #WU\GKEJPWPIGP   9GJT   OCEJVU&KGPUVCWU\GKEJPWPIHÒT&KGPUVLCJTG 9GJTOCEJVU&KGPUVCWU\GKEJPWPIHÒT&KGPUVLCJTG  /GFCKNNG\WT'TKPPGTWPICPFGP/·T\(GNFUEJPCNNGHÒTFKGINGKEJGP#WU\GKEJPWPIGPRNWU'- ++  WPF /GFCKNNG 9KPVGTUEJNCEJV KO 1UVGP  +PHCPVGTKG5VWTOCD\GKEJGP KP 5KNDGT <KPM   5EJYCT\GU8GTYWPFGVGPCD\GKEJGPOKVXQNNMQOOGPXGTICPIGPGT.CEMKGTWPI/ÒV\GPCFNGT\YGK5RNKPVG HGJNGP 5VÒEM++



'ZGORNCTCWUWPUGTGT#WMVKQP1TFGPWPF'JTGP\GKEJGPCO1MVQDGT0T





8136 1:1







/KPKCVWTGP5EJPCNNG GKPGU URCPKUEJGP 1HHK\KGTU FGT 5RCPKUEJGP (TGKYKNNKIGP $NCWGP &KXKUKQP  OKV   UGEJUXQPWTURTÒPINKEJUKGDGP#WU\GKEJPWPIUOKPKCVWTGP /GFCKNNGHÒT+HPK5CJCTC#WUICDG HÒT 1HHK\KGTG   /KNKV·T8GTFKGPUVQTFGP  /QFGNN   TQVG #DVGKNWPI -TGW\  -NCUUG OKV   2GPUKQPUUVTGKHGP /KNKV·T8GTFKGPUVQTFGP/QFGNN  YGK­G#DVGKNWPI5VGTP-NCUUG   /KNKV·TKUEJGT 1TFGP FGU JN *GTOGPGIKNFQ $TWUVUVGTP  -NCUUG   &GWVUEJGU 4GKEJ &GWVUEJGT   #FNGT1TFGP-NCUUGOKV5EJYGTVGTP &GWVUEJGU4GKEJ'KUGTPGU-TGW\++-NCUUG#P0CFGN &C\W 4GXGTUOKPKCVWT FGU $TWUVUVGTPU  -NCUUG FGU /KNKV·TKUEJGP 1TFGPU FGU JN *GTOGPGIKNFQ CP   0CFGN 5VÒEM++



-QPXQNWV XQP HÒPH XGTUEJKGFGPGP #WU\GKEJPWPIGP &CTWPVGT '- +  5EJYCT\GU WPF 5KNDGTPGU   8GTYWPFGVGPCD\GKEJGP5WFGPVGPNCPFOGFCKNNGOKV5RCPIG2TCIGT$WTI&C\W'-++WPF(KPPKUEJG (TGKJGKVUOGFCKNNG++-NCUUG#WEJ-QRKGPXGTUEJKGFGPG/GVCNNGKPWPVGTUEJKGFNKEJGP'TJCNVWPIGP VGKNUCP0CFGNVGKNUCP$·PFGTP 5VÒEM++



-QPXQNWV XQP  #WU\GKEJPWPIGP &CTWPVGT -TKGIUXGTFKGPUVMTGW\  -NCUUG OKV 5EJYGTVGTP     -TKGIUXGTFKGPUVOGFCKNNG/GFCKNNG9KPVGTUEJNCEJVKO1UVGP&GWVUEJGU5EJWV\YCNN'JTGP\GK EJGP5WFGPVGPNCPFOGFCKNNG#WEJ-QRKGPXGTUEJKGFGPG/GVCNNGKPWPVGTUEJKGFNKEJGP'TJCNVWPIGPVGKNU CP0CFGNVGKNUCP$·PFGTP 5VÒEM+++++++

 41


BUNDESREPUBLIK DEUTSCHLAND 



-QPXQNWVXQPXKGT#WU\GKEJPWPIGP7C55&KGPUVCWU\GKEJPWPI5VWHGKOTWPFGP4KPIRWP\KGTV . 6TGWFKGPUV'JTGP\GKEJGP KP 5KNDGT WPF$TQP\GFGT5VCFV&CP\KIWPF4GVVWPIUOGFCKNNGCO$CPF &C\WHÒPHYGKVGTGFGWVUEJG'JTGPWPF#D\GKEJGP#WEJ-QRKGPXGTUEJKGFGPG/GVCNNG CWEJ5KNDGT KP XGTUEJKGFGPGP'TJCNVWPIGPVGKNUCP$·PFGTP 5VÒEM++



-QPXQNWVXQPXKGT7PKHQTOGHHGMVGPWPFGKPGOTOGNDCPF2CCT5EJWNVGTUVÒEMGWPF2CCT-TCIGP URKGIGN GKPGU )GPGTCNU FGT 9GJTOCEJV QJPG 5VGTPG  WPF TOGNDCPF FGT 55 6GKNU IGUVKEMV KP WPVGT   UEJKGFNKEJGT'TJCNVWPI 5VÒEM++



$70&'54'27$.+-&'765%*.#0& 5'+6  1TFGP WPF 'JTGP\GKEJGP FGT $WPFGUTGRWDNKM &GWVUEJNCPF WPF KJTGT $WPFGUN·PFGT GDGPUQ YKG   FGTGP /KPKCVWTGP $CPFUVGIG -PQRHNQEJUEJNGKHGP WPF $CPFUEJPCNNGP FÒTHGP IGO·­ h  #DU     )GUGV\ÒDGT6KVGN1TFGPWPF'JTGP\GKEJGPPWTCP$GTGEJVKIVGCDIGIGDGPYGTFGP#NU$GTGEJVKIVG IGNVGP JKGTDGK PGDGP FGP $GNKGJGPGP CWEJ CNNG FKGLGPKIGP 2GTUQPGP FKG KO $GUKV\ GKPGT   5COOGNIGPGJOKIWPI UKPF &KGUG 5COOGNIGPGJOKIWPI GTVGKNV CWH #PHTCIG FKG LGYGKNU \WUV·PFKIG   $GJÌTFG &KG<WUV·PFKIMGKVKUVKPFGPGKP\GNPGP$WPFGUN·PFGTPWPVGTUEJKGFNKEJIGTGIGNV &KG'TVGK NWPI GKPGT UQNEJGP )GPGJOKIWPI MCPP IGO·­ FGU -QOOGPVCTU \WO )GUGV\ XQP FGT \WUV·PFKIGP   $GJÌTFG PWT DGK 8QTNKGIGP UEJYGTYKGIGPFGT )TÒPFG XGTYGKIGTV YGTFGP /KV GKPGO )GDQV CWH   1TFGP WPF 'JTGP\GKEJGP FGT $WPFGUTGRWDNKM WPF KJTGT $WPFGUN·PFGT XGTUKEJGTV FGT $KGVGT KO   QTFPWPIUIGO·­GP$GUKV\GKPGTUQNEJGP5COOGNIGPGJOKIWPI\WUGKP

8141 1:1



8GTFKGPUVQTFGP FGT $WPFGUTGRWDNKM &GWVUEJNCPF 5GV FGT 5QPFGTUVWHG FGU )TQ­MTGW\GU HÒT *GTTGP   DGUVGJGPFCWU-NGKPQF$TQP\GXGTIQNFGVWPFGOCKNNKGTVCOQTKIKPCNGP5EJWNVGTDCPFOKVJCPFIGUVKEMVGP $WPFGUCFNGTPWPF$TWUVUVGTP CEJVUVTCJNKI 5KNDGTXGTIQNFGVWPFVNYGOCKNNKGTVQJPG*GTUVGNNGTRWP\GP OKV5KNDGTRWP\GōŋCP0CFGNKOQTKIKPCNGPTQVGP  OKVIQNFHCTDGPGO$WPFGUCFNGTDGFTWEMVGP8GT NGKJWPIUGVWKFGT(KTOC5VGKPJCWGT.ÒEMKP.ÒFGPUEJGKF5. 4++  &KG 5QPFGTUVWHG KUV CWUUEJNKG­NKEJ 5VCCVUQDGTJ·WRVGTP WPF FGTGP )GOCJNKPPGP XQTDGJCNVGP WPF YKTF GZ QHHKEKQ XQO   $WPFGURT·UKFGPVGPIGVTCIGP  &GT 8GTFKGPUVQTFGP FGT $WPFGUTGRWDNKM &GWVUEJNCPF CWEJ $WPFGUXGTFKGPUVQTFGP IGPCPPV  YWTFG XQP $WPFGURT·UK   FGPV2TQH&T6JGQFQT*GWUU  OKV'TNC­XQO5GRVGODGT XGTÌHHGPVNKEJVKO$WPFGUIGUGV\DNCVV+ XQP5 CNU\WP·EJUVHÒPHMNCUUKIGTCNNIGOGKPGT8GTFKGPUVQTFGPIGUVKHVGV8GTUEJKGFGPGPFGTWPIGPKPFGP ,CJTGP  WPF  HÒJTVGP \W OKVVNGTYGKNG PGWP -NCUUGP <WT )GUEJKEJVG FGU 1TFGPU WPF UGKPGT 'PVYKEMNWPI   XIN)GKIGT4QNH.KPFPGT,ÒTIGPWPF9ÌTPGT(TCPM,CJTG8GTFKGPUVQTFGPFGT$WPFGUTGRWDNKM&GWVUEJNCPF +P1TFGPWPF'JTGP\GKEJGP&CU/CIC\KPHÒT5COONGTWPF(QTUEJGT,CJTICPI*GHV#WIWUV5HH

42


BUNDESREPUBLIK DEUTSCHLAND

8143 1:1

8142 1:1



8GTFKGPUVQTFGP FGT $WPFGUTGRWDNKM &GWVUEJNCPF 5VGTP \WO )TQ­GP 8GTFKGPUVMTGW\ 5KNDGT XGTIQN   FGVVNYGOCKNNKGTVCP0CFGNFKGUGOKV*GTUVGNNGTRWP\Gō5V.ŋFGT(KTOC5VGKPJCWGT.ÒEMKP.Ò FGPUEJGKFWPF5KNDGTRWP\GōŋQJPG4GXGTUOKPKCVWTKOUGRCTCVGPOKVIQNFHCTDGPGO$WPFGUCFNGTDG FTWEMVGP8GTNGKJWPIUGVWKXQP5VGKPJCWGT.ÒEM5. ++



.CWV'KPNKGHGTGTXGTNKGJGPCP)GPGTCNFKTGMVQTC&*CPU4KVVGTWPF'FNGTXQP4CWUEJGTCWH9GGI



8GTFKGPUVQTFGP FGT $WPFGUTGRWDNKM &GWVUEJNCPF )TQ­GU 8GTFKGPUVMTGW\ $TQP\G XGTIQNFGV WPF   GOCKNNKGTVOKP-QTTQUKQPUURWTGPCOQTKIKPCNGP*CNUDCPFQJPG4GXGTUOKPKCVWTKOOKVIQNFHCTDGPGO $WPFGUCFNGTDGFTWEMVGP8GTNGKJWPIUGVWKXQP5VGKPJCWGT.ÒEMKP.ÒFGPUEJGKF<WUCOOGPOKVWPFC VKGTVGT<GKVWPIUPQVK\ÒDGTFKG8GTNGKJWPIWPFUY2JQVQGKPGU8QTHCJTGPFGU$GNKGJGPGP(GNKZXQP4CW UEJGT  -CPQPKMWUKP.CPFUJWV5. ++



.CWV'KPNKGHGTGTXGTNKGJGPXQO$C[GTKUEJGP/KPKUVGTRT·UKFGPV&T9KNJGNO*QGIPGT /KPKUVGTRT·UKFGPV XQPDKUWPFXQPDKU CP)GPGTCNFKTGMVQTC&*CPU4KVVGTWPF'FNGTXQP4CWUEJGTCWH9GGI

8144



-NGKPQF FGU 5EJNCTCHHGP4G[EJGU (T[DWTIKC $TKUIQXKCG (TGKDWTI KO $TGKUICW  $TQP\G XGTIQNFGV   WPF GOCKNNKGTV CWH FGT 4ÒEMUGKVG *GTUVGNNGTDG\GKEJPWPI FGT (KTOC 2QGNNCVJ KP 5EJTQDGPJCWUGP CP   GOCKNNKGTVGT6TCIGURCPIG 4++



 \·JNVG FCU 4G[EJ CEJV 9ÒTFGPVT·IGT  UG­JCHVG 4KVVGT FTGK ,WPMGT WPF -PCRRGP XKGT (CJTGPFG WPF PGWP   'JTGP4KVVGT

43


DEUTSCHLAND - ROTES KREUZ

ex 8145

&'765%*.#0&('7'49'*4 

#WU\GKEJPWPIUPCEJNC­ FGU 4GIKGTWPIUTCVGU (TCP\ <CWPGT 2T·UKFGPV FGU 5CN\DWTIGT .CPFGUXGT   DCPFGUHÒT(GWGTYGJTWPF4GVVWPIUYGUGPKP5CN\DWTI &GWVUEJGU4GKEJ&GWVUEJGU(GWGTYGJT 'JTGPMTGW\-NCUUG5KNDGTXGTIQNFGVWPFDGKFUGKVKITQVGOCKNNKGTVCONCPIGP1TKIKPCNDCPFOKVGKIG P·JVGO-PQRHNQEJFCTCPDGHGUVKIV#D\GKEJGPFGU&GWVUEJGP(GWGTYGJT8GTDCPFGUOKVQTKIKPCN8GTNGK JWPIUWTMWPFGFCVKGTV/ÒPEJGPCO/CKOKVªDGTUGPFWPIUUEJTGKDGP $C[GTP(GWGYGJT 'JTGPMTGW\FGU.CPFGU(GWGTYGJT8GTDCPFGUOKV$GMTÌPWPICOYGK­TQVGP$CPF5KNDGTXGTIQNFGVWPF VNY GOCKNNKGTV CO QTKIKPCNGP $CPF OKV 2JQVQMQRKG FGT 8GTNGKJWPIUWTMWPFG WPF QTKIKPCNGO ªDGTUGP   FWPIUUEJTGKDGPFCVKGTV#RTKN ¤UVGTTGKEJ/KNKV·T8GTFKGPUVMTGW\+++-NCUUGOKV-TKGIUFGMQ TCVKQPWPF5EJYGTVGTP5KNDGTVNYXGTIQNFGVWPFGOCKNNKGTVKPFGT¤UG*GTUVGNNGTRWP\Gō8/ŋFGT(KTOC 8KPE/C[GT U5ÌJPGKP9KGPWPF&KCPCMQRHRWP\GHÒTGT5KNDGTCO&TGKGEMUDCPFOKV5EJYGTVGTP KO IQNFGP DGFTWEMVGP 8GTNGKJWPIUGVWK FGT (KTOC 4QVJG KP 9KGP   ¤UVGTTGKEJ 5KNDGTPG /KNKV·TXGT   FKGPUVOGFCKNNG5KIPWO.CWFKU/QFGNNOKV2QTVTCKV-CKUGT(TCP\,QUGRJU+5KNDGTKO4KPI*GTUVGNNGT RWP\G,<FGT(KTOC<KODNGTKP9KGPWPFō9KPFJWPFMQRH#ŋ2WP\GPDKUHÒTGT5KNDGTCO&TGK GEMUDCPF OKV CWHIGNGIVGP 5EJYGTVGTP KO QTKIKPCNGP GVYCU DGUEJ·FKIVGP 8GTNGKJWPIUGVWK FGT (KTOC   <KODNGT   ¤UVGTTGKEJ $QP\GPG /KNKV·TXGTFKGPUVOGFCKNNG 5KIPWO .CWFKU /QFGNN OKV 2QTVTCKV -CKUGT   (TCP\,QUGRJU+$TQP\GXGTIQNFGVCO&TGKGEMUDCPFOKVCWHIGNGIVGP5EJYGTVGTPKOQTKIKPCNGP8GTNGK JWPIUGVWK FGT (KTOC <KODNGT   ¤UVGTTGKEJ -CTNU6TWRRGPMTGW\ -TKGIUOGVCNN OKV 4GUVXGTUKNDGTWPI   CO &TGKGEMUDCPF   ¤UVGTTGKEJ 8GTYWPFGVGPOGFCKNNG -TKGIUOGVCNN CO $CPF HÒT GKPG 8GTYWPFWPI    ¤UVGTTGKEJ/KNKV·T,WDKN·WOUMTGW\CO&TGKGEMUDCPF&C\W4GRTQ2JQVQITCRJKGFKG<CWPGTKP 7PKHQTOOKVFKGUGP#WU\GKEJPWPIGP\GKIVKPUDGUQPFGTUOKVFGTDGUQPFGTGP6TCIGYGKUGFGU&GWVUEJGP (GWGTYGJT'JTGPMTGW\GUCONCPIGP$CPFKO-PQRHNQEJ 5VÒEM44++  'Z  #WMVKQP #PFTGCU 6JKGU XQO  DKU  #RTKN  0T  0CJG\W XQNNUV·PFKIG #WU\GKEJPWPIUITWRRG   GKPGUJQJGPÌUVGTTGKEJKUEJGP(GWGTYGJT(WPMVKQP·TUOKVDGFGWVGPFGPFGWVUEJGP(GWGTYGJT#WU\GKEJPWPIGPCWUFGT <GKVFGT9GKOCTGT4GRWDNKM  <WO&GWVUEJGP(GWGTYGJT'JTGPMTGW\-NCUUGHÒJTV'HNGT KP'(5 CWUFC­FKGUGUCONCPIGP$CPFFWTEJ FCU  -PQRHNQEJ IGVTCIGP YWTFG <WO $C[GTKUEJGP (GWGYGJT'JTGPMTGW\ FGU .CPFGU(GWGTYGJT8GTDCPFGU OKV   $GMTÌPWPICOYGK­TQVGP$CPFIKDVGT KP'(5 GKPG8GTNGKJWPIU\CJNXQPCP

&'765%*.#0&416'5-4'7< 

#WU\GKEJPWPIU WPF &QMWOGPVGPPCEJNC­ FGT -TCPMGPUEJYGUVGT (TKGFC 5VQHHTGIGP   2TGW­GP   4QVG-TGW\/GFCKNNG-NCUUG$TQP\GCO$CPFKO8GTNGKJWPIUGVWKKP8GTUCPFUEJCEJVGNOKV8GTNGK JWPIUWTMWPFG FCVKGTV $GTNKP CO  /CK    $C[GTP 8GTFKGPUVMTGW\ HÒT HTGKYKNNKIG -TCPMGP   RHNGIG-TKGIUCWU\GKEJPWPI5KNDGTVNYGOCKNNKGTVCO$CPFKOQTKIKPCNGP8GTNGKJWPIUGVWKOKV8GTNGK JWPIUWTMWPFG FCVKGTV /ÒPEJGP CO&G\GODGT 2TGW­GP4QVG-TGW\/GFCKNNG-NCUUG $TQP\G XGTUKNDGTV VNY GOCKNNKGTV CO $CPF KO 'VWK OKV 8GTNGKJWPIUWTMWPFG FCVKGTV $GTNKP CO   #WIWUV ¤UVGTTGKEJ$TQP\GPG'JTGPOGFCKNNGXQO4QVGP-TGW\OKVFGT-TKGIUFGMQTCVKQP$TQP\G XGTIQNFGV VNY GOCKNNKGTV CP &COGPUEJNGKHG KO QTKIKPCNGP 8GTNGKJWPIUGVWK OKV 8GTNGKJWPIUWTMWPFG   FCVKGTV 9KGP CO  #WIWUV  WPF ªDGTUGPFWPIUUEJTGKDGP   &GWVUEJGU 4GKEJ 'JTGPMTGW\ FGU   9GNVMTKGIGUHÒT-TKGIUVGKNPGJOGTOKV8GTNGKJWPIUWTMWPFGFCVKGTV*CTDWTI9KNJGNOUDWTICO/·T\  <WUCOOGP OKV RCUUGPFGT (GNFUEJPCNNG OKV HÒPH $·PFGTP &C\W  YGKVGTG &QMWOGPVG YKG .G   DGPUNCWH<GWIPKUUG7TNCWDU(CJTWPF'PVNCWUWPIUUEJGKP&KG&QMWOGPVGVGKNYGKUGOGJTHCEJIGHCN VGVLGFQEJKPIWVGO<WUVCPF 5VÒEM++



5GJT KPVGTGUUCPVGT WOHCPITGKEJGT WPF CWUUCIGMT·HVKIGT 0CEJNC­ GKPGT FGWVUEJGP -TCPMGPUEJYGUVGT KO 'TUVGP 9GNV   MTKGI



44

-QPXQNWV XQP HÒPH XGTUEJKGFGPGP FGWVUEJGP 4QV-TGW\#D\GKEJGP &CTWPVGT GKPGU OKV TÒEMUGKVKIGT   8GTNGKJWPIUPWOOGTō47*4.#0&ŋ+PWPVGTUEJKGFNKEJGP/GVCNNGPVGKNUXGTIQNFGVVGKNUGOCKNNKGTVKP XGTUEJKGFGPGP 'TJCNVWPIGP LGYGKNU CP 0CFGNP &C\W #D\GKEJGP XQO +PVGTPCVKQPCNGP 6WDGTMWNQUG   -QPITGUUKP2CTKUCODGUVKEMVGP$CPF ++




DEUTSCHLAND - ORDENSSCHNALLEN

ex 8148 8149 1:1

&'765%*.#0&'+5'0$#*0 

'KUGPDCJPGT#WU\GKEJPWPIU WPF &QMWOGPVGP0CEJNC­ XQP )ÒPVJGT WPF 9KNJGNO 9·JNKPI   'KUGPDCJPCUUKVGPV)ÒPVJGT9·JNKPI 2TGW­GP'TKPPGTWPIU\GKEJGPFGT2TGW­KUEJGP5VCCVGKUGPDCJPGP HÒT L·JTKIG &KGPUV\GKV 5KNDGT CP 0CFGN OKV 8GTNGKJWPIUWTMWPFG FCVKGTV $GTNKP CO  /CK      2TGW­GP 8GTFKGPUVMTGW\ HÒT -TKGIUJKNHG CO $CPF OKV (GNFUEJPCNNG OKV $GUKV\\GWIPKU FCVKGTV   $GTNKP CO  #RTKN    2TGW­GP #D\GKEJGP FGU 2TGW­KUEJGP 8GTGKPU FGT 9GKEJGPUVGNNGT WPF   $CJPY·TVGTXQPCP5EJNGKHGOKV0CFGN  1DGTNQMQOQVKXHÒJTGT)ÒPVJGT9·JNKPI 2TGW­GP'KUGTPGU-TGW\++-NCUUG \WUCOOGPOKV(TQPV M·ORHGTMTGW\CP<YGKGT5EJPCNNG OKV$GUKV\\GWIPKUFCVKGTVCO,WNKOKV1TKIKPCNWPVGTUEJTKHV XQP)GPGTCNOCLQT)TQGPGT%JGHFGU(GNFGKUGPDCJPYGUGPU &GWVUEJGU4GKEJ'JTGPMTGW\FGU9GNV MTKGIGUHÒT(TQPVM·ORHGT\WUCOOGPOKV8GTNGKJWPIUWTMWPFGFCVKGTVCO&G\GODGT 7PICTP 7PICTKUEJGU)QNFGPGU8GTFKGPUVMTGW\5KNDGTXGTIQNFGVVNYGOCKNNKGTVCO&TGKGEMUDCPFKOQTKIKPCNGP IQNFGP DGFTWEMVGP 8GTNGKJWPIUGVWK \WUCOOGP OKV 8GTNGKJWPIUWTMWPFG KP FGWVUEJGT 5RTCEJG FCVKGTV   $WFCRGUVCO/·T\5VCVWVGPCWU\WIWPFFGWVUEJG#PPCJOGIGPGJOKIWPIFCVKGTV$GTEJVGUICFGP CO,WNKOKVITQ­GO2T·IGUKGIGN &GWVUEJGU4GKEJ5KNDGTPGU6TGWFKGPUV'JTGP\GKEJGPCO $CPFKO'VWKFGT(KTOC(TKGFTKEJ-GNNGTKP1DGTUVGKP\WUCOOGPOKV8GTNGKJWPIUWTMWPFGFCVKGTVCO ,WNKOKVMNGKPGO2T·IGUKGIGN &GWVUEJGU4GKEJ-TKGIUXGTFKGPUVMTGW\++-NCUUG QJPG $CPF KP8GTNGKJWPIUVÒVGFGT(KTOC)GDTÒFGT$GPFGTKP1DGTUVGKP\WUCOOGPOKV8GTNGKJWPIUWTMWPFG FCVKGTV $GTNKP CO  ,CPWCT &C\W YGKVGTG \GJP 'TPGPPWPIUWTMWPFGP (ÒJTWPIU WPF   &KGPUV\GWIPKUUG <GKVWPIUCWUUEJPKVVG WPF 'JTGPWTMWPFGP HÒT )ÒPVJGT WPF HÒT 9KNJGNO 9·JNKPI   &QMWOGPVGVGKNUIGHCNVGVVGKNUIGNQEJV 5VÒEM++

+PUGKPGT8QNNUV·PFKIMGKVUGNVGPG)TWRRG\YGKGT'KUGPDCJPGTYQJN8CVGTWPF5QJPDGUQPFGTUKPVGTGUUCPVFWTEJFCU UGJTUGNVGPG7PICTKUEJG)QNFGPG8GTFKGPUVMTGW\



&'765%*.#0&14&'055%*0#..'0 

)TQ­G1TFGPUEJPCNNGFGU1DGTOCCVU4<CEJCPVMGXQPFGTMCKUGTNKEJGP;CEJV5/;*QJGP\QNNGTP

++ OKVXKGT#WU\GKEJPWPIGP 2TGW­GP-TQPGP1TFGP/GFCKNNG#WUHÒJTWPI OKVCPIGNÌVGVGT-TQPG  $TQP\GXGTIQNFGV 2TGW­GP/KNKV·T&KGPUVCWU\GKEJPWPIHÒT7PVGTQHHK\KGTGWPF/CPPUEJCHVGP/QFGNN

  -TGW\ HÒT  &KGPUVLCJTG -WRHGT   &GWVUEJGU 4GKEJ %JKPC&GPMOÒP\G HÒT -·ORHGT   OKV)GHGEJVUURCPIGō6+'065+0ŋ 5EJYGFGP5EJYGTVOGFCKNNG5KNDGT#P0CFGN 5VÒEM++



'Z#WMVKQP%CTUVGP<GKIGKP*CODWTICO1MVQDGT0T  4 <CEJCPVMG YCT 6GKNPGJOGT FGU &GWVUEJGP /CTKPG'ZRGFKVKQPUMQTRU PCEJ %JKPC  DKU  \WT 0KGFGTUEJNC   IWPI FGU #WHUVCPFGU FGT (·WUVG FGT )GTGEJVKIMGKV UQIGP $QZGTCWHUVCPF  WPF DGVGKNKIV CP FGT 8GTVGKFKIWPI D\Y   $GHTGKWPIFGTEJKPGUKUEJGP*CHGPUVCFV6KGPVUKP JGWVG6KCPLKP XQO,WPKDKU\WO,WNK6KGPVUKPUÒFÌUV NKEJ XQP 2GMKPI IGNGIGP XGTHÒIVG UGKV FGP GT ,CJTGP ÒDGT \CJNTGKEJG SWCUKCWVQPQOG *CPFGNUPKGFGTNCUUWPIGP   $GNIKGPUFGU&GWVUEJGP4GKEJGU(TCPMTGKEJU)TQ­DTKVCPPKGPU+VCNKGPU,CRCPU¤UVGTTGKEJ7PICTPUWPF4W­NCPFU YCT UQOKV CNU 6WOOGNRNCV\  CNNGT GWTQR·KUEJGP )TQ­O·EJVG DGXQT\WIVGU <KGN FGT #WHUV·PFKUEJGP &KG )GHGEJVU   URCPIGō6+'065+0ŋYWTFGNCWV'HNGT 'HNGT)GTV&GT(GNF\WIKP%JKPC $QZGTCWHUVCPF +P1TFGP/KNKVC TKC/CIC\KP0T5 CPEC1HHK\KGTG7PVGTQHHK\KGTGWPF/CPPUEJCHVGPXGTIGDGPWPF\YCTCPFKG FGWVUEJGP6GKNPGJOGTFGT5G[OQWT'ZRGFKVKQP FKGCNNGCWEJFKG)GHGEJVUURCPIGō5';/174':2'&'6+10ŋ GTJKGNVGP  FKG  #PIGJÌTKIGP FGU FGWVUEJGP $GUCV\WPIU&GVCEJGOGPVU FGT 5VCFV 6KGPVUKP WPVGT -CRKV·PNCWVPCPV   -ÒJPG FKG EC  #PIGJÌTKIGP FGT -QORCPKG XQP -CRKV·PNGWVPCPV 9GFFKPI XQP FGT 5/5 )GHKQP WPF FKG    #PIGJÌTKIGPFGT\YGK-QORCPKGPFGU+++5GGDCVCKNNQPUWPVGT/CLQT%JTKUV  +PFGTGTUVGP&GMCFGFGU,CJTJWPFGTVUFKGPVG<CEJCPVMGCNU1DGTOCCVCWHFGTMCKUGTNKEJGP;CEJV5/;*QJGP \QNNGTPCWHFGTGTCWEJCPGKPGTQFGTOGJTGTGPFGTCNNL·JTNKEJGP0QTFNCPFHCJTVGP-CKUGT9KNJGNOU++VGKNIGPQOOGP JCV 9·JTGPF GKPGT UQNEJGP0QTFNCPFHCJTVFÒTHVGKJOFKGUEJYGFKUEJG5EJYGTVOGFCKNNGXGTNKGJGPYQTFGPUGKP#O 5GRVGODGTJCV<CEJCPVMGXQP-CKUGT9KNJGNO++GKPG)GUEJGPM6CUEJGPWJTGTJCNVGP XGTUVGKIGTVKPFGT #WMVKQPXQP%CTUVGP<GKIGKP*CODWTICO1MVQDGT0T 

45


DEUTSCHLAND - MINIATURENSCHNALLEN

8150







8152

)TQ­G 1TFGPUUEJPCNNG OKV XKGT #WU\GKEJPWPIGP   2TGW­GP 'KUGTPGU -TGW\  ++ -NCUUG    $C[GTP/KNKV·TXGTFKGPUVMTGW\+++-NCUUGOKV-TQPGWPF5EJYGTVGTP 1NFGPDWTI(TKGFTKEJ#WIWUV -TGW\ ++ -NCUUG $TQP\G IGUEJY·T\V 5EJY·T\WPI VNY XGTICPIGP   $C[GTP /KNKV·T&KGPUVCWU\GKEJ   PWPIHÒT7PVGTQHHK\KGTGWPF/CPPUEJCHVGP/QFGNN  /GFCKNNG+++-NCUUG#P0CFGN  5VÒEM++



)TQ­G 1TFGPUUEJPCNNG OKV FTGK #WU\GKEJPWPIGP   2TGW­GP 'KUGTPGU -TGW\  ++ -NCUUG     9ÒTVVGODGTI /KNKV·TXGTFKGPUVOGFCKNNG  /QFGNN OKV 2QTVTCKV -ÌPKI 9KNJGNOU ++  5KNDGTPG   /GFCKNNG 5KNDGT OKV 5VGORGNUEJPGKFGTUKIPCVWT - 5EJYGP\GT   9ÒTVVGODGTI /KNKV·T   &KGPUVCWU\GKEJPWPI/QFGNN/GFCKNNG-NCUUG5KNDGT#P0CFGN 5VÒEM++



)TQ­G 1TFGPUUEJPCNNG OKV FTGK #WU\GKEJPWPIGP   2TGW­GP 'KUGTPGU -TGW\  ++ -NCUUG    5CEJUGP%QDWTIWPF)QVJC'JTGP\GKEJGPHÒT*GKOCVXGTFKGPUV-TKGIUOGVCNN 2TGW­GP8GTFKGPUV MTGW\HÒT-TKGIUJKNHG-TKGIUOGVCNN 5VÒEM++



8153

&'765%*.#0&/+0+#674'05%*0#..'070&-'66%*'0 

/KPKCVWTGPMGVVEJGP OKV XKGT #WU\GKEJPWPIUOKPKCVWTGP   2TGW­GP '- ++    5EJCWODWTI   .KRRG-TGW\HÒT6TGWG&KGPUVG .KRRG-TKGIUXGTFKGPUVMTGW\ &GWVUEJGU4GKEJ'JTGPMTGW\ FGU9GNVMTKGIGUHÒT(TQPVM·ORHGT#P-GVVEJGPOKVGKPGT0CFGN \YGKVG0CFGNHGJNV  5VÒEM++



8154 1:1



46

/KPKCVWTGPMGVVEJGPOKVUGEJU#WU\GKEJPWPIUOKPKCVWTGP 2TGW­GP'-++ 2TGW­GP/KNK V·T&KGPUVCWU\GKEJPWPI HÒT 7PVGTQHHK\KGTG WPF /CPPUEJCHVGP  /QFGNN /GFCKNNG HÒT  &KGPUVLCJTG    $C[GTP$C[GTKUEJGU-TKGIUGTKPPGTWPIUMTGW\FGU.CPFGUXGTDCPFGU$C[GTPFGU&GWVUEJGP-TKGIGTDWPFGU  CNU/KPKCVWTUGNVGP  *CODWTI*CPUGCVGPMTGW\ &GWVUEJGU4GKEJ'JTGPMTGW\ FGU 9GNVMTKGIGU HÒT (TQPVM·ORHGT   &GWVUEJGU 4GKEJ 5EJYCT\GU 8GTYWPFGVGPCD\GKEJGP  #P   -GVVEJGPOKV0CFGNP 5VÒEM++




ALBANIEN

8155



/KPKCVWTGPMGVVEJGPOKVUGEJU#WU\GKEJPWPIUOKPKCVWTGP 2TGW­GP'-++ 2TGW­GP-TKG IGTXGTGKPU'JTGPMTGW\  -NCUUG FGU 2TGW­KUEJGP .CPFGUMTKGIGTXGTDCPFGU   2TGW­GP 2TGW­KUEJGU   -TKGIU'TKPPGTWPIUMTGW\HÒT-QODCVVCPVGPOKV5EJYGTVGTPFGT8GTGKPKIWPI2TGW­KUEJGT-TKGIUVGKNPGJ OGTKO&GWVUEJGP-TKGIGT$WPF ¤UVGTTGKEJ'TKPPGTWPIUOGFCKNNGHÒT9GNVMTKGIUVGKNPGJ OGT $WNICTKGP'TKPPGTWPIUOGFCKNNGHÒTFGP-TKGI 7PICTP5ÒFWPICTKUEJG 'TKPPGTWPIUOGFCKNNG8KGT/KPKCVWTGPOKV-QTTQUKQPUURWTGPCP-GVVEJGPOKV0CFGNP  5VÒEM++++p+++



&'765%*.#0&-1081.76' 

-QPXQNWVXQP'JTGP\GKEJGPFGWVUEJGT5VCCVGPDKU7PVGTCPFGTGOCWU$CFGP$C[GTP*CP PQXGT*QJGP\QNNGTP5CEJUGPWPF9ÒTVVGODGTI8GTUEJKGFGPG/GVCNNGVGKNUGOCKNNKGTVKPWPVGTUEJKGF NKEJGP'TJCNVWPIGPCP$·PFGTP 5VÒEM++++p+++



-QPXQNWVXQPEC'JTGP\GKEJGP#D\GKEJGP#PUVGEMPCFGNPGVE8QTYKGIGPFFGTFGWVUEJGP5VCCVGP WPFFGU&GWVUEJGP4GKEJGUFCTWPVGTXKGTITQ­G1TFGPUUEJPCNNGPOKVCEJVXQPWTURTÒPINKEJ\GJP#WU \GKEJPWPIGP7PVGTUEJKGFNKEJG/GVCNNG CWEJ5KNDGT VGKNGOCKNNKGTVVGKNUCP$·PFGTPQFGT0CFGNP&C\W OGJTGTGCWUN·PFKUEJG#D\GKEJGP ++++p+++





-QPXQNWV XQP  OGKUV FGWVUEJGP #PUVGEMPCFGNP WPF -NGKPCD\GKEJGP 8GTUEJKGFGPG /GVCNNG VGKNU   GOCKNNKGTVKPWPVGTUEJKGFNKEJGT'TJCNVWPICP0CFGNP 5VÒEM++





-QPXQNWV XQP  XGTUEJKGFGPGP GKPUGKVKIGP 5COONGTCPHGTVKIWPIGP XQP 1TFGP FGWVUEJGT 5VCCVGP   5QIGPCPPVG)ÌFG1TFGP 5VÒEM++





8160

70$'-#006'#75<'+%*070)'0 

7PDGMCPPVGU #D\GKEJGP OKV 5MQTRKQP $TQP\G XGTUKNDGTV WPF GOCKNNKGTV VNYXGTIQNFGVCP5EJTCWDG OKV5EJTCWDUEJGKDG ++



8161

#.$#0+'0 (ª456'067/#.$#0+'0   

1TFGP XQO 5EJYCT\GP #FNGT )QNFGPG 8GTFKGPUVOGFCKNNG 5KNDGT XGTIQNFGV CO UEJOCNGP MQTTGMVGP   $CPF<- 444++

&GT5EJYCT\G#FNGT1TFGPYWTFG\WUCOOGPOKVFGPFC\WIGJÌTKIGP/GFCKNNGPXQP9KNJGNO(ÒTUVGPXQP#NDCPKGP

CWU FGO *CWUG 9KGF  KO ,CJTG  IGUVKHVGV 0CEJ -NKGVOCPP +P -NKGVOCPP -WTV)GTJCTF WPF 0GWDGEMGT   1VVHTKGF1TFGPU.GZKMQP$CPF1JPG1TVUWPF,CJTGUCPICDG-CRKVGN,G5 YWTFGPKPUIGUCOVPWT   IQNFGPG/GFCKNNGPXGTNKGJGPWPF\YCTCO#RTKNCNUUKEJFGT(ÒTUVDGTGKVUKPFGT'OKITCVKQPDGHCPFWPF \YCT CWUUEJNKG­NKEJ CP #PIGUVGNNVG FGT (ÒTUVN 5EJÌPDWTI9CNFGPDWTIKUEJGP 8GTYCNVWPI FKG KP &KGPUVGP FGU   (ÒTUVGP9KNJGNOUVCPFGP



47


KÖNIGREICH BELGIEN

8163

8162

8164

-¤0+)4'+%*$'.)+'0 

.GQRQNF1TFGP  /QFGNN   4KVVGTMTGW\ #WUHÒJTWPI OKV -TQPG FGU 6[RU ō'URCIPQNŋ   5KNDGT/GFCKNNQPU)QNFGOCKNNKGTV'OCKNNGEJKRUCWH8QTFGTWPF4ÒEMUGKVGCO$CPFKO'VWK$9- <- +++





-TQPGP1TFGP4KVVGTFGMQTCVKQP$TQP\GXGTUKNDGTVVNYXGTIQNFGVGOCKNNKGTVCO$CPFHÒT-TKGIUGKPUCV\ OKVGOCKNNKGTVGT$CPFURCPIGHÒT*KPVGTDNKGDGPG$9-XCT ++





-TQPGP1TFGP -TQPGP/GFCKNNG  /QFGNN OKV GKPURTCEJKIGT +PUEJTKHV    )QNFGPG /G   FCKNNG$TQP\GXGTIQNFGVCO$CPFOKV$CPFURCPIGHÒT8GVGTCPGPXGTIQNFGVVNYGOCKNNKGTV ++



8165





8166

8168

1TFGP.GQRQNF++/QFGNN OKVGKPURTCEJKIGT/GFCKNNQPWOUEJTKHV 4KVVGTMTGW\5KNDGT VNYGOCKNNKGTVCO$CPFHÒT-TKGIUGKPUCV\OKVGOCKNNKGTVGT$CPFURCPIGHÒT*KPVGTDNKGDGPG $9-XCT ++



/KNKV·TMTGW\/QFGNN OKV/QPQITCOO-ÌPKI.GQRQNFU++CWHFGT4ÒEMUGKVG -TGW\+ -NCUUG.WZWUCWUHÒJTWPI5KNDGTXGTIQNFGVWPFGOCKNNKGTVCOQTKIKPCNGP$CPFOKVCWHIGNGIVGT4QUGVVG $9-C 4++



$GUQPFGTUNWZWTKÌUGUWPFUGNVGPGU'ZGORNCTOKVUGJTRNCUVKUEJIGUVCNVGVGT-TQPG





48

<KXKN8GTFKGPUVMTGW\ /KPKCVWT FGU 5KNDGTPGP 8GTFKGPUVMTGW\GU KP .WZWUCWUHÒJTWPI 5KNDGT ¯ LQWT   DGUGV\VOKVXQPWTURTÒPINKEJ5KOKNKUVGKPGPQJPG$·PFEJGP&C\W'JTGP\GKEJGPXQO4QVGP-TGW\ 5KNDGTGOCKNNKGTVKPFGT#WHJ·PIWPITGRCTKGTVCO$CPF 5VÒEM++p+++



-TKGIUGTKPPGTWPIUOGFCKNNG$TQP\GOKV5VGORGNUEJPGKFGTUKIPCVWTō',FG$4'/#0-74ŋ CO $CPF OKV XCTKCPVGT $CPFURCPIG HÒTFCUDGNIKUEJG'ZRGFKVKQPUMQTRUKP4W­NCPF5KNDGT WPFGKPGTUKNDGTHCTDGPGPWPFGKPGTIQNFHCTDGPGPUEJOCNGP$CPFURCPIG$9-EFJ 4++




KÖNIGREICH BELGIEN

8171

8169

8170 8172



)GFGPM'JTGP\GKEJGP\WOL·JTKIGP$GUVGJGPFGUDGNIKUEJGP6GNGITCRJGPYGUGPU8GTIQNFGVWPF GOCKNNKGTVOKP'OCKNNGTGRCTCVWTKOTÒEMUGKVKIGP/GFCKNNQPCOQTKIKPCNGP$CPF$9- ++





)GFGPM'JTGP\GKEJGP\WOL·JTKIGP$GUVGJGPFGUDGNIKUEJGP6GNGITCRJGPYGUGPU8CTKCPVG#WU HÒJTWPIXGTIQNFGVWPFGOCKNNKGTVCOQTKIKPCNGP$CPF$9-XCT ++





-TKGIUGTKPPGTWPIUOGFCKNNG  $TQP\G CO $CPF OKV \YGK $CPFURCPIGP ō9#.%*'4'0ŋ   ō;17)15.#9+'ŋ #WHNCIG ō(4#0%' ŋ UQYKG MNGKPGP IGMTGW\VGP 5·DGNP WPF IGMTGW\VGP   $NKV\GP ++



-TKGIUGTKPPGTWPIUOGFCKNNG  $TQP\G CO $CPF OKV HÒPH $CPFURCPIGP ō'/&'0ŋ   ō#4&'00'5 $'.)'5ŋ ō014/#0&+'ŋ ō$'.)+37'ŋ WPF ō1.&'0$74)ŋ UQYKG MNGKPGP   IGMTGW\VGP5·DGNP ++





8173 8174 1:1



'JTGP\GKEJGP\WT,CJTHGKGTFGT'TÌHHPWPIFGTGTUVGPDGNIKUEJGP6GNGITCRJGPNKPKG$TQP\G XGTIQNFGVCO$CPF ++





/KPKCVWTGPUEJPCNNG GKPGU 8GVGTCPGP FGU <YGKVGP 9GNVMTKGIU OKV UGEJU #WU\GKEJPWPIUOKPKCVWTGP    1TFGP.GQRQNF++4KVVGTMTGW\ (TCPMTGKEJ-TKGIUMTGW\OKV5VGTPEJGP -TKGIUGTKPPGTWPIU OGFCKNNGOKVIGMTGW\VGP5·DGNPWPFIGMTGW\VGP$NKV\GP /GFCKNNGHÒTOKNKV·TKUEJG-·OR HGT /GFCKNNGHÒT9KGFGTUVCPFUM·ORHGT $GUQPFGTG#WU\GKEJPWPIHÒT#TDGKVUXGTFKGPUV -NCUUG#P0CFGN 5VÒEM++



-QPXQNWV OKV UKGDGP #WU\GKEJPWPIGP &CTWPVGT /KNKV·T'JTGP\GKEJGP  WPF  -NCUUG 5KNDGTPGU   <KXKNXGTFKGPUVMTGW\ HÒT FKG (GWGTYGJT FKVQ HÒT $GCOVG +PFWUVTKGCTDGKVGT'JTGP\GKEJGP HÒT *KPVGTDNKG   DGPG 7PVGTUEJKGFNKEJG /GVCNNG VGKNU XGTUKNDGTV VGKNU XGTIQNFGV VGKNU GOCKNNKGTV KP WPVGTUEJKGFNKEJGP   'TJCNVWPIGPCP$·PFGTPVGKNUOKV#WHNCIGP 5VÒEM++





49


BULGARIEN

Punze im Ring

8176 1:1

8176 1:1

$7.)#4+'0 (ª456'067/$7.)#4+'0   

1TFGP ō(ÒT 6CRHGTMGKVŌ=Îðäåí „Çà Õðàáðîñò“?  /QFGNN OKV IQNFHCTDGPGP /GFCKNNQPTKPIGP     -TGW\+++-NCUUG#WUHÒJTWPIOKVCWHIGNGIVGO.ÌYGPWPF/QPQITCOO5KNDGTXGTIQNFGV WPFGOCKNNKGTVKO4KPI5V2GVGTUDWTIGT2WP\GHÒT<QNQVPKMK5KNDGTXQPDKUWPF/GKUVGT OCTMG ō02ŋ FGT (KTOC 0KEJQNNU  2NKPEMG KP 5V 2GVGTUDWTI CO QTKIKPCNGP RGPVCIQPCNGP $CPF $-   #$9-&'-.'2#2'5HH4$80<- 444++



.CWV 2GVTQX KP 2' 5   UKPF XQP (ÒTUV #NGZCPFGT + XQP  DKU  KPUIGUCOV PWT  -TGW\G +++ -NCUUG  

FKGUGU/QFGNNU XGTNKGJGPYQTFGPFCXQPCP#WUN·PFGT  .CWV 6COOCP 642 5 H  GTUEJGKPV %JCTNGU %CTN  0KEJQNNU DGTGKVU  KP 5V 2GVGTUDWTI CNU )QNF WPF 5KNDGT   J·PFNGTQFGTPCJOGT*GKPTKEJ2NKPEMGCNU,WPKQTRCTVPGTCWHFGTPCEJFGO6QFXQP0KEJQNNUFCU )GUEJ·HV CNNGKP ÒDGTPCJO &KG (KTOC YWTFG OKPFGUVGPU DKU  HQTVIGHÒJTV WPF UVGNNVG UQYQJN TWUUKUEJG CNU CWEJ   CWUN·PFKUEJG1TFGPJGT  )GUVKHVGV XQP (ÒTUV #NGZCPFGT + XQP $WNICTKGP OKV 7MCU 0T  XQO  ,CPWCT  XGTÌHHGPVNKEJV KP FGT 5VCCVU   )C\GVVG0TXQO,CPWCT CNU\WP·EJUVXKGTMNCUUKIGT DKU-NCUUG 8GTFKGPUVQTFGPHÒTOKNKV·TKUEJG6CRHGT MGKV OKV CHHKNKKGTVGO \WP·EJUV FTGKUVWHKIGO 5QNFCVGPMTGW\  YWTFG HÒT T\VG (GNFIGKUVNKEJG /WUKMGT GVE GKPG    -NCUUG QJPG 5EJYGTVGT IGUVKHVGV #O  &G\GODGT  GTHQNIVG FKG 5VKHVWPI FGU 5QNFCVGPMTGW\GU  -NCUUG   WPFCO/·T\FKG)TQ­MTGW\MNCUUG OKVWPFQJPG6QVGPMÌRHG FKGFGO(ÒTUVGPCNU)TQ­OGKUVGTXQTDGJCNVGP YCT&KG-NCUUGOKV6QVGPMÌRHGPYCTYQJNGDGPHCNNUPWTFGO(ÒTUVGPXQTDGJCNVGP-GPP\GKEJPGPFHÒTFKGUGU /QFGNNKUVFGTIQNFHCTDGPG/GFCKNNQPTKPI

8177



1TFGPō(ÒT6CRHGTMGKVŌ=Îðäåí „Çà Õðàáðîñò“?/QFGNN OKVITÒPGOD\YYGK­GO/GFCKNNQPTKPI CWH FGT 8QTFGTUGKVG OKV GKPGO UGEJU\CEMKIGP 5VGTP DGKFUGKVU DGINGKVGV XQP GKPGT UVKNKUKGTVGP .KNKG QFGT   $NÒVG WPF \YGK 2WPMVGP    -TGW\ +++ -NCUUG D\Y -TGW\ +++ -NCUUG  5VWHG CD ,CPWCT    $TQP\GXGTIQNFGVWPFGOCKNNKGTVOKP'OCKNNGEJKRUKPGKPGT-TGW\CTOURKV\GCOQTKIKPCNGPCNVGP &TGKGEMUDCPF $-  $9-  &'  -.'  2#  2' 5HH 4$  6#    80<- ++ .CWV2GVTQX KP2'5 UKPFXQP(ÒTUV(GTFKPCPF+XQPDKUPWT-TGW\G+++-NCUUGWPF\YCTCNNG CP#WUN·PFGTXGTNKGJGPYQTFGP  0CEJ FGT 4GIKGTWPIUÒDGTPCJOG (ÒTUV (GTFKPCPFU + GTJKGNVGP FKG +PUKIPKGP  LGYGKNU GKPGP ITÒPGP /GFCKNNQP   TKPI /QFGNN 

50




BULGARIEN

8181

8179

8178

8180 1:1















1TFGPō(ÒT6CRHGTMGKVŌ=Îðäåí „Çà Õðàáðîñò“?/QFGNN OKVITÒPGOD\YYGK­GO/GFCKNNQPTKPI CWH FGT 8QTFGTUGKVG OKV GKPGO UGEJU\CEMKIGP 5VGTP DGKFUGKVU DGINGKVGV XQP GKPGT UVKNKUKGTVGP .KNKG QFGT   $NÒVG WPF \YGK 2WPMVGP    -TGW\ +8 -NCUUG D\Y -TGW\ +8 -NCUUG  5VWHG CD ,CPWCT    GVYCUITÌ­GTG#WUHÒJTWPI &WTEJOGUUGTOO OKV.KNKGPCITCHHGWPFCWHIGNGIVGO.ÌYGPKO /GFCKNNQP $TQP\G XGTUKNDGTV WPF GOCKNNKGTV CO CNVGP &TGKGEMUDCPF $- $ $9-  &'   -.'2#2'5HH4$80<- ++



1TFGPō(ÒT6CRHGTMGKVŌ=Îðäåí „Çà Õðàáðîñò“?/QFGNN OKVITÒPGOD\YYGK­GO/GFCKNNQPTKPI CWH FGT 8QTFGTUGKVG OKV GKPGO UGEJU\CEMKIGP 5VGTP DGKFUGKVU DGINGKVGV XQP GKPGT UVKNKUKGTVGP .KNKG QFGT   $NÒVG WPF \YGK 2WPMVGP    -TGW\ +8 -NCUUG D\Y -TGW\ +8 -NCUUG  5VWHG CD ,CPWCT     GVYCU MNGKPGTG #WUHÒJTWPI &WTEJOGUUGT  OO  OKV CWHIGNGIVGO .ÌYGP KO /GFCKNNQP   $TQP\G XGTUKNDGTV WPF GOCKNNKGTV CO CNVGP &TGKGEMUDCPF $- # $9-  &'    -.'2#2'5HH4$80<- ++



1TFGPō(ÒT6CRHGTMGKVŌ=Îðäåí „Çà Õðàáðîñò“?/QFGNN OKVITÒPGOD\YYGK­GO/GFCKNNQPTKPI CWH FGT 8QTFGTUGKVG OKV GKPGO UGEJU\CEMKIGP 5VGTP DGKFUGKVU DGINGKVGV XQP GKPGT UVKNKUKGTVGP .KNKG QFGT   $NÒVGWPF\YGK2WPMVGP -TGW\+8-NCUUG5VWHGQJPG5EJYGTVGT#WUHÒJTWPIOKVGKP VGKNKIGP/GFCKNNQPU$TQP\GXGTUKNDGTVWPFGOCKNNKGTVCOCNVGP&TGKGEMUDCPF$-$9- &'-.'2#2'5HH4$6#80<- 444++



1TFGPō(ÒT6CRHGTMGKVŌ=Îðäåí „Çà Õðàáðîñò“?/QFGNN OKVITÒPGOD\YYGK­GO/GFCKNNQPTKPI CWH FGT 8QTFGTUGKVG OKV GKPGO UGEJU\CEMKIGP 5VGTP DGKFUGKVU DGINGKVGV XQP GKPGT UVKNKUKGTVGP .KNKG QFGT   $NÒVG WPF \YGK 2WPMVGP    5QNFCVGPMTGW\ HÒT 6CRHGTMGKV ++ -NCUUG $TQP\G XGTIQNFGV CO   $CPF$-$9-&'-.'2#XCT2'5HH4$80<-  ++



1TFGPō(ÒT6CRHGTMGKVŌ=Îðäåí „Çà Õðàáðîñò“?/QFGNN OKVITÒPGOD\YYGK­GO/GFCKNNQPTKPI CWH FGT 8QTFGTUGKVG OKV GKPGO UGEJU\CEMKIGP 5VGTP DGKFUGKVU DGINGKVGV XQP GKPGT UVKNKUKGTVGP .KNKG QFGT   $NÒVG WPF \YGK 2WPMVGP    5QNFCVGPMTGW\ HÒT 6CRHGTMGKV ++ -NCUUG $TQP\G XGTIQNFGV CO   MWT\GP$CPF$-$9-&'-.'2#XCT2'5HH4$80 <- ++



1TFGPō(ÒT6CRHGTMGKVŌ=Îðäåí „Çà Õðàáðîñò“?/QFGNN OKVITÒPGOD\YYGK­GO/GFCKNNQPTKPI CWH FGT 8QTFGTUGKVG OKV GKPGO UGEJU\CEMKIGP 5VGTP DGKFUGKVU DGINGKVGV XQP GKPGT UVKNKUKGTVGP .KNKG QFGT   $NÒVGWPF\YGK2WPMVGP 5QNFCVGPMTGW\HÒT6CRHGTMGKV+8-NCUUG$TQP\GXGTUKNDGTVCO $CPF$-$9-&'-.'2#2'5HH4$80<- ++



1TFGPō(ÒT6CRHGTMGKVŌ=Îðäåí „Çà Õðàáðîñò“?/QFGNN OKVITÒPGOD\YYGK­GO/GFCKNNQPTKPI CWH FGT 8QTFGTUGKVG OKV GKPGO UGEJU\CEMKIGP 5VGTP DGKFUGKVU DGINGKVGV XQP GKPGT UVKNKUKGTVGP .KNKG QFGT   $NÒVGWPF\YGK2WPMVGP 5QNFCVGPMTGW\HÒT6CRHGTMGKV+8-NCUUG$TQP\GXGTUKNDGTVCO $CPF$-$9-&'-.'2#2'5HH4$80<- ++

 51


BULGARIEN

Rs. der Kronenpendilie

8185 1:1

8185 1:1



1TFGPō5V#NGZCPFGTŋ=Îðäåí „Ñâ. Àëåêñàíäúð“?D\Y1TFGPō5V#NGZCPFGT0GYUM[ŋ=Îðäåí „Ñâ. Àëåêñàíäúð Íåâñêèé“?    /QFGNN OKV JGTCNFKUEJGT -ÌPKIUMTQPG       #WUHÒJTWPI OKV GKPVGKNKIGP 8QTFGT WPF 4ÒEMUGKVGPOGFCKNNQPU    -TGW\ +++ -NCUUG   5KNDGT XGTIQNFGV WPF GOCKNNKGTV CWH FGT 4ÒEMUGKVG GKPGT -TQPGPRGPFKNKG 5V 2GVGTUDWTIGT 2WP\G HÒT    <QNQVPKMK5KNDGTXQPDKUWPF/GKUVGTOCTMGÄ1FGT(KTOC&KOKVTK1UKRQXKP5V2GVGTUDWTI CO QTKIKPCNGP CNVGP *CNUDCPF $-  $9-  XCT &'  XCT -.'  2#    2'5HH4$6#OK80<- 44++  .CWV2GVTQX KP2'5 UKPFXQP(ÒTUV#NGZCPFGT+XQPDKUKPUIGUCOVPWT-TGW\G+++-NCUUG

FKGUGT#WUHÒJTWPIFGU/QFGNNU XGTNKGJGPYQTFGPFCXQPCP$WNICTGP  /KV7MCUXQO&G\GODGTUVKHVGVG#NGZCPFGT+XQP$CVVGPDGTI(ÒTUVXQP$WNICTKGPFGP\WP·EJUVHÒPHMNCU UKIGP + DKU 8 -NCUUG  CNNIGOGKPGP 8GTFKGPUVQTFGP OKV CHHKNKKGTVGO 5KNDGTPGP <GKEJGP  /QFGNN  'T YWTFG \W   'JTGP<CT#NGZCPFGTU++WPFFGTTWUUKUEJGP$GHTGKGT$WNICTKGPUPCEJFGOTWUUKUEJGP0CVKQPCNJGNFGPWPFņJGKNKIGP )TQ­HÒTUV 5V #NGZCPFGT 0GYUM[ EC   DGPCPPV (ÒT FGP (ÒTUVGP CNU )TQ­OGKUVGT FGU 1TFGPU YCT GKPG    -QNNCPG CD  ō)TQ­G -QNNCPGŋ IGPCPPV  XQTIGUGJGP  YWTFGP HÒT -TKGIU\GKVGP 5EJYGTVGT FWTEJ FKG /KVVG   HÒT6CRHGTMGKVXQTFGO(GKPFGWPF5EJYGTVGTÒDGTFGO-TGW\IGUVKHVGV/KV7MCU0T(ÒTUV(GTFKPCPFU+XQO  #WIWUV  YWTFG FCU 5KNDGTPG -TGW\ KP 8+ -NCUUG WODGPCPPV WPF FKG UQIGP ō-NGKPG -QNNCPGŋ HÒT HTGOFG   5QWXGT·PGWPFFGTGP(COKNKGPOKVINKGFGTUQYKGHÒTJGTXQTTCIGPFG2GTUÌPNKEJMGKVGPIGUVKHVGV

8186



1TFGPō5V#NGZCPFGTŋ=Îðäåí „Ñâ. Àëåêñàíäúð“?D\Y1TFGPō5V#NGZCPFGT0GYUM[ŋ[Îðäåí  „Ñâ. Àëåêñàíäúð Íåâñêèé“?    /QFGNN OKV JGTCNFKUEJGT -ÌPKIUMTQPG      #WUHÒJTWPI OKV GKPVGKNKIGP 8QTFGT WPF 4ÒEMUGKVGPOGFCKNNQPU    5KNDGTPGU <GKEJGP   5KNDGTFGTWTURTÒPINKEJN·PINKEJG$CPFTKPIFWTEJ\YGKPQTOCNG4KPIGGTUGV\VCO$CPF$- $9-XCT&'XCT-.'2#XCT2'5HH4$80<- 44++ .CWV 2GVTQX KP 2' 5   UKPF XQP (ÒTUV #NGZCPFGT + XQP  DKU  KPUIGUCOV PWT  5KNDGTPG <GKEJGP  

FKGUGT#WUHÒJTWPIFGU/QFGNNU XGTNKGJGPYQTFGPFCXQPCP$WNICTGP

52




BULGARIEN

8187



1TFGPō5V#NGZCPFGTŋ=Îðäåí „Ñâ. Àëåêñàíäúð“?D\Y1TFGPō5V#NGZCPFGT0GYUM[ŋ=Îðäåí  „Ñâ. Àëåêñàíäúð Íåâñêèé“?    /QFGNN OKV JGTCNFKUEJGT -ÌPKIUMTQPG      #WUHÒJTWPI OKV\YGKVGKNKIGO8QTFGTWPFGKPVGKNKIGO4ÒEMUGKVGPOGFCKNNQP -TGW\+++ -NCUUG OKV 5EJYGTVGTP ÒDGT FGO -TGW\ 5KNDGT XGTIQNFGV GXGPVWGNN PCEJXGTIQNFGV  WPF GOCKNNKGTV CO   *CNUDCPF$-$9-XCT&'XCT-.'2#2'5HH4$6# 80<- 444++  .CWV2GVTQX KP2'5 UKPFXQP(ÒTUV(GTFKPCPF+XQPDKUKPUIGUCOVPWT-TGW\G++-NCUUGWPF PWT-TGW\G+++-NCUUGLGYGKNUOKV5EJYGTVGTPÒDGTFGO-TGW\XGTNKGJGPYQTFGPFCXQPLGYGKNUCP#WUN·PFGT

8188



1TFGPō5V#NGZCPFGTŋ=Îðäåí „Ñâ. Àëåêñàíäúð“?D\Y1TFGPō5V#NGZCPFGT0GYUM[ŋ=Îðäåí  „Ñâ. Àëåêñàíäúð Íåâñêèé“?    /QFGNN OKV JGTCNFKUEJGT -ÌPKIUMTQPG       #WUHÒJTWPI OKV \YGKVGKNKIGP 8QTFGT WPF 4ÒEMUGKVGPOGFCKNNQPU    5GV FGT + -NCUUG   DGUVGJGPFCWU-NGKPQF5KNDGTXGTIQNFGVWPFGOCKNNKGTVKPFGT¤UGHTCP\ÌUKUEJG'KPHWJTRWP\GHÒT5KNDGT XQP  DKU  ō5EJYCPGPRWP\Gŋ  CO QTKIKPCNGP CNVGP 5EJWNVGTDCPF WPF $TWUVUVGTP 5KNDGT VNY   XGTIQNFGV WPF GOCKNNKGTV &GXKUG WPF <YGKIG KO /GFCKNNQPTKPI UGRCTCV CWHIGNGIV CP 0CFGN FKGUG OKV   HTCP\ÌUKUEJGT 'KPHWJTRWP\G XQP  DKU  ō5EJYCPGPRWP\Gŋ  KO QTKIKPCNGP 8GTNGKJWPIUGVWK FGT   (KTOC -T¾VN[ KP 2CTKU OKV IQNFHCTDGPGO HÒTUVNKEJGP 9CRRGP $- $ $ $9-     &'  XCT  XCT -.'   2#  XCT 2' 5HH 4$   6#  80     <- 5VÒEM4++  .CWV2GVTQX KP2'5 UKPFXQP(ÒTUV(GTFKPCPF+XQPDKUKPUIGUCOVPWT+-NCUUGPXGTNKGJGP YQTFGPFCXQPCP$WNICTGP

53


BULGARIEN

8189



1TFGPō5V#NGZCPFGTŋ=Îðäåí „Ñâ. Àëåêñàíäúð“?D\Y1TFGPō5V#NGZCPFGT0GYUM[ŋ=Îðäåí  „Ñâ. Àëåêñàíäúð Íåâñêèé“?    /QFGNN OKV JGTCNFKUEJGT -ÌPKIUMTQPG       #WUHÒJTWPI OKV \YGKVGKNKIGP 8QTFGT WPF 4ÒEMUGKVGPOGFCKNNQPU    5GV FGT ++ -NCUUG   DGUVGJGPF CWU *CNUMTGW\ 5KNDGT XGTIQNFGV WPF GOCKNNKGTV KP FGT ¤UG HTCP\ÌUKUEJG )CTCPVKGRWP\G HÒT   5KNDGT XQP  DKU  ō9KNFUEJYGKPMQRHŋ  CO *CNUDCPFCDUEJPKVV WPF $TWUVUVGTP 5KNDGT VNY   XGTIQNFGV WPF GOCKNNKGTV MNGKPG 'OCKNNGCWUDTÒEJG KO 5EJTKHVTKPI CP 0CFGN FKGUG OKV HTCP\ÌUKUEJGT   )CTCPVKGRWP\GUGKV ō9KNFUEJYGKPMQRHŋ WPF*GTUVGNNGTRWP\Gō'%ŋFGT(KTOC%JQDKNNQPKOPKEJV \WIGJÌTKIGP'VWKFGT(KTOC#/CTKG5VWCTVKP2CTKU$-$$$9-&' -.'2#2'5HH4$80<- 5VÒEM++



.CWV2GVTQX KP2'5 UKPFXQP(ÒTUV(GTFKPCPF+XQPDKUKPUIGUCOVPWT++-NCUUGPXGTNKGJGP YQTFGPFCXQPCP$WNICTGP

8190



1TFGPō5V#NGZCPFGTŋ=Îðäåí „Ñâ. Àëåêñàíäúð“?D\Y1TFGPō5V#NGZCPFGT0GYUM[ŋ=Îðäåí  „Ñâ. Àëåêñàíäúð Íåâñêèé“?    /QFGNN OKV JGTCNFKUEJGT -ÌPKIUMTQPG       #WUHÒJTWPI OKV \YGKVGKNKIGP 8QTFGT WPF 4ÒEMUGKVGPOGFCKNNQPU    -TGW\ +++ -NCUUG   5KNDGTXGTIQNFGVWPFGOCKNNKGTVKPFGT¤UGWPFKO6TCIGTKPIOGJTHCEJÌUVGTTGKEJKUEJ DKU RWP\KGTV

ō(4ŋHÒT(TKGFTKEJ4QVJGKP9KGPō9KPFJWPFMQRH#ŋ2WP\GHÒTGT5KNDGTWPFō#ŋ2WP\G CO *CNUDCPF$-#$9-&'-.'2#QD2'5HH4$80 <- ++ .CWV2GVTQX KP2'5 UKPFXQP(ÒTUV(GTFKPCPF+XQPDKUKPUIGUCOVPWT-TGW\G++-NCUUGWPF PWT-TGW\G+++-NCUUGXGTNKGJGPYQTFGPFCXQPD\YCP$WNICTGP

54




BULGARIEN

8192

8191



1TFGPō5V#NGZCPFGTŋ=Îðäåí „Ñâ. Àëåêñàíäúð“?D\Y1TFGPō5V#NGZCPFGT0GYUM[ŋ=Îðäåí  „Ñâ. Àëåêñàíäúð Íåâñêèé“?    /QFGNN OKV JGTCNFKUEJGT -ÌPKIUMTQPG       #WUHÒJTWPI OKV \YGKVGKNKIGP 8QTFGT WPF 4ÒEMUGKVGPOGFCKNNQPU    -TGW\ +8 -NCUUG   5KNDGTXGTIQNFGVWPFGOCKNNKGTVKPFGT¤UGÌUVGTTGKEJKUEJ DKU RWP\KGTV ō(4ŋHÒT(TKGFTKEJ4QVJG KP 9KGP ō 9KPFJWPFMQRH #ŋ2WP\GP HÒT GT 5KNDGT  CO QTKIKPCNGP CNVGP &TGKGEMUDCPF OKV   CWHIGNGIVGT 4QUGVVG KO QTKIKPCNGP 8GTNGKJWPIUGVWK FGT (KTOC 4QVJG OKV IQNFHCTDGPGO HÒTUVNKEJGO   9CRRGP $- # $9-  &'  -.'  2#  2' 5HH 4$  80    <- 4++



.CWV2GVTQX KP2'5 UKPFXQP(ÒTUV(GTFKPCPF+XQPDKUKPUIGUCOV-TGW\G+8-NCUUGXGT NKGJGPYQTFGPFCXQPCP$WNICTGP



1TFGPō5V#NGZCPFGTŋ=Îðäåí „Ñâ. Àëåêñàíäúð“?D\Y1TFGPō5V#NGZCPFGT0GYUM[ŋ=Îðäåí  „Ñâ. Àëåêñàíäúð Íåâñêèé“?    /QFGNN OKV JGTCNFKUEJGT -ÌPKIUMTQPG      #WUHÒJTWPI OKV\YGKVGKNKIGP8QTFGTWPF4ÒEMUGKVGPOGFCKNNQPU -TGW\+8-NCUUGOKV 5EJYGTVGTP 5KNDGT XGTIQNFGV WPF GOCKNNKGTV CO &TGKGEMUDCPF OKV CWHIGNGIVGT 4QUGVVG $-    $9-&'-.'2#2'5HH4$80<- 4++



.CWV2GVTQX KP2'5 UKPFXQP(ÒTUV(GTFKPCPF+XQPDKUKPUIGUCOVPWT-TGW\G+8-NCUUGOKV 5EJYGTVGTPXGTNKGJGPYQTFGPFCXQPCP$WNICTGP

8193



8194

1TFGPō5V#NGZCPFGTŋ=Îðäåí „Ñâ. Àëåêñàíäúð“?D\Y1TFGPō5V#NGZCPFGT0GYUM[ŋ=Îðäåí  „Ñâ. Àëåêñàíäúð Íåâñêèé“?    /QFGNN OKV JGTCNFKUEJGT -ÌPKIUMTQPG      #WUHÒJTWPI OKV\YGKVGKNKIGP8QTFGTWPF4ÒEMUGKVGPOGFCKNNQPU -TGW\+8-NCUUGOKV 5EJYGTVGTPÒDGTFGO-TGW\5KNDGTXGTIQNFGVWPFGOCKNNKGTVFKG5EJYGTVGTCWHFGT4ÒEMUGKVGITCXKGTV CO $CPF $-  $9-  &'  -.'  2#  2' 5HH 4$  80    <- 4++



.CWV2GVTQX KP2'5 UKPFXQP(ÒTUV(GTFKPCPF+XQPDKUKPUIGUCOVPWT-TGW\G+8-NCUUGOKV 5EJYGTVGTPÒDGTFGO-TGW\XGTNKGJGPYQTFGPFCXQPCP$WNICTGP



1TFGPō5V#NGZCPFGTŋ=Îðäåí „Ñâ. Àëåêñàíäúð“?D\Y1TFGPō5V#NGZCPFGT0GYUM[ŋ=Îðäåí  „Ñâ. Àëåêñàíäúð Íåâñêèé“?  /QFGNN OKVJGTCNFKUEJGT-ÌPKIUMTQPG QFGT GTUV! #WUHÒJTWPI OKV\YGKVGKNKIGP8QTFGTWPF4ÒEMUGKVGPOGFCKNNQPU QFGTGTUV !  -TGW\ 8 -NCUUG 5KNDGT VNY XGTIQNFGV GOCKNNKGTV KO TÒEMUGKVKIGP /GFCKNNQP \YGK   'OCKNNGEJKRU KP FGT ¤UG ÌUVGTTGKEJKUEJ DKU   RWP\KGTV ō(4ŋ HÒT (TKGFTKEJ 4QVJG KP 9KGP   ō9KPFJWPFMQRH#ŋ2WP\GPHÒTGT5KNDGT CONCPIGP$CPFTKPIOKVSWGTOQPVKGTVGO$CPFOKVCNVGT 0CFGN$-#$9-XCT&'-.'2#XCT2'5HH4$80 <- ++++p+++



.CWV 2GVTQX KP 2' 5   UKPF XQP (ÒTUV (GTFKPCPF + XQP  DKU  KPUIGUCOV  -TGW\G 8 -NCUUG   XGTNKGJGPYQTFGPFCXQPCP#WUN·PFGT

55


BULGARIEN

8196

8195



8197

1TFGPō5V#NGZCPFGTŋ=Îðäåí „Ñâ. Àëåêñàíäúð“?D\Y1TFGPō5V#NGZCPFGT0GYUM[ŋ=Îðäåí  „Ñâ. Àëåêñàíäúð Íåâñêèé“?    /QFGNN OKV JGTCNFKUEJGT -ÌPKIUMTQPG       #WUHÒJTWPI OKV \YGKVGKNKIGP 8QTFGT WPF 4ÒEMUGKVGPOGFCKNNQPU    -TGW\ 8 -NCUUG   5KNDGTGOCKNNKGTVCOUR·VGTGP&TGKGEMUDCPF$-$$9-&'-.'2# 2'5HH4$80<- ++



.CWV 2GVTQX KP 2' 5   UKPF XQP (ÒTUV (GTFKPCPF + XQP  DKU  KPUIGUCOV  -TGW\G 8 -NCUUG   XGTNKGJGPYQTFGPFCXQPCP#WUN·PFGT



/GFCKNNG ō5V #NGZCPFGT =Ìåäàë „Ñâ. Àëåêñàíäúð“? D\Y CD   1TFGP ō(ÒT 8GTFKGPUV    =Îðäåí „Ça Çàñëóãà“?  /QFGNN OKV 2QTVTCKV (ÒTUV #NGZCPFGTU+WPFPQTOCNGP5EJYGTVGTP   1TFGPU\GKEJGP 5KNDGT CO CNVGP LGFQEJ PKEJV \GKVIGPÌUUKUEJGP &TGKGEMUDCPF KP (TKGFGPU\GKVGP   $9-&'-.'2#2'5HH4$80<- 4++  .CWV2GVTQX KP2'5 UKPFXQP(ÒTUV#NGZCPFGT+XQPDKUKPUIGUCOVPWT/GFCKNNGP5V#NGZ CPFGTD\Y1TFGP(ÒT8GTFKGPUVXGTNKGJGPYQTFGPFCXQPCP#WUN·PFGT  )NGKEJ\GKVKIOKVFGO1TFGPō5V#NGZCPFGTŋUVKHVGVG#NGZCPFGTXQP$CVVGPDGTI(ÒTUVXQP$WNICTKGPOKV7MCUXQO  &G\GODGT  FKG OKV KJO CHHKNKKGTVG GKPMNCUUKIG/GFCKNNGō5V#NGZCPFGTŋCNU/KNKV·T8GTFKGPUVCWU\GKEJPWPI KP(TKGFGPUWPFKP-TKGIU\GKVGP /QFGNN /KV7MCUXQO/·T\GTJKGNVUKGWPVGTFGTPGWGP$G\GKEJPWPI ō1TFGPō(ÒT8GTFKGPUVŋŋ YGKVGTJKPOKVFGO1TFGPō5V#NGZCPFGTŋCHHKNKKGTV GKPGGVYCUXGT·PFGTVG)GUVCNVWPI  /QFGNN 



/GFCKNNG ō5V #NGZCPFGT =Ìåäàë „Ñâ. Àëåêñàíäúð“? D\Y CD   1TFGP ō(ÒT 8GTFKGPUV    =Îðäåí „Ça Çàñëóãà“?/QFGNN OKVFGOLÒPIGTGP2QTVTCKV(ÒTUV(GTFKPCPFU+ 1TFGPU \GKEJGP ++ -NCUUG 5KNDGT CO CNVGP LGFQEJ PKEJV \GKVIGPÌUUKUEJGP &TGKGEMUDCPF KP (TKGFGPU\GKVGP   $9-&'-.'2#2'5HH4$80<- ++



.CWV 2GVTQX KP 2' 5   UKPF XQP (ÒTUV #NGZCPFGT + XQP  DKU  KPUIGUCOV PWT  1TFGP (ÒT 8GT   FKGPUVXGTNKGJGPYQTFGPFCXQPCP#WUN·PFGT  0CEJ FGT 4GIKGTWPIUÒDGTPCJOG (ÒTUV (GTFKPCPFU + KO ,CJT  GTJKGNV FKG 8QTFGTUGKVG OKV 7MCU 0T  XQO    #WIWUVFGUUGPLÒPIGTGU2QTVTCKV /QFGNN #NU(ÒTUVHÒJTVGGTCWEJGKPG+-NCUUGKP)QNFGKPFKGCDGTNCWV $CTCOQX\KVKGTVXQP2CXNQX KP2#5 KPFKGUGT(QTO DKU PWT\YGKOCN CP1DGTUV42GVTQXWPF CP)GPGTCN&0KMQNCGX XGTNKGJGPYQTFGPKUV

8198 1:1



/GFCKNNGō(ÒT8GTFKGPUVŋ =Ìåäàë „Ça Çàñëóãà“?/QFGNN OKVFGOLÒPIGTGP2QTVTCKVFGU(ÒTUVGP #NGZCPFGT+ )QNFGPG/GFCKNNG)QNF  CO$CPF$9-XCT&'2#2' 5HH4$80 444++p &KG)QNFGPG/GFCKNNGKUVXQP(ÒTUV#NGZCPFGT+XQPDKUKOWPFKO/QFGNNKPUIGUCOVPWTOCN

CPUKGDGP$WNICTGPWPFCP#WUN·PFGT XGTNKGJGPYQTFGP  )NGKEJ\GKVKI OKV FGO 1TFGP ō5V #NGZCPFGTŋ UVKHVGVG #NGZCPFGT + XQP $CVVGPDGTI (ÒTUV XQP $WNICTKGP OKV 7MCU   XQO  &G\GODGT  FKG FGO GTUVGTGP CHHKNKKGTVGP \WP·EJUV FTGKMNCUUKIG )QNF 5KNDGT WPF $TQP\G  /GFCKNNG   ō(ÒT8GTFKGPUVŋ /QFGNN 

56




BULGARIEN

8199



8201

8200

/GFCKNNG ō(ÒT 8GTFKGPUVŋ =Ìåäàë „Ça Çàñëóãà“?  /QFGNN OKV FGO ·NVGTGP 2QTVTCKV FGU (ÒTUVGP   #NGZCPFGT +    5KNDGTPG /GFCKNNG 5KNDGT CO $CPF $9-  &'  2#  2'   5HH4$80 4++



/GFCKNNG ō(ÒT 8GTFKGPUVŋ =Ìåäàë „Ça Çàñëóãà“?  /QFGNN OKV FGO ·NVGTGP 2QTVTCKV FGU (ÒTUVGP   #NGZCPFGT+ $TQP\GPG/GFCKNNG$TQP\GCO$CPF$9-&'2#2' 5HH4$80 ++



/GFCKNNG ō(ÒT 8GTFKGPUVŋ =Ìåäàë „Ça Çàñëóãà“?  /QFGNN OKV FGO LÒPIGTGP 2QTVTCKV XQP (ÒTUV   (GTFKPCPF + OKV UEJOCNGO *CNU    $TQP\GPG /GFCKNNG $TQP\G CO GVYCU UR·VGTGP   &TGKGEMUDCPF$9-&'2#2'5HH4$80 44++



GTJKGNVFKG8QTFGTUGKVGGKP·NVGTGU2QTVTCKVFGU(ÒTUVGP#NGZCPFGT /QFGNN 





5GKV FGT 4GIKGTWPIUÒDGTPCJOG (ÒTUV (GTFKPCPFU + KO ,CJT  \GKIV FKG 8QTFGTUGKVG FGUUGP LÒPIGTGU 2QTVTCKV    /QFGNN 

8202



8203

8204

8205

8207

/GFCKNNG ō(ÒT 8GTFKGPUVŋ =Ìåäàë „Ça Çàñëóãà“?  /QFGNN OKV FGO LÒPIGTGP 2QTVTCKV XQP (ÒTUV   (GTFKPCPF+VNYOKVUQIGPōTWPFGTŋ(ÒTUVGPMTQPG )QNFGPG/GFCKNNG OKV-TQPG  $TQP\G XGTIQNFGV 5VGORGNUEJPGKFGTUKIPCVWT VNY PKEJV CWUIGRT·IV CO QTKIKPCNGP CNVGP &TGKGEMUDCPF   $9-&'2#2'5HH4$80 ++



/GFCKNNG ō(ÒT 8GTFKGPUVŋ =Ìåäàë „Ça Çàñëóãà“?  /QFGNN OKV FGO LÒPIGTGP 2QTVTCKV XQP (ÒTUV   (GTFKPCPF+VNYOKVUQIGPōTWPFGTŋ(ÒTUVGPMTQPG 5KNDGTPG/GFCKNNGOKV-TQPG 5KNDGTOKV5VGORGNUEJPGKFGTUKIPCVWTō#5%*#4((ŋCOQTKIKPCNGPCNVGP&TGKGEMUDCPF$9-&' 2#2'5HH4$80 ++



/GFCKNNG ō(ÒT 8GTFKGPUVŋ =Ìåäàë „Ça Çàñëóãà“?  /QFGNN OKV FGO LÒPIGTGP 2QTVTCKV XQP (ÒTUV   (GTFKPCPF+VNYOKVUQIGPōTWPFGTŋ(ÒTUVGPMTQPG 5KNDGTPG/GFCKNNG5KNDGT5VGO RGNUEJPGKFGTUKIPCVWTVNYPKEJVCWUIGRT·IVCOQTKIKPCNGPCNVGP&TGKGEMUDCPF$9-&'2# 2'5HH4$80 ++





/GFCKNNG ō(ÒT 8GTFKGPUVŋ =Ìåäàë „Ça Çàñëóãà“?  /QFGNN OKV FGO LÒPIGTGP 2QTVTCKV XQP (ÒTUV   (GTFKPCPF+VNYOKVUQIGPōTWPFGTŋ(ÒTUVGPMTQPG $TQP\GPG/GFCKNNGOKV-TQPG $TQP\G 5VGORGNUEJPGKFGTUKIPCVWT VNY PKEJVCWUIGRT·IVCOQTKIKPCNGPCNVGP&TGKGEMUDCPF$9- &'2#2'5HH4$80 ++





/GFCKNNG ō(ÒT 8GTFKGPUVŋ =Ìåäàë „Ça Çàñëóãà“?  /QFGNN OKV FGO LÒPIGTGP 2QTVTCKV XQP (ÒTUV   (GTFKPCPF + VNY OKV UQIGP ōTWPFGTŋ (ÒTUVGPMTQPG    $TQP\GPG /GFCKNNG $TQP\G   5VGORGNUEJPGKFGTUKIPCVWTVNYPKEJVCWUIGRT·IVCOQTKIKPCNGPCNVGP&TGKGEMUDCPF$9-&' 2#2'5HH4$80 ++





/GFCKNNG ō(ÒT 8GTFKGPUVŋ =Ìåäàë „Ça Çàñëóãà“?  /QFGNN OKV FGO LÒPIGTGP 2QTVTCKV XQP (ÒTUV   (GTFKPCPF + VNY OKV UQIGP ōGEMKIGTŋ <CTGPMTQPG    $TQP\GIW­   CO QTKIKPCNGP CNVGP   &TGKGEMUDCPF$9-&'2#2'5HH4$80 ++



&KG )QNFGPG /GFCKNNG UGKV  IGPGTGNN OKV -TQPG YCT NCWV 2GVTQX KP 2' 5   UGKV KJTGT 5VKHVWPI DKU   KPUIGUCOVPWTOCNXGTNKGJGPYQTFGPYQXQPCNNGKPG8GTNGKJWPIGP CP#WUN·PFGTWPFCP$WNICTGP  FGT,CJTGDKUKPFKG4GIKGTWPIU\GKVXQP(ÒTUV#NGZCPFGTU+HKGNGP  &KGDWNICTKUEJG(ÒTUVGP-TQPG UQIGPōTWPFG-TQPGŋ CNUYGKVGTGU-NCUUGPOGTMOCN ōOKVŋWPFōQJPGŋ-TQPG HÒT FKG5KNDGTPGWPF$TQP\GPG/GFCKNNGYWTFGNCWV&GPMQXWPFNCWV$CTCOQX\KVKGTVXQP2CXNQX KP2#5H  GKPIGHÒJTV /QFGNN 





1DGUUKEJJKGTDGKWOGKPG\GKVIGPÌUUKUEJG1TKIKPCNCPHGTVKIWPIQFGTWOGKPGUR·VGTG)W­MQRKGJCPFGNVMQPPVGNGKFGT PKEJVHGUVIGUVGNNVYGTFGPYWTFGFKGDKUJGTKIGōTWPFGŋDWNICTKUEJG(ÒTUVGPMTQPGKPFKGōGEMKIGŋDWNICTKUEJG ō<CTGPMTQPGŋWOIG·PFGTV /QFGNN 

57


BULGARIEN

-- 8202 1:1 --

8208 1:1,3



1TFGP ō(ÒT $ÒTIGTNKEJGU 8GTFKGPUVŋ =Îðäåí „Ça Ãðàæäàíñêà Çàñëóãà“? CWEJ <KXKN8GTFKGPUVQT   FGPQFGT0CVKQPCNGT<KXKN8GTFKGPUVQTFGPIGPCPPV /QFGNN OKVUQIGPōTWPFGTŋDWNICTKUEJGT(ÒT UVGPMTQPG 5GVFGT+-NCUUGDGUVGJGPFCWU-NGKPQF$TQP\GXGTIQNFGVWPFGOCKNNKGTVCO QTKIKPCNGPCNVGP5EJWNVGTDCPFWPF$TWUVUVGTPOGJTVGKNKIGU5VGTPMQTRWU$TQP\GXGTUKNDGTVVNYXGTIQN FGVCWHFGT4ÒEMUGKVG*GTUVGNNGTDG\GKEJPWPIFGT(KTOC,QJCPP5EJYGTFVPGTKP9KGPCP0CFGNKOPKEJV \WIGJÌTKIGP 'VWK FGT (KTOC $CESWGXKNNG KP 2CTKU $9-   &'   -.'     -ª2#2'5HH4$6#80<- 5VÒEM++  .CWV2GVTQX KP2'5 UKPFXQP(ÒTUV(GTFKPCPF+XQPDKU  KPUIGUCOV+-NCUUGPXGTNKGJGP YQTFGPFCXQPCP$WNICTGP  (ÒTUV (GTFKPCPF + XQP $WNICTKGP CWU FGO *CWUG 5CEJUGP%QDWTI WPF ņ)QVJC  UVKHVGVG FGP 1TFGP HÒT \KXKNG 8GT   FKGPUVGOKVHÒTUVNKEJGO4GUMTKRVXQO#WIWUV'TWOHCUUVG\W$GIKPPUGEJU-NCUUGP +DKU8+-NCUUG HÒT *GTTGPYQDGKFKGDGKFGPWPVGTUVGPKP\YGK)TCFG OKVWPFQJPG-TQPG WPVGTVGKNVYCTWPFFTGK-NCUUGPHÒT&COGP

+DKU+++-NCUUG YQDGKCWEJJKGTFKG++WPFFKG+++-NCUUGOKVWPFQJPG-TQPGXGTNKGJGPYGTFGPMQPPVGP&KG +PUKIPKGP FGT + DKU +++ -NCUUG HÒT *GTTGP WPF FGT + -NCUUG HÒT &COGP MQPPVGP CNU DGUQPFGTG #WU\GKEJPWPI CWEJ   ōKP$TKNNCPVGPŋXGTNKGJGPYGTFGP.CWV2CXNQX KP2#5 YWTFGFKGUQIGPCPPVGō<CTGPMTQPGŋ /QFGNN DGTGKVU KO<WUCOOGPJCPIOKVFGT5VKHVWPIFGU/KNKV·T8GTFKGPUVQTFGPUCO/CKGKPIGHÒJTV

58


BULGARIEN

8210

8211



1TFGP ō(ÒT $ÒTIGTNKEJGU 8GTFKGPUVŋ =Îðäåí „Ça Ãðàæäàíñêà Çàñëóãà“? CWEJ<KXKN8GTFKGPUVQT FGPQFGT0CVKQPCNGT<KXKN8GTFKGPUVQTFGPIGPCPPV /QFGNN OKVUQIGPōTWPFGTŋDWNICTKUEJGT(ÒT UVGPMTQPG 5EJWNVGTDCPF\WO-NGKPQFFGT+-NCUUGCNVMQPHGMVKQPKGTV QJPG-NGKPQF  ++





1TFGP ō(ÒT $ÒTIGTNKEJGU 8GTFKGPUVŋ =Îðäåí „Ça Ãðàæäàíñêà Çàñëóãà“? CWEJ<KXKN8GTFKGPUVQT FGPQFGT0CVKQPCNGT<KXKN8GTFKGPUVQTFGPIGPCPPV /QFGNN OKVUQIGPōTWPFGTŋDWNICTKUEJGT(ÒT UVGPMTQPG    5GV FGT ++ -NCUUG DGUVGJGPF CWU*CNUMTGW\$TQP\GXGTIQNFGVWPFGOCKNNKGTV COQTKIKPCNGPCNVGP*CNUDCPFWPF$TWUVUVGTP$TQP\GXGTUKNDGTVVNYXGTIQNFGVCWHFGT4ÒEMUGKVG*GT UVGNNGTDG\GKEJPWPI FGT (KTOC ,QJCPP 5EJYGTFVPGT KP 9KGP CP 0CFGN KO PKEJV \WIGJÌTKIGP 'VWK FGT   (KTOC #TVJWU $GTVTCPF KP 2CTKU $9-   &'   -.'   2#     2'5HH4$6#80<- 5VÒEM++



1TFGP ō(ÒT $ÒTIGTNKEJGU 8GTFKGPUVŋ =Îðäåí „Ça Ãðàæäàíñêà Çàñëóãà“? CWEJ<KXKN8GTFKGPUVQT FGPQFGT0CVKQPCNGT<KXKN8GTFKGPUVQTFGPIGPCPPV /QFGNN OKVUQIGPōTWPFGTŋDWNICTKUEJGT(ÒT UVGPMTQPG    5GV FGT ++ -NCUUG DGUVGJGPF CWU*CNUMTGW\$TQP\GXGTIQNFGVWPFGOCKNNKGTV OKP'OCKNNGEJKRUKPFTGK-TGW\CTOURKV\GPCOCNVGP*CNUDCPFWPF$TWUVUVGTP$TQP\GXGTUKNDGTVVNY XGTIQNFGV WPF GOCKNNKGTV CWH FGT 4ÒEMUGKVG *GTUVGNNGTDG\GKEJPWPI FGT (KTOC ,QJCPP 5EJYGTFVPGT KP   9KGPCP0CFGNKOPKEJV\WIGJÌTKIGPQDGTHN·EJNKEJGVYCUDGUEJ·FKIVGP'VWKFGT(KTOC#/CTKG5VWCTV KP2CTKU$9-&'-.'2#2'5HH4$ 6#80<- 5VÒEM++



.CWV2GVTQX KP2'5 UKPFXQP(ÒTUV(GTFKPCPF+XQPDKU  KPUIGUCOV++-NCUUGPXGTNKGJGP YQTFGPFCXQPCP$WNICTGP



.CWV2GVTQX KP2'5 UKPFXQP(ÒTUV(GTFKPCPF+XQPDKU  KPUIGUCOV++-NCUUGPXGTNKGJGP YQTFGPFCXQPCP$WNICTGP

59


BULGARIEN

8213

8212



1TFGP ō(ÒT $ÒTIGTNKEJGU 8GTFKGPUVŋ =Îðäåí „Ça Ãðàæäàíñêà Çàñëóãà“? CWEJ<KXKN8GTFKGPUVQT FGPQFGT0CVKQPCNGT<KXKN8GTFKGPUVQTFGPIGPCPPV /QFGNN OKVUQIGPōTWPFGTŋDWNICTKUEJGT(ÒT UVGPMTQPG    -TGW\  -NCUUG $TQP\G XGTIQNFGV WPF GOCKNNKGTV OKP 'OCKNNGEJKR CWH FGT   8QTFGTUGKVG FGU WPVGTGP -TGW\CTOU KP /GFCKNNQPP·JG CO CNVGP \WO 2GPVCIQPCNDCPF FTCRKGTVGP *CNU   DCPF$9-&'-.'2#2'5HH4$80<- ++



.CWV2GVTQX KP2'5 UKPFXQP(ÒTUV(GTFKPCPF+XQPDKU  KPUIGUCOV++-NCUUGPXGTNKGJGP YQTFGPFCXQPCP$WNICTGPWPF-TGW\GMNCUUGFCXQPCP$WNICTGP



1TFGP ō(ÒT $ÒTIGTNKEJGU 8GTFKGPUVŋ =Îðäåí „Ça Ãðàæäàíñêà Çàñëóãà“? CWEJ<KXKN8GTFKGPUVQT FGPQFGT0CVKQPCNGT<KXKN8GTFKGPUVQTFGPIGPCPPV /QFGNN OKVUQIGPōTWPFGTŋDWNICTKUEJGT(ÒT UVGPMTQPG    -TGW\ +8 -NCUUG $TQP\G XGTIQNFGV WPF GOCKNNKGTV CO QTKIKPCNGPCNVGP&TGK GEMUDCPFOKVCWHIGNGIVGT4QUGVVG$9-&'-.'2#2'5HH4$ 80<- ++



.CWV2GVTQX KP2'5 UKPFXQP(ÒTUV(GTFKPCPF+XQPDKU  KPUIGUCOV-TGW\G+8-NCUUG XGTNKGJGPYQTFGPFCXQPCP$WNICTGP

8214



8215

1TFGPō(ÒT$ÒTIGTNKEJGU8GTFKGPUVŋ=Îðäåí „Ça Ãðàæäàíñêà Çàñëóãà“? CWEJ<KXKN8GTFKGPUVQTFGP QFGT0CVKQPCNGT<KXKN8GTFKGPUVQTFGPIGPCPPV /QFGNN OKVUQIGPōTWPFGTŋDWNICTKUEJGT(ÒTUVGPMTQPG  -TGW\8-NCUUGOKV-TQPG$TQP\GXGTUKNDGTVWPFGOCKNNKGTVCOQTKIKPCNGPCNVGP&TGKGEMU DCPF$9-&'XCT-.'2#2'5HH4$80<- 4++



.CWV2GVTQX KP2'5 UKPFXQP(ÒTUV(GTFKPCPF+XQPDKU  KPUIGUCOVPWT-TGW\G8-NCUUG OKV-TQPGXGTNKGJGPYQTFGPFCXQPCP$WNICTGP



1TFGPō(ÒT$ÒTIGTNKEJGU8GTFKGPUVŋ=Îðäåí „Ça Ãðàæäàíñêà Çàñëóãà“? CWEJ<KXKN8GTFKGPUVQTFGP QFGT0CVKQPCNGT<KXKN8GTFKGPUVQTFGPIGPCPPV /QFGNN OKVUQIGPōTWPFGTŋDWNICTKUEJGT(ÒTUVGPMTQPG   -TGW\ 8+ -NCUUG OKV -TQPG 5KNDGT CO QTKIKPCNGP CNVGP &TGKGEMUDCPF KO QTKIKPCNGP   8GTNGKJWPIUGVWKFGT(KTOC,QJ5EJYGTFVPGTKP9KGPOKVIQNFHCTDGPGOGVYCUDGUEJ·FKIVGPHÒTUVNKEJGO 9CRRGP$9-&'-.'2#2'5HH4$80<- 4++ .CWV2GVTQX KP2'5 UKPFXQP(ÒTUV(GTFKPCPF+XQPDKU  KPUIGUCOVPWT-TGW\G8+-NCUUG OKV-TQPGXGTNKGJGPYQTFGPFCXQPCP$WNICTGP

60




BULGARIEN

8216 1:1

8216



8218

1TFGP ō(ÒT /KNKV·T8GTFKGPUVŋ =Îðäåí „Ça Âîåííà Çàñëóãà“?   CWEJ ō/KNKV·T8GTFKGPUVQTFGP   IGPCPPV   /QFGNN ITÌ­GTG +PUKIPKGP    5GV FGT ++ -NCUUG DGUVGJGPF CWU *CNUMTGW\   $TQP\G XGTIQNFGV WPF GOCKNNKGTV CO CNVGP *CNUDCPF WPF $TWUVUVGTP $TQP\G XGTUKNDGTV VNY XGTIQNFGV   WPF GOCKNNKGTV CWH FGO NKPMGP -TGW\CTO QDGTHN·EJNKEJGT 'OCKNNGEJKR WPF URTWPI CWH FGT 4ÒEMUGKVG   *GTUVGNNGTDG\GKEJPWPIFGT(KTOC,QJCPP5EJYGTFVPGTKP9KGPCP0CFGNKOQTKIKPCNGP8GTNGKJWPIUGVWK FGT(KTOC5EJYGTFVPGTOKVHÒTUVNKEJGO9CRRGP DKU $9-&'-.' 2#2'5HH4$80<- 5VÒEM++



.CWV 2GVTQX KP 2' 5   UKPF XQP (ÒTUV (GTFKPCPF + XQP  DKU  KPUIGUCOV  ++ -NCUUGP XGTNKGJGP   YQTFGPFCXQPCP$WNICTGP  (ÒTUV(GTFKPCPF+XQP$WNICTKGP CWUFGO*CWUG5CEJUGP%QDWTIWPFņ)QVJC UVKHVGVGFGP/KNKV·TXGTFKGPUVQTFGPKP 'TYGKVGTWPI FGU <KXKN8GTFKGPUVQTFGPU HÒT /KNKV·TRGTUQPGP OKV HÒTUVNKEJGO 4GUMTKRV XQO  /CK  WPF YKG   LGPGTFWTEJNKGHGTKPFGPHQNIGPFGP,CJTGPFKGINGKEJGP'PVYKEMNWPIUUVWHGP'TWOHCUUVG\W$GIKPPUGEJU-NCUUGP + DKU8+-NCUUG YQDGKFKGDGKFGPWPVGTUVGPKP\YGK)TCFG OKVWPFQJPG-TQPG WPVGTVGKNVYCTGP&KG+PUKIPKGPFGT+ DKU+++-NCUUGMQPPVGPCNUDGUQPFGTG#WU\GKEJPWPICWEJōKP$TKNNCPVGPŋXGTNKGJGPYGTFGP



1TFGP ō(ÒT /KNKV·T8GTFKGPUVŋ =Îðäåí „Ça Âîåííà Çàñëóãà“?   CWEJ ō/KNKV·T8GTFKGPUVQTFGP   IGPCPPV /QFGNN ITÌ­GTG+PUKIPKGP -TGW\8+-NCUUGOKV-TQPG$TQP\GXGTUKNDGTV CO QTKIKPCNGP &TGKGEMUDCPF \WUCOOGP OKV FGT QTKIKPCNGP 8GTNGKJWPIUWTMWPFG HÒT FGP #FLWFCPVUWT   XGKNNCPV /CVGTP FCVKGTV 5QHKC CO  0QXGODGT  OKV 2T·IGUKGIGN WPF 7PVGTUEJTKHVGP KO $KNFGT   TCJOGP$9-&'-.'2#2'5HH4$80<-  5VÒEM++



#FLWVCPFUWTXGKNNCPV/CVGTPYCT%JGHFGT9CEJGKO'N[U¾G2CNCUVFGO#OVUUKV\FGUHTCP\ÌUKUEJGP5VCCVURT· UKFGPVGP



1TFGP ō(ÒT /KNKV·T8GTFKGPUVŋ =Îðäåí „Ça Âîåííà Çàñëóãà“?   CWEJ ō/KNKV·T8GTFKGPUVQTFGP   IGPCPPV   /QFGNN ITÌ­GTG +PUKIPKGP    -TGW\ +++-NCUUG$TQP\GXGTIQNFGVWPFGOCKN NKGTVCOCNVGP*CNUDCPFKOQTKIKPCNGP8GTNGKJWPIUGVWKFGT(KTOC,QJ5EJYGTFVPGTKP9KGPOKVHÒTUVNK EJGO9CRRGP DKU $9-&'-.'2#2'5HH4$80 <- ++



.CWV2GVTQX KP2'5 UKPFXQP(ÒTUV(GTFKPCPF+XQPDKUKPUIGUCOV-TGW\G+++-NCUUGXGTNKG JGPYQTFGPFCXQPCP$WNICTGP

61


BULGARIEN

8219



8220 1:1

1TFGP ō(ÒT /KNKV·T8GTFKGPUVŋ =Îðäåí „Ça Âîåííà Çàñëóãà“?   CWEJ ō/KNKV·T8GTFKGPUVQTFGP   IGPCPPV /QFGNN ITÌ­GTG+PUKIPKGP -TGW\8+-NCUUGOKV-TQPG$TQP\GXGTUKNDGTV COQTKIKPCNGP&TGKGEMUDCPFKOQTKIKPCNGP8GTNGKJWPIUGVWKFGT(KTOC,QJCPP5EJYGTFVPGTKP9KGPOKV HÒTUVNKEJGO 9CRRGP DKU   $9-  &'  -.'  2#  2' 5HH 4$    80<- 4++



.CWV2GVTQX KP2'5 UKPFXQP(ÒTUV(GTFKPCPF+XQPDKUKPUIGUCOVPWT-TGW\G8+-NCUUG OKV-TQPGXGTNKGJGPYQTFGPFCXQPCP$WNICTGP



/GFCKNNG ō(ÒT 9KUUGPUEJCHV WPF -WPUVŋ =Ìåäàë „Çà Íàóêà è Èçêóñòâî“?  /QFGNN OKV FGO   2QTVTCKV (ÒTUV #NGZCPFGTU +    )QNFGPG /GFCKNNG 5KNDGT XGTIQNFGV 8GTIQNFWPI VNY   XGTICPIGPQJPG$CPF$9-XCT&'2#XCT2'2'5HH4$80 44++



