Page 1


154. AUKTION DER MÜNZSCHATZ VON HERBORN MÜNZEN UND MEDAILLEN AUS MITTELALTER UND NEUZEIT 23. - 24. Juni 2009 Steigenberger Hotel Remarque Osnabrück Natruper-Tor-Wall 1 Hotel-Telefon +49 (0)5 41-60 96 633 Hotel-Fax +49 (0)5 41-60 96 634 (nur während der Auktion/only during the auction/ uniquement pendant la vente/solamente durante l'asta/solamente durante la subasta/только во время аукциона)

ZEITPLAN AUKTIONEN 154 - 157 AUKTION 154 DER MÜNZSCHATZ VON HERBORN MÜNZEN UND MEDAILLEN AUS MITTELALTER UND NEUZEIT

Dienstag, den 23. Juni 2009 9.30 Uhr - 13.00 Uhr Nr. 1 bis Nr. 655 14.00 Uhr - 19.00 Uhr Nr. 656 bis Nr. 1681 Mittwoch, den 24. Juni 2009 9.30 Uhr - 13.00 Uhr Nr. 1682 bis Nr. 2306

AUKTION 155 1000 GOLDPRÄGUNGEN AUS 3 JAHRTAUSENDEN DEUTSCHE MÜNZEN AB 1871

14.00 Uhr - 19.00 Uhr Nr. 3001 bis Nr. 4000 Donnerstag, den 25. Juni 2009 9.30 Uhr - 11.30 Uhr Nr. 4001 bis Nr. 4532

AUKTION 156 DIE SAMMLUNG DER FREIHERREN BONDE

11.30 Uhr - 13.00 Uhr Nr. 5001 bis Nr. 5200

AUKTION 157 RUSSISCHE MÜNZEN UND MEDAILLEN

14.00 Uhr - 19.00 Uhr Nr. 6001 bis Nr. 6628 Freitag, den 26. Juni 2009 9.30 Uhr - 13.00 Uhr Nr. 6629 bis Nr. 7012

Detaillierter Zeitplan siehe Seite 5 Besichtigungen siehe Seite 10 Horaire détaillé voir page 5 Exposition des monnaies voir page 10

Detailed timetable view page 5 Viewing of auction good view page 10 Calendario dettagliato veda pagina 5 Esposizione veda pagina 10


Sehr geehrte Kundin, sehr geehrter Kunde und Münzfreund, ich freue mich, daß Sie bereits heute, 4 Wochen vor unserer nächsten Auktion, die neuen Kataloge erhalten haben und wünsche Ihnen viel Freude bei der Lektüre unseres Auktionsangebotes. Wir wurden oft gebeten, den Ablauf einer Auktion etwas näher zu beschreiben, diesem Wunsch kommen wir gerne nach. Am Ende dieses Kataloges finden Sie die Rubrik: “Wie biete ich richtig“, die Ihnen als Ratgeber zur erfolgreichen Teilnahme an unseren Auktionen dienen soll. Sollten Sie darüber hinaus Fragen zum Auktionsablauf haben, helfen wir Ihnen auch gerne persönlich weiter. Die Mitarbeiterinnen unserer Kundenbetreuung stellen wir Ihnen auf der nächsten Seite vor. Mit herzlichen Grüßen aus Osnabrück

Ihr Fritz Rudolf Künker UNSERE ADRESSE OUR ADDRESS

Fritz Rudolf Künker GmbH & Co. KG Gutenbergstr. 23 · 49076 Osnabrück Ust.-Id.-Nr.: DE 256 270 181 Telefon/Phone: Fax: Gebührenfrei: E-Mail: Internet:

+49 (0)5 41-96 20 20 +49 (0)5 41-96 20 222 08 00-58 36 537 service@kuenker.de www.kuenker.de

Montag-Donnerstag Freitag Sonnabend

9.00 - 17.00 Uhr 9.00 - 15.30 Uhr nach Vereinbarung

Außerhalb unserer Geschäftszeit steht unseren Kunden ein automatischer Anrufbeantworter zur Verfügung. Monday-Thursday 9.00 a. m. to 5.00 p. m. Friday 9.00 a. m. to 3.30 p. m. Saturday by prior appointment Answering machine available after opening hours. WWW.KUENKER.DE WWW.KUENKER.COM

Auf unserer Internetseite haben Sie die Möglichkeit • die Abbildungen zu vergrößern • Ihre Gebote direkt abzugeben • die Ergebnisse der Auktionen abzurufen On our website you have the possibility • to zoom all images • to place your bids • to view all auction results

AUKTIONSHOTEL AUCTION LOCATION

Steigenberger Hotel Remarque, Natruper-Tor-Wall 1, 49076 Osnabrück Telefon/Phone: Fax:

2

+49 (0)5 41-60 96 633 +49 (0)5 41-60 96 634

Mitglied im Verband der Deutschen Münzenhändler e. V. Associaton Internationale des Numismates Professionnels (AINP)


UNSERE KUNDENBETREUUNG STEHT IHNEN GERNE ZUR VERFÜGUNG Die Maxime unseres Teams lautet: Nur wenn Sie als Kunde zufrieden sind, sind wir es auch! Geben Sie uns Ihre Auktionsgebote zu treuen Händen, wir sorgen dafür, daß sie korrekt ausgeführt werden. Auch wenn Sie sich von Teilen oder Ihrer gesamten Sammlung trennen möchten, sind wir Ihre ersten Ansprechpartner. Beachten Sie dazu bitte auch die Hinweise für Einlieferer auf der folgenden Seite bzw. im hinteren Teil des Kataloges.

WIR FREUEN UNS AUF IHRE AUKTIONSGEBOTE UND EINLIEFERUNGEN!

Ulrich Künker Leitung Kundenbetreuung ulrich.kuenker@kuenker.de

Marion Künker Deutsch, English marion.kuenker@kuenker.de

Alexandra Elflein English, Français, Italiano alexandra.elflein@kuenker.de

Anastasija Koepsell Russian, Deutsch anastasija.koepsell@kuenker.de

Nadine Zuber Deutsch, English nadine.zuber@kuenker.de

Barbara Westmeyer Deutschsprachige Kundenbetreuung barbara.westmeyer@kuenker.de

Cristina Welzel Italiano, Deutsch, English, Français cristina.welzel@kuenker.de

SO ERREICHEN SIE UNS GEBÜHRENFREI (AUS DEUTSCHLAND) TELEFON FAX INTERNET EMAIL

0800 / 5836537 (0800 / KUENKER) +49 (0) 541/ 96 20 20 +49 (0) 541/ 96 20 222 www.kuenker.de service@kuenker.de

WAS IST ZUR ERFOLGREICHEN AUKTIONSTEILNAHME BESONDERS WICHTIG? • • • • •

Ihr schriftlicher Auftrag sollte möglichst frühzeitig eintreffen, spätestens einen Tag vor der Auktion. Wenn Sie telefonisch an der Auktion teilnehmen möchten, bedarf das unserer vorherigen Genehmigung. Bitte teilen Sie uns diesen Wunsch daher mindestens 48 Stunden vor der Versteigerung mit. Nähere Informationen zum telefonischen Bieten finden Sie auf den folgenden Seiten. Beachten Sie bitte auch die Hinweise „Wie biete ich richtig“ im hinteren Teil des Kataloges. Gerne können Sie Ihre Gebote auch online abgeben. Unter www.kuenker.de bieten wir den gesamten Auktionskatalog online an. Bei Fragen rufen Sie uns an, unsere Kundenbetreuung freut sich auf Ihren Anruf! 3


WICHTIGE HINWEISE FÜR UNSERE EINLIEFERER 1.

Unser Expertenteam garantiert Ihnen eine fachgerechte Bearbeitung der von Ihnen eingelieferten Stücke. 2. Die Schätzpreise werden von uns aufgrund unserer hervorragenden Marktkenntnisse sorgfältig festgelegt. Die Stücke werden zu 80% der im Katalog angegebenen Schätzpreise ausgerufen. Durch diese Regelung werden Sie als Einlieferer geschützt. Für nicht verkaufte Objekte werden keine Gebühren erhoben. 3. Der Standard unserer Kataloge ist von hoher Qualität und findet internationale Anerkennung. Wir haben eine der besten Kundendateien, die es weltweit gibt. 4, Von der individuellen Betreuung unserer Kunden profitieren auch Sie als Einlieferer. 5. Als Einlieferer erhalten Sie Ihren Auktionserlös innerhalb von 45 Tagen nach der Auktion. Sonderregelungen sind nach Absprache möglich. 6. Auf Wunsch kann Ihre Einlieferung bei Ihnen zuhause abgeholt werden. Ab € 2.500,-- Einlieferungssumme übernehmen wir die Kosten, ab € 25.000,-können wir Ihre Einlieferungen unter Umständen und nach Absprache auch an einem vereinbarten Ort persönlich entgegennehmen. Selbstverständlich ist Ihr Versteigerungsgut durch uns versichert. 7. Nicht alle Münzen eignen sich, als Einzelstücke aufgenommen zu werden. Vertrauen Sie auf die Erfahrung unserer Experten, die niedrigpreisige Münzen liebevoll zu interessanten Lots zusammenstellen. 8. Der Schätzwert Ihrer Einlieferung sollte mindestens € 1.000,-- betragen. 9. Ihre Einlieferung wird Ihnen sofort bei Übernahme durch ein Protokoll quittiert. Spätestens fünf Wochen vor der Auktion erhalten Sie eine genaue Auflistung Ihrer Objekte mit den dazugehörenden Katalognummern. 10. Innerhalb einer Woche nach der Auktion erhalten Sie bereits die Ergebnisliste und können alle erzielten Preise feststellen. 11. Profitieren Sie von der Anziehungskraft eines führenden Unternehmens. Bitte wenden Sie sich bei Fragen an unseren Kundenservice unter 05 41 – 96 20 20 oder gebührenfrei unter 08 00-58 36 537. 12. Unsere Verträge für Einlieferungen können Sie unverbindlich anfordern. Haben Sie noch Fragen? Wir freuen uns auf Ihren Anruf. Telefon: 05 41 – 96 20 20 oder gebührenfrei unter 08 00-58 36 537.

RENSEIGNEMENTS IMPORTANTS A L'ATTENTION DES VENDEURS 1.

Notre équipe d’experts garantit une prise en charge compétente des pièces que vous nous confiez. 2. Notre excellente connaissance du marché nous permet de fixer soigneusement les prix estimés. Les pièces seront mises aux enchères à un prix représentant 80% du prix estimé indiqué dans le catalogue. Cette réglementation vous protège en tant que vendeur. Aucuns frais ne seront prélevés sur les pièces invendues. 3. Nos catalogues ont un niveau qualitatif élevé, reconnu au plan international. Nous disposons d’un des meilleurs fichiers clients du monde. 4. En tant que vendeur, vous profiterez vous aussi du suivi personnalisé que nous offrons à nos clients. 5. Le vendeur recevra le produit de la vente dans les 45 jours qui suivront les enchères. Des dispositions spéciales pourront être prises sur accord préalable. 6. Nous prendrons en charge les frais d´expédition des pièces dont le montant sera supérieur à € 2.500,--: Si leur montant est supérieur à € 25.000,--, l´un de nos employés pourra se charger de prendre la livraison à un lieu convenu. A votre demande notre assurance couvrira tous les risques. 7. Les pièces de monnaie ne se prêtent pas toutes à une vente individuelle. Faites confiance à l’expérience de nos spécialistes qui se chargeront avec plaisir de rassembler les pièces bon marché de manière à constituer des lots intéressants. 8. La valeur estimée des pièces fournies devra s’élever à un minimum de € 1.000,--. 9. Au moment de la prise en charge, vous recevrez un détail des pièces fournies. Au plus tard cinq semaines avant la vente aux enchères, vous recevrez une liste exacte de vos pièces avec les numéros de catalogue correspondants. 10. Dans la semaine qui suivra la vente aux enchères, vous recevrez déjà la liste de ses résultats et pourrez prendre connaissance des prix obtenus. 11. Profitez de l’attrait du leader du marché. Pour tout renseignement, veuillez-vous adresser à notre service clientèle: +49 (0)5 41-96 20 20. 12. Vous pouvez demander sans engagement de votre part nos contrats de dépôt de pièces? Vous avez d’autres questions? Nous serons heureux de vous répondre au +49 (0)5 41-96 20 20.

4

IMPORTANT INFORMATION FOR OUR CONSIGNERS 1.

Our team of specialists guarantees an expert treatment of the consigned items. 2. The estimates are carefully established by us due to our excellent knowledge of the market. Bidding for the items is then started at 80 % of the estimate price stated in the catalogue. This arrangement protects you as a consigner. Unsold items incur no fees. 3. The standard offered in our catalogue is of the highest quality, and is recognised internationally. We have one of the best clientele lists worldwide. 4. You as a consigner also profit from the individual consultation offered to our customers. 5. As a consigner, you receive the auction proceeds within 45 days of the close of auction. Special arrangements can be made following discussion. 6. For consignments with a value over € 2.500,-- we may bear the transportation costs. For deliveries over € 25.000,-- we may personally collect the items at an arranged place after prior consultation. Upon consultation, the shipping of your goods could be covered by our insurance. 7. Not all coins are suited to be registered as individual items. Trust in our expert´s experience as they carefully combine less-valuable coins into interesting lots. 8. The valuation price of your delivery should be at least € 1.000,--. 9. Your delivery is confirmed in writing immediately on receipt. At least five weeks before the auction, you receive an exact list of your objects with the relevant catalogue numbers. 10. Within a week of the close of auction, you receive a list with the results in order to see what prices were reached for each individual lot. 11. Profit from our position as a leading coin dealer. If you have any questions, please contact our customer service team on +49 (0)5 41-96 20 20. 12. Would you like to receive copies of our contracts for consigner, without making any commitment? Do you have any other questions? Our customer service team will be pleased to help you – please call on +49 (0)5 41-96 20 20.

INFORMAZIONI PER I NOSTRI DEPOSITANTI 1.

Il nostro team di esperti assicura un trattamento accurato dei pezzi che ci avete inviato. 2. Eseguiamo valutazioni finalizzate alla vendita. I prezzi di stima sono frutto della nostra eccezionale conoscenza del mercato e della nostra attenta valutazione. La base d´asta ammonta all´80% del prezzo di stima indicato sul catalogo. Non si addebitano spese per gli oggetti invenduti. 3. I nostri cataloghi sono di alta qualità e sono riconosciuti a livello internazionale. I nostri clienti sono fra i migliori al mondo. 4. Come depositanti potete beneficiare dell’assistenza riservata a ciascuno dei nostri clienti. 5. Come depositanti riceverete gli importi realizzati all’asta entro 45 giorni dal termine della stessa. Si possono concordare condizioni particolari. 6. A partire da un controvalore degli oggetti di € 2.500,--i costi del trasporto sono a nostro carico, mentre a partire da un controvalore di € 25.000 gli oggetti possono essere ritirati personalmente da un nostro incaricato ad un posto concordato. Naturalmente il trasporto dei vostri oggetti puó essere assicurato tramite la nostra assicurazione. 7. Non tutte le monete possono essere negoziate singolarmente. Fidatevi dell´esperienza dei nostri esperti, che raggruppano le monete non molto preziose in lotti di sicuro interesse. 8. Il valore stimato degli oggetti depositati deve ammontare ad almeno € 1.000,--. 9. Nel momento in cui gli oggetti sono presi in consegna, viene rilasciata una ricevuta numerata. Riceverete un elenco preciso degli oggetti che avete depositato con i relativi numeri di catalogo al massimo cinque settimane prima dell’asta. 10. Riceverete l’elenco degli oggetti aggiudicati entro una settimana dalla chiusura dell’asta. Potrete cosi verificare i prezzi realizzati. 11. Approfittate della capacità di un leader di mercato per aumentare il valore dei vostri oggetti. Se avete delle domande, rimaniamo a vostra disposizione per qualsiasi necessità. Rivolgetevi alla nostra consulenza ai clienti diretta al numero +49 (0)5 41-91 20 20. 12. Volete ricevere i nostri contratti senza impegno? Avete altre domande? Potete contattarci al numero +49 (0)5 41-96 20 20.


DETAILLIERTER ZEITPLAN AUKTIONEN 154-157 AUKTION 154 DER MÜNZSCHATZ VON HERBORN MÜNZEN UND MEDAILLEN AUS MITTELALTER UND NEUZEIT

Dienstag, den 23. Juni 2009 9.30 Uhr - 13.00 Uhr Nr. 1 bis Nr. 655 Der Münzschatz von Herborn, Münzen und Medaillen: Aachen - Mühlhausen in Thüringen 14.00 Uhr - 19.00 Uhr Nr. 656 bis Nr. 1681 Münzen und Medaillen: Münster - Würzburg, Medaillen, Orden, Papiergeld, Lots, Habsburg, Europa: Baltikum - Griechenland

Mittwoch, den 24. Juni 2009 9.30 Uhr - 13.00 Uhr Nr. 1682 bis Nr. 2306 Europa: Großbritannien - Zypern, Übersee, Münzwaagen, Münzgefäße AUKTION 155 1000 GOLDPRÄGUNGEN AUS 3 JAHRTAUSENDEN DEUTSCHE MÜNZEN AB 1871

AUKTION 156 DIE SAMMLUNG DER FREIHERREN BONDE AUKTION 157 RUSSISCHE MÜNZEN UND MEDAILLEN

14.00 Uhr - 19.00 Uhr Nr. 3001 bis Nr. 4000

Donnerstag, den 25. Juni 2009 9.30 Uhr - 11.30 Uhr Nr. 4001 bis Nr. 4532 11.30 Uhr - 13.00 Uhr Nr. 5001 bis Nr. 5200 14.00 Uhr - 19.00 Uhr Nr. 6001 bis Nr. 6628 Rußland: Dmitry Iwanowitsch - Nikolaus I. Freitag, den 26. Juni 2009 9.30 Uhr - 13.00 Uhr Nr. 6629 bis Nr. 7012 Rußland: Alexander II. - Republik, Lots Rußland

5


INHALT AUKTION 154 Nr. DER MÜNZSCHATZ VON HERBORN

1

-

123

13

-

29

Goldmünzen Deutschland Baden Frankfurt Hanau-Lichtenberg Nürnberg

1 1

-

13

-

2

-

10 5 1 3 4 5

14 13 13 13 13 13

Lothringen Niederlande Silbermünzen Deutschland Hessen Bentheim-Tecklenburg-Rheda Brandenburg in Franken Braunschweig-Wolfenbüttel Frankfurt Hanau Hessen-Darmstadt Isenburg-Büdingen Mansfeld-Bornstedt Marsberg Pfalz Rietberg Sachsen Salm-Dhaun Schwarzburg Solms-Hohensolms Worms

7

-

11 11

-

15 23 38 44

-

55 61 63 66

-

80 82

6 10

-

121 90 11 12 13 14 22 37 43 52 53 54 60 62 65 78 79 81 86

87

-

Belgien Frankreich Italien Niederlande Baltikum Polen Schweiz

91 98 107

-

113

Lots MÜNZEN UND MEDAILLEN AUS MITTELALTER UND NEUZEIT

Römisch-Deutsches Reich

Deutsche Münzen und Medaillen Aachen Anhalt Augsburg 6

Seite

13 14 14 14

-

29 24 14 15 15 15 16 17 18 20 20 20 21 21 21 23 23 23 24

15 16

-

19

-

20

-

22

-

90

24

-

25

25 26

-

-

97 106 109 110 111 112 121

28

-

26 27 27 28 28 28 29

122

-

123

124

-

2306

30

-

226

124

-

30

-

125 141

-

1283 124 140 154

30 33

-

218 30 33 35

29


Nr. Baden Bamberg Bayern Bentheim Brandenburg in Franken Brandenburg-Preußen Braunau Braunschweig Braunschweig und Lüneburg Breisach Bremen Breslau Burgmilchling Corvey Deutscher Orden Donauwörth Eichstätt Eisleben Emden Erbach Erfurt Frankfurt Friedberg Fürstenberg Fulda Gandersheim Halberstadt Hamburg Harz Henneberg Hersfeld Hessen Hildesheim Hohenzollern Hohnstein Jever Jülich-Kleve-Berg Kaufbeuren Kempten Köln Konstanz Lippe Lübeck Lüneburg Magdeburg Mainz Mansfeld Mecklenburg Minden

155 172 175 231 233 239 318 327 329 472 476

-

488 491 493

-

497

-

502 504

-

528

-

536 563 566

-

573 589 592 595 598 603 605

-

608

-

617 620 624 627

-

634 642

-

Seite 171 174 230 232 238 317 326 328 471 475 484 485 486 487 490 492 495 496 500 501 503 525 526 527 533 534 535 562 565 571 572 588 591 594 597 602 604 606 607 615 616 619 623 626 632 633 641 653 654

35

-

39

-

49 60

-

61 86 87

-

90

-

93

-

97

-

99

-

107 109

-

110 111

-

113

-

115 116

-

118 119

-

38 39 47 47 48 60 61 61 86 87 89 89 89 90 90 91 91 91 92 93 93 97 97 97 98 98 99 105 105 106 107 109 110 110 111 112 112 112 113 114 114 114 115 116 117 117 119 121 122 7


Nr. Mühlhausen in Thüringen Münster Nassau Neuss Nördlingen Nordhausen Nürnberg Öttingen Oldenburg Osnabrück Ostfriesland Paderborn Passau Pfalz Pommern Quedlinburg Ravensberg Regensburg Reuss Rietberg Sächsische Herzogtümer Sayn Schaumburg-Lippe Schlesien Schleswig-Holstein Schwäbisch Hall Schwarzburg Schwarzenberg Solms Speyer Stolberg Stralsund Trier Uphoven Verden Waldeck Wallenstein Weingarten Westfalen Wetzlar Wied Wismar Württemberg Würzburg Medaillen, Orden

656 667

-

681 729 731

-

739 742

-

745 751 755

-

761 781

-

830 1137 1140 1142 1154 1158 1160

-

1207

-

1210 1212 1216

-

1222 1232

-

1236

-

1241 1243 1274

-

655 666 677 678 679 680 728 730 737 738 741 743 744 750 754 759 760 780 828 829 1136 1139 1141 1153 1157 1159 1205 1206 1208 1209 1211 1215 1219 1220 1221 1231 1234 1235 1238 1239 1240 1242 1273 1283

1284

-

1295

Papiergeld Lots

8

Seite

122 125

-

127

-

136

-

139 140

-

142 145

-

152

-

196 198

-

199

-

206 207

-

208

-

212 217

-

122 124 126 126 126 127 136 136 137 138 138 138 139 140 141 141 142 145 151 152 195 195 196 198 199 199 205 205 205 205 206 207 208 208 208 210 210 211 211 211 212 212 216 218

219

-

223

1296 1297

-

1338

224 224

-

226


Nr. Habsburgische Erblande - Österreich Tirol, Grafschaft Römisch-Deutsches Reich Kaiserreich Österreich Lots Habsburg Geistlichkeit Standesherren Kremnitz, Stadt Europäische Münzen und Medaillen Baltikum Belgien Bosnien-Herzegowina Bulgarien Dänemark Finnland Frankreich Griechenland Großbritannien Island Italien Kroatien Luxemburg Monaco Montenegro Niederlande Norwegen Polen Portugal Rumänien San Marino Schweden Schweiz Serbien Spanien Tschechien Türkei Ungarn Zypern Münzen und Medaillen aus Übersee Ägypten Argentinien Bolivien Brasilien Chile China Guatemala Haiti

1339

-

1340 1461 1482 1487 1505

-

1514 1514 1529

-

1543

-

1569 1665 1682

-

1752

-

1915 1918 1921 1965 2031 2102 2107

-

2118 2162

-

2190 2204

-

2209

-

2221

-

2224

-

2227 2233 2236

-

Seite 1513 1339 1460 1481 1486 1504 1512 1513 2220 1528 1540 1541 1542 1567 1568 1664 1681 1750 1751 1912 1913 1914 1917 1920 1964 2030 2101 2106 2116 2117 2161 2188 2189 2203 2207 2208 2219 2220 2290 2221 2222 2223 2225 2226 2232 2235 2237

226

-

227 247

-

251 254

-

256 256 259

-

261

-

267 281 284

-

298

-

322 332 341 353 354

-

356 366

-

370

-

374

-

376

-

377

-

378

-

255 226 247 250 251 254 255 255 376 259 261 261 261 266 266 281 283 297 298 320 320 320 321 321 332 341 353 354 356 356 366 370 370 373 373 374 376 376 387 376 376 377 377 377 378 378 379

9


Nr. Honduras Hong Kong Indien Indonesien Iran Japan Kambodscha Kanada Komoren Korea Mexiko Paraguay Peru Sri Lanka (Ceylon) Südafrika Thailand Venezuela Vereinigte Staaten von Amerika/USA Vietnam

2239

-

2244

-

2248

-

2251 2253

-

2259 2263

-

2269

-

Münzwaagen und Gewichte

2291

-

Münzgefäße

2304

-

Seite 2238 2240 2241 2242 2243 2246 2247 2249 2250 2252 2255 2256 2257 2258 2262 2267 2268 2289 2290

379 379 379 379 380 380 380 380 381 381 381 382 382 382 383 384 384 387 387

382 383

-

384

-

2303

388

-

390

2306

391

-

392

Ein Stichwortverzeichnis finden Sie am Ende des Auktionskataloges 155. __________________________

BESICHTIGUNG Besichtigung des Auktionsgutes in unseren Geschäftsräumen, Gutenbergstr. 23, 49076 Osnabrück, ab dem 2. Juni 2009, nach vorheriger telefonischer Vereinbarung unter +49 (0)5 41 96 20 20.

EXPOSITION Les monnaies seront visibles à partir du 2 juin 2009, Gutenbergstr. 23, 49076 Osnabrück, sur rendez-vous téléphonique +49 (0)541 96 20 20.

EXPOSICIÓN

 10

Con cita previa +49 (0)541 96 20 20 podrá ver todos los lotes a partir del 2 de Junio del 2009 en nuestras oficinas en 49076 Osnabrück, Gutenbergstr. 23.

ON VIEW The coins are on view at our premises in 49076 Osnabrueck, Gutenbergstr. 23, from June 2, 2009 by prior appointment: +49 (0)541 96 20 20.

ESPOSIZIONE Tutti i lotti sono visionabili a partire dal 2 giugno 2009 presso la nostra sede, Gutenbergstr. 23, 49076 Osnabrück previo appuntamento telefonico +49 (0)541 96 20 20.

ПРОСМОТР АУКЦИОННЫХ ЛОТОВ Просмотр аукционных лотов проходит с 2 июня 2009 года года в нашем офисе по телефонной договоренности +49 (0)541 96 20 20 по адресу: Gutenbergstr. 23, 49076 Osnabrück.




WICHTIGE HINWEISE FÜR UNSERE TELEFONBIETER

IMPORTANT INFORMATION ON TELEPHONE BIDDING

Wenn Sie telefonisch mitbieten möchten, bitten wir Sie aus organisatorischen Gründen, uns diesen Wunsch bis spätestens 48 Stunden vor der Versteigerung schriftlich mitzuteilen. Voraussetzung für ein telefonisches Mitbieten ist, daß Sie mindestens den Schätzpreis bieten. Telefonisches Bieten ist erst ab einem Schätzpreis von ca. 500 Euro pro Los möglich.

If you wish to participate in the auction as a telephone bidder, please inform us at least 48 hours in advance as we have to approve and schedule all calls. To register for telephone bidding, we require that you submit at least the estimate as written bid in addition to being called. Telephone bidding is accepted on lot numbers with estimates starting at 500 Euro.

Bitte beachten Sie, daß wir keinerlei Haftung übernehmen, falls die telefonische Verbindung während der Auktion nicht zustande kommt.

We do not assume liability should the telephone line be interrupted or not be achieved.

Sollten Sie Fragen zu der telefonischen Teilnahme an unseren Auktionen haben, können Sie uns vor der Auktion unter +49 (0)5 41-96 20 20 oder 08 00-58 36 537 (gebührenfrei) anrufen. Während der Auktion erreichen Sie uns unter der auf der ersten Seite angegebenen Telefonnummer.

INFORMATIONS POUR LA PARTICIPATION PAR TELEPHONE

Please call +49 (0)5 41-96 20 20 for more information or to register for telephone bidding. During the auction you will be able to reach us at the telephone number indicated on page 1.

INFORMAZIONI PER LA PARTECIPAZIONE TELEFONICA

Si vous désirez participer par téléphone à nos ventes aux enchères, veuillez vous mettre en relation avec Alexandra Elflein au moins 48 heures avant la vente au numéro +49 (0)5 41-96 20 233. Pendant la vente aux enchères nous vous prions d'appeler le numéro indiqué sur page no. 1 de ce catalogue.

Se desiderate la partecipazione telefonica in diretta durante l´asta, siete pregati di chiamare la Signora Cristina Welzel al numero diretto +49 (0)5 41-96 20 250 come minimo 48 ore prima dell´asta e di inviarci la vostra offerta, la quale deve ammontare come minimo al prezzo di stima anche per iscritto.

Une participation téléphonique à la vente sera possible à la condition que vous nous fassiez parvenir aussi votre ordre par écrit. Cet ordre devra être au moins égal au minimum au prix d’estimation et concerner un lot estimé au moins 500 Euros.

Accettiamo una partecipazione telefonica in diretta durante l´asta per oggetti il cui prezzo di stima ammonta come minimo ai 500 Euro. Non assumeremo nessuna responsabilità se la linea telefonica è occupata o se non siete raggiungibili.

Nous déclinons toute responsabilité dans le cas où la communication téléphonique serait interrompue, ou bien ne pourrait être établie.

INFORMACIONES DE COMO PARTICIPAR POR TELÉFONO Si quiere participar por teléfono en la subasta por favor se ponga en contacto anteriormente con la señora Cristina Welzel +49 (0)5 41-96 20 250 y envienos las pujas tambien por escrito por lo menos 48 oras antes de la subasta. Autorizamos una participación por teléfono solamente para lotes cuyos precio de estima es por lo menos 500 Euro. No asumimos la responsabilidad si la conexión telefónica se interumpa sin previsión o si está comunicando.

ВАЖНАЯ ИНФОРМАЦИЯ ДЛЯ УЧАСТИЯ ПО ТЕЛЕФОНУ Для участия в торгах по телефону просим Вас связаться с нами не позднее 48 часов до начала аукциона. Условием проведения телефонных торгов является письменное подтверждение ставки, равной как минимум стартовой цене. Участие в телефонных торгах возможно только для лотов со стартовой ценой свыше 500 евро. Для получения дополнительной информации и регистрации на аукционе звоните Анастасии Кепселль до аукциона по телефону +49 (0)5 41-96 20 268 и во время аукциона по телефону, указанному на первой странице каталога.

11


DER MÜNZSCHATZ VON HERBORN

&'4/ª0<5%*#6<810*'4$140 #O 0CEJOKVVCI FGU  1MVQDGT  GPVFGEMVG *GTT (TKGFJGNO 5EJQNN FGT   'KIGPVÒOGTFGU)TWPFUVÒEMU*CWRVUVTCUUGKPFGT*GTDQTPGT#NVUVCFVDGKFGT 4GPQXKGTWPI UGKPGU (CEJYGTMJCWUGU GKPGP ITÌ­GTGP UVCTM OKV )TÒPURCP ÒDGT   \QIGPGP-NWORGPXQP/ÒP\GP ECMI FGTUKEJCNUGKPGTFGTDGFGWVGPFUVGP 5EJCV\HWPFG *GUUGPU GPVRWRRGP UQNNVG )NÒEMNKEJGTYGKUG \·JNV *GUUGP \W FGP   FGWVUEJGP$WPFGUN·PFGTPKPFGPGPFKGTGEJVNKEJG$GJCPFNWPIXQP/ÒP\UEJCV\ HWPFGP FGT KO $ÒTIGTNKEJGP )GUGV\DWEJ XQTIGUGJGPGP 4GIGNWPI HQNIV )GHWP   FGPG /ÒP\GP YGTFGP FGUJCND TGIGNO·­KI IGOGNFGV WPF \WT YKUUGPUEJCHVNKEJGP   PWOKUOCVKUEJGP$GCTDGKVWPI\WT8GTHÒIWPIIGUVGNNV)TWPFJKGTHÒTKUVFC­OKV FGT XQTÒDGTIGJGPFGP #WUJ·PFKIWPI FGU /ÒP\UEJCV\GU CP FKG $GJÌTFGP MGKP   'KPITKHHKPFKG'KIGPVWOUTGEJVGFGU5EJCV\GUXGTDWPFGPKUV  'U IKNV FGT h  $)$ KP FGO HQTOWNKGTV KUV ō9KTF GKPG 5CEJG FKG UQ NCPIG   XGTDQTIGPIGNGIGPJCVFC­FGT'KIGPVÒOGTPKEJVOGJT\WGTOKVVGNPKUV 5EJCV\  GPVFGEMV WPF KPHQNIG FGT 'PVFGEMWPI KP $GUKV\ IGPQOOGP YKTF FCU 'KIGPVWO   \WT*·NHVGXQPFGO'PVFGEMGT\WT*·NHVGXQPFGO'KIGPVÒOGTFGT5CEJGGTYQT DGPKPYGNEJGTFGT5EJCV\XGTDQTIGPYCTŋ)GTCFGXQTFGO*KPVGTITWPFFKGUGT YKUUGPUEJCHVUHÌTFGTPFGP 4GEJVUNCIG KP *GUUGP YQ /ÒP\HWPFG UGKV  U[U   VGOCVKUEJGTHC­VWPFXGTÌHHGPVNKEJVYWTFGPKUVGUUGJTDGFCWGTNKEJFC­FKG5VGNNG FGUHÒTFKG(WPFCWHPCJOG\WUV·PFKIGP$GCOVGPUGKVPKEJVOGJTPGWDGUGV\V YWTFG  

*GTT(TKGFJGNO5EJQNNPCJOWPOKVVGNDCTPCEJFGT'PVFGEMWPI-QPVCMVOKVFGP$GJÌTFGPCWHWPFÒDGTICDFGP(WPFDGTGKVUCO  0QXGODGT  FGO JGUUKUEJGP .CPFGUCOV HÒT IGUEJKEJVNKEJG .CPFGUMWPFG KP /CTDWTI +P <WUCOOGPCTDGKV OKV FGO   .CPFGUCOVHÒT&GPMOCNRHNGIGKP9KGUDCFGPYWTFGPFKGGKP\GNPGP/ÒP\GPCWUFGO-NWORGPIGNÌUVWPFFCPPXQP2TQH0KMNQV -NÒ­GPFQTH KP /CTDWTI DGCTDGKVGV &CU 'TIGDPKU FKGUGT 7PVGTUWEJWPIGP YCT FKG  GTUEJKGPGPG OGJT CNU  5GKVGP   WOHCUUGPFG /QPQITCRJKG -NÒ­GPFQTHU ō&GT /ÒP\UEJCV\ XQP *GTDQTP \WT -KRRGT\GKV KP FGT )TCHUEJCHV 0CUUCW&KNNGPDWTIŋ   

&KGUGU$WEJIGJVYGKVÒDGTFKGGZCMVG$GUEJTGKDWPICNNGT(WPFOÒP\GPOKV#DDKNFWPIGPFGT*CWRVV[RGPJKPCWUWPFUVGNNVFGP -QORNGZ KP FGP Y·JTWPIU WPF NCPFGUIGUEJKEJVNKEJGP <WUCOOGPJCPI &KG #TDGKV DKGVGV PGDGP FGT #WUYGTVWPI FGU (WPFU   INGKEJ\GKVKI GKPGITWPFNGIGPFG'KPHÒJTWPIKPFCUFGWVUEJG/ÒP\YGUGPKPFGT)GNFMTKUGFGT-KRRGTWPF9KRRGT\GKVWPFUGK CNNGP CP FGT )GNFIGUEJKEJVG +PVGTGUUKGTVGP GORHQJNGP 5KG KUV GTJ·NVNKEJ DGKO *GUUKUEJGP .CPFGUCOV HÒT IGUEJKEJVNKEJG   .CPFGUMWPFGKP/CTDWTI  

&GTWOXGTDQTIGPG5EJCV\XQP*GTDQTPGPVJ·NV)QNFWPF5KNDGTOÒP\GPXQPFGPGPMPCRRFKG*·NHVGCWUFGT <GKVFGT)GNFMTKUGXQPDKUUVCOOV&KG·NVGUVG/ÒP\GKUVGKPYQJNGJGT\WH·NNKIKPFGP5EJCV\IGNCPIVGT2HGPPKIFGU ,CJTJWPFGTVUFKG5EJNW­OÒP\GPUKPFXKGTRT·IGHTKUEJG&TGKMTGW\GT5VÒEMGOKVFGT,CJTGU\CJN&KG0QOKPCNUVTWMVWT FGU (WPFGU KUV WPIGYÌJPNKEJ XKGNH·NVKI WPF TGKEJV XQO *GNNGT ÒDGT *CNDDCV\GP )TQUEJGP &TGK WPF 5GEJUD·V\PGT DKU \WO   4GKEJUVCNGT WPF UGKPGP 6GKNYGTVGP UQYKG \WO )QNFIWNFGP &WMCVGP WPF 4QUGPQDNG +PUIGUCOV UVGNNVG FGT /ÒP\UEJCV\ KO     ,CJTGKPGP)GUCOVYGTVXQP)WNFGPQFGT„4GKEJUVCNGTPFCTFGTKPGVYCOKV<GPVPGTP9GK\GPQFGTOKVFTGK ,CJTGUGKPMQOOGPGKPGU5EJTGKPGTOGKUVGTUINGKEJ\WUGV\GPYCT  5QXKGNUEJKEJVKIYKGFKGFKXGTUGPKO(WPFXGTVTGVGPGP/ÒP\UQTVGPKUVCWEJFKGÌTVNKEJG*GTMWPHVFGT2T·IWPIGP9·JTGPFCWU FGOJGUUKUEJOKVVGNTJGKPKUEJGP4CWOPCEJ#P\CJNFGT5VÒEMGFGU(WPFGUUVCOOGP PCEJFGTGP9GTVLGFQEJPWT  YWTFGP   FGT 5VÒEM\CJN KP CPFGTGP FGWVUEJGP .CPFUEJCHVGP IGRT·IV WPF   KP CWUN·PFKUEJGP /ÒP\UV·VVGP &KG   CWUN·PFKUEJGP/ÒP\GPFGU*GTDQTPGT(WPFGUOCEJGPLGFQEJFGU(WPFYGTVGUCWU5QUKPFFKG)TCHUEJCHVGP5QNOU.KEJ WPF 5QNOU*QJGPUQNOU CNU FKG /ÒP\UV·PFG \W PGPPGP FKG OKV    5VÒEMG  UVÒEM\CJNO·­KI OKV ITQ­GO #DUVCPF CO   UV·TMUVGPXGTVTGVGPUKPF GUHQNIVFKG5VCFV(TCPMHWTVOKV5VÒEMQFGT 9GTVO·­KIDGVT·IVFGT5QNOUGT#PVGKNLGFQEJPWT &GPYGTVO·­KIJÌEJUVGP#PVGKNFGU5EJCV\GUUVGNNGPFKG/ÒP\GPFGTURCPKUEJGP0KGFGTNCPFGOKVFKGCDGTOKV 5VÒEMPWTFGT)GUCOVCP\CJNCWUOCEJGP   1UPCDTÒEMKO/·T\      &T#PFTGCU-CKUGT 

0KMNQV -NÒ­GPFQTH &GT /ÒP\UEJCV\ XQP *GTDQTP <WT -KRRGT\GKV KP FGT   )TCHUEJCHV 0CUUCW&KNNGPDWTI 7PVGTUWEJWPIGP WPF /CVGTKCNKGP \WT 8GT   HCUUWPIUWPF.CPFGUIGUEJKEJVG$F /CTDWTIKZ56HP  -CTVGP  (CNVDGKNCIGP +5$0  DTQUEJ b  $G\WIU   SWGNNG*GUU.CPFGUCOVHÒTIGUEJKEJVNKEJG.CPFGUMWPFG&/CTDWTI  4WH   ņ  (CZ  #WH FGT *QORGRCIG   YYYJINFG \CJNTGKEJG +PHQTOCVKQPGP CWEJ ÒDGT YGKVGTG 6KVGN WPF +PJCNVG   \WT0WOKUOCVKM  12


DER MÜNZSCHATZ VON HERBORN

)1.&/ª0<'0

2

1

3

&'765%*.#0& &+'/#4-)4#(5%*#(6$#&'0 

%JTKUVQRJ+Ó)QNFIWNFGPQ,$CFGP$CFGPI(D9KGNCPFV  )GNQEJVUGJTUEJÌP -NÒ­GPFQTH*GTDQTP0T



&+'4'+%*5/ª0<5666'(4#0-(746 

(TKGFTKEJ+++XQP*CDUDWTI-CKUGT2HCPFKPJCDGT2JKNKRRFGTNVGTGXQP9GKPUDGTI )QNFIWNFGPQ,  I(D,W(  2T·IGUEJY·EJGHCUVUGJTUEJÌP



/CZKOKNKCP+XQP¤UVGTTGKEJ-ÌPKI2HCPFKPJCDGT'DGTJCTF+8XQP'RRUVGKP-ÌPKIUVGKP /ÒP\GPDGTI)QNFIWNFGPI(D,W(K.GXKPUQP+p  4/KPIGYGNNVUGJTUEJÌP



-NÒ­GPFQTH*GTDQTP0T



-NÒ­GPFQTH*GTDQTP0T

4

1,5:1

1,5:1

&+')4#(5%*#(6*#0#7.+%*6'0$'4) 

,QJCPP4GKPJCTF)QNFIWNFGP9ÌTVJOKV6KVGNXQP/CVVJKCUI(DC 5WEJKGTXCT 44-N2T·IGUEJY·EJGXQT\ÒINKEJ  -NÒ­GPFQTH*GTDQTP0T

5



6

&+'56#&60ª40$'4)

)QNFIWNFGPI(D-GNNPGT

5GJTUEJÌPpXQT\ÒINKEJ



4-N5EJTÌVNKPIUTK­UGJTUEJÌP



-NÒ­GPFQTH*GTDQTP0T



&+'56#&6/'6<

.16*4+0)'0

)QNFIWNFGPQ,I(D(NQPXCT -NÒ­GPFQTH*GTDQTP0T

13


DER MÜNZSCHATZ VON HERBORN

7

8

0+'&'4.#0&'

&+'56#&6&'8'06'4 

)QNFIWNFGPQ,  OKV6KVGNXQP/CVVJKCUI&GNOXCT 4 (D  -N2T·IGUEJY·EJGUGJTUEJÌP -NÒ­GPFQTH*GTDQTP0T



&+'2418+0<(4+'5.#0&

&WMCVI&GNO(D

)1.&/KPIGYGNNVUGJTUEJÌP





-NÒ­GPFQTH*GTDQTP0T

10

9

9

&+'2418+0<764'%*6 

4QUGPQDNGQ,  I&GNOXCT(D  8KGTMNGKPG2TÒHRWP\GPIGYGNNVHCUVUGJTUEJÌP -NÒ­GPFQTH*GTDQTP0T



&+'2418+0<<''.#0&

4QUGPQDNGQ,I&GNO(D

(CUVUGJTUEJÌP





-NÒ­GPFQTH*GTDQTP0T

5+.$'4/ª0<'0

11 1,5:1

&'765%*.#0&

1,5:1

&+'.6'56'/ª0<'&'55%*#6<'5#75'+0'470$'56+//6'0 /ª0<5666'&'5/+66'.*'55+5%*'04#7/'5 

/KVVGFGU,CJTJWPFGTVU2HGPPKIWOI/CWGTCWUHÒPHU·WNGPCTVKIGP'NGOGPVGPKPFGT /KVVGGKPVTCIGPFGU'NGOGPVOKVGKPGOOKVVNGTGP6WTOOKVFQRRGNUVÌEMKIGO&CEJ\WFGP5GKVGPLGGKP -WRRGNVWTO-TGW\KPFGP9KPMGNPLGGKPG-WIGN*·XGTPKEM-ÌNPXINH 5GJTUEJÌP -NÒ­GPFQTH*GTDQTP0T  'UJCPFGNVUKEJWOFKG·NVGUVG/ÒP\GFGU5EJCV\HWPFGUXQP*GTDQTP  &GT 2HGPPKI KOKVKGTV FKG J·WHKIGP -ÌNPGT 2HGPPKIG PCEJ FGO 4ÒEMUGKVGP6[R /CWGT FGT UGKV 'T\DKUEJQH 5KIYKP  

  XQTMQOOV XIN *·XGTPKEM -ÌNP + 0T  H  WPF XGTDCNNJQTPV  YKG \CJNTGKEJG UR·VGTG 0CEJCJ   OWPIGPFKG7OUEJTKHV1&&1+/2#8)FGTWPVGT1VVQ+++CNU-CKUGT  KP-ÌNPIGUEJNCIGPGP2HGPPKIG %JCTCMVGTKUVKUEJ HÒT FKG KO JGUUKUEJGP 4CWO GPVUVCPFGPGP 0CEJCJOWPIGP KUV FGT FQRRGNVG 2GTNMTGKU FGT -TGW\UGKVG  

XIN CNU UGJT HTÒJGU $GKURKGN GVYC *·XGTPKEM -ÌNP 0T  UR·VGTGU 'ZGORNCT 0T  FGTU 9GVVGTCW   0TH 8QPFGP-ÌNPGT8QTDKNFGTPCWUIGJGPFKUV\WDGOGTMGPFC­FQTVFCU/CWGTIGD·WFGQJPG6QTXGT GKP\GNV UGKV 'T\DKUEJQH (TKGFTKEJ +   GTUEJGKPV WPF XQTPGJONKEJ WPVGT 'T\DKUEJQH $TWPQ ++     WPF #TPQNF +   (QTOGP CWHYGKUV FKG CP FGP XQTNKGIGPFGP 2HGPPKI GTKPPGTP *·XGTPKEM -ÌNP 0T    H    8QP FGP KO JGUUKUEJGP 4CWO CP\WUKGFGNPFGP 0CEJRT·IWPIGP -ÌNPGT 2HGPPKIG KUV CWEJ \W   XGTYGKUGPCWH*·XGTPKEM-ÌNP+0T *GTUHGNF  /CTDWTIJKGT\WXIN*GUU/CTDWTIGT2HGPPKI5 FGTU/CTDWTIKPFGTJGUUKUEJGP/ÒP\WPF)GNFIGUEJKEJVG5 +P#PDGVTCEJVFGTWPXQNNUV·PFKIGP.GUWPIFGT .GIGPFGPFGU5VÒEMGUMCPPGUPWTCNNIGOGKPKPGKP)GDKGVXGTYKGUGPYGTFGPFCUXQOJGWVKIGP/KVVGNJGUUGPDKUKP FGP 4CWO XQP *GTUHGNF TGKEJV (ÒT GKPG (GKPFCVKGTWPI KUV FGT IGIGPY·TVKIG (WPF\WUCOOGPJCPI FGU CWEJ KO   UEJYGFKUEJGP/CVGTKCNPKEJVCWHIGVTGVGPGP5VÒEMUPKEJVIGGKIPGV&KG2T·IWPIFGU2HGPPKIUFGTUVKNKUVKUEJ\YKUEJGP *·XGTPKEM-ÌNP+0TWPF0TUVGJVFÒTHVGUR·VGUVGPU\WT/KVVGFGU,CJTJWPFGTVUGTHQNIVUGKP &KGUG #POGTMWPICWU-NÒ­GPFQTH*GTDQTP5H 

14




DER MÜNZSCHATZ VON HERBORN

12 13

13

&+')4#(5%*#(6$'06*'+/6'%-.'0$74)4*'&# 

#FQNH5VÒDGTQ,(TGWFGPDGTI-GPPGRQJNF  44<CKPGPFG2T·IGUEJY·EJGUGJTUEJÌP -NÒ­GPFQTH*GTDQTP0T



&+'/#4-)4#(5%*#(6$4#0&'0$74)+0(4#0-'0 

)GQTI WPF #NDTGEJV  OKV 6KVGN )GQTIU DKU   6CNGT  5EJYCDCEJ &CX    X5EJTC 9KP\5EJTÌVNKPIUHGJNGTUGJTUEJÌP



-NÒ­GPFQTH*GTDQTP0T

15 14

14

&#5(ª456'067/$4#705%*9'+)91.('0$ª66'. 

*GKPTKEJ,WNKWU4GKEJUVCNGT)QUNCT&CX9GNVGT  'VYCUIGTGKPKIVUGJTUEJÌP -NÒ­GPFQTH*GTDQTP0T



&+'56#&6(4#0-(746

6WTPQUG,W(I

45GJTUEJÌP





-NÒ­GPFQTH*GTDQTP0T

16

17

18

19



6WTPQUG8CTKCPVGOKVCDIGMÒT\VGT,CJTGU\CJN\WFGP5GKVGPFGT5EJYCP\HGFGT,W(KC 445GJTUEJÌP -NÒ­GPFQTH*GTDQTP0T





6WTPQUG,W(H

5GJTUEJÌP



48QT\ÒINKEJ



5GJTUEJÌPpXQT\ÒINKEJ



-NÒ­GPFQTH*GTDQTP0T



6WTPQUG,W(p XIN  -NÒ­GPFQTH*GTDQTP0T



6WTPQUG,W(C -NÒ­GPFQTH*GTDQTP0T

15


DER MÜNZSCHATZ VON HERBORN

20



21

6WTPQUG,W(E

8QT\ÒINKEJ



5GJTUEJÌP



4-N<CKPGPFGUGJTUEJÌP



-NÒ­GPFQTH*GTDQTP0T



6WTPQUG,W(JC -NÒ­GPFQTH*GTDQTP0T

22



23

4GKEJUVCNGTOKV6KVGN(GTFKPCPFU++,W(D -NÒ­GPFQTH*GTDQTP0T

&+')4#(5%*#(6*#0#7.+%*6'0$'4) 

,QJCPP4GKPJCTF6GUVQP9ÌTVJQFGT$CDGPJCWUGP5WEJKGT

5GJTUEJÌP



(CUVXQT\ÒINKEJ



5EJÌPG2CVKPCXQT\ÒINKEJ



-NÒ­GPFQTH*GTDQTP0T

24



25

6GUVQPQ,9ÌTVJQFGT$CDGPJCWUGP5WEJKGTXCT -NÒ­GPFQTH*GTDQTP0T



6GUVQPQ,9ÌTVJQFGT$CDGPJCWUGP5WEJKGTNGKEJVXCT -NÒ­GPFQTH*GTDQTP0T

27

28

26



26

-TGW\GT9ÌTVJQFGT$CDGPJCWUGP8CTKCPVGOKV&QRRGNRWPMVGPCNU6TGPPWPIU\GKEJGPCWHFGT 4ÒEMUGKVG5WEJKGTXCT 45GJTUEJÌP



-NÒ­GPFQTH*GTDQTP0T



2HGPPKI #NDWU $CDGPJCWUGP5WEJKGT

45GJTUEJÌPpXQT\ÒINKEJ



42T·IGUEJY·EJGUGJTUEJÌP



-NÒ­GPFQTH*GTDQTP0T

&+')4#(5%*#(6*#0#7/ª0<'0$'4) 

2JKNKRR.WFYKI++#NDWU*CPCW5WEJKGTXCT -NÒ­GPFQTH*GTDQTP0T

16


DER MÜNZSCHATZ VON HERBORN

30

29



-CVJCTKPC$GNIKEC8QTOÒPFGTKPHÒT2JKNKRR/QTKV\6GUVQP ,CJTGU\CJNKO5VGORGN CWUIG·PFGTV *CPCW5WEJKGTNGKEJVXCT 8QT\ÒINKEJp5VGORGNINCP\



-NÒ­GPFQTH*GTDQTP0T



6GUVQP ,CJTGU\CJNKO5VGORGNCWUIG·PFGTV *CPCW5WEJKGT

(CUVXQT\ÒINKEJ



6GUVQP ,CJTGU\CJNKO5VGORGNCWUIG·PFGTV *CPCW5WEJKGT  /KPMQTTQFKGTVHCUVXQT\ÒINKEJ



6GUVQP ,CJTGU\CJNKO5VGORGNCWUIG·PFGTV *CPCW5WEJKGT



-NÒ­GPFQTH*GTDQTP0T

31



32

-NÒ­GPFQTH*GTDQTP0T



5GJTUEJÌPpXQT\ÒINKEJ

-NÒ­GPFQTH*GTDQTP0T

33



34

6GUVQP*CPCW5WEJKGTXCT

8QT\ÒINKEJp5VGORGNINCP\



4-N5EJTÌVNKPIUHGJNGTUGJTUEJÌP



-NÒ­GPFQTH*GTDQTP0T



-TGW\GT*CPCWOKV6KVGN(GTFKPCPFU++5WEJKGT -NÒ­GPFQTH*GTDQTP0T

35

37

36



-TGW\GT*CPCWOKV6KVGNXQP/CVVJKCU5WEJKGT

4(CUVXQT\ÒINKEJ



45GJTUEJÌP



45GJTUEJÌP



-NÒ­GPFQTH*GTDQTP0T



5GEJUD·V\PGT*CPCWOKV6KVGN(GTFKPCPFU++5WEJKGT -NÒ­GPFQTH*GTDQTP0T



-TGW\GT*CPCWOKV6KVGN(GTFKPCPFU++5WEJKGTNGKEJVXCT -NÒ­GPFQTH*GTDQTP0T

17


DER MÜNZSCHATZ VON HERBORN

38 1,5:1

1,5:1

&+'.#0&)4#(5%*#(6*'55'0&#4/56#&6 

.WFYKI84GKEJUVCNGT&CTOUVCFV5EJÒV\  44#VVTCMVKXGU'ZGORNCTUGJTUEJÌPpXQT\ÒINKEJ -NÒ­GPFQTH*GTDQTP0T



39 1,5:1



1,5:1

4GKEJUVCNGT&CTOUVCFV8CTKCPVGOKV.8&18%85KPFGT8QTFGTUGKVGPWOUEJTKHV5EJÒV\ 8QPITQ­GT5GNVGPJGKV/KPMQTTQFKGTVHCUVXQT\ÒINKEJ



-NÒ­GPFQTH*GTDQTP0T

40



41

4GKEJUVCNGT&CTOUVCFV5EJÒV\NGKEJVXCT

42

43

445GJTUEJÌP



445GJTUEJÌP



8QPITQ­GT5GNVGPJGKV5GJTUEJÌP



-TGW\GT&CTOUVCFV5EJÒV\NGKEJVXCT  8QPITQ­GT5GNVGPJGKV.GKEJVMQTTQFKGTVUGJTUEJÌP



-NÒ­GPFQTH*GTDQTP0T



4GKEJUVCNGT&CTOUVCFV5EJÒV\NGKEJVXCT -NÒ­GPFQTH*GTDQTP0T



4GKEJUVCNGT&CTOUVCFV5EJÒV\NGKEJVXCT -NÒ­GPFQTH*GTDQTP0T



-NÒ­GPFQTH*GTDQTP0T

18


DER MÜNZSCHATZ VON HERBORN

44

45

&#5(ª456'067/+5'0$74)$ª&+0)'0 

9QNHICPI 'TPUV   4GKEJUVCNGT  !  $ÒFKPIGP OKV 6KVGN XQP /CVVJKCU /KV   XGT\KGTVGO9CRRGP)TQVGXCT 8QPITQ­GT5GNVGPJGKV2T·IGUEJY·EJGUGJTUEJÌP



-NÒ­GPFQTH*GTDQTP0T



4GKEJUVCNGT$ÒFKPIGPOKV6KVGNXQP/CVVJKCU/KVHÒPHUVTCJNKIGO5VGTPCO$GIKPPFGT8QT FGTUGKVGPWOUEJTKHV)TQVGCXCT 45GJTUEJÌPpXQT\ÒINKEJ



-NÒ­GPFQTH*GTDQTP0T

46



47

4GKEJUVCNGT$ÒFKPIGPOKV6KVGNXQP/CVVJKCU/KVHÒPHUVTCJNKIGO5VGTPCO$GIKPPFGT8QT FGTUGKVGPWOUEJTKHV)TQVGCXCT 45GJTUEJÌP



-NÒ­GPFQTH*GTDQTP0T



4GKEJUVCNGT$ÒFKPIGPOKV6KVGNXQP/CVVJKCU/KV\WIGURKV\VGO9CRRGPUEJKNFWPF'KEJGNCO $GIKPPFGT8QTFGTUGKVGPWOUEJTKHV)TQVGEXCT 44-N5VGORGNHGJNGTXQT\ÒINKEJ



-NÒ­GPFQTH*GTDQTP0T

48



49

4GKEJUVCNGT$ÒFKPIGPOKV6KVGNXQP/CVVJKCU/KV\WIGURKV\VGO9CRRGPUEJKNFWPF'KEJGNCO $GIKPPFGT8QTFGTUGKVGPWOUEJTKHV)TQVGEXCT  44-N5VGORGNHGJNGTWPFFWTEJIGJGPFGT5EJTÌVNKPIUHGJNGTXQT\ÒINKEJ



4GKEJUVCNGT$ÒFKPIGPOKV6KVGNXQP/CVVJKCU/KVURCPKUEJGO9CRRGPUEJKNF)TQVGEXCT 4.GKEJVMQTTQFKGTVGVYCUFG\GPVTKGTVUGJTUEJÌP



-NÒ­GPFQTH*GTDQTP0T



-NÒ­GPFQTH*GTDQTP0T

50



4GKEJUVCNGT$ÒFKPIGPOKV6KVGNXQP/CVVJKCU)TQVGp

51

445EJÌPG2CVKPCHCUVXQT\ÒINKEJ



4GKEJUVCNGT$ÒFKPIGPOKV6KVGNXQP/CVVJKCU)TQVGp  44<CKPGPFG2T·IGUEJY·EJGNGKEJVG8GTRT·IWPIGPUGJTUEJÌP



-NÒ­GPFQTH*GTDQTP0T



-NÒ­GPFQTH*GTDQTP0T

19


DER MÜNZSCHATZ VON HERBORN

52 53

53



)TQUEJGP -TGW\GT $ÒFKPIGPOKV6KVGN(GTFKPCPFU++)TQVGNGKEJVXCT  445VCTMG2T·IGUEJY·EJGUEJÌP -NÒ­GPFQTH*GTDQTP0T



&+')4#(5%*#(6/#05('.&$14056'&6 

$TWPQ++9KNJGNO+,QJCPP)GQTI+8WPF8QNTCV8+4GKEJUVCNGT'KUNGDGP 6QTPCWD 5GJTUEJÌP



-NÒ­GPFQTH*GTDQTP0T

54 55

55

&+'56#&6/#45$'4) 

6CNGTOKV6KVGNXQP/CVVJKCU5VCFGNOCKGTHHXCT -NÒ­GPFQTH*GTDQTP0T

4/KPMQTTQFKGTVUGJTUEJÌP



&#5-74(ª456'067/2(#.< 

(TKGFTKEJ+8#NDWU )WNFGP /CPPJGKO&CX*CCUC5NI/GOOGUJ (GNFGTCNVIGIN·VVGVUGJTUEJÌP -NÒ­GPFQTH*GTDQTP0T



57

56



#NDWU )WNFGP /CPPJGKO*CCUC5NI/GOOGUJ

8QT\ÒINKEJ





#NDWU )WNFGP /CPPJGKO*CCUNGKEJVXCT5NI/GOOGUJ  5GJTUEJÌPpXQT\ÒINKEJ



-NÒ­GPFQTH*GTDQTP0T

-NÒ­GPFQTH*GTDQTP0T

58



59

58

#NDWUWPF2HGPPKI )WNFGP /CPPJGKO*CCU5NI/GOOGUJ  4/KPMQTTQFKGTVUGJTUEJÌP



#NDWU 2HGPPKI /CPPJGKO*CCU FQTVHCNUEJDGUEJTKGDGP 5NI/GOOGUJp  4-QTTQFKGTVUGJTUEJÌP



-NÒ­GPFQTH*GTDQTP0T



-NÒ­GPFQTH*GTDQTP0T

20


DER MÜNZSCHATZ VON HERBORN

61

60

&#5*'4<1)67/2(#.<<9'+$4ª%-'0 

,QJCPP++4GKEJUVCNGTQ,<YGKDTÒEMGP/KV#FOKPKUVTCVQTVKVGN5NI/GOOGUJXCT (CUVXQT\ÒINKEJ



-NÒ­GPFQTH*GTDQTP0T

&+')4#(5%*#(64+'6$'4) 

,QJCPP+++XQP1UVHTKGUNCPF-KRRGT5EJTGEMGPDGTIGT4KGVDGTIOKV6KVGNXQP/CV VJKCU$WUGXCT5NI-TCC\p 445GJTUEJÌPpXQT\ÒINKEJ



-NÒ­GPFQTH*GTDQTP0T

62

63

63



-KRRGT5EJTGEMGPDGTIGT4KGVDGTIOKV6KVGNXQP/CVVJKCU$WUGXCT5NI-TCC\p  44.GKEJVMQTTQFKGTVUGJTUEJÌP -NÒ­GPFQTH*GTDQTP0T



&#5-74(ª456'067/5#%*5'0

#WIWUV6CNGT5EJPGGDGTI&CX5EJPGG -NÒ­GPFQTH*GTDQTP0T

'VYCUMQTTQFKGTVUGJTUEJÌP





65

64



64

%JTKUVKCP ++ ,QJCPP )GQTI + WPF #WIWUV  4GKEJUVCNGT  &TGUFGP &CX    5EJPGG 5GJTUEJÌP



-NÒ­GPFQTH*GTDQTP0T

&#5*'4<1)67/5#%*5'09'+/#4 

,QJCPP 'TPUV WPF UGKPG UGEJU $TÒFGT  -KRRGT5GEJUD·V\PGT FQRRGNVGT 5EJTGEMGPDGTIGT    9GKOCT$QTPGOCPPNGKEJVXCT5NI/GTUGDNGKEJVXCT  -N5VGORGNHGJNGTHCUVXQT\ÒINKEJ -NÒ­GPFQTH*GTDQTP0T

 21


DER MÜNZSCHATZ VON HERBORN

66

67

68

68

&+')4#(5%*#(65#./&*#70 

9QNHICPI (TKGFTKEJ WPF ,QJCPP -QPTCF WPVGT 8QTOWPFUEJCHV KJTGT /WVVGT ,WNKCPG    #NDWU9ÌTTUVCFV/KV9GTVCPICDG#.$01885,QUGRJD 45GJTUEJÌP



-NÒ­GPFQTH*GTDQTP0T



#NDWU9ÌTTUVCFV/KV9GTVCPICDG#.$018'5,QUGRJCXCT  42T·IGUEJY·EJGUGJTUEJÌP

-NÒ­GPFQTH*GTDQTP0T



&KEMGP  9ÌTTUVCFV OKV 6KVGN XQP /CVVJKCU /KV 41/ KP FGT 4ÒEMUGKVGPWOUEJTKHV   ,QUGRJENGKEJVXCT 445GJTUEJÌP





-NÒ­GPFQTH*GTDQTP0T

69



70

&KEMGP  9ÌTTUVCFV OKV 6KVGN XQP /CVVJKCU /KV 41/# KP FGT 4ÒEMUGKVGPWOUEJTKHV   ,QUGRJDNGKEJVXCT 445VCTMG2T·IGUEJY·EJGUGJTUEJÌP



-NÒ­GPFQTH*GTDQTP0T



9QNHICPI(TKGFTKEJWPF,QJCPP-QPTCF&KEMGP9ÌTTUVCFVOKV6KVGNXQP/CVVJKCU ,QUGRJCNGKEJVXCT 445GJTUEJÌP



-NÒ­GPFQTH*GTDQTP0T

71



72

&KEMGP  QFGT  ,CJTGU\CJN PKEJV NGUDCT  9ÌTTUVCFV OKV 6KVGN XQP /CVVJKCU ,QUGRJ  QFGT   HH 42T·IGUEJY·EJGMN5EJTÌVNKPIUTK­UGJTUEJÌP



-NÒ­GPFQTH*GTDQTP0T



&KEMGP9ÌTTUVCFVOKV6KVGNXQP/CVVJKCU,QUGRJFXCT

44-N5EJTÌVNKPIUTK­UGJTUEJÌP



-NÒ­GPFQTH*GTDQTP0T

73



&KEMGP9ÌTTUVCFVOKV6KVGNXQP/CVVJKCU,QUGRJE



&KEMGP9ÌTTUVCFVOKV6KVGNXQP/CVVJKCU,QUGRJEXCT

22

-NÒ­GPFQTH*GTDQTP0T -NÒ­GPFQTH*GTDQTP0T

74

44-N2T·IGUEJY·EJGUGJTUEJÌP



445GJTUEJÌPpXQT\ÒINKEJ




DER MÜNZSCHATZ VON HERBORN

76

75



&KEMGP9ÌTTUVCFVOKV6KVGNXQP/CVVJKCU,QUGRJGXCT 44-N2T·IGUEJY·EJGUGJTUEJÌP



-NÒ­GPFQTH*GTDQTP0T



&KEMGP9ÌTTUVCFVOKV6KVGNXQP/CVVJKCU,QUGRJE  44-N5EJTÌVNKPIUTKUUGWPF2T·IGUEJY·EJGUGJTUEJÌP -NÒ­GPFQTH*GTDQTP0T

77



79

78

&KEMGP9ÌTTUVCFVOKV6KVGN(GTFKPCPFU++,QUGRJD



80

445GJTUEJÌP



-TGW\GT )TQUEJGP Q,9ÌTTUVCFVOKV6KVGN(GTFKPCPFU++,QUGRJFE  9KP\5EJTÌVNKPIUTK­UGJTUEJÌP -NÒ­GPFQTH*GTDQTP0T



-NÒ­GPFQTH*GTDQTP0T



&+')4#(5%*#(65%*9#4<$74) 

)ÒPVJGT:.+XQP#TPUVCFV)TQUEJGPQ,#TPUVCFV(KUEJGTGCNGKEJVXCT  /KPIGDQIGPUGJTUEJÌP -NÒ­GPFQTH*GTDQTP0T



&+')4#(5%*#(651./5*1*'051./5 

2JKNKRR4GKPJCTF+&KEMGP0KGFGTYGKUGNOKV6KVGNXQP/CVVJKCU,QUGRJXCT 8QPITQ­GT5GNVGPJGKV/KPMQTTQFKGTVMN2T·IGUEJY·EJGUGJTUEJÌP -NÒ­GPFQTH*GTDQTP0T



81 1,5:1



1,5:1

&KEMGP0KGFGTYGKUGNOKV6KVGN(GTFKPCPFU++,QUGRJXCT  8QPITQ­GT5GNVGPJGKV-N5EJTÌVNKPIUHGJNGTUGJTUEJÌPpXQT\ÒINKEJ -NÒ­GPFQTH*GTDQTP0T

 23


DER MÜNZSCHATZ VON HERBORN

82

83

&+'56#&6914/5 

-TGW\GT,QUGRJDNGKEJVXCT



&KEMGP,QUGRJXCT

-NÒ­GPFQTH*GTDQTP0T -NÒ­GPFQTH*GTDQTP0T

84

442T·IGUEJY·EJGUGJTUEJÌP



,WUVKGTVUGJTUEJÌPpXQT\ÒINKEJ



85



-TGW\GT,QUGRJXCT



&KEMGP,QUGRJD



&KEMGP,QUGRJDC

-NÒ­GPFQTH*GTDQTP0T -NÒ­GPFQTH*GTDQTP0T -NÒ­GPFQTH*GTDQTP0T

86

445GJTUEJÌP



5GJTUEJÌP



5GJTUEJÌP



87

88

88

4¤/+5%*&'765%*'54'+%* 

'T\JGT\QI(GTFKPCPF<GJPGT/ÒJNCW*CNN/6  4/KPMQTTQFKGTVUGJTUEJÌPXQT\ÒINKEJ -NÒ­GPFQTH*GTDQTP0T





4WFQNH++4GKEJUVCNGT0$0CI[D±P[C&CX8QINJ8+  5VGORGNHGJNGTCWHFGT4ÒEMUGKVGXQT\ÒINKEJ



-NÒ­GPFQTH*GTDQTP0T

24


DER MÜNZSCHATZ VON HERBORN



90

91

89

4GKEJUVCNGT  -WVVGPDGTI /ÒP\OGKUVGT &CXKF 'PFGTNG &CX  &KGVKMGT  *CNCEMC    8QINJ+++ 5GJTUEJÌP



-NÒ­GPFQTH*GTDQTP0T



4GKEJUVCNGT-WVVGPDGTI/ÒP\OGKUVGT2CWN5MT¾VC5QVPQXUMÓXQP<±XQTKEG&CX&KGVKMGT *CNCEMC8QINJ+++ 'VYCUMQTTQFKGTVUGJTUEJÌP



-NÒ­GPFQTH*GTDQTP0T

$'.)+'0 &#5*'4<1)67/$4#$#06 

#NDGTVWPF+UCDGNNC(NQTKPF CTIGPV 5QNU #PVYGTRGP&GNO 4   445EJTÌVNKPIUHGJNGTCWHFGT8QTFGTUGKVGHCUVUGJTUEJÌP -NÒ­GPFQTH*GTDQTP0T

92



93

(NQTKPF CTIGPV 5QNU #PVYGTRGP&GNO 4   4-N2T·IGUEJY·EJGCO4CPFUGJTUEJÌPpXQT\ÒINKEJ



(NQTKPF CTIGPV 5QNU $TÒUUGN&GNO 4 

45GJTUEJÌP



(NQTKPF CTIGPV 5QNU $TÒUUGN&GNO 4  44ÒEMUGKVGGVYCUMQTTQFKGTVUGJTUEJÌP



-NÒ­GPFQTH*GTDQTP0T





-NÒ­GPFQTH*GTDQTP0T

94



95

-NÒ­GPFQTH*GTDQTP0T

&+'*'445%*#(64'%-*'+/ 

'TPUVXQP#URTGOQPV.[PFGP5VÒDGTQ,/KV8+4685241&'55'215&6CWH FGT4ÒEMUGKVGFG/G[p.WECUp \W 8CPJQWFVp \W)   44-N2T·IGUEJY·EJGUGJTUEJÌP -NÒ­GPFQTH*GTDQTP0T

 25


DER MÜNZSCHATZ VON HERBORN

96

97

&+'#$6'+56#8'.16 

(GTFKPCPFXQP$C[GTP5VÒDGTQ,OKV6KVGNXQP/CVVJKCU8CPJQWFV)NGKEJVXCT 445EJTÌVNKPIUTK­UGJTUEJÌP -NÒ­GPFQTH*GTDQTP0T



&+'*'445%*#(661740#+ 

#NDGTVWPF+UCDGNNC(NQTKPF CTIGPV 5QNU 6QWTPCK&GNO8CT  44(CUVUGJTUEJÌP -NÒ­GPFQTH*GTDQTP0T

98



99

(4#0-4'+%*('1&#.'5 &#5(ª456'067/%*#6'#74'0#7& 



(TCP¼QKUXQP$QWTDQPWPF.QWKUG/CTIWGTKVG'EWQ,2QG[F #XCPV  8QPITÌ­VGT5GNVGPJGKV5EJÌP -NÒ­GPFQTH*GTDQTP0T

&+'56#&6*#)'0#7



(4#0-4'+%*'.5#55

&KEMGPQ,'PIGN.GJTXCT

5GJTUEJÌP



-NÒ­GPFQTH*GTDQTP0T

100

101

102

&+'#$6'+/74$#%*70&.ª&'45 

.GQRQNFXQP¤UVGTTGKEJCNU#FOKPKUVTCVQT6CNGTQ,'PUKUJGKO/KV/10'KP FGT4ÒEMUGKVGPWOUEJTKHV&KXQXCT 8QT\ÒINKEJ



-NÒ­GPFQTH*GTDQTP0T



6CNGTQ,'PUKUJGKO/KV/10'KPFGT4ÒEMUGKVGPWOUEJTKHV&KXQXCT  -N<CKPGPFGHCUVXQT\ÒINKEJ



6CNGTQ,'PUKUJGKO/KV/10KPFGT4ÒEMUGKVGPWOUEJTKHV&KXQXCT  .GKEJVDGTKGDGPHCUVXQT\ÒINKEJ



-NÒ­GPFQTH*GTDQTP0T



-NÒ­GPFQTH*GTDQTP0T

26


DER MÜNZSCHATZ VON HERBORN

103

104

&#5$+567/564#55$74) 

-CTNXQP.QVJTKPIGP6CNGT'PIGN.GJTp

9KP\5EJTÌVNKPIUHGJNGTXQT\ÒINKEJ



(CUVXQT\ÒINKEJ



-NÒ­GPFQTH*GTDQTP0T



6CNGTQ,'PIGN.GJTNGKEJVXCT -NÒ­GPFQTH*GTDQTP0T

105



107

106

6CNGTQ,'PIGN.GJTXCT

8QT\ÒINKEJ



5GJTUEJÌPpXQT\ÒINKEJ



44/KP-QTTQUKQPUUVGNNGCO4CPFXQT\ÒINKEJ



-NÒ­GPFQTH*GTDQTP0T

&+'56#&6564#55$74) 

&KEMRHGPPKI 5GEJUD·V\PGT Q, ,CJTJWPFGTV 'PIGN.GJTNGKEJVXCT -NÒ­GPFQTH*GTDQTP0T

+6#.+'0 &#5(ª456'067/%144'))+1 

5KTQF #WUVTKC(KQTKPQQ,8CTGUK -NÒ­GPFQTH*GTDQTP0T

109 108

108

&#5*'4<1)67//#+.#0& 

2JKNKRR+++XQP5RCPKGP&GPCTQFC5QNFK%TKRRC$&CX  4-QTTQFKGTVHCUVUGJTUEJÌPUGJTUEJÌP -NÒ­GPFQTH*GTDQTP0T



&#5*'4<1)67//#067# 

)WINKGNOQ.KTCQ,$KIPQVVK 4 8CTGUK 4 

44(CUVUGJTUEJÌP



-NÒ­GPFQTH*GTDQTP0T

27


DER MÜNZSCHATZ VON HERBORN

111

110

&+'56#&6&'8'06'4 

110

0+'&'4.#0&'

6CNGTQ,OKV6KVGNXQP/CVVJKCU&GNOp \WFQTV,CJTICPI   8QPITQ­GT5GNVGPJGKV5GJTUEJÌPpXQT\ÒINKEJ -NÒ­GPFQTH*GTDQTP0T



$#.6+-7/ &#5)4155(ª456'067/.+6#7'0 

5KIKUOWPF#WIWUVXQP2QNGP)TÌUEJGT9KNPC)WO

5GJTUEJÌP



5KIKUOWPF+++)TÌUEJGT/ÒP\UV·VVGXGTOWVNKEJ$TQODGTI)WO  (CUVXQT\ÒINKEJ



-NÒ­GPFQTH*GTDQTP0T

112

113

&#5-¤0+)4'+%*21.'0 

113

21.'0

-NÒ­GPFQTH*GTDQTP0T

&#5$+567/%*74 

5%*9'+<

,QJCPP8(NWIKXQP#URGTOQPV&KEMGPQ,&6XCT 5EJTÌVNKPIUTK­UGJTUEJÌP



-NÒ­GPFQTH*GTDQTP0T

114

115

116

&+'*'445%*#(6*#.&'056'+0 

6JQOCU+XQP5EJCWGPUVGKP'JTGPHGNU&KEMGPQ,/KV2WPMVCWHFGT$TWUV&6C 44-N2T·IGUEJY·EJGUGJTUEJÌP



&KEMGPQ,/KV2WPMVCWHFGT$TWUV&6C

44-N2T·IGUEJY·EJGUGJTUEJÌP



44,WUVKGTVUGJTUEJÌP



-NÒ­GPFQTH*GTDQTP0T



-NÒ­GPFQTH*GTDQTP0T



&KEMGPQ,/KV4QUGVVGCWHFGT$TWUV&6CXCT -NÒ­GPFQTH*GTDQTP0T

28


DER MÜNZSCHATZ VON HERBORN

117

118

&+'56#&6.7<'40 

&KEMGP&6D



&KEMGP#NVFQTH&6D

5GNVGPKPFKGUGT'TJCNVWPI(CUVXQT\ÒINKEJ



8QPITQ­GT5GNVGPJGKV-N5EJTÌVNKPIUTK­UGJTUEJÌP



-NÒ­GPFQTH*GTDQTP0T

&'4-#061074+ -NÒ­GPFQTH*GTDQTP0T

119

120

121

&+'56#&6<7) 

&KEMGP&6E

(CUVXQT\ÒINKEJ





&KEMGPQ,&6C

5GJTUEJÌP





&KEMGPQ,&6C

5GJTUEJÌP



-NÒ­GPFQTH*GTDQTP0T -NÒ­GPFQTH*GTDQTP0T -NÒ­GPFQTH*GTDQTP0T

.165 .16'7412# 

#NNIGOGKP -QPXQNWV OKV  GWTQR·KUEJGP 5KNDGTOÒP\GP CWU FGO 5EJCV\HWPF XQP *GTDQTP JCWRV   U·EJNKEJ CWU FGT <GKV XQP  DKU  CDGT CWEJ GKPKIG 5VÒEMG UGKV FGO  ,CJTJWPFGTV DKU \WO   6CNGT8GTVTGVGPUKPFXQTCNNGO2QNGP.KVCWGPFKG5EJYGK\WPFFKGURCPKUEJGP0KGFGTNCPFGCDGTCWEJ &·PGOCTM 'PINCPF (TCPMTGKEJ WPF +VCNKGP &CU -QPXQNWV GPVJ·NV \CJNTGKEJG 5GNVGPJGKVGP 'U DKGVGV   GKPGPIWVGP'KPDNKEMKPFGP7ONCWHCWUN·PFKUEJGT2T·IWPIGP\WT<GKVFGTITQ­GP)GNFMTKUGFGT-KRRGT WPF9KRRGT\GKV#NNG/ÒP\GPUKPFUQTIH·NVKIDGUVKOOVWPFOKV.KVGTCVWT\KVCVGPXGTUGJGP  5VÒEM)GTKPIGTJCNVGPpXQT\ÒINKEJ 

.16#.6&'765%*.#0& 

-QPXQNWVOKVOGJTCNUFGWVUEJGP5KNDGTOÒP\GPCWUFGO5EJCV\HWPFXQP*GTDQTPJCWRVU·EJNKEJCWU FGT<GKVXQPDKUCDGTCWEJGKPKIGHTÒJGTG5VÒEMGUGKVFGO,CJTJWPFGTVXQO*GNNGTDKU \WO6CNGT8GTVTGVGPUKPFOGJTCNU/ÒP\UV·PFGOGKUVFGUJGUUKUEJYGUVH·NKUEJGP4CWOGUCDGTCWEJ CWU 0QTFFGWVUEJNCPF FGO 'NUC­ .QVJTKPIGP .WZGODWTI UQYKG FGP /ÒP\UV·VVGP FGU 4ÌOKUEJ   &GWVUEJGP 4GKEJGU &CU -QPXQNWV GPVJ·NV \CJNTGKEJG 5GNVGPJGKVGP 'U DKGVGV GKPGP DGUQPFGTU IWVGP   'KPDNKEMKPFCUFGWVUEJG/ÒP\YGUGPFGT)GNFMTKUGFGTUQIGPCPPVGP-KRRGTWPF9KRRGT\GKVWPFUQNNVG FCJGT WPDGFKPIV DGUKEJVKIV YGTFGP #NNG /ÒP\GP UKPF UQTIH·NVKI PCEJ 8CTKCPVGP DGUVKOOV WPF OKV   .KVGTCVWT\KVCVGPXGTUGJGP  %C5VÒEM<WO6GKNUGNVGP'KPKIG5VÒEMG\GTDTQEJGPIGTKPIGTJCNVGPpXQT\ÒINKEJ  29


ANHALT

&'765%*'/ª0<'070&/'&#+..'0

124

56#&6 

##%*'0

4GKEJUVCNGTOKV6KVGN/CZKOKNKCPU++&CX/GPCFKGTD  #VVTCMVKXGU'ZGORNCTOKVHGKPGT2CVKPCUGJTUEJÌP



125 (doppelt)

#0*#.6 #0*#.6-¤6*'0(ª456'067/5'+6*'4<1)67/ 

.GDTGEJVWPF'OCPWGN&QRRGNVGT4GKEJUVCNGT'KUNGDGPCWHFGP6QFKJTGU8GVVGTU 9KNJGNO .WFYKI  I 8GT\KGTWPI  9+.*'./75  .7&18+%75 & ) Û 24+0  #0*#.6 Ü   %1/Ü#5%Û&1/$'40$'65'48Ü0#6+++#7#1Ü%*4Û/Û&%Û:::++:Ü&'0#6Ü :+++Ü#24Û%+4%#*14Û+++Ü/'4+&Ü#1Ü%*4Û/Ü&%Ü.:8Ü8+:+6#0Ù::8+Û /'05Ü8+++Ü&+'5:+++Û&TGKHCEJDGJGNOVGUPGWPHGNFKIGU9CRRGPQDGP\WFGP5GKVGPFGT*GNOG FKGIGVGKNVG5KIPCVWT*2- *CPU2JKNKRR-QDWTIGT/ÒP\OGKUVGTKP'KUNGDGP WOJGT.GJTG OKEJFGKPYQTV/GKPGT5GGNGP*QTV&CX/CPP  8QPITQ­GT5GNVGPJGKV#VVTCMVKXGU'ZGORNCTOKVJÒDUEJGT2CVKPCXQT\ÒINKEJ 

126

 30

*GKPTKEJ8GTGKPUFQRRGNVCNGT#-5&CX-CJPV6JWP  40WT'ZGORNCTGIGRT·IV8QT\ÒINKEJ




ANHALT

127

128

128



5VCFV-ÌVJGP5KNDGTOGFCKNNGWPUKIPKGTVCWHFCUL·JTKIG$GUVGJGPFGU.WFYKIUI[OPCUKWOU $TWUVDKNF FGU (ÒTUVGP .WFYKI TGI   T OKV WOIGNGIVGO /CPVGN#PUKEJV XQO 5EJNQ­JQH   OOI 2TCEJVXQNNG2CVKPCHCUV5VGORGNINCP\



#0*#.6$'40$74)(ª456'067/5'+6*'4<1)67/ 

8KEVQT#OCFGWU6CNGTCWHFKG9KGFGTCWHPCJOGFGU$GTIDCWGUKO$KTPDCWOGT<WIG DGK*CT\IGTQFG&CX/CPP/ÒUGNGT  44/KP$GCTDGKVWPIUURWTGPKO4CPFDGTGKEJUGJTUEJÌP

130

129



131



(TKGFTKEJ#NDTGEJV-QPX6CNGT5KNDGTJÒVVG&CX/CPP  5GJTUGNVGPKPFKGUGT'TJCNVWPI2TCEJVGZGORNCT(GKPG2CVKPCHCUV5VGORGNINCP\





#NGZKWU(TKGFTKEJ%JTKUVKCP-QPX6CNGT#-5,  W­GTUVUGNVGPKPFKGUGT'TJCNVWPI-CDKPGVVUVÒEM2TCEJVXQNNG2CVKPC5VGORGNINCP\





#NGZCPFGT%CTN5KNDGTOGFCKNNGWPUKIPKGTVCWHFGP$GUWEJFGU*GT\QIURCCTGU#NGZ CPFGT%CTNWPF(TKGFGTKMGKP$CNNGPUVGFV*COOGTWPF5EJN·IGNIGMTGW\VCWH'KEJGP\YGKIGPWOJGTGKP $CPFOKVFGP<GKEJGPFGT/GVCNNGWPFFGT#WHUEJTKHV&'58#6'4.#0&'55%*6<'FCTWPVGTXKGT <GKNGP IGTCFG WPF XKGT <GKNGP IGDQIGPG 5EJTKHV <GKNGP 5EJTKHV  OO  I /CPP    /ÒUGNGT *ÒDUEJG2CVKPCXQT\ÒINKEJ

 31


ANHALT

132

#0*#.6&'55#7(ª456'067/5'+6*'4<1)67/ 

,QJCPP %CUKOKT  4GKEJUVCNGT  $GTNKP CWH UGKPGP 6QF  I &TGKHCEJ DGJGNOVGU   PGWPHGNFKIGU9CRRGP\WFGP5GKVGPFKG5KIPCVWT#$ &T#FTKCP$GEMGT9CTFGKPKP$GTNKP  <GKNGP5EJTKHV&CX/CPP 448QT\ÒINKEJGU2TCEJVGZGORNCTOKVHGKPGT2CVKPC 

134



133

133

,QJCPP)GQTI++6CNGT<GTDUV&CX/CPPC

5GJTUEJÌP



/KV FGT 'KPTKEJVWPI FGU 5GPKQTCVGU KO *CWUG #PJCNV YWTFG FGT LGYGKNU NVGUVTGIKGTGPFG WPVGT FGP TGIKGTGPFGP   (ÒTUVGP WPVGT CPFGTGO \WO +PJCDGT FGT 4GKEJUNGJGP CNUQ CWEJ FGU /ÒP\TGEJVGU DGUVGNNV 2T·IWPIGP FGT )GUCOV   JGKVFGT(ÒTUVGPYWTFGPXQPKJOXQPDKU,QJCPP)GQTI++XQP#PJCNV&GUUCWCNU\WUV·PFKIGT+PUVCP\ KO0COGPCNNGTTGIKGTGPFGP(ÒTUVGPCWUIGIGDGP&GTXQTNKGIGPFG<YGKFTKVVGNVCNGTMÌPPVGCDGTCWEJPQEJFGOCO ,WPKXGTUVQTDGPGP(ÒTUVGP(TKGFTKEJXQP#PJCNV$GTPDWTI*CT\IGTQFG\WIGUEJTKGDGPYGTFGPFGTUGKVFGP 5GPKQTCV KPPGJCVVG WPF KP FGUUGP #OVU\GKV FKG #WUICDG FGT  )WVG )TQUEJGP5VÒEMG XQP  H·NNV HTGWPFNKEJGT   *KPYGKUXQP*GKP\6JQTOCPP1UPCDTÒEM 



.GQRQNF(TKGFTKEJ-W2HGPPKI#-5,  5GJTUGNVGPKPFKGUGT'TJCNVWPI2TCEJVGZGORNCT2QNKGTVG2NCVVG



135

#0*#.65%*#7/$74)(ª456'067/ 

%CTN .WFYKI  -QPX6CNGT  (TCPMHWTV #WUDGWVG FGU *QN\CRRGNGT $GTIYGTMU   &CX/CPP/ÒUGNGT 48QT\ÒINKEJ 

136

137

#0*#.6*'4<1)67/ 

)GOGKPUEJCHVURT·IWPIGP5KNDGTITQUEJGP#-5,  5GJTUGNVGPKPFKGUGT'TJCNVWPI2TCEJVGZGORNCT2QNKGTVG2NCVVG





5KNDGTITQUEJGP#-5,  5GJTUGNVGPKPFKGUGT'TJCNVWPI2TCEJVGZGORNCT2QNKGTVG2NCVVG



32


AUGSBURG

138

140

139



5KNDGTITQUEJGP#-5,

 5GJTUGNVGPKPFKGUGT'TJCNVWPI2TCEJVGZGORNCT2QNKGTVG2NCVVG





5KNDGTITQUEJGP#-5,  5GJTUGNVGPKPFKGUGT'TJCNVWPI2TCEJVGZGORNCT2QNKGTVG2NCVVG





5KNDGTITQUEJGP#-5,

142

56#&6

 5GJTUGNVGPKPFKGUGT'TJCNVWPI2TCEJVGZGORNCT2QNKGTVG2NCVVG



141 142

#7)5$74)



)WNFGPVCNGT -TGW\GT OKV6KVGN/CZKOKNKCPU++&CX(QTUVGT  'VYCU$GNCIUGJTUEJÌPpXQT\ÒINKEJ





4GKEJUVCNGT TÌOKUEJG,CJTGU\CJNKO5VGORGNCWUIG·PFGTV OKV6KVGN(GTFKPCPFU++&CX (QTUVGT 5GJTUEJÌPpXQT\ÒINKEJ



143



144

145

4GKEJUVCNGTOKV6KVGN(GTFKPCPFU++&CX(QTUVGT  5GJTCVVTCMVKXGU'ZGORNCTOKVJÒDUEJGT2CVKPCHCUVXQT\ÒINKEJ





4GKEJUVCNGTOKV6KVGN(GTFKPCPFU++&CX(QTUVGT





4GKEJUVCNGTIGRT·IVWPVGTUEJYGFKUEJGT$GUGV\WPIFWTEJ)WUVCX++#FQNH#JNUVTÌO&CX (QTUVGT*CICPFGT 8QT\ÒINKEJ

5GJTUEJÌP

 33


AUGSBURG

146



 

148

147

4GKEJUVCNGTIGRT·IVWPVGTUEJYGFKUEJGT$GUGV\WPIFWTEJ)WUVCX++#FQNH#JNUVTÌO&CX (QTUVGT*CICPFGT )GTGKPKIVXQT\ÒINKEJ 9GKVGTG #WIUDWTIGT 2T·IWPIGP CWU FGT 5COONWPI FGT (TGKJGTTGP $QPFG HKPFGP 5KG KP -CVCNQI    WPVGTFGP0TP 4GKEJUVCNGTOKV6KVGN(GTFKPCPFU+++&CX(QTUVGT 445GJTUEJÌP 4GKEJUVCNGTOKV6KVGN(GTFKPCPFU+++&CX(QTUVGT -N(GKNURWTCO4CPFXQT\ÒINKEJ

149

151

 

150

 

4GKEJUVCNGTOKV6KVGN.GQRQNFU+&CX(QTUVGT 4GKEJUVCNGTOKV6KVGN.GQRQNFU+&CX(QTUVGT



$TGVVUVGKP CWU FWPMNGO *QN\ Q , 'PFG FGU  ,CJTJWPFGTVU  IGHGTVKIV KP #WIUDWTI XQP %JT ,   .GJGTTCWHFKG.KGDGWPFFCU)NÒEM#/17464178'/1;'0 .KGDGHKPFGV/KVVGN #OQTTWFGTV PCEJNCWHUGKPGO-ÌEJGTFGPGTCNU5EJKHHDGPWV\VKO*KPVGTITWPF5GIGNUEJKHHG08038#/0+*+.Ü

0KGOCNUPKEJVU 2WVVQUVGJVXXKPFGT4GEJVGPGKPGDTGPPGPFG.CORGCWUUGKPGT.KPMGPH·NNVGKP 9ÒTHGNOO(QTUVGT*KOOGNJGDGT 4ÒEMUGKVG  8QT\ÒINKEJ

34



-N<CKPGPFGUGJTUEJÌP 5GJTUEJÌPpXQT\ÒINKEJ

 




BADEN

153

152





152

$TGVVUVGKPCWUJGNNGO*QN\Q, 'PFGFGU,CJTJWPFGTVU IGHGTVKIVKP#WIUDWTIXQP%JT,.GJGTT CWHFKG-KPFGTGT\KGJWPIÉ%106+%8+55'Û&'%'6Û 'U\KGOVUKEJ\WUEJYGKIGP 'KP2WVVQUVGJVHCUV XXWPFJ·NVGKPGP(KUEJKPFGT.KPMGPFGPTGEJVGP<GKIGHKPIGTCWHFGP/WPFIGNGIVÉ)#448.#Û .+0)8#Û01%'6Û &KGIGUEJY·V\KIG<WPIGUEJCFGV 'KP2WVVQUVGJVPCEJTOKVGKPGO8QIGNCWH FGT4GEJVGPXQTKJOGKPG)CPUOO(QTUVGT*KOOGNJGDGT 8QT\ÒINKEJ 6CNGT(QTUVGT *ÒDUEJG2CVKPCLWUVKGTVXQT\ÒINKEJ

 

155 154



154

5KNDGTOGFCKNNG  XQP  , 6JKGDCWF CWH FKG )TÒPFWPI FGT 5VCFV FWTEJ FKG 4ÌOGT 'KP IGMTÌPVGT   #WHDCW CWU  9CRRGP KP FTGK 4GKJGP KP FGT /KVVG 5VCFVR[T \W FGP 5GKVGP FKG (NW­IÌVVGT .GEJ WPF   9GTVCEJ#PUKEJVFGU#WIWUVWUDTWPPGPUOOI(QTUVGT  9KP\5EJTÌVNKPIUHGJNGTCO4CPFXQT\ÒINKEJp5VGORGNINCP\  'ZGORNCTFGT#WMVKQP(TKV\4WFQNH-ÒPMGT1UPCDTÒEM0T

$#&'0/#4-)4#(5%*#(6 

$#&'0

%JTKUVQRJ+Ó&KEMGP9KGNCPFV  9KP\5EJTÌVNKPIUTKUUGWPF2TQDKGTURWTCO4CPF UGJTCVVTCMVKXGUXQT\ÒINKEJGU'ZGORNCTOKVHGKPGT2CVKPC 

156



$#&'0$#&'0/#4-)4#(5%*#(6

.WFYKI9KNJGNO$TGVVUVGKPCWUJGNNGO*QN\Q, WO IGHGTVKIVKP0ÒTPDGTIXQP2 */ÒNNGTCWHFKG5KGIGFGU/CTMITCHGPÒDGTFKG6ÒTMGPDGK5CNCPMCOGP.KRRC)TQ­YCTFGKP$TQF WPF)TCFKUECKPFGP,CJTGPWPF&GTIGJCTPKUEJVG/CTMITCHTGKVGVTOKV(GNFJGTTGPUVCDWPF *GNO KO *KPVGTITWPF GKPG 4GKVGTUEJNCEJV.ÌYG XGTHQNIV GKP PCEJ T HNKGJGPFGU 4WFGN 9ÌNHG N GKP   $CWOUVWORHCWUFGOGKP<YGKIURTKG­VOO*KOOGNJGDGT 8QT\ÒINKEJ

 35


BADEN

157



.WFYKI)GQTIWPVGT8QTOWPFUEJCHVUGKPGT/WVVGT(TCP\KUMC5KD[NNC#WIWUVC Ó  5KNDGTOGFCKNNGXQP)98GUVPGTCWHFGP(TKGFGPXQP4CUVCVV#PUKEJVFGU5EJNQUUGUXQP4CUVCVV XQP FGT 'JTGPJQHUGKVG&KG RGTUQPKHK\KGTVG $GUV·PFKIMGKV OKV 5VCD WPF (ÒNNJQTP UVGJV X X  OO   I$GTPJGKOGT2CZKP0WOOKU2QRGNMC#PO9KGNCPFV<GKV\p 5GJTUEJÌP



&KG8QTFGTUGKVGVT·IVFKG,CJTGU\CJNCNU%JTQPQITCOO  &GT (TKGFGPUUEJNW­ XQP 4CUVCVV XQO  /·T\  \YKUEJGP 2TKP\ 'WIGP CNU $GXQNNO·EJVKIVGO FGU -CKUGTU WPF   FGOHTCP\ÌUKUEJGP/CTUEJCNN8KNNCTUDGGPFGVGFGP5RCPKUEJGP'TDHQNIGMTKGI

158

159

160

$#&'0&74.#%*/#4-)4#(5%*#(6 5'+6-74(ª456'067/5'+6)4155*'4<1)67/ 

(TKGFTKEJ84GKEJUVCNGT2HQT\JGKO&CX9KGNCPFV  *ÒDUEJG2CVKPCYKP\<CKPGPFGCVVTCMVKXGUUGJTUEJÌPGU'ZGORNCT





-CTN 9KNJGNO  5KNDGTOGFCKNNG  XQP 2 * /ÒNNGT CWH UGKPGP 4GIKGTWPIUCPVTKVV )G   JCTPKUEJVGU $TWUVDKNF T OKV WOIGNGIVGO /CPVGN)GMTÌPVGT .ÌYG OKV FQRRGNVGO 5EJYGKH UEJTGKVGV N   ÒDGT\GTUVÌTVG9CHHGPOOI(QTUVGT9KGNCPFV<GKV\  #VVTCMVKXGUHCUVXQT\ÒINKEJGU'ZGORNCT