&KG\YGKMNCUUKIG )QNFWPF5KNDGT /GFCKNNGYWTFGCO/CKXQP(ÒTUV#NGZCPFGT+IGUVKHVGV.CWV2GVTQX

KP 2' 5   YWTFG FKG )QNFGPG/GFCKNNGXQP(ÒTUV#NGZCPFGT+XQPDKUPWTOCNXGTNKGJGPFKG 5KNDGTPGOCN

8221 1:1



8222

/GFCKNNG ō(ÒT 9KUUGPUEJCHV WPF -WPUVŋ =Ìåäàë „Çà Íàóêà è Èçêóñòâî“?  /QFGNN OKV FGO   LÒPIGTGP 2QTVTCKV (ÒTUV (GTFKPCPFU +    5KNDGTPG /GFCKNNG 5KNDGT QJPG $CPF $9-    &'2#2'5HH4$80 4++



0CEJ FGT 4GIKGTWPIUÒDGTPCJOG XQP (ÒTUV (GTFKPCPF +  GTJKGNV UKG FGUUGP LÒPIGTGU 2QTVTCKV  /QFGNN  .CWV   2GVTQX KP2'5 YWTFGFKG5KNDGTPG/GFCKNNGXQP(ÒTUV(GTFKPCPF+XQPDKUPWTOCNXGTNKGJGP



'JTGP\GKEJGP ō4QVGU -TGW\ŋ =ÏQ÷eòíè Çíaê „×eïâeí Kðúcò“? /QFGNN FCUTQVG-TGW\KUVCWU IGU·IVXQPGKPGTUVKNKUKGTVGPIGHÒVVGTVGP-TQPGÒDGTJÌJV #WUHÒJTWPIHÒT*GTTGP/GUUKPI

! XGTIQNFGVWPFGOCKNNKGTVCP0CFGN$9-&'XCT2'5HH4$$ ++



)GUVKHVGV XQP (ÒTUV #NGZCPFGT + OKV HÒTUVNKEJGO 4GUMTKRV XQO  #RTKN   /QFGNN  CNU #WU\GKEJPWPI HÒT   8GTYWPFGVGPJKNHGKO-TKGINKG­GU(ÒTUV(GTFKPCPF+PGWIGUVCNVGP /QFGNN 



62

'JTGP\GKEJGP ō4QVGU -TGW\ŋ =ÏQ÷eòíè Çíaê „×eïâeí Kðúcò“?   /QFGNN FCU TQVG -TGW\ KUV   CWUIGU·IVXQPGKPGTUVKNKUKGTVGPIGHÒVVGTVGP-TQPGÒDGTJÌJV #WUHÒJTWPIHÒT*GTTGP8CTK CPVGOKVPKEJVIGHÒVVGTVGT-TQPG/GUUKPI ! XGTIQNFGVWPFGOCKNNKGTVCP0CFGN$9-&' XCT2'5HH4$$ ++




BULGARIEN

8224 1:1



'TKPPGTWPIUOGFCKNNGō(ÒTFKG'TY·JNWPIFGU(ÒTUVGP#NGZCPFGTXQP$CVVGPDGTIŋ=Âúçïîìåíàòåëåí  Ìåäàë „Çà BúçøecòâèeòQ ía Kíÿç Aëeêcaíäúp Áaòeíáeðã“?5KNDGTCOQTKIKPCNGP$CPF$9- &'2#2'5H4$6# 44++



+P(QNIGFGU$GTNKPGT-QPITGUUGUYWTFG$WNICTKGPGKPCWVQPQOGU(ÒTUVGPVWOWPVGTFGT1DGTJQJGKVFGU1UOC PKUEJGP4GKEJGU#O(GDTWCTYWTFGKP9GNKMQ6CTPQYQFGTOKVVGNCNVGTNKEJGP*CWRVUVCFV$WNICTKGPUFKG GTUVG$WNICTKUEJG0CVKQPCNXGTUCOONWPIWPVGTFGO8QTUKV\FGUGJGOCNKIGPDWNICTKUEJQTVJQFQZGP'ZCTEJGP#PVKO+ GTÌHHPGV FKG CO  #RTKN  GKPG 8GTHCUUWPI DGUEJNQ­ #O 6CI FCPCEJ FGO  #RTKN Y·JNVG FKG ō)TQ­G   0CVKQPCNXGTUCOONWPIŋ#NGZCPFGT,QUGRJ2TKP\XQP$CVVGPDGTI  5QJPXQP2TKP\#NGZCPFGTXQP*GUUGP

&CTOUVCFV  \WO (ÒTUVGP #NGZCPFGT + XQP $WNICTKGP 'PVIGIGP FGU #TVKMGNU  FGT 8GTHCUUWPI XQP 6CTPQXQ   UVKHVGVG GT WPOKVVGNDCT PCEJ ªDGTPCJOG FGT 4GIKGTWPI FKG GKPMNCUUKIG /GFCKNNG FKG XQP - 5EJYGP\GT GPVYQTHGP   WPF KP 9KGP JGTIGUVGNNV YWTFG &KG GTUVGP  8GTNGKJWPIGP FGT CNU RGTUÌPNKEJG 'TKPPGTWPIUOGFCKNNG FGU (ÒTUVGP   IGNVGPFGP#WU\GKEJPWPIGTHQNIVGPKO,CPWCTFKGNGV\VG8GTNGKJWPI CP/CLQT-2CPKVUC CO#WIWUV FGO6CIFGT#DFCPMWPIXQP(ÒTUV#NGZCPFGT+

8225 8226





8228 1:1

,GVQPCWHFKG'TY·JNWPIFGU2TKP\GPXQP$CVVGPDGTI\WO$WNICTKUEJGP(ÒTUVGP#NGZCPFGT+FWTEJ FKG&GRWVKGTVGPXGTUCOONWPICO#RTKN*GNNG$TQP\G&WTEJOGUUGTOO6GZVKPHTCP \ÌUKUEJ ++



'TKPPGTWPIUOGFCKNNGō(ÒTFKG$GHTGKWPIŋ=Âúçïîìåíàòåëåí Ìåäàë „Çà 1câQáQæäeíèeòQ  1877-1878 ã.“?$TQP\GCOQTKIKPCNGPCNVGPGVYCU\GTUEJNKUUGPGP$CPF$9-&'2# 2'54$ ++



0CEJFGTDNWVKIGP0KGFGTUEJNCIWPIFGU#RTKN#WHUVCPFGUFGT$WNICTGPXQPIGIGPFKGUGKV,CJTGPY·JTGPFG QUOCPKUEJG *GTTUEJCHV WPF FGO 5EJGKVGTP FGT XQP )TQ­DTKVCPPKGP WPF 4W­NCPF GKPDGTWHGPGP -QPHGTGP\ XQP -QP   UVCPVKPQRGN  GTMN·TVG 4W­NCPF FGO 1UOCPKUEJGP 4GKEJ CO  #RTKN  FGP -TKGI FGT PCEJ JQJGP   8GTNWUVGPCWHDGKFGP5GKVGPCO/·T\OKVFGO(TKGFGPXQP5CP5VGHCPQDGGPFGVYWTFG(ÒTUV#NGZCPFGT+ UVKHVGVG FKG /GFCKNNG OKV 8GTQTFPWPI 0T  XQO  ,WNK  FGO GTUVGP ,CJTGUVCI FGT 5EJNCEJV XQP 5VCTC   <CIQTC&GT/QUMCWGT/ÒP\JQHJCVUKGPCEJGKPGO'PVYWTHXQP-82KEEQNQJGTIGUVGNNV





'TKPPGTWPIUOGFCKNNGō(ÒTFKG$GHTGKWPIŋ=Âúçïîìåíàòåëåí Ìåäàë „Çà 1câQáQæäeíèeòQ  1877-1878 ã.“?$TQP\GCOCNVGP2GPVCIQPCNDCPF$9-&'2#2'54$ ++



/GFCKNNG ō(ÒT FKG ªDGTICDG FGT -TKGIUHCJPGP CP FKG $WNICTKUEJG #TOGGŋ =Meäaë „Ça   Paçëaâaíeòo ía ÁúëãaðEêaòa $Qécêa ïðeç 1881 ã.“? &WTEJOGUUGT  OO 5KNDGT CO CNVGP   1TKIKPCND·PFEJGP$9-&'2#2'5 4++



#O  #WIWUV  DGIKPI FKG LWPIG 0CVKQP FGP ō6CI FGT $WNICTKUEJGP #TOGGŋ FKG CP FKGUGO 6CI KJTG GTUVGP   (GNF\GKEJGP CWU FGT *CPF (ÒTUV #NGZCPFGTU + GTJKGNV &KG 'TKPPGTWPIUOGFCKNNG YWTFG CO INGKEJGP 6CIG IGUVKHVGV   WPFWCCPGKPG4GKJGFGTCPFGP(GKGTPVGKNPGJOGPFGPJQJGP1HHK\KGTGWPF(CJPGPVT·IGTXGTNKGJGP

63


BULGARIEN

8229



8232

8230

'TKPPGTWPIUOGFCKNNG ō(ÒT FGP 5GTDKUEJ$WNICTKUEJGP -TKGI ŋ =Âúçïîìåíàòåëåí Ìåäàë „Çà   %ðúáEêQ-$úëãCðEêCòC $QéíC 1885 ã.“?/QFGNN OKV2QTVTCKVXQP(ÒTUV#NGZCPFGT+ $TQP \GPG/GFCKNNG$TQP\GCOUR·VGTGP$CPF$9-&'2#2'5HH4$80 ++



&GT $GTNKPGT -QPITG­ XQP  JCVVG 1UVTWOGNKGP WPF /CMGFQPKGP FKG KO (TKGFGP XQP 5CP 5VGHCPQ CP FCU PGWG   $WNICTKGP IGNCPIV YCTGP YKGFGT FGO 1UOCPKUEJGP 4GKEJ \WIGTURTQEJGP +P (QNIG GKPGU 1HHK\KGTURWVUEJGU  KP   1UVTWOGNKGPÒDGTPCJO(ÒTUV#NGZCPFGT+FKG*GTTUEJCHHVÒDGTFKGDKUFCJKPCWVQPQOGQUOCPKUEJG2TQXKP\&CTCWH JKP GTMN·TVG -ÌPKI /KNCP + XQP 5GTDKGP OKV 7PVGTUVÒV\WPI XQP ¤UVGTTGKEJ7PICTP FGO (ÒTUVGPVWO $WNICTKGP FGP   -TKGI0CEJFGO¤UVGTTGKEJ7PICTPFGOKO8GTNCWHGFGU-TKGIGUKP$GFT·PIPKUIGTCVGPGP5GTDKGP\W*KNHGIGMQO OGP YCT YWTFG OKV FGO (TKGFGP XQP $WMCTGUV CO  /·T\  FGT 5VCVWU ōSWQ CPVGŋ YKGFGT JGTIGUVGNNV +O   6QRJCPG8GTVTCI XQO  #RTKN  YWTFG FKG 8GTGKPKIWPI FGU (ÒTUVGPVWOU$WNICTKGPOKV1UVTWOGNKGPKO*GTDUV  KPVGTPCVKQPCN CPGTMCPPV /KV 7MCU 0T  XQO  (GDTWCT  UVKHVGVG (ÒTUV #NGZCPFGT + FKG \YGKMNCUUKIG  

5KNDGT WPF $TQP\G  /GFCKNNG  /QFGNN  -WT\ PCEJ #DFCPMWPI (ÒTUV #NGZCPFGTU + YWTFG FKG 8GTNGKJWPI FGT   /GFCKNNGGKPIGUVGNNV



'TKPPGTWPIUOGFCKNNG ō(ÒT FGP 5GTDKUEJ$WNICTKUEJGP -TKGI ŋ =Âúçïîìåíàòåëåí Ìåäàë „Çà   %ðúáEêQ$úëãCðEêCòC$QéíCãŋ?/QFGNN OKV\YGK9CRRGP 5KNDGTPG/GFCKNNGCO UR·VGTGP$CPF$9-&'2#2'5HH4$80 ++



0CEJ FGT #DFCPMWPI (ÒTUV #NGZCPFGTU + UVKHVGVGP FKG 4GIGPVGP FKG \YGKMNCUUKIG 5KNDGT WPF $TQP\G  /GFCKNNG OKV   7MCU0TXQO0QXGODGTPGW /QFGNN &KGUGYWTFGDKUXGTNKGJGP





'TKPPGTWPIUOGFCKNNG ō(ÒT FGP 5GTDKUEJ$WNICTKUEJGP -TKGI ŋ =Âúçïîìåíàòåëåí Ìåäàë „Çà   %ðúáEêQ$úëãCðEêCòC$QéíCãŋ?/QFGNN OKV\YGK9CRRGP $TQP\GPG/GFCKNNGCO QTKIKPCNGPCNVGP2GPVCIQPCNDCPF$9-&'2#2'5HH4$80 ++



7PDGMCPPVGU'TKPPGTWPIUMTGW\OKVFGO/QPQITCOOFGU(ÒTUVGP#NGZCPFGT+$TQP\GCORGPVC IQPCNGP$CPFFGU1TFGPU(ÒT6CRHGTMGKV 4++



8233 8235

8234



'TKPPGTWPIUOGFCKNNG CP (ÒTUV #NGZCPFGT + XQP $WNICTKGP $TQP\G XGTUKNDGTV CWH FGT 4ÒEMUGKVG   FGWVUEJURTCEJKIG+PUEJTKHVCOPGWGP&TGKGEMUDCPF ++





0KEJVVTCIDCTG'TKPPGTWPIUOGFCKNNGCWHFKG4GIKGTWPIU\GKV(ÒTUV#NGZCPFGT+XQP$WNICTKGPXQO #RTKNDKU\WO#WIWUV*GNNG$TQP\G&WTEJOGUUGTOO ++





'TKPPGTWPIUOGFCKNNGō(ÒTFKG'TY·JNWPIFGU(ÒTUVGP(GTFKPCPF+ŋ=Âúçïîìåíàòåëåí Ìåäàë „Çà $úçøecòâèeòoía-íÿçÔeðäèíaíä+ïðeçŋ?-TGW\-NCUUG$TQP\GXGTIQNFGVWPFVNY GOCKNNKGTV CO QTKIKPCNGP &TGKGEMUDCPF $9-  &'  2#  2' 5HH 4$    80 ++



0CEJ FGO (TKGFGP XQP $WMCTGUV XQO  /·T\   XGTUCIVG <CT #NGZCPFGT +++ FGO (ÒTUVGP #NGZCPFGT + FKG   YGKVGTG 7PVGTUVÒV\WPI WPF \YCPI FKGUGP FWTEJ GKPGP RTQTWUUKUEJGP 2WVUEJ \WT #DFCPMWPI CO  #WIWUV    0CEJFGOGTPQEJGKPOCNCWHFGP6JTQP\WTÒEMIGMGJTVYCTXGT\KEJVGVGGTCO5GRVGODGTGPFIÒNVKICWHFGP DWNICTKUEJGP 6JTQP 0CEJ NCPIGP KPPGPRQNKVKUEJGP 9KTTGP YWTFG (GTFKPCPF 2TKP\ XQP 5CEJUGP%QDWTI)QVJC   -QJ±T[ 5QJP XQP 2TKP\ #WIWUV .WFYKI 8KMVQT XQP 5CEJUGP%QDWTI)QVJC-QJ±T[ \WO (ÒTUV (GTFKPCPF + XQP   $WNICTKGP IGY·JNV 'PVIGIGP FGU #TVKMGNU  FGT 8GTHCUUWPI XQP 6WTPQXC UVKHVGVG GT CO  &G\GODGT  FCU   FTGKMNCUUKIG + DKU +++ -NCUUG  'TKPPGTWPIUMTGW\ FCU XQP FGT (KTOC 4QVJG KP 9KGP JGTIGUVGNNV YWTFG 8QO    1MVQDGTDKUYWTFGPNCWV2CXNQX KP2#5H -TGW\GFGT+-NCUUGFGT++WPFFGT+++ -NCUUGXGTNKGJGP

64


BULGARIEN

8236 8237

8237



,GVQPCWHFKG8GTGKFKIWPI(ÒTUV(GTFKPCPFU+CWHFKG$WNICTKUEJG8GTHCUUWPICO#WIWUV *GNNG$TQP\G&WTEJOGUUGTOO6GZVKPHTCP\ÌUKUEJ ++





/GFCKNNGHÒT#TDGKVWPF.GKUVWPIFGT+PVGTPCVKQPCNGP.CPFYKTVUEJCHVU#WUUVGNNWPIKP2NQXFKX 0KEJV VTCIDCTG QXCNG )QNFGPG /GFCKNNG  Z  OO $TQP\G)CNXCPQ OKV 4GUVXGTIQNFWPI   4$5 ++



8239

8240 8238 1:1



'TKPPGTWPIUOGFCKNNG ō<WT 8GTGJGNKEJWPI XQP (GTFKPCPF + WPF /CTKG.QWKUGŋ =Âúçïîìåíàòåëåí   Ìåäàë „Çà ÁðCêQEú÷GòCíèGòQ íC ÔGðäèíCíä + E /Cðèÿ-Ë[èçC"? )QNFGPG /GFCKNNG OKV -TQPG   $TQP\GXGTIQNFGVCOQTKIKPCNGPCNVGP&TGKGEMUDCPF$9-&'2#2'5H4$ 80XCT 4++



.CWV2GVTQX KP2'5 YWTFGFKG)QNFGPG/GFCKNNGOKV-TQPGPWTOCNXGTNKGJGP  #O  #RTKN  JGKTCVGVG (ÒTUV (GTFKPCPF + XQP $WNICTKGP KP FGT 8KNNC FGNNG2KCPQTGDGK8KC4GIIKQKP+VCNKGP 2TKP\GUUKP /CTKG .QWKUG XQP $QWTDQP2CTOC   6QEJVGT *GT\QI 4QDGTVU XQP 2CTOC   FGU   NGV\VGP TGIKGTGPFGP *GT\QIU XQP 2CTOC 2KCEGP\C WPF )WCUVCNNC WPF *CNDUEJYGUVGT FGT UR·VGTGP NGV\VGP -CKUGTKP   XQP¤UVGTTGKEJWPF-ÌPKIKPXQP7PICTP<KVCXQP$QWTDQP2CTOC  &CU2CCTJCVVGXKGT-KPFGT-TQP RTKP\$QTKU  FGTUR·VGTG<CT$QTKU+++2TKP\-[TKNN  FGTUR·VGTGDWNICTKUEJG4GIGPV2TKP \GUUKP 'WFQZKC   WPF 2TKP\GUUKP 0CFGLFC   #WU #PNC­ FGT 6TCWWPI UVKHVGVG (GTFKPCPF FKGUG   UGEJUMNCUUKIG )QNF 5KNDGT WPF $TQP\G LGYGKNU OKV QFGT QJPG -TQPG  'TKPPGTWPIUOGFCKNNG FKG XQP # 5EJCTHH   IGUVCNVGVWPFXQPFGT(KTOC4QVJGWPF0GHHGKP9KGPJGTIGUVGNNVYWTFG  $GOGTMGPUYGTVKUVFGT7OUVCPFFC­DGKFKGUGT/GFCKNNGUEJQP\WOGTUVGPOCNFKGUQIGPCPPVGGEMKIG<CTGP MTQPG UKGDGP ,CJTG XQT 5VKHVWPI FGU 1TFGPU (ÒT /KNKV·T8GTFKGPUV WPF HÒPH\GJP ,CJTG XQT FGT 'KPHÒJTWPI KP FKG   UVCCVNKEJG*GTCNFKM  QHHK\KGNNKP'TUEJGKPWPIVTKVV





'TKPPGTWPIUOGFCKNNG ō<WT 8GTGJGNKEJWPI XQP (GTFKPCPF + WPF /CTKG.QWKUGŋ =Âúçïîìåíàòåëåí   Ìåäàë „Çà ÁðCêQEú÷GòCíèGòQ íC ÔGðäèíCíä + E /Cðèÿ-Ë[èçC"?$TQP\GPG/GFCKNNG$TQP\GCO UR·VGTGP LGFQEJ MQTTGMVGP &TGKGEMUDCPF $9-  &'  2#  XCT 2' 5H 4$    80 ++



'TKPPGTWPIUOGFCKNNG ō<WT 6TCWWPI XQP (ÒTUV (GTFKPCPF + WPF 2TKP\GUUKP /CTKG.QWKUGŋ   =Âúçïîìåíàòåëåí Ìåäàë „Çà $Gí÷CâêCòC íC -íÿç ÔGðäèíCíä + E ÏðèíöGEC /Cðèÿ-Ë[èçC"?   #WUHÒJTWPIOKV4WPFÌUG$TQP\GCOUR·VGTGP&TGKGEMUDCPF&'4$ ++



#WU#PNC­FGT6TCWWPIXQP(ÒTUV(GTFKPCPF+OKV2TKP\GUUKP/CTKG.QWKUGXQP$QWTDQP2CTOCCO#RTKN YWTFGCWEJFKGUG/GFCKNNGCNU'TKPPGTWPIUOGFCKNNGCWUIGIGDGP

65


BULGARIEN

8241

8242 8243



'TKPPGTWPIUOGFCKNNG CP FKG 6CWHG FGU 6JTQPHQNIGTU $QTKU (ÒTUVGP XQP 6CTPQXC CO  (GDTWCT   5KNDGTQJPG$CPF ++





'TKPPGTWPIUOGFCKNNGō<WO6QFFGT(ÒTUVKP/CTKG.QWKUGŋ=Âúçïîìåíàòåëåí Ìåäàë „Çà %ìúðòòC íC -íÿãèÿ /Cðèÿ-Ë[èçC"? -NGKPG 5KNDGTPG /GFCKNNG $TQP\G XGTUKNDGTV CO UR·VGTGP &TGKGEMUDCPF   &'4$ ++



-WT\PCEJFGT)GDWTVKJTGTLÒPIUVGP6QEJVGT2TKP\GUUKP0CFGLFC  XGTUVCTD(ÒTUVKP/CTKG.QWKUGCO ,CPWCTKOCNVGTXQPPWT,CJTGP#WUFKGUGO#PNC­YWTFGFKGUG/GFCKNNGCWUIGIGDGP



'TKPPGTWPIUOGFCKNNGō<WO6QFFGT(ÒTUVKP/CTKG.QWKUGŋ=Âúçïîìåíàòåëåí Ìåäàë „Çà %ìúðòòC íC -íÿãèÿ /Cðèÿ-Ë[èçC"? )TQ­G $TQP\GPG /GFCKNNG $TQP\G CO UR·VGTGP &TGKGEMUDCPF &'    4$ ++

8244 1:1





8245 1:1

'TKPPGTWPIUOGFCKNNG ō<WO  )GDWTVUVCI FGT (ÒTUVKPOWVVGT -NGOGPVKPGŋ =Âúçïîìåíàòåëåí   Ìåäàë „ÏQ %ëy÷aé 80-ãoäèøíèíaòa ía -íÿãèíÿ -ëeìeíòèía? )QNFGPG /GFCKNNG $TQP\G XGT   IQNFGVCOPKEJVMQTTGMVGP&TGKGEMUDCPF$9-&'2#XCT2'54$ 4++



(ÒTUVKPOWVVGT %NGOGPVKPG XQP $WNICTKGP   IGDQTGPGP 2TKP\GUUKP XQP 1TN¾CPU YCT FKG LÒPIUVG 6QEJVGT   FGU HTCP\ÌUKUEJGP ō$ÒTIGTMÌPKIUŋ .QWKU 2JKNKRRG   WPF JCVVG  2TKP\ #WIWUV .WFYKI 8KMVQT XQP   5CEJUGP%QDWTI)QVJC-QJ±T[ IGJGKTCVGV #O  ,WPK  DGIKPI UKG KJTGP  )GDWTVUVCI #WU FKGUGO #PNC­   UVKHVGVG(ÒTUV(GTFKPCPF+CO/CKFKGFTGKMNCUUKIG )QNF5KNDGTWPF$TQP\G /GFCKNNG5KGYWTFGKP)QNF CPFKG5VCDUQHHK\KGTGKP5KNDGTCPFKGUQPUVKIGP1HHK\KGTGWPFKP$TQP\GCPFKG7PVGTQHHK\KGTGWPF/CPPUEJCHVGPFGU +PHCPVGTKG4GIKOGPVU2NQXFKXFGUUGP%JGHUKGYCTXGTNKGJGP



'TKPPGTWPIUOGFCKNNG ō ,CJTG #RTKN#WHUVCPFŋ =Âúçïîìåíàòåëåí Ìåäàë „25 ÃQäèíè #ïðèëEêQ   $úEòCíèG“?$TQP\GCOQTKIKPCNGPCNVGPGVYCU\GTUEJNKUUGPGP$CPF$9-&'2# 2'5H4$80 ++



#O  #RTKN  DTCEJ KP FGT QUOCPKUEJGP 2TQXKP\ $WNICTKGP GKP #WHUVCPF FGT $GXÌNMGTWPI IGIGP FKG UGKV    ,CJTGPY·JTGPFG*GTTUEJCHVFGU1UOCPKUEJGP4GKEJGUKO.CPFGCWU1DYQJNXQPFGP6ÒTMGPDNWVKIPKGFGTIGUEJNCIGP IKNV GT CNU $GIKPP FGT 'PVYKEMNWPI CP FGUUGP 'PFG FKG 2TQMNCOCVKQP FGT XQNNMQOOGPGP 7PCDJ·PIKIMGKV FGU   -ÌPKITGKEJU $WNICTKGP XQO 1UOCPKUEJGP 4GKEJ CO  1MVQDGT  UVCPF #WU #PNC­ FGU  ,CJTGUVCIGU   FGU $GIKPPU FGU #WHUVCPFU UVKHVGVG (ÒTUV (GTFKPCPF + OKV 4GUMTKRV XQO  #RTKNFKGUG/GFCKNNGFKGDGIKP PGPF CO HQNIGPFGP 6CI FGO ,CJTGUVCI CP CNNG PQEJ NGDGPFGP 6GKNPGJOGT FGU #WHUVCPFGU XGTNKGJGP YWTFG 5KG   YWTFGXQO$KNFJCWGT$QTKU5EJCV\GPVYQTHGPWPFXQPFGT(KTOC0KMQNC5CDGXKP5QHKCJGTIGUVGNNV

 66

'TKPPGTWPIUOGFCKNNG \WO  ,CJTGUVCI FGU #WHUVCPFGU XQO  #RTKN#NWOKPKWO/GFCKNNG #NWOKPKWOCOPGWGP&TGKGEMUDCPF ++




BULGARIEN

8247 1:1



'TKPPGTWPIUOGFCKNNG ō(ÒT FKG /CPÌXGT KP 5EJKRMC ŋ =Âúçïîìåíàòåëåí Ìåäàë „ÌaíåÂp ía    Øèïêa T“?$TQP\GPG/GFCKNNG$TQP\GCOPGWGP$CPF$9-2# 4++



9·JTGPF FGU 4WUUKUEJ1UOCPKUEJGP -TKGIGU XQP  JCVVG KP FGT 0·JG FGT 5VCFV 5EJKRMC XQO  DKU    #WIWUVWPFGTPGWVXQODKU5GRVGODGTFKGHÒTFKGUGP-TKGIDGFGWVGPFG5EJNCEJVCO5EJKRMC2CUUUVCVV IGHWPFGP KP FGT FKG 4WUUGP VNY WPVGT JQJGP 8GTNWUVGP FGP #PUVWTO FGT 1UOCPGP YKGFGTJQNV CDIGYGJTV JCVVGP   #O  ,CPWCT  MQPPVG UEJNKG­NKEJ FKG IGUCOVG QUOCPKUEJG #TOGG OKV  /CPP IGHCPIGP IGPQOOGP YGT   FGP +O <WUCOOGPJCPI OKV (GKGTP \WO  ,CJTGUVCI FGT ō$GHTGKWPI $WNICTKGPU XQO QUOCPKUEJGP ,QEJŋ YWTFGP   WOHCPITGKEJG /KNKV·TOCPÌXGT KP FGT 5VCFV 5EJKRMC WPF CO 5EJKRMC2CUU FWTEJIGHÒJTV #WU FKGUGO #PNC­ YWTFG   FKGUG'TKPPGTWPIUOGFCKNNGKP$TQP\GWPFKP#NWOKPKWOCWUIGIGDGPXQPFGTCDGTPWTYGPKIG'ZGORNCTGJGTIGUVGNNV YWTFGP

8249 1:1

8248 1:1

8250 1:1



'TKPPGTWPIUOGFCKNNGCPFGP4WUUKUEJGP<CTGP#NGZCPFGT++WPFCPFGP,CJTGUVCIFGT5EJNCEJV XQP5EJKRMCXQPKO,CJTG$TQP\GPG/GFCKNNG$TQP\GCOPGWGP$CPF ++





'TKPPGTWPIUOGFCKNNGCPFGP4WUUKUEJGP<CTGP#NGZCPFGT++WPFCPFGP,CJTGUVCIFGT5EJNCEJV XQP 5EJKRMC XQP  KO ,CJTG  $TQP\GPG /GFCKNNG XCTKCPVG #WUHÒJTWPI $TQP\G CO PGWGP   $CPF ++p+++



'TKPPGTWPIUOGFCKNNGCPFGP4WUUKUEJGP<CTGP#NGZCPFGT++WPFCPFGP,CJTGUVCIFGT5EJNCEJV XQP5EJKRMCXQPKO,CJTG)TQ­G#NWOKPKWO/GFCKNNG#NWOKPKWOCOPGWGP$CPF +++





67


BULGARIEN <#4'067/$7.)#4+'0  

8251



68

1TFGPō*N*N#RQUVGN-[TKNNWPF/GVJQFKWUŋ=Îðäåí „Ñâ. Ñâ. Ðàâíîàïîñòîëè Êèðèë èÌåòîäèé“? /QFGNN  )TQ­G-QNNCPG#WUHÒJTWPIOKVMNGKPGTGP-GVVGPINKGFGTPDGUVGJGPFCWU.Ì YGPUGEJU.KNKGPWPFUGEJU/QPQITCOO)NKGFGTP5KNDGTXGTIQNFGVWPFGOCKNNKGTVOKV-NGKPQF5KNDGT VNY ITCXKGTV VNY \KUGNKGTV XGTIQNFGV WPF GOCKNNKGTV HGKPUVG 'OCKNNGOCNGTGK KO QTKIKPCNGP YGK­GP    GVYCU XGTUEJOWV\VGP OKV IQNFHCTDGPGT GEMKIGT <CTGPMTQPG DGFTWEMVGP 8GTNGKJWPIUGVWK $9-    &'-.'2#2'5H4$80<- 444+p++ 


BULGARIEN

8251 Detail 1:1

#W­GTIGYÌJPNKEJ UEJÌPG #PHGTVKIWPIUSWCNKV·V KP CNNGTDGUVGT 'TJCNVWPISWCNKV·V GKPG FGT UGNVGPUVGP 1TFGPUMQNNCPGP   ÒDGTJCWRV.CWV#PICDGPFGU'KPNKGHGTGTUMQOOVFKG-QNNCPGCWU$WNICTKGPYQUKGXQPFGP0CEJMQOOGPGKPGUFGT UGEJU DWNICTKUEJGP PKEJV FGT MÌPKINKEJGP (COKNKG CPIGJÌTGPFGP $GNKGJGPGP DKU PCEJ FGO <WUCOOGPDTWEJ FGU   -QOOWPKUOWUKO,CJTXGTUVGEMVYQTFGPYCT  &KG )TQ­G -QNNCPG FKG JÌEJUVG #WU\GKEJPWPIFGU<CTGPVWOU$WNICTKGPYWTFGXQO5VKHVWPIULCJTDKU\WO 5GRVGODGT  PWT CP PGWP $WNICTGP XGTNKGJGP CP <CT (GTFKPCPF WPF UGKPG DGKFGP 5ÌJPG 2TKP\ $QTKU WPF 2TKP\   %[TKNCP'ZCTEJ;QUUKH+  +XCP)GUJQY  &T8CUUKN4CFQUNCXQX  +XCP8C\QX  $KUEJQH 5KOGQP   WPF )GPGTCN &CPCKN 0KMQNCGX   #WUN·PFKUEJG +PJCDGT FGT ITQ­GP -QNNCPG YCTGP W C <CT   0KMQNCWU ++ XQP 4W­NCPF FGT &GWVUEJG -CKUGT 9KNJGNO ++ -CKUGT (TCP\ ,QUGRJ + XQP ¤UVGTTGKEJ -ÌPKI XQP   7PICTPWPF-ÌPKI)GQTI8+XQP)TQ­DTKVCPPKGPWPF+TNCPF-CKUGTXQP+PFKGP  &GT1TFGPYWTFGIGUVKHVGVOKVMÌPKINKEJGO4GUMTKRVXQP<CT(GTFKPCPF+CO/CKCNUGKPMNCUUKIGTJÌEJ UVGT DWNICTKUEJGT 1TFGP FGT JÌEJUVGP 9ÒTFGPVT·IGTP XQTDGJCNVGP YCT &KG )TQ­G -QNNCPG FGU 1TFGPU DGUVGJGPF   CWU  -GVVGPINKGFGTP YCT UVCVWCTKUEJ FGO <CT XQTDGJCNVGP MQPPVG LGFQEJ CNU DGUQPFGTG #WU\GKEJPWPI CP HTGOFG   EJTKUVNKEJG5QWXGT·PGWPFKP#WUPCJOGH·NNGPCWEJCP$WNICTGPXGTNKGJGPYGTFGP&GT<CTUGNDUVVTWI\WDGUQPFGTGP #PN·UUGPGKPGUQIGPō)TQ­OGKUVGTMQNNCPGŋOKVITQ­GP-GVVGPINKGFGTP&KGMNGKPG-QNNCPGYWTFGCPFKGMÌPKINK EJGP2TKP\GPWPFCPHTGOFGEJTKUVNKEJG5VCCVUQDGTJ·WRVGTXGTNKGJGP&GT1TFGPYWTFGXQPUGKPGT5VKHVWPIDKU CPPWTPGWP$WNICTGPWPFCPKPUIGUCOV#WUN·PFGTXGTNKGJGPCNUGTUVGOFGOTWUUKUEJGP<CTGP0KMQNCWU++0CEJ YWTFGGTPKEJVOGJTXGTNKGJGPWPFUEJNKG­NKEJPCEJ#WUTWHWPIFGT4GRWDNKMCDIGUEJCHHV  /KV 7MCU 0T  XQO  &G\GODGT  UVKHVGVG FCU 2T·UKFKWO FGT 8QNMUXGTUCOONWPI FGP FTGKMNCUUKIGP 1TFGP   ō-[TKNN WPF /GVJQFKWUŋ HÒT 8GTFKGPUVG WO FKG 9KUUGPUEJCHV 'T\KGJWPI WPF -WNVWT  /QFGNN  FGT LGFQEJ OKV   7MCU0TXGTÌHHGPVNKEJVKPFGT5VCCVU)C\GVVG#WUICDGXQO#RTKNYKGFGTCDIGUEJCHHVYWTFG/KV FGO ō#MV ÒDGT FKG 1TFGP WPF /GFCKNNGP FGT 4GRWDNKM $WNICTKGPŋ FGT :::+: 8QNMUXGTUCOONWPI XQO  /CK    7MCU 0T  XQO  ,WPK  XGTÌHHGPVNKEJVKPFGT5VCCVU)C\GVVG#WUICDGXQO,WPK FGOō#MV ÒDGT FKG PFGTWPI WPF 'TYGKVGTWPI FGT 1TFGP WPF /GFCKNNGP FGT 4GRWDNKM $WNICTKGPŋ FGT :::+: 8QNMUXGT   UCOONWPIXQO/CKWPFFGO7MCU0TXQO/CK XGTÌHHGPVNKEJVKPFGT5VCCVU)C\GVVGCW­GT QTFGPVNKEJG#WUICDGXQO/CK YWTFGGKPPGWGU5[UVGOUVCCVNKEJGT#WU\GKEJPWPIGPIGUEJCHHGPYQOKVCWEJ FGTFTGKMNCUUKIG1TFGPō5V5V-[TKNNWPF/GVJQFKWUŋCNU#WU\GKEJPWPIHÒT8GTFKGPUVGWOFKG9KUUGPUEJCHV'T\KG JWPI WPF -WNVWT YKGFGT GTTKEJVGV FKG )GUVCNVWPI FGUUGP +PUKIPKGP LGFQEJ CP FGP 1TFGP FGT <CTGP\GKV CPIGNGJPV   YWTFG /QFGNN 5QDGUVGJVFKG-NCUUGCWUGKPGO-NGKPQF·JPNKEJFGOFGT<CTGP\GKVCPGKPGT-GVVG·JPNKEJFGT MNGKPGP-QNNCPGFGT<CTGP\GKVWPFCWUGKPGO$TWUVUVGTPFKGWPFFKG-NCUUGLGYGKNUCWUFGO1TFGPUMTGW\CO &TGKGEMUDCPF -NCUUGIQNFHCTDGP$CPFOKV4QUGVVGWPFFTKVVG-NCUUGUKNDGTHCTDGP 

69


BULGARIEN

8252 1:1



1TFGP ō*N *N #RQUVGN -[TKNN WPF /GVJQFKWUŋ =Îðäåí „Ñâ. Ñâ. Ðàâíîàïîñòîëè Êèðèë è   Ìåòîäèé“?/QFGNN  5COONGTCPHGTVKIWPIFGTMNGKPGP1TFGPUMQNNCPGOKV-NGKPQF5KNDGT XGTIQNFGVWPFGOCKNNKGTV2# ++  *GTXQTTCIGPF IGCTDGKVGVG 5COONGTCPHGTVKIWPI HÒT GKP PWT UEJYGT GTJ·NVNKEJGU WPF UGJT VGWGTGU 1TKIKPCNGZGORNCT   #PIGHGTVKIVKPFGPGT,CJTGPYQJNXQPFGT(KTOC%GLCNXQKP/CFTKF$GK2CXNQX 2#0TWPF KUVGKP KFGPVKUEJGU'ZGORNCTCNU\GKVIGPÌUUKUEJGU1TKIKPCNRWDNK\KGTV

8253 1:1



8254 1:1

1TFGP ō(ÒT 6CRHGTMGKVŌ =Îðäåí „Çà Õðàáðîñò“?  /QFGNN /KPKCVWT FGU -TGW\GU +8 -NCUUG OKV   FGTKPQHHK\KGNNGP,CJTGU\CJNōŋXGTUKNDGTVGOCKNNKGTVCO&TGKGEMUD·PFEJGP 4++



&KGCWHFGT/KPKCVWTCPIGDTCEJVGKPQHHK\KGNNG,CJTGU\CJNōŋFGWVGVGKPG8GTNGKJWPIY·JTGPFFGU'TUVGP$CNMCP MTKGIGUCP



1TFGP ō(ÒT 6CRHGTMGKVŌ =Îðäåí „Çà Õðàáðîñò“?  /QFGNN /KPKCVWT FGU -TGW\GU +8 -NCUUG OKV   FGTKPQHHK\KGNNGP,CJTGU\CJNōŋXGTUKNDGTVGOCKNNKGTVCP5EJTCWDGOKV5EJTCWDUEJGKDG 4++ &KGCWHFGT/KPKCVWTCPIGDTCEJVGKPQHHK\KGNNG,CJTGU\CJNōŋFGWVGVGKPG8GTNGKJWPIY·JTGPFFGU'TUVGP$CNMCP MTKGIGUCP

70




BULGARIEN

8255 1:1



1TFGP ō(ÒT 6CRHGTMGKVŌ =Îðäåí „Çà Õðàáðîñò“?  /QFGNN OKV ITÒPGO D\Y YGK­GO /GFCKNNQP   TKPI CWH FGT 8QTFGTUGKVG OKV GKPGO UGEJU\CEMKIGP 5VGTP DGKFUGKVU DGINGKVGV XQP GKPGT UVKNKUKGTVGP .KNKG   QFGT$NÒVGWPF\YGK2WPMVGP -TGW\+++-NCUUG5VWHG CD,CPWCT$TQP\GXGTIQNFGV WPFGOCKNNKGTVFGTQDGTG-TGW\CTOCNVPCEJGOCKNNKGTVCP0CFGN$-$9-&'-.'2# 2'5HH4$80<- 444++p+++



'ZVTGOUGNVGPG#WUHÒJTWPIFKGPWTYGPKIG9QEJGPNCPIPCEJKJTGT5VKHVWPIKO,CPWCTKPFKGUGT(QTO QJPG ,CJTGU\CJNGPCWHFGP-TGW\CTOGP XGTNKGJGPYQTFGPKUV&KGGKPUEJN·IKIG(CEJNKVGTCVWTMGPPVFKGUG#WUHÒJTWPIPKEJV

8256 1:1



1TFGPō(ÒT6CRHGTMGKVŌ=Îðäåí „Çà Õðàáðîñò“?/QFGNN OKVFGT,CJTGU\CJNōŋCWHFGOXQT FGTUGKVKIGP /GFCKNNQPTKPI    5GV FGT + -NCUUG DGUVGJGPF CWU -TGW\ FGT  -NCUUG  Z   OO$TQP\GXGTIQNFGVWPFGOCKNNKGTVCOCNVGP*CNUDCPFWPF$TWUVMTGW\ZOO$TQP\G XGTIQNFGVVNYXGTUKNDGTVGOCKNNKGTVFGTWPVGTG-TGW\CTOPCEJGOCKNNKGTVCP0CFGNKOPKEJV\WIGJÌTK IGP'VWKFGT(KTOC#/CTKG5VWCTVKP2CTKU$-$9-&'-.' 2#2'5HH4$80<- 5VÒEM44++  0CEJFGO$WNICTKGPCWH5GKVGFGT/KVVGNO·EJVGKPFGP'TUVGP9GNVMTKGIGKPIGVTGVGPYCTUVKHVGVG<CT(GTFKPCPF KO,CPWCTLGYGKNUFKG-NCUUG5VWHGFKG-NCUUG5VWHGWPFFKG-NCUUG5VWHGQJPG5EJYGTVGTCNU 5VGEMMTGW\G OKV FGP ,CJTGU\CJNGP ōŋ WPF ōŋ   YQFWTEJ FKG DKUJGTKIGP +PUKIPKGP FGT   LGYGKNKIGP -NCUUGP \WT  5VWHG FGT LGYGKNKIGP -NCUUG YWTFGP -WT\ FCTCWH GTJKGNVGP FKG +PUKIPKGP CWH FGO   /GFCKNNQPTKPIFGT8QTFGTUGKVGFKG,CJTGU\CJNōŋ /QFGNN #WH$GHGJN<CT(GTFKPCPFU+MQPPVGLGYGKNUFKG INGKEJG-NCUUGOGJTOCNUCPGKPWPFFKGUGNDG2GTUQPXGTNKGJGPYGTFGP

71


BULGARIEN

8257 1:1





1TFGPō(ÒT6CRHGTMGKVŌ=Îðäåí „Çà Õðàáðîñò“?/QFGNN  -TGW\+++-NCUUG5VWHG #WUHÒJTWPIOKV,CJTGU\CJNGPōŋWPFōŋCWHFGP-TGW\CTOGP$TQP\GXGTIQNFGVGOCKNNKGTV\YGK -TCV\GT KP FGT YGK­GP 'OCKNNG CP 0CFGN $-  $9-  &'  -.'  2#    2'5HH4$80<- 4++



1TFGPō(ÒT6CRHGTMGKVŌ=Îðäåí „Çà Õðàáðîñò“?/QFGNN  -TGW\+++-NCUUG5VWHG #WUHÒJTWPIOKV,CJTGU\CJNGPōŋWPFōŋCWHFGP-TGW\CTOGP$TQP\GXGTIQNFGVGOCKNNKGTVOKP *CCTTKUUG KP GKPGT -TGW\CTOURKV\G CP 0CFGN $-  $9-  &'  -.'  2#    2'5HH4$80<- 44++



8259







72

8260

1TFGPō(ÒT6CRHGTMGKVŌ=Îðäåí „Çà Õðàáðîñò“?/QFGNN OKVFGT,CJTGU\CJNōŋCWHFGOXQT FGTUGKVKIGP/GFCKNNQPTKPI -TGW\+++-NCUUG5VWHG$TQP\GXGTIQNFGVWPFGOCKNNKGTVCO QTKIKPCNGPCNVGP&TGKGEMUDCPFKOQTKIKPCNGPUEJYCT\GP8GTNGKJWPIUGVWKOKVIQNFHCTDGPGO/QPQITCOO (ÒTUV #NGZCPFGTU + $-  $9-  &'  -.'  2#  2' 5HH 4$    80<- ++



1TFGPō(ÒT6CRHGTMGKVŌ=Îðäåí „Çà Õðàáðîñò“?/QFGNN  -TGW\+8-NCUUG5VWHG #WUHÒJTWPIOKV,CJTGU\CJNGPōŋWPFōŋCWHFGP-TGW\CTOGP$TQP\GXGTUKNDGTVVNYXGTIQNFGV GOCKNNKGTVOKP*CCTTKUUGKPFGTYGK­GP'OCKNNG8GTUKNDGTWPIVNYXGTICPIGPCP0CFGN$- $9-&'-.'2#2'5HH4$80<- ++



8261



8258 1:1

8262

1TFGPō(ÒT6CRHGTMGKVŌ=Îðäåí „Çà Õðàáðîñò“?/QFGNN  -TGW\+8-NCUUG5VWHG #WUHÒJTWPIOKV,CJTGU\CJNGPōŋWPFōŋCWHFGP-TGW\CTOGP#WUHÒJTWPIOKVFKEMGO.ÌYGP $TQP\GXGTUKNDGTVVNYXGTIQNFGVGOCKNNKGTVCP0CFGN$-$$9-&'-.' 2#2'5HH4$6#80<- ++



1TFGPō(ÒT6CRHGTMGKVŌ=Îðäåí „Çà Õðàáðîñò“?/QFGNN  -TGW\+8-NCUUG5VWHG #WUHÒJTWPIOKV,CJTGU\CJNGPōŋWPFōŋCWHFGP-TGW\CTOGP#WUHÒJTWPIOKVUEJNCPMGO.ÌYGP $TQP\G XGTIQNFGV PCEJXGTIQNFGV  GOCKNNKGTV GKPKIG 4GRCTCVWTGP KP FGT TQVGP WPF YGK­GP 'OCKNNG CP   0CFGN 0CFGNJCMGP CWH FGT 4ÒEMUGKVG TGRCTKGTV $- # XCT $9-  XCT &'  XCT   -.'XCT2#XCT2'5HH4$XCT80XCT<-XCT +++




BULGARIEN

8264







8263 1:1

1TFGPō(ÒT6CRHGTMGKVŌ=Îðäåí „Çà Õðàáðîñòŋ?/QFGNN  /KPKCVWTFGU-TGW\GU+8 -NCUUG  5VWHG #WUHÒJTWPI OKV ,CJTGU\CJNGP ōŋ WPF ōŋ CWH FGP -TGW\CTOGP $TQP\G   XGTUKNDGTVVNYXGTIQNFGVGOCKNNKGTV ++



1TFGPō(ÒT6CRHGTMGKVŌ=Îðäåí „Çà Õðàáðîñò“?/QFGNN  -TGW\+8-NCUUG5VWHG QJPG5EJYGTVGT#WUHÒJTWPIOKV,CJTGU\CJNGPōŋWPFōŋCWHFGP-TGW\CTOGP#WUHÒJTWPIOKV FKEMGO.ÌYGP$TQP\GXGTUKNDGTVVNYXGTIQNFGVGOCKNNKGTVCP0CFGN$-$9-&' -.'2#2'5HH4$80<- 4++



1TFGPō(ÒT6CRHGTMGKVŌ=Îðäåí „Çà Õðàáðîñò“?/QFGNN OKVFGT,CJTGU\CJNōŋCWHFGOXQT FGTUGKVKIGP/GFCKNNQPTKPI -TGW\+8-NCUUG5VWHG#WUHÒJTWPIOKVITÌ­GTGP$WEJUVC DGPKPFGP/GFCKNNQPTKPIGP$TQP\GXGTUKNDGTVVNYXGTIQNFGVGOCKNNKGTVCOQTKIKPCNGPCNVGP&TGKGEMU DCPF $- % $9-  &'  -.'  2#  2' 5HH 4$  80    <- ++



8266

















8265

8273

1TFGPō(ÒT6CRHGTMGKVŌ=Îðäåí „Çà Õðàáðîñò“?/QFGNN OKVFGT,CJTGU\CJNōŋCWHFGOXQT FGTUGKVKIGP /GFCKNNQPTKPI    5QNFCVGPMTGW\ HÒT 6CRHGTMGKV + -NCUUG $TQP\G XGTIQNFGV CO   $CPF OKV CWHIGP·JVGT 5EJNGKHG $-  $9-  &'  -.'  2#  2' 5HH   4$80<- ++



1TFGPō(ÒT6CRHGTMGKVŌ=Îðäåí „Çà Õðàáðîñò“?/QFGNN OKVFGT,CJTGU\CJNōŋCWHFGOXQT FGTUGKVKIGP /GFCKNNQPTKPI    5QNFCVGPMTGW\ HÒT 6CRHGTMGKV + -NCUUG $TQP\G XGTIQNFGV CO   GVYCUXGTH·TDVGP$CPFOKVCWHIGP·JVGT5EJNGKHG$-$9-&'-.'2# 2'5HH4$80<- ++



1TFGPō(ÒT6CRHGTMGKVŌ=Îðäåí „Çà Õðàáðîñò“?/QFGNN OKVFGT,CJTGU\CJNōŋCWHFGOXQT FGTUGKVKIGP/GFCKNNQPTKPI 5QNFCVGPMTGW\HÒT6CRHGTMGKV++-NCUUG$TQP\GXGTIQNFGVCO $CPF $-  $9-  &'  XCT -.'  2#  2' 5HH 4$  80    <- ++



1TFGPō(ÒT6CRHGTMGKVŌ=Îðäåí „Çà Õðàáðîñò“?/QFGNN OKVFGT,CJTGU\CJNōŋCWHFGOXQT FGTUGKVKIGP/GFCKNNQPTKPI 5QNFCVGPMTGW\HÒT6CRHGTMGKV+++-NCUUG$TQP\GXGTUKNDGTVCO $CPF OKV CWHIGP·JVGT 5EJNGKHG $-  $9-  &'  -.'  2#  2' 5HH   4$80<- ++



1TFGPō(ÒT6CRHGTMGKVŌ=Îðäåí „Çà Õðàáðîñò“?/QFGNN OKVFGT,CJTGU\CJNōŋCWHFGOXQT FGTUGKVKIGP/GFCKNNQPTKPI 5QNFCVGPMTGW\HÒT6CRHGTMGKV+++-NCUUG$TQP\GXGTUKNDGTVCO GVYCUXGTH·TDVGP$CPFOKVCWHIGP·JVGT5EJNGKHG$-$9-&'-.'2# 2'5HH4$80<- ++



1TFGPō(ÒT6CRHGTMGKVŌ=Îðäåí „Çà Õðàáðîñò“?/QFGNN OKVFGT,CJTGU\CJNōŋCWHFGOXQT FGTUGKVKIGP/GFCKNNQPTKPI 5QNFCVGPMTGW\HÒT6CRHGTMGKV+8-NCUUG$TQP\GXGTUKNDGTVCO $CPF$-$9-&'XCT-.'2#XCT2'5HH4$80 <- ++



1TFGPō(ÒT6CRHGTMGKVŌ=Îðäåí „Çà Õðàáðîñò“?/QFGNN OKVFGT,CJTGU\CJNōŋCWHFGOXQT FGTUGKVKIGP/GFCKNNQPTKPI 5QNFCVGPMTGW\HÒT6CRHGTMGKV+8-NCUUG$TQP\GXGTUKNDGTVCO $CPF$-$9-&'XCT-.'2#XCT2'5HH4$80 <- ++



1TFGPō(ÒT6CRHGTMGKVŌ=Îðäåí „Çà Õðàáðîñò“?/QFGNN OKVFGT,CJTGU\CJNōŋCWHFGOXQT FGTUGKVKIGP/GFCKNNQPTKPI 5QNFCVGPMTGW\HÒT6CRHGTMGKV+8-NCUUG$TQP\GXGTUKNDGTVCO $CPF$-$9-&'XCT-.'2#XCT2'5HH4$80 <- ++

 73


BULGARIEN

8275

8281

8276 1:1

8276 1:1 8277 1:1





8278 1:1

8279 1:1

1TFGPō(ÒT6CRHGTMGKVŌ=Îðäåí „Çà Õðàáðîñò“?/QFGNN OKVFGT,CJTGU\CJNōŋCWHFGOXQT FGTUGKVKIGP/GFCKNNQPTKPI 5QNFCVGPMTGW\HÒT6CRHGTMGKV+8-NCUUG$TQP\GXGTUKNDGTVCO $CPF$-$9-&'XCT-.'2#XCT2'5HH4$80 <- ++



1TFGPō(ÒT6CRHGTMGKVŌ=Îðäåí „Çà Õðàáðîñò“?/QFGNN OKVFGT,CJTGU\CJNōŋCWHFGOXQT FGTUGKVKIGP/GFCKNNQPTKPI 5QNFCVGPMTGW\HÒT6CRHGTMGKV8-NCUUG$TQP\GCO$CPF$- $9-&'XCT-.'2#2'5HH4$80<- ++



1D GU UKEJ JKGTDGK WO GKPG RTQLGMVKGTVG QFGT VCVU·EJNKEJ XGTCWUICDVG -NCUUG JCPFGNV MQPPVG NGKFGT PKEJV IGMN·TV   YGTFGP



1TFGPō(ÒT6CRHGTMGKVŌ=Îðäåí „Çà Õðàáðîñò“?/QFGNN CWHFGOXQTFGTUGKVKIGP/GFCKNNQPTKPI FTGKHÒPH\CEMKIG5VGTPGUQIGPō&TGK2WPMVG/QFGNNŋ -TGW\++-NCUUG$TQP\GXGTIQNFGV WPF GOCKNNKGTV CO CNVGP *CNUDCPF $-  $9-  &'  -.'  2#  2' 5HH   4$80<- 44++  0CEJ 'PFG FGU 'TUVGP 9GNVMTKGIU WPF FGT #DFCPMWPI <CT (GTFKPCPFU + DGUVKGI UGKP 5QJP CNU <CT $QTKU +++ FGP   6JTQP5VCVVFGT,CJTGU\CJNōŋGTJKGNVGPFKG8QTFGTUGKVGPOGFCKNNQPUPWPOGJTFTGKHÒPH\CEMKIG5VGTPG /QFGNN 



1TFGPō(ÒT6CRHGTMGKVŌ=Îðäåí „Çà Õðàáðîñò“?/QFGNN CWHFGOXQTFGTUGKVKIGP/GFCKNNQPTKPI FTGKHÒPH\CEMKIG5VGTPGUQIGPō&TGK2WPMVG/QFGNNŋ /KPKCVWTFGU-TGW\GU+++-NCUUG /GUUKPIDNGEJXGTIQNFGVWPFGOCKNNKGTVCP0CFGN ++





1TFGPō(ÒT6CRHGTMGKVŌ=Îðäåí „Çà Õðàáðîñò“?/QFGNN CWHFGOXQTFGTUGKVKIGP/GFCKNNQPTKPI FTGKHÒPH\CEMKIG5VGTPGUQIGPō&TGK2WPMVG/QFGNNŋ /KPKCVWTFGU-TGW\GU+8-NCUUG /GUUKPIDNGEJXGTIQNFGVWPFGOCKNNKGTVCP0CFGN ++





1TFGP ō(ÒT 6CRHGTMGKVŌ =Îðäåí „Çà Õðàáðîñò“?  /QFGNN CWH FGO XQTFGTUGKVKIGP /GFCKNNQPTKPI   FTGKHÒPH\CEMKIG5VGTPGUQIGPō&TGK2WPMVG/QFGNNŋ /KPKCVWTFGU5QNFCVGPMTGW\GUHÒT 6CRHGTMGKV+WPF++-NCUUG/GUUKPIDNGEJXGTIQNFGVCP0CFGN ++



1TFGPō(ÒT6CRHGTMGKVŌ=Îðäåí „Çà Õðàáðîñò“?/QFGNN CWHFGOXQTFGTUGKVKIGP/GFCKNNQPTKPI FTGKHÒPH\CEMKIG5VGTPGUQIGPō&TGK2WPMVG/QFGNNŋ /KPKCVWTFGU5QNFCVGPMTGW\GUHÒT 6CRHGTMGKV+++WPF+8-NCUUG/GUUKPIDNGEJXGTUKNDGTVCP0CFGN ++



1TFGPō(ÒT6CRHGTMGKVŌ=Îðäåí „Çà Õðàáðîñò“?/QFGNN OKVFGT,CJTGU\CJNōŋCWHFGOXQT FGTUGKVKIGP /GFCKNNQPTKPI    -TGW\ +++ -NCUUG  5VWHG $TQP\G XGTIQNFGV WPF GOCKNNKGTV   OGJTGTG OKP *CCTTKUUG KP FGT YGK­GP 'OCKNNG FGT QDGTGP TGEJVGP -TGW\CTOURKV\G CP 0CFGN $-   $9-&'-.'2#2'5HH4$80<- ++







0CEJFGO $WNICTKGP CO  /·T\  FGP UQIGP ō#EJUGPO·EJVGPŋ DGKIGVTGVGP WPF OKV FGT -TKGIUGTMN·TWPI CP   )TQ­DTKVCPPKGP WPF CP FKG 8GTGKPKIVGP 5VCCVGP XQP #OGTKMC CO  &G\GODGT  KP FGP <YGKVGP 9GNVMTKGI   GKPIGVTGVGPYCTYWTFGPFKG+PUKIPKGPFGU1TFGPUFKGUGP)GIGDGPJGKVGPCPIGRCUUVWPFPWPOGJTCWHFGOXQTFGTUGK VKIGP /GFCKNNQPTKPI FKG ,CJTGU\CJN ōŋ GKPIGHÒIV  /QFGNN  &KGUGU /QFGNN KUV PWT KP FGT  WPF  -NCUUG   UQYKGCNU5QNFCVGPMTGW\XGTNKGJGPYQTFGP

74


BULGARIEN

8282









8284

8285

1TFGPō(ÒT6CRHGTMGKVŌ=Îðäåí „Çà Õðàáðîñò“?/QFGNN OKVFGT,CJTGU\CJNōŋCWHFGOXQT FGTUGKVKIGP/GFCKNNQPTKPI -TGW\+++-NCUUG5VWHG$TQP\GXGTIQNFGVWPFGOCKNNKGTVCO QTKIKPCNGP CNVGP &TGKGEMUDCPF $-  $9-  &'  -.'  2#  2' 5HH   4$80<- ++



1TFGPō(ÒT6CRHGTMGKVŌ=Îðäåí „Çà Õðàáðîñò“?/QFGNN OKVFGT,CJTGU\CJNōŋCWHFGOXQT FGTUGKVKIGP/GFCKNNQPTKPI -TGW\+8-NCUUG5VWHG$TQP\GXGTUKNDGTVWPFGOCKNNKGTVFKG #TOGOÌINKEJGTYGKUGPCEJGOCKNNKGTVCP0CFGN$-$9-&'-.'2# 2'5HH4$80<- ++



1TFGPō(ÒT6CRHGTMGKVŌ=Îðäåí „Çà Õðàáðîñò“?/QFGNN OKVFGT,CJTGU\CJNōŋCWHFGOXQT FGTUGKVKIGP /GFCKNNQPTKPI    -TGW\ +8 -NCUUG  5VWHG $TQP\G XGTUKNDGTV VNY XGTIQNFGV   WPF GOCKNNKGTV CO QTKIKPCNGP CNVGP &TGKGEMUDCPF $-  $9-  &'  -.'    2#2'5HH4$80<- ++



1TFGPō(ÒT6CRHGTMGKVŌ=Îðäåí „Çà Õðàáðîñò“?/QFGNN OKVFGT,CJTGU\CJNōŋCWHFGOXQT FGTUGKVKIGP /GFCKNNQPTKPI    -TGW\ +8 -NCUUG  5VWHG $TQP\G XGTUKNDGTV VNY XGTIQNFGV   WPFGOCKNNKGTVCO2GPVCIQPCNDCPFFGU1TFGPUō(ÒT$ÒTIGTNKEJGU8GTFKGPUVŋ$-$9- &'-.'2#2'5HH4$80<- ++



8286



8283

8287

8288

8289

1TFGPō(ÒT6CRHGTMGKVŌ=Îðäåí „Çà Õðàáðîñò“?/QFGNN OKVFGT,CJTGU\CJNōŋCWHFGOXQT FGTUGKVKIGP /GFCKNNQPTKPI    5QNFCVGPMTGW\ HÒT 6CRHGTMGKV + -NCUUG $TQP\G XGTIQNFGV CO   QTKIKPCNGP CNVGP 2GPVCIQPCNDCPF $-  $9-  &'  -.'  2#  XCT 2' 5HH   4$80<- 4++



+O  /QFGNN OKV FGT ,CJTGU\CJN  KO XQTFGTUGKVKIGP /GFCKNNQPTKPI  YWTFG FKG 'KPVGKNWPI FGT 5QNFCVGPMTGW\G   FCJKPIGJGPF IG·PFGTV FC­ GU PWPOGJT PWT PQEJ  -NCUUGP P·ONKEJ FKG + -NCUUG IQNFHCTDGP  FKG ++ -NCUUG  

UKNDGTHCTDGP WPFFKG+++-NCUUG DTQP\GHCTDGP ICD&KGDKUJGTKIG3WGTUEJNGKHGFGT+-NCUUGGPVHKGN







1TFGPō(ÒT6CRHGTMGKVŌ=Îðäåí „Çà Õðàáðîñò“?/QFGNN OKVFGT,CJTGU\CJNōŋCWHFGOXQT FGTUGKVKIGP /GFCKNNQPTKPI    5QNFCVGPMTGW\ HÒT 6CRHGTMGKV + -NCUUG $TQP\G XGTIQNFGV CO   CNVGP&TGKGEMUDCPF$-$9-&'-.'2#XCT2'5HH4$80 <- 4++



1TFGPō(ÒT6CRHGTMGKVŌ=Îðäåí „Çà Õðàáðîñò“?/QFGNN OKVFGT,CJTGU\CJNōŋCWHFGOXQT FGTUGKVKIGP/GFCKNNQPTKPI 5QNFCVGPMTGW\HÒT6CRHGTMGKV++-NCUUG$TQP\GXGTUKNDGTVCO $CPF$-$9-&'-.'2#2'5HH4$80<- 4++



1TFGPō(ÒT6CRHGTMGKVŌ=Îðäåí „Çà Õðàáðîñò“?/QFGNN OKVFGT,CJTGU\CJNōŋCWHFGOXQT FGTUGKVKIGP/GFCKNNQPTKPI 5QNFCVGPMTGW\HÒT6CRHGTMGKV+++-NCUUG$TQP\GCOQTKIKPCNGP $CPF$-$9-&'-.'2#2'5HH4$80<- 4++

 75


BULGARIEN

8290 1:1



76

1TFGPō5V#NGZCPFGTŋ[Îðäåí „Ñâ. Àëåêñàíäúð“]D\Y1TFGPō5V#NGZCPFGT0GYUM[ŋ=Îðäåí  „Ñâ. ÀëåêñàíäúðÍåâñêèé“?  /QFGNN OKVUQIGPōGEMKIGTŋDWNICTKUEJGT<CTGPMTQPG )TQ­MTGW\UGV CD OKV$TKNNCPVGPDGUVGJGPFCWU-NGKPQFZOOI)QNF 5KNDGT VNY GOCKNNKGTV DGUGV\V OKV KPUIGUCOV  &KCOCPVTQUGP CWH 'EJVJGKV IGRTÒHV  XQP WPVGT   UEJKGFNKEJGT )TÌ­G QJPG LGINKEJG 2WP\KGTWPI CO QTKIKPCNGP CNVGP 5EJWNVGTDCPF WPF $TWUVUVGTP   &WTEJOGUUGT  OO  I )QNF 5KNDGT VNY GOCKNNKGTV /GFCKNNQPWOUEJTKHV UGRCTCV IGHGTVKIV WPF   CWHIGNGIVDGUGV\VOKV&KCOCPVTQUGP CWH'EJVJGKVIGRTÒHV XQPWPVGTUEJKGFNKEJGT)TÌ­GCP0CFGN KOQTKIKPCNGPKP5COVCWUIGHÒJTVGO8GTNGKJWPIUGVWKFGT(KTOC4QVJGWPF0GHHGKP9KGPOKVCWHIGNGIVGT RNCUVKUEJGT KP /GVCNN IGHGTVKIVGT XGTIQNFGVGT WPF VNY GOCKNNKGTVGT \YGK ō'FGNUVGKPGŋ KO -TQPTGKH   CDIGRNCV\V  GEMKIGT <CTGPMTQPG $-  %  $9-   &' 5HH -.'   2#    2'5HH4$$80<-XCTXCT 5VÒEM444+ 


BULGARIEN #PHGTVKIWPIFGT(KTOC4QVJG0GHHGKP9KGP\YKUEJGPWPFXGTNKGJGPXQP<CT$QTKU+++  CP GKPGP HTCP\ÌUKUEJGP 5VCCVURT·UKFGPVGP CNU 'ORH·IGT MQOOGP KP $GVTCEJV #NGZCPFTG /KNNGTCPF  2T·UK   FGPV )CUVQP&QWOGTIWG 2T·UKFGPV 2CWN&QWOGT 2T·UKFGPV  WPF#NDGTV.GDTWP 2T·UKFGPV   #W­GTIGYÌJPNKEJGU 'PUGODNG KP CNNGTDGUVGT #PHGTVKIWPIU WPF 'TJCNVWPISWCNKV·V DGUGV\V OKV KPUIGUCOV ÒDGT    &KCOCPVTQUGPKPXGTUEJKGFGPUVGP)TÌ­GP DKUPCJG\WEV XQPJKUVQTKUEJJÌEJUVDGFGWVGPFGT2TQXGPKGP\  'PVIGIGPFGPWPDGNGIVGP(GUVUVGNNWPIGPKOITÌ­VGP6GKNFGTDKUJGTKIGP(CEJNKVGTCVWTYWTFGDGTGKVUKO,CJTKO <WUCOOGPJCPI OKV FGT 5VKHVWPI FGU 1TFGPU ō(ÒT /KNKV·T8GTFKGPUVŋ FKG UQIGP ōGEMKIGŋ DWNICTKUEJG <CTGPMTQPG   UVCVV FGT DKUJGTKIGP JGTCNFKUEJGP -ÌPKIUMTQPG GKPIGHÒJTV $GNGIG JKGTHÒT UKPF PKEJV PWT FKG LGYGKNKIG 6CVUCEJG FC­   #WUHÒJTWPIGP FKGUGU /QFGNNU KP 'VWKU OKV FGO HÒTUVNKEJGP 9CRRGP DKU   XQTMQOOGP WPF FC­ 8GTFKGPUV   OGFCKNNGP OKV FGO (ÒTUVGP2QTVTCKV (GTFKPCPFU WPF FGT ōGEMKIGPŋ <CTGPMTQPG GZKUVKGTGP UQPFGTP XQT CNNGO FKG   'ZKUVGP\ FGT UKGDGP UGJT UGNVGPGP 1TFGPUVCHGNP FGT 1TFGP ō5V #NGZCPFGTŋ ō(ÒT 8GTFKGPUVŋ ō(ÒT $ÒTIGTNKEJGU   8GTFKGPUVŋ WPF ō(ÒT /KNKV·T8GTFKGPUVŋ UQYKG FGT /GFCKNNGP ō(ÒT 8GTFKGPUVŋ WPF ō(ÒT -WPUV WPF 9KUUGPUEJCHVŋ   CWHFGPGPFKGUGVNYCNUōHÒTUVNKEJŋDG\GKEJPGVYGTFGPWPFFKGQFGTMWT\FCPCEJDGK+2TCUGKP5QHKCIGFTWEMV YQTFGPUKPF'KPUQNEJGT5CV\FKGUGT6CHGNPIGNCPIVGCO1MVQDGTDGK6JKGUKPFGUUGP#WMVKQPWPVGTFGP 0WOOGTPDKU\WT8GTUVGKIGTWPI  +P (QNIG FGT 'TNCPIWPI FGT XQNNUV·PFKIGP 7PCDJ·PIKIMGKV $WNICTKGPU WPF UGKPGT 2TQMNCOCVKQP \WO <CTGPVWO KO   ,CJTG  YWTFGP FKG -QNNCPGP PGW IGUVCNVGV FKG DKUJGTKIG ō+ -NCUUGŋKPō)TQ­MTGW\ŋWODGPCPPVWPFGKPGPGWG ō+ -NCUUGŋ OKV ITÒP GOCKNNKGTVGO -NGKPQF IGUVKHVGV UQYKG FKG  -NCUUG PGW ITÒP GOCKNNKGTV  IGUVCNVGV &CU   )TQ­MTGW\WPFFKG+DKU+++-NCUUGMQPPVGPCWEJKP$TKNNCPVGPXGTNKGJGPYGTFGP<YKUEJGPWPFYWTFG OWVOC­NKEJ FKG )TQ­OGKUVGTMQNNCPG PQEJ GKPOCN PGW IGUVCNVGV 0CEJ UGKPGT 4GIKGTWPIUÒDGTPCJOG WPVGTVGKNVG <CT   $QTKU+++FKGWPFFKG-NCUUGKP\YGK5VWHGP LGYGKNUOKVWPFQJPG-TQPG 

8291 1:1

8292





1TFGPō5V#NGZCPFGTŋ[Îðäåí „Ñâ. Àëåêñàíäúð“]D\Y1TFGPō5V#NGZCPFGT0GYUM[ŋ=Îðäåí  „Ñâ. ÀëåêñàíäúðÍåâñêèé“?  /QFGNN OKVUQIGPōGEMKIGTŋDWNICTKUEJGT<CTGPMTQPG   /KPKCVWT \WT  -NCUUG   D\Y \WO )TQ­MTGW\   5KNDGT VNY   XGTIQNFGVWPFGOCKNNKGTVCO$·PFEJGPOKVCWHIGNGIVGT)QNFNKV\GWPF4QUGVVG 4++



1TFGPō5V#NGZCPFGTŋ[Îðäåí „Ñâ. Àëåêñàíäúð“]D\Y1TFGPō5V#NGZCPFGT0GYUM[ŋ=Îðäåí  „Ñâ. ÀëåêñàíäúðÍåâñêèé“?  /QFGNN OKVUQIGPōGEMKIGTŋDWNICTKUEJGT<CTGPMTQPG  5GVFGT+-NCUUGOKV5EJYGTVGTP DKU D\YFGU)TQ­MTGW\GUOKV5EJYGTVGTP CD   DGUVGJGPF CWU -NGKPQF 5KNDGT XGTIQNFGV WPF GOCKNNKGTV CO UR·VGTGP LGFQEJ QTKIKPCNIGVTGWGP   5EJWNVGTDCPF WPF $TWUVUVGTP 5KNDGT VNY XGTIQNFGV WPF GOCKNNKGTV FKG 5EJYGTVGT OKVVGNU XKGT   4WPFMQRHPKGVGPDGHGUVKIVCP0CFGNKOPKEJV\WIGJÌTKIGP8GTNGKJWPIUGVWKFGT(KTOC#TVJWU$GTVTCPFKP 2CTKU$-$9-&'-.'2#2'5HH4$ 80<- 5VÒEM4++  77


BULGARIEN

8293 1:1



1TFGPō5V#NGZCPFGTŋ[Îðäåí „Ñâ. Àëåêñàíäúð“]D\Y1TFGPō5V#NGZCPFGT0GYUM[ŋ=Îðäåí  „Ñâ. ÀëåêñàíäúðÍåâñêèé“?  /QFGNN OKVUQIGPōGEMKIGTŋDWNICTKUEJGT<CTGPMTQPG  /KPKCVWT\WT+-NCUUGOKV5EJYGTVGTP DKU D\Y\WO)TQ­MTGW\OKV5EJYGTVGTP

CD 5KNDGTXGTIQNFGVWPFGOCKNNKGTVCO$·PFEJGPOKVCWHIGNGIVGT.KV\GWPF4QUGVVG ++



8294 1:1



78

1TFGPō5V#NGZCPFGTŋ[Îðäåí „Ñâ. Àëåêñàíäúð“]D\Y1TFGPō5V#NGZCPFGT0GYUM[ŋ=Îðäåí  „Ñâ. ÀëåêñàíäúðÍåâñêèé“?  /QFGNN OKVUQIGPōGEMKIGTŋDWNICTKUEJGT<CTGPMTQPG  5GVFGT+-NCUUG CD DGUVGJGPFCWU-NGKPQF5KNDGTXGTIQNFGVWPFGOCKNNKGTVCO QTKIKPCNGP 5EJWNVGTDCPF WPF $TWUVUVGTP 5KNDGT VNY XGTIQNFGV WPF GOCKNNKGTV CWH FGT 4ÒEMUGKVG   OGJTHCEJ ÌUVGTTGKEJKUEJ DKU   RWP\KGTV ō(4ŋ HÒT (TKGFTKEJ 4QVJG KP 9KGP ō 9KPFJWPF   MQRH #ŋ2WP\GP HÒT GT 5KNDGT WPF ō#ŋ2WP\G  CP 0CFGN FKGUG OKV *GTUVGNNGTDG\GKEJPWPIGP   ō%(416*'ŋWPFō9+'0ŋUQYKG\YGKō#ŋ2WP\GPKOQTKIKPCNGP8GTNGKJWPIUGVWKOKVIQNFHCTDGPGT <CTGPMTQPG $- # # $9-   &'   -.'   2#  2'   5HH4$6#80<- 5VÒEM44+p++ 


BULGARIEN

8296 1:1 8295



1TFGPō5V#NGZCPFGTŋ[Îðäåí „Ñâ. Àëåêñàíäúð“]D\Y1TFGPō5V#NGZCPFGT0GYUM[ŋ=Îðäåí  „Ñâ. ÀëåêñàíäúðÍåâñêèé“?  /QFGNN OKVUQIGPōGEMKIGTŋDWNICTKUEJGT<CTGPMTQPG  -NGKPQFFGT+-NCUUG CD QJPG-TQPG5KNDGTXGTIQNFGVWPFGOCKNNKGTVKPFGT¤UG HTCP\ÌUKUEJG 'KPHWJTRWP\G HÒT 5KNDGT XQP  DKU  ō5EJYCPGPRWP\Gŋ  CO YQJN GTI·P\VGP   *CNUDCPFTKPI OKV *CNUDCPF $-  XCT $9-  XCT &'  XCT -.'  XCT   2#QDXCT2'5HH4$XCT80XCT<-XCT ++ -WTKQUGU'ZGORNCTOÌINKEJGTYGKUGPCEJFWTEJ'PVHGTPWPIFGT-TQPGTGRWDNKMCPKUKGTV



1TFGPō5V#NGZCPFGTŋ[Îðäåí „Ñâ. Àëåêñàíäúð“]D\Y1TFGPō5V#NGZCPFGT0GYUM[ŋ=Îðäåí „Ñâ. Àëåêñàíäúð Íåâñêèé“?    /QFGNN OKV UQIGP GEMKIGT DWNICTKUEJGT <CTGPMTQPG      /KPKCVWT \WT  -NCUUG   5KNDGT VNY XGTIQNFGV WPF ITÒP GOCKNNKGTV CO     $·PFEJGPOKVCWHIGNGIVGT)QNFNKV\GWPF4QUGVVG 44++





8297 1:1



1TFGPō5V#NGZCPFGTŋ[Îðäåí „Ñâ. Àëåêñàíäúð“]D\Y1TFGPō5V#NGZCPFGT0GYUM[ŋ=Îðäåí  „Ñâ. ÀëåêñàíäúðÍåâñêèé“?  /QFGNN OKVUQIGPōGEMKIGTŋDWNICTKUEJGT<CTGPMTQPG   5GV FGT + -NCUUG CD   OKV 5EJYGTVGTP ÒDGT FGO -TGW\ DGUVGJGPF   CWU -NGKPQF 5KNDGT XGTIQNFGV WPF GOCKNNKGTV KO 6TCIGTKPI HTCP\ÌUKUEJG 'KPHWJTRWP\G HÒT 5KNDGT XQP    DKU  ō5EJYCPGPRWP\Gŋ COQTKIKPCNGP5EJWNVGTDCPFWPF$TWUVUVGTP5KNDGTVNYXGTIQNFGV WPFGOCKNNKGTVCWHFGT4ÒEMUGKVGOGJTHCEJÌUVGTTGKEJKUEJ DKU RWP\KGTV ō(4ŋHÒT(TKGFTKEJ4QVJG KP9KGPō9KPFJWPFMQRH#ŋ2WP\GPHÒTGT5KNDGTWPFō#ŋ2WP\G CP0CFGNFKGUGOKV*GTUVGNNGT DG\GKEJPWPIō%(416*'ŋWPFō9+'0ŋ\YGKō#ŋ2WP\GPWPFHTCP\ÌUKUEJG'KPHWJTRWP\GHÒT5KNDGT XQP  DKU  ō5EJYCPGPRWP\Gŋ  KO QTKIKPCNGP 8GTNGKJWPIUGVWK FGT (KTOC 4QVJG OKV ITQ­GO   DWNICTKUEJGP 5VCCVUYCRRGP $-   $9-   &'   -.'     2#2'5HH4$80<- 5VÒEM44++  79


BULGARIEN

8298



1TFGPō5V#NGZCPFGTŋ[Îðäåí „Ñâ. Àëåêñàíäúð“]D\Y1TFGPō5V#NGZCPFGT0GYUM[ŋ=Îðäåí  „Ñâ. ÀëåêñàíäúðÍåâñêèé“? /QFGNN OKVUQIGPōGEMKIGTŋDWNICTKUEJGT<CTGPMTQPG   5GV ++ -NCUUG DGUVGJGPF CWU *CNUMTGW\ 5KNDGT XGTIQNFGV WPF GOCKNNKGTV CO PGWGP   *CNUDCPF WPF $TWUVUVGTP 5KNDGT VNY XGTIQNFGV WPF GOCKNNKGTV CP 0CFGN FKGUG RWP\KGTV ō5+.$'4ŋ   KO QTKIKPCNGP 8GTNGKJWPIUGVWK OKV /QPQITCOO <CT $QTKU +++ $-   $9-     &'-.'2#2'5HH4$80<-  5VÒEM++

8299





80



8300

1TFGPō5V#NGZCPFGTŋ[Îðäåí „Ñâ. Àëåêñàíäúð“]D\Y1TFGPō5V#NGZCPFGT0GYUM[ŋ=Îðäåí  „Ñâ. ÀëåêñàíäúðÍåâñêèé“?  /QFGNN OKVUQIGPōGEMKIGTŋDWNICTKUEJGT<CTGPMTQPG   $TWUVUVGTP \WT  -NCUUG 5KNDGT VNY XGTIQNFGV WPF GOCKNNKGTV CWH FGT 4ÒEMUGKVG   *GTUVGNNGTRWP\G ō(4ŋ FGT (KTOC 4QVJG KP 9KGP ō 9KPFJWPFMQRH #ŋ2WP\GP DKU  HÒT GT   5KNDGT WPF #OVURWP\G ō#ŋ CP 0CFGN FKGUG OKV *GTUVGNNGTDG\GKEJPWPI FGT (KTOC 4QVJG WPF \YGK   #OVURWP\GP ō#ŋ $-  $9-  &'  -.'  2#  2' 5HH 4$    80<- ++



1TFGPō5V#NGZCPFGTŋ[Îðäåí „Ñâ. Àëåêñàíäúð“]D\Y1TFGPō5V#NGZCPFGT0GYUM[ŋ=Îðäåí  „Ñâ. ÀëåêñàíäúðÍåâñêèé“?  /QFGNN OKVUQIGPōGEMKIGTŋDWNICTKUEJGT<CTGPMTQPG   $TWUVUVGTP \WT  -NCUUG OKV 5EJYGTVGTP ÒDGT FGO -TGW\ 5KNDGT VNY XGTIQNFGV WPF   GOCKNNKGTV CP 0CFGN FKGUG OKV 5KNDGTRWP\G ōŋ $-  $9-  &'  -.'    2#2'5HH4$80<- ++




BULGARIEN

8301





1TFGPō5V#NGZCPFGTŋ[Îðäåí „Ñâ. Àëåêñàíäúð“]D\Y1TFGPō5V#NGZCPFGT0GYUM[ŋ=Îðäåí  „Ñâ. ÀëåêñàíäúðÍåâñêèé“?  /QFGNN OKVUQIGPōGEMKIGTŋDWNICTKUEJGT<CTGPMTQPG  -TGW\+++-NCUUG5KNDGTXGTIQNFGVWPFGOCKNNKGTVKPFGT¤UGRWP\KGTVō'ŋCOQTKIKPCNGP CNVGP *CNUDCPF KO QTKIKPCNGP 8GTNGKJWPIUGVWK OKV FGO IQNFHCTDGPGP /QPQITCOO <CT (GTFKPCPFU +   $-$9-&'-.'-ª2#2'5HH4$80 <- ++



1TFGPō5V#NGZCPFGTŋ[Îðäåí „Ñâ. Àëåêñàíäúð“]D\Y1TFGPō5V#NGZCPFGT0GYUM[ŋ=Îðäåí  „Ñâ. ÀëåêñàíäúðÍåâñêèé“?  /QFGNN OKVUQIGPōGEMKIGTŋDWNICTKUEJGT<CTGPMTQPG   -TGW\ +++ -NCUUG OKV 5EJYGTVGTP 5KNDGT XGTIQNFGV WPF GOCKNNKGTV CO QTKIKPCNGP CNVGP   *CNUDCPF$-$9-&'-.'2#2'5HH4$80 <- ++



8303





8302

8304

1TFGPō5V#NGZCPFGTŋ[Îðäåí „Ñâ. Àëåêñàíäúð“]D\Y1TFGPō5V#NGZCPFGT0GYUM[ŋ=Îðäåí  „Ñâ. ÀëåêñàíäúðÍåâñêèé“?  /QFGNN OKVUQIGPōGEMKIGTŋDWNICTKUEJGT<CTGPMTQPG   -TGW\ +++ -NCUUG OKV 5EJYGTVGTP ÒDGT FGO -TGW\ #WUHÒJTWPI OKV -TQPGP2GPFKNKGP   5KNDGTXGTIQNFGVWPFGOCKNNKGTVCOCNVGP*CNUDCPF$-$9-&'-.'2# 2'5HH4$80<- ++



1TFGPō5V#NGZCPFGTŋ[Îðäåí „Ñâ. Àëåêñàíäúð“]D\Y1TFGPō5V#NGZCPFGT0GYUM[ŋ=Îðäåí  „Ñâ. ÀëåêñàíäúðÍåâñêèé“?  /QFGNN OKVUQIGPōGEMKIGTŋDWNICTKUEJGT<CTGPMTQPG   -TGW\ +8 -NCUUG OKV -TQPG  OKV 5EJYGTVGTP 5KNDGT XGTIQNFGV WPF GOCKNNKGTV KP FGT   ¤UGÌUVGTTGKEJKUEJ DKU RWP\KGTV ō(4ŋHÒT(TKGFTKEJ4QVJGKP9KGPō9KPFJWPFMQRH#ŋ2WP\GP HÒTGT5KNDGT COQTKIKPCNGPCNVGP&TGKGEMUDCPFOKVCWHIGNGIVGPIGMTGW\VGP5EJYGTVGTP$-$ $9-&'-.'2#XCT2'5HH4$80<- ++

 81


BULGARIEN

8307 8306

8305







1TFGPō5V#NGZCPFGTŋ[Îðäåí „Ñâ. Àëåêñàíäúð“]D\Y1TFGPō5V#NGZCPFGT0GYUM[ŋ=Îðäåí  „Ñâ. ÀëåêñàíäúðÍåâñêèé“?  /QFGNN OKVUQIGPōGEMKIGTŋDWNICTKUEJGT<CTGPMTQPG  -TGW\+8-NCUUG OKV-TQPG 5KNDGTXGTIQNFGVWPFGOCKNNKGTVKPFGT¤UGHTCP\ÌUKUEJG 'KPHWJTRWP\G HÒT 5KNDGT XQP  DKU  ō5EJYCPGPRWP\Gŋ  CO QTKIKPCNGP &TGKGEMUDCPF OKV   CWHIGNGIVGT 4QUGVVG $- $ $9-  &'  -.'  2#  2' 5HH 4$    80<- ++



1TFGPō5V#NGZCPFGTŋ[Îðäåí „Ñâ. Àëåêñàíäúð“]D\Y1TFGPō5V#NGZCPFGT0GYUM[ŋ=Îðäåí  „Ñâ. ÀëåêñàíäúðÍåâñêèé“?  /QFGNN OKVUQIGPōGEMKIGTŋDWNICTKUEJGT<CTGPMTQPG   -TGW\ +8 -NCUUG OKV -TQPG  OKV 5EJYGTVGTP ÒDGT FGO -TGW\ #WUHÒJTWPI QJPG   -TQPGP2GPFKNKGP5KNDGTXGTIQNFGVWPFGOCKNNKGTV5EJYGTVGTCWHFGT4ÒEMUGKVGITCXKGTVCOQTKIKPCNGP CNVGP&TGKGEMUDCPFOKVCWHIGNGIVGT4QUGVVG$-$$9-&'-.'2# 2'5HH4$80<- ++



1TFGPō5V#NGZCPFGTŋ[Îðäåí „Ñâ. Àëåêñàíäúð“]D\Y1TFGPō5V#NGZCPFGT0GYUM[ŋ=Îðäåí  „Ñâ. ÀëåêñàíäúðÍåâñêèé“?  /QFGNN OKVUQIGPōGEMKIGTŋDWNICTKUEJGT<CTGPMTQPG   -TGW\ 8 -NCUUG OKV -TQPG 5KNDGT VNY XGTIQNFGV  GOCKNNKGTV CO QTKIKPCNGP CNVGP   &TGKGEMUDCPF KO QTKIKPCNGP 8GTNGKJWPIUGVWK OKV IQNFHCTDGPGO /QPQITCOO <CT $QTKU +++ $-    $9-&'-.'2#2'5HH4$80<- ++ 

8308

8309



1TFGPō5V#NGZCPFGTŋ[Îðäåí „Ñâ. Àëåêñàíäúð“]D\Y1TFGPō5V#NGZCPFGT0GYUM[ŋ=Îðäåí  „Ñâ. ÀëåêñàíäúðÍåâñêèé“?  /QFGNN OKVUQIGPōGEMKIGTŋDWNICTKUEJGT<CTGPMTQPG   -TGW\ 8 -NCUUG OKV -TQPG WPF 5EJYGTVGTP 5KNDGT VNY XGTIQNFGV GOCKNNKGTV CO   QTKIKPCNGPCNVGP&TGKGEMUDCPF$-$9-&'-.'2#2'5HH4$ 80<- ++





1TFGPō5V#NGZCPFGTŋ[Îðäåí „Ñâ. Àëåêñàíäúð“]D\Y1TFGPō5V#NGZCPFGT0GYUM[ŋ=Îðäåí  „Ñâ. ÀëåêñàíäúðÍåâñêèé“?  /QFGNN OKVUQIGPōGEMKIGTŋDWNICTKUEJGT<CTGPMTQPG  -TGW\8-NCUUGOKV-TQPGWPF5EJYGTVGTPÒDGTFGO-TGW\#WUHÒJTWPIQJPG-TQPGP 2GPFKNKGP 5KNDGT VNY XGTIQNFGV GOCKNNKGTV CO QTKIKPCNGP CNVGP &TGKGEMUDCPF KO QTKIKPCNGP   8GTNGKJWPIUGVWK OKV IQNFHCTDGPGO /QPQITCOO <CT $QTKU +++ $- # $9-  &'    -.'2#2'5HH4$80<- ++



82


BULGARIEN

8318























8311

8316

8319

1TFGPō5V#NGZCPFGTŋ[Îðäåí „Ñâ. Àëåêñàíäúð“]D\Y1TFGPō5V#NGZCPFGT0GYUM[ŋ=Îðäåí  „Ñâ. ÀëåêñàíäúðÍåâñêèé“?  /QFGNN OKVUQIGPōGEMKIGTŋDWNICTKUEJGT<CTGPMTQPG   NGGTGU 'VWK FGT 4GIGPVUEJCHVU\GKV   \WO -TGW\ 8 -NCUUG OKV IQNFHCTDGPGT   <CTGPMTQPG ++ 1TFGPō5V#NGZCPFGTŋ[Îðäåí „Ñâ. Àëåêñàíäúð“]D\Y1TFGPō5V#NGZCPFGT0GYUM[ŋ=Îðäåí  „Ñâ. ÀëåêñàíäúðÍåâñêèé“?  /QFGNN OKVUQIGPōGEMKIGTŋDWNICTKUEJGT<CTGPMTQPG  -TGW\8-NCUUGOKV5EJYGTVGTP5KNDGTVNYXGTIQNFGVGOCKNNKGTVCOQTKIKPCNGPCNVGP &TGKGEMUDCPF KO QTKIKPCNGP 8GTNGKJWPIUGVWK OKV IQNFHCTDGPGO /QPQITCOO <CT (GTFKPCPFU + $-   $9-&'-.'2#2'5HH4$80<- ++ 1TFGPō5V#NGZCPFGTŋ[Îðäåí „Ñâ. Àëåêñàíäúð“]D\Y1TFGPō5V#NGZCPFGT0GYUM[ŋ=Îðäåí  „Ñâ. ÀëåêñàíäúðÍåâñêèé“?  /QFGNN OKVUQIGPōGEMKIGTŋDWNICTKUEJGT<CTGPMTQPG   NGGTGU 8GTNGKJWPIUGVWK \WO -TGW\ 8 -NCUUG OKV  5EJYGTVGTP OKV IQNFHCTDGPGO   /QPQITCOO<CT(GTFKPCPFU+ ++ 1TFGPō5V#NGZCPFGTŋ[Îðäåí „Ñâ. Àëåêñàíäúð“]D\Y1TFGPō5V#NGZCPFGT0GYUM[ŋ=Îðäåí  „Ñâ. ÀëåêñàíäúðÍåâñêèé“?  /QFGNN OKVUQIGPōGEMKIGTŋDWNICTKUEJGT<CTGPMTQPG   NGGTGU 8GTNGKJWPIUGVWK \WO -TGW\ 8 -NCUUG OKV  5EJYGTVGTP OKV IQNFHCTDGPGO   /QPQITCOO<CT(GTFKPCPFU+ ++ 1TFGPō5V#NGZCPFGTŋ[Îðäåí „Ñâ. Àëåêñàíäúð“]D\Y1TFGPō5V#NGZCPFGT0GYUM[ŋ=Îðäåí  „Ñâ. ÀëåêñàíäúðÍåâñêèé“?  /QFGNN OKVUQIGPōGEMKIGTŋDWNICTKUEJGT<CTGPMTQPG   NGGTGU 8GTNGKJWPIUGVWK \WO -TGW\ 8 -NCUUG OKV  5EJYGTVGTP OKV IQNFHCTDGPGO   /QPQITCOO<CT(GTFKPCPFU+OKV-WIGNUEJTGKDGTDGUEJTKGDGP ++ 1TFGPō5V#NGZCPFGTŋ[Îðäåí „Ñâ. Àëåêñàíäúð“]D\Y1TFGPō5V#NGZCPFGT0GYUM[ŋ=Îðäåí  „Ñâ. ÀëåêñàíäúðÍåâñêèé“?  /QFGNN OKVUQIGPōGEMKIGTŋDWNICTKUEJGT<CTGPMTQPG   NGGTGU 8GTNGKJWPIUGVWK \WO -TGW\ 8 -NCUUG OKV 5EJYGTVGTP OKV IQNFHCTDGPGO   /QPQITCOO <CT (GTFKPCPFU + WPF H·NUEJNKEJGTYGKUG IGMTGW\VG 5EJYGTVGT KP FGT (QTO HÒT 5EJYGTVGT   ÒDGTFGO-TGW\ ++ 1TFGPō5V#NGZCPFGTŋ[Îðäåí „Ñâ. Àëåêñàíäúð“]D\Y1TFGPō5V#NGZCPFGT0GYUM[ŋ=Îðäåí  „Ñâ. ÀëåêñàíäúðÍåâñêèé“?  /QFGNN OKVUQIGPōGEMKIGTŋDWNICTKUEJGT<CTGPMTQPG  -TGW\8-NCUUGOKV5EJYGTVGTPÒDGTFGO-TGW\5KNDGTVNYXGTIQNFGVGOCKNNKGTVOKP 'OCKNNGCWUDTWEJ KO <GPVTWO FKG 5EJYGTVGT CWH FGT 4ÒEMUGKVG ITCXKGTV CO QTKIKPCNGP CNVGP &TGK   GEMUDCPF KO QTKIKPCNGP 8GTNGKJWPIUGVWK FGT 4GIGPVUEJCHVU\GKV   OKV IQNFHCTDGPGT <CTGP   MTQPG $-  $9-  &'  -.'  2#  2' 5HH 4$  80    <- ++ 1TFGPō5V#NGZCPFGTŋ[Îðäåí „Ñâ. Àëåêñàíäúð“]D\Y1TFGPō5V#NGZCPFGT0GYUM[ŋ=Îðäåí  „Ñâ. ÀëåêñàíäúðÍåâñêèé“?  /QFGNN OKVUQIGPōGEMKIGTŋDWNICTKUEJGT<CTGPMTQPG  -TGW\8+-NCUUGOKV-TQPG$TQP\GXGTUKNDGTVCOQTKIKPCNGPCNVGP&TGKGEMUDCPF$- $9-&'-.'2#2'5HH4$80<- ++ 1TFGPō5V#NGZCPFGTŋ[Îðäåí „Ñâ. Àëåêñàíäúð“]D\Y1TFGPō5V#NGZCPFGT0GYUM[ŋ=Îðäåí  „ Ñâ. ÀëåêñàíäúðÍåâñêèé“?  /QFGNN OKVUQIGPōGEMKIGTŋDWNICTKUEJGT<CTGPMTQPG   -TGW\ 8+ -NCUUG OKV -TQPG WPF 5EJYGTVGTP $TQP\G XGTUKNDGTV CO QTKIKPCNGP CNVGP   &TGKGEMUDCPF $-  $9-  &'  -.'  2#  2' 5HH 4$  80    <- ++ 1TFGPō5V#NGZCPFGTŋ[Îðäåí „Ñâ. Àëåêñàíäúð“]D\Y1TFGPō5V#NGZCPFGT0GYUM[ŋ=Îðäåí  „Ñâ. ÀëåêñàíäúðÍåâñêèé“?  /QFGNN OKVUQIGPōGEMKIGTŋDWNICTKUEJGT<CTGPMTQPG   -TGW\ 8+ -NCUUG OKV -TQPG WPF 5EJYGTVGTP ÒDGT FGO -TGW\ $TQP\G XGTUKNDGTV CO   QTKIKPCNGPCNVGP&TGKGEMUDCPF$-$9-&'-.'2#2'5HH4$ 80<- ++ 1TFGPō5V#NGZCPFGTŋ[Îðäåí „Ñâ. Àëåêñàíäúð“]D\Y1TFGPō5V#NGZCPFGT0GYUM[ŋ=Îðäåí  „Ñâ. ÀëåêñàíäúðÍåâñêèé“?  /QFGNN OKVUQIGPōGEMKIGTŋDWNICTKUEJGT<CTGPMTQPG  -TGW\8+-NCUUG$TQP\GXGTUKNDGTVCOQTKIKPCNGPCNVGP&TGKGEMUDCPF$- $9-&'-.'2#2'5HH4$80<- ++





















 83


BULGARIEN

8322

8321







8324

8323

1TFGPō5V#NGZCPFGTŋ[Îðäåí „Ñâ. Àëåêñàíäúð“]D\Y1TFGPō5V#NGZCPFGT0GYUM[ŋ=Îðäåí  „Ñâ. ÀëåêñàíäúðÍåâñêèé“?  /QFGNN OKVUQIGPōGEMKIGTŋDWNICTKUEJGT<CTGPMTQPG  -TGW\8+-NCUUGOKV5EJYGTVGTP$TQP\GXGTUKNDGTVCOQTKIKPCNGPCNVGP&TGKGEMUDCPF$- $9-&'-.'2#2'5HH4$80<- ++



1TFGPō5V#NGZCPFGTŋ[Îðäåí „Ñâ. Àëåêñàíäúð“]D\Y1TFGPō5V#NGZCPFGT0GYUM[ŋ=Îðäåí  „Ñâ. Àëåêñàíäúð Íåâñêèé“?  /QFGNN OKVUQIGPōGEMKIGTŋDWNICTKUEJGT<CTGPMTQPG  -TGW\8+-NCUUGOKV5EJYGTVGTPÒDGTFGO-TGW\$TQP\GXGTUKNDGTVCO$CPF$- $9-&'-.'2#2'5HH4$80<- ++



/GFCKNNG ō5V #NGZCPFGTŌ =Ìåäàë „Ñâ. Àëåêñàíäúð“? D\Y CD   1TFGP ō(ÒT 8GTFKGPUVŋ   =Îðäåí „ÇC Çàñëóãà“?/QFGNN OKVFGO·NVGTGP2QTVCKV<CT(GTFKPCPFU+ 1TFGPU\GK EJGP+-NCUUG5KNDGTXGTIQNFGVQJPG5VGOGRNUEJPGKFGTCOQTKIKPCNGPCNVGP&TGKGEMUDCPFKP(TKGFGPU \GKVGP$9-&'-.'2#XCT2'5HH4$80<- ++



0CEJFGT#PPCJOGFGU<CTGPVKVGNUGTJKGNVFKG8QTFGTUGKVGFCU·NVGTG2QTVTCKV<CT(GTFKPCPFU /QFGNN 



/GFCKNNG ō5V #NGZCPFGT =Ìåäàë „Ñâ. Àëåêñàíäúð“?  D\Y CD   1TFGP ō(ÒT 8GTFKGPUVŋ   =Îðäåí „ÇC Çàñëóãà“?/QFGNN OKVFGO·NVGTGP2QTVCKV<CT(GTFKPCPFU+ 1TFGPU\GK EJGP ++ -NCUUG 5KNDGT QJPG 5VGOGRGNUEJPGKFGT CO QTKIKPCNGP CNVGP &TGKGEMUDCPF KP (TKGFGPU\GKVGP   $9-&'-.'2#2'5HH4$80<- ++



8326 8325



8327

/GFCKNNG ō5V #NGZCPFGTŋ =Ìåäàë „Ñâ. Àëåêñàíäúð“?  D\Y CD   1TFGP ō(ÒT 8GTFKGPUVŋ   =Îðäåí „ÇC Çàñëóãà“?/QFGNN OKVFGO2QTVTCKV<CT$QTKU+++! 1TFGPU\GKEJGP++-NCUUG 5KNDGT CO QTKIKPCNGP CNVGP &TGKGEMUDCPF KP (TKGFGPU\GKVGP $9-  XCT &'  -.'    2#2'5HH4$80<- ++



7PVGT$QTKU+++\GKIVGUKGCDFGUUGP2QTVTCKV /QFGNN FKG9CRRGP\GKEJPWPICWHFGT4ÒEMUGKVGYWTFGUR·VGT GVYCUXGT·PFGTV /QFGNN 9·JTGPFFGT<GKVFGT4GIGPVUEJCHVHÒTFGPOKPFGTL·JTKIGP-ÌPKI5KOGQPXQPDKU  KUV FGT 1TFGP OKV FGO 2QTVTCKV <CT $QTKU +++ YGKVGTJKP XGTNKGJGP YQTFGP LGFQEJ KP GKPGO 'VWK OKV GKPGT   <CTGPMTQPGUVCVVOKVFGO/QPQITCOO<CT$QTKU+++&GT1TFGPYWTFGKP(TKGFGPU\GKVGPCO$CPFGFGU1TFGPUō5V #NGZCPFGTŋWPFKP-TKGIU\GKVGPCO$CPFGUFGU1TFGPUō(ÒT6CRHGTMGKVŋXGTNKGJGP0CEJFGOCO5GRVGODGT GKPGUQIGPCPPVGō8QNMUHTQPVTGIKGTWPIŋFKG/CEJVKP$WNICTKGPÒDGTPQOOGPJCVVGUEJGKPVFGT1TFGPGPVIGIGPFGT (GUVUVGNNWPI2GVTQXU KP2'5 PKEJVOGJTXGTNKGJGPYQTFGP\WUGKP





84

/GFCKNNG ō5V #NGZCPFGTŋ =Ìåäàë „Ñâ. Àëåêñàíäúð“?  D\Y CD   1TFGP ō(ÒT 8GTFKGPUVŋ   =Îðäåí „ÇC Çàñëóãà“?  /QFGNN OKV FGO 2QTVTCKV <CT $QTKU +++ WPF XGT·PFGTVGO 9CRRGP CWH FGT   4ÒEMUGKVG  !  1TFGPU\GKEJGP + -NCUUG 5KNDGT XGTIQNFGV CO QTKIKPCNGP CNVGP &TGKGEMUDCPF KP   (TKGFGPU\GKVGPKOQTKIKPCNGP8GTNGKJWPIUGVWKFGT4GIGPVUEJCHVU\GKV  OKVIQNFHCTDGPGT<CTGP MTQPG$9-&'-.'2#XCT2'5HH4$80<- ++



/GFCKNNG ō5V #NGZCPFGTŋ =Ìåäàë „Ñâ. Àëåêñàíäúð“?  D\Y CD   1TFGP ō(ÒT 8GTFKGPUVŋ   =Îðäåí „ÇC Çàñëóãà“?  /QFGNN OKV FGO 2QTVTCKV <CT $QTKU +++ WPF XGT·PFGTVGO 9CRRGP CWH FGT   4ÒEMUGKVG! 1TFGPU\GKEJGP++-NCUUG5KNDGTCOQTKIKPCNGPCNVGP&TGKGEMUDCPFKP(TKGFGPU\GK VGPKOQTKIKPCNGPGVYCUXGTUEJOWV\VGP8GTNGKJWPIUGVWKFGT4GIGPVUEJCHVU\GKV  OKVIQNFHCT DGPGT <CTGPMTQPG $9-  &'  -.'  2#  2' 5HH 4$  80    <- ++




BULGARIEN

8328



8329

8330

/GFCKNNGō(ÒT8GTFKGPUVŋ=Ìåäàë „ÇC Çàñëóãà“?/QFGNN OKVFGO·NVGTGP2QTVTCKV<CT(GTFKPCPFU+   )QNFGPG /GFCKNNG OKV -TQPG  $TQP\G XGTIQNFGV QJPG 5VGORGNUEJPGKFGTUKIPCVWT MNGKPG   (GKNURWTKO4CPFCO&TGKGEMUDCPFFGU1TFGPU(ÒT6CRHGTMGKV$9-&'2#XCT2' 5HH4$80 44++



&KG )QNFGPG /GFCKNNG UGKV  IGPGTGNN OKV -TQPG YCT NCWV 2GVTQX KP 2' 5   UGKV KJTGT 5VKHVWPI DKU   KPUIGUCOVPWTOCNXGTNKGJGPYQTFGPYQXQPCNNGKPG8GTNGKJWPIGP CP#WUN·PFGTWPFCP$WNICTGP  FGT,CJTGDKUKPFKG4GIKGTWPIU\GKVXQP(ÒTUV#NGZCPFGTU+HKGNGP  0CEJFGT#PPCJOGFGU<CTGPVKVGNUGTJKGNVFKG8QTFGTUGKVGFCU·NVGTG2QTVTCKV(GTFKPCPFU /QFGNN #O ,WNKYWTFGHÒT8GTNGKJWPIGPHÒT-TKGIUXGTFKGPUVFCU$CPFFGU1TFGPUō(ÒT6CRHGTMGKVŋGKPIGHÒJTV



/GFCKNNGō(ÒT8GTFKGPUVŋ=Ìåäàë „ÇC Çàñëóãà“?/QFGNN OKVFGO·NVGTGP2QTVTCKV<CT(GTFKPCPFU+  )QNFGPG/GFCKNNG$TQP\GXGTIQNFGVOKV5VGORGNUEJPGKFGTUKIPCVWTō26'.)'ŋCOQTKIK PCNGPCNVGP&TGKGEMUDCPF$9-&'2#XCT2'5HH4$80 ++



5QYQJNNCWV2GVTQXCNUCWEJNCWV2CXNQXWPFNCWV&GPMQXKUVFKG/GFCKNNGKPFKGUGT(QTOPKGXGTNKGJGPYQTFGPFC FKG )QNFGPG /GFCKNNG XQP  DKU  ITWPFU·V\NKEJ XQP GKPGT -TQPG ÒDGTJÌJV YCT 1D GU UKEJ JKGTDGK   FGPPQEJWOGKPWPXGTNKGJGPGU1TKIKPCNGZGORNCTJCPFGNVMCPPPKEJVOKV5KEJGTJGKVHGUVGIGUVGNNVYGTFGP



/GFCKNNGō(ÒT8GTFKGPUVŋ=Ìåäàë „ÇC Çàñëóãà“?/QFGNN OKVFGO·NVGTGP2QTVTCKV<CT(GTFKPCPFU+  5KNDGTPG/GFCKNNGOKV-TQPG5KNDGTOKV5VGORGNUEJPGKFGTUKIPCVWTō26'.)'ŋCOQTKIK PCNGPCNVGP&TGKGEMUDCPF$9-&'2#2'5HH4$80 ++

8331









8334



8331

/GFCKNNGō(ÒT8GTFKGPUVŋ=Ìåäàë „ÇC Çàñëóãà“?/QFGNN OKVFGO·NVGTGP2QTVTCKV<CT(GTFKPCPFU+   5KNDGTPG /GFCKNNG 5KNDGT QJPG 5VGORGNUEJPGKFGTUKIPCVWT CO QTKIKPCNGP CNVGP 2GPVCIQ   PCNDCPF FGU 1TFGPU ō(ÒT 6CRHGTMGKVŋ $9-  &'  2#  XCT 2' 5HH 4$    80 ++



/GFCKNNGō(ÒT8GTFKGPUVŋ=Ìåäàë „ÇC Çàñëóãà“?/QFGNN OKVFGO·NVGTGP2QTVTCKV<CT(GTFKPCPFU+   $TQP\GPG /GFCKNNG OKV -TQPG $TQP\G QJPG 5VGORGNUEJPGKFGTUKIPCVWT CO QTKIKPCNGP   CNVGP &TGKGEMUDCPF FGU 1TFGPU ō(ÒT 6CRHGTMGKVŋ $9-  &'  2#  XCT 2' 5HH   4$80 ++



/GFCKNNGō(ÒT8GTFKGPUV/QFGNN OKVFGO·NVGTGP2QTVTCKV<CT(GTFKPCPFU+ $TQP \GPG /GFCKNNG $TQP\G QJPG 5VGORGNUEJPGKFGTUKIPCVWT CO QTKIKPCNGP CNVGP &TGKGEMUDCPF FGU 1TFGPU   ō(ÒT6CRHGTMGKVŋ$9-&'2#2'5HH4$80 ++



/GFCKNNG ō(ÒT 8GTFKGPUVŋ =Ìåäàë „ÇC Çàñëóãà“?  /QFGNN OKV FGO 2QTVTCKV XQP <CT $QTKU +++      )QNFGPG /GFCKNNG OKV -TQPG  $TQP\G XGTIQNFGV CO $CPF FGU 1TFGPU (ÒT 6CRHGTMGKV   $9-&'QD2#XCT2'5HH4$80 ++



&KG )QNFGPG /GFCKNNG UGKV  IGPGTGNN OKV -TQPG YCT NCWV 2GVTQX KP 2' 5   UGKV KJTGT 5VKHVWPI DKU   KPUIGUCOVPWTOCNXGTNKGJGPYQTFGPYQXQPCNNGKPG8GTNGKJWPIGP CP#WUN·PFGTWPFCP$WNICTGP  FGT,CJTGDKUKPFKG4GIKGTWPIU\GKVXQP(ÒTUV#NGZCPFGTU+HKGNGP  7PVGT $QTKU +++ \GKIVG UKG FGUUGP 2QTVTCKV  /QFGNN  0CEJFGO CO  5GRVGODGT  GKPG UQIGPCPPVG   ō8QNMUHTQPVTGIKGTWPIŋFKG/CEJVKP$WNICTKGPÒDGTPQOOGPJCVVGYWTFGCWHFGT8QTFGTUGKVGUVCVVFGU<CTGPRQTVTCKVU FGT WPIGMTÌPVG DWNICTKUEJG .ÌYG GKPIGHÒIV  /QFGNN  WPF FKG ō)QNF-NCUUGŋ CDIGUEJCHHV 0CEJ #WUTWHWPI FGT   4GRWDNKMCO/CKYWTFGFKG-TQPGFWTEJGKPGPUVKNKUKGTVGPJTGPMTCP\GTUGV\V /QFGNN DKUFKG/GFCKNNG ō(ÒT8GTFKGPUVŋOKV7MCUFGU/KPKUVGTTCVGUXQO,WPKCDIGUEJCHHVYQTFGPKUV

85


BULGARIEN

8336

8340



8335

8341

/GFCKNNG ō(ÒT 8GTFKGPUVŋ =Ìåäàë „ÇC Çàñëóãà“?  /QFGNN OKV FGO 2QTVTCKV XQP <CT $QTKU +++      )QNFGPG /GFCKNNG $TQP\G XGTIQNFGV CO $CPF FGU 1TFGPU ō(ÒT 6CRHGTMGKVŋ $9-    &'2#XCT2'5HH4$80 ++



5QYQJNNCWV2GVTQXCNUCWEJNCWV2CXNQXWPFNCWV&GPMQXKUVFKG/GFCKNNGKPFKGUGT(QTOPKGXGTNKGJGPYQTFGPFC FKG )QNFGPG /GFCKNNG XQP  DKU  ITWPFU·V\NKEJ XQP GKPGT -TQPG ÒDGTJÌJV YCT 1D GU UKEJ JKGTDGK   FGPPQEJWOGKPWPXGTNKGJGPGU1TKIKPCNGZGORNCTJCPFGNVMCPPPKEJVOKV5KEJGTJGKVHGUVGIGUVGNNVYGTFGP











/GFCKNNG ō(ÒT 8GTFKGPUVŋ =Ìåäàë „ÇC Çàñëóãà“?  /QFGNN OKV FGO 2QTVTCKV XQP <CT $QTKU +++      5KNDGTPG /GFCKNNG OKV -TQPG 5KNDGT CO $CPF FGU 1TFGPU ō(ÒT 6CRHGTMGKVŋ $9-    &'QD2#2'5HH4$80 ++



/GFCKNNG ō(ÒT 8GTFKGPUVŋ =Ìåäàë „ÇC Çàñëóãà“?  /QFGNN OKV FGO 2QTVTCKV XQP <CT $QTKU +++      5KNDGTPG /GFCKNNG $TQP\G XGTUKNDGTV CO $CPF FGU 1TFGPU ō(ÒT 6CRHGTMGKVŋ $9-    &'2#XCT2'5HH4$80 ++



/GFCKNNG ō(ÒT 8GTFKGPUVŋ =Ìåäàë „ÇC Çàñëóãà“?  /QFGNN OKV FGO 2QTVTCKV XQP <CT $QTKU +++     $TQP\GPG/GFCKNNGOKV-TQPG$TQP\GCO$CPFFGU1TFGPUō(ÒT6CRHGTMGKVŋ$9- &'QD2#XCT2'5HH4$80 ++



/GFCKNNG ō(ÒT 8GTFKGPUVŋ =Ìåäàë „ÇC Çàñëóãà“?  /QFGNN OKV FGO 2QTVTCKV XQP <CT $QTKU +++      $TQP\GPG /GFCKNNG $TQP\G CO $CPF FGU 1TFGPU ō(ÒT 6CRHGTMGKVŋ $9-  &'    2#XCT2'5HH4$80 ++



1TFGP (ÒT ō$ÒTIGTNKEJGU 8GTFKGPUVŋ =Îðäåí „ÇC Ãðàæäàíñêà Çàñëóãà“? CWEJ <KXKN8GTFKGPUV   QTFGP QFGT 0CVKQPCNGT <KXKN8GTFKGPUVQTFGP IGPCPPV   /QFGNN ITÌ­GTG +PUKIPKGP OKV UQIGP    ōGEMKIGTŋ <CTGPMTQPG    -TGW\ +++ -NCUUG $TQP\G XGTIQNFGV WPF GOCKNNKGTV CO CNVGP   *CNUDCPFKOQTKIKPCNGP8GTNGKJWPIUGVWKFGT(KTOC,QJ5EJYGTFVPGTKP9KGPOKVMÌPKINKEJGO9CRRGP

CD $9-&'-.'2#QD2'5HH4$80<- ++  .CWV2CXNQX KP2#5 YWTFGFKGUQIGPCPPVGōGEMKIGŋ<CTGPMTQPG /QFGNN GDGPUQYKGDGKO1TFGPō5V#NGZ CPFGTŋDGTGKVU KO<WUCOOGPJCPIOKVFGT5VKHVWPIFGU/KNKV·T8GTFKGPUVQTFGPUCO/CKGKPIGHÒJTV  &GOKUVGPVIGIGPCPFGTGTWPDGNGIVGT(GUVUVGNNWPIGPKPGKPGO6GKNFGTDKUJGTKIGP(CEJNKVGTCVWT\W\WUVKOOGP$GNGIG JKGTHÒTKUVPKEJVPWTFKG6CVUCEJGFC­#WUHÒJTWPIGPFKGUGU/QFGNNUKP'VWKUOKVFGOHÒTUVNKEJGP9CRRGP DKU  XQTMQOOGPUQPFGTPXQTCNNGOFKG'ZKUVGP\FGTUKGDGPUGJTUGNVGPGP1TFGPUVCHGNPFGT1TFGPō5V#NGZCPFGTŋō(ÒT 8GTFKGPUVŋ ō(ÒT $ÒTIGTNKEJGU 8GTFKGPUVŋ WPF ō(ÒT /KNKV·T8GTFKGPUVŋ UQYKG FGT /GFCKNNGP ō(ÒT 8GTFKGPUVŋ WPF   ō(ÒT -WPUV WPF 9KUUGPUEJCHVŋ CWH FGPGP FKGUG VNY CNU ōHÒTUVNKEJŋ DG\GKEJPGV YGTFGP WPF FKG  QFGT MWT\   FCPCEJDGK+2TCUGKP5QHKCIGFTWEMVYQTFGPUKPF'KPUQNEJGT5CV\FKGUGT6CHGNPIGNCPIVGCO1MVQDGTDGK 6JKGUKPFGUUGP#WMVKQPWPVGTFGP0WOOGTPDKU\WT8GTUVGKIGTWPI  $GK'TNCPIWPIFGT7PCDJ·PIKIMGKV$WNICTKGPUYWTFGPFKG+PUKIPKGPFGU1TFGPUPKEJVIG·PFGTV





86

1TFGP ō(ÒT $ÒTIGTNKEJGU 8GTFKGPUV =Îðäåí „ÇC Ãðàæäàíñêà Çàñëóãà“? CWEJ <KXKN8GTFKGPUVQT   FGPQFGT0CVKQPCNGT<KXKN8GTFKGPUVQTFGPIGPCPPV /QFGNN ITÌ­GTG+PUKIPKGPOKVUQIGPōGEMKIGTŋ <CTGPMTQPG -TGW\8-NCUUG$TQP\GXGTUKNDGTVWPFGOCKNNKGTVCOQTKIKPCNGPCNVGP&TGK GEMUDCPF$9-&'-.'2#2'5HH4$80<- ++



1TFGP ō(ÒT $ÒTIGTNKEJGU 8GTFKGPUV =Îðäåí „ÇC Ãðàæäàíñêà Çàñëóãà“? CWEJ <KXKN8GTFKGPUVQT   FGPQFGT0CVKQPCNGT<KXKN8GTFKGPUVQTFGPIGPCPPV /QFGNN ITÌ­GTG+PUKIPKGPOKVUQIGPōGEMKIGTŋ <CTGPMTQPG -TGW\8+-NCUUGOKV-TQPG$TQP\GXGTUKNDGTVWPFGOCKNNKGTVCOQTKIKPCNGP CNVGP &TGKGEMUDCPF $9-  &'  -.'  2#  2' 5HH 4$  80    <- ++




BULGARIEN 



1TFGP ō(ÒT $ÒTIGTNKEJGU 8GTFKGPUV =Îðäåí „ÇC Ãðàæäàíñêà Çàñëóãà“? CWEJ <KXKN8GTFKGPUVQT   FGPQFGT0CVKQPCNGT<KXKN8GTFKGPUVQTFGPIGPCPPV /QFGNN ITÌ­GTG+PUKIPKGPOKVUQIGPōGEMKIGTŋ <CTGPMTQPG -TGW\8+-NCUUG$TQP\GXGTUKNDGTVWPFGOCKNNKGTVCOQTKIKPCNGPCNVGP&TGK GEMUDCPF$9-&'-.'2#2'5HH4$80<- ++



1TFGP ō(ÒT $ÒTIGTNKEJGU 8GTFKGPUV =Îðäåí „ÇC Ãðàæäàíñêà Çàñëóãà“? CWEJ <KXKN8GTFKGPUVQT   FGPQFGT0CVKQPCNGT<KXKN8GTFKGPUVQTFGPIGPCPPV /QFGNN ITÌ­GTG+PUKIPKGPOKVUQIGPōGEMKIGTŋ <CTGPMTQPG -TGW\8+-NCUUG$TQP\GXGTUKNDGTVWPFGOCKNNKGTVCOQTKIKPCNGPCNVGP&TGK GEMUDCPF$9-&'-.'2#2'5HH4$80<- ++



8345

8346



1TFGP(ÒT$ÒTIGTNKEJGU8GTFKGPUV=Îðäåí „ÇC Ãðàæäàíñêà Çàñëóãà“? CWEJ<KXKN8GTFKGPUVQTFGP QFGT 0CVKQPCNGT <KXKN8GTFKGPUVQTFGP IGPCPPV   /QFGNN ITÌ­GTG +PUKIPKGP OKV UQIGP ōGEMKIGTŋ   <CTGPMTQPG    -TGW\ + -NCUUG HÒT &COGP &WTEJOGUUGT  OO 5KNDGT XGTIQNFGV WPF   GOCKNNKGTV KP FGT ¤UG ÌUVGTTGKEJKUEJ DKU   RWP\KGTV ō(4ŋ HÒT (TKGFTKEJ 4QVJG KP 9KGP    ō 9KPFJWPFMQRH #ŋ2WP\GP HÒT GT 5KNDGT  CP QTKIKPCNGT CNVGT &COGPUEJNGKHG $9-  &'    -.'2#2'5HH4$#80<- 4++ 



1TFGP ō(ÒT $ÒTIGTNKEJGU 8GTFKGPUV =Îðäåí „ÇC Ãðàæäàíñêà Çàñëóãà“? CWEJ <KXKN8GTFKGPUVQT   FGPQFGT0CVKQPCNGT<KXKN8GTFKGPUVQTFGPIGPCPPV /QFGNN ITÌ­GTG+PUKIPKGPOKVUQIGPōGEMKIGTŋ <CTGPMTQPG    -TGW\ +++ -NCUUG HÒT &COGP $TQP\G XGTUKNDGTV CP QTKIKPCNGT CNVGT &C   OGPUEJNGKHG$9-&'-.'2#2'5HH4$#80<- ++



8347



1TFGP ō(ÒT $ÒTIGTNKEJGU 8GTFKGPUV =Îðäåí „ÇC Ãðàæäàíñêà Çàñëóãà“? CWEJ <KXKN8GTFKGPUVQT   FGP IGPCPPV   /QFGNN MNGKPGTG +PUKIPKGP    5GV FGT + -NCUUG DGUVGJGPF CWU -NGKPQF   $TQP\G XGTIQNFGV WPF GOCKNNKGTV CO PCEJ HTCP\ÌUKUEJGT #TV MQPHGMVKQPKGTVGP 5EJWNVGTDCPF WPF $TWUV   UVGTPOGJTVGKNKIGT5VGTPMQTRWU$TQP\GXGTUKNDGTVVNYXGTIQNFGVCP0CFGNKOQTKIKPCNGPOKVIQNFHCT DGPGTGEMKIGT<CTGPMTQPGDGFTWEMVGP8GTNGKJWPIUGVWK$9-&'-.' 2#2'5HH4$80<- ++ 0CEJ FGT ªDGTPCJOG FGT 4GIKGTWPI  FWTEJ <CT $QTKU +++ YWTFGP FKG +PUKIPKGP MNGKPGT WPF FGTGP 1DGTHN·EJG   HNCEJGTIGUVCNVGV /QFGNN 



87


BULGARIEN

8348



8349

1TFGPō(ÒT$ÒTIGTNKEJGU8GTFKGPUV=Îðäåí „ÇC Ãðàæäàíñêà Çàñëóãà“? CWEJ<KXKN8GTFKGPUVQT FGPIGPCPPV /QFGNN MNGKPGTG+PUKIPKGP -TGW\+++-NCUUG5KNDGT  XGTIQNFGVWPF GOCKNNKGTV KO $CPFTKPI *GTUVGNNGTRWP\G ō(4ŋ FGT (KTOC 4QVJG KP 9KGP WPF ō 9KPFJWPFMQRH #ŋ   2WP\GP HÒT GT 5KNDGT DKU  CO QTKIKPCNGP *CNUDCPF KO QTKIKPCNGP 8GTNGKJWPIUGVWK OKV   IQNFHCTDGPGO /QPQITCOO <CT $QTKU +++ $9-  &'  -.'  2#  2' 5HH   4$80<- ++



1TFGP ō(ÒT $ÒTIGTNKEJGU 8GTFKGPUV =Îðäåí „ÇC Ãðàæäàíñêà Çàñëóãà“? CWEJ <KXKN8GTFKGPUVQT   FGP QFGT 0CVKQPCNGT <KXKN8GTFKGPUVQTFGP IGPCPPV   /QFGNN MNGKPGTG +PUKIPKGP      -TGW\+8-NCUUG5KNDGT  XGTIQNFGVWPFGOCKNNKGTVOGJTGTGMNGKPG'OCKNNGEJKRUKPFGP-TGW\CTOURKV \GPCOQTKIKPCNGP&TGKGEMUDCPFOKVCWHIGNGIVGT4QUGVVGKOQTKIKPCNGP8GTNGKJWPIUGVWKOKVIQNFHCTDG PGT <CTGPMTQPG $9-  &'  -.'  -ª  2#  2' 5HH 4$    80<- ++p+++



1TFGP ō(ÒT $ÒTIGTNKEJGU 8GTFKGPUV =Îðäåí „ÇC Ãðàæäàíñêà Çàñëóãà“? CWEJ <KXKN8GTFKGPUVQT   FGP QFGT 0CVKQPCNGT <KXKN8GTFKGPUVQTFGP IGPCPPV   /QFGNN MNGKPGTG +PUKIPKGP      -TGW\ 8 -NCUUG $TQP\G XGTUKNDGTV WPF GOCKNNKGTV 'OCKNNGTGRCTCVWTGP KP FGP /GFCKNNQPTKPIGP &C\W   1TFGP(ÒT/KNKV·T8GTFKGPUV-TGW\8+-NCUUG$TQP\GXGTUKNDGTVLGYGKNUCPPKEJVMQTTGMVGP$·PFGTP 5VÒEM++



#WHITWPF FGT ō9KPFJWPFMQRHŋ2WP\G N·­V UKEJ 'PVUVGJWPIU\GKVTCWO FKGUGU -TGW\GU CWH 'PFG  DKU #RTKN    DGITGP\GP





8351

8352



1TFGP ō(ÒT $ÒTIGTNKEJGU 8GTFKGPUV =Îðäåí „ÇC Ãðàæäàíñêà Çàñëóãà“? CWEJ <KXKN8GTFKGPUVQT   FGP QFGT 0CVKQPCNGT <KXKN8GTFKGPUVQTFGP IGPCPPV   /QFGNN MNGKPGTG +PUKIPKGP      -TGW\ ++ -NCUUG OKV -TQPG HÒT &COGP $TQP\G XGTUKNDGTV WPF GOCKNNKGTV CP FGT QTKIKPCNGP &C   OGPUEJNGKHG$9-&'-.'2#2'5HH4$#80<- 4++





1TFGP(ÒT$ÒTIGTNKEJGU8GTFKGPUV=Îðäåí „ÇC Ãðàæäàíñêà Çàñëóãà“? CWEJ<KXKN8GTFKGPUVQTFGP QFGT0CVKQPCNGT<KXKN8GTFKGPUVQTFGPIGPCPPV /QFGNN MNGKPGTG+PUKIPKGP -TGW\++ -NCUUGHÒT&COGP$TQP\GXGTUKNDGTVWPFGOCKNNKGTVCPFGTQTKIKPCNGP&COGPUEJNGKHG$9-&' -.'2#2'5HH4$#80<- 4++



88


BULGARIEN

8353

8354 1:1





8354 1:1

1TFGP ō(ÒT $ÒTIGTNKEJGU 8GTFKGPUV =Îðäåí „ÇC Ãðàæäàíñêà Çàñëóãà“? CWEJ <KXKN8GTFKGPUVQT   FGP QFGT 0CVKQPCNGT <KXKN8GTFKGPUVQTFGP IGPCPPV   /QFGNN MNGKPGTG +PUKIPKGP      -TGW\+++-NCUUGOKV-TQPGHÒT&COGP$TQP\GXGTUKNDGTVCPFGTQTKIKPCNGP&COGPUEJNGKHG$9- &'-.'2#2'5HH4$#80<- ++



1TFGP(ÒT$ÒTIGTNKEJGU8GTFKGPUV CWEJ<KXKN8GTFKGPUVQTFGPQFGT0CVKQPCNGT<KXKN8GTFKGPUVQT FGP IGPCPPV   /QFGNN VNY PGWG -NCUUGPGKPVGKNWPI    5GV FGT + -NCUUG -NGKPQF   $TQP\GXGTIQNFGVWPFGOCKNNKGTVCOQTKIKPCNGPCNVGP5EJWNVGTDCPFWPF$TWUVUVGTP5KNDGTVNYXGTIQNFGV WPFGOCKNNKGTVCP0CFGNFKGUGRWP\KGTVō5+.$'4ŋKOQTKIKPCNGP8GTNGKJWPIUGVWKOKVIQNFHCTDGPGO/Q PQITCOO<CT$QTKU+++$9-&'-.'2#2'5HH4$ 6#80<- 5VÒEM4++  QTFPGVG<CT$QTKU+++GKPG4GQTICPKUCVKQPFGU1TFGPUCP /QFGNN FKGUQHQTVYKTMUCOCDGTGTUVOKV&CVWO XQO/CKUVCVWCTKUEJHGUVIGJCNVGPYWTFG9GUGPVNKEJFCDGKYCTFKG'KPHÒJTWPIFGU)TQ­MTGW\GUOKVGKPGO DTKNNCPVKGTVGP$TWUVUVGTPÒDGTFGT-NCUUG PWPOGJTOKVGKPGOGKPHCEJGPCEJVUVTCJNKIGP$TWUVUVGTP +PFKGUGT(QTO YWTFGFGT1TFGPDKUCWHYGPKIG#WUPCJOGP UW DKUXGTNKGJGP  #NNGTFKPIU YWTFG  CWEJ WPF PKEJV GTUV  YKG &GPMQX WPF 2CXNQX CPPGJOGP  OÌINKEJGTYGKUG KO   <WUCOOGPJCPI OKV FGT 0GWHCUUWPI FGT 5VCVWVGP HÒT DGUVKOOVG 8GTNGKJWPIGP WPF PKEJV IGPGTGNN  GKP DGUQPFGTGU   GKPVGKNKIGU4ÒEMUGKVGPOGFCKNNQP KPFGT(CEJNKVGTCVWTōHNCEJGUŋ4ÒEMUGKVGPOGFCKNNQPIGPCPPV GKPIGHÒJTV /QFGNN  FCU KP FGT 7OUEJTKHV FGP 0COGP <CT (GTFKPCPFU ō¢’ž–›ˆ›¨ +ŋ  FCU 5VKHVWPIUFCVWO FGU 1TFGPU ō 8+++   ŋ WPFFGP.ÌYGPQJPG5CEJUGPUEJKNF\GKIV8GTNGKJWPIUITWRRGPOKVDGKIGHÒIVGP7TMWPFGPJCDGPIG\GKIVFC­ GUUKEJJKGTDGKWO8GTNGKJWPIGPJCPFGNVGFKGCWH8QTUEJNCIFGUUKEJUGKV'PFGKOFGWVUEJGP'ZKNDGHKPFNKEJGP <CTGP (GTFKPCPF + LGFQEJ KO 0COGP XQP <CT $QTKU +++ GTHQNIVGP WPF FKG CWEJ ÒDGT FCU *QHOCTUEJCNNCOV   (GTFKPCPFUKP%QDWTI WPFPKEJVÒDGTFKG1TFGPUMCP\NGKQFGTFCU-CDKPGVVXQP-ÌPKI$QTKUKP5QHKC ōCDIGYKEMGNVŋ YWTFGP 7YG $TGV\GPFQTHGT .WFYKIUDWTI UGK HÒT FKGUDG\ÒINKEJG *KPYGKUG WPF FKG ªDGTNCUUWPI GPVURTGEJGPFGT   7PVGTNCIGPJGT\NKEJUVIGFCPMV   #O  5GRVGODGT  KP (QNIG FGU 'KPOCTUEJGU FGT 5QYLGVWPKQP ÒDGTPCJO GKPG UQIGPCPPVG ō8QNMUHTQPV   TGIKGTWPIŋ FKG /CEJV WPF GPVOCEJVGVG HCMVKUEJ FGP HÒT FGP OKPFGTL·JTKIGP -ÌPKI 5KOGQP TGIKGTGPFGP 4GIGPV   UEJCHVUTCV YQTCWH CWEJ FKG +PUKIPKGP FGU 1TFGPU XGT·PFGTV YWTFGP KPFGO FCU <GPVTWO FGU 4ÒEMUGKVGPOGFCKNNQPU  

FGTCWHTGEJVUEJTGKVGPFGIGMTÌPVG.ÌYG CP5VGNNGFGUŋ¢+Ō (+ CWHFGT8QTFGTUGKVGRNCV\KGTVWPFUVCVVFGUUGPCWH FGT4ÒEMUGKVGFKGDWNICTKUEJG6TKMQNQTGUEJT·IGKPIGHÒIVYWTFG /QFGNN &KG<CTGPMTQPGCNUªDGTJÌJWPIDNKGD DGK FKGUGT CNU ō4GIGPVUEJCHVU/QFGNNŋ DG\GKEJPGVGP #WUHÒJTWPI GTJCNVGP 0CEJFGO CO  5GRVGODGT  KPGKPGT 8QNMUCDUVKOOWPI FKG /QPCTEJKG CDIGUEJCHHV YQTFGP YCT TKGH )GQTIK &KOKVTQX CO  5GRVGODGT  FKG   4GRWDNKMCWU0WPOGJTYWTFGKPFGP1TFGPUMTGW\GPFKG<CTGPMTQPGFWTEJGKPGPUVKNKUKGTVGPJTGPMTCP\GTUGV\VWPF CWEJ FKG CWH FGO -QRH FGU .ÌYGP UKV\GPFG -TQPG GPVHGTPV  /QFGNN   YWTFG FGT 1TFGP UEJNKG­NKEJ   CDIGUEJCHHV

89


BULGARIEN 





1TFGP ō(ÒT $ÒTIGTNKEJGU 8GTFKGPUV =Îðäåí „ÇC Ãðàæäàíñêà Çàñëóãà“? CWEJ <KXKN8GTFKGPUVQT   FGPIGPCPPV 8GTNGKJWPIUWTMWPFG\WT-NCUUGHÒTFGP4WO·PKUEJGP$QVUEJCHVGTKP$WNICTKGP)GQTIGU %CTCPHKNFCVKGTV5QHKCCO/·T\OKV2T·IGUKGIGNWPF1TKIKPCNWPVGTUEJTKHVGPIGHCNVGVOGJTGTG MNGKPG 'KPTKUUG OKV ªDGTUGPFWPIUUEJTGKDGP FGU -CDKPGVVU FGU -ÌPKIU FCVKGTV 5QHKC CO #RTKN OKV1TKIKPCNWPVGTUEJTKHVFGU%JGHUFGU-ÌPKINKEJGP-CDKPGVVU 5VÒEM++



1TFGP ō(ÒT $ÒTIGTNKEJGU 8GTFKGPUV =Îðäåí „ÇC Ãðàæäàíñêà Çàñëóãà“? CWEJ <KXKN8GTFKGPUVQT   FGP QFGT 0CVKQPCNGT <KXKN8GTFKGPUVQTFGP IGPCPPV   /QFGNN VNY PGWG -NCUUGPGKPVGKNWPI       NGGTGU QTKIKPCNGU 8GTNGKJWPIUGVWK FGT 4GIGPVUEJCHVU\GKV   \WO -TGW\ +8 -NCUUG OKV   IQNFHCTDGPGT<CTGPMTQPG ++



1TFGP ō(ÒT $ÒTIGTNKEJGU 8GTFKGPUV =Îðäåí „ÇC Ãðàæäàíñêà Çàñëóãà“? CWEJ <KXKN8GTFKGPUVQT   FGP QFGT 0CVKQPCNGT <KXKN8GTFKGPUVQTFGP IGPCPPV   /QFGNN VNY PGWG -NCUUGPGKPVGKNWPI       NGGTGU QTKIKPCNGU 8GTNGKJWPIUGVWK FGT 4GIGPVUEJCHVU\GKV   \WO -TGW\ +8 -NCUUG OKV   IQNFHCTDGPGT<CTGPMTQPG ++



8358





8359

1TFGPō(ÒT$ÒTIGTNKEJGU8GTFKGPUVŋ=Îðäåí „ÇC Ãðàæäàíñêà Çàñëóãà“? CWEJ<KXKN8GTFKGPUVQTFGP QFGT0CVKQPCNGT<KXKN8GTFKGPUVQTFGPIGPCPPV /QFGNN VNYPGWG-NCUUGPGKPVGKNWPI  -TGW\8-NCUUGOKV-TQPG$TQP\GXGTUKNDGTVWPFGOCKNNKGTVCOQTKIKPCNGP&TGKGEMUDCPFKOQTKIKPCNGP GVYCU DGUEJ·FKIVGP 8GTNGKJWPIUGVWK FGT 4GIGPVUEJCHVU\GKV   OKV IQNFHCTDGPGT <CTGPMTQPG   $9-&'-.'2#2'5HH4$80<- ++

1TFGP (ÒT /KNKV·T8GTFKGPUV =Îðäåí „ÇC Âîåííà Çàñëóãà“? CWEJ ō/KNKV·T8GTFKGPUVQTFGP    IGPCPPV /QFGNN ITÌ­GTG+PUKIPKGP 5GVFGT+-NCUUGDGUVGJGPFCWU-NGKPQF$TQP\G XGTIQNFGVWPFGOCKNNKGTVCOQTKIKPCNGP5EJWNVGTDCPFWPF$TWUVUVGTP$TQP\GXGTUKNDGTVVNYXGTIQNFGV WPFGOCKNNKGTV5VGTPMÌTRGTOGJTVGKNKIIGHGTVKIVCP0CFGNKOPKEJV\WIGJÌTKIGP'VWKFGT(KTOC$CESWG XKNNG KP 2CTKU $9-   &'   -.'   2#  2' 5HH 4$    80<- 5VÒEM+p++  $GK'TNCPIWPIFGT7PCDJ·PIKIMGKV$WNICTKGPUYWTFGPFKG+PUKIPKGPFGU1TFGPUPKEJVIG·PFGTV#DMQPPVGPFKG +88WPF8+-NCUUGCWEJCO$CPFFGU1TFGPUō(ÒT6CRHGTMGKVŋXGTNKGJGPYGTFGPYWTFGHÒT8GTNGKJWPIGP FGT + DKU 8 -NCUUG KP -TKGIU\GKVGP PCEJ FGO 8QTDKNF ÌUVGTTGKEJKUEJGT 1TFGP GKPG UQIGPCPPVG -TKGIUFGMQTCVKQP   DGUVGJGPFCWUGKPGO'KEJGPWPF.QTDGGTDN·VVGT-TCP\FKGCWHFCU-TGW\CWHIGNGIVKUVIGUVKHVGVYQDGKFKG+8WPF 8-NCUUGOKVFGT-TKGIUFGMQTCVKQPITWPFU·V\NKEJCO$CPFFGU1TFGPUō(ÒT6CRHGTMGKVŋXGTNKGJGPYWTFGP

90




BULGARIEN

8360 1:1



1TFGP (ÒT /KNKV·T8GTFKGPUV =Îðäåí „ÇC Âîåííà Çàñëóãà“? CWEJ ō/KNKV·T8GTFKGPUVQTFGP IG   PCPPV /QFGNN ITÌ­GTG+PUKIPKGP 5GVFGT+-NCUUGOKVFGT-TKGIUFGMQTCVKQP CD  DGUVGJGPFCWU-NGKPQF$TQP\GXGTIQNFGVWPFGOCKNNKGTVCOQTKIKPCNGPCNVGP5EJWNVGTDCPFWPF$TWUV UVGTP OGJTVGKNKIGT 5VGTPMÌTRGT $TQP\G XGTUKNDGTV VNY XGTIQNFGV WPF GOCKNNKGTV TÒEMUGKVKIG #DFGEM   RNCVVGFGU<GPVTWOUGTI·P\VCP0CFGNKOPKEJV\WIGJÌTKIGP8GTNGKJWPIUGVWKFGT(KTOC$CESWGXKNNGKP 2CTKU$9-&'-.'2#2'5HH4$80 <- 5VÒEM++ 

91


BULGARIEN

8361



1TFGP (ÒT /KNKV·T8GTFKGPUV =Îðäåí „ÇC Âîåííà Çàñëóãà“? CWEJ ō/KNKV·T8GTFKGPUVQTFGP IG   PCPPV   /QFGNN ITÌ­GTG +PUKIPKGP    5GV FGT ++ -NCUUG OKV FGT -TKGIUFGMQTCVKQP CD    DGUVGJGPFCWU*CNUMTGW\$TQP\GXGTIQNFGVWPFGOCKNNKGTVCO*CNUDCPFWPF$TWUVUVGTP$TQP\G XGTUKNDGTV VNY XGTIQNFGV WPF GOCKNNKGTV CP 0CFGN $9-   &'   -.'     -ª2#2'5HH4$80<- 5VÒEM++

8362









92

8363



8365

1TFGP (ÒT /KNKV·T8GTFKGPUV =Îðäåí „ÇC Âîåííà Çàñëóãà“? CWEJ ō/KNKV·T8GTFKGPUVQTFGP IG   PCPPV /QFGNN ITÌ­GTG+PUKIPKGP -TGW\+8-NCUUGOKV-TKGIUFGMQTCVKQP$TQP\GXGT IQNFGVWPFGOCKNNKGTVCOQTKIKPCNGP&TGKGEMUDCPFFGU1TFGPUō(ÒT6CRHGTMGKVŋ$9-&'XCT -.'2#2'5HH4$80<- ++



1TFGP (ÒT /KNKV·T8GTFKGPUV =Îðäåí „ÇC Âîåííà Çàñëóãà“? CWEJ ō/KNKV·T8GTFKGPUVQTFGP IG   PCPPV /QFGNN ITÌ­GTG+PUKIPKGP -TGW\8-NCUUGOKV-TQPG5KNDGT  GOCKNNKGTVCO QTKIKPCNGP&TGKGEMUDCPFFGU1TFGPUō(ÒT6CRHGTMGKVŋKOQTKIKPCNGP8GTNGKJWPIUGVWKOKVIQNFHCTDGPGO /QPQITCOO <CT (GTFKPCPFU + $9-  &'  -.'  2#  2' 5HH 4$    80<- 4++



1TFGP (ÒT /KNKV·T8GTFKGPUV =Îðäåí „ÇC Âîåííà Çàñëóãà“? CWEJ ō/KNKV·T8GTFKGPUVQTFGP IG   PCPPV   /QFGNN ITÌ­GTG +PUKIPKGP    .GGTGU 8GTNGKJWPIUGVWK \WO -TGW\ 8 -NCUUG OKV   -TQPGOKVIQNFHCTDGPGO/QPQITCOO<CT(GTFKPCPFU+ ++



1TFGP (ÒT /KNKV·T8GTFKGPUV =Îðäåí „ÇC Âîåííà Çàñëóãà“? CWEJ ō/KNKV·T8GTFKGPUVQTFGP IG   PCPPV /QFGNN ITÌ­GTG+PUKIPKGP -TGW\8-NCUUG$TQP\GXGTUKNDGTVWPFGOCKNNKGTV CO &TGKGEMUDCPF KO QTKIKPCNGP GVYCU XGTUEJOWV\VGP 8GTNGKJWPIUGVWK OKV IQNFHCTDGPGO /QPQITCOO   <CT (GTFKPCPFU + $9-  &'  -.'  2#  2' 5HH 4$  80    <- ++




BULGARIEN 



1TFGP (ÒT /KNKV·T8GTFKGPUV =Îðäåí „ÇC Âîåííà Çàñëóãà“? CWEJ ō/KNKV·T8GTFKGPUVQTFGP IG   PCPPV /QFGNN ITÌ­GTG+PUKIPKGP -TGW\8+-NCUUGOKV-TQPG$TQP\GXGTUKNDGTVCO &TGKGEMUDCPFFGU1TFGPUō(ÒT6CRHGTMGKVŋ$9-&'-.'2#XCT2'5HH 4$80<- ++



1TFGP (ÒT /KNKV·T8GTFKGPUV =Îðäåí „ÇC Âîåííà Çàñëóãà“? CWEJ ō/KNKV·T8GTFKGPUVQTFGP IG   PCPPV /QFGNN ITÌ­GTG+PUKIPKGP -TGW\8+-NCUUG$TQP\GXGTUKNDGTVCO&TGKGEMU DCPFFGU1TFGPUō(ÒT6CRHGTMGKVŋ$9-&'-.'2#XCT2'5HH4$ 80<- ++



8369

8370 8368



1TFGP (ÒT /KNKV·T8GTFKGPUV =Îðäåí „ÇC Âîåííà Çàñëóãà“? CWEJ ō/KNKV·T8GTFKGPUVQTFGP IG   PCPPV   /QFGNN VNYPGWG-NCUUGPGKPVGKNWPI -TGW\+8-NCUUGOKV-TKGIUFGMQTCVKQP $TQP\GXGTUKNDGTVWPFGOCKNNKGTVCO&TGKGEMUDCPFFGU1TFGPUō(ÒT6CRHGTMGKVŋ$9-&' -.'2#2'5HH4$80<- ++



0CEJ FGT ªDGTPCJOG FGT 4GIKGTWPI  FWTEJ <CT $QTKU +++ YWTFGP FKG +PUKIPKGP MNGKPGT WPF FGTGP 1DGTHN·EJG   HNCEJGT IGUVCNVGV  /QFGNN   QTFPGVG GT GKP 4GQTICPKUCVKQP FGU 1TFGPU CP  /QFGNN  FKG UQHQTV YKTMUCO   YWTFGCDGTGTUVOKV&CVWOXQO/CKUVCVWCTKUEJHGUVIGJCNVGPYWTFG9GUGPVNKEJFCDGKYCTFKG'KPHÒJTWPI FGU)TQ­MTGW\GUOKVGKPGODTKNNCPVKGTVGP$TWUVUVGTPÒDGTFGT-NCUUG PWPOGJTOKVGKPGOGKPHCEJGPCEJVUVTCJNKIGP $TWUVUVGTP +PFKGUGT(QTOYWTFGFGT1TFGPDKUCWHYGPKIG#WUPCJOGP UW DKUXGTNKGJGP  #NNGTFKPIU YWTFG  CWEJ WPF PKEJV GTUV  YKG &GPMQX WPF 2CXNQX CPPGJOGP  OÌINKEJGTYGKUG KO   <WUCOOGPJCPI OKV FGT 0GWHCUUWPI FGT 5VCVWVGP HÒT DGUVKOOVG 8GTNGKJWPIGP WPF PKEJV IGPGTGNN  GKP DGUQPFGTGU   GKPVGKNKIGU4ÒEMUGKVGPOGFCKNNQP KPFGT(CEJNKVGTCVWTōHNCEJGUŋ4ÒEMUGKVGPOGFCKNNQPIGPCPPV GKPIGHÒJTV /QFGNN  FCU KP FGT 7OUEJTKHV FGP 0COGP <CT (GTFKPCPFU ō¢’ž–›ˆ›¨ +ŋ  FCU 5VKHVWPIUFCVWO FGU 1TFGPU ō(ÒT   $ÒTIGTNKEJGU 8GTFKGPUVŋ ō 8+++ ŋ WPF FGP .ÌYGP QJPG 5CEJUGPUEJKNF \GKIV 8GTNGKJWPIUITWRRGP OKV   DGKIGHÒIVGP7TMWPFGPJCDGPIG\GKIVFC­GUUKEJJKGTDGKWO8GTNGKJWPIGPJCPFGNVGFKGCWH8QTUEJNCIFGUUKEJUGKV 'PFGKOFGWVUEJGP'ZKNDGHKPFNKEJGP<CTGP(GTFKPCPF+LGFQEJKO0COGPXQP<CT$QTKU+++GTHQNIVGPWPF FKGCWEJÒDGTFCU*QHOCTUEJCNNCOV(GTFKPCPFUKP%QDWTI WPFPKEJVÒDGTFKG1TFGPUMCP\NGKQFGTFCU-CDKPGVVXQP -ÌPKI$QTKUKP5QHKC ōCDIGYKEMGNVŋYWTFGP 7YG$TGV\GPFQTHGT.WFYKIUDWTIUGKHÒTFKGUDG\ÒINKEJG*KPYGKUGWPF FKGªDGTNCUUWPIGPVURTGEJGPFGT7PVGTNCIGPJGT\NKEJUVIGFCPMV   #O  5GRVGODGT  KP (QNIG FGU 'KPOCTUEJGU FGT 5QYLGVWPKQP ÒDGTPCJO GKPG UQIGPCPPVG ō8QNMUHTQPV   TGIKGTWPIŋ FKG /CEJV WPF GPVOCEJVGVG HCMVKUEJ FGP HÒT FGP OKPFGTL·JTKIGP -ÌPKI 5KOGQP TGIKGTGPFGP   4GIGPVUEJCHVUTCV YQTCWH CWEJ FKG +PUKIPKGP FGU 1TFGPU XGT·PFGTV YWTFGP KPFGO FCU <GPVTWO FGU 4ÒEM   UGKVGPOGFCKNNQPU FGT CWHTGEJV UEJTGKVGPFG IGMTÌPVG .ÌYG  CP 5VGNNG FGU ŋ¢+Ō (+  CWH FGT 8QTFGTUGKVG RNCV\KGTV    WPFUVCVVFGUUGPCWHFGT4ÒEMUGKVGFKGDWNICTKUEJG6TKMQNQTGUEJT·IGKPIGHÒIVYWTFG /QFGNN #WEJFCUDKUJGTKIG $CPF YWTFG FWTEJ FCU FGU 1TFGPU ō(ÒT $ÒTIGTNKEJGU 8GTFKGPUVŋ CWUIGVCWUEJV 8GTNGKJWPIGP CO $CPF FGU 1TFGPU   ō(ÒT 6CRHGTMGKVŋ YWTFGP LGFQEJ YGKVGT XQTIGPQOOGP &KG <CTGPMTQPG CNU ªDGTJÌJWPI DNKGD DGK FKGUGT CNU   ō4GIGPVUEJCHVU/QFGNNŋ DG\GKEJPGVGP #WUHÒJTWPI GTJCNVGP 0CEJFGO CO  5GRVGODGT  KP GKPGT 8QNMU   CDUVKOOWPIFKG/QPCTEJKGCDIGUEJCHHVYQTFGPYCTTKGH)GQTIK&KOKVTQXCO5GRVGODGTFKG4GRWDNKMCWU 0WPOGJTYWTFGKPFGP1TFGPUMTGW\GPFKG<CTGPMTQPGFWTEJGKPGPUVKNKUKGTVGPJTGPMTCP\GTUGV\VWPFCWEJFKGCWH FGO-QRHFGU.ÌYGPUKV\GPFG-TQPGGPVHGTPV /QFGNN /KV$GUEJNW­0TFGU/KPKUVGTTCVGUXQO,WPK YWTFGFGT1TFGPUEJNKG­NKEJCDIGUEJCHHV



1TFGP ō(ÒT /KNKV·T8GTFKGPUVŋ =Îðäåí „ÇC Âîåííà Çàñëóãà“? CWEJ ō/KNKV·T8GTFKGPUVQTFGP    IGPCPPV /QFGNN VNYPGWG-NCUUGPGKPVGKNWPI -TGW\+8-NCUUGOKV-TKGIUFGMQTCVKQP $TQP\GXGTUKNDGTVWPFGOCKNNKGTVCO&TGKGEMUDCPFFGU1TFGPUō(ÒT6CRHGTMGKVŋ$9-&' -.'2#2'5HH4$80<- ++ 



1TFGP (ÒT /KNKV·T8GTFKGPUV =Îðäåí „ÇC Âîåííà Çàñëóãà“? CWEJ ō/KNKV·T8GTFKGPUVQTFGP IG   PCPPV /QFGNN MNGKPGTG+PUKIPKGP -TGW\8-NCUUGOKV-TQPG$TQP\GXGT UKNDGTV WPF GOCKNNKGTV CO QTKIKPCNGPCNVGP&TGKGEMUDCPF$9-&'-.'2#2' 5HH4$80<- ++

 93


BULGARIEN

8372

8371









1TFGP (ÒT /KNKV·T8GTFKGPUV =Îðäåí „ÇC Âîåííà Çàñëóãà“? CWEJ ō/KNKV·T8GTFKGPUVQTFGP IG   PCPPV /QFGNN VNYPGWG-NCUUGPGKPVGKNWPI -TGW\8-NCUUGOKV-TQPGWPF-TKGIUFGMQ TCVKQP$TQP\GXGTUKNDGTVWPFGOCKNNKGTVCO&TGKGEMUDCPFFGU1TFGPUō(ÒT6CRHGTMGKVŋKOQTKIKPCNGP 8GTNGKJWPIUGVWKOKVIQNFHCTDGPGO/QPQITCOO<CT$QTKU+++$9-&'-.'-ª 2#2'5HH4$80<- ++



1TFGP (ÒT /KNKV·T8GTFKGPUV =Îðäåí „ÇC Âîåííà Çàñëóãà“? CWEJ ō/KNKV·T8GTFKGPUVQTFGP IG   PCPPV /QFGNN VNYPGWG-NCUUGPGKPVGKNWPI -TGW\8-NCUUGOKV-TQPGWPF-TKGIUFGMQ TCVKQP $TQP\G XGTUKNDGTV WPF GOCKNNKGTV CO &TGKGEMUDCPF FGU 1TFGPU ō(ÒT 6CRHGTMGKVŋ $9-    &'-.'-ª2#2'5HH4$80<- ++



1TFGP (ÒT /KNKV·T8GTFKGPUV =Îðäåí „ÇC Âîåííà Çàñëóãà“? CWEJ ō/KNKV·T8GTFKGPUVQTFGP IG   PCPPV   /QFGNN VNY PGWG -NCUUGPGKPVGKNWPI    -TGW\ 8 -NCUUG OKV -TKGIUFGMQTCVKQP   $TQP\GXGTUKNDGTVWPFGOCKNNKGTVGKP-TGW\CTOCWHFGT8QTFGTUGKVGOKVITQ­HN·EJKIGT'OCKNNGTGRCTCVWT CO&TGKGEMUDCPFFGU1TFGPUō(ÒT6CRHGTMGKVŋ$9-&'-.'2#2'5HH 4$80<- ++



1TFGP (ÒT /KNKV·T8GTFKGPUV =Îðäåí „ÇC Âîåííà Çàñëóãà“? CWEJ ō/KNKV·T8GTFKGPUVQTFGP IG   PCPPV   /QFGNN MNGKPGTG +PUKIPKGP    -TGW\ 8+ -NCUUG $TQP\G XGTUKNDGTV CO   QTKIKPCNGPCNVGP&TGKGEMUDCPFKOQTKIKPCNGP8GTNGKJWPIUGVWKOKVIQNFHCTDGPGO/QPQITCOO<CT$QTKU +++ OKV DGUEJ·FKIVGO 8GTUEJNW­ $9-  &'  -.'  2#  2' 5HH 4$    80<- ++



8375



94

'JTGP\GKEJGP ō(ÒT FGP #PURQTP \WT /GPUEJNKEJMGKVŋ =Ïî÷åòåí Çíàê „Çà Íàñúð÷åíèå êúì   ×åëîâåêîëþáèå“? CWEJ ō1TFGP HÒT 9QJNV·VKIMGKVŋ IGPCPPV QFGT H·NUEJNKEJGTYGKUG CNU ō1TFGP   XQO4QVGP-TGW\ŋDG\GKEJPGV /QFGNN OKV/QPQITCOOGP<CT(GTFKPCPFU+\YKUEJGPFGP-TGW \CTOGP 5GVFGT+-NCUUGHÒT*GTTGPDGUVGJGPFCWU*CNUMTGW\5KNDGTGOCKNNKGTVCOQTKIK PCNGP*CNUDCPFWPF$TWUVMTGW\5KNDGTGOCKNNKGTVOKP'OCKNNGURTÒPIGWPF-TCV\GTKO4QVGP-TGW\CP 0CFGN$9-&'-.'2#2'5H4$80 <- 5VÒEM4++ 


BULGARIEN /KV 4GUMTKRV XQO  /CK  UVKHVGVG <CT (GTFKPCPF + FCU 'JTGP\GKEJGP 'U WOHCUUVG XKGT -NCUUGP + DKU +8   -NCUUG HÒT*GTTGPWPFFTGK-NCUUGPHÒT&COGP +DKU+++-NCUUG 1DYQJN4GUMTKRVWPF5VCVWVXQPGKPGO'JTGP\GK EJGP URTGEJGP YGKUV GU CNNG %JCTCMVGTKUVKMC GKPGU1TFGPUCWH&KGDGTGKVUCO1MVQDGTIGUVKHVGVGPFTGKMNCUUKIGP

)QNF5KNDGTWPF$TQP\G /GFCKNNGPō(ÒTFGP#PURQTP\WT/GPUEJNKEJMGKVŋWPFō(ÒTFKG4GVVWPIXQP/GPUEJGPNG DGPŋYWTFGPFGO'JTGP\GKEJGPDGKFGUUGP5VKHVWPICHHKNKKGTV  #O  5GRVGODGT  KP (QNIG FGU 'KPOCTUEJGU FGT 5QYLGVWPKQP ÒDGTPCJO GKPG UQIGPCPPVG ō8QNMUHTQPV   TGIKGTWPIŋ FKG /CEJV WPF GPVOCEJVGVG HCMVKUEJ FGP HÒT FGP OKPFGTL·JTKIGP -ÌPKI 5KOGQP TGIKGTGPFGP   4GIGPVUEJCHVUTCV YQTCWH CWEJ FKG +PUKIPKGP FGU 'JTGP\GKEJGPU XGT·PFGTV YWTFGP KPFGO FKG \YKUEJGP FGP   -TGW\CTOGP DGHKPFNKEJGP /QPQITCOOG <CT (GTFKPCPFU GTUCV\NQU GPVHGTPV YWTFGP #NNGTFKPIU DGJKGNV FGT .ÌYG CWH   FGT 4ÒEMUGKVG UGKPG WTURTÒPINKEJG (QTO OKV <CTGPMTQPG WPF 5CEJUGPUEJKNF  +P FKGUGT (QTO YWTFG GU CWEJ PCEJ   #WUTWHWPIFGT4GRWDNKMCO5GRVGODGTYGKVGTXGTNKGJGPDKUGURGT&GMTGVFGU/KPKUVGTTCVGUXQO,WNK CDIGUEJCHHVYWTFG

8376

8377







8378

'JTGP\GKEJGP ō(ÒT FGP #PURQTP \WT /GPUEJNKEJMGKVŋ =Ïî÷åòåí Çíàê „Çà Íàñúð÷åíèå êúì   ×åëîâåêîëþáèå“? CWEJ ō1TFGP HÒT 9QJNV·VKIMGKVŋ IGPCPPV QFGT H·NUEJNKEJGTYGKUG CNU ō1TFGP   XQO4QVGP-TGW\ŋDG\GKEJPGV /QFGNN OKV/QPQITCOOGP<CT(GTFKPCPFU+\YKUEJGPFGP-TGW \CTOGP    -TGW\ ++ -NCUUG HÒT *GTTGP 5KNDGT GOCKNNKGTV CO QTKIKPCNGP *CNUDCPF   $9-&'-.'2#2'5H4$80<- 4++



'JTGP\GKEJGP ō(ÒT FGP #PURQTP \WT /GPUEJNKEJMGKVŋ =Ïî÷åòåí Çíàê „Çà Íàñúð÷åíèå êúì   ×åëîâåêîëþáèå“? CWEJ ō1TFGP HÒT 9QJNV·VKIMGKVŋ IGPCPPV QFGT H·NUEJNKEJGTYGKUG CNU ō1TFGP   XQO4QVGP-TGW\ŋDG\GKEJPGV /QFGNN OKV/QPQITCOOGP<CT(GTFKPCPFU+\YKUEJGPFGP-TGW \CTOGP    -TGW\ +++ -NCUUG HÒT *GTTGP 5KNDGT GOCKNNKGTV CO QTKIKPCNGP &TGKGEMUDCPF   $9-&'-.'2#2'5H4$80<- ++



'JTGP\GKEJGP ō(ÒT FGP #PURQTP \WT /GPUEJNKEJMGKVŋ =Ïî÷åòåí Çíàê „Çà Íàñúð÷åíèå êúì   ×åëîâåêîëþáèå“? CWEJ ō1TFGP HÒT 9QJNV·VKIMGKVŋ IGPCPPV QFGT H·NUEJNKEJGTYGKUG CNU ō1TFGP   XQO4QVGP-TGW\ŋDG\GKEJPGV /QFGNN OKV/QPQITCOOGP<CT(GTFKPCPFU+\YKUEJGPFGP-TGW \CTOGP -TGW\+8-NCUUGHÒT*GTTGP5KNDGTVNYGOCKNNKGTVCOQTKIKPCNGP&TGKGEMUDCPF $9-&'-.'2#2'5H4$80<- ++



8379



'JTGP\GKEJGP ō(ÒT FGP #PURQTP \WT /GPUEJNKEJMGKVŋ =Ïî÷åòåí Çíàê „Çà Íàñúð÷åíèå êúì   ×åëîâåêîëþáèå“? CWEJ ō1TFGP HÒT 9QJNV·VKIMGKVŋ IGPCPPV QFGT H·NUEJNKEJGTYGKUG CNU ō1TFGP   XQO4QVGP-TGW\ŋDG\GKEJPGV /QFGNN OKV/QPQITCOOGP<CT(GTFKPCPFU+\YKUEJGPFGP-TGW \CTOGP -TGW\+-NCUUGHÒT&COGP5KNDGT CNV XGTIQNFGVWPFGOCKNNKGTVCPFGTQTKIKPC NGP&COGPUEJNGKHG$9-XCT&'-.'2#XCT2'5H4$#XCT 80XCT<-XCT 444++



'UJCPFGNVUKEJJKGTDGKVCVU·EJNKEJWOGKPCNVXGTIQNFGVGU'ZGORNCTFCUKPFKGUGT#WUHÒJTWPIDKUJGTPKEJVRWDNK\KGTV YQTFGPKUV1DGUUKEJJKGTDGKWOGKPG\YGKVG#WUHÒJTWPIFGT+-NCUUGHÒT&COGP CPUVGNNGFGU$TWUV5VGEMMTGW\GU  QFGTWOGKPGGKPOCNKIGDGUQPFGTG#WUHÒJTWPIJCPFGNVMQPPVGNGKFGTPKEJVHGUVIGUVGNNVYGTFGP

95


BULGARIEN

8382

8380







8381

'JTGP\GKEJGP ō(ÒT FGP #PURQTP \WT /GPUEJNKEJMGKVŋ =Ïî÷åòåí Çíàê „Çà Íàñúð÷åíèå êúì   ×åëîâåêîëþáèå“? CWEJ ō1TFGP HÒT 9QJNV·VKIMGKVŋ IGPCPPV QFGT H·NUEJNKEJGTYGKUG CNU ō1TFGP   XQO4QVGP-TGW\ŋDG\GKEJPGV /QFGNN OKV/QPQITCOOGP<CT(GTFKPCPFU+\YKUEJGPFGP-TGW \CTOGP -TGW\++-NCUUGHÒT&COGP5KNDGTGOCKNNKGTVCPFGTQTKIKPCNGP&COGPUEJNGKHG KO QTKIKPCNGP 8GTNGKJWPIUGVWK OKV /QPQITCOO <CT (GTFKPCPFU + $9-  &'  -.'    2#2'5H4$#80<- ++



'JTGP\GKEJGP ō(ÒT FGP #PURQTP \WT /GPUEJNKEJMGKVŋ =Ïî÷åòåí Çíàê „Çà Íàñúð÷åíèå êúì   ×åëîâåêîëþáèå“? CWEJ ō1TFGP HÒT 9QJNV·VKIMGKVŋ IGPCPPV QFGT H·NUEJNKEJGTYGKUG CNU ō1TFGP   XQO4QVGP-TGW\ŋDG\GKEJPGV /QFGNN OKV/QPQITCOOGP<CT(GTFKPCPFU+\YKUEJGPFGP-TGW \CTOGP    -TGW\ +++ -NCUUG HÒT &COGP 5KNDGT  VNY GOCKNNKGTV CP FGT QTKIKPCNGP &COGP   UEJNGKHGKOQTKIKPCNGP8GTNGKJWPIUGVWKOKV/QPQITCOO<CT(GTFKPCPFU+$9-&'-.' 2#2'5H4$#80<- ++



/GFCKNNGō(ÒTFGP#PURQTP\WT/GPUEJNKEJMGKVŋ=Ìåäàë „Çà Íàñúð÷åíèå êúì ×åëîâåêîëþáèå“?

CWEJō/GFCKNNGHÒT9QJNV·VKIMGKVŋIGPCPPV /QFGNN OKVFGO2QTVTCKV<CT(GTFKPCPFU+   )QNFGPG /GFCKNNG QJPG -TQPG $TQP\G XGTIQNFGV QJPG 5VGORGNUEJPGKFGTUKIPCVWT CO PGWGP   LGFQEJPCJG\WMQTTGMVGP&TGKGEMUDCPF$9-&'XCT2#XCT2'54$XCT 80 ++



&KG GKPUEJN·IKIG (CEJNKVGTCVWT &GPMQX 2CXNQX 2GVTQX WPF 4QOCPQHH  MGPPV FKGUG #WUHÒJTWPI QJPG -TQPG PKEJV   1DGUUKEJJKGTDGKWOGKPFGPPQEJXGTNKGJGPGU'ZGORNCTJCPFGNVMCPPPKEJVOKV5KEJGTJGKVHGUVIGUVGNNVYGTFGP  #O1MVQDGTUVKHVGVG<CT(GTFKPCPF+FKGFTGKMNCUUKIG )QNF5KNDGTWPF$TQP\G /GFCKNNG$GKFGT5VKHVWPI FGU'JTGP\GKEJGPō(ÒTFGP#PURQTP\WT/GPUEJNKEJMGKVŋYWTFGFKG/GFCKNNGFKGUGOCHHKNKKGTV$KUYWTFG UKG KP WPXGT·PFGTVGT (QTO OKVFGO2QTVTCKV<CT(GTFKPCPFU XGTNKGJGP#O5GRVGODGTKP(QNIGFGU'KP OCTUEJGU FGT 5QYLGVWPKQP ÒDGTPCJO GKPG UQIGPCPPVG ō8QNMUHTQPVTGIKGTWPIŋ FKG /CEJV WPF GPVOCEJVGVG HCMVKUEJ   FGPHÒTFGPOKPFGTL·JTKIGP-ÌPKI5KOGQPTGIKGTGPFGP4GIGPVUEJCHVUTCVYQTCWHCWEJFKG/GFCKNNGXGT·PFGTVYWTFG KPFGOFKGDKUJGTKIG4ÒEMUGKVG\WT8QTFGTUGKVGYWTFG0CEJ#WUTWHWPIFGT4GRWDNKMCO5GRVGODGTYWTFG FKG -TQPGPÒDGTJÌJWPI FWTEJ GKPGP UVKNKUKGTVGP JTGPMTCP\ GTUGV\V 2GT &GMTGVFGU/KPKUVGTTCVGUXQO,WNK YWTFGFKG/GFCKNNGCDIGUEJCHHV

8383





8384

/GFCKNNGō(ÒTFGP#PURQTP\WT/GPUEJNKEJMGKVŋ=Ìåäàë „Çà Íàñúð÷åíèå êúì ×åëîâåêîëþáèå“?

CWEJō/GFCKNNGHÒT9QJNV·VKIMGKVŋIGPCPPV /QFGNN OKVFGO2QTVTCKV<CT(GTFKPCPFU+   5KNDGTPG /GFCKNNG 5KNDGTIW­   OKV 5VGORGNUEJPGKFGTUKIPCVWT 2 6'.)' CO PGWGP LGFQEJ   PCJG\WMQTTGMVGP&TGKGEMUDCPF$9-&'2#2'54$80 ++p+++



/GFCKNNGō(ÒTFKG4GVVWPIXQP/GPUEJGPNGDGPŋ=Ìåäàë „Çà Ñïàñÿâàíå Ïîãèáàþùè“? /QFGNN

OKVFGO2QTVTCKV<CT(GTFKPCPFU+ $TQP\GPG/GFCKNNG$TQP\GOKV5VGORGNUEJPGKFGTUK IPCVWT 2 6'.)' CO QTKIKPCNGP CNVGP &TGKGEMUDCPF $9-  &'  2#  2' 5H   4$80 4++



&KGFTGKMNCUUKIG )QNF5KNDGTWPF$TQP\G /GFCKNNGYWTFGCO1MVQDGTXQP<CT(GTFKPCPF+IGUVKHVGV/KV 5VKHVWPIFGU'JTGP\GKEJGPUō(ÒTFGP#PURQTP\WT/GPUEJNKEJMGKVŋKO,CJTYWTFGUKGFKGUGOCHHKNKKGTV

96


BULGARIEN

8386



8385

8386

/GFCKNNGō(ÒTFKG4GVVWPIXQP/GPUEJGPNGDGPŋ=Ìåäàë „Çà Ñïàñÿâàíå Ïîãèáàþùè“? /QFGNN

OKV FGO 2QTVTCKV <CT $QTKU +++    $TQP\GPG /GFCKNNG $TQP\G CO QTKIKPCNGP CNVGP &TGK   GEMUDCPF$9-&'2#XCT2'5H4$80 4++



0CEJ4GIKGTWPIUCPVTKVV<CT$QTKU+++\GKIVGUKGFGUUGP2QTVTCKV /QFGNN 9·JTGPFFGTUQIGPō8QNMUHTQPV TGIKGTWPIŋYWTFGFKGDKUJGTKIG4ÒEMUGKVGCP5VGNNGFGUDKUJGTKIGP<CTGPRQTVTCKVU\WT8QTFGTUGKVG /QFGNN 0CEJ #WUTWHWPI FGT 4GRWDNKM CO  5GRVGODGT  YWTFG FKG DKUJGTKIG <CTGPMTQPG FWTEJ GKPGP UVKNKUKGTVGP JTGP   MTCP\GTUGV\V /QFGNN +O&G\GODGTYWTFGFKG/GFCKNNGCDIGUEJCHHV



/GFCKNNG ō(ÒT 9KUUGPUEJCHV WPF -WPUVŋ =Ìåäàë „Çà Íàóêà è Èçêóñòâî“?  /QFGNN OKV FGO   ·NVGTGP2QTVTCKV<CT(GTFKPCPFU+WPFFGT<CTGPMTQPGCNUªDGTJÌJWPI 5KNDGTPG/GFCKNNG 5KNDGT CO QTKIKPCNGP CNVGP &TGKGEMUDCPF $9-  &'  2#  2' 5HH 4$    80 4++



.CWV2GVTQX KP2'5 YWTFGFKG5KNDGTPG/GFCKNNGXQP<CT(GTFKPCPF+XQPDKUPWTOCNXGTNKGJGP GTJKGNVFKG/GFCKNNGFCU·NVGTG2QTVTCKVFGUPWPOGJTKIGP<CTGP(GTFKPCPFWPFCNUªDGTJÌJWPIFKGDWNICTKUEJG <CTGPMTQPG /QFGNN 

8387



/GFCKNNG ō(ÒT 9KUUGPUEJCHV WPF -WPUVŋ =Ìåäàë „Çà Íàóêà è Èçêóñòâî“?  /QFGNN OKV FGO   2QTVTCKV<CT$QTKU+++WPFFGT<CTGPMTQPGCNUªDGTJÌJWPI 5KNDGTPG/GFCKNNG5KNDGTCO QTKIKPCNGP CNVGP &TGKGEMUDCPF KO QTKIKPCNGP 8GTNGKJWPIUGVWK FGT 4GIGPVUEJCHVU\GKV   OKV   IQNFHCTDGPGT<CTGPMTQPG$9-&'2#2'5HH4$80 4++



.CWV2GVTQX KP2'5 YWTFGFKG5KNDGTPG/GFCKNNGXQP<CT$QTKU+++XQPDKUPWTOCNXGTNKGJGP 0CEJFGOÒDGTTCUEJGPFGP6QF<CT$QTKU+++CO#WIWUVKUVFKG/GFCKNNGY·JTGPFFGT4GIGPVUEJCHVHÒTFGP OKPFGTL·JTKIGP -ÌPKI 5KOGQP DKU \WO  5GRVGODGT  PQEJ KP GKPKIGP 'ZGORNCTGP YGKVGTXGTNKGJGP YQTFGP   #NNGTFKPIU \GKIGP FKG 'VWKU FKGUGT MWT\GP 2GTKQFG PKEJV OGJT FCU /QPQITCOO <CT $QTKU +++ UQPFGTP YKG CNNG   8GTNGKJWPIUGVWKUFKGUGT<GKVPWTFKG<CTGPMTQPG IGIGDGPGPHCNNUOKV$G\GKEJPWPI   9·JTGPF FGT UQIGP ō8QNMUHTQPVTGIKGTWPIŋ UEJGKPV FKG /GFCKNNG PKEJV XGTNKGJGP YQTFGP \W UGKP +P (QNIG FGT   #WUTWHWPI FGT 4GRWDNKM CO  5GRVGODGT  YWTFG  FKG /GFCKNNG KP )QNF CDIGUEJCHHV WPF GKPG 5VWHG KP   $TQP\GGKPIGHÒJTV&CU<CTGPRQTVTCKVGPVHKGNWPFFKGDKUJGTKIG4ÒEMUGKVGMCOPCEJXQTPGWPFFKG<CTGPMTQPGYWTFG FWTEJGKPGPUVKNKUKGTVGPJTGPMTCP\GTUGV\V /QFGNN &WTEJGKP&GMTGVFGT8QNMUXGTUCOONWPIXQO&G\GODGT YWTFGFKG/GFCKNNGCDIGUEJCHHV



/GFCKNNGō(ÒT9KUUGPUEJCHVWPF-WPUVŋ=Ìåäàë „Çà Íàóêà è Èçêóñòâî“? .GGTGU8GTNGKJWPIUGVWK HÒT FKG /GFCKNNG CWU FGT <GKV FGT 4GIGPVUEJCHV HÒT -ÌPKI5KOGQP\YKUEJGPFGO#WIWUVWPF FGO5GRVGODGT 4++

 97


BULGARIEN

8389



'JTGP\GKEJGPō(ÒTNCPIGP&KGPUVKPFGT$WNICTKUEJGP#TOGGŋ=Ñíàê „Çà Ïðîñëóæåíè Ãîäèíè â Áúëãàðñêàòà Âîéñêà“? /QFGNN OKV/QPQITCO(GTFKPCPFU+ 'JTGP\GKEJGPHÒT :: &KGPUVLCJTG FGT 1HHK\KGTG 5KNDGT VNY XGTIQNFGV GOCKNNKGTV OKP #DURNKVVGTWPIGP KP FGT ITÒPGP   'OCKNNG FGU .QTDGGTMTCP\GU COQTKIKPCNGPCNVGP&TGKGEMUDCPF$9-&'2# 2'5HH4$80 ++



(ÒTUV(GTFKPCPF+UVKHVGVGOKV7MCU0TXQO#WIWUVFKG\YGKUVWHKIG KP5KNDGTHÒT1HHK\KGTGWPFKP$TQP\G HÒT7PVGTQHHK\KGTG #WU\GKEJPWPIHÒT&KGPUVLCJTGKPFGT$WNICTKUEJGP#TOGGFKGCO6CIFGT5VKHVWPI\WOGTUVGP OCNXGTNKGJGPYWTFGYWTFGFKG&KGPUVCWU\GKEJPWPIHÒT1HHK\KGTGHÒT&KGPUVLCJTGGKPIGHÒJTV

8390











8391

8394

'JTGP\GKEJGPō(ÒTNCPIGP&KGPUVKPFGT$WNICTKUEJGP#TOGGŋ=Ñíàê „Çà Ïðîñëóæåíè Ãîäèíè â Áúëãàðñêàòà Âîéñêà“? /QFGNN OKV/QPQITCO(GTFKPCPFU+ 'JTGP\GKEJGPHÒT :: &KGPUVLCJTG FGT 1HHK\KGTG 5KNDGT VNY XGTIQNFGV GOCKNNKGTV 'OCKNNGEJKR CWH FGT 8QTFGTUGKVG FGU   TGEJVGP -TGW\CTOU CO CNVGP &TGKGEMUDCPF KO QTKIKPCNGP 8GTNGKJWPIUGVWK OKV FGO HÒTUVNKEJGP /QPQ   ITCOO(ÒTUV(GTFKPCPFU+$9-&'2#2'5HH4$80 ++



'JTGP\GKEJGPō(ÒTNCPIGP&KGPUVKPFGT$WNICTKUEJGP#TOGGŋ=Ñíàê „Çà Ïðîñëóæåíè Ãîäèíè â Áúëãàðñêàòà Âîéñêà“? /QFGNN OKV/QPQITCO(GTFKPCPFU+ 'JTGP\GKEJGPHÒT : &KGPUVLCJTG FGT 1HHK\KGTG 5KNDGT CO QTKIKPCNGP &TGKGEMUDCPF $9-  &'  2#    2'5HH4$80 ++



'JTGP\GKEJGPō(ÒTNCPIGP&KGPUVKPFGT$WNICTKUEJGP#TOGGŋ=Ñíàê „Çà Ïðîñëóæåíè Ãîäèíè â Áúëãàðñêàòà Âîéñêà“? /QFGNN OKV/QPQITCO(GTFKPCPFU+ 'JTGP\GKEJGPHÒT : &KGPUVLCJTG FGT 1HHK\KGTG 5KNDGT CO QTKIKPCNGP &TGKGEMUDCPF $9-  &'  2#    2'5HH4$80 ++



'JTGP\GKEJGPō(ÒTNCPIGP&KGPUVKPFGT$WNICTKUEJGP#TOGGŋ=Ñíàê „Çà Ïðîñëóæåíè Ãîäèíè â Áúëãàðñêàòà Âîéñêà“? /QFGNN OKV/QPQITCO(GTFKPCPFU+ 'JTGP\GKEJGPHÒT : &KGPUVLCJTG FGT 7PVGTQHHK\KGTG WPF /CPPUEJCHVGP $TQP\G XGTIQNFGV CO QTKIKPCNGP &TGKGEMUDCPF   $9-&'2#2'5HH4$80 ++



'JTGP\GKEJGPō(ÒTNCPIGP&KGPUVKPFGT$WNICTKUEJGP#TOGGŋ=Ñíàê „Çà Ïðîñëóæåíè Ãîäèíè â Áúëãàðñêàòà Âîéñêà“?/QFGNN OKV/QPQITCOO<CT$QTKU+++ 'JTGP\GKEJGPHÒT:: &KGPUVLCJTGFGT1HHK\KGTG5KNDGTXGTIQNFGVWPFGOCKNNKGTVCOQTKIKPCNGPCNVGP&TGKGEMUDCPF$9- &'2#2'5HH4$80 ++



0CEJ 4GIKGTWPIUCPVTKVV <CT $QTKU +++ KO ,CJT  YWTFG FGUUGP /QPQITCOO CWH FGT 8QTFGTUGKVG CP 5VGNNG FGU   DKUJGTKIGP /QPQITCOOU (GTFKPCPFU + CPIGDTCEJV WPF DGK FGP #WU\GKEJPWPIGP HÒT  &KGPUVLCJTG GPVHKGN FGT   5CEJUGPUEJKNFCWHFGT$TWUVFGUDWNICTKUEJGP.ÌYGP /QFGNN CWU#PNC­UGKPGU\GJPL·JTKIGP6JTQPLWDKN· WOUGTJKGNV<CT$QTKU+++XQPFGTDWNICTKUEJGP#TOGGGKPGDGUQPFGTG&KGPUVCWU\GKEJPWPIKP(QTOGKPGUCEJVUVTCJ NKIGP$TWUVUVGTPUGDGPUQCWU#PNC­UGKPGU\YCP\KIL·JTKIGP6JTQPLWDKN·WOUYWTFGGKPG&KGPUVCWU\GKEJ PWPIHÒT7PVGTQHHK\KGTGHÒT,CJTGGKPIGHÒJTV  PCEJFGT/CEJVÒDGTPCJOGFGTUQIGPō8QNMUHTQPVTGIKGTWPIŋDGJKGNVFKG#WU\GKEJPWPIKJT#WUUGJGPDGKPWT FCU$CPFYWTFGFWTEJFCU$CPFFGU1TFGPUō(ÒT$ÒTIGTNKEJGU8GTFKGPUVŋGTUGV\V  0CEJFGOCO5GRVGODGTFKG4GRWDNKMCWUIGTWHGPYQTFGPYCTYWTFGFCU/QPQITCOOCWHFGT8QTFGTUGKVG FWTEJ FGP WPIGMTÌPVGP DWNICTKUEJGP .ÌYGP GTUGV\V WPF FCU 4ÒEMUGKVGPOGFCKNNQP \GKIVG FKG #P\CJN FGT &KGPUVLCJTG   ō:ŋQFGTō::ŋ,CJTG/KVVGYWTFGFKG#WU\GKEJPWPIō(ÒT.CPIGP&KGPUVKPFGT$WNICTKUEJGP#TOGGŋFWTEJ $GUEJNW­FGU/KPKUVGTTCVGUCDIGUEJCHHV

98


BULGARIEN

8400 8396





8398

8402 8401

'JTGP\GKEJGPō(ÒTNCPIGP&KGPUVKPFGT$WNICTKUEJGP#TOGGŋ=Ñíàê „Çà Ïðîñëóæåíè Ãîäèíè â Áúëãàðñêàòà Âîéñêà“? /QFGNN OKV/QPQITCOO<CT$QTKU+++ 'JTGP\GKEJGPHÒT: &KGPUVLCJTGFGT1HHK\KGTG$TQP\GXGTUKNDGTVCOQTKIKPCNGP&TGKGEMUDCPF$9-&'2# 2'5HH4$80 ++



'JTGP\GKEJGPō(ÒTNCPIGP&KGPUVKPFGT$WNICTKUEJGP#TOGGŋ=Ñíàê „Çà Ïðîñëóæåíè Ãîäèíè â Áúëãàðñêàòà Âîéñêà“?/QFGNN OKV/QPQITCOO<CT$QTKU+++ 'JTGP\GKEJGPHÒT:: &KGPUVLCJTGFGT7PVGTQHHK\KGTGWPF/CPPUEJCHVGP$TQP\GXGTIQNFGVCOQTKIKPCNGPCNVGP&TGKGEMUDCPF $9-&'2#2'5HH4$80 4++



YWTFGFKG&KGPUVCWU\GKEJPWPIHÒT7PVGTQHHK\KGTGHÒT,CJTGGKPIGHÒJTV





'JTGP\GKEJGPō(ÒTNCPIGP&KGPUVKPFGT$WNICTKUEJGP#TOGGŋ=Ñíàê „Çà Ïðîñëóæåíè Ãîäèíè â Áúëãàðñêàòà Âîéñêà“? /QFGNN OKV/QPQITCOO<CT$QTKU+++ 'JTGP\GKEJGPHÒT: &KGPUVLCJTG FGT 7PVGTQHHK\KGTG WPF /CPPUEJCHVGP $TQP\G XGTIQNFGV CO QTKIKPCNGP &TGKGEMUDCPF   $9-&'2#2'5HH4$80 ++



'JTGP\GKEJGP ō4QVGU -TGW\ŋ =ÏQ÷Gòíè ÇíCê „×GïâGí KðúEò“?  /QFGNN \YGKMNCUUKI OKV TQVGO   -TGW\CWHYGK­GO)TWPF 'JTGP\GKEJGP+-NCUUG#WUHÒJTWPIHÒT*GTTGP$TQP\GXGTIQN FGVVNYGOCKNNKGTVCP0CFGN$9-&'2'5HH4$#6# ++



)GUVKHVGV XQP (ÒTUV #NGZCPFGT + OKV HÒTUVNKEJGO 4GUMTKRV XQO  #RTKN   /QFGNN  CNU #WU\GKEJPWPI HÒT   8GTYWPFGVGPJKNHGKO-TKGINKG­GU(ÒTUV(GTFKPCPF+PGWIGUVCNVGP /QFGNN   #O#RTKNYWTFGFCU'JTGP\GKEJGPVKGHITGKHGPFXGT·PFGTV /QFGNN 8QPFKGUGO<GKVRWPMVMQPPVGGUCWEJ HÒT 4QV-TGW\#MVKXKV·VGP KP (TKGFGPU\GKVGP XGTNKGJGP YGTFGP &CU 'JTGP\GKEJGP PWPOGJT CNU 'JTGP\GKEJGP +   -NCUUG GTJKGNV GKPG PGWG )GUVCNVWPI WPF GKP 'JTGP\GKEJGP ++ -NCUUG  #WUHÒJTWPI  YWTFG IGUVKHVGV <W GKPGO   DKUJGT WPDGMCPPVGP <GKVRWPMV YQJN Y·JTGPF FGT 4GIKGTWPI <CT $QTKU +++ GTJKGNV FCU 'JTGP\GKEJGP ++ -NCUUG UVCVV   FGT DKUJGTKIGP JGTCNFKUEJGP -ÌPKIUMTQPG FKG UQIGPCPPVG ōGEMKIG <CTGPMTQPGŋ  KUV GKPG UQNEJG 8GT·PFGTWPI   CWEJHÒTFKG+-NCUUGRTQLGMVKGTVYQTFGPYCUCDGTPKG\WT#WUHÒJTWPIIGMQOOGPKUV&CU'JTGP\GKEJGPYWTFGDKU \WO 'PFG FGT /QPCTEJKG XGTNKGJGP (TCWGP VTWIGP FKG +PUKIPKGP OKV GKPGT $CPFUEJNGKHG /·PPGT CNU 5VGEMFGMQTC   VKQP







'JTGP\GKEJGP ō4QVGU -TGW\ŋ =ÏQ÷Gòíè ÇíCê „×GïâGí KðúEò“?  /QFGNN \YGKMNCUUKI OKV TQVGO   -TGW\CWHYGK­GO)TWPF 'JTGP\GKEJGP+-NCUUG#WUHÒJTWPIHÒT*GTTGP$TQP\GXGTIQN FGVVNYGOCKNNKGTVCP0CFGN$9-&'2'5HH4$#6# ++



'JTGP\GKEJGP ō4QVGU -TGW\ŋ =ÏQ÷Gòíè ÇíCê „×GïâGí KðúEò“?  /QFGNN \YGKMNCUUKI OKV TQVGO   -TGW\ CWH YGK­GO )TWPF    'JTGP\GKEJGP ++ -NCUUG  #WUICDG OKV IGHÒVVGTVGT JGTCNFK   UEJGT-TQPG! #WUHÒJTWPIHÒT*GTTGP5KNDGTXGTIQNFGVVNYGOCKNNKGTVCP0CFGN$9- &'NK-ª2'5HH4$XCT ++



#WU\GKEJPWPI ō(ÒT 8GTFKGPUVG ņ 4QVGU -TGW\ŋ =HCãðCäGí ÇíCê „ÇC ÇCEë[ãC - ×GïâGí KðúEò“?   -TGW\ + -NCUUG $TQP\G XGTIQNFGV WPF GOCKNNKGTV CO QTKIKPCNGP &TGKGEMUDCPF $9-  &'  TG   4++



)GUVKHVGVXQP<CT(GTFKPCPF+KPFTGK-NCUUGP +ņ+++-NCUUG WPFDKU\WO'PFGFGT/QPCTEJKGKP$WNICTKGP XGTNKGJGP



/GFCKNNGō4QVGU-TGW\ŋ=MGäCë „×GïâGí KðúEò“? /QFGNN OKVFGT,CJTGU\CJNōŋWPFQJPG 'OCKNNG CWH FGT 8QTFGTUGKVG    5KNDGTPG /GFCKNNG $TQP\G XGTUKNDGTV CO QTKIKPCNGP CNVGP   &TGKGEMUDCPF$9-&'2#2'5H4$80# ++



)GUVKHVGV XQP <CT (GTFKPCPF + OKV 7MCU 0T  XQO  (GDTWCT  KP \YGK -NCUUGP 5KNDGT WPF $TQP\G     PCJO<CT$QTKUGKPKIG8GT·PFGTWPIGPXQTUKGXGTHÒIVGPWPOGJTÒDGTGKPG)QNFWPFGKPG5KNDGTMNCUUGCWHFGT8QT FGTUGKVGGPVHKGNFKG,CJTGU\CJNōŋWPFFCU/KVVGNOGFCKNNQPYCTLGV\VGOCKNNKGTV

99


BULGARIEN

8404



8403

8405

'JTGP\GKEJGP ō<CTKP 'NGQPQTGŋ =ÏQ÷Gòíè ÇíCê „ÖCðèíà Åëåîíîðà“?  /QFGNN OKV FGP ,CJTGU   \CJNGP     #WUHÒJTWPI HÒT *GTTGP 5KNDGT VNY GOCKNNKGTV CWH FGT 4ÒEMUGKVG RWP\KGTV   COPGWGP$CPF$9-&'4$ ++



&CU GKPMNCUUKIG 'JTGP\GKEJGP HÒT 8GTFKGPUVG WO FCU 4QVG -TGW\ Y·JTGPF FGT $CNMCPMTKGIG YWTFG XQP <CT (GTFK   PCPF+CO#WIWUVIGUVKHVGV /QFGNN 0CEJ'KPVTKVV$WNICTKGPUKPFGP'TUVGP9GNVMTKGIYWTFGFCU'JTGP \GKEJGPXQP<CT(GTFKPCPFGTPGWGTVWPFDKUXGTNKGJGP /QFGNN 



-TGW\ HÒT -TKGIUJKNHUFKGPUVG FGU $WNICTKUEJGP 4QVGP -TGW\GU #WUHÒJTWPI OKV -TQPG WPF HÒT   &COGP$TQP\GXGTUKNDGTVGOCKNNKGTVCP0CFGN$9-XCT4$ ++



&CU-TGW\YWTFGXQP<CT(GTFKPCPF+IGUVKHVGVWPFDKUXGTNKGJGP



'JTGP\GKEJGP FGT 2TKP\GUUKP 'WFQZKC HÒT FCU $WNICTKUEJG 4QVG -TGW\ 5KNDGT VNY GOCKNNKGTV CWH   FGT 4ÒEMUGKVG *GTUVGNNGTDG\GKEJPWPI ō6*ŋ GKPGT FGWVUEJGP (KTOC WPF ,CJTGU\CJN ōŋ QJPG $CPF   $'< ++



8406 8407



7PDGMCPPVGU 'JTGP\GKEJGP (ÒT RJKNCPVJTQRKUEJG 8GTFKGPUVG 5VGEMMTGW\  Z  OO 5KNDGT   XGTIQNFGVWPFGOCKNNKGTVCWHFGT4ÒEMUGKVG*GTUVGNNGTDG\GKEJPWPIFGT(KTOC,)QFGV5QJPKP$GTNKP CP0CFGN 444++



6TQV\ KPVGPUKXGT (QTUEJWPIUDGOÒJWPIGP YCTGP P·JGTG +PHQTOCVKQPGP ÒDGT FKGUGU 'JTGP\GKEJGP PKEJV \W GTJCNVGP   &GT <WUCOOGPJCPI OKV FGO -ÌPKITGKEJ $WNICTKGP KUV VTQV\ FGT HTCP\ÌUKUEJURTCEJKIGP /GFCKNNQPKPUEJTKHV FWTEJ FKG   GKPFGWVKIKFGPVKHK\KGTDCTGUQIGPōGEMKIGŋ<CTGPMTQPGIGIGDGP#WHITWPFFGTSWCNKVCVKXJQEJYGTVKIGP#PHGTVKIWPIU SWCNKV·V FGTQDGTG-TGW\CTOOKVFGT-TQPGKUVCWUGKPGO5VÒEMIGHGTVKIV JCPFGNVGUUKEJJKGTDGKMGKPGUHCNNUWOGKPG CWU6GKNGPXGTUEJKGFGPGT*GTMWPHV\WUCOOGPIGHÒIVGPō$CUVGNCTDGKVŋ



'TKPPGTWPIUOGFCKNNG ō(ÒT FKG 7PCDJ·PIKIMGKV $WNICTKGPU ŋ =Âúçïîìåíàòåëåí Ìåäàë „ÇC   *GçCâèEèìQEòòC ÁúëãCðèC 1908 ãQäèíC“? #WUHÒJTWPIOKVJQTK\QPVCNGP-TQPGPCWHFGP-TGW\CTOGP $TQP\GCOQTKIKPCNGP&TGKGEMUDCPF$9-&'2#2'5H4$80 ++ 7PVGT #WUPWV\WPI XQP /CEJVM·ORHGP \YKUEJGP FGP GWTQR·KUEJGP )TQ­O·EJVGP IGNCPI GU (ÒTUV (GTFKPCPF + OKV   VCVMT·HVKIGT7PVGTUVÒV\WPI4W­NCPFUCO5GRVGODGTKPFGTOKVVGNCNVGTNKEJGPDWNICTKUEJGP*CWRVUVCFV9GNKMQ 6CTPQXQ FKG XQNNUV·PFKIG 7PCDJ·PIKIMGKV UGKPGU .CPFGU XQO 1UOCPKUEJGP 4GKEJ \W RTQMNCOKGTGP WPF UKEJ UGNDUV   \WO -ÌPKI ō<CTŋ  \W -TÌPGP YQFWTEJ $WNICTKGP \WO -ÌPKITGKEJ YWTFG &KG 'TKPPGTWPIUOGFCKNNG HÒT FKGUGP   #PNC­KP(QTOGKPGU-TGW\GUYWTFGKPFGTGTUVGP,CJTGUJ·NHVGXQPFGT:+88QNMUXGTUCOONWPIIGUVKHVGVWPF CP 8GVGTCPGP 1HHK\KGTG WPF $GCOVG FKG DGK FGP (GKGTNKEJMGKVGP CPYGUGPF IGYGUGP YCTGP XGTNKGJGP 5KG YCT XQP   FGT(KTOC2CWN6GNIGKP$GTNKPJGTIGUVGNNVYQTFGP

100




BULGARIEN

8408



8409

,WDKN·WOUOGFCKNNG ō ,CJTG 4GIKGTWPI XQP (GTFKPCPF +ŋ =ÞáèëGGí Ìåäàë „25 ÃQäèíè   ÖCð[âCíG íC ÔGðäèíCíä +“? )QNFGPG /GFCKNNG $TQP\G XGTIQNFGV OKV 5VGORGNUEJPGKFGTUKIPCVWT    ō/#45%*#.. ('%ŋ CO QTKIKPCNGP &TGKGEMUDCPF $9-  &'  2#  2' 5H   4$80 44++  .CWV2GVTQX KP2'5 YWTFGFKG)QNFGPG/GFCKNNGPWTOCNXGTNKGJGP  DGIKPI(GTFKPCPFUGKPL·JTKIGU6JTQPLWDKN·WO#WUFKGUGO#PNC­UVKHVGVGGTOKV7MCUXQO#WIWUV FKGUG/GFCKNNG5KGYWTFGXQP4WFQNH/CTUEJCNNGPVYQTHGPKP9KGPJGTIGUVGNNVWPFXQO<CTGPRGTUÌPNKEJCP2GTUQ PGPUGKPGUFKTGMVGP7OHGNFGUCP/KPKUVGT)GPGT·NGWPF1HHK\KGTGCWEJPCEJUGKPGT#DFCPMWPIXGTNKGJGP



'TKPPGTWPIUOGFCKNNG ō+P &KGUGO <GKEJGP YGTFGV +JT UKGIGPŋ =Âúçïîìåíàòåëåí Ìåäàë „% òQçè   %èìáQë ùG ïQáGäèø"? $TQP\GPG /GFCKNNG FWPMNG $TQP\G CO QTKIKPCNGP &TGKGEMUDCPF $9-    2#4$XCT ++



DKNFGVGP$WNICTKGPWPF5GTDKGPWPVGTFGO2CVTQPCV4WUUNCPFUFGP$CNMCPDWPFFGOUKEJPQEJKOINGKEJGP,CJT CWEJ )TKGEJGPNCPF WPF /QPVGPGITQ CPUEJNQUUGP &COKV TKEJVGVG UKEJ FGT $WPF PKEJV OGJT PWT IGIGP ¤UVGTTGKEJ   7PICTPUQPFGTPCWEJIGIGPFCU1UOCPKUEJG4GKEJ<KGNFGU$WPFGUYCTFKG$GHTGKWPIFGU$CNMCPUUQYQJNXQPFGP 6ÒTMGPCNUCWEJFKG<WTÒEMFT·PIWPIFGT¤UVGTTGKEJGT#O1MVQDGTGTMN·TVG/QPVGPGITQFGO1UOCPKUEJGP 4GKEJ FGP -TKGI YQTCWH FKGUGU CO  $WNICTKGP FGP -TKGI GTMN·TVG #O  1MVQDGT GTMN·TVGP $WNICTKGP )TKG   EJGPNCPFWPF5GTDKGPIGOGKPUCOFGO1UOCPKUEJGP4GKEJFGP-TKGI&KGCO1MVQDGTFWTEJFCU1UOCPK UEJG4GKEJGTHQNIVG-TKGIUGTMN·TWPICP$WNICTKGPYWTFGXQPFGP8ÌNMGTPFGU$CNMCPUCNUKUNCOKUEJGT#PITKHHIGIGP FKG EJTKUVNKEJQTVJQFQZGP 8ÌNMGT XGTUVCPFGP FGT CWEJ KO 0COGP FGT EJTKUVNKEJGP 4GNKIKQP \W DGIGIPGP YCT <WO   #PURQTP FKGUGU )GFCPMGPU YWTFG FKGUG /GFCKNNG CWUIGIGDGP FKG KP $TQP\G XGTNKGJGP YWTFG 0WT <CT (GTFKPCPF   GTJKGNVGKP'ZGORNCTKP)QNF

8413 8410



8411

8412

'TKPPGTWPIUOGFCKNNGō(ÒTFGP-TKGIFGUDGHTGWPFGVGP$CNMCPUHÒTFKG(TGKJGKVXQP/C\GFQPKGPŋ =Âúçïîìåíàòåëåí Ìåäàë „ÇC $QéíCòC íC $CëêCíêèòG ÄúðæCâè çC %âQáQäCòC íC /CêGäQíèCC"?ŋ 5KNDGTPG/GFCKNNG$TQP\GXGTUKNDGTVCOPGWGP$CPF&'2# ++p+++



#NU-TKGIU\KGNFGHKPKGTVGPFKGXKGT5VCCVGPFGU$CNMCPDWPFGU $WNICTKGP)TKGEJGPNCPF/QPVGPGITQWPF5GTDKGP FKG $GHTGKWPI /C\GFQPKGPU XQP FGT QUOCPKUEJGP *GTTUEJCHV WPF FKG #WHVGKNWPI FGU )GDKGVGU WPVGT UKEJ YQTCWH FKGUG   'TKPPGTWPIUOGFCKNNGJKPYGKUV/KVFGO9CHHGPUVKNNUVCPF\YKUEJGPFGP-TKGIUVGKNPGJOGTPXQO/CKFGOCO /CKFGT8GTVTCIXQP.QPFQPHQNIVGHCPFFGT'TUVG$CNMCPMTKGIUGKP'PFG



'TKPPGTWPIUOGFCKNNGō-QOOCPFGWTGKO$CNMCP-TKGIŋ=Âúçïîìåíàòåëåí Ìåäàë „ÏúëêQâQäöè Qò ÁCëêCíêCòC $QéíC"?