-CTN9KNJGNO ,CPWCTÓ/CKYCTFGT5QJPFGU/CTMITCHGP(TKGFTKEJ8++WPFFGUUGP)GOCJ NKP#WIWUVC/CTKCXQP*QNUVGKP)QVVQTR-CTN9KNJGNOFGT5VCFVITÒPFGTXQP-CTNUTWJGHQNIVGUGKPGO8CVGT(TKGF TKEJ 8++ /CIPWU CO  ,WPK  KP FGT 4GIKGTWPI 'T JCVVG PCEJ 5VWFKGP KP .CWUCPPG )GPHWPF7VTGEJVWPVGT UGKPGO 8GVVGT FGO 6ÒTMGPNQWKU CO 4GKEJUMTKGI IGIGP (TCPMTGKEJ WPF CO 5RCPKUEJGP 'TDHQNIGMTKGI VGKNIGPQO   OGP+PFGT6TWRRGPHÒJTWPIJGTXQTTCIGPFDGY·JTVUVKGIGTDKU\WO)GPGTCNHGNF\GWIOGKUVGTCWH  &KG 4ÒEMUGKVGPFCTUVGNNWPI FGT XQTNKGIGPFGP /GFCKNNG PKOOV CNNGIQTKUEJ CWH FKG OKNKV·TKUEJG .CWHDCJP FGU .ÌYGP   CWU<·JTKPIGT)GUEJNGEJV$G\WI



36

-CTN(TKGFTKEJ-QPX6CNGT&WTNCEJ&CX9KGNCPFV  *ÒDUEJG2CVKPCCVVTCMVKXGUUGJTUEJÌPGU'ZGORNCT




BADEN

161

161 1,5:1



-QPX6CNGT#-5&CX-CJPV6JWP  44-CDKPGVVUVÒEMXQPHGKPUVGT'TJCNVWPI*GTTNKEJG2CVKPC'TUVCDUEJNCI5VGORGNINCP\



'ZGORNCTFGT5COONWPI8KTIKN/$TCPF6GKN#WMVKQP.GW<ÒTKEJ0T



$TQP\GOGFCKNNGXQP,2&TQ\WPF$#PFTKGWCWHFKG8GTO·JNWPIUGKPGU'PMGNU-CTN.WFYKI (TKGFTKEJ OKV 5VGRJCPKG FG $GCWJCTPCKU #FQRVKXVQEJVGT 0CRQNGQPU + $ÒUVG 0CRQNGQPU + T OKV .QT   DGGTMTCP\&KG 2TKP\GUUKP WPF FGT 2TKP\ CNU ,CMQD WPF 4CEJGN UVGJGP GKPCPFGT IGIGPÒDGT WPF TGKEJGP   UKEJFKG*·PFGQDGPUVTCJNGPFGU0OO5NI,WNKWU FQTVKP5KNDGT 9KGNCPFV<GKV\ 5R·VGTG2T·IWPI8QT\ÒINKEJ

163

164



165



-CTN.WFYKI(TKGFTKEJ-TQPGPVCNGT#-5&CX-CJPV6JWP  5GJTUEJÌP



.WFYKI  -TQPGPVCNGT  /KV 5KIPCVWT 9& XGTUEJNWPIGP  WPVGT FGT $ÒUVG #-5    &CX-CJPV6JWP#  5GJTUGNVGPDGUQPFGTUKPFKGUGT'TJCNVWPI2TCEJVGZGORNCTOKVJGTTNKEJGT2CVKPC 8QT\ÒINKEJp5VGORGNINCP\ 



-CTN .GQRQNF (TKGFTKEJ  -TQPGPVCNGT  /ÒP\DGUWEJ #-5  &CX  -CJPV    6JWP 4(GKPG2CVKPCYKP\4CPFHGJNGTXQT\ÒINKEJp5VGORGNINCP\ 



37


BADEN

167

166

 

8GTGKPUFQRRGNVCNGT#-5&CX-CJPV6JWP &QRRGNIWNFGP#-5&CX-CJPV6JWP

8QT\ÒINKEJ 8QT\ÒINKEJ

 

168 1,5:1



1,5:1

(TKGFTKEJ+)WNFGPQ,2T·OKGPIWNFGPHÒTFKG)CTPKUQPUUEJWNGHÒT(NGK­WPF5KVV NKEJMGKV  I -QRH T FCTWPVGT FKG 5KIPCVWT 81+)6(ÒPH <GKNGP 5EJTKHV KP 2CNO\YGKIGP OKV   5EJNGKHGQDGP5VGTPWPVGP$KGPG#-5,  8QPITÌ­VGT5GNVGPJGKV2TCEJVGZGORNCT2QNKGTVG2NCVVG 

170

169

171



8GTGKPUVCNGT#-5&CX-CJPV6JWP  8QT\ÒINKEJGU'ZGORNCTXQPRQNKGTVGP5VGORGNP





5KNDGTOGFCKNNG  XQP % 5EJPKV\URCJP CWH FCU L·JTKIG ,WDKN·WO FGU .CPFYKTVUEJCHVNKEJGP 8GT   GKPU-QRHN5GEJU<GKNGP5EJTKHVKP'KEJGPNCWDMTCP\OOI9KGNCPFV<GKV\  -CDKPGVVUVÒEM+P'VWK2TCEJVXQNNG2CVKPC5VGORGNINCP\



5KNDGTOGFCKNNGXQP.GC#JNDQTPCWHFKG8GTO·JNWPIUGKPGT6QEJVGT8KMVQTKCOKVFGOUEJYGFK UEJGP -TQPRTKP\GP )WUVCX $GKFGT $ÒUVGP PGDGPGKPCPFGT T#WH 2QFGUV FKG 9CRRGP XQP 5EJYGFGP   WPF 0QTYGIGP UQYKG $CFGP QDGP FKG UEJYGFKUEJG -TQPRTKP\GPMTQPG  OO  I 9KG   NCPFV<GKV\ 2TCEJVGZGORNCTOKVJGTTNKEJGT6ÌPWPI(CUV5VGORGNINCP\





38


BAMBERG

$#/$'4)

$+567/ 



174

172

173

5GFKUXCMCP\5KNDGTOGFCKNNGXQP229GTPGT-CKUGT*GKPTKEJ++VJTQPVXXOKV<GRVGT WPF 4GKEJUCRHGN WOJGT 9CRRGPMTCP\2QUVCOGPV OKV 5VKHVUYCRRGP FCTCWH 5EJYGTV $KUEJQHUUVCD   (ÒTUVGPJWV /KVTC WPF -TGW\ FCTÒDGT UVTCJNGPFGU )QVVGUCWIG N PGDGP FGO 2QUVCOGPV NGJPV -CKUGT   *GKPTKEJ++TUVGJV-CKUGTKP%WPKIWPFCOKV<GRVGTKO*KPVGTITWPFLGYGKNUFKG#PUKEJVFGT&QOMKT EJGWOJGT9CRRGPMTCP\OOI*GNNGT<GRGTPKEM  8QT\ÒINKEJGU'ZGORNCTOKVHGKPGT6ÌPWPI



%JTKUVQRJ(TCP\XQP$WUGEM-QPX6CNGT&CX-TWI  .GKEJVDGTKGDGPUGJTUEJÌP



56#&6 

5KNDGTIW­OGFCKNNGWPUKIPKGTVXQP/CVVJGU)GDGNCWHFGP$CODGTIGT$ÒTIGT9QNH*QRH  $TWUVDKNF *QRHU T OKV WOIGNGIVGO /CPVGN$GJGNOVGU (COKNKGPYCRRGP *QRH  OO  I   *CDKEJ++OJQH 5R·VGTGT)W­5GJTUEJÌP

176

175



176

$#;'40 *'4<1)67/5'+6-74(ª456'067/5'+6-¤0+)4'+%* 



9KNJGNO +8 WPF .WFYKI  5KNDGTIW­OGFCKNNG  WPUKIPKGTV XQP (TKGFTKEJ *CIGPCWGT   CWH FGP /ÒPEJGPGT -QORQPKUVGP .WFYKI 5GPPHN  $CUGN Ó /ÒPEJGP $ÒUVG 5GPPHNU T  (ÒPH<GKNGP5EJTKHVFCTWPVGT.CWDDNCVVOOI*CDKEJ+*CWUGT  5R·VGTGT)W­5GJTUEJÌP



#NDGTV8FGT)TQ­OÒVKIG)WNFGPVCNGT -TGW\GT /ÒPEJGPOKV6KVGN/CZKOKNK CPU++&CX*CJP 5GNVGPKPFKGUGT'TJCNVWPI(CUVXQT\ÒINKEJ

 39


BAYERN

178

177

177



/CZKOKNKCP+-KRRGT-TGW\GT )WNFGP /ÒPEJGP*CJPC5NI-TCC\p  4(CUVXQT\ÒINKEJ





4GKEJUVCNGT/ÒPEJGP&CX*CJP  8QPITQ­GT5GNVGPJGKV8QT\ÒINKEJGU'ZGORNCTOKVHGKPGT6ÌPWPI



180

181

179



4GKEJUVCNGT/ÒPEJGP/KVTÌOKUEJGT,CJTGU\CJN&CX*CJP

448QT\ÒINKEJ





/CZKOKNKCP++'OCPWGN4GKEJUVCNGT/ÒPEJGP&CX*CJP  (CUVXQT\ÒINKEJ





/CZKOKNKCP +++ ,QUGRJ  -QPX6CNGT  # #ODGTI #TUNCPKVCNGT /KV 4CPFUEJTKHV   &CX*CJP 4/KPLWUVKGTVUGJTUEJÌP  &GT 7TURTWPI FKGUGU 6CNGTU YKTF CWH MCWHO·PPKUEJG 7PVGTPGJOWPIGP KP FGT .GXCPVG \WTÒEMIGHÒJTV &GT 0COG   TÒJTVXQPFGO.ÌYGPJGTFGTCWHVÒTMKUEJ#TUNCPJGK­V

182

183



-CTN6JGQFQT-TGW\GT##ODGTI*CJP  5GNVGPKPFKGUGT'TJCNVWPI/KPLWUVKGTVHCUV5VGORGNINCP\



/CZKOKNKCP+ +8 ,QUGRJ-QPX6CNGT#-5*CJP

40

 45GJTUEJÌP

 


BAYERN

185 184

184



-QPX6CNGT  /KV /#:+/ Û ,15'2* KP FGT 8QTFGTUGKVGPWOUEJTKHV #-5  #PO &CX    -CJPV6JWP 445GJTUEJÌP 



5KNDGTOGFCKNNGKPFGT)TÌ­GGKPGUHTCP\ÌUKUEJGP(TCPEU5VÒEMUXQP,26KQNKGTCWHFGP$GUWEJ FGU -TQPRTKP\GP .WFYKI KP FGT 2CTKUGT /ÒP\UV·VVG $TWUVDKNF T KP 7PKHQTO OKV WOIGNGIVGO 1TFGPU   DCPF5GEJU <GKNGP 5EJTKHV /KV 4CPFITCXWT ‰ $#.#0%+'4 # 8+41.' #&126'y '0    OOI/C\CTF9KVV 8QT\ÒINKEJ

187

186



188



-QPX6CNGT8GTHCUUWPI#-5&CX-CJPV6JWP  8QT\ÒINKEJXQT\ÒINKEJp5VGORGNINCP\





5KNDGTOGFCKNNG  XQP , .ÌUEJ 2T·UGPV FGT 5V·PFG \WO ,CJTGUVCI FGT 8GTHCUUWPI $ÒUVG T5GEJU   <GKNGP5EJTKHVOOI9KVV *ÒDUEJG2CVKPCYKP\4CPFHGJNGTXQT\ÒINKEJ





.WFYKI+-QPX6CNGT4GIKGTWPIUCPVTKVV#-5&CX-CJPV6JWP 8QT\ÒINKEJ



189

190



-QPX6CNGT  8GTNGIWPI FGT .WFYKI /CZKOKNKCPU*QEJUEJWNG XQP .CPFUJWV PCEJ /ÒPEJGP   #-5&CX-CJPV6JWP (CUVXQT\ÒINKEJ





-QPX6CNGT4GKEJGPDCEJ(TCWPJQHGT#-5&CX-CJPV6JWP



8QT\ÒINKEJ

41


BAYERN

  

-QPX6CNGT.WFYKIU1TFGP#-5&CX-CJPV6JWP 8QT\ÒINKEJp5VGORGNINCP\ -QPX6CNGT.WFYKIU1TFGP#-5&CX-CJPV6JWP (CUVXQT\ÒINKEJ -QPX6CNGT8GTHCUUWPIUU·WNG#-5&CX-CJPV6JWP 8QT\ÒINKEJ

194

  

193

192

191

196

195

-QPX6CNGT8GTHCUUWPIUU·WNG#-5&CX-CJPV6JWP 5GJTUEJÌPpXQT\ÒINKEJ -QPX6CNGT5GIGPFGU*KOOGNU#-5&CX-CJPV6JWP 8QT\ÒINKEJ -QPX6CNGT5GIGPFGU*KOOGNU#-5&CX-CJPV6JWP 8QT\ÒINKEJ

197

  

  

198



-QPX6CNGT  *CPFGNUXGTVTCI \YKUEJGP $C[GTP 2TGW­GP 9ÒTVVGODGTI WPF *GUUGP #-5    &CX-CJPV6JWP (CUVXQT\ÒINKEJ





-QPX6CNGT<QNNXGTGKP#-5&CX-CJPV6JWP



42

8QT\ÒINKEJ


BAYERN

200

199



201

8GTUKNDGTVG-W2TQDG\W6CNGTXQP6'TVGNCWHFKG'TTKEJVWPIFGU&GPMOCNUHÒTFKGKP 4W­NCPFIGHCNNGPGP$C[GTP/KV4KHHGNTCPFI&KXQ2*CWUGT6JWP\W9KVV  448QT\ÒINKEJ





-QPX6CNGT.CPFVCI#-5&CX-CJPV6JWP  2TCEJVGZGORNCT'TUVCDUEJNCIHCUV5VGORGNINCP\





-QPX6CNGT$C[GTKUEJG*[RQVJGMGP$CPM#-5&CX-CJPV6JWP  8QT\ÒINKEJp5VGORGNINCP\



202

203

202



-QPX6CNGT&GP$GPGFKMVKPGTPYKGFGTGKPG.GJTCPUVCNVÒDGTIGDGP#-5&CX-CJPV 6JWP 8QT\ÒINKEJ





5KNDGTPG <YKVVGTOGFCKNNG Q ,   XQP , , 0GWUU CWH UGKPG 5KNDGTJQEJ\GKV IGUVKHVGV XQO   JKUVQTKUEJGP8GTGKP\W$CODGTIWPFCWHUGKPG4ÒEMMGJTCWU)TKGEJGPNCPF#PUKEJVFGT&QOMKTEJG\W $CODGTI&GT-ÌPKIKPCPVKMGO)GYCPFYKTFXQPFGTVTCWGTPFGP*GNNCUXGTCDUEJKGFGVWPFXQP$CXC TKCGORHCPIGPOOI9KVV 44/KPDGTKGDGPXQT\ÒINKEJ



204



-TQPGPVCNGT#-5&CX-CJPV6JWP



-QPX6CNGT1VVQ-CRGNNG#-5&CX-CJPV6JWP

205

(CUVXQT\ÒINKEJXQT\ÒINKEJ



5GJTUEJÌPpXQT\ÒINKEJ

 43


BAYERN

206

207



-QPX6CNGT5V/KEJCGNU1TFGP#-5&CX-CJPV6JWP



8GTGKPUFQRRGNVCNGT'KPVGKNWPIFGU-ÌPKITGKEJU/KV4CPFUEJTKHVmm&4';'+0*#.$)7.&'0 mm8++'(/#-5C&CX-CJPV6JWP 8QT\ÒINKEJ

208

209

(CUVXQT\ÒINKEJ

 

211

210



8GTGKPUFQRRGNVCNGT'KPVGKNWPIFGU-ÌPKITGKEJU/KV4CPFUEJTKHVmm&4';'+0*#.$)7.&'0 mm8++'(/#-5C&CX-CJPV6JWP 8QT\ÒINKEJ





8GTGKPUFQRRGNVCNGT#-5&CX-CJPV6JWP

8QT\ÒINKEJ





8GTGKPUFQRRGNVCNGT#-5&CX-CJPV6JWP

5GJTUEJÌPUGJTUEJÌPpXQT\ÒINKEJ





8GTGKPUFQRRGNVCNGT  8GTO·JNWPI FGU -TQPRTKP\GP /CZKOKNKCP OKV /CTKG XQP 2TGW­GP /KV   4CPFUEJTKHVmm&4';'+0*#.$)7.&'0mm8++'(/#-5C&CX-CJPVXCT 6JWPXCT 8QT\ÒINKEJp5VGORGNINCP\

212



 44



213

8GTGKPUFQRRGNVCNGT  )TÒPFWPI FGT *QEJUEJWNG KP 'TNCPIGP /KV 4CPFUEJTKHV m m &4';   '+0*#.$)7.&'0mm8++'(/#-5C&CX-CJPVXCT6JWPXCT  'TUVCDUEJNCIOKP4CPFHGJNGTXQT\ÒINKEJp5VGORGNINCP\



8GTGKPUFQRRGNVCNGT(GNFJGTTPJCNNG/KV4CPFUEJTKHVmm&4';'+0*#.$)7.&'0mm8++' (/#-5C&CX-CJPVXCT6JWPXCT /KP4CPFHGJNGTXQT\ÒINKEJp5VGORGNINCP\




BAYERN

215

214



8GTGKPUFQRRGNVCNGT'TDRTKP\.WFYKI/KV4CPFUEJTKHVmm&4';'+0*#.$)7.&'0mm8++ '(/#-5C&CX-CJPVXCT6JWPXCT 5GJTUEJÌPpXQT\ÒINKEJ





8GTGKPUFQRRGNVCNGT.WFYKIUMCPCN/KV4CPFUEJTKHVmm&4';'+0*#.$)7.&'0mm8++'(/ #-5C&CX-CJPVXCT6JWPXCT (GKPG2CVKPCXQT\ÒINKEJ



216





217

8GTGKPUFQRRGNVCNGT  ,WNKWU 'EJVGT XQP /GURGNDTWPP /KV 4CPFUEJTKHV m m &4';'+0*#.$   )7.&'0mm8++'(/#-5C&CX-CJPVXCT6JWPXCT  4GUVGXQP<CRQPNCEMHCUVXQT\ÒINKEJ



/CZKOKNKCP++8GTGKPUFQRRGNVCNGT#-5&CX-CJPV6JWP  5GNVGPGT,CJTICPI9KP\4CPFHGJNGTUGJTUEJÌPpXQT\ÒINKEJXQT\ÒINKEJ



218

219

220



8GTGKPUFQRRGNVCNGT#-5&CX-CJPV6JWP

(CUVXQT\ÒINKEJ





8GTGKPUFQRRGNVCNGT#-5&CX-CJPV6JWP

(CUVXQT\ÒINKEJ





8GTGKPUFQRRGNVCNGT  )NCURCNCUV /KV 4CPFUEJTKHV ô 8'4'+05/ª0<' ô 8++ '+0' ( /#4-   #-5C&CX-CJPV6JWP 8QT\ÒINKEJ

 45


BAYERN

221

222

223



8GTGKPUFQRRGNVCNGT  )NCURCNCUV /KV 4CPFUEJTKHV ô 8'4'+05/ª0<' ô 8++ '+0' ( /#4-   #-5C&CX-CJPV6JWP -N5EJTÌVNKPIUHGJNGTXQT\ÒINKEJ





8GTGKPUFQRRGNVCNGT#-5&CX-CJPV6JWP9KVV

(CUVXQT\ÒINKEJ





8GTGKPUFQRRGNVCNGT#-5&CX-CJPV6JWP  #VVTCMVKXGU'ZGORNCTOKVJÒDUEJGT2CVKPCXQT\ÒINKEJ



224





 46

225

226

8GTGKPUFQRRGNVCNGT UR·VGTG2T·IWPICD &GPMOCNFGU-ÌPKIUKP.KPFCW/KV4CPFUEJTKHVn &4';'+0*#.$)7.&'0n:8'+02(70&('+0#-5&CX-CJPV6JWP  0WT'ZGORNCTGIGRT·IV2TCEJVGZGORNCT'TUVCDUEJNCIHCUV5VGORGNINCP\



8GTGKPUFQRRGNVCNGT UR·VGTG2T·IWPICD &GPMOCNFGU-ÌPKIUKP.KPFCW/KV4CPFUEJTKHVn &4';'+0*#.$)7.&'0n:8'+02(70&('+0#-5&CX-CJPV6JWP  0WT'ZGORNCTGIGRT·IV*ÒDUEJG2CVKPCXQT\ÒINKEJ



&QRRGNVGT8GTGKPUVCNGT#-5&CX-CJPV6JWP



(CUVXQT\ÒINKEJ


BENTHEIM

227



.WFYKI++5KNDGTOGFCKNNGQ,XQP,4KGU2TGKUOGFCKNNGFGUNCPFYKTVUEJCHVNKEJGP8GT GKPU2HNWI5GEJU<GKNGP5EJTKHVWOJGT(TÒEJVGMTCP\OOI9KVVp 8QT\ÒINKEJ

230

229

228





&QRRGNVGT8GTGKPUVCNGT#-5&CX-CJPV6JWP  44/GJTGTGMN-TCV\GTUQPUVXQT\ÒINKEJ



&QRRGNVGT8GTGKPUVCNGT#-5&CX-CJPV6JWP

 449KP\-TCV\GTXQT\ÒINKEJ





&QRRGNVGT8GTGKPUVCNGT#-5&CX-CJPV6JWP

 449KP\-TCV\GTXQT\ÒINKEJ





232

231

$'06*'+/ $'06*'+/6'%-.'0$74)4*'&#)4#(5%*#(6 

/QTKV\   6CNGT &QRRGNVGT (ÒTUVGPITQUEJGP   -KTEJUVCRGN OKV 6KVGN .GQRQNFU +   -GPPGRQJNE 45GJTUEJÌP



6CNGT &QRRGNVGT(ÒTUVGPITQUEJGP -KTEJUVCRGNOKV6KVGN.GQRQNFU+-GPPGRQJNI  45GJTUEJÌP 'KP(ÒPUVÒDGTUVÒEMFGU)TCHGP#FQNHCWUFGO5EJCV\HWPFXQP*GTDQTPHKPFGP5KGWPVGT0T

  47


BRANDENBURG IN FRANKEN

233

234

$4#0&'0$74)+0(4#0-'0 $4#0&'0$74)$#;4'76*/#4-)4#(5%*#(6 

%JTKUVKCP4GKEJUVCNGT-WNODCEJ&CX5NI9KNOp  #VVTCMVKXGUUGJTUEJÌPGU'ZGORNCTOKVUEJÌPGT2CVKPC



%JTKUVKCPG %JCTNQVVG CNU 8QTOÒPFGTKP KJTGU 5QJPGU -CTN 9KNJGNO (TKGFTKEJ  5KNDGT   OGFCKNNG Q ,   XQP 2 2 9GTPGT CWH FKG -TÌPWPI FGT 2TKP\GUUKP 9KNJGNOKPG -CTQNKPG XQP   #PUDCEJ\WTGPINKUEJGP-ÌPKIKP%CTQNKPGWPFKJTGU)GOCJNU)GQTI\WOGPINKUEJGP-ÌPKI)GQTIG++ $GKFGT$TWUVDKNFGTPGDGPGKPCPFGTT$TKVCPPKCOKV-TQPG<GRVGTWPFGPINKUEJGO5EJKNFVJTQPVXXCWH 5VWHGP FCTCWH UKV\GP N GKP DGJGNOVGT -TKGIGT OKV FGO 9GNHGPUEJKNF T YGKDNKEJG )GUVCNV OKV FGO   DTCPFGPDWTIKUEJGP 9CRRGPUEJKNF WPF ¤N\YGKI  OO  I 'KOGT p (KUEJGT/CW¾    5NI9KNO 48QT\ÒINKEJ



$4#0&'0$74)#05$#%*/#4-)4#(5%*#(6

235



237



236

%JTKUVKCP(TKGFTKEJ-CTN#NGZCPFGT-QPX6CNGT5EJYCDCEJCWHFKG8GTGKPKIWPI FGTDGKFGP(ÒTUVGPVÒOGT&CX5NI9KNO  2TCEJVGZGORNCTOKVHGKPGT6ÌPWPI8QT\ÒINKEJp5VGORGNINCP\





-QPX6CNGT5EJYCDCEJCWHFKG8GTGKPKIWPIFGTDGKFGP(ÒTUVGPVÒOGT&CX5NI9KNO 8QT\ÒINKEJ





-QPX6CNGT5EJYCDCEJ&CX5NI9KNO

5GJTUEJÌPpXQT\ÒINKEJ





.QV,QJCPP(TKGFTKEJ6CNGT Z 

5VÒEM5GJTUEJÌP



'KPGP6CNGTXQPFGT/CTMITCHGP)GQTIWPF#NDTGEJVCWUFGO5EJCV\HWPFXQP*GTDQTPHKPFGP5KG WPVGT0T 

48


BRANDENBURG-PREUSSEN

239

240

241

$4#0&'0$74)24'755'0 $4#0&'0$74)/#4-)4#(5%*#(6 5'+6&'/,#*4*70&'46-74(ª456'067/ 

#NDTGEJVFGT$·T$TCMVGCV$TCPFGPDWTII/CTMITCHTGKVGVNOKV(CJPGFCJKPVGTCEJV UVTCJNKIGT5VGTP$CJTHD$GTIGT6JQTOCPP #VVTCMVKXGUHCUVXQT\ÒINKEJGU'ZGORNCT



$TCMVGCV 9GIGNGDGP  I /CTMITCH OKV 5EJYGTV WPF (CJPG UVGJV JCNDT \YKUEJGP \YGK 6ÒTOGP   $CJTH$GTIGT6JQTOCPP 4*ÒDUEJG2CVKPCUGJTUEJÌPpXQT\ÒINKEJ 



1VVQ +  $TCMVGCV $TCPFGPDWTI  I /CTMITCH UKV\V X X OKV 5EJYGTV WPF (CJPG CWH   /CWGT\WFGP5GKVGPLGGKP-WRRGNVWTO$CJTH$GTIGT (GKPG2CVKPCUGJTUEJÌP

242

243





244



1VVQ++$TCMVGCV5VGPFCNI/CTMITCHOKV(CJPGWPF#FNGTUEJKNFUVGJVXXKPFGT .KPMGP\YGK6ÒTOEJGPNKO(GNF4QUGVVG$CJTHp$GTIGT(F-WUG[ 48QT\ÒINKEJ





$TCMVGCV5VGPFCNI/CTMITCHOKV5EJYGTVWPF(CJPGUVGJVXX\WFGP5GKVGPLGGKP4GKEJUCRHGN $CJTHp$GTIGTp(F-WUG[5NI$QPJQHH5NI.ÌDDGEMG  49KP\5EJTÌVNKPIUTK­XQT\ÒINKEJGU'ZGORNCT



,QJCPP5KIKUOWPF6CNGT )TQUEJGP /*%ÌNP$CJTHC  5GJTUEJÌPpXQT\ÒINKEJ





245

246

246



)GQTI9KNJGNO4GKEJUVCNGT-ÌPKIUDGTI&CX/CTKGPD1NFC  *GPMGNURWTUGJTUEJÌP



(TKGFTKEJ9KNJGNOFGT)TQ­G-WTHÒTUV4GKEJUVCNGT%6$GTNKPI*ÒHVDKNF T KP -WTQTPCV OKV FGT 4GEJVGP FCU <GRVGT UEJWNVGTPF FKG .KPMG CO 5EJYGTVITKHH5KGDGPHCEJ   DGJGNOVGUHGNFKIGU9CRRGPOKV/KVVGNUEJKNF\WFGP5GKVGPLGGKPDGJGNOVGTYKNFGT/CPP&CX# X5EJT 48QT\ÒINKEJ 



49


BRANDENBURG-PREUSSEN

248

247



5KNDGTOGFCKNNG Q ,   WPUKIPKGTV XQP , *ÌJP CWH FGP 'KPHCNN FGT 5EJYGFGP )GJCTPKUEJVGU   $TWUVDKNF T OKV WOIGNGIVGO /CPVGN+P GKPGT .CPFUEJCHV GKP PCEJ N TWJGPFGT .ÌYG OKV YCEJUCOGP   QHHGPGP#WIGPOOI$TQEMOCPP0QTVJ 445GJTUEJÌP



&KG5[ODQNKMOKVFGOTWJGPFGPCDGTFGPPQEJYCEJUCOGP.ÌYGPYKTFKPFGT/GFCKNNGPMWPUVKOOGTYKGFGTCWHIG TKHHGP&GTITQ­GUVCTMG.ÌYGJKGTFCU-WTHÒTUVGPVWO$TCPFGPDWTIKUVUVGVUYCEJUCOWPFUQCWEJFGO'KPHCNNFGT 5EJYGFGPIGYCEJUGP



5KNDGTCDUEJNCI XQP FGP 5VGORGNP FGU &QRRGNFWMCVGP  %5 $GTNKP CWH FKG 'TQDGTWPI XQP 5VGVVKP   FWTEJFKG$TCPFGPDWTIGTCO&G\GODGT$CJTHXCT FQTVCNU&QRRGNFWMCV   *ÒDUEJG2CVKPCUGJTUEJÌP

249





250

251

5KNDGTOGFCKNNG  XQP $ 5EJWNV\ CWH UGKPGP 6QF )GJCTPKUEJVG $ÒUVG ÒDGT GKPGO 2QUVCOGPV OKV   9CHHGP'KPCWUGKPGT9CHHGPVTQRJ·GYCEJUGPFGT2CNODCWOFCTCWHGKPIGMTÌPVGT#FNGTXQP5VTCJNGP DGUEJKGPGPNFCPGDGP/GTMWTUVCDWPF$KDGNQDGP5EJTKHVDCPFOOI$TQEMOCPP 48QT\ÒINKEJGU'ZGORNCTOKVHGKPGT6ÌPWPI



(TKGFTKEJ +++  5KNDGTOGFCKNNG  XQP , $ 5EJWNV\ CWH FGP 5KGI DGK -CKUGTUYGTVJ   )GJCTPKUEJVGU $TWUVDKNF T OKV WOIGNGIVGO /CPVGN#PUKEJV FGT DGUEJQUUGPGP (GUVWPI  OO   I$TQEMOCPP 44-N4CPFHGJNGTUGJTUEJÌPpXQT\ÒINKEJ



6CNGT.%5$GTNKP&CXX5EJT

8QT\ÒINKEJ





2HGPPKI$*/KPFGPX5EJT  5GJTUGNVGPKPFKGUGT'TJCNVWPI2TCEJVGZGORNCT*GTTNKEJG2CVKPCHCUV5VGORGNINCP\





#NDGTVWUVCNGT $CPEQVCNGT .%5$GTNKP1JPG7OUEJTKHVCWHFGT/QPQITCOOUGKVG&CXX 5EJTC#PO 5GNVGPG8CTKCPVG(GKPG2CVKPCUGJTUEJÌP







252 253

50

253


BRANDENBURG-PREUSSEN

255

254

254



6CNGT*(*/CIFGDWTI&CXX5EJT

5GJTUEJÌP



24'755'0-¤0+)4'+%* 

(TKGFTKEJ +++ +&KEMGT5KNDGTCDUEJNCIXQPFGP5VGORGNPFGU&WMCVGPKO)GYKEJVGKPGU 6CNGTU-ÌPKIUDGTICWHUGKPG-TÌPWPI\WO-ÌPKIIX5EJT#PO  5GJTUEJÌP



256

257



6CNGT%5$GTNKPX5EJT

4-N5EJTÌVNKPIUHGJNGTUGJTUEJÌP



5KNDGTOGFCKNNGXQP%JT9GTOWVJCWHFKG,CJTHGKGTFGT7PKXGTUKV·V(TCPMHWTV1FGTWPFFKG #OVUGKPHÒJTWPIUGKPGU5QJPGU-TQPRTKP\(TKGFTKEJ9KNJGNO UR·VGT(TKGFTKEJ9KNJGNO+ CNU4GMVQT )GJCTPKUEJVGU $TWUVDKNF T OKV .QTDGGTMTCP\ WPF WOIGNGIVGO /CPVGN)GJCTPKUEJVGU $TWUVDKNF FGU   -TQPRTKP\GP (TKGFTKEJ 9KNJGNO N OKV WOIGNGIVGO /CPVGN /KV 4CPFUEJTKHV  OO  I   $TQEMOCPP.CXGTTGP\9QJNHCJTV 448QT\ÒINKEJ 

258

259

261



260



6CNGT*(*/CIFGDWTI&CXX5EJT

8QT\ÒINKEJ





4GKEJUVCNGT0GWGPDWTI 0GWEJ³VGN &6D*/</CTVKP  9KP\4CPFHGJNGTHCUVXQT\ÒINKEJ





(TKGFTKEJ9KNJGNO+FGT5QNFCVGPMÌPKI6CNGT*(*/CIFGDWTI&CXX 5EJT /GJTGTGMN-TCV\GTCWHFGT4ÒEMUGKVGUGJTUEJÌP





6CNGT*(*/CIFGDWTIX5EJT



44'VYCURQTÌUGT5EJTÌVNKPIUGJTUEJÌP

51


BRANDENBURG-PREUSSEN

262

262 1,5:1



4GKEJUVCNGT0GWGPDWTI 0GWEJ³VGN I(4+&Û9+.*Û&Û)Û4':Û$14Û'.Û5Û 24Û#4Û0'1%Û8#.Û)GJCTPKUEJVGU$TWUVDKNFTOKV1TFGPUDCPF5VGTPWPFWOIGNGIVGO/CP VGN WPVGP FKG 5KIPCVWT . %JTKUVKCP (TKGFTKEJ .ÒFGTU 5VGORGNUEJPGKFGT KP $GTNKP  )G   MTÌPVGUXKGTHGNFKIGU9CRRGPOKVIGMTÌPVGO/KVVGNUEJKNF\WFGP5GKVGPFKGIGVGKNVG,CJTGU\CJN &6&CX*/<pC/CTVKP 8QPITQ­GT5GNVGPJGKV-T·HVKIG2CVKPCXQT\ÒINKEJ 

264

263

265



(TKGFTKEJ++FGT)TQ­G5RGEKGUVCNGT')0$GTNKPI8CTKCPVGOKVMNGKPGO 1TFGPUMTGW\ )GJCTPKUEJVGU $TWUVDKNF T OKV 1TFGPUDCPF -TGW\ WPF WOIGNGIVGO /CPVGN1XCNGT   5EJKNFKPIGMTÌPVGT4QMQMQGKPHCUUWPIFCTKPFGTIGMTÌPVGRTGW­KUEJG#FNGTOKV<GRVGTWPF4GKEJUCRHGN KP FGP (·PIGP CWH FGT $TWUV IGMTÌPVGU /QPQITCOO WPVGP .QTDGGT WPF 2CNO\YGKI &CX  #   1NFX5EJT 445EJÌPG2CVKPCUGJTUEJÌPpXQT\ÒINKEJ 



4GKEJUVCNGTRTGW­$$TGUNCW&CX1NFDX5EJT  2TCEJVGZGORNCT9KP\5EJTÌVNKPIUHGJNGTXQT\ÒINKEJp5VGORGNINCP\





4GKEJUVCNGTRTGW­ 5VÒDGT %%NGXG&CX1NFX5EJT



52

4(CUVUGJTUEJÌP


BRANDENBURG-PREUSSEN

267 266

 

4GKEJUVCNGTRTGW­&#WTKEJ&CX1NFX5EJT -TGW\GT$$TGUNCW5EJNGUKUEJGT6[R1NFDX5EJT

45EJÌPpUGJTUEJÌP 8QT\ÒINKEJp5VGORGNINCP\

 

269

268



5KNDGTOGFCKNNG  XQP . * $CTDKG\ CWH FKG 'KPPCJOG XQP 2TCI CO  5GRVGODGT $ÒUVG T  &CTUVGNNWPIFGU#PITKHHUCWH2TCIOOI1NFC 445GJTUEJÌP





5KNDGTOGFCKNNG  WPUKIPKGTV XQP ) 9 -KVVGN CWH FKG 'KPPCJOG XQP 2TCI CO  5GRVGODGT   5VCFVCPUKEJVXQP2TCI5KGDGP<GKNGP5EJTKHVKP-CTVWUEJGQDGP9CHHGPOOI1NF 2TCEJVGZGORNCT(GKPG6ÌPWPI5VGORGNINCP\



271







270

272

5KNDGTOGFCKNNG  WPUKIPKGTV XQP ) 9 -KVVGN CWH FKG 'KPPCJOG XQP 2TCI CO  5GRVGODGT   5VCFVCPUKEJV XQP 2TCI5KGDGP <GKNGP 5EJTKHV QDGP 9CHHGP WPVGP 8GT\KGTWPI  OO  I   (W51NF 8QT\ÒINKEJ



5KNDGTOGFCKNNGXQP62KPIQCWHFKG5KGIGFGU,CJTGU)GJCTPKUEJVGU$TWUVDKNFTOKVWO IGNGIVGO 1TFGPUDCPF8KMVQTKC UEJTGKVGV N KP FGT 4GEJVGP -TCP\ KO NKPMGP #TO 2CNO\YGKI XQT KJT   6TQRJ·GFCTÒDGTHNKGIGPFGT#FNGTOKV\WTÒEMIGYCPFVGO-QRHKO#DUEJPKVV\YGK<GKNGP5EJTKHVFCT WPVGT,CJTGU\CJNOOI(W51NF (GKPGT5VGORGNHGJNGTXQT\ÒINKEJ



5KNDGTOGFCKNNG  XQP , #DTCJCO CWH FKG 5EJNCEJV DGK <QTPFQTH )GJCTPKUEJVGU $TWUVDKNF T FCT   ÒDGT J·NV GKPG *CPF CWU 9QNMGP GKPGP .QTDGGTMTCP\ OKV :OC#PUKEJV FGU 5EJNCEJVHGNFGU OKV FGO   DTGPPGPFGP<QTPFQTHTFKGDTGPPGPFG(GUVWPI-ÒUVTKPOOI(W5*QHHOCPP 1NF 4*GPMGNURWT(GNFGTCNVIGIN·VVGVUGJTUEJÌP



&KG \YKUEJGP GKPGO RTGW­KUEJGP WPF GKPGO TWUUKUEJGP *GGT KO 8GTNCWH FGU 5KGDGPL·JTKIGP -TKGIGU CWUIGHQEJVGPG   5EJNCEJV GPFGVG CWH DGKFGP 5GKVGP OKV CW­GTQTFGPVNKEJGP 8GTNWUVGP LGFQEJ QJPG 5KGIGT &KG /GFCKNNG HGKGTV JKPIG   IGP GKPGP RTGW­KUEJGP 5KGI &KG XQTNKGIGPFG 2T·IWPI KUV UQOKV GKP IWVGU $GKURKGN FCHÒT FC­ /GFCKNNGP CWEJ CNU   /GFKWORQNKVKUEJGT2TQRCICPFCHWPIKGTVGP

53


BRANDENBURG-PREUSSEN

273









274

275

5KNDGTOGFCKNNGXQP##DTCOUQPCWHFKG,CJTHGKGTFGT(TCP\ÌUKUEJGP-QNQPKGKP2TGW­GP+P GKPGT5·WNGPJCNNGMPKGVGKPGXGTUEJNGKGTVG(TCWGPIGUVCNVCPGKPGO1RHGTCNVGTXQTFGO5VCPFDKNFFGTIÌVV NKEJGP8QTUGJWPIFKGKONKPMGP#TOGKP(ÒNNJQTPJ·NVWPFKPFGT4GEJVGPGKP<GRVGTOKVUVTCJNGPFGO )QVVGUCWIGQDGPGKP/GFCKNNQPDKNF(TKGFTKEJU++8QTFGTDGNQTDGGTVGP$ÒUVGFGU-WTHÒTUVGP(TKGFTKEJ 9KNJGNOMPKGVGKPG(TCWOKVNCPIGO5EJNGKGTFKGFGPNKPMGP#TOWOFGP$ÒUVGPUQEMGNNGIVWPFKPFGT TGEJVGP *CPF FCU 'XCPIGNKWO J·NV KO *KPVGTITWPF GKPG DTGPPGPFG 1TVUEJCHV  OO  I   *QHHOCPP1NF (CUVXQT\ÒINKEJ



5KNDGTOGFCKNNGXQP##DTCOUQPCWHUGKPGP6QFWPFFGP&GWVUEJGP(ÒTUVGPDWPF7PKHQTOKGTVGU $TWUVDKNF N OKV 1TFGPUUVGTP WPF WOIGNGIVGO /CPVGN'KP TÌOKUEJGT -TKGIGT WOUEJNKPIV OGJTGTG   4WVGPDÒPFGN OKV GKPGT ¤N\YGKIIKTNCPFG WPF NGJPV UKG CP FGP #NVCT FGT 'KPVTCEJV FGT FWTEJ \YGK XGT   UEJNWPIGPG(ÒNNJÌTPGTIGMGPP\GKEJPGVKUVOOI*QHHOCPP1NF  (CUVXQT\ÒINKEJGU'ZGORNCTOKVHGKPGT6ÌPWPI



5KNDGTOGFCKNNGXQP&(.QQUCWHUGKPGP6QF$ÒUVGTOKV5VTCJNGPMTQPG$QTWUUKCMPKGVPCEJ TXQT#NVCTFCTCWHFGTIGMTÌPVGRTGW­KUEJG#FNGTOKV<GRVGTWPF4GKEJUCRHGNQDGP5VTCJNGPCWU9QN MGPOOI1NF5QOOGT# (GKPG2CVKPCUGJTUEJÌPpXQT\ÒINKEJ



.QV &KXGTUG 2T·IWPIGP XQO 2HGPPKI DKU \WO 6CNGT FCTWPVGT CWEJ GKPKIG KPVGTGUUCPVG 5VÒEMG $KVVG   DGUKEJVKIGP 5VÒEM5EJÌPpUGJTUEJÌP



278 277



 54

277

(TKGFTKEJ 9KNJGNO ++  5KNDGTOGFCKNNG Q ,   XQP & ( .QQU CWH UGKPGP    )GDWTVUVCI CO  5GRVGODGT )GJCTPKUEJVGU $TWUVDKNF N OKV WOIGNGIVGO /CPVGN'KPG 9CCIG   UEJYGDVKP9QNMGPKO#DUEJPKVV\YGK<GKNGP5EJTKHVWPF,CJTGU\CJNOOI/CTKGPD 5QOOGT# (GKPG2CVKPCXQT\ÒINKEJ



4GKEJUVCNGTRTGW­#$GTNKP&CX,



*ÒDUEJG2CVKPCHCUVXQT\ÒINKEJ


BRANDENBURG-PREUSSEN

279





280

5KNDGTOGFCKNNG  XQP , -KVVGN CWH FKG 4GKEJGPDCEJGT -QPXGPVKQP 'KP OKV FGO IGMTÌPVGP /QPQ   ITCOO (9 IGUEJOÒEMVGT 5QEMGN CWH FGO FKG $ÒUVG FGU -ÌPKIU UVGJV T FCXQT MPKGV FKG IGMTÌPVG   5KNGUKC N PGDGP FGO 5QEMGN FGT UEJNGUKUEJG 9CRRGPUEJKNF WPF GKP ¤NDCWO5VTCJNGPFG 5QPPG ÒDGT   GKPGT.CPFUEJCHVOKVRHNÒIGPFGO.CPFOCPP9CTGPDCNNGP(C­(ÒNNJQTP/QNNGOKV'T\WPF/GTMWT UVCDNFGT9CRRGPUEJKNFXQP4GKEJGPDCEJOOI(W5/CTKGPD  4(CUVXQT\ÒINKEJ



4GKEJUVCNGTRTGW­#$GTNKP&CX,



9KP\2T·IGUEJY·EJGXQT\ÒINKEJp5VGORGNINCP\

282

281



281

5KNDGTOGFCKNNGXQP,9*QGEMPGTCWHFKG<WUCOOGPMWPHVWPFFGP(TKGFGPXQP2KNNPKV\$TWUV DKNFGT .GQRQNFU ++ XQP ¤UVGTTGKEJ (TKGFTKEJ 9KNJGNOU ++ XQP 2TGW­GP WPF (TKGFTKEJ #WIWUVU XQP   5CEJUGP PGDGPGKPCPFGT T4GEJVU KO 8QTFGTITWPF UKV\V 5CZQPKC PCEJ N OKV (ÒNNJQTPWPFU·EJUKUEJGO 9CRRGPUEJKNFWPFFGWVGVOKVFGT4GEJVGPCWHFCUKO*KPVGTITWPFNKGIGPFG5EJNQ­2KNNPKV\ÒDGTFGOFKG 5QPPG CWHIGJV  OO  I /CTKGPD  2CZ KP 0WOOKU  5NI /GTUGD  5NI   /QPVGPWQXQ 5EJÌPG2CVKPCHCUV5VGORGNINCP\



&GT(TKGFGPXQP2KNNPKV\YWTFGCO#WIWUVKO5EJNQ­FGUU·EJUKUEJGP-WTHÒTUVGP(TKGFTKEJ#WIWUVIGUEJNQUUGP



6CNGT$GTNKP*CPFGNUOÒP\G,

5GJTUEJÌP





(TKGFTKEJ9KNJGNO+++6CNGT#$GTNKP&CX,  2TCEJVGZGORNCTOKVHGKPGT6ÌPWPI(CUV5VGORGNINCP\





5KNDGTOGFCKNNGQ, WO XQP(9.QQU2T·OKGFGT#MCFGOKGFGT9KUUGPUEJCHVGPKP$GTNKP $TWUVDKNF N KP 7PKHQTO OKV WOIGNGIVGO /CPVGN#FNGT HNKGIV \WT 5QPPG WPVGP FKG 5VTC­G 7PVGT FGP   .KPFGPOOI$QN\GPVJCN/CTKGPD5QOOGT#  *ÒDUEJG2CVKPCXQT\ÒINKEJ



283

284

55


BRANDENBURG-PREUSSEN

286

285





5KNDGTOGFCKNNG  XQP ( .QQU CWH FKG *GKOMGJT #NGZCPFGT XQP *WODQNFVU PCEJ $GTNKP $ÒUVG   *WODQNFVUN&GOQMTKVUKV\VPCEJNXQTGKPGO)NQDWUOOI5QOOGT#  42TCEJVGZGORNCT*GTTNKEJG2CVKPCHCUV5VGORGNINCP\



5KNDGTOGFCKNNG  XQP # #DTCOUQP CWH FKG 4ÒEMMGJT FGU -ÌPKIURCCTGU PCEJ $GTNKP &KG $ÒUVGP   (TKGFTKEJ 9KNJGNOU +++ WPF UGKPGT )GOCJNKP -ÌPKIKP .WKUG PGDGPGKPCPFGT T(QTVWPC OKV 5VGWGTTW   FGTKPFGT4GEJVGPWPF(ÒNNJQTPKPFGT.KPMGPUVGJVPCEJNXQTGKPGODTGPPGPFGP#NVCTOO I$QN\GPVJCN*QHHOCPP/CTKGPD /KP-TCV\GTXQT\ÒINKEJ



8QO5EJNCEJHGNFDGK,GPCWPF#WGTUVGFVCWUOW­VGFCU-ÌPKIURCCTPCEJ-ÌPKIUDGTIHNÒEJVGP+O(TKGFGPXQP6KNUKV KO ,CJTG  JCVVG 2TGW­GP CNNG )GDKGVG YGUVNKEJ FGT 'NDG CDIGVTGVGP &CU TGUVNKEJG )GDKGV UQNNVG UQNCPIG XQP   HTCP\ÌUKUEJGP6TWRRGPDGUGV\VDNGKDGPDKU2TGW­GPGKPGTKGUKIG-TKGIUMQPVTKDWVKQPDG\CJNVJ·VVG8QP1MVQDGT DKU &G\GODGT  JCVVG CWEJ $GTNKP GKPG HTCP\ÌUKUEJG $GUCV\WPI 'TUV GKP ,CJT UR·VGT CO  &G\GODGT    MGJTVGFCU-ÌPKIURCCTKPFKG*CWRVUVCFV\WTÒEMWPFYWTFGXQPFGT$GXÌNMGTWPIDGIGKUVGTVGORHCPIGP

287



6CNGT)#-5,



6CNGT##-5&CX-CJPV6JWP

288

49KP\5EJTÌVNKPIUHGJNGTXQT\ÒINKEJ



9KP\4CPFHGJNGTHCUV5VGORGNINCP\



290

289

289



5KNDGTOGFCKNNG  XQP ( -ÌPKI 9GTMUVCVV ) .QQU CWH FCU L·JTKIG &KGPUVLWDKN·WO FGU RTGW­K   UEJGP)GPGTCNUWPF5VCCVUOKPKUVGTU)(*)TCHXQP9[NKEJWPF.QVVWO$ÒUVGXQP9[NKEJUN&GT 9CRRGPUEJKNF FGU )GPGTCNU UVGJV CWH GKPGO 5QEMGN CP GKPGP 'KEJDCWO IGNGJPV WPF YKTF XQP FGO T   UVGJGPFGP/CTUDGMT·P\VOOI(W5/CTKGPD FQTVKP$TQP\G   +P5KNDGTUGJTUGNVGP2TCEJVGZGORNCT*GTTNKEJG2CVKPCXQT\ÒINKEJp5VGORGNINCP\





8GTGKPUFQRRGNVCNGT##-5&CX-CJPV6JWP



56

/KPDGTKGDGPXQT\ÒINKEJ


BRANDENBURG-PREUSSEN

291 292

292



6CNGT##-5,D



(TKGFTKEJ9KNJGNO+86CNGT##WUDGWVG#-5&CX-CJPV6JWP 8QT\ÒINKEJ

293

(CUV5VGORGNINCP\

295

 

294



8GTGKPUFQRRGNVCNGT##-5&CX-CJPV6JWP

8QT\ÒINKEJ





8GTGKPUFQRRGNVCNGT##-5&CX-CJPV6JWP  5GNVGPGT,CJTICPI-N-TCV\GTUGJTUEJÌPpXQT\ÒINKEJ





6CNGT##-5&CX-CJPV6JWP



8QT\ÒINKEJp5VGORGNINCP\

296



5KNDGTOGFCKNNGXQP-(KUEJGTCWHFKG8GTO·JNWPIUGKPGT0KEJVG2TKP\GUUKP/CTKG.WKUG#PPC OKV#NGZKU.CPFITCHXQP*GUUGP2JKNKRRUVJCN$CTEJHGNFKO,CJTG$ÒUVGPFGU$TCWVRCCTGUPGDGP GKPCPFGT T#OQT WPF *[OGP IGNGKVGP FGP .CPFITCHGP T \W UGKPGT )GOCJNKP FKG CWH GKPGO XGT\KGT   VGP 5GUUGN UKV\V CP FGUUGP 5GKVG UVGJV FGT RTGW­KUEJG #FNGT KO #DUEJPKVV DGHKPFGP UKEJ FKG IGMTÌPVGP   9CRRGPUEJKNFGXQP*GUUGPWPF2TGW­GPOOI/CTKGPD  442TCEJVGZGORNCTOKVJGTTNKEJGT2CVKPC(CUV5VGORGNINCP\

 57


BRANDENBURG-PREUSSEN

298

297

297



&QRRGNVGT8GTGKPUVCNGT##-5&CX-CJPV6JWP  2TCEJVGZGORNCTXQPRQNKGTVGP5VGORGNP(CUV5VGORGNINCP\



6CNGT##-5,

(CUV5VGORGNINCP\

 

300

299



8GTGKPUVCNGT##-5&CX-CJPV6JWP

2QNKGTVG2NCVVGNGKEJVDGTKGDGP





8GTGKPUVCNGT##WUDGWVG#-5&CX-CJPV6JWP  -N4CPFHGJNGTRQNKGTVG2NCVVGOKPDGTÃ&#x2019;JTV



302

301



 58

301

9KNJGNO+5KNDGTOGFCKNNGQ,  XQP#/GTVGPUWPF'5EJKNNKPI2T·OKGPOGFCKNNG HÃ&#x2019;T.GKUVWPIGPKO)CTVGPDCW9GKDNKEJG)GUVCNVKPCPVKMGO)GYCPFUKV\VNOKV(Ã&#x2019;NNJQTPWPF4GJOGU UGTNFCXQT)KG­MCPPGWPF*CTMGXQTGKPGO$CWO&GTRTGW­KUEJG#FNGTUKV\VXXFGP-QRHPCEJN IGYCPFV OKV FTGK -T·P\GP KP FGP (·PIGP WOJGT -TCP\ CWU $NWOGP WPF (TÃ&#x2019;EJVGP FGT OKV XKGT /G   FCKNNQPU DGNGIV KUV KP FGPGP LGYGKNU GKP CPVKMGT -QRH CDIGDKNFGV KUV  OO  I *Ã&#x2019;UMGP    4/GJTGTGMN4CPFHGJNGTXQT\Ã&#x2019;INKEJ &QRRGNVGT8GTGKPUVCNGT##-5&CX-CJPV6JWP

(CUVXQT\Ã&#x2019;INKEJ

 


BRANDENBURG-PREUSSEN

303

304

305

306



&QRRGNVGT8GTGKPUVCNGT##-5&CX-CJPV6JWP  9KP\4CPFHGJNGTCVVTCMVKXGUUGJTUEJÌPGU'ZGORNCT





8GTGKPUVCNGT##WHFGP5KGIÒDGT¤UVGTTGKEJ#-5&CX-CJPV6JWP  8QT\ÒINKEJp5VGORGNINCP\





8GTGKPUVCNGT##-5&CX-CJPV6JWP-N5EJTÌVNKPIUHGJNGTHCUV5VGORGNINCP\





&QRRGNVGT8GTGKPUVCNGT##-5&CX-CJPV6JWP  (GKPG2CVKPCYKP\4CPFHGJNGTXQT\ÒINKEJp5VGORGNINCP\



307

308



&QRRGNVGT8GTGKPUVCNGT##-5&CX-CJPV6JWP  /KPDGTKGDGPXQT\ÒINKEJp5VGORGNINCP\CWURQNKGTVGT2NCVVG



8GTGKPUVCNGT$#-5&CX-CJPV6JWP$

309





8QT\ÒINKEJ

 

310

5KNDGTOGFCKNNG  XQP 1 $GTIOCPP \WT 'TKPPGTWPI CP FKG )QNFGPG *QEJ\GKV -CKUGT 9KNJGNOU +   WPF#WIWUVCUCO,WPK&KG-ÌRHGFGU-CKUGTRCCTGUPGDGPGKPCPFGTT0GWP<GKNGP5EJTKHVKP.QT DGGTMTCP\QDGPFKG*CODWTIGT$WTIOOI)CGF/CTKGPD  8QPRQNKGTVGP5VGORGNPHCUV5VGORGNINCP\



9KNJGNO++5KNDGTOGFCKNNG9GTMUVCVV1GTVGN$GTNKPCWHFGP$GUWEJFGU5EJCJUXQP 2GTUKGP KP $GTNKP $ÒUVG T7PKHQTOKGTVGU $TWUVDKNF FGU5EJCJUXXKO*KPVGTITWPFNKGIGPFGT.ÌYG PCEJTWPFUVTCJNGPFG5QPPGOOI/CTKGPD 448QT\ÒINKEJp5VGORGNINCP\

 59


BRAUNAU

311



5KNDGTOGFCKNNGXQP*&ÒTTKEJ9GTMUVCVV/C[GT9KNJGNO5VWVVICTVCWHFGP#WUDCWFGTFGWV UEJGP (NQVVG 7PKHQTOKGTVGU $TWUVDKNF T OKV #FOKTCNUJWV <GKNGP 5EJTKHV N #PMGT WPF -TKGIU   UEJKHH/KV4CPFRWP\GOOI/CTKGPD FQTVKP$TQP\G   44/KP4CPFHGJNGTXQT\ÒINKEJ



.165$4#0&'0$74)24'755'0 

&KXGTUG6CNGTWPF&QRRGNVCNGTFGU-ÌPKITGKEJU2TGW­GP6JWP 5VÒEM-TCV\GT Z YKP\4CPFHGJNGT Z XQT\ÒINKEJ





-NGKPG5COONWPIXQP)TÌUEJGTP(TKGFTKEJ9KNJGNOUFGU)TQ­GP-WTHÒTUVGP Z WPF(TKGFTKEJU+++ +PVGTGUUCPVGU1DLGMVDKVVGDGUKEJVKIGP 5VÒEM5EJÌPpUGJTUEJÌP





-NGKPG5COONWPIXQP6CNGTP(TKGFTKEJ9KNJGNOUFGU)TQ­GP-WTHÒTUVGP Z WPF(TKGFTKEJU+++

Z +PVGTGUUCPVGU1DLGMVDKVVGDGUKEJVKIGP 5VÒEM/GKUVUGJTUEJÌP





2TGW­GP*GT\QIVWO 1UVRTGW­GP 5COONWPIXQP)TQUEJGP#NDTGEJVUXQP$TCPFGPDWTI+PVGTGU UCPVGU1DMLGMVDKVVGDGUKEJVKIGP 5VÒEM/GKUVUGJTUEJÌP 



-NGKPG5COONWPIXQP)TQUEJGP5VÒEMGP Z WPF6CNGTP Z (TKGFTKEJ9KNJGNOU+++&C\W 6CNGT 5VÒEM5EJÌPpUGJTUEJÌP





.QVXQPXKGT'KUGPOGFCKNNGP(TKGFTKEJ9KNJGNO+++'KUGPIW­OGFCKNNGXQP%,CEQD \WO #PFGPMGP CP FKG -TKGIULCJTG VTCIDCTG GKPUGKVKIG 'KUGPOGFCKNNG Q , $TWUVDKNF N  VTCIDCTG   GKPUGKVKIG 'KUGPOGFCKNNG Q , $TWUVDKNF UGKPGT )GOCJNKP .WKUG T  &C\W .WZGODWTI 9KNJGNO +   'KUGPOGFCKNNGXQP)TWPCWHFKG(GTVKIUVGNNWPI\YGKGTIW­GKUGTPGT$TÒEMGP  5VÒEM8QT\ÒINKEJ



320 318

56#&6 

321

319

$4#70#7

'KPUGKVKIG-NKRRG\W6CNGTIGRT·IVY·JTGPFFGT$GNCIGTWPIFWTEJFKGÌUVGTTGKEJKUEJGP6TWR RGPI)GMTÌPVGUU·EJUKUEJGU9CRRGP$TCWUG/CPUHGNF6H-GNNPGT  448QT\ÒINKEJGU'ZGORNCTOKVHGKPGT2CVKPC



&KG DGTGKVU UGKV  UVCTM DGHGUVKIVG 5VCFV $TCWPCW CO +PP YWTFG KO <WIG FGU ¤UVGTTGKEJKUEJGP 'TDHQNIGMTKGIGU   XQO  /CK  CP FWTEJ ÌUVGTTGKEJKUEJG 6TWRRGP DGNCIGTV &GT DC[GTKUEJG )GPGTCN .WFYKI (TKGFTKEJ XQP 5CEJ   UGP*KNFDWTIJCWUGP NKG­ HÒT FKG 8GTVGKFKIGT 0QVMNKRRGP RT·IGP <WP·EJUV YWTFG HÒT FKGUG 0QVOÒP\GP FKG FCU   U·EJUKUEJG9CRRGP\GKIGP6CHGNWPF-KTEJGPUKNDGTXGTYGPFGV#NUFKG'FGNOGVCNNXQTT·VGGTUEJÌRHVYCTGPYWTFGP KP GKPGT \YGKVGP 2JCUG -NKRRGP CWU $NGK WPF <KPP IGRT·IV FKG OKV GKPGT 9GTVCPICDG  )WNFGP DKU  -TGW\GT    XGTUGJGPYCTGP



'KPUGKVKIG-NKRRG\W6CNGTIGRT·IVY·JTGPFFGT$GNCIGTWPIFWTEJFKGÌUVGTTGKEJKUEJGP6TWRRGP I$TCWUG/CPUHGNF6H-GNNPGT 448QT\ÒINKEJGU2TCEJVGZGORNCTOKVHGKPGT2CVKPC





'KPUGKVKIG-NKRRG\W6CNGTIGRT·IVY·JTGPFFGT$GNCIGTWPIFWTEJFKGÌUVGTTGKEJKUEJGP6TWR RGPI$TCWUG/CPUHGNF6H-GNNPGT 448QT\ÒINKEJGU'ZGORNCTOKVHGKPGT2CVKPC





'KPUGKVKIG -NKRRG \W  -TGW\GTP  IGRT·IV Y·JTGPF FGT $GNCIGTWPI FWTEJ FKG ÌUVGTTGKEJKUEJGP   6TWRRGPI$TCWUG/CPUHGNF6H-GNNPGT 48QT\ÒINKEJGU'ZGORNCTOKVHGKPGT6ÌPWPI 

60


BRAUNSCHWEIG UND LÜNEBURG

325

326

324

323 322



'KPUGKVKIG$NGKMNKRRG\WGKPGO)WNFGPIGRT·IVY·JTGPFFGT$GNCIGTWPIFWTEJFKGÌUVGTTGKEJKUEJGP 6TWRRGPI$TCWUG/CPUHGNF6HXCT-GNNPGT 44(CUVXQT\ÒINKEJ





'KPUGKVKIG$NGKMNKRRG\W-TGW\GTPIGRT·IVY·JTGPFFGT$GNCIGTWPIFWTEJFKGÌUVGTTGKEJKUEJGP 6TWRRGPI$TCWUG/CPUHGNF6H-GNNPGT 445GJTUEJÌP





'KPUGKVKIG$NGKMNKRRG\W-TGW\GTPIGRT·IVY·JTGPFFGT$GNCIGTWPIFWTEJFKGÌUVGTTGKEJKUEJGP 6TWRRGPI$TCWUG/CPUHGNF6H-GNNPGT 45GJTUEJÌP





'KPUGKVKIG<KPPMNKRRG\W-TGW\GTPIGRT·IVY·JTGPFFGT$GNCIGTWPIFWTEJFKGÌUVGTTGKEJKUEJGP 6TWRRGPI$TCWUG/CPUHGNF6H-GNNPGT 45GJTUEJÌP





'KPUGKVKIG <KPPMNKRRG \W GKPGO -TGW\GT  IGRT·IV Y·JTGPF FGT $GNCIGTWPI FWTEJ FKG ÌUVGTTGKEJK   UEJGP6TWRRGPI$TCWUG/CPUHGNF6H FQTVKP5KNDGT -GNNPGT  45GJTUEJÌP



327

56#&6

328

329

$4#705%*9'+)



4GKEJUVCNGT )TQUEJGP OKV6KVGN(GTFKPCPFU++&CX,GUUG  5CWDGTCWUIGRT·IVGU'ZGORNCTOKVHGKPGT2CVKPCUGJTUEJÌPpXQT\ÒINKEJ





4GKEJUVCNGT )TQUEJGP OKV6KVGN(GTFKPCPFU++&CX,GUUG  5EJÌPG2CVKPCUGJTUEJÌPpXQT\ÒINKEJ



$4#705%*9'+)70&.ª0'$74) $4#705%*9'+)91.('0$ª66'.(ª456'067/ 

*GKPTKEJFGT,ÒPIGTG6CNGT )TQUEJGP )QUNCTOKV6KVGN/CZKOKNKCPU++&CX 9GNVGT 45GJTUEJÌP

 61


BRAUNSCHWEIG UND LÜNEBURG

331

330

332

 

,WNKWU4GKEJUVCNGT)QUNCT.KEJVVCNGT&CX9GNVGT 4GKEJUVCNGT)QUNCT.KEJVVCNGT&CX9GNVGT

5GJTUEJÌP 5GJTUEJÌP

 



*GKPTKEJ,WNKWU4GKEJUVCNGT)QUNCT&CX9GNVGT

5GJTUEJÌP



'KPGPYGKVGTGP4GKEJUVCNGTXQPCWUFGO5EJCV\HWPFXQP*GTDQTPHKPFGP5GKWPVGT0T



333

335

334



4GKEJUVCNGT)QUNCT4GDGNNGPVCNGT&CX9GNVGT



4GKEJUVCNGT#PFTGCUDGTI#WUDGWVGFGT)TWDG5V#PFTGCU&CX/ÒUGNGTC9GNVGT (CUVXQT\ÒINKEJ





4GKEJUVCNGT)QUNCT&CX#9GNVGT



62

5GJTUEJÌP

7PVGT *GKPTKEJ ,WNKWU GPVUVCPF GKPG ICP\G 4GKJG UQIGPCPPVGT GODNGOCVKUEJGT 6CNGT FKG CWH 5VTGKVKIMGKVGP FGU *GT   \QIUOKVGKPKIGPNCPFUV·PFKUEJGP#FGNKIGP$G\WIPGJOGPFCTWPVGTFKGXQP5CNFGTP5VGKPDGTIWPF5VQEMJGKO&GT *WPF CWH FKGUGO UQIGPCPPVGP 4GDGNNGPVCNGT U[ODQNKUKGTV FKG IGIGP FGP 5VCEJGN NGEMGPFGP WP\WHTKGFGPGP #FGNKIGP   FKG FGP *GT\QI XQT FGO 4GKEJUMCOOGTIGTKEJV XGTMNCIV JCVVGP &KG 4ÒEMUGKVG UQNN CP\GKIGP FC­ UKG YKG FKG 4QVVG   -QTCJWPVGTIGJGPYGTFGP

5GJTUGNVGPGT/ÒP\V[R5GJTUEJÌP

'ZGORNCTFGT5COONWPI&T#JNGTU#WMVKQP(TKV\4WFQNH-ÒPMGT1UPCDTÒEM0T




BRAUNSCHWEIG UND LÜNEBURG

337

336

 

4GKEJUVCNGT)QUNCT9GNVGT 4GKEJUVCNGT)QUNCT9GNVGT#

45GJTUEJÌP -N&QRRGNUEJNCIHGKPG6ÌPWPIUGJTUEJÌPpXQT\ÒINKEJ

 

338 (doppelt)

339

339



&QRRGNVGT4GKEJUVCNGT<GNNGTHGNFI&CX#9GNVGT#

445GJTUEJÌP



.ÌUGT\W4GKEJUVCNGTP<GNNGTHGNF1JPG9GTVRWP\GI&CXC&WXG9GNVGT 44*ÒDUEJG2CVKPCYKP\4CPFHGJNGTMN2T·IGUEJY·EJGUGJTUEJÌP

 

340



(TKGFTKEJ 7NTKEJ  .ÌUGT \W  4GKEJUVCNGTP  )QUNCT QFGT <GNNGTHGNF /KV 9GTVRWP\G   I&CX&WXG++9GNVGT  4-N5EJTÌVNKPIUHGJNGTNGKEJVG)N·VVWPIUURWTGPUGJTUEJÌPGU'ZGORNCT  63


BRAUNSCHWEIG UND LÜNEBURG

341



.ÌUGT \W  4GKEJUVCNGTP  )QUNCT #WUDGWVG FGT )TWDG 5V ,CEQD KP.CWVGPVJCN1JPG9GTVRWP\G I(ÒPHHCEJDGJGNOVGU9CRRGPTYKNFGT/CPPCNU5EJKNFJCNVGTQDGP5V,CEQDUVGJVX XOKV2KNIGTUVCDWPF$WEJQDGPUVTCJNGPFGT0COG,GJQXCU&CXC&WXG/ÒUGNGTE 9GNVGT 8QPITQ­GT5GNVGPJGKV*ÒDUEJG2CVKPCYKP\5EJTÌVNKPIUHGJNGTUGJTUEJÌP  5V ,CEQD ,CEQDWU  IGJÌTVG \WO -TGKU FGT \YÌNH #RQUVGN WPF YCT UR·VGT 5EJWV\JGKNKIGT FGT 2KNIGT &GT .GIGPFG   PCEJUQNNGTKP5RCPKGPIGYKTMVJCDGPªDGTUGKPGOCPIGDNKEJGP)TCDYWTFGGKPG-KTEJGGTDCWVWOFKGJGTWOFKG 5VCFV 5CPVKCIQ FG %QORQUVGNC GPVUVCPF FKG DGTGKVU UGKV FGO /KVVGNCNVGT GKPGT FGT DGMCPPVGUVGP 9CNNHCJTVUQTVG FGT   %JTKUVGPJGKVKUV

342



343

344

4GKEJUVCNGT<GNNGTHGNFCWHFGP6QFUGKPGT/WVVGT'NKUCDGVJ&CX9GNVGT  4'VYCUTCWJUGJTUEJÌP



'NKUCDGVJ KP-QNFKPIJCWUYCTFKG6QEJVGT-ÌPKI(TKGFTKEJU++XQP&·PGOCTM5KGXGTO·JNVGUKEJ OKV*GT\QI*GKPTKEJ,WNKWU'NKUCDGVJUVCTDCO,WNKKP$TCWPUEJYGKI



4GKEJUVCNGT)QUNCTQFGT<GNNGTHGNF&CX9GNVGT#



%JTKUVKCP$KUEJQHXQP*CNDGTUVCFV4GKEJUVCNGT<GNNGTHGNFCWHUGKPGP6QF&CX 9GNVGT 44#VVTCMVKXGUUGJTUEJÌPGU'ZGORNCT

64

*ÒDUEJG2CVKPCUGJTUEJÌP






BRAUNSCHWEIG UND LÜNEBURG

345

346



#WIWUVFGT,ÒPIGTG4GKEJUVCNGT<GNNGTHGNF&CX9GNVGT

5GJTUEJÌP





4GKEJUVCNGT)QUNCTQFGT<GNNGTHGNF&CX9GNVGT  9KP\5EJTÌVNKPIUHGJNGTCVVTCMVKXGUUGJTUEJÌPGU'ZGORNCT



348

347

347



.ÌUGT\W4GKEJUVCNGTP<GNNGTHGNF1JPG9GTVRWP\GI&CX&WXG9GNVGT 8QT\ÒINKEJGU'ZGORNCTOKVHGKPGT2CVKPC



4GKEJUVCNGT)QUNCTQFGT<GNNGTHGNF&CX9GNVGT

5GJTUEJÌPpXQT\ÒINKEJ

 

349 350

350



4GKEJUVCNGT<GNNGTHGNF9GNVGT

45EJÌPG2CVKPCMN2T·IGUEJY·EJGHCUVXQT\ÒINKEJ



4WFQNH#WIWUV5KNDGTOGFCKNNGXQP//ÌNNGTCWHFKG'TQDGTWPIFGT5VCFV$TCWP UEJYGKI#WHIGUEJNCIGPGU$WEJCWH6TQOOGNKO*KPVGTITWPF6TQRJ·GPCWU-TKGIUYCHHGP'KPPCEJT UGIGNPFGT &TGKOCUVGT CWH 5GG QDGP FGT UVTCJNGPFG 0COG ,GJQXCU KP 9QNMGP  OO  I   $TQEMOCPP 44-N$GCTDGKVWPIUUVGNNGCWHFGT8QTFGTUGKVGUGJTUEJÌPpXQT\ÒINKEJ



 65


BRAUNSCHWEIG UND LÜNEBURG

351

353

352



4GKEJUVCNGT<GNNGTHGNF&CX9GNVGT

5GJTUEJÌP





4GKEJUVCNGT<GNNGTHGNF&CX9GNVGT  #VVTCMVKXGUUGJTUEJÌPGU'ZGORNCTOKVHGKPGT6ÌPWPI





4WFQNH#WIWUVWPF#PVQP7NTKEJ6CNGT%QDWTICWHFGP6QFKJTGT5EJYGUVGT /CTKC'NKUCDGVJ-Q\KPQYUMK1VVQ4W­9GNVGTp 8QT\ÒINKEJp5VGORGNINCP\



/CTKC 'NKUCDGVJ  Ó 6QEJVGT *GT\QI #WIWUVU FGU ,ÒPIGTGP WPF FGUUGP FTKVVGT )GOCJNKP   5QRJKC 'NKUCDGVJ XGTO·JNV  OKV #FQNH 9KNJGNO XQP 5CEJUGP9GKOCT WPF \WO  /CN  OKV *GT\QI #N   DTGEJVXQP5CEJUGP%QDWTI

354

355

356



4GKEJUVCNGT<GNNGTHGNF&CX9GNVGT



4GKEJUVCNGT<GNNGTHGNF&CX9GNVGT  5GNVGPGT,CJTICPI-N5EJTÌVNKPIUHGJNGTCO4CPF6WUEJG\KHHGTCWHFGT8QTFGTUGKVGXQT\ÒINKEJ





4GKEJUVCNGT<GNNGTHGNF&CX#PO9GNVGT



66

8QT\ÒINKEJ

5EJÌPG2CVKPCUGJTUEJÌP




BRAUNSCHWEIG UND LÜNEBURG

357

ex 358

359



#PVQP7NTKEJ4GKEJUVCNGT<GNNGTHGNF&CX9GNVGT  5GJTUEJÌPGU'ZGORNCTOKVHGKPGT6ÌPWPI





5KNDGTOGFCKNNG Q ,   WPUKIPKGTV XQP * 2 )TQ­MWTV CWH UGKPGP &WTEJJCNVGYKNNGP $TQEMOCPP     5KNDGTOGFCKNNG  WPUKIPKGTV CWH FKG 4GKUG UGKPGT 'PMGNKP 'NKUCDGVJ %JTKUVKPG PCEJ 5RCPKGP  

$TQEMOCPP &C\W5CEJUGP,QJCPP)GQTI++5KNDGTOGFCKNNGXQP'%&ÒTTCWHFKG&· PGOCTM4GKUG UGKPGT 5EJYKGIGTVQEJVGT #PPC 5QRJKC )GOCJNKP ,QJCPP )GQTIU +++ XQP 5CEJUGP WPF   5EJYGUVGTXQP(TKGFTKEJ8XQP&·PGOCTM .CPIG#5NI/GTUGD   5VÒEMOKV5EJKHHUOQVKXGP#NNGDGCTDGKVGVWPFOKV&GHGMVGPHCUVUGJTUEJÌPWPFUGJTUEJÌP



.WFYKI 4WFQNH  UGKV  KP $NCPMGPDWTI 4GKEJUVCNGT  <GNNGTHGNF &CX    9GNVGT 5GJTUEJÌP





360

361

361



-CTN9KNJGNO(GTFKPCPF)WVG)TQUEJGP$TCWPUEJYGKI9GNVGT

 5GJTUEJÌP





-QPX6CNGT 5RGEKGUVCNGT $TCWPUEJYGKI&CX9GNVGT  W­GTUVUGNVGPGT,CJTICPI5GJTUEJÌPGU'ZGORNCTOKVHGKPGT2CVKPC

 67


BRAUNSCHWEIG UND LÜNEBURG

362

 

363

-CTN++5GNDUV·PFKIG4GIKGTWPI-W#DUEJNCIXQPFGP5VGORGNPFGU6CNGT 5VÒEMGU%X%I#-5p \W &KXQ5p \W ,p \W   44&QRRGNUEJNCIUGJTUEJÌPpXQT\ÒINKEJ 9KNJGNO/CTKGPITQUEJGP%X%#-5, 8QT\ÒINKEJp5VGORGNINCP\

365

364



366

 

367

8GTGKPUFQRRGNVCNGT%X%2TQDGI#-5&CXp,:-CJPVp5VWV\OCPP$56 2+XCT6JWPp 8QPITQ­GT5GNVGPJGKV9KP\5COONGTRWP\GPKO4CPFDGTKGDGPUQPUVXQT\ÒINKEJ



-WTV,CGIGTMCPPVGUKGDGP'ZGORNCTG+O#-5YGTFGPFKGUG5VÒEMGCNU&QRRGNVCNGTRTQDGPDG\GKEJPGV,CGIGTJ·NVGU JKPIGIGPHÒTOÌINKEJFC­GUUKEJWOUR·VGTG2TKXCVRT·IWPIGPJCPFGNV



8GTGKPUFQRRGNVCNGT$#-5&CX-CJPV6JWP



8GTGKPUFQRRGNVCNGT$L·JTKIGU4GIKGTWPIULWDKN·WO#-5&CX-CJPV6JWP -N4CPFHGJNGTXQT\ÒINKEJ

(CUV5VGORGNINCP\





8GTGKPUVCNGT$#-5&CX-CJPV6JWP



/KP4CPFHGJNGTHCUV5VGORGNINCP\



$4#705%*9'+)%#.'0$'4)(ª456'067/ 

'TKEJ FGT ,ÒPIGTG WPVGT 8QTOWPFUEJCHV UGKPGT /WVVGT 'NKUCDGVJ XQP $TCPFGPDWTI    'KPUGKVKIGT .GFGTCDUEJNCI FGT )W­OGFCKNNG  WPUKIPKGTV CWH UGKPG /WVVGT 'NKUCDGVJ XQP $TCPFGP   DWTI&GT.GFGTCDUEJNCI\GKIVFKG8QTFGTUGKVGFGT)W­OGFCKNNGOKVFGO$TWUVDKNFFGT*GT\QIKPXX FKGGKPG9KVYGPJCWDGOKVFCTÒDGTCWHIGUGV\VGT/ÒP\GVT·IVOOZOO$TQEMOCPP\W 5GJTUEJÌP



369 370

  68

370

'TKEJFGT,ÒPIGTG/CTKGPITQUEJGP/ÒPFGP9GNVGTXCT 4GKEJUVCNGT )TQUEJGP /ÒPFGPOKV6KVGN4WFQNHU++&CX9GNVGT

8QT\ÒINKEJ 48QT\ÒINKEJ

 


BRAUNSCHWEIG UND LÜNEBURG

Das Wappen um 1625

Karte der Herrschaft Dannenberg im Fürstentum Lüneburg-Celle

$4#705%*9'+)&#00'0$'4)(ª456'067/ *GKPTKEJ*GT\QI\W$TCWPUEJYGKI.ÒPGDWTI  TGIKGTVGFCU*GT\QIVWOOKVUGKPGO$TWFGT 9KNJGNOFGO,ÒPIGTGP  ,CJTGNCPIIGOGKPUCODKUGKPG(TCWFC\YKUEJGPMCOņ7TUWNC XQP5CEJUGP.CWGPDWTIFKG6QEJVGT*GT\QI(TCP\+  /KVFGT*QEJ\GKVYKFGTUGV\VGGTUKEJ FGPDGTGKVUIGVTQHHGPGPRQNKVKUEJGP8GTGKPDCTWPIGPPCEJFGPGPGTUKEJPKEJVGJGTXGTO·JNGPUQNNVGDKU GTFKG'KPYKNNKIWPIFGT.CPFUV·PFGGTJCNVGPJCVVG*GKPTKEJXGTUWEJVGGKPG5RCNVWPIFGU*GT\QIVWOU\W GTTGKEJGP FKG LGFQEJ UEJGKVGTVG 5VCVV FGUUGP OW­VG GT CWH GKPG 4GIKGTWPIUDGVGKNKIWPI XGT\KEJVGP WPF   GTJKGNV FCHÒT GKPG L·JTNKEJG <CJNWPI XQP  6CNGTP UQYKG GKPG GKPOCNKIG <CJNWPI XQP  6CNGTP   #W­GTFGONKG­GTUKEJOKVFGT8QIVGK&CPPGPDGTIWPFFGO-NQUVGTCOV5EJCTPGDGEMCDHKPFGP+PPGTJCND XQPPWT,CJTGPYCTFKGUDGTGKVUFKGFTKVVG#DURCNVWPIXQO*CWRVJCWU.ÒPGDWTI%GNNG  5GKP 5QJP,WNKWU'TPUVXQP$TCWPUEJYGKI&CPPGPDGTI  YCT\YCT\YGKOCNXGTJGKTCVGVņKP GTUVGT'JGOKV/CTKCXQP1UVHTKGUNCPF  WPFKP\YGKVGT'JGOKV5[DKNNGXQP$TCWPUEJYGKI .ÒPGDWTI   ņ MQPPVG CDGT MGKPGP O·PPNKEJGP 'TDGP JKPVGTNCUUGP 5Q GTDVG UGKP$TWFGT#W IWUVFGT,ÒPIGTG  FKG*GTTUEJCHV&CPPGPDGTIWPFXGTGKPKIVGUKGOKVUGKPGO$GUKV\*KV\CEMGT  +P FKG 9KTTGP FGU &TGK­KIL·JTKIGP -TKGIGU H·NNV CWEJ FKG /ÒP\RT·IWPI XQP ,WNKWU 'TPUV  KP   5EJCTPGDGEMWPF&CPPGPDGTIOÌINKEJGTYGKUGCNU4GCMVKQPCWHFKG\WGTYCTVGPFGP-TKGIUMQUVGPWPFFKG CNNIGOGKPG8GTUEJNGEJVGTWPIFGUIGOÒP\VGP)GNFGU5EJTKHVNKEJG3WGNNGPÒDGTFKG'KPTKEJVWPIWPFFGP $GVTKGD FGT /ÒP\UV·VVGP IKDV GU PWT YGPKIG OCP MCPP CDGT FCXQP CWUIGJGP FC­ UKEJ FKG /ÒP\G KP   5EJCTPGDGEMKPGKPGOFGT-NQUVGTIGD·WFGDGHWPFGPJCV'KP/[UVGTKWOFGT0WOKUOCVKMKUVFKG6CVUC EJG FC­ VTQV\ FGU XGTINGKEJUYGKUG MWT\GP 2T·IG\GKVTCWOU XQP PWT FTGK ,CJTGP QHHGPUKEJVNKEJ UGEJU   /ÒP\OGKUVGTKP5EJCTPGDGEMV·VKIYCTGP/ÌINKEJGTYGKUGHKGNGPCDGTCWEJGKPKIGFGPKPFGT )GIGPFXQP.ÒPGDWTIYÒVGPFGP2GUVGRKFGOKGP\WO1RHGT  &KG /ÒP\RT·IWPI KP &CPPGPDGTI WPF 5EJCTPGDGEM DNKGD GKPG MWT\G 'RKUQFG FGT )GUEJKEJVG WPF UVGNNV   FCOKVGKPÒDGTCWUURCPPGPFGU-CRKVGNFGT/ÒP\IGUEJKEJVGFGU&TGK­KIL·JTKIGP-TKGIGUFCT9KTHTGWGP WPU +JPGP GKPG WOHCPITGKEJG 5RG\KCNUCOONWPI XQP UGNVGPGP /ÒP\GP FKGUGU (ÒTUVGPVWOU CPDKGVGP \W   MÌPPGP  &CU /ÒP\YGUGP FGU (ÒTUVGPVWOU $TCWPUEJYGKI.ÒPGDWTI&CPPGPDGTI YWTFG WOHCUUGPF KO JKUVQTK   UEJGP -QPVGZV XQP )ÒPVJGT $QEMGNOCPP GTHQTUEJV WPF RWDNK\KGTV $QEMGNOCPP )ÒPVJGT 5EJCTPGDGEM   WPFFCU/ÒP\YGUGPKP)TKOOG5VGHCP=*TUI?5EJCTPGDGEMIGUVGTPWPFJGWVG5EJCTPGDGEM5     /ª0<5666'&#00'0$'4)

371



,WNKWU'TPUV4GKEJUVCNGT )TQUEJGP Q,&CPPGPDGTIOKV6KVGN(GTFKPCPFU++&CX 9GNVGT 445EJÌPG2CVKPCUGJTUEJÌP

 69


BRAUNSCHWEIG UND LÜNEBURG

372

373

374



4GKEJUVCNGT )TQUEJGP Q,&CPPGPDGTIOKV6KVGN(GTFKPCPFU++&CX9GNVGT  445GJTUEJÌP





4GKEJUVCNGT ,CJTGU\CJNKO5VGORGNCWUI·PFGTV &CPPGPDGTI&CX9GNVGT#  444CPFGVYCUDGCTDGKVGVUGJTUEJÌP





4GKEJUVCNGT&CPPGPDGTI&CX9GNVGT

375

376

45EJÌPCWUIGRT·IVUGJTUEJÌP



377



4GKEJUVCNGT&CPPGPDGTI&CX9GNVGT

45GJTUEJÌP





4GKEJUVCNGT&CPPGPDGTI&CX9GNVGT  41DGTHN·EJGFGT8QTFGTUGKVGOKPMQTTQFKGTVUQPUVIWVCWUIGRT·IVUGJTUEJÌP





4GKEJUVCNGT&CPPGPDGTI&CX9GNVGT



70

45EJTÌVNKPIUTK­UGJTUEJÌP


BRAUNSCHWEIG UND LÜNEBURG

378

379

380



4GKEJUVCNGT ,CJTGU\CJNKO5VGORGNCWUIG·PFGTV &CPPGPDGTI&CX#9GNVGTXCT 4-N-TCV\GTUGJTUEJÌP





4GKEJUVCNGT&CPPGPDGTI&CX#9GNVGT

45EJTÌVNKPIUTK­HCUVUGJTUEJÌP





4GKEJUVCNGT&CPPGPDGTI&CX#XCT9GNVGT  4*GPMGNURWTWPF(GNFGTNGKEJVIGIN·VVGVUGJTUEJÌP



381

382



4GKEJUVCNGT&CPPGPDGTI9GNVGT  8QPITQ­GT5GNVGPJGKV-N5EJTÌVNKPIUHGJNGTCO4CPFUGJTUEJÌP





4GKEJUVCNGT&CPPGPDGTI9GNVGT



383

8QPITQ­GT5GNVGPJGKV5EJTÌVNKPIUHGJNGTUGJTUEJÌP

384



4GKEJUVCNGT&CPPGPDGTI8CTKCPVGOKVFGT,CJTGU\CJN<CWHFGT4ÒEMUGKVG9GNVGT  8QPITQ­GT5GNVGPJGKV5EJTÌVNKPIUHGJNGTHCUVUGJTUEJÌP





4GKEJUVCNGT&CPPGPDGTI9GNVGT  8QPITQ­GT5GNVGPJGKV5EJÌPCWUIGRT·IVGU'ZGORNCTOKVJGTTNKEJGT2CVKPCUGJTUEJÌPpXQT\ÒINKEJ

 71


BRAUNSCHWEIG UND LÜNEBURG

386

385



4GKEJUVCNGT&CPPGPDGTI9GNVGT

8QPITQ­GT5GNVGPJGKV5EJTÌVNKPIUTK­UGJTUEJÌP





4GKEJUQTV 4GKEJUVCNGT &CPPGPDGTI9GNVGT  8QPITQ­GT5GNVGPJGKV5EJTÌVNKPIUHGJNGTWPFGVYCUMQTTQFKGTVHCUVUGJTUEJÌP



387

388

389

390



&QRRGNUEJKNNKPIQ, WOIGRT·IV &CPPGPDGTI9GNVGT$

8QT\ÒINKEJ





&QRRGNUEJKNNKPIQ, WOIGRT·IV &CPPGPDGTI9GNVGT$

8QT\ÒINKEJ





&QRRGNUEJKNNKPI Q , WO  IGRT·IV  &CPPGPDGTI OKV )GIGPUVGORGN XQP /CNEJKP CWH FGT   8QTFGTUGKVG$ÒHHGNMQRHFCTWPVGT/(TKGFGTKEJp9GNVGT$ FQTVQJPG)GIGPUVGORGN   /ÒP\GHCUVUGJTUEJÌP)GIGPUVGORGNUGJTUEJÌP



&QRRGNUEJKNNKPI Q , WO  IGRT·IV  &CPPGPDGTI OKV )GIGPUVGORGN XQP 4QUVQEM CWH FGT   4ÒEMUGKVG4(TKGFGTKEJp9GNVGT$ FQTVQJPG)GIGPUVGORGN   /ÒP\GWPF)GIGPUVGORGNUGJTUEJÌP





391



392

393

395

&QRRGNUEJKNNKPI Q , WO  IGRT·IV  &CPPGPDGTI OKV )GIGPUVGORGN XQP 4QUVQEM CWH FGT   4ÒEMUGKVG4(TKGFGTKEJp9GNVGT$ FQTVQJPG)GIGPUVGORGN   /ÒP\GWPF)GIGPUVGORGNUGJTUEJÌP



&QRRGNUEJKNNKPI Q , WO  IGRT·IV  &CPPGPDGTI OKV )GIGPUVGORGN XQP 4QUVQEM CWH FGT   8QTFGTUGKVG4WPFGKPGOYGKVGTGP)GIGPUVGORGNXQP5VTCNUWPFCWHFGT8QTFGTUGKVG5VTCJNOKV-TGW\ (TKGFGTKEJp 4QUVQEM  5VTCNUWPF 9GNVGT& FQTVQJPG)GIGPUVGORGN   /ÒP\GWPF)GIGPUVGORGNUGJTUEJÌP





&QRRGNUEJKNNKPI&CPPGPDGTIOKV)GIGPUVGORGNXQP)TGKHUYCNFCWHFGT8QTFGTUGKVG)(KCNCp (TKGFGTKEJp9GNVGTp /ÒP\GWPF)GIGPUVGORGNUGJTUEJÌP





-NGKPG5GTKGXQPFKXGTUGPXCTKKGTGPFGP&QRRGNUEJKNNKPIGPFGT/ÒP\UV·VVG&CPPGPDGTI9GNVGTWPF 5VÒEM(CUVUGJTUEJÌPWPFUGJTUEJÌP



-KRRGT-W2HGPPKI.ÒPGDWTI9GNVGT







72

5EJÌP

&CU XQTNKGIGPFG 5VÒEM KUV XQO /ÒP\OGKUVGT ,QPCU )GQTIGP WPVGT /KVJKNHG UGKPGU 5EJYKGIGTUQJPGU $ $CTVGNU   /ÒP\OGKUVGTKP&CPPGPDGTIIGRT·IVYQTFGP


BRAUNSCHWEIG UND LÜNEBURG

396

397

398

/ª0<5666'5%*#40'$'%- 

4GKEJUVCNGT5EJCTPGDGEM&CX9GNVGT0CEJVTCI$

445EJÌPG2CVKPCUGJTUEJÌP





4GKEJUVCNGT5EJCTPGDGEM&CX9GNVGT$

44(CUVUGJTUEJÌP





4GKEJUVCNGT5EJCTPGDGEM&CX9GNVGT$  5EJTÌVNKPIUHGJNGTWPFMN<CKPGPFGUQPUVUGJTUEJÌPGU'ZGORNCTOKVUEJÌPGT2CVKPC



399

400

401



4GKEJUVCNGT5EJCTPGDGEM&CX9GNVGT$

445GJTUEJÌP





4GKEJUVCNGT5EJCTPGDGEM&CX9GNVGT$

445GJTUEJÌP





4GKEJUVCNGT5EJCTPGDGEM&CX9GNVGT

4-QTTQFKGTVHCUVUGJTUEJÌP

 73


BRAUNSCHWEIG UND LÜNEBURG

403

402

402



4GKEJUVCNGT5EJCTPGDGEM&CX9GNVGT



4GKEJUVCNGT5EJCTPGDGEM9GNVGT0CEJVTCI#

442T·IGUEJY·EJG-TCV\GTHCUVUGJTUEJÌP 8QPITQ­GT5GNVGPJGKV5GJTUEJÌP

 

405

404



4GKEJUVCNGT5EJCTPGDGEM9GNVGT0CEJVTCI#  8QPITQ­GT5GNVGPJGKV-N5EJTÌVNKPIUTK­HCUVUGJTUEJÌP





5EJKNNKPI5EJCTPGDGEM9GNVGT FQTVWPIGPCWDGUEJTKGDGP 

445GJTUEJÌP



-N<CKPGPFGUGJTUEJÌP



445GJTUEJÌP



407

406 406

$4#705%*9'+)*#4$74)(ª456'067/ 

9KNJGNO4GKEJUVCNGT*CTDWTI&CX9GNVGT#



4GKEJUQTV 4GKEJUVCNGT *CTDWTI9GNVGT#

408

409



6CNGT &QRRGNUEJKNNKPI *CTDWTIOKV6KVGNXQP/CVVJKCU9GNVGT



6CNGT &QRRGNUEJKNNKPI *CTDWTIOKV6KVGNXQP/CVVJKCU9GNVGT#



6CNGT &QRRGNUEJKNNKPI *CTDWTIOKV6KVGN(GTFKPCPFU++9GNVGT

74

410

5GJTUEJÌP



 2CVKPCUGJTUEJÌP



48QT\ÒINKEJ




BRAUNSCHWEIG UND LÜNEBURG

411

412 ex 414

413

ex 414



4GKEJUVCNGTQ,/QKUDWTI&CX9GNVGT$

*ÒDUEJG2CVKPCUGJTUEJÌP





4GKEJUVCNGT/QKUDWTI&CX9GNVGT$

-QTTQFKGTVUEJÌPpUGJTUEJÌP





4GKEJUVCNGT<GNNGTHGNF&CX$9GNVGT

*ÒDUEJG2CVKPCUGJTUEJÌP





/CTKGPITQUEJGPQ,<GNNGTHGNF9GNVGT

5VÒEM5GJTUEJÌP



415

416

417

$4#705%*9'+).ª0'$74)%'..'(ª456'067/ 

%JTKUVKCP$KUEJQHXQP/KPFGP4GKEJUVCNGT%NCWUVJCN&CX9GNVGT  5GJTUEJÌPpXQT\ÒINKEJ





4GKEJUVCNGT  #PFTGCUDGTI #WUDGWVG FGT )TWDG 5V #PFTGCU &CX  /ÒUGNGT  C   9GNVGT 5GJTUEJÌPpXQT\ÒINKEJ





4GKEJUVCNGT%NCWUVJCN&CX HCNUEJG#PICDGFGT8Up7OUEJTKHV 9GNVGT



8QT\ÒINKEJ

75


BRAUNSCHWEIG UND LÜNEBURG

419

418



(TKGFTKEJ4GKEJUVCNGTQ,  <GNNGTHGNF&CX9GNVGT  5GJTCVVTCMVKXGU'ZGORNCTOKVRTCEJVXQNNGT2CVKPCXQT\ÒINKEJ





4GKEJUVCNGTQ,  <GNNGTHGNF&CX9GNVGT  (CUVXQT\ÒINKEJGU'ZGORNCTOKVHGKPGT2CVKPC



420

421



4GKEJUVCNGT%NCWUVJCN&CX9GNVGT  9KP\2T·IGUEJY·EJGXQT\ÒINKEJGU'ZGORNCTOKVHGKPGT6ÌPWPI





5KNDGTOGFCKNNGXQP,$NWOCWHUGKPGP)GDWTVUVCIWPFFKG(TKGFGPUXGTJCPFNWPIGP\WO9GUV H·NKUEJGP (TKGFGP )GJCTPKUEJVGU $TWUVDKNF T OKV 5RKV\GPMTCIGP WPF WOIGNGIVGO /CPVGN/GTEWTKWU   UVGJV N CWH GKPGO 5EJYGTV WPF J·NV GKPGP *GNO FGT XQP $KGPGP WOUEJY·TOV KUV N GKP 2WVVQ OKV   2HGKNDÒPFGN KO *KPVGTITWPF .CPFUEJCHV OKV GKPGT $WTI  OO  I $TQEMOCPP    &GVJ1TF,WPIM *ÒDUEJG2CVKPCMN5VGORGNHGJNGTUGJTUEJÌPpXQT\ÒINKEJ



422

 76

%JTKUVKCP .WFYKI  .ÌUGT \W  4GKEJUVCNGTP  <GNNGTHGNF 1JPG 9GTVRWP\G  I   &CX&WXG9GNVGT 4#VVTCMVKXGU'ZGORNCTOKVJÒDUEJGT2CVKPCUGJTUEJÌP 