'KPG)GFGPMOGFCKNNGCWH<CT(GTFKPCPF+WPFUGKPG$GHGJNUJCDGTY·JTGPFFGU'TUVGP$CNMCPMTKGIGUFKG )GPGT·NG5CXQX(KEJGX&KOKVTKGX+XCPQX-QXCEJGX6QFQTQXWPF-WVKPEJGX



'TKPPGTWPIUOGFCKNNG ō0GWPVG &KXKUKQPŋ =Âúçïîìåíàòåëåí Ìåäàë „ÄGâGòC Äèâèçèÿ"? #NWOKPKWO COPGWGP$CPF2# ++p



&KG DWNICTKUEJG  &KXKUKQP GT\KGNVG Y·JTGPF FGU 'TUVGP 9GNVMTKGIGU ITQ­G OKNKV·TKUEJG 'THQNIG YQHÒT FKGUG /G   FCKNNGCWUIGIGDGPYWTFG



'TKPPGTWPIUOGFCKNNG CWH FKG #NGZCPFGT0GYUM[-CVJGFTCNG KP 5QHKC &CVKGTV  ++  WPF    +:-QPXQNWVXQPFTGK/GFCKNNGP -NGKPG5KNDGTPG/GFCKNNG$TQP\GXGTUKNDGTVQJPG$CPF  -NGKPG $TQP\GPG /GFCKNNG $TQP\G QJPG $CPF   )TQ­G PKEJV VTCIDCTG $TQP\GOGFCKNNG $TQP\G   &WTEJOGUUGTOO 5VÒEM++



&GT)TWPFUVGKP\WT#NGZCPFGT0GYUM[-CVJGFTCNGYWTFGIGNGIV5KGYWTFGKP'TKPPGTWPICP<CT#NGZCPFGT++ XQP4W­NCPFWPFCPFKGHÒTFKG$GHTGKWPI$WNICTKGPUXQOQUOCPKUEJGP,QEJIGHCNNGPGPTWUUKUEJGP5QNFCVGP \W 'JTGP FGU TWUUKUEJGP 0CVKQPCNJGNFGP WPF ņJGKNKIGP )TQ­HÒTUV 5V #NGZCPFGT 0GYUM[ EC   DGPCPPV   &GT $CW YWTFG KO 9GUGPVNKEJGP \YKUEJGP  WPF  CWUIGHÒJTV 5KG KUV 5KV\ FGU 2CVTKCTEJGP XQP 5QHKC FGU   1DGTJCWRVUFGT$WNICTKUEJ1TVJQFQZGP-KTEJGWPF9CJT\GKEJGPFGTDWNICTKUEJGP*CWRVUVCFV

101


BULGARIEN

8414

8420 8419



'TKPPGTWPIUOGFCKNNG ō<WT 8GTGJGNKEJWPI XQP <CT $QTKU +++ WPF 2TKP\GUUKP ,QJCPPCŋ   =Âúçïîìåíàòåëåí Ìåäàë „ÇC ÁðCêQEú÷GòCíèGòQ íC ÖCð ÁQðèE +++ è ÏðèíöGEa ÉQCííC"?)QNFGPG 'TKPPGTWPIUOGFCKNNG5KNDGTXGTIQNFGVQJPG$CPF&'4$ ++



#O1MVQDGTJGKTCVGVG<CT$QTKU+++XQP$WNICTKGP  KP#UUKUK2TKP\GUUKP)KQXCPPCXQP+VCNKGP

  6QEJVGT -ÌPKI 8KMVQT 'OCPWGNU +++ XQP +VCNKGP   &KG *QEJ\GKV YCT XQO UGKPGT\GKVKIGP   #RQUVQNKUEJGP8KUKVCVQTKP$WNICTKGP#PIGNQ4QPECNNK FGOUR·VGTGP2CRUV,QJCPPGU::+++ XGTOKVVGNVYQTFGP5KG JCVVGP \YGK -KPFGT -TQPRTKP\ 5KOGQP WPF 2TKP\GUUKP /CTKG .QWKUG #WU #PNC­ FGT *QEJ\GKV YWTFG FKG /GFCKNNG   CWUIGIGDGP



'TKPPGTWPIUOGFCKNNGHÒTFKG-TKGIGWPF=Âúçïîìåíàòåëåí Ìåäàë çC $QéíèòG 1912-1913 ã. è 1915-1918 ã.? -QPXQNWV XQP FTGK 'TKPPGTWPIUOGFCKNNGP HÒT FKG -TKGIG    $TQP\G XGTUKNDGTV CP FGP QTKIKPCNGP &TGKGEMUD·PFGTP HÒT/KNKV·TCPIGJÌTKIG<KXKNKUVGPWPF*KPVGTDNKG DGPGLGYGKNUOKV/KPKCVWTOGFCKNNGPGDGPHCNNUCPFGP&TGKGEMUD·PFEJGPHÒT/KNKV·TCPIGJÌTKIG<KXKNKUVGP WPF*KPVGTDNKGDGPGWPFFTGK'TKPPGTWPIUOGFCKNNGPHÒTFGP-TKGI$TQP\GXGTIQNFGVCPFGP QTKIKPCNGP&TGKGEMUD·PFGTPHÒT/KNKV·TCPIGJÌTKIG<KXKNKUVGPWPF*KPVGTDNKGDGPGFC\WGKPG/KPKCVWTOG FCKNNG CO &TGKGEMUD·PFEJGP HÒT /KNKV·TCPIGJÌTKIG $9-  &'  2#    2'5HH4$$80 5VÒEM++



0CEJFGOUQYQJNFKGDGKFGP$CNMCPMTKGIGWPFYKGCWEJFGT'TUVG9GNVMTKGIXQP$WNICTKGPXGTNQTGP YWTFGP YWTFG MGKPG -TKGIUGTKPPGTWPIUOGFCKNNGP IGUVKHVGV WPF CWUIGIGDGP <CT $QTKU +++ UVKHVGVG DGKFG /GFCKNNGP   \WUCOOGP GTUV OKV 7MCU 0T  XQO  &G\GODGT  &KG /GFCKNNG ō(ÒT FGP -TKGI ŋ YWTFG CP FKG   DWNICTKUEJGP 6GKNPGJOGT FGU 'TUVGP WPF <YGKVGP $CNMCPMTKGIGU FKG /GFCKNNG ō(ÒT FGP -TKGI ŋ CP CNNG   -TKGIUVGKNPGJOGT$WNICTKGPUWPFFGTXGTDÒPFGVGP/·EJVGXGTNKGJGPFKGY·JTGPFFGU-TKGIGUCWHFGODWNICTKUEJGP -TKGIUUEJCWRNCV\GKPIGUGV\VYCTGP/KNKV·TCPIGJÌTKIGGTJKGNVGPGTUVGTGCPGKPGOITÒPGP&TGKGEMUDTCPFOKVYGK­TQV YGK­GP4CPFUVTGKHGPWPFNGV\VGTGCPGKPGOTQVGP&TGKGEMUDCPFOKVUEJOCNGPYGK­ITÒPYGK­GP4CPFUVTGKHGP<KXKNK UVGPCOLGYGKNUINGKEJGP$CPFOKVGKPGO\WU·V\NKEJGPYGK­GP/KVVGNUVTGKHGPWPF*KPVGTDNKGDGPGCOLGYGKNUINGKEJGP $CPF OKV GKPGO \WU·V\NKEJGP UEJYCT\GP /KVVGNUVTGKHGP &KG /GFCKNNGP YWTFGP XQP OGJTGTGP (KTOGP JGTIGUVGNNV UQ   WCXQP)GDTÒFGT)NQGTHGNFWPFXQP5VGKPJCWGT.ÒEMDGKFGKP.ÒFGPUEJGKF1VVQ5EJKEMNGKP2HQT\JGKO*WIW GPKP (T½TGU KP .G .QENG 5EJYGK\  WPF $GFL -GTGUVGFLKGX KP 5QHKC .CWV 2CXNQX KP 2# 5   YCTGP FKG KP   &GWVUEJNCPFJGTIGUVGNNVGP'ZGORNCTGWOFKGOOFKEMFKGKPFGT5EJYGK\IGHGTVKIVGPLGFQEJOOFKEM&KG 8GTNGKJWPIGPFGT/GFCKNNGPYWTFGP\WO&G\GODGTCDIGUEJNQUUGP







-QPXQNWVXQPVTCIDCTGPWPFPKEJVVTCIDCTGP/GFCKNNGP#WU(ÒTUVGPVWO<CTGPVWO8QNMUTGRW DNKMWPF'ZKNKPXGTUEJKGFGPGP/GVCNNGPWPFOKVWPVGTUEJKGFNKEJGP&WTEJOGUUGTPKPWPVGTUEJKGFNKEJGP 'TJCNVWPIGPVNYCP$·PFGTP 5VÒEM++++++8



-QPXQNWV1TFGPUD·PFGTXQPDWNICTKUEJGP1TFGPWPF'JTGP\GKEJGP&CTWPVGTGKPMQPXGMTKQPKGTVGU *CNUDCPF  &TGKGEMUD·PFGT WPF  $CPFCDUEJPKVVG KP XGTUEJKGFGPGP .·PIGP KP WPVGTUEJKGFNKEJGP   'TJCNVWPIGP 5VÒEM++



-QPXQNWVXQPFTGKDWNICTKUEJGP'JTGP\GKEJGP&C\WHÒPHNGGTGPKEJVDWNICTKUEJG'VWKU



5VÒEM++

$7.)#4+5%*'81.-5(41064')+'470)   

1TFGP ō(ÒT6CRHGTMGKVŌ=Îðäåí „Çà Õðàáðîñò“? /QFGNN OKVUGEJU\CEMKIGO5VGTPOKV\YGK.K PKGPCWHFGO/GFCKNNQPTKPIFGT8QTFGTUGKVG.ÌYGOKV-TQPG -TGW\+8-NCUUG5VWHG #WUHÒJTWPI OKV MNGKPGO .ÌYGP $TQP\G XGTUKNDGTV WPF GOCKNNKGTV CP 0CFGN $-  $   $9-&'-.'2#2'5HH4$80<- ++



#O5GRVGODGTKP(QNIGFGU'KPOCTUEJGUFGT5QYLGVWPKQPÒDGTPCJOGKPGUQIGPCPPVGō8QNMUHTQPVTGIKGTWPIŋ FKG /CEJV WPF GPVOCEJVGVG HCMVKUEJ FGP HÒT FGP OKPFGTL·JTKIGP -ÌPKI 5KOGQP UGKV  TGIKGTGPFGP 4GIGPV    UEJCHVUTCV YQTCWH CWEJ FKG +PUKIPKGP FGU 1TFGPU XGT·PFGTV YWTFGP KPFGO FKG ,CJTGU\CJN ōŋ CWH FGO    8QTFGTUGKVGPOGFCKNNQP FWTEJ GKPGP UGEJU\CEMKIGP 5VGTP DGKFUGKVKI DGINGKVGV XQP \YGK 5VTKEJGP GTUGV\V YWTFG  

 /QFGNN  0CEJFGO CO  5GRVGODGT  KP GKPGT 8QNMUCDUVKOOWPI FKG /QPCTEJKG CDIGUEJCHHV YQTFGP YCT   TKGH)GQTIK&KOKVTQXCO5GRVGODGTFKG4GRWDNKMCWUYQTCWHFKG+PUKIPKGPFGU1TFGPUCDGTOCNUIG·PFGTV YWTFGP&GT5VGTPCWHFGO/GFCKNNQPTKPIYWTFGHÒPH\CEMKIFKGCWHFGO-QRHFGU9CRRGP.ÌYGPUKV\GPFG-TQPG YWTFG GPVHGTPV WPF FKG -TQPGPªDGTJÌJWPI FWTEJ GKPGP UVKNKUKGTVGP JTGPMTCP\ GTUGV\V  /QFGNN  &KG NGV\VGP   8GTNGKJWPIGPFGU1TFGPUGTHQNIVGP2CXNQX 2#5 \WHQNIGCO/·T\



102

1TFGP ō(ÒT6CRHGTMGKVŌ=Îðäåí „Çà Õðàáðîñò“? /QFGNN OKVUGEJU\CEMKIGO5VGTPOKV\YGK.K PKGPCWHFGO/GFCKNNQPTKPIFGT8QTFGTUGKVG.ÌYGOKV-TQPG -TGW\+8-NCUUG5VWHG QJPG5EJYGTVGT$TQP\GXGTUKNDGTVWPFGOCKNNKGTVCO&TGKGEMUDCPF$-$9-&' -.'2#2'5HH4$80<- 44++




BULGARIEN 

1TFGP ō(ÒT6CRHGTMGKVŌ=Îðäåí „Çà Õðàáðîñò“? /QFGNN OKVUGEJU\CEMKIGO5VGTPOKV\YGK.K PKGPCWHFGO/GFCKNNQPTKPIFGT8QTFGTUGKVG.ÌYGOKV-TQPG NGGTG8GTNGKJWPIUVÒVG\WO 5QNFCVGPMTGW\ ō(ÒT 6CRHGTMGKVŋ  -NCUUG OKV WPIGMTÌPVGO DWNICTKUEJGP .ÌYGP OKV GKPIGTKUUGPGT   .CUEJG 44++p+++



8422 1:1



1TFGPō5V#NGZCPFGTŋ=Îðäåí „Ñâ. Àëåêñàíäúð“?D\Y1TFGPō5V#NGZCPFGT0GYUM[ŋ=Îðäåí „Ñâ. Àëåêñàíäúð Íåâñêèé“?  /QFGNN .ÌYGFGU5VGTPUFGT-NCUUGWPFFGT-NCUUG QJPG 5CEJUGPUEJKNF    5GV FGT ++ -NCUUG OKV 5EJYGTVGTP ÒDGT FGO -TGW\ DGUVGJGPF CWU   *CNUMTGW\5KNDGTXGTIQNFGVWPFGOCKNNKGTVCOMWT\GP*CNUDCPFWPF$TWUVUVGTP5KNDGTVNYXGTIQNFGV WPFGOCKNNKGTVCP0CFGNKOQTKIKPCNGPGVYCUDGUEJTKGDGPGP8GTNGKJWPIUGVWKOKVCNVCWHIGMNGDVGOWPIG MTÌPVGP DWNICTKUEJGP .ÌYGP WPF IGMTGW\VGP 5EJYGTVGTP $-   $9-   &'    -.'2#2'5HH4$80<- 5VÒEM44++  #O  5GRVGODGT  KP (QNIG FGU 'KPOCTUEJGU FGT 5QYLGVWPKQP ÒDGTPCJO GKPG UQIGPCPPVG ō8QNMUHTQPV   TGIKGTWPIŋ FKG /CEJV WPF GPVOCEJVGVG HCMVKUEJ FGP HÒT FGP OKPFGTL·JTKIGP -ÌPKI 5KOGQP UGKV    TGIKGTGPFGP 4GIGPVUEJCHVUTCV $KU CWH FKG 'PVHGTPWPI FGU 5CEJUGPUEJKNFGU CWH FGT $TWUV FGU 9CRRGP.ÌYGP FGU   $TWUVUVGTPUFGT+WPFFGU-TGW\GUFGT+++-NCUUGGTHQNIVGPMGKPGYGKVGTGP8GT·PFGTWPIGP /QFGNN &KG&GEMGN FGT8GTNGKJWPIUGVWKUYWTFGPLGFQEJPGWIGUVCNVGV  0CEJFGO CO  5GRVGODGT  KP GKPGT 8QNMUCDUVKOOWPI FKG /QPCTEJKG CDIGUEJCHHV YQTFGP YCT TKGH )GQTIK   &KOKVTQXCO5GRVGODGTFKG4GRWDNKMCWUYQTCWHFGT0COGFGU1TFGPU 1TFGPō5V#NGZCPFGT0GYUM[ŋ  WPF FKG +PUKIPKGP FGU 1TFGPU IG·PFGTV YWTFGP &KG CWH FGO -QRH FGU 9CRRGP.ÌYGP GKPKIGT +PUKIPKGP UKV\GPFG   -TQPG YWTFG GPVHGTPV WPF FKG -TQPGPªDGTJÌJWPI FWTEJ GKPGP UVKNKUKGTVGP JTGPMTCP\ GTUGV\V  /QFGNN  &KGUGU   /QFGNN XGTHÒIVG OWVOC­NKEJ YGFGT ÒDGT GKPG )TQ­OGKUVGTMQNNCPG PQEJ ÒDGT GKPG UQIGP ō-NGKPG -QNNCPGŋ &KG   NGV\VGP8GTNGKJWPIGPFGU1TFGPUGTHQNIVGP2CXNQX 2#5 \WHQNIGCO,WPK#O,WPKKUVFGT 1TFGP RGT 7MCU FGU /KPKUVGTTCVGU CDIGUEJCHHV YQTFGP #NNGTFKPIU YKTF GT XQP 5KOGQP FGO NGV\VGP -ÌPKI XQP   $WNICTKGP DKU KP FKG )GIGPYCTV CNU *CWUQTFGP YGKVGT XGTNKGJGP &GUUGP +PUKIPKGP \GKIGP PWPOGJT IGPGTGNN FGP   IGMTÌPVGPDWNICTKUEJGP.ÌYGP /QFGNN 



1TFGPō5V#NGZCPFGTŋ=Îðäåí „Ñâ. Àëåêñàíäúð“?D\Y1TFGPō5V#NGZCPFGT0GYUM[ŋ=Îðäåí „Ñâ. Àëåêñàíäúð Íåâñêèé“?  /QFGNN .ÌYGFGU5VGTPUFGT-NCUUGWPFFGT-NCUUG QJPG 5CEJUGPUEJKNF    NGGTGU 'VWK \WO -TGW\ +++ -NCUUG OKV 5EJYGTVGTP ÒDGT FGO -TGW\   OKVCNVCWHIGMNGDVGOWPIGMTÌPVGPDWNICTKUEJGP.ÌYGPGVYCUDGUVQ­GP ++

 103


BULGARIEN

8424

8425

8426

8427

8428

$7.)#4+5%*'#$<'+%*'0 

'JTGP\GKEJGP (ÒT FKG 4GVVWPI GKPGT (CJPG =*CãðCäGí ÇíCê „ÇC %ïCEÿâíG íC ÇíCìG“? 5KNDGT   XGTIQNFGVWPF$TQP\GCWHFGT4ÒEMUGKVG8GTNGKJWPIUPWOOGTō:8++ŋCP5EJTCWDGOKV5EJTCWDUEJGKDG $9-&'2#2'5H 44++



8QO 1TFGPUTCV FGU -TKGIUOKPKUVGTKWOU CO  ,WNK  XQTIGUEJNCIGP YWTFG UGKPG 5VKHVWPI CO  /·T\    XQO DWNICTKUEJGP -TKGIUOKPKUVGT DGHQJNGP  YWTFGP  'ZGORNCTG KP ¤UVGTTGKEJ JGTIGUVGNNV XQP FGPGP NCWV   2GVTQX KP 2' 5  KPUIGUCOV CNUQCWEJKO<YGKVGP9GNVMTKGI PWTGVYCUOGJTCNU\WT8GTNGKJWPIMCOGP YWTFGFCU'JTGP\GKEJGPCDIGUEJCHHV



#D\GKEJGP HÒT #WUIG\GKEJPGVGP /KNKV·TFKGPUV  /QFGNN !  #D\GKEJGP  -NCUUG HÒT )GPG   T·NG  $TQP\G XGTIQNFGV VNY GOCKNNKGTV CWH FGT 4ÒEMUGKVG *GTUVGNNGTDG\GKEJPWPI FGT (KTOC 5VTCEJKN   /KNQUEJGYKP5QHKCCP0CFGN$9-2'< ++



&CUFTGKMNCUUKIG#D\GKEJGPYWTFGKPFGT4GIKGTWPIU\GKVXQP<CT$QTKU+++GKPIGHÒJTV







#D\GKEJGP HÒT #WUIG\GKEJPGVGP /KNKV·TFKGPUV  /QFGNN !  #D\GKEJGP  -NCUUG HÒT 1HHK   \KGTG  $TQP\G XGTUKNDGTV VNY GOCKNNKGTV CWH FGT 4ÒEMUGKVG *GTUVGNNGTDG\GKEJPWPI FGT (KTOC 5VTCEJKN   /KNQUEJGY KP 5QHKC CP 5EJTCWDG OKV 5EJTCWDUEJGKDG FKGU GDGPHCNNU OKV *GTUVGNNGTDG\GKEJPWPI   $9-2'< ++



#D\GKEJGPHÒT#WUIG\GKEJPGVGP/KNKV·TFKGPUV/QFGNN ! #D\GKEJGP-NCUUG HÒT7PVGTQHHK \KGTG #WUHÒJTWPIOKVGOCKNNKGTVGO(GNF$TQP\GVNYGOCKNNKGTVCWHFGT4ÒEMUGKVG*GTUVGNNGTDG\GKEJ PWPIFGT(KTOC5VTCEJKN/KNQUEJGYKP5QHKCCP5EJTCWDGOKV5EJTCWDUEJGKDGFKGUGGDGPHCNNUOKV*GT UVGNNGTDG\GKEJPWPI$9-2'< ++



8GTYWPFGVGPD\Y6TCWGT#D\GKEJGP/QFGNN ! #D\GKEJGPHÒTGKPG8GTYWPFWPI$TQP\G VNY XGTUKNDGTV VNY XGTIQNFGV VNY GOCKNNKGTV CWH FGT 4ÒEMUGKVG *GTUVGNNGTDG\GKEJPWPI FGT (KTOC %   /CTFKTQUQYKP5QHKCCP5EJTCWDUEJGKDG$9-2'< ++



8429





8430

8431

8GTYWPFGVGP D\Y 6TCWGT#D\GKEJGP  /QFGNN !  6TCWGT#D\GKEJGP $TQP\G VNY XGTUKN   DGTVVNYXGTIQNFGVVNYGOCKNNKGTVCWHFGT4ÒEMUGKVG*GTUVGNNGTDG\GKEJPWPIFGT(KTOC%/CTFKTQUQY KP5QHKCCP5EJTCWDUEJGKDG$9-2'< ++



#D\GKEJGPHÒT/KNKV·T(NWI\GWIHÒJTGT/QFGNN  #D\GKEJGP5KNDGTIW­  VNYXGTIQN FGV CWH FGT 4ÒEMUGKVG *GTUVGNNGTDG\GKEJPWPI FGT (KTOC ,WPEMGT KP $GTNKP WPF 5KNDGTRWP\G ōŋ CP   0CFGN$9-%#($72'<80 44++



&CU#D\GKEJGPKUVXQP<CT(GTFKPCPF+GKPIGHÒJTVYQTFGP



104

#D\GKEJGP HÒT /KNKV·T(NWI\GWIHÒJTGT  /QFGNN   #D\GKEJGP 5KNDGT VNY $TQP\G VNY   XGTIQNFGVVNYGOCKNNKGTVOKP#WUDTWEJUQYKG4GRCTCVWTKPFGTJGNNDNCWGP'OCKNNGCWHFGT4ÒEMUGKVG *GTUVGNNGTDG\GKEJPWPI FGT (KTOC 5VTCEJKN /KNQUEJGY KP 5QHKC CP 5EJTCWDG OKV 5EJTCWDUEJGKDG   $9-%#($72'<6#80 ++p




BULGARIEN

8434 8433

8435

8432



#D\GKEJGP HÒT $GQDCEJVGT  /QFGNN   #D\GKEJGP KP 0QTOCNCWUHÒJTWPI 5KNDGT JQJN IG   HGTVKIVWPFXGTDÌFGVOKV\YGK.WHVFTWEM#WUINGKEJU¤HHPWPIGPCP0CFGNFKGUGOKV5KNDGTRWP\Gōŋ $9-%#($72'<80 ++



&CU#D\GKEJGPKUVXQP<CT(GTFKPCPF+GKPIGHÒJTVYQTFGP





#D\GKEJGPHÒT$GQDCEJVGT/QFGNN  #D\GKEJGP$TQP\GVNYXGTUKNDGTVVNYXGTIQNFGV VNY GOCKNNKGTV CWH FGT 4ÒEMUGKVG *GTUVGNNGTDG\GKEJPWPI FGT (KTOC 5VTCEJKN /KNQUEJGY KP 5QHKC CP   5EJTCWDGOKV5EJTCWDUEJGKDG$9-%#($72'<80 ++



#D\GKEJGPHÒT<KXKNG(NWI\GWIHÒJTGT/QFGNN  #D\GKEJGPKP$TQP\G$TQP\GXGTIQNFGV CP0CFGN%#($7$2'<80 ++



&CU#D\GKEJGPKUVXQP<CT$QTKU+++GKPIGHÒJTVYQTFGP



5EJCTHUEJÒV\GP#D\GKEJGP/QFGNN OKV/QPQITCOOXQP(ÒTUV#NGZCPFGT+ #D\GK EJGP$TQP\GIW­  \YGKVGKNKIIGHGTVKIVVNYNCEMKGTVCP5EJTCWDGQJPG5EJTCWDUEJGKDG$9- XCT2'<XCT ++



&CU#D\GKEJGPYWTFGXQP(ÒTUV#NGZCPFGT+GKPIGHÒJTV /QFGNN WPFKPFGP,CJTGP /QFGNN 

 /QFGNN    /QFGNN    /QFGNN    /QFGNN    /QFGNN  WPF   /QFGNN    XGT·PFGTV

8437

8439

8440 8438

8436



5EJCTHUEJÒV\GP#D\GKEJGP  /QFGNN OKV /QPQITCOO XQP <CT (GTFKPCPF +      5KNDGTPGU#D\GKEJGPHÒT)WVG5EJÒV\GPXGTUKNDGTVCP0CFGN$9-2'< ++





5EJCTHUEJÒV\GP#D\GKEJGP/QFGNN FTGKMNCUUKIOKV/QPQITCOOXQP<CT$QTKU+++  #D\GKEJGP + -NCUUG $TQP\G XGTIQNFGV CWH FGT 4ÒEMUGKVG VNY WPNGUGTNKEJG *GTUVGNNGTDG\GKEJPWPI CP   5EJTCWDGOKV5EJTCWDUEJGKDG$9-2'<XCT ++





#D\GKEJGPFGT/KNKV·TCMCFGOKG/QFGNN  #DUQNXGPVGP#D\GKEJGPFGT/KNKV·TCMCFGOKG 5KNDGTVNY$TQP\GVNYGOCKNNKGTVOKV$GHGUVKIWPIUU[UVGO$9-2'< ++





#D\GKEJGP HÒT #TVKNNGTKG+PURGMVQTGP #D\GKEJGP + -NCUUG $TQP\G XGTIQNFGV WPF GOCKNNKGTV CP   5EJTCWDGOKV5EJTCWDUEJGKDG$9-2'< ++





#D\GKEJGPHÒT/KNKV·THCJTGT/QFGNN OKVDWNICTKUEJGT6TKMQNQTG #D\GKEJGP$TQP\G XGTUKNDGTVVNYXGTIQNFGVVNYGOCKNNKGTVCP5EJTCWDGOKV5EJTCWDUEJGKDG2'< ++



&CU #D\GKEJGP KUV  XQP <CT (GTFKPCPF + GKPIGHÒJTV  /QFGNN  WPF   /QFGNN  WPF   /QFGNN    XGT·PFGTVYQTFGP

105


BULGARIEN

8441

8442

8443

8444

8445



#D\GKEJGPHÒT/KNKV·THCJTGT/QFGNN OKVDWNICTKUEJGT6TKMQNQTGQJPG-TQPG #D\GK EJGP$TQP\GXGTUKNDGTVVNYXGTIQNFGVVNYGOCKNNKGTVCP5EJTCWDGOKV5EJTCWDUEJGKDG2'< ++





#D\GKEJGPHÒTGTHÒNNVG#TDGKVURHNKEJV/QFGNN QF #D\GKEJGP++-NCUUG$TQP\G XGTUKNDGTVVNYGOCKNNKGTVCP0CFGN$9-2'< ++





#D\GKEJGPHÒT2KQPKGTVTWRRGP#D\GKEJGP+-NCUUG5KNDGTVNYXGTIQNFGVVNYGOCKNNKGTVCP5EJTCWD UEJGKDG$9-2'< ++





#D\GKEJGPHÒT'KUGPDCJP+PIGPKGWTG#D\GKEJGP-NCUUGXGTUKNDGTVVNYGOCKNNKGTVCP5EJTCWDGOKV 5EJTCWDUEJGKDGFKGUGOKV*GTUVGNNGTDG\GKEJPWPIFGT(KTOC5VTCEJKN/KNQUEJGYKP5QHKC$9-XCT ++





#D\GKEJGPHÒT#DIGQTFPGVG5KNDGTXGTIQNFGVVNYGOCKNNKGTVCP0CFGN2'<



8446

8447

8448

++

8449



'JTGP\GKEJGPFGT2QNK\GK/QFGNN  #D\GKEJGPHÒTDGUQPFGTG6CVGPXGTUKNDGTVVNY GOCKNNKGTVCP5EJTCWDGOKV/WVVGT$9-2'< ++





'JTGP\GKEJGPFGT2QNK\GK/QFGNN  #D\GKEJGPHÒTJGTXQTTCIGPFGP&KGPUVXGTUKN DGTVVNYGOCKNNKGTVCP5EJTCWDGOKV/WVVGT$9-2'< ++





'JTGP\GKEJGP FGT 2QNK\GK  /QFGNN   #D\GKEJGP HÒT IWVGP &KGPUV XGTUKNDGTV VNY   GOCKNNKGTVCP5EJTCWDGOKV/WVVGT$9-2'< ++





'JTGP\GKEJGP FGT 2QNK\GK  /QFGNN   #D\GKEJGP HÒT 8GTFKGPUVG XGTUKNDGTV VNY   GOCKNNKGTVCWHFGT4ÒEMUGKVG*GTUVGNNGTDG\GKEJPWPIFGT(KTOC5VTCEJKN/KNQUEJGYKP5QHKCCP5EJTCWDG OKV5EJTCWDUEJGKDGFKGUGGDGPHCNNUOKV*GTUVGNNGTDG\GKEJPWPI$9-2'< ++



8450

8451



'TKPPGTWPIU#D\GKEJGP  ,CJTG $GHTGKWPI XQP $WNICTKGP =ÏQ÷GòGí -ðúñò „50 ã. îò   Îñâîáîæäåíèåòî íà Áúëãàðèÿ“?8GTIQNFGVGOCKNNKGTVCP0CFGN&'2'< ++





)WTIWNLCV'TKPPGTWPIUMTGW\&WTEJOGUUGTOO$TQP\GXGTIQNFGVWPFGOCKNNKGTVCWHFGT4ÒEM UGKVG*GTUVGNNGTD\GKEJPWPIFGT(KTOC5VÌIGTKP9KGPWPF/CVTKMGNPWOOGTōŋCP0CFGN2'< ++



-QPXQNWVXQP#D\GKEJGP-QMCTFGPWPF-PÌRHGP8GTUEJKGFGPG/GVCNNGVNYGOCKNNKGTVVGKNUCP 0CFGNPQFGT5RNKPVGPKPWPVGTUEJKGFNKEJGT'TJCNVWPI 5VÒEM++++++8



 106


KÖNIGREICH DÄNEMARK

-¤0+)4'+%*&0'/#4- 

&CPGDTQI1TFGP -QPHGMVKQPKGTVGU WPF IGVTCIGPGU ·NVGTGU 5EJWNVGTDCPF \WO )TQ­MTGW\ GVYCU XGT   HNGEMV ++p+++



&GT &CPPGDTQI1TFGP YWTFG CO  1MVQDGT  XQP -ÌPKI %JTKUVKCP 8 XQP &·PGOCTM WPF 0QTYGIGP      KP 'TPGWGTWPI GKPGU UEJQP  XQP -ÌPKI 9CNFGOCT ++ XQP &·PGOCTM   IGUVKHVGVGP 4KVVGTQTGPU   GTPGWGTV<WP·EJUVPWTCWUGKPGT-NCUUGDGVGJGPFGTYGKVGTVGKJP-ÌPKI(TGFGTKM8+XQP&·PGOCTMWPF0QTYGIGP

  CO  ,WPK  \W GKPGO CWU XKGT -NCUUGP )TQ­MQOOCPFGWT  CD  FKG QDGTUVG -NCUUG  )TQ­   MTGW\4KVVGT -QOOCPFGWT WPF 4KVVGT  DGUVGJGPFGP CNNIGOGKPGP 8GTFKGPUVQTFGP CNU ·W­GTGU <GKEJGP CPGTMCPPVGT   $ÒTIGTRHNKEJV HÒT CNNG 7PVGTVCPGP QJPG 4ÒEMUKEJV CWH 5VCPF QFGT #FGN 1JO*KGTQP[OWUUGP KP '1 5      YWTFGFKG-QOOCPFGWTMNCUUGFKG4KVVGTMNCUUGKPLGYGKNU\YGK)TCFGWPVGTVJGKNV&GO1TFGPKUVUGKVFCU 'JTGP\GKEJGP FGU &CPGDTQI1TFGPU 5KNDGTPGU -TGW\  CPIGUEJNQUUGP       WPF    PCEJ 4GIKGTWPIUCPVTKVV FGU LGYGKNKIGP 5QWXGT·PU YWTFG FKG )GUVCNVWPI FGT 1TFGPUMTGW\G FWTEJ #PDTKPIWPI   FGULGYGKNKIGPMÌPKINKEJGP/QPQITCOOUXGT·PFGTV



&CPGDTQI1TFGP.GGTG8GTNGKJWPIUGVWK\WO)TQ­MTGW\FGT(KTOC#/KEJGNUGPKP-QRGPJCIGPCWU FGT4GIKGTWPIU\GKV-ÌPKI(TGFGTKMU+:QFGT-ÌPKIKP/CTICTGVJGU++ ++



8455

8456





8457

&CPGDTQI1TFGP $TWUVUVGTP \WO )TQ­MTGW\ QHHK\KGNNG DKU  XGTNKGJGPG IGUVKEMVG #WUHÒJ   TWPINGKEJVIGYÌNDV5KNDGTWPF)QNFNCCP XGTIQNFGVGU5KNDGT 5VKEMGTTGK2CKNNGVVGPCWHFGT4ÒEMUGKVG YGK­GU#DFGEMNGFGTOKVJCPFUEJTKHVNKEJGT#WHUEJTKHVō*U'ZEGNNGPEG$T'.CIGTJGKOŋ568 <- ++



&CPGDTQI1TFGP$TWUVUVGTP\WO)TQ­MTGW\GKPHCEJGKPQHHK\KGNNG<YGKVCPHGTVKIWPIXQPXQT $TQP\GXGTUKNDGTVVNYXGTIQNFGVVNYGOCKNNKGTVOKP-QTTQUKQPUHNGEMGPCPUGPMTGEJVGT$GHGUVKIWPIU URCPIG<-XCT ++p



&CDKUFCU)TQ­MTGW\FGU&CPGDTQI1TFGPUOKVGKPGOIGUVKEMVGP$TWUVUVGTPXGTNKGJGPYWTFGYCTGPFKG 6T·IGT IG\YWPIGP WO GKPG IGYKUUG 2TCMVKMCDKNKV·V DGKO 6TCIGP \W JCDGP UKEJ <YGKVCPHGTVKIWPIGP XQP $TWUVUVGT   PGPKP/GVCNN\WDGUEJCHHGPYCUFGTGPITQ­GP8CTKCPVGP4GKEJVWOGTMN·TV



&CPGDTQI1TFGP$TWUVUVGTP\WO)TQ­MTGW\QHHK\KGNNG/GVCNNCWUHÒJTWPI UGKV 5KNDGTVNYXGT IQNFGV WPF GOCKNNKGTV MCWO UKEJVDCTG 'OCKNNGCDURNKVVGTWPI KO QDGTGP 'EMFGUTGEJVGP-TGW\CTOUCWH FGT4ÒEMUGKVG*GTUVGNNGTRWP\Gō#/ŋFGT(KTOC#/KEJGNUGPKP-QRGPJCIGPCP&QRRGNPCFGNFKGUGOKV HTCP\ÌUKUEJGT'KPHWJTRWP\GHÒT5KNDGTXQPDKU ō5EJYCPGPRWP\Gŋ 568<- ++

 107


KÖNIGREICH DÄNEMARK

8460 8458







8459

&CPGDTQI1TFGP$TWUVUVGTP\WO-QOOCPFGWT-NCUUGQHHK\KGNNGDKUXGTNKGJGPGIGUVKEMVG #WUHÒJTWPI 5KNDGT WPF )QNFNCCP XGTIQNFGVGU 5KNDGT  5VKEMGTTGK 2CKNNGVVGP GVYCUIGFWPMGNVCWHFGT 4ÒEMUGKVGWPNGUGTNKEJDGUEJTKHVGVGUYGK­GU#DFGEMNGFGT568<- ++



&CPGDTQI1TFGP$TWUVUVGTP\WO-QOOCPFGWT-NCUUGQHHK\KGNNGDKUXGTNKGJGPGIGUVKEMVG #WUHÒJTWPI 5KNDGT WPF )QNFNCCP XGTIQNFGVGU 5KNDGT  5VKEMGTTGK 2CKNNGVVGP GVYCUIGFWPMGNVCWHFGT 4ÒEMUGKVGYGK­GU#DFGEMNGFGT568<- ++



&CPGDTQI1TFGP $TWUVUVGTP \WO -QOOCPFGWT  -NCUUG KPQHHK\KGNNG <YGKVCPHGTVKIWPI XQP XQT   ZOO5KNDGTDTKNNCPVKGTV)QNFVNYGOCKNNKGTVOGJTGTGMCWOUKEJVDCTG%JKRUKP FGTTQVGP'OCKNNGCP&QRRGNPCFGN568<- 4++



8463

8464

8465

8466



&CPGDTQI1TFGP.GGTGU'VWKHÒTFGP$TWUVUVGTP\WO-QOOCPFGWT-NCUUGFGT(KTOC#/KEJGNUGP KP-QRGPJCIGPCWUFGT<GKVPCEJ ++





&CPGDTQI1TFGP.GGTGU'VWKHÒTFGP$TWUVUVGTP\WO-QOOCPFGWT-NCUUGFGT(KTOC#/KEJGNUGP KP-QRGPJCIGPCWUFGT<GKVPCEJ ++





&CPGDTQI1TFGP  /QFGNN OKV /QPQITCOO -ÌPKI (TGFGTKMU 8++   4KVVGTMTGW\ )QNF   GOCKNNKGTVI8GTH·TDWPIGPWPF-TCV\GTKPFGTYGK­GP'OCKNNG#DRNCV\WPIGPKPFGTTQVGP'OCKNNG FGT8QTFGTUGKVGWPFFGT4ÒEMUGKVGCOPKEJVMQTTGMVGPDTGKVGP$CPF568<- ++p





&CPGDTQI1TFGP  /QFGNN OKV /QPQITCOO -ÌPKI (TGFGTKMU 8++   5KNDGTPGU -TGW\   5KNDGTCO2GPVCIQPCNDCPF568<- 4++





&CPGDTQI1TFGP  /QFGNN OKV /QPQITCOO -ÌPKI %JTKUVKCPU +:   4KVVGTMTGW\ )QNF   GOCKNNKGTV  I #DRNCV\WPIGP KP FGT TQVGP 'OCKNNG FGT 8QTFGT WPF 4ÒEMUGKVG FGT NKPMGP WPVGTGP   -TGW\CTOGEMG $CPFTKPI GVYCU XGTDQIGP OKV UGJT MWT\GO CNVGP $CPFUVÒEM KO QTKIKPCNGP 8GTNGK   JWPIUGVWKFGT(KTOC#/KEJGNUGPKP-QRGPJCIGP568<- ++



&CPGDTQI1TFGP  /QFGNN OKV /QPQITCOO -ÌPKI %JTKUVKCPU +:   4KVVGTMTGW\ )QNF   GOCKNNKGTVI$CPFTKPIRWP\KGTVOKV-QRGPJCIGPGT,CJTGURWP\GōŋHÒTCOCNVGPPKEJVF·PK UEJGP LGFQEJ MQTTGMVGP $CPF KO QTKIKPCNGP 8GTNGKJWPIUGVWK FGT (KTOC # /KEJGNUGP KP -QRGPJCIGP   568<- ++





108


KÖNIGREICH DÄNEMARK

8467





8468

8469

8470

&CPGDTQI1TFGP  /QFGNN OKV /QPQITCOO -ÌPKI %JTKUVKCPU +:   4KVVGTMTGW\ )QNF   GOCKNNKGTV  I CNVG 'OCKNNGTGRCTCVWT KP FGT TQVGP 'OCKNNG CWH 8QTFGT WPF 4ÒEMUGKVG FGU QDGTGP   -TGW\CTOTCPFGUOGJTGTGQDGTHN·EJNKEJG'OCKNNGEJKRU$CPFTKPIRWP\KGTVOKV-QRGPJCIGPGT5VCFVRWP\G COCNVGPUGJTMWT\GP$CPF568<- 4++p+++



&CPGDTQI1TFGP  /QFGNN OKV /QPQITCOO -ÌPKI %JTKUVKCPU +:   4KVVGTMTGW\ )QNF   GOCKNNKGTV  I #DRNCV\WPIGP KP FGT TQVGP 'OCKNNG FGT 8QTFGTUGKVG WPF FGT 4ÒEMUGKVG $CPFTKPI   RWP\KGTVOKV-QRGPJCIGPGT,CJTGURWP\GōŋHÒTCO$CPF568<- ++p+++



'ZGORNCTCWUWPUGTGT#WMVKQP1TFGPWPF'JTGP\GKEJGPCO1MVQDGT0T



&CPGDTQI1TFGP  /QFGNN OKV /QPQITCOO -ÌPKI %JTKUVKCPU +:   5KNDGTPGU -TGW\   5KNDGTCO2GPVCIQPCNDCPF568<- 4++





&CPGDTQI1TFGP  /QFGNN OKV /QPQITCOO -ÌPKI (TGFGTKMU 8+++   4KVVGTMTGW\ )QNF   GOCKNNKGTVI$CPFTKPIRWP\KGTVOKV-QRGPJCIGPGT,CJTGRWP\GōŋHÒTWPFOKVō%(*ŋCOCNVGP 2GPVCIQPCNDCPF568<- 4++



9KGCNNG1TFGPUKPUKIPKGPCWUFGTPWTUGEJU,CJTGFCWGTPFGP4GIKGTWPIU\GKV-ÌPKI(TGFGTKMU8+++UGJTUGNVGP

8471 1:1



&CPGDTQI1TFGP  /QFGNN OKV /QPQITCOO -ÌPKI %JTKUVKCPU :   )TQ­MTGW\UGV DGUVG   JGPFCWU-NGKPQF)QNFGOCKNNKGTVICWHFGT4ÒEMUGKVGFGU/QPQITCOOUHTCP\ÌUKUEJG'KPHWJT RWP\GPXQPDKU ō7JWRWP\Gŋ COQTKIKPCNGPCNVGPMQPHGMVKQPKGTVGP5EJWNVGTDCPFWPF$TWUV UVGTP DTKNNCPVKGTVG #WUHÒJTWPI 5KNDGT DTKNNCPVKGTV )QNF GOCKNNKGTV CWH FGT 4ÒEMUGKVG *GTUVGNNGTRWP\G   ō#/ŋFGT(KTOC#/KEJGNUGPKP-QRGPJCIGPKOQTKIKPCNGP8GTNGKJWPIUGVWKFGT(KTOC/KEJGNUGPOKV UR·VGTGTI·P\VGTWPFGVYCUXGTHNGEMVGT'KPNCIG568<- ++  109


KÖNIGREICH DÄNEMARK

8473 8472





&CPGDTQI1TFGP  /QFGNN OKV /QPQITCOO -ÌPKI %JTKUVKCPU :   5KNDGTPGU -TGW\   #WUHÒJTWPI OKV QHHGPGP -TQPGP \YKUEJGP FGP -TGW\CTOGP 5KNDGT CO 2GPVCIQPCNDCPF 568    <- 4++



&CPGDTQI1TFGP  /QFGNN OKV /QPQITCOO -ÌPKI (TGFGTKMU +:   -QOOCPFGWTUUGV   -NCUUGDGUVGJGPFCWU-QOOCPFGWTMTGW\5KNDGTXGTIQNFGVWPFGOCKNNKGTVOKP4GRCTCVWTKPFGTTQVGP 'OCKNNGFGT8QTFGTUGKVGCWHFGT4ÒEMUGKVGFGU$CPFTKPIUOGJTHCEJRWP\KGTV *GTUVGNNGTRWP\Gō#/ŋFGT (KTOC#/KEJGNUGPKP-QRGPJCIGPGT5KNDGTRWP\GWPF,CJTGRWP\GōŋFGT5VCFV-QRGPJCIGPHÒT  CO*CNUDCPFWPF$TWUVUVGTP#WUHÒJTWPIXQPDKU5KNDGTDTKNNCPVKGTVVNYXGTIQNFGV VNY GOCKNNKGTV #WHNCIGP )QNF CWH FGT 4ÒEMUGKVG *GTUVGNNGTRWP\G ō#/ŋ FGT (KTOC /KEJGNUGP WPF   5KNDGTRWP\G ō56'4.+0)  &'0/#4-ŋ CP &QRRGNPCFGN KO QTKIKPCNGP 8GTNGKJWPIUGVWK FGT (KTOC   /KEJGNUGP\WUCOOGPOKVFGTQTKIKPCNGP8GTNGKJWPIUWTMWPFGHÒTFGPDTKVKUEJGP%QOOCPFGT5KT&WFNG[ %QNNGU &GRWV[ 6TGCUWTGT FGU -ÌPKIU FCVKGTV -QRGPJCIGP CO  #WIWUV  OKV 2T·IGUKGIGN WPF   1TKIKPCNWPVGTUEJTKHV FGU 1TFGPUMCP\NGTU 2TKP\ 8KIIQ )TCH XQP 4QUGPDQTI OGJTHCEJ IGHCNVGV 568   <- 5VÒEM++



8474



8475

8476

8477

8478

&CPGDTQI1TFGP  /QFGNN OKV /QPQITCOO -ÌPKI (TGFGTKM +:    4KVVGTMTGW\ UQ IG   PCPPV XQP  DKU   5KNDGT XGTIQNFGV GOCKNNKGTV CO $CPF KO 1TKIKPCNGVWK FGU *QHLWYGNKGTU #   /KEJGNUGPKP-QRGPJCIGP568XCT<- ++



&CPGDTQI1TFGP  /QFGNN OKV FGO /QPQITCOO -ÌPKI (TGFGTKM +:    4KVVGTMTGW\   -NCUUG UGKV 5KNDGTGOCKNNKGTVOKV$CPFCDUEJPKVVKOQTKIKPCNGP8GTNGKJWPIUGVWK568 <- ++





&CPGDTQI1TFGP  /QFGNN OKV FGO /QPQITCOO -ÌPKI (TGFGTKM +:    4KVVGTMTGW\   -NCUUG UGKV 5KNDGTGOCKNNKGTVCO2GPVCIQPCNDCPF568<- ++





&CPGDTQI1TFGP  /QFGNN OKV FGO /QPQITCOO -ÌPKI (TGFGTKM +:    4KVVGTMTGW\   -NCUUG UGKV 5KNDGTGOCKNNKGTVCO2GPVCIQPCNDCPF568<- ++





&CPGDTQI1TFGP  /QFGNN OKV FGO /QPQITCOO -ÌPKI (TGFGTKM +:    4KVVGTMTGW\   -NCUUG UGKV 5KNDGTGOCKNNKGTVCO2GPVCIQPCNDCPF568<- ++





110


KÖNIGREICH DÄNEMARK

8479 1:1



&CPGDTQI1TFGP  /QFGNN OKV /QPQITCOO -ÌPKIKP /CTICTGVJGU ++ UGKV   -QOOCPFGWTUUGV   -NCUUGDGUVGJGPFCWU-QOOCPFGWTMTGW\5KNDGTXGTIQNFGVWPFGOCKNNKGTVOKP%JKRKPFGTTQVGP'OCKNNG FGT 4ÒEMUGKVG CO *CNUDCPF WPF $TWUVUVGTP #WUHÒJTWPI UGKV  5KNDGT VNY XGTIQNFGV VNY   GOCKNNKGTV#WHNCIGP)QNFCWHFGT4ÒEMUGKVG*GTUVGNNGTRWP\Gō#/ŋFGT(KTOC#/KEJGNUGPKP-QRGPJC IGPWPFGT5KNDGTRWP\GCP&QRRGNPCFGN\WUCOOGPOKV(GNFUEJPCNNGOKV.KV\GPWPF4QUGVVGP#WHNCIG KOQTKIKPCNGP8GTNGKJWPIUGVWKFGT(KTOC/KEJGNUGP568<- 5VÒEM4++ 



&CPGDTQI1TFGP-QPXQNWVXQPUKGDGP1TFGPUD·PFGTPKPXGTUEJKGFGPGP$TGKVGPWPF.·PIGPFCTWPVGT CWEJGKP-QOOCPFGWTDCPF 5VÒEM++



8482 8481

8484

8485



/GFCKNNGHÒTFGP&GWVUEJ&·PKUEJGP-TKGIXQP$TQP\GCOQTKIKPCNGPCNVGP$CPF568 ++





(TGKJGKVU/GFCKNNG-ÌPKI%JTKUVKCPU:5KNDGTCO$CPF568XCT





&KGPUVCWU\GKEJPWPIU/GFCKNNGFGT/CTKPG#WUHÒJTWPI5KNDGTCO2GPVCIQPCNDCPFKOQTKIKPCNGP IQNFGPDGFTWEMVGP8GTNGKJWPIUGVWK568 ++





&KGPUVCWU\GKEJPWPIU/GFCKNNGFGT/CTKPG#WUHÒJTWPI5KNDGTCO2GPVCIQPCNDCPF568 ++





&KGPUVCWU\GKEJPWPIU/GFCKNNGFGT/CTKPG#WUHÒJTWPI5KNDGTCO2GPVCIQPCNDCPF568 ++





&KGPUVCWU\GKEJPWPIU/GFCKNNGFGT/CTKPG#WUHÒJTWPI5KNDGTCO2GPVCIQPCNDCPF568 ++





&KGPUVCWU\GKEJPWPIU/GFCKNNGFGT/CTKPG#WUHÒJTWPI5KNDGTCO2GPVCIQPCNDCPF568 ++



++

111


REPUBLIK FINNLAND

8488

8489

8491

8490

 

&KGPUVCWU\GKEJPWPIU/GFCKNNGFGU*GGTGU#WUHÒJTWPI5KNDGTCO2GPVCIQPCNDCPF568 ++ &KGPUVCWU\GKEJPWPIU/GFCKNNGFGT<KXKN8GTVGKFKIWPI5KNDGTCO2GPVCIQPCNDCPF568 ++

 



'JTGP\GKEJGP FGU &·PKUEJGP 4QVGP -TGW\GU HÒT    5KNDGT GOCKNNKGTV CO 2GPVCIQPCNDCPF   KOQTKIKPCNGP8GTNGKJWPIUGVWKXQP#/KEJGNUGPKP-QRGPJCIGPOKVTQVGO-TGW\568 ++





)GUEJGPMPCFGN-ÌPKI%JTKUVKCPU:  ZOO)QNFGOCKNNKGTVFKG-TQPGOKVCEJV &KCOCPVTQUGPDGUGV\VCP0CFGNKOOKVIQNFHCTDGPGT-TQPGDGFTWEMVGP8GTNGKJWPIUGVWKFGU*QHLWGNKGTU /KEJGNUGPKP-QRGPJCIGP +p++



%JTKUVKCP:YCTXQPDKU-ÌPKIXQP&·PGOCTMWPFKUVFGT)TQ­XCVGTFGTJGWVKIGP/QPCTEJKP/CTICTGVJG++

4'27$.+-(+00.#0& <WT5VCCVU5[ODQNKMFGT4GRWDNKM(KPPNCPFIGJÌTVPGDGPFGO.ÌYGPKOHKPPKUEJGP5VCCVUYCRRGP CWEJ GKP CNU ō(TGKJGKVUMTGW\ŋ DG\GKEJPGVGU *CMGPMTGW\ &KGUGU (TGKJGKVUMTGW\ YWTFG DGTGKVU   Y·JTGPFFGU'TUVGP9GNVMTKGIU\WO5[ODQNFGTHKPPKUEJGP(TGKJGKVUDGYGIWPIIGIGPFKG\CTKUVKUEJ TWUUKUEJG *GTTUEJCHV WPF JCV UQOKV PKEJVU IGOGKP OKV FGO GTUV UR·VGT GPVUVCPFGPGP 5[ODQN FGU   0CVKQPCNUQ\KCNKUOWU $KU JGWVG KUV GU CWH FGO JÌEJUVGP HKPPKUEJGP 1TFGP FGO 1TFGP FGU   (TGKJGKVUMTGW\GU \W UGJGP WPF FKGPV \ $ CWEJ CNU 5[ODQN HÒT FGP HKPPKUEJGP 5VCCVURT·UKFGPVGP   D\Y FKG 5VCCVURT·UKFGPVKP KP FGUUGP D\Y FGTGP 5VCPFCTVG 5QOKV MCPP CWUFTÒEMNKEJ HGUVIGUVGNNV   YGTFGPFCUUFKGUGU(TGKJGKVUMTGW\CNUGKPPKEJVFGO0CVKQPCNUQ\KCNKUOWU\WIGJÌTKIGU5[ODQNPKEJV WPVGTFKG$GUVKOOWPIGPFGThhC#DUD\Y#DU5V)$H·NNV

8492 Rv.







8494 8493

1TFGPFGU(TGKJGKVUMTGW\GU/QFGNN OKVFGT,CJTGU\CJN (TGKJGKVUOGFCKNNG-NCUUG5KNDGT CWH FGT 4ÒEMUGKVG OGJTHCEJ UEJYGFKUEJ   RWP\KGTV *GTUVGNNGTRWP\G 5%Q YQJN HÒT FGP *GTUVGNNGT   5RQTTQPI  %Q KP 5VQEMJQNO 5VQEMJQNOGT 5VCFVRWP\G CD  ,CJTGURWP\G ō3ŋ HÒT  WPF   UVCCVNKEJG)CTCPVKGRWP\G5HÒT5KNDGTUGKV QJPG$CPF ++



1TFGP FGT (KPPKUEJGP 9GK­GP 4QUG -QOOCPFGWTMTGW\  #WUHÒJTWPI OKV JQTK\QPVCN CPIGNÌVGVGT   ¤UGUGKV 5KNDGTXGTIQNFGVWPFGOCKNNKGTVKPFGT¤UGOGJTHCEJRWP\KGTV WCō#6ŋHÒTFKG(KTOC #6KNNCPFGTKP*GNUKPMKWPF5KNDGTRWP\Gō*ŋ COMWT\GP*CNUDCPFKOQTKIKPCNGPIQNFDGFTWEMVGP 8GTNGKJWPIUGVWKFGT(KTOC6KNNCPFGT<- ++



1TFGPFGT(KPPKUEJGP9GK­GP4QUG<GKEJGPFGT(KPPKUEJGP9GK­GP4QUG#WUHÒJTWPI OKVXGTVK MCN CPIGNÌVGVGT ¤UG WPF QJPG 'OCKNNG  5KNDGT CWH FGT 4ÒEMUGKVG OGJTHCEJ RWP\KGTV W C *GTUVGNNGT   RWP\Gō8.ŋHÒT8KMVQT.KPFOCP5KNDGTRWP\Gō*ŋWPF,CJTGURWP\Gō1ŋHÒT COQTKIKPCNGP $CPF<- 44++



'ZGORNCT CWU FGT GTUVGP (GTVKIWPIUUGTKG 0CEJ #WUMWPHV XQP (TCW &T - 6KNNCPFGT)QFGPJKGNO UVGJV FKG 2WP\G   ō8.ŋHÒT8KMVQT.KPFOCPFGPGTUVGP*GTUVGNNGTFGT1TFGPUKPUKIPKGPFGTFKGUGPQEJXQT6KNNCPFGTJGTIG UVGNNVJCV9TGFGIKDV KP94&5HH HÒTFCU,CJTPWT8GTNGKJWPIGPCP(KPPGPWPF8GTNGKJWPIGPCP #WUN·PFGTCP

112


REPUBLIK FINNLAND

8495

8497

8498

8496





1TFGPFGT(KPPKUEJGP9GK­GP4QUG/GFCKNNGFGT(KPPKUEJGP9GK­GP4QUG-NCUUGOKV)QNFGPGO -TGW\ 5KNDGT VNY XGTIQNFGV KO 4CPF OGJTHCEJ RWP\KGTV W C VNY WPNGUGTNKEJG *GTUVGNNGTRWP\G   5KNDGTRWP\Gō*ŋWPF,CJTGURWP\Gō7ŋHÒTCOQTKIKPCNGPCNVGP$CPF<- ++



(KPPKUEJGT .ÌYGPQTFGP -QOOCPFGWTMTGW\ 5KNDGT XGTIQNFGV WPF GOCKNNKGTV KP FGT ¤UG OGJTHCEJ   RWP\KGTVCO*CNUDCPF<- ++



#O5GRVGODGTUVKHVGVGFGTHKPPKUEJG2T·UKFGPV4[UVQ4[VKFGPHÒPHMNCUUKIGP1TFGPFGOGKP8GTFKGPUVMTGW\ WPF FKG CO  &G\GODGT  IGUVKHVGVG 2TQ (KPNCPFKC/GFCKNNG CPIGUEJNQUUGP KUV (ÒT OKNKV·TKUEJG 8GTFKGPUVG KP   -TKGIU\GKVGPYKTFFGT1TFGPOKV5EJYGTVGTPXGTNKGJGP



5RQTVNKEJGU8GTFKGPUVMTGW\(KPPNCPFU8GTFKGPUVMTGW\-NCUUGXGTUKNDGTVCO$CPF

++



.WHVYCHHGP-TGW\  )GUEJY·T\V VNY XGTIQNFGV CO QTKIKPCNGP $CPF OKV $CPFURCPIG   ō.'061,17-16ŋ6'66CH 4GKJG ++

 

8499

8502

8501 8500



(KPPKUEJ&GWVUEJGU0QTFHTQPV-TGW\#WUHÒJTWPIOKVUEJYCT\GOCKNNKGTVGO/GFCKNNQPHGNF XGTUKNDGTVVNYXGTIQNFGVGOCKNNKGTVCP5EJTCWDGOKV5EJTCWDUEJGKDG-&1 ++





#D\GKEJGP FGT 5EJWNG HÒT 4GUGTXGQHHK\KGTG $TQP\G XGTUKNDGTV VNY XGTIQNFGV WPF VNY GOCKNNKGTV CP   5EJTCWDGOKV5EJTCWDUEJGKDGOKV*GTUVGNNGTDG\GKEJPWPIō#$#4%-ŋ ++





$KGT\KRHGN OKV HKPPKUEJGO 9CRRGP 5KNDGT VNY GOCKNNKGTV CWH FGT 4ÒEMUGKVG ITCXKGTV ō4+56+4'6   -'.6#  ŋ WPF OGJTHCEJ RWP\KGTV W C *GTUVGNNGTRWP\G ō'4ŋ 5KNDGTRWP\G ō *ŋ WPF   ,CJTGURWP\Gō-ŋHÒT CO$CPFOKV$CPFURCPIGWPF-CTCDKPGTJCMGP ++



1TFGPUUEJPCNNGOKVXKGT#WU\GKEJPWPIGPCP&COGPUEJNGKHGP 1TFGPFGT(KPPKUEJGP9GK­GP4QUG <GKEJGPFGT(KPPKUEJGP9GK­GP4QUG5KNDGTVNYGOCKNNKGTVKPFGT¤UGOGJTHCEJRWP\KGTV WC,CJTG URWP\G ō2ŋ HÒT     /GFCKNNG ō241 $'0+0)#6' *7/#0#ŋ FGU (KPPKUEJGP 4QVGP -TGW\GU     5KNDGTPG 8GTFKGPUVOGFCKNNG FGU (KPPKUEJGP 4QVGP -TGW\GU 5KNDGT   9KPVGTMTKGIU6GKNPGJOGT   /GFCKNNG  HÒT CWUN·PFKUEJG (TGKYKNNKIG $TQP\G #P 0CFGNP /KV \WIGJÌTKIGT /KPKCVWTGP    UEJPCNNG 5VÒEM4++





&CU<GKEJGPFGT(KPPKUEJGP9GK­GP4QUGKUVGKPGUGJTUGNVGPXGTIGDGPGHKPPKUEJG#WU\GKEJPWPI

113


FRANKREICH

ex 8503





-QPXQNWV XQP FTGK HKPPKUEJGP #WU\GKEJPWPIGP   -TGW\ HÒT UEJYGFKUEJG (TGKYKNNKIG KO HKPPKUEJGP   9KPVGTMTKGI$TQP\GIGUEJY·T\VVNYXGTUKNDGTVVNYGOCKNNKGTVCWHFGT4ÒEMUGKVG*GTUVGN NGTDGK\G\GKEJPWPI FGT (KTOC 5RQTTQPI  %Q KP 5VQEMJQNO OKV /CVTKMGNPWOOGT ōŋ CO $CPF    $NCWGU-TGW\FGT(TGKYKNNKIGP8GTVGKFKIWPI$TQP\GGOCKNNKGTCO$CPF 9KPVGTMTKGIU6GKNPGJOGT /GFCKNNG  HÒT CWUN·PFKUEJG (TGKYKNNKIG 'KUGP IGUEJY·T\V CO QTKIKPCNGP $CPF OKV   $CPFURCPIGō-'066#4/'+,#ŋWPFIGMTGW\VGP5·DGNP 5VÒEM++



-QPXQNWVXQPHÒPHXGTUEJKGFGPGPHKPPKUEJGP#WU\GKEJPWPIGP&CTWPVGT$NCWGU-TGW\FGT(TGKYKNNK IGP8GTVGKFKIWPI/GFCKNNGō241$'0+0)#6'*7/#0#ŋFGU(KPPKUEJGP4QVGP-TGW\GU8GTFKGPUV OGFCKNNG FGU 8GTDCPFGU FGU (TGKYKNNKIGP 8GTVGKFKIWPIU8GTD·PFG (KPPKUEJG 8GTVGKFKIWPIU/GFCKNNG   &C\W'JTGP\GKEJGPFGU2QNPKUEJGP4QVGP-TGW\GU,GYGKNU$TQP\GGKPGXGTUKNDGTV\YGKGOCKNNKGTVFTGK OKVTÒEMUGKVKIGO6T·IGTPCOGPō%,2'45510ŋLGYGKNUCP$·PFGTP 5VÒEM++



8507

8506

8505

(4#0-4'+%*

<9'+6'5 (4#0<¤5+5%*'5-#+5'44'+%*   



-CKUGTNKEJGT 1TFGP FGT 'JTGPNGIKQP  /QFGNN   OKV 2QTVTCKV -CKUGT 0CRQN¾QPU + PCEJ   TGEJVUCWHFGO85WPFFGOMCKUGTNKEJGP#FNGTOKV-QRHPCEJNKPMUCWHFGO45/GFCKNNQPFKG&GMQ TCVKQP ÒDGTJÌJV XQP GKPGT JGTCNFKUEJGP PCRQNGQPKUEJGP -CKUGTMTQPG OKV #FNGTP  -QOOCPFGWTFGMQTC   VKQP )QNF GOCKNNKGTV  I OGJTGTG $GUEJ·FKIWPIGP CWH 8QTFGT WPF 4ÒEMUGKVG CO ·NVGTGP $CPF   CDUEJPKVV<- ++p++++++ 5V*GNGPC/GFCKNNG$TQP\GXGTUKNDGTV  CO\GKVIGPÌUUKUEJGP1TKIKPCNDCPF

++

 

&4+66'8+'46'70&(ª0(6' (4#0<¤5+5%*'4'27$.+- 5'+6  

0CVKQPCNGT1TFGPFGT'JTGPNGIKQP4GFWMVKQPFGT4KVVGTFGMQTCVKQPZOO5KNDGT/GFCKN NQPU)QNFGOCKNNKGTVOKP'OCKNNGCWUDTWEJKPGKPGT5RKV\G ++ #NU4GFWMVKQPPKEJVJ·WHKI

114




VEREINIGTES KÖNIGREICH

8510 8508

8511

ex 8509



1TFGPFGT$GHTGKWPI1TFGPUFGMQTCVKQP$TQP\GVNYNCEMKGTVCO$CPFFGU6[RU<-



1TFGPFGT$GHTGKWPI1TFGPUFGMQTCVKQP$TQP\GVNYNCEMKGTVCO$CPFFGU6[RU&C\WHÒPHYGKVGTG HTCP\ÌUKUEJG#WU\GKEJPWPIGPCP$·PFGTP 5VÒEM++





'TKPPGTWPIUOGFCKNNGHÒT%JKPC-QPXQNWVXQP\YGK'ZGORNCTGPGKPG\GKVIGPÌUUKUEJGWPF GKPGUR·VGTG#WUICDGCP$·PFGTPGKPGOKVWPFGKPGQJPG$CPFURCPIG 5VÒEM++





'JTGPMTGW\GKPGT*GT\,GUW$TWFGTUEJCHV$TQP\GXGTUKNDGTVCO$CPF



'ZGORNCTCWUWPUGTGT#WMVKQP1TFGPWPF'JTGP\GKEJGPCO1MVQDGT0T

++

++p



)4+'%*'0.#0&

<9'+6'5 -¤0+)4'+%*)4+'%*'0.#0&   

<YGK'TKPPGTWPIUOGFCKNNGPHÒTFGP)TKGEJKUEJ$WNICTKUEJGP-TKGI*GNNG$TQP\GCO$CPFOKV TQVGO/KVVGNUVTGKHGPOKV\YGK$CPFURCPIGPōΓ+#0+Σ6#ŋWPFō+Ω#00+0#ŋ WPFFWPMNG$TQP\GCO $CPF OKV YGK­ITÒPYGK­GO /KVVGNUVTGKHGP OKV \YGK $CPFURCPIGP ōΜΠΕΛΕΣŋ WPF ōΚΡΕΣΝΑ   ΤΣΟΥΜΑΓΙΑŋ ++

8514 8513



8517

8515 8516

8'4'+0+)6'5-¤0+)4'+%*810)4155$4+6#00+'0 70&014&+4.#0& 

&GT 5GJT *GTXQTTCIGPFG 1TFGT FGU +PFKUEJGP 'ORKTGU /KPKCVWT FGT &GMQTCVKQP FGT )GHQNIUNGWVG  

%QORCPKQP  %+'   /QFGNN DKU   )QNF GOCKNNKGTV CO $·PFEJGP OKV $CPFURCPIG 5KNDGT   XGTIQNFGV/; 4++





&GTUGJT#WUIG\GKEJPGVG1TFGPXQOJN/KEJCGNWPFXQOJN)GQTI/KPKCVWTFGT1TFGPUFGMQTCVKQP 5KNDGTXGTIQNFGVWPFGOCKNNKGTVHGKPUVG'OCKNNGOCNGTGKCO$·PFEJGPKO.GFGTGVWK/; ++





-TKO/GFCKNNG5KNDGT8QTFGTWPF4ÒEMUGKVGOKV5VGORGNUEJPGKFGTUKIPCVWTXQP99[QPQJPG6T· IGTPCOGP UQXGTNKGJGPCPPKEJVDTKVKUEJG5QNFCVGP OKVUGJTMWT\GO$CPFUVÒEM/; ++





5ÒFCHTKMC/GFCKNNGFGT-ÌPKIKP5KNDGTOKV4CPFPCOGPō2VG.(156'481.%Q[51((1.- 4')+ŋ 4CPFFGNNGP OKV FTGK XQP WTURTÒPINKEJ XKGT )GHGEJVUURCPIGP ō5176* #(4+%# ŋ   ō64#058##.ŋōŋWPFō%#2'%1.10;ŋQJPG$CPF/; ++



-CPCFKUEJGU )GHCNNGPGP'TKPPGTWPIUMTGW\  /QFGNN   5KNDGT CWH FGT 4ÒEMUGKVG )TCXWT   ō$%RN,$9'$56'4ŋCO$·PFEJGP/;# ++





115


VEREINIGTES KÖNIGREICH

8518 8519





8GTFKGPUVOGFCKNNGFGT8GTGKPKIWPIFGT*QHNKGHGTCPVGP/QFGNNOKV2QTVCKV-ÌPKI)GQTI85KNDGTPG /GFCKNNG 5KNDGT CWH FGT 4ÒEMUGKVG 6T·IGTPCOG ō)GQTIGU 4QDKPGVŋ WPF 8GTNGKJWPIUFCVWO ō #RTKN   ŋCO$CPFOKV6TCIGURCPIG 4++



)TQ­G1TFGPUEJPCNNGFGU.GWVPCPVU4/CE&QPPGNNFGT4Q[CN/CTKPGUOKVHÒPH#WU\GKEJPWPIGP    5VGTP   $TKVKUEJG -TKGIUOGFCKNNG  5KNDGT   +PVGTCNNKKGTVG 5KGIGUOGFCKNNG   8GTVGKFKIWPIUOGFCKNNG    -TKGIUOGFCKNNG  &KG GTUVGP FTGK OKV 6T·IGTPCOGP   ō.+'764/#%&100'..4/ŋ#P0CFGN 5VÒEM++



5EJPCNNGGKPGU.GWVPCPVUFGT-ÌPKINKEJGP/CTKPG+PHCPVGTKGWPF8GVGTCPGPDGKFGT9GNVMTKGIG

8520 8523



1TFGPUUEJPCNNGGKPGU-CPCFKUEJGP5QNFCVGPOKVHÒPH#WU\GKEJPWPIGP 5VGTP (TCPM TGKEJ WPF &GWVUEJNCPF5VGTP   8GTVGKFKIWPIUOGFCKNNG  5KNDGT   /GFCKNNG HÒT HTGKYKNNKIG   -CPCFKGT5KNDGT -TKGIUOGFCKNNG5KNDGTCP0CFGN 5VÒEM++



-QPXQNWV XQP UGEJU #WU\GKEJPWPIGP &CTWPVGT 5GTXKPI $TQVJGT FGU 1TFGTU QH 5V ,QJP +ORGTKCN   5GTXKEG/GFCN)GQTI8WPF#WUICDG-TÌPWPIUOGFCKNNGWPF$CTTKPIVQP-GPPGVV6TQRJ[ /GFCKNNGFGT4Q[CN#KT(QTEG#WEJ-QRKGPOGKUV5KNDGTVGKNUOKV4CPFPCOGPVGKNUCP$·PFGTPFTGK KP'VWKU&C\WPKEJVVTCIDCTG,WDKN·WOUOGFCKNNGFGT0CVKQPCN.KHG$QCV+PUKVWVKQP 5VÒEM++





-QPXQNWVXQPUGEJU#WU\GKEJPWPIUOKPKCVWTGPLGYGKNUOKV5RCPIG%#0#&#8GTUEJKGFGPG/GVCNNG CWEJ5KNDGTCP$·PFEJGP 5VÒEM++





)GUEJGPMPCFGN-ÌPKIKP'NKUCDGVJUXQP)TQ­DTKVCPPKGP)QNFVNYGOCKNNKGTVVNYDGUGV\VOKV6ÒTMK UGPWPF2GTNGPCP0CFGNKOQTKIKPCNGPOKVIQNFHCTDGPGT-ÌPKIUMTQPGDGFTWEMVGP8GTNGKJWPIUGVWKFGT (KTOC%QNNKPIYQQF%QKP.QPFQP ++





'NK\CDGVJ $QYGU.[QP   CWU FGT (COKNKG FGT 'CTNU XQP 5VTCVJOQTG WPF -KPIJQTPG JGKTCVGVG  2TKP\   #NDGTV *GT\QI XQP ;QTM   5QJP -ÌPKI )GQTIU 8   WPF LÒPIGTGT $TWFGT FGU 2TKP\GP XQP   9CNGU 'FYCTF   #NU FKGUGT  CDFCPMVG YWTFG KJT /CPP WPVGT FGO 0COGP )GQTI 8+ -ÌPKI XQP   )TQ­DTKVCPPKGP WPF -CKUGT XQP +PFKGP WPF UKG -ÌPKIKP WPF -CKUGTKP 5GKV FGO ÒDGTTCUEJGPFGP 6QF -ÌPKI )GQTIU   8+WPFFGO4GIKGTWPIUCPVTKVVKJTGT·NVGUVGP6QEJVGT'NKUCDGVJ++PCJOUKGCNU-ÌPKIKPOWVVGTCOÌHHGPVNKEJGP .GDGPVGKNUVCTDFKGUGJTRQRWN·TGō3WGGP/WOŋKO#NVGTXQP,CJTGP

116


VEREINIGTES KÖNIGREICH

8526

8525 8524







<KICTGVVGP'VWK\WO4GCT%QOOQFQTGU2TK\G5KNDGTVNYGOCKNNKGTVOKV)TCXWTō4GCT%QOOQ FQTGU2TK\G9QPD[42)QUPGNNŋ'OCKNNGOCNGTGKKPPGPXGTIQNFGVOKV,CJTGURWP\Gō2ŋFGT5VCFV %JGUVGTHÒT ++



$TKVKUEJGT (TGKOCWTGTKUEJGT 1TFGP FGT 6GORGNTKVVGT $TWUVUVGTP 5KNDGT DTKNNCPVKGTV VNY GOCKNNKGTV   CWHFGT4ÒEMUGKVG*GTUVGNNGTRWP\Gō)-ŋFGT(KTOC-GPPKPIWPF.QPFQPGT,CJTGURWP\GōDŋHÒTCP 0CFGN ++



$TKVKUEJGT (TGKOCWTGTKUEJGT 1TFGP FGT 6GORGNTKVVGT $TWUVUVGTP $TQP\G XGTUKNDGTV VNY GOCKNNKGTV   CWHFGT4ÒEMUGKVG*GTUVGNNGTRWP\Gō)-5ŋFGT(KTOC-GPPKPIWPF5RGPEGTCP0CFGN ++



8527

8528



#D\GKEJGPGKPGT(TGKOCWTGT.QIG8GTUKNDGTVVNYXGTIQNFGVWPFGOCKNNKGTVCO$CPFOKVOGJTGTGP $CPFURCPIGPKO1TKIKPCNGVWKFGT(KTOC6,$TCIIKP$KTOKPIJCO ++





#D\GKEJGP FGT .QIG ō5V )GQTIG HQT 'PINCPFŋ $TQP\G XGTIQNFGV WPF GOCKNNKGTV CO $CPF OKV   GOCKNNKGTVGT#WHNCIG ++

 117


INTERNATIONALE UND GESELLSCHAFTSORDEN

8530

8531 8529

+06'40#6+10#.'70&)'5'..5%*#(6514&'0 

#TCWMCPKGP WPF 2CVCIQPKGP-ÌPKINKEJGT1TFGPXQO-TGW\FGU5ÒFGPU/QFGNN OKV4GXGTUKP UEJTKHVō#4#7%#0+'2#6#)10+'ŋPCEJ 1HHK\KGTUMTGW\5KNDGTXGTIQNFGVWPFGOCKNNKGTVCWH FGO6TCIGUVGIHTCP\ÌUKUEJG)CTCPVKGRWP\GHÒT5KNDGTXQPDKU ō9KNFUEJYGKPMQRHŋ COQTKIK PCNGP$CPFOKV4QUGVVG005HH 44++



1TNNKG#PVQKPG FG 6QWPGPU   UGNDUVGTPCPPVGT -ÌPKI 1TNNKG#PVQKPG + XQP #TCWMCPKGP WPF 2CVCIQPKGP   UVKHVGVGFGP1TFGPPCEJKP2CTKU /QFGNN WOUGKPG7PVGTUVÒV\GTKPUGKPGO6JTQPCPURTWEJ\WDGNQJPGP5GKP 0CEJHQNIGT#EJKNN+ )WUVCXG#EJKNNG.CXKCTFGXGTUVQTDGPKP2CTKU ÒDGTPCJOFGP1TFGPOKVNGKEJVGP8GT·P FGTWPIGP LGV\VOKV4GXGTUKPUEJTKHVō#4#7%#0+'2#6#)10+'ŋ/QFGNN 





#TCWMCPKGP WPF 2CVCIQPKGP-ÌPKINKEJGT1TFGPXQO-TGW\FGU5ÒFGPU/QFGNN OKV4GXGTUKP UEJTKHV #4#7%#0+' 2#6#)10+'  PCEJ   4KVVGTMTGW\ 5KNDGT XGTIQNFGV -TQPG KO /GFCKNNQP   )QNF GOCKNNKGTV OGJTGTG 'OCKNNGUEJ·FGP KP FGP -TGW\CTOURKV\GP CO QTKIKPCNGP $CPF 00 5HH   44+++p+8



#TCWMCPKGPWPF2CVCIQPKGP-TGW\FGT)GUGNNUEJCHVFGTOKVFGT/GFCKNNGXQO-TGW\FGU5ÒFGPU $GNKGJGPGP #DVGKNWPI HÒT %JTKUVGP 4KVVGTMTGW\ 5KNDGT XGTIQNFGV OGJTGTG *CCTTKUUG KP FGT YGK­GP   'OCKNNGCOQTKIKPCNGP$CPF 444++



&KG)GUGNNUEJCHVFGTOKVFGT/GFCKNNGXQO-TGW\FGU5ÒFGPU$GNKGJGPGPKUVKPFGT4GIKGTWPIU\GKVō-ÌPKIŋ XQP DKU   #EJKNNU + XQP #TCWMCPKGP WPF 2CVCIQPKGP CWU FGT XQP -ÌPKI 1TNNKG#PVQKPG + IGITÒPFGVGP -ÌPKINKEJGP   )GUGNNUEJCHV XQO -TGW\ FGU 5ÒFGPU =5QEK¾V¾ 4Q[CNG FG NC %QPUVGNNCVKQP FW 5WF? JGTXQTIGICPIGP &KG )GUGNNUEJCHV   FKG UKEJ UQYQJNFGT9CJTWPIFGT6JTQPCPURTÒEJGFGULGYGKNKIGP-ÌPKIUXQP#TCWMCPKGPWPF2CVCIQPKGPYKGCWEJ RJKNCPVJTQRKUEJGP #WHICDGP YKFOGVG YCT DKU \WO 8QTCDGPF FGU <YGKVGP 9GNVMTKGIU CMVKX /KEJGN )QPVKGT WPF   &CPKGN4GPCWFUGKHÒTFKGUG+PHQTOCVKQPGPJGT\NKEJIGFCPMV 

8532



8533

8532

#TCWMCPKGPWPF2CVCIQPKGP8GTFKGPUVOGFCKNNG-ÌPKI2JKNKRRU+XQP#TCWMCPKGPWPF2CVCIQPKGP )QNFGPG8GTFKGPUVOGFCKNNG$TQP\GXGTIQNFGVOKV5VGORGNUEJPGKFGTUKIPCVWTō,*%1'((+0ŋCOQTKIK PCNGP$CPF 444++



#O/CKXGT\KEJVGVGFGTHÒPHVG-ÌPKI#PVQKPG+++ ,CESWGU#PVQKPG$GTPCTF XQP#TCWMCPKGPWPF2CVCIQ PKGP CWH UGKPG 6JTQPTGEJVG \W )WPUVGP XQP 2TKP\ 2JKNKRRG 2JKNKRRG $QKT[  FGT UQOKV CNU -ÌPKI 2JKNNKRR + FGT   UGEJUVGō/QPCTEJŋYWTFG



-ÌPKINKEJGT1TFGPFGTJGKNKIGP-CVJCTKPCXQO$GTIG5KPCK4KVVGTMTGW\5KNDGTVNYXGTIQNFGV/G FCKNNQPCWHNCIGP )QNF GOCKNNKGTV CO QTKIKPCNGP &TGKGEMUDCPF KO QTKIKPCNGP 8GTNGKJWPIUGVWK 00   5HH + $GUQPFGTUHTÒJGWPFHGKPG#PHGTVKIWPIUSWCNKV·V

118




INTERNATIONALE UND GESELLSCHAFTSORDEN

8534



/KNKV·TKUEJGT*QURKVCN4KVVGTQTFGPXQOJN.C\CTWUXQP,GTWUCNGO1DQGFKGP\XQP/CNVC5GVGKPGU ,WUVK\)TQ­MTGW\GUDGUVGJGPFCWU-NGKPQF5KNDGTXGTIQNFGVWPFGOCKNNKGTVOKP#DURNKVVGTWPIKOTÃ&#x2019;EM UGKVKIGP/GFCKNNQPTKPIWPF$TWUVUVGTP5KNDGT IGRTÃ&#x2019;HV XGTIQNFGVVNYGOCKNNKGTV-QTTQUKQPUURWTGPCP 0CFGNOKV\YGK5GKVGPJCMGPWPF,WUVK\-TGW\XGTIQNFGVWPFGOCKNNKGTVCP0CFGN$;5 5VÃ&#x2019;EM++

8537











8535 8538

/KNKV·TKUEJGT*QURKVCN4KVVGTQTFGPXQOJN.C\CTWUXQP,GTWUCNGO1DQGFKGP\XQP/CNVC$TWUVUVGTP FGT,WUVK\-NCUUG5KNDGTXGTIQNFGVVNYGOCKNNKGTVOKP#DURNKVVGTWPIKO/GFCKNNQPTKPICP0CFGNOKV \YGK5GKVGPJCMGP$;5H ++



/KNKV·TKUEJGT*QURKVCN4KVVGTQTFGPXQOJN.C\CTWUXQP,GTWUCNGO1DQGFKGP\XQP/CNVC#D\GKEJGP GKPGU5QEKWUWPF5CPEVK.C\CTK$TQP\GXGTUKNDGTVVNYGOCKNNKGTVCO*CNUDCPF&C\W\YGK'TKPPGTWPIU OGFCKNNGP /CNVC5CN\DWTI WPFUKNDGTPG8GTFKGPUVOGFCKNNGLGYGKNUCP$·PFGTPUQYKGCEJV 'RCWNGVVGP#WHNCIGP 5VÃ&#x2019;EM++



/KNKV·TKUEJGT*QURKVCN4KVVGTQTFGPXQOJN.C\CTWUXQP,GTWUCNGO-TGW\HÃ&#x2019;T8GTFKGPUV4KVVGT -PKIJV %QORCPKQP  XGTIQNFGV WPF GOCKNNKGTV CO *CNUDCPF KO 1TKIKPCNGVWK FGT (KTOC 6Q[G -GPPKPI    5RGPEGTKP.QPFQP$;5 4++



/KNKV·TKUEJGT *QURKVCN4KVVGTQTFGP XQO JN .C\CTWU XQP ,GTWUCNGO -TGW\ HÃ&#x2019;T 8GTFKGPUV-QOOCP   FGWTG %QOOCPFGT %QORCPKQP  XGTUKNDGTV WPF GOCKNNKGTV CO *CNUDCPF KO 1TKIKPCNGVWK FGT (KTOC   6Q[G-GPPKPI5RGPEGTKP.QPFQP$;5 4++

 119


INTERNATIONALE UND GESELLSCHAFTSORDEN

8539 1:1 8540



8541

8542

/KNKV·TKUEJGT*QURKVCN4KVVGTQTFGPXQOJN.C\CTWUXQP,GTWUCNGO1DQGFKGP\XQP2CTKU/KPKCVWT GKPGU,WUVK\)TQ­QHHK\KGTU)QNF  GOCKNNKGTVCO$·PFEJGPOKVCWHIGNGIVGTIQNFGPGTWPFUKNDGTPGT.KV\G WPF4QUGVVG 44++



/KPKCVWTGPFGU1TFGPUKPGEJV)QNFUKPFXQPCNNGTITÌ­VGT5GNVGPJGKV



1TFGPFGUJN-QPUVCPVKPFGU)TQ­GP-QOOCPFGWTMTGW\XGTIQNFGVWPFGOCKNNKGTVCO*CNUDCPF



7PDGMCPPVGT -QPUVCPVKP1TFGP 1HHK\KGTUMTGW\ $TQP\G XGTIQNFGV WPF GOCKNNKGTV OKV -QTTQUKQPU   URWTGPCO$CPFOKV4QUGVVGOKV/KPKCVWT$TQP\GXGTIQNFGVWPFGOCKNNKGTVCO$·PFEJGPOKV4QUGVVG 5VÒEM++



1TFGPFGU#NVGP#FGNUQFGTFGT8KGT4ÌOKUEJGP-CKUGT/QFGNN  -QOVWTMTGW\5KNDGT XGTIQNFGVWPFGOCKNNKGTVOGJTGTG'OCKNNGEJKRU&KG$WEJUVCDGPCWHFGP-TGW\CTOGPXGTDNC­V ++





++



&GT UQPUV PKEJV DGMCPPVG (TKGFTKEJ-CTN 'UDCEJ ITÒPFGVG  GKPGP ŋ5V )GQTIUDWPF &GWVUEJGT 'FGNNGWVG WPF   2CVTK\KGTIGPCPPV4KVVGTDWPFXQP5V)GQTIŌFGTKOINGKEJGP,CJTGKP,CJTDWEJJGTCWUICDICDUKEJFGT$WPF WPVGT UGKPGO )QWXGTPGWT )TCH $GTPJCTF \W 5VQNDGTI5VQNDGTI 5VCVWVGP WPF FGP PGWGP 0COGP ŋ#NVGT 5V)GQTIU   4KVVGTQTFGPCWEJ1TFGPFGTXKGT4ÌOKUEJGP-CKUGTIGPCPPVŌ5GKP<KGNYCTFKGVTCFKVKQPGNNGCDGPFN·PFKUEJEJTKUV NKEJG )GUKPPWPI \W RHNGIGP 0COJCHVG 2GTUQPGPYKGFKGGJGOCNKIGPÌUVGTTGKEJKUEJGP$WPFGUMCP\NGT'TPUV5VTGGTX 5VTGGTWYKV\WPF-WTVX5EJWUEJPKIIYCTGP/KVINKGFGT&GT1TFGPYWTFGKP&GWVUEJNCPFXGTDQVGPCWEJ KP ¤UVGTTGKEJ &KG 1TFGPUKPUKIPKGP YCTGP GKPG /QFGTPKUKGTWPI FGU WTURTÒPINKEJGP 1TFGPU FGT 8KGT -CKUGT &GT   1TFGPICDGKPŋ0CEJTKEJVGPDNCVVŌJGTCWU

8544 8543



1TFGPFGT&QTPGPMTQPG-QOOCPFGWTMTGW\5KNDGTXGTIQNFGVWPFGOCKNNKGTV\YGKMNGKPG'OCKNNGTGRC TCVWTGPWPFGKPKIG*CCTTKUUGKPFGTYGK­GP'OCKNNGCWHFGT4ÒEMUGKVG*GTUVGNNGTRWP\Gō6(ŋ5VCFVRWP\G XQP$KTOKPIJCOWPF,CJTGURWP\Gō$ŋHÒTCO*CNUDCPF ++



'ZGORNCT CWU WPUGTGT  #WMVKQP 1TFGP WPF 'JTGP\GKEJGP CO  1MVQDGT  0T  FCXQT GZ #WMVKQP    1TFGPCWUCNNGT9GNV5COONWPI6COOCPPFGT7$5KP$CUGNCOWPF0QXGODGT.QV0T

 120

1TFGP0KCPJ0CUM)TQ­MTGW\UGVDGUVGJGPFCWU-NGKPQF$TQP\GXGTIQNFGVWPFGOCKNNKGTVCO5EJWN VGTDCPFWPF$TWUVUVGTPXGTIQNFGVWPFGOCKNNKGTVCP0CFGNOKV\YGK5GKVGPJCMGP 5VÒEM++




INTERNATIONALE UND GESELLSCHAFTSORDEN

8547 8545

8546



1TFGP0KCPJ0CUM)TQ­UVGTPō(ÒTJGTXQTTCIGPFG8GTFKGPUVGŋXGTIQNFGVWPFGOCKNNKGTVCP0CFGNKO QTKIKPCNGP8GTNGKJWPIUGVWKFGT(KTOC%GLCNXQKP/CFTKF ++





7PKXGTUGNNGT1TFGPFGT4KVVGTFGU9GKPU1TFGPU\GKEJGPKP(QTOGKPGU2TQDKGTIGH·­GU$TQP\GXGT IQNFGVCO*CNUDCPFWPF8GTFKGPUVMTGW\FGU1TFGPUXGTIQNFGVWPFGOCKNNKGTVCO*CNUDCPF  5VÒEM++



1TFGP FGT 5EJYCPGPTKVVGT FGU JN )GQTI *CNUMTGW\ XGTIQNFGV WPF GOCKNNKGTV CO *CNUDCPF KP   5EJCEJVGN ++





8548



)TQ­G5EJPCNNGOKVUGEJUKPVGTPCVKQPCNGP1TFGPWPF'JTGP\GKEJGP&CTWPVGT%TQKZ#NNK¾U/¾FCKNNG F 'WTQRGRQNPKUEJGU'TKPPGTWPIUMTGW\WPF5RJKPZ-TGW\<WUCOOGPOQPVKGTV 5VÒEM++

 121


ISLAND

8549



/KPKCVWTGPUEJPCNNGOKVPGWP/KPKCVWTGPKPVGTPCVKQPCNGT1TFGPWPF'JTGP\GKEJGP&CTWPVGT2QNPK UEJGU8GTFKGPUVMTGW\(TCP\ÌUKUEJG-TKGIUGTKPPGTWPIUOGFCKNNG-TGW\FGT#PEKGPU%QODCV VCPVUF 'WTQRGRQNPKUEJGU'TKPPGTWPIUMTGW\%TQKZ#NNK¾UWPF/¾FCKNNGF 'WTQRG#P0CFGN  5VÒEM++



8550



/KPKCVWTGPUEJPCNNGOKVPGWP/KPKCVWTGPKPVGTPCVKQPCNGT1TFGPWPF'JTGP\GKEJGP&CTWPVGT1TFGP 0KCPJ 0CUM 5KNDGTPGU -TGW\ 8KTVWVK/KNKVCTK .C\CTWU1TFGP 8GTFKGPUVMTGW\ FGU ,CRCPKUEJGP 4QVGP   -TGW\GU 8GTFKGPUVMTGW\ FGU .C\CTWU1TFGPU .KRRKUEJGU 8GTFKGPUVMTGW\ WPF 1TFGP FGT 4KVVGT XQP   /CNVC/QPVKGTVKPEQWTVUV[NGCP0CFGN 5VÒEM++



8551 8552

+5.#0& -¤0+)4'+%*+5.#0&   

-ÌPKINKEJ DKU   +UN·PFKUEJGT (CNMGPQTFGP  /QFGNN   OKV -ÌPKIMTQPG  -QOOCP   FGWTMTGW\5KNDGTXGTIQNFGVWPFGOCKNNKGTVCOMWT\GP$CPFCDUEJPKVV<- ++



#O  ,WNK  JCV -ÌPKI %JTKUVKCP : XQP &·PGOCTM WPF +UNCPF FGP FTGKMNCUUKIGP CNNIGOGKPGP 8GTFKGPUVQTFGP   IGUVKHVGV YQDGK FKG  -NCUUG KP \YGK 5VWHGP WPVGTVGKNV YCT 0CEJFGO FCU .CPF  UGKPG XÌNNKIG 7PCDJ·PIKIMGKV   GTNCPIV WPF UKEJ \WT 4GRWDNKM GTMN·TV JCVVG GTJKGNV FGT 1TFGP CO  ,WNK FGU INGKEJGP ,CJTGU PGWG 5VCVWVGP 8IN   CWEJ 6JQTNCEKWU $KTIKT ›UNGPUM *GKFWTUOGTMK *±UMÉNCÐVI±HCP  7PF -NKGVOCPP -WTV) +UNCPF  +UN·PFK   UEJGT(CNMGPQTFGP+P1TFGPU.GZKMQP$CPF$GTNKPQ, 



-ÌPKINKEJ DKU +UN·PFKUEJGT(CNMGPQTFGP/QFGNN OKV-ÌPKIMTQPG 4KVVGTMTGW\ 5KNDGTXGTIQNFGVWPFGOCKNNKGTVQJPG$CPF<- 4++ &KG4KVVGTMTGW\GFGU/QFGNNUUKPFYGKVCWUUGNVGPGT\WHKPFGPCNUFKG-QOOCPFGWTMTGW\G

122




ITALIEN

+6#.+'0 +6#.+'0-¤0+)4'+%*$'+&'45+<+.+'0 

$WEJ &GNN  +PUGIPG 4GCN 1TFKPG FK 5 (GTFKPCPFQ G FGN /GTKVQ 0GCRGN   5GKVGP WPF   5VKEJVCHGNPIGDWPFGP/KV'KIGPVWOU5VGORGN-ÌPKI.QWKU0CRQN¾QPXQP*QNNCPF 4++



8555

8554

+6#.+'0-¤0+).+%*'(#/+.+'$174$10$'+&'5+<+.+'0 5'+6  

1TFGPXQOJGKNKIGP,CPWCTKWU$TWUVUVGTPFGT1TFGPUTKVVGT5KNDGTVNYXGTIQNFGVWPFGOCKNNKGTVOGJ TGTG'OCKNNGCDRNCV\WPIGP ++p+++



#PHGTVKIWPICWUFGONGV\VGP&TKVVGNFGU<YCP\KIUVGP,CJTJWPFGTVU

-¤0+)4'+%*+6#.+'0   

/KNKV·T1TFGP XQP 5CXQ[GP   /QFGNN   ·NVGTG <YGKVCPHGTVKIWPI GKPGU )TQ­MTGW\UGVU   DGUVGJGPFCWU-NGKPQF$TQP\GXGTIQNFGVWPFGOCKNNKGTVCOMWT\GP$CPFUVÒEMFGU4KVVGTMTGW\GUWPF $TWUVUVGTP$TQP\GDTKNNCPVKGTVWPFXGTUKNDGTVVNYXGTIQNFGVWPFGOCKNNKGTVCP0CFGN ++



<GKVIGPÌUUKUEJGWPFUEJYGTG#PHGTVKIWPI

8556



1TFGP FGT -TQPG XQP +VCNKGP )TQ­QHHK\KGTUUGV DGUVGJGPF CWU )TQ­QHHK\KGTUMTGW\ )QNF GOCKNNKGTV   $CPFTKPI HGJNV OKV QTKIKPCNGO *CNUDCPF WPF $TWUVUVGTP 5KNDGT DTKNNCPVKGTV )QNF GOCKNNKGTV CWH FGT   4ÒEMUGKVG*GTUVGNNGTDG\GKEJPWPIFGT(KTOC%TCXCP\QNC5WEE4CXKQNQ)CTFKPQKP4QOCP0CFGNKO QTKIKPCNGP OKV IQNFHCTDGPGO /QPQITCOO -ÌPKI 8KMVQT 'OCPWGNU +++ TGI XQP  DKU   DG   FTWEMVGP8GTNGKJWPIUGVWKFGT(KTOC.4CXKQNQ')CTFKPQ5WEEGUUQTK&EQ%TCXCP\QNCOKVDGUEJ·FKI VGO8GTUEJNW­<- 5VÒEM++



)GUVKHVGVXQP-ÌPKI8KMVQT'OCPWGN++  CO(GDTWCTCWU#PNC­FGT*QEJ\GKVFGU-TQPRTKP\GP *WODGTVOKV2TKP\GUUKP/CTIGTKVCXQP5CXQ[GP)GPWCCNUHÒPHMNCUUKIGTCNNIGOGKPGT8GTFKGPUVQTFGP0CEJ#DUEJCH HWPI FGT /QPCTEJKG XQO 5VCCV PKEJV OGJT XGTNKGJGP YWTFG GT LGFQEJ GTUV OKV )GUGV\ 0T  XQO  /·T\    FGO 5VKHVWPIUIGUGV\ \WO 8GTFKGPUVQTFGP FGT +VCNKGPKUEJGP 4GRWDNKM GTNCUUGP XQP 2T·UKFGPV .WKIK 'KPCWFK  

 HQTOGNNCDIGUEJCHHV#NNGTFKPIUJCVKJPFGTGZKNKGTVG-ÌPKI*WODGTV++XQP+VCNKGP  DKU\W UGKPGO6QFGHÒTKJORGTUÌPNKEJIGNGKUVGVG&KGPUVGXGTNKGJGP

123


REPUBLIK LITAUEN

8558 1:1 8557



1TFGP FGT -TQPG XQP +VCNKGP 4KVVGTMTGW\ HTÒJG MNGKPG #WUHÒJTWPI )QNF GOCKNNKGTV  I OKV   $CPF OKP'OCKNNGEJKRGKPGT5RKV\GCWHFGT4ÒEMUGKVGFGUTGEJVGP-TGW\CTOUCOQTKIKPCNGP&TGKGEMU DCPF KO MNGKPGP QTKIKPCNGP 5COVGVWK FGT (KTOC %TCXCP\QNC 5WEE (TCVGNNK $QTCPK KP 4QO OKV GVYCU   DGTKGDGPGOIQNFHCTDGPGO/QPQITCOO-ÌPKI7ODGTVQU+ TGIKGTVGXQPDKU <- 4++



'ZGORNCTGCWUFGT4GIKGTWPIU\GKV-ÌPKI7ODGTVQU+UKPFPWTUGNVGP\WHKPFGP



1TFGP FGT -TQPG XQP +VCNKGP /KPKCVWT FGU 4KVVGTMTGW\G )QNF GOCKNNKGTV  I QJPG $CPFTKPI WPF   QJPG$·PFEJGP ++



5GJTHGKPG#PHGTVKIWPIWO

8561 8560

8559

4'27$.+-.'66.#0&

'456' 4'27$.+-.'66.#0&   



1TFGPFGT&TGK5VGTPG/QFGNN  -TGW\-NCUUG5KNDGTXGTIQNFGVWPFGOCKNNKGTVFKG FTGK5VGTPG)QNFCWHFGT4ÒEMUGKVGFGT#WHJ·PIWPIOGJTHCEJRWP\KGTV WC*GTUVGNNGTRWP\Gō(/ŋHÒT FKG (KTOC 9 ( /ÒNNGT KP 4KIC WPFGT5KNDGTRWP\G COQTKIKPCNGP$CPFOKVCWHIGNGIVGT4QUGVVG <- ++



(GWGTYGJT#D\GKEJGP$TQP\GXGTUKNDGTVCP5EJTCWDGOKV5EJTCWDUEJGKDGFKGUGOKV*GTUVGNNGTDG\GKEJ PWPIFGT(KTOC(/ÒNNGTKP4KICWPF0WOOGT ++



4'27$.+-.+6#7'0 

1TFGPFGU)TQ­HÒTUVGP)GFKOKPCU/QFGNN OKVPKEJVGOCKNNKGTVGT4ÒEMUGKVG -NGKPQF FGT  -NCUUG  Z  OO 5KNDGT VGKNYGKUG XGTIQNFGV WPF GOCKNNKGTV CO $CPFCDUEJPKVV \WT   -NCUUG<- 4++ 0CEJ8-CXCNKCWUMCU KP-85 KUVFGT1TFGPXQPDKU#PHCPIPWTOCNKPFGT-NCUUGXGTNKGJGP YQTFGP&GTHÒPHMNCUUKIGCNNIGOGKPG8GTFKGPUVQTFGPYWTFGCO(GDTWCTXQP2T·UKFGPV5OGVQPCIGUVKHVGV &CU \YGKVG /QFGNN WPVGTUEJGKFGV UKEJ XQO GTUVGP W C FCTKP FC­ JKGT DGK FGP +PUKIPKGP FKG 4ÒEMUGKVG PKEJV   GOCKNNKGTVKUV/KVFGT#PPGMVKQP.KVCWGPUFWTEJFKG5QYLGVWPKQPJÌTVGFGT1TFGPCWH\WDGUVGJGP/KV)GUGV\ XQO5GRVGODGTYWTFGGTXQPVJGNKVCWKUEJGP4GIKGTWPIYKGFGTKPU.GDGPIGTWHGP

124




MALTA

8563

8562



1TFGP FGU )TQ­HÒTUVGP )GFKOKPCU  /QFGNN OKV GOCKNNKGTVGT 4ÒEMUGKVG    &GMQTCVKQP   FGT-NCUUG5KNDGTVNYXGTIQNFGVWPFGOCKNNKGTVCOCNVGP1TKIKPCNDCPF<- ++



0CEJ8-CXCNKCWUMCU KP-85 KUVFGT1TFGPKPUIGUCOVPWTOCNKPFGT-NCUUGXGTNKGJGPYQTFGPFCXQP OCNCP#WUN·PFGT

/#.6'5'414&'0 5178'40'4/#.6'5'44+66'414&'0 5178'40'44+66'470& *152+6#.14&'081/*.,1*#00'5<7,'475#.'/8104*1&15 70&810/#.6#  

1TFGPUKPUKIPKGP +PVGTPCVKQPCNG (QTO OKV .KNKGP \YKUEJGP FGP -TGW\CTOGP   #WUHÒJTWPI       -NCUUG  )TCF -TGW\ FGT &GXQVKQPU&QPCVGP  -NCUUG   5KNDGT XGTIQNFGV WPF   GOCKNNKGTVCO&TGKGEMUDCPF 4++



.CWV2TQEJ±\MC KP2415 JCPFGNVGGUUKEJDGKFGP-TGW\GPFGT&GXQVKQPUFQPCVGP\WP·EJUVWO'JTGPMTGW\G HÒT1TFGPUDGCOVGWPF5VKHVGT5KGYWTFGPKP\YGK-NCUUGPIGUEJCHHGPFKGWOGKPGFTKVVG-NCUUGGTI·P\V YWTFGP #TVKMGN  FGU %QFGZ XQO  #WIWUV  URTKEJV XQP 8GTFKGPUVGP DGUQPFGTGT #TV KO &KGPUVG FGT FGO   1TFGPIGJÌTKIGP9GTMGFKGHÒTGKPG#WHPCJOGWPVGTFKG&GXQVKQPUFQPCVGPXGTNCPIVYGTFGP/KVFGT2TQOWNICVKQP FGTPGWGP8GTHCUUWPIWPFFGUPGWGP%QFGZFGU1TFGPUCODKU#RTKNYWTFGPFKG&GXQVKQPUFQPCVGPCWH GKPG -NCUUG TGFW\KGTV FGTGP &GMQTCVKQP FGO HTÒJGTGP -TGW\ FGT &GXQVKQPUFQPCVGP  -NCUUG GPVURTKEJV  YQDGK   PWPOGJTCWEJ&COGP#WHPCJOGHKPFGPMÌPPGP&KGDKUJGTKIGWPF-NCUUGFGT&GXQVKQPUFQPCVGPYWTFGCDIG UEJCHHV

8564 1:1





8566 8565 1:1

1TFGPUKPUKIPKGP FGT ōHTCP\ÌUKUEJGP <WPIGŋ OKV .KNKGPMTQPG   WPF  #WUHÒJTWPI      -NCUUG  4CPI /KPKCVWT FGU -TGW\GU FGT 'JTGP WPF &GXQVKQPUTKVVGT 5KNDGT XGTIQNFGV WPF   GOCKNNKGTVCO$·FEJGPOKVCWHIGNGIVGT4QUGVVG ++



1TFGPUKPUKIPKGP FGT ōHTCP\ÌUKUEJGP <WPIGŋ OKV .KNKGPMTQPG   WPF  #WUHÒJTWPI      -NCUUG  4CPI /KPKCVWT FGU -TGW\GU FGT )PCFGP WPF /CIKUVTCVUTKVVGT )QNF GOCKNNKGTV CO   $·FEJGPOKVCWHIGNGIVGTUKNDGTHCTDGPGT.KV\GWPF4QUGVVG 4++



/KPKCVWTGPKPGEJV)QNFUKPFUGNVGP\WHKPFGP



8GTFKGPUVOGFGFCKNNG FGU 1TFGPU ō(ÒT /CNVGUKUEJGU 8GTFKGPUVŋ 5KNDGTPG /GFCKNNG 5KNDGT   CO   UEJYCT\GP$CPF<- ++



(TÒJG#WUHÒJTWPIKPGEJV5KNDGT

125


KÖNIGREICH DER NIEDERLANDE

Punze

8567

8568

Punze

8567

/106'0')41 (ª456'067/70&-¤0+)4'+%*/106'0')41   

1TFGP FGU (ÒTUVGP &CPKNQU + =1ðäåí Êíüàçà Äàíèëà +? /QFGNN EC -TGW\WPF -NCUUG#WUHÒJTWPIOKVFGT/GFCKNNQPWOUEJTKHVÊÍßÇÚ ÖÐÍÎÃÎÐÑÊ+Èŋ=(ÒTUVXQP/QPVGPGITQ? CWH FGT 8QTFGTUGKVG 5KNDGT GOCKNNKGTV 6GKNGFGT#WHNCIGP)QNFªDGTJÌJWPI5KNDGTXGTIQNFGVCWHFGT 4ÒEMUGKVGFGT-TQPGP2GPFKNKGPTWUUKUEJG/GKUVGTOCTMGÈÐWPF5V2GVGTUDWTIGT2WP\GHÒT<QNQV PKMK5KNDGTXQPDKU COQTKIKPCNGP&TGKGEMUDCPFFGT-NCUUG<- 4++



#WHITWPF FGT 2WP\KGTWPI N·­V UKEJ FKG 'PVUVGJWPIU\GKV FGU -TGW\GU CWH FGP <GKVTCWO \YKUEJGP  WPF    GKPITGP\GP



1TFGPFGU(ÒTUVGP&CPKNQU+=1ðäåí Êíüàçà Äàíèëà +?/QFGNN EC -TGW\-NCUUG #WUHÒJTWPIOKVFGT/GFCKNNQPWOUEJTKHVÊÍßÇÚ ÖÐÍÎÃÎÐÑÊ+Èŋ =(ÒTUVXQP/QPVGPGITQ?CWHFGT 8QTFGTUGKVG 5KNDGT GOCKNNKGTV 6GKNG FGT #WHNCIGP )QNF ªDGTJÌJWPI 5KNDGT XGTIQNFGV CO QTKIKPCNGP   &TGKGEMUDCPFFGT-NCUUG<- ++

8569



8570

-¤0+)4'+%*&'40+'&'4.#0&' 

/KNKV·T9KNJGNOU1TFGP)GUVKEMVGU$TWUVMTGW\\WO-QOOCPFGWTUVCTMIGFWPMGNV

4++



1TCPKGP0CUUCW1TFGP 1HHK\KGTU D\Y 4KVVGTMTGW\ OKV 5EJYGTVGTP )QNF GOCKNNKGTV 5KNDGT QJPG   $CPF<- ++

 

)GUVKHVGV CO  #RTKN  XQP FGT 4GIGPVKP WPF -ÌPKIKPYKVYG 'OOC KP 0COGP KJTGT 6QEJVGT -ÌPKIKP 9KNJGN   OKPC CNU HÒPHMNCUUKIGT CNNIGOGKPGT 8GTFKGPUVQTFGP FGO GKPG FTGKUVWHKIG /GFCKNNG CHHKNKKGTV KUV (ÒT OKNKV·TKUEJG   8GTFKGPUVGYKTFFGT1TFGPOKVIGMTGW\VGP5EJYGTVGTPXGTNKGJGP



126

1TCPKGP0CUUCW1TFGP 4KVVGTMTGW\ OKV 5EJYGTVGTP )QNF GOCKNNKGTV 5KNDGT CO $CPF OKV (GNF   UEJPCNNGWPF8GTNGKJWPIUFGMTGVHÒTFGPCOGTKMCPKUEJGP/CLQT*6WTPG[*KEJFCVKGTV/·T\ OKV 2T·IGUKGIGN WPF 1TKIKPCNWPVGTUEJTKHV FGU -CP\NGTU FGT 0KGFGTN·PFKUEJGP 1TFGP )GPGTCNOCLQT FGT   4GUGTXG*-QQHIGHCNVGV\WUCOOGPKO$KNFGTTCJOGP<- ++




ÖSTERREICH

8573

8574

8572

8575

0149')'0 

5'.$56560&+)'5 -¤0+)4'+%*0149')'0 5'+6 

-ÌPKINKEJ 0QTYGIKUEJGT 5CPMV 1NCXU1TFGP  /QFGNN UGKV   QJPG .ÌYGP ÒDGT FGT -TQPG    /KPKCVWT FGU -QOOCPFGWTMTGW\GU OKV 5EJYGTVGTP 5KNDGT XGTIQNFGV WPF GOCKNNKGTV OKV $CPFOQPVWT   FCTCWH.KV\GPWPF4QUGVVGPCWHNCIG ++



&GT\WP·EJUVFTGKMNCUUKIG1TFGPYWTFGCO#WIWUVXQP-ÌPKI1UECT+HÒTFCUOKV5EJYGFGPKP2GTUQPCN WPKQPXGTDWPFGPG-ÌPKITGKEJ0QTYGIGPIGUVKHVGV$KUECYCTGPFKGXGTNKGJGPGP$TWUVUVGTPGYKGKP5EJYGFGP IGUVKEMV  YWTFGGTCWHXKGT -QOOCPFGWTWPF-NCUUGUR·VGT-QOOCPFGWTOKV5VGTPWPF-QO OCPFGWT   CWH HÒPH -NCUUGP 4KVVGT  -NCUUG WPF 4KVVVGT  GTYGKVGTV PCEJFGO DGTGKVU  FKG -QNNCPG GKPIG   HÒJTVYQTFGPYCT0CEJFGT#WHNÌUWPIFGT2GTUQPCNWPKQPOKV5EJYGFGPDGUV·VKIGFGTPGWIGY·JNVG-ÌPKI*CCMQP 8++CO,WPKFGP1TFGPKPGVYCUXGT·PFGTVGT)GUVCNVWPIYQDGKFCUDKUJGTKIG-NCUUGPU[UVGOGTJCNVGPDNKGD  XGTUEJYCPF UEJNKG­NKEJ FGT MNGKPG .ÌYG ÒDGT FGO -TGW\ FGT -TQPG YQOKV FGT 1TFGP UGKPG JGWVKIG )GUVCNV   GTJKGNV#NNG-NCUUGPFGU1TFGPUMÌPPGPCWEJOKV5EJYGTVGTPXGTNKGJGPYGTFGPFKGLGFQEJPWTCWHFGP1TFGPUMTGW \GPPKEJVCWHFGP$TWUVUVGTPGPCPIGDTCEJVYGTFGP#NUDGUQPFGTUJQJG#WU\GKEJPWPIMCPPFGT1TFGPKP$TKNNCPVGP XGTNKGJGPYGTFGP#NNG+PUKIPKGPFGU1TFGPUCW­GTFKGLGPKIGPOKV$TKNNCPVGPUKPFUVTGPITÒEMICDGRHNKEJVKI







(TGKJGKVUMTGW\ -ÌPKI *CCMQP U 8++ 5KNDGT XGTIQNFGV WPF GOCKNNKGTV CWH FGT 4ÒEMUGKVG *GTUVGNNGTDG   \GKEJPWPIFGT(KTOC6QUVTWRKP1UNQCOQTKIKPCNGP$CPFCPFGTQTKIKPCNGP6TCIGPURCPIGKOQTKIKPC NGP8GTNGKJWPIUGVWKFGT(KTOC6QUVTWROKVIQNFHCTDGPGO/QPQITCOO-ÌPKI*CCMQP U8++FC\W/K PKCVWT 5KNDGT XGTIQNFGV WPF GOCKNNKGTV \WUCOOGP OKV 4KVVGTMTGW\ FGU UEJYGFKUEJGP 5EJYGTVQTFGPU   )QNFGOCKNNKGTVOKP'OCKNNGEJKRUCP<YGKGT/KPKCVWTGPUEJPCNNG'1 4++



'TKPPGTWPIUOGFCKNNG-ÌPKI*CCMQPU8++5KNDGTPG/GFCKNNGOKVQTKIKPCNGO$CPFKOGVYCUDGUVQ­G PGPQTKIKPCNGPOKVIQNFHCTDGPGT-ÌPKIUMTQPGDGFTWEMVGP8GTNGKJWPIUGVWK\WUCOOGPOKVFGTQTKIKPCNGP 6TCIGIGPGJOKIWPIHÒTFGP-ÌPKIN&·PKUEJGP*QHNCMCKGP%JTKUVKCP,ÌTIGPUGPFCVKGTV-QRGPJCIGPCO ,CPWCTOKV1TKIKPCNWPVGTUEJTKHVXQP2TKP\*CPUXQP)NÒEMUDQTIOGJTHCEJIGHCNVGV#4  4+++



#WU\GKEJPWPIUOGFCKNNG FGT -ÌPKINKEJGP )GUGNNUEJCHV HÒT FCU 9QJN 0QTYGIGPU 5KNDGTPG /GFCKNNG   5KNDGT OKV 6T·IGTITCXWT ō-4+56+0# ,1*#0510 ŋ CO $CPF KO 'VWK XQP &CXKF #PFGTUGP KP   1UNQ ++



8577

8576

¤56'44'+%* -#+5'44'+%*¤56'44'+%*   

¤UVGTTGKEJKUEJ-CKUGTNKEJGT.GQRQNF1TFGP/QFGNN  (GKPG/KPKCVWTFGU4KVVGTMTGW\GU )QNFGOCKNNKGTVKO4KPIOGJTHCEJRWP\KGTVCOGEJVIQNFGPGP-GVVEJGP\WUCOOGPI ++





¤UVGTTGKEJKUEJ-CKUGTNKEJGT .GQRQNF1TFGP  /QFGNN   4KVVGTMTGW\ #PHGTVKIWPI PCEJ   5KNDGTXGTIQNFGVWPFGOCKNNKGTVQJPGLGINKEJG2WP\KGTWPICO&TGKGEMUDCPF ++



5EJÌPGU'TUCV\GZGORNCTHÒTGKPVGWGTGU1TKIKPCNCWUFGT<GKVXQPXQT

127


ÖSTERREICH

8578



8579

8581

8580

¤UVGTTGKEJKUEJ-CKUGTNKEJGT1TFGPFGT'KUGTPGP-TQPG/QFGNN  &GMQTCVKQP-NCUUG OKV -TKGIUFGMQTCVKQP WPF 5EJYGTVGTP 5KNDGT XGTIQNFGV WPF VNY GOCKNNKGTV CWH FGP -TQPGP2GPFKNKGP   *GTUVGNNGTRWP\G ō(4ŋ FGT (KTOC 4QVJG KP 9KGP WPF ō 9KPFJWPFMQRH #ŋ2WP\G DKU  HÒT GT   5KNDGT 'KUGTPG -TQPG KPPGP OKV 'KUGPTKPI CO &TGKGEMUDCPF OKV CWHIGNGIVGP IGMTGW\VGP 5EJYGTVGTP   $9-<- ++





-CKUGTNKEJ ¤UVGTTGKEJKUEJGT (TCP\ ,QUGRJ1TFGP 4KVVGTMTGW\ )QNF GOCKNNKGTV  I OKV $CPF    /GFCKNNQP CWH FGT 4ÒEMUGKVG \W ÌHHPGP 'OCKNNG FGT 4ÒEMUGKVG XQP \YGK -TGW\CTOGP CDIGRNCV\V KO   6TCIGTKPI*GTUVGNNGTDG\GKEJPWPIFGT(KTOC8KPE/C[GT U5ÌJPGKP9KGPō)GOUMQRHRWP\GŋHÒTGT )QNF   CO CNVGP DQTFGCWZTQVGP WPF GVYCU CWUIGDNKEJGP &TGKGEMUDCPF $9-    <- +++++





-CKUGTNKEJ¤UVGTTGKEJKUEJGT(TCP\,QUGRJ1TFGP4KVVGTMTGW\OKV-TKGIUFGMQTCVKQP -TKGIUDCPF WPF 5EJYGTVGTP$TQP\GXGTIQNFGVWPFGOCKNNKGTV8GTIQNFWPIDGKFUGKVKIDGTKGDGPKO$CPFTKPI*GTUVGNNGTDG \GKEJPWPIFGT(KTOC-$ÌJOKP9KGPWPFō5VGTPEJGPŋ2WP\GCO-TKGIU&TGKGEMUDCPFOKVCWHIGNGIVGP 5EJYGTVGTPKOQTKIKPCNGP8GTNGKJWPIUGVWK$9-<- ++





-CKUGTNKEJ ¤UVGTTGKEJKUEJGT (TCP\ ,QUGRJ1TFGP 4KVVGTMTGW\ OKV -TKGIUFGMQTCVKQP -TKGIUDCPF    $TQP\G XGTIQNFGV WPF GOCKNNKGTV DGKFUGKVKI -QTTQUKQPUURWTGP KO $CPFTKPI *GTUVGNNGTDG\GKEJPWPI FGT   (KTOC-$ÌJOKP9KGPWPFō5VGTPEJGPŋ2WP\GCO-TKGIU&TGKGEMUDCPF$9-<- ++p



8584

8583 8582



/KNKV·T8GTFKGPUVMTGW\ -NGKPFGMQTCVKQP FGU /KNKV·TXGTFKGPUVMTGW\GU ++ -NCUUG OKV -TKGIUFGMQTCVKQP   WPF5EJYGTVGTPDGUVGJGPFCWU-TGW\+++-NCUUGOKV-TKGIUFGMQTCVKQP5KNDGTVNYXGTIQNFGVGOCKNNKGTV QJPG 2WP\KGTWPI CO &TGKGEMUDCPF OKV CWHIGNGIVGT OGJTVGKNKI IGHGTVKIVGT /KPKCVWT FGU -TGW\GU ++   -NCUUGOKV-TKGIUFGMQTCVKQPWPFIQNFHCTDGPGP5EJYGTVGTP$TQP\GXGTIQNFGVWPFGOCKNNKGTVKOIQNFGP DGFTWEMVGP 8GTNGKJWPIUGVWK FGT (KTOC 4QVJG KP 9KGP CWH FGO $QFGP CWHIGMNGDVGT CNVGT JCPFUEJTKHVNK   EJGT<GVVGNō8GTFKGPUV-TGW\++-NMNGKPG&GMQTCVOGKP'KIGPVŋ$9-C ++





/KNKV·T8GTFKGPUVMTGW\-TGW\+++-NCUUGOKVFGT-TKGIUFGMQTCVKQP5KNDGTVNYXGTIQNFGVWPFGOCKN NKGTVKPFGT¤UG*GTUVGNNGTRWP\Gō“-ŋFGT(KTOC#'-ÌEJGTVKP9KGPWPFō&KCPCMQRHRWP\GŋHÒT GT5KNDGTCOQTKIKPCNGP&TGKGEMUDCPF$9- ++



8GTFKGPUVMTGW\)QNFGPGU8GTFKGPUVMTGW\OKVFGT-TQPG)QNFGOCKNNKGTVMNGKPG'OCKNNGCDRNCV\WPICWHFGT 4ÒEMUGKVGFGUNKPMGP-TGW\CTOUKO4KPIOGJTHCEJRWP\KGTVCO-TKGIU&TGKGEMUDCPF$9- ++



 128


ÖSTERREICH

8585

8588 8587



6CRHGTMGKVUOGFCKNNG  /QFGNN LÒPIGTGU 2QTVTCKV (TCP\ ,QUGRJU OKV $CTV -QRH PCEJ NKPMU      5KNDGTPG/GFCKNNG-NCUUG5KNDGTCOCNVGP&TGKGEMUDCPF$9- 4++





/KNKV·T&KGPUVCWU\GKEJPWPI HÒT 1HHK\KGTG  /QFGNN   -TGW\ +++ -NCUUG HÒT  &KGPUV   LCJTG$TQP\GXGTIQNFGV#WHNCIG5KNDGTQJPG$CPF$9- ++





'TKPPGTWPIUOGFCKNNGHÒTFGP5EJNGUYKI*QNUVGKP(GNF\WI¤UVGTTGKEJKUEJG#WUICDG$TQP\GOKV 4CPFRT·IWPICOQTKIKPCNGPCNVGP&TGKGEMUDCPF$9- ++



2TCIGT$ÒTIGTYGJTOGFCKNNG5KNDGTCOQTKIKPCNGPCNVGP&TGKGEMUDCPF

++

 

8589

8592

8593 8595



8GTFKGPUVOGFCKNNG HÒT UQTIH·NVKIG 2HGTFG\WEJV KO -ÌPKITGKEJ )CNK\KGP WPF .QFQOGTKGP 5KNDGTPG   /GFCKNNG PKEJV VTCIDCT &WTEJOGUUGT  OO 5KNDGT CWH FGT 4ÒEMUGKVG <GEMKPUEJTKHV KP RQNPKUEJGT   5RTCEJGō<#56#4#00;%*19-10+ŋ ++





-QPXQNWVXQPHÒPHXGTUEJKGFGPGP#WU\GKEJPWPIGP&CTWPVGT5KNDGTPGU8GTFKGPUVMTGW\OKVFGT-TQPG

5KNDGT /KNKV·T8GTFKGPUVMTGW\+++-NCUUGOKV-TKGIUFGMQTCVKQPWPF5EJYGTVGTP 5KNDGTQJPG4GXGTU OGFCKNNQP WPF 5KNDGTPG 5KIPWO .CWFKU -CKUGT -CTN 5KNDGT  &C\W #WUUVGNNWPIU#WU\GKEJPWPI ō++   2#46+'024'+5ŋ8GTUEJKGFGPG/GVCNNGOGKUV5KNDGTVGKNUGOCKNNKGTVKPWPVGTUEJKGFNKEJGP'TJCNVWPIGP VGKNUCP$·PFGTP 5VÒEM++





1TFGPUNKVGTCVWT&GTÌUVGTTGKEJKUEJ-CKUGTNKEJG1TFGPFGT'KUGTPGP-TQPGWPFUGKPG/KVINKGFGT 9KGP   &GT -CKUGTNKEJ ¤UVGTTGKEJKUEJGU (TCP\ ,QUGRJ 1TFGP WPF UGKPG /KVINKGFGT 9KGP   <YGK   6GKNNKGHGTWPIGPXQP4CFCMQXKEJ.GQRQNF1TFGPWPF1TFGPFGT'KUGTPGP-TQPG+PGKP\GNPGP$N·VVGTP PKEJVCWH8QNNUV·PFKIMGKVIGRTÒHV +++





*QJGT&GWVUEJGT4KVVGTQTFGP*CNUMTGW\FGT1TFGPURTKGUVGT5KNDGTXGTIQNFGVWPFGOCKNNKGTVCP6TCIG MQTFGN$9-<- ++





/CTKCPGTMTGW\FGU&GWVUEJGP4KVVGTQTFGPU$TWUVMTGW\5KNDGT-TGW\KO/GFCKNNQP)QNFGOCKNNKGTV OGJTGTGQDGTHN·EJNKEJG%JKRUKPFGTYGK­GP'OCKNNGKPFGT¤UG*GTUVGNNGTRWP\Gō(4ŋFGT(KTOC(TKGFTKEJ 4QVJG KP 9KGP WPF ō 9KPFJWPFMQRH #ŋ2WP\G HÒT GT 5KNDGT CO QTKIKPCNGP CNVGP &TGKGEMUDCPF   $9-<- ++p+++



8GTFKGPUVMTGW\ FGU &GWVUEJGP1TFGPU5EJWNVGTDCPF\WO)TQ­MTGW\WPMQPHGMVKQPKGTVEONCPI

CWUTGKEJGPF\WT-QPHGMVKQPKGTWPI  4++





&CU XKGTMNCUUKIG 8GTFKGPUVMTGW\ DGUVCPF PWT XQP  DKU  YQDGK XQP  DKU  MGKPG 8GTNGKJWPIGP   GTHQNIVUKPFYQOKVCNNG-NCUUGPCNUUGJTUGNVGPCP\WUGJGPUKPF



'456'4'27$.+-  

'JTGP\GKEJGP HÒT 8GTFKGPUVG WO FKG 4GRWDNKM ¤UVGTTGKEJ   D\Y ¤UVGTTGKEJKUEJGT 8GT   FKGPUVQTFGP  /QFGNN DKUD\Y $TWUVUVGTP\WO)TQ­GP'JTGP\GKEJGP OKVFGO5VGTP  D\Y-QOVWTMTGW\OKVFGO5VGTP  5KNDGTDTKNNCPVKGTVWPFTGRGT EKGTVVNYXGTIQNFGVGOCKNNKGTV'OCKNNGVNYGVYCUXGTH·TDVCWHFGT4ÒEMUGKVG*GTUVGNNGTDG\GKEJPWPIFGT (KTOC#PVQP4GKVVGTGTKP9KGPCP0CFGN$9-<- ++

 129


POLEN

8597 8596



8596

'JTGP\GKEJGP HÒT 8GTFKGPUVG WO FKG 4GRWDNKM ¤UVGTTGKEJ   D\Y ¤UVGTTGKEJKUEJGT 8GT   FKGPUVQTFGP  'TUVGU/QFGNN DKUD\Y )TQ­GU5KNDGTPGU'JTGP\GKEJGP  #WUICDG    #PHGTVKIWPI PCEJ    \W 5COONGT\YGEMGP OKV INCVVGT 4ÒEMUGKVG  5KNDGT   VNYXGTIQNFGVWPFGOCKNNKGTVCP0CFGN ++



'ZGORNCTCWUWPUGTGT#WMVKQP1TFGPWPF'JTGP\GKEJGPCO1MVQDGT0T

<9'+6'4'27$.+- UGKV  

&CPM'JTGP\GKEJGPFGU-·TPVPGT.CPFGUJCWRVOCPPU&T,ÌTI*CKFGT5QIGPCPPVGT*CKFGT1TFGP $WPVOGVCNNXGTIQNFGVWPFGOCKNNKGTVCP0CFGNKO'VWK 44++



&GT CO  1MVQDGT  DGK GKPGO 8GTMGJTUWPHCNN WOU .GDGP IGMQOOGPG -·TPVPGT .CPFGUJCWRVOCPP &T ,ÌTI   *CKFGT   GJGOCNU (2¤ FCPP $<¤ XGTICD FKGUGU 'JTGP\GKEJGP FCU PWT KP YGPKIGP (·NNGP XGTNKGJGP   YQTFGP KUVHÒTFKGKJOCNU.CPFGUJCWRVOCPP /KPKUVGTRT·UKFGPV FGUÌUVGTTGKEJKUEJGP$WPFGUNCPF-·TPVGPIGNGKUVG VGP&KGPUVG

8599

8600

ex 8598 8601

21.'0 

-QPXQNWVXQPHÒPHXGTUEJKGFGPGPRQNPKUEJGP1TFGP'JTGPWPF#D\GKEJGP&CTWPVGT$TWUVUVGTPFGU 1TFGPU2QNQPKC4GUVKVWVCFGT(KTOC5RKPM5QPKP.QPFQP8GTUEJKGFGPG/GVCNNGVGKNUGOCKNNKGTVKP WPVGTUEJKGFNKEJGP'TJCNVWPIGPVGKNUCP0CFGN$·PFEJGPQFGT5EJTCWDGOKV5EJTCWDUEJGKDG ++



4755+5%*'5 -¤0+)4'+%*21.'0   

1TFGP 8KTVWVK /KNKVCTK  /QFGNN   OKV FGT ,CJTGU\CJN   5KNDGTPGU -TGW\ 5KNDGT QJPG   $CPF<- ++





4WUUKUEJG/GFCKNNGō(ÒTFKGRQNPKUEJGP$TÒFGTŋ6TCIDCTG &WTEJOGUUGTOO WPFPKEJV VTCIDCTG &WTEJOGUUGTOO #WUHÒJTWPI$TQP\GGKPGCO$·FEJGP 5VÒEM4++



'456' 4'27$.+-21.'0   

130

1TFGP 2QNQPKC 4GUVKVWVC  /QFGNN OKV ,CJTGU\CJN     -QOOCPFGWTMTGW\ $TQP\G   XGTIQNFGV WPF GOCKNNKGTV CO QTKIKPCNGP *CNUDCPF KO QTKIKPCNGP IQNFGP DGFTWEMVGP 8GTNGKJWPIUGVWK   <- ++




POLEN

8602 8604





8603

1TFGP2QNQPKC4GUVKVWVC/QFGNN OKV,CJTGU\CJN 4KVVGTMTGW\5KNDGT  XGTIQN FGV WPF GOCKNNKGTV OGJTGTG MNGKPG 'OCKNNGEJKRU CWH FGT 4Ã&#x2019;EMUGKVG *GTUVGNNGTDG\GKEJPWPI FGT (KTOC   9CDKPUMK CO QTKIKPCNGP $CPF &C\W 5KNDGTPGU 8GTFKGPUVMTGW\  /QFGNN XGTUKNDGTV VNY GOCKNNKGTV   CO$CPF<- 4++p+++



6CRHGTMGKVUMTGW\ FGU )GPGTCNU $WNCM$CNCEJQYKVUEJ 5R·VGTG #WUHÃ&#x2019;JTWPI $TQP\G XGTUKNDGTV WPF   GOCKNNKGTVOGJTGTGMNGKPG'OCKNNGHNGEMGPCWHFGT4Ã&#x2019;EMUGKVG*GTUVGNNGTDG\GKEJPWPIFGT(KTOC5<[ICFNG YKE\&TGKGEMUDCPF ++



81.-54'27$.+-21.'0   

1TFGP 2QNQPKC 4GUVKVWC  /QFGNN OKV FGT ,CJTGU\CJN     -QOOCPFGWTMTGW\ QJPG   $CPFTKPI QJPG *CNUDCPF  WPF \YGK 4KVVGTMTGW\G &C\W ,CP -TCUKEMK-TGW\ KP )QNF ,GYGKNU $TQP\G   XGTIQNFGVWPFGOCKNNKGTVFKGNGV\VGPFTGKCP$·PFGTP<- 5VÃ&#x2019;EM++

8606



8606

8605



#OVUMGVVGFGT4KEJVGT$TQP\GFCU-NGKPQF$TQP\GXGTUKNDGTV

4++



&4+66' 4'27$.+-21.'0 5'+6  

1TFGPXQO9GK­GP#FNGT/QFGNN UGKV 1TFGPUUGVDGUVGJGPFCWU-NGKPQF$TQP\GXGTIQNFGV WPFGOCKNNKGTVQJPG5EJWNVGTDCPFWPF$TWUVUVGTP$TQP\GXGTUKNDGTVVGKNYGKUGXGTIQNFGVWPFGOCKNNKGTV CP0CFGN<-XIN 5VÃ&#x2019;EM++

 131


PORTUGAL

8607

21467)#. -¤0+)4'+%*21467)#. $+5  

/KNKV·TKUEJGT1TFGP7PUGTGU*GTTP,GUWU%JTKUVWU DKU D\Y/KNKV·TKUEJGT%JTKUVWU1TFGP =1TFGO /KNKVCT FG %TKUVQ? UGKV    /QFGNN   $TWUVUVGTP \WO )TQ­MTGW\ 5KNDGT   DTKNNCPVKGTV WPF TGRGTEKGTV #WHNCIGP VNY )QNF GOCKNNKGTV HGKPUVG 'OCKNNGOCNGTGK OKP QDGTHN·EJNKEJG   'OCKNNGEJKRUKO-TGW\FGU/GFCKNNQPUWPFKPFGP(NCOOGPWPFKO-TGW\FGT*GT\,GUW&GMQTCVKQPCWH FGT 4ÒEMUGKVG *GTUVGNNGTITCXWT ō*WPV  4QUMGNN  NCVG  5VQTT /QTVKOGT CPF *WPV  ,GYGNNGTU VQ VJG   3WGGP0GY$QPF5VTGGV.QPFQPŋWPF2WP\Gō90ŋCPGEJVIQNFGPGT0CFGN 4++



'ZGORNCTCWUWPUGTGT#WMVKQP1TFGPWPF'JTGP\GKEJGPCO1MVQDGT0TW­GTUVSWCNKV·VUXQNNG DTKVKUEJG#PHGTVKIWPICWUFGOFTKVVGP8KGTVGNFGU0GWP\GJPVGP,CJTJWPFGTVU&KG(KTOC*WPV4QUMGNN\QIIGO·­ ,CEQD KP ,% 5  WPF   EC  KP FKG 0GY $QPF 5VTGGV WPF HGTVKIVG FQTV DKU  CNU FKG (KTOC XQP , 9   $GPUQPÒDGTPQOOGPYWTFG

8608 1:1

4'27$.+-21467)#. UGKV  

132

/KNKV·TKUEJGT1TFGPFGUJGKNKIGP,CMQDWUXQO5EJYGTV DKU D\Y1TFGPFGUJN,CMQDWUHÒT 8GTFKGPUV KP 9KUUGPUEJCHV .KVGTCVWT WPF -WPUV  /QFGNN UGKV   -QNNCPG \WO )TQ­MTGW\   #WUHÒJTWPIOKVMNGKPGTGP-GVVGPINKGFGTPDGUVGJGPFCWU-TGW\WPF.QTDGGTMTCP\INKGFGTP5KNDGT XGTIQNFGVWPFGOCKNNKGTVCWHFGO8GTUEJNW­INKGF*GTUVGNNGTDG\GKEJPWPIFGT(KTOC(TGFGTKEQFC%QUVCKP .KUUCDQPOKV-NGKPQF5KNDGTXGTIQNFGVWPFGKPUGKVKIGOCKNNKGTVOKV$TWUVUVGTP#WUHÒJTWPI EC   KP DGUQPFGTGT #WUHÒJTWPI 5KNDGT DTKNNCPVKGTV   FWTEJDTQEJGP IGCTDGKVGV VNY XGTIQNFGV WPF   GOCKNNKGTVFGT/GFCKNNQPTCPFDGUGV\VOKV5KOKNKUVGKPGPCWHFGT4ÒEMUGKVG*GTUVGNNGTDG\GKEJPWPIFGT (KTOCFC%QUVCCP0CFGNFKGUGOKVHTCP\ÌUKUEJG'KPHWJTRWP\GHÒT5KNDGTXQPDKU ō5EJYC PGPRWP\Gŋ  \WUCOOGP OKV -PQRHNQEJTQUGVVG KO 1TKIKPCNGVWK FGT (KTOC (TGFGTKEQ %QUVC OKV /GVCNN   DGUEJN·IGP<- 44++ 


PORTUGAL

8608 1:1,5

8608 Detail 1:1

133


RUMÄNIEN

8609

8610

47/0+'0 -¤0+)4'+%*47/0+'0   



1TFGP ō/KEJCGN FGT 6CRHGTGŋ  /QFGNN OKV /QPQITCOO -ÌPKI (GTFKPCPFU    -TGW\    -NCUUG $TQP\G XGTIQNFGV WPF GOCKNNKGTV 'OCKNNG YGNNKI GXVNPCEJGOCKNNKGTV CO$CPF<- ++



1TFGPō5VGTP4WO·PKGPUŋ CWEJ1TFGPFGU5VGTPUXQP4WO·PKGP /QFGNN  -NGKPQF \WO)TQ­MTGW\HTCP\ÌUKUEJG#PHGTVKIWPI5KNDGTXGTIQNFGVWPFGOCKNNKGTVOKPMCWOUKEJVDCTG'OCKNNG UEJ·FGPWPFTGRCTCVWTGPKO6TCIGUVGIHTCP\ÌUKUEJG)CTCPVKGRWP\GHÒT5KNDGTXQPDKU ō9KNF UEJYGKPMQRHŋ COMWT\GPVNYGVYCUCWUIGDNKEJGPGPQTKIKPCNGPCNVGP5EJWNVGTDCPF<- ++



8612 8611



1TFGPō5VGTP4WO·PKGPUŋ CWEJ1TFGPFGU5VGTPUXQP4WO·PKGP /QFGNN  $TWUV UVGTP \WO )TQ­MTGW\ $TQP\G XGTUKNDGTV   VNY XGTIQNFGV WPF GOCKNNKGTV CP 0CFGN OKV \YGK 5GKVGP   JCMGP<- 4+p++



#WHITWPF FGU XGTYCPFVGP /GVCNNU $TQP\G UVCVV 5KNDGT  FÒTHVG GU UKEJ JKGTDGK WO GKPG OWVOC­NKEJ HTCP\ÌUKUEJG    #PHGTVKIWPI CWU FGO <GKVTCWO \YKUEJGP 'PFG  WPF #PHCPI  JCPFGNP CNU 5KNDGT MTKGIUYKTVUEJCHVUDGFKPIV   UGNVGPIGYQTFGPYCT



134

1TFGPō5VGTP4WO·PKGPUŋ CWEJ1TFGPFGU5VGTPUXQP4WO·PKGP /QFGNN  1HHK \KGTUMTGW\OKV5EJYGTVGTP5KNDGTXGTIQNFGVWPFGOCKNNKGTVOGJTGTGOKP#WUDTÒEJGKO/GFCKNNQPTKPI FGT8QTFGTUGKVGCOPKEJVMQTTGMVGP$CPFTWO·PKUEJGT0·JCTV<- ++




RUMÄNIEN

8615

8614 8613







1TFGPō5VGTP4WO·PKGPUŋ CWEJ1TFGPFGU5VGTPUXQP4WO·PKGP /QFGNN  1HHK\KGTU MTGW\OKV5EJYGTVGTP#WUHÒJTWPIOKVXCTKCPVGT-TQPGFGUōURCPKUEJGP6[RUŋ$TQP\GXGTIQNFGVWPFGOCKNNKGTV CO QTKIKPCNGP $CPF TWO·PKUEJGT 0·JCTV OKV CWHIGNGIVGT 4QUGVVG KO DGUEJ·FKIVGP 8GTNGKJWPIUGVWK FGT   (KTOC).GOCKVTGKP2CTKUOKVXGTDNCUUVGO/QPQITCOO-ÌPKI(GTFKPCPFU+<- ++



1TFGPō5VGTP4WO·PKGPUŋ CWEJ1TFGPFGU5VGTPUXQP4WO·PKGP /QFGNN  1HHK \KGTUMTGW\OKV5EJYGTVGTP$TQP\GXGTIQNFGVWPFGOCKNNKGTVOGJTGTG%JKRUKPFGTDNCWGP'OCKNNGXQP 8QTFGTWPF4ÒEMUGKVG#WHJ·PIWPIKPFGT-TQPGTGRCTKGTVCO$CPFQJPG4QUGVVG<- ++p



1TFGPō5VGTP4WO·PKGPUŋ CWEJ1TFGPFGU5VGTPUXQP4WO·PKGP /QFGNN  1HHK \KGTUMTGW\ OKV 5EJYGTVGTP #WUHÒJTWPI OKV XCTKCPVGT UGJT RNCUVKUEJ CWUIGHÒJTVGT -TQPG WPF UGRCTCV   CWHIGNGIVGP5EJYGTVGTP5KNDGTVNY\KUGNKGTVWPFGOCKNNKGTVGKPKIG#DRNCV\WPIGPKPFGTITÒPGP'OCKNNG XQTFGT WPF TÒEMUGKVKIGP 'KEJGPNCWDMTCP\GU UQYKG OKP 'OCKNNGEJKRUKOXQTFGTUGKVKIGP/GFCKNNQPTKPI WPF KP \YGK -TGW\CTOGP OKV MWT\GO $CPFUVÒEM KO QTKIKPCNGP DQTFDGCWNGFGTPGP 8GTNGKJWPIUGVWK FGT   (KTOC,QUGRJ4GUEJKP$WMCTGUVOKVIQNFHCTDGPGO/QPQITCOO-ÌPKI%CTQNU+<- 4++



+PFKGUGTDGUQPFGTGP#WUHÒJTWPIPKEJVJ·WHKI\WHKPFGP

8616



8617

1TFGPō5VGTP4WO·PKGPUŋ CWEJ1TFGPFGU5VGTPUXQP4WO·PKGP /QFGNN  $TWUVUVGTP  -NCUUG   #WUHÒJTWPI QJPG -TQPG    5KNDGT DTKNNCPVKGTV WPF TGRGTEKGTV VNY XGTIQNFGV   WPFGOCKNNKGTVCWHFGT4ÒEMUGKVG*GTUVGNNGTDG\GKEJPWPIFGT(KTOC*GKPTKEJ9GKUUKP$WMCTGUVCP0C FGNFKGUGOGJTHCEJRWP\KGTV WC*GTUVGNNWPIUPWOOGT*GTUVGNNGTRWP\Gō*9ŋFGT(KTOC9GKUUWPF ,CJTGURWP\GōŋHÒT<'+ ++



1TFGPō5VGTP4WO·PKGPUŋ CWEJ1TFGPFGU5VGTPUXQP4WO·PKGP /QFGNN  1HHK \KGTUMTGW\OKV5EJYGTVGTP$TQP\GXGTIQNFGVWPFGOCKNNKGTVCOQTKIKPCNGP$CPFHÒT6CRHGTMGKVTWO·PK UEJGT 0·JCTV OKV CWHIGNGIVGT 4QUGVVG FCTCWH IGMTGW\VG 5EJYGTVGT KO 8GTNGKJWPIUGVWK FGT (KTOC )   .GOCKVTGKP2CTKUOKVIQNFHCTDGPGO/QPQITCOO-ÌPKI(GTFKPCPFU+<- ++



&C NCWV 9GDGT KP 1',  FKG  -NCUUG GTUV OKV MÌPKINKEJGO &GMTGV XQO  (GDTWCT IGUVKHVGVFKG-TQPG CWH FGO QDGTGP -TGW\CTO FGU $TWUVUVGTPU GTUV OKV MÌPKINKEJGO &GMTGV  XQO  &G\GODGT  D\Y OKV   FGUUGP PFGTWPIUFGMTGV XQO  (GDTWCT  IGUEJCHHGP YQTFGP YCT UKPF FKG 5VGTPG QJPG FKGUG -TQPG PWT EC   \YGK,CJTGNCPIXGTNKGJGPYQTFGPWPFFGOGPVURTGEJGPFUGJTUGNVGP\WHKPFGP



135


RUMÄNIEN

8619

8618





8620

1TFGPō5VGTP4WO·PKGPUŋ CWEJ1TFGPFGU5VGTPUXQP4WO·PKGP /QFGNN  4KVVGT MTGW\OKV5EJYGTVGTP$TQP\GXGTUKNDGTVVNYXGTIQNFGVWPFGOCKNNKGTVCOQTKIKPCNGP$CPFHÒT6CRHGT MGKVTWO·PKUEJGT0·JCTVKO8GTNGKJWPIUGVWKFGT(KTOC).GOCKVTGKP2CTKUOKVIQNFHCTDGPGO/QPQ ITCOO-ÌPKI(GTFKPCPFU+<- ++



1TFGPō-TQPG4WO·PKGPUŋ CWEJ1TFGPFGT-TQPGXQP4WO·PKGP /QFGNN  #WU ICDG OKV -TQPG CWU 5KNDGT KP FGP /GFCKNNQPU 1HHK\KGTUMTGW\HTCP\ÌUKUEJG#PHGTVKIWPI 5KNDGTXGTIQNFGVWPFGOCKNNKGTVKPFGT#ITCHHGHTCP\ÌUKUEJG)CTCPVKGRWP\GHÒT5KNDGTXQPDKU

ō9KNFUEJYGKPMQRHŋ COCNVGP1TKIKPCNDCPFOKVCWHIGNGIVGT4QUGVVG&C\W5KNDGTPG/GFCKNNGHÒT/CPP JCHVKIMGKVWPF6TGWG$TQP\GXGTUKNDGTVQJPG$CPF<- 5VÒEM++



0CEJFGOFCUUKEJFCU(ÒTUVGPVWO4WO·PKGPCO/·T\\WOUQWXGT·PGP-ÌPKITGKEJRTQMNCOKGTVWPF(ÒTUV %CTQN CWU FGO *CWUG *QJGP\QNNGTP5KIOCTKPIGP  \WO -ÌPKI CWUIGTWHGP JCVVG UVKHVGVG FKGUGT CO  /CK    FGO 6CIG UGKPGT -TÌPWPI FGP HÒPHMNCUUKIGP )TQ­MTGW\ )TQ­QHHK\KGT -QOOCPFGWT 1HHK\KGT WPF 4KVVGT  <KXKN   WPF/KNKV·T8GTFKGPUVQTFGPOKVFGP-ÌPKINKEJGP&GMTGVGP0T8WPF8$KUEC YCTFKG-TQPGKO/GFCKNNQPXQP-TGW\WPF$TWUVUVGTPKP#PNGJPWPICPFKGō5V·JNGTPG-TQPG4WO·PKGPŋCWU'KUGP

/QFGNN#WUHÒJTWPI FCPCEJCWU5KNDGTQFGTXGTUKNDGTVGT$TQP\G /QFGNN#WUHÒJTWPI #O#WIWUV VTCV4WO·PKGPCWHFGT5GKVGFGT'PVGPVGKPFGP'TUVGP9GNVMTKGIGKPYQTCWH-ÌPKI(GTFKPCPFOKV-ÌPKINKEJGO &GMTGV0T+:XQO5GRVGODGTHÒT8GTFKGPUVGKO-TKGI5EJYGTVGTHÒTCNNG-NCUUGPUVKHVGVG /KV-ÌPKINKEJGO&GMTGV0T+8XQO#RTKNYWTFGHÒTFKGFTGKWPVGTGP-NCUUGP -QOOCPFGWT 1HHK\KGT WPF 4KVVGT  HÒT DGUQPFGTU VCRHGTGP 'KPUCV\ FKG /ÌINKEJMGKV FGT 8GTNGKJWPI CO $CPFG HÒT ō/KNKV·TKUEJG   6WIGPFŋ 6CRHGTMGKVUDCPF  IGUEJCHHGP #O  /CK  TGQTICPKUKGTVG -ÌPKI %CTQN ++ FGP 1TFGP XQNNUV·PFKI OKV   -ÌPKINKEJGO &GMTGV 0T  8  WPF ICD FGP +PUKIPKGP GKP PGWGU #WUUGJGP  /QFGNN  YQDGK FKG $TWUV   UVGTPG CPHCPIU PQEJ KJTG WTURTÒPINKEJG )TÌ­G DGJKGNVGP CDGT DCNF YGUGPVNKEJ MNGKPGT YWTFGP UQYKG GKP PGWGU   1TFGPUDCPF#O(GDTWCTUVKHVGVGGTOKV-ÌPKINKEJGO&GMTGV0T++GTI·P\VFWTEJFCU-ÌPKI NKEJG&GMTGV0T8+++XQO#WIWUVFKGō/KNKV·TCDVGKNWPIKP(TKGFGPU\GKVGPŋIGUVKHVGVFGTGP +PUKIPKGP GKPG -ÌPKIUMTQPG CNU ªDGTJÌJWPI GTJKGNVGP WPF CO  &G\GODGT  YWTFG OKV -ÌPKINKEJGO &GMTGV   0T  :++  FKG ō#DVGKNWPI HÒT -TKGIU\GKVGPŋ FWTEJ *KP\WHÒIWPI XQP IGMTGW\VGP 5EJYGTVGTP HÒT FKG   +PUKIPKGP FGT /KNKV·TCDVGKNWPI WPF FCU UQIGP ō-TKGIUDCPFŋ IGUEJCHHGP /KV -ÌPKINKEJGO &GMTGV 0T  :++   XQO&G\GODGTIGUVCVVGVG-ÌPKI%CTQN++CWEJFKG8GTNGKJWPICNNGT-NCUUGPFGT\KXKNGP#DVGKNWPICP (TCWGPYQDGKGKPGDGUQPFGTG&GMQTCVKQPFGT-QOOCPFGWTG UVCVVFGU*CNUMTGW\GU IGUEJCHHGPYWTFG/KV-ÌPKINK EJGO&GMTGV0T8+XQO,WPKYWTFGXQP-ÌPKI/KJCK+HÒTCNNG-NCUUGPFGT#DVGKNWPIHÒT -TKGIU\GKVGP HÒT DGUQPFGTU VCRHGTGP 'KPUCV\ FKG /ÌINKEJMGKV FGT 8GTNGKJWPI CO $CPFG HÒT ō/KNKV·TKUEJG 6WIGPFŋ  

6CRHGTMGKVUDCPF  IGUEJCHHGP #O  ,WPK  UVKHVGVG GT OKV -ÌPKINKEJGO &GMTGV 0T  8+  HÒT FKG   FTGKWPVGTGP-NCUUGPō'KEJGPDN·VVGTŋCNUDGUQPFGTG6CRHGTMGKVUCWU\GKEJPWPIFKG QFGT$N·VVGT CWHFGO6CRHGT MGKVUDCPF FGU 4KVVGT QFGT 1HHK\KGTMTGW\GU D\Y CNU IGMTGW\VGU 'KEJGPNCWD CNU ªDGTJÌJWPI ÒDGT FGT -TQPG FGU   -QOOCPFGWTMTGW\GU CPIGDTCEJV YCTGP WPF UEJNKG­NKEJ PQEJ OKV -ÌPKINKEJGO &GMTGV 0T  :  XQO   1MVQDGTHÒTFKG1HHK\KGTUMNCUUGFGT-TKGIUCDVGKNWPICO6CRHGTMGKVUDCPFCNUDGUQPFGTG#WU\GKEJPWPIGKPGP XKGTUVTCJNKIGP/GVCNNUVGTPFGTCWHFCU$CPFCWHIGNGIVYWTFG/KVFGT#DFCPMWPI-ÌPKI/KJCKU+CO&G\GODGT  YWTFG CWEJ FKG 8GTNGKJWPI FGU 1TFGPU ō-TQPG 4WO·PKGPUŋ KP 4WO·PKGP GKPIGUVGNNV #NNGTFKPIU JCV KP -ÌPKI   /KJCKIGNGIGPVNKEJKO'ZKNCNU*CWUQTFGPYGKVGTJKPXGTNKGJGP 8INCWEJ9GDGT9KNJGNO-ÌPKI-CTN+5EJÌR HGTFGUOQFGTPGP4WO·PKGPU)TÒPFGTFGUTWO·PKUEJGP1TFGPUYGUGPUWPF5VKHVGTFGU1TFGPUō-TQPG4WO·PKGPUŋ +P1TFGPWPF'JTGP\GKEJGP,CJTICPI  0T5 



136

1TFGPō-TQPG4WO·PKGPUŋ CWEJ1TFGPFGT-TQPGXQP4WO·PKGP /QFGNN  #WU ICDG OKV-TQPGCWU5KNDGTKPFGP/GFCKNNQPU 1HHK\KGTUMTGW\OKV5EJYGTVGTP5KNDGTXGT IQNFGVWPFGOCKNNKGTVOGJTGTGOKP'OCKNNGEJKRUKOXQTFGTUGKVKIGP/GFCKNNQPTKPIKO$CPFTKPITWO·PK UEJG(KUEJRWP\GHÒTGT5KNDGTXQPDKUCOCNVGP1TKIKPCNDCPFOKVCWHIGNGIVGT4QUGVVGKO QTKIKPCNGP DNCWNGFGTPGP 8GTNGKJWPIUGVWK FGT (KTOC ,QUGRJ 4GUEJ KP $WMCTGUV OKV IQNFHCTDGPGO /QPQ   ITCOO-ÌPKI%CTQNU+<- ++




RUMÄNIEN

8622 8623

8621

8626 8625



1TFGPō-TQPG4WO·PKGPUŋ CWEJ1TFGPFGT-TQPGXQP4WO·PKGP /QFGNN  #WU ICDG OKV -TQPG CWU 5KNDGT KP FGP /GFCKNNQPU    $TWUVUVGTP \WO )TQ­QHHK\KGT 5KNDGT VNY   XGTIQNFGV WPF GOCKNNKGTV CWH FGT 4ÒEMUGKVG *GTUVGNNGTDG\GKEJPWPI FGT (KTOC ,QUGRJ 4GUEJ (KNU KP   $WMCTGUVCP0CFGN<- ++





1TFGPō-TQPG4WO·PKGPUŋ CWEJ1TFGPFGT-TQPGXQP4WO·PKGP /QFGNN  #WU HÒJTWPIHÒT-TKGIU\GKVGP OKV-TQPGWPF5EJYGTVGTP -QOOCPFGWTMTGW\5KNDGTXGTIQNFGVWPFGOCKNNKGTV KO6TCIGTKPIOGJTHCEJRWP\KGTV WC*GTUVGNNGTRWP\Gō%(<ŋFGT(KTOC%CTN(TKGFTKEJ<KOOGTOCPPKP 2HQT\JGKO*GTUVGNNWPIUPWOOGTōŋWPF,CJTGURWP\GōŋHÒT COQTKIKPCNGPWPIGVTCIGPGP *CNUDCPFHÒT6CRHGTMGKVKOQTKIKPCNGPOKPDGUEJ·FKIVGP8GTNGKJWPIUGVWKFGT/QPGVCTKC0CVKQPCNCOKV IQNFHCTDGPGO/QPQITCOO-ÌPKI/KJCKU+<- ++





1TFGPō-TQPG4WO·PKGPUŋ CWEJ1TFGPFGT-TQPGXQP4WO·PKGP /QFGNN  #WUHÒJ TWPI HÒT (TKGFGPU\GKVGP 1HHK\KGTUMTGW\ $TQP\G XGTIQNFGV WPF GOCKNNKGTV CO $CPF OKV CWHIGNGIVGP   IGMTGW\VGP5EJYGTVGTP<- ++



/WVOC­NKEJG#PHGTVKIWPICWUFGP,CJTGPDKU



1TFGPō-TQPG4WO·PKGPUŋ CWEJ1TFGPFGT-TQPGXQP4WO·PKGP /QFGNN  NGGTGU 8GTNGKJWPIUGVWK\WO1HHK\KGTUMTGW\OKVIQNFHCTDGPGO/QPQITCOO-ÌPKI/KJCKU+ ++





1TFGPō.CPFYKTVUEJCHVU8GTFKGPUVŋ/QFGNN OKV/QPQITCOO-ÌPKI%CTQNU++ 1HHK \KGTUMTGW\5KNDGTXGTIQNFGVWPFGOCKNNKGTVCWHFGT4ÒEMUGKVGOGJTHCEJRWP\KGTV WC*GTUVGNNGTRWP\G ō*9ŋ FGT (KTOC *GKPTKEJ 9GKUU KP $WMCTGUV  WPF /CVTKMGNPWOOGT ōŋ CO $CPF OKV CWHIGNGIVGT   4QUGVVG<- ++



51<+#.+56+5%*'4'27$.+-47/0+'0   

6KVGN ō*GNF FGT 5Q\KCNKUVKUEJGP 4GRWDNKM 4WO·PKGPŋ /GFCKNNG \WO 'JTGPVKVGN $TQP\G XGTIQNFGV   DGUGV\V OKV 5KOKNKUVGKPGP CP 6TCIURCPIG $TQP\G XGTIQNFGV OKV 5KOKNKUVGKP DGUGV\V 54    <- 4++



)GUVKHVGV CO  FWTEJ &ET %5 WPF XGTÌHHGPVNKEJV KO $ 1H 0T &GT 6KVGN YWTFG HÒT CW­GTIG   YÌJPNKEJG RGTUÌPNKEJG 8GTFKGPUVG WO FKG TWO·PKUEJG -QOOWPKUVKUEJG 2CTVGK WO FGP 5VCCV WPF FKG TGXQNWVKQP·TG   TWO·PKUEJG$GYGIWPIDGKFGP#WHICDGPFGU#WHDCWGUFGU5Q\KCNKUOWUWPFHÒTDGUQPFGTG8GTFKGPUVGKO$GTGKEJFGT +PPGP WPF #W­GPRQNKVKM XGTNKGJGP #NU UKEJVDCTGU <GKEJGP FGU 'JTGPVKVGNU YWTFG GKPG IQNFGPG /GFCKNNG XGTNKGJGP   /KV FKGUGT #WU\GKEJPWPI YWTFG CWEJ FGT 5VCCVURT·UKFGPV )GPGTCNUGMTGV·T FGT -QOOWPKUVKUEJGP 2CTVGK WPF 8QTUKV   \GPFGT FGU 5VCCVUTCVGU FGT 5Q\KCNKUVKUEJGP 4GRWDNKM 4WO·PKGP 0KEQNCG %GCWUGUEW CWUIG\GKEJPGV 'U JCPFGNVG UKEJ   WOFKGJÌEJUVG#WU\GKEJPWPIFGT5Q\KCNKUVKUEJGP4GRWDNKM4WO·PKGPU

137


RUMÄNIEN

8627 8629

8628



6KVGNō*GNFFGT5Q\KCNKUVKUEJGP#TDGKVŋ/QFGNN OKVō454ŋ )QNFGPG/GFCKNNGō5KEJGN WPF*COOGTŋ\WO'JTGPVKVGN$TQP\GXGTIQNFGVCP6TCIGURCPIG54<- ++



)GUVKHVGV CO  CPN·­NKEJ FGU L·JTKIGP $GUVGJGPU FGT -QOOWPKUVKUEJGP 2CTVGK 4WO·PKGPU &GT 6KVGN   YWTFGHÒTRGTUÌPNKEJG8GTFKGPUVGKO4CJOGPFGT#TDGKVGPDGKO#WHDCWFGU5Q\KCNKUOWUKP4WO·PKGPHÒTJGTCWUTC IGPFG .GKUVWPIGP XGTNKGJGP /KV FGT 8GTNGKJWPI FGU 6KVGNU YCT FKG 8GTNGKJWPI FGT )QNFGPGP /GFCKNNG ō5KEJGN WPF   *COOGTŋUGKVFGTGP5VKHVWPIXGTDWPFGP  &KG/GFCKNNGYWTFGIGUVKHVGVCOFWTEJ&ET2/#0WPFKO$1H0TXGTÌHHGPVNKEJV /QFGNN  WPFIG·PFGTVFWTEJ&ET%5XGTÌHHGPVNKEJVKO$1H0T /QFGNN#WUHÒJTWPI &KG\YGKVG#WUHÒJ TWPIYWTFGRGT&GMTGV XGTÌHHGPVNKEJVKO$1H0TCO GKPIGHÒJTV#DYWTFGFKG#WU\GKEJ PWPIPKEJVOGJTCWU(GKPIQNFUQPFGTPCWU$WPVOGVCNNJGTIGUVGNNV5GKVFKGUGT<GKVKUVCWEJFKG8GTNGKJWPIUPWOOGT CWHFGT4ÒEMUGKVGFGT6TCIGURCPIGGPVHCNNGP



'JTGPVKVGN ō*GNFGP/WVVGTŋ WPF 1TFGP ō*GNFGP/WVVGTŋ  /QFGNN OKV ō454ŋ       #WUHÒJTWPI $WPVOGVCNN XGTUKNDGTV VNY XGTIQNFGV CP 6TCIGURCPIG XGTIQNFGV WPF NCEMKGTV 54 <- ++



)GUVKHVGV CO  FWTEJ &ET  2/#0 WPF CO  KO $1H 0T XGTÌHHGPVNKEJV 6KVGN WPF   1TFGPYWTFGCP(TCWGPXGTNKGJGPFKG\GJPWPFOGJT-KPFGTIGDQTGPWPFCWHIG\QIGPJCVVGP$GKO\YGKVGP/QFGNN YWTFG FKG +PUEJTKHV ō424ŋ FWTEJ ō454ŋ GTUGV\V <W GKPGO PKEJV DGMCPPVGP <GKVRWPMV YWTFG FCU 1TFGPU\GKEJGP   PKEJVOGJTCWU'FGNOGVCNNGPUQPFGTPCWU$WPVOGVCNNIGHGTVKIV5GKVFKGUGT<GKVKUVCWEJFKG8GTNGKJWPIUPWOOGTCWH FGT4ÒEMUGKVGGPVHCNNGP



1TFGP ō*GNF FGT 0GWGP .CPFYKTVUEJCHVNKEJGP 4GXQNWVKQPŋ 1TFGPU\GKEJGP $TQP\G XGTIQNFGV CP   6TCIGURCPIG45<- 4++



)GUVKHVGVCOFWTEJ&ET%5WPFXGTÌHHGPVNKEJVKO$1H0TCO  &GT 1TFGP YWTFG CP .CPFYKTVUEJCHVNKEJG 2TQFWMVKQPUIGPQUUGPUEJCHVGP WPF -QNNGMVKXG XGTNKGJGP 8QTCWUUGV\WPI HÒT   FKG 8GTNGKJWPI FKGUGT #WU\GKEJPWPI YCT FKG )TÌ­G FGU 'TVTCIGU RTQ *GMVCT DGK DGUVKOOVGP 2HNCP\GPCTVGP \$   9GK\GP/CKUWPF)GTUVG'KPG8GTNGKJWPICP'KP\GNRGTUQPGPKUVPKEJVGTHQNIV

8630



8631

1TFGP5KGIFGU5Q\KCNKUOWU$TWUVUVGTP$WPVOGVCNNXGTUKNDGTVVNYXGTIQNFGVWPFGOCKNNKGTVCP0CFGN 54<'+ ++



)GUVKHVGVCOFWTEJ&ET%5WPFXGTÌHHGPVNKEJVKO$1H0T&GT1TFGPYWTFGFGP*GNFGPFGT 5Q\KCNKUVKUEJGP 4GRWDNKM 4WO·PKGP XGTNKGJGP MQPPVG CDGT CWEJ CP CPFGTG XGTFKGPVG 2GTUQPGP HÒT CW­GTQTFGPVNKEJG   8GTFKGPUVGWOFGP#WHDCWFGU5Q\KCNKUOWUCDGTCWEJHÒTDGUQPFGTG8GTFKGPUVGDGKFGT8GTVGKFKIWPIFGU8CVGTNCPFGU XGTNKGJGP YGTFGP &GT 1TFGP JCV GKPG -NCUUG WPF YWTFG CNU $TWUVUVGTP IGVTCIGP &GT 1TFGP 5KGI FGU 5Q\KCNKUOWU   YWTFGKPXGTUEJKGFGPGP/GVCNNGPJGTIGUVGNNV5QIKDVGU5VÒEMGCWU5KNDGTWPF(GKPIQNFCWUXGTUKNDGTVGT$TQP\GWPF 6QODCMUVÒEMG

 138

1TFGP5KGIFGU5Q\KCNKUOWU$TWUVUVGTPXGTEJTQOVVNYXGTIQNFGVWPFGOCKNNKGTVCP0CFGN54 <'+ ++




RUMÄNIEN



8634

8633

8632

1TFGP ō5VGTP FGT 8QNMUTGRWDNKM 4WO·PKGP    D\Y 1TFGP ō5VGTP FGT 5Q\KCNKUVKUEJGP   4GRWDNKM4WO·PKGPŋ=1TFKPWN5VGCWC4GRWDNKEKK5QEKCNKUVG4QO³PG?  /QFGNN 9CR RGPOKV+PUEJTKHVō454ŋ $TWUVUVGTP-NCUUG$TQP\GXGTIQNFGVWPFVNYGOCKNNKGTVOKV 5KOKNKUVGKPGPDGUGV\VCP0CFGN54<- ++



1TFGP ō5VGTP FGT 8QNMUTGRWDNKM 4WO·PKGP    D\Y 1TFGP ō5VGTP FGT 5Q\KCNKUVKUEJGP   4GRWDNKM4WO·PKGPŋ=1TFKPWN5VGCWC4GRWDNKEKK5QEKCNKUVG4QO³PG?  /QFGNN 9CR RGPOKV+PUEJTKHVō454ŋ $TWUVUVGTP-NCUUG$TQP\GXGTIQNFGVWPFVNYGOCKNNKGTVOKV 5KOKNKUVGKPGPDGUGV\VCP0CFGN54<- ++



1TFGP ō5VGTP FGT 8QNMUTGRWDNKM 4WO·PKGP    D\Y 1TFGP ō5VGTP FGT 5Q\KCNKUVKUEJGP   4GRWDNKM4WO·PKGPŋ=1TFKPWN5VGCWC4GRWDNKEKK5QEKCNKUVG4QO³PG?  /QFGNN 9CR RGPOKV+PUEJTKHVō454ŋ $TWUVUVGTP-NCUUG5KNDGT IGRTÒHV VNYXGTIQNFGVWPFGOCKNNKGTV OKV5KOKNKUVGKPGPDGUGV\VCP0CFGN54<- 4++



)GUVKHVGVCOFWTEJ&ET2424WPFXGTÌHHGPVNKEJVCOKO/1H0T&GT1TFGPJCV CNNIGOGKPGP%JCTCMVGT'TMQPPVG<KXKNWPF/KNKV·TRGTUQPGPUQYQJN4WO·PGPCNUCWEJ#WUN·PFGTP\WT$GNQJPWPI HÒT RQNKVKUEJGP MWNVWTGNNGP UQ\KCNGP QFGT YKUUGPUEJCHVNKEJGP 'KPUCV\ WPF HÒT 8GTYKTMNKEJWPI FGT (TGKJGKV FGT   &GOQMTCVKGWPFFGU#WHDCWUFGTTWO·PKUEJGP8QNMUTGRWDNKMXGTNKGJGPYGTFGP&KG8GTNGKJWPIIGUEJCJCWH8GTCP NCUUWPIFGU5VCCVUTCVGUFGT8QNMUTGRWDNKM&GT1TFGPJCVHÒPH-NCUUGP  &GT1TFGPYWTFGIG·PFGTVFWTEJ&ET%5WPFXGTÌHHGPVNKEJVCOKO$1H0T /QFGNN &GT 1TFGPJCVPCEJYKGXQTHÒPH-NCUUGP&GT7PVGTUEJKGFFGTLGYGKNKIGP-NCUUGPYKTFFWTEJFKG(CTDGFGU5VGTPGUFGU /GFCKNNQPUWPFFWTEJ#WHNCIGPXQP5KOKNKDTKNNCPVGPIGMGPP\GKEJPGV  &GT 1TFGP YWTFG GTPGWV IG·PFGTV FWTEJ &ET  %5 WPF XGTÌHHGPVNKEJV CO  KO $ 1H 0T    /QFGNN  &GT 1TFGP YWTFG CP 2GTUQPGP XGTNKGJGP FKG FWTEJ KJTG 6·VKIMGKV WPF FWTEJ KJTGP -CORH KO RQNKVKUEJGP   UQ\KCNGPMWNVWTGNNGPWPFYKUUGPUEJCHVNKEJGP$GTGKEJ\WT(QTVGPVYKEMNWPIFGTUQ\KCNKUVKUEJGP1TFPWPIWPF\WT'TNCP IWPIFGTPCVKQPCNGP(TGKJGKVWPF7PCDJ·PIKIMGKVDGKIGVTCIGPJCDGP  <W GKPGO WPDGMCPPVGP <GKVRWPMV YWTFG \W FGP HÒPH -NCUUGP GKPG 5QPFGTUVWHG KP (QTO GKPGT 5EJ·TRGPFGMQTCVKQP   JKP\WIGHÒIV$GKFGO1TFGPUMNGKPQFJCPFGNVGUUKEJWOGKPGHGWGTXGTIQNFGVG/KPKCVWTFGMQTCVKQPFKGIGJGPMGNVWPF OKV GKPGT 6TCIGCITCHHG XGTUGJGP KUV &CU <GPVTWO KUV QTCPIGHCTDKI GOCKNNKGTV &KGUG 5QPFGTUVWHG YCT CWUN·PFKUEJGP   5VCCVUQDGTJ·WRVGTPXQTDGJCNVGP





8635





8636

1TFGP ō5VGTP FGT 8QNMUTGRWDNKM 4WO·PKGP    D\Y 1TFGP ō5VGTP FGT 5Q\KCNKUVKUEJGP   4GRWDNKM4WO·PKGPŋ=1TFKPWN5VGCWC4GRWDNKEKK5QEKCNKUVG4QO³PG?  /QFGNN 9CR RGP OKV +PUEJTKHV ō454ŋ    $TWUVUVGTPG  WPF  -NCUUG LGYGKNU $TQP\G XGTEJTQOV VNY   GOCKNNKGTVCP0CFGNP54<- 5VÒEM++



1TFGPō#WIWUVŋ/QFGNN OKVō454ŋKO/GFCKNNQP $TWUVUVGTP-NCUUG$WPV OGVCNNXGTIQNFGVVNYGOCKNNKGTVOKV5KOKNKUVGKPGPDGUGV\VGVYCUCPIGNCWHGPCP0CFGN54<-  ++



)GUVKHVGVCOFWTEJ&ET2/#0WPFXGTÌHHCOKO$1H0T&GT1TFGPYWTFG\WT $GNQJPWPI HÒT 8GTFKGPUVG KP 8GTDKPFWPI OKV FGT 4GXQNWVKQP XQO  IGUVKHVGV +P (QNIG YWTFGP CDGT CWEJ   <KXKNWPF/KNKV·TRGTUQPGPUQYQJN4WO·PGPCNUCWEJ#WUN·PFGTHÒT8GTFKGPUVGCWHRQNKVKUEJGOQFGTYKUUGPUEJCHVNK EJGO )GDKGV HÒT OKNKV·TKUEJG +PUVTWMVKQP 1TICPKUCVKQP WPF .GKVWPI WPF HÒT 6CRHGTMGKV KO -CORH UQYKG WO 8GT   FKGPVGWOFKG#TDGKVGTMNCUUGOKVFGO1TFGPCWUIG\GKEJPGV&KG8GTNGKJWPIIGUEJCJCWH8GTCPNCUUWPIFGU5VCCVUTC VGU&GT1TFGPJCVHÒPH-NCUUGP  &CU/QFGNNWPVGTUEJGKFGVUKEJPWTFWTEJFKGWPVGTUEJKGFNKEJG+PUEJTKHVKO.CPFGUYCRRGPYQUKEJPWPOGJTFKG/CLWU MGNPō454ŋDGHKPFGP&KGGKP\GNPGP'NGOGPVGFGT-NCUUGPGKPUWPF\YGKUKPFPWPPKEJVOGJTIGPKGVGVUQPFGTPIGMNGDV <W GKPGO WPDGMCPPVGP <GKVRWPMV YWTFG FGP HÒPH -NCUUGP GKPG 5EJ·TRGPFGMQTCVKQP CNU 5QPFGTUVWHG JKP\WIGHÒIV 'U   JCPFGNVUKEJJKGTDGKWOGKPGIQNFHCTDGPGNQZKGTVGIGJGPMGNVG/KPKCVWTFKGOKVGKPGT6TCIGCITCHHGXGTUGJGPKUV&KG 8GTNGKJWPI FKGUGT 5VWHG YCT CWUN·PFKUEJGP 5VCCVUQDGTJ·WRVGTP XQTDGJCNVGP 1D CNNGTFKPIU 'ZGORNCTG FKGUGT -NCUUG   XGTNKGJGPYWTFGPKUVPKEJVDGMCPPV



139


RUMÄNIEN

8637

8638 8639







1TFGPō#WIWUVŋ/QFGNN OKVō454ŋKO/GFCKNNQP $TWUVUVGTP-NCUUG$WPVOGVCNN XGTIQNFGVVNYGOCKNNKGTVOKV5KOKNKUVGKPGPDGUGV\VGVYCUCPIGNCWHGPCP0CFGN54<- ++



1TFGPō#WIWUVŋ/QFGNN OKVō454ŋKO/GFCKNNQP &GMQTCVKQPGPWPF-NCUUG $WPVOGVCNN XGTIQNFGV D\Y XGTUKNDGTV D\Y DTQP\KGTV VNY GOCKNNKGTV CP 2GPVCIQPCNDCPFURCPIG 54   <- 5VÒEM++



1TFGPō6WFQT8NCFKOKTGUEWŋ8QNNUV·PFKIGT5CV\FGT$TWUVUVGTPGDKU-NCUUGWPFFGTDGKFGP/G FCKNNGPXGTIQNFGVD\YXGTEJTQOVD\YDTQP\GHCTDGPVGKNUGOCKNNKGTVFKG-NCUUGDGUGV\V¯LQWTOKV 5KOKNKUVGKPGPLGYGKNUCP0CFGNPD\YFKGDGKFGP/GFCKNNGPCP$·PFGTPTWO·PKUEJGT0·JCTVOKV#WHNC IGP54<- 5VÒEM++



1TFGPWPF/GFCKNNGYWTFGPIGUVKHVGVCOFWTEJ&ET%5WPFXGTÌHHGPVNKEJVKO$1H0T&GT 1TFGP YWTFGCP2GTUQPGPXGTNKGJGPFKGFWTEJ6GKNPCJOGCOTGXQNWVKQP·TGP-CORHGKPGPDGFGWVGPFGP$GKVTCI\WT 'TNCPIWPIFGTFGOQMTCVKUEJGP(TGKJGKVGPWPF\WT)TÒPFWPIFGU5Q\KCNKUOWUIGNGKUVGVJCDGP&GUYGKVGTGPYWTFGGT CP +P WPF #WUN·PFGT XGTNKGJGP FKG KO KPVGTPCVKQPCNGP RQNKVKUEJGP .GDGP GKPGP DGUQPFGTGP $GKVTCI \WT (ÌTFGTWPI   FGT 2TKP\KRKGP FGT KPVGTPCVKQPCNGP <WUCOOGPCTDGKV \WT 'TJCNVWPI FGT KPVGTPCVKQPCNGP 5KEJGTJGKV WPF FGU (TKGFGPU   UQYKGHÒTFKG'PVYKEMNWPIFGT$G\KGJWPIGPFGT(TGWPFUEJCHVWPF<WUCOOGPCTDGKVOKVFGT5Q\KCNKUVKUEJGP4GRWDNKM 4WO·PKGPIGNGKUVGVJCDGP&GT1TFGPJCVHÒPH-NCUUGP  <W GKPGO WPDGMCPPVGO <GKVRWPMV YWTFG FGP HÒPH -NCUUGP GKPG 5QPFGTUVWHG KP (QTO GKPGT 5EJ·TRGPFGMQTCVKQP   JKP\WIGHÒIV 'U JCPFGNV UKEJ JKGTDGK WO GKPG IGJGPMGNVG &COGPFGMQTCVKQP FGT \YGKVGP -NCUUG FKG OKV GKPGT 6TC   IGCITCHHGXGTUGJGPKUV&KGUG1TFGPUMNCUUGYCTCWUN·PFKUEJGP5VCCVUQDGTJ·WRVGTPXQTDGJCNVGP

8640



8641

1TFGP HÒT DGUQPFGTG IGNGKUVGVG &KGPUVG \WT 8GTVGKFKIWPI FGT UQ\KCNGP 1TFPWPI WPF FGU 5VCCVGU   8QNNUV·PFKIGT5CV\FGT$TWUVUVGTPGFGTDKU-NCUUG$WPVOGVCNNXGTIQNFGVD\YXGTUKNDGTVD\YDTQP \KGTV VNY GOCKNNKGTV LGYGKNU OKV 5KOKNKUVGKPGP DGUGV\V LGYGKNU CP 0CFGN WPF /GFCKNNG XGTUKNDGTV CP   $CPFURCPIG54<- 5VÒEM++



1TFGPWPF/GFCKNNGYWTFGPIGUVKHVGVCOFWTEJ&ET%5WPFXGTÌHHGPVNKEJVKO$1H0T&GT 1TFGP YWTFG CP YGJTFKGPUVNGKUVGPFG 5GTIGCPVGP 1HHK\KGTG WPF <KXKNRGTUQPGP CWU FGO +PPGPOKPKUVGTKWO XGTNKGJGP   FKG KP FGT 8QTDGWIWPI #WHFGEMWPI WPF $GGPFKIWPI HGKPFNKEJGT #MVKXKV·VGP IGIGP FKG UVCCVNKEJG 1TFPWPI WPF FGP   5Q\KCNKUOWUKPDGUQPFGTGO/C­GOKVIGYKTMVJCDGP$GKURKGNUYGKUGHÒT6CRHGTMGKVWPF5GNDUVNQUKIMGKVKO-CORHHÒT OWVKIGQFGTIWVIGHÒJTVG1RGTCVKQPGPKO$GTGKEJFGT8QTDGWIWPIQFGTFGT#WHFGEMWPIXQP8GTDTGEJGPHÒTJGTXQT TCIGPFG (ÒJTWPI DGK FGT 'TITGKHWPI XQP 8GTDTGEJGTP HÒT IWVG 1TICPKUCVKQP FGT 5KEJGTJGKVU WPF /KNK\QTICPG KO   -CORH IGIGP 8GTDTGEJGT WPF UWDXGTUKXG 'NGOGPVG HÒT FKG 8GTVGKFKIWPI FGT 5VCCVUQTFPWPI WPF FGU 5Q\KCNKUOWU   UQYKGHÒTOCMGNNQUGP&KGPUVDGKFGP5GEWTKVCVGWPF/KNK\QTICPGP&KGUGT1TFGPNÌUVGFGPCOIGUVKHVG VGP 1TFGP HÒT DGUQPFGTG IGNGKUVGVG 8GTFKGPUVG \WT 8GTVGKFKIWPI FGT 1TFPWPI FGU 5VCCVGU =1TFKPWN RGPVTW 5GTXKEKK   &GQUGDKVG#FWUGÄP#RCTCTGC1TÄPFWKTKKFG5VCV?CD&GT1TFGPJCVFTGK-NCUUGP&KGUG#WU\GKEJPWPIFKGURCTUCO WPFOGKUVCP/KVINKGFGTFGT5GEWTKVCVGXGTNKGJGPYWTFGKUVYKGFKG8QTI·PIGTCWU\GKEJPWPITGNCVKXUGNVGP



140

1TFGPō8GTVGKFKIWPIFGU8CVGTNCPFGUŋ/QFGNN OKVō454ŋKO/GFCKNNQP XQNNUV·PFKIGT 5CV\FGTDKU-NCUUG$WPVOGVCNNVNYXGTUKNDGTVVNYXGTIQNFGVVNYGOCKNNKGTVCP0CFGND\YCP 2GPVCIQPCNDCPFURCPIG54<- 5VÒEM++




RUMÄNIEN )GUVKHVGVCOFWTEJ&ET2/#0WPFXGTÌHHGPVNKEJVKO$1H0T&GT1TFGPMQPPVG/KNKV·TWPF <KXKNRGTUQPGP TWO·PKUEJGT UQYKG CWUN·PFKUEJGT 5VCCVU\WIGJÌTKIMGKV XGTNKGJGP YGTFGP 'T DGNQJPVG GKP\KICTVKIG   .GKUVWPIGP CWH RQNKVKUEJGO WPF YKUUGPUEJCHVNKEJGO )GDKGV \GKEJPGVG OKNKV·TKUEJG .GKUVWPIGP KP 1TICPKUCVKQP WPF   6TWRRGPHÒJTWPI CWU WPF YWTFG CNNIGOGKP \WT $GNQJPWPI HÒT 8GTFKGPUVG KO 4CJOGP FGT 8GTVGKFKIWPI 4WO·PKGPU   XGTNKGJGP&KG8GTNGKJWPIGTHQNIVGCWH8GTCPNCUUWPIFGU5VCCVUTCVGU&GT1TFGPJCVFTGK-NCUUGP  $GKO \YGKVGP /QFGNN KUV PWP KP FGT QDGTGP ¤HHPWPI FGU JTGPMTCP\GU KO .CPFGUYCRRGP GKP HÒPH\CEMKIGT 5VGTP   #PUQPUVGPJCVUKEJFCU#WUUGJGPFGT&GMQTCVKQPPKEJVXGT·PFGTV  0CEJPFGTWPIFGT5VCCVUHQTOYWTFGFKG+PUEJTKHVō424ŋKO.CPFGUYCRRGPFWTEJō454ŋHÒT4GRWDNKEC5QEKCNKUVC 4QO³PKCGTUGV\V

8642 8643

8645



1TFGPō9KUUGPUEJCHVU8GTFKGPUVŋ8QNNUV·PFKIGT5CV\FGT$TWUVUVGTPGDKU-NCUUG$TQP\GXGTIQNFGV D\Y XGTUKNDGTV D\Y DTQP\GHCTDGP LGYGKNU GOCKNNKGTV CP 0CFGNP UQYKG FGT /GFCKNNG XGTIQNFGV CO   $CPF54<- ++



1TFGPWPF/GFCKNNGYWTFGPIGUVKHVGVCOFWTEJ&ET%5WPFXGTÌHHGPVNKEJVKO$1H0T&GT 1TFGP YWTFG CP 2GTUQPGP XGTNKGJGP FKG FWTEJ YGTVXQNNG 4GCNKUKGTWPIGP KP FGP 9KUUGPUEJCHVGP GKPGP DGUQPFGTGP   $GKVTCI\WOYKTVUEJCHVNKEJGPWPFVGEJPKUEJYKTVUEJCHVNKEJGP(QTVUEJTKVVIGNGKUVGVJCDGP&GT1TFGPJCVFTGK-NCUUGP



1TFGPō5CPKV·VU8GTFKGPUVŋ8QNNUV·PFKIGT5CV\FGT$TWUVUVGTPGDKU-NCUUG$TQP\GXGTIQNFGVD\Y XGTUKNDGTVD\YDTQP\GHCTDGPLGYGKNUVNYGOCKNNKGTVWPFOKV5KOKNKUVGKPGPDGUGV\VCP0CFGNPUQYKGFGT /GFCKNNGXGTIQNFGVCP$CPFURCPIG54<- 5VÒEM++



1TFGP WPF /GFCKNNG YWTFGP IGUVKHVGV CO  FWTEJ &ET %5 WPF XGTÌHHGPVNKEJV KO $ 1H 0T XQO    &GT 1TFGP YWTFG XGTNKGJGP HÒT XGTFKGPUVXQNNG .GKUVWPIGP CWH CNNGP )GDKGVGP FGT /GFK\KP WPF FGT   UCPKV·TGP'KPTKEJVWPIGPFGU5VCCVGUUQYKGCP2GTUQPGPFKGFCU#PUGJGPWPF9CEJUVWOFGTOGFK\KPKUEJGP9KUUGP UEJCHVGPIGHÌTFGTVJCDGP&GT1TFGPJCVFTGK-NCUUGP  &KG /GFCKNNG YWTFG XGTNKGJGP CP 2GTUQPGP CWU FGO OGFK\KPKUEJUCPVKV·TGP 2GTUQPCN UQYKG CP 2GTUQPGP FKG DGUQP   FGTG 8GTFKGPUVG KO 5EJWV\ FGT )GUWPFJGKV FGU TWO·PKUEJGP 8QNMGU WPF KO 9CEJUVWO FGU 2TGUVKIGU FGT OGFK\KPK   UEJGP9KUUGPUEJCHVGPIGNGKUVGVJCDGP



1TFGPō/KNKV·T8GTFKGPUVŋ/QFGNN  &GMQTCVKQPFGTFGTWPF-NCUUGXGTIQNFGVD\Y XGTUKNDGTVWPFGOCKNNKGTVLGYGKNUCP2GPVCIQPCNDCPFURCPIGWPFKO'VWK&C\W/GFCKNNG\WO,CJTGU VCIFGT2TQMNCOCVKQPFGT4GRWDNKMCP$CPFURCPIG45<- 5VÒEM++



)GUVKHVGV CO  FWTEJ &ET  2/#0 WPF XGTÌHHGPVNKEJV KO $ 1H 0T  &GT 1TFGP YWTFG HÒT VTGWG   &KGPUVG KP FGP DGYCHHPGVGP 1TICPGP #TOGG WPF +PPGPOKPKUVGTKWO  XGTNKGJGP &KG  -NCUUG HÒT  FKG  HÒT    WPFFKGHÒT&KGPUVLCJTG$GK&KGPUV\GKVGPÒDGT,CJTGPYWTFGFKG+-NCUUGLGYGKNUPCEJHÒPHYGKVGTGP,CJTGP YKGFGTXGTNKGJGP&KG&KGPUVLCJTGYWTFGPCD#WIWUVD\YHÒT(TGKYKNNKIGFGT&KXKUKQP6WFQT8NCFKOKTG UEW&GDTGVKPCD1MVQDGTFGO6CIFGT)TÒPFWPIFGT&KXKUKQPKPFGT5QYLGVWPKQPIGTGEJPGV&CU8GTVGKFK IWPIUD\YFCU+PPGPOKPKUVGTKWOMQPPVGGKPHTÒJGTGU&CVWOCNUFCU&KGPUVGKPVTKVVUFCVWOGKPGT2GTUQPCNU$GTGEJ PWPIUITWPFNCIGHÒTFKG&KGPUV\GKVXQTUEJNCIGP&GT1TFGPJCVFTGK-NCUUGP  9GIGPPFGTWPIFGT5VCCVUHQTOYWTFGPFKG$WEJUVCDGPō424ŋFWTEJō454ŋGTUGV\V&CU1TFGPUDCPFCNNGT-NCU UGPKUVPWPINGKEJGUDGHKPFGVUKEJPWTPQEJGKPTQVGT/KVVGNUVTGKHGPCWHFGP$·PFGTP&KGFWPMGNDNCWGP5GKVGPUVTGK HGP UKPF PWP GKPG 0WCPEG JGNNGT WPF GTUEJGKPGP PWP PKEJV OGJT UEJYCT\ &KG +PVGTKOURCPIGP JCDGP LGFQEJ FKG   #P\CJNFGT/KVVGNUVTGKHGPGPVURTGEJGPFKJTGT-NCUUG



2CCT5EJWNVGTUVÒEMGGKPGU&TGKUVGTPG)GPGTCNUWPF-TCIGPURKGIGN5VKEMGTGKGP

5VÒEM++

 141


RUSSLAND

8646 1:1

Rv.-Punze

8646 1:1

4755.#0& <#4'067/4755.#0& $+5  

1TFGPFGUJN#RQUVGNU#PFTGCUFGU'TUVDGTWHGPGP$TWUVUVGTP5KNDGTVNYGOCKNNKGTVCWHFGT4ÒEM UGKVGOGJTHCEJRWP\KGTV Ô?WPF5KNDGTRWP\Gō##ŋ CP5EJTCWDGOKV5EJTCWDUEJGKDGFKGUGOKVGK PGT-QMQUJPKM2WP\GXQPDKURWP\KGTV-.'1044780<- ++



'ZGORNCT CWU WPUGTGT  #WMVKQP CO  ,WPK  1TFGP WPF 'JTGP\GKEJGP  'KPG PQTFCOGTKMCPKUEJG 2TKXCV   UCOONWPI0T  $GK FGO \YGKVGP $WEJUVCDGP FGT /GKUVGTRWP\G FGT PWT VNY GTMGPPDCT KUV JCPFGNV GU UKEJ GPVYGFGT WO GKP ō$ŋ   QFGTWOGKPō2ŋUQFC­FKGUGGPVYGFGTōÔ$ŋQFGTōÔ2ŋNCWVGV



-CKUGTNKEJGT WPF MÌPKINKEJGT 1TFGP XQO 9GK­GP #FNGT 8GTNGKJWPIUWTMWPFG FCVKGTV  OKV   2CRKGT2T·IGUKGIGNWPF1TKIKPCNWPVGTUEJTKHV<CT0KMQNCWU+ 444++ 

8648

8651 8649

8650 1:1



1TFGPXQOJN)GQTI-TGW\-NCUUG5KNDGTXGTIQNFGV/GFCKNNQPTKPIG)QNFGOCKNNKGTV'OCKNNGOC NGTGKQJPGLGINKEJG2WP\KGTWPIQJPG$CPF<- +p++



5GJTSWCNKV·VUXQNNGPKEJVTWUUKUEJG#PHGTVKIWPIKPDGUVGT'TJCNVWPI



1TFGPXQOJN)GQTI-TGW\-NCUUG$TQP\GXGTIQNFGVWPFGOCKNNKGTV'OCKNNGOCNGTGKQJPG$CPF <- ++





1TFGP XQO JN )GQTI 4GFWMVKQP FGU -TGW\GU +8 -NCUUG &WTEJOGUUGT  OO )QNF GOCKNNKGTV   HGKPUVG'OCKNNGOCNGTGKQJPG2WP\KGTWPICPMWT\GO)QNFMGVVEJGP ++





5V)GQTIU5QNFCVGPMTGW\FGU1TFGPUXQOJN)GQTI5V)GQTIU5QNFCVGPMTGW\+-NCUUG$TQP\GCWHFGT 4ÒEMUGKVGPWOOGTKGTVōŋWPFōÆŋWPFō/ŋ<GKEJGPHÒTWPGFNGU/GVCNNCOPGWGP$CPF +++



142


RUSSLAND

Rv.-Punze 8652 8652



1TFGPFGU#RQUVGNINGKEJGPJGKNKIGP(ÒTUVGP9NCFKOKT$TWUVUVGTP\WTWPF-NCUUGOKV5EJYGTVGTP

FKGYQJNPCEJOQPVKGTV 5KNDGTVNYXGTIQNFGVWPFGOCKNNKGTVFGT5EJTKHVTKPIMQORNGVVNCEMKGTV  CWH FGT4ÒEMUGKVG*GTUVGNNGTRWP\G"ÝÄÓÀÐÄÚ"FGT(KTOC'FWCTFKP5V2GVGTUDWTI/GKUVGTOCTMG"ÂÄ"HÒT 8CTXCTC2GVTQXPC&KGVYCNF<QNQVPKMK-QMQUJPKM5KNDGTRWP\GXQPDKUWPFFTGK FCXQP \YGKKPFGP5VGTPURKV\GP -QMQUJPKM2WP\GPXQPDKUCP0CFGN<- +++



8653



1TFGPFGU#RQUVGNINGKEJGPJGKNKIGP(ÒTUVGP9NCFKOKT4GFWMVKQPFGU1TFGPUMTGW\GUZOO )QNF GOCKNNKGTV  I OKV $CPF  HGKPUVG 'OCKNNGOCNGTGK QJPG LGINKEJG 2WP\KGTWPI CO CNVGP 2GPVC   IQPCNDCPF ++



8654



1TFGPFGTJGKNKIGP#PPC/QFGNN  $TWUVUVGTP KPQHHK\KGNNG/GVCNNCWUHÒJTWPIDKU  OKV-TQPG5KNDGTIW­  DTKNNCPVKGTVWPFTGRGTEKGTV)QNFVNYGOCKNNKGTVOGJTGTGOKP#WUDTÒEJGKP FGT TQVGP 'OCKNNG FGU /GFCKNNQPTKPIU GKP $WEJUVCDG HGJNV FKG -TQPG )QNF GOCKNNKGTV YWTFG UR·VGT    JKP\WIGHÒIVQJPGLGINKEJG*GTUVGNNGTRWP\GPCWHFGT4ÒEMUGKVGXGTIQNFGVCP0CFGN<- ++  &C DKU  QHHK\KGNN PWT IGUVKEMVG $TWUVUVGTPG XGTNKGJGP YWTFGP UKPF OW­VGP UKEJ FKG$GNKGJGPGPUGNDUVFKG$TWUV UVGTPGKP/GVCNNDGUEJCHHGPUQUKGUQNEJGYÒPUEJVGP  &KG-TQPGFÒTHVGGTUVPCEJKPFGT\YGKVGP*·NHVGFGU<YCP\KIUVGP,CJTJWPFGTVU  CPIGDTCEJVYQTFGPUGKPFGPPDGK 'ZGORNCTGPOKV-TQPGHGJNVFKGUGPQTOCNGTYGKUGKO/GFCKNNQPTKPI

143


RUSSLAND

8655 1:1

8655 1:1 Rv.-Punze



1TFGP FGT JGKNKIGP #PPC  /QFGNN   $TWUVUVGTP QHHK\KGNNG /GVCNNCWUHÒJTWPI UGKV     5KNDGTIW­  VNYGOCKNNKGTV/GFCKNNQPWOuXGTFTGJVCWHFGT4ÒEMUGKVG*GTUVGNNGTDG\GKEJPWPIFGT (KTOC -GKDGN &QRRGNCFNGT HÒT *QHNKGHGTCPVGP XQP  DKU  WPF 5V 2GVGTUDWTIGT 5KNDGTRWP\G    <QNQVPKMKXQPDKUCP0CFGN<- ++ 

Punze in der Öse

8656 1:1



8656 1:1

1TFGP FGT JGKNKIGP #PPC  /QFGNN   -TGW\  -NCUUG OKV 5EJYGTVGTP )QNF GOCKNNKGTV    I 'OCKNNGOCNGTGK CWH FGT 4ÒEMUGKVG WPVGT FGT 'OCKNNG *GTUVGNNGTRWP\G "ÝÄÓÀÐÄÚ" FGT (KTOC   'FWCTF KP 5V 2GVGTUDWTI WPF /GKUVGTOCTMG "ÂÄ" HÒT 8CTXCTC 2GVTQXPC &KGVYCNF KP FGT ¤UG    <QNQVPKMK -QMQUEJPKM)QNFRWP\G XQP  DKU  OKV FGP $WEJUVCDGP ō#2ŋ HÒT # 4KEJVGT   2TQDKGTOGKUVGTKP5V2GVGTUDWTIFKGTÒEMUGKVKIG'OCKNNGOCNGTGKGVYCU\GTMTCV\VOKVWPMQPHGMVKQPKGTVGO UR·VGTGO*CNUDCPFCDUEJPKVVKOQTKIKPCNGP8GTNGKJWPIUGVWKOKVIQNFHCTDGPGO<CTGPCFNGT<- ++  #WHITWPFFGT2WP\G"ÂÄ"N·­VUKEJFKG*GTUVGNNWPIU\GKVFGU5VÒEMGUCWHDKUGKPITGP\GP6COOCPPHÒJTV KP 642 5   CWU FCU 8CTXCTC 2GVTQXPC &KGVYCNF 9KVYG XQP 'FWCTF (GTPCFQYKEJ &KGVYCNF FKG (KTOC PCEJ   FGUUGP 6QF  ÒDGTPQOOGP JCV 0CEJ 7OYCPFNWPI FGT (KTOC KP GKPG #MVKGPIGUGNNUEJCHV ÒDGTPCJO &KOKVTK   +XCPQXKEJ1UKRQXFKG/CLQTKV·VFGT(KTOCFKGCDGTYGKVGTJKPWPVGTFGO0COGP'FWCTFHKTOKGTVG

144


RUSSLAND

8659

8658 1:1 8657



1TFGPFGTJGKNKIGP#PPC/QFGNN  -TGW\-NCUUG)QNFGOCKNNKGTVI OKV$CPF  'OCKNNGOCNGTGKCWHFGT4ÒEMUGKVGWPVGTFGT'OCKNNG*GTUVGNNGTRWP\G"ÝÄÓÀÐÄÚ"FGT(KTOC'FWCTFKP 5V2GVGTUDWTIFKG/GKUVGTOCTMGFWTEJFCUHGUVIGP·JVG$CPFCDIGFGEMVGKPG8GT\KGTWPI\YKUEJGPFGP -TGW\CTOGPJGTCWUIGDTQEJGPKPFGT¤UG\GKVNKEJPKEJV\W\WQTFPGPFG<QNQVPKMK)QNFRWP\GCOQTKIK PCNGPCNVGP$QIGPDCPFUEJYGFKUEJGT0·JCTV<- +++





1TFGPFGTJGKNKIGP#PPC/QFGNN  /KPKCVWTFGU1TFGPUMTGW\GU5KNDGTXGTIQNFGV/G FCKNNQPU)QNFGOCKNNKGTVDGKFUGKVKI'OCKNNGOCNGTGKFGT8QTFGTUGKVGCO$·PFEJGP ++





1TFGPFGTJGKNKIGP#PPC/QFGNN  #D\GKEJGPHÒTFGP5CPMV#PPGP5·DGNHÒT0KEJVEJTK UVGP$TQP\GPGW  GOCKNNKGTV&C\W$TQP\GOGFCKNNGHÒTFGP-TKGIOKV$CPF 5VÒEM++



Punzen

8660 1:1



-CKUGTNKEJGTWPFMÌPKINKEJGT1TFGPXQOJGKNKIGP5VCPKUNCWU/QFGNN#WUICDG EC  -TGW\FGT-NCUUG)QNFGOCKNNKGTVI'OCKNNGOCNGTGKCWHFGT4ÒEMUGKVGRWP\KGTVō#-ŋHÒT#NDGTV -GKDGNWPF&QRRGNCFNGTFGT*QHNKGHGTCPVGPXQPDKUKPFGT¤UG5V2GVGTUDWTIGT<QNQVPKMK )QNFRWP\GXQPDKUKO$CPFTKPI5V2GVGTUDWTIGT5VCFVRWP\GQJPG5EJWNVGTDCPF<- ++



#PHGTVKIWPI CWU FGP ,CJTGP  DKU   8QP  DKU  JCVVG #NDGTV -GKDGN   CNU QHHK\KGNNGT   1TFGPULWYGNKGT GKPGP 'ZMNWUKXXGTVTCI OKV FGO 1TFGPUMCRKVGN  &GT  XQP -ÌPKI 5VCPKUNCY ++ #WIWUV 2QPKC   VQYUMKIGUVKHVGVGMÌPKINKEJRQNPKUEJG1TFGPXQOJN5VCPKUNCWUYWTFGFWTEJFKG5VCVWVGPXQO,WPKWPVGTFKG MCKUGTNKEJTWUUKUEJGP1TFGPCWHIGPQOOGP&KGWTURTÒPINKEJG-NCUUGYWTFGCDIGUEJCHHV+PFGP,CJTGP  JCVVG FGT 1TFGP PWT FKG  -NCUUG +P FGT *KGTCTEJKG FGT TWUUKUEJGP 1TFGP UVCPF GT CP WPVGTUVGT 5VGNNG CDGT   UGKPG-NCUUG +:6UEJKP TCPIKGTVGJÌJGTCNUFKG-NCUUGFGU5V#PPC1TFGPUWPFUGKPG-NCUUG +86UEJKP  JÌJGTCNUFKG-NCUUGFGU5V#PPC1TFGPUWPFFKG-NCUUGFGU5V9NCFKOKT1TFGPU#NUDGUQPFGTGT)PCFGPGT YGKUMQPPVGPFKGWPF-NCUUGXQPDKUOKVMCKUGTNKEJGT-TQPGXGTNKGJGPYGTFGP

145


RUSSLAND

8663 1:1

8663 1:1 8661 1:1

Punzen 8662 1:1



-CKUGTNKEJGTWPFMÌPKINKEJGT1TFGPXQOJGKNKIGP5VCPKUNCWU/QFGNN$TWUVUVGTP QHHK\KGNNG/GVCNN CWUHÒJTWPIUGKV 5KNDGTVNYXGTIQNFGVWPFGOCKNNKGTVCWHFGTXGTIQNFGVGP4ÒEMUGKVG*GTUVGNNGTDG \GKEJPWPI FGT (KTOC -GKDGN &QRRGNCFNGT HÒT *QHNKGHGTCPVGP XQP  DKU  WPF 5V 2GVGTUDWTIGT   5KNDGTRWP\G<QNQVPKMKXQPDKUCP0CFGNFKGUGGDGPHCNNUOKV&QRRGNCFNGT-GKDGN/CTMG WPF5V2GVGTUDWTIGT5KNDGTRWP\G<QNQVPKMKXQPDKUUQYKGHTCP\ÌUKUEJG'KPHWJTRWP\GHÒT 5KNDGTXQPDKU ō5EJYCPGPRWP\Gŋ NGV\VGTGGDGPUQCO0CFGNJCMGP<- ++ 



-CKUGTNKEJGTWPFMÌPKINKEJGT1TFGPXQOJGKNKIGP5VCPKUNCWU/QFGNN#WUICDG EC  -TGW\FGT-NCUUG)QNFGOCKNNKGTVI'OCKNNGOCNGTGKCWHFGT4ÒEMUGKVGRWP\KGTVō#-ŋHÒT#NDGTV -GKDGNWPF&QRRGNCFNGTFGT*QHNKGHGTCPVGPXQPDKUKPFGT¤UG<QNQVPKMK-QMQUJPKM)QNF RWP\GXQPDKUOKVFGO2TQDKGTOGKUVGT\GKEJGP"ßË"HÒT;CMQX.[CRWPQX2TQDKGTOGKUVGTKP 5V2GVGTUDWTICOCNVGP*CNUDCPFCDUEJPKVV<- ++



&C;CMQX.[CRWPQXNCWV6COOCP KP6425 PWTXQPDKUCNU2TQDKGTOGKUVGTV·VKIYCTJCPFGNVGUUKEJ JKGTDGKWOGKPG#PHGTVKIWPICWUFKGUGO<GKVTCWO



-CKUGTNKEJGTWPFMÌPKINKEJGT1TFGPXQOJGKNKIGP5VCPKUNCWU/QFGNN#WUICDG #FNGTOKVCWU IGDTGKVGVGP (NÒIGNP  EC   -TGW\ FGT  -NCUUG )QNF GOCKNNKGTV  I 'OCKNNGOCNGTGK   8QTFGTUGKVGPOGFCKNNQPDGTKGDGP'OCKNNGUEJCFGPKOTÒEMUGKVKIGP/GFCKNNGPQJPG2WP\KGTWPIKO-TGW\ ¤UGHGJNVQJPG$CPF<-XCT ++  'UJCPFGNVUKEJJKGTDGKWOGKPG\GKVIGPÌUUKUEJGPKEJVQHHK\KGNNG#PHGTVKIWPI\YKUEJGPWPFEC  0CEJ FGO 6QF 'OOCPWGN )GQTIU XQP 2CPPCUEJ  HÒJTVGP FKG KJO PCEJHQNIGPFGP QHHK\KGNNGP 1TFGPULWYGNKGTG   -GKDGN-·OOGTGTECFKGPCEJQDGPIGTKEJVGVGP#FNGT(NÒIGNGKP'KPKIGRTKXCVG*GTUVGNNGTLGFQEJDGJKGNVGP FKGYGKVCWUIGDTGKVGVGP5EJYKPIGPFGT#FNGTDKUWODGK

146


RUSSLAND

8664

8665

8666 8669



-CKUGTNKEJGTWPFMÌPKINKEJGT1TFGPXQOJGKNKIGP5VCPKUNCWU/QFGNN#WUICDG EC  -TGW\FGT-NCUUGOKV5EJYGTVGTP$TQP\GXGTIQNFGVWPFGOCKNNKGTVQJPG$CPF<- ++





/GFCKNNGHÒT'KHGT/QFGNN OKVFGO2QTVTCKV<CT#NGZCPFGT+++ #WUHÒJTWPI)TQ­G 5KNDGTPG/GFCKNNG5KNDGTOKV5VGORGNUEJPGKFGT\GKEJGP"#Ã" HÒT#XGPKT)TKGIQTKGYKVEJ)TKNKEJGU5T  KO*CNUCDUEJPKVVCOQTKIKPCNGPCNVGPMQPHGMVKQPKGTVGP*CNUDCPF447$ ++





/GFCKNNGHÒT'KHGT/QFGNNOKVFGO2QTVTCKV<CT0KMQNCWU++  -NGKPG5KNDGTPG/GFCKNNG 5KNDGTCOCNVGP1TKIKPCNDCPF4147# ++





/GFCKNNGHÒTFGP4WUUKUEJ6ÒTMKUEJGP-TKGI/GFCKNNGKPJGNNGT$TQP\GHÒTFKG6GKNPGJOGT CPFGP5EJNCEJVGPWPF)GHGEJVGPFGT-CWMCUKUEJGP(TQPVQFGTKO5EJYCT\OGGTCOPGWGP$CPF&C\W /GFCKNNGHÒTFKG$GHTGKWPIXQP$WNICTKGP$TQP\GIW­  COPGWGP$CPF447 5VÒEM++





'TKPPGTWPIUOGFCKNNGCPFKG4GIKGTWPI<CT#NGZCPFGTU+++5KNDGTQJPG$CPF





+PQHHK\KGNNG /GFCKNNG CWH FKG 'KPJWPFGTVLCJTHGKGT FGU 5KGIGU <CT #NGZCPFGTU + ÒDGT 0CRQN¾QP   $TQP\GCO$CPF ++

++



8670 1:1



)TQ­G 1TFGPUUEJPCNNGGKPGUTWUUKUEJGP1HHK\KGTUOKVHÒPH#WU\GKEJPWPIGP 1TFGTFGTJN#PPC -TGW\-NCUUG)QNFGOCKNNKGTVCWHFGT4ÒEMUGKVGWPVGTFGT'OCKNNGRWP\KGTVō#-ŋHÒT#NDGTV-GKDGNWPF &QRRGNCFNGTFGT*QHNKGHGTCPVGPXQPDKUKPFGT¤UG<QNQVPKMK-QMQUEJPKM)QNFRWP\GXQP DKUOKVFGO2TQDKGTOGKUVGT\GKEJGP"ßË"HÒT;CMQX.[CRWPQX2TQDKGTOGKUVGTKP5V2GVGTUDWTI  1TFGPXQOJN5VCPKUNCWU-TGW\-NCUUG)QNFGOCKNNKGTVCWHFGT4ÒEMUGKVGRWP\KGTVō#-ŋHÒT#NDGTV -GKDGN WPF &QRRGNCFNGT FGT *QHNKGHGTCPVGP XQP  DKU  KP FGT ¤UG  <QNQVPKMK -QMQUEJPKM   )QNFRWP\G XQP  DKU    'TKPPGTWPIUOGFCKNNG CP FKG 4GIKGTWPI <CT #NGZCPFGT +++ 5KNDGT    'TKPPGTWPIUOGFCKNNGCPFKG,CJTHGKGTFGT&[PCUVKG4QOCPQY$TQP\GXGTIQNFGV /QDKNKUCVKQPU /GFCKNNG ++  ;CMQX.[CRWPQXYCTNCWV6COOCP KP6425 CNU2TQDKGTOGKUVGTPWTXQPDKUV·VKI

147


RUSSLAND

8671 1:1

<#4'067/4755.#0&#$<'+%*'0 

7PDGMCPPVGU#D\GKEJGPCWH<CTKP-CVJCTKPC++)QNFVNYGOCKNNKGTVIHGKPUVG'OCKNNGOCNGTGK CWHFGT4ÒEMUGKVGRWP\KGTV "KÔ"YQJNHÒT-CTN(CDGTI¾WPF/QUMCWGT2WP\GHÒT<QNQVPKMK)QNFXQP DKU CP0CFGN +p++