BRAUNSCHWEIG UND LÜNEBURG

423



.ÌUGT\W4GKEJUVCNGTP<GNNGTHGNF1JPG9GTVRWP\GI&CX&WXG9GNVGT  4*ÒDUEJG2CVKPCUGJTUEJÌP



ex 424



6CNGT%NCWUVJCNCWHFGP6QFUGKPGT6CPVG5[DKNNCXQP.ÒPGDWTI&CPPGPDGTI9GNVGT &C\W$TCWPUEJYGKI9QNHGPDÒVVGN#WIWUV9KNJGNO-NGKPG5KNDGTOGFCKNNGQ,  XQP #QFGT)98GUVPGTCWH'TPUVFGP$GMGPPGTIGRT·IVCPN·­NKEJFGT,CJTHGKGTFGTªDGTICDGFGT #WIUDWTIGT-QPHGUUKQPOOI$GTPJGKOGT$TQEMOCPP5NI9JKVKPI FQTVKP )QNF  5VÒEM5GJTUEJÌPWPFXQT\ÒINKEJ



425



.ÌUGT \W   4GKEJUVCNGTP  %NCWUVJCN #WUDGWVG FGT *CT\GT )TWDGP /KV 9GTVRWP\G  I   &CXD&WXG$/ÒUGNGT9GNVGT *GPMGNURWT(GNFGTIGIN·VVGVUGJTUEJÌP



77


BRAUNSCHWEIG UND LÜNEBURG

426

$4#705%*9'+)%#.'0$'4)*#0018'4 #$-74(ª456'067/*#0018'4#$-¤0+)4'+%**#0018'4 

)GQTI.ÌUGT\W4GKEJUVCNGTP<GNNGTHGNF#WUDGWVGFGT*CT\GT)TWDGP1JPG9GTV RWP\G  I /KV #7( Û )16 64#9 Û +%*  KP FGT 4ÒEMUGKVGPWOUEJTKHV &GT IGJCTPKUEJVG   *GT\QITGKVGVNKPFGT4GEJVGPOKV-QOOCPFQUVCDFKG.KPMGCO5EJYGTVITKHHKO*KPVGTITWPF$GTI YGTMUNCPFUEJCHV WOJGT 8GT\KGTWPIGP<YGK DGJGNOVG YKNFG /·PPGT JCNVGP FCU FTGKHCEJ DGJGNOVG   HGNFKIG9CRRGPQDGPFKG5KIPCVWT*5IGMTGW\VG5EJNÒUUGN *GPPKPI5EJNÒVGT/ÒP\OGKUVGTKP<GN NGTHGNF &CX#&WXG++/ÒUGNGTC9GNVGT  8QPITQ­GT5GNVGPJGKV*GPMGNURWT(GNFGTÒDGTCTDGKVGVUGJTUEJÌP 

428

427

429



4GKEJUVCNGT<GNNGTHGNF&CX9GNVGT



)GQTI9KNJGNO4GKEJUVCNGT<GNNGTHGNF&CX9GNVGT  -N5EJTÌVNKPIUTK­HCUVXQT\ÒINKEJ





4GKEJUVCNGT<GNNGTHGNF&CX9GNVGT



78

5GJTUEJÌP

5GJTUEJÌPpXQT\ÒINKEJ




BRAUNSCHWEIG UND LÜNEBURG

430

432

431



4GKEJUVCNGT<GNNGTHGNF&CX9GNVGT  8QPITQ­GT5GNVGPJGKV/KP$GCTDGKVWPIUURWTGPUGJTUEJÌP



4GKEJUVCNGT<GNNGTHGNF&CX9GNVGT



,QJCPP(TKGFTKEJ5KNDGTOGFCKNNGQ,XQP.<GTPGOCPP)GJCTPKUEJVGU$TWUVDKNFNOKV 5VKTPDCPF WPF WOIGNGIVGO /CPVGN2CNOG CWH \GTMNÒHVGVGO (GNUGP WOJGT 5GIGNUEJKHHG KO 8QTFGT   ITWPFGKP4WFGTDQQVOOI$TQEMOCPP  8QPITQ­GT5GNVGPJGKV*ÒDUEJG2CVKPC5VGORGNHGJNGTCO4CPF(GNFGTCNVIGIN·VVGVUGJTUEJÌP

5GJTUEJÌPpXQT\ÒINKEJ

 



'ZGORNCTFGT#WMVKQP(TKV\4WFQNH-ÒPMGT$GTNKP0T  'KPG V[RKUEJG 4ÒEMUGKVGPFCTUVGNNWPI FKG UKEJ CWH XKGNGP /ÒP\GP WPF /GFCKNNGP ,QJCPP (TKGFTKEJU HKPFGV <W FGO   9CJNURTWEJ':&84+5).14+#UEJTKGD)QVVHTKGF9KNJGNO.GKDPK\&GTYCJTG4WJOGKPGU/CPPGUGTJGDVUKEJ CWUJCTVGP&KPIGPUQYKGFKGDGNCFGPG2CNOGKJT*CWRVCWUFGO(GNUGPGTJGDV

434

433

433



4GKEJUVCNGT<GNNGTHGNF&CX9GNVGT

5GJTUEJÌP





6CNGT*CPPQXGT&KEMUVÒEM9GNVGT

5GJTUEJÌP

 79


BRAUNSCHWEIG UND LÜNEBURG

435



.ÌUGT\W4GKEJUVCNGTP<GNNGTHGNF#WUDGWVGFGT*CT\GT)TWDGP/KV9GTVRWP\GI)G MTÌPVGU /QPQITCOO KP .QTDGGTMTCP\ WOIGDGP XQP  MNGKPGP IGMTÌPVGP 9CRRGP CWH 2CNO\YGKIGP   WPVGP FKG ,CJTGU\CJN WPF FKG IGVGKNVG 5KIPCVWT 4  $ 4WFQNH $QTPGOCPP /ÒP\OGKUVGT KP <GNNGTHGNF    4Q­ URTKPIV N ÒDGT $GTIYGTMUNCPFUEJCHV FCTÒDGT J·NV GKPG CWU 9QNMGP MQOOGPFG *CPF   GKPGP.QTDGGTMTCP\&CX&WXG/ÒUGNGT9GNVGT  8QPITQ­GT5GNVGPJGKV(GNFGTGVYCUÒDGTCTDGKVGVUGJTUEJÌPGU'ZGORNCTOKVHGKPGT6ÌPWPI 

436

437

437



6CNGT*CPPQXGT&CX9GNVGT



'TPUV#WIWUVUGKV$KUEJQHXQP1UPCDTÒEM4GKEJUVCNGT%NCWUVJCN&CX 9GNVGT 445GJTUEJÌP

438

  80

6CNGT%NCWUVJCN&CX9GNVGT 6CNGT%NCWUVJCN&CX9GNVGT

/KPLWUVKGTVHCUVXQT\ÒINKEJ

 

439

8QT\ÒINKEJ (CUVXQT\ÒINKEJ

 


BRAUNSCHWEIG UND LÜNEBURG

440



.ÌUGT\W4GKEJUVCNGTP<GNNGTHGNF#WUDGWVGFGT)TWDG.CWVGPVJCNU)NÒEM/KV9GTVRWP\GI (ÒPHHCEJ DGJGNOVGU HGNFKIGU 9CRRGP OKV 1UPCDTÒEMGT /KVVGNUEJKNF \W FGP 5GKVGP FKG 5KIPCVWT 4    $ 4WFQNH $QTPGOCPP /ÒP\OGKUVGT KP <GNNGTHGNF   WPVGP FKG IGVGKNVG ,CJTGU\CJN.CWVGP   URKGNGTKPCWH5EJPGEMGTKO*KPVGTITWPF5VCFVCPUKEJVXQP.CWVGPVJCNWPF$GTIYGTMUCPNCIGP&CX &WXG/ÒUGNGT9GNVGT 44*ÒDUEJG2CVKPCMN4CPFHGJNGTUGJTUEJÌPpXQT\ÒINKEJ 

442



441

443

5KNDGTOGFCKNNG  XQP ' $TCDCPFV CWH UGKPGP 6QF )GJCTPKUEJVGU $TWUVDKNF T OKV WOIGNGIVGO   /CPVGN6TQRJ·GPDCWOOOI$TQEMOCPP  44-N5VGORGNHGJNGTCO4CPFUGJTUEJÌPpXQT\ÒINKEJ





)GQTI+.WFYKI4GKEJUVCNGT<GNNGTHGNF&CX9GNVGT

5GJTUEJÌP





4GKEJUVCNGT<GNNGTHGNF&CX9GNVGT

5GJTUEJÌP

 81


BRAUNSCHWEIG UND LÜNEBURG

444





445

4GKEJUVCNGT%NCWUVJCNCWHFGP6QFUGKPGT/WVVGT5QRJKCXQPFGT2HCN\+P752NCUVKMJQNFGTFGT 0)%OKVFGT$GYGTVWPI/5&CX9GNVGT  2TCEJVGZGORNCTOKVHGKPGT6ÌPWPI8QT\ÒINKEJp5VGORGNINCP\



CNU)GQTI+-ÌPKIXQP)TQ­DTKVCPPKGP5KNDGTOGFCKNNGWPUKIPKGTVXQP&)XCP *CEJVGP*CODWTICWHUGKPG-TÌPWPI\WO-ÌPKIXQP)TQ­DTKVCPPKGP/GFCKNNQPFCTKPFKG$ÒUVGFGU -ÌPKIUTOKV.QTDGGTMTCP\NO·PPNKEJG)GUVCNVOKV*GNOWPF5EJKNFTYGKDNKEJG)GUVCNVOKV.CP\G 4Q­ URTKPIV N QDGP N J·NV GKPG CWU 9QNMGP MQOOGPFG *CPF GKPG *CTHG  OO  I   $TQEMOCPP)CGFC 45GJTUEJÌPpXQT\ÒINKEJ



446

448

447



4GKEJUVCNGT%NCWUVJCN&CX9GNVGT  2TCEJVGZGORNCTOKVHGKPGT2CVKPC8QT\ÒINKEJp5VGORGNINCP\



4GKEJUVCNGT%NCWUVJCN&CX9GNVGT



5KNDGTOGFCKNNGXQP,%TQMGTCWHFGP5GGUKGIDGK-CR2CUUCTQ 5K\KNKGP )GJCTPKUEJVGU$TWUVDKNF T OKV .QTDGGTMTCP\ WPF WOIGNGIVGO /CPVGN0GRVWP UVGJV CWH GKPGT 4QUVTCNU·WNG KPOKVVGP XQP 5GG   MTKGIUVTQRJ·GPOOI$GTPJGKOGT'KOGT  8QT\ÒINKEJGU'ZGORNCTOKVHGKPGT2CVKPC

5GNVGPKPFKGUGT'TJCNVWPI8QT\ÒINKEJ

'ZGORNCTFGT#WMVKQP(TKV\4WFQNF-ÒPMGT1UPCDTÒEM0T  0CEJFGO FKG 5RCPKGT 5CTFKPKGP GTQDGTV JCVVGP WPF KO $GITKHH YCTGP 5K\KNKGP \W DGUGV\GP YWTFG FGT DTKVKUEJG   #FOKTCN5KT)GQTIG$[PIOKV5EJKHHGPCWUIGUCPFVFGPURCPKUEJGP)GPGTCN&G.GFGFCTCP\WJKPFGTP/GUUKPC \W GTTGKEJGP 'U MCO \WO -CORH FKG \CJNGPO·­KI ÒDGTNGIGPG URCPKUEJG (NQVVG YWTFG \GTUVÌTV WPF FGT )GPGTCN   IGHCPIGPIGPQOOGP  4QUVTWOJKG­FGT4COOURQTPFGTCPVKMGP5EJKHHG&KGUGTIGH·JTNKEJUVG6GKNYWTFGFGPGTQDGTVGP5EJKHHGPCDIGU·IV WPFCP4GFPGTVTKDÒPGPWPF5KGIGUU·WNGPDGHGUVKIVFCJGT4QUVTCNU·WNG

82

 




BRAUNSCHWEIG UND LÜNEBURG

449

  

450

4GKEJUVCNGT<GNNGTHGNF&CX9GNVGT 4GKEJUVCNGT<GNNGTHGNF&CX9GNVGT 4GKEJUVCNGT<GNNGTHGNF&CX9GNVGT

452

454

451

5GJTUEJÌPpXQT\ÒINKEJ 5GJTUEJÌPpXQT\ÒINKEJ (CUVXQT\ÒINKEJGU'ZGORNCTOKVHGKPGT6ÌPWPI

  

453



4GKEJUVCNGT<GNNGTHGNF&CX9GNVGT

-N5EJTÌVNKPIUHGJNGTUGJTUEJÌP





)GQTI++4GKEJUVCNGT<GNNGTHGNF&CX9GNVGT  8QT\ÒINKEJGU'ZGORNCTOKVHGKPGT2CVKPC





6CNGT%NCWUVJCN(GKPUKNDGT9GNVGT



445EJÌPG2CVKPCUGJTUEJÌPpXQT\ÒINKEJ

83


BRAUNSCHWEIG UND LÜNEBURG

456

455



455

5KNDGTOGFCKNNG  XQP ' *CPPKDCN CWH FKG HGKGTNKEJG 'TÌHHPWPI FGT 7PKXGTUKV·V )ÌVVKPIGP )GJCT   PKUEJVGU $TWUVDKNF N OKV .QTDGGTMTCP\ WPF WOIGNGIVGO /CPVGN5KGDGP <GKNGP 5EJTKHV  OO   I$TQEMOCPP.CXGTTGP\ 45GJTUEJÌP



&KG )GQTIKC#WIWUVC7PKXGTUKV·V KP )ÌVVKPIGP YWTFG  XQP )GQTI ++ IGUVKHVGV #O  5GRVGODGT    GTHQNIVG FKG HGKGTNKEJG 'TÌHHPWPI PCEJFGO KO ,CJTG \WXQT FCU MCKUGTNKEJG 2TKXKNGIKWO GTVGKNV YQTFGP YCT -WTCVQT   WPF.GKVGTFGT*QEJUEJWNGYWTFG)GTNCEJ#FQNRJXQP/ÒPEJJCWUGP



4GKEJUVCNGT<GNNGTHGNF&CX9GNVGT

5GJTUEJÌP



2TCEJVGZGORNCT(GKPG6ÌPWPIHCUV5VGORGNINCP\



458

457



6CNGT%NCWUVJCN&CX9GNVGT



6CNGT /CTKGPITQUEJGP <GNNGTHGNF9GNVGT

459

(CUVXQT\ÒINKEJ



460



4GKEJUVCNGT  <GNNGTHGNF #WUDGWVG FGT )TWDG )ÒVG FGU *GTTP &CX  /ÒUGNGT    9GNVGT 8QT\ÒINKEJGU'ZGORNCT 



)GQTI+++6CNGT%/KV/GFCKNNGWTUKIPCVWT/CO*CNUCDUEJPKVV#-5,D 9KP\4CPFHGJNGTXQT\ÒINKEJp5VGORGNINCP\

84




BRAUNSCHWEIG UND LÜNEBURG

461 462

462



)WVG)TQUEJGP/#-5,C

5GNVGPDGUQPFGTUKPFKGUGT'TJCNVWPI(CUVXQT\ÒINKEJ



)GQTI+85KNDGTOGFCKNNGXQP-(8QKIVCWHUGKPG#PMWPHVKP*CPPQXGT$ÒUVGT OKV.QTDGGTMTCP\WPFWOIGNGIVGO/CPVGN&GT-ÌPKIOKV.QTDGGTMTCP\WPFWOIGNGIVGO/CPVGNTGKVGV TXQTKJOUEJTGKVGV(GNKEKVCUTOKV/GTMWTUVCDWPF(ÒNNJQTPOOI$TQEMOCPP  2TCEJVGZGORNCT(CUV5VGORGNINCP\

463

6CNGT%/#-5,C



'TPUV #WIWUV  6CNGT  # 8CTKCPVG OKV GTJCDGPGO 9 CO *CNUCDUEJPKVV #-5    #PO&CX-CJPV#PO6JWP#PO 5GJTUEJÌP





8QT\ÒINKEJ

 

466

6CNGT5CWHFKG8GTO·JNWPI)GQTIU-TQPRTKP\XQP*CPPQXGTOKV/CTKG*GT\QIKPXQP5CEJUGP #NVGPDWTI#-5&CX-CJPV6JWP  0WT'ZGORNCTGIGRT·IV9KP\4CPFHGJNGTXQT\ÒINKEJ )GQTI86CNGT$/ÒP\DGUWEJ#-5&CX-CJPV6JWP  442TCEJVGZGORNCT(CUV5VGORGNINCP\

467



464



465



 

468



8GTGKPUFQRRGNVCNGT$/ÒP\DGUWEJCO/CK#-5&CX-CJPV6JWP 44-N-TCV\GTKO(GNFFGT4ÒEMUGKVGHCUV5VGORGNINCP\



8GTGKPUFQRRGNVCNGT$#-5&CX-CJPV6JWP

8QT\ÒINKEJ

  85


BREISACH

470

469

471



8GTGKPUFQRRGNVCNGT$#-5&CX-CJPV6JWP

9KP\4CPFHGJNGTXQT\ÒINKEJ





8GTGKPUVCNGT$,CJTG8GTGKPKIWPI1UVHTKGUNCPFUOKV*CPPQXGT#-5&CX-CJPV 6JWP 0WT'ZGORNCTGIGRT·IV8QT\ÒINKEJ





8GTGKPUVCNGT$7RUVCNUDQQO#-5&CX-CJPV6JWP  0WT'ZGORNCTGIGRT·IV9KP\4CPFHGJNGTXQT\ÒINKEJ



472

56#&6 

$4'+5#%*

4GKEJUVCNGTMNKRRGCWHFGP'PVUCV\FGT5VCFV$TGKUCEJWPFFKG8GTVTGKDWPIFGUCNNKKGTVGPGXCPIGNK UEJGP*GGTGUCO1MVQDGTI&GT$TGKUCEJGT5VCFVUEJKNFFCTÒDGT\WFGP5GKVGPFKG9CRRGP UEJKNFG FGU 'T\JGT\QIVWOU ¤UVGTTGKEJ WPF FGT .CPFITCHUEJCHV 1DGT'NUC­ WOIGDGP XQP 5EJTKHV'KP   PCEJNHNKGJGPFGT\WTÒEMDNKEMGPFGT9QNHQDGPUVTCJNGPFGT5VGTPOKVFGO/QPQITCOO($GTUVGVV XCT$TCWUG/CPUHGNF6HXCT  8QPITQ­GT5GNVGPJGKV*GTTNKEJG2CVKPCOKP5EJTÌVNKPIUHGJNGTHCUVXQT\ÒINKEJGU'ZGORNCT  &KG -CKUGTNKEJGP JCVVGP  FCU 'NUC­ T·WOGP OÒUUGP WPF KJTG 8GTYCNVWPI KP FCU DGHGUVKIVG WPF UVTCVGIKUEJ IÒP   UVKI IGNGIGPG $TGKUCEJ XGTNGIV <WP·EJUV YWTFG FKG (GUVWPI XQO GXCPIGNKUEJGP )GIPGT FWTEJ FGP 'KPUCV\ OQDKNGT   -QPVKPIGPVGXQO0CEJUEJWDCDIGUEJPKVVGPKO5QOOGTYWTFGFCPPFKG$GNCIGTWPI$TGKUCEJUDGIQPPGP#O ,WNKHÒJTVG9KNFWPF4JGKPITCH1VVQUGKPG6TWRRGPXQTFKGNKPMUTJGKPKUEJIGIGPÒDGTFGT5VCFVIGNGIGPGP5EJCP \GP FKG FKG $TÒEMG UEJÒV\GP UQNNVGP Y·JTGPF/CTMITCH.WFYKIXQP$CFGP&WTNCEJCO#WIWUVFKG5VCFVUGNDUV XQP FGT DCFKUEJGP 5GKVG CWU OKV UGKPGP 6TWRRGP GKPUEJNQ­ $GKFG &CVGP UKPF KP FGT 8QTFGTUGKVGPWOUEJTKHV FGT   XQTNKGIGPFGP 2T·IWPI IGPCPPV 0CEJ JGHVKIGP -·ORHGP MQPPVG FCU MCKUGTNKEJG *GGT GTUV CO  1MVQDGT  OKV   7PVGTUVÒV\WPI URCPKUEJKVCNKGPKUEJGT 6TWRRGP WPVGT FGO *GT\QI XQP (GTKC FCU CNNKKGTVG GXCPIGNKUEJG *GGT \WT #WH   JGDWPIFGT$GNCIGTWPI\YKPIGP&GT'PVUCV\FGT(GUVWPI$TGKUCEJKUVCWHFKGUGT5RQVVRT·IWPIFWTEJFGP9QNH FCU CNNKKGTVG GXCPIGNKUEJG *GGT  FCTIGUVGNNV FGT XQT GKPGO CWU FGP 9QNMGP GTUEJGKPGPFGP 5VGTP OKV FGT +PKVKCNG ( FCU   MCKUGTNKEJMCVJQNKUEJG*GGT HNKGJV7PMNCTKUVQD(HÒTFGP*GT\QIXQP(GTKCQFGTHÒT-CKUGT(GTFKPCPF++UVGJV

86


BREMEN

473

474



-NKRRG \W  -TGW\GTP  IGRT·IV Y·JTGPF FGT $GNCIGTWPI FWTEJ 4JGKPITCH 1VVQ WPF /CTMITCH   (TKGFTKEJXQP$CFGP$GTUVGVV$TCWUG/CPUHGNF6HXCT 5EJÌPpUGJTUEJÌP





'KPUGKVKIG -NKRRG\W-TGW\GTPQ,  IGRT·IVY·JTGPFFGT$GNCIGTWPIFWTEJ4JGKPITCH1VVQ WPF/CTMITCH(TKGFTKEJXQP$CFGP$GTUVGVVNGKEJVXCT$TCWUG/CPUHGNF6H  49KP\2T·IGUEJY·EJGUGJTUEJÌP



475



5KNDGTOGFCKNNGXQP5&CFNGTCWHFKG'KPPCJOGFGTDGNCIGTVGP5VCFVFWTEJ*GT\QI$GTPJCTFXQP 5CEJUGP9GKOCTCO&G\GODGT&GTIGJCTPKUEJVG*GT\QITGKVGVTWPFYKTFXQPGKPGTCWU9QN MGP MQOOGPFGP *CPF DGMT·P\V KO *KPVGTITWPF 5EJNCEJVU\GPG KP GKPGT (NW­NCPFUEJCHV<YGK 'PIGN   JCNVGPFCU5VCFVYCRRGPÒDGTFGT5VCFVCPUKEJVXQP9GUVGPOKVFGO4JGKPWPFFGT(GUVWPI$TGKUCEJKO 8QTFGTITWPFOOI$GTUVGVV/CW¾5NI/GTUGD9KGEGM  448QT\ÒINKEJGU'ZGORNCTOKVHGKPGT6ÌPWPI  $GTPJCTF *GT\QI XQP 5CEJUGP9GKOCT IKNV CNU FGT YQJN DGFGWVGPFUVG FGWVUEJG RTQVGUVCPVKUEJG (GNFJGTT FGU &TGK   ­KIL·JTKIGP-TKGIGU&GTCO#WIWUVKP9GKOCTIGDQTGPG*GT\QIUEJNQUUUKEJPCEJGKPKIGP5VWFKGPOQPC VGPKP,GPCFGPRTQVGUVCPVKUEJGP6TWRRGPCPWPFHQEJVDGK9KGUNQEJWPF9KORHGP#NU)GPGTCN)WUVCX#FQNHU XQP 5EJYGFGP JKGNV $GTPJCTF  FKG GTQDGTVGP 4JGKPNCPFG PCJO CO 5VWTO CWH 9CNNGPUVGKPU .CIGT VGKN WPF   DGJCWRVGVG PCEJ FGO 6QF )WUVCX #FQNHU FCU 5EJNCEJVHGNF DGK .ÒV\GP 0CEJ FGO 8GTNWUV XQP 4GIGPUDWTI    YWTFG$GTPJCTFDGK0ÌTFNKPIGPXGTPKEJVGPFIGUEJNCIGPWPFXGTNQTUGKP*GT\QIVWO+PFGPDGKFGPHQNIGPFGP,CJTGP M·ORHVG GT OKV HTCP\ÌUKUEJGP 8GTDÒPFGVGP OKV YGEJUGNPFGP 'THQNIGP XQT CNNGO KP .QVJTKPIGP UEJNWI  FKG   MCKUGTNKEJGP 6TWRRGP DGK 4JGKPHGNFGP WPF PCJO PCEJ OGJTOQPCVKIGT $GNCIGTWPI CO  &G\GODGT  $TGKUCEJ   GKPYQTCWHFKGXQTNKGIGPFG/GFCKNNG$G\WIPKOOV

477

'4<$+567/  

476

$4'/'0

477

*CTVYKEJ ++ XQP 7VJNGFG  $TCMVGCV  I 5V 2GVTWU VJTQPV HCUV X X OKV -TGW\ WPF   5EJNÒUUGN$GTIGT(F$TGOGP(F$ÒPUVQTHH/GKGT(WPFXQP$QMGN XIN /GTVGPU(F XQP0QTFJCWUGP XIN 5NI$QPJQHH 45GJTUEJÌP )GQTI*GT\QIXQP$TCWPUEJYGKI6CNGT$TGOGP&CX#,WPIM9GNVGT 5GJTUEJÌP

  87


BREMEN

478

479

479

56#&6 



5KNDGTOGFCKNNGXQP,$NWOCWHFKG6TCWWPI'KPXGTNQDVGU2CCTUVGJVCPGKPGO6KUEJWPFTGKEJV UKEJ GKPCPFGT FKG TGEJVG *CPF CWH FGO 6KUEJ GKP QHHGPGU $WEJ#OQT OKV 2HGKN WPF $QIGP UKV\V CWH   GKPGO.ÌYGPWOKJP\WDGU·PHVKIGPOOI,WPIM 5GJTUEJÌP



5KNDGTOGFCKNNGXQP,$NWO4QNCPFOGFCKNNG5VCFVCPUKEJVOKV(GUVWPIUYGTMGPWPFFGT9GUGTOKV 5EJKHHGP FCTÒDGT \YGK 'PIGN OKV 9CRRGPUEJKNFGP KO 8QTFGTITWPF KUV FKG 0GWUVCFV CNU )TWPFTK­   FCTIGUVGNNV&KG4QNCPFU·WNGOOI,WPIM  *ÒDUEJG2CVKPCMN5VGORGNHGJNGTHCUVXQT\ÒINKEJ 

480 (doppelt)

481

482



&QRRGNVGT4GKEJUVCNGTOKV6KVGN(GTFKPCPFU+++I&CX,WPIM  44*ÒDUEJG2CVKPCYKP\4CPFHGJNGTUGJTUEJÌPpXQT\ÒINKEJ





4GKEJUVCNGTOKV6KVGN(GTFKPCPFU+++&CX,WPIM  (CUVXQT\ÒINKEJGU'ZGORNCTOKVHGKPGT6ÌPWPI





4GKEJUVCNGTOKV6KVGN(GTFKPCPFU+++&CX,WPIMNGKEJVXCT  #VVTCMVKXGU'ZGORNCTOKVHGKPGT2CVKPCUGJTUEJÌPpXQT\ÒINKEJ



88


BREMEN

483



4GKEJUVCNGTOKV6KVGNXQP(TCP\+,WPIM  -CDKPGVVUVÒEM2TCEJVXQNNG2CVKPCHCUV5VGORGNINCP\



484



.QV0QVIGNFFGT5VCFV$TGOGP-W2HGPPKI-W2HGPPKI-W2HGPPKI 5VÒEM448QT\ÒINKEJp5VGORGNINCP\



486

485



56#&6

485

$4'5.#7

6CNGT&CX(W5

8QT\ÒINKEJ



$74)/+.%*.+0) 

*GKPTKEJ*GTOCPP5EJWV\DCT4GKEJUVCNGT0ÒTPDGTIOKV6KVGN4WFQNHU++&CX 5NI'TNCPIGTp 445VGORGNHGJNGTUGJTUEJÌP



&GT CWU 1DGTJGUUGP UVCOOGPFG *GKPTKEJ *CTVOCPP 5EJWV\DCT IGPCPPV /KNEJNKPI  YWTFG  XQP -CKUGT   /CZKOKNKCP++KPFGP4GKEJUHTGKJGTTGPUVCPFGTJQDGP'TGTYCTDFKG(GUVWPI9KNJGTOUFQTHKP/KVVGNHTCPMGPFKGGT KP $WTIOKNEJNKPI WODGPCPPVG WPF PCPPVG UKEJ UGNDUV (TGKJGTT KP $WTIOKNEJNKPI WPF 9KNJGTOUFQTH 5GKP 5QJP   *GKPTKEJ*GTOCPPMCOKO#NVGTXQP,CJTGPCPFKG4GIKGTWPIWPFGTJKGNVXQP-CKUGT4WFQNH++XGTOWVNKEJ  FCU /ÒP\TGEJV 8QP  DKU  YWTFGP KP 0ÒTPDGTI 6CNGT OKV 9CRRGP WPF 6KVGN FGU 4GKEJUHTGKJGTTP   IGRT·IV FKG KP GKPFTWEMUXQNNGT 9GKUG FKG <GTURNKVVGTWPI FGU #NVGP 4GKEJGU WPF FCU 2TGUVKIGDGYW­VUGKP FGU MNGKPGP   6GTTKVQTKCNJGTTPDGNGIGP#NNG2T·IWPIGPXQP$WTIOKNEJNKPIUKPF·W­GTUVUGNVGP

89


DONAUWÖRTH

1,5:1

%148';

#$6'+ 

487

1,5:1

,QJCPP %JTKUVQRJ XQP $TCODCEJ CNU #FOKPKUVTCVQT  -KRRGT-W2HGPPKI  *ÌZVGT   +NKUEJ5EJYGFG#PO8CTKCPVGP5NI-TCC\p9GKPIp 8QPITQ­GT5GNVGPJGKV5GJTUEJÌP

488

490



489

&'765%*'414&'0 &'765%*'414&'0+0/'4)'06*'+/ 

-CTNXQP¤UVGTTGKEJ4GKEJUVCNGT0ÒTPDGTI&CX2TQMKUEJ#C  9KP\5EJTÌVNKPIUHGJNGTUGJTUEJÌP





%CTN#NGZCPFGTXQP.QVJTKPIGP5KNDGTOGFCKNNGXQP,.1GZNGKPCWHUGKPG9CJN \WO)TQ­OGKUVGTFGU&GWVUEJGP1TFGPU)GJCTPKUEJVGU$TWUVDKNFTOKVWOIGNGIVGO/CPVGNWPF-TGW\ )QVVHTKGFXQP$QWKNNQPUVGJVXXKO*CTPKUEJOKVWOIGNGIVGO/CPVGNKPFGT4GEJVGPFKG(CJPGFGU &GWVUEJGP 1TFGPU FKG .KPMG NKGIV CWH FGO 9CRRGPUEJKNF XQP ,GTWUCNGO WPF .QVJTKPIGP KO   *KPVGTITWPF5VCFVCPUKEJVXQP,GTWUCNGOOOI&WFKM5NI/QPVGPWQXQ  *GTTNKEJG2CVKPCHCUV5VGORGNINCP\ -QPX6CNGT9GTVJGKO0GWOCPP 45GJTUEJÌPpXQT\ÒINKEJ

 



491

56#&6  90

&10#79¤46*

6CNGTOKV6KVGN-CTNU8&CX)GDJCTV  #W­GTIGYÌJPNKEJIWVCWUIGRT·IVUGJTUEJÌPXQT\ÒINKEJ




EISLEBEN

493

492





492

6CNGTOKV6KVGN-CTNU8&CX)GDJCTV

(GKPG2CVKPCUGJTUEJÌP



,QJCPP#PVQP+++XQP<GJOGP-QPX6CNGT/ÒPEJGP%CJP 8QT\ÒINKEJ



$+567/

495

'+%*5666

494

496



5GFKUXCMCP\&QRRGNVGT-QPX6CNGT0ÒTPDGTII%CJP&CX<GRGTPKEM 5GJTUEJÌPpXQT\ÒINKEJ





,QUGRJXQP5VWDGPDGTI-QPX6CNGT/ÒPEJGP-QPVTKDWVKQP%CJP&CX (CUVXQT\ÒINKEJ



56#&6 

'+5.'$'0

6CNGTCWHFKG,CJTHGKGTFGT0CWODWTIGT-QPXGPVKQP5NI9JKVKPI6QTPCWE  49KP\-TCV\GTXQT\ÒINKEJ

 91


EMDEN

497

56#&6 

'/&'0

5KNDGTPG 8KGT\KIGT/GFCKNNG Q,  XQP'$TCDCPFV*CHGPWPF5VCFVCPUKEJVFCTÒDGTGKP XQP \YGK 'PIGNP IGMTÌPVGU 5VCFVYCRRGP \YKUEJGP 2CNO\YGKIGP<YGK KPGKPCPFGTITGKHGPFG *·PFG CWU   9QNMGP JCNVGP GKP <GRVGT FCTÒDGT GKPG -TQPG OKV \YGK )KTNCPFGP FCTWPVGT \YGK IGMTGW\VG 2CNO   \YGKIG/KV4CPFUEJTKHV241Û.')'Û'6Û)4')'ÛÛÌÛOOI-P[RJXCT  44-N4CPFHGJNGT(GNFGTNGKEJVIGIN·VVGVUGJTUEJÌPpXQT\ÒINKEJ



'ZGORNCTFGT#WMVKQP(TKV\4WFQNH-ÒPMGT1UPCDTÒEM0T

498

499

500



6CNGTOKV6KVGN.GQRQNFU+&CX-P[RJXCT



5KNDGTOGFCKNNG Q ,   WPUKIPKGTV CWH FKG ,CJTHGKGT FGU 8KGT\KIGT-QNNGIKWOU *CHGP WPF   5VCFVCPUKEJV\WFGP5GKVGPLGGKPG2CNOGQDGPJCNVGP\YGKCWU9QNMGPMQOOGPFG*·PFGGKPDTGPPGP FGU*GT\WPVGP\YGK6CWDGP<GKNGP5EJTKHVOOI-P[RJ (CUVUGJTUEJÌP



5KNDGTPG8KGT\KIGT/GFCKNNGWPUKIPKGTVCWHFKG,CJTHGKGTFGU8KGT\KIGT-QNNGIKWOU)GMTÌP VGT RTGW­KUEJGT #FNGT OKV <GRVGT WPF 4GKEJUCRHGN ÒDGT *CHGP WPF 5VCFVCPUKEJV WPVGP FGT IGMTÌPVG   5VCFVUEJKNF \YKUEJGP 2CNO\YGKIGP<YGK KPGKPCPFGTITGKHGPFG *·PFG CWU 9QNMGP JCNVGP IGMTÌPVGU   <GRVGT OKV )KTNCPFG FCTÒDGT  <GKNGP FCTWPVGTGKPG<GKNG5EJTKHVQDGP%%KP-TCP\OO I-P[RJ 'VYCUDGTKGDGPXQT\ÒINKEJ





92

5GJTUEJÌP




FRANKFURT

501

'4$#%*

)4#(5%*#(6 

(TCP\  5EJCWVCNGT  2T·OKG HÒT NCPFYKTVUEJCHVNKEJG 8GTDGUUGTWPIGP  I )TQ­GU   -NGGDNCVV CWH FGT NKPMGP 5GKVG FCU 'TDCEJGT 5EJNQ­ CP GKPGO DGYCNFGVGP $GTI FCXQT FGT (NW­   /ÒONKPICWHFGTTGEJVGP5GKVGFKG1TVUEJCHV'TDCEJOKVCWHIGJGPFGT5QPPGWPFGKPOKV\YGK1EJUGP RHNÒIGPFGT$CWGT8KGT<GKNGP5EJTKHV,QUGRJ  8QPITQ­GT5GNVGPJGKV9KP\4CPFHGJNGTWPF-TCV\GTUGJTUEJÌPpXQT\ÒINKEJ  &CUXQTNKGIGPFG5VÒEMYKTFCWHITWPFUGKPGT&CTUVGNNWPICWHFGT8QTFGTUGKVGCWEJ-NGGVCNGTIGPCPPV

502

503

504

504

56#&6

505

'4(746



4GKEJUVCNGT&CX.GKV\OCPPXCT

5GJTUEJÌP



5KNDGTOGFCKNNG  XQP ( 9 (CEKWU CWH FGP (ÒTUVGPMQPITG­ 5VCFVCPUKEJV KO #DUEJPKVV FCTWPVGT   \YGK <GKNGP 5EJTKHV<YGK <GKNGP 5EJTKHV  OO  I $TCOUGP  .GKV\OCPP    5NI,WNKWU 8QT\ÒINKEJ





9GKVGTG 'THWTVGT 2T·IWPIGP CWU FGT 5COONWPI FGT (TGKJGTTGP $QPFG HKPFGP 5KG KP -CVCNQI  WPVGT   FGP0TP 

56#&6

(4#0-(746



-NKRRGPHÌTOKIGT&KEMCDUEJNCIXQO*GNNGTQ, ,CJTJWPFGTV I,W(

48QT\ÒINKEJ





4GKEJUVCNGTOKV6KVGN(GTFKPCPFU++&CX,W(C

5GJTUEJÌP



9GKVGTG(TCPMHWTVGT/ÒP\GPFGUWPF,CJTJWPFGTVUCWUFGO5EJCV\HWPFXQP*GTDQTPHKPFGP5KG WPVGTFGP0TP 

93


FRANKFURT







507

508

506

5KNDGTOGFCKNNGWPUKIPKGTVXQP2*/ÒNNGTCWHFKG-TÌPWPI-CTNU8+\WOTÌOKUEJGP-CKUGT /GFCKNNQP FCTKP FCU IGJCTPKUEJVG $TWUVDKNF -CTNU 8+ T OKV .QTDGGTMTCP\ WPF WOIGNGIVGO /CPVGN   WOJGT UGEJU YGKVGTG /GFCKNNQPU OKV FGP $TWUVDKNFGTP FGT -WTHÒTUVGP XQP /CKP\ FGT 2HCN\ $TCPFGP   DWTI $TCWPUEJYGKI.ÒPGDWTI 5CEJUGP WPF 6TKGT&QRRGNCFNGT OKV <GRVGT 5EJYGTV WPF 4GKEJUCRHGN   KP FGP (·PIGP CWH FGT $TWUV *GT\ FCTCWH -CKUGTMTQPG  OO  I (ÌTUEJPGT  (QTUVGT   ,W(5NI/QPVGPWQXQ 8QT\ÒINKEJ



5KNDGTOGFCKNNGXQP%JTX.QJCWHFKG-TÌPWPI-CTNU8+\WOTÌOKUEJGP-CKUGT)GTOCPKCOKV FGT-CKUGTMTQPGKPFGT4GEJVGPUVGJVPCEJNKPGKPGT)CTVGPCPNCIGWPFJ·NVOKVFGT.KPMGPGKP/GFCKN NQPOKVFGOIGJCTPKUEJVGP$TWUVDKNF-CTNU8+TOKV.QTDGGTMTCP\WPFWOIGNGIVGO/CPVGNQDGPWPVGT UVTCJNGPFGT 5QPPG FTGK XQP )GPKGP IGJCNVGPG YGKVGTG /GFCKNNQPU OKV FGP $TWUVDKNFGTP XQP -CTN FGO   )TQ­GP -CTN +8 FGO 9GKUGP WPF -CTN 80ÌTFNKEJG 'TFJCNDMWIGN OKV FGP $G\GKEJPWPIGP *+52    )'4/#0  +6#. QDGP GKP *CNDMTGKU OKV FGP 5VGTP\GKEJGP .ÌYG ,WPIHTCW 9CCIG -TGDU WPF   5EJÒV\GKO#DUEJPKVV\YGK<GKNGP5EJTKHVOOI(ÌTUEJPGT(QTUVGT,W( 5NI/QPVGPWQXQ 445GJTUEJÌPpXQT\ÒINKEJ



-QPX6CNGT&CX,W(C



509

511

8QT\ÒINKEJ

510

511



5KNDGTCDUEJNCIXQPFGP5VGORGNPFGU-W*GNNGTU#-5#PO,\W  448QT\ÒINKEJp5VGORGNINCP\





'KPUGKVKIGT2TQDGCDUEJNCIKP5KNDGTXQPFGP5VGORGNPFGU-W*GNNGTU#-5XIN,XIN  448QT\ÒINKEJp5VGORGNINCP\





8GTGKPUFQRRGNVCNGT'TÌHHPWPIFGTPGWGP/ÒP\G#-5&CX-CJPV6JWP  40WT'ZGORNCTGIGRT·IV8QT\ÒINKEJ



94


FRANKFURT

512

514

513



8GTGKPUFQRRGNVCNGT#-5&CX-CJPV6JWP

8QT\ÒINKEJp5VGORGNINCP\





8GTGKPUFQRRGNVCNGT#-5&CX-CJPV6JWP

*ÒDUEJG2CVKPCXQT\ÒINKEJ





8GTGKPUFQRRGNVCNGT#-5&CX-CJPV6JWP 5GNVGPGT,CJTICPI(CUVXQT\ÒINKEJ



515

516



&QRRGNIWNFGP#-5&CX-CJPV6JWP



&QRRGNIWNFGP%QPUVKVWKGTGPFG8GTUCOONWPI2TQDGQJPG4CPFUEJTKHVI#-5p XIN  &CXp XIN -CJPVp XIN 5VWV\OCPP$56C8CTKCPVGD6JWPp XIN   44/KP4CPFHGJNGTXQT\ÒINKEJ 

517

8QT\ÒINKEJp5VGORGNINCP\



518



&QRRGNIWNFGP'T\JGT\QI,QJCPP#-5&CX-CJPV6JWP  5GNVGPKPFKGUGT'TJCNVWPI2TCEJVGZGORNCT(CUV5VGORGNINCP\



&QRRGNIWNFGP)GRT·IVCWHFKG9CJNFGURTGW­KUEJGP-ÌPKIU(TKGFTKEJ9KNJGNO+8\WO-CKUGT FGT&GWVUEJGPCO/·T\#-5&CX-CJPV6JWP  440WT'ZGORNCTGIGRT·IV-CDKPGVVUVÒEMOKVHGKPGT2CVKPC2QNKGTVG2NCVVGOKPDGTÒJTV



 95


FRANKFURT

519

520

520



8GTGKPUFQRRGNVCNGT#-5&CX-CJPV6JWP  5GNVGPGT,CJTICPIKPCW­GTIGYÌJPNKEJGT3WCNKV·V2TCEJVGZGORNCT(CUV5VGORGNINCP\





5KNDGTOGFCKNNGXQP%8QKIVCWHFCUL·JTKIG&QMVQTLWDKN·WOXQP(TKGFTKEJ6KGFGOCPP

 -CUUGN Ó /ÒPEJGP  KP (TCPMHWTV $ÒUVG 6KGFGOCPPU T5GGUVGTP  OO  I , W (   5NI$TGVVCWGT 4*ÒDUEJG2CVKPCMN4CPFHGJNGTXQT\ÒINKEJ



(TKGFTKEJ6KGFGOCPPYCTGKPDGTÒJOVGT2J[UKQNQIG$GTGKVUYWTFGGT2TQHGUUQTKP.CPFUJWVWPFDKU 2TQHGUUQT KP *GKFGNDGTI 7PVGT UGKPGP \CJNTGKEJGP YKUUGPUEJCHVNKEJGP 5EJTKHVGP YWTFG FKG #DJCPFNWPI ÒDGT FKG   #PCVQOKG FGT 4ÌJTGPJQNQVJWTKGP 5GGIWTMGP  KO ,CJTG  XQO HTCP\ÌUKUEJGP +PUVKVWV CWUIG\GKEJPGV YQTCWH UKEJ   FKG 4ÒEMUGKVGPFCTUVGNNWPI FGT XQTNKGIGPFGP /GFCKNNG DG\KGJV 0CEJFGO 6KGFGOCPP UKEJ XQP UGKPGT CMCFGOKUEJGP   .CWHDCJP \WTÒEMIG\QIGP JCVVG \QI GT UKEJ PCEJ (TCPMHWTV \WTÒEM YQ FKG T\VG 'WTQRCU KO ,CJTG  UGKP   L·JTKIGU&QMVQTLWDKN·WOHGKGTVGP

522

521



&QRRGNIWNFGP4GNKIKQPUHTKGFGP#-5&CX-CJPV6JWP  (GKPG6ÌPWPIHCUV5VGORGNINCP\





8GTGKPUVCNGT/KV&·EJGTPDGKO'UEJGPJGKOGT6WTO#-5&CX-CJPV6JWP  48QT\ÒINKEJ



524

523



)WNFGP#-5,



8GTGKPUVCNGT#-5&CX-CJPV6JWP

96

524

42TCEJVGZGORNCTOKVJGTTNKEJGT2CVKPC(CUV5VGORGNINCP\ 8QT\ÒINKEJp5VGORGNINCP\

 


FULDA

525

526

527

(ª456'067/(4#0-(746 

%CTN 6JGQFQT XQP &CNDGTI (ÒTUVRTKOCU FGU 4JGKPDWPFGU  -QPX6CNGT  #-5    &CX-CJPV6JWP $GTKGDGPUGJTUEJÌPpXQT\ÒINKEJ



(4+'&$'4) 4'+%*5$74) 

,QJCPP /CTKC 4WFQNRJ XQP 9CNFDQVV$CUUGPJGKO  -QPX6CNGT  OKV 6KVGN XQP   (TCP\++&CX-CJPV6JWP /KPLWUVKGTVXQT\ÒINKEJ

(ª456'067/ 



(ª456'0$'4)

-CTN,QCEJKO-QPX6CNGT#-5&CX-CJPV6JWP  40WT'ZGORNCTGIGRT·IV(GKPG2CVKPCXQT\ÒINKEJ



528

529

529

(7.&#  

#$6'+5'+6$+567/

(TKGFTKEJXQP4QOTQFV)TQUEJGP 5EJKNNKPI Q,(WNFC)GJTNKPI'TFOCPPp  442T·IGUEJY·EJGHCUVUGJTUEJÌP



2NCEKFWU XQP &TQUVG  5EJCWVCNGT  5VGORGN XQP 2 * /ÒNNGT #WIUDWTI  I   &CXp(QTUVGT)GJTNKPI'TFOCPPp 44(GKPG2CVKPCUGJTUEJÌPpXQT\ÒINKEJ  97


GANDERSHEIM

530

531

532



#FQNRJXQP&CNDGTI4GKEJUVCNGT/KV-GTDTCPF$WEJQPKC&CX  44(GKPG2CVKPCXQT\ÒINKEJ



*GKPTKEJ8+++XQP$KDTC-QPX6CNGT(WNFCI$TWUVDKNFTKPIGKUVNKEJGO 1TPCV OKV WOIGNGIVGO /CPVGN WPF 1TFGPUMTGW\&TGKHCEJ DGJGNOVGU XKGTHGNFKIGU 9CRRGP CWH 2QUVC   OGPV\WFGP5GKVGPFKGIGVGKNVG,CJTGU\CJNWPFFKG5KIPCVWT8* .WFYKIXCP*QXG/ÒP\OGKUVGTKP (WNFC $WEJQPKC&CX#  8QPITQ­GT5GNVGPJGKV(GKPG2CVKPCOKP5EJTÌVNKPIUHGJNGTCO4CPFXQT\ÒINKEJGU'ZGORNCT 



5GFKUXCMCP\-QPX6CNGT$WEJQPKC+++5&CX<GRGTPKEM  5GJTUEJÌPpXQT\ÒINKEJ 'ZGORNCTFGT#WMVKQP(TKV\4WFQNH-ÒPMGT1UPCDTÒEM0T





533

534



#FCNDGTV+++XQP*CTUVCNN-QPX6CNGT(WNFC-QPVTKDWVKQP$WEJQPKC&CX *ÒDUEJG2CVKPCOKPLWUVKGTVYKP\5EJTÌVNKPIUHGJNGTXQT\ÒINKEJ

#$6'+ 

98

534



)#0&'45*'+/

'NKUCDGVJ 'TPGUVKPG #PVQPKG XQP 5CEJUGP/GKPKPIGP  5KNDGTOGFCKNNG  XQP + 1   9CJN CWH KJT L·JTKIGU ,WDKN·WO CNU DVKUUKP )GRCP\GTVGU $TWUVDKNF T OKV -TGW\ 1TFGPUDCPF   ,WYGNGPWPFWOIGNGIVGO*GTOGNKP<GKNGP5EJTKHVOOI)TQDG5NI/GTUGD 4(GKPG2CVKPCGVYCUDGTKGDGPUGJTUEJÌP




HAMBURG

535

*#.$'456#&6 $+567/ 

#NDTGEJV8XQP$TCPFGPDWTI6CNGT$GUUGT$T·OGT$ÒTIGTXCT&CX 2T·IGUEJY·EJGHCUVUGJTUEJÌP

536

56#&6 

537



538

*#/$74)

5KNDGTOGFCKNNG Q , WPUKIPKGTV CWH FCU XKGTVG )GDQV <YGK 6CHGNP PGDGPGKPCPFGT FCTCWH FCU XKGTVG   )GDQV'KP KP GKPGP -ÒDGN IGRHNCP\VGT ITÌ­GTGT $CWO UVGJV \YKUEJGP \YGK MNGKPGTGP $·WOEJGP KP   -ÒDGNPOOI)CGF\W++5 (CUVXQT\ÒINKEJ





&QRRGNVGT5EJCWVCNGTQ,/ÒP\OGKUVGT/CVVJKCU/QGTU)GMTÌPVG/CFQPPCOKV<GRVGTKPFGT4GEJVGP WPF FGO -KPF CWH FGO NKPMGP #TO UVGJV X X CWH /QPFUKEJGN FGP -QRH PCEJ T IGYCPFV WOJGT   5VTCJNGPMTCP\&KG6CWHG%JTKUVKKO,QTFCPOOI)CGF  (GNFGTOKPIGIN·VVGVUGJTUEJÌPpXQT\ÒINKEJ 



 HCEJGT 5EJCWVCNGT Q , CWH FKG )GDWTV %JTKUVK $GJGNOVGU QXCNGU 5VCFVYCRRGP WOJGT $N·VVGT   MTCP\)GDWTV %JTKUVK KO #DUEJPKVV \YGK <GKNGP 5EJTKHV WOJGT $N·VVGTMTCP\  OO  I   )CGF 5GJTUEJÌP  99


HAMBURG

540

539

541



6CNGT IGRT·IV )CGF



4GKEJUVCNGTOKV6KVGN4WFQNHU++&CX)CGFNGKEJVXCT  4*ÒDUEJG2CVKPCCVVTCMVKXGUUGJTUEJÌPGU'ZGORNCT





4GKEJUVCNGTOKV6KVGN4WFQNHU++&CX)CGF



543

45GJTUEJÌP

542

(GKPG2CVKPCUGJTUEJÌP



544



4GKEJUVCNGTOKV6KVGNXQP/CVVJKCU&CX)CGF



5KNDGTOGFCKNNG  XQP 5 &CFNGT 5KNDGTPGT $CPM2QTVWICNÌUGT CWH FKG 5GIPWPIGP FGU (TKGFGPU   5VCFVCPUKEJVOKV\CJNTGKEJGP5EJKHHGPCWHFGT'NDGQDGPMNGKPGU5VCFVYCRRGPFCTÒDGTJCNVGP\YGKCWU 9QNMGP MQOOGPFG *·PFG GKPGP 5EJKNF OKV FGO 0COGP ,GJQXCU&GT RGTUQPKHK\KGTVG (TKGFG UEJYGDV   ÒDGT FGT 'NDG WPF NGGTV \YGK (ÒNNJÌTPGT  OO  I &GVJ1TF  )CGF  FQTV KP   )QNF /CW¾ 8QT\ÒINKEJGU'ZGORNCTOKVUEJÌPGT2CVKPC 



5KNDGTOGFCKNNG  OKV 5KIPCVWT +- 5KNDGTPGT $CPM2QTVWICNGUGT 5VCFVCPUKEJV OKV XKGNGP 5EJKHHGP   CWHFGT'NDGQDGPUVTCJNGPFGT0COG,GJQXCU6KUEJFCTCWH5VCFVYCRRGPWPF$WEJQDGPJ·NVGKPGCWU 9QNMGPMQOOGPFG*CPFGKPG9CCIGFCTÒDGTUVTCJNGPFGU)QVVGUCWIGOOI)CGF 445EJÌPG2CVKPCYKP\&TWEMUVGNNGXQT\ÒINKEJ 

100

45GJTUEJÌP




HAMBURG

545



5KNDGTOGFCKNNGXQP,4GVGMG5KNDGTPGT$CPMRQTVWICNÌUGTCWHFKGITQ­GPGWTQR·KUEJGP$CPMUV·FVG 8GPGFKI#OUVGTFCO*CODWTIWPF0ÒTPDGTI&KGRGTUQPKHK\KGTVG)ÌVVKPFGUªDGTHNWUUGUOKV(ÒNNJQTP KO TGEJVGP #TO WPF 5VCD KP FGT .KPMGP UVGJV JCNDT \W KJTGP (Ò­GP *CPFGNUYCTGP PGDGP KJT UVGJGP   9CTGPCWHFGO$QFGPTGKPG5·WNGOKVFGP9CRRGPFGTXKGT5V·FVGKO*KPVGTITWPF6GKNCPUKEJVFGT 5VCFV QDGP FGT UVTCJNGPFG 0COG ,GJQXCU&KG FTGK 2GTUQPKHKMCVKQPGP XQP -NWIJGKV 'KPKIMGKV WPF   9CEJUCOMGKVUVGJGPXXOKVKJTGP#VVTKDWVGPQDGPFCUUVTCJNGPFG5[ODQNFGT&TGKHCNVKIMGKVOO I)CGF FQTVKP)QNF  448QT\ÒINKEJGU'ZGORNCT 

546



-NGKPG5KNDGTOGFCKNNGWPUKIPKGTVCWHFGPGTUEJKGPGPGP-QOGVGP&GT-QOGV\YKUEJGP 5VGTPGP5KGDGP<GKNGP5EJTKHVOOI)CGF 45GJTUEJÌPpXQT\ÒINKEJ



547



5CVKTKUEJG 5KNDGTOGFCKNNG  WPUKIPKGTV CWH FKG $GNCIGTWPI FGT 5VCFV FWTEJ FKG &·PGP 'KP -QOGV   ÒDGT FGT 5VCFVCPUKEJV XQP *CODWTI KO #DUEJPKVV \YGK <GKNGP 5EJTKHV'KP #FNGT XGTUWEJVGKP.COO XQPFGT'TFG\WGPVHÒJTGPXQPTGKNVGKP5EJ·HGTJGTDGKQDGPHNKGIVGKPYGKVGTGT#FNGTFGTDGTGKVUGKP .COOKPFGP(·PIGPJ·NVOOI%QNN(KGYGIGT FQTVKP<KPP )CGF  8QPITQ­GT5GNVGPJGKV#VVTCMVKXGUXQT\ÒINKEJGU'ZGORNCTOKVUEJÌPGT2CVKPC  &KG <GTUVÌTWPI FGU *CODWTIGT *KPVGTNCPFGU FWTEJ FGP &TGK­KIL·JTKIGP -TKGI HÒJTVG \W GKPGT UVCTMGP $GGKPVT·EJVK   IWPI FGU *CPFGNU FGT *CPUGUVCFV FKG FGP -TKGI UGNDUV XÌNNKI WPDGUEJCFGV ÒDGTUVCPFGP JCVVG &KG 7P\WHTKGFGPJGKV   FGT$ÒTIGTTKEJVGVGUKEJXQTCNNGOIGIGPFGP4CVFGT5VCFVWPFFGPUVTGPIGP$ÒTIGTOGKUVGT/GWTGT#NUFKG$ÒTIGT 5EJPKVIGT WPF ,CUVTCO UQICT XQO F·PKUEJGP -ÌPKI *KNHG GTDCVGP GTUEJKGPGP  F·PKUEJG 6TWRRGP XQT FGT 5VCFV   WPF XGTNCPIVGP FKG 'TDJWNFKIWPI HÒT -ÌPKI %JTKUVKCP 8 &KG &·PGP DGTKGHGP UKEJ CWH FKG KPU  ,CJTJWPFGTV \W   TÒEMTGKEJGPFG*GTTUEJCHVFGT5EJCWGPDWTIGTFKGUKGKO,CJTJWPFGTVDGGTDVJCVVGP+OOGTYKGFGTDGCPURTWEJVGP FKG&·PGPFKGUGKVFGO&TGK­KIL·JTKIGP-TKGICWEJFCUPCJGIGNGIGPG#NVQPCDGUC­GPFKG*QJGKVÒDGT*CODWTI+P DNWVKIGP -·ORHGP IGNCPI GU FGT $ÒTIGTUEJCHV OKV YGNHKUEJGT WPF DTCPFGPDWTIKUEJGT*KNHGFKGF·PKUEJG$GNCIGTWPI \W DGGPFGP 'PFIÒNVKI XGT\KEJVGVGP FKG &·PGP LGFQEJ GTUV KO )QVVQTRGT 8GTVTCI XQP  CWH KJTG #PURTÒEJG CWH   *CODWTI#PFKG$GNCIGTWPIXQPGTKPPGTVGKPG5GTKGRTCEJVXQNNIGUVCNVGVGTJGWVGUGJTUGNVGPGT/GFCKNNGPFKG CWH UCVKTKUEJG 9GKUG FGP (GJNUEJNCI FGT F·PKUEJGP #MVKQP FCTUVGNNGP #WH WPUGTGO 5VÒEM YKTF &·PGOCTM CNU   MTKGIUNÒUVGTPGT #FNGT DGK FGO GTHQNINQUGP 8GTUWEJ FCTIGUVGNNV GKP HTKGFNKEJGU .COO *CODWTI  FCXQP\WVTCIGP   /ÌINKEJGTYGKUG UVGNNV FCU \YGKVG .COO FCU DGTGKVU XQP GKPGO #FNGT GORQTIGJQDGP YWTFG FKG 5EJYGUVGTUVCFV   #NVQPCFCT

101


HAMBURG

548

549

550



5KNDGTOGFCKNNG  WPUKIPKGTV CWH FKG $GNCIGTWPI FGT 5VCFV FWTEJ FKG &·PGP 5VCFVCPUKEJV KO 8QT   FGTITWPF5GIGNUEJKHHGWPF$QQVG&KG)GUVKTPGFGU5EJYCPUWPFFGU#FNGTUFC\YKUEJGP9QNMGP/KV 4CPFUEJTKHV d #752+% Ü %“5 Ü #7:+. Ü $4#0& Ü '6 .70 Ü *#/$74)'05 Ü 56'..#4'   /70+/'06Ü1227)0#4+&'5+0+6ÜOOI)CGF 448QT\ÒINKEJ 



5CVKTKUEJG5KNDGTOGFCKNNGQ,  OKV5KIPCVWT'(CWHFKG$GNCIGTWPIFGT5VGTPUEJCP\GFWTEJFKG &·PGP 5VCFVCPUKEJV XQP *CODWTI KO *KPVGTITWPF $GUEJW­ FGT 5VGTPUEJCP\G,WPIHTCW *CODWTI    XGTVGKFKIV UKEJ IGIGP GKPGP F·PKUEJGP 'FGNJGTTGP GKP YGKVGTGT &·PG MPKGV XQT KJT WPF DGTÒJTV UKG KO   *KPVGTITWPFN5VGTPUEJCP\GOOI%QNN(KGYGIGT)CGF  44#VVTCMVKXGUXQT\ÒINKEJGU'ZGORNCTOKVHGKPGT6ÌPWPI 



5CVKTKUEJG5KNDGTOGFCKNNGQ,  OKV5KIPCVWT'(CWHFKG$GNCIGTWPIFGT5VGTPUEJCP\GFWTEJFKG &·PGP 5VCFVCPUKEJV XQP *CODWTI KO *KPVGTITWPF $GUEJW­ FGT 5VGTPUEJCP\G,WPIHTCW *CODWTI    XGTVGKFKIV UKEJ IGIGP GKPGP F·PKUEJGP 'FGNJGTTGP GKP YGKVGTGT &·PG MPKGV XQT KJT WPF DGTÒJTV UKG KO   *KPVGTITWPFN5VGTPUEJCP\GOOI%QNN(KGYGIGT)CGF  44&WPMNG2CVKPCUGJTUEJÌPpXQT\ÒINKEJ 

552





102

551 552

5KNDGTOGFCKNNGQ,  WPUKIPKGTVCWHFCU0GWG,CJT5VCFVCPUKEJVFCTWPVGTNGGTG-CTVWUEJGQDGP TGKEJGP UKEJ \YGK CWU 9QNMGP MQOOGPFG *·PFG GKP )GNFUVÒEM <GKNGP 5EJTKHV QDGP WPF WPVGP   LGGKPG4QUGVVGOOI)CGFC 8QT\ÒINKEJ



5KNDGTOGFCKNNG Q ,   XQP , 4GVGMG )NWEMJGPPGPOGFCKNNG )NWEMJGPPG OKV -ÒMGP WPVGT   GKPGO (GKIGPDCWOFGTXQP9GKPTGDGPWOTCPMVKUV2GTUQPKHK\KGTVG)GTGEJVKIMGKVOKV5EJYGTV9CCIG WPF2CNO\YGKIWPFRGTUQPKHK\KGTVGT(NGK­OKV$KGPGPMQTDUVGJGPCP#NVCTCWHFGOGKPCWHIGUEJNCIGPGU $WEJNKGIVQDGP)QVVGUPCOGKPUVTCJNGPFGO2GTNMTGKUOOI)CGF  #VVTCMVKXGU'ZGORNCTOKVHGKPGT2CVKPCYKP\4CPFHGJNGTXQT\ÒINKEJp5VGORGNINCP\




HAMBURG

553



5KNDGTOGFCKNNG Q , WO   WPUKIPKGTV )NWEMJGPPGPOGFCKNNG )NWEMJGPPG OKV -ÒMGP WPVGT GKPGO   (GKIGPDCWO FGT XQP 9GKPTGDGP WOTCPMV KUV2GTUQPKHK\KGTVG )GTGEJVKIMGKV OKV 5EJYGTV 9CCIG WPF   2CNO\YGKIWPFRGTUQPKHK\KGTVGT(NGK­OKV$KGPGPMQTDUVGJGPCP#NVCTCWHFGOGKPCWHIGUEJNCIGPGU$WEJ NKGIVQDGP)QVVGUPCOGKPUVTCJNGPFGO2GTNMTGKUOOI)CGFp \W   (CUVXQT\ÒINKEJ



555

554

554



5KNDGTOGFCKNNG Q ,   XQP & ) XCP *CEJVGP 5KNDGTPGT $CPM2QTVWICNÌUGT CWH FGP   (TKGFGPUYWPUEJ 5VCFVCPUKEJV OKV FGO *CHGP KO 8QTFGTITWPF 5EJKHHG QDGP UVTCJNGPFG 5QPPG KP   9QNMGP&KGRGTUQPKHK\KGTVG*QHHPWPIUKV\VPCEJNCWHGKPGO#PMGTCP/GGTGUWHGTKO.KPMGP#TOJ·NV UKGGKPG.KNKGOKVFGT4GEJVGPFGWVGV5KGCWHGKP5GIGNUEJKHHQDGPNUEJYGDVGKP'PIGNOKV-TCP\WPF .QTDGGT\YGKIOOI)CGF++5 FQTVKP)QNF  48QT\ÒINKEJ 



-NKRRGPHÌTOKIG5KNDGTOGFCKNNGWPUKIPKGTVCWHFKG'KPUGV\WPIGKPGTMCKUGTNKEJGP-QOOKUUKQPWPF FGP 'KPOCTUEJ XQP 4GKEJUVTWRRGP KP FKG 5VCFV *CODWTI CO  /CK \WT $GKNGIWPI FGT TGNKIKÌUGP   7PTWJGP 5VCFVCPUKEJV OKV 5EJKHHGP FCXQT QDGP )QVVGUCWIG CWH 9QNMGP <GKNGP 5EJTKHV WOJGT   #%**#/$74)&'0%-&#4#09#5)166&+5+#*4)'6#*0ZOOI )CGF*KNFGDTCPF+5 44*ÒDUEJG2CVKPCUGJTUEJÌP #PNC­FGT7PTWJGPYCTGKP5VTGKV\YKUEJGPFGO2CUVQTFGT*CODWTIGT2GVGTUMKTEJG&T%JTKUVKCP-TWODJQNV\WPF FGO ,WTKUVGP $CTVJQNF (GKPF FGT OGJTGTG 5EJO·JUEJTKHVGP IGIGP FGP GJGOCNKIGP 2CUVQT ,QJCPP (TKGFTKEJ /C[GT   WPF IGIGP -TWODJQNV\ UGNDUV XGTHC­V JCVVG 2CUVQT -TWODJQNV\ XGTNCPIVG FKG *KPTKEJVWPI (GKPFU WPF FKG   8GTDTGPPWPI UGKPGT 5EJTKHVGP #NU FKGU XQO /CIKUVTCV CDIGNGJPV YWTFG XGTUCOOGNVG UKEJ GKP 6GKN FGT *CODWTIGT   $ÒTIGTUEJCHVXGTDTCPPVGFKG5EJTKHVGPWPFUGV\VGCEJV/CIKUVTCVUOKVINKGFGTCD&GTWO*KNHGIGDGVGPG-CKUGT,QUGH +DGCWHVTCIVGFCU&KTGMVQTKWOFGU0KGFGTU·EJUKUEJGP4GKEJUMTGKUGUFCUXQOUEJYGFKUEJGP-ÌPKI CNU*GT\QIXQP $TGOGP WPF 8GTFGP  IGHÒJTV YWTFG OKV FGT 9KGFGTJGTUVGNNWPI XQP 4WJG WPF 1TFPWPI 'KP XQP 5EJYGFGP 2TGW   ­GPWPFFGPYGNHKUEJGP*GT\QIVÒOGTPCWHIGUVGNNVGUEC/CPPWOHCUUGPFGU*GGTWPVGT(ÒJTWPIFGUUEJYG FKUEJGP )GPGTCNIQWXGTPGWTU KP $TGOGP WPF 8GTFGP 0KNU )[NNGPUVKGTPC TÒEMVG CO  /CK  KP *CODWTI GKP   Y·JTGPFGKPGMCKUGTNKEJG-QOOKUUKQPFKG7PVGTUWEJWPIGPHÒJTVG#O,WPKYWTFGPFGT2CUVQT&T-TWOD JQNV\WPFYGKVGTG7PTWJGUVKHVGTXGTJCHVGV  &KG4ÒEMUGKVGPKPUEJTKHVNKUVGVFKG'TGKIPKUUGFGU,CJTGUCWH&KG'KPPCJOGFGU*COOGT$CWOGUCO/CK FKG'KPTKEJVWPIFGTMCKUGTNKEJGP-QOOKUUKQPCO/CKFGT'KP\WIFGUPKGFGTU·EJUKUEJGP-TGKUJGGTGUCO/CK WPFFKG8GTJCHVWPIXQP#WHTÒJTGTPCO,WPK



103


HAMBURG

556 557





557

5KNDGTOGFCKNNGWPUKIPKGTVCWHFCU*QEJYCUUGT\W9GKJPCEJVGP5VCFVCPUKEJVKO8QTFGTITWPFFKG XQO9KPFCWHIGYÒJNVG'NDGQDGPUVTCJNGPFGU)QVVGUCWIG<GJP<GKNGP5EJTKHVQDGPWPFWPVGPLGGKPG 4QUGVVGOOI)CGF5NI$TGVVCWGT  442TCEJVGZGORNCTOKVHGKPGT2CVKPC(CUV5VGORGNINCP\



4GKEJUVCNGTOKV6KVGN-CTNU8+CWHFKG,CJTHGKGTFGTªDGTICDGFGT#WIUDWTIGT-QPHGUUKQP &CX)CGF5NI9JKVKPI /KP5EJTÌVNKPIUHGJNGTXQT\ÒINKEJ



559

558

558



5KNDGTOGFCKNNGXQP&*·UNKPIJ5KNDGTPGT$CPM2QTVWICNÌUGT0GRVWPOKV&TGK\CEMWPF'NDIQVV OKV 4WFGT WPF 3WGNNWTPG UKV\GP GKPCPFGT IGIGPÒDGT WPF TGKEJGP UKEJ 5EJKHHUOQFGNNG GPVIGIGP WOJGT   9GNNGP5VCFVYCRRGP \YKUEJGP .QTDGGT WPF 'KEJGP\YGKI FCTÒDGT \YGK <GKNGP 5EJTKHV \W FGP 5GKVGP   LGFTGK5EJKNFGOKV'ODNGOGPQDGPGKPITQ­GT5EJKNFOKVFGOUVTCJNGPFGP0COGP,GJQXCUWPVGP-CT VWUEJGOKV\YGK<GKNGP5EJTKHVOOI)CGF FQTVKP)QNF   44/KPDGTKGDGPXQT\ÒINKEJ 



-NGKPG 5KNDGTOGFCKNNG  WPUKIPKGTV CWH FGP KO (GDTWCT FGU ,CJTGU GTUEJKGPGPGP -QOGVGP &GT   -QOGV\YKUEJGP5VGTPGPÒDGT9KPVGTNCPFUEJCHV5GEJU<GKNGP5EJTKHVOOI)CGF -N4CPFHGJNGTXQT\ÒINKEJ

560



561



5KNDGTOGFCKNNG  XQP 2 * )QGFGEMG CWH FKG -TÌPWPIUHGKGTNKEJMGKVGPHÒT-CKUGT(TCP\+)GJCT PKUEJVGU$TWUVDKNFFGU-CKUGTUTOKV.QTDGGTMTCP\WOIGNGIVGO/CPVGNWPFFGT-GVVGFGU1TFGPUXQO )QNFGPGP 8NKGU5VCFVCPUKEJV XQP *CODWTI OKV FGO #NUVGTDGEMGP WPF FGT #NUVGTVGTTCUUG CWH FGT GKP   (GWGTYGTMCDIGDTCPPVYKTFOOI(ÌTUEJPGT)CNUVGT  45GJTCVVTCMVKXGUXQT\ÒINKEJGU'ZGORNCTOKVHGKPGT6ÌPWPI 



5KNDGTOGFCKNNGXQP,8&ÌNNWPF&(.QQUCWHFKG,CJTHGKGTFGT5VCFV5VCFVIÌVVKPOKV 5VGWGTTWFGT 9CRRGPUEJKNF /GTMWTUVCD WPF (ÒNNJQTP UKV\V CP L·JTKIGT 'KEJG WOJGT \CJNTGKEJG   8ÌIGN#PUKEJV FGT $KPPGPCNUVGT OKV FGO ,WPIHGTPUVKGI QDGP UEJYGDV GKP  )GPKWU OKV ¤N\YGKI WPF   )TCPCVCRHGNCWH9QNMGPOOI)CGF5QOOGT#  (GKPG6ÌPWPIHCUV5VGORGNINCP\

104




HARZ

562

563



563

5KNDGTOGFCKNNGWPUKIPKGTVXQP##DTCOUQPCWHFKG,CJTHGKGTFGT5VCFV&TGKMNGKPG*·WUGT CO 7HGT FGT 'NDG KO 8QTFGTITWPF GKPKIG (KUEJGTDQQVG#PUKEJV FGT DGHGUVKIVGP 5VCFV FCXQT FKG 'NDG   OKVOGJTGTGP5GIGNUEJKHHGPOOI)CGF*QHHOCPP  5GJTCVVTCMVKXGU'ZGORNCTXQT\ÒINKEJp5VGORGNINCP\



*#4< 

6CWHVCNGTQ,-CVUQWTQUp-P[RJp

*ÒDUEJG2CVKPCUGJTUEJÌPpXQT\ÒINKEJ



564

565

565



5KNDGTPG6CWHOGFCKNNGQ,XQP429CJN6CWHG%JTKUVKKO,QTFCPQDGPFGT0COG,GJQXCUKP9QNMGP <GKNGP5EJTKHVFCTWPVGT5VGTP-P[RJp5NI)QRRGNp *ÒDUEJG2CVKPCUGJTUEJÌPpXQT\ÒINKEJ





6CWHVCNGT4$<GNNGTHGNF/ÒP\OGKUVGT4WFQNH$QTPGOCPP-CVUQWTQU  9KP\5EJTÌVNKPIUHGJNGTUGJTUEJÌP

 105


HENNEBERG

566

567

*'00'$'4))4#(5%*#(6

568

*'00'$'4)



)GOGKPUEJCHVNKEJ U·EJUKUEJGT #PVGKN 4GKEJUVCNGT  +NOGPCW #WUDGWVG FGT )TWDGP KP +NOGPCW   &CX/ÒUGNGTC #VVTCMVKXGU'ZGORNCTOKVJÒDUEJGT2CVKPCXQT\ÒINKEJ 



4GKEJUVCNGT+NOGPCW#WUDGWVGFGT)TWDGPKP+NOGPCW&CX/ÒUGNGT  (GKPG2CVKPCYKP\2TQDKGTURWTCO4CPFUGJTUEJÌP





4GKEJUVCNGT+NOGPCW#WUDGWVGFGT)TWDGPKP+NOGPCW&CX/ÒUGNGT  5GJTCVVTCMVKXGU'ZGORNCTOKVJGTTNKEJGT2CVKPCXQT\ÒINKEJ



570

569

571



4GKEJUVCNGT+NOGPCW#WUDGWVGFGT)TWDGPKP+NOGPCW&CX/ÒUGNGT  5GJTUEJÌPpXQT\ÒINKEJ





4GKEJUVCNGT+NOGPCW#WUDGWVGFGT)TWDGPKP+NOGPCW&CX/ÒUGNGTD 8QT\ÒINKEJ





4GKEJUVCNGT+NOGPCW#WUDGWVGFGT)TWDGPKP+NOGPCW&CX/ÒUGNGTF  44(GKPG2CVKPCCVVTCMVKXGUXQT\ÒINKEJGU'ZGORNCT



106


HESSEN

573 2:1 572

#$6'+ 

*'45('.&

,QJCPP +  $TCMVGCV  I #DV UVGJV X X OKV -TWOOUVCD WPF -TGW\ WPVGT &TGKDQIGP   \WFGP5GKVGPLGGKP6WTO$GTIGTp5NI$QPJQHH5NI*QJGPUVCWHGP\GKV5NI.ÌDDGEMGp 44*ÒDUEJG2CVKPC4CPFCWUDTÒEJGHCUVXQT\ÒINKEJ

&GT XQTNKGIGPFG 6[R VCWEJVG GTUVOCNU KO (WPF XQP -NGKPXCEJ 0T   CWH $GK FGT 7OUEJTKHV 80#+8%+%   +++'0%+#+8 UEJGKPVGUUKEJPWTWOGKPGUKPPNQUG#PGKPCPFGTTGKJWPIXQP$WEJUVCDGP\WJCPFGNP



*'55'0 *'55'0/#4$74).#0&)4#(5%*#(6 

.WFYKI+8'KPUGKVKIGT*GNNGT 5EJÒUUGNJGNNGTTJGKPKUEJGT2HGPPKI Q,  )NCFGP DCEJ5EJÒV\ 445GJTUEJÌP

'ZGORNCTFGT#WMVKQP(TKV\4WFQNH-ÒPMGT1UPCDTÒEM0T





&KG *GNNGT YWTFGP KO ,CJT  PCEJ FGO /ÒP\TG\GUU FGT XKGT 4JGKPKUEJGP -WTHÒTUVGP IGRT·IV 5KG JCVVGP (QTO   WPF#WUUGJGPFGTTJGKPKUEJGP2HGPPKIGYCTGPPWTGVYCUMNGKPGT.WFYKIYWTFGIGVCFGNVWPFFC\WCPIGJCNVGPFKG 2T·IWPIGKP\WUVGNNGPQFGTFKGJGTIGDTCEJVG*GNNGTHQTOYKGFGTCP\WPGJOGP 

574



4GKEJUVCNGT/CTDWTI5EJÒV\

576

575

445GJTUEJÌP



*'55'0-#55'..#0&)4#(5%*#(65'+6-74(ª456'067/ 

9KNJGNO8CNU#FOKPKUVTCVQTHÒTFKG#DVGK*GTUHGNF4GKEJUVCNGT-CUUGNI )GMTÌPVGU \YGKHGNFKIGU 9CRRGP 2CVTKCTEJGPMTGW\IGMTÌPVGT WPF IGUVTGKHVGT .ÌYG  CWH (ÒT   UVGPOCPVGNQDGP-TWOOUVCDWPF/KVTC#WU9QNMGPMQOOGPFG*CPFOKVCWUIGUVTGEMVGO<GKIGWPF /KVVGNHKPIGTKPFGT*CPFHN·EJG)QVVGUCWIG5EJÒV\ 445GJTUEJÌP 



9KNJGNO8+4GKEJUVCNGT-CUUGNI)GJCTPKUEJVGU$TWUVDKNFTOKVWOIGNGI VGO /CPVGN)GMTÌPVGU UGEJUHGNFKIGU 9CRRGP OKV /KVVGNUEJKNF \YKUEJGP 2CNO\YGKIGP &CX    5EJÒV\ 44#VVTCMVKXGU'ZGORNCTUGJTUEJÌPpXQT\ÒINKEJ  9GKVGTG JGUUKUEJG 2T·IWPIGP CWU FGT 5COONWPI FGT (TGKJGTTGP $QPFG HKPFGP 5KG KP -CVCNQI    WPVGT0TWPF 

107


HESSEN

577

578

580

579



9KNJGNO+: +   -QPX6CNGT*CPCW#WUDGWVGFGT$KGDGTGT)TWDGP &CX/ÒUGNGTC5EJÒV\  5GNVGPKPFKGUGT'TJCNVWPI2TCEJVGZGORNCT8QT\ÒINKEJp5VGORGNINCP\ 



9KNJGNO+6CNGT#-5&CX-CJPV6JWP  5GJTUGNVGPKPFKGUGT'TJCNVWPI(CUV5VGORGNINCP\



9KNJGNO++6CNGT#-5&CX-CJPV6JWP



9KNJGNO++WPF(TKGFTKEJ9KNJGNO8GTGKPUFQRRGNVCNGT#-5&CX-CJPV 6JWP 5GNVGPKPFKGUGT'TJCNVWPI'TUVCDUEJNCIYKP\-TCV\GTXQT\ÒINKEJp5VGORGNINCP\

5GJTUEJÌP

  

582

581



(TKGFTKEJ9KNJGNO6CNGT#-5&CX-CJPV6JWP  5GNVGPGT,CJTICPI8QT\ÒINKEJ





8GTGKPUVCNGT#-5&CX-CJPV6JWP



583

8QT\ÒINKEJ

584

*'55'0&#4/56#&6.#0&)4#(5%*#(65'+6)4155*'4<1)67/ 

.WFYKI+-QPX6CNGT#-5&CX-CJPV6JWP  2TCEJVGZGORNCTOKVHGKPGT6ÌPWPI8QT\ÒINKEJp5VGORGNINCP\





.WFYKI++-TQPGPVCNGT#-5&CX-CJPV6JWP



108

8QT\ÒINKEJ


HILDESHEIM

586

585

587



8GTGKPUFQRRGNVCNGT#-5&CX-CJPV6JWP  'TUVCDUEJNCIHGKPG2CVKPCXQT\ÒINKEJp5VGORGNINCP\





.WFYKI+++)WNFGP2TGUUGHTGKJGKV+P752NCUVKMJQNFGTFGT0)%OKVFGT$GYGTVWPI /5#-5, &WPMNG2CVKPCXQT\ÒINKEJ



*'55'0*1/$74).#0&)4#(5%*#(6 

2JKNKRR#WIWUV(TKGFTKEJ&QRRGNIWNFGP#-5&CX-CJPV6JWP 45GJTUEJÌP



.16 

*GUUGP-CUUGN(TKGFTKEJ9KNJGNO8GTGKPUVCNGT*GUUGP&CTOUVCFV.WFYKI+++8GTGKPUFQRRGN VCNGT*GUUGP*QODWTI.WFYKI+++8GTGKPUVCNGT6JWP  5VÒEM9KP\4CPFHGJNGTXQT\ÒINKEJ



9GKVGTGJGUUKUEJG2T·IWPIGPCWUFGO5EJCV\HWPFXQP*GTDQTPHKPFGP5KGWPVGTFGP0TP 

590

ex 589

$+567/ 



ex 589

*+.&'5*'+/

5GFKUXCMCP\5KNDGTOGFCKNNGXQP229GTPGT-CTNFGT)TQ­GUVGJVHCUVXXOKV5EJYGTV WPF 4GKEJUCRHGN PGDGP FGO TGEJVGP (W­ FGU -CKUGTU FKG 5KIPCVWT FGU 5VGORGNUEJPGKFGTU WOJGT   9CRRGPMTCP\.WFYKIFGT(TQOOGUVGJVHCUVXXKPFGT4GEJVGPFCU/QFGNNFGT5VKHVUMKTEJGKPFGT .KPMGP GKP <GRVGT WOJGT 9CRRGPMTCP\  OO  I /GJN  D <GRGTPKEM  FQTV OKV   5KIPCVWT &C\W *KNFGUJGKO 5GFKUXCMCP\  5KNDGTOGFCKNNG  /GJN  <GRGTPKEM    /ÒPUVGT5GFKUXCMCP\5KNDGTOGFCKNNG5EJWN\G5QOOGT#<GRGTPKEM  5VÒEM*ÒDUEJG2CVKPCXQT\ÒINKEJ



/CTKGPITQUEJGP$WEM$CJTHD



56#&6

45GJTUEJÌP

109


HOHNSTEIN

591



5KNDGTOGFCKNNGWPUKIPKGTVCWHFKG,CJTHGKGTFGT4GHQTOCVKQP,WPIHTCWUVGJVXXOKV-TCP\ WPF(CEMGNNCWHGKPGO#NVCTNKGIVGKPQHHGPGU$WEJKO*KPVGTITWPFFKG5VCFVCPUKEJVXQP*KNFGUJGKO QDGP FGT UVTCJNGPFG 0COG ,GJQXCU5GIGNPFGT &TGKOCUVGT T  OO  I $WEM$CJTH    5NI9JKVKPINGKEJVXCT FQTVQJPG(GFGTPCWHFGO-QRH   4*GTTNKEJG2CVKPCMN2T·IGUEJY·EJGXQT\ÒINKEJ 'ZGORNCTFGT#WMVKQP(TKV\4WFQNH-ÒPMGT$GTNKP0T

592

593



594

*1*'0<1..'40 *1*'0<1..'40*'%*+0)'0(ª456'067/ 

(TKGFTKEJ 9KNJGNO %QPUVCPVKP  8GTGKPUFQRRGNVCNGT  #-5  &CX  -CJPV    6JWP 48QT\ÒINKEJ 



%CTN8GTGKPUFQRRGNVCNGT#-5&CX-CJPV6JWP  5GJTUEJÌPXQT\ÒINKEJ





8GTGKPUFQRRGNVCNGT#-5&CX-CJPV6JWP



*1*'0<1..'405+)/#4+0)'0(ª456'067/ 5GJTUEJÌPUGJTUEJÌPpXQT\ÒINKEJ

595

)4#(5%*#(6 

110

*1*056'+0

'NIGT+++$TCMVGCVPCEJ0QTFJ·WUGT5EJNCI+NHGNFI&[PCUVGPRCCTUKV\V XXCWHGKPGT$CPMFKGNKPMG(KIWTGTJGDVFKGNKPMG*CPFFKGTGEJVG(KIWTJ·NVKPFGTTGEJVGP*CPFGKP .KNKGP\GRVGTKPFGT/KVVG&QRRGNDQIGPOKV\YGK6ÒTOGP$GTIGT5EJWNVGP  5GJTUEJÌPpXQT\ÒINKEJ




JEVER

597

596



8QNMOCT9QNHICPI4GKEJUVCNGT'NNTKEJ#WUDGWVGFGT)TWDG5V#PFTGCU&CX /ÒUGNGTD5EJWNVGPD 5GJTUEJÌP





4GKEJUVCNGT'NNTKEJ#WUDGWVGFGT)TWDG5V#PFTGCU&CX/ÒUGNGTC5EJWNVGPC *ÒDUEJG2CVKPCUGJTUEJÌP



598

*'445%*#(6

599

,'8'4



%CTN9KNJGNOXQP#PJCNV<GTDUV4GKEJUVCNGT,GXGT/CPPEXCT/GT\FQTHXCT 4(CUVXQT\ÒINKEJ



(TKGFTKEJ #WIWUV XQP #PJCNV<GTDUV   -QPX6CNGT  *CT\IGTQFG /CPP    /GT\FQTH 44-N4CPFHGJNGTXQT\ÒINKEJ 



0CEJPGWGUVGP7PVGTUWEJWPIGPXQP,*GEMNUKPFFKG/ÒP\GPHÒT,GXGTPKEJVKP5KNDGTJÒVVGUQPFGTPKP*CT\IGTQFG IGRT·IVYQTFGP

601

600



600

(TKGFGTKMG #WIWUVG 5QRJKG XQP #PJCNV<GTDUV  4GKEJUVCNGT RTGW­  5KNDGTJÒVVG   )GMTÌPVGT&QRRGNCFNGTOKV<GRVGTWPF4GKEJUCRHGNKPFGP(·PIGPCWHFGT$TWUV.ÌYGPUEJKNFQDGP-TQPG 9GTV WPF ,CJTGU\CJN KP XKGT <GKNGP WOJGT .QTDGGT\YGKIG +P 752NCUVKMJQNFGT FGT 2%)5 OKV FGT   $GYGTVWPI/5&CX/CPP/GT\FQTH  5GJTUGNVGPKPFKGUGT'TJCNVWPI0WT'ZGORNCTGIGRT·IV-CDKPGVVUVÒEM 2TCEJVXQNNG2CVKPCHCUV5VGORGNINCP\  'TUV  YWTFG CWH FGT 5KNDGTJÒVVG DGK *CT\IGTQFG HÒT #PJCNV$GTPDWTI GKPG /ÒP\UV·VVG GTTKEJVGV *KGT NKG­ (TKG   FGTKMG #WIWUVG 5QRJKG XQP #PJCNV<GTDUV #FOKPKUVTCVQTKP HÒT <CT 2CWN + XQP 4W­NCPF FKG /ÒP\GP HÒT ,GXGT   RT·IGPFCKP<GTDUVMGKPG/ÒP\UV·VVGOGJT\WT8GTHÒIWPIUVCPF



4GKEJUVCNGTRTGW­5KNDGTJÒVVG&CX/CPP/GT\FQTH  0WT'ZGORNCTGIGRT·IV8QT\ÒINKEJ

 111


KAUFBEUREN

603



602

604

 4GKEJUVCNGT RTGW­  5KNDGTJÒVVG +P 752NCUVKMJQNFGT FGT 2%)5 OKV FGT $GYGTVWPI /5    /CPP/GT\FQTH  5GJTUGNVGPKPFKGUGT'TJCNVWPI0WT'ZGORNCTGIGRT·IV2TCEJVGZGORNCT *GTTNKEJG2CVKPCHCUV5VGORGNINCP\ 

,ª.+%*-.'8'$'4) $'4)*'4<1)67/5'+6)4155*'4<1)67/ 

/CZKOKNKCP,QUGRJXQP$C[GTP6CNGT.CPFOÒP\G#-5&CX-CJPV 6JWP 5GJTUEJÌPpXQT\ÒINKEJ





,QCEJKO/WTCV6CNGT.CPFOÒP\G#-5&CX-CJPV6JWP  9KP\5EJTÌVNKPIUHGJNGTUGJTUEJÌP



0CRQN¾QP + ICD FCU *GT\QIVWO $GTI CP UGKPGP 5EJYCIGT WPF /CTUEJCNN ,QCEJKO /WTCV YGKVGT FGT CWEJ FGP   TGEJVUTJGKPKUEJGP 6GKN XQP -NGXG GTJKGNV $GKO #DUEJNW­ FGT 4JGKPDWPFCMVG D\Y MWT\G <GKV UR·VGT GTJKGNV /WTCV   PQEJ FKG 5VCFV &GWV\ FKG )TCHUEJCHVGP 5C[P 0CUUCW5KGIGP WPF *CFCOCT FKG #DVGKGP 'UUGP WPF 'NVGP )NGKEJ   \GKVKI YWTFG GT \WO )TQ­JGT\QI OKV FGT #PTGFG -ÌPKINKEJG *QJGKV GTJQDGP YCU UGKPGT 'KVGNMGKV UEJOGKEJGNVG    YWTFG $GTI WO /CTM &QTVOWPF 6GEMNGPDWTI .KPIGP WPF 6GKNG XQP /ÒPUVGT CTTQPFKGTV +O UGNDGP ,CJT   YWTFG ,QCEJKO /WTCV CDGT CNU -ÌPKI XQP 0GCRGN PCEJ 5ÒFKVCNKGP XGTUGV\V WPF 0CRQN¾QP + ÒDGTPCJO FCU )TQ­   JGT\QIVWO UGNDUV &KG /ÒP\RT·IWPI KP &ÒUUGNFQTH NKGH Y·JTGPF UGKPGT 4GIKGTWPI KP FGP XQTIG\GKEJPGVGP $CJPGP   YGKVGT

605

606

56#&6 

 112

606

-#7($'74'0

5KNDGTIW­OGFCKNNGWPUKIPKGTVXQP*CPU-GNUCWHFGP-CWHDGWTGT$ÒTIGT)GQTI*GTOCPP  -CWHDGWTGP Ó -CWHDGWTGP $TWUVDKNF *GTOCPPU N OKV WOIGNGIVGO /CPVGN#O $QFGP NKGIGPFG   4ÒUVWPI FCTCWH N (COKNKGPYCRRGP *GTOCPP OKV 5VGTP WPF *CNDOQPF T *GNO  OO  I   *CDKEJ+ 5R·VGTGT)W­5GJTUEJÌP



6CNGTOKV6KVGN-CTNU8&CX0CW  4#VVTCMVKXGU'ZGORNCTOKVUEJÌPGT2CVKPCUGJTUEJÌP




KÖLN

608

609

607

607

-'/26'0

56#&6 

6CNGTOKV6KVGN-CTNU8&CX*CGTVNGXCT

5GJTUEJÌPpXQT\ÒINKEJ

-¤.0

'4<$+567/ 

9KNJGNOXQP)GPPGR&QRRGNUEJKNNKPIQ, WO $QPP0QUUHH



&QRRGNUEJKNNKPIQ, WO $QPP0QUUD

610



611

 445GJTUEJÌP



45GJTUEJÌP



612

613



&QRRGNUEJKNNKPIQ, WO $QPP0QUUD

445GJTUEJÌP





#FQNH+++XQP5EJCWGPDWTI6CNGT&GWV\&CX0QUU  -N-QTTQUKQPUUVGNNGPMN-TCV\GTUGJTUEJÌP





/CZKOKNKCP(TKGFTKEJXQP-ÌPKIUGII-QPX6CNGT&CX0QUU  45EJTÌVNKPIUHGJNGTUGJTUEJÌPpXQT\ÒINKEJ



56#&6 

)TQUEJGPQ,0QUU

5EJÌPG2CVKPCUGJTUEJÌPpXQT\ÒINKEJ

 113


LIPPE

614

616

615



4GKEJUVCNGTOKV6KVGN/CZKOKNKCPU++&CX0QUUCD  #VVTCMVKXGU'ZGORNCTOKVJÒDUEJGT2CVKPCUGJTUEJÌPpXQT\ÒINKEJ





6CNGT -TGW\GT XQP¤VVKPIGP#NDGTV'TPUVOKV)GIGPUVGORGNFGT5VCFV-ÌNP CWHFGT8QTFGTUGKVG5EJTKHV\WI&CX QJPG)GIGPUVGORGN .ÌHHGNJQN\ QJPG)GIGPUVGORGN   44)GIGPUVGORGNUGJTUEJÌP/ÒP\GUEJÌPpUGJTUEJÌP



-1056#0<

56#&6 

4GKEJUVCNGTOKV6KVGN(GTFKPCPFU++&CX0CW

5GJTUEJÌPpXQT\ÒINKEJ



617

618

619

.+22' )4#(5%*#(65'+6(ª456'067/ 

$GTPJCTF+++2HGPPKIQ,I*'04+%854':)GMTÌPVG$ÒUVGFGU-ÌPKIUXXOKV <GRVGT.10&' %+8+6#5 <YKNNKPIUHCFGPMTGW\ KP FGP 9KPMGNP LG GKP -TGW\ +JN .GOIQ XIN   5p -N2T·IGUEJY·EJGCO4CPFUGJTUEJÌPpXQT\ÒINKEJ



'U JCPFGNV UKEJ WO FKG YGUVH·NKUEJG 0CEJCJOWPI 0QTVJ , , 'PINKUJ *COOGTGF %QKPCIG 8QNWOG + .QPFQP    5   GKPGU 2GPP[ XQO 5JQTV ETQUU V[RG CWU FGT 4GIKGTWPIU\GKV XQP -ÌPKI *GPT[ +++     2$GTIJCWUXGTOWVGVGGKPG2T·IWPIFGT'FGNJGTTGP\WT.KRRGXQT $GTIJCWU29GUVH·NKUEJG/ÒP\IGUEJKEJVG FGU /KVVGNCNVGTU /ÒPUVGT  5   * +JN DGOGTMV FCUU GKPG 2T·IWPI KP .GOIQ CWHITWPF FGT UVKNKUVKUEJGP   JPNKEJMGKV YGPKIUVGPU GKPGU 'ZGORNCTU OÌINKEJ KUV +JN * &KG /ÒP\RT·IWPI FGT 'FGNJGTTGP \WT .KRRG .GOIQ   5 'KP(WPFPCEJYGKUCWUFGTP·JGTGP7OIGDWPIGKPGTNKRRKUEJGP/ÒP\UV·VVGGZKUVKGTVUGKPGU9KUUGPU LGFQEJPKEJVYGUJCNDFKG<WYGKUWPIPKEJV\YGKHGNUHTGKIGUKEJGTVKUV



(TKGFTKEJ#FQNH6CNGT&GVOQNF)TQVGp



5KOQP#WIWUV6CNGT&GVOQNF)TQVGD

114

44(CUVUGJTUEJÌP



8QT\ÒINKEJp5VGORGNINCP\




LÜNEBURG

620

.ª$'%-

56#&6 

)WNFKPGT  OKV 6KVGN -CTNU 8 WPF CNVGT )TCXWT CWH FGT 4ÒEMUGKVG 2.75 7.64# +)0     I$GJTGPUC&CX 8QPITQ­GT5GNVGPJGKV*GPMGNURWTUGJTUEJÌP  &GT1TV.KWDKEGYWTFGGTUVOCNUWPVGTFGOEJTKUVNKEJGP9GPFGPHÒTUV)QVVUEJCNM Ó GTY·JPV0CEJOGJTHC EJGT 8GTYÒUVWPI WPF FGO 9KGFGTCWHDCW \W #PHCPI FGU  ,CJTJWPFGTVU XGTNKGJ *GKPTKEJ FGT .ÌYG  .ÒDGEM   FKGUV·FVKUEJGP4GEJVGYWTFGFGT$KUEJQHUUKV\XQP1NFGPDWTIPCEJ.ÒDGEMXGTNGIV(TKGFTKEJ++GTJQD.ÒDGEM KO,CJT\WT4GKEJUUVCFV.ÒDGEMYWEJUUEJPGNNYWTFGDCNF\WO8QTQTVFGTUKEJDKNFGPFGP*CPUGWPFFCOKV\W GKPGT FGT DGFGWVGPFUVGP 5V·FVG 0QTFFGWVUEJNCPFU 9CT KO UR·VGP /KVVGNCNVGT FGT &QRRGNUEJKNNKPI  /CTM  FCU   JÌEJUVG5KNDGTPQOKPCNFGU9GPFKUEJGP/ÒP\XGTGKPUUQRT·IVG.ÒDGEMOKVGKPGT/CTMFGPGTUVGP)WNFGP ITQUEJGP 0QTFFGWVUEJNCPFU 'KP /ÒP\V[R FGT DCNF XQO 6CNGT CDIGNÌUV YGTFGP UQNNVG $GK WPUGTGO )WNFKPGT   PCEJ/C­ICDGFGU'UUNKPIGT/ÒP\CDUEJKGFUXQPIGRT·IVJCPFGNVGUUKEJWOGKPGFGTUGNVGPUVGP/ÒP\GP FGTPQTFFGWVUEJGP4GPCKUUCPEG