'ZGORNCT CWU WPUGTGT  #WMVKQP CO  ,WPK  1TFGP WPF 'JTGP\GKEJGP  'KPG PQTFCOGTKMCPKUEJG 2TKXCV   UCOONWPI0T

8674 1:1 8677

8672

8673 1:1

8675 8676





8678

4GIKOGPVUCD\GKEJGP FGU .GVVKUEJGP 5EJÒV\GP4GIKOGPVU #WUICDG  $TQP\G XGTUKNDGTV VNY   XGTIQNFGV8GTUKNDGTWPIVNYXGTICPIGPCP5EJTCWDGOKV5EJTCWDUEJGKDGFCTCWH*GTUVGNNGTDG\GKEJPWPI FGT(KTOCō!$#0-ŋKP4KIC2$ ++



)TCFWKGTWPIU#D\GKEJGPFGU2QN[VGEJPKUEJGP+PUVKVWVU"ÐÏÈ"KP4KIC4GFW\KGTVG#WUHÒJTWPIZ OO)QNFI QJPG5EJTCWDUEJGKDG CP5EJTCWDGOKV5EJTCWDUEJGKDG 44++



&CU#D\GKEJGPKUVDGK2CVTKMGGXWPF$QLPQXKEJ 2$2$2$ UQPKEJVCDIGDKNFGV



#D\GKEJGP FGU /QUMCWGT 4GIKOGPVU FGT .GKDICTFG /KPKCVWT $TQP\G XGTIQNFGV WPF GOCKNNKGTV CP   5EJTCWDG OKV 5EJTCWDUEJGKDG CWH FKGUGT *GTUVGNNGTDG\GKEJPWPI FGT(KTOC9KNJGNO&GWOGTKP.ÒFGP UEJGKF ++





#D\GKEJGPFGT5VCCVNKEJGP/KNK\#WUHÒJTWPIOKV/QPQITCOO<CT0KMQNCWU++$TQP\G0CFGNCDIG DTQEJGP2$ +++





#OVUMGVVGOKV#D\GKEJGPHÒT4KEJVGT&CVKGTV0QXGODGT$TQP\GXGTIQNFGV



#OVUCD\GKEJGP9QJNHÒT#PY·NVG$TQP\GXGTIQNFGVOKV5EJTCWDGWPF5EJTCWDUEJGKDGOKVCPJ·PIGP FGTMWT\GT-GVVG ++





#OVUCD\GKEJGP/KVITQ­GO<CTGPCFNGT OKV9CRRGPCWHFGP(NÒIGNP $TQP\GXGTIQNFGVOKV5EJTCWDG WPF5EJTCWDUEJGKDGOKVCPJ·PIGPFGTMWT\GT-GVVG ++



148

++




SCHWEDEN

8680

8679

70+10&'451<+#.+56+5%*'0519,'64'27$.+-'0 519,'670+10  

#D\GKEJGPFGTTWUUKUEJGP/KNKV·TOKUUKQPDGKFGP0ÒTPDGTIGT2TQ\GUUGPDKU ! $TQP\G VNYGOCKNNKGTVCWHFGT4ÒEMUGKVGWPFGWVNKEJRWP\KGTVCP5EJTCWDGOKV5EJTCWDUEJGKDG 4++





#D\GKEJGP     Î.Ã.Ï.Ó. $TQP\G FKG 'OCKNNG ITÌ­VGPVGKNU CDIGRNCV\V CP 5EJTCWDG OKV   5EJTCWDUEJGKDG +++





-QPXQNWVXQPFTGKUQYLGVKUEJGP#WU\GKEJPWPIGP 1TFGPō<GKEJGPFGT'JTGŋ 1TFGPFGU4QVGP #TDGKVUDCPPGTU   1TFGP XQO 4QVGP 5VGTP LGYGKNU 5KNDGT VGKNU VNY XGTIQNFGV GOCKNNKGTVLGYGKNUCWH FGT 4ÒEMUGKVG PWOOGTKGTV FKG GTUVGP DGKFGP CP 2GPVCIPQPCNDCPFURCPIG FKG FTKVVG OKV 5EJTCWDG WPF   5EJTCWDUEJGKDG&C\W(TCP\ÌUKUEJG/GFCKNNG/¾TKVG%KXKSWGXGTIQNFGVCO$CPFOKV4QUGVVG  5VÒEM++



.+6'4#674 

1TFGPUNKVGTCVWT -QPXQNWV XQP  /QPQITCHKGP \WTWUUKUEJGP1TFGPWCXQP$GTIJOCP&WTQX Z  )NCFMQX/QNNQWPF5KOQPQX<CMCVQX)CP\NGKPGP Z -CTVQPKGTV Z $TQUEJKGTV Z  5VÒEM++



8683 1:1

-¤0+)4'+%*5%*9'&'0 

-ÌPKINKEJGT 5EJYGTVQTFGP  /QFGNN FGU 1TFGPU UGKV   )TQ­MTGW\  Z  OO )QNF   GOCKNNKGTV  I CWH FGT 8QTFGTUGKVG FGU NKPMGP WPVGTGP -TGW\CTOU UQYKG KP \YGK -TGW\URKV\GP CNVG   'OCKNNGTGRCTCVWTGP CWH FGT 4ÒEMUGKVG OGJTGTG #WUDTÒEJG %JKRU WPF $GUEJ·FKIWPIGP KP FGT YGK­GP   WPFDNCWGP'OCKNNGCOQTKIKPCNGPCNVGP5EJWNVGTDCPF<- 44++  'ZVTGOUGNVGPGHTÒJG#PHGTVKIWPICWUFGOGTUVGP8KGTVGNFGU0GWP\GJPVGP,CJTJWPFGTVUKPGKPGTHÒTFCUJQJG#NVGT FGU'ZGORNCTUQTFGPVNKEJGP'TJCNVWPI

149


SCHWEDEN

8685 1:1

8684 1:1



8684 1:1

-ÌPKINKEJGT5EJYGTVQTFGP/QFGNNFGU1TFGPU UGKV )TQ­MTGW\)QNFGOCKNNKGTVIKO 8QTFGTUGKVGP/GFCKNNQP\YGKQDGTHN·EJNKEJG'OCKNNGMTCV\GTQJPG5EJWNVGTDCPF<- ++



5GJTSWCNKV·VUXQNNG#PHGTVKIWPICWUFGO\YGKVGP&TKVVGNFGU0GWP\GJPVGP,CJTJWPFGTVUKPJGTXQTTCIGPFGT'TJCNVWPI #O  (GDTWCT  UVKHVGVG -ÌPKI (TGFTKM + XQP 5EJYGFGP CWU FGO *CWUG *GUUGP-CUUGN  FGP \WP·EJUV   \YGKMNCUUKIGP -QOOCPFGWT WPF 4KVVGT  1TFGP \WUCOOGP OKV FGO -ÌPKINKEJGP 5GTCRJKO1TFGP WPF FGO -ÌPKINK   EJGP 5EJYGTVQTFGP  TGQTICPKUKGTVG -ÌPKI )WUVCX +++ FGP 1TFGP KPFGO GT GKP )TQ­MTGW\ UVKHVGVG YQDGK FKG   +PJCDGT FKGUGT -NCUUGō-QOOCPFGWTOKV)TQ­MTGW\ŋIGPCPPVYWTFGP UVKHVGVGGTHÒT-TKGIU\GKVGPFKG-NCUUG FGT4KVVGTOKVFGO)TQ­GP-TGW\-NCUUGFGU5EJYGTVQTFGPU 4KVVGTMTGW\CO*CNUOKVCWHTGEJVUVGJGPFGO5EJYGTV CWH FGT NKPMGP $TWUV  FKG FWTEJ -ÌPKI -CTN :+++  WO FKG -NCUUG FGT 4KVVGT OKV FGO )TQ­GP -TGW\ FGU   5EJYGTVQTFGPU 4KVVGTMTGW\CO*CNUOKVIGMTGW\VGP5EJYGTVGTPCWHFGTNKPMGP$TWUV GTYGKVGTVYWTFG#O,WPK UVKHVGVG-ÌPKI1UECT+FCUCHHKNKKGTVG5EJYGTV\GKEJGPWPFFKGCHHKNKKGTVG5EJYGTVOGFCKNNGHÒT7PVGTQHHK\KGTGWPF /CPPUEJCHVGP+O/CKYWTFG-CKUGT9KNJGNO+XQP-ÌPKI1UECT++GKPGIQNFGPG5EJYGTVOGFCKNNGXGTNKGJGP FKG\YCTGDGPHCNNUIGUVKHVGVYQTFGPYCTCDGTPWTGKPOCNXGTNKGJGPYWTFGGDGPCP-CKUGT9KNJGNO+ XIN'8 5H -ÌPKI%CTN:8UVKHVGVGGKPGP$TWUVUVGTP\WO-QOOCPFGWTWPF-ÌPKI1UECT++WPVGTVGKNVGCWU #PNC­ UGKPGT -TÌPWPI FKG-QOOCPFGWTGKP-QOOCPFGWTG-NCUUG OKV$TWUVUVGTP WPF-QOOCPFGWTG-NCUUG

QJPG$TWUVUVGTPCDō-QOOCPFGWTŋIGPCPPV YQDGKNGV\VGTGDKU\WO5GRVGODGT#WUN·PFGTPXQTDG JCNVGP YCT $GTGKVU  YCTGP FKG DKU FCJKP IGUVKEMVGP $TWUVUVGTPG QHHK\KGNN KP /GVCNNUVGTPG WOIGYCPFGNV YQTFGP   FGTGP#TOHN·EJGPDKUDTKNNCPVKGTVXQPDKUIGUEJWRRVWPFUGKVFKGUGO<GKVRWPMVINCVVYCTGP/KVFGP PGWGP5VCWVGPXQO0QXGODGTYWTFGCWEJFKG4KVVGTMNCUUGKP4KVVGT-NCUUGWPF4KVVGT-NCUUG CD ō4KVVGTŋ IGPCPPV  WPVGTVGKNV YQDGK NGV\VGTG \WP·EJUV GDGPHCNNU PWT #WUN·PFGTP XQTDGJCNVGP YCT  YWTFG FCU   5EJYGTV\GKEJGP QJPG 5EJYGTVGT XQP -ÌPKI 1UECT ++ IGUVKHVGV #O  /·T\  GTNKG­ -ÌPKI )WUVCX 8+ #FQNH   PGWG 5VCVWVGP OKV FGPGP HÒT -TKGIU\GKVGP GKP FTGKMNCUUKIGU CHHKNKKGTVGU -TKGIUMTGW\ FGU 5EJYGTVQTFGPU IGUVKHVGV   YWTFG#WH$GUEJNW­FGU5EJYGFKUEJGP4GKEJUVCIGUXQO,WPKYWTFGFKG8GTNGKJWPIFGU5EJYGTVQTFGPUOKV 9KTMWPIXQO,CPWCTIGPGTGNNGKPIGUVGNNV



-ÌPKINKEJGT5EJYGTVQTFGP/QFGNNFGU1TFGPU UGKV $TWUVUVGTP\WO)TQ­MTGW\#WUICDG

QHHK\KGNNPWTKPIGUVKEMVGT#WUHÒJTWPI 5KNDGT#WHNCIGP)QNFHGKPUVITCXKGTVWPF\KUGNKGTVVNYGOCKN NKGTV\YGKCNVG'OCKNNGTGRCTCVWTGPKO/GFCKNNQPCP0CFGN<- ++  5GJTSWCNKV·VUXQNNG#PHGTVKIWPICWUFGO\YGKVGP&TKVVGNFGU0GWP\GJPVGP,CJTJWPFGTVU  $KU  YWTFGP KP 5EJYGFGP QHHK\KGNN PWT IGUVKEMVG $TWUVUVGTPG DGK FGT 8GTNGKJWPI XGTIGDGP /GVCNNCWUHÒJTWPIGP   NKG­GPUKEJFKG$GNKGJGPGPCNU<YGKVUVÒEMGCPHGTVKIGP

150


SCHWEDEN

8687

8688

8686







-ÌPKINKEJGT 5EJYGTVQTFGP  /QFGNN UGKV   4KVVGTMTGW\ CD  4KVVGTMTGW\  -NCUUG  )QNF   GOCKNNKGTV  I OKV $CPF  CWH FGO 4CPF FGU TGEJVGP WPVGTGP -TGW\CTOU OGJTHCEJ RWP\KGTV W C   ō%(%ŋHÒTFGP*GTUVGNNGT%(%CTNOCPKP5VQEMJQNOō-ŋHÒTEVQJPG,CJTGURWP\G COCNVGP 1TKIKPCNDCPFKO1TKIKPCNGVWKFGU*QHLWYGNKGTU%CTNOCP<- +p++



-ÌPKINKEJGT 5EJYGTVQTFGP  /QFGNN UGKV   4KVVGTMTGW\ CD  4KVVGTMTGW\  -NCUUG  )QNF   GOCKNNKGTVI OKV$CPFWPF6TCIGURCPIG CWHFGO4CPFFGUTGEJVGPWPVGTGP-TGW\CTOUOGJTHCEJ RWP\KGTV WCō%(%ŋHÒTFGP*GTUVGNNGT%(%CTNOCPKP5VQEMJQNOō-ŋHÒTEVQJPG,CJTGURWP\G  COCNVGP1TKIKPCNDCPFOKV6TCIGURCPIGKO1TKIKPCNGVWKFGU*QHLWYGNKGTU%CTNOCP<- ++



-ÌPKINKEJGT 5EJYGTVQTFGP  /QFGNN UGKV   4KVVGTMTGW\ CD  4KVVGTMTGW\  -NCUUG  )QNF   GOCKNNKGTV  I OKV $CPF  CWH FGO 4CPF FGU TGEJVGP QDGTGP -TGW\CTOU OGJTHCEJ RWP\KGTV W C   ō%(%ŋ HÒT FGP *GTUVGNNGT % ( %CTNOCP KP 5VQEMJQNO ō-ŋ HÒT  EV OKV ,CJTGURWP\G ō7ŋ HÒT    COCNVGP1TKIKPCNDCPF<- ++



8690



8689

-ÌPKINKEJGT5EJYGTVQTFGP/QFGNN UGKV 4KVVGTMTGW\ CD4KVVGTMTGW\-NCUUG 5KNDGT XGTIQNFGV/GFCKNNQP)QNFGOCKNNKGTVCO1TKIKPCNDCPFOKV6TCIGURCPIG<- ++



'ZGORNCTGKP5KNDGTXGTIQNFGVUKPFYGKVCWUUGNVGPGT\WHKPFGPCNU'ZGORNCTGKP)QNF



-ÌPKINKEJGT5EJYGTVQTFGP/QFGNN UGKV 5EJYGTVGTMTGW\OKV5EJYGTVGTP UGKV #WU ICDG OKV IQNFGPGO 8QTFGTUGKVGPOGFCKNNQP  5KNDGT 8QTFGTUGKVGPOGFCKNNQP )QNF GOCKNNKGTV CWH FGT   4ÒEMUGKVGFGT#MCPVJWU#ITCHHGOGJTHCEJRWP\KGTV WCō%(%ŋHÒTFGP*GTUVGNNGT%CTNOCPWPFō5ŋHÒT 5KNDGT COCNVGP$QIGPDCPFUEJYGFKUEJGT0·JCTVOKV0CFGN<- ++



151


SCHWEDEN

8691







8693

8692

-ÌPKINKEJGT5EJYGTVQTFGP/QFGNN UGKV 5EJYGTVGTMTGW\OKV5EJYGTVGTP UGKV #WU ICDG OKV IQNFGPGO 8QTFGTUGKVGPOGFCKNNQP  5KNDGT 8QTFGTUGKVGPOGFCKNNQP )QNF GOCKNNKGTV QJPG 2WP   \KGTWPI CO CNVGP 1TKIKPCNDCPF KO QTKIKPCNGP 8GTNGKJWPIUGVWK FGU *QHLWYGNKGTU % ( %CTNOCP KP   5VQEMJQNO<- ++



-ÌPKINKEJGT5EJYGTVQTFGP/QFGNN UGKV 5EJYGTVGTMTGW\OKV5EJYGTVGTP UGKV #WU ICDG OKV IQNFGPGO 8QTFGTUGKVGPOGFCKNNQP  5KNDGT 8QTFGTUGKVGPOGFCKNNQP )QNF GOCKNNKGTV QJPG 2WP   \KGTWPICOCNVGP1TKIKPCNDCPFKOQTKIKPCNGPCNVGP8GTNGKJWPIUGVWKFGU*QHLWYGNKGTU%(%CTNOCPKP 5VQEMJQNO<- ++



-ÌPKINKEJGT0QTFUVGTPQTFGP4KVVGTMTGW\ UGKV4KVVGTMTGW\-NCUUG )QNFGOCKNNKGTVI OKV $CPF CWHFGO4CPFFGUGEJVGP-TGW\CTOUOGJTHCEJRWP\KGTV WCō%(%ŋHÒTFGP*GTUVGNNGT%( %CTNOCPKP5VQEMJQNOō-ŋHÒTEVWPF,CJTGURWP\Gō)ŋHÒT COUEJYCT\GP$CPFKOGVYCU DGUEJ·FKIVGP1TKIKPCNGVWKFGU*QHLWYGNKGTU%CTNOCP<- +p++



#O  (GDTWCT  UVKHVGVG -ÌPKI (TGFTKM + XQP 5EJYGFGP CWU FGO *CWUG *GUUGP-CUUGN  FGP \WP·EJUV   \YGKMNCUUKIGP -QOOCPFGWT WPF 4KVVGT  1TFGP \WUCOOGP OKV FGO -ÌPKINKEJGP 5GTCRJKO1TFGP WPF FGO -ÌPKINK   EJGP5EJYGTVQTFGPUVKHVGVG-ÌPKI)WUVCX+++-QNNCPGPHÒTFKG-QOOCPFGWTG-ÌPKI1UECT+UVKHVGVGFKG )TQ­MTGW\MNCUUG IGPCPPV ō-QOOCPFGWT OKV )TQ­MTGW\ŋ -ÌPKI %CTN :8 UVKHVGVG  GKPGP $TWUVUVGTP \WO   -QOOCPFGWT WPF -ÌPKI 1UECT ++ WPVGTVGKNVG  CWU #PNC­ UGKPGT -TÌPWPI FKG -QOOCPFGWTG KP -QOOCPFGWTG   -NCUUG OKV$TWUVUVGTP WPF-QOOCPFGWTG-NCUUG QJPG$TWUVUVGTPCDō-QOOCPFGWTŋIGPCPPV YQDGK NGV\VGTG DKU  #WUN·PFGTP XQTDGJCNVGP YCT $GTGKVU  YCTGP FKG DKU FCJKP IGUVKEMVGP $TWUVUVGTPG QHHK\KGNN KP   /GVCNNUVGTPG WOIGYCPFGNV YQTFGP FGTGP #TOHN·EJGP DKU  DTKNNCPVKGTV XQP  DKU  IGUEJWRRV WPF UGKV   FKGUGO <GKVRWPMV INCVV YCTGP +P DGUQPFGTGP (·NNGP MQPPVGP FKG +PUKIPKGP CNNGT -NCUUGP CWEJ ōOKV $TKNNCPVGPŋ XGT   NKGJGPYGTFGP#WH$GUEJNW­FGU5EJYGFKUEJGP4GKEJUVCIGUXQO,WPKYWTFGFKG8GTNGKJWPIFGU0QTFUVGT PQTFGPU CP UEJYGFKUEJG 5VCCVUDÒTIGT OKV 9KTMWPI XQO  ,CPWCT  GKPIGUVGNNV /KV FGT 4GHQTO FGU UEJYGFK   UEJGP1TFGPUYGUGPUXQPYWTFGCWEJFKG4KVVGTMNCUUGKP4KVVGT-NCUUGWPF4KVVGTCWHIGVGKNVUQYKGGKPGPGWG $CPFHCTDG DNCW OKV IGNDGP 4CPFUVTGKHGP  GKPIGHÒJTV  YWTFG XQP -ÌPKI %CTN :8+ )WUVCX FKG FGO 1TFGP   CHHKNKKGTVG0QTFUVGTPOGFCKNNGIGUVKHVGV/KV&CVWOXQO#WIWUVGTJKGNVFGT1TFGPPGWG5VCVWVGP

8694





152

8695

-ÌPKINKEJGT0QTFUVGTPQTFGP4KVVGTMTGW\ UGKV4KVVGTMTGW\-NCUUG )QNFGOCKNNKGTVI OKV $CPFWPF6TCIGURCPIG CWHFGO4CPFFGUGEJVGP-TGW\CTOUOGJTHCEJRWP\KGTV WCō%(%ŋHÒTFGP *GTUVGNNGT%(%CTNOCPKP5VQEMJQNOō-ŋHÒTEVWPF,CJTGURWP\Gō+ŋHÒT COUEJYCT\GP $CPFKO1TKIKPCNGVWKFGU*QHLWYGNKGTU%CTNOCP<- +p++



-ÌPKINKEJGT 0QTFUVGTPQTFGP 4KVVGTMTGW\ UGKV  4KVVGTMTGW\  -NCUUG  5KNDGT XGTIQNFGV /GFCKN   NQPU)QNFGOCKNNKGTVCOUEJYCT\GP$CPFKOGVYCUDGUEJ·FKIVGP1TKIKPCNGVWKFGU*QHLWYGNKGTU%( %CTNOCPKP5VQEMJQNO<- ++




SCHWEDEN

8696 1:1



8697 1:1

-ÌPKINKEJGT 9CUC1TFGP  /QFGNN   4KVVGTFGMQTCVKQP  Z  OO )QNF HGKPUV   ITCXKGTV GOCKNNKGTV  I QJPG $CPF KO PKEJV \WIGJÌTKIGP 'VWK FGU ,WYGNKGTU ' , 'TKMUUQP KP   *·TPÌUCPF<- 44+p++  *GTXQTTCIGPFG #PHGTVKIWPI CWU FGT /KVVG FGU 0GWP\GJPVGP ,CJTJWPFGTVU  )GUVKHVGV CO  /CK  XQP -ÌPKI   )WUVCX +++   CNU \WP·EJUV FTGKMNCUUKIGT -QOOCPFGWT OKV )TQ­MTGW\ -QOOCPFGWT 4KVVGT  1TFGP HÒT   8GTFKGPUVGWOFKG.CPFYKTVUEJCHV*CPFGN)GYGTDGWPF+PFWUVTKG-WPUVWPF9KUUGPUEJCHV&WTEJ-ÌPKI1UECT+ GTJKGNVGP  FCU -NGKPQF FGU )TQ­MTGW\GU WPF FKG -QOOCPFGWTFGMQTCVKQP LGYGKNU GKPG MÌPKINKEJG -TQPG CNU   ªDGTJÌJWPI #O  #RTKN  TGQTICPKUKGTVG -ÌPKI %CTN :8   FGP 1TFGP ICD FGP +PUKIPKGP GKPG   )GUVCNVWPFHÒJTVGGKPGP$TWUVUVGTP\WO-QOOCPFGWTGKP#WU#PNC­UGKPGT-TÌPWPIVGKNVG-ÌPKI1UECT++   FKG-QOOCPFGWTMNCUUGKP-QOOCPFGWTG-NCUUG OKV$TWUVUVGTP WPF-QOOCPFGWTG-NCUUG QJPG $TWUVUVGTP CD  ō-QOOCPFGWTŋ IGPCPPV  YQDGK NGV\VGTG DKU \WO  5GRVGODGT  #WUN·PFGTP XQTDGJCNVGP   YCT $GTGKVU  YCTGP FKG DKU FCJKP IGUVKEMVGP $TWUVUVGTPG QHHK\KGNN KP /GVCNNUVGTPG WOIGYCPFGNV YQTFGP FGTGP   #TOHN·EJGPDKUDTKNNCPVKGTVXQPDKUIGUEJWRRVWPFUGKVFKGUGO<GKVRWPMVINCVVYCTGP/KVFGPPGWGP 5VCWVGP XQO  0QXGODGT  YWTFG CWEJ FKG 4KVVGTMNCUUG KP 4KVVGT  -NCUUG WPF 4KVVGT  -NCUUG CD    ō4KVVGTŋ IGPCPPV  WPVGTVGKNV YQDGK NGV\VGTG \WP·EJUV GDGPHCNNU PWT #WUN·PFGTP XQTDGJCNVGP YCT #O  0QXGODGT    UVKHVGVG 1UECT ++ FCU 9CUC\GKEJGP WPF FKG OGJTUVWHKIG 9CUC/GFCKNNG KP )QNF WPF 5KNDGT #O  ,WPK    DGUEJNQ­FGT4GKEJUVCIFCUUEJYGFKUEJG2CTCNOGPVFC­FKGUEJYGFKUEJGP1TFGPWPFUQOKVCWEJFGT9CUC1TFGP MÒPHVKI PWT PQEJ #WUN·PFGTP XQTDGJCNVGP UGK WPF OKV FGP PGWGP 5VCVWVGP FGT UEJYGFKUEJGP 1TFGP XQO  #WIWUV   YWTFGFKG8GTNGKJWPIFGU9CUC1TFGPU YKGCWEJFGU5EJYGTVQTFGPU IGPGTGNNGKPIGUVGNNV



-ÌPKINKEJGT 9CUC1TFGP  /QFGNN   4KVVGTFGMQTCVKQP  Z  OO )QNF HGKPUV   ITCXKGTVGOCKNNKGTVICOPGWGP$CPF<- 44++  *GTXQTTCIGPFG#PHGTVKIWPICWUFGT/KVVGFGU0GWP\GJPVGP,CJTJWPFGTVU

8698



8699

8700

-ÌPKINKEJGT 9CUC1TFGP  /QFGNN UGKV   4KVVGTMTGW\ UGKV  4KVVGTMTGW\  -NCUUG  )QNF   GOCKNNKGTV  I CO NCPIGP CNVGP 1TKIKPCNDCPF KO \GKVIGPÌUUKUEJGP 1TKIKPCNGVWK FGU *QHLWYGNKGTU   %(%CTNOCPKP5VQEMJQNO<- ++p+++



#PHGTVKIWPICWUFGONGV\VGP&TKVVGNFGU0GWP\GJPVGP,CJTJWPFGTVUKPJGTXQTTCIGPFGT'TJCNVWPI



-ÌPKINKEJGT 9CUC1TFGP  /QFGNN UGKV   4KVVGTMTGW\ UGKV  4KVVGTMTGW\  -NCUUG  )QNF   GOCKNNKGTVICOPGWGP$CPFCDUEJPKVVKO1TKIKPCNGVWKFGU*QHLWYGNKGTU%(%CTNOCPKP5VQEM JQNO<- ++



#PHGTVKIWPICWUFGONGV\VGP&TKVVGNFGU0GWP\GJPVGP,CJTJWPFGTVU



-ÌPKINKEJGT 9CUC1TFGP  /QFGNN UGKV   4KVVGTMTGW\ UGKV  4KVVGTMTGW\  -NCUUG  )QNF   GOCKNNKGTVCWHFGO4CPFFGUNKPMGP-TGW\CTOUOGJTHCEJRWP\KGTV WCō%(%ŋHÒTFGP*GTUVGNNGT%( %CTNOCPKP5VQEMJQNOō-ŋHÒTEVQJPG,CJTGURWP\G CO$CPFOKV6TCIGURCPIGKO1TKIKPCNGVWK FGU*QHLWYGNKGTU%CTNOCP<- ++

 153


SCHWEDEN

8701



8702

8703

8704

-ÌPKINKEJGT 9CUC1TFGP  /QFGNN UGKV   4KVVGTMTGW\ UGKV  4KVVGTMTGW\  -NCUUG  )QNF   GOCKNNKGTVICWHFGO4CPFFGUWPVGTGP-TGW\CTOUOGJTHCEJRWP\KGTV WCō%(%ŋHÒTFGP*GTUVGN NGT%(%CTNOCPKP5VQEMJQNOō-HÒTEVWPFō6ŋHÒT CO$CPFKO1TKIKPCNGVWKFGU *QHLWYGNKGTU%CTNOCP<- +p++





-ÌPKINKEJGT 9CUC1TFGP  /QFGNN UGKV   4KVVGTMTGW\ UGKV  4KVVGTMTGW\  -NCUUG  )QNF   GOCKNNKGTVIQJPG2WP\KGTWPIGPCOQTKIKPCNGPCNVGP$CPF<- ++





#FNKIGU ,WPIHTCWGPUVKHV \W 8CFUVGPC .QXKUC7NTKMC'JTGP\GKEJGP ·NVGTG #WUHÒJTWPI OKV TQVYGK­GP   (NCOOGP\YKUEJGPFGP-TGW\CTOGP)QNFGOCKNNKGTVHGKPG'OCKNNGOCNGTGKCOQTKIKPCNGPCNVGP5EJWNVGT DCPF ++



*GTXQTTCIGPFG#PHGTVKIWPIYQJNCWUFGT\YGKVGP*·NHVGFGU,CJTJWPFGTVU  #O  /CK  GTJKGNVGP FKG GTUVGP 5VKHVUHT·WNGKP FGU DGTGKVU  IGITÒPFGVGP CDGT PQEJ PKEJV GTTKEJVGVGP ,WPI   HTCWGPUVKHVGU 1VVKNKCPC )T·HKP .CIGTDGTI IGD 8GNNKPIM CNU GTUVG DVKUUKP IGUV   %JCTNQVVC *COKNVQP CH *C   IGD[ WPF /CTKC (CNMGPDGTI CH 6T[UVQTR CWU FGT *CPF XQP -ÌPKIKP .QXKUC 7NTKMC XQP 5EJYGFGP   FGT   IGDQTGPGP 2TKP\GUUKP .QWKUG 7NTKMG XQP $TCPFGPDWTI2TGW­GP WPF 5EJYGUVGT (TKGFTKEJU FGU )TQ­GP FKG PGW IG   UVKHVGVGP+PUKIPKGP(ÒTIKDV)TKV\PGTKP)&GKPG<CJNXQP5VKHVUFCOGPCP



#FNKIGU ,WPIHTCWGPUVKHV \W 8CFUVGPC .QXKUC7NTKMC'JTGP\GKEJGP ·NVGTG #WUHÒJTWPI OKV TQVYGK­GP   (NCOOGP\YKUEJGPFGP-TGW\CTOGP)QNFGOCKNNKGTVI OKV5EJNGKHG HGKPG'OCKNNGOCNGTGKOGJ TGTGMCWOUKEJVDCTG'OCKNNGEJKRUKPFGTFWPMGNDNCWGP'OCKNNGFGU8QTFGTWPF4ÒEMUGKVGPOGFCKNNQPUCP CNVGT&COGPUEJNGKHG ++



*GTXQTTCIGPFG#PHGTVKIWPIYQJNCWUFGT\YGKVGP*·NHVGFGU,CJTJWPFGTVU



#FNKIGU ,WPIHTCWGPUVKHV \W 8CFUVGPC .QXKUC7NTKMC'JTGP\GKEJGP ·NVGTG #WUHÒJTWPI OKV TQVYGK­GP   (NCOOGP \YKUEJGP FGP -TGW\CTOGP )QNF GOCKNNKGTV 'OCKNNGCWUDTWEJ CWH FGT 8QTFGT WPF 4ÒEMUGKVG   FGUWPVGTGP-TGW\CTOU-TÌPEJGPFGT4ÒEMUGKVGHGJNVQJPG$CPF ++

8706





8708

#FNKIGU,WPIHTCWGPUVKHV\W8CFUVGPC.QXKUC7NTKMC'JTGP\GKEJGPLÒPIGTG#WUHÒJTWPIOKVIQNFYGK ­GP(NCOOGP\YKUEJGPFGP-TGW\CTOGP)QNFGOCKNNKGTVIHGKPG'OCKNNGOCNGTGKCOCNVGP*CNU DCPF ++



*GTXQTTCIGPFG#PHGTVKIWPIYQJNWO&KGUR·VGTGP#WUHÒJTWPIGPUKPFYGKVCWUUGNVGPGT\WHKPFGPCNUFKG·NVGTGP



#OCTCPVJGP1TFGP-QPXQNWVXQP\YGK1TFGPUMTGW\GP\YGK/KPKCVWTGPWPFGKPGT/GFCKNNGLGYGKNU XGTIQNFGVVGKNUCP$·PFEJGP 5VÒEM++





'JTGP\GKEJGP \WO L·JTKIGP 4GIKGTWPIULWDKN·WO -ÌPKI 1UMCTU ++ KO ,CJTG  )QNFGPGU   'JTGP\GKEJGPOKVJGNNDNCWGT'OCKNNG5KNDGTXGTIQNFGVVGKNYGKUGGOCKNNKGTVCO$CPF 4++



6JQTPKVHÒJTV KP6*15 CWUFC­FCU'JTGP\GKEJGP\WOL·JTKIGP4GIKGTWPIULWDKN·WO-ÌPKI1UMCTU++KO ,CJTGKPFGT#WUHÒJTWPIKPXGTIQNFGVGO5KNDGTOKVJGNNDNCWGT'OCKNNGCWUUEJNKG­NKEJCP/KVINKGFGTFGTMÌPKINK EJGP (COKNKG WPF CP MÌPKINKEJG WPF HÒTUVNKEJG )·UVG FGT (GKGTNKEJMGKVGP XGTNKGJGP YQTFGP KUV +PUIGUCOV KUV FCU   'JTGP\GKEJGPKPFKGUGT(QTOOCNXGTNKGJGPYQTFGP

154


SCHWEDEN

8709



8711

8710

8712

'JTGP\GKEJGP \WO L·JTKIGP 4GIKGTWPIULWDKN·WO -ÌPKI 1UMCTU ++ KO ,CJTG  5KNDGTPGU   'JTGP\GKEJGPOKVFWPMGNDNCWGT'OCKNNG5KNDGTVGKNYGKUGGOCKNNKGTVCO$CPF 4++



6JQTPKVHÒJTV KP6*15 CWUFC­FCU'JTGP\GKEJGPKPFKGUGT#WUHÒJTWPICP/KVINKGFGTFGUMÌPKINKEJGP*CWU JCNVUXGTNKGJGPYQTFGPKUV+PUIGUCOVKUVFCU'JTGP\GKEJGPKPFKGUGT(QTOOCNXGTNKGJGPYQTFGP



'JTGP\GKEJGP\WT)QNFGPGP*QEJ\GKV-ÌPKI1UECTU++WPF-ÌPKIKP5QRJKCUCO,WPK5KNDGT XGTIQNFGVCO$CPF ++



6JQTPKVIKDV KP6*15 CPFC­XQPFKGUGO'JTGP\GKEJGPPWT5VÒEMCPIGHGTVKIVYQTFGPUKPF



8GTFKGPUVOGFCKNNGFGT-ÌPKINKEJGP2CVTKQVKUEJGP)GUGNNUEJCHV/QFGNNOKVFGOLÒPIGTGP2QTVTCKVXQP -ÌPKI%CTN:8+)WUVCX ! -NGKPG)QNFGPG/GFCKNNGI OKV$CPF CWHFGT4ÒEMUGKVG6T· IGTPCOGō)'<#(+00#ŋWPF8GTNGKJWPIULCJTKO4CPFOGJTHCEJRWP\KGTV WC*GTUVGNNGTRWP\G ō/8ŋ)QNFRWP\Gō-ŋWPF,CJTGURWP\Gō)ŋHÒT COQTKIKPCNGP$CPFKOQTKIKPCNGPIQNFGP DGFTWEMVGP8GTNGKJWPIUGVWK 4+p++





/KNKV·TKUEJGU'JTGP\GKEJGPō-1070)1%*(&'40'5.#0&ŋ)QNFGPGU'JTGP\GKEJGP$TQP\G XGTIQNFGV WPF GOCKNNKGTV CWH FGT 4ÒEMUGKVG 6T·IGTPCOG ō%, 2'45510ŋ WPF &CVWO  CO   QTKIKPCNGP$CPF\WUCOOGPOKV/KPKCVWTXGTIQNFGVWPFGOCKNNKGTVCO$·PFEJGP 5VÒEM++



8713

8716 1:1

8717 1:1



)TQ­G1TFGPUUEJPCNNGOKVHÒPH#WU\GKEJPWPIGP 'JTGP\GKEJGP\WO)GDWTVUVCI-ÌPKI)WUVCXU 8 5KNDGT XGTIQNFGV   9CUC1TFGP -NGKPG )QNFGPG 9CUC/GFCKNNG )TÌ­G  5KNDGT XGTIQNFGV    -NGKPG)QNFGPG*QH8GTFKGPUVOGFCKNNG#WUHÒJTWPI)WUVCX8+#FQNH5KNDGTXGTIQNFGV 5KNDGTPG *QH8GTFKGPUVOGFCKNNG#WUHÒJTWPI)WUVCX8+#FQNH5KNDGTCWHFGT4ÒEMUGKVG6T·IGTPCOG//GNCP FGT   /GFCKNNG HÒT 'KHGT WPF 4GFNKEJMGKVKO4GKEJUFKGPUV#WUHÒJTWPI)WUVCX8CWHFGT4ÒEMUGKVG 6T·IGTPCOGō/CTVKP,WNKWU/GNCPFGTŋ#P0CFGN 5VÒEM++





-QPXQNWV XQP  'JTGP\GKEJGP WPF \YGK \WIGJÌTKIGP /KPKCVWTGP &CTWPVGT )QNFGPG WPF 5KNDGTPG   -ÌPKIKP 8KEVQTKC/GFCKNNG )QNFGPG 2TKP\GUUKP 'WIGPKG/GFCKNNG )GF·EJVPKU'JTGP\GKEJGP \WO   )GDWTVUVCI-ÌPKI)WUVCXU85KNDGTPG/GFCKNNGHÒT'KHGTWPF4GFNKEJMGKVKO4GKEJUFKGPUV#WUICDG -ÌPKI )WUVCX 8 5KNDGTPG $GNQJPWPIUOGFCKNNG  -NCUUG FGT -ÌPKINKEJ 2CVTKQVKUEJGP )GUGNNUEJCHV   #WUICDGP-ÌPKI1UECT++WPF)WUVCX8 Z 7PVGTUEJKGFNKEJG/GVCNNG CWEJ5KNDGT VGKNUXGTIQNFGV GKPGGOCKNNKGTVVGKNUOKV6T·IGTPCOGPKPXQTYKGIGPFQTFGPVNKEJGT'TJCNVWPIITÌ­VGPVGKNUCP$·PFGTP UGEJUKP'VWKU 5VÒEM++



-QPXQNWV XQP CEJV UEJYGFKUEJGP 'JTGP\GKEJGP &CTWPVGT 'JTGP\GKEJGP \WO  Z  WPF \WO   )GDWTVUVCI)WUVCXU8UQYKG)TQ­G)QNFGPG 5KNDGTXGTIQNFGV *QH8GTFKGPUVOGFCKNNG%CTNU:8+ )WUVCX WPF 8GTFKGPUVOGFCKNNG )WUVCXU ++ #FQNH 8GTUEJKGFGPG /GVCNNG VNYXGTIQNFGVVGKNUGOCKNNKGTV VGKNUCP$·PFGTP 5VÒEM++





/+0+#674'0 

-ÌPKINKEJGT5EJYGTVQTFGP/QFGNN UGKV /KPKCVWTFGU1TFGPUMTGW\GU ZOO )QNF GOCKNNKGTVCO$·PFEJGPCWHFGT4ÒEMUGKVG6TCIGMPQRH ++





-ÌPKINKEJGT0QTFUVGTPQTFGP/KPKCVWTFGU1TFGPUMTGW\GUZOO)QNFGOCKNNKGTVCO$·PF EJGP ++

 155


SCHWEDEN

8718 1:1



8719 1:1

8720 1:1

8724 1:1

-ÌPKINKEJGT 9CUC1TFGP  /QFGNN   /KPKCVWT FGT 4KVVGTFGMQTCVKQP  Z  OO   )QNF GOCKNNKGTV  I OGJTGTG MNGKPG 'OCKNNGCWUDTÒEJG CWH 8QTFGT WPF 4ÒEMUGKVG CO MWT\GP CNVGP   $CPF 4+++





-ÌPKINKEJGT9CUC1TFGP/QFGNN UGKV /KPKCVWTFGU1TFGPUMTGW\GUZOO)QNF GOCKNNKGTVCO$·PFEJGPOKV6TCIGMPQRH ++





-ÌPKINKEJGT9CUC1TFGP/QFGNN UGKV /KPKCVWTFGU1TFGPUMTGW\GUZOO)QNF GOCKNNKGTVCOGVYCU\GTUEJNKUUGPGP$·PFEJGPOKV6TCIGMPQRH ++





-ÌPKINKEJGT9CUC1TFGP/QFGNN UGKV /KPKCVWTFGU1TFGPUMTGW\GUZOO)QNF GOCKNNKGTVCO$·PFEJGPOKV6TCIGMPQRH ++





-ÌPKINKEJGT9CUC1TFGP/QFGNN UGKV /KPKCVWTFGU1TFGPUMTGW\GUZOO)QNF GOCKNNKGTVCO$·PFEJGPOKV6TCIGMPQRH ++





-ÌPKINKEJGT9CUC1TFGP/QFGNN UGKV /KPKCVWTFGU1TFGPUMTGW\GUZOO)QNF GOCKNNKGTVCO$·PFEJGP ++





/GFCKNNG.+66'4+5'6#46+$75HÒT8GTFKGPUVGWO.KVGTCVWTWPF-WPUV#WUICDG-ÌPKI1UECTU++ /KPKCVWT FGT )QNFGPGP /GFCKNNG )QNF \WUCOOGP OKV 4KVVGTMTGW\ FGU 9CUCQTFGPU )QNF GOCKNNKGTV   CP<YGKGT/KPKCVWTGPUEJPCNNGCP6TCIGMPQRH 5VÒEM4++



8725 1:1

8726 1:1



/GFCKNNG ō.+66'4+5 '6 #46+$75ŋ HÒT 8GTFKGPUVG WO .KVGTCVWT WPF -WPUV #WUICDG -ÌPKI   )WUVCX8/KPKCVWTFGT)QNFGPGP/GFCKNNG)QNFIQJPG$·PFEJGP 4++





8GTFKGPUVOGFCKNNG FGT-ÌPKINKEJ2CVTKQVKUEJGP)GUGNNUEJCHV/KPKCVWTFGT)QNFGPGP/GFCKNNG)QNF CO$·PFEJGPOKV6TCIGMPQRH 4++



8727 1:1



156

/KPKCVWTGPUEJPCNNG GKPGU UEJYGFKUEJGP /KNKV·TCPIGJÌTKIGP OKV  UEJYGFKUEJGP WPF HKPPKUEJGP   #WU\GKEJPWPIUOKPKCVWTGP +P XGTUEJKGFGPGP /GVCNNGP CWEJ 5KNDGT  VGKNU XGTIQNFGV VGKNU GOCKNNKGTV   VGKNUOGJTHCEJRWP\KGTV#P0CFGN 5VÒEM++




SCHWEDEN

8728 1:1



/KPKCVWTGPUEJPCNNGGKPGUUEJYGFKUEJGP1HHK\KGTUOKVUGEJU#WU\GKEJPWPIUOKPKCVWTGP 5EJYGTVQT FGP4KVVGTMTGW\)QNFGOCKNNKGTV 9CUCQTFGP/QFGNN4KVVGTMTGW\5KNDGTXGTIQNFGVWPFGOCKNNKGTV   /GFCKNNG HÒT FKG 1N[ORKUEJGP 5RKGNG  KP 5VQEMJQNO 5KNDGT   5KNDGTPG 8GTFKGPUVOGFCKNNG FGU   .CPFUVWTOXGTDCPFGUXQP8·UVOCPNCPF5KNDGT 4W­NCPF5V#PPGPQTFGP-NCUUG)QNFGOCKNNKGTV 'OCKNNGOCNGTGK )TKGEJGPNCPF'TNÌUGTQTFGP/QFGNN5KNDGTPGU 4KVVGT -TGW\5KNDGT/GFCKNNQPU )QNFGOCKNNKGTV'OCKNNGOCNGTGK#P6TCIGMPQRH ++

8729 1:1





8734 1:1

/KPKCVWTGPUEJPCNNGFGUUEJYGFKUEJGP(NQVVKNNGPEJGHU-CRKV·P,QJP1NUGPOKVUGEJU#WU\GKEJPWPIU OKPKCVWTGP   5EJYGTVQTFGP  /QFGNN UGKV   4KVVGTMTGW\ )QNF GOCKNNKGTV   9CUC1TFGP   /QFGNN UGKV 4KVVGTMTGW\)QNFGOCKNNKGTV )QNFGPG/GFCKNNGHÒT8GTFKGPUVGWOFKG5GGHCJTV #WUHÒJTWPI )WUVCX 8 5KNDGT XGTIQNFGV   )QNFGPG 8GTFKGPUVOGFCKNNG FGT -ÌPKINKEJ 2CVTKQVKUEJGP   )GUGNNUEJCHV#WUHÒJTWPI)WUVCX8+#FQNH)QNF 8GTFKGPUVOGFCKNNGFGT/CTKPGDCUKU-CTNUMTQPC5KNDGT XGTIQNFGVOKV6T·IGTPCOGP 5VQEMJQNOGT/CTKPG'JTGP\GKEJGP5KNDGTXGTIQNFGVCP0CFGN ++



/KPKCVWTGPUEJPCNNGOKVHÒPH#WU\GKEJPWPIUOKPKCVWTGP 9CUC1TFGP/QFGNN UGKV 4KVVGT MTGW\ 5KNDGT XGTIQNFGV WPF GOCKNNKGTV      FTGK UEJYGFKUEJG 'JTGP\GKEJGP   (KPPNCPF 2TQ   $GPKIPKVCVG*WOCPC/GFCKNNGFGU(KPPKUEJGP4QVGP-TGW\GU#P0CFGN 5VÒEM++





/KPKCVWTGPUEJPCNNGOKVHÒPH#WU\GKEJPWPIUOKPKCVWTGP&CTWPVGT\YGK4QV-TGW\/GFCKNNGPLGYGKNU 5KNDGTQFGT5KNDGTXGTIQNFGV#P6TCIGMPQRH 5VÒEM++





/KPKCVWTGPUEJPCNNG OKV UGEJU #WU\GKEJPWPIUOKPKCVWTGP CP &COGPUEJNGKHEJGP 8KGT UEJYGFKUEJG   GKPGHKPPKUEJGWPFGKPGHTCP\ÌUKUEJG#WU\GKEJPWPIFKGGTUVGPXKGT5KNDGTXGTIQNFGV#P0CFGN ++





/KPKCVWTGPUEJPCNNG OKV XKGT #WU\GKEJPWPIUOKPKCVWTGP   'JTGP\GKEJGP \WO  )GDWTVUVCI -ÌPKI   )WUVCXU8 8GTFKGPUVOGFCKNNGFGT5VCFV5VQEMJQNO (KPPNCPF(TGKJGKVUMTGW\-NCUUGOKVFGO 4QVGP-TGW\ (TCPMTGKEJ1TFGPFGT'JTGPNGIKQP4KVVGTFGMQTCVKQP 5VÒEM++





/KPKCVWTGPUEJPCNNG OKV \YGK #WU\GKEJPWPIUOKPKCVWTGP   0QTFUVGTP1TFGP 4KVVGTMTGW\   9CUC   1TFGP/QFGNN DKU 4KVVGTFGMQTCVKQPDGKFG)QNFGOCKNNKGTV#P0CFGN 5VÒEM++





-QPXQNWVXQP/KPKCVWTGP&CTWPVGT5EJYGTVQTFGP/KPKCVWTFGU1TFGPUMTGW\GU Z 9CUCQTFGP  /QFGNN /KPKCVWT FGU 1TFGPUMTGW\GU Z  XGTUEJKGFGPG UEJYGFKUEJG 'JTGP\GKEJGP 8GTUEJKGFGPG   /GVCNNG CWEJ)QNFWPF5KNDGT VGKNUGOCKNNKGTVGKPGOKV'OCKNNGUEJ·FGPLGYGKNUCP$·PFEJGPQFGTOKV 5EJNGKHGUKGDGP5VÒEMCPFTGK/KPKCVWTURCPIGP 5VÒEM++



-QPXQNWV XQP  UEJYGFKUEJGP #WU\GKEJPWPIUOKPKCVWTGP &CTWPVGT )QNFGPGU 'JTGP\GKEJGP \WO    4GIKGTWPIULWDKN·WO -ÌPKI 1UECTU OKV JGNNDNCWGT 'OCKNNG WPF HTÒJGU 5EJYGTVGTMTGW\ OKV 5EJYGT   VGTP FGU 5EJYGTVQTFGPU &C\W \YGK YGKVGTG /KPKCVWTGP 8GTUEJKGFGPG /GVCNNG OGKUV 5KNDGT VGKNU   XGTIQNFGVVGKNUGOCKNNKGTVKPWPVGTUEJKGFNKEJGP'TJCNVWPIGPVGKNUCP$·PFEJGP ++







157


SERBIEN UND JUGOSLAWIEN

8738 1:1

8740 1:1

8739 1:1

8737

5'4$+'070&,7)15.#9+'0 (ª456'067/70&-¤0+)4'+%*5'4$+'0   

1TFGPXQO9GK­GP#FNGT=1ðäåí ÁGëî³ Îðëà?/QFGNN OKVFGT,CJTGU\CJNCWHFGT4ÒEMUGKVG UGKV &GMQTCVKQP-NCUUG5KNDGTVNYXGTIQNFGVWPFGOCKNNKGTVCWHFGP-TQPGP2GPFKNKGPOKP 'OCKNNGCDRNCV\WPIGP OKP 'OCKNNGCWUDTWEJ KO 4ÒEMUGKVGPOGFCKNNQP CO QTKIKPCNGP &TGKGEMUDCPF   %/-9'++8<- ++p .CWV %CT WPF /WJKE KP %#/ 5   CJPFGNV GU UKEJ JKGTDGK WO GKPG #PHGTVKIWPI FGT (KTOC #TVJWU $GTVTCPF KP   2CTKU

 

1TFGPXQO9GK­GP#FNGT=1päeí ÁGëî³ Îðëà?/QFGNN OKVFGT,CJTGU\CJNCWHFGT4ÒEMUGKVG UGKV /KPKCVWTFGT&GMQTCVKQP-NCUUG5KNDGTVNYXGTIQNFGVWPFGOCKNNKGTVCO$·PFEJGP ++ 1TFGP FGU JGKNKIGP 5CXC =1päeí %âGòQã %CâG?  /QFGNN FGT *GKNKIG KO TQVGP )GYCPF CWH FGT   4ÒEMUGKVG/QPQITCOO/KNCPU+ /KPKCVWTFGU-TGW\GU+8-NCUUG5KNDGTXGTIQNFGVWPF GOCKNNKGTV'OCKNNGOCNGTGKQJPG$·PFEJGP ++



1TFGPFGUJGKNKIGP5CXC=1päeí %âGòQã %CâG? /QFGNN#WUHÒJTWPI FGT*GKNKIGKOTQVGP)G YCPF CWH FGT 4ÒEMUGKVG     /KPKCVWT FGU -TGW\GU +8 -NCUUG 5KNDGT XGTIQNFGV WPF   GOCKNNKGTV'OCKNNGOCNGTGKQJPG$·PFEJGP ++



&GT HÒPHMNCUUKIG +DKU8-NCUUG 1TFGPHÒT8GTFKGPUVGWOFKG$KNFWPIWPF9KUUGPUEJCHV.KVGTCVWTWPF5EJÌPGP -ÒPUVG )NCWDGP WPF -KTEJG YWTFG XQP -ÌPKI /KNCP + 1DTGPQXKE   OKV FGO )GUGV\ ÒDGT 1TFGP WPF   /GFCKNNGPXQP,CPWCTIGUVKHVGV /QFGNN 'TYWTFGDGPCPPVPCEJ4CUVMQ0GOCPLKE LÒPIUVGT 5QJP FGU 5GTDKUEJGP )TQ­HÒTUVGP 5VGHCP 0GOCPLC  FGT  WPVGT FGO 0COGP 5CXC GTUVGT 'T\DKUEJQH FGT CWVQMG   RJCNGP WPCDJ·PIKIGP UGTDKUEJQTVJQFQZGP-KTEJGWPFFCOKV\WFGTGP)TÒPFGTIGYQTFGPYCT'TYKTFXQPKJTCNU *GKNKIGTXGTGJTV&KG+PUKIPKGPFGU/QFGNNUYWTFGPXQPFGP(KTOGP4QVJG0GHHG-CTN(NGKUEJJCEMGT#PVQP (ÒTUVWPF)#5EJGKFLGYGKNUKP9KGPUQYKGXQP,CEQD.GUGTKP5VTCWDKPIJGTIGUVGNNV







0CEJFGT'TOQTFWPI-ÌPKI#NGZCPFGTU+1DTGPQXKE  WPFFGT4GIKGTWPIUÒDGTPCJOGFWTEJ-ÌPKI2GVGT + -CTCIGQTIGXKE   GTUGV\VG FKGUGT OKV 8GTQTFPWPI XQO  0QXGODGT  FCU /QPQITCOO -ÌPKI   /KNCPU CWH FGT 4ÒEMUGKVG FWTEJ FCU 5VKHVWPIULCJT   /QFGNN  #WUHÒJTWPI  /KV GKPGO &GMTGV XQO   0QXGODGTYWTFGDGUVKOOVFCUUFGT1TFGPCWEJHÒTOKNKV·TKUEJG8GTFKGPUVXGTNKGJGPYGTFGPMQPPVG&KG +PUKIPKGPFKGUGT#WUHÒJTWPIUVGNNVGPFKG(KTOGP)GQTI#FCO5EJGKFKP9KGPWPF#TVJWU$GTVTCPFKP2CTKUJGT

8741





158

8742

1TFGPFGUJGKNKIGP5CXC=1päeí %âGòQã %CâG? /QFGNN#WUHÒJTWPI FGT*GKNKIGKOTQVGP)G YCPFCWHFGT4ÒEMUGKVG -TGW\8-NCUUG5KNDGTVNYXGTIQNFGVWPFGOCKNNKGTVMCWO UKEJVDCTG 'OCKNNGTGRCTCVWTGP KP \YGK -TGW\URKV\GP 'OCKNNGOCNGTGK KO 4KPI OGJTHCEJ RWP\KGTV W C   ō)#5ŋHÒTFGP*GTUVGNNGT)GQTI#FCO5EJGKFKP9KGP QJPG$CPF%/-55++C8<- ++ 1TFGP FGU JGKNKIGP 5CXC =1päeí %âGòQã %CâG?  /QFGNN FGT *GKNKIG KO TQVGP )GYCPF CWH FGT   4ÒEMUGKVG/QPQITCOO/KNCPU+ -TGW\8-NCUUG5KNDGTVNYXGTIQNFGVWPFGOCKNNKGTV CWHFGT4ÒEMUGKVGFGUQDGTGP-TGW\CTOU'OCKNNGEJKR'OCKNNGOCNGTGKKO4KPIOGJTHCEJRWP\KGTV WC ō)#5ŋ HÒT FGP *GTUVGNNGT )GQTI #FCO 5EJGKF KP 9KGP  CO QTKIKPCNGP CNVGP &TGKGEMUDCPF %/-   55+8<- ++p+++






SERBIEN UND JUGOSLAWIEN

8743 1:1



1TFGPFGUJGKNKIGP5CXC=1päeí %âeòoã %aâe? /QFGNN#WUHÒJTWPI FGT*GKNKIGKOTQVGP)G YCPFCWHFGT4ÒEMUGKVG /KPKCVWTFGU-TGW\GU8-NCUUG5KNDGT/GFCKNNQPU)QNF GOCKNNKGTVHGKPUVG'OCKNNGOCNGTGKCO$·PFEJGP +p++



$GUQPFGTUHGKPIGCTDGKVGVG/KPKCVWTOKVRNCUVKUEJIGUVCNVGVGT-TQPG

8744 1:1



1TFGP FGU JGKNKIGP 5CXC =1päeí %âeòoã %aâe?  /QFGNN  #WUHÒJTWPI FGT *GKNKIG KO ITÒPGP   )GYCPFUGKV 5GVFGT+-NCUUGDGUVGJGPFCWU-NGKPQF5KNDGTXGTIQNFGVWPFGOCKNNKGTV'OCKNNG OCNGTGKCOQTKIKPCNGPCNVGP5EJWNVGTDCPFWPF$TWUVUVGTPUVCTMIGYÌNDVG#WUHÒJTWPI5KNDGTDTKNNCPVKGTV WPF TGRGTEKGTV VNY XGTIQNFGV WPF GOCKNNKGTV 'OCKNNGOCNGTGK CP 0CFGNKOQTKIKPCNGP8GTNGKJWPIUGVWK FGT(KTOC*WIWGPKP(T½TGUKP.G.QENG 5EJYGK\ %/-55++D+<- 5VÒEM++



ÒDGTPCJOFKG(KTOC*WIWGPKP(T½TGUKP.G.QENG 5EJYGK\ FKG*GTUVGNNWPIFGT1TFGPUKPUKIPKGP5KG·PFGTVG

QJPG UVCCVNKEJG 8GTQTFPWPI  FKG (CTDG FGU /CPVGNU FGU JN 5CXC KO 8QTFGTUGKVGPOGFCKNNQP XQP TQV KP ITÒP  

/QFGNN#WUHÒJTWPI &KGCPFGTGPUR·VGTGP*GTUVGNNGT(TCP5QTNKPKKP8CTC\FKP)TKGUDCEJ-PCWUGKP<CIGD WPF%(<KOOGTOCPPKP2HQT\JGKOHQNIVGPFKGUGO/WUVGT&GT1TFGPYWTFGCWEJPCEJFGT)TÒPFWPIFGU-ÌPKI TGKEJUFGT5GTDGP-TQCVGPWPF5NQYGPGPWPFPCEJFGUUGP7ODGPGPPWPIKP,WIQUNCYKGPDKU\WO'ZKN-ÌPKI2GVGTU ++-CTCIGQTIGXKE  D\YDKU\WUGKPGT#DUGV\WPICO0QXGODGTWPFFGTFCOKVGKPJGTIG JGPFGP#DUEJCHHWPIFGT/QPCTEJKGWPFFGTOQPCTEJKUEJGP1TFGPWPF'JTGP\GKEJGPQHHK\KGNNYGKVGTXGTNKGJGP  -ÌPKI2GVGT++XGTNKGJKJPCNU*CWUQTFGPKPWPXGT·PFGTVGT(QTOCWEJKO'ZKNYGKVGTYCUXQPUGKPGO5QJP-TQP RTKP\ #NGZCPFGT -CTCIGQTIGXKE IGD   HQTVIGHÒJTV YWTFG 5Q GTJKGNV \ $ FGT COGTKMCPKUEJG 2JCNGTKUVKMGT   4QDGTV 9GTNKEJ  FKG +++ -NCUUG FGU 1TFGPU XQP -ÌPKI 2GVGT ++ &KGUG +PUKIPKGP UKPF CWUUEJNKG­NKEJ XQP FGT   (KTOC*WIWGPKP(T½TGUKP.G.QENG 5EJYGK\ CPIGHGTVKIVYQTFGP  )GTOCP2CVTKCTEJFGT5GTDKUEJ1TVJQFQZGP-KTEJG  UVKHVGVGGKPGPFTGKMNCUUKIGP1TFGPFGUJGKNKIGP 5CXC FGUUGP +PUKIPKGP GKPG IGYKUUGJPNKEJMGKVOKVFGOMÌPKINKEJGP1TFGPCWHYGKUGPWPFFGTHÒT8GTFKGPUVGWO FKG5GTDKUEJ1TVJQFQZG-KTEJGXGTNKGJGPYKTF 

159


SERBIEN UND JUGOSLAWIEN

8745



1TFGP FGU JGKNKIGP 5CXC =1päeí %âGòQã %CâG?  /QFGNN  #WUHÒJTWPI FGT *GKNKIG KO ITÒPGP   )GYCPFUGKV 5GVFGT++-NCUUGDGUVGJGPFCWU*CNUMTGW\5KNDGTXGTIQNFGVWPFGOCKNNKGTVQDGT HN·EJNKEJGT 'OCKNNGEJKR CWH FGT 8QTFGTUGKVG FGU QDGTGP -TGW\CTOU 'OCKNNGOCNGTGK FKGUG GVYCU DGTKG   DGPCOUR·VGTGP*CNUDCPFWPF$TWUVUVGTP5KNDGTDTKNNCPVKGTVWPFTGRGTEKGTVVNYXGTIQNFGVWPFGOCKN NKGTVMCWOUKEJVDCTGT'OCKNNGEJKRKO/GFCKNNQPTKPI'OCKNNGOCNGTGKCP0CFGNKOQTKIKPCNGP8GTNGKJWPIU GVWKFGT(KTOC*WIWGPKP(T½TGUKP.G.QENG 5EJYGK\ %/-55++D++<- ++

8746



8748



8749

1TFGP FGU JGKNKIGP 5CXC =1päeí %âGòQã %CâG?  /QFGNN  #WUHÒJTWPI FGT *GKNKIG KO ITÒPGP   )GYCPF  UGKV   -TGW\ +++ -NCUUG 5KNDGT XGTIQNFGV WPF GOCKNNKGTV OKP #DURNKVVGTWPI KP GKPGT   -TGW\CTOURKV\GFGT4ÒEMUGKVG'OCKNNGOCNGTGKCO*CNUDCPFKOQTKIKPCNGP8GTNGKJWPIUGVWKFGT(KTOC *WIWGPKP(T½TGUKP.G.QENG 5EJYGK\ %/-55++D+++<- ++





1TFGPFGUJGKNKIGP5CXC=1päeí %âGòQã %CâG? /QFGNN#WUHÒJTWPI UGKV NGGTGU8GTNGK JWPIUGVWK\WT+++-NCUUGFGT(KTOC*WIWGPKP(T½TGUKP.G.QENG 5EJYGK\  ++





1TFGP FGU JGKNKIGP 5CXC =1päeí %âGòQã %CâG?  /QFGNN  #WUHÒJTWPI FGT *GKNKIG KO ITÒPGP   )GYCPFUGKV -TGW\+8-NCUUG5KNDGTXGTIQNFGVWPFGOCKNNKGTV'OCKNNGOCNGTGKCOQTKIKPCNGP &TGKGEMUDCPF KO QTKIKPCNGP 8GTNGKJWPIUGVWK FGT (KTOC *WIWGPKP (T½TGU KP .G .QENG 5EJYGK\    %/-55++D+8<- ++



1TFGP FGU JGKNKIGP 5CXC =1päeí %âGòQã %CâG?  /QFGNN  #WUHÒJTWPI FGT *GKNKIG KO ITÒPGP   )GYCPF  UGKV   -TGW\+8-NCUUG5KNDGTXGTIQNFGVWPFGOCKNNKGTVOKPQDGTHN·EJNKEJGT'OCKNNG EJKRKO/GFCKNNQPTKPIFGT8QTFGTUGKVG'OCKNNGOCNGTGKCPWPMQTTGMVGT&COGPUEJNGKHG%/-55++D+8 <- ++





.CWV%CTWPF/WJKE KP%#/5 JCPFGNVGUUKEJJKGTDGKWOGKPG#PHGTVKIWPIFGT(KTOC*WIWGPKP(T½TGUKP.G .QENG 5EJYGK\ 

160


SERBIEN UND JUGOSLAWIEN

8750



8751

1TFGP FGU JGKNKIGP 5CXC =1päeí %âGòQã %CâG?  /QFGNN  #WUHÒJTWPI FGT *GKNKIG KO ITÒPGP   )GYCPFUGKV -TGW\8-NCUUG5KNDGTVNYXGTIQNFGVWPFGOCKNNKGTVOKP4GRCTCVWTKOTÒEMUGK VKIGP /GFCKNNQPTKPI 'OCKNNGOCNGTGK CO QTKIKPCNGP \GTUEJNKUUGPGP &TGKGEMUDCPF %/- 55++D8   <- ++



1TFGP FGU JGKNKIGP 5CXC =1päeí %âGòQã %CâG?  /QFGNN  #WUHÒJTWPI FGT *GKNKIG KO ITÒPGP   )GYCPFUGKV -TGW\8-NCUUG5KNDGTVNYXGTIQNFGVWPFGOCKNNKGTVOGJTGTG%JKRUKPFGTDNCWGP 'OCKNNG'OCKNNGOCNGTGKCO&TGKGEMUDCPF%/-55++D8<- ++



.CWV%CTWPF/WJKE KP%#/5 JCPFGNVGUUKEJJKGTDGKWOGKPG#PHGTVKIWPIFGT(KTOC*WIWGPKP(T½TGUKP.G .QENG 5EJYGK\ 



.CWV%CTWPF/WJKE KP%#/5 JCPFGNVGUUKEJJKGTDGKWOGKPG#PHGTVKIWPIFGT(KTOC*WIWGPKP(T½TGUKP.G .QENG 5EJYGK\ 

8752



8753

1TFGP FGU JGKNKIGP 5CXC =1päeí %âGòQã %CâG?  /QFGNN  #WUHÒJTWPI FGT *GKNKIG KO ITÒPGP   )GYCPFUGKV -TGW\8-NCUUG5KNDGTVNYXGTIQNFGVWPFGOCKNNKGTVOGJTGTG%JKRUKOXQTFGT UGKVKIGP/GFCKNNQPTKPI'OCKNNGOCNGTGKQJPG$CPF%/-55++D8<- ++



.CWV%CTWPF/WJKE KP%#/5 JCPFGNVGUUKEJJKGTDGKWOGKPG#PHGTVKIWPIFGT(KTOC*WIWGPKP(T½TGUKP.G .QENG 5EJYGK\ 



1TFGP FGU JGKNKIGP 5CXC =1päeí %âGòQã %CâG?  /QFGNN  #WUHÒJTWPI FGT *GKNKIG KO ITÒPGP   )GYCPFUGKV -TGW\8-NCUUG5KNDGTVNYXGTIQNFGVWPFGOCKNNKGTVOGJTGTG%JKRUKOXQTFGT UGKVKIGP/GFCKNNQPTKPI'OCKNNGOCNGTGKQJPG$CPF%/-55++D8<- ++



.CWV%CTWPF/WJKE KP%#/5 JCPFGNVGUUKEJJKGTDGKWOGKPG#PHGTVKIWPIFGT(KTOC*WIWGPKP(T½TGUKP.G .QENG 5EJYGK\ 





1TFGP FGU JGKNKIGP 5CXC =1päeí %âGòQã %CâG?  /QFGNN  #WUHÒJTWPI UGKV NGGTGUQDGT HN·EJNKEJDGUEJ·FKIVGU8GTNGKJWPIUGVWK\WT8-NCUUGFGT(KTOC*WIWGPKP(T½TGUKP.G.QENG 5EJYGK\  ++



1TFGPFGUJGKNKIGP5CXC=1päeí %âGòQã %CâG? /QFGNN#WUHÒJTWPI UGKV NGGTGU8GTNGK JWPIUGVWK\WT8-NCUUGFGT(KTOC(TCP5QTNKPKKP8CTCĻFKP ++

 161


SERBIEN UND JUGOSLAWIEN

8757

8758 8756

-¤0+)4'+%*&'45'4$'0-41#6'070&5.19'0'0$<9  -¤0+)4'+%*,7)15.#9+'0   

1TFGPFGT,WIQUNCYKUEJGP-TQPG=1ðäåí ßó³îñëîâåíñêå Êðóíå? -NGKPQFFGT+-NCUUG5KNDGTXGT IQNFGVWPFGOCKNNKGTVOKP%JKRUKPFGTITÒPGP'OCKNNGFGTªDGTJÌJWPICOQTKIKPCNGP5EJWNVGTDCPF %/-;%+<- ++



&GTHÒPHMNCUUKIGCNNIGOGKPG8GTFKGPUVQTFGPYWTFGCO#RTKNXQP-ÌPKI#NGZCPFGT+IGUVKHVGVWPFDKU\WO 'PFGFGT/QPCTEJKGKP,WIQUNCYKGPXGTNKGJGP



1TFGPFGT,WIQUNCYKUEJGP-TQPG=1ðäåí ßó³îñëîâåíñêå Êðóíå? -TGW\8-NCUUG5KNDGTXGTIQNFGV WPFGOCKNNKGTVOGJTGTGOKP'OCKNNGEJKRUCO&TGKGEMUDCPF%/-;%8<- ++





(GWGTYGJT8GTFKGPUVMTGW\ $TQP\G XGTUKNDGTV GOCKNNKGTV OGJTGTG 'OCKNNGUEJ·FGP WPF URTÒPIG CO   &TGKGEMUDCPF KO QTKIKPCNGP 8GTNGKJWPIUGVWK FGT (KTOC (TCPLQ (TKECM KP 8KTQXKVKEC OKV ÒDGTMNGDVGO   #WHFTWEM +++



8761

8759 8760



(CNNUEJKTOURTKPIGT#D\GKEJGP FGT LWIQUNCYKUEJGP .WHVYCHHG $TQP\G XGTUKNDGTV CWH FGT 4ÒEMUGKVG   PWOOGTKGTVōŋCP\YGK5EJTCWDGPOKV5EJTCWDUEJGKDGPFKGUGOKV$G\GKEJPWPI$'1)4#& ++



(¤&'4#.+56+5%*'81.-54'27$.+-,7)15.#9+'0   

/KNKV·T8GTFKGPUVQTFGP  /QFGNN   $TWUVUVGTP FGT  -NCUUG 5KNDGT VNY XGTIQNFGV WPF   GOCKNNKGTVCP0CFGN<- ++



&GT$TWUVUVGTPYKTFCNNGKPGQJPGYGKVGTG+PUKIPKGPYKG*CNUQFGT$TWUVMTGW\XGTNKGJGPWPFIGVTCIGP

 162

1TFGP FGT #TDGKV &GMQTCVKQP +++ -NCUUG $TQP\G XGTUKNDGTV VNY XGTIQNFGV CP XGTDQIGPGT 0CFGN   FCTCWH*GTUVGNNGTDG\GKEJPWPIō<+0-180+%#ŋ<- ++




SPANIEN

8762 1:1

52#0+'0 

&4+66'5 -¤0+)4'+%*52#0+'04')+'470)+5#$'..#5++  

$TWUVUVGTPFGTQDGTUVGP/KNKV·TTKEJVGTFGU-ÌPKITGKEJGU)QNFOCUUKXFWTEJDTQEJGPIGCTDGKVGVVNY GOCKNNKGTVIHGKPUVG'OCKNNGOCNGTGK\YGK4GRCTCVWTGPKPFGTDNCWGP'OCKNNGOKP$GUEJ·FKIWPIGP KO 9CRRGP CWH FGT 4ÒEMUGKVG *GTUVGNNGTDG\GKEJPWPI FGT (KTOC ) ;CTCDWTQ KP /CFTKF CP UKNDGTPGT   0CFGNOKV\YGK5GKVGPJCMGP 44++p+++  'ZGORNCT CWU WPUGTGT #WMVKQP1TFGPWPF'JTGP\GKEJGPCO1MVQDGT0T5GJTNWZWTKÌUCWUIG HÒJTVGT $TWUVUVGTP OKV CNNGTHGKPUVGT 'OCKNNGOCNGTGK FGUUGP *GTUVGNNWPI W C CWHITWPF FGT )GUVCNVWPI FGT -TQPG   GKPFGWVKIKPFKG4GIKGTWPIU\GKV-ÌPKIKP+UCDGNNCU++FCVKGTVYGTFGPMCPP

8763

8764

8765

(ª0(6'5 -¤0+)4'+%*52#0+'0   



-ÌPKINKEJ #OGTKMCPKUEJGT 1TFGP +UCDGNNCU FGT -CVJQNKUEJGP   D\Y -ÌPKINKEJGT     1TFGP+UCDGNNCUFGT-CVJQNKUEJGP UGKV /QFGNN OKV/QPQITCOOō(41ŋ  -NGKPQF \WO )TQ­MTGW\ )QNF GOCKNNKGTV HGKPUVG 'OCKNNGOCNGTGK CO OQFGTPGP 5EJWNVGTDCPF &C\W   -QOOCPFGWTMTGW\ QJPG ªDGTJÌJWPI $TQP\G XGTIQNFGV WPF VNY GOCKNNKGTV 'OCKNNGUEJ·FGP HGKPUVG   'OCKNNGOCNGTGKOKVTÒEMUGKVKICPIGDTCEJVGT$TQUEJKGTWPI<'+ 5VÒEM++



'JTGP\GKEJGP XQO 4QVGP -TGW\ <YGKVGU /QFGNN   /GFCKNNG  -NCUUG CD   5KNDGT   XGTIQNFGVVNYGOCKNNKGTVCO*CNUDCPFKORCUUGPFGPQTKIKPCNGP8GTNGKJWPIUGVWKFGT(KTOC6CPHCPK $GTVCTGNNKKP4QOOKVFGO9CRRGP2CRUV$GPGFKMV:8 UKE <- ++



6TQV\ FGU WPRCUUGPF GTUEJGKPGPFGP R·RUVNKEJGP 9CRRGPU KUV FCU 'VWK FWTEJ FKG T·WONKEJGP #WUURCTWPIGP FGT 'KP   NCIGGKPFGWVKICNUFGO'JTGP\GKEJGP\WIGJÌTKI\WKFGPVKHK\KGTGP

52#0+5%*'456##64')+'470)810(4#0%+5%1(4#0%1   

/KNKV·T8GTFKGPUVQTFGP  /QFGNN OKV UQIGP KORGTKCNGT -TQPG    YGK­G #DVGKNWPI HÒT   8GTFKGPUVGKP(TKGFGPU\GKVGP5VGTP-NCUUGOKVTQVGP5VTGKHGPHÒT2GPUKQPUDGTGEJVKIVG$TQP\GXGTIQNFGV VNYXGTUKNDGTVWPFGOCKNNKGTVCP0CFGNOKV\YGK5GKVGPJCMGP<- ++

 163


TSCHECHOSLOWAKEI 

/KNKV·T8GTFKGPUVQTFGP  /QFGNN OKV UQIGP KORGTKCNGT -TQPG    YGK­G #DVGKNWPI HÒT   8GTFKGPUVGKP(TKGFGPU\GKVGP-QPXQNWVXQPFTGK-TGW\GP&C\W/CTKPGWPF.WHVYCHHGP8GTFKGPUVQT FGPLGYGKNU/QFGNNOKVUQIGPKORGTKCNGT-TQPGLGYGKNUYGK­G#DVGKNWPIHÒT8GTFKGPUVGKP(TKGFGPU \GKVGPLGGKP-TGW\,GYGKNU$TQP\GGOCKNNKGTVVGKNUOKV'OCKNNGEJKRUDGKGKPGOHGJNVFCU4ÒEMUGKVGP OGFCKNNQPCP$·PFGTPOKV6TCIGURCPIGP 5VÒEM++

8768

8767





-TKGIUMTGW\/QFGNN XKGTMNCUUKI 5VGTPOKV2CNOGP  HÒTHÒJTGPFG1HHK\KGTG=LGHGU? $TQP\GXGTUKNDGTVVNYXGTIQNFGVVNYGOCKNNKGTVCP0CFGNOKV\YGK5GKVGPJCMGP2)XCT 4++



52#0+'0+01((+<+'..'#75<'+%*070)'0 

1TFGPXQO*QURKVCNFGJGKNKIGP,QJCPPGU$TWUVUVGTP$TQP\GXGTIQNFGVWPFGOCKNNKGTV*CCTTKUUGCP 0CFGNOKV\YGK5GKVGPJCMGP ++



8772 1:1 8771

8770

8769

65%*'%*15.19#-'+

'456' 65%*'%*15.19#-+5%*'4'27$.+-   

6UEJGEJQUNQYCMKUEJGT 1TFGP XQO 9GK­GP .ÌYGP  /QFGNN   1HHK\KGTUFGMQTCVKQP HÒT   <KXKNXGTFKGPUV5KNDGTVNYXGTIQNFGVWPFGOCKNNKGTVKO6TCIGTKPIOGJTHCEJRWP\KGTV ō--ŋHÒTFGP*GT UVGNNGT(KTOC-CTPGV-[UGNÓKP2TCIGT5KNDGTRWP\GWPFHTCP\ÌUKUEJG'KPHWJTRWP\GHÒT5KNDGTXQP DKU ō5EJYCPGPRWP\Gŋ COQTKIKPCNGP$CPFOKVCWHIGNGIVGT4QUGVVG$9-<- ++



6UEJGEJQUNQYCMKUEJGT 1TFGP XQO 9GK­GP .ÌYGP  /QFGNN   1HHK\KGTUFGMQTCVKQP HÒT   <KXKNXGTFKGPUV5KNDGTVNYXGTIQNFGVWPFGOCKNNKGTVCOQTKIKPCNGP$CPFOKVCWHIGNGIVGT4QUGVVG$9- <- ++





6UEJGEJQUNQYCMKUEJGT1TFGPXQO9GK­GP.ÌYGP/QFGNN  /KPKCVWTFGT4KVVGTFGMQTC VKQPHÒT<KXKNXGTFKGPUV5KNDGTVNYXGTIQNFGVWPFGOCKNNKGTVCOQTKIKPCNGP$·PFEJGP ++





6UEJGEJQUNQYCMKUEJGT 1TFGP XQO 9GK­GP .ÌYGP  /QFGNN .ÌYG OKV /CWGTMTQPG      4KVVGTFGMQTCVKQPHÒT<KXKNXGTFKGPUVHTCP\ÌUKUEJG#PHGTVKIWPI5KNDGTVNYXGTIQNFGVWPFGOCKNNKGTVKPFGT ¤UGHTCP\ÌUKUEJG)CTCPVKGRWP\GHÒT5KNDGTXQPDKU ō9KNFUEJYGKPMQRHŋ COQTKIKPCNGP$CPF 44++





164


UNGARN

8773

8776



8777

8775

5QMQN (CNMGP  1TFGP 1TFGPUFGMQTCVKQP OKV 5EJYGTVGTP  #WUICDG FGT (KTOC -CTPGV  -[UGNÓ  

  $TQP\G XGTIQNFGV WPF GOCKNNKGTV KO PCEJ WPVGP XGTTWVUEJVGP TÒEMUGKVKIGP /GFCKNNQP 'OCKNNG   URTÒPIGWPFEJKRUCO$CPF$9-<- ++



&GTHTÒJGVUEJGEJQUNQYCMKUEJG1TFGPYWTFGXQO-TKGIUOKPKUVGTKORTQXKUQTKUEJGPVUEJGEJQUNQYCMKUEJGP0CVKQPCN TCV KP 2CTKU &T /KNCP ĥVGRCPKM GKPGO #UVTQPQOGP FGT KP (TCPMTGKEJ \WO (NKGIGTIGPGTCN CWHIGUVKGIGP YCT GPV   YQTHGP KP 6QMKQ JGTIGUVGNNV WPF UGKV 0QXGODGT  XQP FKGUGO CP FKG VUEJGUNQYCMKUEJGP .GIKQP·TG KP 5KDKTKGP   XGTNKGJGP &KG 5VCVWVGP HQNIVGP  FWTEJ FGP 0CVKQPCNTCV 5KG UCJGP HÒPH -NCUUGP XQT VCVU·EJNKEJ MCO CDGT PWT   GKPG-NCUUGOKVWPFQJPG5EJYGTVGT\WT#WUHÒJTWPI/GTKEMCWPVGTUEJGKFGVFTGKXGTUEJKGFGPG#WUICDGPFKGGTUVG KP6QMKQJGTIGUVGNNVG#WUICDGOKVFWPMGNDNCWGO'OCKNFKG\YGKVGXQP-CTPGV-[UGNÓKP2TCIJGTIG UVGNNVG#WUICDGOKVOKVVGNDNCWGO'OCKNWPFFKGFTKVVGXQP-CTPGV-[UGNÓKP2TCIJGTIGUVGNNVG#WUICDGOKV JGNNDNCWGO 'OCKN 8IN /GTKEMC 8±ENCX &GT 6GUEJQUNQYCMKUEJG(CNMGP1TFGP+P1TFGPUMWPFG0T$GTNKP &GTU.GURTGOKGTU1TFTGUGV&¾EQTCVKQPU/KNKVCKTGUFG6EJ¾EQENQXCSWKG+P5QEK¾V¾5WKUUGFG2JCN¾TKUVKSWG $WNNGVKP  5   'Z#WMVKQP*KTUEJKP/ÒPEJGPXQODKU0QXGODGT 0T /GTKEMCWPVGTUEJGKFGVFTGKXGTUEJKG FGPG#WUICDGPFKGGTUVGKP6QMKQJGTIGUVGNNVG#WUICDGOKVFWPMGNDNCWGO'OCKNFKG\YGKVGXQP-CTPGV  -[UGNÓ KP 2TCI JGTIGUVGNNVG #WUICDG OKV OKVVGNDNCWGO 'OCKN WPF FKG FTKVVG  XQP -CTPGV  -[UGNÓ KP 2TCI   JGTIGUVGNNVG #WUICDG OKV JGNNDNCWGO 'OCKN =8IN /GTKEMC 8CENCX &GT VUEJGEJQUNQYCMKUEJG (CNMGP1TFGP +P   1TFGPUMWPFG 0T  $GTNKP  7PF GTKEMC 8CENCX .GU 2TGOKGTU 1TFTGU GV &¾EQTCVKQPU /KNKVCKTGU FG   6EJ¾EQUNQXCSWKG+P5QEK¾V¾5WKUUGFG2JCN¾TKUVKSWG$WNNGVKP  ?5QOKVFÒTHVGGUUKEJDGKFKGUGO'ZGO RNCTWOFKG\YGKVG#WUICDGJCPFGNP







-QPXQNWV XQP XKGT XGTUEJKGFGPGP #WU\GKEJPWPIGP &CTWPVGT +PVGTCNNKKGTVG 5KGIGUOGFCKNNG (TGKYKNNK   IGP-TGW\ OKV'VWK WPF/GFCKNNGWPFō2TCXFC8KVG\Kŋ/GFCKNNGLGYGKNUCP$·PFGTP  5VÒEM++



65%*'%*15.19#-+5%*'81.-54'27$.+-  

#DUQNXGPVGP#D\GKEJGP FGT VUEJGEJQUNQYCMKUEJGP /KNKV·T#MCFGOKG  /QFGNN   #WU   ICDG  5KNDGT VNY GOCKNNKGTV CWH FGT 4ÒEMUGKVG /CVTKMGNPWOOGT ōŋ WPF OGJTGTG 2WP\GP CP   5EJTCWDGOKV5EJTCWDUEJGKDGFKGUGOKV*GTUVGNNGDGT\GKEJPWPIFGT(KTOC<WMQXKP2TCI ++



#DUQNXGPVGP#D\GKEJGP FGT /KNKV·T#MCFGOKG - )QVVYCNF 5KNDGT GOCKNNKGTV CWH FGT 4ÒEMUGKVG   /CVTKMGNPWOOGTōŋWPFOGJTGTG2WP\GPCP5EJTCWDGOKV5EJTCWDUEJGKDGFKGUGOKV*GTUVGNNGDGT \GKEJPWPIFGT(KTOC<WMQX&C\W$TQP\GOGFCKNNG(ÒT&KGPUVFGO8CVGTNCPF/QFGNN   CO$CPF 5VÒEM++



70)#40 

6+67.#4 -¤0+)4'+%*70)#40  

7PICTKUEJGU8GTFKGPUVMTGW\  D\Y7PICTKUEJGT8GTFKGPUVQTFGP=/CI[CT—TFGOTGPF? /QFGNN  $TWUVUVGTP\WO)TQ­MTGW\D\Y#WUHÒJTWPI QJPGIQNFGPG5VTCJNGP\YK UEJGPFGP-TGW\CTOGPWPF 5KNDGTDTKNNCPVKGTVVNYXGTIQNFGVWPFGOCKNNKGTVCP 0CFGN<- ++



.CWV (GNU\GIJ[ (GNU\GIJ[ ( W C # 4GPFLGNGM ¾U -KVÒPVGV¾UGM 6ÌTV¾PGNOÒPDMGP $WFCRGUV  5   KUV   FKGUG 5VWHG XQP  DKU  KPUIGUCOV  OCN XGTNKGJGP YQTFGP FCXQP  OCN CP 7PICTP WPF XQP  DKU   #RTKNKPUIGUCOVOCNFCXQPOCNCP7PICTP

165


KICHENSTAAT UND VATIKAN

8779

8778

8780



 

7PICTKUEJGU8GTFKGPUVMTGW\  D\Y7PICTKUEJGT8GTFKGPUVQTFGP=/CI[CT—TFGOTGPF?  /QFGNN   -QOVWTMTGW\ 5KNDGT XGTIQNFGV WPF GOCKNNKGTV QJPG $CPFTKPI CO RGPVCIQPCN   IGHCNVGVGP*CNUDCPFCDUEJPKVV<- ++ )QNFGPGU7PICTKUEJGU8GTFKGPUVMTGW\5KGJG-CV0T 2KNQVGPCD\GKEJGP$TQP\GCP0CFGN

++

 

$ª4)'4.+%*'4'27$.+-  

'JTGPOGFCKNNG\WT'KPJWPFGTVLCJTHGKGTFGU#WHUVCPFGUXQP$TQP\GVNYGOCKNNKGTVCO QTKIKPCNGP&TGKGEMUDCPF ++

8781

8782

8785



8786

':+.   

5KNDGTPG/GFCKNNG5KNDGTCO&TGKGEMUDCPFKOQTKIKPCNGP8GTNGKJWPIUGVWKFGT(KTOC4QVJG KP 9KGP &C\W <YGK #D\GKEJGP FGU -CPCFKUEJ7PICTKUEJGP 1TFGPU XQO JN .±U\NÉ XGTIQNFGV VNY   GOCKNNKGTVCP0CFGNP 5VÒEM++



70)#4+5%*'81.-54'27$.+-   

8GTFKGPUVOGFCKNNG FGT 7PICTKUEJGP 8QNMUTGRWDNKM )QNFGPG /GFCKNNG $TQP\G XGTIQNFGV WPF GOCKN   NKGTV CO &TGKGEMUDCPF OKV 7PKHQTODCPF KO QTKIKPCNGP OKV IQNFHCTDGPGO 5VCCVUYCRRGP DGFTWEMVGP   8GTNGKJWPIUGVWK ++





8GTFKGPUVOGFCKNNG FGT 7PICTKUEJGP 8QNMUTGRWDNKM )QNFGPG /GFCKNNG $TQP\G XGTIQNFGV WPF GOCKN   NKGTVCO&TGKGEMUDCPFKOQTKIKPCNGPOKVIQNFHCTDGPGO5VCCVUYCRRGPDGFTWEMVGP8GTNGKJWPIUGVWK ++





8GTFKGPUVOGFCKNNG FGT 7PICTKUEJGP 8QNMUTGRWDNKM 5KNDGTPG /GFCKNNG $TQP\G XGTUKNDGTV WPF GOCKN   NKGTVCO&TGKGEMUDCPFKOQTKIKPCNGPOKVIQNFHCTDGPGO5VCCVUYCRRGPDGFTWEMVGP8GTNGKJWPIUGVWK ++





7PICTKUEJGT 8GTFKGPUVQTFGP FGT #TDGKV  /QFGNN   8QNNUV·PFKIGT 5CV\ FGU 1TFGPU KP   )QNF 5KNDGT WPF $TQP\G XGTIQNFGV D\Y XGTUKNDGTV VNY GOCKNNKGTV CP &TGKGEMD·PFGTP LGYGKNU OKV   7PKHQTOD·PFGTPKPQTKIKPCNGP8GTNGKJWPIUGVWKU 5VÒEM++





-QPXQNWV XQP XKGT #WU\GKEJPWPIGP  &KGPUV8GTFKGPUVOGFCKNNG/QFGNN   8GTFKGPUVOG FCKNNG HÒT CW­GTQTFGPVNKEJG &KGPUVG     8GTFKGPUVQTFGP HÒT CW­GTQTFGPVNKEJG &KGPUVG      )QNFGPG8GTFKGPUVOGFCKNNGHÒTFKG2QNK\GK8GTIQNFGVD\YXGTUKNDGTVVNYGOCKNNKGTVLGYGKNUCP&TGK GEMUD·PFGTPKO1TKIKPCNGVWK ++





-QPXQNWV XQP  #WU\GKEJPWPIGP &CTWPVGT 8GTFKGPUVOGFCKNNG HÒT FKG 9CHHGPDTÒFGTUEJCHV KP )QNF   5KNDGT WPF $TQP\G 'TKPPGTWPIUOGFCKNNG HÒT FKG #TDGKVGTYCEJG 'TKPPGTWPIUOGFCKNNG FGT 7PICTKUEJGP   4·VGTGRWDNKM8GTFKGPUVOGFCKNNGHÒT$GTINGWVGKP)QNFWPF5KNDGT&C\W-TGW\Gō2'-ŋ FGT LGV\KIGP 4GRWDNKM 8GTUEJKGFGPG /GVCNNG VGKNU XGTIQNFGV VGKNU XGTUKNDGTV VGKNU GOCKNNKGTV  CP   &TGKGEMUD·PFGTP ++



-+4%*'056##6*'+.+)'4567*.70&8#6+-#0 

166

-+4%*'056##6*'+.+)'4567*.70&8#6+-#014&'0

-QPXQNWVXQPUGEJUXGTUEJKGFGPGP'VWKU\W1TFGPWPF'JTG\GKEJGPFGU*GKNKIGP5VWJNU&CTWPVGT )TQ­QHHK\KGTUQYKG4KVVGTMTGW\ CO&TGKGEMUDCPF FGU4KVVGTQTFGPUXQO*GKNKIGP)TCDGWPF-QOOCP FGWTMTGW\GKPGUR·RUVNKEJGP1TFGPU+PWPVGTUEJKGFNKEJGP'TJCNVWPIGP 5VÒEM++++p+++




KICHENSTAAT UND VATIKAN

8789 Detail 1:1

8789 1:1,5

4+66'414&'081/*'+.+)'0)4#$810,'475#.'/ 

1TFGPUKPUKIPKGP  /QFGNN   URCPKUEJG #WUICDG OKV MNGKPGT -TQPG  1TFGPUMQNNCPG FGT   5VCVVJCNVGTGK XQP #TCIQPKGP WPF -CVCNQPKGP DGUVGJGPF CWU  *GKNKI)TCD-TGW\)NKGFGTP WPF CEJV   %JTKUVWU/QPQITCOO)NKGFGTP UQYKG \YGK 8GTUEJNW­INKGFGTP WPF GKPGO 6TCIGINKGF OKV -NGKPQF LG   YGKNU 5KNDGT XGTIQNFGV WPF GOCKNNKGTV GKP %JTKUVWUOQPQITCOO)NKGF OKV OKP 'OCKNNGCDRNCV\WPIGP   UQYKG\YGKVG-GVVGDGUVGJGPFCWUUGEJU6TQRJ·GPINKGFGTPOKVCPJ·PIGPFGO-TGW\FGT'JTGP-CPQPKMGT XQP%CNCVC[WFLGYGKNU5KNDGTXGTIQNFGVWPFGOCKNNKGTVKOQTKIKPCNGP8GTNGKJWPIUGVWKFGT(KTOC%GLCNXQ KP/CFTKF)550T 44++  &KG+PJCDGTFGT-QNNCPGFGT5VCVVJCNVGTGKXQP#TCIQPKGPWPF-CVCNQPKGPYCTGPCWEJ'JTGP-CPQPKMGTXQP%CNCVC[WF WPF VTWIGP FGTGP -CPQPKMGT-TGW\ CP GKPGT -GVVG FKG OKV FGT -QNNCPG FGU 1TFGPU XQO *GKNKIGP )TCD MQODKPKGTV   YCT

167


KICHENSTAAT UND VATIKAN

8790 1:1



1TFGPUKPUKIPKGP/QFGNN  URCPKUEJG#WUICDG OKVMNGKPGT-TQPG )TQ­MTGW\UGVDGUVG JGPFCWU-NGKPQF5KNDGTXGTIQNFGVWPFGOCKNNKGTVCOQTKIKPCNGP5EJWNVGTDCPFWPF$TWUVUVGTP5KNDGT DTKNNCPVKGTVWPFTGRGTEKGTV#WHNCIGP)QNFGOCKNNKGTVKOQTKIKPCNGP8GTNGKJWPIUGVWKFGT(KTOC'*GTTGTQU KP/CFTKF 5VÒEM+p++

8791 1:1

8792

8793



8795 1:1

8794



1TFGPUKPUKIPKGP/QFGNN QJPG-TQPGWPFQJPG6TQRJ·G /KPKCVWTFGU-QOOCPFGWT MTGW\GU5KNDGTXGTIQNFGVWPFGOCKNNKGTVCO$·PFEJGPOKVCWHIGNGIVGT4QUGVVG 4++





1TFGPUKPUKIPKGP  /QFGNN   HTCP\ÌUKUEJG KPQHHK\KGNNG #WUICDG OKV ITQ­GT -TQPG    -QOOCPFGWTMTGW\5KNDGTXGTIQNFGVWPFGOCKNNKGTVKO$CPFTKPIHTCP\ÌUKUEJG)CTCPVKGRWP\GHÒT5KNDGT XQPDKU ō9KNFUEJYGKPMQRHŋ COQTKIKPCNGPUEJYCT\GP$CPFOKVTQVGP5GKVGPUVTGKHGP ++





1TFGPUKPUKIPKGP/QFGNN QJPG-TQPGWPFQJPG6TQRJ·G 4KVVGTMTGW\$TQP\GXGTIQN FGVMQORNGVVPCEJGOCKNNKGTVCO$CPF ++





1TFGPUKPUKIPKGPWPF/QFGNN OKV6TQRJ·GUGKV -QOOCPFGWTMTGW\5KNDGTXGTIQNFGVWPF GOCKNNKGTV OKP #DRNCV\WPIGP CWH FGO -TGW\EJGP FGU $TWUVRCP\GTU FGT 6TQRJ·G CWH FGO $CPFTKPI   HTCP\ÌUKUEJG*GTUVGNNGTRWP\GCOQTKIKPCNGPCNVGP*CNUDCPF<- ++p



1TFGPUKPUKIPKGPWPF/QFGNN OKV6TQRJ·GUGKV /KPKCVWTFGU-QOOCPFGWTMTGW\GU5KNDGT XGTIQNFGVWPFGOCKNNKGTVCO$·PFEJGP ++



 168


ÄTHIOPIEN

8796 1:1

8798

8797



8GTFKGPUVQTFGPXQO*GKNKIGP)TCD/KPKCVWT\WO8GTFKGPUVMTGW\OKV5KNDGTPGO5VGTP )TQ­QHHK\KGT  5KNDGTVNYXGTIQNFGVWPFGOCKNNKGTVCOUEJYCT\GP$·PFEJGP ++



8#6+-#0'*4'0<'+%*'0 



$GPGOGTGPVKMTGW\HÒT8GTFKGPUVGWOFCU#W­GTQTFGPVNKEJG*GKNKIG,CJTFGT'TNÌUWPI)QNFG PGU $GPGOGTGPVKMTGW\ 5KNDGT XGTIQNFGV WPF GOCKNNKGTV CO $CPF KO QTKIKPCNGP OKV IQNFHCTDGPGO   2CRUVYCRRGPDGFTWEMVGP8GTNGKJWPIUGVWK ++



$GPGOGTGPVKMTGW\HÒT8GTFKGPUVGWOFCU#W­GTQTFGPVNKEJG*GKNKIG,CJTFGT'TNÌUWPI5KNDGT PGU$GPGOGTGPVKMTGW\5KNDGTGOCKNNKGTVCO$CPF ++



8802 8800

8799

8801

);26'0 -¤0+)4'+%*);26'0   



1TFGP FGU 0KNU  /QFGNN   &GMQTCVKQP  -NCUUG 5KNDGT VNY XGTIQNFGV WPF GOCKNNKGTV   OKP 'OCKNNGCDURNKVVGTWPIGP CWH FGT 4ÒEMUGKVG *GTUVGNNGTDG\GKEJPWPI FGT (KTOC .CVVGU OGJTHCEJ IG   RWP\VWPVGTCPFGTGO,CJTGRWP\Gō'ŋHÒTCO$CPF&C\W8GTFKGPUVQTFGP FGT4GRWDNKM &GMQTC VKQPFGT8-NCUUG5KNDGTVNYXGTIQNFGVWPFGOCKNNKGTVQJPGªDGTJÌJWPIWPF$CPF ++



0CVKQPCNGT5RQTV%NWD('##0KEJVVTCIDCTG2TGKUOGFCKNNGFGUVÒTMKUEJ·I[RVKUEJGP5RQTVNGT VTGHHGPU5KNDGTVNYGOCKNNKGTVWPFPKEJVVTCIDCTG/GFCKNNGCWHFCU+PVGTPCVKQPCNG#VJNGVGP6TGHHGPKO ,WPK$TQP\GVNYGOCKNNKGTVDGKFG&WTEJOGUUGTOO 5VÒEM++



6*+12+'0 -#+5'44'+%*6*+12+'0 $+5  

1TFGP FGU 5VGTPU XQP VJKQRKGP 4KVVGTFGMQTCVKQP ·NVGTG HKNKITCPG #WUHÒJTWPI 5KNDGT XGTIQNFGV   )NCUECDQEJQP CO PKEJV MQTTGMVGP $CPF &C\W 8GTFKGPUVOGFCKNNG FGU 1TFGPU ·NVGTG MNGKPGTG    #WUHÒJTWPI$TQP\GXGTIQNFGV 5VÒEM++



4'27$.+-%*+.' 