621

623

622

624

622



6CNGT  OKV #D\GKEJGP FGU $ÒTIGTOGKUVGTU )QVVJCTF XQP *ÌXGNP WPF #PVQP XQP 5VKVGP   $GJTGPUCD&CX (GKPG2CVKPCUGJTUEJÌP





/CTM$GJTGPUD





4GKEJUVCNGT 5EJKNNKPI OKV6KVGN4WFQNHU++WPFFGO#D\GKEJGPFGU$ÒTIGTOGKUVGTU#NGZCPFGT .ÒPGDWTI$GJTGPUDXCT&CXp XIN  W­GTUVUGNVGPGT,CJTICPI5GJTUEJÌP

56#&6 

6CNGT&CX5EJPGG

8QPITQ­GT5GNVGPJGKV5EJTÌVNKPIUTKUUGUGJTUEJÌP



.ª0'$74) *ÒDUEJG2CVKPCUGJTUEJÌP

 115


MAGDEBURG

625

627

626



6CNGT&CX5EJPGG

5EJÌPG2CVKPCUGJTUEJÌP





&QRRGNVGT4GKEJUVCNGTQ, WO I$CJTHC&CX5EJPGG  4(GKPG2CVKPCHCUVXQT\ÒINKEJ



'4<$+567/ 

/#)&'$74)

#NDTGEJV+8XQP$TCPFGPDWTI)WNFGPITQUEJGP/CIFGDWTI&CXX5EJT 'VYCUMQTTQFKGTVUGJTUEJÌP



629

628



628

&QOMCRKVGN4GKEJUVCNGT&CX#X5EJT  *ÒDUEJG2CVKPCYKP\5EJTÌVNKPIUHGJNGTUGJTUEJÌP



'ZGORNCTFGT#WMVKQP(TKV\4WFQNH-ÒPMGT1UPCDTÒEM0T

 116

4GKEJUVCNGT*CNNGQFGT/CIFGDWTIX5EJT

44(CUVUGJTUEJÌP




MAINZ

631

630



630

#WIWUVXQP5CEJUGP9GKUUGPHGNU4GKEJUVCNGT*CNNG&CXX5EJT  44*ÒDUEJG2CVKPCYKP\*GPMGNURWTUGJTUEJÌP



'ZGORNCTFGT#WMVKQP(TKV\4WFQNH-ÒPMGT1UPCDTÒEM0T

56#&6 

4GKEJUVCNGT )TQUEJGP OKV6KVGN(GTFKPCPFU++&CXX5EJTNGKEJVXCT  #VVTCMVKXGU'ZGORNCTOKVJÒDUEJGT2CVKPCUGJTUEJÌPpXQT\ÒINKEJ



633

632



4GKEJUVCNGTCWHFGP0GWDCWFGT5VCFV&CXX5EJT  44.GKEJVG2T·IGUEJY·EJGUGJTUEJÌP 'KPGP/CIFGDWTIGT*CNDVCNGTCWUFGT5COONWPIFGT(TGKJGTTGP$QPFGHKPFGP5KGKP-CVCNQI WPVGT0T

'4<$+567/ 

632



/#+0<

'OGTKEJ,QUGRJXQP$TGKVDCEJ$ÒTTGUJGKO 5KNDGTOGFCKNNGXQP#(5VKGNGTCWH FGP &QOJGTTGP %CTN XQP &CNDGTI WPF FCU &QOU·PIGT,WDKN·WO 0GWP <GKNGP 5EJTKHV WOJGT $NW   OGPMTCP\2[TCOKFG OKV FGO 9CRRGPUEJKNF XQP &CNDGTI KP DGTIKIGT .CPFUEJCHV \W FGP 5GKVGP GKP   $CWO WPF GKP MPKGPFGT )GPKWU QDGP UVTCJNGPFGU &TGKGEM KP 9QNMGP  OO  I 2T #NGZ   5NI9CNVJGTp 44#VVTCMVKXGU'ZGORNCTOKVHGKPGT2CVKPCUGJTUEJÌPpXQT\ÒINKEJ 9GKVGTG /CKP\GT 2T·IWPIGP CWU FGT 5COONWPI FGT (TGKJGTTGP $QPFG HKPFGP 5KG KP -CVCNQI    WPVGTFGP0TP



117


MANSFELD

634

/#05('.& /#05('.&)4#(5%*#(6 

)ÒPVJGT +8 'TPUV ++ *Q[GT 8+ )GDJCTF 8++ WPF #NDTGEJV 8++  6CNGT    'KUNGDGPI$GJGNOVGUXKGTHGNFKIGU9CRRGP5V)GQTITGKVGVNWPFVÌVGVFGP&TCEJGPOKVFGO 5EJYGTV&CX6QTPCWH 449KP\5EJTÌVNKPIUHGJNGTCO4CPFUGJTUEJÌP  &GT/CPUHGNFGT6CNGT

635

636

637

/#05('.&$14056'&6)4#(5%*#(6 

$TWPQ ++ 9KNJGNO + ,QJCPP )GQTI +8 WPF 8QNTCV 8+  4GKEJUVCNGT  'KUNGDGP   &CX6QTPCWDNGKEJVXCT 5EJÌPG2CVKPCUGJTUEJÌPpXQT\ÒINKEJ



'KPGP /CPUHGNFGT *CNDVCNGT  CWU FGT 5COONWPI FGT (TGKJGTTGP $QPFG HKPFGP 5KG KP -CVCNQI    WPVGT0T 

/#05('.&'+5.'$'0)4#(5%*#(6 

,QJCPP)GQTI+2GVGT'TPUV+WPF,QJCPP*Q[GT+++4GKEJUVCNGT'KUNGDGPOKV 6KVGN/CZKOKNKCPU++&CX6QTPCWN -N4CPFHGJNGTUGJTUEJÌPpXQT\ÒINKEJ



/#05('.&(4+'&'$74))4#(5%*#(6  118

2GVGT 'TPUV + $TWPQ ++ )GDJCTF 8+++ WPF ,QJCPP )GQTI +8  4GKEJUVCNGT    'KUNGDGP&CX6QTPCWF *GPMGNURWTUGJTUEJÌP




MECKLENBURG

638



640

4GKEJUVCNGT'KUNGDGP&CX6QTPCWE

639

5GJTUEJÌP



/#05('.&#46'40)4#(5%*#(6 

8QNTCV8+9QNHICPI+++WPF,QJCPP)GQTI++4GKEJUVCNGT'KUNGDGP&CX 6QTPCWGNGKEJVXCT 5GJTUEJÌP



/#05('.&*+06'4146+5%*'.+0+')4#(5%*#(6 

&CXKF4GKEJUVCNGT'KUNGDGP<YKVVGTRT·IWPI&CX6QTPCWD  44.GKEJVG-QTTQUKQPUpWPF)N·VVWPIUURWTGPUGJTUEJÌP



642

641

641



%JTKUVKCP(TKGFTKEJ&QRRGNVGT4GKEJUVCNGT'KUNGDGPI5V)GQTITGKVGVNWPF VÌVGVFGP&TCEJGPOKVFGO5EJYGTV$GJGNOVGUXKGTHGNFKIGU9CRRGP\WFGP5GKVGPFKGIGVGKNVG,CJTGU \CJN&CX6QTPCW  8QPITQ­GT5GNVGPJGKV#VVTCMVKXGU'ZGORNCTOKVJÒDUEJGT2CVKPCUGJTUEJÌPpXQT\ÒINKEJ



/'%-.'0$74) /'%-.'0$74)(ª456'067/5'+6*'4<1)67/ 

#NDTGEJV8++&QRRGNUEJKNNKPI)ÒUVTQY-WP\GN#H

445GJTUEJÌP



'ZGORNCTFGT#WMVKQP(TKV\4WFQNH-ÒPMGT1UPCDTÒEM0T

119


MECKLENBURG

643

644



6CNGT .GKEJVGT)WNFGP )CFGDWUEJ-WP\GN#C FQTVCNU)WNFGPDG\GKEJPGV   45GJTUEJÌP





,QJCPP#NDTGEJV+CDKP5EJYGTKP6CNGT)CFGDWUEJ&CX-WP\GN*C 5GJTUEJÌP



645



646

6CNGT)CFGDWUEJ&CX-WP\GN)C

5GJTUEJÌP



/'%-.'0$74))ª56419*'4<1)67/ 

7NTKEJ+++4GKEJUVCNGT 5EJKNNKPI2HGPPKI )TGXGUOÒJNGPOKV6KVGN/CZKOKNK CPU++&CX-WP\GN#D #VVTCMVKXGUUGJTUEJÌPGU'ZGORNCT



5GKVFGT/KVVGFGU,CJTJWPFGTVUJCVVGPUKEJXGTUEJKGFGPG4GKEJUUV·PFGCPIGYÌJPVFGP9GTVFGU6CNGTUD\YFGU 4GKEJUVCNGTU KP -NGKPOÒP\GP KO CDIGDKNFGVGP 4GKEJUCRHGN CP\WIGDGP 5GKV   #WIUDWTIGT 4GKEJUOÒP\QTF   PWPI  YCT GU UQICT XQTIGUEJTKGDGP +P 5ÒFFGWVUEJNCPF GTHQNIVG FKG #PICDG KP -TGW\GTP KP /KVVGNFGWVUEJNCPF KP   )TQUEJGP KP 6GKNGP 0QTFFGWVUEJNCPFU KP 5EJKNNKPIGP UQ CWEJ KP /GEMNGPDWTI #WH FGO XQTNKGIGPFGP 6CNGT HKPFGV   OCP KO 4GKEJUCRHGN FGP 9GTV  F J  5EJKNNKPI NÒDKUEJ  2HGPPKIG &KGU KUV FKG CNVG $GYGTVWPI FGU 6CNGTU  

UGKV4GKEJUVCNGT &KGUG4GNCVKQPYCTCDGTDGTGKVUÒDGTJQNVYKGCWUGKPGO$GTKEJV*GT\QI7NTKEJUCPFGP 2TQDCVKQPUVCI JGTXQTIGJV &CJGT YWTFG  FGT 4GKEJUVCNGT CWH  5EJKNNKPI  /CTM NÒDKUEJ  HGUVIGUGV\V &CTCWU   N·­VUKEJUEJNKG­GPFC­CNNG6CNGTOKVFKGUGT9GTV\CJNKO4GKEJUCRHGNQFGTUR·VGTIGRT·IVYQTFGPUKPF

648 647



4GKEJUVCNGT)TGXGUOÒJNGP&CX-WP\GN#D

647

5GJTUEJÌP



/'%-.'0$74)5%*9'4+0*'4<1)67/5'+6 )4155*'4<1)67/ 

%JTKUVKCP+.WFYKI1XCNGXGTIQNFGVG5KNDGTOGFCKNNGQ,  XQP,4GVGEMGCWHFGP 'KP\WI FGU *GT\QIU KP 4QUVQEM WPF CWH FKG *WNFKIWPI FGT 5VCFV )GJCTPKUEJVGU $TWUVDKNF T OKV   WOIGNGIVGO /CPVGN'KPG 5QPPGPDNWOG FGTGP $NÒVG $NKV\GP 5VWTO WPF 4GIGP CWUIGUGV\V KUV   ZOOI-WP\GN5NI)CGVVGPU FKGUGU'ZGORNCT   8QPITQ­GT5GNVGPJGKV)GRT·IVGU1TKIKPCN#NVXGTIQNFGVUGJTUEJÌP  'ZGORNCTFGT5COONWPI2QRMGP#WMVKQP(TKV\4WFQNH-ÒPMGT1UPCDTÒEM0T



&KGXQTNKGIGPFG/GFCKNNGJCVFGT*GT\QIRT·IGPNCUUGPWOUKGGKP\GNPGP/KVINKGFGTPFGU5VCFVTCVGUCNU)PC FGPRHGPPKI \W XGTNGKJGP &KG /GFCKNNG KUV CNU IGRT·IVGU 1TKIKPCN XQP ITÌ­VGT 5GNVGPJGKV CNU 0CEJIW­ MQOOV UKG   IGNGIGPVNKEJXQT 

120


MECKLENBURG

649



  

651

650

652

%JTKUVKCP .WFYKI ++  5KNDGTOGFCKNNG  XQP 2 #CTQP CWH FKG 8GTNGKJWPI FGU TWUUK   UEJGP 5V #PFTGCUQTFGPU )GJCTPKUEJVGU $TWUVDKNF N OKV 1TFGPUUVGTP 1TFGPUDCPF WPF WOIGNGIVGO   /CPVGN)GMTÌPVGU UGEJUHGNFKIGU 9CRRGP OKV /KVVGNUEJKNF WOJGT FKG -GVVGP FGU F·PKUEJGP 'NGHCP   VGPQTFGPU WPF FGU TWUUKUEJGP 5V #PFTGCUQTFGPU QDGP FKG IGVGKNVG ,CJTGU\CJN  OO  I   -WP\GN 445GJTUEJÌP  (TKGFTKEJ(TCP\+6CNGT#-5, 8QT\ÒINKEJ  6CNGT#-5,C /KP5EJTÌVNKPIUHGJNGTXQT\ÒINKEJ  2CWN(TKGFTKEJ5KNDGTOGFCKNNGXQP,,$CTTGCWHFKG8GTO·JNWPIUGKPGT5EJYGUVGT *GNGPGOKV*GT\QI(GTFKPCPFXQP1TN¾CPUIGYKFOGVXQPFGT5VCFV2CTKU$GKFGT$ÒUVGPPGDGPGKPCPFGT N&KG5VCFVIÌVVKPXQP2CTKUUKV\VXXCP9CRRGPUEJKNFIGNGJPVWPFFGWVGVCWHGKPGPNXQPKJTUVGJGP FGPXGT\KGTVGP#NVCTOOI5NI)CGVVGPU FQTVKP$TQP\G  8QT\ÒINKEJ



653



(TKGFTKEJ(TCP\+88GTUKNDGTVG$TQP\GOGFCKNNGXQP15EJWNV\CWHFKG,CJT HGKGT FGT 9KGFGTGTYGTDWPI 9KUOCTU -ÌRHG XQP (TKGFTKEJ (TCP\ + WPF (TKGFTKEJ (TCP\ +8 PGDGP   GKPCPFGT N5VCFVCPUKEJV XQP 9KUOCT XQP FGT 5GGUGKVG OKV CWUHCJTGPFGO 5EJKHH QDGP 5EJTKHVDCPF   CPFGP'PFGPFKG9CRRGPUEJKNFGXQP/GEMNGPDWTIWPF9KUOCTOO-WP\GN  440WT5VÒEMIGRT·IV+P1TKIKPCNGVWK8QT\ÒINKEJ 9KUOCTIGJÌTVGUGKVFGOL·JTKIGP-TKGI\W5EJYGFGPYWTFGFKG5VCFVCP/GEMNGPDWTIXGTRH·PFGVGTUVKO ,CJTGXGT\KEJVGVG5EJYGFGPGPFIÒNVKIFCTCWH



121


MÜNSTER

654

/+0&'0 &+'$'.#)'470)810/+0&'09*4'0&&'5,*4+)'0-4+')'5 

-NKRRG \W  )TQUEJGP  OKV )GIGPUVGORGN XQP /KPFGP CWH FGT 4ÒEMUGKVG )GMTGW\VG 5EJNÒUUGN   I0QVMNKRRGFGT5VCFV/KPFGPIGRT·IVY·JTGPFFGT$GNCIGTWPIFWTEJ*GT\QI)GQTIXQP$TCWP UEJYGKI.ÒPGDWTIXQO,WNKDKU1MVQDGT$TCWUG/CPUHGNF6H5VCPIG  (CUVUGJTUEJÌP)GIGPUVGORGN5GJTUEJÌP

*GT\QI )GQTI XQP $TCWPUEJYGKI.ÒPGDWTI YCT Y·JTGPF FGU &TGK­KIL·JTKIGP -TKGIGU  CWH FKG 5GKVG FGT   5EJYGFGP ÒDGTIGVTGVGP 5GKP XQTTCPIKIGU <KGN YCT GU FKG 9GUGT XQP MCKUGTNKEJGP 6TWRRGP \W DGHTGKGP   &KG $NQEMCFG /KPFGPU KP FGT 6TWRRGP )GPGTCN 6KNN[ U UVCPFGP DGICPP CO  ,WNK  WPF FCWGTVG DKU \WO   1MVQDGTFGUUGNDGP,CJTGU&KGCPIGDQVGPG0QVOÒP\GUVCOOVCWU\GTUEJNCIGPGO5KNDGTIGUEJKTT

56#&6 

$+567/ 

/ª*.*#75'0+06*ª4+0)'0

6TCIDCTG5KNDGTOGFCKNNGWPUKIPKGTVCWHFCU6JÒTKPIKUEJG$G\KTMUUEJKG­GP$GJGNOVGU9CRRGP 7PKHQTOKGTVGU$TWUVDKNF9KNJGNOU++NOOI&C\W5VWVVICTV5KNDGTOGFCKNNGXQP -5EJYGP\GTCWHFCU&GWVUEJG$WPFGUUEJKG­GPKP5VWVVICTV5NI2GNV\GT  5VÒEM8QT\ÒINKEJ

657



656



658

/ª056'4

(GTFKPCPFXQP$C[GTP4GKEJUVCNGT/ÒPUVGT&CX5EJWN\GCXCT  9KP\2T·IGUEJY·EJGUGJTUEJÌP





%JTKUVQRJ$GTPJCTFXQP)CNGP$TGKVGT4GKEJUVCNGT/ÒPUVGTCWHFKG'KPPCJOGFGT 5VCFV&CX&GVJNGHU%J5EJWN\GH 5GJTUEJÌP





5GFKUXCMCP\5KNDGTOGFCKNNGXQP229GTPGT5V2CWNWUUVGJVHCUVXXOKV5EJYGTVWPF $WEJ \YKUEJGP FGT IGVGKNVGP ,CJTGU\CJN WOJGT 9CRRGPMTCP\-CTN FGT )TQ­G UVGJV X X OKV 5EJYGTV   WPF4GKEJUCRHGNWOJGT9CRRGPMTCP\OOI5EJWN\G<GRGTPKEM  *GTTNKEJG2CVKPCXQT\ÒINKEJGU'ZGORNCT



'ZGORNCTFGT5COONWPI-GPPGRQJN#WMVKQP(TKV\4WFQNH-ÒPMGT1UPCDTÒEM0T

122


MÜNSTER

660

659

659





5GFKUXCMCP\  5KNDGTOGFCKNNG  XQP , 6JKGDCWF 5V 2CWNWU UVGJV HCUVXXOKV5EJYGTVWPF $WEJ WOJGT 9CRRGPMTCP\-CTN FGT )TQ­G UVGJV X X OKV5EJYGTVWPF4GKEJUCRHGNWOJGT9CRRGP MTCP\OOI5EJWN\G<GRGTPKEM 9KP\4CPFHGJNGTXQT\ÒINKEJ 4GKEJUVCNGT#WIUDWTI&CX5EJWN\G<GRGTPKEM  2TCEJVGZGORNCTOKVHGKPGT6ÌPWPI(CUV5VGORGNINCP\

 

662

661





661

5GFKUXCMCP\  5KNDGTOGFCKNNG  XQP & ( QFGT ( 9 .QQU 5V 2CWNWU UVGJV HCUV X X OKV   5EJYGTV WPF $WEJ WOJGT 9CRRGPMTCP\-CTN FGT )TQ­G UVGJV X X OKV 5EJYGTV WPF 4GKEJUCRHGN   WOJGT9CRRGPMTCP\OOI5EJWN\G5QOOGT#<GRGTPKEM  (GKPG2CVKPCXQT\ÒINKEJ



-QPX6CNGT  %NCWUVJCN  I $TWUVDKNF XQP 5V 2CWNWU OKV 5EJYGTV WPF $WEJ X X KP   -CRKVGNUYCRRGP-CTN FGT )TQ­G UVGJV X X OKV 5EJYGTV WPF 4GKEJUCRHGN &CX  5EJWN\G  C   6JWP<GRGTPKEM 440WT'ZGORNCTGIGRT·IV(GKPG2CVKPCOKPLWUVKGTVXQT\ÒINKEJ  123


MÜNSTER

664

663

663



-QPX6CNGT%NCWUVJCN5EJWN\G<GRGTPKEM

8QT\ÒINKEJ





6CNGT%NCWUVJCN5EJWN\G<GRGTPKEM

8QT\ÒINKEJ



665

&'49'56(.+5%*'(4+'&'0810/ª056'470&150#$4ª%- 

/ÒPUVGT 5VCFV 5KNDGTOGFCKNNG  XQP ' -GVVGNGT CWH FGP 9GUVH·NKUEJGP (TKGFGP <YGK 'PIGN   JCNVGPGKP5RTWEJDCPFÒDGTFKG5VCFVCPUKEJVXQP/ÒPUVGT<YGKKPGKPCPFGTITGKHGPFG*·PFGCWU9QNMGP FCJKPVGT\YGK(ÒNNJÌTPGTWPF<YGKICO$QFGPXGTUVTGWVG9CHHGPOOI&GVJ1TF 2CZKP0WOOKU (GKPGT2T·IGINCP\XQT\ÒINKEJ



666



5KNDGTOGFCKNNGXQP'-GVVGNGTCWHFGP9GUVH·NKUEJGP(TKGFGP5VCFVCPUKEJVXQP/ÒPUVGTFCTÒDGT 2CNO WPF .QTDGGT\YGKI IGMTGW\V&TGK 6CWDGP FKG FGP -CKUGT (TCPMTGKEJ WPF 5EJYGFGP   U[ODQNKUKGTGPJCNVGPOKVKJTGP5EJP·DGNPLGGKPGP¤N\YGKIÒDGTGKP-KUUGPCWHFGO-TQPGWPF<GRVGT NKGIGPOOI&GVJ1TF2CZKP0WOOKU 8QT\ÒINKEJ 5GKV #PHCPI  VTCHGP UKEJ )GUCPFVG CNNGT MTKGIUHÒJTGPFGP 2CTVGKGP KP FGP YGUVH·NKUEJGP 5V·FVGP /ÒPUVGT WPF   1UPCDTÒEM \W (TKGFGPUXGTJCPFNWPIGP YQDGK KP 1UPCDTÒEM FGT -CKUGTFKGKPFKGMCVJQNKUEJGPWPFRTQVGUVCPVKUEJGP .CIGT IGJÌTGPFGP 4GKEJUUV·PFG UQYKG 5EJYGFGP WPF KP /ÒPUVGT FGT -CKUGT (TCPMTGKEJ WPF FKG ÒDTKIGP CO -TKGI   DGVGKNKIVGP/·EJVGXGTJCPFGNVGP(TCPMTGKEJWPF5EJYGFGPJCVVGPDGTGKVUDGUEJNQUUGPPWTIGOGKPUCO(TKGFGP \WUEJNKG­GP#WHUEJYGFKUEJGT5GKVGYWTFGPFKG8GTJCPFNWPIGPXQP#FNGT5CNXKWUWPF,QJCP1ZGPUVKGTPC FGT5QJP FGUUEJYGFKUEJGP4GKEJUMCP\NGTU#ZGN1ZGPUVKGTPC IGNGKVGV0CEJFTGKGKPJCND,CJTGPYWTFGFGT9GUVH·NKUEJG(TKGFG GPFNKEJ CO  1MVQDGT  KP /ÒPUVGT WPF 1UPCDTÒEM WPVGT\GKEJPGV 5EJYGFGP GTJKGNV 8QTRQOOGTP OKV FGP   +PUGNP 4ÒIGP 7UGFQO WPF 9QNNKP 6GKNG XQP *KPVGTRQOOGTP 9KUOCT FCU CWU FGO 'T\DKUVWO $TGOGP IGDKNFGVG   *GT\QIVWO $TGOGP WPF 8GTFGP UQYKG GKPG -TKGIUGPVUEJ·FKIWPI XQP  /KNNKQPGP 4GKEJUVCNGTP #O  ,WPK    YWTFGFKGMQPMTGVG7OUGV\WPIFGT(TKGFGPUDGUVKOOWPIGPKO(TKGFGPUGZGMWVKQPUTG\G­XQP0ÒTPDGTIDGUEJNQUUGP

124




NASSAU

668

667

668

0#55#7 

0#55#7&+..'0$74))4#(5%*#(65'+6(ª456'067/ *GKPTKEJ-TGW\GT*GTDQTP+UGPDGEM

(GKPG2CVKPCUGJTUEJÌP



0#55#7*'4<1)67/ 

(TKGFTKEJ9KNJGNO\W9GKNDWTI-QPX6CNGT#-5&CX-CJPV6JWP 5GJTUEJÌPpXQT\ÒINKEJ

670

669



671



-QPX6CNGT#-5&CX-CJPV6JWP  -N5EJTÌVNKPIUHGJNGTXQT\ÒINKEJp5VGORGNINCP\





-QPX6CNGT#-5&CX-CJPV6JWP  /KPLWUVKGTVXQT\ÒINKEJXQT\ÒINKEJp5VGORGNINCP\





9KNJGNO-TQPGPVCNGT#-5&CX-CJPV6JWP  2TCEJVGZGORNCT9KP\5EJTÌVNKPIUHGJNGTXQT\ÒINKEJp5VGORGNINCP\



672

ex 673



-TQPGPVCNGT#-5&CX-CJPV6JWP  5GNVGPKPFKGUGT'TJCNVWPI2QNKGTVG2NCVVGOKPDGTKGDGP





-TQPGPVCNGT#-5&CX-CJPV6JWP  5VÒEM-N4CPFHGJNGTUGJTUEJÌPpXQT\ÒINKEJWPFHCUVXQT\ÒINKEJ

 125


NÖRDLINGEN

675

  

674

676

#FQNRJ5KNDGTOGFCKNNGQ,FGU.CPFYKTVUEJCHVNKEJGP8GTGKPUXQP%JT<QNNOCPP$ÒUVG T)GFGPMUVGKPXQPJTGPWPF9GKPWOTCPMVFCXQT2HNWIOOI+UGPDGEM  4(GKPG2CVKPCXQT\ÒINKEJ &QRRGNVGT8GTGKPUVCNGT#-5&CX-CJPV6JWP 5GJTUEJÌPpXQT\ÒINKEJ &QRRGNVGT8GTGKPUVCNGT#-5&CX-CJPV6JWP 5GJTUEJÌP

  

677



8GTGKPUVCNGT#-5&CX-CJPV6JWP  2TCEJVGZGORNCTOKVHGKPGT6ÌPWPI5VGORGNINCP\



679 678

56#&6 

126

0'755

4GKEJUVCNGT&CX0QUUXCT  5GNVGPKPFKGUGT'TJCNVWPI2TCEJVXQNNG2CVKPCUGJTUEJÌPpXQT\ÒINKEJ

4'+%*5/ª0<5666' 

678



0¤4&.+0)'0

'DGTJCTF XQP 'RRUVGKP-ÌPKIUVGKP  $CV\GP  -TGW\GT   OKV 6KVGN -CTNU 8   *GT\HGNFGTC 8QT\ÒINKEJ




NÜRNBERG

680

4'+%*5/ª0<5666' 







0ª40$'4)

'KPUGKVKIG 5KNDGTIW­OGFCKNNG  WPUKIPKGTV XGTOWVNKEJ XQP /CVVJGU )GDGN CWH FKG 0ÒTPDGTIGT   $ÒTIGTKP$CTDCTC-GV\GN$TWUVDKNFJCNDNOKV*CCTDCPFWPF-GVVGOOI*CDKEJ+ 5NI'TNCPIGTp 5R·VGTGT)W­5GJTUEJÌP

682



014&*#75'0

(TKGFTKEJ ++  $TCMVGCV  I -CKUGTRCCT UKV\V PGDGPGKPCPFGT X X FC\YKUEJGP -TGW\   UVCDFGT-CKUGTJ·NVGKP.KNKGP\GRVGTWPVGPFTGKVÒTOKIGU)GD·WFGOKV6QT$GTIGT$WEJGPCW(F XQP5GGICp5NI$QPJQHH (GKPG2CVKPCXQT\ÒINKEJ

56#&6 

681

684



683

5KNDGTIW­OGFCKNNGWPUKIPKGTVXGTOWVNKEJXQP/CVVJGU)GDGNCWHFGP0ÒTPDGTIGT4CVWPF-CWH OCPP *CPU 0GWMCO  .KPFCW Ó 0ÒTPDGTI $TWUVDKNF 0GWMCOU T OKV ITQ­GO *WV#O   $QFGPNKGIGPFG4ÒUVWPIFCTCWHN*GNOOKVGKPGO-KUUGPCWHFGOUKEJGKP4GIGPDQIGPOKVFTGK5VGT PGPDGHKPFGVT(COKNKGPYCRRGP0GWMCOGDGPHCNNUOKVGKPGO4GIGPDQIGPWPFFTGK5VGTPGPOO I*CDKEJ++OJQHXIN5NI'TNCPIGT 5R·VGTGT)W­5GJTUEJÌP



5KNDGTIW­OGFCKNNG  WPUKIPKGTV XQP /CVVJGU )GDGN CWH FGP 0ÒTPDGTIGT 2CVTK\KGT 1DTKUV WPF   -TKGIUTCV %JTKUVQRJ -TGUU XQP -TGUUGPUVGKP  0ÒTPDGTI Ó 0ÒTPDGTI )GJCTPKUEJVGU $TWUV   DKNF XQP -TGUUGPUVGKPU T#O $QFGP NKGIGPFG 4ÒUVWPI FCTCWH N *GNO OKV GKPGO .ÌYGP FGT GKP   5EJYGTV KO /CWN J·NV T (COKNKGPYCRRGP XQP -TGUUGPUVGKP OKV GKPGO CWHIGTKEJVGVGP 5EJYGTV   OOI*CDKEJ+5NI'TNCPIGTp 5R·VGTGT)W­5GJTUEJÌP



5KNDGTIW­OGFCKNNGWPUKIPKGTVXQP/CVVJGU)GDGNCWHFGP0ÒTPDGTIGT2CVTK\KGT#NGZCPFGT+OJQH

Ó$TWUVDKNF+OJQHUT#O$QFGPNKGIGPFG4ÒUVWPIFCTCWHN(COKNKGPYCRRGP+OJQHOKV GKPGO 5GGNÌYGP T *GNO OKV GKPGO CWHIGTKEJVGVGP 5GGNÌYGP  OO  I *CDKEJ +     +OJQH5NI'TNCPIGTp 5R·VGTGT)W­5GJTUEJÌP

 127


NÜRNBERG

687

686 685







'KPUGKVKIGXGTUKNDGTVG$TQP\GIW­OGFCKNNGQ,WPUKIPKGTVCWHFGP0ÒTPDGTIGT/GKUVGT#NDTGEJV&ÒTGT

 Ó $TWUVDKNF &ÒTGTU N OKV -QRHVWEJ WPF WOIGNGIVGO /CPVGN T /QPQITCOO FGU -ÒPUV   NGTUOO*CDKEJXIN+/GPFG5NI'TNCPIGTp 5R·VGTGT)W­5GJTUEJÌP



'KPUGKVKIG $NGKIW­OGFCKNNG  WPUKIPKGTV CWH FGP 0ÒTPDGTIGT /GKUVGT #NDTGEJV &ÒTGT    Ó $TWUVDKNF &ÒTGTU T OKV WOIGNGIVGO /CPVGN N -TGW\ T /QPQITCOO WPF .GDGPUCNVGT FGU   -ÒPUVNGTUOO*CDKEJp/GPFG5NI'TNCPIGT 5R·VGTGT)W­5GJTUEJÌP



5KNDGTIW­OGFCKNNGWPUKIPKGTVXQP/CVVJGU)GDGNCWHFGP0ÒTPDGTIGT5VGKPWPF5KGIGNUEJPGKFGT 5VGRJCP 5VCKPRGT $TWUVDKNF5VCKPRGTUTOKVWOIGNGIVGO/CPVGN#O$QFGPNKGIGPFG4ÒUVWPI FCTCWH N (COKNKGPYCRRGP 5VCKPRGT OKV GKPGO ÒDGT 5VGKPG NCWHGPFGP $·TGP T *GNO OKV GKPGO   CWHIGTKEJVGVGP$·TGPOOI*CDKEJ+5NI'TNCPIGTp 5R·VGTGT)W­5GJTUEJÌP



688

689



690

689

8GTIQNFGVG 5KNDGTIW­OGFCKNNG  WPUKIPKGTV PCEJ /CVVJGU )GDGN CWH FGP 0ÒTPDGTIGT 5VGKP WPF   5KGIGNUEJPGKFGT 5VGRJCP 5VCKPRGT  $TWUVDKNF 5VCKPRGTU T OKV WOIGNGIVGO /CPVGN#O $QFGP   NKGIGPFG4ÒUVWPIFCTCWHN(COKNKGPYCRRGP5VCKPRGTOKVGKPGOÒDGT5VGKPGNCWHGPFGP$·TGPT*GNO OKVGKPGOCWHIGTKEJVGVGP$·TGPOOI*CDKEJXIN+5NI'TNCPIGTp  5R·VGTGTCNVXGTIQNFGVGT0CEJIW­5GJTUEJÌP



$GKFGOXQTNKGIGPFGP0CEJIW­FGUXQP)GQTI*CDKEJWPVGT0TXGT\GKEJPGVGP1TKIKPCNUUKPFFKG7OUEJTKHVGP FGT8QTFGTWPFFGT4ÒEMUGKVGXGTWPINÒEMV5QKUV\$CWHFGT8QTFGTUGKVGCPUVCVV“6#6+558'#001:::\W NGUGP'4#6+558'#001:::





128

5KNDGTIW­OGFCKNNGWPUKIPKGTVXQP/CVVJGU)GDGNCWHFGP0ÒTPDGTIGT2CVTK\KGT*KGTQP[OWU*QN\ UEJWJGT  0ÒTPDGTI Ó 0ÒTPDGTI $TWUVDKNF *QN\UEJWJGTU T$GJGNOVGU (COKNKGPYCRRGP   *QN\UEJWJGTOOI*CDKEJ+5NI'TNCPIGT FQTVKP$NGK   5R·VGTGT)W­5GJTUEJÌP



5KNDGTIW­OGFCKNNGWPUKIPKGTVXQP*CPU-TCHHVCWHFGP0ÒTPDGTIGT2CVTK\KGT1DTKUVWPF-TKGIU TCV %JTKUVQRJ -TGUU XQP -TGUUGPUVGKP  Ó $TWUVDKNF XQP -TGUUGPUVGKPU T)TCXWT $G   JGNOVGU(COKNKGPYCRRGPXQP-TGUUGPUVGKPOKVGKPGOCWHIGTKEJVGVGP5EJYGTVCWHFGO*GNO.ÌYGOKV 5EJYGTV KO /CWN  OO  I *CDKEJ XIN +   8QTFGTUGKVG  +OJQH XIN   

8QTFGTUGKVG 5NI'TNCPIGTXIN 8QTFGTUGKVG   5R·VGTGT)W­)TCXKGTVGU9CRRGPCWHFGT4ÒEMUGKVGUGJTUEJÌP




NÜRNBERG

692

691



691

$TQP\GIW­OGFCKNNGWPUKIPKGTVXQP/CVVJGU)GDGNCWHFKG0ÒTPDGTIGT2CVTK\KGTVQEJVGT-CVJCTKPC *QN\UEJWJGT  Ó $TWUVDKNF *QN\UEJWJGTU N OKV HNCEJGO *WV8KGT <GKNGP 5EJTKHV KO #D   UEJPKVVFCU'DPGTUEJG(COKNKGPYCRRGPOO*CDKEJ++OJQH  5R·VGTGT)W­5GJTUEJÌP



-CVJCTKPC *QN\UEJWJGT YCT FKG 6QEJVGT FGU /CVVJ·WU 'DPGT WPF UGKPGT )GOCJNKP *GNGPC 5KG XGTO·JNVG UKEJ    OKV.WFYKI*QN\UEJWJGT Ó



8GTIQNFGVG 5KNDGTIW­OGFCKNNG  WPUKIPKGTV XQP /CVVJGU )GDGN CWH FGP 0ÒTPDGTIGT -TKGIU WPF   5VCCVUOCPP9KNJGNO.ÌHHGNJQN\XQP-QNDGTI Ó$TWUVDKNF.ÌHHGNJQN\XQP-QNDGTIUTOKV HNCEJGO *WV WPF WOIGNGIVGO /CPVGN#O $QFGP NKGIGPFG 4ÒUVWPI FCTCWH N *GNO T (COKNKGPYCR   RGPXQP-QNDGTIOOI*CDKEJ++OJQH5NI'TNCPIGTp  5R·VGTGT)W­#NVXGTIQNFGVUGJTUEJÌP

694

693





5KNDGTIW­OGFCKNNG  WPUKIPKGTV PCEJ *CPU $QNUVGTGT CWH FGP 0ÒTPDGTIGT 4CVUUEJTGKDGT 9KNDQNV   )GDJCTV  Ó $TWUVDKNF T OKV WOIGNGIVGO /CPVGN#O $QFGP NKGIGPFG 4ÒUVWPI FCTCWH N   (COKNKGPYCRRGP )GDJCTV OKV \YGK IGMTGW\VGP 5EJYGTVGTP T *GNO FCTCWH (KIWT GDGPHCNNU OKV \YGK   IGMTGW\VGP5EJYGTVGTPOOI*CDKEJ++OJQH5NI'TNCPIGT FQTV KP$NGK  5R·VGTGT)W­KPCNVGO<KGTTGKH#NVXGTIQNFGVUGJTUEJÌP



/QFGTPGU UKNDGTPGU )CNXCPQ Q , OKV FGT ,CJTGU\CJN   WPUKIPKGTV CWH FGP 0ÒTPDGTIGT 5GPCVQT   ,QDUV6GV\GN Ó$TWUVDKNF6GV\GNUTOKVWOIGNGIVGO/CPVGNOOI  <WUCOOGPIGUGV\VGU)CNXCPQ5GJTUEJÌP



695







696

'KPUGKVKIG5KNDGTIW­OGFCKNNGWPUKIPKGTVXQP8CNGPVKP/CNGTCWHFGP0ÒTPDGTIGT4CVUJGTTP,CMQD /WHHGN  Ó $TWUVDKNF /WHHGNU HCUV X X OKV WOIGNGIVGO /CPVGN  OO  I   *CDKEJ++5NI'TNCPIGT FQTVKP$NGK  5R·VGTGT)W­*GPMGNURWTUGJTUEJÌP



'KPUGKVKIG 5KNDGTIW­OGFCKNNG  XQP 8CNGPVKP /CNGT CWH FGP 0ÒTPDGTIGT 5GPCVQT ,QDUV 6GV\GN  

Ó$TWUVDKNF6GV\GNUHCUVXXOKVWOIGNGIVGO/CPVGNOOI*CDKEJ++ 5NI'TNCPIGTp 5R·VGTGT)W­5GJTUEJÌP

 129


NÜRNBERG

698

697





5KNDGTIW­OGFCKNNG  WPUKIPKGTV XQP 8CNGPVKP /CNGT CWH FGP 0ÒTPDGTIGT 5VCFVTCV 2JKNKRR 4ÌOGT   $TWUVDKNF 4ÌOGTU T OKV *CNUMTCWUG$GJGNOVGU (COKNKGPYCRRGP 4ÌOGT  OO  I *CDKEJ   +++OJQH5NI'TNCPIGT 5R·VGTGT)W­5GJTUEJÌP



5KNDGTIW­OGFCKNNGWPUKIPKGTVXQP8CNGPVKP/CNGTCWHFGPKP0ÒTPDGTIIGDQTGPGPKP5VTC­DWTI V·VKIGP $WEJFTWEMGT /CVVJ·WU 5EJ[TGT $TWUVDKNF 5EJ[TGTU T OKV ITQ­GT *CNUMTCWUG WPF WOIGNGIVGO   /CPVGN0CEMVG (QTVWPC OKV 5GIGN UVGJV  X X CWH -WIGN KP /GGT  OO  I *CDKEJ ++    #PO+OJQH5NI'TNCPIGTXIN 5R·VGTGT)W­5GJTUEJÌP



$GK FGO XQTNKGIGPFGP 0CEJIW­ YWTFG FCU CWH FGT QTKIKPCNGP /GFCKNNG \W NGUGPFG 9QTV (+0)+684 KP   ,70)+684XGT·PFGTV&CTCWHYKGUDGTGKVU)GQTI*CDKEJKPFGT#POGTMWPI\W0TJKP

699





5KNDGTOGFCKNNGXQP8CNGPVKP/CNGTCWHFCU'JGINÒEMWPFFCU0GWG,CJT'KP)TGKUUKV\VXXOKV GKPGO-KPFKOTGEJVGP#TOWPFGKPGT$KDGNKPFGTNKPMGP*CPFTPGDGPKJOUVGJVGKPPCEMVGT-PCDG OKV 2CNO\YGKI FCJKPVGT UVGJV GKPG YGKDNKEJG )GUVCNV FKG GKPG -TQPG ÒDGT FGP )TGKU J·NV KP FGT   NKPMGP *CPF GKPGP HNCOOGPFGP 2QMCN <GKNGP 5EJTKHV  OO  I *CDKEJ ++     5NI'TNCPIGT++ 8QT\ÒINKEJGU'ZGORNCTOKVHGKPGT6ÌPWPI



'KPUGKVKIG5KNDGTIW­OGFCKNNGWPUKIPKGTVXQP,QJCPP2JKNKRRXQPFGT2ÒVVCWHFGPPÒTPDGTIKUEJGP 2HNGIGT\W#NVFQTH2CWN2CWOICTVPGTÓ$TWUVDKNF2CWOICTVPGTUHCUVXXOKVITQ­GT*CNUMTCWUG OOI*CDKEJXIN++5NI'TNCPIGTp 5R·VGTGT)W­5GJTUEJÌP



701





130

700

702

5KNDGTIW­OGFCKNNG  WPUKIPKGTV XQP /CVVJ·WU %CTN CWH FGP 0ÒTPDGTIGT -CWHOCPP *GKPTKEJ   /ÒNGII $TWUVDKNF/ÒNGIIUHCUVXXOKVITQ­GT*CNUMTCWUGWPFWOIGNGIVGO/CPVGN$GJGNOVGU (COKNKGPYCRRGP /ÒNGII \W FGP 5GKVGP FKG (COKNKGPYCRRGP UGKPGT DGKFGP 'JGHTCWGP /CIFCNGPC   $TGKPKPIWPF/CIFCNGPC¤TVGNFCJKPVGTDGJGNOVGT9CRRGPOCPVGNOOI*CDKEJ++ +OJQH5NI'TNCPIGTp <GKVIGPÌUUKUEJGT)W­#NVIGIN·VVGVUGJTUEJÌP



8GTIQNFGVG 5KNDGTIW­OGFCKNNG Q , XQP %JTKUVKCP /CNGT 5QIGPCPPVG 4KGVGTUEJG OQTCNKUEJG /GFCKNNG   2QUVCOGPV OKV FGO 4KGVGTUEJGP (COKNKGPYCRRGP FCTCWH 5·WNG CP FGT GKPG 9CCIG CPIGDTCEJV KUV N   NKGIGPFGU.COO#PMGTWPF-TW\KHKZT2GNKMCPOKV,WPIGP5RKGIGNWOFGPUKEJGKPG5EJNCPIGYKP FGVUQYKGGKPG9CUUGTMCPPGQDGPUVTCJNGPFGU%JTKUVWUOQPQITCOO*CJPUVGJVPCEJNKP.CPFUEJCHV QDGPNUVTCJNGPFG5QPPGTNGWEJVGPFGT/QPFOOI+OJQH5NI'TNCPIGT #NVXGTIQNFGVGT\GKVIGPÌUUKUEJGT)W­5GJTUEJÌP




NÜRNBERG

703







703

4GNKIKÌUG5KNDGTIW­OGFCKNNGXQP%JTKUVKCP/CNGTCWHFGP6QFWPFFKG#WHGTUVGJWPI2TWPMXQNN IGMNGKFGVGYGKDNKEJG)GUVCNVFCJKPVGTUVGJVFGT6QFOKV5CPFWJTKPFGT.KPMGP-CJNGT$CWOKP.CPF UEJCHV KO *KPVGTITWPF U·GPFGT $CWGT CWH (GNF FCJKPVGT *·WUGT  OO  I 5NI $TGVVCWGT   5NI'TNCPIGT <GKVIGPÌUUKUEJGT)W­)GUVQRHVGU.QEJUGJTUEJÌP



5KNDGTIW­OGFCKNNGWPUKIPKGTVCWHFGP0ÒTPDGTIGT2CVTK\KGT5GDCUVKCP'DGT$TWUVDKNF'DGTUTOKV ITQ­GT *CNUMTCWUG$GJGNOVGU (COKNKGPYCRRGP 'DGT  OO  I *CDKEJ p +OJQH    5NI'TNCPIGTp 5R·VGTGT)W­*GPMGNURWTUGJTUEJÌP



705



704

706

705

5KNDGTIW­OGFCKNNG  WPUKIPKGTV XQP /CVVJ·WU %CTN CWH FGP 0ÒTPDGTIGT 5VCFVTCV ,QJCPP 9KNJGNO   .ÌHHGNJQN\ Ó$TWUVDKNFXQP.ÌHHGNJQN\HCUVXXOKVITQ­GT*CNUMTCWUGWPFWOIGNGIVGO /CPVGN)TCXWT $GJGNOVGU (COKNKGPYCRRGP .ÌHHGNJQN\  OO  I *CDKEJ XIN ++    

8QTFGTUGKVGFQTVXQP +OJQH5NI'TNCPIGT  5R·VGTGT)W­)TCXKGTVGU9CRRGPCWHFGT4ÒEMUGKVGUGJTUEJÌP



5KNDGTOGFCKNNG  XQP %JTKUVKCP /CNGT CWH FGP -WTHÒTUVGPVCI KP 0ÒTPDGTI &KG UKIPKGTVGP YCDGP   HÌTOKI CPIGQTFPGVGP 9CRRGP FGT UKGDGP -WTHÒTUVGP,WUVKVKC WPF 2TWFGPVKC YGTFGP XQP %QPEQTFKC   WOCTOVOOI5NI'TNCPIGT 5VGORGNHGJNGTXQT\ÒINKEJ



&GT-WTHÒUVGPVCIFCWGTVGXQO1MVQDGTDKU\WO0QXGODGT2GTUÌPNKEJCPYGUGPFYCTGPFKG-WTHÒTUVGP XQP -ÌNP /CKP\ 6TKGT 2HCN\ WPF 5CEJUGP UQYKG GKPKIG UQPUVKIG (ÒTUVGP #PNC­ YCTGP #WUGKPCPFGTUGV\WPIGP   -CKUGT 4WFQNHU ++ OKV UGKPGO $TWFGT /CVVJKCU &KG -WTHÒTUVGP XGTNCPIVGP FKG 9CJN XQP /CVVJKCU \WO TÌOKUEJGP   -ÌPKIFKGCWEJHÒTFCUFCTCWHHQNIGPFG(TÒJLCJTDGYKNNKIVYWTFG4WFQNH++UVCTDLGFQEJUEJQPCO

707

708

707



4GKEJUVCNGTOKV6KVGNXQP/CVVJKCU&CX-GNNPGT  44*GPMGNURWT(GNFGTIGIN·VVGVUGJTUEJÌP





5KNDGTIW­OGFCKNNGWPUKIPKGTVXQP)GQTI*QNFGTOCPPCWHFGP0GWDCWFGU4CVJCWUGU#PUKEJVFGU PGWGP4CVJCWUGUCWUFGT8QIGNRGTURGMVKXGQDGPFGTIGMTÌPVG4GKEJUUEJKNF\YKUEJGPFGPDGKFGP5VCFV UEJKNFGP WPVGP -CTVWUEJG OKV FTGK <GKNGP 5EJTKHV ÒDGT ,CJTGU\CJN2CNOG CP FGT FCU *CNNGTUEJG   9CRRGPCPIGDTCEJVKUVWOJGTFKG(COKNKGPYCRRGPFGTNVGUVGPFGU4CVUWPFFGU$CWOGKUVGTUOO I5NI'TNCPIGT 5R·VGTGT)W­5GJTUEJÌP

 131


NÜRNBERG

709

710





710

1XCNG 5KNDGTIW­OGFCKNNG  XQP 6JQOCU 5VÌT CWH FCU 0ÒTPDGTIGT 2CVTK\KGTRCCT )CDTKGN WPF   'NGQPQTC 5EJGWTN $TWUVKNF )CDTKGN 5EJGWTNU HCUV X X OKV ITQ­GT *CNUMTCWUG$TWUVDKNF 'NGQPQTC   5EJGWTNUHCUVXXOKVITQ­GT*CNUMTCWUGWPFWOIGNGIVGT-GVVGZOOI*CDKEJ++ #PO+OJQH5NI'TNCPIGTp 5R·VGTGT)W­5GJTUEJÌP



<KPPIW­OGFCKNNGXQP%JTKUVKCP/CNGTCWHFKGXKGTHÒJTGPFGP$CPMUV·FVG'WTQRCU 8GPGFKI*CO DWTI0ÒTPDGTIWPF#OUVGTFCO &KGXKGT9CRRGPUEJKNFGFGT$CPMUV·FVGKPXGT\KGTVGP-CTVWUEJGPKPU -TGW\IGUVGNNV#RQNNQOKV.[TCWPF&KCPCOKV$QIGPUVGJGPXXFC\YKUEJGPDGHKPFGPUKEJ#VVTKDWVG FGU*CPFGNUFKGCO$QFGPNKGIGPFCTÒDGT5GIGNUEJKHHCWH5GGQDGPUKV\V/GTMWTCWHGKPGOXGT\KGTVGP $QIGPOO5NI'TNCPIGT FQTVKP5KNDGT   5R·VGTGT0CEJIW­KP<KPP-N4CPFHGJNGTUGJTUEJÌP



712

711

713



4GKEJUVCNGTOKV6KVGN(GTFKPCPFU++&CX-GNNPGT  #VVTCMVKXGU'ZGORNCTOKVJÒDUEJGT2CVKPCUGJTUEJÌPpXQT\ÒINKEJ





)WNFGPVCNGT -TGW\GT OKV6KVGN(GTFKPCPFU+++&CX-GNNPGT  8QPITQ­GT5GNVGPJGKV(GKPG2CVKPCYKP\-TCV\GTCVVTCMVKXGUUGJTUEJÌPGU'ZGORNCT





5KNDGTOGFCKNNG  WPUKIPKGTV XGTOWVNKEJ XQP %JTKUVKCP /CNGT CWH -ÌPKI &CXKF -ÌPKI &CXKF OKV   -TQPGWPF7OJCPIMPKGVNWPFURKGNV*CTHGFCXQT#NVCTOKVCWHIGUEJNCIGPGO$WEJQDGPUVTCJNGPFGT 0COG ,GJQXCU KO #DUEJPKVV FKG CTCDKUEJG ,CJTGU\CJN5EJYGDGPFGT 'PIGN PCEJ T OKV 2CNO\YGKI   -TCP\ WPF 5EJTKHVDCPF FCTWPVGT FKG TÌOKUEJG ,CJTGU\CJN  OO  I 5NI 'TNCPIGT p   5NI'TNCPIGT++p5NI)QRRGNp 4)GRT·IVGU1TKIKPCN(CUVXQT\ÒINKEJGU'ZGORNCTOKVHGKPGT2CVKPC

132




NÜRNBERG

715

714



'KPUGKVKIGT XKGTRC­HÌTOKIGT UKNDGTPGT $GEJGTCWHUCV\  6CWHIGUEJGPM FGU *CPU *GKPTKEJ 5EJPWEM   HÒT*CPU)GQTI*CTVWPI /·T\5QJPXQP)GQTIWPF-CVJCTKPC'NKUCDGVJ*CTVWPI<GKNGP 5EJTKHVZOOI 5R·VGTGU)CNXCPQ5GJTUEJÌP



5KNDGTOGFCKNNGXQP,QJCPP*ÌJPFGONVGTGPCWHFGP(TKGFGPUGZGMWVKQPUJCWRVTG\G­KP0ÒTPDGTI KO ,WPK  <YGK CWU 9QNMGP MQOOGPFG KPGKPCPFGTITGKHGPFG *·PFG JCNVGP /GTMWTUVCD QDGP   UVTCJNGPFGT0COG,GJQXCUWPVGP5VCFVCPUKEJVXQP0ÒTPDGTI'KPCWU9QNMGPMQOOGPFGT#TOJ·NVFTGK OKVGKPCPFGT XGTDWPFGPG *GT\GP ÒDGT GKPG -TQPG FKG OKV 1NKXGP\YGKIGP DGUVGEMV KUV KO *KPVGTITWPF   2CNONCPFUEJCHVOOI&GVJ1TF2CZKP0WOOKU5NI'TNCPIGT  5EJÌPG2CVKPCXQT\ÒINKEJ 



716



5KNDGTIW­OGFCKNNG  WPUKIPKGTV CWH FGP 0ÒTPDGTIGT 2CVTK\KGT #PFTGCU )GQTI 2CWOICTVPGT XQP   *QNGPUVGKP WPF .QPGTUVCFV )GJCTPKUEJVGU $TWUVDKNF 2CWOICTVPGTU T OKV WOIGNGIVGO /CPVGN<YGK   HCEJDGJGNOVGU(COKNKGPYCRRGP2CWOICTVPGTOOI+OJQH5NI'TNCPIGTp  5R·VGTGT)W­5GJTUEJÌP



717



5KNDGTOGFCKNNGQ, WO XQP)GQTI*CWVUEJWPF.C\CTKWU)QVVNKGD.CWHHGTCWHFKG.KGDG<YGK 2WVVGPOKV(CEMGNPUVGJGPGKPCPFGTIGIGPÒDGT<YGKUKEJMÒUUGPFG2WVVGPOOI-CJCPG 5NI'TNCPIGT 5GJTUEJÌPGU'ZGORNCTOKVHGKPGT6ÌPWPI

 133


NÜRNBERG

719



718

720

4GNKIKÌUG5KNDGTOGFCKNNGQ, WO XQP.C\CTKWU)QVVNKGD.CWHHGTCWHFKG6CWHG'KP2TKGUVGTVCWHV GKP-KPFCO6CWHDGEMGPFCPGDGP%JTKUVWUCO-TGW\FGUUGP$NWVKPFCU6CWHDGEMGPHNKG­V%JTKUVWUOKV 9CPFGTUVCD IGJV PCEJ N CWH GKP -KPF \W FCU CO $QFGP NKGIV WPF FKG #TOG PCEJ KJO CWUUVTGEMV KO   *KPVGTITWPFJÒIGNKIG.CPFUEJCHVOOI5NI'TNCPIGTp5NI)QRRGNp  -N5VGORGNHGJNGTUGJTUEJÌPpXQT\ÒINKEJ



5EJTCWDVCNGT1JPG+PJCNV&CX\W-GNNPGT\W2TG­NGT

 *ÒDUEJG2CVKPCXQT\ÒINKEJ



5KNDGTOGFCKNNG  XQP )GQTI *CWVUEJ CWH FKG *WNFKIWPI FGT 5VCFV \WT )GDWTV XQP .GQRQNF ,QUGH   5QJPXQP,QUGH+&KG$TWUVDKNFGTXQP.GQRQNF+WPF,QUGH+)TQ­XCVGTWPF8CVGTFGU0GWIGDQTGPGP GKPCPFGT IGIGPÒDGT FCTWPVGT /GFCKNNQP OKV FGT &CTUVGNNWPI FGU PGWIGDQTGPGP 2TKP\GP(ÒPH <GKNGP   5EJTKHV WOJGT 'KEJGPMTCP\ \W FGP 5GKVGP .QTDGGT\YGKIG  OO  I +OJQH    5NI'TNCPIGT5NI/QPVGPWQXQ 49KP\4CPFHGJNGTUGJTUEJÌPGU'ZGORNCTOKV2CVKPC

 



&KG (TGWFG ÒDGT FGP PGWIGDQTGPGP 6JTQPHQNIGT Y·JTVG PWT MWT\ FGPP .GQRQNF ,QUGH UVCTD DGTGKVU KO #NVGT XQP   GKPGO,CJTFGP-KPFUVQF0CEJHQNIGTFGU-CKUGTU,QUGH+  FGTCO#RTKNKO#NVGTXQP ,CJTGPUVCTDYWTFGFGUUGPLÒPIGTGT$TWFGT-CTN 8+ 

721



134

5KNDGTOGFCKNNGXQP)GQTI9KNJGNO8GUVPGTWPF2JKNKRR*GKPTKEJ/ÒNNGTCWHFKG,CJTHGKGTFGT 4GHQTOCVKQP $TWUVDKNF /CTVKP .WVJGTU T OKV WOIGNGIVGO /CPVGN4GNKIKQ OKV -GNEJ WPF -TGW\ MPKGV   PCEJ T XQT 5·WNGPUVWORH CWH FGO GKP CWHIGUEJNCIGPGU $WEJ NKGIV QDGP UVTCJNGPFGT 0COG ,GJQXCU   OOI$GTPJGKOGT(QTUVGT5NI'TNCPIGT++5NI9JKVKPI  (CUVXQT\ÒINKEJGU'ZGORNCTOKVHGKPGT2CVKPC




NÜRNBERG

723

722





722

5KNDGTOGFCKNNG  XQP #PFTGCU 8GUVPGT CWH FGP 6QF FGU 0ÒTPDGTIGT 2CVTK\KGTU ,CMQD 9KNJGNO   +OJQH  Ó $TWUVDKNF +OJQHU T OKV WOIGNGIVGO /CPVGN1DGNKUM OKV CPIGDTCEJVGO   /GFCKNNQP FCTKP FCU $TWUVDKNF +OJQHU T WOJGT UVGJGP FKG 2GTUQPKHKMCVKQPGP XQP )GUEJKEJVG   )GPGCNQIKGWPF*GTCNFKMOOI$GTPJGKOGT+OJQH5NI'TNCPIGT FQTV KP$TQP\G  9KP\-TCV\GTXQT\ÒINKEJGU'ZGORNCTOKVHGKPGT6ÌPWPI



5KNDGTOGFCKNNG  XQP 2GVGT 2CWN 9GTPGT CWH FKG ,CJTHGKGT FGT ªDGTICDG FGT #WIUDWTIGT   -QPHGUUKQP $TWUVDKNFGT /CTVKP .WVJGTU WPF /GNCPEJVJQPU PGDGPGKPCPFGT T&KG ªDGTICDG FGT   -QPHGUUKQP CWH FGO 4GKEJUVCI  OO  I 5NI 'TNCPIGT ++  XCT FQTV OKV ITÌ­GTGP   $TWUVDKNFGTP 5NI9JKVKPI -N5VGORGNHGJNGTHCUVXQT\ÒINKEJGU'ZGORNCTOKVHGKPGT2CVKPC



724

725





725

5KNDGTOGFCKNNG Q ,   XQP 2GVGT 2CWN 9GTPGT CWH FGP  6QFGUVCI FGU 0ÒTPDGTIGT 2CVTK\KGTU   ,QJCPP 'KUGT  Ó )GJCTPKUEJVGU $TWUVDKNF 'KUGTU T OKV ITQ­GT *CNUMTCWUG$GJGNOVGU   (COKNKGPYCRRGP'KUGTOOI+OJQH5NI'TNCPIGT  (GKPG6ÌPWPIXQT\ÒINKEJ



5KNDGTOGFCKNNG Q ,   XQP 2GVGT 2CWN 9GTPGT CWH FGP  6QFGUVCI FGT -CWHOCPPUYKVYG   'NKUCDGVJ-TCWUUWPFFCUL·JTKIG,WDKN·WOFGT-TCWUU UEJGP5VKHVWPI$TWUVDKNFXQP'NKUCDGVJ-TCWUU NOKVITQ­GT*CNUMTCWUG9GKDNKEJG)GUVCNVUKV\VPCEJNWPFXGTVGKNV$TQVCP\YGK-KPFGTOO I+OJQH5NI'TNCPIGT -N-TCV\GTUGJTUEJÌPGU'ZGORNCTOKV2CVKPC



'NKUCDGVJ -TCWUU FKG 9KVYG FGU -CWHOCPPU -QPTCF -TCWUU CWU -KV\KPIGP XGTOCEJVG PCEJ FGO 6QFG KJTGT FTGK   -KPFGT KJT 8GTOÌIGP XQP  )WNFGP GKPGT UQ\KCNGP 5VKHVWPI &KGUG TKEJVGVG 9CKUGPJ·WUGT GKPHÌTFGTVG5EJW NGPWPFXGTICDXKGTL·JTKIG5VKRGPFKGP  &KG XQTNKGIGPFG /GFCKNNG YWTFG DGK FGT (GKGT \WO L·JTKIGP ,WDKN·WO FGT -TCWUU UEJGP 5VKHVWPI CP CNNG CPYG   UGPFGPJQJGPWPFÒDTKIGP)·UVGÒDGTTGKEJV

135


OLDENBURG

726 727



727

-NGKPG5KNDGTOGFCKNNGQ,  WPUKIPKGTVXQP2GVGT2CWN9GTPGTCWHFGP6QFGUVCIFGT-CWH OCPPUYKVYG 'NKUCDGVJ -TCWUU WPF FCU L·JTKIG ,WDKN·WO FGT -TCWUU UEJGP 5VKHVWPI $TWUVDKNF XQP   'NKUCDGVJ-TCWUUNOKVITQ­GT*CNUMTCWUG8KGT<GKNGP5EJTKHVWOJGT.QTDGGTMTCP\OOI +OJQH5NI'TNCPIGT (GKPG6ÌPWPIXQT\ÒINKEJ



&KGMNGKPGP/GFCKNNGPKO9GTVXQP-TGW\GTPYWTFGPDGKFGT(GKGTCPFKG(KPFGNMKPFGTXGTVGKNV



-QPX6CNGTOKV6KVGN,QUGHU++/KV.CWDTCPF&CX-GNNPGTE  9KP\5EJTÌVNKPIUHGJNGTXQT\ÒINKEJp5VGORGNINCP\





.16-NGKPG5GTKG5KNDGTOGFCKNNGPCWHFGP0ÒTPDGTIGT-ÒPUVNGT#NDTGEJV&ÒTGTFCTWPVGTZXQP -CTN)QGV\ 5VÒEM<WO6GKNUGNVGP8QT\ÒINKEJp5VGORGNINCP\



729

¤66+0)'0)4#(5%*#(6

731

730

¤66+0)'0



-CTN 9QNHICPI .WFYKI :8 WPF /CTVKP  6CNGT  OKV 6KVGN -CTNU 8 &CX    .ÌHHGNJQN\XCT #W­GTIGYÌJPNKEJIWVCWUIGRT·IVHCUVXQT\ÒINKEJ





.WFYKI'DGTJCTF4GKEJUVCNGTOKV6KVGN(GTFKPCPFU++/KEJCGNUVCNGTI&GT 'T\GPIGN/KEJCGNOKVGTJQDGPGO(NCOOGPUEJYGTVWPFFGO¤VVKPIGT9CRRGPUEJKNFUVGJVXXFGP(W­ CWHFGPXQTKJONKGIGPFGPIGVÌVGVGP&TCEJGPIGUGV\V)GMTÌPVGT&QRRGNCFNGTOKV5EJYGTV<GRVGTWPF 4GKEJUCRHGNKPFGP(·PIGP&CX.ÌHHGNJQN\  8QPITQ­GT5GNVGPJGKV-N5EJTÌVNKPIUHGJNGTCO4CPFHGKPG6ÌPWPIXQT\ÒINKEJGU'ZGORNCT



1.&'0$74) )4#(5%*#(65'+6*'4<1)67/#$)4155*'4<1)67/ 

%JTKUVQRJ Ó&QRRGNUEJKNNKPI/CNOÌQFGT-QRGPJCIGPOKV6KVGN%JTKUVKCPU++XQP &·PGOCTM)CNUVGT-CNXGNCIG6TKRRNGTD (CUVUGJTUEJÌP %JTKUVQRJYCTMGKPTGIKGTGPFGT)TCHXQP1NFGPDWTI$GKFGOXQTNKGIGPFGP&QRRGNUEJKNNKPIJCPFGNVGUUKEJWOGKPG 2T·IWPI CWU FGT <GKV FGT )TCHGPHGJFG  7PVGT FGO 8QTYCPF %JTKUVKCP ++ XQP &·PGOCTM FGT    XGTVTKGDGP YWTFG YKGFGT GKP\WUGV\GP XGTUWEJVG %JTKUVQRJ UGNDGT &·PGOCTM CP UKEJ \W DTKPIGP $GK FKGUGO 8QT   JCDGP YWTFG GT XQP FGT 5VCFV .ÒDGEM WPVGTUVÒV\V +O(TKGFGPXQP*CODWTILGFQEJOW­VG.ÒDGEMWPFFCOKV CWEJ%JTKUVQRJCNNG#ODKVKQPGPCWHIGDGP

136




OLDENBURG

732

734

733



#PVQP )ÒPVJGT  )WNFGP  5VÒDGT  Q , ,GXGT OKV 6KVGN .GQRQNFU +  /ÒP\RGTKQFG   /ÒP\OGKUVGT,ÒTIGP*CTVOCPP  $GPFKIXCT&CX-CNXGNCIG6TKRRNGTC  45GJTUEJÌP





)WNFGP 5VÒDGT Q,,GXGTOKV6KVGN.GQRQNFU+/ÒP\RGTKQFG/ÒP\OGKUVGT,ÒTIGP*CTVOCPP

 $GPFKI&CX-CNXGNCIG6TKRRNGTD 45GJTUEJÌP





5EJKNNKPI Q ,   ,GXGT OKV 6KVGN XQP /CVVJKCU  /ÒP\RGTKQFG /ÒP\OGKUVGT 0KMQNCWU   9KPVIGPU  $GPFKIXCT-CNXGNCIG6TKRRNGTXCT 5GJTUEJÌPpXQT\ÒINKEJ



735



(TKGFTKEJ 8 XQP &·PGOCTM  5KNDGTOGFCKNNG  XQP ( #TDKGP CWH FCU L·JTKIG   ,WDKN·WO FGU *CWUGU 1NFGPDWTI IGUVKHVGV XQP FGT MÌPKINKEJ CUKCVKUEJGP -QORCPKG )GJCTPKUEJVGU   $TWUVDKNF T OKV .QTDGGTMTCP\ WOIGNGIVGO /CPVGN WPF 'NGHCPVGPQTFGP <GKNGP 5EJTKHV  OO   I)CNUVGT 440WT'ZGORNCTGIGRT·IV4CPFWPF(GNFGTDGCTDGKVGVUGJTUEJÌP

0CEJFGO6QFUGKPGU8CVGTU%JTKUVKCP8+ÒDGTPCJO(TKGFTKEJ8KO,CJTGFGPF·PKUEJGP6JTQP+O)GIGP UCV\ \W UGKPGP 8QTHCJTGP TGFW\KGTVG GT FKG OKNKV·TKUEJGP #MVKXKV·VGP WPF FCOKV XGTDWPFGPGP 6TWRRGPUV·TMGP GTJGD   NKEJ'TGTMCPPVGFC­FKG<WMWPHV&·PGOCTMUPKEJVKPOKNKV·TKUEJOCEJVRQNKVKUEJGP6TWIDKNFGTPNCI/KVFGT(ÌTFG TWPIXQP*CPFGN*CPFYGTM)GYGTDG9KUUGPUEJCHVGP-WPUVWPF.KVGTCVWTUGV\VGGT\WO9QJNUGKPGU.CPFGUPGWG<KGNG

736



737



2CWN(TKGFTKEJ#WIWUV6CNGT#-5&CX-CJPV6JWP  5GNVGPKPFKGUGT'TJCNVWPI(GKPG2CVKPCHCUV5VGORGNINCP\



6CNGT#-5&CX-CJPV6JWP 5GJTUEJÌPpXQT\ÒINKEJ 'KPGUGJTUGNVGPG1NFGPDWTIGT5KNDGTOGFCKNNGXQPCWUFGT5COONWPIFGT(TGKJGTTGP$QPFGHKPFGP 5KGKP-CVCNQIWPVGT0T

 

137


PADERBORN

738

150#$4ª%-

$+567/ 

739

%CTNXQP.QVJTKPIGP6CNGT1UPCDTÒEM-GPPGRQJN

5GJTUEJÌP



'KPGP 1UPCDTÒEMGT 6CNGT CWU FGT 5COONWPI FGT (TGKJGTTGP $QPFG HKPFGP 5KG KP -CVCNQI  WPVGT   0T



156(4+'5.#0& 156(4+'5.#0&)4#(5%*#(65'+6(ª456'067/ 

'PPQ++5EJCH'OFGP/ÒP\OGKUVGT*KPTKEJ/KV/ÒP\OGKUVGT\GKEJGPIGNFTKUEJGU -TGW\CWHDGKFGP5GKVGP-CRRGNJQHHXCT 5GNVGPKPFKGUGT'TJCNVWPI5GJTUEJÌPpXQT\ÒINKEJ



740

741

741



'PPQ+++5VÒDGTQ,'OFGP!/ÒP\OGKUVGTXGTOWVNKEJ,CEQD5VCNRGTV-CRRGNJQHH -N2T·IGUEJY·EJGXQT\ÒINKEJ





)GQTI%JTKUVKCP4GKEJUVCNGTQ,'UGPUOKV6KVGN.GQRQNFU+-P[RJXCT  5GJTUEJÌP



742

743

743

2#&'4$140 $+567/ 

 138

$GTPJCTF+++XQP1GUGFG2HGPPKI2CFGTDQTPI-TGW\KPFGP9KPMGNPa-WIGN L-WIGN$KUEJQHVJTQPVXXOKV\YGKURKV\KIGT/KVTC-TWOOUVCDWPF$WEJ9GKPI  5EJÌPpUGJTUEJÌP 9KNJGNO#PVQPXQPFGT#UUGDWTI-QPX6CNGT0GWJCWU&CX5EJYGFG #C9GKPI *GTTNKEJG2CVKPC4ÒEMUGKVGOKPLWUVKGTVXQT\ÒINKEJ

 


PFALZ

744

,QJCPP 2JKNKRR XQP .CODGTI  4GKEJUVCNGT  #WIUDWTI &CX  (QTUVGT    -GNNPGT 2TCEJVXQNNG2CVKPCXQT\ÒINKEJp5VGORGNINCP\ 

2(#.<-74(ª456'067/ 



747



746

-CTN6JGQFQT-QPX6CNGT/CPPJGKO&CX*CCUC5NI/GOOGUJp  5GJTUEJÌP -QPX6CNGT/CPPJGKO*CCU5NI/GOOGUJ  2TCEJVGZGORNCTOKVHGKPGT2CVKPC(CUV5VGORGNINCP\

748



2(#.<

,QJCPP9KNJGNO5KNDGTOGFCKNNGQ,  XQP,5GNVGT)GJCTPKUEJVGU$TWUVDKNFT $TWUVDKNFUGKPGT)GOCJNKP#PPC/CTKC.WKUGXQP/GFKEKOKVJQJGT.QEMGPHTKUWTNOOI 5NI/GOOGUJ5VGORGT 445GJTUEJÌPGU'ZGORNCTOKVUEJÌPGT2CVKPC

746



744

2#55#7

$+567/ 

745

 

749 748

-QPX6CNGT/CPPJGKO&CX*CCU5NI/GOOGUJ  5GJTUGNVGPKPFKGUGT'TJCNVWPI*GTTNKEJG2CVKPCXQT\ÒINKEJp5VGORGNINCP\



2H·N\GT2T·IWPIGPCWUFGO5EJCV\HWPFXQP*GTDQTPHKPFGP5KGWPVGTFGP0TP 

2(#.<0'7$74)*'4<1)67/ 

1VVQ*GKPTKEJWPF2JKNKRR5KNDGTIW­OGFCKNNGWPUKIPKGTVXQP/)GDGN0ÒTPDGTI CWH1VVQ*GKPTKEJ$ÒUVGFGU(ÒTUVGPT2QUGKFQPKPGKPGOXQP\YGK2HGTFGPIG\QIGPGP5EJKHHCWH5GG KPFGTGTJQDGPGP4GEJVGP)GK­GNOOI*CDKEJ+5VGORGT  5R·VGTGT)W­5GJTUEJÌP

 139


POMMERN

750

1$'42(#.< 

(TKGFTKEJ ++  4GKEJUVCNGT  0GWOCTMV &CX  )ÌV\  XCT 5NI /GOOGUJ   XCT 8QT\ÒINKEJ 

751

21//'40 21//'40*'4<1)67/706'45%*9'&'0 

)WUVCX++#FQNH5KNDGTOGFCKNNQPXQP5&CFNGTCWHUGKPGP6QFDGK.ÒV\GPWPF UGKP$GIT·DPKUKPFGT4KFFCTJQNOUM[TMCPKP5VQEMJQNOCO,WPK&GTCWHIGDCJTVG-ÌPKINKGIV KO 8QTFGTITWPF KO *KPVGTITWPF 5EJNCEJVU\GPG QDGP HÒJTGP  'PIGN UGKPG 5GGNG FGO UVTCJNGPFGP   0COGP ,GJQXCU \W&GT -ÌPKI KO /CPVGN OKV 5EJYGTV WPF $WEJ FGT -ÌTRGT JCND KO *CTPKUEJ JCND   CNU5MGNGVVUKV\VKPGKPGOXQPFTGKIGHNÒIGNVGP2HGTFGPIG\QIGPGO9CIGPÒDGTUGKPGO-QRHGKP.QT DGGTMTCP\FGTIGOGKPUCOXQPFGTNKPMUUVGJGPFGP4GNKIKQPUHTGKJGKVWPFFGTTGEJVUUVGJGPFGP6CRHGTMGKV IGJCNVGP YKTF 7PVGTFGO9CIGPXKGNMÌRHKIG5EJNCPIG.ÌYGPMQRHWPFIGHNÒIGNVGT/CPPOO I*KNFGDTCPF+59KGEGM 2TCEJVXQNNGU'ZGORNCTOKVHGKPGT2CVKPC MN4CPFHGJNGTWPF4CPFRWP\G ( XQT\ÒINKEJp5VGORGNINCP\ 

752

753



-CTN:+6CNGT5VGVVKP/KV/ÒP\OGKUVGTUKIPCVWT+.#WPF\YGKIGMTGW\VG<CKP JCMGP#JNUVTÌOD&CX -N2T·IGUEJY·EJGUGJTUEJÌPpXQT\ÒINKEJ



6CNGT5VGVVKP/KV/ÒP\OGKUVGTUKIPCVWT+%#PGDGPFGO#TOCDUEJPKVV#JNUVTÌOD&CX 5GJTUEJÌP 9GKVGTG RQOOGTUEJG 2T·IWPIGP CWU FGT 5COONWPI FGT (TGKJGTTGP $QPFG HKPFGP 5KG KP -CVCNQI    WPVGTFGP0TP

140

 


QUEDLINBURG

754

755 754

56'66+056#&6 

7PVGT5EJYGFGP-CTN:)WUVCX5KNDGTOGFCKNNGXQP)6CDGTVCWHFGP#D\WIFGT MCKUGTNKEJGPMÌPKINKEJRQNPKUEJGPWPFHÒTUVNKEJDTCPFGPDWTIKUEJGP$GNCIGTWPIUVTWRRGP&GTUVTCJNGPFG 0COG ,GJQXCU KP HÒPHHCEJGO 5EJTKHVMTGKU5VCFVCPUKEJV OKV FGO *CHGP QDGP UVTCJNGPFGT 0COG   ,GJQXCUOOI*KNFGDTCPF+5/CTKGPDp5NI2QIIG  8QPITQ­GT5GNVGPJGKV-N4CPFHGJNGTUGJTUEJÌPGU'ZGORNCTOKVUEJÌPGT2CVKPC 

37'&.+0$74)

#$6'+ 

#FGNJGKF+++XQP5CEJUGP$TCMVGCVIDVKUUKPUKV\VXXOKV.KNKGWPFIGÌHHPGVGO $WEJCWH/CWGTTKPI\YKUEJGP\YGKITQ­GP6ÒTOGPKO/CWGTTKPIUKPFHÒPH5VCFVVQTG\WUGJGP$GTIGT /GJN 44CPFCDDTWEJUGJTUEJÌP

758

756

759



757

759



&QTQVJGC5QRJKCXQP5CEJUGP#NVGPDWTI4GKEJUVCNGT3WGFNKPDWTIOKV6KVGN(GTFK PCPFU++&CX/GJNC *ÒDUEJG2CVKPCCVVTCMVKXGUUGJTUEJÌPGU'ZGORNCT



4GKEJUVCNGT3WGFNKPDWTI&CX/GJN

4-N*GPMGNURWT5VGORGNHGJNGTUGJTUEJÌP





#PPC5QRJKCXQP2HCN\$KTMGPHGNF6CNGT3WGFNKPDWTI&CX/GJNC (CUVXQT\ÒINKEJ





#PPC&QTQVJGCXQP5CEJUGP9GKOCT4GKEJUVCNGT$TCWPUEJYGKICWHKJTGP6QF /GJN 8QT\ÒINKEJ





141


REGENSBURG

1,5:1

)4#(5%*#(6 

760

1,5:1

4#8'05$'4)

1VVQ ++  2HGPPKI 5VGTNKPI  0CEJCJOWPI GKPGU OÒPUVGTKUEJGP 2HGPPKIU 8GEJVC  I   ¸/10'6# 1610+ -QRH FGU JGKNKIGP 2CWNWU X X OKV 0KODWU /16 8' &QRRGNHCFGPMTGW\   KPFGPGTUVGPFTGK9KPMGNP4QUGVVGPKOXKGTVGP-WIGNMTGW\$GTIJCWU8GEJVC5VCPIGE  8QPITQ­GT5GNVGPJGKV5EJYCEJCWUIGRT·IVHCUVUGJTUEJÌP



761 762

4'+%*5/ª0<5666' 

762

4')'05$74)

*GKPTKEJ+++&GPCTI-TGW\OKV-WIGNPCPFGP'PFGPFGT#TOGKPFGP 9KPMGNP%48:-KTEJGPIGD·WFG*CJP 4#VVTCMVKXGUUGJTUEJÌPGU'ZGORNCT



56#&6 

-NKRRGPHÌTOKIG5KNDGTOGFCKNNGQ,WPUKIPKGTVCWHFKG'TDCWWPIFGT5VCFV5VCFVYCRRGPWOJGT.QT DGGTMTCP\5GEJU<GKNGP5EJTKHVQDGPWPFWPVGPLGGKPG4QUGVVGZOOI2NCVQ  *ÒDUEJG2CVKPCXQT\ÒINKEJ



764

763





142

763

5KNDGTOGFCKNNGWPUKIPKGTVCWHFKG)TWPFUVGKPNGIWPIFGT&TGKGKPKIMGKVUMKTEJGCO,WNK#PUKEJV FGT -KTEJG N GKP 'PIGN OKV 2CNO\YGKI T GKP'PIGNOKV¤N\YGKIFCTÒDGTFKGRGTUQPKHK\KGTVG&TGKGK PKIMGKV KP 9QNMGP5KGDGP <GKNGP 5EJTKHV WOJGT FKG  9CRRGP FGT FCOCNKIGP *GTTGP FGU +PPGTGP   4CVGUQDGPFCU4GIGPUDWTIGT9CRRGPWPVGP-CTVWUEJGOKVGKPGOCWHIGUEJNCIGPGP$WEJOO I2NCVQ *ÒDUEJG2CVKPCYKP\-TCV\GTHCUVXQT\ÒINKEJ



4GKEJUVCNGT  CWH FKG 'KPPCJOG XQP 4GIGPUDWTI FWTEJ UEJYGFKUEJRTQVGUVCPVKUEJG 6TWRRGP WPVGT   *GT\QI $GTPJCTF XQP 5CEJUGP9GKOCT WPF UGKPGP FTGK $TÒFGTP CO  0QXGODGT $GEMGPD    &CX5EJPGG 445GJTUEJÌPGU'ZGORNCTOKVHGKPGT2CVKPC 


REGENSBURG

766

765





765

5KNDGTOGFCKNNGXQP*)$CJTG ! CWHFGP4GKEJUVCIKP4GIGPUDWTI$TWUVDKNF(GTFKPCPFU+++T OKV.QTDGGTMTCP\QDGP-TQPGWPVGPFGT4GIGPUDWTIGT9CRRGPUEJKNFKP-CTVWUEJG\WFGP5GKVGPMNGKP FKG 5KIPCVWT *)$4(ÒPH <GKNGP 5EJTKHV KP -TCP\ QDGP IGMTÌPVGT &QRRGNCFNGT WOJGT 9CRRGPMTGKU   DGUVGJGPFCWUFGP9CRRGPFGTUKGDGP-WTHÒTUVGPOOI2NCVQ5NI/QPVGPWQXQ

FQTVKOCPFGTGP)GYKEJV  (CUVXQT\ÒINKEJ



5KNDGTOGFCKNNG  WPUKIPKGTV CWH FKG ,CJTHGKGT FGT 4GHQTOCVKQP <YGK CWU 9QNMGP MQOOGPFG   #TOGJCNVGPGKPGP.GWEJVGTOKVDTGPPGPFGO.KEJVÒDGTGKPGP6KUEJOKVCWHIGUEJNCIGPGT$KDGNCO(W­G FGU 6KUEJGU NGJPV GKP YGKVGTGU $WEJ9CRRGP \YKUEJGP FGT IGVGKNVGP ,CJTGU\CJN FCTWPVGT HÒPH <GKNGP   5EJTKHVOOI2NCVQ5NI9JKVKPI  #VVTCMVKXGUXQT\ÒINKEJGU'ZGORNCTOKVHGKPGT6ÌPWPI



767

768

769



4GKEJUVCNGTOKV6KVGN.GQRQNFU+$GEMGPD&CX

 (GKPG2CVKPCXQT\ÒINKEJGU'ZGORNCT





4GKEJUVCNGTOKV6KVGN.GQRQNFU+$GEMGPD&CX

 /KPRQTÌUGT5EJTÌVNKPIXQT\ÒINKEJ





4GKEJUVCNGTOKV6KVGN.GQRQNFU+$GEMGPD&CX

 (GKPG2CVKPCUGJTUEJÌPpXQT\ÒINKEJ

 143


REGENSBURG

770



771

772

5KNDGTOGFCKNNGWPUKIPKGTVCWHFCU'PFGFGT2GUV(QTVWPCUVGJVPCEJNOKV(ÒNNJQTPWPFÒDGTIKDV FGTPCEJTUKV\GPFGPVTCWGTPFGP4CVKUDQPCFGP5VCFVUEJNÒUUGN5GEJU<GKNGP5EJTKHVOOI 2NCVQ5NI$TGVVCWGT 48QT\ÒINKEJ





4GKEJUVCNGTQ,  OKV6KVGN-CTNU8+I5VGORGNUEJPGKFGT%JTKUVQRJ&CPKGN1GZNGKP 5VCFVUEJNÒUUGN KP DCTQEMGT )TQVGUMGPMCTVWUEJG WPVGP DGKFGTUGKVU /ÒP\OGKUVGT\GKEJGP (NÒIGN ,QJCPP   /KEJCGN (GFGTGT /ÒP\OGKUVGT KP 4GIGPUDWTI  )GJCTPKUEJVGU $TWUVDKNF FGU -CKUGTU T OKV   .QTDGGTMTCP\ WPF WOIGNGIVGO /CPVGN CWH FGT XQTIG\QIGPGP 5EJWNVGT .ÌYGPOCUMG $GEMGPD    &CX 44#VVTCMVKXGUXQT\ÒINKEJGU'ZGORNCT 



4GKEJUVCNGTQ,  OKV6KVGNXQP(TCP\+$GEMGPD&CX 5GJTUEJÌPpXQT\ÒINKEJ

773

774



775



-QPX6CNGTOKV6KVGNXQP(TCP\+$GEMGPD&CX$

5GJTUEJÌP





-QPX6CNGTOKV6KVGNXQP(TCP\+$GEMGPD&CX  #VVTCMVKXGUXQT\ÒINKEJGU'ZGORNCT





-QPX6CNGTOKV6KVGNXQP(TCP\+$GEMGPD&CX



144

5GJTUEJÌPpXQT\ÒINKEJ


REUSS

777

776

776



-QPX6CNGTOKV6KVGNXQP(TCP\+$GEMGPD&CX

5GJTUEJÌP



5KNDGTOGFCKNNG  XQP + % $WUEJ WPF + 0 -ÌTPNGKP FGT 4GIGPUDWTIGT $QIGPUEJÒV\GP CWH FGP   (TKGFGP XQP *WDGTVWUDWTI #NVCT FCTCWH )NQDWU FCTÒDGT -TCP\#EJV <GKNGP 5EJTKHV  OO   I2CZKP0WOOKU2NCVQ5NI2GNV\GT 8QT\ÒINKEJ

 

779

778

(ª456'067/ 

%CTN6JGQFQTXQP&CNDGTI-QPX6CNGT#-5&CX-CJPV6JWP  .GKEJVLWUVKGTVXQT\ÒINKEJ





-QPX6CNGT#-5&CX-CJPV6JWP  *ÒDUEJG2CVKPC5EJTÌVNKPIUTK­UGJTUEJÌPpXQT\ÒINKEJ



781



780

782

-QPX6CNGT#-5,

8QT\ÒINKEJ



4'755 4'7551$'4)4'+<)4#(5%*#(65'+6(ª456'067/ 

*GKPTKEJ:+-QPX6CNGT5CCNHGNF&CX5EJOKFV-PCD  *ÒDUEJG2CVKPCXQT\ÒINKEJ





-QPX6CNGT5CCNHGNF&CX5EJOKFV-PCD



9KP\5EJTÌVNKPIUHGJNGTXQT\ÒINKEJ

145


REUSS

784 783

783



-QPX6CNGT5CCNHGNF&CX5EJOKFV-PCD 2TCEJVGZGORNCT8QT\ÒINKEJp5VGORGNINCP\



-QPX6CNGT5CCNHGNF5EJOKFV-PCD

785



2TCEJVXQNNG2CVKPCXQT\ÒINKEJp5VGORGNINCP\

786

 

787

*GKPTKEJ:+++-QPX6CNGT4ÒEMUGKVGPUVGORGNXQP,QJCPP8GKV&ÌNN#-58CTK CPVG&CX-CJPV6JWP  0WT'ZGORNCTGIGRT·IV2TCEJVGZGORNCT/KP2T·IGUEJY·EJG5VGORGNINCP\





-QPX6CNGT#-5&CX-CJPV6JWP  440WT'ZGORNCTGIGRT·IV/KPDGTKGDGPXQT\ÒINKEJ





-QPX6CNGT#-5&CX-CJPV6JWP  5GJTUGNVGPDGUQPFGTUKPFKGUGT'TJCNVWPI2TCEJVGZGORNCT5VGORGNINCP\



789

788



6CNGT#-5,



-QPX6CNGT#-5&CX-CJPV6JWP

146

789

4*ÒDUEJG2CVKPCXQT\ÒINKEJ



44/KPLWUVKGTVXQT\ÒINKEJ




REUSS

791

790



-QPX6CNGT#-5&CX-CJPV6JWP *GTTNKEJG2CVKPCXQT\ÒINKEJp5VGORGNINCP\





-QPX6CNGT#-5&CX-CJPV6JWP  9KP\5EJTÌVNKPIUHGJNGTUGJTUEJÌPpXQT\ÒINKEJXQT\ÒINKEJ



792

793



*GKPTKEJ::8GTGKPUFQRRGNVCNGT#-5&CX-CJPV6JWP  5GJTCVVTCMVKXGU'ZGORNCTOKVJGTTNKEJGT2CVKPCXQT\ÒINKEJp5VGORGNINCP\



8GTGKPUFQRRGNVCNGT#-5&CX-CJPV6JWP



8QT\ÒINKEJ





8GTGKPUFQRRGNVCNGT#-5&CX-CJPV6JWP  9KP\-TCV\GTXQT\ÒINKEJp5VGORGNINCP\





8GTGKPUFQRRGNVCNGT#-5&CX-CJPV6JWP



795

794

796

797

$GTKGDGPUGJTUEJÌPpXQT\ÒINKEJ

796



8GTGKPUFQRRGNVCNGT#-5&CX-CJPV6JWP

8QT\ÒINKEJ





8GTGKPUVCNGT#-5&CX-CJPV6JWP  2TCEJVGZGORNCTOKVJGTTNKEJGT2CVKPC'TUVCDUEJNCIXQT\ÒINKEJp5VGORGNINCP\5VGORGNINCP\

 147


REUSS

799

798



*GKPTKEJ::++8GTGKPUVCNGT#-5&CX-CJPV6JWP 8QT\ÒINKEJ



8GTGKPUVCNGT#-5&CX-CJPV6JWP

800

5GJTUEJÌPpXQT\ÒINKEJ

802

801

 

803

4'755706'4)4'+<*'445%*#(65'+6)4#(5%*#(6 

*GKPTKEJ +++   -QPX6CNGT  5CCNHGNF #WUDGWVG FGT 'T\ITWDGP -NGKPTGKPUFQTH   /ÒUGNGT5EJOKFV-PCD 2TCEJVGZGORNCT(GKPG2CVKPCHCUV5VGORGNINCP\





-QPX6CNGT5CCNHGNF#WUDGWVGFGT'T\ITWDGP-NGKPTGKPUFQTH/ÒUGNGT5EJOKFV-PCD -N2T·IGUEJY·EJGXQT\ÒINKEJ





5RGEKGUVCNGT5CCNHGNF#WUDGWVGFGT'T\ITWDGP-NGKPTGKPUFQTH/ÒUGNGT5EJOKFV-PCD 5GJTUEJÌP





5RGEKGUVCNGT5CCNHGNF#WUDGWVGFGT'T\ITWDGP-NGKPTGKPUFQTH/ÒUGNGT5EJOKFV-PCD (CUVXQT\ÒINKEJ



804

805

805



6CNGT5CCNHGNF5EJOKFV-PCD

5GJTUEJÌPpXQT\ÒINKEJ





-QPX6CNGT5CCNHGNFCWHFGP(TKGFGPXQP*WDGTVWUDWTI&CX5EJOKFV-PCD  4*ÒDUEJG2CVKPCMN2T·IGUEJY·EJGXQT\ÒINKEJ



148


REUSS

807

806

4'7555%*.'+<)4#(5%*#(65'+6(ª456'067/ 

*GKPTKEJ:++-QPX6CNGT5CCNHGNFCWHFGP(TKGFGPXQP*WDGTVWUDWTI&CX 5EJOKFV-PCD 5GJTCVVTCMVKXGUXQT\ÒINKEJGU'ZGORNCT





-QPX6CNGT5CCNHGNF&CX5EJOKFV-PCD



808

4#VVTCMVKXGUXQT\ÒINKEJGU'ZGORNCT

809



*GKPTKEJ:.++)TQUEJGP#-5,C  5GJTUGNVGPDGUQPFGTUKPFKGUGT'TJCNVWPI'TUVCDUEJNCIHCUV5VGORGNINCP\





-W2HGPPKI#-5, 5GNVGPKPFKGUGT'TJCNVWPI2TCEJVGZGORNCT(CUV5VGORGNINCP\



810

811



*GKPTKEJ.:++8GTGKPUFQRRGNVCNGT#-5&CX-CJPV6JWP  0WT'ZGORNCTGIGRT·IV2TCEJVGZGORNCT'TUVCDUEJNCIHCUV5VGORGNINCP\





8GTGKPUFQRRGNVCNGTL·JTKIGU4GIKGTWPIULWDKN·WO#-5&CX-CJPV6JWP  40WT'ZGORNCTGIGRT·IV2TCEJVGZGORNCT*GTTNKEJG2CVKPCHCUV5VGORGNINCP\5VGORGNINCP\



812

813



8GTGKPUFQRRGNVCNGTL·JTKIGU4GIKGTWPIULWDKN·WO#-5&CX-CJPV6JWP  40WT'ZGORNCTGIGRT·IV*ÒDUEJG2CVKPCXQT\ÒINKEJp5VGORGNINCP\





8GTGKPUFQRRGNVCNGTL·JTKIGU4GIKGTWPIULWDKN·WO#-5&CX-CJPV6JWP  40WT'ZGORNCTGIGRT·IV#VVTCMVKXGUXQT\ÒINKEJGU'ZGORNCTOKVHGKPGT6ÌPWPI

 149


REUSS

814

815



8GTGKPUFQRRGNVCNGT#-5&CX-CJPV6JWP  0WT'ZGORNCTGIGRT·IV*ÒDUEJG2CVKPCYKP\4CPFHGJNGTXQT\ÒINKEJ





8GTGKPUFQRRGNVCNGT#-5&CX-CJPV6JWP  0WT'ZGORNCTGIGRT·IV2TCEJVGZGORNCT(CUV5VGORGNINCP\



816

817



*GKPTKEJ.:8++8GTGKPUVCNGT#-5&CX-CJPV6JWP  5GJTUEJÌPpXQT\ÒINKEJ





8GTGKPUVCNGT#-5&CX-CJPV6JWP *ÒDUEJG2CVKPCXQT\ÒINKEJp5VGORGNINCP\



818

819

819



-W2HGPPKI##-5,

5GNVGPKPFKGUGT'TJCNVWPI2QNKGTVG2NCVVG





*GKPTKEJ:+88GTGKPUVCNGT#-5&CX-CJPV6JWP  2TCEJVGZGORNCTOKVJGTTNKEJGT2CVKPC(CUV5VGORGNINCP\CWURQNKGTVGT2NCVVG



820



8GTGKPUVCNGT#-5&CX-CJPV6JWP

821

8QT\ÒINKEJp5VGORGNINCP\



4'755'$'45&14()4#(5%*#(65'+6(ª456'067/  150

*GKPTKEJ::+86CNGT5CCNHGNF5EJOKFV-PCD

/KPLWUVKGTVXQT\ÒINKEJ




REUSS

822

823



*GKPTKEJ.+-QPX6CNGT#-5&CX-CJPV6JWP  2TCEJVXQNNG2CVKPCXQT\ÒINKEJGU2TCEJVGZGORNCT



-QPX6CNGT#-5&CX-CJPV6JWP

5GJTUEJÌPpXQT\ÒINKEJ

 

825

824



*GKPTKEJ.::++8GTGKPUFQRRGNVCNGT#-5&CX-CJPV6JWP  0WT'ZGORNCTGIGRT·IV2TCEJVXQNNG2CVKPCHCUV5VGORGNINCP\





8GTGKPUFQRRGNVCNGT#-5&CX-CJPV6JWP  0WT'ZGORNCTGIGRT·IV8QT\ÒINKEJ



826

827

828



8GTGKPUFQRRGNVCNGT#-5&CX-CJPV6JWP  *ÒDUEJG2CVKPCXQT\ÒINKEJp5VGORGNINCP\





8GTGKPUFQRRGNVCNGTL·JTKIGU4GIKGTWPIULWDKN·WO#-5&CX-CJPV6JWP  40WT'ZGORNCTGIGRT·IV*ÒDUEJG2CVKPCXQT\ÒINKEJXQT\ÒINKEJp5VGORGNINCP\





8GTGKPUFQRRGNVCNGTL·JTKIGU4GIKGTWPIULWDKN·WO#-5&CX-CJPV6JWP  40WT'ZGORNCTGIGRT·IV5GJTUEJÌPpXQT\ÒINKEJ

 151


SACHSEN

829

830

831

832

4+'6$'4) )4#(5%*#(65'+6(ª456'067/ 

,QJCPP+++XQP1UVHTKGUNCPF#FNGTUEJKNNKPIOKV6KVGNXQP/CVVJKCU$WUGXCT  442T·IGUEJY·EJGUGJTUEJÌP 9GKVGTG4KGVDGTIGT2T·IWPIGPCWUFGO5EJCV\HWPFXQP*GTDQTPHKPFGP5GKWPVGTFGP0TPWPF

5#%*5'0-74(ª456'067/



5#%*5'0



(TKGFTKEJ +++ FGT 9GKUG #NDTGEJV WPF ,QJCPP  5EJTGEMGPDGTIGT Q , #PPCDGTI   -GKNKV\-QJN 5GNVGPDGUQPFGTUKPFKGUGT'TJCNVWPI(CUVXQT\ÒINKEJ





(TKGFTKEJ+++FGT9GKUG)GQTIWPF,QJCPP5EJTGEMGPDGTIGTQ,#PPCDGTI-GKNKV\ ªDGTFWTEJUEJPKVVNKEJGTJCNVGP8QT\ÒINKEJ





5EJTGEMGPDGTIGTQ,$WEJJQN\-GKNKV\

833

5GJTUEJÌP

834



835



(TKGFTKEJ+++,QJCPPWPF)GQTI6CNGTQ,#PPCDGTI-NCRROÒV\GPVCNGT&CX# 5EJPGG (GKPG2CVKPCMN5EJTÌVNKPIUTKUUGCVVTCMVKXGUXQT\ÒINKEJGU'ZGORNCT



6CNGTQ,#PPCDGTI-NCRROÒV\GPVCNGT&CX5EJPGGXCT



(TKGFTKEJ +++ FGT 9GKUG ,QJCPP WPF )GQTI  6CNGT Q , .GKR\KI -NCRROÒV\GPVCNGT   I)GJCTPKUEJVGU$TWUVDKNFTKP-WTQTPCVOKVIGUEJWNVGTVGO<GRVGT&KG$TWUVDKNFGT,QJCPPUWPF )GQTIUGKPCPFGTIGIGPÒDGT&CX#5EJPGG  8QPITQ­GT5GNVGPJGKV#VVTCMVKXGU'ZGORNCTOKVHGKPGT2CVKPCUGJTUEJÌP 

152

*GPMGNURWTUGJTUEJÌP

 


SACHSEN

837

836



5EJTGEMGPDGTIGTQ,#PPCDGTI-GKNKV\



,QJCPP6CNGTQ,<YKEMCW&CX5EJPGG$

836

5GJTUEJÌPpXQT\ÒINKEJ



445GJTUEJÌP



838

839

839



,QJCPPWPF)GQTI6CNGTQ,#PPCDGTI&CX5EJPGG  4*ÒDUEJG2CVKPCYKP\-QTTQUKQPUUVGNNGPHCUVXQT\ÒINKEJ



,QJCPP(TKGFTKEJFGT)TQ­OÒVKIG&QRRGNVGT4GKEJUVCNGT$WEJJQN\CWHFKG'KPNÌ UWPIFGT$WTIITCHUEJCHV/CIFGDWTII&CX5EJPGG 445GJTUEJÌPpXQT\ÒINKEJ

840

841

 

842



'KPUGKVKIG (GNFMNKRRG \W GKPGO  6CNGT   I 1JPG )TCXWT CWH FGT 4ÒEMUGKVG $TCWUG   /CPUHGNF6HNGKEJVXCT-GKNKV\NGKEJVXCT 445GJTUEJÌP





'KPUGKVKIG(GNFMNKRRG\WGKPGO6CNGTI/KV)TCXWTCWHFGT4ÒEMUGKVG&KGUGU)GJÌTGV FGT$TÒFGTUEJCHV$TCWUG/CPUHGNF6HNGKEJVXCT-GKNKV\NGKEJVXCT  44.GKEJVG(CUUWPIUURWTGP)TCXWTCWHFGT4ÒEMUGKVGUQPUVUGJTUEJÌP



5KNDGTIW­OGFCKNNG  WPUKIPKGTV XQP *CPU 4GKPJCTV F  CWH FGP .GKR\KIGT $ÒTIGTOGKUVGT *KG   TQP[OWU .QVVGT  0ÒTPDGTI Ó 'T\IGDKTIG $TWUVDKNF .QVVGTU N OKV WOIGNGIVGO /CPVGN  9GKDNKEJG)GUVCNVUKV\VXXFGP-QRHCWHFGPTGEJVGP#TOIGUVÒV\VFGTCWHGKPGT5CPFWJTNGJPVCWH FGTGKPDTGPPGPFGT.GWEJVGTUVGJVKPFGT.KPMGPJ·NVUKGGKPGP5EJ·FGNXQTKJT.COOFCUUGKPGP-QRH CWHKJTGP5EJQ­NGIVKO*KPVGTITWPFN$CWOT5VCFVCPUKEJVOOI*CDKEJ++ +OJQH5NI/GTUGD 5R·VGTGT)W­5GJTUEJÌP





153


SACHSEN

843

844



,QJCPP (TKGFTKEJ FGT )TQ­OÒVKIG WPF )GQTI  6CNGT  5EJPGGDGTI &CX    5EJPGG 44-N)TCHHKVKUGJTUEJÌP 



,QJCPP (TKGFTKEJ FGT )TQ­OÒVKIG WPF *GKPTKEJ  6CNGT  #PPCDGTI &CX    5EJPGG )WVCWUIGRT·IVUGJTUEJÌPXQT\ÒINKEJ

845



846



,QJCPP(TKGFTKEJWPF/QTKV\6CNGT$WEJJQN\&CX5EJPGG  445GJTUEJÌP





/QTKV\6CNGT(TGKDGTI&CX5EJPGGp \W#FQTVXQP   448QT\ÒINKEJGU2TCEJVGZGORNCTOKVUEJÌPGT6ÌPWPI



848 847



'KPUGKVKIGUKNDGTPG0QVMNKRRG\WGKPGO6CNGT.GKR\KIIGRT·IVY·JTGPFFGT$GNCIGTWPIKP.GKR \KIFWTEJ,QJCPP(TKGFTKEJXQP5CEJUGPI4CWVGPUEJKNF\YKUEJGPFGTIGVGKNVGP,CJTGU\CJNQDGP /*<5WPVGPFGT$WEJUVCDG.KO-TGKU$TCWUG/CPUHGNF6H-GKNKV\  W­GTUVUGNVGP5GJTUEJÌP  *GT\QI /QTKV\ XQP 5CEJUGP XGTNKG­  FGP 5EJOCNMCNFKUEJGP $WPF WPF NCXKGTVG ÒDGT OGJTGTG ,CJTG JKPYGI   \YKUEJGP FGT RTQVGUVCPVKUEJGP WPF FGT MCKUGTNKEJGP 5GKVG  YGEJUGNVG FGT RTQVGUVCPVKUEJG (ÒTUV HQTOGNN FKG   (TQPVGPWPFUEJNQ­UKEJ-CKUGT-CTN8CP0CEJ8GTJ·PIWPIFGT4GKEJUCEJVÒDGTUGKPGPGTPGUVKPKUEJGP8GTYCPF VGP -WTHÒTUV ,QJCPP (TKGFTKEJ HKGN /QTKV\ KP -WTUCEJUGP GKP #WEJ .GKR\KI HKGN KO <WIG FKGUGT OKNKV·TKUEJGP   1RGTCVKQP KP UGKPG *·PFG &QEJ UEJQP DCNF GTUEJKGP ,QJCPP (TKGFTKEJ OKV GKPGT 5VTGKVOCEJV XQT FGT 5VCFV WPF   DGICPPCO,CPWCTOKVFGT$GNCIGTWPI4CUEJGPVUVCPFWPVGTFGP8GTVGKFKIGTPGKPGTJÌJVGT)GNFDGFCTHFGT FWTEJ FKG 2T·IWPI XQP 0QVMNKRRGP CWU )QNF WPF 5KNDGT IGFGEMV YGTFGP UQNNVG FC FKG XQO 5VCFVMQOOCPFCPVGP   $CUVKCPXQP9CNNYKV\DGHGJNKIVGP5ÌNFPGTOKVIWVGO)GNFDG\CJNVYGTFGPOW­VGP<WT8GTOÒP\WPIIGNCPIVGKPUDG UQPFGTG FCU CWU FGO $GUKV\ FGU 5VKHVGU /GTUGDWTI UVCOOGPFG 5KNDGTIGUEJKTT WPF -KTEJGPIGT·V FCU XQT FGO -TKGI   CWU5KEJGTJGKVUITÒPFGPKP.GKR\KIGKPIGNCIGTVYQTFGPYCT&CUXGTHÒIDCTG'FGNOGVCNNIGT·VYWTFG\WFKGUGO<YGEM KP FGT 5VCFV XQP )QNFUEJOKGFGP WPF *CPFYGTMGTP GKPIGUEJOQN\GP \W <CKPGP IGIQUUGP \W MNKRRGPHÌTOKIGP   5EJTÌVNKPIGP IGUEJPKVVGP WPF UEJNKG­NKEJ \W 0QVIGNF IGRT·IV &KG -NKRRGP VTCIGP KP +PKVKCNGP 0COGP WPF 6KVGN FGU   *GT\QIU/QTKV\WPFFGPJGT\QINKEJU·EJUKUEJGP4CWVGPUEJKNF$GTGKVUCO,CPWCTJQDFGT)GIPGTFKG$GNCIGTWPI YKGFGTCWHFCUKEJGKPMCKUGTNKEJGU'PVUCV\JGGTFGT5VCFVP·JGTVG

 154

6CNGT#PPCDGTI&CX5EJPGG

-N5EJTÌVNKPIUTK­XQT\ÒINKEJ




SACHSEN

849

850



6CNGT(TGKDGTI&CX5EJPGG

49KP\-TCV\GTUGJTUEJÌP





#WIWUV6CNGT#PPCDGTI&CX5EJPGG  5GNVGPGT,CJTICPI9KP\5EJTÌVNKPIUHGJNGTCO4CPFUGJTUEJÌP



852

851

853

854



6CNGT  &TGUFGP <YKVVGTRT·IWPI OKV ,CJTGU\CJN CWH 8QTFGT WPF 4ÒEMUGKVG &CX    5EJPGG 8QPITÌ­VGT5GNVGPJGKV5GJTUEJÌPpXQT\ÒINKEJ 



5EJTGEMGPDGTIGT&TGUFGP-GKNKV\-CJPV

5GJTUEJÌPpXQT\ÒINKEJ





6CNGT&TGUFGP&CX5EJPGG

5GJTUEJÌPpXQT\ÒINKEJ





5EJTGEMGPDGTIGT&TGUFGP-GKNKV\-CJPV

5GJTUEJÌP





%JTKUVKCP+4GKEJUVCNGT&TGUFGPCWHUGKPGP6QF&CX5EJPGG  45GJTCVVTCMVKXGU'ZGORNCTOKVUEJÌPGT2CVKPCUGJTUEJÌPpXQT\ÒINKEJ





%JTKUVKCP++,QJCPP)GQTI+WPF#WIWUV&TGKGT&TGUFGP-GKNKV\-CJPV  (CUV5VGORGNINCP\



856

855

855

155


SACHSEN

857 (doppelt)

858 (dreifach)

859



&QRRGNVGT4GKEJUVCNGT&TGUFGPI&CX5EJPGG



&KEMGTFTGKHCEJGT4GKEJUVCNGT&TGUFGPI)GJCTPKUEJVGU*ÒHVDKNF%JTKUVKCPU++TOKVFGT 4GEJVGP FCU 5EJYGTV UEJWNVGTPF T *GNO&KG IGJCTPKUEJVGP *ÒHVDKNFGT XQP ,QJCPP )GQTI + WPF   #WIWUVGKPCPFGTIGIGPÒDGT&CX5EJPGG 8QPITÌ­VGT5GNVGPJGKV5GJTUEJÌP 



4GKEJUVCNGT&TGUFGP&CX5EJPGG

860

862 (doppelt)

45GJTUEJÌP

5GJTUEJÌPpXQT\ÒINKEJ





863



4GKEJUVCNGT&TGUFGP&CX5EJPGG



4GKEJUVCNGT  &TGUFGP &CX  5EJPGG  &C\W *CDUDWTIKUEJG 'TDNCPFG 4GKEJUVCNGT    -$-TGOPKV\&CX8QINJ 5VÒEM5EJTÌVNKPIUTK­ Z UGJTUEJÌP



&QRRGNVGT4GKEJUVCNGT&TGUFGPCWHFGP6QFXQP%JTKUVKCP++I&CX5EJPGG  44#VVTCMVKXGU'ZGORNCTOKVJÒDUEJGT2CVKPCUGJTUEJÌP





,QJCPP)GQTI+WPF#WIWUV4GKEJUVCNGT&TGUFGP&CX5EJPGG  8QT\ÒINKEJGU'ZGORNCT



156

5GJTUEJÌP

 


SACHSEN

865

864

865



,QJCPP )GQTI +  1XCNG 5KNDGTOGFCKNNG Q , WPUKIPKGTV )GJCTPKUEJVGU $TWUVDKNF T OKV   WOIGNIVGO /CPVGN8GT\KGTVGU XKGTHGNFKIGU 9CRRGP OKV /KVVGNUEJKNF  Z  OO  I   5NI/GTUGD 44-N*GPMGNURWTUGJTUEJÌP 



5KNDGTOGFCKNNG Q , XQP 4 0 -KV\MCV\ &GT -WTHÒTUV TGKVGV T KP -WTQTPCV OKV FGT 4GEJVGP FCU   5EJYGTV UEJWNVGTPF WPVGP FCU U·EJUKUEJG -WTYCRRGP*GNO XQP 5EJTKHV WOIGDGP WOJGT 9CRRGP   MTCP\OOI)TWPF-Q,5NI/GTUGD  #VVTCMVKXGU'ZGORNCTOKVJÒDUEJGT2CVKPCUGJTUEJÌP



867

866

866



&QRRGNVGT4GKEJUVCNGT&TGUFGPI&CXC5EJPGG  44$GCTDGKVWPIUURWTGPCO4CPFUGJTUEJÌP



4GKEJUVCNGT&TGUFGPCWHFKG,CJTHGKGTFGT4GHQTOCVKQP%NCW­-CJPV5NI9JKVKPI 5GJTUEJÌPpXQT\ÒINKEJ

 

868

869

869



-KRRGT5EJTGEMGPDGTIGT&TGUFGP+85QTVG4CJPGPHÒJTGT-TWI  -N5VGORGNHGJNGTUGJTUEJÌP





-KRRGT)TQUEJGP0GWUVCFVCPFGT1TNC+++5QTVG4CJPGPHÒJTGT-TWI  44.GKEJVG-QTTQUKQPUURWTGPUGJTUEJÌP

 157


SACHSEN

870



&TGKHCEJGT4GKEJUVCNGT&TGUFGPI&GTIGJCTPKUEJVG-WTHÒTUVTGKVGVTOKVFGT4GEJVGPFCU 5EJYGTVUEJWNVGTPFKO*KPVGTITWPF5VCFVCPUKEJVXQP&TGUFGP5GEJUHCEJDGJGNOVGU9CRRGP&CX 5EJPGG 444CPFDGCTDGKVGVUGJTUEJÌP



871



4GKEJUVCNGT&TGUFGP&CX5EJPGG

8QT\ÒINKEJGU2TCEJVGZGORNCT



872 (doppelt)



&QRRGNVGT 4GKEJUVCNGT  &TGUFGP CWH FKG ,CJTHGKGTFGTªDGTICDGFGT#WIUDWTIGT-QPHGUUKQP I&CX# FQTVHCNUEJG#DDKNFWPI 5EJPGG5NI9JKVKPI  4*ÒDUEJG2CVKPCUGJTUEJÌP 

873

 158

4GKEJUVCNGT&TGUFGPCWHFKG,CJTHGKGTFGTªDGTICDGFGT#WIUDWTIGT-QPHGUUKQP&CX#

FQTVHCNUEJG#DDKNFWPI 5EJPGG5NI9JKVKPI 5GJTUEJÌPpXQT\ÒINKEJ




SACHSEN

874



4GKEJUVCNGTMNKRRG&TGUFGPCWHFKG8GTO·JNWPIUGKPGT6QEJVGT/CTKC'NKUCDGVJOKV(TKGFTKEJ8++ XQP*QNUVGKP)QVVQTR&CX5EJPGG (CUVXQT\ÒINKEJ

875





876



877

5KNDGTOGFCKNNGXQP*XQP.ÒPGPWPF40-KV\MCV\CWHFCU0GWG,CJT<YKVVGTRT·IWPI 'KP 5RCVGP XQP 5EJNCPIGPTKPI WPF .QTDGGTMTCP\ WOIGDGP UVGJV CWH GKPGO XGT\KGTVGP 5QEMGN FCTCWH   FKG ,CJTGU\CJN  FCTWPVGT FKG 5KIPCVWT *8. \W FGP 5GKVGP $NWOGP5GEJU <GKNGP 5EJTKHV ÒDGT   ,CJTGU\CJN QDGP WPF WPVGP LG GKPG 4QUGVVG WPVGP T KO (GNF FKG 5KIPCVWT 40-  OO  I   )TWPF.p-5NI/GTUGDp 44*ÒDUEJG2CVKPCXQT\ÒINKEJ



5KNDGTOGFCKNNG  XQP 5 &CFNGT CWH FGP .GKR\KIGT -QPXGPV FGT RTQVGUVCPVKUEJGP 5V·PFG CO    (GDTWCT 5VCFVCPUKEJV XQP .GKR\KI FCTÒDGT \YGK 'PIGN OKV ITQ­GO 5EJKNF ,GJQXCU XQP FGO FKG   5EJKNFG XQP -WTUCEJUGP WPF 5CEJUGP JGTCDJ·PIGP&KG RGTUQPKHK\KGTVG IGHNÒIGNVG 6WIGPF YGKUV FGP   LWPIGP*GTMWNGUCWH#RQNNWPF/GTMWTJKPOOI5NI/GTUGD5NI9JKVKPI 9KGEGM #VVTCMVKXGU'ZGORNCTOKVHGKPGT6ÌPWPIYKP\5VGORGNHGJNGTWPFMN-TCV\GTXQT\ÒINKEJ  0CEJFGOUKEJ)WUVCX++#FQNHXGTIGDNKEJWOGKP$ÒPFPKUOKVFGPPGWVTCNGP-WTHÒTUVGPXQP$TCPFGPDWTIWPF 5CEJUGPDGOÒJVJCVVGNWF-WTHÒTUV,QJCPP)GQTI+XQP5CEJUGPU·OVNKEJGRTQVGUVCPVKUEJGP4GKEJUUV·PFGKO,CPWCT  \W GKPGT -QPHGTGP\ PCEJ .GKR\KI GKP WO GKPG IGOGKPUCOG *CNVWPI KO )TQ­GP -TKGI CD\WUVKOOGP &KG   6CIWPIDGICPPCO(GDTWCT PCEJITGIQTKCPKUEJGO-CNGPFGTCO(GDTWCT WPVGT6GKNPCJOG\CJNTGKEJGT (ÒTUVGP WPF 8GTVTGVGTP SWCUK CNNGT RTQVGUVCPVKUEJGP 5V·PFG #O  #RTKN XGTCDUEJKGFGVG FGT UQIGPCPPVG .GKR\KIGT   $WPF GKPGP GTPGWVGP 2TQVGUV IGIGP FCU 4GUVKVWVKQPUGFKMV -CKUGT (GTFKPCPFU ++ XQP  WPF FKG #WHUVGNNWPI XQP   IGOGKPUCOGP 6TWRRGP KP GKPGO 7OHCPI XQP  /CPP 0KEJV DGUEJNQUUGP YWTFG FCIGIGP FKG XQP )WUVCX ++   #FQNH GTJQHHVG #NNKCP\ OKV 5EJYGFGP &KGUGT 8GTUWEJ FGT (QTOKGTWPI GKPGT FTKVVGP 2CTVGK  PGDGP FGO -CKUGT WPF   5EJYGFGPUQNNVGLGFQEJUEJGKVGTP



4GKEJUVCNGT&TGUFGP&CX5EJPGG

-N4CPFHGJNGTHCUVXQT\ÒINKEJ

 159


SACHSEN

879

878

878



&TGKHCEJGT4GKEJUVCNGT&TGUFGPCWHFGP9GUVH·NKUEJGP(TKGFGPI&GTIGJCTPKUEJVG-WT HÒTUV UVGJV X X CWH IGHNKGUVGO $QFGP OKV FGT 4GEJVGP FCU 5EJYGTV UEJWNVGTPF FKG .KPMG NGJPV CWH   GKPGO6KUEJFCTCWH*GNO*GNOÒDGT\YGK9CRRGPWOJGT9CRRGPMTGKU&CX5EJPGG  44-N5EJTÌVNKPIUHGJNGTXQT\ÒINKEJGU2TCEJVGZGORNCTOKVHGKPGT6ÌPWPI 



&QRRGNVGT4GKEJUVCNGT&TGUFGPI&CXp \W 5EJPGG

 445GJTUEJÌPpXQT\ÒINKEJ



881 880

880



4GKEJUVCNGT&TGUFGP&CX5EJPGG



,QJCPP)GQTI++4GKEJUVCNGT&TGUFGPCWHFCU8KMCTKCV&KEMCDUEJNCIXQPFGP 5VGORGNPFGU4GKEJUVCNGTUI%NCW­-CJPV  8QPITÌ­VGT5GNVGPJGKV#VVTCMVKXGU'ZGORNCTOKVHGKPGT2CVKPCUGJTUEJÌPpXQT\ÒINKEJ

883

8QT\ÒINKEJGU2TCEJVGZGORNCTOKVHGKPGT6ÌPWPI

 

882 883



4GKEJUVCNGT&TGUFGPCWHFCU8KMCTKCV%NCW­-CJPV

5GJTUEJÌPpXQT\ÒINKEJ





4GKEJUVCNGT&TGUFGPCWHFGP6QFUGKPGT/WVVGT/CIFCNGPC5KD[NNC&CX5EJPGG  'VYCU$GNCIUGJTUEJÌP



160


SACHSEN

885

884

886



4GKEJUVCNGT&TGUFGP'TDN·PFKUEJGT6CNGT&CX5EJPGG

5GJTUEJÌPpXQT\ÒINKEJ





4GKEJUVCNGT&TGUFGP'TDN·PFKUEJGT*CNDVCNGT%NCW­-CJPV

 45EJÌPG2CVKPCUGJTUEJÌP





4GKEJUVCNGT&TGUFGP'TDN·PFKUEJGT*CNDVCNGT%NCW­-CJPV  4#VVTCMVKXGUUGJTUEJÌPGU'ZGORNCT



887

888

888



4GKEJUVCNGT&TGUFGP)GUCOVVCNGT&CX5EJPGG

45EJÌPG2CVKPCHCUVXQT\ÒINKEJ



4GKEJUVCNGTMNKRRG  &TGUFGP CWH FCU $ÒEJUGPUEJKG­GP CPN·­NKEJ FGT 6CWHG UGKPGU 'PMGNU ,QJCPP   )GQTI+8&CX5EJPGG -N&TWEMUVGNNG(GNFGTOKPIGIN·VVGVUGJTUEJÌP

  161


SACHSEN

889

890

890



6CNGT.GKR\KIHÒTFKG/CTMITCHUEJCHV/GK­GP%NCW­-CJPV  44#VVTCMVKXGUUGJTUEJÌPGU'ZGORNCT





9GEJUGNVCNGT&TGUFGP&CX5EJPGG



891

893

#VVTCMVKXGUUGJTUEJÌPGU'ZGORNCT

892



6CNGTMNKRRGPCEJ\KPPCKUEJGO(W­&TGUFGPCWHFKG'TÌHHPWPIFGUPGWGP5EJKG­JCWUGU&CX 5EJPGG .GKEJVG-TCV\GTUGJTUEJÌPpXQT\ÒINKEJ





6CNGTMNKRRGPCEJ\KPPCKUEJGO(W­&TGUFGPCWHFCU5EJKG­GP\WT(GKGTFGU(TKGFGPUXQP0KLOG IGP&CX2CZKP0WOOKU5EJPGG /KPMQTTQFKGTVUGJTUEJÌP





,QJCPP)GQTI+++6CNGTPCEJ\KPPCKUEJGO(W­&TGUFGPCWHFGP6QFUGKPGT/WVVGT /CIFCNGPC5KD[NNC2TKP\GUUKPXQP$TCPFGPDWTI$C[TGWVJ&CX5EJPGG  44*GPMGNURWTUGJTUEJÌP



162


SACHSEN

895

894

896



,QJCPP)GQTI+84GKEJUVCNGT&TGUFGP&CX5EJPGG  4*ÒDUEJG2CVKPCCVVTCMVKXGUUGJTUEJÌPGU'ZGORNCT



6CNGTMNKRRG PCEJ .GKR\KIGT (W­  &TGUFGP CWH FGP 'ORHCPI FGU *QUGPDCPFQTFGPU &CX    5EJPGG (GKPG6ÌPWPIXQT\ÒINKEJ





6CNGTMNKRRG PCEJ .GKR\KIGT (W­  &TGUFGP CWH FGP 'ORHCPI FGU *QUGPDCPFQTFGPU &CX    5EJPGG (CUVXQT\ÒINKEJ





898

897

897



6CNGTMNKRRG PCEJ .GKR\KIGT (W­  &TGUFGP CWH FGP 'ORHCPI FGU *QUGPDCPFQTFGPU &CX    5EJPGG *GPMGNURWTUGJTUEJÌP





4GKEJUVCNGT&TGUFGPCWHUGKPGP6QF&CX5EJPGG  9KP\$GCTDGKVWPIUUVGNNGCO4CPFUGJTUEJÌP

 163


SACHSEN

899 900

900



(TKGFTKEJ#WIWUV+ #WIWUVFGT5VCTMG 6CNGT&TGUFGP-QJN FKGU'ZGO RNCTCDIGDKNFGV  44*GTTNKEJG2CVKPCHCUVXQT\ÒINKEJ





4GKEJUVCNGT&TGUFGP&CX5EJPGG  5GNVGPDGUQPFGTUKPFKGUGT'TJCNVWPI9KP\-TCV\GTXQT\ÒINKEJ



902

901





5KNDGTOGFCKNNG  XQP , -KVVGN CWH FKG \WO  /CN DNÒJGPFG COGTKMCPKUEJG #NQG KO $QVCPKUEJGP   )CTVGPKP.GKR\KI5VCFVCPUKEJVXQP.GKR\KI#PUKEJVFGTDNÒJGPFGP2HNCP\GCPFGPWPVGTUVGP$N·VVGTPKUV FGT0COGFGU)·TVPGTU%7.614''2'+0 'NKCU2GKP \WNGUGPOOI(W5 5NI$TGVVCWGT5NI/GTUGD 4-N5VGORGNHGJNGTXQT\ÒINKEJ 6CNGT&TGUFGP%QUGNIWNFGP&CX-QJN 5GJTUEJÌP

904

   164

901

903

 

905

5KNDGTOGFCKNNG  WPUKIPKGTV XQP ) 9 8GUVPGT CWH FKG ,CJTHGKGT FGT 4GHQTOCVKQP $TWUVDKNF   /CTVKP.WVJGTUTOKVWOIGNGIVGO/CPVGN8KGTVCP\GPFG#OQTGVVGPOOI$GTPJGKOGT 5NI/GTUGD5NI9JKVKPI 49KP\-TCV\GTHCUVXQT\ÒINKEJ  4GKEJUVCNGT&TGUFGP&CX5EJPGG 42TCEJVXQNNG2CVKPCUGJTUEJÌPpXQT\ÒINKEJ  4GKEJUVCNGT&TGUFGP&CX5EJPGG  -N$GCTDGKVWPIUUVGNNGKO(GNFGTFGT8QTFGTUGKVGUGJTUEJÌP




SACHSEN

907 906





906

<KPPOGFCKNNGXQP)98GUVPGTCWHFCU.WUVNCIGTWPFFCU/CPÌXGTKP/ÒJNDGTI)GJCTPKUEJVGU $TWUVDKNF T OKV .QTDGGTMTCP\ WPF WOIGNGIVGO /CPVGN&GT -ÌPKI TGKVGV N FCJKPVGT FTGK RQNPKUEJG   4GKVGT KO *KPVGTITWPF #PUKEJV FGU .CIGTU KO #DUEJPKVV\YGK<GKNGP5EJTKHVOO$GTPJGKOGT *%\ FQTVKP5KNDGT 5NI/GTUGD FQTVKP5KNDGT   /KV1TKIKPCNMWRHGTUVKHVUGJTUEJÌP



6CNGT&TGUFGP&CX-QJN

5GJTUEJÌP



5GJTUEJÌP



909

908

909



6CNGT&TGUFGP&CX-QJN



(TKGFTKEJ#WIWUV++5KNDGTOGFCKNNGXQP,9*ÌEMPGTCWHFKG*WNFKIWPIFGT5VCFV (TGKDGTI\WUGKPGO4GIKGTWPIUCPVTKVV)GJCTPKUEJVGU$TWUVDKNFTOKVWOIGNGIVGO/CPVGNFCTWPVGTFTGK <GKNGP IGDQIGPG 5EJTKHV5VCFVCPUKEJV XQP (TGKDGTI OKV 9GJTCPNCIGP KO 8QTFGTITWPF $GTIYGTM   UCPNCIGPÒDGT6CIGGKP9ÒPUEJGNTWVGPI·PIGT\YGK*CURGNMPGEJVGCO(ÌTFGTJCURGNGKP$GTIOCPPFGT GKP 5EJÒTHNQEJ CWUYKTHV UQYKG GKP 2HGTFGIÌRGN OKV \YGK )GD·WFGP WPVGP GKPG$GTIYGTMUCPNCIGWPVGT 6CIGFCTKPGKP-CTTGPN·WHGTCWHFGO9GI\WO(ÒNNQTVTXKGT$GTINGWVGKPGKPGO5VTQUUGPDCWDGKFGT #TDGKVOKV5EJN·IGNWPF'KUGPKO#DUEJPKVVFCU(TGKDGTIGT9CRRGP\YKUEJGP).8%-#8(OO I/ÒUGNGTC5NI/GTUGD (GKPG2CVKPCUGJTUEJÌPpXQT\ÒINKEJ



910

911

911



6CNGT&TGUFGP&CX-QJN

5GJTUEJÌP





4GKEJUVCNGT&TGUFGPCWHFCU8KMCTKCV&CX5EJPGG  (CUVXQT\ÒINKEJGU'ZGORNCTOKVHGKPGT6ÌPWPI

 165


SACHSEN

912

913

914

 

4GKEJUVCNGT&TGUFGPCWHFCU8KMCTKCV&CX5EJPGG 4GKEJUVCNGT&TGUFGPCWHFCU8KMCTKCV&CX5EJPGG

5GJTUEJÌPpXQT\ÒINKEJ *ÒDUEJG2CVKPCUGJTUEJÌP

 



4GKEJUVCNGT&TGUFGP&CX5EJPGG

5GJTCVVTCMVKXGU'ZGORNCTOKVHGKPGT6ÌPWPI



'ZGORNCTFGT#WMVKQP(TKV\4WFQNH-ÒPMGT1UPCDTÒEM0T

915

916



6CNGT&TGUFGPCWHFKG8GTO·JNWPIUGKPGT6QEJVGT/CTKC,QUGHCOKVFGO&CWRJKP.QWKUXQP (TCPMTGKEJ&CXp-QJN 5GJTUEJÌP





6CNGT&TGUFGPCWHFKG8GTO·JNWPIUGKPGU5QJPGU(TKGFTKEJ%JTKUVKCPOKV2TKP\GUUKP#PVQPKC XQP$C[GTP&CXp-QJN (GKPG2CVKPCUGJTUEJÌP



917



5KNDGTOGFCKNNG  XQP , 9 *ÌEMPGT CWH FGP NWVJGTKUEJGP 6JGQNQIGP 8CNGPVKP 'TPUV .ÌUEJGT KP   &TGUFGP 0CEJ N MPKGPFGT 2TGFKIGT WPVGT UVTCJNGPFGT 5QPPG T )GD·WFG OKV 5QPPGPWJT$ÒUVG FGU   6JGQNQIGPCWHGKPGO5QEMGNFCXQTUKV\VFGTRGTUQPKHK\KGTVG)NCWDGOOI5NI/GTUGD 8QT\ÒINKEJ 8CNGPVKP 'TPUV .ÌUEJGT YWTFG  KP 5QPFGTUJCWUGP IGDQTGP 'T YWTFG  2TQHGUUQT KP 9KVVGPDGTI WPF    5WRGTKPVGPFGPV WPF 1DGTMQPUKUVQTKCNTCV KP &TGUFGP 'T YCT FGT NGV\VG DGFGWVGPFG 8GTVTGVGT FGT NWVJGTKUEJGP 1TVJQ   FQZKG 4GNKIKQPUYKUUGPUEJCHV DGM·ORHVGFGP2KGVKUOWU GKPGKO,CJTJWPFGTVGKPUGV\GPFGTGNKIKÌUG$GYGIWPIKO 2TQVGUVCPVKUOWU UQYKGFKG9QNHHUEJG5EJWNGWPFITÒPFGVGFKGGTUVGVJGQNQIKUEJG<GKVUEJTKHV8CNGPVKP'TPUV.ÌUEJGT UVCTDKP&TGUFGP

166




SACHSEN

918

919

920



4GKEJUVCNGT  &TGUFGP IGRT·IV WPVGT RTGW­KUEJGT $GUCV\WPI #WUDGWVG FGT U·EJUKUEJGP )TWDGP   &CX/ÒUGNGTD1NFC5EJPGG  4*GTTNKEJG2CVKPCMN5EJTÌVNKPIUHGJNGTCO4CPFUGJTUEJÌPpXQT\ÒINKEJ 



:CXGT  $TQP\GOGFCKNNG  XQP , ( 5VKGNGT CWH FKG #TVKNNGTKG5EJWNG )GJCTPKUEJVGU   $TWUVDKNFTOKVWOIGNGVGO1TFGPUDCPF/CTUUVGJVHCUVXXWPFHÒJTVGKPGP-PCDGP\WXGTUEJKGFGPGP #TVKNNGTKGIGT·VGPFKGNCO$QFGPNKGIGPOO5NI/GTUGD (GKPG6ÌPWPIXQT\ÒINKEJ





-QPX6CNGT&TGUFGP&CX5EJPGG



921

922

8QT\ÒINKEJp5VGORGNINCP\

921



-QPX6CNGT&TGUFGP&CX5EJPGG



(TKGFTKEJ #WIWUV +++ +   5KNDGTOGFCKNNG XQP-9*QGEMPGTCWHFKG0KG FGTUEJNCIWPI FGT #WHUV·PFG FGU .CPFXQNMGU 7PKHQTOKGTVGU $TWUVDKNF T(ÒPH <GKNGP 5EJTKHV KO #D   UEJPKVVFKG,CJTGU\CJNOOI5NI/GTUGD 8QT\ÒINKEJ

923



-QPX6CNGT5)*#WUDGWVG&CX-CJPV6JWP

5GJTUEJÌP

 

924

445GJTUEJÌPpXQT\ÒINKEJ



(TKGFTKEJ#WIWUV+-QPX6CNGT5)*#-5&CX-CJPV6JWP  8QT\ÒINKEJ



5#%*5'0-¤0+)4'+%* 

167


SACHSEN

925

926

927



-QPX6CNGT5)*#WUDGWVG#-5&CX-CJPV6JWP



5KNDGTOGFCKNNG  XQP - 9 *QGEMPGT CWH UGKP L·JTKIGU 4GIKGTWPIULWDKN·WO IGHGTVKIV KO #WH   VTCIFGU&TGUFPGT5VCFVTCVGU$TWUVDKNFT)GPKWUOKV.QTDGGTMTCP\WPF(ÒNNJQTPKONKPMGP#TOUVGJV PCEJ N XQT HNCOOGPFGO #NVCT WOJGT -TCP\ OKV 6KGTMTGKU\GKEJGP  OO  I )GDCWGT   5NI/GTUGD 448QT\ÒINKEJGU'ZGORNCTOKVUEJÌPGT2CVKPC



-QPX6CNGT)5#-5,

48QT\ÒINKEJ





928

,WUVKGTVXQT\ÒINKEJ



929



-QPX6CNGT5#-5&CX-CJPV6JWP

8QT\ÒINKEJ





(TKGFTKEJ#WIWUV++-QPX6CNGT)#-5&CX-CJPV6JWP  48QT\ÒINKEJ



930



-QPX6CNGT)#-5&CX#-CJPV6JWP



-QPX6CNGT)#WUDGWVG#-5&CX-CJPV6JWP

168

931

8QT\ÒINKEJ



5GJTUEJÌPpXQT\ÒINKEJ




SACHSEN

933

932



-QPX6CNGT)#WUDGWVG#-5&CX-CJPV6JWP  /GJTGTGMNTCWJG5VGNNGPNGKEJVDGTKGDGPXQT\Ã&#x2019;INKEJ5VGORGNINCP\



6CNGT  ) /Ã&#x2019;P\DGUWEJ /KV 4CPFUEJTKHV ù ñ ù )166 k 5')0' k 5#%*5'0 k #-5    &CX-CJPV6JWP 8QPITQ­GT5GNVGPJGKV'TUVCDUEJNCIXQT\Ã&#x2019;INKEJp5VGORGNINCP\ 

935

934



935



6CNGT)#-5&CX-CJPV6JWP  2TCEJVGZGORNCT(GKPG2CVKPCHCUV5VGORGNINCP\





8GTGKPUFQRRGNVCNGT)#-5&CX-CJPV6JWP  (GKPG2CVKPCXQT\Ã&#x2019;INKEJp5VGORGNINCP\



936

937



6CNGT)#WUDGWVG#-5&CX-CJPV6JWP  5GNVGPDGUQPFGTUKPFKGUGT'TJCNVWPI8QT\Ã&#x2019;INKEJp5VGORGNINCP\





6CNGT(#WUDGWVG#-5&CX-CJPV6JWP(  48QT\Ã&#x2019;INKEJXQT\Ã&#x2019;INKEJp5VGORGNINCP\



938

939



6CNGT(#-5&CX-CJPV6JWP

8QT\Ã&#x2019;INKEJp5VGORGNINCP\





,QJCPP6CNGT(#WUDGWVG#-5&CX-CJPV6JWP 48QT\Ã&#x2019;INKEJ

 169


SACHSEN

941

940

940



&QRRGNVGT8GTGKPUVCNGT(#-5&CX-CJPV6JWP  8QT\ÒINKEJXQT\ÒINKEJp5VGORGNINCP\





8GTGKPUVCNGT(#-5&CX-CJPV6JWP  2TCEJVGZGORNCT(CUV5VGORGNINCP\5VGORGNINCP\



942

945

944

943

  

&QRRGNVGT8GTGKPUVCNGT(#-5&CX-CJPV6JWP &QRRGNVGT8GTGKPUVCNGT(#-5&CX-CJPV6JWP 8GTGKPUVCNGT(#-5&CX-CJPV6JWP

8QT\ÒINKEJp5VGORGNINCP\ 8QT\ÒINKEJ 8QT\ÒINKEJp5VGORGNINCP\

  



8GTGKPUVCNGT$#WUDGWVG#-5&CX-CJPV6JWP  5GJTUGNVGPDGUQPFGTUKPFKGUGT'TJCNVWPI8QT\ÒINKEJ



946 947

947



8GTGKPUVCNGT$#WUDGWVG#-5&CX-CJPV6JWP  2TCEJVGZGORNCT(CUV5VGORGNINCP\





#NDGTV  -NKRRGPHÌTOKIG 5KNDGTOGFCKNNG  9GTMUVCVV )NCUGT  5QJP &TGUFGP CWH FCU    &GWVUEJG $WPFGUUEJKG­GP KP &TGUFGP 5VCFVCPUKEJV OKV 'NDG KO #DUEJPKVV 9CRRGP WPF 'KEJGP   \YGKIG)GMTÌPVG )GTOCPKC UKV\V PCEJ N OKV 'KEJGP\YGKI KP FGT 4GEJVGP FKG .KPMG CWH GKPGP   9CRRGPUEJKNFIGNGJPVZOOI5NI2GNV\GT +P1TKIKPCNGVWK5VGORGNINCP\



9GKVGTG /GFCKNNGP FGU -ÌPKIU #NDGTV CWU FGT 5COONWPI FGT (TGKJGTTGP $QPFG HKPFGP 5KG KP -CVCNQI   WPVGTFGP0TP 

170


SACHSEN

948



-NKRRGPHÌTOKIG5KNDGTOGFCKNNG9GTMUVCVV)NCUGT5QJP&TGUFGPCWHFCU&GWVUEJG$WPFGU UEJKG­GP KP &TGUFGP 5VCFVCPUKEJV OKV 'NDG KO #DUEJPKVV 9CRRGP WPF 'KEJGP\YGKIG)GMTÌPVG   )GTOCPKC UKV\V PCEJ N OKV 'KEJGP\YGKI KP FGT 4GEJVGP FKG .KPMG CWH GKPGP 9CRRGPUEJKNF IGNGJPV   ZOOI5NI2GNV\GT 2QNKGTVG2NCVVG



.1655#%*5'0-74(ª456'067/70&-¤0+)4'+%* 

-NGKPG5COONWPIXQPFKXGTUGP)TQUEJGPFGU-WTHÒTUVGPVWOU5CEJUGPCWUFGO,CJTJWPFGTV  5VÒEM5EJÌPpUGJTUEJÌP





.QV (TKGFTKEJ #WIWUV ++  8GTGKPUFQRRGNVCNGT  )  (  ( Z FCXQP Z CWH   UGKPGP6QF 6JWP( Z  5VÒEM5GJTUEJÌPpXQT\ÒINKEJ





.QV ,QJCPP  6CNGT  ( /ÒP\DGUWEJ  8GTGKPUVCNGT  $  $  $ &C\W   (TKGFTKEJ #WIWUV ++  6CNGT  ( CWH UGKPGP 6QF WPF #WUDGWVG  6JWP       5VÒEM8QT\ÒINKEJWPFDGUUGT



952

953

952

5%*5+5%*'56&6' 

&TGUFGP 4GNKIKÌUG 5KNDGTOGFCKNNG Q , /KVVG FGU  ,CJTJWPFGTVU  XGTOWVNKEJ XQP 4 -TÒIGT 5CN   XCVQTOGFCKNNG $TWUVDKNF %JTKUVK N OKV UVTCJNGPFGO *GKNKIGPUEJGKP<GJP <GKNGP 5EJTKHV  OO   I5NI&T#PVQKPG(GKNN5NI/GTUGDp 45GJTUEJÌP



.GKUPKI-NGKPG5KNDGTOGFCKNNGWPUKIPKGTVCWHFGPL·JTKIGP)GFGPMVCIFGU$TCPFGUXQP WPFFGP9KGFGTCWHDCWFGT5VCFV#PUKEJVFGTDTGPPGPFGP5VCFV#PUKEJVFGTYKGFGTJGTIGUVGNNVGP5VCFV OOI5NI/GTUGD -N5VGORGNHGJNGTXQT\ÒINKEJ



&KG<WYGKUWPI\W&TGUFGPKUVPKEJVIGUKEJGTV



954

5#%*5'09'+55'0('.5*'4<1)67/ 

,QJCPP )GQTI  6CNGTMNKRRG PCEJ .GKR\KIGT (W­ Q , 9GK­GPHGNU CWH GKP WPDGMCPPVGU   5EJKG­GP&CXp5EJPGG 8QPITQ­GT5GNVGPJGKV*GPMGNURWTUGJTUEJÌP  'ZGORNCTFGT5COONWPI*QHTCV&T(TKGFTKEJ#WMVKQP*GUU0CEJH(TCPMHWTVCO/CKP0T

171


SACHSEN

956

955



955

6CNGTMNKRRGPCEJ.GKR\KIGT(W­9GK­GPHGNUCWHFCU$ÒEJUGPUEJKG­GPCPN·­NKEJFGT6CWHGUGKPGU 5QJPGU -WTRTKP\ ,QJCPP )GQTI  I /QPQITCOO FGU -WTRTKP\GP*GTMWNGU KP 9KGIG GTYÒTIV   5EJNCPIGP&CXp5EJPGG 44<CRQPKGTVYKP\*GPMGNURWTHCUVXQT\ÒINKEJ 

5#%*5'0<'+6<*'4<1)67/ 

/QTKV\  4GKEJUVCNGT  CWH FGP $CW FGU 5EJNQUUGU /QTKV\DWTI KP <GKV\ &CX    5EJPGG 44(GKPG2CVKPCYKP\-TCV\GTCVVTCMVKXGUHCUVXQT\ÒINKEJGU'ZGORNCT  -WTUCEJUGPGTNKVVGTJGDNKEJGVGTTKVQTKCNG8GTNWUVGCNU-WTHÒTUV,QJCPP)GQTI+FWTEJUGKP6GUVCOGPVUGKPGLÒPIGTGP 5ÌJPG #WIWUV %JTKUVKCP WPF /QTKV\ OKV WOHCPITGKEJGP )GDKGVGP CWUUVCVVGVG WPF FGT ·NVGUVG 5QJP ,QJCPP)GQTI++ FKGU KO *CWRVXGTINGKEJ \W &TGUFGP CO  #RTKN  CPGTMCPPVG 5Q GPVUVCPFGP FKG FTGK MWTU·EJUKUEJGP 0GDGPNK   PKGP5CEJUGP9GK­GPHGNU5CEJUGP/GTUGDWTIWPF5CEJUGP<GKV\&CU*GT\QIVWO5CEJUGP<GKV\WOHC­VGCW­GTFGO XQTJGTKIGP 5VKHV 0CWODWTI<GKV\ FGP 8QIVN·PFKUEJGP WPF 0GWUV·FVGT -TGKU 6CWVGPDWTI WPF FGP CNDGTVKPKUEJGP   #PVGKN CP *GPPGDGTI &GT GTUVG *GT\QI NKG­ FKG CWHYGPFKIG /QTKV\DWTI GTDCWGP YQTCWH FKG JKGT CPIGDQVGPG 2T·   IWPI$G\WIPKOOV

957

959

958

958

5#%*5'0*'4<1)67/ 'TPGUVKPGTPCEJFGO8GTNWUVFGT-WTYÒTFG  

&KG 5ÌJPG ,QJCPP (TKGFTKEJU Y·JTGPF UGKPGT )GHCPIGPUEJCHV  5EJTGEMGPDGTIGT Q ,   5CCNHGNF-QRRG9CNFGJ 5GJTUEJÌP



,QJCPP (TKGFTKEJ ++  IGUVQTDGP  KP )GHCPIGPUEJCHV  6CNGT Q , 5CCNHGNF   -QRRGF 8QPITQ­GT5GNVGPJGKV5GJTUEJÌP 



5EJTGEMGPDGTIGT5CCNHGNF-QRRG9CNFG

172

5GJTUEJÌP






SACHSEN

960 961

961



5EJTGEMGPDGTIGT5CCNHGNF-QRRG9CNFGG

5GJTUEJÌP



,QJCPP9KNJGNO4GKEJUVCNGT5CCNHGNF/KV/ÒP\\GKEJGP8KGTKPU3WCFTCVIGUVGNNVG 2WPMVG&CX5EJPGG #VVTCMVKXGUXQT\ÒINKEJGU'ZGORNCT

 

962

963

963

5#%*5'0%1$74)'+5'0#%**'4<1)67/ 

,QJCPP %CUKOKT WPF ,QJCPP 'TPUV   4GKEJUVCNGT  5CCNHGNF )TCUUGT    -Q\KPQYUMK1VVQ4W­XCT *ÒDUEJG2CVKPCCVVTCMVKXGUHCUVXQT\ÒINKEJGU'ZGORNCT



&QRRGNVGT 4GKEJUVCNGT  ,CJTGU\CJN KO 5VGORGN CWU  IG·PFGTV  5CCNHGNF  I 5GEJUHCEJ   DGJGNOVGU9CRRGPOKV/KVVGNUEJKNF&GTIGJCTPKUEJVG*GT\QITGKVGVTKPFGT4GEJVGP-QOOCPFQUVCD KO*KPVGTITWPFTFKG8GUVG%QDWTI&CXD)TCUUGT-Q\KPQYUMK1VVQ4W­D5EJPGG  4.GKEJVMQTTQFKGTVHCUVXQT\ÒINKEJ 



964

965

965

5#%*5'0#.6'0$74)*'4<1)67/ 



,QJCPP 2JKNKRR (TKGFTKEJ ,QJCPP 9KNJGNO WPF (TKGFTKEJ 9KNJGNO ++  -KRRGT   5GEJUD·V\PGT -TGW\GT Q,5CCNHGNF$QTPGOCPPXCT  4/KPMQTTQFKGTVUGJTUEJÌPpXQT\ÒINKEJ



,QJCPP2JKNKRR,QJCPP9KNJGNOWPF(TKGFTKEJ9KNJGNO++4GKEJUVCNGT5CCNHGNF &CX-GTPDCEJ5EJPGG 8QT\ÒINKEJGU2TCEJVGZGORNCTOKVHGKPGT2CVKPC

 173


SACHSEN

967

966

966



,QUGH6CNGT#-5&CX-CJPV6JWP  W­GTUVUGNVGPKPFKGUGT'TJCNVWPI2TCEJVGZGORNCT5VGORGNINCP\



-W2HGPPKI#-5,

8QPRQNKGTVGP5VGORGNP5VGORGNINCP\





970

969

968



8GTGKPUFQRRGNVCNGT#-5&CX-CJPV6JWP  0WT'ZGORNCTGIGRT·IV-CDKPGVVUVÒEMXQPHGKPUVGT'TJCNVWPI *GTTNKEJG2CVKPC5VGORGNINCP\





8GTGKPUFQRRGNVCNGT#-5&CX-CJPV6JWP  0WT'ZGORNCTGIGRT·IV*ÒDUEJG2CVKPCXQT\ÒINKEJ





8GTGKPUFQRRGNVCNGT#-5&CX-CJPV6JWP  0WT'ZGORNCTGIGRT·IV8QT\ÒINKEJ



971

972

973

973



0GWITQUEJGP 2HGPPKIG #-5,

(CUV5VGORGNINCP\





0GWITQUEJGP 2HGPPKIG #-5,

(CUV5VGORGNINCP\





8GTGKPUFQRRGNVCNGT#-5&CX-CJPV6JWP

8QT\ÒINKEJ



174


SACHSEN

974

975

976



8GTGKPUFQRRGNVCNGT#-5&CX-CJPV6JWP(  (GKPG2CTVKPCXQT\ÒINKEJp5VGORGNINCP\





)GQTI8GTGKPUFQRRGNVCNGT#-5&CX-CJPV6JWP  42TCEJVGZGORNCTXQPHGKPUVGT'TJCNVWPI'TUVCDUEJNCIHCUV5VGORGNINCP\5VGORGNINCP\





8GTGKPUFQRRGNVCNGT#-5&CX-CJPV6JWP  )GTGKPKIVMN4CPFHGJNGTHCUVXQT\ÒINKEJ



977

 

978

-W2HGPPKI#-5, 'TPUV+-W2HGPPKI#-5,

 

980

979

 

(CUV5VGORGNINCP\ (CUV5VGORGNINCP\

8GTGKPUVCNGT#-5&CX-CJPV6JWP$ 8GTGKPUVCNGT#-5&CX-CJPV6JWP$

2TCEJVGZGORNCT(CUV5VGORGNINCP\ 8QT\ÒINKEJ

 

981

5#%*5'09'+/#4*'4<1)67/#$5#%*5'09'+/#4'+5'0#%* 

(TKGFTKEJ9KNJGNOWPF,QJCPP4GKEJUVCNGT5CCNHGNF&CX5EJPGG  *ÒDUEJG2CVKPCUGJTUEJÌP

 175


SACHSEN

983

982



4GKEJUVCNGT5CCNHGNF&CX5EJPGG  4#VVTCMVKXGU'ZGORNCTOKVJÒDUEJGT2CVKPCXQT\ÒINKEJ





4GKEJUVCNGT5CCNHGNF&CX5EJPGG



5GJTUEJÌP

985

984 (doppelt)



,QJCPP'TPUVWPFUGKPGUKGDGP$TÒFGT&KEMGTFQRRGNVGT4GKEJUVCNGT5CCNHGNF&CX 5EJPGG 5GJTUEJÌP



4GKEJUVCNGT5CCNHGNF&CX5EJPGG

5GJTUEJÌP

989



988

987

986



989



4GKEJUVCNGT5CCNHGNF&CX5EJPGG  7PIGYÌJPNKEJIWVCWUIGRT·IVGU'ZGORNCTOKVHGKPGT2CVKPCGVYCUTCWJXQT\ÒINKEJ 'KPGP9GKOCTGT5GEJUD·V\PGTCWUFGO5EJCV\HWPFXQP*GTDQTPHKPFGP5KGWPVGT0T



,QJCPP'TPUVWPFUGKPGHÒPH$TÒFGT4GKEJUVCNGT9GKOCT2CNNCUVCNGT&CX 5EJPGG #VVTCMVKXGUXQT\ÒINKEJGU'ZGORNCTOKVHGKPGT2CVKPC



9KNJGNO4GKEJUVCNGT9GKOCTCWHFKG'KPYGKJWPIFGTPGWGP5EJNQ­MKTEJG&CX 5EJPGG (GKPG2CVKPCOKP5EJTÌVNKPIUHGJNGTXQT\ÒINKEJ  'KPGP 9GKOCTGT 4GKEJUVCNGT  CWU FGT 5COONWPI FGT (TGKJGTTGP $QPFG HKPFGP 5KG KP -CVCNQI    WPVGT0T



&TGKGT9GKOCT-QRRG

176

8QT\ÒINKEJ








SACHSEN

991

992

990



4GKEJUVCNGT9GKOCTCWHUGKPGP6QF5NI/GTUGD  *GTTNKEJG2CVKPCHCUVXQT\ÒINKEJGU'ZGORNCT



'TPUV #WIWUV %QPUVCPVKP  DKU  WPVGT 8QTOWPFUEJCHV (TKGFTKEJU +++ XQP )QVJC    2HGPPKI'KUGPCEJ-QRRG 8QT\ÒINKEJp5VGORGNINCP\





-W2HGPPKI'KUGPCEJ-QRRG#PO



8QT\ÒINKEJ

993



994

995

995



6CNGT )TQUEJGP 'KUGPCEJ-QRRG#PO

(CUV5VGORGNINCP\





6CNGT )TQUEJGP 'KUGPCEJ-QRRG

(CUV5VGORGNINCP\





5QTVGPIWNFGP'KUGPCEJCWHUGKPGPQHHK\KGNNGP4GIKGTWPIUCPVTKVV&CX#-QRRG  8QT\ÒINKEJ



996

997

998



#PPC#OCNKC4GIGPVKP-QPX6CNGT'KUGPCEJ&CX#5EJPGG  -CDKPGVVUVÒEMOKVRTCEJVXQNNGT2CVKPC'TUVCDUEJNCI5VGORGNINCP\





-QPX6CNGT'KUGPCEJ&CX#5EJPGG  (GKPG2CVKPCYKP\5EJTÌVNKPIUHGJNGTMN5VGORGNDTWEJXQT\ÒINKEJGU'ZGORNCT





-QPX6CNGT'KUGPCEJ&CX5EJPGG



#VVTCMVKXGUXQT\ÒINKEJGU'ZGORNCT

177


SACHSEN

1000

999

999



-QPX6CNGT'KUGPCEJ-QRRG



%CTN#WIWUV5GEJUGT *CNDITQUEJGP 'KUGPCEJ-QRRG

1001

(GKPG2CVKPCXQT\ÒINKEJ



(CUV5VGORGNINCP\



1002



-QPX6CNGT/KV.CWDTCPF#-5&CX-CJPV6JWP  #VVTCMVKXGU'ZGORNCTOKVJÒDUEJGT2CVKPCXQT\ÒINKEJ





-QPX6CNGT/KV.CWDTCPF#-5&CX-CJPV6JWP



1003

/KPLWUVKGTVXQT\ÒINKEJ

1004



-QPX6CNGT#-5,

*ÒDUEJG2CVKPCXQT\ÒINKEJ





-QPX6CNGT&GO8CVGTNCPFG#-5&CX-CJPV6JWP  5GJTCVVTCMVKXGU'ZGORNCTOKVJGTTNKEJGT2CVKPCXQT\ÒINKEJ



1005

1006



-QPX6CNGT&GO8CVGTNCPFG#-5&CX-CJPV6JWP  *ÒDUEJG2CVKPCYKP\4CPFHGJNGTUGJTUEJÌPpXQT\ÒINKEJ





-QPX6CNGT&GO8CVGTNCPFG#-5&CX-CJPV6JWP  -N5EJTÌVNKPIUHGJNGTUGJTUEJÌPpXQT\ÒINKEJ



178


SACHSEN

1007 1008

1008



%CTN(TKGFTKEJ-W2HGPPKI#-5,

8QT\Ã&#x2019;INKEJ





8GTGKPUFQRRGNVCNGT#-5&CX-CJPV6JWP  2TCEJVGZGORNCT(GKPG2CVKPCHCUV5VGORGNINCP\



1010

1009

1011

1012

 

6CNGT#-5&CX-CJPV6JWP 8GTGKPUFQRRGNVCNGT#-5&CX-CJPV6JWP

8QT\Ã&#x2019;INKEJ (CUVXQT\Ã&#x2019;INKEJ

 



%CTN#NGZCPFGT8GTGKPUFQRRGNVCNGT#-5&CX-CJPV6JWP  /KP4CPFHGJNGTXQT\Ã&#x2019;INKEJ





8GTGKPUVCNGT#-5&CX-CJPV6JWP

1014

1013

     

1016

 8QPRQNKGTVGP5VGORGNPHCUV5VGORGNINCP\



1017

1013

8GTGKPUVCNGT#-5&CX-CJPV6JWP 8QT\Ã&#x2019;INKEJ 5KNDGTITQUEJGP#-5, (CUV5VGORGNINCP\ -W2HGPPKI#-5, (CUV5VGORGNINCP\ -W2HGPPKI#-5, 2QNKGTVG2NCVVG -W2HGPPKI#-5, 8QPRQNKGTVGP5VGORGNPXQT\Ã&#x2019;INKEJp5VGORGNINCP\ -W2HGPPKI#-5, (CUV5VGORGNINCP\

      179


SACHSEN

1019

1020



8GTGKPUVCNGT#-5&CX-CJPV6JWP  (GKPG2CVKPCXQT\Ã&#x2019;INKEJXQT\Ã&#x2019;INKEJp5VGORGNINCP\





8GTGKPUVCNGT#-5&CX-CJPV6JWP  5GJTUGNVGPKPFKGUGT'TJCNVWPI2TCEJVGZGORNCT2QNKGTVG2NCVVGOKPDGTÃ&#x2019;JTV



1022

1021



8GTGKPUVCNGT#-5&CX-CJPV6JWP

8QT\Ã&#x2019;INKEJ



5#%*5'0'+5'0#%**'4<1)67/ 

,QJCPP 9KNJGNO  5KNDGTOGFCKNNG  XQP %JT 9GTOWVJ CWH FKG ,CJTHGKGT FGT 4G   HQTOCVKQP $TWUVDKNF T-GT\G JKPVGT CWHIGUEJNCIGPGO $WEJ  OO  I 5NI /GTUGD    5NI9JKVKPI9QJNHCJTV *Ã&#x2019;DUEJG2CVKPCHCUVXQT\Ã&#x2019;INKEJ



1024

1023

1023

5#%*5'0)16*#*'4<1)67/#$5#%*5'0)16*##.6'0$74) 

 180

'TPUV FGT (TQOOG  4GKEJUVCNGT  )QVJC CWH FGP9GUVH·NKUEJGP(TKGFGP&CX &GVJ1TF2CZKP0WOOKU5EJPGG5VGIWYGKV  #VVTCMVKXGU'ZGORNCT4GUVGXQP<CRQPNCEMXQT\Ã&#x2019;INKEJ



6CNGT PCEJ \KPPCKUEJGO (W­  )QVJC QFGT 'KUNGDGP -CVGEJKUOWUVCNGT &CX  5EJPGG    5VGIWYGKV 5GNVGPKPFKGUGT'TJCNVWPI5GJTCVVTCMVKXGUXQT\Ã&#x2019;INKEJGU'ZGORNCT 


SACHSEN

1025



(TKGFTKEJ + CNNGKP   HCEJGT (GKPUKNDGTVCNGT PCEJ \KPPCKUEJGO (W­ Q , )QVJC   &CX5EJPGG5VGIWYGKV FQTVCNU(GKPUKNDGTUEJCWVCNGT   4#VVTCMVKXGU'ZGORNCTOKVJÒDUEJGT2CVKPCUGJTUEJÌPpXQT\ÒINKEJ 

1027

1026

1026



5KNDGTOGFCKNNGQ, WO XQP,)5QTDGTIGT)GJCTPKUEJVGU$TWUVDKNFTOKVWOIGNGIVGO/CPVGN 5EJKHHOKVGKPIGJQNVGP5GIGNPCWH/GGTFCXQT.CPFCDUEJPKVVOOI5NI/GTUGD 44(CUUWPIUURWTGP(GNFGTUVCTMIGIN·VVGVWPFDGCTDGKVGVUGJTUEJÌP



6CNGT)QVJC5VGIWYGKV#PO

8QT\ÒINKEJp5VGORGNINCP\

 

1029

1028

1028



(TKGFTKEJ ++  6CNGT PCEJ .GKR\KIGT (W­  )QVJC CWH FKG 6CWHG %JTKUVK &CX p   5EJPGG5VGIWYGKV 5GJTUEJÌP





6CNGT)QVJC&CX5VGIWYGKV



5GJTUEJÌP

181


SACHSEN

1030

1031

1031



4GKEJUVCNGT)QVJCCWHFKG,CJTHGKGTFGT4GHQTOCVKQP5NI9JKVKPI5VGIWYGKV  48QT\Ã&#x2019;INKEJ





4GKEJUVCNGT)QVJC(COKNKGPVCNGT&CX5EJPGG5VGIWYGKV  #VVTCMVKXGU'ZGORNCTOKVJGTTNKEJGT2CVKPCXQT\Ã&#x2019;INKEJ



1033

1032

1032



(TKGFTKEJ +++  4GKEJUVCNGT  'KUGPCEJ CWH FKG ,CJTHGKGT FGU 4GNKIKQPUHTKGFGPU   &CX5EJPGG  5NI9JKVKPI 4-N4GUVGCNVGT6KPVGPUEJTKHVXQT\Ã&#x2019;INKEJ 



 )TQUEJGP  )QVJC CWH FKG ,CJTHGKGT FGU 4GNKIKQPUHTKGFGPU 5NI 9JKVKPI  FQTV CNU    6CNGTDG\GKEJPGV 5VGIWYGKV 2TCEJVGZGORNCT*GTTNKEJG2CVKPCHCUV5VGORGNINCP\

1034

1035

1036

1037



1038



)TQUEJGP)QVJCCWHFKG,CJTHGKGTFGU4GNKIKQPUHTKGFGPU5NI9JKVKPI5VGIWYGKV (CUV5VGORGNINCP\





)TQUEJGP  )QVJC CWH FKG ,CJTHGKGT FGU 4GNKIKQPUHTKGFGPU 5NI 9JKVKPI  HCNUEJG #DD    5VGIWYGKV 2TCEJVGZGORNCT5VGORGNINCP\



 

2HGPPKI)QVJC5VGIWYGKV -W2HGPPKI)QVJC5VGIWYGKV#PO

2TCEJVGZGORNCT5VGORGNINCP\ -N-TCV\GTHCUV5VGORGNINCP\

 



6CNGT)QVJC5VGIWYGKV  5GNVGPDGUQPFGTUKPFKGUGT'TJCNVWPI2TCEJVGZGORNCT5VGORGNINCP\



182


SACHSEN

1040

1039

1039



-QPX6CNGT)QVJC&CX#5EJPGG5VGIWYGKV  /KP5EJTÌVNKPIUHGJNGTXQT\ÒINKEJp5VGORGNINCP\





-QPX6CNGT)QVJC5VGIWYGKV



2TCEJVGZGORNCT(CUV5VGORGNINCP\

1042

1041



-QPX6CNGT)QVJC&CX5EJPGG5VGIWYGKV  2TCEJVGZGORNCTOKVHGKPGT6ÌPWPI5VGORGNINCP\





-QPX6CNGT)QVJC&CX5EJPGG5VGIWYGKV  W­GTUVUGNVGPGT,CJTICPI2TCEJVXQNNG2CVKPCHCUV5VGORGNINCP\



1043

1044

ex 1046

1045

1047

  

6CNGT)QVJC5VGIWYGKV -W*GNNGT)QVJC5VGIWYGKV 6CNGT)QVJC5VGIWYGKV

2TCEJVGZGORNCT5VGORGNINCP\ 5VGORGNINCP\ (CUV5VGORGNINCP\

  



6CNGT)QVJC6CNGT)QVJCDGKFGCWHUGKPGP6QF5VGIWYGKV  5VÒEM(CUV5VGORGNINCP\





6CNGT)QVJC5VGIWYGKV

1049

 

2TCEJVGZGORNCT5VGORGNINCP\

1048

'TPUV++6CNGT)QVJC5VGIWYGKV -QPX6CNGT)QVJC&CX5EJPGG5VGIWYGKV



1049

2TCEJVGZGORNCT5VGORGNINCP\ 8QT\ÒINKEJ

  183


SACHSEN

1050

1051



-QPX6CNGT)QVJC8CTKCPVGOKV/Ã&#x2019;P\\GKEJGP-TCPKEJWPVGTFGO-QRH5VGIWYGKV#PO 2TCEJVGZGORNCTOKVHGKPGT2CVKPC5VGORGNINCP\





-QPX6CNGT)QVJC5VGIWYGKV



2TCEJVXQNNG2CVKPCXQT\Ã&#x2019;INKEJp5VGORGNINCP\

1052

1053

1053

5#%*5'0/'+0+0)'0*'4<1)67/ 810$+55#%*5'0%1$74)/'+0+0)'0 



-CTN-NGKPG5KNDGTOGFCKNNGCWHUGKPG*QEJ\GKVOKV.WKUGXQP5VQNDGTI)GFGTP<YGK IGHNÃ&#x2019;IGNVG )GPKGP XGTMPÃ&#x2019;RHGP FWTEJ GKPGP .KGDGUMPQVGP FKG DGKFGP 9CRRGPUEJKNFG XQP 5CEJUGP WPF   5VQNDGTI FCTÃ&#x2019;DGT 5EJTKHV5GEJU <GKNGP 5EJTKHV  OO  I (TKGFGTKEJ  )TQDG  5NI   /GTUGD 2TCEJVGZGORNCT(CUV5VGORGNINCP\



$GTPJCTF 'TKEJ (TGWPF  -QPX6CNGT Q ,   CWH FGP 6QF UGKPGU 8CVGTU *GT\QI   )GQTICO9GKJPCEJVUHGUV#-5C&CX-CJPV6JWP  2TCEJVGZGORNCTOKVHGKPGT2CVKPC-N5VGORGNHGJNGT5VGORGNINCP\ 

1055

1054

1055



-TGW\GT#-5,  5GNVGPDGUQPFGTUKPFKGUGT'TJCNVWPI2TCEJVGZGORNCT(CUV5VGORGNINCP\





)WNFGP#WUDGWVG#-5,



1056

8QT\Ã&#x2019;INKEJ

1057



)WNFGP.#-5,  5GNVGPDGUQPFGTUKPFKGUGT'TJCNVWPI2TCEJVGZGORNCT(CUV5VGORGNINCP\





)WNFGP#-5,



184

9KP\4CPFHGJNGTHCUV5VGORGNINCP\


SACHSEN

1058 1059

1059



)WNFGP#-5,

8QT\ÒINKEJ





8GTGKPUFQRRGNVCNGT#-5&CX-CJPV6JWP  9KP\4CPFHGJNGTUGJTUEJÌPpXQT\ÒINKEJ



1060

1061

1062



8GTGKPUFQRRGNVCNGT#-5&CX-CJPV6JWP  -N4CPFXGTRT·IWPIXQT\ÒINKEJp5VGORGNINCP\





8GTGKPUFQRRGNVCNGT#-5&CX-CJPV6JWP

4CPFHGJNGTUGJTUEJÌP





8GTGKPUFQRRGNVCNGT#-5&CX-CJPV6JWP

(CUVXQT\ÒINKEJ



5GJTUEJÌPpXQT\ÒINKEJ



2TCEJVGZGORNCT(CUV5VGORGNINCP\



1063

1064

1063



8GTGKPUFQRRGNVCNGT#-5&CX-CJPV6JWP



&QRRGNIWNFGP#-5&CX-CJPV6JWP

185


SACHSEN

1066

1065

1066



)WNFGP#-5,

2TCEJVXQNNG2CVKPCHCUV5VGORGNINCP\





8GTGKPUVCNGT#-5&CX-CJPV6JWP  -CDKPGVVUVÃ&#x2019;EM2TCEJVXQNNG2CVKPCXQPRQNKGTVGP5VGORGNP5VGORGNINCP\



1068

1067

 

8GTGKPUVCNGT#-5&CX-CJPV6JWP 8GTGKPUVCNGT#-5&CX-CJPV6JWP

1069

8QT\Ã&#x2019;INKEJp5VGORGNINCP\ 8QT\Ã&#x2019;INKEJ

 

1070



8GTGKPUVCNGT#-5&CX-CJPV6JWP

8QT\Ã&#x2019;INKEJp5VGORGNINCP\





8GTGKPUVCNGT#-5&CX-CJPV6JWP  *GTTNKEJG2CVKPCXQT\Ã&#x2019;INKEJp5VGORGNINCP\



1071

1073

1073



)GQTI++8GTGKPUVCNGT#-5&CX-CJPV6JWP  5GJTCVVTCMVKXGU'ZGORNCTOKVJGTTNKEJGT2CVKPCXQT\Ã&#x2019;INKEJ





.QV)WNFGP-TGW\GT-TGW\GT-W-TGW\GT-W2HGPPKI -W2HGPPKI-W-TGW\GT 5VÃ&#x2019;EM/GKUVXQT\Ã&#x2019;INKEJ



5#%*5'0*+.&$74)*#75'0*'4<1)67/  186

'TPUV (TKGFTKEJ -CTN  -QPX6CNGT  *KNFDWTIJCWUGP &CX  *QNNOCPP    5EJPGG 2TCEJVXQNNG2CVKPCXQT\Ã&#x2019;INKEJp5VGORGNINCP\ 


SACHSEN

1075 1074

1074



-QPX6CNGT*KNFDWTIJCWUGP8CTKCPVGOKVCPFGTGO8QTFGTUGKVGPUVGORGN&CX*QNNOCPP 5EJPGG #VVTCMVKXGU'ZGORNCTOKVJÒDUEJGT2CVKPCGVYCURQTÌUGT5EJTÌVNKPIHCUVXQT\ÒINKEJ





6CNGT*KNFDWTIJCWUGP*QNNOCPP



(CUV5VGORGNINCP\

1077 1076





1076

,QUGH(TKGFTKEJ8QTOWPFHÒT(TKGFTKEJ-QPX6CNGTQ,  *KNFDWTIJCWUGP CWHUGKPGP6QF&CX*QNNOCPP5EJPGG  5GNVGPKPFKGUGT'TJCNVWPI*GTTNKEJG2CVKPCUGJTCVVTCMVKXGUXQT\ÒINKEJGU'ZGORNCT (TKGFTKEJ-TGW\GT#-5,

48QT\ÒINKEJp5VGORGNINCP\

 

1079

1078

1078

5#%*5'05##.('.&*'4<1)67/#$5#%*5'0%1$74)5##.('.& 

,QJCPP 'TPUV 8+++  4GKEJUVCNGT  5CCNHGNF &CX  -Q\KPQYUMK1VVQ4W­    5EJPGG 44(GKPG6ÌPWPIYKP\4CPFHGJNGTUGJTUEJÌP 



4GKEJUVCNGT5CCNHGNFCWHUGKPG8GTO·JNWPIOKV%JCTNQVVC,QJCPPGXQP9CNFGEM  Ó 6QEJVGTFGU)TCHGP,QUKCU&CX#-Q\KPQYUMK1VVQ4W­55EJPGG  44#VVTCMVKXGU'ZGORNCTOKVHGKPGT2CVKPCYKP\-TCV\GTXQT\ÒINKEJ  187


SACHSEN

1082

1080

1081



4GKEJUVCNGT5CCNHGNF&CX-Q\KPQYUMK1VVQ4W­5EJPGG  48QT\ÒINKEJGU2TCEJVGZGORNCTOKVJGTTNKEJGT2CVKPC





4GKEJUVCNGT5CCNHGNFCWHFKG,CJTHGKGTFGT4GHQTOCVKQP&CX#-Q\KPQYUMK1VVQ4W­ 5EJPGG5NI9JKVKPI 45GJTCVVTCMVKXGU'ZGORNCTOKVJÒDUEJGT2CVKPCXQT\ÒINKEJ





 4GKEJUVCNGT  5CCNHGNF CWH FKG ,CJTHGKGT FGT 4GHQTOCVKQP -Q\KPQYUMK1VVQ4W­    5NI9JKVKPI 5GNVGPDGUQPFGTUKPFKGUGT'TJCNVWPI8QT\ÒINKEJGU2TCEJVGZGORNCT 

1083

1085

1084



 4GKEJUVCNGT  5CCNHGNF CWH FKG ,CJTHGKGT FGT 4GHQTOCVKQP -Q\KPQYUMK1VVQ4W­    5NI9JKVKPI 4*GTTNKEJG2CVKPCXQT\ÒINKEJGU'ZGORNCT





 4GKEJUVCNGT  5CCNHGNF CWH FKG ,CJTHGKGT FGT 4GHQTOCVKQP -Q\KPQYUMK1VVQ4W­    5NI9JKVKPI *ÒDUEJG2CVKPCUGJTUEJÌP



'ZGORNCTFGT#WMVKQP(TKV\4WFQNH-ÒPMGT1UPCDTÒEM0T



 4GKEJUVCNGT  5CCNHGNF CWH FKG ,CJTHGKGT FGT 4GHQTOCVKQP -Q\KPQYUMK1VVQ4W­    5NI9JKVKPI 8QT\ÒINKEJGU'ZGORNCTOKVHGKPGT6ÌPWPI 'ZGORNCT FGT 5NI 9JKVKPI #WMVKQP 5RKPM  5QP <ÒTKEJ WPF % ' $WNNQYC %QKPJWPVGT 2JKNCFGNRJKC <ÒTKEJ   0T

188




SACHSEN

1086

1087

1088



4GKEJUVCNGT5CCNHGNF#WUDGWVGFGT5CCNHGNFGT)TWDGPI)GJCTPKUEJVGU$TWUVDKNFTKPFGT 4GEJVGP -QOOCPFQUVCD FKG .KPMG NKGIV CWH GKPGO *GNO OKV )KVVGTXKUKGT WPF (GFGTUEJOWEM5VCFVCP   UKEJVOKVFGT5CCNGQJPG$TÒEMGKO8QTFGTITWPFQDGPJCNVGP\YGKCWU9QNMGPMQOOGPFG*·PFGGKPGP UVTCJNGPFGP.QTDGGTMTCP\ÒDGTFKG5VCFV&CX$-Q\KPQYUMK1VVQ4W­D/ÒUGNGTD 5EJPGG  W­GTUVUGNVGPG8CTKCPVG2TCEJVGZGORNCTOKVRTCEJVXQNNGT2CVKPC8QT\ÒINKEJp5VGORGNINCP\ 



4GKEJUVCNGT  5CCNHGNF #WUDGWVG FGT 5CCNHGNFGT )TWDGP &CX  -Q\KPQYUMK1VVQ4W­    /ÒUGNGTC5EJPGG 448QT\ÒINKEJGU2TCEJVGZGORNCTOKVRTCEJVXQNNGT2CVKPC 



4GKEJUVCNGT  5CCNHGNF #WUDGWVG FGT 5CCNHGNFGT )TWDGP &CX  -Q\KPQYUMK1VVQ4W­    /ÒUGNGTC5EJPGG 44/KPIGTGKPKIVXQT\ÒINKEJ 

1090

1089

1089



4GKEJUVCNGT5CCNHGNF#WUDGWVGFGT5CCNHGNFGT)TWDGPI)GJCTPKUEJVGU$TWUVDKNFTKPFGT 4GEJVGP-QOOCPFQUVCDFKG.KPMGCWHGKPGP*GNOIGNGIV5VCFVCPUKEJVOKVFGT5CCNGKO8QTFGTITWPF QDGP JCNVGP \YGK CWU 9QNMGP MQOOGPFG *·PFG GKPGP UVTCJNGPFGP .QTDGGTMTCP\ ÒDGT FKG 5VCFV KO   #DUEJPKVV*COOGTWPF5EJNGIGNIGMTGW\VFCTÒDGTFGT$WEJUVCDG#\WFGP5GKVGPFKGIGVGKNVG,CJTGU \CJNWPFFKG5KIPCVWT+Û/Û' ,QJCPP/KEJCGN'FNGT/ÒP\OGKUVGTKP5CCNHGNF  &CX-Q\KPQYUMK1VVQ4W­/ÒUGNGT5EJPGG  448QT\ÒINKEJGU2TCEJVGZGORNCT 



4GKEJUVCNGT5CCNHGNF-Q\KPQYUMK1VVQ4W­

45GJTUEJÌPpXQT\ÒINKEJ

 189


SACHSEN

1092

1091

1091



4GKEJUVCNGT5CCNHGNF#WUDGWVGFGT5CCNHGNFGT)TWDGPI)GJCTPKUEJVGU$TWUVDKNFTKPFGT 4GEJVGP-QOOCPFQUVCDFKG.KPMGCWHGKPGP*GNOIGNGIV5VCFVCPUKEJVOKVFGT5CCNGKO8QTFGTITWPF QDGPUVTCJNGPFG5QPPGKO#DUEJPKVV*COOGTWPF5EJNGIGNIGMTGW\V\WFGP5GKVGPFKGIGVGKNVG,CJTGU \CJNWPFFKG5KIPCVWT+/'c ,QJCPP/KEJCGN'FNGT/ÒP\OGKUVGTKP5CCNHGNF  &CX-Q\KPQYUMK1VVQ4W­/ÒUGNGT5EJPGG  8QPITQ­GT5GNVGPJGKV5GJTCVVTCMVKXGU'ZGORNCTOKVJÒDUEJGT2CVKPCXQT\ÒINKEJ 



4GKEJUVCNGT5CCNHGNFCWHUGKPGP6QF-Q\KPQYUMK1VVQ4W­  *ÒDUEJG2CVKPCHCUV5VGORGNINCP\

1093



1094



)TQUEJGP5CCNHGNFCWHUGKPGP6QF-Q\KPQYUMK1VVQ4W­ 2TCEJVGZGORNCT5VGORGNINCP\





%JTKUVKCP'TPUVCNNGKP5KNDGTCDUEJNCIXQPFGP5VGORGNPFGU&QRRGNFWMCVGP5CCNHGNF CWHFGP6QFUGKPGT)GOCJNKP%JTKUVKCPG(TKGFGTKMG-Q\KPQYUMK1VVQ4W­C  (GKPG6ÌPWPIXQT\ÒINKEJ



1095

1096

1096



5KNDGTCDUEJNCI XQP FGP 5VGORGNP FGU &QRRGNFWMCVGP Q ,   5CCNHGNF CWH UGKPGP 6QF -Q\K   PQYUMK1VVQ4W­C -N5VGORGNHGJNGTUGJTUEJÌP





'TPUV(TKGFTKEJ-QPX6CNGT5CCNHGNF&CX#-Q\KPQYUMK1VVQ4W­G 5EJPGG 9KP\5EJTÌVNKPIUHGJNGTXQT\ÒINKEJp5VGORGNINCP\



190


SACHSEN

1098 1097

1097



(TCP\(TKGFTKEJ#PVQP-QPX6CNGT#-5p&CX-CJPV6JWP  40WTEC'ZGORNCTGIGRT·IV-N-TCV\GTXQT\ÒINKEJ





'TPUV+-TGW\GTHÒT%QDWTI#-5,



48QT\ÒINKEJ

1100

1099



-QPX6CNGT/KV4CPFUEJTKHV'+052'%+'56*#.'4#-5&CX-CJPV6JWP 8QT\ÒINKEJp5VGORGNINCP\





-QPX6CNGT/KV4CPFUEJTKHV'+052'%+'56*#.'4#-5&CX-CJPV6JWP (GKPG2CVKPCXQT\ÒINKEJGU2TCEJVGZGORNCT



1102

1101

1102



-TGW\GTHÒT%QDWTI#-5,

8QT\ÒINKEJp5VGORGNINCP\



-TQPGPVCNGT/KV4CPFUEJTKHV'+0-4106*#.'4#-5&CX-CJPV6JWP 8QPITQ­GT5GNVGPJGKV0WT'ZGORNCTGIGRT·IV #VVTCMVKXGU'ZGORNCTOKV2T·IGINCP\OKP5EJTÌVNKPIUHGJNGTXQT\ÒINKEJ



6CNGT-TGW\GT Z -TGW\GT

5VÒEM/GKUVXQT\ÒINKEJWPFDGUUGT

1104

  

1105

5#%*5'0%1$74)70&)16*#*'4<1)67/ 

'TPUV+-TQPGPVCNGT#-5&CX-CJPV6JWP  -CDKPGVVUVÒEM2TCEJVXQNNG2CVKPC5VGORGNINCP\





-TQPGPVCNGT#-5&CX-CJPV6JWP  9KP\4CPFHGJNGTYKP\5EJTÌVNKPIUHGJNGTXQT\ÒINKEJ

 191


SACHSEN

1106 1107

1107



-TGW\GT#-5,

(CUV5VGORGNINCP\





-QPX6CNGT/KVINCVVGO4CPF#-5&CX-CJPV6JWP  42TCEJVGZGORNCT'TUVCDUEJNCIHCUV5VGORGNINCP\



1108

1109



-QPX6CNGT#-5,



-TGW\GT#-5#PO,



-QPX6CNGT#-5,



-TGW\GT#-5,

1115

1112

1111

(GKPG2CVKPCUGJTUEJÌPpXQT\ÒINKEJXQT\ÒINKEJ



8QT\ÒINKEJ



2TCEJVXQNNG2CVKPCXQT\ÒINKEJ



2TCEJVGZGORNCT(CUV5VGORGNINCP\CWURQNKGTVGT2NCVVG



1113



-TGW\GT#-5,

  

-TGW\GT#-5,



-TGW\GT#-5,



-TGW\GT-TGW\GT#-5,

192

1110

1114

1116

8QT\ÒINKEJ



-W2HGPPKI#-5,

8QPRQNKGTVGP5VGORGNPXQT\ÒINKEJ



-W2HGPPKI#-5,

(CUV5VGORGNINCP\



8QT\ÒINKEJ



(CUV5VGORGNINCP\



5VÒEM8QT\ÒINKEJp5VGORGNINCP\




SACHSEN

1118

1119

1119



-TGW\GT#-5,

8QT\ÒINKEJp5VGORGNINCP\





8GTGKPUFQRRGNVCNGT#-5&CX-CJPV6JWP  (GKPG2CVKPCXQT\ÒINKEJXQT\ÒINKEJp5VGORGNINCP\



1121

1120

1120



6CNGT#-5&CX-CJPV6JWP  ªDGTFWTEJUEJPKVVNKEJGTJCNVGP2CVKPCUGJTUEJÌPpXQT\ÒINKEJ





6CNGT#-5,



1122

*GTTNKEJG2CVKPCXQT\ÒINKEJp5VGORGNINCP\

1123

1124

1125



8GTGKPUFQRRGNVCNGT#-5&CX-CJPV6JWP

(CUVXQT\ÒINKEJ





6CNGT#-5&CX-CJPV6JWP  2TCEJVGZGORNCTOKVHGKPGT6ÌPWPI(CUV5VGORGNINCP\





6CNGT#-5&CX-CJPV6JWP

*ÒDUEJG2CVKPCXQT\ÒINKEJ





8GTGKPUFQRRGNVCNGT#-5&CX-CJPV6JWP  'TUVCDUEJNCIHGKPG2CVKPCXQT\ÒINKEJp5VGORGNINCP\

 193


SACHSEN

1126

1127

1129

1128



8GTGKPUFQRRGNVCNGT#-5&CX-CJPV6JWP

5GJTUEJÌP





'TPUV++6CNGT#-5&CX-CJPV6JWP  5GNVGPKPFKGUGT'TJCNVWPI(GKPG2CVKPCXQT\ÒINKEJp5VGORGNINCP\





8GTGKPUFQRRGNVCNGT#-5&CX-CJPV6JWP  8QT\ÒINKEJGU'ZGORNCTOKVHGKPGT6ÌPWPI





6CNGT#-5&CX-CJPV6JWP

1130

1132

8QT\ÒINKEJ

1133



1131



8GTGKPUFQRRGNVCNGT#-5&CX-CJPV6JWP  'TUVCDUEJNCIXQT\ÒINKEJp5VGORGNINCP\





8GTGKPUFQRRGNVCNGT#-5&CX-CJPV6JWP  <CRQPKGTVYKP\4CPFHGJNGTUGJTUEJÌPpXQT\ÒINKEJ





8GTGKPUVCNGT#-5&CX-CJPV6JWP

8QT\ÒINKEJp5VGORGNINCP\





8GTGKPUVCNGT#-5&CX-CJPV6JWP

8QT\ÒINKEJ



194


SAYN

1134

1136

1135

1135



6CNGT#-5,

8QT\ÒINKEJp5VGORGNINCP\





8GTGKPUVCNGTL·JTKIGU4GIKGTWPIULWDKN·WO#-5&CX-CJPV6JWP  (GKPG2CVKPCXQT\ÒINKEJGU'ZGORNCTXQPRQNKGTVGP5VGORGNP





6CNGTL·JTKIGU4GIKGTWPIULWDKN·WO#-5,

1137

1139

8QT\ÒINKEJp5VGORGNINCP\



1138

5#;0 5#;09+66)'056'+0*1*'056'+0)4#(5%*#(6 

)WUVCX6CNGT'NNTKEJ&CX/,8

5GJTUEJÌP





/CTKGPITQUEJGPWPDGUVKOOVG/ÒP\UV·VVG&CX/,8  44(GKPG2CVKPCYKP\5EJTÌVNKPIUHGJNGTUGJTUEJÌP



5#;0*#%*'0$'4))4#(5%*#(6 

)GQTI(TKGFTKEJXQP-KTEJDGTI4GKEJUVCNGT IGRT·IV #NVGPMKTEJGPCWHUGKPGP 6QF#WUDGWVGFGT)TWDG5V/KEJCGNDGK*COOI)GJCTPKUEJVGU$TWUVDKNFTOKVWOIGNGIVGO /CPVGNKO#DUEJPKVVXKGT<GKNGP5EJTKHV$GTIYGTMUNCPFUEJCHVNKO8QTFGTITWPFFCU&QTH*COOT FGT5EJCEJV5V/KEJCGNOKV(ÌTFGTJCURGNKPFGT/KVVGFCU5VQNNGPOWPFNQEJFGU5GNNDCEJUVQNNGPUUQYKG YGKVGTG5EJ·EJVGFWTEJ(ÌTFGTJCURGNPWPF*CNFGPCPIGFGWVGV&CX/,8/ÒUGNGT 440WT'ZGORNCTGIGRT·IV*ÒDUEJG2CVKPCUGJTUEJÌPpXQT\ÒINKEJ  195


SCHLESIEN

1141

1140

1140

5%*#7/$74).+22' 5%*#7/$74).+22')4#(5%*#(65'+6(ª456'067/ 

)GQTI 9KNJGNO  &QRRGNVGT 8GTGKPUVCNGT  L·JTKIGU 4GIKGTWPIULWDKN·WO #-5    &CX-CJPV6JWP 8QT\ÒINKEJ





#FQNH)GQTI8GTGKPUVCNGT#-5&CX-CJPV6JWP



8QT\ÒINKEJ

1143

1142

1142

5%*.'5+'0 .+')0+6<$4+')*'4<1)67/ 

,QJCPP%JTKUVKCPWPF)GQTI4WFQNH4GKEJUVCNGT4GKEJGPUVGKP&CX(W5 5GJTUEJÌP



)GQTI +++   4GKEJUVCNGT  CWH FGP 6QF UGKPGT  )GOCJNKP 'NKUCDGVJ /CTKC %JCT   NQVVGXQP2HCN\5KOOGTP(W5  *ÒDUEJG2CVKPCMN5EJTÌVNKPIUHGJNGTCO4CPFNGKEJVG2T·IGUEJY·EJGXQT\ÒINKEJ





1144



196

)GQTI9KNJGNOHCEJGT4GKEJUVCNGT5-$TKGICWHUGKPGP6QFI)QNF UEJOKGF5COWGN-QNNGT&CX(W5p \W   2CVKPC5EJTÌVNKPIUHGJNGTCO4CPFUGJTUEJÌP 


SCHLESIEN

1145

1147

1146

/ª056'4$'4)1'.5*'4<1)67/ 

*GKPTKEJ9GP\GNWPF-CTN(TKGFTKEJ4GKEJUVCNGT$*1GNU/ÒP\OGKUVGT$WTMJCTV *CUG&CX(W5 #VVTCMVKXGU'ZGORNCTOKVJÒDUEJGT2CVKPCUGJTUEJÌP



'ZGORNCTFGT5COONWPI-NCWU2TQRR#WMVKQP(TKV\4WFQNH-ÒPMGT1UPCDTÒEM0T



4GKEJUVCNGT$*1GNU/ÒP\OGKUVGT$WTMJCTV*CUG&CX(W5

5GJTUEJÌP





)GQTI(TKGFTKEJ4GKEJUVCNGT,·IGTPFQTH&CX(W5  5GJTCVVTCMVKXGUHCUVXQT\ÒINKEJGU'ZGORNCT



,)'40&14(*'4<1)67/

1148

1149

1149

6'5%*'0*'4<1)67/ 

(TKGFTKEJ9KNJGNO-KRRGT-TGW\GT(W5p XINFQTVOKV5KIPCVWT*.  5NI-TCC\p5NI.ÌHHNGTp XINFQTVOKV5KIPCVWT*. 5NI5VTKGDQNNp XINFQTVOKV5K IPCVWT*.  8QPITQ­GT5GNVGPJGKV5GJTUEJÌP



/'&#+..'0 

5KNDGTOGFCKNNGXQP,-KVVGNCWHFKG*GWUEJTGEMGPRNCIGKP5EJNGUKGP-TKGEJGPFG*GWUEJTGEMGN )GVTGKFGHGNFOKV)GFGPMUVGKPWPVGTGKPGO$CWOOOI(W55NI$TGVVCWGT 44*ÒDUEJG2CVKPCCVVTCMVKXGUHCUVXQT\ÒINKEJGU'ZGORNCT

 197


SCHLESWIG-HOLSTEIN

1150

1151







1152

5KNDGTOGFCKNNG Q , XQP , -KVVGN )NWEMJGPPGPOGFCKNNG )NWEMJGPPG OKV -ÒMGP WPVGT GKPGO (GKIGP   DCWO FGT XQP 9GKPTGDGP WOTCPMV KUV \W FGP 5GKVGP 1NKXGPD·WOG2GTUQPKHK\KGTVG )GTGEJVKIMGKV OKV   5EJYGTV9CCIGWPF2CNO\YGKIWPFRGTUQPKHK\KGTVGT(NGK­OKV$KGPGPMQTDUVGJGPCP#NVCTCWHFGOGKP CWHIGUEJNCIGPGU$WEJNKGIVQDGPUVTCJNGPFGT0COG,GJQXCUOOI(W5  -N4CPFHGJNGTUGJTUEJÌPGU'ZGORNCTOKVHGKPGT6ÌPWPI



5KNDGTOGFCKNNGQ, ,CJTJWPFGTV WPUKIPKGTVXGTOWVNKEJXQP,-KVVGNCWHFKG(TGWPFUEJCHV<YGK KPGKPCPFGTITGKHGPFG*·PFGÒDGT.CPFUEJCHVFCTÒDGT5EJTKHVDCPFWPFUVTCJNGPFGU)QVVGUCWIGKP9QNMGP <YGK 9CRRGPUEJKNFG CWH FGPGP FKG 0COGP ,QPCVJCP D\Y &CXKF \W NGUGP UKPF NGJPGP CP GKPGO   $CWOKP.CPFUEJCHVOOI(W55NI)QRRGNNGKEJVXCT  *GTTNKEJG6ÌPWPIXQT\ÒINKEJ



5KNDGTOGFCKNNG  XQP , .KODWTI CWH FKG )QNFGPG *QEJ\GKV FGU 2QNKVKMGTU WPF +PFWUVTKGNNGP )TCH   (TCP\XQP$CNNGUVTGOWPFUGKPGT)GOCJNKP*GFYKI)T·HKPXQP5CWTOC(TGKKPXQPWPF\WFGT,GNVUEJ $TWUVDKNFGT FGU 2CCTGU PGDGPGKPCPFGT N&KG DGKFGP (COKNKGPYCRRGP WOJGT .QTDGGT\YGKIG QDGP   -TQPGOOI,CUEJMG/CGTEMGT FQTVKP$TQP\G   4GUVGCNVGT8GTIQNFWPIHCUVXQT\ÒINKEJ



.16



/ÒPUVGTDGTI1GNU*GT\QIVWO-CTN++)TQUEJGP Z  Z WPF Z   5VÒEM5GJTUEJÌPpXQT\ÒINKEJ

1154



1155

5%*.'59+)*1.56'+0 -¤0+).+%*&0+5%*'4#06'+. 

%JTKUVKCP8-TQPG /CTM )NÒEMUVCFV&CX*GFG.CPIGp



(TKGFTKEJ 8++  9GK­OGVCNNOGFCKNNG  XQP 5 &TGPVYGVV CWH FCU 5GGIGHGEJV DGK 'E   MGTPHÌTFG &KG (TGICVVG )GHKQP WPF FCU DTGPPGPFG .KPKGPUEJKHH %JTKUVKCP 8+++ KO /GGT XQT FGT   5VTCPFUEJCP\G CWH FGT GKPG FTGKHCTDKIG (CJPG YGJV9CRRGP CWH 8GT\KGTWPIGP  OO  I   .CPIGD 2TCEJVGZGORNCT(CUV5VGORGNINCP\

198

 5GJTUEJÌP






SCHWARZBURG

1156

*1.56'+0)166142*'4<1)67/ 

%JTKUVKCP#NDTGEJV5KNDGTOGFCKNNGXQP#-CTNUVGGPCWHFGP#NVQPCGT8GTINGKEJOKV %JTKUVKCP8XQP&·PGOCTM(GWGTNQFGTVCWHGKPGO#NVCTWPVGP$NWOGP8QPNKPMUDN·UV9KPFCWHGKP 5EJKHH KP UVCTM DGYGIVGT 5GG TGEJVU H·JTV GKP 5EJKHH KP TWJKIGO 9CUUGT WPVGT 5VGTPGPJKOOGN KO   *KPVGTITWPFFKGCWHIGJGPFG5QPPGOOI.CPIG 445GJTUEJÌP 'ZGORNCTFGT#WMVKQP(TKV\4WFQNH-ÒPMGT1UPCDTÒEM0T





0CEJFGO %JTKUVKCP 8 KJP \YGKOCN UGKPGT .·PFGT DGTCWDVG GTJKGNV %JTKUVKCP #NDTGEJV FWTEJ 7PVGTUVÒV\WPI 5EJYG   FGPU$TCPFGPDWTIUWPF'PINCPFUKO#NVQPCGT8GTINGKEJUGKP*GT\QIVWOYKGFGT\WTÒEM 



.16

-NGKPG5COONWPIXQPUEJNGUYKIJQNUVGKPKUEJGP/ÒP\GPFGU,CJTJWPFGTVUFKXGTUGT.KPKGPFCTWPVGT \CJNTGKEJGWPF5EJKNNKPI5VÒEMG 4GWVGTRHGPPKI CWEJXQO'T\DKUVWO$TGOGP  5VÒEM/GKUVUGJTUEJÌP

1158

56#&6

1159



1160

5%*9$+5%**#..