/GFCKNNG\WT'KPJWPFGTVLCJTHGKGTFGT7PCDJ·PIKIMGKV%JKNGU5KNDGTCO$CPF

++

 169


KAISERREICH JAPAN

8805

8804 8803 1:1

%*+0# -#+5'44'+%*%*+0# $+5  

-CKUGTNKEJGT 1TFGP XQO &QRRGNVGP &TCEJGP  /QFGNN   &GMQTCVKQP FGT  -NCUUG    )TCF&WTEJOGUUGTOO5KNDGTVNYGOCKNNKGTVOKVDNCWGO5VGKPKPFGT/KVVGWPFMNGKPGT-QTCNNG QDGPQJPG*CNUDCPFOKV/GVCNNUEJNKG­G.+51#05H6#81.2'5H ++ (ÒT$QVUEJCHVU5GMTGV·TWPF-NCUUG-QPUWNGªDGTUGV\WPIU5GMTGV·TG#VVCEJ¾UJÌJGTG1HHK\KGTGFGT/CTKPG 1DGTUVGWPF2TQHGUUQTGPKP%JKPC



81.-54'27$.+- 5'+6  

1TFGPHÒT8GTFKGPUVGWOFKG(ÌTFGTWPIFGT'KPVTCEJVFGU8QNMGU8GTUKNDGTVCP0CFGN

++



4'27$.+-'%7#&14 

0CVKQPCNGT 8GTFKGPUVQTFGP  /QFGNN CD   4KVVGTMTGW\ 5KNDGT XGTIQNFGV WPF GOCKNNKGTV CO   IGNDGP$CPF$7H 4++



+PFGPWPVGTGP-NCUUGPPWTUGJTUGNVGP\WHKPFGP  &GT 1TFGP KUV CO  1MVQDGT  YQJN KO *KPDNKEM CWH FGP  ,CJTGUVCI FGT 5EJNCEJV XQP 2KPEJKPEJC CO    /CK   XQP 2T·UKFGPV ,QU¾ .WKU 6COC[Q IGUVKHVGV YQTFGP &KG )GUVCNVWPI FGU GTUVGP /QFGNNU FGU \WP·EJUV   FTGKMNCUUKIGP1TFGPU GTUVG-NCUUGKP)QNF\YGKVG-NCUUGKP5KNDGTWPFFTKVVG-NCUUGKP$TQP\G KUVFGT2KPEJKPEJC /GFCKNNGXQPPCEJGORHWPFGPYWTFGGTOKV&GMTGV0TXQO,WPKCWHUGEJU-NCUUGPGTYGKVGTVWPF FKG+PUKIPKGPPGWIGUVCNVGV

8807

-#+5'44'+%*,#2#0 

170

1TFGPFGT#WHIGJGPFGP5QPPG&GMQTCVKQPGPFGTWPFFGT-NCUUG5KNDGTXGTIQNFGVWPFGOCKNNKGTV D\Y 5KNDGT LGYGKNU CO QTKIKPCNGP $CPF LCRCPKUEJGT 0·JCTV WPF KP OKV IQNFHCTDGPGP 5EJTKHV\GKEJGP   DGFTWEMVGP8GTNGKJWPIUGVWK&C\W/GFCKNNGXQO4QVGP-TGW\5KNDGTCOQTKIKPCNGP$CPFLCRCPKUEJGT 0·JCTVOKVCWHIGNGIVGT4QUGVVGKPOKVIQNFHCTDGPGP5EJTKHV\GKEJGPDGFTWEMVGP8GTNGKJWPIUGVWK  5VÒEM++




KAISERREICH JAPAN

8809

8808



1TFGP FGT )QNFGPGP 9GKJG  5COONGTCPHGTVKIWPI =EQR[? FGU -NGKPQFU FGT  -NCUUG XGTIQNFGV WPF   GOCKNNKGTVQJPG$CPF ++



'ZGORNCT CWU WPUGTGT  #WMVKQP 1TFGP WPF 'JTGP\GKEJGP CO  1MVQDGT  0T  *GTXQTTCIGPF IGCT   DGKVGVGU'TUCV\UVÒEMHÒTGKPGUGJTVGWGTGUWPFPWTUGJTUEJYGT\WDGUEJCHHGPFGU1TKIKPCNGZGORNCT



/GFCKNNGHÒTFGPEJKPGUKUEJLCRCPKUEJGP-TKGI&WPMNG$TQP\GCOQTKIKPCNGP$CPFLCRCPK UEJGT0·JCTV ++





-QPXQNWV XQP FTGK -TKGIUOGFCKNNGP   /GFCKNNG HÒT FGP -TKGI XQP    /GFCKNNG HÒT FGP   -TKGIXQP /GFCKNNGHÒTFGP-TKGIXQPLGYGKNUCP$·PFGTPLCRCPKUEJGT0·JCTV &C\W)W­MQRKGFGT0CXCN)GPGTCN5GTXKEG/GFCNXQP)TQ­DTKVCPPKGP 5VÒEM++



8810

8812 8811 8813



'JTGP\GKEJGPFGU,CRCPKUEJGP4QVGU-TGW\GU)QNFGPGU8GTFKGPUVMTGW\5KNDGTXGTIQNFGVWPFGOCKN NKGTVOKP#DURNKVVGTWPIKPGKPGT-TGW\CTOGEMGCO$CPFKOQTKIKPCNGP8GTNGKJWPIUGVWK ++



/QFGTPG#PHGTVKIWPI



'JTGP\GKEJGPFGU,CRCPKUEJGP4QVGU-TGW\GU5KNDGTPGU8GTFKGPUVMTGW\5KNDGTXGTIQNFGVWPFGOCKNNKGTV CO$CPF&C\W'JTGPOGFCKNNG$TQP\GXGTUKNDGTVVNYXGTIQNFGVCO$CPFOKV4QUGVVG 5VÒEM++



/QFGTPG#PHGTVKIWPI







4GVVWPIUOGFCKNNG FGT -CKUGTNKEJGP )GUGNNUEJCHV \WT 4GVVWPI CWU 5GGPQV 5KNDGT CWH FGT 4ÒEMUGKVG   -NGDUVQHHTGUVG CO $CPF &C\W 'JTGPOGFCKNNG $TQP\GXGTUKNDGTVVNYXGTIQNFGV4ÒEMUGKVGOKV-NGD UVQHHTGUVGPWPF/KVINKGFUEJCHVUOGFCKNNG+-NCUUG#NWOKPKWOLGYGKNUCO$CPFOKV4QUGVVGP  5VÒEM++



#WU\GKEJPWPIHÒT.GDGPUTGVVWPI5KNDGTVNYGOCKNNKGTVCWHFGT4ÒEMUGKVGOKV/CVTKMGNPWOOGTōŋWPF ITCXKGTVGP 5EJTKHV\GKEJGP CO $CPF LCRCPKUEJGT 0·JCTV &C\W FKG /KPKCVWT CP &TGKGT/KPKCVWTGP   UEJPCNNGCP0CFGN 5VÒEM4++



-QPXQNWVXQPHÒPHXGTUEJKGFGPGP#WU\GKEJPWPIGP /GFCKNNG\WT'TKPPGTWPICPFKG+PVJTQPKUCVKQP -CKUGT5JQYCU *KTQJKVQ CODKU0QXGODGT5KNDGTVNYXGTIQNFGV /GFCKNNGHÒTFGP 4WUUKUEJ,CRCPKUEJGP -TKGI    /GFCKNNG HÒT FGP EJKPGUKUEJLCRCPKUEJGP -TKGI      /GFCKNNG HÒTFGP%JKPC<YKUEJGPHCNN-TKGI 'TKPPGTWPIUOGFCKNNGFGU,CRCPKUEJGP4QVGP-TGW\GU HÒTFGP4WUUUKUEJ,CRCPKUEJGP-TKGI,GYGKNUCOQTKIKPCNGP$CPFLCRCPKUEJGT0·JCTV  5VÒEM++

 171


KOREA

8816

8815

-¤0+)4'+%* -#0#&#

9GKVGTGMCPCFKUEJG#WU\GKEJPWPIGPUKGJGWPVGT)TQ­DTKVCPPKGP



-CPCFKUEJG,CJTJWPFGTVHGKGT/GFCKNNG5KNDGTCO$CPF



/KPKCVWTGPUEJPCNNG OKV \GJP #WU\GKEJPWPIGP   1TFGT QH %CPCFC OGODGT   1TFGT QH 5V ,QJP   1HHKEGT 5VCT #KT%TGY'WTQRG5VCT &GHGPEG/GFCN %CPCFKCP8Q NWPVGGT /GFCN OKV $CPFURCPIG   9CT/GFCN    %CPCFC %GPVGPKCN /GFCN   3WGGP   'NK\CDGVJ5KNXGT,WDKNGG/GFCN [GCTU%CPCFC/GFCN#P0CFGN 5VÒEM++

+p++





8817

 

/KPKCVWTGPUEJPCNNG OKV PGWP XQTYKGIGPF MCPCFKUEJGP )GUGNNUEJCHVU#WU\GKEJPWPIGP &CTWPVGT   1TFGTQH2QNCTKU8GTFKGPUVOGFCKNNGFGT5VCFV'FOQPVQP'JTGP\GKEJGPFGT4Q[CN.KHG5CXKPI5QEKGV[ #P0CFGN 5VÒEM++



-QPXQNWV XQP  YQJN OGKUV MCPCFKUEJGP )GUGNNUEJCHVUQTFGP WPF CWU\GKEJPWPIGP &CTWPVGT 'J   TGPDÒTIGTUEJNÒUUGN FGT 5VCFV 9JKVGJQTUG KP ;WMQP 8GTFKGPUVOGFCKNNG FGT 5V·FVG 6QTQPVQ WPF 'FOQP   VQP /GFCKNNGP   WPF 'JTGP\GKEJGP   FGT 4Q[CN .KHG 5CXKPI 5QEKGV[ 6JG .KHG QH #NDGTVC #YCTF   7PVGTUEJKGFNKEJG /GVCNNG VGKNU GOCKNNKGTV KP XGTUEJKGFGPGP 'TJCNVWPIGP OGKUV CP $·PFGTP FTGK CP   *CNUD·PFGTP \YGKKP$KNFGTTCJOGP 5VÒEM++



8819

-14'# 

172

-#+5'44'+%*-14'#  

6CGIWM1TFGP CWEJ1TFGPFGT-QTGCPKUEJGP.CPFGUHNCIIGIGPCPPV &GMQTCVKQP-NCUUG5KNDGT XGTIQNFGV WPFGOCKNNKGTVCOMWT\GPQTKIKPCNGP$CPFCDUEJPKVVOKV'KPMPÌRHNÌEJGTPKOQTKIKPCNGP8GT NGKJWPIUGVWKOKV\GTUEJNKUUGPGT&GEMGNGKPNCIGWPFFGHGMVGO8GTUEJNW­10 ++ 


UNION MYANMAR 'ZGORNCTCWUWPUGTGT#WMVKQP'KPGPQTFCOGTKMCPKUEJG2TKXCVUCOONWPIWCCO,WPK0T  9KGCNNG1TFGPUKPUKIPKGPFGUWPVGTLCRCPKUEJGO2TQVGMVQTCVUVGJGPFGP-CKUGTTGKEJGU-QTGCGZVTGOUGNVGPFCFGUUGP 1TFGPKO,CJTGIGUVKHVGVWPFPWTDKUFGO,CJTFGTGPFIÒNVKIGP#PPGZKQP-QTGCUFWTEJ,CRCPXGTNKGJGP YQTFGPUKPF)GKNGPGPPVKP5#PWTGKPGPGKP\KIGPFGWVUEJGP6T·IGTFGU1TFGPUWPF\YCTFGT-NCUUGFGTKO &GWVUEJGP1TFGPUCNOCPCEJCWHIGHÒJTVKUV&T)QVVHTKGF0G[8K\G-QPUWNKP5GQWN'KPGINGKEJG&GMQTC VKQPKOXGTINGKEJDCTGP<WUVCPFLGFQEJQJPG'VWKCWUFGT5COONWPIFGT#OGTKECP0WOKUOCVKE5QEKGV[YWTFGCO #RTKNDGK/QTVQP'FGPKP.QPFQPCPIGDQVGP

8820

8822

8823

8824

8826

-7$#

$ª4)'4.+%*' 4'27$.+--7$# $+5  



1TFGPFGT'JTGWPFFGU8GTFKGPUVGU CWEJ1TFGPXQO4QVGP-TGW\IGPCPPV /QFGNNOKV/G FCKNNQPWOUEJTKHVō+06'4+0+/+%15%*#4+6#5ŋ-TGW\-NCUUG5KNDGTVNYXGTIQNFGVWPFGOCKNNKGTV HGKPG'OCKNNGOCNGTGKCO$CPF$9- ++



-QPXQNWVXQPFTGK#WU\GKEJPWPIGP /GFCKNNG+PVGTPCVKQPCNKUVKUEJGT-·ORHGT /GFCKNNGHÒT8GT FKGPUVGWOFKG#NRJCDGVKUKGTWPIFGU8QNGU /GFCKNNG%CTNQU$CNKÇQ,GYGKNUCP2GPVCIQPCNDCPFURCP IGP &C\W &KGPUVCWU\GKEJPWPIUOGFCKNNG WPF 5KNDGTPG 8GTFKGPUVOGFCKNNG FGT 5VTGKVMT·HVG DGKFG FGT   $ÒTIGTNKEJGP4GRWDNKMQJPG$·PFGT ++



/10)1.'+ /10)1.+5%*'81.-54'27$.+- 

1TFGPXQO2QNCTUVGTP/QFGNN  1TFGPUUVGTP5KNDGTXGTIQNFGVVNYGOCKNNKGTVCWHFGT 4ÒEMUGKVG0CFGNU[UVGOWPF6T·IGTPWOOGTōŋ$6*(/5/11/ ++





'JTGPOGFCKNNGHÒT8GTFKGPUVGKO-CORH/QFGNN#WUHÒJTWPI  5KNDGTVNYXGTIQN FGVWPFGOCKNNKGTVCWHFGT4ÒEMUGKVG6T·IGTPWOOGTōŋCPFTGKGEMKIGT$CPFURCPIGOKV5EJTCWDGWPF DTQP\GPG5EJTCWDUEJGKDGFCTCWH/QUMCWGT*GTUVGNNGTDG\GKEJPWPI$6*(/5/11/ ++



'JTGPOGFCKNNG FGT #TDGKV  /QFGNN  #WUHÒJTWPI OKV M[TKNNKUEJGT +PUEJTKHV   5KNDGT   VNYXGTIQNFGVWPFGOCKNNKGTVCWHFGT4ÒEMUGKVG6T·IGTPWOOGTōŋCPFTGKGEMKIGT$CPFURCPIGOKV 0CFGN$6*(/5/11/ ++



-QPXQNWV XQP  #WU\GKEJPWPIGP &CTWPVGT 1TFGP FGU /WVVGTTWJOGU  -NCUUG   /GFCKNNG \WO   ,CJTGUVCIFGTOQPIQNKUEJGP8QNMUTGXQNWVKQP/GFCKNNG\WO,CJTGUVCIFGUUGNDGP#PNCUUGU/G FCKNNG \WO  ,CJTGUVCI FGUUGNDGP #PNCUUGU /GFCKNNG \WO  ,CJTGUVCI FGUUGNDGP #PNCUUGU     /GFCKNNG\WO,CJTGUVCIFGUUGNDGP#PNCUUGU/GFCKNNGHÒTFGP,CJTGUVCIFGU5KGIGUXQP%JCNEJKP )QN /GFCKNNG \WO  ,CJTGUVCI FGT )TÒPFWPI FGT /QPIQNKUEJGP 5VTGKVMT·HVG /GFCKNNG \WO  ,CJ   TGUVCI FGU 5KGIGU ÒDGT ,CRCP \YGK #DUQNXGPVGPCD\GKEJGP ,GYGKNU XGTIQNFGV D\Y XGTUKNDGTV WPF VNY   GOCKNNKGTV D\Y NCEMKGTV CP GOCKNNKGTVGP D\Y NCEMKGTVGP 6TCIGURCPIGP QFGT 5EJTCWDGP OKV 5EJTCWD   UEJGKDG 5VÒEM++







70+10/;#0/#4 $74/#  

1TFGP5VGTPFGT4GXQNWVKQP5VGTP-NCUUGXGTUKNDGTVVNYXGTIQNFGVWPFGOCKNNKGTVCP0CFGN$7 5 ++



&GT FTGKMNCUUKIG 1TFGP YWTFG CO  0QXGODGT  IGUVKHVGV 'T YWTFG CP FKG 6GKNPGJOGT FGT 7PCDJ·PIKIMGKVU   M·ORHG XGTNKGJGP &KGUG YWTFGP FCDGK KP FTGK 2GTKQFGP WPVGTVGKNV  2GTKQFG  DKU   2GTKQFG    DKU   2GTKQFG  DKU   &KG 6GKNPGJOGT CNNGT Y·JTGPF CNNGT FTGK 2GTKQFGP   GTJKGNVGPFKG-NCUUGFKG6GKNPGJOGTY·JTGPFGKPGTQFGT\YGK2GTKQFGPFKG\YGKVGWPFFKG6GKNPGJOGTCPOKPFG UVGPUGKPGT2GTKQFGFKGFTKVVG-NCUUG$GOGTMGPUYGTVCPFKGUGO1TFGPKUVFGT7OUVCPFFC­KJPCWEJFKTGMVG0CEJ MQOOGPFGT$GNKGJGPGPDGKQHHK\KGNNGP8GTCPUVCNVWPIGPVTCIGPMQPPVGP5GKVKUVFGT1TFGPPKEJVOGJTXGTNKGJGP YQTFGP

173


KÃ&#x2013;NIGREICH THAILAND

8831 8827

8828

-¤0+)4'+%*6*#+.#0& 

&GTUGJTJQJG1TFGPFGU9GK­GP'NGRJCPVGP/QFGNN UGKV #DVGKNWPIHÃ&#x2019;T*GTTGP-QOOCP FGWTFGMQTCVKQP  -NCUUG  5KNDGT VNY XGTIQNFGV WPF GOCKNNKGTV CWH FGT 4Ã&#x2019;EMUGKVG FGT -TQPG VJCKN·P   FKUEJRWP\KGTVCO*CNUDCPF ++



&GTUGJTJQJG1TFGPFGU9GK­GP'NGRJCPVGP/QFGNN UGKV #DVGKNWPIHÃ&#x2019;T&COGP&GMQTC VKQP FGT )GHQNIUNGWVG  -NCUUG  5KNDGT VNY XGTIQNFGV WPF GOCKNNKGTV CWH FGT 4Ã&#x2019;EMUGKVG FGT -TQPG   VJCKN·PFKUEJRWP\KGTVCP&COGPUEJNGKHGOKVCWHIGNGIVGT4QUGVVG ++





&GTUGJTJQJG1TFGPFGU9GK­GP'NGRJCPVGP/QFGNN UGKV #DVGKNWPIHÃ&#x2019;T*GTTGP&GMQTC VKQPFGT/KVINKGFGT -NCUUG 5KNDGTVNYXGTIQNFGVWPFGOCKNNKGTVCO$CPF ++





&GTUGJTJQJG1TFGPFGU9GK­GP'NGRJCPVGP/QFGNN UGKV #DVGKNWPIHÃ&#x2019;T&COGP5KNDGTPG /GFCKNNG -NCUUG 5KNDGCWHFGT4Ã&#x2019;EMUGKVGFGT-TQPGVJCKN·PFKUEJRWP\KGTVCP&COGPUEJNGKHG ++





&KG/GFCKNNGKPGEJV5KNDGTKUVPKEJVJ·WHKI\WHKPFGP



&GTUGJTXQTPGJOG1TFGPFGT-TQPGXQP6JCKNCPF/QFGNN UGKV #DVGKNWPIHÃ&#x2019;T*GTTGP5GV FGT4KVVGT-QOOCPFGWTG -NCUUG DGUVGJGPFCWU*CNUFGMQTCVKQP5KNDGTVNYXGTIQNFGVWPFGOCKNNKGTV CWH FGT 4Ã&#x2019;EMUGKVG FGT -TQPG WPF FGT &GMQTCVKQP OGJTHCEJ VJCKN·PFKUEJ RWP\KGTV CO *CNUDCPF WPF   $TWUVUVGTP5KNDGTVNYXGTIQNFGVWPFGOCKNNKGTVCP0CFGNFKGUGVJCKN·PFKUEJRWP\KGTV 5VÃ&#x2019;EM+p++

8832







174



8833

&GT UGJT XQTPGJOG 1TFGP FGT -TQPG XQP 6JCKNCPF /QFGNN UGKV   #DVGKNWPI HÃ&#x2019;T *GTTGP   -QOOCPFGWTFGMQTCVKQP  -NCUUG  5KNDGT VNY XGTIQNFGV WPF GOCKNNKGTV CWH FGT 4Ã&#x2019;EMUGKVG FGT -TQPG   VJCKN·PFKUEJRWP\KGTVCO*CNUDCPF ++



&GT UGJT XQTPGJOG 1TFGP FGT -TQPG XQP 6JCKNCPF /QFGNN UGKV   #DVGKNWPI HÃ&#x2019;T &COGP   -QOOCPFGWTFGMQTCVKQP  -NCUUG  5KNDGT VNY XGTIQNFGV WPF GOCKNNKGTV CWH FGT 4Ã&#x2019;EMUGKVG FGT -TQPG   VJCKN·PFKUEJRWP\KGTVCP&COGPUEJNGKHG ++



&GT UGJT XQTPGJOG 1TFGP FGT -TQPG XQP 6JCKNCPF /QFGNN UGKV   #DVGKNWPI HÃ&#x2019;T &COGP   &GMQTCVKQP FGT )GHQNIUNGWVG  -NCUUG  5KNDGT VNY XGTIQNFGV WPF GOCKNNKGTV CWH FGT 4Ã&#x2019;EMUGKVG FGT   -TQPGWPFFGT&GMQTCVKQPVJCKN·PFKUEJRWP\KGTVCP&COGPUEJNGKHGOKVCWHIGNGIVGT4QUGVVG ++




TÜRKEI 



&GT UGJT XQTPGJOG 1TFGP FGT -TQPG XQP 6JCKNCPF /QFGNN UGKV   #DVGKNWPI HÒT *GTTGP   &GMQTCVKQPFGT/KVINKGFGT -NCUUG 5KNDGTVNYXGTIQNFGVWPFGOCKNNKGTVCWHFGT4ÒEMUGKVGFGT-TQPG VJCKN·PFKUEJRWP\KGTVCO$CPF ++



&GT UGJT XQTPGJOG 1TFGP FGT -TQPG XQP 6JCKNCPF /QFGNN UGKV   #DVGKNWPI HÒT *GTTGP   )QNFGPG/GFCKNNG -NCUUG 5KNDGTXGTIQNFGVUVCTMCPIGNCWHGPCWHFGT4ÒEMUGKVGFGT-TQPGRWP\KGTV CO$CPF ++



8838

8837

6ª4-'+ 6ª4-'+15/#0+5%*'54'+%* $+5  

1UOCPKLG1TFGP $TWUVUVGTP FGT  -NCUUG &WTEJOGUUGT  OO GWTQR·KUEJG #PHGTVKIWPI 5KNDGT   DTKNNCPVKGTVWPFTGRGTEKGTVVNYXGTIQNFGVWPFGOCKNNKGTVFKGITÒPG'OCKNNGXQNNUV·PFKIFWTEJHCTDKIGP .CEMGTUGV\VQJPG2WP\KGTWPIGPCP0CFGNOKV\YGK5GKVGPJCMGP +++



1UOCPKLG1TFGP $TWUVUVGTP FGT  -NCUUG &WTEJOGUUGT  OO 5KNDGT DTKNNCPVKGTV WPF TGRGTEKGTV   VNY GOCKNNKGTV CWH FGT 4ÒEMUGKVG QUOCPKUEJG *GTUVGNNGTDG\GKEJPWPI FGT /ÒP\G KP -QPUVCPVKPQRGN CP   0CFGN FKGUG OKV HTCP\ÌUKUEJGT 'KPHWJTRWP\G XQP  DKU  ō5EJYCPGPRWP\Gŋ  OKV \YGK   5GKVGPJCMGP ++



&GT HÒPHMNCUUKIG PCEJ 5WNVCP 1UOCP +   FGO )TÒPFGT FGU 1UOCPKUEJGP 4GKEJGU DGPCPPVG <KXKN WPF   /KNKV·T8GTFKGPUVQTFGPYWTFGCO,CPWCTXQP5WNVCP#DFÒN#\K\IGUVKHVGVWPFDKU\WO'PFGFGT/QPCTEJKG XGTNKGJGP



8840 1:1 8839



8841

1UOCPKLG1TFGP&GMQTCVKQPFGTWPF-NCUUG5KNDGTVNYDTKNNCPVKGTVVNYXGTIQNFGVVNYGOCKN NKGTVFCU*CNUDCPFKP2GPVCIQPCNHQTOIGHCNVGV +p++



+PUGNVGPIWVGT'TJCNVWPI



1UOCPKLG1TFGP/KPKCVWTFGT1TFGPUFGMQTCVKQP5KNDGTVNYXGTIQNFGVWPFGOCKNNKGTVCO$·PFEJGP ++





/GFLKFLKG1TFGP &GMQTCVKQP  -NCUUG 5KNDGT DTKNNCPVKGTV /GFCKNNQP )QNF GOCKNNKGTV #ITCHHG 5KNDGT   XGTIQNFGV WPF GOCKNNKGTV CWH FGT 4ÒEMUGKVG QUOCPKUEJG *GTUVGNNGTDG\GKEJPWPI FGT /ÒP\G KP -QPUVCP   VKPQRGNKO$CPFTKPIHTCP\ÌUKUEJG'KPHWJTRWP\GPXQPDKU ō5EJYCPGPRWP\GŋWPFō7JWRWP\Gŋ  COMWT\GP*CNUDCPFCDUEJPKVV ++

 175


USA

8846

8842

8848 8847 8845



/GFLKFLKG1TFGP &GMQTCVKQP  -NCUUG 5KNDGT DTKNNCPVKGTV /GFCKNNQP WPF #ITCHHG )QNF GOCKNNKGTV   'OCKNNGTGRCTCVWTGPKO/GFCKNNQPTKPIWPFKO*CNDOQPFCOCNVGP1TKIKPCNDCPF ++



(TÒJG#PHGTVKIWPICWUFGO\YGKVGP&TKVVGNFGU0GWP\GJPVGP,CJTJWPFGTVUOKVUKNDGTPGO/GFCKNNQPHGNF  &GTHÒPHMNCUUKIGPCEJUGKPGO5VKHVGTDGPCPPVG<KXKNWPF/KNKV·T8GTFKGPUVQTFGPYWTFGKO#WIWUVXQP5WNVCP #DFÒN/GLKF+IGUVKHVGVWPFDKU\WO'PFGFGT/QPCTEJKGXGTNKGJGP



5JGHMCV1TFGP'VWK\WT-NCUUG#PHGTVKIWPICWUFGPGT,CJTGP  OKVIQNFDGFTWEMVGO*CND OQPFWPF5VGTPWPF$G\GKEJPWPI ++





.GGTGU'VWK#PHGTVKIWPICWUFGPGT,CJTGP  KPTQVGO5COVOKVCWHIGNGIVGO.QTDGGTMTCP\WPF 5VGTP ++



670'5+'0 (ª456'067/670+5 $+5  

1TFGPFGU4WJOGU/QFGNN#WUHÒJTWPI OKVFGO/QPQITCOOXQP/QJCOGFGN*CDKD   &GMQTCVKQP  -NCUUG 1HHK\KGT  HTCP\ÌUKUEJG #PHGTVKIWPI 5KNDGT DTKNNCPVKGTV VNY GOCKNNKGTV   'OCKNNGCWUDTÒEJG KP \YGK 5VTCJNGP CWH FGT 4ÒEMUGKVG FGU 6TCIGUVTCJNU HTCP\ÌUKUEJG )CTCPVKGRWP\G HÒT   5KNDGTXQPDKU ō9KNFUEJYGKPMQRHŋ COQTKIKPCNGP$CPFOKVCWHIGNGIVGT4QUGVVG\WUCOOGP OKV-PQRHNQEJTQUGVVG ++p+++



0CEJ FGO 8QTDKNF FGU QUOCPKUEJGP 0KUJCP +HVKMJCT1TFGPU YWTFG FGT 1TFGP XQP/WUVCRJC$G[XQP6WPKU IGUVKHVGV 5GKP 0CEJHQNIGT #JOGF $G[ GTYGKVGTVG KJP CWH HÒPH 5VWHGP WPF HÒIVG UGKP GKIGPGU /QPQITCOO GKP GKPG   2TCZKUFKGCNNGUGKPG0CEJHQNIGTDKU\WO'PFGFGT/QPCTEJKGDGKDGJKGNVGP/QJCOGFGU5CFQM$G[XQP6WPKUICD FGP+PUKIPKGPOKV&GMTGVXQO(GDTWCT/·T\GKPGPGWG)GUVCNVWPIWPFGTYGKVGTVGKJPCWHPWPOGJTUGEJU-NCU UGP )TQ­MQTFQP  DKU  -NCUUG  /KV FGT #DUGV\WPI FGU NGV\VGP $G[U /QJCOGF 'N #OKP  FWTEJ 2T·UKFGPV   $QWTIWKDCJÌTVGFGT1TFGPCWH\WDGUVGJGP#WITWPFFGT\YGK/QFGNNGOKVUKGDGPXGTUEJKGFGPGP#WUHÒJTWPIGPFGU  /QFGNNU KP \WFGO LGYGKNU \CJNTGKEJGP 8CTKCPVGP IGJÌTV FKGUGT 1TFGP \W FGP XKGNUGKVKIUVGP WPF KPVGTGUUCPVGUVGP   ÒDGTJCWRV

8'4'+0+)6'56##6'0810#/'4+-# 75#  

.GIKQP HÒT 8GTFKGPUVG -QOOCPFGWT&GMQTCVKQP $TQP\G XGTIQNFGV WPF GOCKNNKGTV CO *CNUDCPFCD   UEJPKVV ++





.GIKQPHÒT8GTFKGPUVG.GIKQP·TU&GMQTCVKQP$TQP\GXGTIQNFGVWPFGOCKNNKGTVCWHFGT4ÒEMUGKVG6T· IGTITCXWTō41$'46*/15'4ŋ\WUCOOGPOKV(GNFUEJPCNNGWPF4GXGTUCD\GKEJGPUQYKGGKPGO$KNF FGU6T·IGTUKO8GTNGKJWPIUGVWK ++



/CLQT&T4QDGTV*/QUGT/&/%YCT#T\VFGTCOGTKMCPKUEJGP5VTGKVMT·HVGWPFOGFK\KPKUEJGT(CEJCWVQT



(TKGFGPUOGFCKNNG FGU COGTKMCPKUEJGP 2T·UKFGPVGP /CTVKP 8CP $WTGP HÒT *·WRVNKPIG XQP +PFKC   PGTUV·OOGP&CVKGTV&WTEJOGUUGTOO$TQP\GIGUEJY·T\VOKV5VGORGNUEJPGKFGTUKIPCVWT ō(7456(ŋIGNQEJVOGJTGTG4CPFFGNNGPWPF-TCV\GTCP6TCIGUEJPWT 44++ /CTVKPXCP$WTGP  TGIKGTVGFKG8GTGKPKIVGP5VCCVGPXQP#OGTKMCCNUFGTGP2T·UKFGPVXQPDKU

176




ORDENSSCHNALLEN INTERNATIONAL

8850

8849



'TKPPGTWPIUOGFCKNNGCPFKG#NCUMC;WMQP2C\KHKM#WUUVGNNWPIKP5GCVVNG$TQP\GXGTUKNDGTVCP 6TCIGURCPIG ++





5KGIGUOGFCKNNG FGT +PFGRGPFGPEG &C[ %GNGDTCVKQP $CVJ $GCEJ  $GPUQPJWTUV CO  DKU  ,WNK   &WTEJOGUUGTOO)QNFVNYGOCKNNKGTVECICWHFGT4ÒEMUGKVGITCXKGTVō&/(9QTNFU )TGCVGUV#VJNGVGŋCWHFGT4ÒEMUGKVG*GTUVGNNGTWPF)QNFRWP\GPCONCPIGP*CNUDCPF&C\W2TGKUOG FCKNNGHÒTFKG.GKEJVIGYKEJV/GKUVGTUEJCHVKO$QZGPCO,WN[HÒT9O)TGGP$TQP\GTÒEMUGK VKI9KFOWPIUITCXWTCO$CPF7PF#D\GKEJGPFGU+PFGRGPFGPV1TFGTFGT1FF(GNNQYU)QNFGOCKN NKGTVICP0CFGN 5VÒEM++



-QPXQNWVXQPUGEJU#WU\GKEJPWPIGP&CTWPVGT.GIKQPQH/GTKV1HHKEGT5KNXGT5VCT$TQP\G5VCTWPF #TO[&KUVKPIWKUJGF5GTXKEG%TQUU6GKNUGOCKNNKGTVCP$·PFGTPFTGK\WUCOOGPOKV(GNFUEJPCNNGPWPF 4GXGTUCD\GKEJGPKPCNVGP'VWKU 5VÒEM++





8852

14&'055%*0#..'0+06'40#6+10#. 

)TQ­G 1TFGPUUEJPCNNG OKV HÒPH XQP WTURTÒPINKEJ UGEJU #WU\GKEJPWPIGP   5EJYGFGP $CPF FGT   /GFCKNNG HÒT 'KHGT WPF 4GFNKEJMGKV KO 4GKEJUFKGPUV QJPG /GFCKNNG   &·PGOCTM &CPGDTQIQTFGP    /QFGNN OKV /QPQITCOO XQP -ÌPKIKP /CTICTGVJG ++  UGKV   4KVVGTMTGW\ ++ -NCUUG 5KNDGT   GOCKNNKGTV   0QTYGIGP 8GTFKGPUVQTFGP 4KVVGTMTGW\ ++ -NCUUG 5KNDGT VNY GOCKNNKGTV   +UNCPF   (CNMGPQTFGP  /QFGNN QJPG -TQPG  UGKV   4KVVGTMTGW\ 5KNDGT XGTIQNFGV WPF GOCKNNKGTV     $GNIKGP -TQPGPQTFGP 4KVVGTFGMQTCVKQP XGTUKNDGTV VNY XGTIQNFGV WPF GOCKNNKGTV CWH 8QTFGT WPF   4ÒEMUGKVG UVCTMG -NGDUVQHHURWTGP   )TQ­DTKVCPPKGP 1TFGP FGU $TKVKUEJGP 'ORKTGU  /QFGNN OKV   *GTTUEJGTRCCT KO /GFCKNNQP  UGKV   -TGW\ FGT /KVINKGFGT /GODGT  /$'  5KNDGT CO   OKNKV·TKUEJGP $CPF #P 0CFGN /KV PCJG\W  RCUUGPFGT /KPKCVWTGPUEJPCNNG GDGPHCNNU OKV NGGTGO $CPF   FGT /GFCKNNG HÒT 'KHGT WPF 4GFNKEJMGKV KO 4GKEJUFKGPUV WPF 1HHK\KGTU UVCVV 4KVVGTMTGW\GP FGU   PQTYGIKUEJGP8GTFKGPUVQTFGPUWPFFGU1TFGPUFGU$TKVKUEJGP'ORKTGU#P0CFGN 5VÒEM++

 177


MINIATURENSCHNALLEN INTERNATIONAL

8853



)TQ­G 1TFGPUUEJPCNNG OKV FTGK #WU\GKEJPWPIGP   &·PGOCTM (TGKJGKVU/GFCKNNG -ÌPKI %JTKUVKCPU   : 5KNDGT   (KPNCPF 5KNDGTPG 8GTFKGPUVOGFCKNNG FGU(KPPKUEJGP4QVGP-TGW\GU5KNDGT (KPPNCPF /GFCKNNG241$'0+0)#6'*7/#0#FGU(KPPKUEJGP4QVGP-TGW\GU#P0CFGN/KVFC\WRCUUGPFGT /KPKCVWTGPUEJPCNNG ++

8854



8855

/+0+#674'05%*0#..'070&-'66%*'0+06'40#6+10#. 



/KPKCVWTGPMGVVEJGP OKV XKGT #WU\GKEJPWPIUOKPKCVWTGP   1UOCPKUEJGU 4GKEJ /GFLKFLKG1TFGP   1TFGPUFGMQTCVKQP 5KNDGT /GFCKNNQP WPF #ITCHHG )QNF GOCKNNKGTV   (TCPMTGKEJ 'JTGP\GKEJGP GKPGU   1HHK\GTUFG#MCFGOKG UQIGPō5KNDGTPG#MCFGOKUEJG2CNOGPŋ 5KNDGTVNYGOCKNNKGTV 2QTVWICN1T FGP7PUGTGT.KGDGP(TCWXQP8KNC8KEQUC1TFGPUFGMQTCVKQP)QNFGOCKNNKGTV 5QWXGT·PGT/CNVGUGT 4KVVGTQTFGP 1TFGPUMTGW\ 5KNDGT XGTIQNFGV WPF GOCKNNKGTV #O GEJV IQNFGPGP /KPKCVWTGPMGVVEJGP OKV   \YGK0CFGNPKO'VWKXQP$CSWGXKNNGKP2CTKU 5VÒEM++



/KPKCVWTGPMGVVEJGPOKVXKGT#WU\GKEJPWPIUOKPKCVWTGP (TCPMTGKEJ1TFGPFGT'JTGPNGIKQP/Q FGNN  4KVVGTFGMQTCVKQP5KNDGT/GFCKNNQPU)QNFGOCKNNKGTV 5EJYGFGP9CUCQTFGP/QFGNN

UGKV 4KVVGTFGMQTCVKQP5KNDGTXGTIQNFGV/GFCKNNQP)QNFGOCKNNKGTV 4WO·PKGP1TFGPō-TQPG 4WO·PKGPUŋ/QFGNN  4KVVGTMTGW\5KNDGTVNYXGTIQNFGVWPFGOCKNNKGTV (TCPMTGKEJ 1TFGPHÒT8GTFKGPUVGWOFKG.CPFYKTVUEJCHV4KVVGTFGMQTCVKQP5KNDGT/GFCKNNQPU)QNFGOCKNNKGTV/KP 'OCKNNGCWUDTÒEJGDGK\YGK/KPKCVWTGPCO-GVVEJGP5KNDGTXGTIQNFGVCP\YGK0CFGNP 5VÒEM+++++



8856

8857



/KPKCVWTGPURCPIGOKVHÒPH#WU\GKEJPWPIUOKPKCVWTGP (TCPMTGKEJ1TFGPFGT'JTGPNGIKQP/Q FGNN   4KVVGTFGMQTCVKQP 5KNDGT /GFCKNNQPU )QNF GOCKNNKGTV   (TCPMTGKEJ 1TFGP HÒT 8GTFKGP   UVG WO FKG .CPFYKTVUEJCHV 4KVVGTFGMQTCVKQP 5KNDGT /GFCKNNQPU )QNF GOCKNNKGTV 4ÒEMUGKVGPOGFCKNNQP   HGJNV   5EJYGFGP 9CUCQTFGP  /QFGNN UGKV   4KVVGTFGMQTCVKQP 5KNDGT XGTIQNFGV GOCKNNKGTV    4WO·PKGP1TFGPō-TQPG4WO·PKGPUŋ/QFGNN  4KVVGTMTGW\5KNDGT/GFCKNNQP)QNF GOCKNNKGTV 4WO·PKGP1TFGPō.CPFYKTVUEJCHVU8GTFKGPUVŋ/QFGNN OKV/QPQITCOO-ÌPKI%CTQNU++  4KVVGTMTGW\5KNDGTGOCKNNKGTV#P5KNDGTURCPIGOKV0CFGNKO'VWK 5VÒEM++





/KPKCVWTGPURCPIGOKV#WU\GKEJPWPIUOKPKCVWTGP (TCPMTGKEJ1TFGPFGT'JTGPNGIKQP/QFGNN 4KVVGTFGMQTCVKQP 5KNDGT XGTIQNFGV WPF GOCKNNKGTV   5QWXGT·PGT /CNVGUGT 4KVVGTQTFGP 1TFGPUMTGW\   5KNDGT XGTIQNFGV WPFGOCKNNKGTV *GKNKIGT5VWJN4KVVGTQTFGPXQO*GKNKIGP)TCD)TQ­QHHK\KGTUMTGW\ 5KNDGTXGTIQNFGVWPFGOCKNNKGTVOKP'OCKNNGCWUDTWEJ .WZGODWTI/KNKV·TWPF<KXKN8GTFKGPUVQTFGP #FQNRJU XQP 0CUUCW -QOOCPFGWTMTGW\   6UEJGEJQUNQYCMGK 6UEJGEJQUNQYCMKUEJGT 1TFGP XQO   9GK­GP .ÌYGP  /QFGNN    -NCUUG 5KNDGT XGTIQNFGV WPF GOCKNNKGTV   *GKNKIGT 5VWJN   5KNDGTPGU $GPGOGTGPVKMTGW\ HÒT 8GFKGPUVG WO FCU #WU­GTQTFGPVNKEJG *GKNKIG ,CJT FGT 'TNÌUWPI    5KNDGT GOCKNNKGTV   (TCPMTGKEJ -QODCVVCPVGPMTGW\   (TCPMTGKEJ -TKGIUGTKPPGTWPIUOGFCKNNG       (TCPMTGKEJ /GFCKNNG HÒT GPVHNQJGPG -TKGIUIGHCPIGPG   (TCPMTGKEJ 5KNDGTPG 8GTFKGPUV   OGFCKNNGFGT0CVKQPCNGP)GUGNNUEJCHVHÒTFGP#PURQTP\WO)WVGP5KNDGT,GYGKNUCP$·PFEJGPVGKNUOKV .KV\GPWPF4QUGVVGPCP-GVEEJGPKO'VWKFGT(KTOC#/CTKG5VWCTVKP2CTKU 5VÒEM++



7OHCPITGKEJGU /KPKCVWTGPMGVVEJGP GKPGU JQJGP MCVJQNKUEJGP \KXKNGP 9ÒTFGPVT·IGTU YQJN FGT -CVJQNKUEJGP #MVKQP    WPF8GVGTCPGPFGU'TUVGP9GNVMTKGIU

178


VERLEIHUNGSURKUNDEN UND DOKUMENTE

-1081.76'+06'40#6+10#. 









-QXQNWVXQP1TFGPWPF'JTGP\GKEJGP#WU(TCPMTGKEJFGO+TCM-COGTWP¤UVGTTGKEJ2CMKUVCP FGT6UEJGEJQUNQYCMGKWPF<KODCDYG8GTUEJKGFGP/GVCNNGVGKNUXGTIQNFGVVGKNUXGTUKNDGTVVGKNUGOCKN NKGTVKPWPVGTUEJKGFNKEJGP'TJCNVWPIGPVGKNUCP$·PFGTP ++



-QPXQNWVXQP'JTGP#D\GKEJGPWPF$CPFURCPIGP/GKUVHTCP\ÌUKUEJKPXGTUEJKGFGPGP/GVCN NGPVGKNGOCKNNKGTVKPWPVGTUEJKGFNKEJGP'TJCNVWPIGPVGKNUCP$·PFGTPUQYKGGKPGPKEJVVTCIDCTG$TQP \GOGFCKNNG 5VÒEM++++++8



-QPXQNWVXQP\GJP#WU\GKEJPWPIGP7CCWUFGOUQIGP&TKVVGP4GKEJ(TCPMTGKEJ2TGW­GP4WO· PKGP 5GTDKGP WPF 7PICTP 8GTUEJKGFGPG /GVCNNG VGKNU GOCKNNKGTV KP WPVGTUEJKGFNKEJGP 'TJCNVWPIGP   OGKUVQJPG$·PFGT 5VÒEM++++p+++



-QPXQNWVXQP1TFGP'JTGPWPF#D\GKEJGP7CCWU+VCNKGP-CPCFC/CNVGUGTQTFGP/GZKMQ 5QYLGVWPKQPWPFFGO8CVKMCP8GTUEJKGFGPG/CVGTKCNKGPCWEJIGUVKEMVVGKNUGOCKNNKGTVKPWPVGTUEJKGF NKEJGP'TJCNVWPIGPVGKNUCP0CFGNPQFGT$·PFGTPRNWUGKPNGGTGU'VWK 5VÒEM++



-QPXQNWVXQP'VWKU+PWPVGTUEJKGFNKEJGP)TÌ­GP WCFTGK)TQ­MTGW\WPFFTGK-QOOCPFGWTMTGW \GVWKU KPWPVGTUEJKGFNKEJGP'TJCNVWPIGPVGKNUOKV'VKMGVVGPDGMNGDV 5VÒEM+++++



5#//.70)8'4.'+*70)574-70&'070&&1-7/'06' &'765%*'56##6'0 +O(QNIGPFGPIGNCPIVGKPG5COONWPIXQP8GTNGKJWPIUWTMWPFGP\W1TFGPWPF'JTGP\GKEJGPCWU &GWVUEJNCPF ¤UVGTTGKEJ WPF CPFGTGP GWTQR·KUEJGP 5VCCVGP \WO #WHTWH VGKNU OKV #WVQITCRJGP   DGFGWVGPFGT2GTUÌPNKEJMGKVGPFGT)GUEJKEJVGQFGTCPFKGUGIGTKEJVGV&KGCNNGTOGKUVGP&QMWOGPVG FKGUKEJXQTYKGIGPFKPGKPGOQTFGPVNKEJGP<WUVCPFDGHKPFGPMÌPPGPFGPPQEJGKPQFGTOGJTHCEJ IGHCNVGVUGKPMNGKPG'KPTKUUGJCDGPQFGTGVYCUUVQEMHNGEMKIUGKP&KGUGCNVGTUDGFKPIVGP)GDTCWEJU URWTGP YGTFGP UQHGTP UKG PKEJV FCU PQTOCNG WPF \WOWVDCTG /C­ FGWVNKEJ ÒDGTUUVGKIGP KP FGT   $GUEJTGKDWPI FGT LGYGKNKIGP &QMWOGPVG PKEJV IGUQPFGTV GTY·JPV FKGUG 'TJCNVWPI OKV FGO   <WUVCPF ++ MCVGIQTKUKGTV NVGTG CWUN·PFKUEJG 7TMWPFGP MÌPPGP \WFGO GVYCU DGUEJPKVVGP UGKP   YCUYKTLGFQEJCWHITWPFHGJNGPFGT8GTINGKEJUOÌINKEJMGKVGPPKEJVHGUVUVGNNGPMÌPGP$KVVGJCDGP5KG 8GTUV·PFPKUFCHÒTFC­YKTWPUNGKFGTIGPGTGNNPKEJVKPFGT.CIGUGJGP&QMWOGPVGPCEJ9WPUEJ \WRJQVQMQRKGTGPQFGTGKP\WUECPPGPWPF+JPGPFKGUG-QRKGPQFGT&CVGP\WMQOOGP\WNCUUGPFC FGTGP(QTOCVOGKUVFCU(CUUWPIUXGTOÌIGPPQTOCNGT-QRKGTGTWPF5ECPPGTÒDGTUVGKIV9KTYGKUGP CWEJCPFKGUGT5VGNNGPQEJGKPOCNCWUFTÒEMNKEJCWHFKGIGIGDGPGPWOHCPITGKEJGP/ÌINKEJMGKVGP\WT 8QTDGUKEJVKIWPIFGT&QMWOGPVGKO8QTHGNFFGT#WMVKQPJKP

-74(ª456'067/70&-¤0+)4'+%*$#;'40 







/KNKV·T/CZ,QUGRJ1TFGP8GTNGKJWPIUWTMWPFG\WO4KVVGTMTGW\HÒT/CLQT#PVQP$CTQP4GEJDGTIFGU  %JGXCWZ NGIGTU 4GIKOGPVU -QGPKI FCVKGTV /ÒPEJGP CO  /·T\  OKV 2T·IGUKGIGN WPF 1TKIK   PCNWPVGTUEJTKHV-ÌPKI/CZ+,QUGRJ7PF'TPGPPWPIUFGMTGV\WO1DGTUVNGWVPCPVHÒTFGP-·OOGTGTWPF /CLQT(TGKJGTTPXQP4GEJDGTI1DGTJQHOGKUVGTFGU2TKP\GP%CTN6JGQFQTOKV2T·IGUKGIGNWPF1TKIK PCNWPVGTUEJTKHVGPXQP-ÌPKI/CZ+,QUGRJWPFFGU)TCHGP/QPVIGNCU&C\WXKGTYGKVGTG&QMWOGPVGFGU )GPGTCN/CLQTU)TCHXQP4GEJDGTI\YKUEJGPWPFUQYKGGKPIGUKGIGNVGT7OUEJNCI,GYGKNU OGJTHCEJIGHCNVGVWPFVGKNYGKUGOKPGKPIGTKUUGPUQPUVKPIWVGO<WUVCPF 5VÒEM++



/KNKV·T8GTFKGPUVQTFGP 8GTNGKJWPIUWTMWPFG \WT  -NCUUG OKV FGT -TQPG HÒT FGP M W M ÌUVGTTGK   EJKUEJWPICTKUEJ *CWRVOCPP 8KMVQT (KUEJGT XQO  5CN\DWTI1DGTÌUVGTTGKEJKUEJGP +PHCPVGTKG4GIK   OGPVFCVKGTV/ÒPEJGPCO,WPKOKV1TKIKPCNWPVGTUEJTKHVFGU1TFGPU)TQ­MCP\NGTU ++



/KNKV·T8GTFKGPUVQTFGP8GTNGKJWPIUWTMWPFG\WO/KNKV·T8GTFKGPUVMTGW\-NCUUGOKVFGT-TQPGWPF OKV5EJYGTVGTPCO$CPFGHÒT-TKGIUXGTFKGPUVHÒTFGPUVGNNXGTVTGVGPFGP(GNFNC\CTGVV+PURGMVQT'TPUV5GKFN XQO(GNFNC\CTGVV0TFCVKGTV/ÒPEJGPCO,WNK ++



6JGTGUKGP1TFGP8GTNGKJWPIUWTMWPFG\WO1TFGPUMTGW\WPFGKPGT2T·DGPFGXQPHNHÒT#OCNKG .WKUG)GQTIKPG(TG[KPXQP2QGNNPKV\FCVKGTV/ÒPEJGPCO,CPWCTOKV.CEMUKGIGNWPF1TKIK PCNWPVGTUEJTKHV-ÌPKIKP6JGTGUGUXQP$C[GTP 4++

 179


VERLEIHUNGSURKUNDEN UND DOKUMENTE

8867

*'4<1)67/$4#705%*9'+) 

*GT\QINKEJ$TCWPUEJYGKIKUEJGT1TFGP*GKPTKEJFGU.ÌYGP8GTNGKJWPIUWTMWPFG\WO4KVVGTMTGW\++ -NCUUGHÒTFGP1DGTCOVUTKEJVGTXQP4QUGPUVGTPFCVKGTV-KUUKPIGPCO/CKOKV2CRKGT2T·IGUKG IGNWPF1TKIKPCNWPVGTUEJTKHVXQP2TKP\#NDTGEJVXQP2TGW­GP4GIGPVGPFGU*GT\QIVWOU$TCWPUEJYGKI ++



(4'+'70&*#05'56#&6$4'/'0 



&KGPUVGJTGP\GKEJGP 8GTNGKJWPIUWTMWPFG \WO 5KNDGTPGP -TGW\ HÒT  L·JTKIGP /KNKV·TFKGPUV HÒT FGP   (ÒUKNKGT %CTN &CXKF (GTFKPCPF *KTUEJ XQO $TGOKUEJGP (ÒUKNKGTDCVCKNNQP FCVKGTV $TGOGP CO  ,WPK   OKV5KGIGNUVGORGNWPF1TKIKPCNWPVGTUEJTKHV 4++



(ª456'067/*1*'0<1..'40

(ÒTUVNKEJGT *CWUQTFGP XQP *QJGP\QNNGTP 8GTNGKJWPIUWTMWPFG \WO 'JTGPMTGW\  -NCUUG HÒT 4CNH   .CUUGT KP 5KIOCTKPIGP FCVKGTV 5KIOCTKPIGP CO  1MVQDGT  OKV 2CRKGT2T·IGUKGIGN WPF 1TKIK   PCNWPVGTUEJTKHVXQP(ÒTUV-CTN#PVQPXQP*QJGP\QNNGTP ++



(ª456'067/.+22' 



(ÒTUVNKEJ.KRRKUEJGT*CWUQTFGP8GTNGKJWPIUWTMWPFG\WO'JTGPMTGW\-NCUUG 4KVVGTMTGW\-NCUUG  HÒTFGP.GWVPCPV#FQNH5CTVQTKWUXQP$CEJ#FLWVCPVGPFGU9GUVH·NKUEJGP+PHCPVGTKG4GIKOGPVU)TCH $ÒNQY XQP &GOOGYKV\ 0T  FCVKGTV &GVOQNF CO  ,WPK  OKV 2CRKGT2T·IGUKGIGN WPF   1TKIKPCNWPVGTUEJTKHVFGU)TCH4GIGPVGP.GQRQNFXQP.KRRG$KGUVGTHGNF ++



-TKGIUXGTFKGPUVMTGW\ *CPFUEJTKHVNKEJGU $GUKV\\GWIPKU CWH GKPGO $TKGHDQIGP FGU )GJGKOGP -CDKPGVVU   \WO-TKGIUXGTFKGPUVMTGW\COYGK­GP$CPFGHÒTFGP5EJTKHVUVGNNGT/CZKOKNKCP4CMGVVGKP(TCPMHWTVCO /CKP FCVKGTV &GVOQNF CO  0QXGODGT    OKV 1TKIKPCNWPVGTUEJTKHV FGU -CDKPGVVUEJGHU CWH   -CTVQPCWHIGMNGDVFKGDGKFGPWPVGTGP'EMGPCDIGTKUUGPLGFQEJDGKNKGIGPFOKV'JTGP\GKEJGPCO$CPF +++



5GJTUR·VGUWPFKPVGTGUUCPVGU&QMWOGPVFGPPPWTGKPGP6CIPCEJFGUUGP#WUUVGNNWPICNUQCO0QXGODGT FCPMVG(ÒTUV.GQRQNF+8CDWPF.KRRGYWTFG(TGKUVCCV

180


VERLEIHUNGSURKUNDEN UND DOKUMENTE )4155*'4<1)67//'%-.'0$74)5%*9'4+0 



5KNDGTPG/GFCKNNG UKE $GUKV\WTMWPFGHÒTFGP5EJNQ­FKGPGT*KNNLGFGU'TDITQ­JGT\QIUXQP1NFGPDWTI FCVKGTV5EJYGTKPCO1MVQDGTOKV2CRKGT2T·IGUKGIGNWPF1TKIKPCNWPVGTUEJTKHVXQP)TQ­JGT\QI (TKGFTKEJ(TCP\ +++  ++



/KNKV·TXGTFKGPUVMTGW\$GUKV\WTMWPFG\WT-NCUUG  HÒTFGP-CRKV·P\WT5GGXQP-CTRH-QO OCPFCPVGP XQP 5/5 /QNVMG (NÒIGNCFLWVCPV 5 / FGU -CKUGTU WPF -ÌPKIU FCVKGTV 5EJYGTKP CO    ,WPKOKV&TWEMUKGIGNWPF7PVGTUEJTKHV ++



-CTRHYCTWOFKG,CJTJWPFGTVYGPFGCNU-CRKV·PNGWVPCPV5GIGNQHHK\KGTFGT5/;+FWPCFGT;CEJV-CKUGTKP#WIWUVG 8KMVQTKCU

-¤0+)4'+%*5#%*5'0 

-ÌPKINKEJ 5·EJUKUEJGT #NDTGEJVUQTFGP 8GTNGKJWPIUWTMWPFG \WO -QOVWTMTGW\  -NCUUG HÒT FGP   )TQ­JGT\QINKEJ 5·EJUKUEJGP -CDKPGVVUUGMTGV·T WPF -COOGTJGTTP (TGKJGTTP XQP 'INQHHUVGKP FCVKGTV   &TGUFGPCO,WPKOKV2T·IGUKGIGNWPF1TKIKPCNWPVGTUEJTKHV-ÌPKI)GQTIUXQP5CEJUGP 4++ 8GTNGKJWPIUWTMWPFGP -ÌPKI )GQTIU XQP 5CEJUGP UKPF CWHITWPF UGKPGT MWT\GP 4GIKGTWPIU\GKV XQP YGPKI OGJT CNU   \YGK,CJTGPPWTTGNCVKXUGNVGP\WHKPFGP



-¤0+)4'+%*24'755'0 

4QVGT #FNGT1TFGP 8GTNGKJWPIUWTMWPFG \WT  -NCUUG HÒT FGP M W M ÌUVGTTGKEJKUEJWPICTKUEJGP   1DGTUVNGWVPCPV8KEVQT)TCH5EJCHHIQVUEJ(NÒIGNCFLWVCPVGP5/FGU-CKUGTUWPF-ÌPKIUFCVKGTV)ÒPU CO5GRVGODGTOKV2T·IGUKGIGNWPF1TKIKPCNWPVGTUEJTKHV -CKUGTWPF -ÌPKI9KNJGNOU ++  ++





4QVGT#FNGT1TFGPªDGTUGPFWPIUUEJTGKDGPFGUMWMÌUVGTTGKEJKUEJWPICTKUEJGP'KUGPDCJPOKPKUVGTU \WO 2TGW­KUEJGP 4QVGP #FNGT1TFGP ++ -NCUUG HÒT &T (TCP\ 5EJQPMC KP 9KGP FCVKGTV 9KGP CO    ,WPKOKV1TKIKPCNWPVGTUEJTKHVFGU/KPKUVGTU ++





-ÌPKINKEJGT-TQPGP1TFGP8GTNGKJWPIUWTMWPFG\WT-NCUUGHÒTFGP)GPGTCNNGWVPCPV\WT&KURQUKVKQP #FCNDGTV XQP 6C[UGP FCVKGTV 2QVUFCO CO  /CK  OKV 2T·IGUKGIGN WPF 1TKIKPCNWPVGTUEJTKHV  

-CKUGTWPF -ÌPKI9KNJGNOU ++  ++



'TKPPGTWPIU\GKEJGP\WT5KNDGTPGP*QEJ\GKV8GTNGKJWPIUWTMWPFGHÒTFKGMÌPKINKEJG-COOGTU·PIGTKP .KNNK.GJOCPPFCVKGTVCO(GDTWCTOKV1TKIKPCNWPVGTUEJTKHVFGU2TKP\GP5CNO*QTUVOCT&C\W CPFKG'ORH·PIGTKPCFTGUUKGTVGT$TKGHWOUEJNCIWPF-ÌPKINKEJG#PPCJOGIGPGJOKIWPIHÒTFKGUEJYGFK UEJG/GFCKNNGHÒT-WPUVWPF9KUUGPUEJCHVFCVKGTV$GTNKPCO5GRVGODGT 5VÒEM++





(TCP\ÌUKUEJG 5V *GNGPC/GFCKNNG 8GTNGKJWPIUWTMWPFG CP FGP RTGW­KUEJGP 5VCCVUCPIGJÌTKIGP .GQP   JCTF9KNFOKV2T·IGUKGIGNWPF7PVGTUEJTKHV#WH-CTVQPCWHIGMNGDV 4+++





'KUGTPGU-TGW\#WUICDG8GTNGKJWPIUWTMWPFG\WT+-NCUUGFCVKGTV5V*KNCKTGNG2GVKVCO/CK WPF\WT++-NCUUGFCVKGTVÌUVN/QTQPXKNNKGTUCO5GRVGODGTDGKFGHÒTFGPU·EJUKUEJGP /CLQT WPF $CVCKNNQPU-QOOCPFGWT 'FWCTF *GKPTKEJ 5EJQNN FC\W GKPG YGKVGTG \WT ++ -NCUUG HÒT FGP   .GICVKQPUTCV&T(TCP\1NUJCWUGPFCVKGTV$GTNKPCO,WNK 5VÒEM++





)4155*'4<1)67/5#%*5'0 9'+/#4  

)TQ­JGT\QINKEJ5·EJUKUEJGT*CWUQTFGPFGT9CEJUCOMGKVQFGTXQO9GK­GP(CNMGPªDGTUGPFWPIU UEJTGKDGP \WO 8GTNGKJWPIUFKRNQO PGDUV FGP 1TFGPUUVCVWVGP  FGU 4KVVGTMTGW\GU ++ #DVGKNWPI HÒT FGP   -CRKV·PNGWVPCPV-CTRH5GIGNQHHK\KGTUFGT5/;+FWPCFCVKGTVCO,WNK1TKIKPCNWPVGTUEJTKHVFGU )TQ­JGT\QINKEJ5·EJUKUEJGP5VCCVOKPKUVGTUWPF1TFGPUMCP\NGTU4QVJG ++ -CTRHYCT5GIGNQHHK\KGTFGT5/;+FWPCFGT;CEJV-CKUGTKP#WIWUVG8KMVQTKCU



(ª456'067/9#.&'%- 

/KNKV·T8GTFKGPUVMTGW\ 8GTNGKJWPIUWTMWPFG \WT ++ -NCUUG HÒT FGP 2TGOKGT.GWVPCPV #NHTGF 'FOWPF   #WIWUVKPXQO*GUUKUEJGP+PHCPVGTKG4GIKOGPV0TFCVKGTV#TQNUGPCO,CPWCTOKV.CEM UKGIGNWPF1TKIKPCNWPVGTUEJTKHVXQP(ÒTUV)GQTI8KMVQT 4++



-¤0+)4'+%*9ª466'/$'4) 

&KGPUVGJTGP\GKEJGP$GINCWDKIWPIUUEJGKP\WT-NCUUGHÒTFGP*CWRVOCPP\&-ÌNNG$G\KTMUQHHK\KGT DGKO.CPFYGJTDG\KTM7NOFCVKGTV5VWVVICTVCO,WPKOKV2T·IGUKGIGNWPF1TKIKPCNWPVGTUEJTKHV XQPō/CTEJVCNGTŋ ++



ō&'765%*'ŋ56##6'0 

-QPXQNWVXQPXKGT8GTNGKJWPIUWTMWPFGP\W'JTGP\GKEJGPFGWVUEJGT5VCCVGP#WU$CFGP*CODWTI *GUUGPWPF2TGW­GPFC\WUGEJUYGKVGTG&QMWOGPVGWPF7OUEJN·IG+PXGTUEJKGFGPGP'TJCNVWPIGP  5VÒEM++++p++++++

 181


VERLEIHUNGSURKUNDEN UND DOKUMENTE

&'765%*'54'+%* 51)'09'+/#4'44'27$.+-  

-QNQPKCNCD\GKEJGP$GUKV\\GWIPKUHÒT&T1NUJCWUGPFCVKGTV$GTNKPCO/CKOKV5KGIGNUVGORGN FGU#WUY·TVKIGP#OVGUWPF1TKIKPCNWPVGTUEJTKHVō$TÒEMPGTŋ ++





'JTGP\GKEJGP FGU &GWVUEJGP 4QVGP -TGW\GU 8GTNGKJWPIUWTMWPFG \WT  -NCUUG HÒT FGP $QVUEJCHVGT   &T 1NUJCWUGP FCVKGTV $GTNKP CO  #RTKN  OKV 1TKIKPCNWPVGTUEJTKHV FGU 2T·UKFGPVGP FGU 4QVGP   -TGW\GU ++



8887

&'765%*'54'+%* 51)'0&4+66'54'+%*  















182

&GWVUEJGU 5RCPKGP-TGW\ )TQ­G 8GTNGKJWPIUWTMWPFG \WO -TGW\ KP 5KNDGT OKV 5EJYGTVGTP HÒT FGP   1DGTIGHTGKVGP5KGIHTKGF)ÒPVJGTFCVKGTV$GTNKPCO,WPKOKV2T·IGUKGIGNWPF(CMUKOKNG7PVGT UEJTKHVō#FQNH*KVNGTŋ ++



-TKGIUQTFGP FGU 'KUGTPGP -TGW\GU   )TQ­G 8GTNGKJWPIUWTMWPFG \WO 4KVVGTMTGW\ FGU 'KUGTPGP   -TGW\GUHÒTFGP1DGTHGNFYGDGN*GTOCPP%QPTCFFCVKGTVCO,WNKOKV 1TKIKPCN! 7PVGTUEJTKHV ō#FQNH*KVNGTŋ2GTICOGPVOGJTHCEJIGHCNVGVUEJNGEJVGT<WUVCPF 4+++p+8



-TKGIUQTFGPFGU'KUGTPGP-TGW\GU  -NGKPG8GTNGKJWPIUWTMWPFG\WO'KUGTPGP-TGW\-NCUUG HÒTFGP.GWVPCPV*GTDGTV5EJWN\FCVKGTV,WNKOKV5KGIGNUVGORGNWPF1TKIKPCNWPVGTUEJTKHV)GPG TCNOCLQT ++



-TKGIUQTFGPFGU'KUGTPGP-TGW\GU  -NGKPG8GTNGKJWPIUWTMWPFG\WO'KUGTPGP-TGW\-NCUUG HÒT FGP 7PVGTQHHK\KGT #PVQP 4WUU FCVKGTV  /·T\  OKV 5KGIGNUVGORGN WPF 1TKIKPCNWPVGTUEJTKHV   )GPGTCNNGWVPCPV ++



-TKGIUQTFGPFGU'KUGTPGP-TGW\GU  -NGKPG8GTNGKJWPIUWTMWPFG\WT5RCPIG\WO'KUGTPGP-TGW\  -NCUUG HÒT FGP -CRKV·P \WT 5GG +PI  5VKGIGN FCVKGTV 9KNJGNOUJCXGP CO  &G\GODGT  OKV   5KGIGNUVGORGNWPF1TKIKPCNWPVGTUEJTKHVXQP8K\GCFOKTCNWPF(NQVVGPEJGH/CTUEJCNN ++



-TKGIUQTFGPFGU-TKGIUXGTFKGPUVMTGW\GU8GTNGKJWPIUWTMWPFG\WO-TKGIUXGTFKGPUVMTGW\-NCUUGHÒT FGP&KTGMVQT*CPU.KPFGOCPPKP*CODWTIFCVKGTV$GTNKPCO5GRVGODGTOKV2T·IGUKGIGNWPF (CMUKOKNG7PVGTUEJTKHVō#FQNH*KVNGTŋ ++



-TKGIUQTFGP FGU -TKGIUXGTFKGPUVMTGW\GU -NGKPG 8GTNGKJWPIUWTMWPFG \WO -TKGIUXGTFKGPUVMTGW\    -NCUUG HÒT FGP -CRKV·P \WT 5GG 8  /CZ (NGKUEJJCWGT XQO (NQVVGPMQOOCPFQ FCVKGTV $GTNKP CO   5GRVGODGTOKV5KGIGNUVGORGNWPF1TKIKPCNWPVGTUEJTKHV-CRKV·P\WT5GG ++



-QPXQNWVXQPPGWP8GTNGKJWPIUWTMWPFGPWPF$GUKV\\GWIPKUUGP7C\WO'KUGTPGP-TGW\-NCUUG

 \WO-TKGIUXGTFKGPUVMTGW\-NCUUGOKV5EJYGTVGTP  \WOUEJYCT\GP8GTYWPFGVGPCD\GKEJGPWPF \WT/GFCKNNG9KPVGTUEJNCEJVKO1UVGPUQYKG*GNFGPVQF7TMWPFG+PXGTUEJKGFGPGP'TJCNVWP IGP 5VÒEM++++p++++++




VERLEIHUNGSURKUNDEN UND DOKUMENTE

8895

$70&'54'27$.+-&'765%*.#0& 5'+6  

8GTFKGPUVQTFGPFGT$WPFGUTGRWDNKM&GWVUEJNCPF8GTNGKJWPIUWTMWPFG\WO8GTFKGPUVMTGW\CO$CPF HÒT /CVVJKCU 1GTHHNKPI FCVKGTV $QPP CO  /CK  OKV 2T·IGUKGIGN WPF 1TKIKPCNWPVGTUEJTKHV XQP   $WPFGURT·UKFGPV6JGQFQT*GWUU ++



&'765%*.#0&)4722'0 

7TMWPFGP 6GKN0CEJNC­ FGU 1DGTOCUEJKPKUVGP *GTOCPP $QEM/GV\PGT XQP 5/; *QJGP\QNNGTP    8GTNGKJWPIUWTMWPFG\WT<GPVGPCTOGFCKNNGFCVKGTV9KNJGNOUJCXGPCO#WIWUV &·PKUEJGT &CPGDTQI1TFGP8GTNGKJWPIUWTMWPFG\WO4KVVGTMTGW\FCVKGTV#WIWUVOKV+PHQTOCVKQPUDNCVV   ¤UVGTTGKEJKUEJ -CKUGTNKEJGT 1TFGP FGT 'KUGTPGP -TQPG 8GTNGKJWPIUWTMWPFG \WT +++ -NCUUG FCVKGTV   9KGP CO  ,WNK    5EJYGFKUEJGT 9CUC1TFGP 8GTNGKJWPIUWTMWPFG \WO 4KVVGTMTGW\ FCVKGTV   5VQEMJQNO CO  #WIWUV    8QTN·WHKIGU $GUKV\\GWIPKU HÒT FCU 'KUGTPG -TGW\ ++ -NCUUG FCVKGTV   5/5&GWVUEJNCPFCO(GDTWCT1TKIKPCNWPVGTUEJTKHV-QPVGTCFOKTCN 'JTGPMTGW\HÒT(TQPV M·ORHGT FCVKGTV -KGN CO  0QXGODGT    .GGTGT CP $QEM/GV\PGT CFTGUUKGTVGT 7OUEJNCI FGT   -CP\NGKFGUMCKUGTNKEJÌUVGTTGKEJKUEJGP(TCP\,QUGRJ1TFGPU 'ORHCPIUDGUEJGKPKIWPIHÒT4/ HÒTFGPM·WHNKEJGTYQTDGPGP-TQPGPQTFGP-NCUUGFCVKGTV-KGNCO/·T\+PWPVGTUEJKGFNK EJGP'TJCNVWPIGP 5VÒEM++++p+++



&GT \WO 1DGTUVCDUKPIGPKGWT CWHIGUVKGIGPG XQTOCNKIG 1DGTOCUEJKPKUV FGT MCKUGTNKEJ ;CEJV 5/; *QJGP\QNNGTP   *GTOCP$QEM/GV\PGTKUVIGUVQTDGP#WUFGP7TMWPFGPKUVGTUKEJVNKEJFC­GT+PJCDGTGKPGTICP\GP4GKJGXQP KPWPFCWUN·PFKUEJGP1TFGPWPF'JTGP\GKEJGPIGYGUGPKUV

-¤0+)4'+%*$'.)+'0 

-QPXQNWV XQP PGWP 8GTNGKJWPIUWTMWPFGP 7 C \WO 4KVVGTMTGW\ FGU .GQRQNF1TFGPU   \WO   1HHK\KGTMTGW\FGU.GQRQNF1TFGPU  -QOOCPFGWTMTGW\FGU-TQPGPQTFGPU  WPF\WT'TKPPG TWPIUOGFCKNNG  UQYKG GKPG )GHCNNGPGP7TMWPFG CWU FGO 'TUVGP 9GNVMTKGI +P WPVGTUEJKGFNK   EJGP'TJCNVWPIGP 5VÒEM++++p++++++



$7.)#4+'0 (ª456'067/$7.)#4+'0   



/GFCKNNG ō(ÒT 8GTFKGPUV =Ìåäàë „ÇC Çàñëóãà“? 8GTNGKJWPIUWTMWPFG \WT $TQP\GPGP /GFCKNNG OKV   -TQPGHÒTFGP.CKDNCMCKGP.QTGP\5VÌJTFCVKGTV5QHKCCO1MVQDGTOKV2T·IGUKGIGNWPF1TKIK PCNWPVGTUEJTKHVGP ++



1TFGP(ÒT$ÒTIGTNKEJGU8GTFKGPUV=Îðäåí „Ça Ãðàæäàíñêà Çàñëóãà“? CWEJ<KXKN8GTFKGPUVQT FGP QFGT 0CVKQPCNGT <KXKN8GTFKGPUVQTFGP IGPCPPV  8GTNGKJWPIUWTMWPFG \WO -QOOCPFGWTMTGW\  

UKE HÒTFGP-CKUGTNKEJGP4CV,QJCPP-TGP\GTKP9KGPFCVKGTV5QHKCCO0QXGODGTOKV2T· IGUKGIGNWPF1TKIKPCNWPVGTUEJTKHV OÌINKEJGTYGKUGXQP(ÒTUV(GTFKPCPF+!  4++

 183


VERLEIHUNGSURKUNDEN UND DOKUMENTE <#4'067/$7.)#4+'0   

1TFGP(ÒT$ÒTIGTNKEJGU8GTFKGPUV=Îðäåí „ÇC Ãðàæäàíñêà Çàñëóãà“? CWEJ<KXKN8GTFKGPUVQT FGP QFGT 0CVKQPCNGT <KXKN8GTFKGPUVQTFGP IGPCPPV  8GTNGKJWPIUWTMWPFG \WO -QOOCPFGWTMTGW\  

UKE HÒT)GQTIGU*QPPQTCVFCVKGTV5QHKCCO/CKOKV2T·IGUKGIGNWPF7PVGTUEJTKHVGP&C\W QHHK\KGNNGªDGTUGV\WPIGKPGT8GTNGKJWPIUWTMWPFGFGT+++-NCUUGFGU1UOCPKLKG1TFGPUFCVKGTV  5VÒEM++



1TFGP (ÒT /KNKV·T8GTFKGPUV =Îðäåí „ÇC Âîåííà Çàñëóãà“? CWEJ ō/KNKV·T8GTFKGPUVQTFGP   IGPCPPV  8GTNGKJWPIUWTMWPFG\WO1HHK\KGTUMTGW\ UKE OKV-TKGIUFGMQTCVKQPHÒTFGPMWMÌUVGTTGK EJKUEJWPICTKUEJGP*CWRVOCPP2CWN9GE\GTGMFCVKGTV5QHKCCO,WPKOKV2T·IGUKGIGNWPF7P VGTUEJTKHVGP ++



.¾QP)GQTIGU*QPPQTCVYCT%JGHFGT&KXKUKQPFGT2QNK\GKRT·HGMVWTKP2CTKU



4'27$.+-(+00.#0& 

1TFGPFGT(KPPKUEJGP9GK­GP4QUG8GTNGKJWPIUWTMWPFG\WO-QOOCPFGWTMTGW\HÒTFGP4GIKGTWPIU FKTGMVQT1VVQ$-QEJFCVKGTV*GNUKPMKCO1MVQDGTOKV2T·IGUKGIGNWPF1TKIKPCNWPVGTUEJTKHVGP XQP1TFGPUMCP\NGTWPFUGMTGV·T<WUCOOGPOKVªDGTUGV\WPIWPF+PHQTOCVKQPUDNCVV 5VÒEM++





-QPXQNWV XQP XKGT XGTUEJKGFGPGP 8GTNGKJWPIUWTMWPFGP XQP HKPPKUEJGP 'JTGP\GKEJGP +P WPVGT   UEJKGFNKEJGT'TJCNVWPI 5VÒEM++



(4#0-4'+%* -¤0+)4'+%*(4#0-4'+%*#0%+'04')+/' $+5  

-ÌPKINKEJGT WPF /KNKV·TKUEJGT 1TFGP XQO JN .WFYKI *CPFUEJTKHVNKEJG 8GTNGKJWPIU#PMÒPFKIWPI   \WO 4KVVGTMTGW\ HÒT 5 FG $GNDG\G XQP FGT )CTFG FW EQTRU FGU -ÌPKIU FCVKGTV /CTN[ CO  ,CPWCT   OKV1TKIKPCNWPVGTUEJTKHV\WUCOOGPOKVIGFTWEMVGO+PHQTOCVKQPUDNCVV 5VÒEM++



(4#0-4'+%*-1056+676+10'..'/10#4%*+'   

-ÌPKINKEJGTWPF/KNKV·TKUEJGT1TFGPXQOJN.WFYKI8GTNGKJWPIU#PMÒPFKIWPI\WO4KVVGTMTGW\HÒT GKPGPGJGOCNKIGP&TCIQPGT1HHK\KGTFCVKGTV2CTKUCO#RTKNOKV2CRKGT2T·IGUKGIGNWPF1TKIK PCNWPVGTUEJTKHV-ÌPKI.WFYKIU :8+ UQYKGYGKVGTGP7PVGTUEJTKHVGP 4++



8907 8906

(4#0<¤5+5%*'41;#.+56'0+/':+.   

-ÌPKINKEJGTWPF/KNKV·TKUEJGT1TFGPXQOJN.WFYKI8GTNGKJWPIU#PMÒPFKIWPI\WO4KVVGTMTGW\HÒT -CXCNGTKG1DGTUV $CTQP FG /QPVCNGODGTV FCVKGTV 9KODWTI CO  1MVQDGT  OKV 1TKIKPCNWPVGT   UEJTKHV%JCTNGU2JKNKRRG)TCHXQP#TVQKUWPF\WMÒPHVKIGT-ÌPKI%JCTNGU: 4++



%JCTNGU 2JKNKRRG %QOVG F #TVQKU   LÒPIGTGT $TWFGT FGT -ÌPKIG .WFYKI :8+ WPF .WFYKI :8+++   DGHCPF UKEJ CD  KO 'ZKN KP &GWVUEJNCPF WPF YWTFG XQP UGKPGO $TWFGT FGO -ÌPKI KO 'ZKN  .WFYKI :8+++   \WO)GPGTCN5VCVVJCNVGTFGU-ÌPKITGKEJU(TCPMTGKEJGTPCPPV0CEJFGO6QFUGKPGU$TWFGTUDGUVKGIGTCNU -ÌPKI-CTN:FGPHTCP\ÌUKUEJGP6JTQPYWTFGHGKGTNKEJIGMTÌPVOW­VGCDGTCDFCPMGP&GTNGV\VGHTCP \ÌUKUEJG-ÌPKIFGT$QWTDQPGP&[PCUVKGUVCTDKO'ZKNKP)ÌT\

-¤0+)4'+%*(4#0-4'+%* <9'+6' 4'56#74#6+10   

184

-ÌPKINKEJGTWPF/KNKV·TKUEJGT1TFGPXQOJN.WFYKI-CUUGP3WKVVWPIÒDGTGKPG5KGIGNIGDÒJTXQP (THÒTFKG'TVGKNWPIFGU5KGIGNUCWHFGT8GTNGKJWPIUWTMWPFG\WO4KVVGTMTGW\HÒTFGP$CTQP)WGVCTG FGNCRQTVGFCVKGTV2CTKUCO/·T\ ++




VERLEIHUNGSURKUNDEN UND DOKUMENTE 







-ÌPKINKEJGT1TFGPFGT'JTGPNGIKQP8GTNGKJWPIUWTMWPFG\WT1HHK\KGTUFGMQTCVKQPHÒT,GCP4¾P¾%JC VGNCKPFCVKGTV6WKNGTKGPCO/CKOKV2CRKGT2T·IGUKGIGNWPF1TKIKPCNWPVGTUEJTKHVFGU1TFGPU )TQ­MCP\NGTU/CE&QPCNFGKPG'EMGDGUEJPKVVGP ++p+++



-ÌPKINKEJGT 1TFGP FGT 'JTGPNGIKQP 8GTNGKJWPIUWTMWPFG \WT 4KVVGTFGMQTCVKQP HÒT ,GCP 4¾P¾ %JCVG   NCKPFCVKGTV6WKNGTKGPCO1MVQDGTOKV2CRKGT2T·IGUKGIGNWPF1TKIKPCNWPVGTUEJTKHVFGU1TFGPU )TQ­MCP\NGTU/CE&QPCNF#WH-CTVQPCWHIGMNGDVQDGPVNYUV·TMGTDGUEJ·FKIVJCPFUEJTKHVNKEJG'KPVTC IWPIGPVNYUVCTMXGTDNCUUV/KVDGHGUVKIVGT1TKIKPCN&GMQTCVKQPCO$CPFVNYDGUEJ·FKIV 5VÒEM++



'JTGP\GKEJGP FGT 0CVKQPCNICTFG XQP 2CTKU  )TQ­G 8GTNGKJWPIUWTMWPFG HÒT FGP /WUKM1HHK\KGT   //GUUCNFCVKGTV2CTKUCO/CKOKV2CRKGT2T·IGUKGIGNWPF7PVGTUEJTKHVGP/GJTHCEJXGTHNGEMV 4++p+++



'JTGP\GKEJGPFGT.KNKG8GTNGKJWPIUWTMWPFG\WO'JTGP\GKEJGPCOYGK­GP$CPFOKVITÒPGP4·PFGTP HÒT FGP )TGPCFKGT .QWKU ,QUGRJ ,QDGTV FCVKGTV 2CTKU CO  5GRVGODGT  OKV 5KGIGNUVGORGN WPF   7PVGTUEJTKHVGP/GJTHCEJJKPVGTMNGDV +++



8912

(4#0<¤5+5%*'5-¤0+)4'+%*$ª4)'4-¤0+)67/   

-ÌPKINKEJGT1TFGPFGT'JTGPNGIKQP8GTNGKJWPIU/KVVGKNWPI\WO4KVVGTHÒT/5Q[GTKP2CTKUFCVKGTV CO#WIWUVOKV2T·IGUKGIGNWPF7PVGTUEJTKHV ++





,WNK'JTGP\GKEJGP   8GTNGKJWPIUWTMWPFG HÒT FGP $ÒTIGT 2CEQV F [GPPG FCVKGTV CO  #WIWUV   OKVOGJTGTGP7PVGTUEJTKHVGP/GJTHCEJJKPVGTMNGDVWPFFGWVNKEJUVQEMHNGEMKI ++p+++



<9'+6'5 (4#0<¤5+5%*'5-#+5'44'+%*   

-CKUGTNKEJGT1TFGPFGT'JTGPNGIKQP8GTNGKJWPIUWTMWPFG\WT1HHK\KGTU&GMQTCVKQPHÒTFGP$CVCKNNQP UEJGH 2KGTTG .CPPGDKV XQO  .KPKGP+PHCPVGTKG4GIKOGPV FCVKGTV 6WKNGTKGP CO  #RTKN  OKV   2T·IGUKGIGNWPF7PVGTUEJTKHVGP ++p



/KNKV·T/GFCKNNG 8GTNGKJWPIUWTMWPFG HÒT %JCTNGU ,COGU XQO  .KPKGP+PHCPVGTKG4GIKOGPV FCVKGTV   2CTKUCO5GRVGODGTOKVPWTVNYCWUIGRT·IVGP2T·IGUKGIGNWPF7PVGTUEJTKHVGP5EJTKHVGPVNY XGTDNCUUV ++p+++





5V*GNGPC/GFCKNNG8GTNGKJWPIUWTMWPFGHÒTFGPGJGOCNKIGP5GTIGCPVGP3WGNCKPOKV2T·IGUKGIGNWPF 7PVGTUEJTKHV ++p+++





$TKVKUEJG-TKO/GFCKNNG8GTNGKJWPIUWTMWPFG\WT/GFCKNNGOKVFGT)GHGEJVUURCPIG5'$#56121.HÒT FGP (WUKNKGT 2KGTTG )CNDKV XQO  .KPKGP4GIKOGPV FCVKGTV CO  5GRVGODGT  OKV 2T·IGUKGIGN   5KGIGNUVGORGNWPF7PVGTUEJTKHVGP5VCTMXGTIKNDV +++





&4+66'8+'46'70&(ª0(6' (4#0<¤5+5%*'4'27$.+- 5'+6  

0CVKQPCNGT 1TFGP FGT 'JTGPNGIKQP  8GTNGKJWPIUWTMWPFG \WO )TQ­QHHK\KGT HÒT FGP MÌPKINKEJ U·EJUK   UEJGP#W­GPOKPKUVGTXQP/GVUEJFCVKGTV2CTKUCO,WNKOKV2T·IGUKGIGNWPF7PVGTUEJTKHVGP ++





0CVKQPCNGT1TFGPFGT'JTGPNGIKQP-QPXQNWVXQPXKGT8GTNGKJWPIUWTMWPFGP\YGK\WO4KVVGTWPF\YGK \WO1HHK\KGTCWUFGP,CJTGPDKU&CDGKGKPGGVYCUDGUEJ·FKIVG4KVVGTFGMQTCVKQPKP.WZWU #WUHÒJTWPICPFGTDGVTGHHGPFGP7TMWPFGDGHGUVKIV&C\W8GTNGKJWPIUWTMWPFG\WO1HHK\KGTUMTGW\FGU 1TFGPUXQO5EJYCT\GP5VGTPXQP$¾PKPFCVKGTV 5VÒEM++



-QPXQNWV XQP  8GTNGKJWPIUWTMWPFGP WPF &QMWOGPVGP &CXQP FTGK OKV FGT FCTCWH DGHGUVKIVGP   LGYGKNU \WIGJÌTKIGP #WU\GKEJPWPI /KNKV·T/GFCKNNG 8GTFWP/GFCKNNG WPF 'JTGPOGFCKNNG FGT 2QNK\GK   FKGUGCWEJOKV/KPKCVWT UQYKGWC-TKGIUGTKPPGTWPIUOGFCKNNG  WPF)GHCNNGPGP7TMWPFG CWUFGO'TUVGP9GNVMTKGI+PWPVGTUEJKGFNKEJGP'TJCNVWPIGP 5VÒEM++++++8





185


VERLEIHUNGSURKUNDEN UND DOKUMENTE

)4+'%*'0.#0&

<9'+6'5 -¤0+)4'+%*)4+'%*'0.#0&   

-ÌPKINKEJGT 'TNÌUGT1TFGP 8GTNGKJWPIUWTMWPFG \WO -QOOCPFGWTMTGW\ HÒT GKPGP *GTTP -CTRH OKV   2CRKGT2T·IGUKGIGNWPF1TKIKPCNWPVGTUEJTKHV-ÌPKI)GQTIU+ ++



-CTRHYCTWOFKG,CJTJWPFGTVYGPFGCNU-CRKV·PNGWVPCPV5GIGNQHHK\KGTFGT5/;+FWPCFGT;CEJV-CKUGTKP#WIWUVG 8KMVQTKCU



-ÌPKINKEJGT 'TNÌUGT1TFGP 8GTNGKJWPIUWTMWPFG \WO )QNFGP -TGW\ 1HHK\KGT  HÒT GKPGP &T 9KFG   OCPPOKV2CRKGT2T·IGUKGIGNWPF1TKIKPCNWPVGTUEJTKHV-ÌPKI)GQTIU+ ++



8'4'+0+)6'5-¤0+)4'+%*810)4155$4+6#00+'070&014&+4.#0& 









&GTUGJT#WUIG\GKEJPGVG1TFGPXQOJN/KEJCGNWPFXQOJN)GQTI8GTNGKJWPIUWTMWPFG\WO4KV VGT-QOOCPFGWT -PKIJV %QOOCPFGT  -%/)  HÒT FGP $QVUEJCHVGT KP $WMCTGUV 9KNNKCO #TVJWT   9JKVGFCVKGTV9KPFUQTCO/·T\OKV2CRKGT2T·IGUKGIGNWPF1TKIKPCNWPVGTUEJTKHVGPFGT-ÌPK IKP8KMVQTKCWPFFGU)TQ­OGKUVGTU2TKP\)GQTIG 4++



&GT UGJT *GTXQTTCIGPFG 1TFGP FGU +PFKUEJGP 'ORKTGU 8GTNGKJWPIUWTMWPFG \WO )GHQNIUOCPP  

%QORCPKQP%+' HÒTFGP1DGTUVNGWVPCPV*WIJ#NCP%COGTQPXQPFGP4Q[CN'PIKPGGTUFCVKGTV5V ,COGU U CO  ,CPWCT  OKV 2T·IGUKGIGN WPF 1TKIKPCNWPVGTUEJTKHV XQP -ÌPKI )GQTI 8  WPF XQP   #WUVGP%JCODGTNCKP ++



&GT -ÌPKINKEJG 8KMVQTKC1TFGP 8GTNGKJWPIUWTMWPFG \WO -QOOCPFGWT HÒT (TGFGTKE ,GWPG 9KNNCPU   FCVKGTV5V,COGU UCO0QXGODGTOKV2T·IGUKGIGNWPF1TKIKPCNWPVGTUEJTKHVXQP-ÌPKI)GQTI

8 <WUCOOGPOKVªDGTUGPFWPIUUEJGKDGP\WT8GTNGKJWPIUWTMWPFG 5VÒEM++



&GT-ÌPKINKEJG8KMVQTKC1TFGP8GTNGKJWPIUWTMWPFG\WO/KVINKGF-NCUUG /GODGTVJENCUU HÒT FGPMWMÌUVGTTGKEJKUEJWPICTKUEJGP*CWRVOCPP8KEVQT(KUEJGTXQO+PHCPVGTKG4GIKOGPV'T\JGT \QI4CKPGTFCVKGTV5V,COGU UCO#WIWUVOKV2T·IGUKGIGNWPF1TKIKPCNWPVGTUEJTKHVXQP-ÌPKI 'FWCTF 8++ <WUCOOGPOKVªDGTUGPFWPIUUEJGKDGP\WT8GTNGKJWPIUWTMWPFG 5VÒEM++



&GT-ÌPKINKEJG8KMVQTKC1TFGP8GTNGKJWPIUWTMWPFG\WO/KVINKGF-NCUUG /GODGTVJENCUU HÒT (GTFKPCPF&GKVGPJQHGP'FNGTXQP0GWGPUVCOOXQPFGT9KGPGT*QHDWTIFCVKGTV$WEMKPIJCO2CNCEGCO  1MVQDGT  OKV 2T·IGUKGIGN WPF 1TKIKPCNWPVGTUEJTKHV XQP -ÌPKI 'FWCTF 8++  <WUCOOGP OKV   ªDGTUGPFWPIUUEJGKDGP\WT8GTNGKJWPIUWTMWPFG 5VÒEM++



+06'40#6+10#.'70&)'5'..5%*#(6514&'0 

/GNWUKPGP1TFGP 8GTNGKJWPIUWTMWPFG \WO 1HHK\KGTUMTGW\ HÒT 2GVGT %CLGVCP $QWXKGT KP )TC\ FCVKGTV   0GWKNN[2CTKU CO  0QXGODGT  OKV DGUEJ·FKIVGO  2T·IGUKGIGN WPF 1TKIKPKPCNWPVGTUEJTKHV FGU   )TQ­OGKUVGT)W[ FG.WUKIPCP 6NY\GTMPKVVGTVWPFDGUEJ·FKIV 44++



8929

4'27$.+-+6#.+'0 5'+6   186

+6#.+'0

8GTFKGPUVQTFGP FGT +VCNKGPKUEJGP 4GRWDNKM 8GTNGKJWPIUWTMWPFG \WO -QOOCPFGWTMTGW\ HÒT 1VVQ   .GJPGTFCVKGTV4QOCO#WIWUVOKV2T·IGUKGIGNWPF7PVGTUEJTKHVGP ++




VERLEIHUNGSURKUNDEN UND DOKUMENTE +6#.+'0)4155*'4<1)67/615-#0# 

8GTFKGPUVQTFGPWPVGTFGO6KVGNFGUJN,QUGRJ8GTNGKJWPIU#PMÒPFKIWPI\WO4KVVGTMTGW\HÒT%JCTNGU ,GCP 5CNNCPFTQW\G FG .COQTPCKZ FCVKGTV (NQTGP\ CO  /·T\  <WUCOOGP OKV HTCP\ÌUKUEJGT   6TCIGIGPGJOKIWPI FCVKGTV 2CTKU CO  &GODGT  OKV 1TKIKPCNWPVGTUEJTKHV XQP )GPGTCN %QOVG   & 1TPCPQ)TQ­MCP\NGTUFGT'JTGPNGIKQPUQYKG\YGKYGKVGTGPFKGUDG\ÒINKEJGP&QMWOGPVGP  5VÒEM++



-¤0+)4'+%*+6#.+'0   





1TFGPFGT-TQPGXQP+VCNKGP8GTNGKJWPIUWTMWPFG\WO)TQ­MTGW\HÒTFGP)GPGTCNNGWVPCPV#FQNHXQP &GKPGU-QOOCPFGWTFGT/KNKV·T&KXKUKQPKP(TCPMHWTVFCVKGTV4QOCO,CPWCTOKV2T· IGUKGIGNWPF7PVGTUEJTKHVGP ++



1TFGP FGT -TQPG XQP +VCNKGP 8GTNGKJWPIUWTMWPFG \WO -QOOCPFGWTMTGW\ HÒT 8KP\GP\ 4KVVGT WPF   'FNGT XQP /QTCYKV\ FCVKGTV 4QO CO  /·T\  OKV 2T·IGUKGIGN WPF 7PVGTUEJTKHVGP <WUCOOGP   OKVQHHK\KGNNGTªDGTUGV\WPI ++



1TFGPFGT-TQPGXQP+VCNKGP8GTNGKJWPIUWTMWPFG\WO4KVVGTMTGW\HÒT)KQXCPPK&G)TGIQTKQFCVKGTV 4QOCO&G\GODGTOKV2T·IGUKGIGNWPF7PVGTUEJTKHVGP ++



)4155*'4<1)67/.7:'/$74) 

1TFGP FGT 'KEJGPMTQPG 8GTNGKJWPIUWTMWPFG KP HTCP\ÌUKUEJGT 5RTCEJG \WO -QOOCPFGWTMTGW\ HÒT   )GQTIGU*QPPQTCVFCVKGTV*QJGPDQWTICO5GRVGODGTOKV2T·IGUKGIGNWPF7PVGTUEJTKHVGP ++



.¾QP)GQTIGU*QPPQTCVYCT%JGHFGT&KXKUKQPFGT2QNK\GKRT·HGMVWTKP2CTKU



1TFGPFGT'KEJGPMTQPG8GTNGKJWPIUWTMWPFGKPHTCP\ÌUKUEJGT5RTCEJG\WO4KVVGTMTGW\HÒTGKPGP*GTTP 5Q[GTFCVKGTV&GP*CCICO0QXGODGTOKV5KGIGNUVGORGNWPF7PVGTUEJTKHV ++p+++





1TFGPFGT'KEJGPMTQPG8GTNGKJWPIUWTMWPFGKPHTCP\ÌUKUEJGT5RTCEJG\WO4KVVGTMTGW\HÒTFGP*CWRV OCPPFG(TCPEQKU#FLWVCPVFGU/KNKV·T)QWXGTPGWTUFGT(GUVWPI.WZGODWTIFCVKGTV9CNHGTFCPIGCO ,WPKOKV5KGIGNUVGORGNWPF7PVGTUEJTKHVGP ++



/KNKV·T WPF <KXKN8GTFKGPUVQTFGP #FQNRJU XQP 0CUUCW  8GTNGKJWPIUWTMWPFG KP FGWVUEJGT 5RTCEJG   \WO )TQ­MTGW\ HÒT FGP MÌPKINKEJ RTGW­KUEJGP )GPGTCNNGWVPCPV \WT &KURQUKVKQP (TKGFTKEJ XQP #TPQNFK   FCVKGTV5EJNQ­9CNHGTFKPIGPCO,WNKOKV2CRKGT2T·IGUKGIGNWPF1TKIKPCNWPVGTUEJTKHV)TQ­JGT \QI#FQNRJU*GT\QIUXQP0CUUCW ++



'TKPPGTWPIUOGFCKNNGHÒTFKG.WZGODWTIKUEJGP(TGKYKNNKIGPFGU-TKGIGU8GTNGKJWPIUWT MWPFG HÒT FKG 7PCDJ·PIKIG )TWRRKGTWPI FGT /CSWKUCTFU FCVKGTV .WZGODWTI CO  0QXGODGT    OKV2CRKGT2T·IGUKGIGNWPF1TKIKPCNWPVGTUEJTKHVGPFGT)TQ­JGT\QIKP%JCTNQVVGWPFFGU/KPKUVGTUHÒTFKG DGYCHHPGVG/CEJV 4++







&KG 7PCDJ·PIKIG )TWRRKGTWPI FGT /CSWKUCTFU )TQWRG +PF¾RGPFGPVG FGU /CSWKUCTFU  YCTGP GKPG NWZGODWTIKUEJG   9KGFGTUVCPFUITWRRGFGTGP/KVINKGFGTY·JTGPFFGU<YGKVGP9GNVMTKGIUCNU(TGKYKNNKIGKPFGP#TOGGPFGT#NNKKGTVGP IGFKGPVJCDGP



5178'40'4/#.6'5'44+66'414&'0 5178'40'44+66'470&  *152+6#.14&'081/*.,1*#00'5<7,'475#.'/8104*1&15  70&810/#.6# 

8GTFKGPUVMTGW\8GTNGKJWPIUWTMWPFG\WO*CNUMTGW\HÒTFGP1DGTUVNGWVPCPV,QJCPPXQP-QUVKCN<KXCPQ XKEFCVKGTV9KGPCO,WNKOKV7PVGTUEJTKHV<WUCOOGPOKV\YGK5VCVWVGPDN·VVGTP ++



(ª456'067//10#%1 

1TFGPXQOJGKNKIGP-CTN8GTNGKJWPIUWTMWPFG\WO4KVVGTMTGW\HÒTFGPHÒTUVNKEJJQJGP\QNNGTPUEJGP4CV .CUUGTFCVKGTV/QPCEQCO5GRVGODGTOKV2CRKGT2T·IGUKGIGNWPF7PVGTUEJTKHVGP ++



/106'0')41 (ª456'067/70&-¤0+)4'+%*/106'0')41   

1TFGP FGU (ÒTUVGP &CPKNQ + =1ðäåí Êíüàçà Äàíèëà +? 8GTNGKJWPIUWTMWPFG \WT  -NCUUG HÒT   )WUVCX)TCH-±NPQM[FCVKGTVCO(GDTWCTOKV2CRKGT2T·IGUKGIGNWPF1TKIKPCNWPVGTUEJTKHVXQP (ÒTUV0KMQNCK 4++



)WUVCX5KIOWPF)TCH-±NPQM[(TGKJGTTXQP-ÌTÌURCVCM  MWMÌUVGTTGKEJKUEJWPICTKUEJGT#W­GPOKPK UVGTXQPDKU



1TFGP FGU (ÒTUVGP &CPKNQ + =1ðäåí Êíüàçà Äàíèëà +? 8GTNGKJWPIUWTMWPFG \WT  -NCUUG HÒT   )GPGTCN,GCP&GIQWVVG%JGHFGU)GPGTCNUVCDUFGT#TOGGFCVKGTV2CTKUCO#WIWUVOKV 2T·IGUKGIGN WPF 1TKIKPCNWPVGTUEJTKHV XQP -ÌPKI 0KMQNCK <WUCOOGP OKV QHHK\KGNNGT ªDGTUGV\WPI KP   HTCP\ÌUKUEJGT5RTCEJG ++

 187


VERLEIHUNGSURKUNDEN UND DOKUMENTE

-¤0+)4'+%*&'40+'&'4.#0&' 

/KNKV·T9KNJGNO1TFGP  (TCP\ÌUKUEJG #PPCJOG WPF 6TCIGIGPGJOKIWPI \WT  -NCUUG HÒT FGP8K\G #FOKTCN%JCTNGU*GPTK%QOVG8GT*WGNN2CKTFG(TCPEGFCVKGTV2CTKUCO1MVQDGTOKV2T·IG UKGIGNWPF1TKIKPCNWPVGTUEJTKHVFGU)TQ­MCP\NGTUFGT'JTGPNGIKQP/CTUEJCNN)¾TCTF ++



1TFGPXQO0KGFGTN·PFKUEJGP.ÌYGP8GTNGKJWPIU#PMÒPFKIWPIªDGTUGPFWPIUUEJTGKDGPWPFÌUVGTTGK EJKUEJG #PPCJOG WPF 6TCIGIGPGJOKIWPI \WO 4KVVGTMTGW\ HÒT &T -QPUVCPVKP 9WT\DCEJ XQO MM+P PGPOKPKUVGTKWOCWUFGO,CJTGLGYGKNUOKV7PVGTUEJTKHV 5VÒEM++



1TCPKGP0CUUCW1TFGP 8GTNGKJWPIUWTMWPFG \WO 1HHK\KGTMTGW\ OKV 5EJYGTVGTP HÒT FGP FGWVUEJGP   *CWRVOCPP *GNOWVJ )TKRR FCVKGTV *GV .QQ CO  /CK  OKV 2T·IGUKGIGN WPF 7PVGTUEJTKHV <W   UCOOGP OKV FGT FGWVUEJGP #PPCJOGIGPGJOKIWPI XQO  #RTKN  OKV 2T·IGUKGIGN WPF (CMUKOKNG   7PVGTUEJTKHVō#FQNH*KVNGTŋ ++





1TCPKGP0CUUCW1TFGP)TQ­G8GTNGKJWPIUWTMWPFG\WO1HHK\KGTMTGW\HÒT%QTPGNKU1XGTYCVGTFCVKGTV CO&G\GODGTOKV2T·IGUKGIGNWPF7PVGTUEJTKHVGP ++





1TCPKGP0CUUCW1TFGP )TQ­G 8GTNGKJWPIUWTMWPFG \WO 1HHK\KGTMTGW\ HÒT #TGPF ,QPMGT FCVKGTV    U)TCXGPJCIGCO#WIWUVOKV2T·IGUKGIGNWPF7PVGTUEJTKHVGP/GJTHCEJIGHCNVGV<WUCOOGPOKV 8GTNGKJWPIUCPMÒPFKIWPIXQO,WNKOKV2T·IGUKGIGNWPF7PVGTUEJTKHVGP 5VÒEM++







0149')'0 -¤0+)4'+%*0149')'02'4510#.70+10/+65%*9'&'0 $+5  

-ÌPKINKEJ 0QTYGIKUEJGT 5CPMV 1NCXU1TFGP  8GTNGKJWPIUWTMWPFG \WO -QOOCPFGWTMTGW\  -NCUUG   HÒT/CLQTXQP2HWGN(NÒIGNCFLWVCPVFGU&GWVUEJGP-CKUGTUFCVKGTV5VQEMJQNOCO1MVQDGTOKV 2CRKGT2T·IGUKGIGNWPF1TKIKPCNWPVGTUEJTKHV-ÌPKI1UECTU ++  4++



¤56'44'+%* 

-#+5'44'+%*¤56'44'+%*  

1TFGPXQO)QNFGPGP8NKGU2GTUÌPNKEJGUªDGTUGPFWPIUUEJTGKDGP /QP%QWUKP -CKUGT(TCP\,QUGRJU +KPHTCP\ÌUKUEJGT5RTCEJGCP)WUVCX)TCH-±NPQM[XQP-ÌTÌURCVCM\WT1TFGPUMQNNCPGFCVKGTV9KGPCO  #RTKN  OKV ITQ­GO 2CRKGT2T·IGUKGIGN FGU 1TFGPU WPF 1TKIKPCNWPVGTUEJTKHV -CKUGT (TCP\   ,QUGRJU\WUCOOGPOKVYGKVGTGO$GINGKVUEJTGKDGP 44++



$GFGWVGPFGU&QMWOGPVOKVGKPGORTCEJVXQNNGP5KGIGNKPJGTXQTTCIGPFGT'TJCNVWPI  )WUVCX5KIOWPF)TCH-±NPQM[(TGKJGTTXQP-ÌTÌURCVCM  MWMÌUVGTTGKEJKUEJWPICTKUEJGT#W­GPOKPK UVGTXQPDKU'TYWTFGCNU4KVVGTKPFGP1TFGPCWHIGPQOOGP  &C FGT 1TFGP WTURTÒPINKEJ CWU $WTIWPF UVCOOV KUV (TCP\ÌUKUEJ UGKPG QHHK\KGNNG 5RTCEJG &KG 1TFGPUTKVVGT YGTFGP   XQO5QWXGT·PFGU1TFGPUCNU8GVVGTP=EQWUKP?CPIGTGFGV



¤UVGTTGKEJKUEJ-CKUGTNKEJGT .GQRQNF1TFGP 8GTNGKJWPIUOKVVGKNWPI FGT 1TFGPMCP\NGK \WO )TQ­MTGW\   HÒT (GNFOCTUEJCNN .GWVPCPV ,QUGH .CVQWT XQP 6JWTPDWTI FCVKGTV 9KGP CO  ,WNK  OKV 7PVGT   UEJTKHV ++