4GKEJUVCNGT0ÒTPDGTIOKV6KVGNXQP(TCP\+&CX4CHHC

8QT\ÒINKEJ





-QPX6CNGT0ÒTPDGTIOKV6KVGN,QUGHU++WPFOKV.CWDTCPF&CX4CHHD  'VYCUHNGEMKIG2CVKPCXQT\ÒINKEJ



5%*9#4<$74) 5%*9#4<$74)#4056#&6)4#(5%*#(6 

#PVQP)ÒPVJGT++4GKEJUVCNGT#TPUVCFV&CX(KUEJGT  448QT\ÒINKEJGU2TCEJVGZGORNCT  'KPGP#TPUV·FVGT)TQUEJGPFGU,CJTJWPFGTVUCWUFGO5EJCV\HWPFXQP*GTDQTPHKPFGP5KGWPVGT0T 199


SCHWARZBURG

1162

1161

1161

5%*9#4<$74)510&'45*#75'0)4#(5%*#(65'+6(ª456'067/ 

%JTKUVKCP9KNJGNO+WPF#PVQP)ÒPVJGT++4GKEJUVCNGT5QPFGTUJCWUGPCWHFGP 6QFKJTGU1PMGNU.WFYKI)ÒPVJGT++ LÒPIGTGT$TWFGTKJTGU8CVGTU#PVQP)ÒPVJGT+ I&TGK HCEJ DGJGNOVGU 9CRRGP XQP \YGK 5EJKNFJCNVGTP OKV (CJPGP IGJCNVGP WPVGP \W FGP 5GKVGP FKG IGVGKNVG   5KIPCVWT *  / *GPPKPI /ÒNNGT /ÒP\OGKUVGT KP 5QPFGTUJCWUGP   WPF \YGK <CKPJCMGP  &TGK\GJP<GKNGP5EJTKHVQDGP4QUGVVG\YKUEJGP\YGK5VGTPGP&CX#(KUEJGT  8QPITQ­GT5GNVGPJGKV5GJTCVVTCMVKXGU'ZGORNCTOKVJGTTNKEJGT2CVKPCXQT\ÒINKEJ 



%JTKUVKCP)ÒPVJGT+++6CNGT5QPFGTUJCWUGP(KUEJGT  445GJTUEJÌPpXQT\ÒINKEJ

1163

1164 1166



1165 1166



)ÒPVJGT(TKGFTKEJ%CTN++8GTGKPUFQRRGNVCNGT#-5&CX-CJPV6JWP 0WT'ZGORNCTGIGRT·IV2TCEJVGZGORNCT5VGORGNINCP\



8GTGKPUFQRRGNVCNGT#-5&CX-CJPV6JWP  0WT'ZGORNCTGIGRT·IV9KP\-TCV\GTXQT\ÒINKEJp5VGORGNINCP\





8GTGKPUFQRRGNVCNGT#-5&CX-CJPV6JWP

5GJTUEJÌP





5KNDGTITQUEJGP#-5,

8QPRQNKGTVGP5VGORGNPXQT\ÒINKEJ



200




SCHWARZBURG

1167

 

1168

8GTGKPUFQRRGNVCNGT#-5&CX-CJPV6JWP 8GTGKPUFQRRGNVCNGT#-5&CX-CJPV6JWP

1172

1169

8QT\ÒINKEJ (GKPG2CVKPCXQT\ÒINKEJ

1170

1171

   

 

1171

5KNDGTITQUEJGP#-5, 8QPRQNKGTVGP5VGORGNPXQT\ÒINKEJ -W2HGPPKI 2QNKGTVG2NCVVG 8GTGKPUVCNGT#-5&CX-CJPV6JWP 8QT\ÒINKEJ -W2HGPPKI##-5, 5GNVGPKPFKGUGT'TJCNVWPI2TCEJVGZGORNCT2QNKGTVG2NCVVG

1173

1174

   

1175

5%*9#4<$74)47&1.56#&6)4#(5%*#(65'+6(ª456'067/ 

.WFYKI)ÒPVJGT++-QPX6CNGT5CCNHGNF&CX(KUEJGT  442TCEJVGZGORNCTOKVJGTTNKEJGT2CVKPC8QT\ÒINKEJp5VGORGNINCP\



-QPX6CNGT  5CCNHGNF CWH FKG \YGKVG 8GTO·JNWPI UGKPGU 5QJPGU 'TDRTKP\ (TKGFTKEJ -CTN OKV   #WIWUVG6QEJVGTFGU*GT\QIU,QJCPP#WIWUVXQP5CEJUGP)QVJC&CX(KUEJGT  *GTTNKEJG2CVKPCYKP\5EJTÌVNKPIUHGJNGTXQT\ÒINKEJp5VGORGNINCP\ -QPX6CNGT5CCNHGNF&CX(KUEJGT 8QT\ÒINKEJ





  201


SCHWARZBURG

1176

1177



-QPX6CNGT5CCNHGNF&CX(KUEJGT

9KP\-TCV\GTHCUVXQT\ÒINKEJ



(TKGFTKEJ-CTN-QPX6CNGT5CCNHGNF&CX(KUEJGT



8QT\ÒINKEJ



5VGORGNINCP\



1178

1179

1179



.WFYKI(TKGFTKEJ++2HGPPKI,



(TKGFTKEJ)ÒPVJGT-QPX6CNGT/KV.CWDTCPF#-5&CX-CJPV6JWP ªDNKEJGTMN5VGORGNHGJNGTXQT\ÒINKEJp5VGORGNINCP\

1180



1181



-QPX6CNGT/KV.CWDTCPF#-5&CX-CJPV6JWP *ÒDUEJG2CVKPCXQT\ÒINKEJ





-QPX6CNGT/KV.CWDTCPF#-5&CX-CJPV6JWP

8QT\ÒINKEJ





-QPX6CNGT/KV.CWDTCPF#-5&CX-CJPV6JWP  9KP\&TWEMUVGNNGXQT\ÒINKEJ





-QPX6CNGT/KV.CWDTCPF#-5&CX-CJPV6JWP



1182

202

1183

5GJTUEJÌP


SCHWARZBURG

1184

1185

1185

1186

1186

 

2HGPPKI#-5, -W2HGPPKI#-5,

8QT\ÒINKEJ 8QT\ÒINKEJ

 



8GTGKPUFQRRGNVCNGT#-5&CX-CJPV6JWP  5GNVGPKPFKGUGT'TJCNVWPI2TCEJVGZGORNCT5VGORGNINCP\



1187

1188

1189



8GTGKPUFQRRGNVCNGT#-5&CX-CJPV6JWP

-N4CPFHGJNGTHCUVXQT\ÒINKEJ





8GTGKPUFQRRGNVCNGT#-5&CX-CJPV6JWP  'TUVCDUEJNCIHGKPG2CVKPCOKP4CPFHGJNGTXQT\ÒINKEJp5VGORGNINCP\





8GTGKPUFQRRGNVCNGT#-5&CX-CJPV6JWP

1191

1190

1193

5GJTUEJÌPpXQT\ÒINKEJ



1192

1190



&QRRGNIWNFGP#-5&CX-CJPV6JWP  5GNVGPKPFKGUGT'TJCNVWPI(GKPG2CVKPCHCUV5VGORGNINCP\

  

-TGW\GT#-5, -TGW\GT#-5, -W-TGW\GT#-5,

8QT\ÒINKEJ 8QT\ÒINKEJ (CUV5VGORGNINCP\

    203


SCHWARZBURG

1194

1195



8GTGKPUVCNGT#-5&CX-CJPV6JWP

8QT\Ã&#x2019;INKEJ





8GTGKPUVCNGT#-5&CX-CJPV6JWP

8QT\Ã&#x2019;INKEJp5VGORGNINCP\



1197

1196



8GTGKPUVCNGT#-5&CX-CJPV6JWP

8QT\Ã&#x2019;INKEJ





8GTGKPUVCNGT#-5&CX-CJPV6JWP

8QT\Ã&#x2019;INKEJp5VGORGNINCP\



1198

1199



8GTGKPUVCNGT#-5&CX-CJPV6JWP

(CUV5VGORGNINCP\





8GTGKPUVCNGTL·JTKIGU4GIKGTWPIULWDKN·WO#-5&CX-CJPV6JWP  8QT\Ã&#x2019;INKEJXQT\Ã&#x2019;INKEJp5VGORGNINCP\



1200

1201



8GTGKPUVCNGT#-5&CX-CJPV6JWP

(CUV5VGORGNINCP\





8GTGKPUVCNGT#-5&CX-CJPV6JWP

8QT\Ã&#x2019;INKEJ



ex 1202

1203

ex 1202



-W-TGW\GT&C\W#NDGTV-W-TGW\GT#-5, Z   5VÃ&#x2019;EM(CUV5VGORGNINCP\





#NDGTV8GTGKPUVCNGT#-5&CX-CJPV6JWP  8QT\Ã&#x2019;INKEJp5VGORGNINCP\5VGORGNINCP\



204


SPEYER

1204

1205



8GTGKPUVCNGT#-5&CX-CJPV6JWP  8QT\ÒINKEJGU'ZGORNCTXQPRQNKGTVGP5VGORGNP





8GTGKPUVCNGT#-5&CX-CJPV6JWP



8QT\ÒINKEJ

1207

1206

1206

5%*9#4<'0$'4)

(ª456'0 

(GTFKPCPF9KNJGNO'WUGDKWU4GKEJUVCNGT-TGOPKV\CWHUGKPG*QEJ\GKVOKV/CTKC #PPC'TDKPFGT.CPFITCHUEJCHV5WN\ -NGVVICW &CX6CPPKEJ 5GJTUEJÌP

51./5.#7$#%*)4#(5%*#(6 

51./5

%JTKUVKCP#WIWUV4GKEJUVCNGTQ,  0ÒTPDGTICWHUGKPGP4GIKGTWPIUCPVTKVV&CX ,QUGRJ5NI'TNCPIGT 8QPITQ­GT5GNVGPJGKV5GJTUEJÌPpXQT\ÒINKEJ

1208





1209

-QPX6CNGT9GTVJGKOCWHFKG8GTO·JNWPIUGKPGU5QJPGUFGU'TDITCHGP)GQTI#WIWUV9KNJGNO OKV 'NKUCDGVJ %JCTNQVVG (GTFKPCPFG .WKUG 6QEJVGT FGU (ÒTUVGP (TKGFTKEJ 'TPUV XQP +UGPDWTI   &CX,QUGRJ 48QT\ÒINKEJ  5QNOUGT2T·IWPIGPFGU,CJTJWPFGVUCWUFGO5EJCV\HWPFXQP*GTDQTPHKPFGP5KGWPVGTFGP0TPWPF

$+567/ 



52';'4

#WIWUV XQP .KODWTI5V[TWO  -QPX6CNGT  /CPPJGKO CWH UGKPG +PVJTQPKUCVKQP   &CX'JTGPF*CCU 9KP\<CKPGPFGOKPLWUVKGTVXQT\ÒINKEJp5VGORGNINCP\

 205


STRALSUND

1210 (doppelt)

561.$'4) 561.$'4)-¤0+)56'+0)4#(5%*#(6 

.WFYKI++&QRRGNVCNGT0ÌTFNKPIGPOKV6KVGN-CTNU8Iã.8&18+%Ù%1Ù +Ù561.Ù-10+)ÙÙ482'(1$NWOGPMTGW\DGNGIVOKVFGOFTGKHGNFKIGP9CRRGPUEJKNF5VQNDGTI -ÌPKIUVGKP9GTPKIGTQFGKPFGP9KPMGNPFKG9CRRGPUEJKNFG'RRUVGKP/KP\GPDGTI4QEJGHQTV/CTM #IKOQPVÈ %#41.85 Ù 8 Ù 41  /# Ù +/2 Ù #8) Ù  È )GMTÌPVGT &QRRGNCFNGT OKV FGO \YGK   HGNFKIGP9CRRGP¤UVGTTGKEJ-CUVKNKGPCWHFGT$TWUV&CX(TKGFGTKEJ  8QPITÌ­VGT5GNVGPJGKV-N5EJTÌVNKPIUHGJNGTXQT\ÒINKEJGU'ZGORNCT  'KPG UGNVGPG 5VQNDGTIGT /GFCKNNG XQP  CWU FGT 5COONWPI FGT (TGKJGTTGP $QPFG HKPFGP 5KG KP   -CVCNQIWPVGT0T

1212

1211



1213

6CNGT#WIUDWTIOKV6KVGN-CTNU8&CX(QTUVGTXCT(TKGFGTKEJ (CUVUGJTUEJÌP



564#.570& 

7PVGT 5EJYGFGP %JTKUVKPC  4GKEJUVCNGT  5EJKNNKPI   OKV 6KVGN (GTFKPCPFU +++   #JNUVTÌO&CX 8QPITÌ­VGT5GNVGPJGKV-N2T·IGUEJY·EJGUGJTUEJÌP 



-CTN:+6CNGT#JNUVTÌO$TCVTKPIC&CX#

45GJTUEJÌP



1214



206

-CTN:++5KNDGTOGFCKNNGWPUKIPKGTVCWHFKG4ÒEMMGJTFGUUEJYGFKUEJGP-ÌPKIU-CTN:++ CWUFGOVÒTMKUEJGP'ZKNWPFUGKPG#PMWPHVKP5VTCNUWPFCO0QXGODGT PCEJITGIQTKCPKUEJGO -CNGPFGTCO0QXGODGT -CTN:++TGKVGVT9#5514)'6+*4&1%*Û)16670&+%* .'$'0+#01%*ÜOOI'PFTW­GKVE*KNFGDTCPF+5 (CUVXQT\ÒINKEJ




TRIER 0CEJFGO UKEJ FKG *QHHPWPIGP FGU UEJYGFKUEJGP -ÌPKIU -CTN :++ CWH GKP $ÒPFPKU OKV FGT 6ÒTMGK PKEJV GTHÒNNV   JCVVGPXGTNKG­GTOKVUGKPGP.GWVGPUEJNKG­NKEJCO5GRVGODGTUGKPKPFGT0·JGXQP#FTKCPQRGN VÒTMKUEJ 'FKTPG  IGNGIGPGU 'ZKN &GOQVKMC WPF GKNVG KP 4KEJVWPI 0QTFGP +P 2KVGUVK KP FGT TWO·PKUEJGP 9CNNCEJGK EC    MOYGUVNKEJXQP$WMCTGUV VTGPPVGUKEJ-CTN:++XQPUGKPGT/CPPUEJCHVWPFGKNVGWPVGTFGO&GEMPCOGP%CTN(TKUM  PWT XQP \YGK 1HHK\KGTGP DGINGKVGV  ÒDGT *GTOCPPUVCFV 9KGP 4GIGPUDWTI 0ÒTPDGTI WPF -CUUGN PCEJ 5VTCNUWPF   YQGTCO0QXGODGTGKPVTCH  -CTN:++UQNNCWHUGKPGT*GKOTGKUGKPGKPGO)CUVJCWUKP$GTIGP *GUUGP GTMCPPVWPFXQT7OUVWT\RN·PGPIGYCTPV YQTFGPUGKPYQTCWHGTKPGKP)·UVGDWEJFGP5RTWEJGKPIGVTCIGPJCDGFGTCWHFGTXQTNKGIGPFGP/GFCKNNG\WNGUGP KUV&KG'ZKUVGP\\CJNTGKEJGTFGWVUEJGT/GFCKNNGPCWHFGPDGFGWVGPFGP5EJYGFGPMÌPKIKUVGKP$GNGIHÒTUGKPGITQ­G $GNKGDVJGKVKO4GKEJ

1215



5VCFV 5KNDGTOGFCKNNG  XQP #DTCJCO #DTCOUQP 9KFOWPI FGT 5VCFV 5VTCNUWPF \WO L·JTKIGP   ,WDKN·WO XQP (ÒTUV (TKGFTKEJ 9KNJGNO XQP *GUUGPUVGKP PCVÒTNKEJGT 5QJP FGU UEJYGFKUEJGP -ÌPKIU   (TKGFTKEJ +  CNU )GPGTCNIQWXGTPGWT KP 5EJYGFKUEJ2QOOGTP $TWUVDKNF T OKV WOIGNGIVGO $CPF FGU   5GTCRJKOGTQTFGPUWPFWOIGJ·PIVGP5EJYGTVQTFGP<GKNGP5EJTKHVOOI'PFTW­GKV *QHHOCPP*[EMGTV:8++55EJÒV\5NI2QIIG  8QPITQ­GT5GNVGPJGKV0WT'ZGORNCTGIGRT·IV(GKPG6ÌPWPIMN-TCV\GTXQT\ÒINKEJ



(TKGFTKEJ 9KNJGNO XQP *GUUGPUVGKP IGDQTGP CO  /·T\  KP 5VQEMJQNO YCT FGT PCVÒTNKEJG 5QJP CWU GKPGT   .KCKUQPFGUUEJYGFKUEJGP-ÌPKIU(TKGFTKEJ+OKVFGO(T·WNGKP7NTKMCXQP6CWDGFKGCWH$GIGJTGPFGU-ÌPKIUXQP -CKUGT -CTN 8+ \WT 4GKEJUIT·HKP XQP *GUUGPUVGKP GTPCPPVG YWTFG 0CEJ GKPGT /KNKV·TMCTTKGTG YWTFG (TKGFTKEJ   9KNJGNO  XQP /CTKC 6JGTGUKC \WO 4GKEJUHÒTUVGP GTPCPPV 5GKV  YCT GT UEJYGFKUEJGT 5VCVVJCNVGT KP 2QO   OGTP WPF FCOKV \WINGKEJ -CP\NGT FGT 7PKXGTUKV·V )TGKHUYCNF &WTEJ IG\KGNVG +PXGUVKVKQPGP WPF GKUGTPG5RCTUCOMGKV IGNCPI GU *GUUGPUVGKP FC­ FGT RQOOGTUEJG .CPFGUVGKN PKEJV  YKG \WXQT ÒDNKEJ  GKPGP <WUEJW­ CWU FGT UEJYGFK   UEJGP5VCCVUMCUUGGTJCNVGPOW­VGUQPFGTPUKEJWOIGMGJTVGKPªDGTUEJW­XQPGKPGTJCNDGP/KNNKQP6CNGTDKNFGVG#NU -ÌPKI)WUVCX+++FKGUG5WOOGHÒTFKG#WHTÒUVWPIFGT5M·TI¹TFUHNQVVGGKPUGV\GPYQNNVGGTTGKEJVGGTFC­FCU)GNF HÒT #WUICDGP KP 2QOOGTP IGPWV\V YWTFG *GUUGPUVGKP UVCTD CO  ,WNK  KO #NVGT XQP  ,CJTGP KP 2CPMGT  

*QNUVGKP    9GKVGTG5VTCNUWPFGT2T·IWPIGPCWUFGT5COONWPIFGT(TGKJGTTGP$QPFGHKPFGP5KGKP-CVCNQIWPVGT FGP0TP

1216

1217

'4<$+567/ 



64+'4

1217

2QRRQ XQP ¤UVGTTGKEJ  2HGPPKI  I -TGW\ KP FGP 9KPMGNP LG GKPG ITQ­G WPF GKPG   MNGKPG-WIGN$ÒUVGFGU*GKNKIGP5KOGQPXXKP6QTFCTCWH#\WFGP5GKVGPLGGKP6WTO&CPPGP DGTI9GKNNGT 8QTFGTUGKVGNGKEJVFG\GPVTKGTVUGJTUEJÌP



2JKNKRR%JTKUVQRJXQP5ÌVGTP4GKEJUVCNGT-QDNGP\I$TWUVDKNFTOKVXGT \KGTVGO/CPVGN\WFGP5GKVGPFKGIGVGKNVG,CJTGU\CJNCO#TOCDUEJPKVVFKG5KIPCVWT.5 .QTGP\ 5EJPGKFGT /ÒP\OGKUVGT KP -QDNGP\  &TGKHCEJ DGJGNOVGU XKGTHGNFKIGU 9CRRGP OKV /KVVGN   UEJKNFFCJKPVGT5EJYGTVWPF-TWOOUVCDIGMTGW\V&CXX5EJT  8QPITQ­GT5GNVGPJGKV9KP\5COONGT\GKEJGPKO(GNFFGT8QTFGTUGKVGUGJTUEJÌPpXQT\ÒINKEJ  207


WALDECK

1219

1218



(TCP\ )GQTI XQP 5EJÌPDQTP2ÒEJJGKO9QNHUVJCN   -TGW\GT -QRHUVÒEM     -QDNGP\X5EJT #VVTCMVKXGUUGJTUEJÌPGU'ZGORNCT





-TGW\GT -QRHUVÒEM -QDNGP\X5EJT



1221

1220

5KNDGTOGFCKNNGKO)GYKEJVGKPGU8GTGKPUVCNGTUXQP(*GNHTKEJVCWHFKGL·JTKIG2CEJV\GKVXQP (TKGFTKEJ&QGRRKPI(4+'&4+%*&1'22+0)('$4FCTWPVGT9GTVCPICDG:+8'+0' (/#4-WOJGTIGDWPFGPGTJTGPMTCP\5')'0,#'*4+)'42#%*6<'+6#7(&'/ 4+66'4)76'7(*18'0FCTWPVGT5VGORGNUEJPGKFGTUKIPCVWTOOI2KEM  40WT'ZGORNCTGIGRT·IV*GTTNKEJG2CVKPCXQT\ÒINKEJ



8'4&'0

$+567/ 

1220

7(*18'0

4+66'4)76 

48QT\ÒINKEJ

2JKNKRR 5KIKUOWPF XQP $TCWPUEJYGKI9QNHGPDÒVVGN  -KRRGT-W&QRRGNUEJKNNKPI    )TQVGXCT5NI-TCC\9GNVGT 45GJTUEJÌP

1,5:1

1222



1,5:1

9#.&'%- )4#(5%*#(65'+6(ª456'067/ 

*GTOCPP XQP 9CNFGEM  QFGT *GKPTKEJ XQP 5EJYCNGPDGTI  2HGPPKI   /ÒP\UV·VVGXGTOWVNKEJ-QTDCEJI/CWGTOKV6QTFCTÒDGT-WRRGNVWTOFCTKP5VGTPN-TWOO UVCDT-TGW\HCJPG%QNQPKCOQPQITCOO*CGXGTPKEM-TWU[ 445GJTUEJÌP



&KG<WQTFPWPIFKGUGU2HGPPKIU\W9CNFGEMKUVPKEJVIGUKEJGTV

1,5:1



1223

1,5:1

#FQNH + XQP 9CNFGEM  QFGT #FQNH ++ XQP 5EJYCNGPDGTI  OKV #NDGTV + XQP   1NFGPDWTI8KGTNKPIQ, WO -QTDCEJQFGT5EJYCNGPDGTII)TCHUKV\V XXOKV5EJYGTVWPF5VGTP#EJVUVTCJNKIGT5VGTPKO+PPGTGP-WIGNKP2GTNMTCP\KPFGP5VGTPURKV\GP LGGKP2WPMV)TQVGp-TWU[p 5EJGKPVWPGFKGTV9QJN7PKMWO5GJTUEJÌP 

&KGUGT 8KGTNKPI VT·IV MGKPGPGRKITCRJKUEJGP*KPYGKUCWHUGKPGP2T·IGQTV'UUKPFKPFGU\YGKXGTUEJKGFGPGDKNFINGK EJG 2HGPPKIG CWU \YGK XGTUEJKGFGPGP /ÒP\UV·VVGP DGMCPPV IGYQTFGP &GT GKPG GPVUVCPF WPVGT FGP 5EJYCNGPDGTIGT   'FGNJGTTGP#FQNH++  WPF#NDGTV+  YKGFKG7OUEJTKHVGKPFGWVKICWUYGKUV -TWU[)TQVG 50T &GT\YGKVGDKNFINGKEJG2HGPPKI -TWU[#PO)TQVG50T KUVIGO·­UGKPGT7OUEJTKHVGP WPVGT FGO 9CNFGEMGT )TCHGP #FQNH +   WP\YGKHGNJCHV KP FGT /ÒP\UV·VVG -QTDCEJ IGRT·IV YQTFGP &KG   PWT URQTCFKUEJ NGUDCTG 8QTFGTUGKVGPNGIGPFG FGU XQTNKGIGPFGP 8KGTNKPIU WPF FCU (GJNGP GKPGT 4ÒEMUGKVGPNGIGPFG   NCUUGP PKEJV GKPFGWVKI GPVUEJGKFGP QD FKGUGU CW­GTQTFGPVNKEJUGNVGPG5VÒEMCWH8GTCPNCUUWPIFGU9CNFGEMGT)TCHGP KP-QTDCEJQFGTWPVGTFGT*QJGKVFGU5EJYCNGPDGTIGT'FGNJGTTPKP5EJYCNGPDGTIIGRT·IVYQTFGPKUV

208


WALDECK

1224

1225

1226



(TKGFTKEJ-QPX6CNGT#TQNUGP&CX5NI*GPPKI5NI-C[UGT  5GNVGPDGUQPFGTUKPFKGUGT'TJCNVWPI*ÒDUEJG2CVKPCXQT\ÒINKEJ



-QPX6CNGT#-5&CX-CJPV6JWP

*GTTNKEJG2CVKPCHCUVXQT\ÒINKEJ





)GQTI-QPX6CNGT#-5&CX-CJPV6JWP  45GJTUEJÌPpXQT\ÒINKEJ





1227

1,5:1



1,5:1

6CNGT8CTKCPVGOKV)Û(Û<Û9Û4Û)Û<Û2ÛKPFGT8QTFGTUGKVGPWOUEJTKHV#-5 #PO8CT,XCT  8QPITQ­GT5GNVGPJGKV2TCEJVGZGORNCT(GKPG6ÌPWPIXQT\ÒINKEJp5VGORGNINCP\

1228



1229



)GQTI*GKPTKEJ-TQPGPVCNGT#-5&CX-CJPV6JWP  (GKPG6ÌPWPIUGJTUEJÌPpXQT\ÒINKEJ





8GTGKPUFQRRGNVCNGT#-5&CX-CJPV6JWP  42TCEJVGZGORNCT(CUV5VGORGNINCP\

 209


WALLENSTEIN

1231

1230



)GQTI 8KEVQT WPVGT 8QTOWPFUEJCHV UGKPGT /WVVGT 'OOC  8GTGKPUFQRRGNVCNGT    #-5&CX-CJPV6JWP 449KP\4CPFHGJNGTXQT\ÒINKEJp5VGORGNINCP\ 



)GQTI8KEVQT8GTGKPUFQRRGNVCNGT#-5&CX-CJPV6JWP  8QT\ÒINKEJ

1232

1233



1234

9#..'056'+0 

#NDTGEJV*GT\QIXQP(TKGFNCPF4GKEJUVCNGT,KVUEJKP&CX/G[GT0Q JGLNQX±2T±VQX± 445EJÌPpUGJTUEJÌP



4GKEJUVCNGT5CICPIÈ#.$'4685&Ù)Ù&8:/')#2Ù(4+&Ù'65#Ù24+Ù8#0 )GJCTPKUEJVGU $TWUVDKNF HCUV X X OKV WOIGNGIVGO /CPVGN  %1/ Ù 58'4 Ù &1 Ù 41 Ù  '6   56#4)#4 Ù  /KV (ÒTUVGPJWV DGFGEMVGU HGNFKIGU 9CRRGP \W FGP 5GKVGP FKG 5KIPCVWT )  '  

)QVVHTKGF 'JTNKEJ 9CTFGKP KP 5CICP   WOJGT FKG -GVVG FGU 1TFGPU XQO )QNFGPGP 8NKGU   &CX/G[GT0QJGLNQX±2T±VQX± 44(CUVXQT\ÒINKEJ 



 4GKEJUVCNGT  5CICP  I h #.$'4685 & Ù ) Û &8: (4+&.#0&+“ '6 5#)#0“   )GJCTPKUEJVGU $TWUVDKNF HCUV X X OKV WOIGNGIVGO /CPVGN5#%4+ Ù 41/# Ù +/2'4  24+0%'25   #001)GMTÌPVGT#FNGTCWHFGT$TWUVFCUIGMTÌPVGXKGTHGNFKIG9CRRGPWPVGP\WFGP5GKVGP FKG5KIPCVWT+< ,QJCPP<KGUNGT/ÒP\OGKUVGTKP5CICPXGTOWVNKEJIGOGKPUCOOKV*CPU*GKP TKEJ,CEQD/ÒP\OGKUVGTKP5CICP WPVGPFCU/ÒP\UV·VVGP\GKEJGP5KP-CTVWUEJG/G[GT 0QJGLNQX±2T±VQX±5 8QPITQ­GT5GNVGPJGKV-N5EJTÌVNKPIUHGJNGTXQT\ÒINKEJ  'KPGP 4GKEJUVCNGT  XQP #NDTGEJV XQP 9CNNGPUVGKP CWU FGT 5COONWPI FGT (TGKJGTTGP $QPFG HKPFGP   5KGKP-CVCNQIWPVGT0T

210




WETZLAR

1235

9'+0)#46'0

#$6'+ 

)GTXKEWU $NCTGT  5KNDGTIW­OGFCKNNG  WPUKIPKGTV XQP /CVVJGU )GDGN 0ÒTPDGTI CWH   FGP $GFKGPUVGVGP 8KVWU %JWPK  $TWUVDKNF %JWPKU T#O $QFGP NKGIGPFG 4ÒUVWPI FCTCWH N   (COKNKGPYCRRGP %JWPK OKV \YGK .KNKGP WPF FTGK 5VGTPGP T *GNO OKV .KNKG  OO  I   *CDKEJ+ 5R·VGTGT)W­5GJTUEJÌP

1236



-¤0+)4'+%*

1237



1238

9'56(#.'0 (CUVXQT\ÒINKEJ





(TCPMGP,#-5&CX,D  #VVTCMVKXGUÒDGTFWTEJUEJPKVVNKEJGTJCNVGPGU'ZGORNCTUGJTUEJÌPpXQT\ÒINKEJ

*KGTQP[OWU0CRQNGQP(TCPMGP,#-5&CX,D





(TCPMGP,#-5&CX,D

(CUVUGJTUEJÌP



1239

56#&6 

9'6<.#4

5KNDGTOGFCKNNGQ, WO XQP229GTPGTCWH,QJCPP,CMQDXQP<YKGTNGKPKP$KDGTQF4GEJVU IGNGJTVGT DGKO 4GKEJUMCOOGTIGTKEJV KP 9GV\NCT $TWUVDKNF FGU ,WTKUVGP T OKV WOIGNGIVGO /CPVGN  $GJGNOVGU(COKNKGPYCRRGPOOI5NI'TNCPIGT 8QT\ÒINKEJp5VGORGNINCP\

 211


WÜRTTEMBERG

1240

1,5:1

1,5:1

9+'& 9+'&0'79+'&)4#(5%*#(65'+6(ª456'067/ 

,QJCPP(TKGFTKEJ#NGZCPFGT-TGW\GT )TQUEJGP 0GWYKGF5EJPGKFGT  8QPITÌ­VGT5GNVGPJGKV5GJTCVVTCMVKXGUXQT\ÒINKEJGU'ZGORNCT



'ZGORNCT FGT 5COONWPI ,QUGRJ #WMVKQP *CODWTIGT(TCPMHWTV/CKP0TWPFFGT#WMVKQP&T$WUUQ 2GWU(TCPMHWTV/CKP0T

1242

1241

1241

9+5/#4

56#&6 

4GKEJUVCNGT 5EJKNNKPI OKV6KVGN(GTFKPCPFU++&CX)TKOO-WP\GN'O  (GKPG2CVKPCUGJTUEJÌPpXQT\ÒINKEJ





4GKEJUVCNGT 5EJKNNKPI OKV6KVGN(GTFKPCPFU+++&CX-WP\GN#C  8QPITÌ­VGT5GNVGPJGKV*ÒDUEJG2CVKPCUGJTUEJÌP



#WHFGOXQTNKGIGPFGPUGJTUGNVGPGP6CNGTINGKEJVFKGKPFGT,CJTGU\CJNGKPGTURKGIGNXGTMGJTVGP  &KG *CPUGUVCFV 9KUOCT YWTFG  XQP FGP 5EJYGFGP DGUGV\V WPF KO 9GUVH·NKUEJGP (TKGFGP  5EJYGFGP   \WIGURTQEJGP+PFGP,CJTGPDKUWPFDKUYCTFKG5VCFVF·PKUEJDGUGV\VDNKGDCPUQPUVGPCDGTDKU  KP UEJYGFKUEJGT *CPF CNU GU HÒT  ,CJTG CP /GEMNGPDWTI5EJYGTKP XGTRH·PFGV YWTFG  XGT\KEJVGVG   5EJYGFGPCWHFCU4GEJV9KUOCTYKGFGTGKP\WNÌUGP 

9KUOCTGT2T·IWPIGPCWUFGT5COONWPIFGT(TGKJGTTGP$QPFGHKPFGP5KGKP-CVCNQIWPVGTFGP0TP   

1244

1243

9ª466'/$'4) 9ª466'/$'4)*'4<1)67/5'+6-¤0+)4'+%* 

'DGTJCTF +++ FGT /KNFG  *GNNGT Q , IGRT·IV PCEJ FGO 8GTVTCI XQP   5VWVVICTV   -NGKP4CHH 445GJTUEJÌP





7NTKEJ'KPUGKVKIGT2HGPPKIQ,2T·IWPIWPVGTÌUVGTTGKEJKUEJGT*GTTUEJCHV-NGKP4CHH 45GJTUEJÌP



212


WÜRTTEMBERG

1245



7NTKEJ4GIKGTWPI6CNGT&CX-NGKP4CHH  449KP\*GPMGNURWTUGJTUEJÌP

1247

1246



1248



.WFYKI)TÌUEJNGKP5VWVVICTV-NGKP4CHHC

5GJTUEJÌP





,QJCPP(TKGFTKEJ-W*GNNGT5VWVVICTV-NGKP4CHH

48QT\ÒINKEJ





.WFYKI (TKGFTKEJ #FOKPKUVTCVQT WPF 8QTOWPF XQP 'DGTJCTF +++   -TGW\GT    5VWVVICTV-NGKP4CHH 45GJTUEJÌPpXQT\ÒINKEJ



1249 (doppelt)



'DGTJCTF.WFYKI&QRRGNVGT4GKEJUVCNGT5VWVVICTVI'$'4*Ü.7&Û&Ü ) ³Ü &7: 9746'/$ Û )GJCTPKUEJVGU $TWUVDKNFTOKVWOIGNGIVGO/CPVGNCO#TOCDUEJPKVVFKG5K IPCVWT + Ü & Ü & Ü ,QJCPP &CXKF &CPKGN 5KGIGNUVGEJGT WPF )NCUUEJPGKFGT KP 5VWVVICTV WO  m Ð   %7/&'1'6&+'Ðm)GMTÌPVGUXKGTHGNFKIGU9CRRGPWPVGP\WFGP5GKVGPFKGIGVGKNVG,CJTGU\CJN WPVGTFGO9CRRGPFKG5KIPVWT+Ü+ÜÜ9Ü ,QJCPP,CMQD9CIPGT/ÒP\OGKUVGTKP5VWVVICTV  /KV4CPFUEJTKHV .CWDYGTM r+.r .CWDYGTM r/10&1r .CWDYGTM r'r .CWDYGTM r 6QPFQÜ +Û+Û9 &CX-NGKP4CHH  8QPITQ­GT5GNVGPJGKV(GNFGTIGIN·VVGVUGJTUEJÌPpXQT\ÒINKEJ 

1250

1251

1250



4GKEJUVCNGT  5VWVVICTV #WUDGWVG FGT )TWDG &TGK-ÌPKIUVGTP  I )GJCTPKUEJVGU $TWUVDKNF T   OKV WOIGNGIVGO /CPVGN(ÒPHHCEJ DGJGNOVGU XKGTHGNFKIGU 9CRRGP OKV YÒTVVGODGTIKUEJGO /KVVGN   UEJKNF&CX-NGKP4CHHC/ÒUGNGT  #VVTCMVKXGU'ZGORNCTOKVJGTTNKEJGT2CVKPCXQT\ÒINKEJ 



-CTN#NGZCPFGT-TGW\GT5VWVVICTV-NGKP4CHHDNGKEJVXCT  8QT\ÒINKEJGU'ZGORNCTOKVHGKPGT6ÌPWPI

 213


WÜRTTEMBERG

1252 1253

1253



-TGW\GT5VWVVICTV-NGKP4CHHC

8QT\ÒINKEJGU'ZGORNCTOKVHGKPGT6ÌPWPI





-CTN (TKGFTKEJ XQP 9ÒTVVGODGTI1GNU CNU #FOKPKUVTCVQT WPF 8QTOWPF XQP -CTN 'WIGP    4GKEJUVCNGT5VWVVICTV#WUDGWVGFGT)TWDG5V%JTKUVQRJUVCNI)GJCTPKUEJVGU$TWUV DKNFTOKVWOIGNGIVGO/CPVGNWPFOKV-TGW\FGURQNPKUEJGPYGK­GP#FNGTQTFGPUCO$CPFCO#TOCD UEJPKVV FKG 5KIPCVWT + Û 6 ,QPCU 6JK¾DCWF 5VGORGNUEJPGKFGT KP 5VWVVICTV  5V %JTKUVQ   RJQTWUOKVFGO%JTKUVWUMKPFCWHFGT5EJWNVGTUEJTGKVGVFWTEJFGP(QTDCEJKO8QTFGTITWPFNIGMTÌP VGUXKGTHGNFKIGU9CRRGPOKVFGOYÒTVVGODGTIKUEJGP/KVVGNUEJKNF\YKUEJGP\YGK(ÒNNJÌTPGTPT$GTI YGTMUCPNCIGPKO*KPVGTITWPFT(TGWFGPUVCFV&CX-NGKP4CHHC/ÒUGNGT  44(GKPG2CVKPCXQT\ÒINKEJ 

1255 1254

1254



4GKEJUVCNGT  5VWVVICTV #WUDGWVG FGT )TWDG 5V %JTKUVQRJUVCN )GJCTPKUEJVGU $TWUVDKNF T OKV WO   IGNGIVGO /CPVGN WPF OKV -TGW\ FGU RQNPKUEJGP YGK­GP #FNGTQTFGPU CO $CPF CO #TOCDUEJPKVV FKG   5KIPCVWT + Û 6 ,QPCU 6JK¾DCWF 5VGORGNUEJPGKFGT KP 5VWVVICTV  5V %JTKUVQRJQTWU OKV FGO   %JTKUVWUMKPF CWH FGT 5EJWNVGT UEJTGKVGV FWTEJ FGP (QTDCEJ KO 8QTFGTITWPF N IGMTÌPVGU XKGTHGNFKIGU   9CRRGPOKVFGOYÒTVVGODGTIKUEJGP/KVVGNUEJKNF\YKUEJGP\YGK(ÒNNJÌTPGTPT$GTIYGTMUCPNCIGPKO *KPVGTITWPFT(TGWFGPUVCFV&CX-NGKP4CHHC/ÒUGNGT  44*ÒDUEJG2CVKPCYKP\4CPFHGJNGTMN-TCV\GTXQT\ÒINKEJ 



-CTN 'WIGP   6CNGT  5VWVVICTV 2T·IWPI HÒT #WUNCPFU\CJNWPIGP 5QIGPCPPVGU   -TKGIUIGNF-NGKP4CHH 48QT\ÒINKEJp5VGORGNINCP\

1256

1257

1259



1258



(TKGFTKEJ++ + -TGW\GT8CTKCPVGQJPG9CWHFGT8QTFGTUGKVG#-5 42TCEJVGZGORNCT8QT\ÒINKEJp5VGORGNINCP\





-TGW\GT#-5

44(CUVUGJTUEJÌP





-TGW\GT#-5,

45GJTUEJÌP





-TGW\GT#-5,

448QT\ÒINKEJp5VGORGNINCP\



214


WÜRTTEMBERG

1261 1260

1260



-TQPGPVCNGT#-5&CX-CJPV6JWP

9KP\*GPMGNURWTUGJTUEJÌP





-TGW\GT#-5,

5GJTUGNVGPGT,CJTICPI5GJTUEJÌPpXQT\ÒINKEJ



1262

1263



9KNJGNO+-TQPGPVCNGT#-5&CX-CJPV6JWP  (GKPG2CVKPCUGJTUEJÌP





&QRRGNIWNFGP1JPG/ÒP\OGKUVGT\GKEJGP2$WPVGTFGO-QRHWPFQJPG2WPMVPCEJFGO/ÒP\ \GKEJGP9CWHFGT4ÒEMUGKVG#-5&CX-CJPV6JWP  5GJTUGNVGPKPFKGUGT'TJCNVWPI(GKPG2CVKPCXQT\ÒINKEJp5VGORGNINCP\



1264

1265



&QRRGNIWNFGP1JPG5KIPCVWT9#)0'4(CWHFGT8QTFGTUGKVG#-5#PO&CX-CJPV 6JWP 4#VVTCMVKXGU'ZGORNCTUGJTUEJÌPpXQT\ÒINKEJXQT\ÒINKEJ





&QRRGNIWNFGP1JPG5KIPCVWT9#)0'4(CWHFGT8QTFGTUGKVG#-5#PO&CX-CJPV 6JWP 4#VVTCMVKXGU'ZGORNCTUGJTUEJÌP



1266



-TQPGPVCNGT#-5&CX-CJPV6JWP



8GTGKPUFQRRGNVCNGT#-5&CX-CJPV6JWP

1267

2TCEJVGZGORNCT(CUV5VGORGNINCP\



8QT\ÒINKEJ

 215


WÜRTTEMBERG

1268

1271

1272



8GTGKPUFQRRGNVCNGT#-5&CX-CJPV6JWP  (GKPG2CVKPCYKP\4CPFHGJNGTXQT\ÒINKEJ





-TQPGPVCNGT&QRRGNIWNFGP6JWP Z 

5VÒEM5GJTUEJÌPWPFDGUUGT





8GTGKPUFQRRGNVCNGT(&QRRGNVGT8GTGKPUVCNGT((6JWP Z   5VÒEM5GJTUEJÌPpXQT\ÒINKEJ





-CTN&QRRGNVGT8GTGKPUVCNGT7NOGT/ÒPUVGT#-5&CX-CJPV6JWP 8QT\ÒINKEJ &QRRGNVGT8GTGKPUVCNGT7NOGT/ÒPUVGT#-5&CX-CJPV6JWP 8QT\ÒINKEJ

 



1273 (doppelt)

9ª466'/$'4)1'.5*'4<1)67/ 

5[NXKWU (TKGFTKEJ  &QRRGNVGT 4GKEJUVCNGT  52 1GNU  I /ÒP\OGKUVGT 5COWGN   2HCJNGT )GJCTPKUEJVGU $TWUVDKNF T OKV ITQ­GT #NNQPIGRGTÒEMG WPF WOIGNGIVGO /CPVGN8KGTHCEJ   DGJGNOVGUQXCNGUXKGTHGNFKIGU9CRRGPOKV/KVVGNUEJKNF&CX(W5  44(GKPG6ÌPWPI(GNFGTNGKEJVDGCTDGKVGVHCUVXQT\ÒINKEJGU'ZGORNCT  'ZGORNCTFGT5COONWPI-NCWU2TQRR#WMVKQP(TKV\4WFQNH-ÒPMGT1UPCDTÒEM0TWPF'ZGORNCT FGT5NI9WTUVGT#WMVKQP)CNGTKGFGU/QPPCKGU&ÒUUGNFQTH0T  &GT5VKHVGTFGT.KPKG9ÒTVVGODGTI1GNUGKPGU<YGKIGUFGT9GKNVKPIKUEJGP.KPKGYCT*GT\QI5[NXKWU0KOTQFGKP 5QJP FGU *GT\QIU ,WNKWU (TKGFTKEJ XQP 9ÒTVVGODGTI9GKNVKPIGP 'T XGTO·JNVG UKEJ  OKV 'NKUCDGVJ /CTKC FGT   GKP\KIGP6QEJVGT-CTN(TKGFTKEJUFGUNGV\VGP*GT\QIUXQP/ÒPUVGTDGTI1GNUKP5EJNGUKGPWPFGTDVGPCEJFGOXKGT 9QEJGP UR·VGT GTHQNIVGP 6QF UGKPGU 5EJYKGIGTXCVGTU FCU (ÒTUVGPVWO 1GNU PGDUV FGP *GTTUEJCHVGP 5VGTPDGTI KP   /·JTGP WPF /GF\KDQT KP 5EJNGUKGP 'T UVCTD  WPF JKPVGTNKG­ XKGT 5ÌJPG ÒDGT FKG UGKPG 9KVYG FKG 8QTOWPF   UEJCHV DKU \WO ,CJTG  HÒJTVG +P\YKUEJGP YCT FGT ·NVGUVG FGT 5ÌJPG IGUVQTDGP WPF FKG FTGK CPFGTGP 5[NXKWU   (TKGFTKEJ%JTKUVKCP7NTKEJWPF,WNKWU5KIKUOWPFVGKNVGPPWP.CPFWPF4GIKGTWPIKPFKGFTGK.KPKGP1GNU$GTPUVCFV WPF,WNKWUDWTI*GT\QI5[NXKWU(TKGFTKEJXGTO·JNVGUKEJOKV'NGQPQTG%JCTNQVVG6QEJVGTFGU*GT\QIU)GQTI ++ XQP 9ÒTVVGODGTI/ÌORGNICTV 5[NXKWU (TKGFTKEJ UVCTD  MKPFGTNQU WPF GKPG PGWG 6GKNWPI FGT *GT\QIVÒOGT   KP\YGK*·NHVGPYWTFGXQTIGPQOOGP#WHFGOUGJTUGNVGPGP&QRRGNVCNGTFGTFGP*GT\QIKPGKPGTIGYCNVKIGPHÒT FKG<GKVV[RKUEJGP2GTÒEMG\GKIVYGTFGPKPFGT6KVWNCVWTCWEJCWUFTÒEMNKEJFKG*GTTUEJCHVGP5VGTPDGTIWPF/GF\K DQTJGTXQTIGJQDGP

216


WÜRZBURG

1274

1275

1276

9ª4<$74)

$+567/ 

/GNEJKQT <QDGN XQP )KGDGNUVCFV  6CNGT  9ÒT\DWTI OKV 6KVGN -CTNU 8 &CX    *GNOUEJTQVV 5GJTUEJÌP 9ÒT\DWTIGT 2T·IWPIGP CWU FGT 5COONWPI FGT (TGKJGTTGP $QPFG HKPFGP 5KG KP -CVCNQI  WPVGT FGP   0TP



2GVGT2JKNKRRXQP&GTPDCEJ4GKEJUVCNGTQ,9ÒT\DWTI&CX*GNOUEJTQVV  449KP\*GPMGNURWTNGKEJVLWUVKGTVUGJTUEJÌPpXQT\ÒINKEJ



,QJCPP)QVVHTKGFXQP)WVVGPDGTI4GKEJUVCNGT9ÒT\DWTI&CX*GNOUEJTQVV /KPLWUVKGTVUGJTUEJÌP

1277

1278



 

1279



4GKEJUVCNGT9ÒT\DWTI&CX*GNOUEJTQVV

*ÒDUEJG2CVKPCUGJTUEJÌPpXQT\ÒINKEJ





,QJCPP 2JKNKRR XQP )TGKHHGPMNCW8QNNTCVJU  4GKEJUVCNGT  9ÒT\DWTI &CX    *GNOUEJTQVV *ÒDUEJG2CVKPCHCUVXQT\ÒINKEJ





#FCO(TKGFTKEJXQP5GKPUJGKO-QPX6CNGT9ÒT\DWTI&CX%*GNOUEJTQVV .GKEJVLWUVKGTVUGJTUEJÌPpXQT\ÒINKEJ

 217


WÜRZBURG

1280

1281

1281



(TCP\.WFYKIXQP'TVJCN-QPX6CNGT9ÒT\DWTI-QPVTKDWVKQP&CX*GNO UEJTQVV 4-N5EJTÌVNKPIUHGJNGTUGJTUEJÌP





)GQTI -CTN XQP (GEJGPDCEJ  -QPX6CNGT  9ÒT\DWTI -QPVTKDWVKQP &CX    *GNOUEJTQVV *GTTNKEJG2CVKPCNGKEJVLWUVKGTVHCUV5VGORGNINCP\



1282

1283

1283



-QPX6CNGT9ÒT\DWTI-QPVTKDWVKQP&CX*GNOUEJTQVV  (GKPG2CVKPCYKP\5EJTÌVNKPIUHGJNGTXQT\ÒINKEJ



5KNDGTOGFCKNNGXQP,8&ÌNN2T·OKGHÒT8GTFKGPUVGWO-WPUVWPF9KUUGPUEJCHV$TWUVDKNFNKP 1TPCV OKV WOIGNGIVGT -GVVG/KPGTXC OKV 5RGGT WPF 5EJKNFUVGJVXXFGP-QRHPCEJTIGYCPFV\W KJTGP(Ò­GP'ODNGOGFGT-WPUVWPF9KUUGPUEJCHVOOI*GNOUEJTQVV  448QT\ÒINKEJ 

218




MEDAILLEN

/'&#+..'0

1284

/+5%'..#0'# 4'.+)+10 

-NKRRGPHÌTOKIGXGTIQNFGVG5KNDGTIW­OGFCKNNGQ, ,CJTJWPFGTV WPUKIPKGTV&KG)GDWTV%JTK UVK&KG-TGW\KIWPI%JTKUVKZOOI  5R·VGTGT)W­#NVXGTIQNFGV*GPMGNURWTGPUGJTUEJÌP



1285

)1'6</'&#+..'0 

5KNDGTOGFCKNNG  UKIPKGTV XQP )WKFQ )QGV\ 5QJP XQP -CTN )QGV\ CWH FKG )CTCPVKGP FGT 9GUV   O·EJVGHÒT2QNGP'KP'PIN·PFGTWPFGKPG(TCP\ÌUKPWPVGTGKPGO4GIGPUEJKTOFGT'PIN·PFGTNGIVFGP #TO WO GKPGP RQNPKUEJGP,WPIGPOKV5VGEMGPRHGTF'KPFGWVUEJGT5QNFCVUVGJVÒDGTGKPGT-CPQPGWPF J·NVGKPGPRQNPKUEJGP5QNFCVGPKPUGKPGT4GEJVGPWPFGKPGP$NKV\KPFGT.KPMGPWPVGPTGKP2HGTF/KV 4CPFRWP\G$#;'4Ü*#726/ª0<#/6Û5+.$'4HOOI-KGPCUV  8QPITQ­GT5GNVGPJGKV(GKPG2CVKPCHCUV5VGORGNINCP\



1286

.7(6(#*46 

$TQP\GPG 8GTFKGPUVOGFCKNNG  XQP & (CJTPGT (TGWFGPUVCFV 2T·IGCPUVCNV /C[GT WPF 9KNJGNO   5VWVVICTV CWH FKG #OGTKMCHCJTV FGU .<  $ÒUVG &T *WIQ 'EMGPGTU N0CEMVGT /CPP UVGJV HCUV   XXXQTGKPGO.WHVUEJKHHOO-CKUGT 8QT\ÒINKEJ

 219


MEDAILLEN

1287

2'4510'0/'&#+..'0 

XQP $KUOCTEM 1VVQ (ÒTUV  5EJÌPJCWUGP Ó (TKGFTKEJUTWJ &GWVUEJGT 4GKEJMCP\NGT   5KNDGTOGFCKNNG Q ,   XQP , .QTGP\ *CODWTI CWH UGKPG 4GKEJUVCIUTGFG CO  /CK  OKV   FGO DGMCPPVGP 5CV\ 5GKGP 5KG CW­GT 5QTIG PCEJ %CPQUUC IGJGP YKT PKEJV  YGFGT MÌTRGTNKEJ PQEJ   IGKUVKI $ÒUVG FGU 4GKEJUMCP\NGTU N)GMTÌPVG )GTOCPKC OKV 5EJYGTV WPF $WEJ UVGJV PCEJ N WPF   FT·PIVFGP2CRUV\WTÒEM\WUGKPGP(Ò­GPNGKP-CUVGNNCO$QFGPTÒUVGVUKEJFGT#FNGTFGT)GTOCPKC \WO#PITKHHCWHFKG5EJNCPIGFGU2CRUVGUOOI$GPPGTV)CGF  8QPRQNKGTVGP5VGORGNPHCUV5VGORGNINCP\



1288



XQP *WODQNFV #NGZCPFGT  Ó &GWVUEJGT 0CVWTHQTUEJGT WPF )GQITCH 5KNDGTOGFCKNNG    XQP - (KUEJGT CWH FCU 'TUEJGKPGP FGU  $CPFGU UGKPGU 9GTMGU -QUOQU $ÒUVG T)GPKWU   GPVJÒNNVFKG5VCVWGFGT0CVWT\WUGKPGP(Ò­GP5RJKPZWOJGT$NWOGPMTCP\KO·W­GTGP4KPI-QOGVGP WPF6KGTMTGKU\GKEJGPOOI5NI$TGVVCWGT 44-N4CPFMGTDGXQT\ÒINKEJ

ex 1289

220




MEDAILLEN

ex 1289

&'765%*'-1.10+'0 

&GWVUEJ5ÒFYGUVCHTKMC 7OHCPITGKEJG 5COONWPI XQP JQEJQXCNGP GKPUGKVKIGP $TQP\G2C­OCTMGP  

-TQPG ÒDGT 5EJTKHV  FGT -QNQPKG &GWVUEJ5ÒFYGUVCHTKMC FCTWPVGT GKPKIG 5GNVGPJGKVGP +O 'KP\GNPGP   JCPFGNV GU UKEJ WO $< 59-2& -QPVTQNNPWOOGT  $\ -GGVOCPUJQQR -QPVTQNNPWOOGT $\-CTKDKD-QPVTQNNPWOOGT$\)KDGQP-QPVTQNNPWOOGT$\1WVLQ-QPVTQNNPWOOGT $\ .ÒFGTKV\DWEJV -QPVTQNNPWOOGT  -GGVOCPUJQQR -QPVTQNNPWOOGT  9KPFJWM -QPVTQNN   PWOOGT)KDGQPQJPGGKPIGUEJNCIGPG-QPVTQNNPWOOGT-QPVTQNNPWOOGTWPF-QPVTQNNPWOOGT )QDCDKU-QPVTQNNPWOOGT.ÒFGTKV\DWEJV-QPVTQNNPWOOGT-QPVTQNNPWOOGT -QPVTQNNPWOOGT  -QPVTQNNPWOOGT  -QPVTQNNPWOOGT  -QPVTQNNPWOOGT    -QPVTQNNPWOOGT  -QPVTQNNPWOOGT  -QPVTQNNPWOOGT  -QPVTQNNPWOOGT    -QPVTQNNPWOOGT  -QPVTQNNPWOOGT  -QPVTQNNPWOOGT  -QPVTQNNPWOOGT  WPF   -QPVTQNNPWOOGT  1OCTWTW -QPVTQNNPWOOGT  1WVLQ -QPVTQNNPWOOGT  4GJQDQVJ   -QPVTQNNPWOOGT  5YCMQROWPF QJPG GKPIGUEJNCIGPG -QPVTQNNPWOOGT -QPVTQNNPWOOGT    -QPVTQNNPWOOGT-QPVTQNNPWOOGT-QPVTQNNPWOOGT-QPVTQNNPWOOGT-QPVTQNN PWOOGTWPF-QPVTQNNPWOOGT-CTKDKD-QPVTQNNPWOOGT)TQQVHQPVGKP\YGKOCNQJPG GKPIGUEJNCIGPG -QPVTQNNPWOOGT 9CTODCF -QPVTQNNPWOOGT  $GVJCPKGP -QPVTQNNPWOOGT    /CNVCJÌJG -QPVTQNNPWOOGT  &C\W GKPKIG YGKVGTG /CTMGP FGT -QNQPKG 2418 #/6    9+0&*1%-$41&/9 GKPUGKVKITWPF 2418#/69+0&*1%--.)(.'+5%* /9 GKPUGKVKI XKGTGEMKI   -1/2#)0+' /CTM \YGKUGKVKI TWPF  -#+5'4.    *#('0$#7#/6 OKV -QPVTQNNPWOOGT  \YGKUGKVKI CEJVGEMKI  UQYKG  4WRKG  # 'KP   JQEJKPVGTGUUCPVGU1DLGMVFCUUKEJJGTXQTTCIGPF\WO#WHDCWQFGTCNU'TI·P\WPIGKPGTDGTGKVUDGUVGJGP FGP5COONWPIGKIPGVWPFWPDGFKPIVDGUKEJVKIVYGTFGPUQNNVG/E)TGIQT*·DGTNKPI  Z  Z  Z  Z   5VÒEM6GKNYGKUGUGJTUGNVGP5GJTUEJÌPWPFDGUUGT 

221


MEDAILLEN

1290 1:1,3



2NCMGVVGCWUYGK­GO$CMGNKVXQP/C[GTWPF9KNJGNO'JTGPRTGKUFGT5ÒFYGUVCHTKMCPKUEJGP.CP FGUCWUUVGNNWPI KP 9KPFJWM 6KGTG KP .CPFUEJCHV T -CKUGTMTQPG ÒDGT CWHIGJGPFGT 5QPPG5KGDGP <GK   NGP5EJTKHVZOO 8QPITQ­GT5GNVGPJGKV8QT\ÒINKEJ 

1291

9'.6-4+') 

6TCIDCTGXGTIQNFGVG$TQP\G*QJNOGFCKNNGWPUKIPKGTVCWHFKG9GPFWPIFGU-TKGIUXQTVGKNU&GWV UEJG5QNFCVGPOCTUEJKGTGPKP2CTKUGKP&GWVUEJGT-TKGIUIGHCPIGPGTYKTFPCEJ2CTKUIGHÒJTVOO 8QT\ÒINKEJ



/'&#+..'0.165 





222

#NNIGOGKP &KXGTUG /GFCKNNGP FGU <GKVTCWOGU  W C /CIFGDWTI XGTIQNFGVG DTQP\GPG .Q   IGPOGFCKNNG/GEMNGPDWTI$TQP\GOGFCKNNG5CEJUGP$TQP\GPG2TGKUOGFCKNNG<GRRG NKP 5KNDGTOGFCKNNG  FKXGTUG 6CWHOGFCKNNGP UQYKG GKPG CWHYGPFKI IGCTDGKVGVG 5V )GQTIUOGFCKNNG   +PVGTGUUCPVGU.QVDKVVGDGUKEJVKIGP 5VÒEM6GKNYGKUGKP1TKIKPCNGVWKOGKUVXQT\ÒINKEJ



&KXGTUG /GFCKNNGP FGU  ,CJTJWPFGTVU CWH XGTUEJKGFGPG #PN·UUG WPF 2GTUQPGP -GORVGP MNGKPG   5KNDGTOGFCKNNG  0KGFGTNCPFG MNGKPG -WRHGTOGFCKNNG  5CEJUGP 5KNDGTOGFCKNNG Q , 8CNGP   EKGPPGU MNGKPG 5KNDGTOGFCKNNG  5EJYGK\ 1XCNG VTCIDCTG 5KNDGTOGFCKNNG  2TGW­GP <KPPOG   FCKNNG  2TGW­GP $KUOCTM  /GFCKNNGP-NKRRG Q , 4WO·PKGP VTCIDCTG 5KNDGTOGFCKNNG    0ÒTPDGTI5KNDGTOGFCKNNG&GWVUEJGU4GKEJ *KPFGPDWTI 5KNDGTOGFCKNNGQ, Z   5VÒEM6GKNYGKUGOKVMN(GJNGTPOGKUVUGJTUEJÌP



&KXGTUG 5KNDGTOGFCKNNGP FGU  ,CJTJWPFGTVU W C XQP $TCPFGPDWTI2TGW­GP $TGOGP 8CVKMCP   GVE&C\W5CEJUGP6CNGTMNKRRG IGJGPMGNV +PVGTGUUCPVGU.QVDKVVGDGUKEJVKIGP  5VÒEM)GJGPMGNV Z UQPUVUGJTUEJÌPpXQT\ÒINKEJ




ORDEN UND EHRENZEICHEN

'+0'#75<'+%*070)#75&'765%*5ª&9'56#(4+-#

1295

&'765%*'56##6'0$+5 &'765%*'54'+%* 

6TCIDCTG#WU\GKEJPWPIQ, PCEJ KP$TQP\G\WT'TKPPGTWPICPFKG#WHUV·PFGFGT*GTGTQWPF 0COC  7PKHQTOKGTVGU $TWUVDKNF 9KNJGNOU ++ T5KGDGP <GKNGP 5EJTKHV KP .QTDGGT WPF   'KEJGPMTCP\ &WTEJOGUUGT  OO  #P FGT/GFCKNNGUKPFXKGTFWTEJGKPG-GVVGOKVGKPCPFGTXGT DWPFGPG SWCFTCVKUEJG /KPKCVWTRNCMGVVGP EC  Z  OO  CPIGDTCEJV &KG 8QTFGTUGKVGP FGT   2NCMGVVGP\GKIGP&CTUVGNNWPIGPCWUFGO-CORHIGIGPFKG'KPIGDQTGPGPUQYKGFKGWPKHQTOKGTVGP$TWUV DKNFGTFGT#PHÒJTGTFGU#WHUVCPFU*GPFTKM9KVDQQKWPF5COWGN/CJCTGTQ&KG4ÒEMUGKVGP\GKIGPFKG WPKHQTOKGTVGP $TWUVDKNFGT FGT-QOOCPFGWTGFGUFGWVUEJGP'ZRGFKVKQPUMQTRU)GPGTCN#FTKCP&KGVTKEJ .QVJCTXQP6TQVJC1DGTUV6JGQFQT)QVVJKNH.GWVYGKP/CLQT.WFYKIXQP'UVQTHHWPF*CWRVOCPP8KE VQT(TCPMG.·PIGFGT#WU\GKEJPWPIKPUIGUCOVOOI  445GJTUEJÌPpXQT\ÒINKEJ



#WUIGNÌUVFWTEJ&KUMTKOKPKGTWPIGPUGKVGPUFGTYGK­GP-QNQPKUVGPWPFGKPGOKOOGTITÌ­GTYGTFGPFGP8GTNWUVXQP 9GKFGIGDKGVGP MCO GU KO ,CPWCT  \W GKPGO #WHUVCPF FGU 5VCOOGU FGT *GTGTQ IGIGP FKG FGWVUEJG -QNQPKCN   OCEJVKP5ÒFYGUVCHTKMC&KGFGWVUEJG5EJWV\VTWRRGYCTFGO#WHUVCPFOKNKV·TKUEJ\WP·EJUVPKEJVIGYCEJUGPUQFCUU FKG 4GKEJUTGIKGTWPI GKP  /CPP UVCTMGU /CTKPGGZRGFKVKQPUMQTRU WPVGT (ÒJTWPI )GPGTCN .QVJCTU XQP 6TQVJC   GPVUCPFVG &GUUGP -TKGIUHÒJTWPI YCT XQP GKPGT DGUQPFGTGP)TCWUCOMGKVIGIGPÒDGTFGTGKPJGKOKUEJGP$GXÌNMGTWPI IGRT·IV /GJT CNU FKG *·NHVG FGU 8QNMGU FGT *GTGTQ XGTNQT FWTEJ FKG -CORHJCPFNWPIGP -TCPMJGKVGP *WPIGT WPF   &WTUVFCU.GDGP5EJQEMKGTVXQPFGO8QTIGJGPFGT5QNFCVGPIGIGPFKG'KPIGDQTGPGPUEJNQUUGPUKEJFKGDKUJGTOKV FGP &GWVUEJGP XGTDÒPFGVGP 5V·OOG FGT 0COC GDGPHCNNU FGO #WHUVCPF CP +O &G\GODGT  MQPPVG FWTEJ FKG   8GTOKVVNWPI XQP /KUUKQPCTGP GKP (TKGFGPUUEJNWUU GTTGKEJV YGTFGP &KG NGV\VGP #WHUV·PFKUEJGP MCRKVWNKGTVGP LGFQEJ   GTUVKO/·T\

223


LOTS

2#2+'4)'.& $#0-&'765%*'4.0&'4$70&'54'27$.+-&'765%*.#0& 

&GWVUEJG/CTM $# &GWVUEJG/CTM #$ &GWVUEJG/CTM QJPG #WHFTWEM &GWVUEJG/CTM QJPG#WHFTWEM #NNG5GTKG&C\WWPF2HGPPKIQ,  5VÒEM+p+++



.165 #..)'/'+0 

7OHCPITGKEJG5COONWPIXQP/ÒP\GPFGUWPF,CJTJWPFGTVUXQPFGT-NGKPDKU\WT)TQ­UKNDGT WPF)GFGPMOÒP\GCWUHCUVCNNGP.·PFGTPFGT9GNVFCTWPVGT#HIJCPKUVCPI[RVGP#NDCPKGP#PIQNC #TIGPVKPKGPVJKQRKGP#WUVTCNKGP$CJTCKP$CPINCFGUEJ$CTDCFQU$GNIKGP$JWVCP$KTOC$QNKXKGP $QVUYCPC$TCUKNKGP$TWPGK$WNICTKGP%G[NQP%JKNG%JKPC%QUVC4KEC&·PGOCTM&QOKPKMCPKUEJG 4GRWDNKM'EWCFQT'N5CNXCFQT'UVNCPF(KPPNCPF(TCPMTGKEJ)CODKC)JCPC)TKGEJGPNCPF)TQ­ DTKVCPPKGP )WCVGOCNC *CKVK *QPFWTCU +PFKGP +PFQPGUKGP +TCM +TCP +TNCPF +UNCPF +UTCGN +VCNKGP   ,COCKMC,CRCP,GOGP,QTFCPKGP-CODQFUEJC-COGTWP-CPCFC-GPKC-QNWODKGP-QPIQ-QTGC -WDC -WYCKV .CQU .GUQVJQ .GVVNCPF .KDCPQP .KDGTKC .KVCWGP .WZGODWTI /CFCICUMCT /CNC[   UKC /CNK /CNVC /CTQMMQ /CWTKVKWU /GZKMQ /QPCEQ /QPIQNGK 0GRCN 0GWUGGNCPF 0KECTCIWC   0KGFGTNCPFG 0KIGTKC 0QTYGIGP ¤UVGTTGKEJ 2CMKUVCP 2CPCOC 2CTCIWC[ 2GTW 2JKNKRRKPGP 2QNGP   2QTVWICN 4WO·PKGP 4WUUNCPF 5CODKC 5CP /CTKPQ 5CWFK#TCDKGP 5EJYGFGP 5EJYGK\ 5G[EJGNNGP   5KGTTC .GQPG 5QOCNKC 5NQYCMGK 5RCPKGP 5TK .CPMC 5ÒFCHTKMC 5WFCP 5[TKGP 6CKYCP 6CPUCPKC   6JCKNCPF6QIQ6UEJCF6UEJGEJQUNQYCMGK6WPGUKGP6ÒTMGK7ICPFC7PICTP7TWIWC[75#8GPG \WGNC<GPVTCNHTKMCPKUEJG4GRWDNKMWPF<[RGTP&C\WGKP-QPXQNWVFGWVUEJGT/ÒP\GPXQO-CKUGTTGKEJ DKU\WT$WPFGUTGRWDNKM&GWVUEJNCPF'KPJQEJKPVGTGUUCPVGU1DLGMVFCUUKEJJGTXQTTCIGPF\WO#WUDCW QFGTCNU'TI·P\WPIGKPGTDGTGKVUDGUVGJGPFGP5COONWPIGKIPGVDKVVGDGUKEJVKIGP  EC5VÒEM5EJÌPp5VGORGNINCP\ 



5COONWPICNVFGWVUEJGTWPFCWUN·PFKUEJGT-WTUOÒP\GPFGUDKU,CJTJWPFGTVUFCTWPVGT$WNICTKGP ,CRCP-CPCFC.KVCWGP4W­NCPFWPF5RCPKGP&C\WGKPKIGFGWVUEJG/ÒP\GPXQO-CKUGTTGKEJDKU\WO &TKVVGP4GKEJ+PVGTGUUCPVGU.QVDKVVGDGUKEJVKIGP  EC5VÒEM7PVGTUEJKGFNKEJGTJCNVGPOGKUVUGJTUEJÌP





&KXGTUG FGWVUEJG WPF CWUN·PFKUEJG /ÒP\GP FGU  ,CJTJWPFGTVU W C ¤UVGTTGKEJ /ÒP\GP FGT   )GKUVNKEJMGKV 4WO·PKGP ,CRCP UQYKG GKPKIG /ÒP\GP FGU -CKUGTTGKEJU W C $CFGP  /CTM   

4GIKGTWPIULWDKN·WO  5VÒEM5GJTUEJÌPpXQT\ÒINKEJ





5COONWPIXQP*CNDDCV\GPFGU4ÌOKUEJ&GWVUEJGP4GKEJGUWPFFKXGTUGTCNVFGWVUEJGT5VCCVGP  5VÒEM/GKUVUGJTUEJÌP





&KXGTUG5EWFK)WNFGP6CNGTGVEWC#PJCNV<GTDUV6CNGT*QNUVGKP)QVVQTR6CNGT 2CTOC4CPWEEKQ++(CTPGUG5EWFQQ,GVE 5VÒEM5EJÌPpUGJTUEJÌP





(TCPMTGKEJ4GRWDNKM(TCPEU Z -QNQPKGP#HTKSWGQEEKFGPVCNG%GPVKOGU Z   5VÒEM5GJTUEJÌP



#.6&'765%*.#0& 

/KVVGNCNVGT -NGKPG 5COONWPI GWTQR·KUEJGT /ÒP\GP OGKUV FGU /KVVGNCNVGTU XQO  DKU  ,CJT   JWPFGTV FCTWPVGT \CJNTGKEJG DGUUGTG 5VÒEMG W C XQP &GWVUEJNCPF (TCPMTGKEJ +VCNKGP WPF FGP   -TGW\HCJTGTP/GKUVOKV$GUEJTGKDWPIU\GVVGNP 5VÒEM<WO6GKNUGNVGP/GKUVUGJTUEJÌP 



2QOOGTP-NGKPG5COONWPIXQPRQOOGTUEJGP&GPCTGPFGU5R·VOKVVGNCNVGTU  5VÒEM5EJÌPpUGJTUEJÌP





#NNIGOGKP#PJCNV6CNGT #WUDGWVG6JWP 8GTGKPUVCNGT 6JWP  #WUDGWVG6JWP    CWH FKG 8GTGKPKIWPI FGT CPJCNVKPKUEJGP (ÒTUVGPVÒOGT 6JWP   $CFGP 8GTGKPUVCNGT   

6JWP *CPPQXGT8GTGKPUVCNGT$ 9CVGTNQQ6JWP /GEMNGPDWTI6CNGT #PIUVVCNGT 6JWP   8GTGKPUVCNGT  6JWP   1NFGPDWTI 6CNGT  6JWP   5CEJUGP 8GTGKPUVCNGT    6JWP  $  6CNGT  6JWP   9ÒTVVGODGTI &QRRGNIWNFGP  6JWP   &C\W   $CFGP)WNFGP$C[GTP)WNFGP*GUUGP)WNFGP9ÒTVVGODGTI)WNFGP 5VÒEM/GKUVUGJTUEJÌP



*CODWTI4GKEJUVCNGT &CX 0ÒTPDGTI-QPX6CNGT &CX  &CX  4GIGPUDWTI4GKEJUVCNGT &CX 5CEJUGP-QPX6CNGT &CX   5VÒEM/GKUVUGJTUEJÌP



#WIUDWTI 4GKEJUVCNGT  OKV 6KVGN (GTFKPCPFU +++ -QPX6CNGT  OKV 6KVGN XQP (TCP\ +    6CNGT  OKV 6KVGN (GTFKPCPFU ++ $C[GTP -QPX6CNGT   .ÒDGEM 6CNGT  5EJKNNKPI     0ÒTPDGTI -QPX6CNGT  OKV 6KVGN XQP (TCP\ +  OKV 6KVGN ,QUGHU ++ 4GIGPUDWTI   -QPX6CNGT  OKV 6KVGN XQP (TCP\ + 5CEJUGP  -QPX6CNGT  &C\W *CDUDWTIKUEJG   'TDNCPFG-TQPGPVCNGT//CKNCPF 5VÒEM/GKUVUGJTUEJÌP







224


LOTS 

&KXGTUGCNVFGWVUEJG/ÒP\GPFGU,CJTJWPFGTVUXQO2HGPPKIDKU\WO6CNGTFCTWPVGTCWEJDGU UGTG 6[RGP WPF GKPKIG 5GNVGPJGKVGP &C\W YGPKIG CWUN·PFKUEJG 2T·IWPIGP UQYKG GKPG CPVKMG /ÒP\G   *QEJKPVGTGUUCPVGU.QVDKVVGDGUKEJVKIGP 5VÒEM+P1TFPGT5EJÌPpXQT\ÒINKEJ 



&KXGTUG 6CNGT WPF &QRRGNVCNGT FGU  ,CJTJWPFGTVU 6JWP   5KGI   %QPUVKVWKGTGPFG 8GT   UCOONWPI  L·JTKIGU4GIKGTWPIULWDKN·WO  5VÒEM/GKUVXQT\ÒINKEJ





&KXGTUG6CNGTWPF&QRRGNVCNGTFGU,CJTJWPFGTVU6JWP&C\W5CEJUGP (TKGFTKEJ#WIWUV+6CNGT5CWHUGKPGP6QF #-5   5VÒEM5GJTUEJÌPpXQT\ÒINKEJWPFDGUUGT



-NGKPG5COONWPIXQP/ÒP\GPWPF/GFCKNNGPFGU,CJTJWPFGTVUCWU2QT\GNNCPWPF5VGKP\GWIFCTWP VGTCWEJDGUUGTG6[RGP+PVGTGUUCPVGU.QVDKVVGDGUKEJVKIGP  5VÒEM+P#NDWO/GKUVXQT\ÒINKEJ



-NGKPGU .QV XQP FKXGTUGP )TQUEJGP FGWVUEJGT 5V·FVG $TCWPUEJYGKI )TQUEJGP  )ÌVVKPIGP )TQ   UEJGP  *COGNP )TQUEJGP  *ÌZVGT )TQUEJGP  .ÒDGEM )TQUEJGP Q ,    ,CJTJWPFGTV  5VÒEM/GKUVUGJTUEJÌP









7OHCPITGKEJG 5GTKG CNVFGWVUEJGT /ÒP\GP WPF /GFCKNNGP FGU  ,CJTJWPFGTVU FCTWPVGT GKPG WO   HCPITGKEJG 5GTKG XQP $T2TGW­GP FKXGTUG CNVFGWVUEJG 6CNGT GVE *QEJKPVGTGUUCPVGU .QV DKVVG DGUKEJVK   IGP 5VÒEM+P#NDWO6GKNYGKUGOKVMNGKPGP(GJNGTPOGKUVUGJTUEJÌP 



&KXGTUG 6CNGT &QRRGNVCNGT WPF )WNFGP FGU  ,CJTJWPFGTVU Z  &C\W GKPKIG -W-TGW\GT XQP   $CFGPUQYKGGKPKIGCWUN·PFKUEJG5KNDGTOÒP\GPFGU,CJTJWPFGTVU+PVGTGUUCPVGU.QVDKVVGDGUKEJ VKIGP 5VÒEM5GJTUEJÌPpXQT\ÒINKEJ





5COONWPICNVFGWVUEJGT/CTKGPITQUEJGPFGU,CJTJWPFGTVUXGTUEJKGFGPGTCNVFGWVUEJGT5VCCVGP  5VÒEM5EJÌPpUGJTUEJÌP





5COONWPI CNVFGWVUEJGT -TGW\GT5VÒEMG FGU  WPF  ,CJTJWPFGTVU XGTUEJKGFGPGT CNVFGWVUEJGT   5VCCVGPFC\W9ÒTVVGODGTI-TGW\GT 5VÒEM5EJÌPpUGJTUEJÌP





5COONWPIXQP)TQUEJGPFGUWPF,CJTJWPFGTVUFKXGTUGTCNVFGWVUEJGT5VCCVGP  5VÒEM/GKUVUGJTUEJÌP



+PVGTGUUCPVG 5COONWPI XQP #NDWU5VÒEMGP -TGW\GTP GVE FGU  ,CJTJWPFGTVU FKXGTUGT CNVFGWVUEJGT   5VCCVGP 5VÒEM/GKUVUGJTUEJÌP





.QVXQPFKXGTUGPCNVFGWVUEJGP5EJÒUUGNRHGPPKIGP

5VÒEM5EJÌPpUGJTUEJÌP





.QVXQPFKXGTUGPCNVFGWVUEJGP2HGPPKIGP

5VÒEM5EJÌPpUGJTUEJÌP





.QVXQPFKXGTUGPOGKUVU·EJUKUEJGP&TGKGTP

5VÒEM5EJÌPpUGJTUEJÌP





&KXGTUGFGWVUEJG6CNGTWPF)WNFGPFGU,CJTJWPFGTVUWCXQP$C[GTP$TCWPUEJYGKI9QNHGP DÒVVGN/CIFGDWTI2TGW­GP5CEJUGP5VQNDGTIWPF9ÒT\DWTI+PVGTGUUCPVGU.QVDKVVGDGUKEJVKIGP  5VÒEM6GKNYGKUGOKVMN(GJNGTPOGKUVUGJTUEJÌP





&KXGTUG6CNGTWPF6GKNUVÒEMGFGU,CJTJWPFGTVUXQO2HGPPKIDKU\WO6CNGTWCXQP$CODGTI $C[GTP5CEJUGP7NO*CDUDWTIGVE+PVGTGUUCPVGU.QVDKVVGDGUKEJVKIGP 5VÒEM5EJÌPpUGJTUEJÌP





-NGKPGU-QPXQNWVXQPFGWVUEJGP/ÒP\GPWPF/GFCKNNGPFGU,CJTJWPFGTVUFCTWPVGT'KUNGDGP 6CNGT *GPMGNURWTIGIN·VVGV #PJCNV#WUDGWVGVCNGT&C\W0KLOGIGP6CNGTQ,OKV$TWUV DKNFWPF6KVGN-CKUGT-CTNU8 (CUUWPIUURWTGPHCUVUGJTUEJÌP  5VÒEM(CUVUGJTUEJÌPpXQT\ÒINKEJ



5EJNGUKGP 5COONWPI UEJNGUKUEJGT -TGW\GT5VÒEMG FGU  ,CJTJWPFGTVU +PVGTGUUCPVGU 1DLGMV DKVVG   DGUKEJVKIGP 5VÒEM5EJÌPpUGJTUEJÌP







#75.#0& 

#NNIGOGKP&KXGTUG/ÒP\GPFGU,CJTJWPFGTVUWCXQP%JKPC(TCPMTGKEJ)TQ­DTKVCPPKGPFGT 5EJYGK\ 5QOCNKC GVE FCTWPVGT DGUUGTG 6[RGP WPF VGKNYGKUG JÒDUEJG 3WCNKV·VGP &C\W GKPKIG CNVFGWV   UEJG6CNGTWPF6GKNUVÒEMG *CPPQXGT2TGW­GP +PVGTGUUCPVGU.QVDKVVGDGUKEJVKIGP  5VÒEM/GKUVXQT\ÒINKEJ 



'PINCPF 'FYCTF +++ 2GPP[ Q , (KPPNCPF  /CTMMC   2GPPKC  +TNCPF  2GPEG   

$CPM 6QMGP  -CPCFC $NCEMUOKVJ OQPG[  /CFGKTC /CTMG \W  4GKU  2GTW   2TQMNCOCVKQPUOGFCKNNG 5KOQP$QNKXCU UQYKG)TQ­DTKVCPPKGPMNGKPG&QUGOKV/KPKCVWTOGFCKNNGP CWUWPGFNGP/GVCNNGP 5VÒEM5GJTUEJÌPpXQT\ÒINKEJ



'WTQRC&KXGTUG/ÒP\GPFGU,CJTJWPFGTVU(TCPMTGKEJ'EWCWZTCOGCWZF QNKXKGT5KN DGTLGVQPQ,5KNDGTOGFCKNNG5QNU+VCNKGP6CNGT.KTG0KGFGTNCPFG 5KNDGTFWMCV5VÒDGT5EJYGK\&KEMGP$CV\GP(TCPMGP  5VÒEM*GPMGNURWT Z UGJTUEJÌP





225


RÖMISCH-DEUTSCHES REICH 

#TOGPKGP-NGKPGU.QVXQPUKGDGPÕ6TCOU CNNG*GVQWOWPF<CDGN  5VÒEM5GJTUEJÌPpXQT\ÒINKEJ





0KGFGTNCPFG+PVGTGUUCPVG5COONWPIXQPPKGFGTN·PFKUEJGP.ÌYGPVCNGTPFGU,CJTJWPFGTVU  5VÒEM/GKUVUGJTUEJÌP





0KGFGTNCPFG+PVGTGUUCPVG5COONWPIXQPPKGFGTN·PFKUEJGP.ÌYGPVCNGTPFGUWPF,CJTJWPFGTVU 5VÒEM(CUVUGJTUEJÌPWPFUGJTUEJÌP





0KGFGTNCPFG +PVGTGUUCPVG 5COONWPI XQP  PKGFGTN·PFKUEJGP 4GKEJUVCNGTP FGU  ,CJTJWPFGTVU W C   *QNNCPF)GNFGTP9GUVHTKGUNCPFGVE  5VÒEM/GKUVUGJTUEJÌP





0KGFGTNCPFG +PVGTGUUCPVG 5COONWPI XQP  PKGFGTN·PFKUEJGP 5KNDGTFWMCVGP FGU  WPF  ,CJTJWP   FGTVU WC)GNFGTP9GUVHTKGUNCPFGVE  5VÒEM/GKUVUGJTUEJÌP





5RCPKGP-NGKPG5COONWPIXQP4GCNGU Z WPF4GCNGU5VÒEMGP Z 





5RCPKGP-NGKPG5COONWPIXQP4GCNWPF4GCNGU5VÒEMGP*QEJKPVGTGUUCPVGU1DLGMVDKVVGDGUKEJVK IGP 5VÒEM5EJÌPpUGJTUEJÌP 



5RCPKGP-NGKPG5COONWPIURCPKUEJGU5EJKHHUIGNF'PVJCNVGPUKPFXGTUEJKGFGPG0QOKPCNGXQP4GCNGU DKU4GCNGUCNNGOKV,CJTGU\CJN 5VÒEM/GKUVUGJTUEJÌP





#NNG 9GNV &KXGTUG /ÒP\GP FGU  ,CJTJWPFGTV CWU CNNGT 9GNV FCTWPVGT KPVGTGUUCPVG 5VÒEMG 'U   JCPFGNVUKEJ\WOGKUVWO5KNDGTOÒP\GP+PVGTGUUCPVGU.QVDKVVGDGUKEJVKIGP  5VÒEM'KPKIGOKVMN(GJNGTPUEJÌPpXQT\ÒINKEJ



)TQ­G IGRHNGIVG 5COONWPI XQP 9GNVOÒP\GP OGKUV FGU  ,CJTJWPFGTVU CDGT CWEJ GKPKIG FGU    ,CJTJWPFGTVU$GNIKGP&·PGOCTM(KPPNCPF(TCPMTGKEJ)TKGEJGPNCPF)TQ­DTKVCPPKGP OKV-QNQPKGP  +UNCPF+VCNKGP.WZGODWTI/QPCEQ0KGFGTNCPFG FCTWPVGTGKPG)QNFRT·IWPI\W'EWI TCWJ 0QTYGIGP2QTVWICN5EJYGFGP5QYLGVWPKQPWPF(#1/ÒP\GP  /GJTCNU/ÒP\GPKP#NDGP/GKUVXQT\ÒINKEJp5VGORGNINCP\





5VÒEM5EJÌPpUGJTUEJÌP

*#$5$74)+5%*''4$.#0&'¤56'44'+%*

1339

6+41.)4#(5%*#(6 

'T\JGT\QI5KIKUOWPFFGT/ÒP\TGKEJG )WNFKPGT*CNNI5VGORGNUEJPGKFGT 9GP\GN -TÌPFN &GT 'T\JGT\QI UVGJV X X N .ÌYG OKV 9CRRGP T *GNO4KVVGT OKV (CJPG TGKVGV T   FCTWPVGTFKG,CJTGU\CJNWOJGT9CRRGPUEJKNFG&CX/68QINJ++++8  44(CUVXQT\ÒINKEJGU'ZGORNCTOKVHGKPGT6ÌPWPI  $GK FKGUGT 2T·IWPI JCPFGNV GU UKEJ WO FKG ·NVGUVG 6CNGTRT·IWPI 'T\JGT\QI 5KIKUOWPF JCV  PCEJ 8QTCTDGKVGP   FKG DKU KPU ,CJT  \WTÒEMTGKEJGP FKGUG )TQ­UKNDGTOÒP\G RT·IGP NCUUGP 8QTCWUIGICPIGP YCT  FKG 2T·IWPI   XQP *CNDIWNFKPGTP $KU FCJKP JCVVG GT KP ITQ­GT #P\CJN )QNFIWNFGP JGTUVGNNGP NCUUGP WO FGO UVGKIGPFGP $GFCTH   PCEJ GKPGTYGTVXQNNGP/ÒP\GPCEJ\WMQOOGP&C6KTQNMGKPGGKIGPGP)QNFXQTMQOOGPJCVVGYCTFKG)QNFRT·IWPI CDGT IGTCFG MQUVGPFGEMGPF &CIGIGP YCT FKG #WUDGWVG FGU 5EJYC\GT 5KNDGTDGTIDCWU CW­GTQTFGPVNKEJ ITQ­ 5Q   GPVUVCPF FKG +FGG \W GKPGT ITQ­GP 5KNDGTOÒP\G KO 9GTV GKPGU )QNFIWNFGPU GU YCT FKG )GDWTVUUVWPFG FGU 6CNGTU   +JTGP0COGPGTJKGNVGPFKGUG/ÒP\GPCNNGTFKPIUGTUV#PHCPIFGU,CJTJWPFGTVUFWTEJFKG,QCEJKOUVCNGTUR·VGT MWT\ 6CNGT IGPCPPV FKG KO DÌJOKUEJGP ,QCEJKOUVCN XQP FGP )TCHGP 5EJNKEM IGRT·IV YWTFGP &CU 8GTJ·NVPKU XQP   )QNF\W5KNDGTXQPHÒJTVG\WGKPGT)TQ­UKNDGTOÒP\GXQPITCWJWPFGKPGO(GKPIGYKEJVXQPI&KG CNU )WNFKPGT DG\GKEJPGVGP 5VÒEMG YWTFGP CWEJ 7PEKCNKU IGPCPPV YGKN KJT )GYKEJV GKPGT 7P\G FGT 6KTQNGT )G   YKEJVUOCTMGPVURTCEJ&KGPGWG/ÒP\GYCTNÌVKI HGKP WPFGPVURTCEJYKGFGT)QNFIWNFGPFGO9GTV XQP-TGW\GTP

226


RÖMISCH-DEUTSCHES REICH

1340

4¤/+5%*&'765%*'54'+%* 

/CZKOKNKCP +  &QRRGNVGT 5EJCWIWNFKPGT  *CNN CWH FKG #PPCJOG FGU -CKUGTVKVGNU    I 5VGORGN XQP 7NTKEJ 7TUGPVCNGT &GT IGJCTPKUEJVG-CKUGTTGKVGVTOKV*GNOWPFIGUEJWNVGTVGT 4GKEJUHCJPG)GMTÌPVGU 9CRRGP WOIGDGP XQP UKGDGP MNGKPGTGP 9CRRGP WOJGT GKP -TCP\ CWU    YGKVGTGP9CRRGP&CXC'II/6p XINFQTVKP)QNF   44*ÒDUEJG2CVKPCMN4CPFHGJNGTUGJTUEJÌP  'IIDGOGTMVKPUGKPGO9GTMÒDGTFKG/ÒP\GP-CKUGT/CZKOKNKCPUFC­FCU5EJCWUVÒEMXQPKPFGPHQNIGPFGP ,CJTGP UEJGKPDCT KOOGT YKGFGT IGRT·IV YWTFG #NU UKEJ FGT -CKUGT  KP FGP 0KGFGTNCPFGP CWHJKGNV HQTFGTVG GT   FTGK5VGORGNGKUGPFGT*CNNGT/ÒP\GCPWOFQTV'JTGPRHGPPKIGRT·IGP\WMÌPPGP0CEJNCPIGO<ÌIGTPUCPFVGFKG 6KTQNGT 4GIKGTWPI UEJNKG­NKEJ FTGK 'KUGP FKG UKG CDGT OKV GKPGT 4QUGVVG FGT 8QTFGTUGKVGPFCTUVGNNWPI MGPPVNKEJ   OCEJVG &KG -TÌPWPIUFQRRGNIWNFKPGT UKPF V[RKUEJG 4GRT·UGPVCVKQPUUVÒEMG WPF 2TQRCICPFCIGRT·IG &GT -CKUGT KO   *CTPKUEJ\W2HGTFGPVURTKEJVFGT+FGGFGUITQ­GP/CZKOKNKCPFGPMOCNUKP5V7NTKEJWPF#HTCKP#WIUDWTIFCUPKG XQNNGPFGV YWTFG CDGT KP XKGNGP <GKEJPWPIGP WPF *QN\UEJPKVVGP GTJCNVGP KUV &KG 4ÒEMUGKVG OKV FGP 9CRRGP FGT   UKGDGP-ÌPKITGKEJGWPF.·PFGTKUVGKPGUFGTXKGNGP$GKURKGNGHÒTFKG#DUKEJV/CZKOKNKCPUFWTEJ9CRRGPMQODK PCVKQPGP'KPFTWEM\WOCEJGPWPFUGKP5GNDUVXGTUV·PFPKUCNU-ÌPKIXKGNGT2TQXKP\GP'WTQRCUWPFO·EJVKIUVGT(ÒTUV \WFQMWOGPVKGTGP

1341

1341 1,5:1



5EJCWIWNFKPGT  *CNN XQP 7NTKEJ 7TUGPVJCNGT ‰ /A:+/+.+Ay85 Û 41/Ay14 Û   +/2'4A614Û5'/2'4ÛA8)856•A4%*+&8:ÛA8564+')GMTÌPVGUWPFIGJCTPKUEJVGU$TWUV DKNFNOKVWOIGNGIVGT1TFGPUMGVVGFCTWPVGTFKG,CJTGU\CJN2.84+8/Û3<Û'8412'Û2418+y- %+#48/Û4':Û'6Û24+y%'25Û216'y6+55+/85Û&GT-CKUGTTGKVGVTKPFGT4GEJVGP5EJYGTV XQTKJO&KGPGTOKV.CP\GWPVGPGKPIGHCNNGPGT-TKGIGTOKV5EJYGTVWPF*GNNGDCTFGFCTWPVGTFKG9CR RGP XQP 7PICTP $WTIWPF *CDUDWTI WPF ¤UVGTTGKEJ QDGP N 'PIGN OKV IGMTÌPVGO 4GKEJUUEJKNF /KV   5EJÒUUGNTCPFOOI'II8QINJ 445GJTCVVTCMVKXGUXQT\ÒINKEJGU'ZGORNCT  'ZGORNCTFGT5NI9KNE\GM#WMVKQP#FQNRJ*GUU0CEJHQNIGT(TCPMHWTV/CKP0T

227


RÖMISCH-DEUTSCHES REICH

1342



-CTN85KNDGTIW­OGFCKNNGWPUKIPKGTVXQP.WFYKI0GWHCJTGTCWHFGP-TKGIUQDGTUV WPF PKGFGTÌUVGTTGKEJKUEJGP 'TDJQHOGKUVGT 9KNJGNO (TGKJGTT XQP 4QIGPFQTH  Ó $TWUVDKNF   4QIGPFQTHU N OKV WOIGNGIVGO /CPVGN*GNNGDCTFG WPF 5VTGKVJCOOGT IGMTGW\V KP FGP (GNFGTP LG GKP   9CRRGPUEJKNFWPVGPNKGIGPFG4ÒUVWPIOOI*CDKEJ+  5R·VGTGT)W­#NVIGIN·VVGVUGJTUEJÌP

4QIGPFQTH YWTFG DGTGKVU  MCKUGTNKEJGT )GUCPFVGT KP 'PINCPF WPF PCJO CNU 1DGTUVGT FGU (W­XQNMGU  CO   XGPG\KCPKUEJGP (GNF\WI /CZKOKNKCPU + VGKN  YWTFG GT 1DGTUVJQHOGKUVGT FGU 'T\JGT\QIU (GTFKPCPF WPF    XQP-CKUGT-CTN8\WO4GKEJUHTGKJGTTGPGTJQDGPYCT4QIGPFQTHDGKFGT$GNCIGTWPI9KGPUFWTEJFKG6ÒTMGP $GHGJNUJCDGT FGT MCKUGTNKEJGP 4GKVGTGK  PCJO GT CNU QDGTUVGT (GNFJCWRVOCPP KP 7PICTP CO -CORH IGIGP   <CRQN[C VGKN )GIGP UGKPGP 9KNNGP YWTFG GT  OKV FGO 1DGTMQOOCPFQ KO (GNF\WI IGIGP 7PICTP DGVTCWV WPF   GTNKVVXQT1HGP $WFC GKPGITQ­G0KGFGTNCIGDGKFGTGTUEJYGTXGTYWPFGVYWTFG0QEJKOUGNDGP,CJTGTNCIGTKP 7PICTPUGKPGP8GTNGV\WPIGP

1343

1344



1345



(GTFKPCPF+6CNGTQ,9KGP&CX8QINJ+XCT  .GKEJVGT&QRRGNUEJNCIXQT\ÒINKEJGU2TCEJVGZGORNCT



6CNGTQ, WO ,QCEJKOUVCNI/ÒP\OGKUVGT7NTKEJ)GDJCTFVWPF-NCWU-TCWU)G MTÌPVGUWPFIGJCTPKUEJVGU*ÒHVDKNFTOKVFGT4GEJVGPFCU<GRVGTUEJWNVGTPFFKG.KPMGCO5EJYGTVITKHH )GMTÌPVGU 9CRRGP OKV /KVVGNUEJKNF \W FGP 5GKVGP 8GT\KGTWPIGP &KGVKMGT  *CNCEMC  XCT   /CTMNp 44-N5EJTÌVNKPIUHGJNGTCVVTCMVKXGUUGJTUEJÌPGU'ZGORNCT 



6CNGTQ, CD *CNN&CX/68QINJ+  #W­GTIGYÌJPNKEJIWVCWUIGRT·IVGUXQT\ÒINKEJGU2TCEJVGZGORNCT





1346

 228

4GKEJUIWNFKPGT -TGW\GT -NCIGPHWTV&CX#8QINJ+  5EJTÌVNKPIUHGJNGTCO4CPFHCUVUGJTUEJÌP




RÖMISCH-DEUTSCHES REICH

1348

1347

1349



4GKEJUIWNFKPGT -TGW\GT -NCIGPHWTV&CX/CTMN8QINJ+

 48QT\ÒINKEJ





4GKEJUIWNFKPGT -TGW\GT -NCIGPHWTV&CX/CTMN8QINJ+

45GJTUEJÌP





6CNGT2TCI/ÒP\OGKUVGT.WFYKI0GWHCJTGT&CX&KGVKMGT*CNCEMC8QINJ++ 4#VVTCMVKXGUUGJTUEJÌPGU'ZGORNCTOKVHGKPGT6ÌPWPI

1350

1351



1352



6CNGT  ,QCEJKOUVCN /ÒP\OGKUVGT 4WRRTGEJV 2WGNNCEJGT &CX  &KGVKMGT  *CNCEMC    8QINJ8+++ (GKPG2CVKPCMN5EJTÌVNKPIUHGJNGTCO4CPFUGJTUEJÌP 



 6CNGT,QCEJKOUVCNI/ÒP\OGKUVGT4WRTGEJV2WGNNCEJGT)GMTÌPVGUWPFIGJCTPKUEJVGU *ÒHVDKNF T OKV FGT 4GEJVGP FCU <GRVGT UEJWNVGTPF FKG .KPMG CO 5EJYGTVITKHH)GMTÌPVGT &QRRGNCF   NGTCWHFGT$TWUV9CRRGP&KGVKMGT*CNCEMC/CTMNXCT  44#VVTCMVKXGUHCUVXQT\ÒINKEJGU'ZGORNCT 



)WNFGPVCNGT -TGW\GT 2TCI/ÒP\OGKUVGT*CPU*CTFGT+P752NCUVKMJQNFGTFGT0)%OKVFGT $GYGTVWPI/5&CX&KGVKMGT*CNCEMC8QINJ  5GNVGPKPFKGUGT'TJCNVWPI*GTTNKEJG2CVKPCXQT\ÒINKEJp5VGORGNINCP\

 229


RÖMISCH-DEUTSCHES REICH

1353 (doppelt)

1354 (doppelt)

1355 (doppelt)



'T\JGT\QI (GTFKPCPF  &QRRGNVGT 4GKEJUVCNGT Q , RQUVJWOG 2T·IWPI   *CNN   I'KUGPUEJPGKFGT2GVGT*CTVGPDGEM&CX/6 5VGORGN   48QT\ÒINKEJGU2TCEJVGZGORNCTOKVHGKPGT6ÌPWPI 



&QRRGNVGT4GKEJUVCNGTQ, RQUVJWOG2T·IWPI *CNNI'KUGPUEJPGKFGT2GVGT*CTVGP DGEM&CX/6 5VGORGN   4/KPLWUVKGTVXQT\ÒINKEJGU'ZGORNCTOKVHGKPGT6ÌPWPI





&QRRGNVGT 4GKEJUVCNGT Q , RQUVJWOG 2T·IWPI   *CNN  I 'KUGPUEJPGKFGT 2GVGT *CT   VGPDGEM&CX/6XCT 5VGORGN  45GJTUEJÌP 

1356 (doppelt)



&QRRGNVGT 4GKEJUVCNGT Q , RQUVJWOG 2T·IWPI   *CNN  I 'KUGPUEJPGKFGT 2GVGT *CT   VGPDGEM&CX/6 5VGORGN  5GJTUEJÌP  'ZGORNCTFGT#WMVKQP(TKV\4WFQNH-ÒPMGT1UPCDTÒEM0T

1357 (doppelt)

 230

&QRRGNVGT 4GKEJUVCNGT Q , RQUVJWOG 2T·IWPI   *CNN  I 'KUGPUEJPGKFGT 2GVGT *CT   VGPDGEM&CX/6 5VGORGN  *GTTNKEJG2CVKPCXQT\ÒINKEJ 


RÖMISCH-DEUTSCHES REICH

1358 (doppelt)

1361

1359 (doppelt)



&QRRGNVGT 4GKEJUVCNGT Q , RQUVJWOG 2T·IWPI   *CNN  I 'KUGPUEJPGKFGT 2GVGT *CT   VGPDGEM&CX/6 5VGORGN  *GTTNKEJG2CVKPCUGJTUEJÌPpXQT\ÒINKEJ 



&QRRGNVGT 4GKEJUVCNGT Q , RQUVJWOG 2T·IWPI   *CNN  I 'KUGPUEJPGKFGT 2GVGT *CT   VGPDGEM&CX#/6 5VGORGN  /KPLWUVKGTVHCUVXQT\ÒINKEJ 



.QV4GKEJUVCNGTQ,*CNN&CXXCT8QINJ8CT&C\WGKPGYGKVGTG8CTKCPVG/ÒP\UV·VVG 'PUKUJGKO 5EJTÌVNKPIUHGJNGTHCUVUGJTUEJÌP &CX#8QINJ8CT&C\W/CTKC6JGTGUKC -TQPGPVCNGT$TÒUUGN OKPLWUVKGTVUGJTUEJÌP &CX 5VÒEM5GJTUEJÌP



4WFQNH++4GKEJUVCNGT,QCEJKOUVCN&TGKMCKUGTVCNGT&CX FQTVWPVGT'T\JGT\QI (GTFKPCPF/ÒP\UV·VVG*CNN &KGVKMGTp*CNCEMC#DD6[RE 44*GPMGNURWTUGJTUEJÌP





*CNCEMCNGIVFKGUGP6CNGTKPUGKPGO0CEJVTCIWPVGTFGT0TCPCEJ,QCEJKOUVCNWPFIKDVCNU/ÒP\OGKUVGT2CWN *QHOCPPCP'UMÌPPVGGXGPVWGNNCDGTCWEJ2TCICNU/ÒP\UV·VVGKP(TCIGMQOOGP&KG&TGKMCKUGTRT·IWPIGP\·JNGP \WFGPDGIGJTVGUVGP/ÒP\GPFGU4ÌOKUEJ&GWVUEJGP4GKEJGU

1362

1364

1363



4GKEJUVCNGT-$-TGOPKV\&CX8QINJ+++

5GJTUEJÌP



4GKEJUVCNGT-WVVGPDGTI/ÒP\OGKUVGT9QNH*GTQNFXQP#WRC&CX&KGVKMGT*CNCEMC 8QINJ+ (CUVXQT\ÒINKEJGU'ZGORNCTOKVHGKPGT6ÌPWPI





4GKEJUVCNGT-$-TGOPKV\&CX8QINJ+++



5GJTUEJÌP



231


RÖMISCH-DEUTSCHES REICH

1367 (dreifach)

1365

1366



4GKEJUVCNGT-$-TGOPKV\&CX8QINJ+++



4GKEJUVCNGT  -WVVGPDGTI /ÒP\OGKUVGT *CPU 5RKGUU &CX  &KGVKMGT  *CNCEMC    8QINJ+++ 8QPITQ­GT5GNVGPJGKV2CVKPCUGJTUEJÌP 



&TGKHCEJGT 4GKEJUVCNGT  *CNN  I 5VGORGNUEJPGKFGT 2GVGT *CTVGPDGEM &CX    /6 5VGORGN  45GJTUEJÌP 

1369



1368



4GKEJUVCNGT*CNN/6XCT



4GKEJUVCNGT'PUKUJGKO&CX8QINJ8+

1370

5GJTUEJÌP

1369

#VVTCMVKXGUUGJTUEJÌPGU'ZGORNCT



9KP\-TCV\GTHCUVXQT\ÒINKEJ



1371



/CVVJKCU4GKEJUVCNGT9KGP&CX8QINJ++  *GPMGNURWT(GNFGTNGKEJVIGIN·VVGVUGJTUEJÌP





(GTFKPCPF++4GKEJUVCNGT-NCIGPHWTV&CX8QINJ  4)TCHHKVQCPFGT8QTFGTUGKVGUGJTUEJÌP



232


RÖMISCH-DEUTSCHES REICH

1372

1373



4GKEJUVCNGT-NCIGPHWTV/KV'T\JGT\QIUVKVGN&CX8QINJ

4(CUVXQT\ÒINKEJ





4GKEJUVCNGT-NCIGPHWTV/KV'T\JGT\QIUVKVGN&CX8QINJ  4-N5EJTÌVNKPIUTK­HCUVXQT\ÒINKEJ



1375

1374 (doppelt)



&QRRGNVGT4GKEJUVCNGT9KGPI&CX8QINJ++XCT  44#VVTCMVKXGU'ZGORNCTOKVHGKPGT2CVKPCYKP\4CPFHGJNGTUGJTUEJÌP



4GKEJUVCNGT9KGP&CX8QINJ+:

5GNVGPG8CTKCPVG5GJTUEJÌP

 

1377 (doppelt)

1376 (dreifach)

1376 (dreifach)



&KEMGTFTGKHCEJGT4GKEJUVCNGT ,CJTGU\CJNKO5VGORGNCWUIG·PFGTV )TC\I)GJCT PKUEJVGU $TWUVDKNF T OKV .QTDGGTMTCP\ WPF WOIGNGIVGO /CPVGN)GMTÌPVGU OGJTHGNFKIGU 9CRRGP   WOJGT1TFGPUMGVVG&CX*GTKPGM 44-N5EJTÌVNKPIUHGJNGTMN4CPFHGJNGTUGJTUEJÌP 



&QRRGNVGT 4GKEJUVCNGT  ,CJTGU\CJN KO 5VGORGN CWU  IG·PFGTV  )TC\  I &CX    *GTKPGM 8QT\ÒINKEJGU'ZGORNCTOKVHGKPGT2CVKPC  233


RÖMISCH-DEUTSCHES REICH

1380

1,5:1

1378

1379

1381



4GKEJUVCNGT9$TGUNCW/ÒP\R·EJVGT*CPU<KGUGNGT&CX#(W58QINJ8  4*ÒDUEJG2CVKPCYKP\5EJTÌVNKPIUHGJNGTUGJTUEJÌP





4GKEJUVCNGT9$TGUNCW&CX(W58QINJ8+XCT





(TKGFTKEJ XQP FGT 2HCN\ FGT 9KPVGTMÌPKI   'KPUGKVKIGT *GNNGT  -WVVGPDGTI /ÒP\   OGKUVGT5GDCUVKCP*ÌN\N&KGVKMGTXCT*CNCEMCXCT/KVVGKNWPIGPFGT¤UVGTTGKEJKUEJGP0WOKU OCVKUEJGP)GUGNNUEJCHV$CPF:::+++0T5 8QPITQ­GT5GNVGPJGKV5GJTUEJÌP



-KRRGT-TGW\GT2TCI/ÒP\OGKUVGT5MT¾VC5QVPQXUM[&KGVKMGT*CNCEMC  -N5EJTÌVNKPIUTKUUGUGJTUEJÌP





1382

1383

4-N-TCV\GTUGJTUEJÌP

1384



-KRRGT-TGW\GT-WVVGPDGTI/ÒP\OGKUVGT5GDCUVKCP*ÌN\N&KGVKMGT*CNCEMC  5GNVGPKPFKGUGT'TJCNVWPI9KP\5EJTÌVNKPIUHGJNGTHCUVXQT\ÒINKEJ





-KRRGT-TGW\GT-WVVGPDGTI/ÒP\OGKUVGT5GDCUVKCP*ÌN\N&KGVKMGT*CNCEMC  ªDGTFWTEJUEJPKVVNKEJGTJCNVGPUGJTUEJÌPUGJTUEJÌPpXQT\ÒINKEJ





-KRRGT-TGW\GT-WVVGPDGTI/ÒP\OGKUVGT5GDCUVKCP*ÌN\N&KGVKMGT*CNCEMC  5EJTÌVNKPIUTK­UGJTUEJÌPpXQT\ÒINKEJ



234


RÖMISCH-DEUTSCHES REICH

1385



 

1,5:1

1387

1386

1,5:1

'KPUGKVKIGT 2HGPPKI  -WVVGPDGTI /ÒP\OGKUVGT 5GDCUVKCP *ÌN\N &KGVKMGT  XIN  WPF     *CNCEMC XIN /KVVGKNWPIGPFGT¤UVGTTGKEJKUEJGP0WOKUOCVKUEJGP)GUGNNUEJCHV$CPF:::+++ 0T5 8QPITQ­GT5GNVGPJGKV5GJTUEJÌP 'KPUGKVKIGT2HGPPKI-WVVGPDGTI/ÒP\OGKUVGT5GDCUVKCP*ÌN\N&KGVKMGTXCT*CNCEMCXCT 445GJTUEJÌP &KG5V·PFGXQP$ÌJOGPWPF/·JTGP-KRRGT-TGW\GT-WVVGPDGTI/ÒP\OGKUVGT 5GDCUVKCP*ÌN\N&KGVKMGT*CNCEMC 5EJTÌVNKPIUTKUUGXQT\ÒINKEJ

  

1389

1388 1390



-KRRGT -TGW\GT  -WVVGPDGTI /ÒP\OGKUVGT 5GDCUVKCP *ÌN\N $TCWUG/CPUHGNF 6H   NGKEJV   XCT&KGVKMGT*CNCEMC 445GJTUEJÌP





-KRRGT-TGW\GT-WVVGPDGTI/ÒP\OGKUVGT5GDCUVKCP*ÌN\N$TCWUG/CPUHGNF6HNGKEJVXCT &KGVKMGT*CNCEMC 445GJTUEJÌP





-KRRGT-TGW\GT,QCEJKOUVCN/ÒP\OGKUVGT%GPVWTKQ.GPIGHGNFGT&KGVKMGT*CNCEMC 5EJTÌVNKPIUTK­UGJTUEJÌPXQT\ÒINKEJ



1391 (doppelt)



 

1392

1393 (dreifach)

'T\JGT\QI.GQRQNF8&QRRGNVGT4GKEJUVCNGTQ,  'PUKUJGKOI$TWUVDKNFT KO IGKUVNKEJGP )GYCPF WOJGT .CWDTKPI)GMTÌPVGU 9CRRGP OKV 'PUKUJGKOGT /KVVGNUEJKNF \W FGP   5GKVGPLGGKPMNGKPGUOKV/KVTCDGNGIVGU9CRRGPWPVGP\YGKCPGKPCPFGTIGNGJPVGMNGKPG9CRRGPFCT ÒDGTGDGPHCNNU/KVTC&CXXCT/6XCT 44*ÒDUEJG2CVKPCUGJTUEJÌPpXQT\ÒINKEJ  4GKEJUVCNGT*CNN&CX/6XCT8QINJ+ 5GJTUEJÌP  &KEMGT FTGKHCEJGT 4GKEJUVCNGT  *CNN  I &CX #  /6  D FQTV CNU &QRRGNVCNGT   DG\GKEJPGV  8QPITQ­GT5GNVGPJGKV*GTTNKEJG2CVKPCYKP\4CPFHGJNGTUGJTUEJÌP  235


RÖMISCH-DEUTSCHES REICH

1394

1395

1394



4GKEJUVCNGT*CNN2QUVJWOG2T·IWPI&CX/6XCT8QINJ+8XCT 8QT\ÒINKEJ





4GKEJUVCNGT*CNN/6



(CUVXQT\ÒINKEJ

1396 (doppelt)



'T\JGT\QI(GTFKPCPF-CTN&QRRGNVGT4GKEJUVCNGTQ,  *CNNI&CX /6 *ÒDUEJG2CVKPCNGKEJVLWUVKGTVHCUVXQT\ÒINKEJ



'T\JGT\QI (GTFKPCPF -CTN  Ó KP -CNVGTP 5GKPG /WVVGT %NCWFKC XQP /GFKEK FKG 'PMGNKP FGU   (ÒTUVGP%QUKOQ+XQP(NQTGP\JGKTCVGVGKP+PPUDTWEMFGPWTURTÒPINKEJHÒTFGPIGKUVNKEJGP5VCPFDGUVKOOVGP 'T\JGT\QI .GQRQNF 8 XQP ¤UVGTTGKEJ FGO UKG HÒPH -KPFGT UEJGPMVG 0CEJ FGO HTÒJGP 6QF .GQRQNFU  ÒDGT   PCJO%NCWFKCHÒTKJTGPWPOÒPFKIGP5QJP(GTFKPCPF-CTNFKGXQTOWPFUEJCHVNKEJG4GIKGTWPIKP6KTQN#NNGP+PVTKIGP \WO 6TQV\ QTICPKUKGTVG UKG VCVMT·HVKI GKPG YKTMUCOG .CPFGUXGTVGKFKIWPI GT\KGNVG GKPG 8GTUV·PFKIWPI OKV FGP   5EJYGK\GTP WPF MQPPVG FWTEJ -CWH WPF FKRNQOCVKUEJGU )GUEJKEM KJT *GTTUEJCHVUIGDKGV KO 5ÒFGP WPF 0QTFGP XGT   ITÌ­GTP +O ,CJTG  YWTFG (GTFKPCPF -CTN XQNNL·JTKI WPF MQPPVG FKG 4GIKGTWPI UGNDUV ÒDGTPGJOGP 0QEJ KO   UGNDGP,CJTJGKTCVGVGGT#PPC2TKP\GUUKPXQP6QUMCPC6QEJVGTFGU)TQ­JGT\QIU%QUKOQ++

1398

1397 (doppelt)

1397 (doppelt)



&QRRGNVGT4GKEJUVCNGTQ,  *CNNI&CX/6

-N4CPFHGJNGTUGJTUEJÌP





4GKEJUVCNGT*CNN&CX/68QINJ+++  448QT\ÒINKEJGU'ZGORNCTOKVHGKPGT2CVKPC



236


RÖMISCH-DEUTSCHES REICH

1400

1399

1401



(GTFKPCPF+++4GKEJUVCNGT ,CJTGU\CJNKO5VGORGNCWUIG·PFGTV /+ $TGUNCW9CTFGKP/KEJCGN,CP(W5 445GJTUEJÌP 



4GKEJUVCNGT-$-TGOPKV\&CX8QINJ

5GJTUEJÌP





4GKEJUVCNGT-$-TGOPKV\&CX8QINJ

-N5EJTÌVNKPIUHGJNGTCO4CPFUGJTUEJÌP



1402

1403

1404



4GKEJUVCNGT-X$-TGOPKV\2QUVJWOG2T·IWPI&CX8QINJ

5GJTUEJÌPpXQT\ÒINKEJ



'T\JGT\QI5KIKUOWPF(TCP\4GKEJUVCNGT*CNN&CX/68QINJ++ 5GJTUEJÌP



.GQRQNF+4GKEJUVCNGT-X$-TGOPKV\&CX8QINJ+

8QT\ÒINKEJ

   237


RÖMISCH-DEUTSCHES REICH

1405

1407 (doppelt)

1406 (doppelt)

 

4GKEJUVCNGT-X$-TGOPKV\&CX8QINJ+ &QRRGNVGT4GKEJUVCNGTQ,  *CNNI&CX/6

5GJTUEJÌPpXQT\ÒINKEJ 5GJTUEJÌP



&QRRGNVGT4GKEJUVCNGT ,CJTGU\CJNKO5VGORGNXGTOWVNKEJCWUIG·PFGTV +#0)TC\I &CX*GTKPGM 9KP\$GCTDGKVWPIUUVGNNGKO(GNFFGT8QTFGTUGKVGUGJTUEJÌP

  

1409

1408

1408



4GKEJUVCNGT ,CJTGU\CJNKO5VGORGNCWUIG·PFGTV +#0)TC\&CX8QINJ++  (GKPG2CVKPCHCUVXQT\ÒINKEJ





4GKEJUVCNGT  ,CJTGU\CJN KO 5VGORGN CWU  WPF  IG·PFGTV  +#0 )TC\ &CX    8QINJ++ 5GJTUEJÌPpXQT\ÒINKEJ



238


RÖMISCH-DEUTSCHES REICH

1410

1411 (doppelt)

1412



4GKEJUVCNGT-$-TGOPKV\&CX8QINJ+8

-N<CKPGPFGXQT\ÒINKEJGU'ZGORNCT





&QRRGNVGT4GKEJUVCNGTQ, PCEJ *CNNI&CX/6 (GKPG2CVKPCXQT\ÒINKEJ





4GKEJUVCNGT  )' 2TCI /ÒP\OGKUVGT )TGIQT 'IGTGT &CX  &KGVKMGT  *CNCEMC    8QINJ+++ 9KP\)TCHHKVKUGJTUEJÌP



1413

1413

1,5:1



5KNDGTOGFCKNNG  XQP / $TWPPGT KO #WHVTCI XQP )(0ÒTPDGTIGTIGHGTVKIVCWHFKG'THQNIGKP 5RCPKGP )GJCTPKUEJVGU $TWUVDKNF 'T\JGT\QI -CTNU T OKV WOIGNGIVGO /CPVGN5GIGNUEJKHH CWH /GGT   /KV4CPFUEJTKHV%8+85'6#00+5'6)'0'4+(#68/+0&8.)'638'/08/+0#215%806| 8+4)+.| )(0 ÛOOI5NI,WNKWU5NI/QPVGPWQXQ  445GJTUEJÌPpXQT\ÒINKEJ



&KGXQTNKGIGPFG/GFCKNNGKUVCNUGKPG)NÒEMYWPUEJOGFCKNNGCP'T\JGT\QI-CTN CD-CKUGT-CTN8+ \WXGTUVG JGP 0CEJFGO FGT NGV\VG URCPKUEJG *CDUDWTIGT -CTN ++   IGUVQTDGP YCT XGTNCPIVG -CKUGT .GQRQNF FGP   URCPKUEJGP $GUKV\ HÒT UGKPGP 5QJP 'T\JGT\QI -CTN 5GKP )GIGPURKGNGT YCT .WFYKI :+8 XQP (TCPMTGKEJ FGT FGP   6JTQP HÒT UGKPGP 'PMGN 2JKNKRR XQP #PLQW HQTFGTVG #WU FGP 'TDUVTGKVKIMGKVGP TGUWNVKGTVG FGT URCPKUEJG 'TDHQNIG   MTKGIFGTDKUCPFCWGTVGWPFJCND'WTQRCKPUGKPGP$CPP\QI

239


RÖMISCH-DEUTSCHES REICH

1418 (doppelt)

1417 (doppelt)

1414



4GKEJUVCNGT9KGP&CX8QINJ8+++

8QT\ÒINKEJGU'ZGORNCT





.QVU)TÌUEJGN 1RRGNP8CTKCPVGP )TÌUEJGN $TKGI  $TKGIZ   5VÒEM5GJTUEJÌP





&KXGTUG 5KNDGTOÒP\GP CWU FGT 4GIKGTWPIU\GKV .GQRQNFU + XQO  -TGW\GT5VÒEM DKU \WO  6CNGT   +PVGTGUUCPVGU.QVDKVVGDGUKEJVKIGP 5VÒEM5EJÌPpXQT\ÒINKEJ



,QUGH+&QRRGNVGT4GKEJUVCNGTQ,*CNNI&CX/6  *GTTNKEJG2CVKPCXQT\ÒINKEJ



&QRRGNVGT4GKEJUVCNGTQ,*CNNI&CX/6

1420

 

1419

4GKEJUVCNGTQ,*CNN/6 4GKEJUVCNGTQ,*CNN/6

5GJTUEJÌP

  

1420

8QT\ÒINKEJ 8QT\ÒINKEJ

 

445VGORGNHGJNGTXQT\ÒINKEJ



1421



4GKEJUVCNGT/ÒPEJGP&CX*CJP8QINJ+

+PFGT5EJNCEJVDGK*ÌEJUV·FVYWTFGFCUDC[GTKUEJHTCP\ÌUKUEJG*GGTFWTEJ2TKP\'WIGPXQP5CXQ[GPWPFFGP *GT\QI XQP /CTNDQTQWIJ XQNNUV·PFKI XGTPKEJVGV /CZKOKNKCP 'OCPWGN OW­VG $C[GTP XGTNCUUGP WPF XGTNQT UGKPG   .CPFG/CPXGTJ·PIVGFKG4GKEJUCEJVÒDGTKJP'TUVFWTEJFGP(TKGFGPXQP$CFGPYWTFGPFKG4GKEJUCEJVWPF FKGFCOKVXGTDWPFGPGP5CPMVKQPGPCWHIGJQDGP&KGKPFGT<YKUEJGP\GKVKP/ÒPEJGPGPVUVCPFGPGP/ÒP\GPYKGCWEJ FCUXQTNKGIGPFG5VÒEMUKPFXQPFGTMCKUGTNKEJGP#FOKPKUVTCVKQPKP$C[GTPIGRT·IVYQTFGP

240


RÖMISCH-DEUTSCHES REICH

1422

1424 (doppelt)



4GKEJUVCNGT*CNN&CX/68QINJ+



4GKEJUVCNGT*CNN&CX/6C8QINJ+



1423

5GJTUEJÌPpXQT\ÒINKEJ



(NGEMKIG2CVKPCXQT\ÒINKEJ



-CTN8+&QRRGNVGT4GKEJUVCNGTQ,*CNNI&CX/6  5GJTUEJÌPpXQT\ÒINKEJ



1425

1426



1426

5KNDGTOGFCKNNG  XQP ) 9 8GUVPGT CWH UGKPG WPICTKUEJG -TÌPWPI KP 2TG­DWTI )GJCTPKUEJVGU   $TWUVDKNF T OKV .QTDGGTMTCP\ WOIGNGIVGO /CPVGN WPF FGT -GVVG FGU 1TFGPU XQO )QNFGPGP 8NKGU  )TCPCVCRHGNOOI$GTPJGKOGT5NI/QPVGPWQXQ  *ÒDUEJG2CVKPCHCUVXQT\ÒINKEJ



&KG4ÒEMUGKVGPWOUEJTKHVFKGUGT/GFCKNNGGPVJ·NVFKG,CJTGU\CJNCNU%JTQPQITCOO



5KNDGTOGFCKNNGXQP)98GUVPGTWPF2*/ÒNNGTCWHFGP(TKGFGPXQP4CUVCVV$TWUVDKNFTOKV .QTDGGTMTCP\ WPF WOIGNGIVGO /CPVGN2CZ UVGJV PCEJ N OKV GKPGO ¤N\YGKI KP FGT .KPMGP KP FGT   4GEJVGPGKPG(CEMGNOKVFGTUKGGKPGPXQTKJTNKGIGPFGP9CHHGPJCWHGPGPV\ÒPFGVT,WUVKVKCCWH2QUVC OGPVOOI$GTPJGKOGT(QTUVGT2CZKP0WOOKU5NI/QPVGPWQXQ  *ÒDUEJG2CVKPCHCUVXQT\ÒINKEJ

 241


RÖMISCH-DEUTSCHES REICH

1427



4GKEJUVCNGT2TCI#WUDGWVGFGT,QCEJKOUVCNGT)TWDGPI/ÒP\OGKUVGT(GTFKPCPF5EJCTHH )GJCTPKUEJVGU $TWUVDKNF T OKV .QTDGGTMTCP\ WPF WOIGNGIVGO /CPVGN)GMTÌPVGT &QRRGNCFNGT OKV   5EJYGTVWPF<GRVGTKPFGP(·PIGPCWHFGT$TWUVIGMTÌPVGU&QRRGNYCRRGPOKVFGODÌJOKUEJGP.ÌYGP WPFJGKNKIGP,QCEJKO&CX&KGVKMGT*CNCEMC/ÒUGNGT8QINJ+  449KP\5EJTÌVNKPIUHGJNGTXQT\ÒINKEJ  &KG)TWDGPXQP5V,QCEJKOUVCNUKPFFKG·NVGUVGPKP$ÌJOGP5EJQPFKG)TCHGPXQP5EJNKEMJCDGPUGKVCWUFGO 5KNDGTFKGUGT)TWDGPKJTG)WNFGPITQUEJGPIGRT·IVFKGFGO6CNGTFGP0COGPIGIGDGPJCDGP+O$CTQEMYWTFGFKG 6TCFKVKQPFGT#WUDGWVGRT·IWPIGPXQP\CJNTGKEJGP(ÒTUVGPCWHIGITKHHGPUQCWEJXQP-CTN8+CNU-ÌPKIXQP$ÌJOGP

1428



1429

1430

5KNDGTOGFCKNNGWPUKIPKGTVXQP)98GUVPGTCWHFKG5GGUEJNCEJVDGK/GUUKPCWPFFGP5GGUKGI FGU#FOKTCNU$[PIDGK5[TCMWU&KG$TWUVDKNFGT-CKUGT-CTNU8+WPF)GQTIU+XQP$TCWPUEJYGKIKP .QTDGGTMT·P\GPGKPCPFGTIGIGPÒDGTFC\YKUEJGPGKPCWU9CHHGPJGTCWUTCIGPFGTIGHNÒIGNVGT/GTMWTUVCD ,WRKVGT UKV\V CWH 9QNMG WPF UEJNGWFGTV UGKPGP &QPPGTMGKN IGIGP HNÒEJVGPFG )CNGQPGP FKG 0GRVWP FGT   CWHGKPGT/WUEJGNUVGJVOKVUGKPGO&TGK\CEMXQO/GGTCWUCPITGKHVOOI$GTPJGKOGT $TQEMOCPP5NI/QPVGPWQXQ  442TCEJVGZGORNCT*GTTNKEJG2CVKPCXQT\ÒINKEJp5VGORGNINCP\



0CEJFGO FKG 5RCPKGT 5CTFKPKGP GTQDGTV JCVVGP WPF KO $GITKHH YCTGP 5K\KNKGP \W DGUGV\GP YWTFG FGT DTKVKUEJG   #FOKTCN5KT)GQTIG$[PIOKV5EJKHHGPCWUIGUCPFVFGPURCPKUEJGP)GPGTCN&G.GFGFCTCP\WJKPFGTP/GUUKPC \W GTTGKEJGP 'U MCO \WO -CORH FKG \CJNGPO·­KI ÒDGTNGIGPG URCPKUEJG (NQVVG YWTFG \GTUVÌTV WPF FGT )GPGTCN   IGHCPIGPIGPQOOGP +P FGT 4ÒEMUGKVGPFCTUVGNNWPI FGU XQTNKGIGPFGP 5VÒEMGU U[ODQNKUKGTV ,WRKVGT FGP -CKUGT WPF   0GRVWP)GQTI+



$TQP\GOGFCKNNGWPUKIPKGTVXQP2*/ÒNNGTCWHFKGGTHQNITGKEJG5GGUEJNCEJVIGIGPFKG5RCPKGT DGK 5[TCMWU&CTUVGNNWPIFGT5GGUEJNCEJVNFCU7HGT\YKUEJGP/GUUKPCWPF5[TCMWU#FNGTDGM·ORHV 4CDGPKP.CPFUEJCHVOO(QTUVGT5NI/QPVGPWQXQ 8QT\ÒINKEJ



&GT5GGUEJNCEJVDGK5[TCMWUYCTCO#WIWUVFKGUQIGPCPPVG3WCFTWRGNCNNKCP\XQTCWUIGICPIGP&KGUGUIGIGP FKG 5RCPKGT IGTKEJVGVG $ÒPFPKU DGUVCPF \YKUEJGP -CKUGT -CTN 8+ (TCPMTGKEJ WPF )TQ­DTKVCPPKGP &KG PÌTFNKEJGP   0KGFGTNCPFGUQNNVGPFCUXKGTVG/KVINKGFYGTFGPVTCVGPCDGTPKGGKP

 242

4GKEJUVCNGT  2TCI /ÒP\OGKUVGT (GTFKPCPF 5EJCTHH &CX  &KGVKMGT  *CNCEMC    8QINJ:8 5GJTUEJÌP




RÖMISCH-DEUTSCHES REICH

1431

1432



4GKEJUVCNGT*CNN&CX/68QINJ++

 

-N(NGEMXQT\ÒINKEJ



4GKEJUVCNGT*CNN&CX/6XCT8QINJ+++

8QT\ÒINKEJ



4GKEJUVCNGT*CNN&CX/68QINJ+++

8QT\ÒINKEJ



1434



1433

1435

1436

5KNDGTOGFCKNNG  XQP 2 2 9GTPGT CWH FGP 6QF FGU 2TKP\GP 'WIGP XQP 5CXQ[GP )GJCTPKUEJVGU   $TWUVDKNFFGU2TKP\GPHCUVXXOKVWOIGNGIVGO/CPVGNWPFFGT-GVVGFGU1TFGPUXQO)QNFGPGP8NKGU 'KP-TKGIGT 2TKP\'WIGP UKV\VUEJNCHGPFCPGKPG7TPGIGNGJPVWPVGTUGKPGP(Ò­GPFKG<GKVKP)GUVCNV GKPGUIGHNÒIGNVGP)TGKUGUFGUUGP5GPUGWPF5VWPFGPINCU\GTDTQEJGPUKPF\WFGP5GKVGPLGGKPG5·WNGCP FGT UGEJU .QTDGGTMT·P\G J·PIGP FCTÒDGT UEJYGDV CWH GKPGT 9QNMG FKG )GUVCNV FGT 'YKIMGKV OKV   5EJNCPIGWPF5VGTPGPMTCP\OOI2QRGNMC5NI,WNKWU5NI/QPVGPWQXQ $GTKGDGPUGJTUEJÌPpXQT\ÒINKEJ





4GKEJUVCNGT*CNN&CX/68QINJ8

*ÒDUEJG2CVKPCXQT\ÒINKEJ





4GKEJUVCNGT*CNN&CX/68QINJ8

(CUVXQT\ÒINKEJ

 243


RÖMISCH-DEUTSCHES REICH

1437



4GKEJUVCNGT2TCI0QVIWNFGPIGRT·IVCWUNGKEJVGO5KNDGT&KGVKMGT*CNCEMC 4-N5EJTÌVNKPIUHGJNGTCO4CPFMN-TCV\GTUGJTUEJÌP



1438



/CTKC6JGTGUKC$TQP\GIW­OGFCKNNGQ,WPUKIPKGTVCWHFKG5KGIGFGU(GNFOCTUEJCNNUWPF (GNFJGTTP .GQRQNF ,QUGRJ )TCH XQP &CWP )GJCTPKUEJVGU $TWUVDKNF FGU )TCHGP HCUV X X OKV WOIG   NGIVGO/CPVGNWPF1TFGPUD·PFGTP/CTUUKV\VJCNDNCWHXGTUEJKGFGP6TQRJ·GPOO5NI,WNKWU 45GJTUEJÌP



.GQRQNF ,QUGRJ )TCH XQP &CWP (ÒTUV XQP 6JKCPQ YWTFG CO  5GRVGODGT  KP 9KGP IGDQTGP 0CEJ FGO   9KNNGP UGKPGU 8CVGTU 9KTKEJ 2JKNKRR )TCH &CWP UQNNVG GT KP FKG &KGPUVG FGT -KTEJG GKPVTGVGP GPVUEJKGF UKEJ FCPP   CDGTHÒTFCU/KNKV·TWPFGTNGDVGFGP-TKGIIGIGP5RCPKGPCWH5K\KNKGPFCPP WPF FGPKP+VCNKGPWPF CO4JGKPWPFCNU)GPGTCNOCLQTFGP6ÒTMGPMTKGIXQPDKU<WO(GNFOCTUEJCNNNGWVPCPVDGHÌTFGTVHQEJVGT KO¤UVGTTGKEJKUEJGP'TDHQNIGMTKGICPHCPIUIGIGPFKG2TGW­GPKP5EJNGUKGPFCPPWPVGTFGO2TKP\GP-CTN#NGZCPFGT XQP.QVJTKPIGPIGIGPFKG(TCP\QUGP+O<YGKVGP5EJNGUKUEJGP-TKGIYWTFG&CWPPQEJ\WO(GNF\GWIOGKUVGT GTPCPPV +O ,CJT  \WO (GNFOCTUEJCNN GTPCPPV UVCPF GT DGKO #PHCPI FGU 5KGDGPL·JTKIGP -TKGIU KP /·JTGP   YCPFVGUKEJUQFCPPIGIGP(TKGFTKEJ++FGTPCEJFGT5EJNCEJVXQP2TCIFKGUG5VCFVGKPIGUEJNQUUGPJKGNVWPFNKGHGTVG KJO FKG UKGITGKEJG 5EJNCEJV XQP -QNKP CO  ,WPK  YQTCWH (TKGFTKEJ $ÌJOGP T·WOGP OW­VG #NU PCEJ FGO   5KGIFGT2TGW­GPDGK.GWVJGPFGT2TKP\-CTNXQP.QVJTKPIGPXQPFGT#TOGGCDVTCVNGIVGFKG-CKUGTKPFGP1DGTDG HGJNKP&CWPU*·PFG+PFGT5EJNCEJVDGK6QTICWIGIGP2TGW­GPCO0QXGODGTYWTFGKJOFGT5KGIFWTEJ <KGVGPU MÒJP GTPGWGTVGP #PITKHH WPF GKPG GKIGPG 8GTYWPFWPI GPVTKUUGP <W UGKPGT *GTUVGNNWPI DGICD GT UKEJ PCEJ   9KGP YQ GT OKV FGT ITÌ­VGP #WU\GKEJPWPI CWHIGPQOOGP YWTFG  ÒDGTPCJO GT YKGFGT FGP 1DGTDGHGJN KP   5EJNGUKGP5QIÒPUVKICWEJFKG.CIGFGU-ÌPKIUXQP2TGW­GPFWTEJFGPTWUUKUEJGP6JTQPYGEJUGNIGYQTFGPYCTUQ MQPPVG GT FQEJ &CWP PKEJV CWU UGKPGT HGUVGP 5VGNNWPI CO <QDVGPDGTI XGTVTGKDGP FKGUGT CDGT GDGPUQ YGPKI FGP   8GTNWUV XQP 5EJYGKFPKV\ XGTJKPFGTP 0QEJ Y·JTGPF FGU -TKGIGU JCVVG &CWPFCU2T·UKFKWOFGU*QHMTKGIUTCVUCPIG VTGVGPWPFYCTKPFKGUGO9KTMWPIUMTGKUGKHTKIDGOÒJVCNNG'THCJTWPIGPCWUUKGDGP(GNF\ÒIGPCWHUGKPGUEJQPHTÒJGT KP#PITKHHIGPQOOGPGP4GHQTOGPCP\WYGPFGP.GQRQNF,QUGRJ)TCH&CWPUVCTDCO(GDTWCTKP9KGP

1439



244

(KNKRRQ/CKNCPFI$TWUVDKNFTOKV&KCFGOWPFWOIGNGIVGO/CPVGN)GMTÌPVGUXKGTHGN FKIGU9CRRGPOKVXKGTHGNFKIGO/KVVGNUEJKNF\WFGP5GKVGP.QTDGGTWPF2CNO\YGKI%TKRRC#&CX '[RGNVCWGT 448QT\ÒINKEJGU2TCEJVGZGORNCTOKVHGKPGT2CVKPC 


RÖMISCH-DEUTSCHES REICH

1441 1440

 

4GKEJUVCNGT-$-TGOPKV\&CX'[RGNVCWGT -TGW\GT*CNN'[RGNVCWGTC/6

1442

  

(CUVXQT\ÒINKEJ -N5VGORGNHGJNGTUGJTUEJÌPpXQT\ÒINKEJ

1443

-QPX6CNGT*CNN&CX'[RGNVCWGT/6 -QPX6CNGT*CNN&CX'[RGNVCWGT/6 -QPX6CNGT*CNN&CX'[RGNVCWGT/6

1445

  

1440

 

1444

5GJTUEJÌP 5GJTUEJÌPXQT\ÒINKEJ 8QT\ÒINKEJ

1446

-QPX6CNGT9KGP&CX'[RGNVCWGT /KPLWUVKGTVXQT\ÒINKEJp5VGORGNINCP\ -QPX6CNGT#5*CNN&CX'[RGNVCWGTD/6XCT (CUVXQT\ÒINKEJ -QPX6CNGT#5*CNN&CX'[RGNVCWGTD/6XCT 5GJTUEJÌPpXQT\ÒINKEJ

  

1447

   245


RÖMISCH-DEUTSCHES REICH

1450

1449

1448



-QPX6CNGT#5*CNN&CX'[RGNVCWGT/6



1451

5GJTUEJÌPpXQT\ÒINKEJ



-QPX6CNGT*CNN'[RGNVCWGT/6

8QT\ÒINKEJ





-QPX6CNGT*CNN'[RGNVCWGT/6

8QT\ÒINKEJGU'ZGORNCTOKVHGKPGT6ÌPWPI





-QPX6CNGT+%5-9KGP&CX'[RGNVCWGT  /KPLWUVKGTVXQT\ÒINKEJGU'ZGORNCTOKVHGKPGT2CVKPC



1452

1453

1452



-QPX6CNGT-'8/&-TGOPKV\&CX'[RGNVCWGT

8QT\ÒINKEJ





-QPX6CNGT#5*CNN'[RGNVCWGTC/6  8QT\ÒINKEJGU'ZGORNCTOKVHGKPGT6ÌPWPI



1454



-QPX6CNGT+%(#9KGP&CX'[RGNVCWGT



5EWFQ/CKNCPF%TKRRC$&CX'[RGNVCWGT

246

1455

5GJTUEJÌP



9KP\4CPFHGJNGTXQT\ÒINKEJ




KAISERREICH ÖSTERREICH

1456

1457

1457



-QPX6CNGT  5( )ÒP\DWTI 0CEJRT·IWPI CWU FGT <GKV  &CX XIN  '[RGNVCWGT   XIN.G[RQNF6 /KPLWUVKGTVXQT\ÒINKEJ





(TCP\+-TGW\GT*CNN/6XCT



1458

1460

5GJTUEJÌPpXQT\ÒINKEJ

1459

 

,QUGH++-QPX6CNGT(8%5*CNN&CX*GTKPGM/65GJTUEJÌP -QPX6CNGT$-TGOPKV\&CX, 8QT\ÒINKEJp5VGORGNINCP\

 



.GQRQNF++5KNDGTOGFCKNNGWPUKIPKGTVXQP6JXCP$GTEMGNCWHFKGDGNIKUEJG*WNFK IWPI-QRHTOKV.QTDGGTMTCP\&GT-CKUGTUVGJVPCEJTCWHGKPGO2QFGUVXQTGKPGO6KUEJOKV-TÌ PWPIUKPUKIPKGPKPFGT.KPMGPJ·NVGTGKPGP5EJKNFOKVFGOGTFKGXQTKJOUVGJGPFG$GNIKCDGUEJKTOV OKVFGT4GEJVGPTGKEJVGTKJTGKPGP¤N\YGKICPFGP5VWHGPFGU2QFGUVGUNKGIGP.ÌYG5EJNCPIGPUVCDWPF (ÒNNJQTPOOI-GPKU5NI/QPVGPWQXQ 8QT\ÒINKEJ



1461

-#+5'44'+%*¤56'44'+%* 

(TCP\ +  5KNDGTOGFCKNNG  XQP . /CPHTGFKPK CWH FKG 8GTO·JNWPI UGKPGT 6QEJVGT   /CTKG .QWKUG OKV 0CRQN¾QP + KP 9KGP $GKFGT $TWUVDKNFGT PGDGPGKPCPFGT T)GHNÒIGNVGT )GPKWU XGT   VTGKDVGKPGP-TKGIGTOOI5NI,WNKWU5NI/QPVGPWQXQ 8QT\ÒINKEJ /CTKG.QWKUGFKG·NVGUVG6QEJVGTXQP-CKUGT(TCP\+YWTFGIGIGPKJTGP9WPUEJOKV0CRQN¾QPPCEJFGUUGP6TGP PWPI XQP ,QUGRJKPG XGTO·JNV <W FGP (GKGTNKEJMGKVGP KP 9KGP CO  /·T\  YWTFG FGT NCPIL·JTKIG )GH·JTVG   WPF GPIG 8GTVTCWVG 0CRQN¾QPU #NGZCPFTG $GTVJKGT IGUCPFV WO FGP HTCP\ÌUKUEJGP -CKUGT \W XGTVTGVGP $GTVJKGT   YWTFG\WO(ÒTUVWPF*GT\QIFGTXQP2TGW­GPCDIGVTGVGPGP(ÒTUVGPVÒOGT0GWGPDWTIWPF8CNCPIKPUQYKG \WO(ÒTUVXQP9CITCOGTPCPPV



247


KAISERREICH ÖSTERREICH

1463

1462

  

-QPX6CNGT)0CI[D±P[C&CX,-CJPV -QPX6CNGT#9KGP&CX,-CJPV -QPX6CNGT)0CI[D±P[&CX,-CJPV

1465



5EWFQ88GPGFKI&CX,



5EWFQ//CKNCPF&CX,

1,5:1



1464

5GJTUEJÌP 8QT\ÒINKEJ 5GJTUEJÌP

  

9KP\5EJTÌVNKPIUHGJNGTXQT\ÒINKEJ



1466

W­GTUVUGNVGPPWTYGPKIG'ZGORNCTGDGMCPPV #VVTCMVKXGU'ZGORNCTOKVJÒDUEJGT2CVKPCXQT\ÒINKEJ

1467



1,5:1

(GTFKPCPF+,GVQPQ,  CWHUGKPGDÌJOKUEJG-TÌPWPIKP2TCI2TQDGKP#NWOK PKWOI 8GTOWVNKEJWPGFKGTVWPF7PKMWO(CUVXQT\ÒINKEJ



1468

 248

5EWFQ88GPGFKI&CX,

448QT\ÒINKEJGU'ZGORNCTOKVHGKPGT6ÌPWPI




KAISERREICH ÖSTERREICH

1469



$TQP\GOGFCKNNG XQP#/CPHTGFKPKCWHUGKPG-TÌPWPIKP/CKNCPF$ÒUVGTOKV.QTDGGTMTCP\ 'T\DKUEJQH-CTFKPCN)CKUTWEMMTÌPVFGPXQTKJOMPKGPFGP-CKUGTOO5NI/QPVGPWQXQ  8QT\ÒINKEJ

1471

1470



1472



-QPX6CNGT#9KGP&CX,-CJPV

(GKPG2CVKPCXQT\ÒINKEJ





-QPX6CNGT#9KGP&CX,-CJPV

8QT\ÒINKEJ





(TCP\,QUGH+&QRRGNIWNFGP$-TGOPKV\&CX,-CJPV6JWP  5GJTUEJÌPpXQT\ÒINKEJ



1473

1474

1475

1475



)WNFGP'-CTNUDWTI,

5GJTUEJÌPpXQT\ÒINKEJ





)WNFGP'-CTNUDWTI,

(CUVXQT\ÒINKEJ





&QRRGNVGT8GTGKPUVCNGT#9KGP&CX,-CJPV6JWP

48QT\ÒINKEJ

 249


KAISERREICH ÖSTERREICH

1477

 

1476

&QRRGNIWNFGP#9KGP&CX,-CJPV6JWP &QRRGNVGT8GTGKPUVCNGT#9KGP&CX,-CJPV6JWP

1,5:1

1478



1476

8QT\ÒINKEJ 5GJTUEJÌPpXQT\ÒINKEJ

 

1478

)WNFGP  )GFGPMOÒP\G CWH FKG 5CKIGTVGWHG KP 2TKDTCO KO #NDTGEJVU5EJCEJV YWTFG GKPG 6KGHG   XQPOGTTGKEJV +P752NCUVKMJQNFGTFGT0)%OKVFGT$GYGTVWPI/5,/ÒUGNGT 2TCEJVGZGORNCTOKVJGTTNKEJGT2CVKPC(CUV5VGORGNINCP\

1479

1480



1481



5KNDGTOGFCKNNGXQP(.GKUGMCWHFKG0WOKUOCVKUEJG)GUGNNUEJCHVKP9KGP7PKHQTOKGTVGU$TWUV DKNF T OKV .QTDGGTMTCP\ WPF WOIGNGIVGO /CPVGN-CTVWUEJG FCTKP CEJV <GKNGP 5EJTKHV WPVGT UVTCJNGP   FGT-TQPGOOI5NI*QTUM[ FQTVKP$TQP\G   2TCEJVGZGORNCTOKVJGTTNKEJGT2CVKPC(CUV5VGORGNINCP\





6CNGTPCEJFGO6[RFGT5V)GQTIUVCNGT/KNNGPKWORT·IWPI\WT,CJTVCWUGPFHGKGTFGT.CPFPCJOG XQP7PICTP&CXp*GTKPGM,p 40WT'ZGORNCTGIGRT·IV*GPMGNURWTUGJTUEJÌP





<YGK GKPUGKVKIG XGTUKNDGTVG $TQP\GOGFCKNNGPJ·NHVGP  XQP 42NCEJVWPF,2TKP\CWHFCUÌUVGTTGK EJKUEJG-TKGIUUEJKHH5/54CFGV\M[-QRHTWOJGT.QTDGGTMTCP\OKV\YGK/CTKPGYCRRGPDGNGIV&CU 5EJKHHCWH/GGTKO*KPVGTITWPF$GTIGOO9WT\DCEJ 5VÒEM5GJTUEJÌP



250


GEISTLICHKEIT

.165*#$5$74) 

&KXGTUG5KNDGTOÒP\GPOGKUVCWUFGT/ÒP\UV·VVG*CNNFCTWPVGT4GKEJUVCNGT4GKEJUVCNGT -TGW\GT *GPMGNURWT -TGW\GT-TGW\GT  5VÒEM7PVGTUEJKGFNKEJGTJCNVGPFGT)GUCOVGKPFTWEMKUVUGJTUEJÌP 5VÒEM/GKUVUGJTUEJÌP





-NGKPGU.QVXQPCNVGP/CTKC6JGTGUKGP6CNGTPFGU,CJTICPIU





-NGKPG5COONWPIXQP-TGW\GT5VÒEMGPFGU4ÌOKUEJ&GWVUEJGP4GKEJGUWPF¤UVGTTGKEJUCWUFGO WPF,CJTJWPFGTV 5VÒEM5EJÌPpUGJTUEJÌP





-NGKPG5COONWPIXQP-TGW\GT5VÒEMGPFGU4ÌOKUEJ&GWVUEJGP4GKEJGUCWUFGO,CJTJWPFGTV  5VÒEM/GKUVUGJTUEJÌP





-NGKPG5COONWPIJCDUDWTIKUEJGT/ÒP\GP OGKUV6CNGT FGUWPF,CJTJWPFGTVUFCTWPVGTDGUUGTG 5VÒEMG 5VÒEM<WO6GKNOKVMN/·PIGNPOGKUVUGJTUEJÌP



1487

&+')'+56.+%*-'+6+0&'0*#$5$74)+5%*'0'4$.#0&'0 1./ª6<$+567/ 

-CTN+++XQP.QVJTKPIGP4GKEJUVCNGT&CX5WEJQOGN8KFGOCP  5EJTÌVNKPIUHGJNGTXQT\ÒINKEJGU'ZGORNCTOKVUEJÌPGT2CVKPC

1488

1489



1490



4GKEJUVCNGT&CX5WEJQOGN8KFGOCP

-N*GPMGNURWTHCUVXQT\ÒINKEJ





9QNHICPIXQP5EJTCVVGPDCEJ4GKEJUVCNGT&CX5WEJQOGN8KFGOCP  *ÒDUEJG2CVKPCCVVTCMVKXGUXQT\ÒINKEJGU'ZGORNCT





4GKEJUVCNGT&CX5WEJQOGN8KFGOCP



(CUVXQT\ÒINKEJ

251


GEISTLICHKEIT

1491

1492

1493

5#.<$74)'4<$+567/ 

,QJCPP,CMQD-JWGPXQP$GNCUK6CNGT2TQDU\V  5GNVGPDGUQPFGTUKPFKGUGT'TJCNVWPI(GKPG2CVKPCXQT\ÒINKEJ





)WNFGPVCNGT -TGW\GT OKV6KVGN/CZKOKNKCPU++&CX2TQDU\V  5GJTUGNVGPDGUQPFGTUKPFKGUGT'TJCNVWPI8QT\ÒINKEJ





)WNFGPVCNGT -TGW\GT OKV6KVGN/CZKOKNKCPU++&CX2TQDU\V  5GNVGPKPFKGUGT'TJCNVWPI9KP\5EJTÌVNKPIUHGJNGTCO4CPFXQT\ÒINKEJp5VGORGNINCP\



1494

1495

1497



9QNH&KGVTKEJXQP4CKVGPCW4GKEJUVCNGTQ,&CX2TQDU\V  -N5EJTÌVNKPIUTK­XQT\ÒINKEJ



4GKEJUVCNGTMNKRRGQ,2TQDU\V



2CTKU XQP .QFTQP  4GKEJUVCNGT  &CX  2TQDU\V  &C\W 4GKEJUVCNGT   

$TQUEJKGTURWTGP &CX2TQDU\VC 5VÒEM5GJTUEJÌP





4GKEJUVCNGT  /KV IGRT·IVGT <KHHGT  T PGDGP FGT .GJPG FGU 6JTQPUGUUGNU -GPP\GKEJPWPI FGT   9CN\G &CX2TQDU\V 8QT\ÒINKEJ



252

2TCEJVXQNNG2CVKPCXQT\ÒINKEJ

 


GEISTLICHKEIT

1498

1500

1499



/CZ)CPFQNRJXQP-ÒGPDWTI4GKEJUVCNGTOKV)GIGPUVGORGNXQP5CN\DWTICWHFGT 4ÒEMUGKVG&CU5CN\DWTIGT9CRRGPFCTÒDGT5&CX2TQDU\V 48QT\ÒINKEJ



,QJCPP'TPUVXQP6JWPWPF*QJGPUVGKP4GKEJUVCNGT&CX2TQDU\V  8QT\ÒINKEJ





#PFTGCU,CMQDXQP&KGVTKEJUVGKP4GKEJUVCNGT&CX2TQDU\V  4(GNFGTIGIN·VVGVUGJTUEJÌP



1502

  

1501



1503

5KIKUOWPF+++XQP5EJTCVVGPDCEJ5KNDGTOGFCKNNGXQP(/CV\GPMQRH$TWUVDKNFT KP IGKUVNKEJGO 1TPCV5VCFVCPUKEJV OKV FGT 5CN\CEJDTÒEMG WPF FGO -CRW\KPGTDGTI KO 8QTFGTITWPF   OOI$4 448QT\ÒINKEJGU'ZGORNCT  -QPX6CNGT&CX2TQDU\V (CUVXQT\ÒINKEJ  -QPX6CNGT/KV4CPFUEJTKHV577/%7+37'FC\YKUEJGP#TCDGUMGP&CX2TQDU\V 48QT\ÒINKEJ

 253


STANDESHERREN

1504



1505

1506

*KGTQP[OWUXQP%QNNQTGFQ-QPX6CNGT&CX2TQDU\V (CUVXQT\ÒINKEJ



&+'¤56'44'+%*+5%*'056#0&'5*'44'0 &+'64+%*56'+0)4(.+%*'.+0+'27.)#7 

-CTN.WFYKI4GKEJUVCNGT9KGP&CX*QN\OCKT  40WT'ZGORNCTGIGRT·IV5GJTUEJÌP



'56'4*#<; 

0KMQNCWU )TCH 'UVGTJC\[ XQP )CNCPVJC  -QPX6CNGT  9KGP /KV 4CPFUEJTKHV   &CX*QN\OCKT 440WT'ZGORNCTGIGRT·IV8QT\ÒINKEJp5VGORGNINCP\ 

1507

1508

5%*.+%-)4#('0 

5VGRJCP$WTKCP*GKPTKEJ*KGTQP[OWUWPF.QTGP\6CNGTQ,,QCEJKOUVCN#WUDGWVG FGT,QCEJKOUVCNGT)TWDGP&CX&QPGDXCT -N5EJTÌVNKPIUHGJNGTUGJTUEJÌP



&KG 2T·IWPIGP FGT )TCHGP 5EJNKEM UKPF OKV YGPKIGP #WUPCJOGP #WUDGWVGRT·IWPIGP &KG HTÒJGUVGP UVCOOGP CWU   FGO CNU $GTIUVCFV IGITÒPFGVGP 5V ,QCEJKOUVCN   #NU TGFGPFGU <GKEJGP GTUEJGKPV FCJGT 5V ,QCEJKO CWH FGP   /ÒP\GP ·JPNKEJ YKG KO *CT\ 5V #PFTGCU CWH GPVURTGEJGPFGP 2T·IWPIGP &KG ITQ­G #WUDGWVG FGU ,CJTGU   

 6CNGT  OCEJVG FKG 'KPTKEJVWPI GKPGT /ÒP\UV·VVG \YKPIGPF  YWTFG OKV FGT TGIWN·TGP 2T·IWPI DGIQP   PGP  IKPI FKG /ÒP\UV·VVG CWH -ÌPKI (GTFKPCPF + ÒDGT  XGTNQTGP FKG )TCHGP 5EJNKEM CWEJ FKG OGKUVGP   $GTIYGTMGWO,QCEJKOUVCNKP(QNIGFGT5EJNCEJVDGK/ÒJNDGTI#DUEJWHGPFKG)TCHGP5EJNKEMUKEJGKPPGWGU 5KNDGT$GTIDCWTGXKGT WO /KEJCGNUDGTI DGK 2NCP W C FKG 5V#PPC(WPFITWDG  YWTFG FCU /ÒP\TGEJV GTPGWV   GTYQTDGPWPFKP2NCPGKPG/ÒP\UV·VVGGTTKEJVGVYQFCU$GTIUKNDGTXGTRT·IVYWTFG'UKUVJKUVQTKUEJDGOGTMGPUYGTV FC­ FKG 6CNGT CWU ,QCEJKOUVCN FKG 0COGPUIGDGT FGU 6CNGTU KO FGWVUEJURTCEJKIGP 4CWO WPF KP #OGTKMC YCTGP  

6CNGT &QNNCT  Y·JTGPF KP 4W­NCPF FGT GTUVG 6GKN FGU 5VCFVPCOGPU ,QCEJKO FGP TWUUKUEJGP 6CNGTP FGP 0COGP   ,GHKOQMICDGP ,GHKOQM,QCEJKO 



254

6CNGTQ,,QCEJKOUVCN#WUDGWVGFGT,QCEJKOUVCNGT)TWDGP&CX&QPGD  .GKEJVG-QTTQUKQPUURWTGPKO4CPFDGTGKEJUGJTUEJÌP




STANDESHERREN

1509

1510

1510



6CNGTQ,,QCEJKOUVCN&QPGDXCT



$WTKCP *GKPTKEJ *KGTQP[OWU WPF .QTGP\  6CNGT  ,QCEJKOUVCN #WUDGWVG FGT   ,QCEJKOUVCNGT)TWDGP&CX&QPGDNGKEJVXCT 449KP\-QTTQUKQPUURWTGPUGJTUEJÌP 

1511

445GJTUEJÌP

1512 (doppelt)



1513

524+0<'056'+0)4#('0 

,QJCPP'JTGPTGKEJ6CNGT#WIUDWTI&CX(QTUVGT*QN\OCKT  448QT\ÒINKEJGU2TCEJVGZGORNCTOKVHGKPGT2CVKPC



64#76510)4#('05'+6(ª456'0 

2CWN5KZVWUXQP(CNMGPUVGKP&QRRGNVGT4GKEJUVCNGTI&CX*QN\OCKT5 8QPITQ­GT5GNVGPJGKV*GPMGNURWT(GNFGTIGIN·VVGVHCUVUGJTUEJÌP



56&6'+0&'0*#$5$74)+5%*'0'4$.#0&'0 -4'/0+6< 

5EJCWVCNGTQ, ,CJTJWPFGTV 5V)GQTIUVCNGTI&GTJGKNKIG)GQTITGKVGVTFGP&TCEJGP VÌVGPF9KPFIQVVDN·UVTCWH5EJKHHFCTKP%JTKUVWUWPF\YGK#RQUVGN*WU\CT 8QT\ÒINKEJ



*WU\CT YGKUV FCU XQTNKGIGPFG 5VÒEM *GKPTKEJ (WEJU \W FGT /KVVG FGU  ,CJTJWPFGTVU KP -TGOPKV\ V·VKI YCT 'T   XGTOWVGVNKPMUWPVGTFGO(NÒIGNFGU&TCEJGPUUGKP/GFCKNNGWTU\GKEJGP

255


BALTIKUM

'7412+5%*'/ª0<'070&/'&#+..'0

1514

$#.6+-7/

-74.#0& 

'TPUV,QJCPP$KTQP  )TÌUEJGT0GWOCPP  4#VVTCMVKXGU'ZGORNCTOKPLWUVKGTVHCUVXQT\ÒINKEJ 'KPGDGFGWVGPFG5GTKGDCNVKUEJGT/ÒP\GPCWUFGT5COONWPIFGT(TGKJGTTGP$QPFGHKPFGP5KGKP-CVCNQI WPVGTFGP0TP

1515





1517

1516

5KNDGTOGFCKNNGQ,  XQP)<)T·HGPUVGKPCWHUGKPGP)GDWTVUVCI)GJCTPKUEJVGU$TWUVDKNF TOKVWOIGNGIVGO/CPVGN(NCOOGPFGT#NVCTNUVGJVGKPGIGMTÌPVGYGKDNKEJG)GUVCNVXXOKV9CR RGPUEJKNF WPF 9GKJTCWEJIGH·­ T YGKDNKEJG )GUVCNV OKV (ÒNNJQTP CWU FGO /ÒP\GP HCNNGP OKV FGT   4GEJVGPUVTGWVUKG9GKJTCWEJKPFKG(NCOOGPOOI*%\  8QPITQ­GT5GNVGPJGKV'VYCUDGTKGDGPMN4CPFHGJNGTXQT\ÒINKEJ





2GVGT$KTQP5KNDGTOGFCKNNGXQP0)GQTIK$GTNKPCWHFGP0GWDCWFGUUV·FVKUEJGP )[OPCUKWOU KP /KVCW )GJCTPKUEJVGU $TWUVDKNF T OKV WOIGNGIVGO /CPVGN#PUKEJV FGU )[OPCUKWOU   OOI*%\ 4(GKPG2CVKPCXQT\ÒINKEJ





5KNDGTOGFCKNNG  XQP % .GDGTGEJV CWH FKG 5VKHVWPI XQP 5VKRGPFKGP HÒTFKGCP$KNFWPIUTGKUGPVGKN PGJOGPFGP 5EJÒNGTFGU)[OPCUKWOUKP/KVCW$ÒUVGTOKVWOIGNGIVGO/CPVGN0GWP<GKNGP5EJTKHV WOJGT.QTDGGTWPF'KEJGPMTCP\OOI*%\  44-N4CPFHGJNGTXQT\ÒINKEJ



1518



256

1,5:1

1518

-NGKPG5KNDGTOGFCKNNGXQP,.CTQSWGCWHUGKPG)GOCJNKP#PPC&QTQVJGCXQP/GFGO$TWUVDKNF FGT*GT\QIKPN&TGK<GKNGP5EJTKHVWPF,CJTGU\CJNOOI*%\  8QPITQ­GT5GNVGPJGKV(GKPG2CVKPCXQT\ÒINKEJ




BALTIKUM

1519

1520

1520

.'66.#0& 



5KNDGTOGFCKNNGQ,WPUKIPKGTV2T·OKGFGT.CPFYKTVUEJCHVNKEJGP)GUGNNUEJCHVKP-WTNCPF-QTPICTDG 9GKDNKEJG )GUVCNV UVGJV X X OKV -TCP\ KP FGT CWUIGUVTGEMVGP .KPMGP WOJGT #VVTKDWVG FGT .CPFYKTV   UEJCHVKO*KPVGTITWPFCWHIGJGPFG5QPPGWPF#VVTKDWVGFGU*CPFGNUUQYKG'KUGPDCJPOOI 8GTIQNFGV4CPFHGJNGTXQT\ÒINKEJ



5KNDGTOGFCKNNGQ, WO WPUKIPKGTVFGU.CPFYKTVUEJCHVUOKPKUVGTKWOU.ÌYGWPF)TGKHJCNVGPFCU FTGKHGNFKIG9CRRGPFCTÒDGTFTGK5VGTPGWPVGP\YGK<GKNGP5EJTKHVÒDGT6CHGNFKGHÒTFKG)TCXWTGKPGT ,CJTGU\CJN XQTIGUGJGP KUV WOJGT JTGPMTCP\2HNÒIGPFGT $CWGT KP .CPFUEJCHV KO *KPVGTITWPF UVTCJ   NGPFG 5QPPG KO 8QTFGTITWPF NCPFYKTVUEJCHVNKEJG 2TQFWMVG  OO  I &C\W  YGKVGTG   MNGKPGTG'ZGORNCTGOOI OKVITCXKGTVGT,CJTGU\CJN WPFOOI  5VÒEM8QT\ÒINKEJ



1521

1522

1522

.'66.#0&,GNICXC /KVCW  



5VCFV6TCIDCTG5KNDGTOGFCKNNGWPUKIPKGTVCWHFCUNGVVKUEJG5·PIGTHGUV.GKGTFCJKPVGT0QVGP DWEJ WPF .QTDGGT\YGKIG(ÒPH <GKNGP 5EJTKHV FCTWPVGT ,CJTGU\CJN WOJGT IGMTGW\VG 'KEJGP\YGKIG   QDGPUVTCJNGPFGT5VGTPOOI 8QT\ÒINKEJ



8GTIQNFGVGDTQP\GPG8GTFKGPUVOGFCKNNGQ, ,CJTJWPFGTV XQP#2GX\PGT4KIC<YGK#TDGKVGT OKV5GPUGD\Y*COOGTUVGJGPGKPCPFGTIGIGPÒDGTWPFTGKEJGPUKEJFKG*·PFG\WFGP5GKVGP'KEJGP \YGKIG KO *KPVGTITWPF 5VCFVCPUKEJVJTG FCJKPVGT <CJPTCF WPF (NÒIGN  OO &C\W .GVVNCPF   8GTIQNFGVG DTQP\GPG 8GTFKGPUVOGFCKNNG  XQP 5 $GTEU 'KEJGP\YGKI FCJKPVGT <CJPTCF9GKDNK   EJG)GUVCNVUVGJVXXOKV'KEJGP\YGKIGPOO 8QT\ÒINKEJ

 257


BALTIKUM

1523

1525

1524

4+)#56#&6 





5KNDGTOGFCKNNGXQP(9.QQUCWHFGP6QFFGU-CWHOCPPU/9XQP(KUEJGT$GITÒPFGTFGU 9CKUGPJCWUGUHÒT/·FEJGPKP4KIC (KUEJGT+PUVKVWV KO,CJT$TWUVDKNFXQP(KUEJGTUNOKVWO IGNGIVGO /CPVGN#PUKEJV FGU 9CKUGPJCWUGU FCXQT GORH·PIV FKG RGTUQPKHK\KGTVG $CTOJGT\KIMGKV \YGK   /·FEJGPFKGXQPGKPGT(TCWJGTCPIGHÒJTVYGTFGPOOI*%\5QOOGT# (GKPG6ÌPWPIXQT\ÒINKEJp5VGORGNINCP\



5KNDGTOGFCKNNGXQP(9.QQUCWHFGP6QFFGU-CWHOCPPU/9XQP(KUEJGT$GITÒPFGTFGU 9CKUGPJCWUGUHÒT/·FEJGPKP4KIC (KUEJGT+PUVKVWV KO,CJT$TWUVDKNFXQP(KUEJGTUNOKVWO IGNGIVGO /CPVGN#PUKEJV FGU 9CKUGPJCWUGU FCXQT GORH·PIV FKG RGTUQPKHK\KGTVG $CTOJGT\KIMGKV \YGK   /·FEJGPFKGXQPGKPGT(TCWJGTCPIGHÒJTVYGTFGPOOI*%\5QOOGT# 9KP\-TCV\GTXQT\ÒINKEJ



8GTUKNDGTVG $TQP\GOGFCKNNG  WPUKIPKGTV CWH FCU  NGVVKUEJG 5·PIGTHGUV KP 4KIC CWUIGVTCIGP XQP   FGP/WUKMXGTGKPGPFGTFTGKNGVVKUEJGP2TQXKP\GPCPN·­NKEJFGT.CPFYKTVUEJCHVUCWUUVGNNWPI5VCFVCPUKEJV XQP4KICOKVFGT&ÒPCKO8QTFGTITWPFQDGP-CTVWUEJGOKV4+)#WPVGP-CTVWUEJGOKVFGT,CJTGU\CJN ÒDGT'KEJGPIKTNCPFG.GKGTOKV'KEJGP\YGKIGPDGUVGEMVQDGP5VGTPOOI*%\ 48QT\ÒINKEJ



1526



258

5KNDGTOGFCKNNG  XQP , 6CWVGPJC[P LWP CWH FGP 6QF XQP &T #PVQP $WEJJQN\  Ó   &KTGMVQTFGU/WUGWOUWPF/ÒP\MCDKPGVVUKP4KICIGYKFOGVXQPFGT)GUGNNUEJCHVHÒT#NVGTVWOUMWPFG FGT 1UVUGGRTQXKP\GP $TWUVDKNF T OKV WOIGNGIVGO /CPVGN4KVVGT UVGJV PCEJ N OKV IGUGPMVGO $CPPGT   KO *KPVGTITWPF 5VCFVCPUKEJV XQP 4KIC QDGP 5VCFVYCRRGP  OO  I 5 5EJOKFV KP $G   TKEJVG$CPF9WT\DCEJ FQTVKP$TQP\G  4+P1TKIKPCNGVWK8QT\ÒINKEJ




BELGIEN

1527

1528

1528

.+8.0&+5%*'414&'0 

*GKPTKEJXQP)CNGP/CTM0GWOCPP

5GJTUEJÌP



.+8.#0&/'&#+..'0 

5KNDGTOGFCKNNG Q , XQP 9 -WNNTKEJ IGUVKHVGV XQP FGT -CKUGTNKEJ .KXN·PFKUEJGP )GOGKPPÒV\KIGP WPF   ¤EQPQOKUEJGP 5QEKGV·V $TWUVDKNF FGU )TÒPFGTU 2GVGT *GKPTKEJ XQP $NCPMGPJCIGP  Ó   -CWHOCPP KP 4KIC N OKV WOIGNGIVGO /CPVGN(ÒPH <GKNGP 5EJTKHV WOJGT 'KEJGPMTCP\  OO   I*%\5QOOGT-XCT FQTVQJPG5KIPCVWT  4*ÒDUEJG2CVKPCXQT\ÒINKEJ



1529 1531 (doppelt)

1532

1530

#069'42'0 

$'.)+'0

5VCFV 5KNDGTOGFCKNNG  XQP , 2 &TQ\ IGYKFOGV XQP FGT *CPFGNUMCOOGT #PVYGTRGP $ÒUVG   0CRQN¾QPU+TOKV.QTDGGTMTCP\WPFWOIGNGIVGO/CPVGN(NW­IQVV 5EJGNFG NCIGTVPCEJTKOTGEJVGP #TO(ÒNNJQTPOOI5NI,WNKWU 8QT\ÒINKEJ



$4#$#06 

2JKNKRRFGT5EJÌPG6QKUQPF CTIGPV#PVYGTRGP.GXKPUQP++pX)*p -N5EJTÌVNKPIUTK­HCUVUGJTUEJÌP



2JKNKRR +8 XQP 5RCPKGP  &QRRGNVGT &WMCVQP  $TÒUUGN  I &CX    &GNOC 4  49KP\4CPFHGJNGTUGJTUEJÌPpXQT\ÒINKEJ 



2JKNKRR8XQP5RCPKGP&WMCVQP#PVYGTRGP&CX&GNOE 4   5GJTUEJÌP



 259


BELGIEN

1533



1535

1534 (dreifach)

2CVCIQP#PVYGTRGP&CX&GNO 4  4#VVTCMVKXGUUGJTUEJÌPGU'ZGORNCT 9GKVGTG/ÒP\GPXQP$TCDCPVCWUFGO5EJCV\HWPFXQP*GTDQTPHKPFGP5KGWPVGTFGP0TP



(.#0&'40 

2JKNKRR +8 XQP 5RCPKGP  &TGKHCEJGT &WMCVQP  $TÒIIG  I &CX p &GNO p   XIND 8QPITÌ­VGT5GNVGPJGKV(GNFGTFGT8QTFGTUGKVGCNVIGIN·VVGVUGJTUEJÌP 

.ª66+%* 

)GTJCTF XQP )TQGUDGEM   4GKEJUVCNGT  *CUUGNV OKV 6KVGN /CZKOKNKCPU ++   &GNO 4 /KIPQNGV 445GJTUEJÌP

1536



1537

4'%-*'+/ 

'TPUVXQP#URTGOQPV.[PFGP5QWUQ,.WECU  8QPITQ­GT5GNVGPJGKV-N2T·IGUEJY·EJGUGJTUEJÌP



5QWUQ,.WECUXCT +PFKGUGT'TJCNVWPIXQPITQ­GT5GNVGPJGKV(CUVXQT\ÒINKEJ  'KP5VÒDGT5VÒEMXQP4GEMJGKOUQYKGYGKVGTG/ÒP\GPXQP5VCXGNQVWPF6QWTPCKCWUFGO5EJCV\HWPF  XQP*GTDQTPHKPFGP5KGWPVGTFGP0TP

1538



1539

6*14'0 

 260

#PPCXQP/CTM5QWUQ,OKV6KVGNXQP/CVVJKCU.WECUXCT  4-N2T·IGUEJY·EJGUGJTUEJÌP

-¤0+)4'+%*$'.)+'0

.GQRQNF+-W%GPVKOGU/QTKPC

448QT\ÒINKEJ

 


DÄNEMARK

1540



1541

$'.)+5%*-10)1

.GQRQNF++(TCPEU&CX-/

1542

-N-TCV\GTXQT\ÒINKEJ



5VGHCP6XTVMQ++WPF)TQUEJGPQ,,QXCPQXKE4GPILGQ  -N&QRRGNUEJNCIUGJTUEJÌP



$150+'0*'4<')19+0# 

$7.)#4+'0 

(GTFKPCPF.GYC-TGOPKV\&CX-/  #VVTCMVKXGUXQT\ÒINKEJGU'ZGORNCT



1543

-¤0+)4'+%* 

&0'/#4-

*CPU5MKNNKPI/CNOÎ)CNUVGT  ªDGTFWTEJUEJPKVVNKEJGTJCNVGP(GKPG2CVKPCUGJTUEJÌP



1544



%JTKUVKCP++)WNFGPVCNGT/CNOÎ&CX)CNUVGT5EJQWXCT  445EJÌPpUGJTUEJÌP



%JTKUVKCP++FWTEJUGKPG*GKTCVOKV+UCDGNNC5EJYCIGT-CTNU8GTQDGTVGPCEJNCPIGP-·ORHGP5EJYG FGP &KG *KPTKEJVWPI UGKPGT )GIPGT KO HWTEJVDCTGP 5VQEMJQNOGT $NWVDCF XQO  0QXGODGT  HÒJTVG \WO #WH   UVCPF WPVGT )WUVCX 8CUC WPF \WO 8GTNWUV 5EJYGFGPU &C -ÌPKI %JTKUVKCP ++ $CWGTP WPF $ÒTIGTVWO DGIÒPUVKIVG   YWTFG GT  FWTEJ #FGN WPF )GKUVNKEJMGKV OKV 7PVGTUVÒV\WPI FGT 5VCFV .ÒDGEM HÒT CDIGUGV\V GTMN·TV #P UGKPG   5VGNNGYWTFGCO/·T\UGKP1PMGN(TGFGTKM+DGTWHGP%JTKUVKCPHNQJKPFKG0KGFGTNCPFGWPFUEJGKVGTVGKP FGPHQNIGPFGP,CJTGPDGKO8GTUWEJFGP6JTQP\WTÒEM\WIGYKPPGPYWTFGGTKP0QTYGIGPIGHCPIGPIGPQOOGP WPF DKU \W UGKPGO6QFKP*CHVIGJCNVGP&KGJKGTCPIGDQVGPGUGJTUGNVGPG4GPCKUUCPEGRT·IWPICWUFGT2T·IGUV·VVG /CNOÌFCUDKUF·PKUEJYCT\·JNV\WFGPHTÒJGUVGPF·PKUEJGP)TQ­UKNDGTOÒP\GP

261


DÄNEMARK

1545 1546

1546



%JTKUVKCP+85QNKFK-QRGPJCIGP*GFG



(TGFGTKM+++6TCIDCTGQXCNG5KNDGTJQJNIW­OGFCKNNGOKV5KIPCVWT*.6CWHFGP (TKGFGP XQP -QRGPJCIGP \YKUEJGP &·PGOCTM WPF 5EJYGFGP )GJCTPKUEJVGU $TWUVDKNF T OKV .QTDGGT   MTCP\ WPF WOIGNGIVGO /CPVGN&KG UEJYGFKUEJG *CPF ITGKHV PCEJ FGT F·PKUEJGP -TQPG WPF YKTF XQP   IÌVVNKEJGT *CPF OKV GKPGO 5EJYGTV CDIGUEJNCIGP  Z  OO  I )CNUVGT  2CZ KP   0WOOKU 44-N&TWEMUVGNNGPHCUVXQT\ÒINKEJ

1547



1549

4<CKPGPFGUGJTUEJÌP





1548

-NKRRGPHÌTOKIG 5KNDGTOGFCKNNG \W GKPGO 4GKEJUVCNGT  WPUKIPKGTV CWH UGKPGP 6QF 4GKEJUCRHGN   FCJKPVGT5EJYGTVWPF<GRVGTIGMTGW\V\WFGP5GKVGPLGGKPG-TQPGQDGPIGMTÌPVGU/QPQITCOO( CWH 9QNMGP KP FGP 'EMGP 9CRRGPUEJKNFG1DGNKUM KP .CPFUEJCHV FCXQT TWJGPFGT .ÌYG T   WPVGTIGJGPFG5QPPGKPFGP'EMGP&CVGPCWUUGKPGO.GDGPZOOI)CNUVGT 4#VVTCMVKXGUXQT\ÒINKEJGU'ZGORNCTOKVHGKPGT6ÌPWPI





%JTKUVKCP 8  5RGEKGUVCNGT  -QRGPJCIGP  I 2T·IWPI HÒT FKG &·PKUEJ1UVKPFK   UEJG -QORCPKG )GJCTPKUEJVGU $TWUVDKNF T OKV .QTDGGTMTCP\ WPF WOIGNGIVGO /CPVGN)GMTÌPVGU   /QPQITCOO % \W FGP 5GKVGP FKG IGVGKNVG ,CJTGU\CJN    FCTWPVGT FCU IGMTÌPVG /QPQITCOO   &1%FGT&·PKUEJ1UVKPFKUEJGP-QORCPKG\WFGP5GKVGPLGGKP2CNO\YGKI&CX*GFG#  44)GTGKPKIVUGJTUEJÌP 



5KNDGTOGFCKNNG  WPUKIPKGTV XQP , ) $TGWGT CWH FGP F·PKUEJPKGFGTN·PFKUEJGP 5GGUKGI DGK FGT   +PUGN ¤NCPF CO  ,WPK )GJCTPKUEJVGU $TWUVDKNF T OKV .QTDGGTMTCP\#PUKEJV FGT 5GGUEJNCEJV N KO   8QTFGTITWPFUKPMVFCUUEJYGFKUEJG$GHGJNUUEJKHH-TQPCPOOI)CNUVGT1UUDCJT 445VGORGNHGJNGTCO4CPFHCUVXQT\ÒINKEJ

262




DÄNEMARK 0CEJFGT'TQDGTWPIXQP)QVNCPFFWTEJFKGF·PKUEJGP6TWRRGPCO/CKOW­VGPFKG5EJYGFGPFKG8GTGKPK IWPI FGT F·PKUEJGP OKV FGT PKGFGTN·PFKUEJGP (NQVVG WPF FGP #PITKHH CWH FKG UEJYGFKUEJG (NQVVG DGHÒTEJVGP 'U   IGNCPI FGO #FOKTCN .QTGPV\ %TGWV\ CO  /CK  DGK $QTPJQNO PKEJV FKG F·PKUEJGP 5EJKHHG CWH\WJCNVGP #O   /CKGTTGKEJVGFGTJQNN·PFKUEJG#FOKTCN%QTPGNKWU6TQOR-QRGPJCIGPÒDGTPCJOFGP$GHGJNÒDGTFKGPWP XGTGKPKIVG PKGFGTN·PFKUEJF·PKUEJG -TKGIUHNQVVG WPF XGTHQNIVG FKG UEJYGFKUEJGP 5EJKHHG FKG UKEJ CPFKGUEJYGFKUEJG 1UVMÒUVG 4KEJVWPI ¤NCPF \WTÒEM\QIGP #O  ,WPK  MCO GU CP FGT 5ÒFURKV\G ¤NCPFU \WO GPVUEJGKFGPFGP )G   HGEJV <WP·EJUV UCPM FCU UEJYGFKUEJG $GHGJNUUEJKHH -TQPCP WPF TK­ OGJT CNU  /CPP FCTWPVGT CWEJ #FOKTCN   %TGWV\KPFGP6QF#WEJFKG#WUGKPCPFGTUGV\WPI\YKUEJGPFGOF·PKUEJGP#FOKTCNUUEJKHH%JTKUVKCPWU8WPFFGO UEJYGFKUEJGP 5EJKHH 5X·TFGV FKG CWH FGT XQTNKGIGPFGP /GFCKNNG IG\GKIV YKTF MQPPVGP FKG #NNKKGTVGP HÒT UKEJ   GPVUEJGKFGP &KG TGUVNKEJGP UEJYGFKUEJGP 5EJKHHG HNÒEJVGVGP &KG UEJYGFKUEJG 0KGFGTNCIG DGK ¤NCPF OCEJVG GKPG   4ÒEMGTQDGTWPI XQP 4ÒIGP WPF 5EJYGFKUEJ2QOOGTP WPOÌINKEJ WPF GTÌHHPGVG FGP &·PGP FGP 'KPOCTUEJ KP 5EJQ   PGPFCFKGUEJYGFKUEJG-ÒUVGPKEJVOGJTIGUEJÒV\VYCT  &CU9TCEMFGT-TQPCPYWTFGXQT¤NCPFGPVFGEMVWPFCTEJ·QNQIKUEJWPVGTUWEJV&CDGKMCOGKPGTFGTDGFGWVGPF UVGP UEJYGFKUEJGP )QNFOÒP\GPUEJ·V\G OKV OGJT CNU  )QNFOÒP\GP FGU  ,CJTJWPFGTVU \WO 8QTUEJGKP &GT   5EJCV\HWPF YWTFG RWDNK\KGTV )WNFUMCVVGP HT¹P TGICNUMGRRGV -TQPCP #WUUVGNNWPIUMCVCNQI  FGU -ÌPKINKEJGP   /ÒP\MCDKPGVVU5VQEMJQNO WPFDGHKPFGVUKEJJGWVGKO/WUGWOXQP-CNOCT

1550

1550 1,5:1



6CNGTHÌTOKIG 5KNDGTOGFCKNNG  XQP ) -TÒIGT CWH FKG 'TQDGTWPI FGT 5VCFV .CPFUMTQPC FWTEJ FKG   &·PGP WPF CWH FCU 7JTGPYWPFGT CO  ,WNK <KHHGTPDNCVV FGT <GKIGT UVGJV CWH XKGTVGN PCEJ PGWP   \YGK 5VWPFGPDG\GKEJPWPIGP UKPF HGJNGTJCHV +++++ UVCVV +++  WPF 88++ UVCVV 8++ <GJP <GKNGP 5EJTKHV   WPVGP8GT\KGTWPI1JPG4CPFUEJTKHVOOI)CNUVGT FQTVOKV4CPFUEJTKHV   8QPITQ­GT5GNVGPJGKVªDNKEJGT5VGORGNDTWEJXQT\ÒINKEJ  0CEJ FGT 'KPPCJOG XQP *GNUKPIDQTI \QI %JTKUVKCP 8 XQT FKG UEJQPKUEJG 5VCFV .CPFUMTQPC $GTGKVU CO  ,WNK   IGNCPIFGT'KPOCTUEJKPFKG5VCFVFKGUEJYGFKUEJGP5QNFCVGP\QIGPUKEJKPFCUDGHGUVKIVG5EJNQ­\WTÒEM0CEJ OGJTGTGP 9QEJGP JGHVKIGP $GUEJWUUGU MCRKVWNKGTVG FGT UEJYGFKUEJG -QOOCPFCPV 1DGTUV *KGTQP[OWU .KPFGDGTI   UEJNKG­NKEJ CO  #WIWUV  GPVIGIGP FGP KJO CWUFTÒEMNKEJ GTVGKNVGP $GHGJN WPF FKG &·PGP PCJOGP FCU 5EJNQ­   COHQNIGPFGP6CIKP$GUKV\.KPFGDGTIYWTFGYKGDGTGKVUXQTKJOFGT-QOOCPFCPVKP*GNUKPIDQTI2GT*·UVGUMQ XQOUEJYGFKUEJGP-TKGIUIGTKEJV\WO6QFGXGTWTVGKNVWPFJKPIGTKEJVGV  #O  ,WNK  YCT GKP $NKV\ KP FKG -KTEJG XQP .CPFUMTQPC GKPIGUEJNCIGP WPF JCVVG FKG DGKFGP <KHHGTP FGT   -KTEJVWTOWJTXGT·PFGTV&KGUGT5EJCFGPCPFGT7JTXGTCPNC­VGOCPEJG<GKVIGPQUUGPFCTKPGKP9WPFGTWPF1OGP \WUGJGPFCUUKEJCWHFKGHÒT&·PGOCTMGTHQNITGKEJG$GNCIGTWPIWPF'TQDGTWPI.CPFUMTQPCUDG\QI  )GQTI )CNUVGT YKGU FCTCWHJKP FC­ FKGUGU5VÒEMFWTEJUGKPG2T·IWPIUGKPG)TÌ­GWPFUGKP)GYKEJVCNU5EJCWVCNGT \W DG\GKEJPGP KUV &GT 6CNGT VT·IV CWEJ FKG +PKVKCNGP FGU /ÒP\OGKUVGTU )QVVHTKGF -TÒIGT FGT FKG -QRGPJCIGPGT   /ÒP\UV·VVGXQPDKUNGKVGVG

1552

1551

1551



-TQPG /CTM -QRGPJCIGP&KEMUVÒEMI*GFG  44#VVTCMVKXGU'ZGORNCTOKVHGKPGT2CVKPCUGJTUEJÌPpXQT\ÒINKEJ



5MKNNKPI-QRGPJCIGP*GFG

(CUVXQT\ÒINKEJ

  263


DÄNEMARK

1553





1554

(TGFGTKM 8  5KNDGTOGFCKNNG  XQP 2 * )ÌFGEMG CWH UGKPGP 4GIKGTWPIUCPVTKVV )G   JCTPKUEJVGU $TWUVDKNF T OKV .QTDGGTMTCP\ WPF WOIGNGIVGO /CPVGN&CPKC UKV\V OKV FGO F·PKUEJGP   9CRRGPUEJKNFPCEJNFKG.KPMGCWHGKP2QUVCOVGPVOKVFGPIGMTÌPVGP+PKVKCNGPFGU-ÌPKIUIGNGJPVN UVTCJNGPFG5QPPGÒDGT.CPFUEJCHVOOI)CGF)CNUVGT  -N4CPFHGJNGTHCUVXQT\ÒINKEJ



5KNDGTOGFCKNNGXQP)99CJNCWHFCUL·JTKIG,WDKN·WOFGU*CWUGU1NFGPDWTIIGUVKHVGVXQP FGT 9GUVKPFKUEJGP *CPFGNUMQORCPKG )GJCTPKUEJVGU $TWUVDKNF T OKV .QTDGGTMTCP\ WPF WOIGNGIVGO   /CPVGN5EJKHHGKO*CHGPGKPGU*CPFGNUUVÒV\RWPMVGUOOI)CNUVGT  8QTFGTUGKVGGVYCUIGIN·VVGVUGJTUEJÌP



1555



5KNDGTOGFCKNNGXQP/)#TDKGPCWHFKG)GDWTVUGKPGU5QJPGU'TDRTKP\%JTKUVKCP UR·VGT%JTK UVKCP8++ $TWUVDKNFGT(TGFGTKMU8WPFUGKPGT)GOCJNKP.WKUG6QEJVGT)GQTIU++XQP$TCWPUEJYGKI %CNGPDGTI*CPPQXGT-ÌPKIXQP)TQ­DTKVCPPKGPPGDGPGKPCPFGTT&KG-ÌPKIKPOKVUVTCJNGPFGT-TQPG ÒDGTIKDVFGTXQTKJTCWHGKPGO.ÌYGPUKV\GPFGP&CPKCFCUPGWIGDQTGPG-KPFFGT.ÌYGJ·NVOKVUGKPGT NKPMGP2TCPMGFCUIGMTÌPVGF·PKUEJG9CRRGPOOI$TQEMOCPP)CNUVGT  40WT'ZGORNCTGIGRT·IV(GKPG6ÌPWPIYKP\-TCV\GTXQT\ÒINKEJ



1556

1557

1557



5MKNNKPI-QRGPJCIGP*GFG$



5KNDGTOGFCKNNG  XQP , * 9QNHH CWH UGKPGP 6QF $ÒUVG T OKV .QTDGGTMTCP\6TCWGTPFG &CPKC   UKV\VCWH5VWHGPXQTFGO)TCDOCN\WKJTGP(Ò­GPFKG5EJKNFGXQP&·PGOCTMWPF0QTYGIGPUQYKGFGT F·PKUEJGP$GUKV\WPIGPOOI)CNUVGT 5GJTUEJÌPpXQT\ÒINKEJ

264

8QT\ÒINKEJ






DÄNEMARK

1558



%JTKUVKCP8++5KNDGTOGFCKNNGXQP&,#F\GTCWHFKG/CTMKGTWPIFGTPQTYGIKUEJ UEJYGFKUEJGP)TGP\GOKV)TGP\UVGKPGP)TGP\UVGKP<GKNGP5EJTKHVOOI)CNUVGT 44#VVTCMVKXGUXQT\ÒINKEJGU'ZGORNCTOKVHGKPGT6ÌPWPI



1560

1559



$TQP\GOGFCKNNG  XQP , 9GUVYQQF CWH UGKPGP $GUWEJ KP 'PINCPF DGK UGKPGO 5EJYCIGT -ÌPKI   )GQTIG+++7PKHQTOKGTVGU$TWUVDKNFN<GJP<GKNGP5EJTKHVOO'KOGT#PO 8QT\ÒINKEJ





$TQP\GOGFCKNNGXQP,-KTMCWHUGKPGP$GUWEJKP'PINCPFDGKUGKPGO5EJYCIGT-ÌPKI)GQTIG+++ $ÒUVGT5GEJU<GKNGP5EJTKHVOO'KOGT#PO 8QT\ÒINKEJ



1562

1561





1561

5KNDGTOGFCKNNG  XQP & , #F\GT CWH FGP 6QF FGU L·JTKIGP -PCDGP 7NTKEJ (TKGFTKEJ 5WJO   GKP\KIGT5QJPFGU*KUVQTKQITCRJGPWPF-COOGTJGTTGP2GVGT(TKGFTKEJ5WJO7PKHQTOKGTVGU$TWUVDKNFN 6TCWGTPFG YGKDNKEJG )GUVCNV OKV .QTDGGTMTCP\ KP FGT 4GEJVGP NGJPV CWH GKPGT 7TPG CWH FGT 70+%1  

FGO'KP\KIGP \WNGUGPKUVOOI)CNUVGT  48QT\ÒINKEJGU'ZGORNCTOKVHGKPGT6ÌPWPI



5KNDGTOGFCKNNGXQP&(QFGT(9.QQUCWHFGPXGTGKVGNVGP#PITKHHFGT'PIN·PFGTCWH-QRGP JCIGP 'KP -TKGIGT KP TÌOKUEJGT 6TCEJV GORH·PIV XQP FGT UKV\GPFGP )GTGEJVKIMGKV GKP 5EJYGTV'KP   -TKGIGTKPTÌOKUEJGT6TCEJVM·ORHVIGIGPGKP5GGWPIGJGWGTOOI$GTIUÎG5QOOGT# 8QT\ÒINKEJ



&·PGOCTM XGTUWEJVG \WUCOOGP OKV 4W­NCPF 2TGW­GP WPF 5EJYGFGP FGP HTGKGP *CPFGN \W UEJÒV\GP WPF FGO   5GGFGURQVKUOWU'PINCPFUGPVIGIGP\WVTGVGP'KPGGPINKUEJG(NQVVGWPVGT0GNUQPGTUEJKGPXQT-QRGPJCIGPWPFFTCPI VTQV\VCRHGTGTF·PKUEJGT)GIGPYGJTKPFGP*CHGPGKP&·PGOCTMOW­VGUEJNKG­NKEJFCUGPINKUEJG5GGTGEJVCPGTMGPPGP

265


FINNLAND

1564

1563



1563

(TGFGTKM8+$TQP\GOGFCKNNGXQP*'(TGWPF/QFGNNHKIWTGKPGULWPIGPPCEMVGP /CPPGU.KGIGPFG /QFGNNHKIWT GKPGU LWPIGP PCEMVGP /CPPGU OKV GKPGT DTGPPGPFGP (CEMGN ÒDGT FGO   -QRHOO$GTIUÎG 0WTYGPKIG'ZGORNCTGKP$TQP\GIGRT·IV(CUV5VGORGNINCP\



&KG XQTNKGIGPFG /GFCKNNG YCT FGT GTUVG 8GTUWEJ FGU 5VGORGNUEJPGKFGTU * ' (TGWPF OKV GKPGT /QFGNNHKIWT   &KG 7OUEJTKHV FKG CWH FGT 8QTFGTUGKVG FGT /GFCKNNG DGIKPPV WPF CWH FGT 4ÒEMUGKVG HQTVIGHÒJTV YKTF UVCOOV CWU   FGO 9GTM 8GTIKNU #GPGKU + 8  &C * ' (TGWPF MGKP .CVGKPGT YCT OCEJVG GT (GJNGT KP FGT NCVGKPKUEJGP   )TCOOCVKMGTUEJTKGD.#$147/CPUVCVV.#$14'/WPF(#%+'$#6CPUVCVV('%+6



/CTITGVJG++UGKV-TQPGPCWHFGP6QFKJTGU8CVGTU-ÌPKI(TGFGTKM+:WPFCWHKJTG 6JTQPDGUVGKIWPI-// 440WT5VÒEMIGRT·IV2QNKGTVG2NCVVGOKPDGTÒJTV

1565

1566



1567

&0+5%*9'56+0&+'0 

%JTKUVKCP8++5MKNNKPI-QRGPJCIGP#NVQPCQFGT-QPIUDGTI*GFG  -N5EJTÌVNKPIUHGJNGTUGJTUEJÌP



)4¤0.#0& 

#PIOCIUUCNKM<KPMOCTMGQ,\W¤TG4Q[CN)TGGPNCPF6TCFG%QORCP[-/6P  0WT'ZGORNCTGIGRT·IV5GJTUEJÌP





+XKIVWV<KPMOCTMGQ,\W¤TG+XKIVWV%T[QNKVG/KPKPI6TCFKPI%QORCP[-/6P  5GJTUEJÌP



1568

(+00.#0&  266

4GRWDNKMUGKV/CTMMCC*GNUKPMKCWHFKG:81N[ORKUEJGP5RKGNGKP*GNUKPMK -/ 5GJTUGNVGPGT,CJTICPI-N&TWEMUVGNNGHCUVXQT\ÒINKEJ




FRANKREICH

1,5:1

1569

1,5:1

(4#0-4'+%*-#41.+0)'4 

-CTN FGT )TQ­G  &GPCT /GNNG  I %ÕQ  .85 WOJGT 2GTNMTGKU-TGKUHÌTOKI m'   &1%85KPFGT/KVVG4QUGVVGWOJGT2GTNMTGKU/) FQTVWPDGMCPPVG/ÒP\UV·VVG   4&WPMNG2CVKPCUGJTUEJÌP 

)TKGTUQP$NCEMDWTP NGIGP FGP DGK /QTTKUQP)TWPVJCN WPVGT +PFGVGTOKPCVG /KPVU XGT\GKEJPGVGP 6[R KP FKG /ÒP\   UV·VVG/GNNGKPFGOUKGFKG$WEJUVCDGPXGTDKPFWPIGPKPFGT7OUEJTKHV\W/'61.1CWHNÌUGP XIN/'% 

1,5:1



1,5:1

&GPCT6QWTUI %#4.854':(4-TGW\ 68410+5-CTQNWUOQPQITCOO/)  44-N(GJNUVGNNGCO4CPFUGJTUEJÌP

1571



1570

1572



1573

.WFYKI FGT (TQOOG  &GPCT WPDGUVKOOVG /ÒP\UV·VVG  I *.8&188+%85+/2   -TGW\KPFGP9KPMGNPLGGKPG-WIGN :2+56+#0#4'.+)+1-KTEJGPIGD·WFG/)  45GJTUEJÌP





-CTN FGT -CJNG  &GPCT $QWTIGU  I %#4.85+/2#8% -TGW\ $+684+%'5   %+8+6-CTQNWUOQPQITCOO/) 5GJTUEJÌP





&GPCT/GNNGI %#4.854':(4-TGW\ /'6 8..1-CTQNWUOQPQITCOO/) 5GJTUEJÌP



1574

1575

1576



&GPCT2CTKUI %#4Ú.854Û':Û-TGW\2#4+Û5Û++/)