<WFKGUGO<GKVRWPMVYCTGTCWEJMMYKTMNKEJGTIGJGKOGT4CVWPFWC-QOOCPFGWTFGU5V5VGHCP1TFGPU



¤UVGTTGKEJKUEJ-CKUGTNKEJGT .GQRQNF1TFGP 8GTNGKJWPIUOKVVGKNWPI \WO -QOOCPFGWTMTGW\ HÒT FGP   )GPGTCN/CLQTWPF$TKICFKGTXQP5EJÒVVGFCVKGTV9KGPCO0QXGODGTOKV7PVGTUEJTKHV ++





¤UVGTTGKEJKUEJ-CKUGTNKEJGT.GQRQNF1TFGP8GTNGKJWPIUOKVVGKNWPIFGT1TFGPMCP\NGK\WO4KVVGTMTGW\ HÒT1DGTUV,QUGH.CVQWTXQP6JWTPDWTIFCVKGTV9KGPCO,WPKOKV7PVGTUEJTKHV<WUCOOGPOKV IGUKGIGNVGO8GTUCPFEQWXGTV ++



1DGTUV,QUGH.CVQWTXQP6JWTPDWTIYCT\WFKGUGT<GKV(NÒIGNCFLWVCPVFGU-CKUGTUWPFFGO-TQPRTKP\GP4WFQNRJ\WT &KGPUVNGKUVWPI\WIGVGKNV





188

¤UVGTTGKEJKUEJ-CKUGTNKEJGT.GQRQNF1TFGP8GTNGKJWPIUOKVVGKNWPIFGT1TFGPMCP\NGK\WO4KVVGTMTGW\ HÒT &T 9NCFKOKT )NQDQEPKM 'FNGT XQP 5QTQFQNUMK /KPKUVGTKCNTCV KO MM (KPCP\OKPKUVGTKWO FCVKGTV   9KGP CO  &G\GODGT  OKV 7PVGTUEJTKHV \WUCOOGP OKV FGT <CJNWPIUCWHHQTFGTWPI HÒT FKG   5EJTGKDWPF5KGIKNNKGTWPIUIGDÒJTHÒTFKG'TUVGNNWPIFGU1TFGPUFKRNQOUKP*ÌJGXQP-TQPGP  5VÒEM++



¤UVGTTGKEJKUEJ-CKUGTNKEJGT.GQRQNF1TFGP8GTNGKJWPIUWTMWPFG\WO4KVVGTMTGW\OKVFGT-TKGIUFGMQ TCVKQPHÒTFGP)GPGTCNOCLQT(TCP\4KVVGT9GKUUXQP/CKPRTWII-QOOCPFCPVFGT+PHCPVGTKGDTKICFG FCVKGTV9KGPCO#RTKNOKV2T·IGUKGIGNWPF1TKIKPCNWPVGTUEJTKHVFGU1TFGPUMCP\NGTU 4++




VERLEIHUNGSURKUNDEN UND DOKUMENTE 

¤UVGTTGKEJKUEJ-CKUGTNKEJGT 1TFGP FGT 'KUGTPGP -TQPG )TQ­G OGJTUGKVKIG 8GTNGKJWPIUWTMWPFG \WT   -NCUUGHÒT,QUGRJ(TGKJGTTXQP$TWMGPVJCNFCVKGTV9KGPCO#RTKNOKV1TKIKPCNWPVGTUEJTKHV -CKUGT(TCP\,QUGRJU2GTICOGPVCEJV5GKVGPRTCEJVXQNNXQTYKGIGPFKP)QNFKNNWOKPKGTVOKV<YKUEJGP DN·VVGTP KP TQVGO 5COV IGDWPFGP GVYCU DGUVQ­GP OKV CPJ·PIGPFGO ITQ­GP 9CEJU1TFGPUUKGIGN KP   /GUUKPIMCRUGN &GEMGNHGJNV  ++



¤UVGTTGKEJKUEJ-CKUGTNKEJGT1TFGPFGT'KUGTPGP-TQPG8GTNGKJWPIUOKVVGKNWPIFGT1TFGPMCP\NGK\WT +++-NCUUGHÒTFGP$WTIJCWRVOCPP#PVQP0KEMNCUKP9KGPFCVKGTV9KGPCO,CPWCTOKV7PVGT UEJTKHV ++



¤UVGTTGKEJKUEJ-CKUGTNKEJGT 1TFGP FGT 'KUGTPGP -TQPG 1TFGPUUVCVWVGP GKPUEJNKG­NKEJ FGU  0CEJ   VTCIUXQO#RTKNKPFGWVUEJGTWPFKVCNKGPKUEJGT5RTCEJG5GKVGPWPFCEJV$KNFVCHGNPKODNCWGP 'KPDCPF ++



-CKUGTNKEJ¤UVGTTGKEJKUEJGT (TCP\,QUGRJ1TFGP )TQ­G 8GTNGKJWPIUWTMWPFG \WO -QOVWTMTGW\ OKV   5VGTP HÒT FGP *QHTCV &T -CTN 2GNUGT XQP (ÒTPDGTI FCVKGTV 9KGP CO  /·T\  OKV 2T·IGUKGIGN   WPF1TKIKPCNWPVGTUEJTKHV-CKUGT(TCP\,QUGRJU8GTUEJOWV\VWPFVNYCPFGP(CNVUVGNNGPGKPIGTKUUGP +++



-CKUGTNKEJ¤UVGTTGKEJKUEJGT (TCP\,QUGRJ1TFGP ªDGTUGPFWPIUUEJTGKDGP FGU EJKPGUKUEJGP )GPGTCN   <QNNKPURGMVQTUKP2GMKPIHÒTGKP4KVVGTMTGW\XGTNKGJGPCPFGPDGNIKUEJGP-QPUWN6JQOCU6(GTIWUUQP KP%JGHQQ %JKPC FCVKGTV2GPMKPICO(GDTWCTOKV5KGIGNUVGORGNWPF7PVGTUEJTKHV ++





-CKUGTNKEJ¤UVGTTGKEJKUEJGT(TCP\,QUGRJ1TFGP1TFGPUUVCVWVGPGKPUEJNKG­NKEJFGU0CEJVTCIUXQO /·T\5GKVGPWPFXKGT(CTDVCHGNPKODNCWGP'KPDCPF ++





*QEJCFGNKIGT 5VGTPMTGW\1TFGP 8GTNGKJWPIUWTMWPFG HÒT 'NGQPQTG 4GKEJUIT·HKP XQP WPF \W *QGPU   DTQGEJIGD2TKP\GUUKP\W9KPFKUEJ)T·V\FCVKGTV9KGPCO#RTKNOKV2CRKGT2T·IGUKGIGNWPF 1TKIKPCNWPVGTUEJTKHV-CKUGTKP'NKUCDGVJU 4++



/KNKV·T8GTFKGPUVMTGW\8GTNGKJWPIUWTMWPFG\WT++-NCUUGOKVFGT-TKGIUFGMQTCVKQP++-NCUUGHÒTFGP )GPGTCNOCLQT4CP\4KVVGT9GKUU6KJCP[KXQP/CKPRTWIIFCVKGTV9KGPCO,WNKOKV2T·IGUKG IGNWPF7PVGTUEJTKHVGP ++



/KNKV·T8GTFKGPUVMTGW\8GTNGKJWPIUWTMWPFG\WT++-NCUUGOKVFGT-TKGIUFGMQTCVKQP++-NCUUGHÒTFGP (GNF\GWIOGKUVGT(GTFKPCPF4KVVGT)QINKCXQP<NQVC.KRCFCVKGTV9KGPCO,CPWCTOKV2T·IG UKGIGNWPF7PVGTUEJTKHVGP ++





/KNKV·T8GTFKGPUVMTGW\8GTNGKJWPIUWTMWPFGHÒTFGP1DGTUVNGWVPCPV(GTFKPCPF)QINKCFCVKGTV9KGPCO ,WPKOKV2T·IGUKGIGNWPF7PVGTUEJTKHVGP ++





/KNKV·T8GTFKGPUVMTGW\8GTNGKJWPIUWTMWPFGHÒTFGP*CWRVOCPP(TCP\4KVVGTXQP9GKUUFCVKGTV9KGP CO#RTKNOKV2T·IGUKGIGNWPF7PVGTUEJTKHVGP ++





/KNKV·T8GTFKGPUVMTGW\8GTNGKJWPIUWTMWPFG\WO/KNKV·T8GTFKGPUVMTGW\OKVFGT-TKGIUFGMQTCVKQPHÒT FGP.GWVPCPV*GKPTKEJ&GF[FCVKGTV9KGPCO#WIWUVOKV2T·IGUKGIGNWPF7PVGTUEJTKHVGP ++















8GTNGKJWPICWUFGPGTUVGP6CIGPFGU'TUVGP9GNVMTKGIU











/KNKV·T8GTFKGPUVMTGW\ 8GTNGKJWPIUWTMWPFG \WT -TKGIUFGMQTCVKQP HÒT 'FWCTF .KPFPGT X $KGPGPYCNF   KP#PGTMGPPWPIJGTXQTTCIGPFVCRHGTGTWPFXQT\ÒINKEJGTUQPUVXGTFKGPUVNKEJGT.GKUVWPIGPKOFKGUL·JTK IGP(GNF\WIGIGIGP2TGW­GPFCVKGTV9KGPCO1MVQDGTOKV7PVGTUEJTKHVGP 4++



8GTFKGPUVMTGW\8GTNGKJWPIUWTMWPFG\WO)QNFGP8GTFKGPUVMTGW\OKVFGT-TQPGCO$CPFGFGT6CRHGT MGKVUOGFCKNNGHÒTFGP$CJP1DGT4GXKFGPVGP#NQKU,ÌDUVN5VCVKQPUXQTUVCPFKP0KGFGTFQTHFCVKGTV9KGP CO5GRVGODGTOKV2T·IGUKGIGNWPF7PVGTUEJTKHV ++



-QPXQNWVXQPCEJV8GTNGKJWPIUWTMWPFGP7CHÒTFKG5KNDGTPG  WPF$TQP\GPG/KNKV·TXGTFKGPUVOG FCKNNGCO$CPFFGU/KNKV·TXGTFKGPUVMTGW\GUWPFHÒTFKG/KNKV·TFKGPUV\GKEJGPWPF-NCUUGHÒT1HHK \KGTG &C\W #DUEJKGFUWTMWPFG FGU - - .GKDICTFG 4GKVGT 4GIKOGPVU XQO  ,CPWCT  +P WPVGT   UEJKGFNKEJGP'TJCNVWPIGP 5VÒEM++



'JTGP\GKEJGP XQO 4QVGP -TGW\ -QPXQNWV XQP \YGK ITQ­GP 8GTNGKJWPIUWTMWPFGP \WO 1HHK\KGTU   'JTGP\GKEJGP WPF \WT 5KNDGTPGP 'JTGPOGFCKNNG LGYGKNU OKV FGT -TKGIUFGMQTCVKQP FTGK 8GTNGKJWPIU   CPMÒPFKIWPIGPWPFGKPYGKVGTGUFKGUDG\ÒINKEJGU&QMWOGPVLGYGKNUOKV7PVGTUEJTKHVGP 5VÒEM++



8GTNGKJWPIUWTMWPFGFGT-CKUGTKP'NKUCDGVJ\WO)TQ­GP#PVTKVV(ÒTFGPMMYKTMNKEJGPIGJGKOGP 4CV WPF -·OOGTGT /KPKUVGT FGU MCKUGTNKEJGP *CWUGU WPF )GPGTCNOCLQT )WUVCX )TCH -±NPQM[ XQP   -ÌTÌU2CVCMFCVKGTV)ÌFÌNNÌCO0QXGODGTOKV1TKIKPCNWPVGTUEJTKHVFGU1DGTJQHOGKUVGTUFGT -CKUGTKP 4++



)WUVCX5KIOWPF)TCH-±NPQM[(TGKJGTTXQP-ÌTÌURCVCM  MWMÌUVGTTGKEJKUEJWPICTKUEJGT#W­GPOKPK UVGTXQPDKU

189


VERLEIHUNGSURKUNDEN UND DOKUMENTE

8972



8973

/CTKCPGTMTGW\ FGU &GWVUEJGP 4KVVGTQTFGPU 8GTNGKJWPIUWTMWPFG \WO  *CNUMTGW\ HÒT 4KEECTFQ 5CP\   FG 5CORGT FCVKGTV +PPUDTWEM CO  &G\GODGT  OKV 2T·IGUKGIGN WPF 1TKIKPCNWPVGTUEJTKHV FGU   *QEJOGKUVGTU'T\JGT\QI'WIGP 4++



5CORGTYCT\WFKGUGT<GKVYKTMNKEJGT)GJGKOGT-·OOGTGT2CRUV2KWU:UR·VGTWPVGT2CRUV2KWU:+/CLQTFQOWU WPF2T·HGMVFGU#RQUVQNKUEJGP2CNCUVGUKO8CVKMCP

ō560&'56##6ŋ¤56'44'+%*   

¤UVGTTGKEJKUEJGT 8GTFKGPUVQTFGP 8GTNGKJWPIUWTMWPFG \WO 4KVVGTMTGW\ + -NCUUG HÒT $GTPJCTF *GT\   OCPUM[FCVKGTV9KGPCO#WIWUVOKV2T·IGUKGIGNWPF7PVGTUEJTKHV ++



21.'0

'456' 4'27$.+-21.'0   

1TFGP 2QNQPKC 4GUVKVWVC 8GTNGKJWPIUWTMWPFG \WO )TQ­MTGW\ HÒT /QPUKIPQTG 4KEECTFQ FG 5CORGT   /CLQTFQOWU WPF 2T·HGMV FGU #RQUVQNKUEJGP 2CNCUVGU KO 8CVKMCP FCVKGTV  OKV 2T·IGUKGIGN WPF   7PVGTUEJTKHVGP<WUCOOGPOKV)NÒEMYWPUEJUEJTGKDGPFGURQNPKUEJGP$QVUEJCHVGTUDGKO*GKNKIGP5VWJN 5VÒEM++



21467)#. -¤0+)4'+%*21467)#. $+5  

/KNKV·TKUEJGT1TFGP7PUGTGU*GTTP,GUWU%JTKUVWU'TPGPPWPIUUEJTGKDGP\WO4KVVGTHÒT4.CUUGTKP 5KIOCTKPIGPFCVKGTV.KUUCDQPCO5GRVGODGTOKV1TKIKPCNWPVGTUEJTKHVō4GKŋXQP-ÌPKI.WKU+ 4++



47/0+'0 -¤0+)4'+%*47/0+'0   







190

1TFGP5VGTP4WO·PKGPU CWEJ1TFGPFGU5VGTPUXQP4WO·PKGP 8GTNGKJWPIUWTMWPFG\WO)TQ­QH HK\KGTHÒTFGP&KXKUKQPUIGPGTCN*GNIG#TVJWT#WNGDFCVKGTV$WMCTGUVCO/·T\OKV2T·IGUKGIGN WPF1TKIKPCNWPVGTUEJTKHV-ÌPKI/KJCKU 4++



1TFGP 5VGTP 4WO·PKGPU CWEJ 1TFGP FGU 5VGTPU XQP 4WO·PKGP  8GTNGKJWPIUWTMWPFG \WO -QO   OCPFGWTMTGW\HÒT*.CUUGTKP5KIOCTKPIGPFCVKGTV5KIOCTKPIGPCO1MVQDGTOKV2T·IGUKG IGNWPF1TKIKPCNWPVGTUEJTKHV-ÌPKI%CTQNU +  ++



1TFGP-TQPG4WO·PKGPU CWEJ1TFGPFGT-TQPGXQP4WO·PKGP 8GTNGKJWPIUWTMWPFG\WO)TQ­QH HK\KGTHÒT*GTOCPP&CJNGP/KPKUVGTKCNTCVKOÌUVGTTGKEJKUEJGP9KTVUEJCHVUOKPKUVGTKWOFCVKGTV$WMCTGUV CO/CKOKV2T·IGUKGIGNWPF1TKIKPCNWPVGTUEJTKHV-ÌPKI%CTQNU ++  4++



1TFGP -TQPG 4WO·PKGPU CWEJ 1TFGP FGT -TQPG XQP 4WO·PKGP  8GTNGKJWPIUWTMWPFG \WO 1HHK   \KGTUMTGW\HÒTFGPÌUVGTTGKEJKUEJGP-CRKV·P-CTN8KMVQTXQP5WRRCPXQPFGT&QPCW&CORHUEJKHHHCJTVU IGUGNNUEJCHVKP9KGPFCVKGTV$WMCTGUVCO&G\GODGTOKV2T·IGUKGIGNWPF7PVGTUEJTKHVGP ++




VERLEIHUNGSURKUNDEN UND DOKUMENTE

8980



8981

/GFCKNNG $GPG/GTGPVK 8GTNGKJWPIUWTMWPFG \WT /GFCKNNG  -NCUUG HÒT FKG -ÌPKINKEJG RTGW­KUEJG    -COOGTU·PIGTKP .KNNK -CNKUEJ IGD .GJOCPP HÒT MÒPUVNGTKUEJG 8GTFKGPUVG FCVKGTV $WMCTGUV CO   (GDTWCTOKV2T·IGUKGIGNWPF1TKIKPCNWPVGTUEJTKHV-ÌPKI%CTQNU + <WUCOOGPOKVRTGW­KUEJGT 6TCIGIGPGJOKIWPIXQO/·T\ 4++



4755.#0& 

<#4'067/4755.#0& $+5 

1TFGPFGUJN#RQUVGNU#PFTGCUFGU'TUVDGTWHGPGP<GKVIGPÌUUKUEJGªDGTUGV\WPIFGT8GTNGKJWPIUWT MWPFG HÒT FGP M W M ÌUVGTTGKEJKUEJWPICTKUEJGP #W­GPOKPKUVGT )TCH #PFT±UU[ FCVKGTV $GTNKP CO   #WIWUV5GRVGODGT 4++



)[WNC )TCH #PFT±UU[   FGT #TEJKVGMV FGU ÌUVGTTGKEJKUEJWPICTKUEJGP #WUINGKEJU XQP  DKU    WPICTKUEJGT /KPKUVGTRT·UKFGPV WPF XQP  DKU  ÌUVTTGKEJKUEJWPICTKUEJGT /KPKUVGT FGU W­GTGP WPF FGU MCK   UGTNKEJGP*CWUGU



1TFGPFGTJGKNKIGP#PPC8GTNGKJWPIUWTMWPFG\WT-NCUUGHÒT)GQTIGU*QPPQTCVFCVKGTV5V2GVGTU DWTICO#WIWUV2CRKGT2T·IGUKGIGNXGTNQTGPOKV7PVGTUEJTKHVGPOKVQHHK\KGNNGTªDGTUGV\WPIKP HTCP\ÌUKUEJGT5RTCEJG ++



.¾QP)GQTIGU*QPPQTCVYCT%JGHFGT&KXKUKQPFGT2QNK\GKRT·HGMVWTKP2CTKU



1TFGPFGTJGKNKIGP#PPC8GTNGKJWPIUWTMWPFG\WT-NCUUGFCVKGTV5V2GVGTUDWTICO/·T\ 2CRKGT2T·IGUKGIGNXGTNQTGPOKV7PVGTUEJTKHVGP#PFGP(CNVUVGNNGPVNYGKPIGTKUUGPWPFJKPVGTMNGDV +++





1TFGPFGTJGKNKIGP#PPC8GTNGKJWPIUWTMWPFG\WT-NCUUGHÒTFGPRTGW­KUEJGP/CTKPG1DGTUVCDUKP IGPKGWT *GTOCPP $QEM/GV\PGT FCVKGTV 5V 2GVGTUDWTI  OKV 2T·IGUKGIGN WPF 7PVGTUEJTKHVGP #P   FGP(CNVUVGNNGPVNYGKPIGTKUUGPWPFJKPVGTMNGDV +++



&GT \WO 1DGTUVCDUKPIGPKGWT CWHIGUVKGIGPG XQTOCNKIG 1DGTOCUEJKPKUV FGT MCKUGTNKEJ ;CEJV 5/; *QJGP\QNNGTP   *GTOCP$QEM/GV\PGTKUVIGUVQTDGP



-CKUGTNKEJGTWPFMÌPKINKEJGT1TFGPXQOJGKNKIGP5VCPKUNCWU8GTNGKJWPIUWTMWPFG\WT-NCUUGOKV 5VGTP HÒT .¾QP )GQTIGU *QPPQTCV FCVKGTV 5V 2GVGTUDWTI  OKV2T·IGUKGIGNWPF7PVGTUEJTKHVGPKP FGTTGEJVGPQDGTGP'EMGDGUEJ·FKIV ++



.¾QP)GQTIGU*QPPQTCVYCT%JGHFGT&KXKUKQPFGT2QNK\GKRT·HGMVWTKP2CTKU



-CKUGTNKEJGT WPF MÌPKINKEJGT 1TFGP XQO JGKNKIGP 5VCPKUNCWU 8GTNGKJWPIUWTMWPFG \WT  -NCUUG HÒT   .¾QP)GQTIGU*QPPQTCVFCVKGTV5V2GVGTUDWTIOKV2CRKGT2T·IGUKGIGNWPF7PVGTUEJTKHVGP ++



.¾QP)GQTIGU*QPPQTCVYCT%JGHFGT&KXKUKQPFGT2QNK\GKRT·HGMVWTKP2CTKU





-CKUGTNKEJGTWPFMÌPKINKEJGT1TFGPXQOJGKNKIGP5VCPKUNCWU8GTNGKJWPIUWTMWPFG\WT-NCUUGFGP ÌUVGTTGKEJKUEJWPICTKUEJGP5VCCVUCPIGJÌTKIGP,QJCPP-TGOUGTFCVKGTV5V2GVGTUDWTICO/·T\ OKV2T·IGUKGIGNWPF7PVGTUEJTKHVGP ++



-CKUGTNKEJGT WPF MÌPKINKEJGT 1TFGP XQO JGKNKIGP 5VCPKUNCWU 8GTNGKJWPIUWTMWPFG \WT  -NCUUG   FCVKGTV 5V 2GVGTUDWTI CO  1MVQDGT  2CRKGT2T·IGUKGIGN XGTNQTGP OKV 7PVGTUEJTKHVGP #P FGP   (CNVUVGNNGPVNYGKPIGTKUUGPWPFJKPVGTMNGDV +++

 191


VERLEIHUNGSURKUNDEN UND DOKUMENTE

-¤0+)4'+%*5%*9'&'0 

-ÌPKINKEJGT 5GTCRJKO1TFGP 8GTNGKJWPIUWTMWPFG HÒT FGP ÌUVGTTGKEJKUEJWPICTKUEJGP #W­GPOKPKUVGT   ,WNKWU#PFT±UU[XQP%UKMU\GPVMKTCN[WPF-TCU\PCJQTMCFCVKGTV5VQEMJQNOCO/CKOKV2CRKGT 2T·IGUKGIGNWPF1TKIKPCNWPVGTUEJTKHV-ÌPKI1UECTU ++ &GWVNKEJIGHCNVGVWPFGVYCUGKPIGTKUUGP ++p+++



)[WNC )TCH #PFT±UU[   FGT #TEJKVGMV FGU ÌUVGTTGKEJKUEJWPICTKUEJGP #WUINGKEJU XQP  DKU    WPICTKUEJGT /KPKUVGTRT·UKFGPV WPF XQP  DKU  ÌUVTTGKEJKUEJWPICTKUEJGT /KPKUVGT FGU W­GTGP WPF FGU MCK   UGTNKEJGP*CWUGU



-ÌPKINKEJGT 5GTCRJKO1TFGP 8GTNGKJWPIUWTMWPFG HÒT FGP ÌUVGTTGKEJKUEJWPICTKUEJGP #W­GPOKPKUVGT   )WUVCX)TCH-±NPQM[XQP-ÌTÌU2CVCMFCVKGTV5VQEMJQNOCO#RTKNOKV2CRKGT2T·IGUKGIGNWPF 1TKIKPCNWPVGTUEJTKHV-ÌPKI1UECTU ++  ++



)WUVCX5KIOWPF)TCH-±NPQM[(TGKJGTTXQP-ÌTÌURCVCM  MWMÌUVGTTGKEJKUEJWPICTKUEJGT#W­GPOKPK UVGTXQPDKU





-ÌPKINKEJGT5EJYGTVQTFGP8GTNGKJWPIUWTMWPFG\WO4KVVGTMTGW\HÒTFGP-COOGTJGTTPWPF*CWRVOCPP (TGFGTKECH-NGTEMGTFCVKGTV5VQEMJQNOCO#WIWUVOKV2T·IGUKGIGNWPF1TKIKPCNWPVGTUEJTKHV -ÌPKI%CTNU :+8 ,QJCPP 4++



-ÌPKINKEJGT0QTFUVGTPQTFGP8GTNGKJWPIUWTMWPFG\WO-QOOCPFGWTMTGW\-NCUUGHÒTFGPFGWVUEJGP 4GIKGTWPIUFKTGMVQT1VVQ-QEJFCVKGTV5VQEMJQNOCO/·T\OKV2CRKGT2T·IGUKGIGNWPF7PVGT UEJTKHVGP ++



5%*9'+< 



1HHK\KGNNG$GUV·VKIWPIFGU$ÒTIGTOGKUVGTUWPFFGT5VCFV<ÒTKEJFC­,CSWG$CWOICTPVGTIGDQTGP\W 9G[CEJKO-CPVQP<ÒTKEJ%CRQTCNKO5EJYGK\GT4GIKOGPV5VGKPGT\WMGKPGT<GKVCPGKPGO-QORNQVV IGIGP FKG HTCP\ÌUKUEJG 4GRWDNKM DGVGKNKIV IGYGUGP KUV &CVKGTV <ÒTKEJ CO  #WIWUV  OKV 2CRKGT   2T·IGWPF.CEMUKGIGNPWPF7PVGTUEJTKHVGP ++



)GFTWEMVG2TQMNCOCVKQP'T\JGT\QI-CTNUXQP¤UVGTTGKEJCPFKG5EJYGK\GT&CVKGTV/·T\ ++



5'4$+'070&,7)15.#9+'0 (ª456'067/70&-¤0+)4'+%*5'4$+'0   

1TFGP FGU -TGW\GU XQP 6CMQXQ=1ðäåí Òàêîâñêî³ Êðñòà? 8GTNGKJWPIUWTMWPFG\WO)TQ­MTGW\HÒT FGPÌUVGTTGKEJKUEJWPICTKUEJGP#W­GPOKPKUVGT)WUVCX)TCH-±NPQM[FCVKGTV$GNITCFCO#RTKN OKV.CEMUKGIGNWPF7PVGTUEJTKHV ++



)WUVCX5KIOWPF)TCH-±NPQM[(TGKJGTTXQP-ÌTÌURCVCM  MWMÌUVGTTGKEJKUEJWPICTKUEJGT#W­GPOKPK UVGTXQPDKU





1TFGP FGU -TGW\GU XQP 6CMQXQ =1ðäåí Òàêîâñêî³ Êðñòà? 8GTNGKJWPIUWTMWPFG \WO 1HHK\KGTUMTGW\   HÒT FGP ÌUVGTTGKEJKUEJWPICTKUEJGP *CWRVOCPP -ÌJPG FCVKGTV $GNITCF CO  #RTKN  OKV 5KGIGN   UVGORGNWPF7PVGTUEJTKHV ++



1TFGP XQO 9GK­GP #FNGT =1ðäåí ÁGëî³ Îðëà? 8GTNGKJWPIUWTMWPFG \WT + -NCUUG HÒT FGP ÌUVGTTGK   EJKUEJWPICTKUEJGP #W­GPOKPKUVGT )WUVCX)TCH-±NPQM[FCVKGTV$GNITCFCO1MVQDGTOKV2C RKGT2T·IGUKGIGNWPF1TKIKPCNWPVGTUEJTKHV-ÌPKI/KNCPU +  4++



)WUVCX5KIOWPF)TCH-±NPQM[(TGKJGTTXQP-ÌTÌURCVCM  MWMÌUVGTTGKEJKUEJWPICTKUEJGT#W­GPOKPK UVGTXQPDKU



1TFGPXQO9GK­GP#FNGT=1ðäåí ÁGëî³ Îðëà? 8GTNGKJWPIUWTMWPFG\WT++-NCUUGHÒTFGPHTCP\ÌUK UEJGP (KPCP\KPURGMVGWT 5CNNCPFTQW\G FG .COQTPCK FCVKGTV $GNITCF  OKV 2T·IGUKGIGN WPF 1TKIK   PCNWPVGTUEJTKHV-ÌPKI2GVGTU +  ++



1TFGPXQO9GK­GP#FNGT=1ðäåí ÁGëî³ Îðëà? 8GTNGKJWPIUWTMWPFG\WT++-NCUUGHÒTFGPHTCP\ÌUK UEJGP$TKICFG)GPGTCN,GCP/CTKG&GIQWVVGFCVKGTV$GNITCFOKV2T·IGUKGIGNWPF7PVGTUEJTKHVGP ++





1TFGPFGUJGKNKIGP5CXC=1Rääí %âGòQã %CâG?8GTNGKJWPIUWTMWPFG\WT++-NCUUGFCVKGTV$GNITCFCO (GDTWCTOKV2T·IGUKGIGNWPF1TKIKPCNWPVGTUEJTKHV-ÌPKI2GVGTU +  4++





-QPXQNWV XQP FTGK 7TMWPFGP FGU 5GTDKUEJGP 4QVGP -TGW\GU &CTWPVGT 8GTNGKJWPIUWTMWPFG HÒT FCU   -TGW\ FGT )GUGNNUEJCHVCPFGPÌUVGTTGKEJKUEJGP1DGTUVCDUCT\V&T,QJCPP5VGKPGTKP9KGPFCVKGTV$GN ITCF CO  #RTKN  OKV ªDGTUGV\WPI  &KG YGKVGTGP XQP  WPF  5GJT HCTDGPRT·EJVKIG   7TMWPFGPKPWPVGTUEJKGFNKEJGP<WUVCPF 5VÒEM+++++





192


VERLEIHUNGSURKUNDEN UND DOKUMENTE -¤0+)4'+%*&'45'4$'0-41#6'07055.19'0'0$<9  -¤0+)4'+%*,7)15.#9+'0   

1TFGPXQO9GK­GP#FNGT=1ðäåí ÁGëî³ Îðëà? 8GTNGKJWPIUWTMWPFG\WT8-NCUUGFCVKGTV$GNITCF CO,WPKOKV2T·IGUKGIGNWPF7PVGTUEJTKHVGP ++





1TFGPFGT,WIQUNCYKUEJGP-TQPG=1ðäåí ßó³îñëîâåíñêå Êðóíå? 8GTNGKJWPIUWTMWPFG\WT++-NCUUG HÒTFGPFGWVUEJGP)GPGTCNOCLQT(TKV\$TCPFFCVKGTV$GNITCFCO(GDTWCTOKV2T·IGUKGIGNWPF 7PVGTUEJTKHVGP <WUCOOGP OKV FGWVUEJGT #PPCJOGIGPGJOKIWPI FCVKGTV $GTNKP CO  ,WNK  OKV   2T·IGUKGIGNWPF(CMUKOKNG7PVGTUEJTKHVō#FQNH*KVNGTŋ 5VÒEM++



1TFGPFGT,WIQUNCYKUEJGP-TQPG=1ðäåí ßó³îñëîâåíñêå Êðóíå? 8GTNGKJWPIUWTMWPFG\WT8-NCUUG HÒTFGP+PHCPVGTKG4GUGTXG*CWRVOCPP-NCUUG.'TPGUV2GNKMCPFCVKGTV$GNITCFCO#RTKN OKV2T·IGUKGIGNWPF7PVGTUEJTKHVGP'VYCUGKPIGTKUUGP/KVOQFGTPGTªDGTUGV\WPI ++p+++



1TFGPFGT,WIQUNCYKUEJGP-TQPG=1ðäåí ßó³îñëîâåíñêå Êðóíå? 8GTNGKJWPIUWTMWPFG\WT8-NCUUG HÒT FGP FGWVUEJGP *CWRVOCPP *GNOWVJ )TKRR FCVKGTV $GNITCF CO  ,WPK  OKV 2T·IGUKGIGN WPF   7PVGTUEJTKHVGP 'VYCU GKPIGTKUUGP <WUCOOGP OKV FGWVUEJGT #PPCJOGIGPGJOKIWPI FCVKGTV $GTNKP CO   &G\GODGTOKV2T·IGUKGIGNWPF(CMUKOKNG7PVGTUEJTKHVō#FQNH*KVNGTŋWPFªDGTUGV\WPI  5VÒEM++p+++







52#0+'0

(ª0(6'5 -¤0+)4'+%*52#0+'0   

/KNKV·T8GTFKGPUVQTFGP 8GTNGKJWPIUWTMWPFG \WO )TQ­MTGW\ HÒT FGP FGWVUEJGP $TKICFG)GPGTCN XQP   5VTCPV\FCVKGTV/CFTKF 2CNCEKQ CO,CPWCTOKV2T·IGUKGIGNWPF7PVGTUEJTKHVGP ++



9007



/CTKPG8GTFKGPUVQTFGP 8GTNGKJWPIUWTMWPFG \WT  -NCUUG FGT 9GK­GP #DVGKNWPI HÒT FGP DGNIKUEJGP   -QPUWN6JQOCU6(GTIWUUQPKP%JGHQQ %JKPC FCVKGTV/CFTKF 2CNCEKQ CO/CKOKV2T·IG UKGIGNWPF7PVGTUEJTKHVGP ++



70)#40 -¤0+)4'+%*70)#40 $+5  



-ÌPKINKEJWPICTKUEJGT 5V 5VGRJCPU1TFGP 8GTNGKJWPIUOKVVGKNWPI KP WPICTKUEJGT 5RTCEJG HÒT FCU   -NGKPMTGW\ CP FGP M W M ÌUVGTTGKEJKUEJWPICTKUEJGP )GPGTCNOCLQT .CLQU 5ÒPFGTOCPP $GXQNN   O·EJVKIVGT FGU M W M -TKGIUOKPKUVGTKWOU DGKO 2TGW­KUEJGP -TKGIUOKPKUVGTKWO FCVKGTV $¾EU CO   /·T\OKV2T·IGUKGIGNWPF7PVGTUEJTKHV&C\W7OUEJNCIWPFOQFGTPGªDGTUGV\WPI ++



7PICTKUEJGT  8GTFKGPUVQTFGP 8GTNGKJWPIUWTMWPFG \WO1HHK\KGTUMTGW\OKV5EJYGTVGTPWPF-TKGIUFG MQTCVKQPHÒT*GKP\,QCEJKO5EJOKFVFCVKGTV$WFCRGUVCO/·T\ 4++



-+4%*'056##6*'+.+)'4567*.70&8#6+-#0 



2·RUVNKEJGT%JTKUVWU1TFGP¤UVGTTGKEJKUEJG6TCIGIGPGJOKIWPI\WO4KVVGTMTGW\HÒTFGPMWMÌUVGT TGKEJKUEJWPICTKUEJGP 1DGTUV KO #FLWVCPVGP%QTRU WPF )GPGTCN#FLWVCPVGP +IPC\ #TDVGT FCVKGTV 9KGP   CO0QXGODGTOKV2T·IGUKGIGNWPF7PVGTUEJTKHV ++



1TFGP FGU JN 2CRUVGU 5[NXGUVGT  8GTNGKJWPIUWTMWPFG \WO -QOOCPFGWTMTGW\ HÒT 3WKPVWU )TWRCNNK   FCVKGTV4QODGK5V2GVGTCO/·T\OKV5KGIGNUVGORGNWPF1TKIKPCNWPVGTUEJTKHVFGUR·RUVNKEJGP 2TQUGMTGV·TU)KQXCPPK$CVVKUVC/QPVKPKFGU\WMÒPHVKIGP2CRUVGU2CWN8+ TGIXQPDKU  ++

 193


VERLEIHUNGSURKUNDEN UND DOKUMENTE 

'JTGPMTGW\2TQ'EENGUKCGV2QPVKHKEG)TQ­GHCTDGPRT·EJVKIG8GTNGKJWPIUWTMWPFGHÒT1VVQ9GKPTKEJ VGTFCVKGTV8CVKMCPCO5GRVGODGTOKV2T·IGUKGIGNWPF1TKIKPCNWPVGTUEJTKHVFGU-CTFKPCN5VCCVU UGMTGV·TU/GTT[FGN8CN ++



4+66'414&'081/*'+.+)'0)4#$<7,'475#.'/



1TFGPUKPUKIPKGP 8GTNGKJWPIUWTMWPFG \WO )TQ­QHHK\KGT HÒT 1VVQ 9GKPTKEJVGT FCVKGTV 8CVKMCPUVCFV CO   (GDTWCTOKV2T·IGUKGIGNWPF1TKIKPCNWPVGTUEJTKHVFGU)TQ­OGKUVGTU-CTFKPCN%CPCNK ++





1TFGPUKPUKIPKGP 'TPGPPWPIUWTMWPFG \WO 4KVVGT HÒT &T *GKPTKEJ /QTCYKV\ FCVKGTV ,GTWUCNGO CO   ,WPK2GTICOGPVOKVCPJ·PIGPFGO IGDTQEJGPGO 9CEJUUKGIGNKP5KGIGNMCRUGNWPF1TKIKPCN WPVGTUEJTKHVFGU)TQ­OGKUVGTU.WFQXKEQ2KCXK.CVGKPKUEJGT2CVTKCTEJXQP,GTWUCNGO 4++



2CNOGPFGU1TFGPU8GTNGKJWPIUWTMWPFGHÒT1VVQ9GKPTKEJVGTFCVKGTV8CVKMCPUVCFVCO,WPK OKV2T·IGUKGIGNWPF1TKIKPCNWPVGTUEJTKHVFGU)TQ­OGKUVGTU-CTFKPCN%CPCNK 4++





/#41--1 57.6#0#6/#41--1   



*CHKFKGP1TFGP &CJKT \WT  -NCUUG HÒT FGP HTCP\ÌUKUEJGP $CVCKNNQPUEJGH ,GCP &GIQWVVG FCVKGTV (G\   CO5CHCT  OKV5KGIGNUVGORGN<WUCOOGPOKVQHHK\KGNNGTªDGTUGV\WPIKPHTCP\ÌUKUEJGT 5RTCEJG 4++



#NCQWKVG%J¾TKHKGP1TFGP&CJKT\WT-NCUUGHÒTFGP2QNK\GK+PURGMVQTDGKO(TCP\ÌUKUEJGP2T·UKFGP VGP (QWTPKGTFCVKGTV/CTTCMGEJCO0QXGODGTOKV5KGIGNUVGORGN&C\W1HHK\KGNNGªDGTUGV \WPIKPHTCP\ÌUKUEJGT5RTCEJG ++



-#+5'44'+%*2'45+'0 

.ÌYGP WPF 5QPPGP1TFGP 8GTNGKJWPIUWTMWPFG \WT  -NCUUG HÒT FGP ÌUVGTTGKEJKUEJGP 'KUGPDCJP   +PURGMVQT ,QJCPP -TGOUGT FCVKGTV CO  /CK  OKV MCKUGTNKEJGO *CPFUKGIGNUVGORGN WPF $GUV·VK   IWPIU5KGIGNUVGORGNFGU)TQ­YGUKTU&C\WQHHK\KGNNGªDGTUGV\WPI 4++



670'5+'0 (ª456'067/670+5 $+5  

1TFGPFGU4WJOGU8GTNGKJWPIUWTMWPFG\WT-NCUUG -QOOCPFGWT HÒT)GQTIGU*QPPQTCVKP2CTKU FCVKGTV6WPKUCO%JCQWCN  OKV5KGIGNUVGORGN<WUCOOGPOKVQHHK\KGNNGTªDGTUGV\WPIKP HTCP\ÌUKUEJGT5RTCEJGWPFYGKVGTGPFTGKFKGUDG\ÒINKEJGP&QMWOGPVGP 5VÒEM++



1TFGPFGU4WJOGU8GTNGKJWPIUWTMWPFGHÒT#FQNH2QVQEPKMXQPFGTMWMÌUVGTTGKEJKUEJWPICTKUEJGP /CTKPGFCVKGTV6WPKUCO0QXGODGTOKV5KGIGNUVGORGN<WUCOOGPOKVQHHK\KGNNGTªDGTUGV\WPI KPHTCP\ÌUKUEJGT5RTCEJG ++



.¾QP)GQTIGU*QPPQTCVYCT%JGHFGT&KXKUKQPFGT2QNK\GKRT·HGMVWTKP2CTKU



$1.+8#4+5%*'4'27$.+-8'0'<7'.# 

1TFGPFGU$GHTGKGTU CWEJ1TFGPFGT$ÒUVG$QNKXCTUIGPCPPV ªDGTUGPFWPIUUEJTGKDGP\WT-NCUUG HÒT4KECTFQ5CORGTFCVKGTV%CTCECUCO#RTKNOKV7PVGTUEJTKHV 4++

5CORGT YCT UR·VGT YKTMNKEJGT )GJGKOGT -·OOGTGT 2CRUV 2KWU : WPFWPVGT2CRUV2KWU:+/CLQTFQOWUWPF2T· HGMVFGU#RQUVQNKUEJGP2CNCUVGUKO8CVKMCP



8'4'+0+)6'56##6'0810#/'4+-# 75#  

.GIKQP HÒT 8GTFKGPUVG =.GIKQP QH /GTKV? 8GTNGKJWPIUWTMWPFG \WO .GIKQP·T HÒT FGP 1DGTUV (CVKEJ    8CNKWNKP XQP FGT 4QVGP #TOGG FCVKGTV 9CUJKPIVQP CO  #RTKN  OKV 2T·IGUKGIGN WPF 1TKIKPCN   WPVGTUEJTKHVGP FGU -TKGIUOKPKUVGTU WPF FGU )GPGTCN#FLWVCPVGP &C\W FKG 8GTNGKJWPIUDGITÒPFWPI CWH   GKPGO$TKGHDQIGPFGU9GK­GP*CWUGU 44++





-QPXQNWV XQP XKGT XGTUEJKGFGPGP 8GTNGKJWPIUWTMWPFGP <WO $TQP\G 5VCT 2WTRNG *GCTV FGT #KT   /GFCNWPFFGT#KT(QTEG%QOOGPFCVKQP/GFCNCWUFGP,CJTGPDKULGYGKNUOKV7PVGTUEJTKH VGP+PWPVGTUEJKGFNKEJGP'TJCNVWPIGP +++++



/CUEJKPGPIGUEJTKGDGPGT $TKGH XQP ,QJP , 2GTUJKPI )GTKEJVGV CP FGP 4GMVQT FGT 7PKXGTUKV·V FGT   5QTDQPPG 2QKPECT¾ FCVKGTV (TCPEG CO  #RTKN  <WUCOOGP OKV GKPGO 'EJVJGKVU<GTVKHKMCV FGT   (TCP\ÌUKUEJGP4GRWDNKMHÒT-WNVWTIWVFCVKGTV2CTKUCO1MVQDGT ++





-1081.76'+06'40#6+10#. 

 194

7OHCPITGKEJGU -QPXQNWV XQP  8GTNGKJWPIUWTMWPFGP CPMÒPFKIWPIGP WPF &QMWOGPVGP 7 C   CWU$WNICTKGP&·PGOCTM(TCPMTGKEJ+VCNKGP,CRCP,WIQUNCYKGP.GVVNCPF.KVCWGP/QPVGPGITQFGP 0KGFGTNCPFGP ¤UVGTTGKEJ 2QNGP WPF 8KGVPCO CWU FGO  WPF  ,CJTJWPFGTV KP WPVGTUEJKGFNKEJGP   'TJCNVWPIGP 5VÒEM++++++8



-QPXQNWV XQP CEJV QTFGPUTGNGXCPVGP 5VKEJGP 8QT CNNGO CWU ¤UVGTTGKEJ &C\W PQEJ YGKVGTG UGEJU   7PVGTNCIGP 5VÒEM++




LITERATUR

.+6'4#674 #$ #4 $- $- $6 $7 $9- $; $;1 %#( %#/ %/- &' '(9 '1 )$ )$* *( *2 -&1 -*- -. -.' -ª -ª .0- /; 0+ 0/  00 1'- 1//

5EJNQUUWPF5RKGNMCTVGPOWUGWO#NVGPDWTI *I 'JTGP\GKEJGPFGU*GT\QIVWOU5CEJUGP#NVGPDWTI&GMQTCVK QPGPFGU*GT\QINKEJ5CEJUGP'TPGUVKPKUEJGP*CWUQTFGPU-CVCNQI\WT#WUUVGNNWPIXQO5GRVGO DGTDKU(GDTWCT#NVGPDWTI #TGGP'TPUV'&G0QTFKUMC.·PFGTPCU1HHKEKGNNC$GNÌPWPIUOGFCNLGT5VQEMJQNO $TGV\GPFQTHGT7YGWPF-WJP6JQOCU$WNICTKGP/KNKV·TQTFGPHÒT6CRHGTMGKVXQPDKU2TGKUMCVC NQI.WFYKIUDWTI $TGV\GPFQTHGT 7YG WPF -WJP 6JQOCU $WNICTKGP  5V #NGZCPFGT 1TFGP XQP  DKU   2TGKUMCVCNQI  $CPF.WFYKIUDWTIWPF-QPUVCP\ $CVVWUJKI#/QPIQNKCP1TFGTU/GFCNU$CFIGU7NCCPDCCVCT 5VCKT5CKPV[)W[WPF*G[FGN/CPMQQ4CHCN *I $WTMG U9QTNF1TFGTUQH-PKIJVJQQF/GTKV9KNOKPIVQP

&GNCYCTG75#  $CTCE$QTPC4GHGTGPEG%CVCNQIWG1TFGTU/GFCNUCPF&GEQTCVKQPUQHVJG9QTNFKPUVKVWVGUWPVKN2CTV+ +TQP$QQM#&<CITGD /QTTKU QH $CNIQP[ 5VWCTV ) 6JG +PUKIPKC CPF &GEQTCVKQPU QH VJG /KNKVCT[ CPF *QURKVCNNGT 1TFGT QH 5CKPV .C\CTWUQH,GTWUCNGO1JPG1TV $G[TGK­ (TKGFJGNO &GT *CWUQTFGP WPF FKG VTCIDCTGP 'JTGP\GKEJGP FGU )TQ­JGT\QIVWOU 1NFGPDWTI   0QTFGTUVGFV %JCNKH &QP /KNKVCT[ 2KNQV  #KTETGY $CFIGU QH VJG 9QTNF  2TGUGPV  8QNWOG  'WTQRG #NDCPKC *WPICT[ 5CP,QU¾ %CT 2CXGN WPF /WJKE 6QOKUNCX 5GTDKUEJG WPF LWIQUNCYKUEJG 1TFGP WPF 'JTGP\GKEJGP XQP  DKU  9KGP %CT 2CXGN WPF /WJKE 6QOKUNCX 2TGKUMCVCNQI HÒT 5GTDKUEJG WPF ,WIQUNCYKUEJG 1TFGP /GFCKNNG WPF #D\GK EJGP&GEQTCVKQPUCPF$CFIGUQH5GTDKCCPF;WIQUNCXKC2TKEG)WKFG-CVCNQI QFNKMQXCPLCK\PCMQXNLC5TDKLGK,WIQUNCXKLG.LWDNLCPCWPF<CITGD &GPMQY8GUGNKP$WNICTKUMK1TFGPKK/GFCNK-CVCNQI5QHKC 'HNGT)GTV&KG1TFGPWPF'JTGP\GKEJGPFGU(ÒTUVGPVWOU9CNFGEMWPF2[TOQPV5EJYCNOUVCFV 1JO*KGTQP[OWUUGP2CWN*CPFDWEJGWTQR·KUEJGT1TFGPKP(CTDG$GTNKP#WHNCIG )GDCWGT 9QNHTCO &KG 1TFGP WPF 'JTGP\GKEJGP XQP 5CEJUGP GKPUEJNKG­NKEJ FGT U·EJUKUEJGP 8GTFKGPUV 2T· OKGP2TGKUWPF#WU\GKEJPWPIUOGFCKNNGP&TGUFGP#WHNCIG )GDJCTFV-NCWU#NQKU$ÌTUEJ-ÌPKINKEJ$C[GTKUEJGT/ÒP\WPF*QHOGFCKNNGWT/ÒPEJGP *GTHWTVJ&KGVTKEJ5QYLGVKUEJG#WU\GKEJPWPIGP#WU\GKEJPWPIGPFGT/QPIQNKUEJGP8QNMUTGRWDNKM 'KP-CVCNQI8KGTVG#WUICDG$GTNKP#WHNCIG *ÒUMGP#PFT¾-CVCNQIFGT1TFGP'JTGP\GKEJGPWPF#WU\GKEJPWPIGPFGU-WTHÒTUVGPVWOU$TCPFGPDWTIFGT /CTMITCHUEJCHVGP$TCPFGPDWTI#PUDCEJWPF$TCPFGPDWTI$C[TGWVJFGU-ÌPKITGKEJU2TGW­GPFGT4GRWDNKM 2TGW­GPWPVGT$GTÒEMUKEJVKIWPIFGU&GWVUEJGP4GKEJGU$·PFG*CODWTI 0KOOGTIWV,ÌTI(GFGT-NCWUWPFXQPFGT*G[FG4WFQNH&GWVUEJG1TFGPWPF'JTGP\GKEJGP-CVCNQI&TKV VGU4GKEJ&&4WPF$WPFGUTGRWDNKMDKUJGWVG#WHNCIG4GIGPUVCWHCMVWCNKUKGTVG#WHNCIG -NCW­,QEJGP*GTHWTVJ&KGVTKEJWPF-NGG,ÒTIGP8KIKNCPFQ#UEGPFKOWU&KG1TFGPWPF'JTGP\GKEJGP5CEJ UGP9GKOCTUDKU#TDGKVUGZGORNCT#NU/CPWUMTKRVXGTXKGNH·NVKIV9GKOCT$GTNKPWPF-QDNGP\ -NKGVOCPP&T-WTV)GTJCTF&GWVUEJGU4GKEJ$GTNKP -NGPCW#TPJCTF)TCH'WTQR·KUEJG1TFGPCD-CVCNQIQJPG&GWVUEJNCPF4QUGPJGKO #WVGPITWDGT/KEJCGN#WMVKQP,WPK1TFGPWPF'JTGP\GKEJGP'KPGPQTFCOGTKMCPKUEJG2TKXCV UCOONWPIWC1UPCDTÒEM #WVGPITWDGT/KEJCGN#WMVKQP1MVQDGT1TFGPWPF'JTGP\GKEJGP1UPCDTÒEM .KPM'XCWPF)CWIIGN*GKP\(ÒTUVNKEJ*QJGP\QNNGTUEJG1TFGPWPF'JTGP\GKEJGP(TKFKPIGP /WUUGNN,QJP9 *I /GFCN;GCTDQQM*QPKVQP#WHNCIG 0KOOGTIWV,ÌTI&GWVUEJG1TFGPWPF'JTGP\GKEJGPDKU)GUCOVCWUICDGKPHÒPH$·PFGP/ÒPEJGP DKU 0KGOCPP &GVNGX $GYGTVWPIU-CVCNQI &GWVUEJNCPF  2TKEG )WKFG )GTOCP[  -C!C!Q!    1TFGP 'JTGP\GKEJGP8GTNGKJWPIU7TMWPFGP/KPKCVWTGPWPF'VWKU1TFGTU&GEQTCVKQPU#YCTF&QEWOGPVU/KPK CVWTGUCPF%CUGUQH +UUWG*CODWTI#WHNCIG )KNNKPIJCO*CTQNF''RJGOGTCN&GEQTCVKQPU0GY;QTM 0KOOGTIWV,ÌTIDGCTDGKVGVXQP&T)GTF5EJCTHGPDGTI&GWVUEJG1TFGPWPF'JTGP\GKEJGP #WU ICDG 4GIGPUVCWHMQORNGVVÒDGTCTDGKVGVGWPFCMVWCNKUKGTVG#WHNCIG $WPF&GWVUEJGT1TFGPUUCOONGTG8 *I 1TFGP/KNKVCTKC/CIC\KP*GHV5VGKPCWCF5VTC­G

195


LITERATUR

    10

2# 2$ 2' 2'< 2) 24- 25 4$ 447 5$ 5. 5/1 51  54 568 6# 6*1 642 66 8. 80 9$ 9< <-

196

9GTNKEJ4QDGTV1TFGTUCPF&GEQTCVKQPUQHCNN0CVKQPUņ#PEKGPVCPF/QFGTPņ%KXKNCPF/KNKVCT[9CUJKPIVQP #WHNCIG\YGKVGT&TWEM 2CXNQX2GVMQ$CNICTUMK1TFGPKK/GFCNK$WNICTKCP1TFGTUCPF/GFCNU5QHKC 2CVTKMGGX5$WPF$QLPQXKEJ#&0CITWFPKG5PCMK4QUUKK$CFIGUQH4WUUKC/QUMCWWPF5V2GVGTUDWTI  $CPF  $CPF WPF $CPF  2GVTQX6QFQT$WNICTKCP1TFGTUCPF/GFCNU5QHKC#WHNCIG KPGPINKUEJ  2GVTQY9$WNICTKUEJG#TOGGCD\GKEJGP5QHKC 2¾TG\)WGTTC,QU¾/CPWGN1TFGPGU[%QPFGEQTCEKQPGUFG'URCPC5CTCIQUUC -NGPCW#TPJCTF)TCHWPF5CWGTYCNF2GVGT&KG1TFGPWPF'JTGP\GKEJGPFGU-ÌPKITGKEJU2TGW­GP(CTDMCVC NQIOKV2TGKUGP1HHGPDCEJCO/CKP 6COOCPP)#2CPFWNC#5GKU*<KOOGTOCPP5(GFGT-*$TGV\GPFQTHGT7.KPMG4&CU&TKVVG WPF8KGTVG)WP\GPJ·WUGT2JCNGTKUVKM5[ORQUKWO1HHGPDCEJCO/CKP 4QOCPQHH2TKPEG&KOKVTK6JG1TFGTU/GFCNUCPF*KUVQT[QHVJG-KPIFQOQH$WNICTKC4WPIUVGF-[UV 4QOCPQHH2TKPEG&KOKVTK6JG1TFGTU/GFCNUCPF*KUVQT[QH+ORGTKCN4WUUKC4WPIUVGF-[UV 5EJCTHGPDGTI)GTF&KG1TFGPWPF'JTGP\GKEJGPFGT#PJCNVKUEJGP5VCCVGP1HHGPDCEJCO/CKP 5CNNCEJ#NGZCPFGTXQP&KG1TFGPWPF'JTGP\GKEJGPWPUGTGT4GRWDNKM&TKVVG#WHNCIG-QPUVCP\FTKVVGGTJGD NKEJGTYGKVGTVGWPFXQNNMQOOGPÒDGTCTDGKVGVG#WHNCIG 5QPPGPDGTI*GKP/QPIQNKUEJG#WU\GKEJPWPIGP/QPIQNKCP#YCTFU/ÒPEJGP 5EJQQU,GCP&KG1TFGPWPF'JTGP\GKEJGPFGU)TQ­JGT\QIVWOU.WZGODWTIWPFFGUGJGOCNKIGP*GT\QIVWOU 0CUUCWKP 8GTICPIGPJGKVWPF)GIGPYCTV.WZGODWTI 5EJOKVV 4CKPGT &KG #WU\GKEJPWPIGP FGT 8QNMUTGRWDNKMWPFFGT5Q\KCNKUVKUEJGP4GRWDNKM4WO·PKGPDKU 1HHGPDCEJCO/CKP 5VGXPUDQTI.CTU -QPIGTKIGV&CPOCTMU1TFGPGT/GFCNLGTQI*CGFGTUVGIP1FGPUG #WVGPITWDGT/KEJCGNWPF6COOCPP)#PFTGCU -CVCNQI\WT#WMVKQPWPF0QXGODGT1TFGP CWUCNNGT9GNVņ5COONWPI6COOCPP9QTNF1TFGTUņ%QNNGEVKQP6COOCPP$CUGN 6JQTPKV2GT6JG4Q[CN%QOOGOQTCVKXGCPF%QTQPCVKQP/GFCNUQH5ECPFKPCXKC-QRGPJCIGP 6COOCPP)WUVCX#+ORGTKCN4WUUKCP/CMGTU /CTMUQP1TFGTUCPF&GEQTCVKQPU.QPFQP 6GVTK,WJC'-WPPKCOGTMMKMKTLC*GNUKPMK#WHNCIG 8QNNG*GPPKPI$CFGPU1TFGP(TGKDWTI 8GTPQP5[FPG[$8GTPQP U%QNNGEVQTU)WKFGVQ1TFGTU/GFCNU&GEQTCVKQPU 9KVJ8CNWCVKQPU 6GOGEWNC ÒDGTCTDGKVGVG#WUHNCIG 9GDGT&KGVGT#TPQNF2CWNWPF-GKN2GVGT&KG1TFGPFGU-ÌPKITGKEJU5CEJUGP1HHGPDCEJCO/CKP 9KGNCPFV(TKGFTKEJWPF<GKV\,QCEJKO&GPMOÒP\GP\WT)GUEJKEJVGFGU\·JTKPIKUEJGPDCFKUEJGP(ÒTUVGPJCW UGUCWUFGT<GKVXQPDKU-CTNUTWJG <GKIG%CTUVGP'WTQR·KUEJG1TFGP QJPG&GWVUEJNCPF XQP2TGKUMCVCNQI*CODWTI#WU ICDG


Bei uns sind Sie goldrichtig!

• Über 35 Jahre Erfahrung im Gold- und Münzenhandel • Faire und objektive Bewertung Ihrer Goldmünzen • Barankauf von Goldmünzen zu tagesaktuellen Preisen • Große Auswahl interessanter Goldmünzen • Vertrauen Sie Europas führendem Auktionshaus für Münzen und Medaillen

Sie möchten Ihre Münzen veräußern? 0800 5836537 (gebührenfrei) Fritz Rudolf Künker GmbH & Co. KG Gutenbergstraße 23 · 49076 Osnabrück · Germany Tel. +49 (0)541 96 20 20 · Fax +49 (0)541 96 20 222 www.kuenker.de · service@kuenker.de Osnabrück · Berlin · München · Zürich · Moskau


Giovanni Battista Tiepolo (1696 – 1770). Einsetzung des Rosenkranzes. Öl, 72 x 34 cm Modeletto für die Decke der Gesuati-Kirche in Venedig. Verkauft für: e 466.000,-

Einladung zu Einlieferungen für unsere Herbstauktionen 2010 Möbel, Porzellan, Fayence, Silber, Schmuck Gemälde, Zeichnungen, Skulpturen 15.–19. Jh. Photographie Zeitgenössische Kunst Moderne Kunst Asiatische Kunst Präkolumbische Kunst

LEMPERTZ gegründet 1845

Neumarkt 3 50667 Köln Poststraße 22 10178 Berlin St.-Anna-Platz 3 80538 München www.Lempertz.com

Tel. 02 21 ⁄ 92 57 29 - 0 Fax - 6 Tel. 030 ⁄ 27 87 60 8 - 0 Fax - 6 Tel. 089 ⁄ 98 10 77 67 Fax 21 01 96 95 info@Lempertz.com


MEINE TEILNAHME ALS SCHRIFTLICHER BIETER 1. 2. 3. 4. 5. 6. 7.

Studieren Sie den Katalog sorgfältig und notieren Sie alle Lose, die interessant für Sie sind. Legen Sie für jedes Los Ihr persönliches Limit fest, das Sie maximal zu zahlen bereit sind. Füllen Sie das beiliegende Formular aus (siehe rechte Seite) und tragen Sie für jedes Los Ihr Höchstgebot ein. Schicken Sie uns Ihren Auftrag frühzeitig. Bei gleich hohen Geboten erhält das zuerst eingegangene Gebot den Zuschlag. Sie haben interessante Lose für insgesamt € 10.000,-- gefunden, möchten jedoch nur € 2.000,-- ausgeben. Kein Problem: Sie geben als Gesamtlimit (ohne Aufgeld) € 2.000,-- an. Wenn Sie Fragen haben: Die MitarbeiterInnen unserer Kundenbetreuung sind für Sie da. Tel. 08 00-58 36 537 (gebührenfrei). Wenn Sie telefonisch an unseren Auktionen teilnehmen möchten, ist das ab einer Schätzung von € 500,- pro Los möglich. Bitte teilen Sie uns diesen Wunsch mindestens einen Werktag vor Beginn der Versteigerung schriftlich mit.

MEINE PERSÖNLICHE TEILNAHME IN OSNABRÜCK 1.

2. 3.

Wir freuen uns sehr, wenn Sie persönlich nach Osnabrück kommen möchten. Das Flair einer Auktion und die Stimmung im Auktionssaal sind ein besonderes Erlebnis für Sie als Sammler. Osnabrück ist außerdem immer eine Reise wert und die persönliche Betreuung durch unsere Mitarbeiter wissen immer mehr Kunden zu schätzen. Bitte rufen Sie uns rechtzeitig an, damit wir Ihnen Tipps für die Anreise geben und Ihnen ein Hotelzimmer reservieren können. Sie erreichen uns gebührenfrei unter: 08 00-58 36 537. Als erfolgreicher Bieter können Sie Ihre neu erworbenen Stücke gleich persönlich mit nach Hause nehmen. Als guter Kunde unseres Hauses haben Sie 20 Tage Zahlungsziel nach der Auktion.

WIE ENTSTEHT DER PREIS EINER AUKTION? 1. 2.

Der im Auktionskatalog angegebene Preis ist ein Schätzpreis, der durch unsere Experten festgelegt wurde. Das Mindestgebot liegt bei 80% dieses Wertes. Die Zuschlagpreise sind oft deutlich höher als die Schätzpreise. Als Auktionshaus müssen wir bereits vor der Auktion alle schriftlichen Gebote koordinieren. Folgende Beispiele sind im Bietverfahren möglich:

Beispiel 1 (Schätzpreis: € 1.000,--) Es liegt kein schriftlicher Auftrag vor: der Auktionator ruft das Los in der Auktion mit € 800,-- aus. Wenn im Saal nur ein Bieter darauf ein Gebot abgibt, erhält der Saalbieter den Zuschlag für € 800,--.

Beispiel 3 (Schätzpreis: € 1.000,--) Es liegt dem Auktionator nur ein schriftliches Gebot von € 850,-- vor: das Los wird in der Auktion mit € 800,-ausgerufen. Falls kein Bieter im Saal ein Gegenangebot abgibt, erhält der schriftliche Bieter den Zuschlag bei € 800,--.

Beispiel 2 (Schätzpreis: € 1.000,--) Es liegen dem Auktionator drei schriftliche Gebote vor:

Beispiel 4: (Schätzpreis: € 1.000,--) Es liegt dem Auktionator nur ein schriftliches Gebot von € 1.200,-- vor: der Auktionator ruft das Los mit € 800,-- aus. Gibt es im Saal keinen Gegenbieter, erhält der schriftliche Bieter den Zuschlag bei € 800,--. Falls es im Saal Gegenbieter gibt, bietet der Auktionator für seinen schriftlichen Bieter bis maximal € 1.200,-- und erteilt einem Gegenbieter im Saal erst bei mehr als € 1.200,-- den Zuschlag.

Bieter 1: Limit € 2.900,-Bieter 2: Limit € 1.800,-Bieter 3: Limit: € 800,-Nach der Versteigerungsordnung muss der Auktionator im Interesse von Bieter 1 und 2 angemessen überbieten (um ca. 5 bis 10%). Der Ausrufpreis in der Auktion beträgt daher im Interesse von Bieter 1, € 1.900,-- (obwohl die Schätzung € 1.000,-- beträgt). Falls keine höheren Gebote aus dem Saal erfolgen, erhält Bieter 1 den Zuschlag für € 1.900,--. Das Höchstangebot von € 2.900,-- musste nicht ausgeschöpft werden.

Beispiel 5 (Schätzpreis: € 1.000,--) Es liegen drei Gebote von je € 975,-- vor: um Missverständnisse zu vermeiden, überzieht der Auktionator das zuerst eingegangene Gebot geringfügig und erteilt den Zuschlag bei € 1.000,--.


MUSTERAUKTIONSAUFTRAG FÜR SCHRIFTLICHE BIETER 1. Name, Adresse, Telefon: Ihre vollständige Anschrift ist wichtig, damit wir Ihren Auktionsauftrag annehmen und bearbeiten können. Ihre Telefonnummer brauchen wir, um Sie bei Rückfragen zu Ihren Geboten schnell erreichen zu können.

5. Ihre Kundennummer Die Angabe Ihrer Kundennummer unterstützt uns bei der Bearbeitung Ihres Auktionsauftrages. Viele Vorarbeiten für die Auktion werden dadurch einfacher und es werden Fehler vermieden.

2. Losnummern und Gebote Listen Sie alle Lose, für die Sie sich interessieren, mit ihrer Katalognummer auf und legen Sie für sich selbst fest, wie viel Sie bereit sind für jedes einzelne Los zu bieten.

6. Ihr Limit pro Einzellos An dieser Stelle geben Sie an, was Sie für jedes einzelne Stück maximal bereit sind auszugeben.

3. „Oder“-Gebote Wenn Sie sich für mehrere Münzen interessieren, aber nur ein Stück davon erwerben wollen, können Sie Ihre Gebote einfach mit einem „oder“ verbinden. Wichtig: bei den „oder“-Geboten können Sie nicht auf frühere Katalognummern zurückgreifen (z.B. 2890 oder 1558), da die Nr. 1558 dann bereits versteigert ist. 4. Unterschreiben Sie Ihren Auktionsauftrag . . .nachdem Sie Ihre Angaben noch einmal überprüft haben. Ihre Unterschrift ist wichtig, denn damit bestätigen Sie uns, dass sie tatsächlich teilnehmen wollen.

7. Überschreitung Ihrer Limits pro Einzellos In der Praxis zeigt sich, daß oft mehrere Bieter mit ihren Geboten dicht beieinander liegen. Deshalb empfiehlt es sich, an dieser Stelle einer geringfügigen Überschreitung Ihrer Gebote zuzustimmen. Dadurch erhöhen sich Ihre Chancen, im Wettbewerb mit anderen den Zuschlag zu erhalten. 8. Begrenzung Ihres Gesamtlimits Hier können sie die Gesamtsumme Ihrer Gebote begrenzen und festlegen, was Sie insgesamt maximal bereit sind auszugeben. Aufgeld und Mehrwertsteuer kommen später noch hinzu.

ANTWORTEN AUF FRAGEN, DIE UNS OFT GESTELLT WERDEN 1.

Zuschlagpreis/Aufgeld: Wir berechnen als Auktionshaus ein Aufgeld von 15% auf den Zuschlagpreis, dazu kommt die gesetzliche Mehrwertsteuer. Beispiel 2: Zuschlagpreis: € 1.000,-€ 100,-Aufgeld 15% € 150,-€ 15,00 Versandkosten, z. B.* € 5,90 € 5,90 MwSt. 7% € 80,91 € 8,46 ______ ________ Rg.-Betrag € 1.236,81 Rg.-Betrag € 129,36 Mehrwertsteuer: üblicherweise in Deutschland 7%, seit dem 01.01.2000 sind viele Goldmünzen, die nach 1800 geprägt wurden, steuerfrei. Bei Fragen zu der MWSt-Berechnung rufen Sie uns an, gebührenfrei unter: 08 00-58 36 537. Rücklosverkauf: Alle Lose, die in der Auktion nicht verkauft wurden, können Sie innerhalb von vier Wochen nach der Versteigerung zu 80% des Schätzpreises (zzgl. Aufgeld und Mehrwertsteuer) erwerben. Achtung: Viele Rücklose sind schnell vergriffen. Unser Spezialservice: Alle Bieter erhalten gratis die Ergebnisliste innerhalb von zwei Wochen nach der Auktion. Im Internet können Sie die Ergebnisliste der Auktion sofort nach der Auktion unter www.kuenker.de einsehen. Beispiel 1:

2. 3.

4.

Zuschlagpreis Aufgeld 15%: Versandkosten, z. B.* MwSt. 7%

* Die Kosten für Versand und Versicherung werden nach Aufwand berechnet.


ВАЖНАЯ ИНФОРМАЦИЯ ОБ УЧАСТИИ В АУКЦИОНЕ 1. 2. 3. 4. 5. 6. 7. 8.

Наши аукционные правила и условия Вы можете найти в конце каталога. Мы просим Вас присылать Ваши ставки заранее. В противном случае вероятность ошибки при обработке заказа, присланного перед самым аукционом, возрастает. Приложенный образец заполнения письменного заказа поможет Вам при отправлении Ваших письменных ставок. Ставки можно отправить как по почте, так и по факсу : +49 (0)541–96 20 222 круглосуточно. Успешные заказы будут обрабатываться в порядке их поступления к нам. Все участники, которым не удалось что-либо купить на аукционе, будут также проинформированы после аукциона. Если Вы впервые принимаете участие в нашем аукционе, то мы рекомендуем Вам сообщить нам Ваш референц – аукционные дома, с которыми Вы уже сотрудничали. Или свяжитесь с нами по телефону. Мы гарантируем подлинность всех предметов, проданных на нашем аукционе, в течении неограниченного времени. Все участники нашего аукциона получают в течении 2-ух недель результаты торгов бесплатно. У Вас есть вопросы по определенной монете? Вы хотели бы лично принять участие в аукционе? У Вас возникли другие вопросы? Звоните нам по телефону +49 (0)541-96 20 268, и мы будем рады Вам помочь.

МОЕ ЗАОЧНОЕ УЧАСТИЕ В АУКЦИОНЕ 1. 2. 3. 4. 5. 6.

Тщательно изучите наш каталог и запишите те лоты, которые Вас заинтересовали. Определите для Себя ту максимальную сумму, которую Вы готовы заплатить за каждый лот. Заполните приложенный формуляр. Отправьте нам Ваш заказ заранее. При 2-ух и более равных ставок на один и тот же лот преимущество получает ставка, пришедшая к нам первой ( ранее других). Если стоимость выбранных Вами лотов составляет например 10000 евро, а Вы могли бы потратить только 2000 евро, то в этом случае укажите Ваш общий лимит в размере 2000 евро. Если у Вас возникли вопросы по заполнению формуляра, звоните нам по телефону +49 (0)541-96 20 268. Наши сотрудники будут рады Вам помочь.

МОЕ ЛИЧНОЕ УЧАСТИЕ В ОСНАБРЮКЕ 1. 2. 3.

Мы будем рады Вашему личному присутствию в Оснабрюке. Атмосфера, которая стоит во время аукционных торгов в зале, особенная и непередаваемая. Для получения более подробной информации по Вашей поездке в Оснабрюк, в частности, бронирования номеров в гостинице, мы просим Вас заранее связаться с нами по телефону: +49 (0)541-96 20 268. Приобретенные на аукционе лоты Вы можете лично забрать после окончания торгов. Наши постоянные клиенты осуществляют оплату в течение 20 дней после получения счета. Участвующие в аукционе впервые осуществляют 100%-ую предоплату.

УЧАСТИЕ ПО ИНТЕРНЕТУ Все каталоги доступны для просмотра на нашем сайте в интернете по адресу www.kuenker.de. На сайте Вы можете выбрать интересующие Вас лоты и отправить Ваши ставки на нашу электронную почту service@kuenker.de. Если у Вас возникнут дополнительные вопросы, мы просим Вас связаться с нами по телефону +49 (0)5 41-96 20 268.

УЧАСТИЕ ПО ТЕЛЕФОНУ Для участия в торгах по телефону просим Вас связаться с нами не позднее 48 часов до начала аукциона. Условием проведения телефонных торгов является письменное подтверждение ставки, равной как минимум стартовой цене. Участие в телефонных торгах возможно только для лотов со стартовой ценой свыше 500 евро. Для получения дополнительной информации и регистрации на аукционе звоните Анастасии Кепселль до аукциона по телефону +49 (0)5 41-96 20 268 и во время аукциона по телефону, указанному на первой странице каталога.


КАК ОБРАЗОВЫВАЕТСЯ ЦЕНА НА АУКЦИОНЕ? 1. 2.

Все лоты в нашем каталоге были предварительно оценены нашими экпертами. Минимальная ставка составляет 80% от оценочной стоимости лота. Конечные цены зачастую намного превышают оценочные. Ваши письменные ( заочные ) ставки должны быть обязательно обработаны нашими сотрудниками до начала аукциона. Рассмотрим несколько возможных примеров: Пример 1 ( Оценочная стоимость: € 1.000,-- ) Пример 3 (Оценочная стоимость: € 1.000,-- ) Заочных ставок нет. Аукционатор начинает торги с У аукционатора имеется только 1 заочная ставка в €800,--. Если в зале только один человек, размере € 850,--. Аукционатор начнет торги с желающий приобрести этот лот, то соответственно € 800,--. Если среди очных участников никто не он получит его за €800,--. даст более высокую ставку, то заочный участник получит этот лот за €800,-Пример 2 ( Оценочная стоимость: € 1.000,-- ) У аукционатора имеются 3 заочные ставки: Заочный участник 1 : Лимит € 2.900,-Заочный участник 2 : Лимит € 1.800,-Заочный участник 3 : Лимит € 800,-По правилам аукциона аукционатор в интересах заочного участника 1 и 2 должен повышать ставку равномерно ( приблизительно на 5 – 10% ). Поэтому в нашем случае в интересах заочного участника 1 аукционатор начнет торги с € 1900,-( хотя оценочная стоимость составляет €1000,--). Если среди очных участников никто не даст более высокую ставку, то заочный участник 1 получит этот лот за €1900,--. Его лимит в €2900,-- ни в коем случае не будет исчерпан.

Пример 4 (Оценочная стоимость: € 1.000,-- ) У аукционатора имеется только 1 заочная ставка в размере €1200,--. Аукционатор начнет торги с €800,--. Если среди очных участников никто не даст более высокую ставку, то заочный участник получит этот лот за €800,--. Если же в зале очный участник согласен на более высокую ставку ( больше €800,-- ), то в этом случае аукционатор в интересах заочного участника имеет право тоговаться до €1200,--. Следовательно только при ставке, превышающей €1200,--, данный лот получит очный участник в зале. Пример 5 (Оценочная стоимость: € 1.000,-- ) У аукционатора имеются 3 заочные ставки, каждая в размере €975,--. Среди очных участников интереса к лоту не имеется. В этом случае чтобы избежать недоразумений, аукционатор имеет право ненамного повысить лимит и сделать ставку равной €1000,--. Данный лот за €1000,-- получит тот заочный участник, чей письменный формуляр мы получили раньше всего.

КАК Я МОГУ ПОЛУЧИТЬ ПРИОБРЕТЕННЫЕ ЛОТЫ? Вывоз приобретенных на аукционе предметов осуществляется одним из следующих способов по Вашему выбору: • Вы можете лично забрать Ваши лоты. По окончании торгов мы готовим все необходимые документы на вывоз из Германии. При вывозе за пределы Евросоюза, НДС Вам возвращается. • Почтовые отправки в Россию ( Беларусь, Украину ) приобретенных Вами лотов осуществляются по предварительной договоренности. Для связи с нами звоните нам по телефону +49 (0)541-96 20 268.

С 1971 года имя Кюнкер является гарантией надежности и компетентности. Мы не станем изменять нашим принципам и в будущем. Спасибо Вам за Ваше доверие, которое является не только самым сильным стимулом в нашей работе, но и наилучшей ее оценкой. Я желаю Вам успехов на нашем аукционе!

Фриц-Рудольф Кюнкер


VERSTEIGERUNGSBEDINGUNGEN Die Versteigerung erfolgt im Auftrag und für Rechnung der Eigentümer unter Einhaltung der sich aus der Versteigerungsordnung (BGB1 I 1976, 1346) ergebenden und für Kommissionäre geltenden gesetzlichen Bestimmungen des BGB und HGB gegen Barzahlung des Kaufpreises in € - Währung. Durch Abgabe eines Gebotes werden die Versteigerungsbedingungen anerkannt, dies gilt auch für die schriftlichen Gebote. Der Zuschlagpreis ist Nettopreis im Sinne des Umsatzsteuergesetzes und bildet die Berechnungsgrundlage für das vom Käufer zu zahlende Aufgeld in Höhe von 15 %. Auf den daraus entstehenden Gesamtpreis (Zuschlag + Aufgeld) wird die jeweils gültige Umsatzsteuer erhoben, soweit dies gesetzlich vorgeschrieben ist. Ausländischen Käufern aus Ländern der europäischen Gemeinschaft wird die in Deutschlang gültige Umsatzsteuer berechnet. Anderen ausländischen Käufern (aus Drittländern) wird, sofern die Münzen durch uns exportiert werden, ein Aufgeld von 15 % netto auf den Zuschlagpreis berechnet; sie erhalten die Lieferung nur gegen Zahlung des Kaufpreises in € - Währung, bankspesenfrei. Ausländischen Münzhändlern aus Ländern der europäischen Gemeinschaft wird bei Nachweis der Umsatzsteuer-Identifikationsnummer (§ 27 a UStG) und der sonstigen Voraussetzungen gemäß § 4 Nr. 1 b UStG in Verbindung mit § 6 a UStG die Lieferung ohne Umsatzsteuer berechnet. Sofern nichts anderes vereinbart wird, ist die Zahlung der Auktionsrechnung bei anwesenden Käufern sofort, bei schriftlichen Bietern spätestens 20 Tage nach Erhalt fällig. Bei Zahlungsverzug werden Zinsen von 1 % pro Monat berechnet. Wird die Zahlung nicht sofort an den Versteigerer geleistet oder die Abnahme der zugeschlagenen Sache verweigert, so findet die Übergabe der Sache an den Ersteigerer nicht statt. Der Ersteigerer verliert vielmehr seine Rechte aus dem Zuschlag, und die Sache kann auf seine Kosten erneut versteigert werden. In diesem Fall haftet der Ersteigerer für den Ausfall, dagegen hat er auf den Mehrerlös keinen Anspruch. Der Zuschlag erfolgt nach dreimaligem Ausruf des höchsten Gebotes und verpflichtet zur Abnahme und Zahlung. Bei Meinungsverschiedenheiten über den Zuschlag wird die Nummer noch einmal ausgerufen. Der Versteigerer ist berechtigt, Nummern zu vereinigen oder zu trennen. Eine Vorausnahme von Nummern erfolgt nicht. Der Zutritt zur Versteigerung ist nur Interessenten gestattet, die einen Katalog besitzen.

Schriftliche Aufträge werden von uns ohne Auftragsprovision gewissenhaft ausgeführt. Aufträge von uns unbekannten Sammlern können nur ausgeführt werden, wenn ein Depot hinterlegt wird oder Referenzen benannt werden. Schriftliche Gebote können nur bis 24 Stunden vor Auktionsbeginn verbindlich berücksichtigt werden. Im Bedarfsfall ist der Auktionator berechtigt, die Limits um 3 – 5 % zu überschreiten. Bei mehreren gleichhohen Geboten erhält das zuerst eingegangene den Zuschlag. Unlimitierte Aufträge haben keinen Anspruch auf unbedingte Ausführung. Telefonisches Bieten ist nur in Ausnahmefällen möglich. Telefonische Bieter müssen sich mindestens einen Werktag vor der Auktion voranmelden. Der Versand geht zu Lasten und auf Risiko des Ersteigerers bzw. Empfängers. Das Auktionsgut bleibt bis zur vollständigen Bezahlung aller Forderungen aus Anlaß der Versteigerung Eigentum des Verkäufers. Ist der Käufer Vollkaufmann, so ist Osnabrück als Gerichtsstand vereinbart. Für das Mahnverfahren gilt die Zuständigkeit des Amtsgerichts Osnabrück auch in allen anderen Fällen als vereinbart. Ansonsten ist es Osnabrück nur, wenn nur die Firma Fritz Rudolf Künker GmbH & Co. KG ihren allgemeinen Gerichtsstand in der BRD hat, oder wenn alle Ansprüche im Wege des Mahnverfahrens geltend gemacht werden, oder wenn die im Klageweg in Anspruch zu nehmende Vertragspartei nach Vertragsabschluß ihren gewöhnlichen Aufenthaltsort aus dem Geltungsbereich der BRD verlegt hat, oder ihr Wohnsitz oder gewöhnlicher Aufenthaltsort zum Zeitpunkt der Klage nicht bekannt ist. Die Beschreibung im Katalog ist gewissenhaft durchgeführt. Sie begründet jedoch keine Rechts- oder Sachmängelhaftung gemäß §§ 434, 459 ff BGB. Die Angabe der Erhaltung ist streng nach den im deutschen Münzhandel üblichen Erhaltungseinstufungen vorgenommen und gilt als persönliche Beurteilung. Bei der Auktion anwesende Käufer kaufen grundsätzlich „wie besehen“. Da durch Vorbesichtigung Gelegenheit gegeben ist, sich vom Erhaltungszustand des Versteigerungsgutes zu überzeugen, können nach erfolgtem Zuschlag Reklamationen nur bei irrtümlich übersehener Henkel- oder Fassungsspur oder gestopftem Loch berücksichtigt werden. Bei Losen mit mehreren Stücken sind die Stückzahlen nur Circa-Angaben, irrtümliche Zuschreibungen sind im Einzelfall nicht ausgeschlossen. Diese Lose sind nach erfolgtem Zuschlag von jeder Reklamation ausgeschlossen. Der Versteigerer kann bei eventuellen Meinungsverschiedenheiten bzw. Beanstandungen einen vereidigten Sachverständiger seiner Wahl (die Kosten trägt der unterliegende Teil) beauftragen. Eventuelle Beanstandungen können nur innerhalb von 8 Tagen nach der Auktion bzw. nach Erhalt der ersteigerten Stücke berücksichtigt werden.

Die Mindeststeigerungsstufen für das Bietungsverfahren betragen:

Mindestangebote

Mindeststeigerungsstufe

Wenn Sie in unserer Auktion erworbene Münzen an einen Grading Service in den USA verschicken möchten, übernehmen wir keine Garantie, daß die Münzen dort angenommen oder entsprechend unserer Bewertung eingestuft werden.

bis zu

€ 100,--

€ 5,--

bis zu

€ 200,--

€ 10,--

bis zu

€ 500,--

€ 20,--

bis zu

€ 1.000,--

€ 50,--

bis zu

€ 2.000,--

€ 100,--

bis zu

€ 5.000,--

€ 200,--

bis zu

€ 10.000,--

€ 500,--

Soweit nicht anders vermerkt, gelten im übrigen die allgemeinen Versteigerungsbestimmungen und – auch im Verhältnis zu ausländischen Kunden – gilt Deutsches Recht.

bis zu

€ 20.000,--

€ 1.000,--

Die Ergebnisliste erscheint sofort nach der Auktion.

bis zu

€ 50.000,--

€ 2.000,--

DIE VERSTEIGERER:

ab

€ 50.000,--

€ 5.000,--

Die Echtheit der Stücke wird bis zur Höhe des Kaufpreises garantiert. Die beigedruckten Preise sind Schätzpreise, die unter- oder überschritten werden können. Aufträge, die unter 80 % des Schätzpreises liegen, können nicht bearbeitet werden. Ausländische Kunden kaufen nach den Devisen-, Zoll- und Steuerbestimmungen ihres Landes. Versandformalitäten werden vom Versteigerer erledigt.

FRITZ RUDOLF KÜNKER DR. ANDREAS KAISER ARNE KIRSCH OLIVER KÖPP


TERMS AND CONDITIONS OF AUCTION The auction is conducted on behalf and for the account of the appropiate proprietors of the goods and is subject to the federal Auction Regulation (Versteigerungsordnung, BGB1 I 1976, 1346) published in the Federal Law GazetteVol. I, 1976, 1346 and the relevant provisions for factors in accordance with the German Cicil Code (BGB) and Commercial Code (HGB). Payment of the hammer-price has to be made in cash and in Euro. The submission of an offer implies the express acknowledgement of these Terms and Conditions of Auction; the same applies to the submission of an offer in writing. The hammer-price is exclusive of applicable German VAT according to the prevailing VAT – legislation and represents the basis for calculating the surcharge of 15 percent payable by the puchaser. The total price so calculated (hammerprice plus surcharge) is subject to the VAT (value added tax=Mehrwertsteuer), which is payabel additionally. Purchasers from abroad will be charged a surcharge of 15 per cent net on the hammer-price, provided the export of the coins is undertaken by the auctioneer. Buyers in European Community (EEC) countries (other than Germany) will be charged Value Added Tax at the rates prevailing in Germany. Dealers from EEC countries (other than Germany) will receive goods free of tax upon presentation of their VAT I.D. number, and upon fulfillment of the other conditions set forth in Paragraph 4, Nr. 1 b, and Paragraph 6 a of the GermanTurnover Tax Law Buyers from other countries are not charged Value Added Tax. Delivery will be made against payment in Euro with no bank charges to the auctioneer. Unless mutually agreed otherwise, payment of the auction bill from purchasers present at the auction is due immediately. From purchaser who have submitted a bid in writing, payment is due within 20 days after receipt of the goods. Defaulted payments shall bear an interest charge of 1 % per month in the amount in default. Should payment to the auctioneer not be made immediately or should the acceptance of the awarded item be refused, such item shall not be handed overt to the purchaser. Instead the purchaser shall forfeit all right and title in and to such item from the award and the item may again be put to auction at this buyer’s cost. In this event the buyer shall be liable for any shortfall, while he shall have no right or claim towards any excess proceeds. An item will be knocked down after the highest bid has been called three times. The award shall be a binding commitment and liability on the part of the bidder to take acceptance and delivery of the item or items so awarded. In the event of any dispute with regard to the award the lot will be put up again for bidding. The auctioneer reserves the right to combine or to seperate lots. Lots will not be called out of sequence. Access to the auction will only be permitted to interested persons who are in possession of the catalogue.

same price or prices for a given lot, the bid first received by the auctioneer shall be given the award. Unlimited bids shall not oblige the auctioneer to consider, accept or carry out such order. Telephone bidding is generally an option for lots of substantial value only. The registration is required at the latest a day before auction. Shipment (by mail or otherwise) of the goods shall be for the sole cost and risk of the purchaser or receipient, resp. The auctioned goods remain the sole and exclusiv property of the vendor until full payment and settlement of any and all dues and claims in connection with the auction. In the event the purchaser is a merchant (in the sense of the German commercial laws) Osnabrück shall be the agreed and exclusive place of jurisdiction. The competence of the District Court (Amtsgericht) of Osnabrück is agreed in respect of summary proceedings for the collection of defaulted payments (Mahnverfahren) as well as in any and all other cases. Should the purchaser not be a merchant Osnabrück shall be the place of jurisdiction with the District Court of Osnabrück’s competence, if only the auctioneer has his ordinary legal domicil in the Federal Republic of Germany or if claims are made by way of summary proceedings of collection (Mahnverfahren) or if the defendant has moved his ordinary legal domicil outside the jurisdiction of the Federal Republik of Germany or if the legal domicil of the defendant is unknown to the auctioneer at the time of filing a suit. To the exclusion of any other legislation German law, as in force at the time, shall be applied for the settlement of any and all legal or judicial matters. The specifications and descriptions in the catalogue have been prepared diligently and in good faith do, however, not constitute the acceptance by the auctioneer of any warranty or liability in respect of defect in material or title. The state of preservation of items is strictly assessed in accordance with the grades accepted by the German coin trade and only represents an individual and personal assessment. Purchasers present at the auction acquire items strictly on the basis of “as is where is” and “as inspected”. In view of the opportunity of prior inspection to ascertain the state and condition of the auction lots, complaints and objections made after the sale will only be considered, if by obvious error or mistake loop or traces or moutings, traces of trimmings or settings, or the plugging of a hole (eyelet) have remained unnoticed. If and when auctioned in lots, the quantities of individual pieces given, only represent an approximate figure. An error in the allocation of indivdual pieces to a certain lot cannot be excluded. Such lots are, therefore, excluded from any complaintes or objections after the lot is knocked down. In the event of disputes or complaints as to the quality of an item the auctioneer may call upon a gernerally sworn expert of the trade, which the auctioneer may choose at his sole discretin, for assessment an the rendering of a decision as to the justification of such dispute or complaint. The costs of such expert shall be borne by the party loosing the dispute according to the expert’s decision. Complaints or objections, if justified, will only be considered if made and received by the auctioneer within 8 days after the auction or after receipt the lots, respectively.

The minimum rates of increase for the bidding procedure are: for minimum offers

minimum increase rate

up to

€ 100,--

€ 5,--

up to

€ 200,--

€ 10,--

up to

€ 500,--

€ 20,--

up to

€ 1.000,--

€ 50,--

up to

€ 2.000,--

€ 100,--

up to

€ 5.000,--

€ 200,--

up to

€ 10.000,--

€ 500,--

up to

€ 20.000,--

€ 1.000,--

up to

€ 50.000,--

€ 2.000,--

above

€ 50.000,--

€ 5.000,--

Orders submitted in writing will be carried out diligently and without charge of an extra commission. Orders from collectors unknown to the auctioneer can only be accepted and carried out if a deposit or references to the satisfaction on the auctioneer are given. To be bindingly accepted, written bids need to be received at least 24 hours before auction. If necessary, the auctioneer is allowed to increase the bids by 3-5%. Should several bids be obtained in writing bidding the

If a coin that is sold by us is sent to a grading service ("slabbing"), we do not guarantee that the coin will be slabbed (nor that it will be slapped at any particular grade or with any particular comments); however, we always warranty that each coin or numismatic item we sell will be genuine. The authenticity of the coins is warranted. Warranted up to the total purchase price. The prices set out in the catalogue are estimates only, which may bei exceeded or undercut. Orders for less than 80 per cent of the estimated price cannot accepted. Purchasers from abroad will have to observe all applicable laws and regulations in respect of foreign exchange, customs duties and taxation of their country. The auctioneer will only discharge such formalities, which have to be observed, in the Federal Republic of Germany in connection with the export of the purchased item(s). Unless stipulated otherwise herein, the general rules regulations for auctions applicable in Germany shall govern any transaction in respect of the auction; German Law shall also be applicable in relation to purchasers form abroad. Only the German text has legal forde. The prices realized will be published in the form of a list immediately after the auction.

THE AUCTIONEERS:

FRITZ RUDOLF KÜNKER DR. ANDREAS KAISER ARNE KIRSCH OLIVER KÖPP


NUMISMATISCHE AUSDRÜCKE EXPRESSIONS NUMISMATIQUES NUMISMATIC TERMS TERMINI DI NUMISMATICA НУМИЗМАТИЧЕСКИЕ ТЕРМИНЫ

DEUTSCH

ENGLISCH

FRANÇAIS

ITALIANO

RUSSISCH

Abschlag Am Rand Berieben Blei Dezentriert Doppelschlag Einfassung Einseitig Emailliert Erhaltung Etwas Exemplar Fassungsspuren Fehlpr?gung

struck at the rim/border slightly polished lead uncentered double struck frame uniface enamelled condition/preservation slightly specimen, copy trace of mounting mis-strike

frappe en tranche frotté plomb décentré double frappe encadrement uniface émaillé conservation un peu exemplaire traces de monture défaut de frappe

coniazione al bordo trattato piombo non centrato ribattitura cornice uniface smaltato conservazione un poco esemplare tracce di montatura difetto di coniazione

Feld(er) Fundexemplar Gedenkmünze Gegl?ttet Gelocht Geprägt Gewellt Goldpatina Henkelspur Hübsch Jahrh. = Jahrhundert. Kl. = klein Korrosionsspuren Kratzer Kupfer Legierung Leicht(e) l. = links Min. = minimal Nachahmung Prachtexemplar

field(s) specimen from a hoard commemorative coin tooled holed minted bent golden patina mount mark attractive century small traces of corrosion scratch(es) copper alloy slightly left minimal imitation attractive, perfect piece

champ exemplaire de trouvaille monnaie commémorative retouch? trou? frappé ondulé patine dorée Trace de monture joli siècle petit traces de corrosion rayure cuivre alliage légèrement gauche minime imitation pièce magnifique

campo da tesoretto moneta commemorativa liscio bucato coniato ondolato patina d´oro Tracce di appicagnolo carino secolo piccolo segni di corrosione graffio(i) rame lega leggero sinistra minimamente contraffazzione esemplare magnifico

Prägeschwäche Randdelle Randfehler Randschrift r. = rechts Rückseite Schriftspuren

weakly struck edge nick edge faults lettered edge to right reverse traces of inscription

de frappe faible défaut sur la tranche erreur sur la tranche tranche inscrite droite revers traces de légende

conio stanco ammaccatura al bordo errore nel bordo inscrizione sul bordo destra rovescio tracce di leggenda

Schrötling Schrötlingsfehler Schwach ausgeprägt Selten in dieser Erhaltung

flan flan defect weakly struck rare in this condition

flan flan défectueux de frappe faible rare en cet état

tondello errore di tondello conio stanco conservazione rara

Seltener Jahrgang Stempel Stempelfehler Überdurchschnittlich erhalten Überprägt Unediert

rare year die(s) mistake in the die extraordinary condition

année rare coin erreur de frappe conservation extraordinaire

annata rara conio errore di conio conservazione estraordinaria

ОТТИСК НА ГУРТЕ ПОТЕРТАЯ СВИНЕЦ АССИМЕТРИЧНЫЙ ДВОЙНОЙ ЧЕКАН КАЙМА ОДНОСТОРОННЯЯ ЭМАЛИРОВАННАЯ СОХРАННОСТЬ СЛЕГКА ЭКЗЕМПЛЯР СЛЕДЫ ОБРАБОТКИ ОШИБКА В ПРОЦЕССЕ ЧЕКАНКИ ПОЛЕ ЭКЗЕМПЛЯР ПАМЯТНАЯ МОНЕТА ОТГЛАЖЕННАЯ ПРОКОЛАТАЯ ОТЧЕКАНЕННАЯ ВОЛНИСТАЯ ЗОЛОТАЯ ПАТИНА СЛЕДЫ ОТ УШКА КРАСИВАЯ СТОЛЕТИЕ МАЛЕНЬКИЙ СЛЕДЫ КОРРОЗИИ ЦАРАПИНА МЕДЬ СПЛАВ ЛЕГКИЙ СЛЕВА МИНИМАЛЬНЫЙ ИМИТАЦИЯ ПРЕВОСХОДНЫЙ ЭКЗЕМПЛЯР ИЗДЕРЖКН ПРИ ЧЕКАНКE ВМЯТИНА НА ГУРТЕ ОШИБКА НА ГУРТЕ ГУРТОВАЯ НАДПИСЬ СПРАВА РЕВЕРС СЛЕДЫ ПРЕДЫДУЩЕЙ НАДПИСИ ЗАГОТОВКА БРАК ЗАГОТОВКИ СЛАБО ОТЧЕКАНEНА РЕДКАЯ В ТАКОЙ СОХРАННОСТИ РЕДКИЙ ГОД ШТАМП ОШИБКА ШТАМПА СОХРАННОСТЬ ВЫШЕ СРЕДНЕГО

overstruck unpublished

surfrappé in?dit

ribattuto inedito

Unikum Vergoldet Von allergrößter Seltenheit Vorderseite Winz.= winzig Zain Zierrand Zinn ziseliert

unique specimen gilt extremely rare head tiny flan ornamental border tin chased

unique doré de toute rareté en face petit flan tranche ornée ?tain ciselé

pezzo unico dorato di estrema raritá diritto veramente piccolo tondello taglio ornato stagno cesellato

ПЕРЕЧЕКАН НЕОПУБЛИКОВАННАЯ МОНЕТА УНИКАЛЬНАЯ ПОЗОЛОЧЕННАЯ НАИРЕДЧАЙШАЯ АВЕРС НЕЗНАЧИТЕЛЬНЫЙ ЗАГОТОВКА ДЕКОРАТИВНЫЙ ГУРТ ЦИНК ГРАВИРОВАННЫЙ


Künker eAuctions

Künker eAuctions

Unsere eAuctions umfassen circa 250 Losnummern. In einem festgelegten Zeitraum von 14 Tagen haben Sie die Möglichkeit, online auf die für Sie interessanten Münzen und Medaillen zu bieten. Die einzelnen Losnummern laufen zeitlich versetzt aus. Selbstverständlich werden Sie über Ihren aktuellen Gebotsstatus laufend per Email informiert und können Ihre Gebote bei Bedarf bis zur letzten Sekunde erhöhen.

Our eAuctions contain 250 lots. During a fixed period of 14 days you have the opportunity to submit your bids online on your favourite coins and medals.

Weitere Informationen und die nächsten Termine zu den Künker eAuctions finden Sie unter:

You may find further information and the next dates of the Künker eAuctions here:

www.kuenker.de

www.kuenker.com

Each lot will expire at different times. Certainly you will be informed constantly by email about the current status of your bids so that you permanent have the possibility – if necessary – to raise your bids till the end of the eAuction.

Fritz Rudolf Künker GmbH & Co. KG Gutenbergstraße 23 · 49076 Osnabrück · Germany Tel. +49 (0)541 96 20 20 · Fax +49 (0)541 96 20 222 www.kuenker.de · service@kuenker.de Osnabrück · Berlin · München · Zürich


IMPRESSUM NUMISMATISCHE BEARBEITUNG FOTOS LAYOUT DRUCK

Michael Autengruber, Alexandra Spreu, Dr. Sebastian Steinbach, Jens Ulrich Thormann M. A., Eva Weber, Manuela Weiß Lübke & Wiedemann, Stuttgart danner pc - gesteuerte systeme waiblingen meister print und media, Kassel Jeglicher Nachdruck, auch auszugsweise, bedarf der Genehmigung des Auktionshauses

ZAHLUNGEN AUS DEM INLAND Deutsche Bank Osnabrück Dresdner Bank Osnabrück Sparkasse Osnabrück Volksbank eG Bad Laer-Borgloh-Hilter-Melle Bankhaus Lampe KG, Bielefeld Postbank Hannover HypoVereinsbank München WestLB Dortmund Paypal

(BLZ 265 700 90) Konto-Nummer 0 177 006 (BLZ 265 800 70) Konto-Nummer 780 520 200 (BLZ 265 501 05) Konto-Nummer 247 320 (BLZ 265 624 90) Konto-Nummer 1 200 222 400 (BLZ 480 201 51) Konto-Nummer 174 076 (BLZ 250 100 30) Konto-Nummer 2900 60-308 (BLZ 700 202 70) Konto-Nummer 24 17 952 (BLZ 440 500 00) Konto-Nummer 1128 842 paypal@kuenker.de, Service charge: 3,5 %

ZAHLUNGEN AUS DEM AUSLAND - FOREIGN PAYMENTS Deutsche Bank Osnabrück Sparkasse Osnabrück Postbank Hannover Credit Suisse-5288 Credit Cards Paypal

IBAN: DE11 2657 0090 0017 7006 00 Swift-Code: DEUTDE3B265 IBAN: DE50 2655 0105 0000 2473 20 Swift-Code: NOLADE22XXX IBAN: DE73 2501 0030 0290 0603 08 Swift-Code: PBNKDEFF IBAN: CH88 0483 5013 5494 4200 1 Swift-Code: CRESCHZZ81Z We do accept VISA and MASTERCARD, Service charge: 4,5 % paypal@kuenker.de, Service charge: 3,5 %

ZAHLUNGEN INNERHALB RUSSLANDS - PAYMENTS WITHIN RUSSIA Deutsche Bank Moskau ʽʽʽΗʪ̸̨̜̖ʥ̡̦̌Η

ИНН 7728717332; КПП 772801001 Получатель: ЗАО "Кюнкер" счет №: 40702810500000000825; БИК: 044525101 корсчет №: 30101810100000000101

ERHALTUNGS- UND SELTENHEITSGRADE Orden, Ehrenzeichen und historische Sammlungsgegenstände sind Objekte, die zum Tragen bzw. zum Gebrauch bestimmt waren und somit einer naturgemäßen Abnutzung unterliegen. Besonders bei frühen Exemplaren berücksichtigt die Erhaltungseinstufung das Alter. Mängel oder Beschädigungen, die über das übliche Maß hinausgehen, werden in der Beschreibung ausdrücklich erwähnt. Wir weisen in diesem Zusammenhang auch ausdrücklich darauf hin, daß der Kunde die Möglichkeit zur Vorbesichtigung vor der Versteigerung hat. Erhaltungsangaben als Ergebnis subjektiver Betrachtung sind kein Bestandteil der Beschreibung. Der jeweilige Erhaltungszustand ist nach der Beschreibung wie folgt angegeben: I II III IV

= = = =

Prachtexemplar, neuwertig oder neu; vorzüglich erhalten, mit kleinen Gebrauchsspuren; gut erhalten, mit Gebrauchsspuren; mit sehr deutlichen Gebrauchsspuren

Auktion 173 Künker  

Orden und Ehrenzeichen aus verschiedenem Besitz

Read more
Read more
Similar to
Popular now
Just for you