45GJTUEJÌP





&GPCT 4GPPGU  I  )4#6+# &+ 4': -CTQNWUOQPQITCOO 02'&10+5%+8+6#5 -TGW\   /) 8QT\ÒINKEJ





1FQ  &GPCT .KOQIGU  I  )4#6+#&+4' WPF 1&1 \YKUEJGP \YGK -TGW\GP   .+/18+%#5%+8+5-TGW\/) 5GJTUEJÌP

 267


FRANKREICH

1577

1578

(4#0-4'+%*

-¤0+)4'+%* 

.QWKU +:  )TQU VQWTPQKU Q ,  I -TGW\ WOJGT \YGK <GKNGP 5EJTKHV-CUVGNN WOJGT   -TGKUXQP.KNKGP&WRNGUU[XCT 8QT\ÒINKEJ





*GPTK+8'EWFG0CXCTTG ,CJTGU\CJNKO5VGORGNCWUIG·PFGTV 5CKPV2CNCKU &WRNGUU[NGKEJVXCT 8QT\ÒINKEJ



1579

1580

1580



'EW*.C4QEJGNNG&WRNGUU[



.QWKU :+++  $TQP\GIW­OGFCKNNG  WPUKIPKGTV XQP ) &WRT¾ CWH FKG 8QNNGPFWPI FGU   #SW·FWMVGUXQP#TEWGKNDGK2CTKU)GJCTPKUEJVGU$TWUVDKNFTOKV*CNUMTCWUGWPFWOIGNGIVGO/CPVGN 5EJKHHCWHJQJGT5GGOO,QPGUp5NI$TGVVCWGT FQTVCNU0CEJIW­ 9WT\DCEJ  )GNQEJVGTHCUVXQT\ÒINKEJGT1TKIKPCNIW­

1581

8QT\ÒINKEJ

1583





1582



'EW F CTIGPV  # 2CTKU )GJCTPKUEJVGU $TWUVDKNF T OKV .QTDGGTMTCP\ WPF WOIGNGIVGO /CPVGN   )GMTÌPVGU9CRRGP&CX&WRNGUU[DKU)CFQWT[ 8QT\ÒINKEJ 

 

'EWF CTIGPV#2CTKU&CX&WRNGUU[)CFQWT[ 'EW#2CTKU&WRNGUU[)CFQWT[

268

5GJTUEJÌP 8QT\ÒINKEJ

 


FRANKREICH

1584



'EW#2CTKU&WRNGUU[)CFQWT[

1585

5GJTCVVTCMVKXGUXQT\ÒINKEJGU'ZGORNCT



1587

1586



'EW F CTIGPV  # 2CTKU  I )GJCTPKUEJVGU $TWUVDKNF T OKV .QTDGGTMTCP\ WPF WOIGNGIVGO   /CPVGN)GMTÌPVGU9CRRGP&CX&WRNGUU[)CFQWT[ 8QT\ÒINKEJ 

 

'EWF CTIGPV#2CTKU&CX&WRNGUU[)CFQWT[ 'EWF CTIGPV&.[QP&CX&WRNGUU[)CFQWT[

1589

5GJTUEJÌP 45EJÌPG2CVKPCUGJTUEJÌP

1588

 

1590



'EWF CTIGPV#2CTKU&WRNGUU[)CFQWT[

8QT\ÒINKEJp5VGORGNINCP\



.QWKU:+8'EW¯NCO½EJGNQPIWG$4QWGP&CX&WRNGUU[)CFQWT[ ,WUVKGTVXQT\ÒINKEJ





'EW¯NCO½EJGNQPIWG#2CTKU&CX&WRNGUU[)CFQWT[



5GJTUEJÌP



269


FRANKREICH

1591



5KNDGTOGFCKNNG  WPUKIPKGTV XQP , 9CTKP CWH FKG 8GTDGUUGTWPI FGT *CPFGNU WPF -TKGIUOCTKPG   )GJCTPKUEJVGU $TWUVDKNF T OKV .QTDGGTMTCP\ WPF WOIGNGIVGO /CPVGN T KO (GNF &TGK\CEM5EJKHH   WPVGTXQNNGP5GIGNPOOI,QPGU++ 2TCEJVGZGORNCT(GKPG6ÌPWPIXQT\ÒINKEJ 

1592



1593

1594

'EW¯NCETCXCVG#2CTKU&CX&WRNGUU[)CFQWT[

5GJTUEJÌP



&CUXQTNKGIGPFGWPFPCEJHQNIGPFG5VÒEMYKTFCWEJCNU'EWFW2CTNGOGPVDG\GKEJPGV



'EW¯NCETCXCVG4GPPGU&CX&WRNGUU[)CFQWT[

(CUVXQT\ÒINKEJ





'EWCWZJWKV.4GPPGU4¾HQTOCVKQP&CX&WRNGUU[#)CFQWT[  8QT\ÒINKEJGU2TCEJVGZGORNCTOKVHGKPGT6ÌPWPI



1595

1596

  270

'EWCWZJWKV.#2CTKU4¾HQTOCVKQP&WRNGUU[#)CFQWT[ 'EWCWZJWKV.&.[QP4¾HQTOCVKQP&CX&WRNGUU[#)CFQWT[

1596

8QT\ÒINKEJ 5GJTUEJÌP

 


FRANKREICH

1597



1597

1,5:1

5KNDGTOGFCKNNG  WPUKIPKGTV CWH FKG 5GGUEJNCEJV DGK .C *QIWG $ÒUVG T&CU CWH 5GG GZRNQFKG   TGPFGWPFUKPMGPFG5EJKHH.G5QNGKN4Q[CNOOI/¾FCKNNGUHTCP¼CKUGUp5NI,WNKWUp X.QQP+85 4ÒEMUGKVG   8QPITQ­GT5GNVGPJGKV2TCEJVGZGORNCT/KP4CPFHGJNGTXQT\ÒINKEJp5VGORGNINCP\  'ZGORNCTFGT#WMVKQP*GUU&KXQ#)<ÒTKEJ0T

1598 1599

1599



'EWCWZJWKV.'6QWTU4¾HQTOCVKQP&WRNGUU[#)CFQWT[



$TQP\GOGFCKNNGXQP,/CWIGTCWHFKG$QODCTFKGTWPIXQP&ÒPMKTEJGP$ÒUVGT(TCP\ÌUKUEJG )CNGGTG KO *CHGP XQP &ÒPMKTEJGP KO 8QTFGTITWPF GKP IGUWPMGPGU 5EJKHH CWU FGT 5VCFV YKTF GKPG   $QODGCDIGUEJQUUGPFKGKPFGT.WHVGZRNQFKGTVOO&KXQ 8QT\ÒINKEJ

1600

1601

8QT\ÒINKEJ

 

1602



'EWCWZVTQKUEQWTQPPGU#2CTKU&CX&WRNGUU[)CFQWT[  #VVTCMVKXGUXQT\ÒINKEJGU'ZGORNCT





'EWCWZVTQKUEQWTQPPGU#2CTKU&CX&WRNGUU[)CFQWT[

8QT\ÒINKEJ





'EWCWZVTQKUEQWTQPPGU#2CTKU&CX&WRNGUU[)CFQWT[  (GKPG6ÌPWPIHCUVXQT\ÒINKEJ

 271


FRANKREICH

1603

1604

1605



'EWCWZVTQKUEQWTQPPGU'6QWTU&CX&WRNGUU[)CFQWT[

(CUVXQT\ÒINKEJ





'EWCWZVTQKUEQWTQPPGU14KQO&CX&WRNGUU[)CFQWT[

,WUVKGTVUGJTUEJÌP





'EWCWZVTQKUEQWTQPPGU#2CTKU&CX&WRNGUU[)CFQWT[

5GJTUEJÌP



1606

1607

1608



.QWKU :8  'EW XGTVWICFKP  # 2CTKU 4¾HQTOCVKQP &CX  &WRNGUU[  #   )CFQWT[ ªDGTRT·IWPIUURWTGPUGJTUEJÌPpXQT\ÒINKEJ





'EWXGTVWICFKP&.[QP4¾HQTOCVKQP&CX&WRNGUU[#)CFQWT[  ªDGTRT·IWPIUURWTGPUGJTUEJÌP



&CU5VÒEMYWTFGCWHGKPGP'EWCWZVTQKUEQWTQPPGUÒDGTRT·IV

 272

'EWXGTVWICFKP9.KNNG(NCPPGWH&CX&WRNGUU[)CFQWT[

(CUVXQT\ÒINKEJ




FRANKREICH

1609

1611

1610



'EWFG0CXCTTG86TQ[GU&CX&WRNGUU[)CFQWT[  9KP\5EJTÌVNKPIUHGJNGTMN-TCV\GTXQT\ÒINKEJ





'EWCWZJWKV.;$QWTIGU&CX&WRNGUU[)CFQWT[  2TCEJVGZGORNCT8QT\ÒINKEJp5VGORGNINCP\





'EWCWZJWKV.%%CGP&CX&WRNGUU[)CFQWT[  45GJTCVVTCMVKXGU'ZGORNCTOKVJÒDUEJGT2CVKPCNGKEJVLWUVKGTVXQT\ÒINKEJ



1613

1612



1612

5KNDGTOGFCKNNGXQP,&WXKXKGTWPF/4ÌICWHFKG'TQDGTWPIXQP/CKNCPF$ÒUVGTOKV.QT DGGTMTCP\ WPF WOIGNGIVGO /CPVGN&GT -ÌPKI CNU -TKGIUIQVV /CTU UVGJV JCNDT OKV 5EJKNF WPF .CP\G   WPFPKOOVFKG*WNFKIWPIXQPFGTXQTKJOMPKGPFGPRGTUQPKHK\KGTVGP5VCFV/CKNCPFGPVIGIGPKO*KP VGTITWPF-TKGIUVTQRJ·GPOOI/¾FCKNNGUHTCP¼CKUGU5  8QPITQ­GT5GNVGPJGKV#VVTCMVKXG2CVKPCXQT\ÒINKEJ



'EWCWDCPFGCW2CW&CX&WRNGUU[)CFQWT[



&KG (TCIG FGT $GUGV\WPI FGU RQNPKUEJGP -ÌPKIUVJTQPU PCEJ FGO 6QFG #WIWUVU FGU 5VCTMGP GPV\ÒPFGVG  GKPGP   -TKGI(TCPMTGKEJUWPFUGKPGT8GTDÒPFGVGPIGIGP¤UVGTTGKEJFCU4GKEJWPF4W­NCPF&KG-CORHJCPFNWPIGPHCPFGP ÒDGTYKGIGPF KP FGT 4JGKPIGIGPF UVCVV CDGT CWEJ KP +VCNKGP YQ FGT HTCP\ÌUKUEJG -ÌPKI OKV FGO *GT\QI XQP 5C   XQ[GPWPFFGO-ÌPKIXQP5RCPKGP8GTDÒPFGVGKO-CORHIGIGP¤UVGTTGKEJIGHWPFGPJCVVGFCUUGKVFGO'PFGFGU 5RCPKUEJGP 'TDHQNIGMTKGIGU  ÒDGT /CKNCPF WPF /CPVWC 2CTOC 2KCEGP\C UQYKG ÒDGT 0GCRGN WPF 5K\KNKGP   JGTTUEJVG WPF UQOKV GKPG OC­IGDNKEJG 5VGNNWPI CWH FGO #RGPPKP KPPGJCVVG 5EJQP  \GKIVG UKEJ FCUU FKG ÌUVGT   TGKEJKUEJGP6TWRRGPKP+VCNKGPFGOITQ­GPOKNKV·TKUEJGP&TWEMFGT)GIPGTPKEJVUVCPFJCNVGPMQPPVGP5CTFKUEJGWPF HTCP\ÌUKUEJG6TWRRGPMQPPVGPKPFKGUGO,CJTFKG.QODCTFGKOKV#WUPCJOG/CPVWCUDGUGV\GPCWEJFKG5VCFV/CK NCPF YWTFG CO  &G\GODGT GKPIGPQOOGP FKG <KVCFGNNG HKGN CO  &G\GODGT 0CEJ FGO 'PFG FGU 2QNPKUEJGP   6JTQPHQNIGMTKGIGUGTJKGNV¤UVGTTGKEJ/CKNCPFWPF/CPVWC\WTÒEMCPFGTGKVCNKGPKUEJG$GUKV\WPIGPIKPIGP KPFGUCPFKG)GIPGT



8QT\ÒINKEJ

273


FRANKREICH

1614



'EW¯NCXKGKNNGV¿VG$4QWGPI$TWUVDKNFNOKV.QTDGGTMTCP\WPFWOIGNGIVGO/CPVGN FCTWPVGT GKP 2HCW FGT GKP 4CF UEJN·IV)GMTÌPVGU 9CRRGP \W FGP 5GKVGP IGMTGW\VG .QTDGGT\YGKIG   &CX&WRNGUU[)CFQWT[  5GJTCVVTCMVKXGU'ZGORNCTOKVHGKPGT6ÌPWPIXQT\ÒINKEJp5VGORGNINCP\ 

1615



 

1616

1617

.QWKU:8+$TQP\GOGFCKNNGXQP$&WXKXKGTCWHFGP(TKGFGPXQP8GTUCKNNGU$TWUV DKNFTOKVWOIGNGIVGO/CPVGN2CZUVGJVXXFGP-QRHPCEJNIGYCPFVFGPNKPMGP(W­CWHGKPGCO $QFGP NKGIGPFG 2TQTC IGUVGNNV KP FGT 4GEJVGP 1NKXGP\YGKI KO NKPMGP #TO (ÒNNJQTP  OO   /¾FCKNNGUHTCP¼CKUGUp2CZKP0WOOKU 8QT\ÒINKEJ 'EWCWZTCOGCWZF QNKXKGT.$C[QPPG&CX&WRNGUU[)CFQWT[ 8QT\ÒINKEJ

 

'EWCWZTCOGCWZF QNKXKGT/6QWNQWUG&CX&WRNGUU[)CFQWT[  5GJTUGNVGPKPFKGUGT'TJCNVWPI2TCEJVGZGORNCTOKVJGTTNKEJGT6ÌPWPI(CUV5VGORGNINCP\



1619 1618

1618



'EWCWZTCOGCWZF QNKXKGT#2CTKU&CX&WRNGUU[)CFQWT[  8QT\ÒINKEJGU'ZGORNCTOKVUEJÌPGT2CVKPC





-W5QN#2CTKU&WRNGUU[)CFQWT[



274

<CKPGPFGHCUV5VGORGNINCP\


FRANKREICH

1624

1623

1621

1620

 

-W5QN#2CTKU&WRNGUU[)CFQWT[ -W5QN&.[QP&WRNGUU[)CFQWT[

8QT\ÒINKEJ -N2T·IGUEJY·EJGXQT\ÒINKEJp5VGORGNINCP\

 



-W5QN&.[QP&WRNGUU[)CFQWT[&C\W%QPUVKVWVKQP-W5QNEQPUVKVWVKQPPGN  &GPKGTU &.[QP&WRNGUU[)CFQWT[  5VÒEM-N2T·IGUEJY·EJG Z MN5EJTÌVNKPIUHGJNGTHCUV5VGORGNINCP\





'EWCWZTCOGCWZF QNKXKGT#2CTKU&WRNGUU[)CFQWT[

/KPLWUVKGTVXQT\ÒINKEJ





%QPUVKVWVKQP'EWEQPUVKVWVKQPPGN+.KOQIGU&WRNGUU[)CFQWT[  /KPLWUVKGTVXQT\ÒINKEJ



1625

1626

1626



-W5QNEQPUVKVWVKQPPGN &GPKGTU &.[QP&WRNGUU[)CFQWT[  2TCEJVGZGORNCT(CUV5VGORGNINCP\





$TQP\GOGFCKNNGFGEQPHKCPEG\W5QNU#0+82T·IWPIFGT)GDTÒFGT/QPPGTQP2CTKU$TCWUG /CPUHGNF6H/C\CTF 8QT\ÒINKEJ



1627

1628



-W5QNU#2CTKU)CFQWT[/C\CTF



%QPXGPVKQP  5KNDGTOGFCKNNG  XQP , , ) 5VKGTNG CWH FGP 6QF FGT -ÌPKIKP /CTKG   #PVQKPGVVG $ÒUVG /CTKG #PVQKPGVVGU N OKV &KCFGO&KG 2GTUQPKHKMCVKQP (TCPMTGKEJU NGJPV VTCWGTPF CP   GKPGT 7TPG FKG CWH GKPGO 2QUVCOGPV UVGJV CO $QFGP NKGIV FGT \GTDTQEJGPG HTCP\ÌUKUEJG 5EJKNF OKV   -TQPGWPF5EJYGTVOOI5NI,WNKWU 8QT\ÒINKEJ

2TCEJVGZGORNCT-N(NGEMGP5VGORGNINCP\



 275


FRANKREICH

1630

1629

 

.KXTGU#0++#2CTKU&CX)CFQWT[/C\CTF .KXTGU#0++#2CTKU&CX)CFQWT[/C\CTF

1631

(CUVXQT\ÒINKEJ 5GJTUEJÌP

 

1633

1632

1632



&KTGEVQKTG-W&¾EKOG#0  #2CTKU)CFQWT[/C\CTF

 8QT\ÒINKEJ





(TCPEU#0  #2CTKU&CX)CFQWT[/C\CTF  5GNVGPKPFKGUGT'TJCNVWPI5GJTCVVTCMVKXGUXQT\ÒINKEJGU'ZGORNCT





%QPUWNCV-W%GPVKOGU#0  #2CTKU)CFQWT[C/C\CTF  8QT\ÒINKEJ



1634

1635





276

1635

#EJVGEMKIG 5KNDGTOGFCKNNG #0 8+++   XQP 4 &WOCTGUV CWH FKG $CPM XQP (TCPMTGKEJ /KPGTXC   WPF(QTVWPCUVGJGPGKPCPFGTIGIGPÒDGTWPFUEJÒVVGP/ÒP\GPCWUGKPGO(ÒNNJQTPKPGKPGP)GNFUEJTCPM 8KGT <GKNGP 5EJTKHV WOJGT 'KEJGP WPF .QTDGGT\YGKI /KV 4CPFRWP\G $KGPG  #4)'06  Z   ZZOOI5NI,WNKWU 8QT\ÒINKEJp5VGORGNINCP\



0CRQN¾QP +   5KNDGTOGFCKNNG  XQP $ #PFTKGW WPF , ,QWCPPKP CWH UGKPG 8GT   O·JNWPIOKV'T\JGT\QIKP/CTKG.QWKUG6QEJVGTFGU-CKUGTU(TCP\XQP¤UVGTTGKEJKP2CTKU-ÌRHGFGU $TCWVRCCTGU PGDGPGKPCPFGT T&CU $TCWVRCCT UVGJV PGDGP GKPGO DTGPPGPFGP #NVCT WPF TGKEJV UKEJ FKG   *·PFGOOI5NI,WNKWU (CUVXQT\ÒINKEJ




FRANKREICH

1636



 

1637

1638

5KNDGTOGFCKNNGXQP,,QWCPPKPCWHUGKPG8GTO·JNWPIOKV'T\JGT\QIKP/CTKG.QWKUG6QEJVGTFGU -CKUGTU (TCP\ XQP ¤UVGTTGKEJ KP2CTKU&CU$TCWVRCCTUVGJVPGDGPGKPGODTGPPGPFGP#NVCTWPFTGKEJV UKEJ FKG *·PFG.GGTGU (GNF HÒT )TCXWTGP WOJGT $NÒVGPMTCP\  OO  I 5NI ,WNKWU   

4ÒEMUGKVG  2TCEJVGZGORNCT5VGORGNINCP\ (TCPEU#2CTKU&CX)CFQWT[/C\CTF 8QT\ÒINKEJ

 

.QWKU:8+++5KNDGTOGFCKNNGXQP$#PFTKGWWPF0$TGPGVCWHUGKPG#PMWPHV KP (TCPMTGKEJ $ÒUVG T&KG 2GTUQPKHKMCVKQP (TCPMTGKEJU GKNV FGO GKPNCWHGPFGP 5EJKHH GPVIGIGP    OOI5NI,WNKWU<GKV\ FQTVKP$TQP\G  48QT\ÒINKEJ



1639

1640

1641



(TCPEU$4QWGP&CX)CFQWT[/C\CTF  2TCEJVGZGORNCTOKVHGKPGT6ÌPWPI5VGORGNINCP\



5KNDGTOGFCKNNG Q ,   XQP &KGWFQPP¾ CWH FKG 'KPPCJOG XQP %CFK\ FWTEJ UGKPGP 0GHHGP .QWKU   #PVQKPG FG $QWTDQP *GT\QI XQP #PIQWN¿OG 5QJP UGKPGU $TWFGTU FGU UR·VGTGP -ÌPKI %JCTNGU :   $ÒUVG FGU *GT\QIU N OKV .QTDGGTMTCP\&GT *GT\QI X X CWH GKPGO URTKPIGPFGP 2HGTF QDGP UEJYG   DGPFG8KMVQTKCOKV2CNO\YGKIFKGGKPGP-TCP\ÒDGTUGKP*CWRVJ·NVKO*KPVGTITWPFT5VCFVCPUKEJVN 5GIGNUEJKHHCWH5GGOOI5NI,WNKWUp9WT\DCEJ FQTVKP$TQP\G   4*GTTNKEJG2CVKPCXQT\ÒINKEJp5VGORGNINCP\ (TCPEU.$C[QPPG&CX)CFQWT[/C\CTF (CUVXQT\ÒINKEJ





  277


FRANKREICH

1643

1642

1644



*GPTK8*GT\QIXQP$QTFGCWZ2TGVGPFGPV

Ó (TCPEU/C\CTF  8QT\ÒINKEJp5VGORGNINCP\





%JCTNGU :  5KNDGTOGFCKNNG  XQP ( # %CWPQKU CWH UGKPG -ÌPKIUYGKJG FWTEJ FGP   'T\DKUEJQH XQP 4GKOU $TWUVDKNF N KP RTWPMXQNNGO 1TPCV WPF OKV WOIGNGIVGT -GVVG FGU *GKNKI)GKUV   1TFGPU&CTUVGNNWPIFGT<GTGOQPKGOOI/¾FCKNNGUHTCP¼CKUGUp  (GKPG2CVKPCXQT\ÒINKEJp5VGORGNINCP\



5KNDGTOGFCKNNGXQP#,&GRCWNKU9GTMUVCVVFG2W[OCWTKP2CTKUCWHFKG#PYGUGPJGKVFGU-Ì PKIUDGKFGT#DHCJTVFGT%QTXGVVG. #UVTQNCDG\WT'ZRGFKVKQPKPFKG5ÒFUGGWPVGTFGO-QOOCPFQFGU -CRKV·PU,WNGU&WOQPVF 7TXKNNG$ÒUVGFGU-ÌPKIUN<GJP<GKNGP5EJTKHVWOJGT5EJTKHVMTGKUOO I/¾FCKNNGUHTCP¼CKUGU5  2TCEJVGZGORNCTOKVHGKPGT6ÌPWPI8QT\ÒINKEJp5VGORGNINCP\





1645

1646

1646



.QWKU2JKNKRRG(TCPEU#2CTKU&CX)CFQWT[/C\CTF



$TQP\GOGFCKNNG  XQP#%CSW¾CWHFKG'TTKEJVWPIFGT4WJOGUU·WNGHÒTFKG8GTVGKFKIGTFGTXQP #TCDGTPDGNCIGTVGP(GUVWPI/C\CITCP #NIGTKGP CO(GDTWCT)GHNÒIGNVGT)GPKWUUVGJVXX CWH FGT 4WJOGUU·WNG KP FGT 4GEJVGP GKPGP KP FGT .KPMGP FTGK .QTDGGTMT·P\G <GKNGP 5EJTKHV OKV   FGP0COGPFGT8GTVGKFKIGTWPFKJTGP&KGPUVITCFGPOO 2TCEJVGZGORNCT5VGORGNINCP\

278

8QT\ÒINKEJ






FRANKREICH

1647

1648



(TCPEU9.KNNG&CX)CFQWT[/C\CTF  2TCEJVGZGORNCT(GKPG2CVKPCHCUV5VGORGNINCP\





0CRQN¾QP+++(TCPEU#2CTKU&CX)CFQWT[/C\CTF



1649





8QT\ÒINKEJ

1650

#EJVGEMKIG5KNDGTOGFCKNNGXQP*FG.QPIQWGKN2T·OKGFGT-TGFKVIGUGNNUEJCHVHÒT+PFWUVTKGWPF *CPFGN9GKDNKEJG)GUVCNVUVGJVXXOKVWOIGNGIVGO/CPVGNKPFGT4GEJVGP$WEJFKG.KPMGCWH2Q FGUV IGNGIV WOJGT #VVTKDWVG FGU *CPFGNU KO *KPVGTITWPF T (CDTKMIGD·WFG,CJTGUCPICDG WOJGT   .QTDGGTMTCP\/KV4CPFRWP\G (ÒNNJQTP #4)'06ZZZOOI  8QT\ÒINKEJ



5KNDGTOGFCKNNGXQP#$CTTG2T·OKGFGU/KPKUVGTKWOUHÒT.CPFYKTVUEJCHV*CPFGNWPF¤HHGPVNK EJG #TDGKV KP 2CTKU CWUIGIGDGP HÒT .CPFOCUEJKPGP FGT #WUUVGNNWPI KP $CTNG&WE -QRH T OKV .QT   DGGTMTCP\JTGPMTCP\ FGT OKV $NÒVGP WPF (TÒEJVGP DGUVGEMV KUV FCTKP 5EJTKHV WPF ,CJTGU\CJN /KV   4CPFRWP\G $KGPG #4)'06OOI2CIG&KXQ&KXQp 8QT\ÒINKEJp5VGORGNINCP\



1651 1654 1:1,3



1654 1:1,3

(TCPEU#2CTKU)CFQWT[/C\CTF  2TCEJVGZGORNCTOKVHGKPGT6ÌPWPIHCUV5VGORGNINCP\



.165 

4GRWDNKM  (TCPEU#2CTKU XQT\ÒINKEJ 4GRWDNKM(TCPEU #2CTKU&C\W$GNIKGP.GQRQNF++(TCPEU 5VÒEM5GJTUEJÌPpXQT\ÒINKEJ





&KXGTUGHTCP\ÌUKUEJG/ÒP\GPFGU,CJTJWPFGTVUWC0CRQNGQP+(TCPE#(TCPEU  DGKFG /ÒP\UV·VVG 7VTGEJV  &C\W GKPKIG /ÒP\GP CWU $GNIKGP WPF FGT 5EJYGK\ DGKURKGNUYGKUG   (TCPMGPUQYKGGKPCEJVGEMKIGTXGTUKNDGTVGT$TQP\GLGVQPXQP  5VÒEM5GJTUEJÌPp5VGORGNINCP\



56&6' 

#OKGPU5KNDGTOGFCKNNGXQP&GRCWNKU2T·OKGFGT5QEKGV¾FGU#PVKSWCKTGUFG2KECTFKGWPFFGU.[E¾G F #OKGPU HÒT *KUVQTKMGT XGTNKGJGP CP %JCTNGU %NCTQ $TWUVDKNF FGU *KUVQTKMGTU WPF (KPCP\FKTGMVQTU   %JCTNGU&WHTGUPGFW%CPIG #OKGPUÓ2CTKUT5EJTKHVWPF,CJTGU\CJNWOJGT-TCP\CWU .QTDGGTWPF'KEJGPDN·VVGTPOOI *ÒDUEJG2CVKPCXQT\ÒINKEJp5VGORGNINCP\

 279


FRANKREICH / LOTHRINGEN

1655



.[QP $TQP\GOGFCKNNG  WPUKIPKGTV 2T·OKG FGT #ECF¾OKG FGU 5EKGPEGU $GNNGU.GVVTGU GV #TVU FG   .[QPIGUVKHVGVXQP/KEJCGNFG$QTEJ9GKPTGDGY·EJUVCPGKPGO.QTDGGTDCWOGORQT5KGDGP<GKNGP 5EJTKHVKP'KEJGPMTCP\OO/QTKP2QPU 8QPCNNGTITÌ­VGT5GNVGPJGKV8QT\ÒINKEJ



1657

1656

(4#0-4'+%*'.5#55 564#55$74)$+567/ 

,QJCPP )GQTI XQP $TCPFGPDWTI  'KPUGKVKIG 6CNGTMNKRRG \W  -TGW\GTP  IGRT·IV   Y·JTGPFFGT$GNCIGTWPIFWTEJ*GT\QI-CTNXQP.QVJTKPIGP$TCWUG/CPUHGNF6H'PIGN.GJT #VVTCMVKXGU'ZGORNCTOKVJÒDUEJGT2CVKPCUGJTUEJÌP



#O  /CK  Y·JNVGP FKG RTQVGUVCPVKUEJGP &QOJGTTGP ,QJCPP )GQTI XQP $TCPFGPDWTI CNU0CEJHQNIGTHÒTFGP XGTUVQTDGPGP $KUEJQH ,QJCPPGU &KG CEJV MCVJQNKUEJGP &QOJGTTGP PCJOGP CP FKGUGT 9CJN PKEJV VGKN WPF GTY·JNVGP   CO  /CK KJTGTUGKVU FGP -CTFKPCN -CTN XQP .QVJTKPIGP &KG (GJFG FGT DGKFGP )NCWDGPUITWRRGP YWTFG FWTEJ   -·ORHG KO $KUVWO WPF FGT 5VCFV CWUIGVTCIGP DKU KO ,CJTG  ,QJCPP )GQTI XQP $TCPFGPDWTI FCU $KUVWO -CTN   XQP.QVJTKPIGPÒDGTNKG­   'KPGP )GIGPUVGORGN FGT 5VCFV 5VTC­DWTI CWH GKPGT UEJYGFKUEJGP /ÒP\G CWU FGT 5COONWPI FGT (TGK     JGTTGP$QPFGHKPFGP5KGKP-CVCNQIWPVGT0T   9GKVGTGGNU·UUKUEJG2T·IWPIGPUQYKGGKPGPUGNVGPGP8KGTVGNGEWCWU%J³VGCW4GPCWFCWUFGO5EJCV\HWPF  XQP*GTDQTPHKPFGP5KGWPVGTFGP0TP 

564#55$74)56#&6 

4GKEJUVCNGTQ, ,CJTJWPFGTV &CX'PIGN.GJT

#VVTCMVKXG2CVKPCUGJTUEJÌP

1658

*'4<1)67/



1659

(4#0-4'+%*.16*4+0)'0



%JCTNGU++)TQUQ,5KGTEM(NQP

*ÒDUEJG2CVKPCUGJTUEJÌPpXQT\ÒINKEJ





4GP¾+)TQUQ,5V/KEJGN(NQP

*ÒDUEJG2CVKPCXQT\ÒINKEJ



280


GRIECHENLAND

1661

1660

/'6<56#&6 

4GKEJUVCNGT&CX(NQP

5GJTUEJÌP



8QT\ÒINKEJ



(4#0-4'+%*-1.10+'0 (4#0<¤5+5%*+0&1%*+0# 

2KCUVGT&CX.GEQORVG

1662

1664

1663



2KCUVGT&CX.GEQORVG

(CUV5VGORGNINCP\





2KCUVGT&CX.GEQORVG

8QT\ÒINKEJp5VGORGNINCP\





2KCUVGT&CX.GEQORVG

8QT\ÒINKEJ





,QJCPPGU-CRQFKUVTKCU2T·UKFGPV-W.GRVCIKPC&KXQ  9KP\5EJTÌVNKPIUHGJNGTCO4CPFUGJTUEJÌP





-W.GRVCIKPC&KXQC



1666

1665

)4+'%*'0.#0&

4CPFHGJNGTUGJTUEJÌP

281


GRIECHENLAND

1668

1667



-W.GRVCIKPC&KXQ

5GNVGPKPFKGUGT'TJCNVWPI8QT\ÒINKEJ





-W.GRVCIKPC&KXQ

5GJTUEJÌP



5EJTÌVNKPIUHGJNGTUGJTUEJÌP



1669

1670



-W.GRVCIKPC&KXQ



1VVQ +  -W2TQDG KP FGT )TÌ­G GKPGU  &TCEJOGP5VÒEMU  XQP 6'TVGN/ÒPEJGP 'PVYWTH \WO DC[GTKUEJGP )GUEJKEJVUVCNGT &GPMOCN FGT  $C[GTP YGNEJG KO TWUUKUEJGP -TKGIG   FGP6QFHCPFGP 6JWP 2TQDGFGU6CNGTRT·IGYGTMUHÒTFKGMÌPKINKEJG/ÒP\GKP)TKGEJGPNCPFI &KXQ29KVV 4-N<CKPGPFGXQT\ÒINKEJ



1672

1671



-W.GRVC/ÒPEJGP&KXQC



-W.GRVC2TQDGXQP6'TVGN/ÒPEJGPI&KXQ2

2TCEJVGZGORNCT5VGORGNINCP\



44(CUVXQT\ÒINKEJ



1674

1673



 282

1,5:1

1673

$TQP\GOGFCKNNG  XQP - .CPIG CWH FKG )TWPFUVGKPNGIWPI FGT 7PKXGTUKV·V #VJGP FGP 5RGPFGTP   IGYKFOGV $TWUVDKNF 1VVQU N KP ITKGEJKUEJGT 6TCEJV#PUKEJV FGU 7PKXGTUKV·VUIGD·WFGU  OO   9KVV FQTVKTTVÒONKEJQ,  9KP\-TCV\GTXQT\ÒINKEJ &TCEJOG9KGP&KXQ

4(GKPG2CVKPCYKP\-TCV\GTXQT\ÒINKEJ

 


GRIECHENLAND

1,5:1



&TCEJOG9KGP&KXQC

1675

1,5:1

44(GKPG2CVKPCCVVTCMVKXGUUGJTUEJÌPGU'ZGORNCT



1676 1,5:1

1,5:1



)GQTI+&TCEJOGPQ, WO 2CTKU2TQDGOKV9CRRGPWPF9GTVCPICDGCWHDGK FGP5GKVGP+P752NCUVKMJQNFGTFGT0)%OKVFGT$GYGTVWPI/5&KXQ2  8QPITQ­GT5GNVGPJGKV/KPRQTÌUGT5EJTÌVNKPIXQT\ÒINKEJp5VGORGNINCP\

1,5:1



1677

1,5:1

.GRVC#2CTKU&KXQC  8QPITQ­GT5GNVGPJGKV0WT'ZGORNCTGIGRT·IV(GKPG2CVKPCXQT\ÒINKEJGU'ZGORNCT

1678

1681





1680



&TCEJOGP#2CTKU&CX&KXQC

 5GNVGPKPFKGUGT'TJCNVWPI8QT\ÒINKEJp5VGORGNINCP\



.16,QJCPPGU-CRQFKUVTKCU-W.GRVC1VVQ+-W.GRVC)GQTI+&TCEJOG 5VÒEM5GJTUEJÌPpXQT\ÒINKEJ

 

+10+5%*'+05'.0 

7PVGTDTKVKUEJGT8GTYCNVWPI-W1DQNK-/  9KP\4CPFHGJNGTHCUVXQT\ÒINKEJ





-W.GRVC-/



5GJTUEJÌPpXQT\ÒINKEJ

283


GROSSBRITANNIEN

1682

1684

)4155$4+6#00+'0

'0).#0& 

1683

#GVJGNTGF ++  2GPP[ WO  XGTOWVNKEJ .GKEGUVGT  I 5GEQPF JCPF V[RG /ÒP\   OGKUVGT )1&2+ )QFYKPG!  $TWUVDKNF T OKV <GRVGT FCTCP FTGK -WIGNP'KPG *CPF MQOOV CWU *KO   OGNUDQIGP\WFGP5GKVGP#NRJCWPF1OGIC0QTVJ5GCD[  &WPMNG2CVKPCFWTEJIGJGPFGT5EJTÌVNKPIUTK­UGJTUEJÌP



&KG 4GIKGTWPIU\GKV FGU GPINKUEJGP -ÌPKIU #GVJGNTGFU ++ YCT ÒDGTUEJCVVGV XQP UV·PFKIGP -TKGIGP OKV FGP 9KMKP   IGTP  YWTFG #GVJGNTGF ++ XQP GKPGT IGYCNVKIGP 9KMKPIGTHNQVVG WPVGT 1NCH 6T[IXCUUQP DGUKGIV 'T MCWHVG UKEJ   HTGKWPFFCUCWEJUR·VGTKP·JPNKEJGP5KVWCVKQPGPIGNGKUVGVG.ÌUGIGNFYWTFGCNU&CPGIGNFDG\GKEJPGV&CU&CPG IGNF GPVYKEMGNVG UKEJ KP FGT (QNIG \W GKPGT TGIWN·T XQP FGP CPINQPQTOCPPKUEJGP -ÌPKIGP GTJQDGPGP )TWPFUVGWGT   8GTOWVNKEJ YGIGP UGKPGT INÒEMNQUGP 4GIKGTWPI YWTFG #GVJGNTGF ++ CNU FGT 7PUEJNÒUUKIG VJG 7PTGCF[  DG   \GKEJPGV





2GPP[ WO  ;QTM  I .QPI ETQUU RGPP[ /ÒP\OGKUVGT 58/'4.+&# $TWUVDKNF N  .CPIGU&QRRGNHCFGPMTGW\OKV*CNDOQPFGPCPFGP'PFGP0QTVJ5GCD[  (GKPG6ÌPWPINGKEJVIGYGNNVUGJTUEJÌP



%PWV  2GPP[ WO  .QPFQP  I 3WCVTGHQKN V[RG /ÒP\OGKUVGT 28.(2+0'  

9WNHYKPG  )GMTÌPVGU $TWUVDKNF N KP 8KGTRC­&QRRGNHCFGPMTGW\ OKV *CNDOQPFGP CP FGP 'PFGP CWH   8KGTRC­0QTVJ5GCD[ -N4CPFCWUDTWEJNGKEJVIGYGNNVUGJTUEJÌP



%PWVFGT)TQ­GYCTFGTDGFGWVGPFUVG-ÌPKIFGT9KMKPIGT'TUGV\VGFGP-CORHUGKPGU8CVGTU-ÌPKI5XGP)CDGN DCTV WO 'PINCPF HQTV  YWTFG GT -ÌPKI XQP 'PINCPF  XQP &·PGOCTM WPF  CWEJ XQP 0QTYGIGP   &WTEJUGKP$ÒPFPKUOKV-CKUGT-QPTCF++IGIGP2QNGPGTJKGNVGTFCU.CPF\YKUEJGP5EJNGKWPF'KFGT%PWVUVCTDCO 0QXGODGTKP5JCHVGUDWT[KO#NVGTXQP,CJTGP

1685





1686

,QJP  2GPP[ WO  4JWFFNCP  I 5JQTV ETQUU V[RG )TQWR  /ÒP\OGKUVGT   5+/10& )GMTÌPVG $ÒUVG FGU -ÌPKIU X X OKV <GRVGT&QRRGNHCFGPMTGW\ KP FGP 9KPMGNP LG GKP   -TGW\CWU2WPMVGPIGDKNFGV0QTVJ5GCD[ 445GJTUEJÌP



*GPT[8++)TQCVQ,  ;QTM/ÒP\\GKEJGP8QIGN /CTVNGV 5GCD[ 5GJTUEJÌP



1687

 284

'FYCTF8+%TQYP5QWVJYCTM&CX5GCD[  4#VVTCMVKXGU'ZGORNCTOKVJGTTNKEJGT2CVKPCUGJTUEJÌP




GROSSBRITANNIEN

1688

1689



5JKNNKPI 2GPEG Q,  .QPFQP/ÒP\\GKEJGP(C­5GCD[  #VVTCMVKXGUUGJTUEJÌPGU'ZGORNCTOKVUEJÌPGT2CVKPC





'NK\CDGVJ+5JKNNKPIQ,  .QPFQP/ÒP\\GKEJGP8QIGN /CTVNGV 5GCD[ 5GJTUEJÌP



1691

1690

1690



%TQYPQ,  .QPFQP/ÒP\\GKEJGP&CX5GCD[  9KP\5EJTÌVNKPIUHGJNGTUGJTUEJÌP



8'4'+0+)6'5-¤0+)4'+%* 

%JCTNGU+2GPEGQ,  .QPFQP/ÒP\\GKEJGP#PMGT5GCD[  (GKPG6ÌPWPIOKPLWUVKGTVHCUVXQT\ÒINKEJ



1692



5KNDGTOGFCKNNGXQP,$NWOCWHFKG8GTO·JNWPIUGKPGT6QEJVGT/CTKCOKV9KNJGNO++XQP0CU UCW&KG\1TCPKGP 5VCVVJCNVGT FGT 0KGFGTNCPFG &CU $TCWVRCCT TGKEJV UKEJ FKG *·PFG QDGP 6CWDG KP   5VTCJNGP\WFGP5GKVGP\YGK2WVVGPKP9QNMGPFKG-T·P\GÒDGTFKG-ÌRHGFGU2CCTGUJCNVGPKO*KPVGT ITWPF 4GKVGT -WVUEJG 2CNCUV WPF $WTI CWH *ÒIGN9KNJGNO CNU CPVKMGT -TKGIGT UVGJV T \W UGKPGP   (Ò­GP $GNNQPC OKV FGT 4GEJVGP ÒDGTTGKEJV GT FGT CPVKM IGMNGKFGVGP /CTKC GKPGP 1NKXGP\YGKI FC\YK   UEJGPUVGJVFGT)GPKWUXQP*QNNCPFOKV2HGKNDÒPFGNWOJGT9CHHGPKO*KPVGTITWPF8KMVQTKCWPF#DWP FCPVKCOOI'KOGT,WPIMX.QQP++5  -N4CPFHGJNGTUGJTUEJÌPpXQT\ÒINKEJ

 285


GROSSBRITANNIEN

1693



5KNDGTPGQXCNG*QJNIW­OGFCKNNGQ,  WPUKIPKGTVCWHFKG'TMN·TWPIFGU2CTNCOGPVU &GENCTCVKQP QH2CTNKCOGPV 5EJKHHWPVGTXQNNGP5GIGNP5KV\WPIXQP1DGTWPF7PVGTJCWUOKVFGO-ÌPKIWPFGKPGO 5RTGEJGTZOOI*CYMKPU6H::8WPF5 7PKSWG!   8QPITQ­GT5GNVGPJGKV <GKVIGPÌUUKUEJGT)W­OKVQTKIKPCNGONQTDGGTMTCP\HÌTOKIGP<KGTTCPF*GTTNKEJG2CVKPCXQT\ÒINKEJ



#O  /CK  GTMN·TVG FCU GPINKUEJG 2CTNCOGPV UGKPG 5QWXGT·PKV·V IGIGPÒDGT-ÌPKI%JCTNGU+WPFHQTFGTVGKJP FC\W CWH FGP 4CV WPF FKG <WUVKOOWPI DGKFGT -COOGTP \W DGTÒEMUKEJVKIGP #WH GKPFTWEMUXQNNG 9GKUG YKTF CWH   FKGUGT GZVTGO UGNVGPGP /GFCKNNG FCU GPINKUEJG 1DGT WPF 7PVGTJCWU DGK UGKPGT #TDGKV WPVGT 'KPDG\KGJWPI -ÌPKI   %JCTNGU+FCTIGUVGNNV

1694



2QWPF\W5JKNNKPIU5JTGYUDWT[IGRT·IVY·JTGPFFGU$ÒTIGTMTKGIUI&GT IGMTÌPVGWPFIGJCTPKUEJVG-ÌPKIOKV5EJYGTVKPFGTGTJQDGPGP4GEJVGPTGKVGVNTKO(GNF/ÒP\\GK EJGP (GFGTDWUEJ<YGK <GKNGP 5EJTKHV FCTÒDGT FTGK (GFGTDÒUEJG WPF FKG 9GTV\CJN :: WPVGP ,CJTGU   \CJN&CXC5GCD[ 44/GJTGTG4CPFHGJNGTHCUVUGJTUEJÌP  &GT GPINKUEJG $ÒTIGTMTKGI YWTFG CWUIGVTCIGP \YKUEJGP FGP #PJ·PIGTP FGU -ÌPKIU %JCTNGU + WPF FGO 2CTNCOGPV   &GT WPWOUEJT·PMVG *GTTUEJCHVUCPURTWEJ FGU -ÌPKIU WPF UGKPG CWH 8GTUÌJPWPI OKV FGO 2CRUV CD\KGNGPFG MKTEJGP   RQNKVKUEJG *CNVWPI UVKG­ CWH \WPGJOGPFGP 9KFGTUVCPF KO 2CTNCOGPV FCU GT  MWT\GTJCPF CWHNÌUVG $KU    TGIKGTVG GT FCU .CPF QJPG 2CTNCOGPV WPF UVÒV\VG UKEJ PWT CWH YGPKIG $GTCVGT KPUDGUQPFGTG CWH .QTF 5VTCHHQTFWPF 'T\DKUEJQH.CWF0CEJFGTGT\YWPIGPGP9KGFGTGKPDGTWHWPIFGU2CTNCOGPVUMQPPVGFKGUG8GTUCOONWPIFGO-ÌPKI OCUUKXG <WIGUV·PFPKUUG CDTKPIGP WPF  FKG *KPTKEJVWPI 5VTCHHQTFU FWTEJUGV\GP #NU FCU 2CTNCOGPV OKV MPCRRGT   /GJTJGKV KP FGT FWTEJ FGP #WUDTWEJ FGU ITQ­GP KTKUEJGP #WHUVCPFGU CWHIGJGK\VGP RQNKVUEJGP #VOQURJ·TG CO    0QXGODGTOKVFGT)TQ­GP4GOQPUVTCP\GKPGPWOHCUUGPFGP$GUEJYGTFGMCVCNQIXQTIGNGIVJCVVGUVCPF-ÌPKI %JCTNGU XQT FGT9CJNGKPGP/CEJVXGTNWUVJKP\WPGJOGPQFGTUGKPGGKIGPGP<KGNGOKV)GYCNVFWTEJ\WUGV\GP0CEJ FGO FGT -ÌPKI CO  ,CPWCT  XGTIGDGPU XGTUWEJV JCVVG GKPKIG (ÒJTGT UGKPGT RCTNCOGPVCTKUEJGP )GIPGTUEJCHV   HGUV\WUGV\GP XGTNKG­ GT .QPFQP KP 4KEJVWPI 1ZHQTF WO UKEJ FQTV \WO -TKGI \W TÒUVGP &CU 2CTNCOGPV DKNFGVG GKP   GKIGPGU CPUGJPNKEJGU *GGT \W UGKPGO 5EJWV\ 0WP UVCPFGP UKEJ FKG UQIGPCPPVGP -CXCNKGTG CNU 2CTVGKI·PIGT FGU   -ÌPKIU WPF FKG UQIGPCPPVGP 4WPFMÌRHG CNU #PJ·PIGT FGU 2CTNCOGPVU IGIGPÒDGT &GT -QPHNKMV GPVYKEMGNVG UKEJ   \WO-TKGIFGTOKVGKPGOXGTIGDNKEJGP#PITKHHFGT4Q[CNKUVGPCWHFKG5VCFV*WNNDGICPPFKGFGO-ÌPKIFGP'KP \WI XGTYGKIGTV JCVVG  WPF  FQOKPKGTVGP PQEJ FKG YCHHGPMWPFKIGP -CXCNKGTG ÒDGT FKG 5VTGKVOCEJV FGU   2CTNCOGPVU &KG 9GPFG \WIWPUVGP FGU 2CTNCOGPVU MCO OKV FGO 'KPVTKVV 5EJQVVNCPFU KP FGP $ÒTIGTMTKGI UQYKG OKV   FGT #WHUVGNNWPI PGWGT 2CTNCOGPVUVTWRRGP CP FGT 1NKXGT %TQOYGNN OC­IGDNKEJ DGVGKNKIV YCT FGT HÒT FKG +PFGRGP   FGPVGP GKPGP TCFKMCNGP (NÒIGN KO 2CTNCOGPV UVCPF &GT 5KGI ÒDGT FKG 4Q[CNKUVGP DGK 0CUGD[ CO  ,WPK    DTCEJVG FKG 'PVUEJGKFWPI KO $ÒTIGTMTKGI HCUV ICP\ 'PINCPF YWTFG PWP XQP FGP 2CTNCOGPVUVTWRRGP DGUGV\V -ÌPKI   %JCTNGUHNQJ\WFGP5EJQVVGPFKGKJPCDGTIGIGP<CJNWPIXQP2HWPF5VGTNKPICPFCU2CTNCOGPVCWUNKG HGTVGP 8GTJCPFNWPIGP UEJKGPGP \WP·EJUV CWH GKPG 8GTUÌJPWPI DGKFGT 2CTVGKGP \W\WNCWHGP FQEJ PCEJ FGT 8GTFT·P   IWPI FGT IGO·­KIVGP 2TGUD[VGTKCPGT XGTJ·PIVG GKP XQO 2CTNCOGPV GKPIGUGV\VGU 6TKDWPCN FKG 6QFGUUVTCHG ÒDGT FGP   -ÌPKI&KG*KPTKEJVWPIFGU-ÌPKIUGTHQNIVGCO,CPWCT

286


GROSSBRITANNIEN

1696

1695





1695

5KNDGTOGFCKNNGQ,  OKV5KIPCVWT(XGTOWVNKEJXQP5&CFNGTCWHUGKPG*KPTKEJVWPI)GJCT PKUEJVGU $TWUVDKNF JCNDN5KGDGPMÌRHKIGU /QPUVGT UVGKIV PCEJ T ÒDGT FGP CDIGUEJNCIGPGP -QRH XQP   %JCTNGU + WPF ÒDGT -TÌPWPIUKPUKIPKGP JKPYGI  OO  I 'KOGT  /CW¾ p X .QQP ++   5NGKEJVXCT 45EJÌPG2CVKPCUGJTUEJÌPpXQT\ÒINKEJ



1NKXGT%TQOYGNN5JKNNKPI.QPFQP 6QYGTOKPV 5GCD[  /KVÒDNKEJGO5VGORGNHGJNGTUGJTCVVTCMVKXGUXQT\ÒINKEJGU'ZGORNCTOKVHGKPGT6ÌPWPI



1698

1697

1697



%JCTNGU++%TQYP.QPFQP/KV4CPFUEJTKHV&CX5GCD[  9KP\-TCV\GTCWHFGT8QTFGTUGKVGUGJTUEJÌPpXQT\ÒINKEJ





5JKNNKPI.QPFQP5GCD[



5GJTUEJÌP

1699



5KNDGTOGFCKNNG  WPUKIPKGTV XQP , 4QGVVKGTU CWH FCU *CPFGNUCDMQOOGP OKV FGP URCPKUEJGP 0KG   FGTNCPFGP$ÒUVGTOKV.QTDGGTMTCP\&KG5VCVWGXQP%JCTNGU++OKV-QOOCPFQUVCDCWH2QUVCOGPVOKV 5VWHGPKO*KPVGTITWPF/GGTOKV\CJNTGKEJGP5EJKHHGPKO#DUEJPKVVFKG,CJTGU\CJNOOI 'KOGTX.QQP++5 4-N4CPFHGJNGTXQT\ÒINKEJGU'ZGORNCTOKVHGKPGT6ÌPWPI  287


GROSSBRITANNIEN

1701

1700





1700

5KNDGTOGFCKNNGQ,  WPUKIPKGTVXQP,4QGVVKGTUCWHFGP(TKGFGPXQP$TGFC$ÒUVGTOKV.QT DGGTMTCP\$TKVCPPKC UKV\V PCEJ N OKV 5RGGT WPF 5EJKNF CWH (GNUGP WPF DGVTCEJVGV KJTG -TKGIUHNQVVG CWH   FGO /GGT /KV 4CPFUEJTKHV È q È %#41.85 » 5'%80&85 » 2#%+5 » '6 » +/2'4++ »   4'56+68614»#8)85685OOI'KOGT2CZKP0WOOKU  -TCV\GTUGJTUEJÌP



,COGU++%TQYP 4GIKGTWPIULCJT .QPFQP5GCD[  -QTTQUKQPCWHFGT8QTFGTUGKVG-TCV\GTCWHFGT4ÒEMUGKVGUGJTUEJÌP



1703

1702



1702

5KNDGTOGFCKNNGXQP4#TQPFGCWZCWHFKG.CPFWPI9KNJGNOU+++XQP0CUUCW1TCPKGPKP6QTDC[ 9KNJGNO+++UVGJVPCEJTOKVGTJQDGPGO5EJYGTVFKG5EJNCPIGFGT<YKGVTCEJVPKGFGTVTGVGPFWPFTGKEJV FGTXQTKJOUVGJGPFGP$TKVCPPKCFKG*CPFKO*KPVGTITWPFHNKGJV'FYCTF8CVGT2GVTGOKVFGOLWPIGP ,COGU CWH FGO #TO FGT GKPG 5RKGN\GWI9KPFOÒJNG KP FGT *CPF J·NV<CJNTGKEJG6TWRRGPNCPFGPOKV KJTGP$QQVGPKO*CHGPOOI'KOGTX.QQP+++5  45GJTUEJÌPpXQT\ÒINKEJ



&GT CWH FGT 8QTFGTUGKVG FGU XQTNKGIGPFGP WPF PCEJHQNIGPFGP 5VÒEMGU FCTIGUVGNNVG ,GUWKV 'FYCTF 8CVGT 2GVTG  

  YCT FGT $GKEJVXCVGT WPF GKP GPIGT 8GTVTCWVGT FGU -ÌPKIU ,COGU ++ FGT CWEJ CNU FGUUGP $GTCVGT HWP   IKGTVG&KG5RKGN\GWIYKPFOÒJNGKPFGT*CPFFGULWPIGP,COGUDG\KGJVUKEJCWHFGPCNNIGOGKPXGTDTGKVGVGP)NCWDGP FC­GTKP9CJTJGKVFGT5QJPGKPGU/ÒNNGTUYCT



288

5CVKTKUEJG$TQP\GOGFCKNNGWPUKIPKGTVXQP%JT9GTOWVJCWHFKG(NWEJVFGU2TKP\GP,COGUPCEJ (TCPMTGKEJ &GT ,GUWKV 'FYCTF 8CVGT 2GVTG OKV FGO LWPIGP 2TKP\GP ,COGU CWH FGO #TO FGT GKPG   5RKGN\GWI9KPFOÒJNG CWH FGO -QRH VT·IV HNKGJV CWH GKPGO .QDUVGT KO *KPVGTITWPF GKP HTCP\ÌUKUEJGU   5EJKHH9KPFOÒJNGPUEJKNF DGFGEMV XQP GKPGT ,GUWKVGPMCRRG WPF WOIGDGP XQP GKPGO 4QUGPMTCP\   WPVGPJ·PIVGKP.QDUVGTOO%QNN(KGYGIGTp'KOGT9QJNHCJTV  -N4CPFHGJNGTUGJTUEJÌPpXQT\ÒINKEJ




GROSSBRITANNIEN

1704



9KNNKCO+++WPF/CT[%TQYP 4GIKGTWPIULCJT .QPFQP5GCD[  5EJÌPG2CVKPCYKP\-TCV\GTUGJTUEJÌPpXQT\ÒINKEJ

1706



1705

1707

9KNNKCO+++WPF/CT[5KNDGTOGFCKNNGXQP2*/ÒNNGTIGHGTVKIVKO#WHVTCIXQP (-NGKPGTVCWHFKG5GGUEJNCEJVDGK.C*QIWG9KNNKCO+++OKV4WFGTKPFGT.KPMGPUVGJVJCNDNWPFYKTF XQP FGT JKPVGT KJO UEJYGDGPFGP 8KMVQTKC DGMT·P\V N FKG 2GTUQPKHKMCVKQP +TNCPFU OKV *CTHG T FKG   2GTUQPKHKMCVKQP FGT 0KGFGTNCPFG OKV (TGKJGKVUUVCD FCXQT .ÌYG OKV 2HGKNDÒPFGN&CTUVGNNWPI FGT 5GG   UEJNCEJV FCTÒDGT GKP 6GKN FGU 6KGTMTGKUGU /KV 4CPFUEJTKHV XQP ( -NGKPGTV c %10%#56+)#685   )#..148/(#5685'6#5685(.8%6+$85'628)0#(4#%685#461%'(4#)14 (-KP 8GT\KGTWPIGP cOOI'KOGTp(QTUVGTX.QQP+85  448QT\ÒINKEJGU'ZGORNCTOKVHGKPGT2CVKPC  'ZGORNCTFGT#WMVKQP(TKV\4WFQNH-ÒPMGT1UPCDTÒEM0T &KG4CPFUEJTKHVGPVJ·NVFKG,CJTGU\CJNCNU%JTQPQITCOO







5KNDGTOGFCKNNGWPUKIPKGTVXQP,4QGVVKGTUCWHFKG5GGUEJNCEJVDGK.C*QIWG$GKFGT$TWUVDKNFGT PGDGPGKPCPFGT T OKV WOIGNGIVGP /·PVGNP5EJKHHG CWH 5GG W C FKG DTGPPGPFG .G 5QNGKN 4Q[CN   FC\YKUEJGP 4CWEJYQNMGP KO *KPVGTITWPF N 5QPPG  OO  I 'KOGT  X .QQP +8   5XCT 442TCEJVGZGORNCT(CUV5VGORGNINCP\  'ZGORNCTFGT#WMVKQP(TKV\4WFQNH-ÒPMGT1UPCDTÒEM0T



5KNDGTOGFCKNNGXQP2*/ÒNNGTIGHGTVKIVKO#WHVTCIXQP(-NGKPGTVCWHFKG5GGUEJNCEJVDGK.C *QIWG .WFYKI :+8 XQP (TCPMTGKEJ OKV &TGK\CEM KP FGT .KPMGP YKTF XQP 0GRVWP CWU UGKPGO   /GGTYCIGP IGUEJNGWFGTV KO *KPVGTITWPF &CTUVGNNWPI FGT 5GGUEJNCEJV8KMVQTKC OKV 5KGIGUMTCP\ WPF   2CNO\YGKI KP FGP *·PFGP UVGJV KP GKPGO $QQV JKPVGT KJT UKV\GP \YGK )GPKGP FKG FKG WPVGT GKPGT   5EJKHHUMTQPGXGTGKPKIVGP9CRRGPXQP'PINCPFWPF*QNNCPFJCNVGPKO*KPVGTITWPFHNKGJGPFGHTCP\ÌUKUEJG 5EJKHHGDGKWPVGTIGJGPFGT5QPPG/KV4CPFUEJTKHVc%10%#56+)#685)#..148/(#5685'6 #5685(.8%6+$85'628)0#(4#%685#641%'(4#)14Û (- OOI'KOGT (QTUVGTX.QQP+85 44(CUVXQT\ÒINKEJGU'ZGORNCTOKVHGKPGT2CVKPC &KG4CPFUEJTKHVGPVJ·NVFKG,CJTGU\CJNCNU%JTQPQITCOO

 289


GROSSBRITANNIEN

1708



5KNDGTOGFCKNNG  XQP , $QUMCO CWH FKG 5GGUEJNCEJV DGK .C *QIWG )GJCTPKUEJVGU $TWUVDKNF   9KNNKCOU+++TOKVWOIGNGIVGO/CPVGN&CUGPINKUEJG'KPJQTPWPFFGTPKGFGTN·PFKUEJG.ÌYGLCIGPFGP HTCP\ÌUKUEJGP*CJPKO*KPVGTITWPF#PUKEJVFGT5GGUEJNCEJVOOI'KOGTp*CYMKPU6H .:::8+++X.QQP+85 445EJÌPG2CVKPCYKP\4CPFHGJNGTHCUVXQT\ÒINKEJXQT\ÒINKEJ



'ZGORNCTFGT#WMVKQP.CWTGPU5EJWNOCP*KNXGTUWO0T

1709



5KNDGTOGFCKNNG  XQP ) *CWVUEJ CWH FKG 5GGUEJNCEJV DGK .C *QIWG &KG $ÒUVG 9KNNKCOU +++ CWH   GKPGO2QUVCOGPV\WFGP5GKVGP\YGK)GPKGPOKV2CNO\YGKIGPWPFFGP5EJKNFGPXQP'PINCPFWPF*QN NCPF WOJGT 5·WNGPJCNNG OKV FGP XKGT 5VCVWGP FGT (NQVVGPMQOOCPFGWTG 4WUUGN #UJD[ &GNCXCN WPF   #NOQPFG FCTWPVGT FKG XKGT $ÒUVGP FGT 8GTNKGTGT5EJTKHVVCHGN \W FGP 5GKVGP 8KMVQTKC OKV 5KGIGUMTCP\   WPF(COCOKV2QUCWPGFCTÒDGTMNGKPGT'PIGNOKV<YGKIGPWPVGPXQTFGT6CHGNUKV\VFKGRGTUQPKHK\KGTVG <GKVWPFDGCWHUKEJVKIVFKGRGTUQPKHK\KGTVG)GUEJKEJVGFKGFKG6CHGNDGUEJTGKDVKO*KPVGTITWPFFCU/GGT OKVUKPMGPFGP5EJKHHGP/KV4CPFUEJTKHVr/#684#6'(8)#/4')+38'156'0&+6'8'5641 010+..++/2'4+8/2'.#)+ÛOOI'KOGTp*CYMKPU6H:%5NI'TNCPIGT ++X.QQP+85 448QT\ÒINKEJ



1711

1710



 290

1710

5KNDGTOGFCKNNGXQP)*CWVUEJCWHFKG5GGUEJNCEJVDGK.C*QIWG$TWUVDKNF9KNNKCOU+++TOKV WOIGNGIVGO /CPVGN5EJKHHG CWH 5GG W C FKG DTGPPGPFG .G 5QNGKN 4Q[CN FC\YKUEJGP 4CWEJYQN   MGP/KV4CPFUEJTKHVc5+%2*#'6*106“16#0&'//#4'58((+%+6+)0+ÛOOI 'KOGT5NI'TNCPIGT++X.QQP+85 445GJTUEJÌPXQT\ÒINKEJ



9KNNKCO+++5JKNNKPI$$TKUVQN5GCD[



/KPLWUVKGTVUGJTUEJÌP


GROSSBRITANNIEN

1712



#PPG5KNDGTOGFCKNNGXQP)*CWVUEJCWHFKG5KGIGDGK&QPCWYÌTVJ)KDTCNVCTWPF *ÌEJUV·VV $TWUVDKNF N$TKVCPPKC UKV\V X X CP 2CNOG IGNGJPV CP FGT 2CNOG FTGK /GFCKNNQPU OKV   5EJTKHV KO *KPVGTITWPF &CTUVGNNWPI FGT 5GGUEJNCEJV XQT )KDTCNVCT /KV 4CPFUEJTKHV r +0 1/0+   )'06' 38“ #8&+'4+6 01/'0688/ /#)0+(+%#$+684 582'4 6' &'85 +54#'. Û   +8&+6*Û:+++ÛOOI'KOGTX.QQP+85 5GJTUEJÌP



1714

1713



1713

5CVKTKUEJG5KNDGTOGFCKNNGXQP)*CWVUEJCWHFKGXGTUWEJVG+PXCUKQPKP5EJQVVNCPF$TWUVDKNFN 'PINKUEJG (NQVVG XGTHQNIV FKG HTCP\ÌUKUEJG (NQVVG XQT 5EJQVVNCPF /KV 4CPFUEJTKHV r 5+% 28'4+   0#58/4*+01%'416+5*#$'06ÛOOI%QNN(KGYGIGT'KOGT  42CVKPCUGJTUEJÌPpXQT\ÒINKEJ



5JKNNKPI.QPFQP5GCD[



&KG 4CPFUEJTKHV UCIV CWU FC­ LGFGT JKGT FKG (TCP\QUGP  DGKO #PDNKEM GKPGU 4JKPQ\GTQU FKG 'PIN·PFGT  FKG 0CUG   YGPFGVWPFXGTUEJYKPFGV



#VVTCMVKXGUXQT\ÒINKEJGU'ZGORNCTOKVHGKPGT6ÌPWPI

1715



5KNDGTOGFCKNNG  XQP , %TQMGT CWH FGP (TKGFGP XQP 7VTGEJV $TWUVDKNF N OKV .QTDGGTMTCP\ WPF   WOIGNGIVGO /CPVGN$TKVCPPKC UKV\V PCEJ N OKV 1NKXGP\YGKI 5RGGT WPF 5EJKNF \W FGP 5GKVGP 5EJKHHG   CWH/GGTWPF$CWGTPFKGGKP(GNFDGUVGNNGPOOI'KOGT2CZKP0WOOKUX .QQP+85 4-TCV\GTWPFUVCTMG4CPFHGJNGTUGJTUEJÌP

 291


GROSSBRITANNIEN

1716



)GQTIG +  5KNDGTOGFCKNNG  WPUKIPKGTV CWH FKG GTHQNITGKEJG 5GGUEJNCEJV IGIGP FKG   5RCPKGT DGK 5[TCMWU &KG $TWUVDKNFGT (GNKRGU ++   WPF (GNKRGU 8   XQP 5RCPKGP GKPCPFGT   IGIGPÒDGTKO#DUEJPKVVFTGK<GKNGP5EJTKHV&CTUVGNNWPIFGT5GGUEJNCEJVKO#DUEJPKVV5EJTKHVWPFFKG ,CJTGU\CJNGPWPFOOI%QNN(KGYGIGTp'KOGTp  44(CUVXQT\ÒINKEJGU'ZGORNCTOKVHGKPGT2CVKPC 'ZGORNCTFGT#WMVKQP(TKV\4WFQNH-ÒPMGT1UPCDTÒEM0T





&GT5GGUEJNCEJVDGK5[TCMWUYCTCO#WIWUVFKGUQIGPCPPVG3WCFTWRGNCNNKCP\XQTCWUIGICPIGP&KGUGUIGIGP FKG 5RCPKGT IGTKEJVGVG $ÒPFPKU DGUVCPF \YKUEJGP )TQ­DTKVCPPKGP -CKUGT -CTN 8+ WPF  (TCPMTGKEJ &KG PÌTFNKEJGP   0KGFGTNCPFG UQNNVGP FCU XKGTVG /KVINKGF YGTFGP VTCVGP CDGT PKG GKP &KG ,CJTGU\CJN  KO #DUEJPKVV FGT   4ÒEMUGKVGP&CTUVGNNWPIDG\KGJVUKEJCWHFKGIGRNCPVG+PXCUKQPFGT5RCPKGTKP'PINCPFFKGCDGTHGJNUEJNWI'KP XGTNWUVTGKEJGT -CORH IGIGP FKG GPINKUEJG (NQVVG HÒJTVG \WO 7PVGTICPI FGT URCPKUEJGP #TOCFC &KG 2CTCNNGNGP   \YKUEJGP FGP DGKFGP 'TGKIPKUUGP  WPF  YGTFGP CWEJ FWTEJ FKG 8QTFGTUGKVGPFCTUVGNNWPI FGWVNKEJ &KG   URCPKUEJGP4GIGPVGPKPFKGUGP,CJTGPVTCIGPPKEJVPWTFGPUGNDGP0COGPCWEJFKG'TGKIPKUUGUKPFINGKEJ 

1717







292

1718

1719

$TQP\GOGFCKNNG  WPUKIPKGTV XQP 1 *COGTCPK CWH FKG #RRGNNCVKQP FGU 6JTQPRT·VGPFGPVGP ,COGU   5VWCTV IGIGP FCU *CWU *CPPQXGT )GJCTPKUEJVGU $TWUVDKNF ,COGU 5VWCTVU T OKV WOIGNGIVGO /CPVGN  &CU JCPPQXGTUEJG 4Q­ VTCORGNV GKPGP .ÌYGP WPF GKP 'KPJQTP FKG DTKVKUEJGP 9CRRGPVKGTG  PKGFGT N   UKV\V$TKVCPPKCPCEJTCPGKPGOXGTFQTTVGP$CWOKO*KPVGTITWPF5VCFVCPUKEJVXQP.QPFQPOO 'KOGT*CYMKPU6H%:.8 8QT\ÒINKEJ



5KNDGTOGFCKNNGXQP,&CUUKGTCWHFGPRTQVGUVCPVKUEJGP4GHQTOGT9KNNKCO9CMG'T\DKUEJQHXQP %CPVGTDWT[  Ó $TWUVDKNF FGU 'T\DKUEJQHU T KP IGKUVNKEJGO 1TPCV <GKNGP 5EJTKHV   OOI'KOGT 8QT\ÒINKEJ



)GQTIG ++  5KNDGTPG 8GTFKGPUVOGFCKNNG Q , XQP 9 , 6C[NQT XGTNKGJGP CP /T #TVJWT   %WTVKUHÒT8GTFKGPUVGKPFGT1CM$GPGHKV5QEKGV[ IGITÒPFGV 9GKDNKEJG)GUVCNVUVGJVPCEJNCP GKPGT-ÒUVGFKG4GEJVGGTJQDGPFKG.KPMGCWHGKPGP#PMGTIGNGJPVFCXQT5EJKHHCWHJQJGT5GG5GEJU <GKNGP5EJTKHVFC\YKUEJGP)TCXWTWOJGT'KEJGPMTCP\OOI'KOGTp  (GKPG6ÌPWPIYKP\4CPFHGJNGTXQT\ÒINKEJ




GROSSBRITANNIEN

1720







1722

1721

5CVKTKUEJG $TQP\GOGFCKNNG  WPUKIPKGTV XQP % 2KPEJDGEM CWH FGP #FOKTCN 6JQOCU /CVJGY  

 Ó WPF FGP 8K\GCFOKTCN 4KEJCTF .GUVQEM  Ó WPF KJTG 0KGFGTNCIG OKV FGT   GPINKUEJGP(NQVVGKO-CORHIGIGPFKGHTCP\ÌUKUEJURCPKUEJG(NQVVGKPFGT5EJNCEJVDGK6QWNQP#PGKPGO )CNIGP J·PIV GKP /CPP WOJGT FKG $WEJUVCDGP %  &  $ KO *KPVGTITWPF 5EJKHHG CWH 5GG#PMQO   OGPFG5EJKHHGKO*CHGPXQP6QWNQPFCTÒDGTFKG$WEJUVCDGP()'KO8QTFGTITWPF5QNFCVGPWPF FGT DTKVKUEJG .ÌYG FGT FGP ICNNKUEJGP *CJP PKGFGTFTÒEMV WOJGT FKG $WEJUVCDGP +  *  OO   %QNN(KGYGIGT'KOGT (CUVXQT\ÒINKEJ



5KNDGTOGFCKNNG  XQP . %JT -QEJ CWH FKG )TÒPFWPI FGT $TKVKUJ (KUJGT[ 5QEKGV[ WPVGT FGT   2T·UKFGPVUEJCHVUGKPGU5QJPGU(TKGFTKEJ.WFYKI2TKP\XQP9CNGU)GJCTPKUEJVGU$TWUVDKNFFGU2TKP\GP TOKVWOIGNGIVGO/CPVGN<YGK(KUEJGTDQQVGCWH5GGCO7HGT\YGK/·PPGTOKV6QPPGPWPF(KUEJGT PGV\KO#DUEJPKVVFTGK<GKNGP5EJTKHVOOI$TQEMOCPP'KOGT  5EJÌPG2CVKPCUGJTUEJÌPpXQT\ÒINKEJ



)GQTIG+++$TQP\GOGFCKNNG IGUVKHVGVXQPFGT4Q[CN5QEKGV[ XQP.2KPIQ\WT 'TKPPGTWPICPFGPDTKVKUEJGP5GGHCJTGTWPF'PVFGEMGT,COGU%QQM 1MVQDGTÓ(GDTWCT 7PKHQTOKGTVGU$TWUVDKNF%QQMUN(QTVWPCUVGJVXXFGP-QRHPCEJNIGYCPFVOKV4WFGTCWH )NQDWUWPF5RGGTCP5EJKHHUU·WNGIGNGJPVT9CRRGPUEJKNFOO'KOGT 8QT\ÒINKEJ



ex 1723



5KNDGTOGFCKNNG  WPUKIPKGTV CWH FGP 7PVGTICPI FGU .KPKGPUEJKHHGU 4Q[CN )GQTIG KP 5RKVJGCF   WPVGT8K\GCFOKTCN4KEJCTF-GORGPHGNV 9GUVOKPUVGTÓ5RKVJGCF&KG4Q[CN)GQTIGCWH JQJGT5GG5EJKHHGKO*CHGPXQP)KDTCNVCTWPFOOWPFI'KOGT Z  8GTXX.QQP Z 9WT\DCEJ Z  5VÒEMKP5KNDGTWPF$TQP\G8QT\ÒINKEJ



&CU DTKVKUEJG .KPKGPUEJKHH */5 4Q[CN )GQTIG  -CPQPGP  UKPMV RNÌV\NKEJ Y·JTGPF GU KO 5RKVJGCF XQT #PMGT   NKGIV 7PIGH·JT  /GPUEJGP GTVTKPMGP FCTWPVGT 8K\GCFOKTCN 4KEJCTF -GORGPHGNV GKPGT FGT H·JKIUVGP DTKVKUEJGP   /CTKPGQHHK\KGTG UGKPGT <GKV UQYKG GVYC  (TCWGP WPF  -KPFGT DGK FGPGP GU UKEJ OGKUV WO #PIGJÌTKIG XQP   $GUCV\WPIUOKVINKGFGTP JCPFGNV &CU 5EJKHH YCT HÒT MNGKPGTG 4GRCTCVWTGP IGMT·PIV WPF INGKEJ\GKVKI OKV 4WOH·UUGTP   DGNCFGP YQTFGP 'KPG 7PVGTUWEJWPI UVGNNVG HGUV FC­ HÒT FCU 7PINÒEM YCJTUEJGKPNKEJ FGT XGTTQVVGVG <WUVCPF FGT   5EJKHHUJÌN\GT XGTCPVYQTVNKEJ YCT WPF FGUJCND GKP 6GKN FGU 7PVGTYCUUGTUEJKHHU JGTCWUDTCEJ &GT 7PVGTICPI KUV DKU   JGWVGFCUUEJYGTUVG5EJKHHUWPINÒEMKP(TKGFGPU\GKVGPKPFGT)GUEJKEJVGFGT4Q[CN0CX[

293


GROSSBRITANNIEN

1724



$TQP\GOGFCKNNGXQP%*-Ã&#x2019;EJNGTCWHFGP5KGIFGTGPINKUEJGP(NQVVGWPVGT(NQVVGPCFOKTCN4K EJCTF *QYG Ã&#x2019;DGT FKG (TCP\QUGP 7PKHQTOKGTVGU $TWUVDKNF *QYGU T#PUKEJV FGT 5EJNCEJV KO #D   UEJPKVVFTGK<GKNGP5EJTKHVOOI'KOGT5NI,WNKWU 8QT\Ã&#x2019;INKEJ

1725

1727



1726



%TQYP.QPFQP&CX5GCD[

*Ã&#x2019;DUEJG2CVKPCXQT\Ã&#x2019;INKEJ



)GQTIG+8%TQYP 4GIKGTWPIULCJT .QPFQP/KV4CPFUEJTKHV&CX5GCD[ *GTTNKEJG2CVKPCMN4CPFHGJNGTXQT\Ã&#x2019;INKEJ





-W2GPP[.QPFQP5GCD[



2TCEJVGZGORNCT(CUV5VGORGNINCP\



1728



294

$TQP\GOGFCKNNGXQP(*GPPKPICWHFGP#FOKTCN9KNNKCO*GPT[*GT\QIXQP%NCTGPEG$Ã&#x2019;UVGT $TKVCPPKC OKV &TGK\CEM 5EJKNF WPF 1NKXGP\YGKI UEJTGKVGV PCEJ T Ã&#x2019;DGT /GGT KO *KPVGTITWPF \YGK   5EJKHHGOO'KOGT 8QT\Ã&#x2019;INKEJ




GROSSBRITANNIEN

1729

1730

1730



9KNNKCO+8-W2GPP[.QPFQP5GCD[  9KP\-TCV\GTXQT\Ã&#x2019;INKEJp5VGORGNINCP\ 'Z2TQQH



8KEVQTKC  5KNDGTOGFCKNNG  XQP $ 9[QP 2T·OKG FGT 4Q[CN 5EQVVKUJ #ECFGO[ QH   2CKPVKPI 5EWNRVWTG CPF #TEJKVGEVWTG /KV )TCXWT KO 4CPF )'14)' 4'+&  '.'%6'&    #%#&'/+%+#0/&%%%.::8++)GPKWUFGT-WPUVMPKGVNWPFUVÃ&#x2019;V\VGKPG2NCVVHQTOCWHFGTUKEJGKP 2GICUWUWPFFKGGYKIG(NCOOGDGHKPFGP.QTDGGT\YGKIGCWH&TGKHW­WOJGT.QTDGGTMTCP\OO I'KOGT 8QPITQ­GT5GNVGPJGKV9KP\-TCV\GTXQT\Ã&#x2019;INKEJ 



)GQTIG4GKFYWTFGKP#DGTFGGPIGDQTGPWPFGPVYKEMGNVGUEJQPHTÃ&#x2019;JGKPGT.GKFGPUEJCHVHÃ&#x2019;TFKG-WPUV5GKV CTDGKVGVG GT HÃ&#x2019;T UKGDGP ,CJTG HÃ&#x2019;T FKG .KVJQITCHGP -GKVJ WPF)KDDKP#DGTFGGPNGTPVGGTDGKFGO2QTVT·VOCNGT 9KNNKCO 0KFFTKG IKPI CDGT DCNF PCEJ 'FKPDWTIJ WO UKEJ FQTV YGKVGT\WDKNFGP 0CEJ #DGTFGGP \WTÃ&#x2019;EMIGMGJTV   CTDGKVGVG GT CNU #WHVTCIUOCNGT  FQTV GPVUVCPF CWEJ FCU 2QTVT·V XQP )GQTIG /CEFQPCN YGNEJGU CNU GTUVGU   UGKPGT 9GTMG #WHOGTMUCOMGKV GTTGIVG #D  NGTPVG 4GKF DGK FKXGTUGP -Ã&#x2019;PUVNGTP CWH FGO (GUVNCPF W C DGK #   /QNNKPIGTKP7VTGEJV;XQPKP2CTKUWPF,QUGH+UTCGNUKP&GP*CCIYWTFG)GQTIG4GKF\WO8QNNOKVINKGFFGT 4Q[CN5EQVVKUJ#ECFGO[QH2CKPVKPI5EWNRVWTGCPF#TEJKVGEVWTGGTPCPPVYWTFGGT2T·UKFGPVFGT#MCFGOKG

1731

1732

1732



%TQYP 4GIKGTWPIULCJT .QPFQP)QVKUEJGT6[R/KV4CPFUEJTKHV&CX5GCD[  *GTTNKEJG2CVKPCXQT\Ã&#x2019;INKEJp5VGORGNINCP\CWURQNKGTVGT2NCVVG



5KNDGTPG2TGKUOGFCKNNG9GTMUVCVV4GKF5QPU0GYECUVNG7RQP6[PGCWHFKG0QTVJ'CUV%QCUV #WUUVGNNWPI KP 6[PGOQWVJ XGTNKGJGP HÃ&#x2019;T .GKUVWPIGP KO /CTKPGYGUGP 0GRVWP OKV &TGK\CEM WPF   .QTDGGTMTCP\UVGJVPCEJNCWHGKPGT/WUEJGNFKGXQP\YGK2HGTFGPFWTEJFCU/GGTIG\QIGPYKTFKO *KPVGTITWPF 5EJKHH XQT FGT -Ã&#x2019;UVG XQP 6[PGOQWVJ OKV .GWEJVVWTO#EJV <GKNGP 5EJTKHV WOJGT -TCP\    OOI (GKPG2CVKPCXQT\Ã&#x2019;INKEJ



 295


GROSSBRITANNIEN

1733



5KNDGTOGFCKNNGWPUKIPKGTVCWHFKG,CJTHGKGTFGT'TQDGTWPIXQP6TKPKFCF7PKHQTOKGTVGU$TWUV DKNFXQP5KT4CNRJ#DGTETQOD[HCUVXX#PUKEJVFGU*CHGPUXQP2QTVQH5RCKPOOI 'KOGT *Ã&#x2019;DUEJG2CVKPCYKP\4CPFHGJNGTXQT\Ã&#x2019;INKEJ

1734



1735



'FYCTF8++%TQYP.QPFQP&CX5GCD[

8QT\Ã&#x2019;INKEJ





%TQYP.QPFQP&CX5GCD[

8QT\Ã&#x2019;INKEJ





/CWPF[5GVDGUVGJGPFCWU2GPEGUQYKG2GPP[5GCD[  5VÃ&#x2019;EM+P1TKIKPCNGVWK5VGORGNINCP\



1737

1738



)GQTIG8%TQYP&CX5GCD[  #VVTCMVKXGU'ZGORNCTXQPRQNKGTVGP5VGORGNPXQT\Ã&#x2019;INKEJp5VGORGNINCP\





%TQYP&CX5GCD[



1739



8QT\Ã&#x2019;INKEJGU'ZGORNCTXQPRQNKGTVGP5VGORGNP

1740

%TQYP/KVGTJCDGPGT4CPFUEJTKHV&CX5GCD[  40WT'ZGORNCTGIGRT·IV8QT\Ã&#x2019;INKEJp5VGORGNINCP\CWURQNKGTVGT2NCVVG



+4.#0&  296

)GQTIG+++5JKNNKPIU6QMGP $CPM&QNNCT 5QJQ $KTOKPIJCO &CX5GCD[ 8QT\Ã&#x2019;INKEJ




GROSSBRITANNIEN

1742

1743

1741

1741

   

1744

+5.'1(/#0

)GQTIG+++-W2GPP[.QPFQP5GCD[



8QT\ÒINKEJ 8QT\ÒINKEJ 48QT\ÒINKEJ

  

(GKPG2CVKPCXQT\ÒINKEJ 8QT\ÒINKEJp5VGORGNINCP\

 

$4+6+5%*'-1.10+'0

$TKVKUJ9GUV+PFKGU6TCFG&QNNCT$$QODC[-/6 6TCFG&QNNCT%%CNEWVVC-/6 6TCFG&QNNCT$$QODC[-/6

1745

 

5GJTUEJÌP

1746

6TCFG&QNNCT.QPFQP-/6 6TCFG&QNNCT$$QODC[-/6

1748

1747

1749

1747



$TKVKUJ9GUV#HTKEC)QNF%QCUV#EMG[$KTOKPIJCO-/  2TCEJVXQNNG2CVKPCXQT\ÒINKEJp5VGORGNINCP\



 

5VTCKVU5GVVNGOGPVU /CNC[UKC -W%GPV*$KTOKPIJCO *GCVQPOKPV -/8QT\ÒINKEJ %GPVU-/ 8QT\ÒINKEJ

 



.16-NGKPG/GFCKNNGPUCOONWPI5KNDGTIW­OGFCKNNG .CPFWPIXQP9KNNKCO+++KP6QTDC[ 5KNDGTIW­ OGFCKNNG -TÌPWPIXQP9KNNKCO+++WPF/CT[ 5KNDGTOGFCKNNG (TKGFGPXQP7VTGEJV (TCP\Ì UKUEJG$TQP\GOGFCKNNG (TKGFGPXQP7VTGEJV $TQP\GOGFCKNNG 'TÌHHPWPIFGT.QPFQP$TKFIG  $TQP\GOGFCKNNG +PVGTPCVKQPCNG*CPFGNUCWUUVGNNWPIKP.KXGTRQQN  5VÒEM5GJTUEJÌPpXQT\ÒINKEJ

 297


ITALIEN

ex 1751

+5.#0& 

.16 5KNDGTOGFCKNNG  CWH FCU L·JTKIG $GUVGJGP FGU #NVKPI KUN·PFKUEJGU 2CTNCOGPV     OOI&C\W'KPGYGKVGTG5KNDGTOGFCKNNGCWHFGPUGNDGP#PNC­OOIUQYKG GKPG$TQP\GOGFCKNNGCWHFGPUGNDGP#PNC­OO-//// 5VÒEM8QT\ÒINKEJ

1752



1753

1754

+6#.+'0

$1.1)0# 

2TQXKUQTKUEJG4GIKGTWPI5EWFQ 2CQNK &CX8CTGUK  -N5EJTÌVNKPIUHGJNGTXQT\ÒINKEJ





5EWFQ 2CQNK &CX8CTGUK

5EJTÌVNKPIUHGJNGTUGJTUEJÌP



44&QRRGNUEJNCIUGJTUEJÌP





%#5#.'/106('44#6

$QPKHCEKWU++%QTPWVQQ,8CTGUK

1755



%+5#.2+0'4'27$.+-

5QNFK#001+:/CKNCPF2CICPK

1756

2TCEJVGZGORNCT(CUV5VGORGNINCP\



(.14'0<  298

4GRWDNKM)TQUUQIWGNHQQ, *CNDLCJT /ÒP\OGKUVGT$GTVQNFQFK$CTVQNQOGQWPF $GTVQNFQFK(KNKRRQ%QTUKPK$GTPQEEJK 5EJTÌVNKPIUHGJNGTUGJTUEJÌP




ITALIEN

1757

5#//.70)-+4%*'056##6 

#PCUVCUKWU++5KNDGTPG5WKVGPOGFCKNNGQ, ,CJTJWPFGTV XQP2*/ÒNNGT$TWUVDKNFT KPIGKUVNKEJGO1TPCV<GKNGP5EJTKHVOOI(QTUVGT5RKPMp  +P5KNDGTXQPITQ­GT5GNVGPJGKV*GTTNKEJG2CVKPCHCUV5VGORGNINCP\

1758



1759

1760

7TDCP8$QNQIPKPQTQOCPQQ,4QO/WPVQPK



1761

-N5EJTÌVNKPIUHGJNGTUGJTUEJÌP



(CUVXQT\ÒINKEJ



5GJTUEJÌP



5GJTUEJÌPpXQT\ÒINKEJ



'ZGORNCTFGT5COONWPI#PFT¾,#WMVKQP$QWTIG[2CTKU0T



)TGIQT:+)TQUUQQ,#XKIPQP/WPVQPK 'ZGORNCTFGT5COONWPIFGU-CTFKPCNU&WDQKU/CKUQP2NCVV.CIGTNKUVG0T



$QPKHCEKWU+:)TQUUQQ,4QO/WPVQPKNGKEJVXCT



)TGIQT:++)TQUUQQ,4QO/WPVQPKNGKEJVXCT 'ZGORNCTFGT#WMVKQP%T¾FKVFGNC$QWTUG2CTKU0T

1762



1763

1764

1765

/CTVKP8%CTNKPQQ,#XKIPQP/WPVQPK

5GJTUEJÌP



'ZGORNCTFGT#WMVKQP0#%<ÒTKEJ0T



'WIGP+8)TQUUQQ,4QO/WPVQPKNGKEJVXCT

5GJTUEJÌP





0KEQNCWU8)TQUUQ#001+7$+.'+  4QOCWHFCU*GKNKIG,CJT/WPVQPK  (CUVXQT\ÒINKEJ





)TQUUQ#001+7$+.'+  4QOCWHFCU*GKNKIG,CJT/WPVQPK



.GKEJVIGYGNNVUGJTUEJÌP

'ZGORNCTFGT5COONWPIFGU-CTFKPCNU&WDQKU/CKUQP2NCVV.CIGTNKUVG0T

299


ITALIEN

1767

1766



%CNKZV+++)TQUUQQ,4QO/WPVQPKXCT

5GJTUEJÌPpXQT\ÒINKEJ





2KWU++)TQUUQQ,4QO/WPVQPKXCT

5GJTUEJÌPpXQT\ÒINKEJ



1768

1770

1769



2CWN++)TQUUQQ,#PEQPC/WPVQPKNGKEJVXCT



5KZVWU+8)TQUUQQ,4QOI/WPVQPK



)TQUUQQ,4QO/WPVQPK



1771

5GJTUEJÌP



*ÒDUEJG2CVKPCUGJTUEJÌP



8QT\ÒINKEJGU'ZGORNCTOKVHGKPGT6ÌPWPI



+PPQEGP\8+++)TQUUQQ,/CEGTCVC/WPVQPK8CT+  #VVTCMVKXGUUGJTUEJÌPGU'ZGORNCT



1772

1773



#NGZCPFGT8+)TQUUQQ,4QO/WPVQPK



)TQUUQQ,4QO/WPVQPK

1774

1775

5GJTUEJÌP



-PCRRGT5EJTÌVNKPIUGJTUEJÌP





,WNKWU++)KWNKQQ,4QO#WHFGT4ÒEMUGKVG/ÒP\\GKEJGPFGT(WIIGT/WPVQPK  8QT\ÒINKEJGU'ZGORNCTOKVHGKPGT6ÌPWPI





*CFTKCP8+)KWNKQQ,4QO/WPVQPK  44-PCRRGT5EJTÌVNKPICVVTCMVKXGUUGJTUEJÌPGU'ZGORNCT



300


ITALIEN

1777

1776



%NGOGPU8++)KWNKQQ,4QO/WPVQPK

#VVTCMVKXGUUGJTUEJÌPGU'ZGORNCT



45GJTUEJÌP



'ZGORNCTFGT#WMVKQP0#%<ÒTKEJ0T



)KWNKQQ,4QO/WPVQPKNGKEJVXCT

1778



1779

1780

2CWN+++$KCPEQQ,$QNQIPC/WPVQPK8CT+

1781

)WVGU2QTVT·V(CUVXQT\ÒINKEJ



45GJTUEJÌPpXQT\ÒINKEJ



5GJTUEJÌP



7PTGIGNO·­KIGT5EJTÌVNKPIHCUVXQT\ÒINKEJ



'ZGORNCTFGT#WMVKQP0#%<ÒTKEJ0T



)TQUUQQ,/CEGTCVC/WPVQPK



)KWNKQ#:+++  /CEGTCVC/WPVQPK



,WNKWU+++)KWNKQQ,#PEQPC/WPVQPK

1782

1783



)KWNKQ#++  4QO/WPVQPK



/CTEGNNWU++)KWNKQQ,4QO/WPVQPKNGKEJVXCT

1784

1785

5GJTUEJÌP



4(CUVXQT\ÒINKEJ





2CWN+86GUVQPGQ,4QO/WPVQPK  #VVTCMVKXGUHCUVXQT\ÒINKEJGU'ZGORNCTOKVHGKPGT6ÌPWPI





)KWNKQQ,4QO/WPVQPK



8QT\ÒINKEJGU'ZGORNCT

301


ITALIEN

1787

1786

 

1788

)KWNKQQ,4QO/WPVQPK 2KWU+86GUVQPGQ,#PEQPC/WPVQPK

1789

8QT\ÒINKEJGU2TCEJVGZGORNCT



#VVTCMVKXGUUGJTUEJÌPGU'ZGORNCT



'ZGORNCTFGT5COONWPIFGU'T\DKUEJQHUXQP.[QP#WMVKQP%TGWU[.[QP0T



6GUVQPGQ,#PEQPC/WPVQPK8CT+

(CUVXQT\ÒINKEJGU'ZGORNCTOKVHGKPGT6ÌPWPI



'ZGORNCTFGT5COONWPIFGU'T\DKUEJQHUXQP.[QP#WMVKQP%TGWU[.[QP0T



2CWN+86GUVQPG#PEQPC/WPVQPK

8QT\ÒINKEJGU'ZGORNCTOKVHGKPGT6ÌPWPI



'ZGORNCTFGT#WMVKQP0#%<ÒTKEJ0T

1791

1790

1793

1792



2KWU86GUVQPGQ,4QO/WPVQPKXCT

4(CUVUGJTUEJÌP





)TGIQT:+++6GUVQPGQ,4QO/WPVQPKNGKEJVXCT  #VVTCMVKXGUUGJTUEJÌPGU'ZGORNCT





6GUVQPG4QO/WPVQPK8CT+

#VVTCMVKXGUUGJTUEJÌPGU'ZGORNCT





6GUVQPG#0:  4QO/WPVQPKNGKEJVXCT

5GJTUEJÌP





5KZVWU86GUVQPGQ,4QO/WPVQPK8CT++  8QT\ÒINKEJGU'ZGORNCTOKVHGKPGT6ÌPWPI





$KCPEJK#XKIPQP/WPVQPK



1794

302

1795

5GJTUEJÌP


ITALIEN

1797

1796

1796



2KCUVTC #0 ++++ 4QO  I $TWUVDKNF N KP IGKUVNKEJGO 1TPCV5V (TCPEGUEQ MPKGV N WPF   GTJGDVFKG*·PFG\WO*KOOGNXQTKJO5VCFVCPUKEJVT$CWO&CX/WPVQPKNGKEJVXCT  4#VVTCMVKXGUUGJTUEJÌPGU'ZGORNCT 



7TDCP 8++  5KNDGTOGFCKNNG  XQP /KEJGNG #PIGNQ $CNNC CWH UGKPGP WPGTYCTVGVGP 6QF   $TWUVDKNFNKPIGKUVNKEJGO1TPCV5VCFVCPUKEJVCWH*ÒIGNOOI/QFGUVK  8QPITQ­GT5GNVGPJGKV(CUVXQT\ÒINKEJ  'ZGORNCTFGT5COONWPI)GPGTCNFG)TCPFRTG[#WMVKQP%KCPK2CTKU0T

1798



1799

2CWN86GUVQPG#++++  4QO/WPVQPKCNGKEJVXCT  #VVTCMVKXGU'ZGORNCTOKVIWVGO2QTVT·VUGJTUEJÌPpXQT\ÒINKEJ



'ZGORNCTFGT#WMVKQP0#%<ÒTKEJ0T



7TDCP8+++6GUVQPG#:+8  4QO/WPVQPKC  )WVGU2QTVT·V#VVTCMVKXGUUGJTUEJÌPGU'ZGORNCT



'ZGORNCTFGT#WMVKQP%T¾FKVFGNC$QWTUG2CTKU0T

1801

1800

1802



(TCPEQQFGT ,CJTGU\CJNPKEJVNGUDCT #XKIPQPI$TWUVDKNFTKPIGKUVNKEJGO1TPCV $NWOGPMTGW\/WPVQPK 445GJTUEJÌP





2KCUVTC#::4QO&CX/WPVQPK  -N5EJTÌVNKPIUHGJNGTUGJTCVVTCMVKXGUXQT\ÒINKEJGU'ZGORNCTOKVHGKPGT6ÌPWPI



'ZGORNCTFGT5COONWPIFGU'T\DKUEJQHUXQP.[QP#WMVKQP%TGWU[.[QP0T



2KCUVTC#::4QO&CX/WPVQPK

5VGORGNHGJNGTCO4CPFUGJTUEJÌPGU'ZGORNCT

 303


ITALIEN

1803



+PPQEGP\:2KCUVTC#001++  4QO&CX$/WPVQPK  <CKPGPFGCVVTCMVKXGUHCUVXQT\ÒINKEJGU'ZGORNCT



'ZGORNCT FGT 5COONWPI FGU 'T\DKUEJQHU XQP .[QP #WMVKQP %TGWU[ .[QP  0T  WPF #WMVKQP $QWTIG[   2CTKU0T

1805

1804



#NGZCPFGT8++6GUVQPGQ,4QO/WPVQPK



%NGOGPU+:)KWNKQQ,4QO/WPVQPK

#VVTCMVKXGUHCUVXQT\ÒINKEJGU'ZGORNCT



8QT\ÒINKEJGU'ZGORNCT



'ZGORNCTFGT#WMVKQP%T¾FKVFGNC$QWTUG2CTKU0T

1807

1806

1808



%NGOGPU:6GUVQPGQ,4QO/WPVQPK  2TCEJVGZGORNCTOKVHGKPGT6ÌPWPI(CUV5VGORGNINCP\





2KCUVTC#0+8$4QOCWHFKG¤HHPWPIFGT*GKNKIGP2HQTVG&CX/WPVQPK  8QT\ÒINKEJGU2TCEJVGZGORNCTOKVHGKPGT2CVKPC





2KCUVTC4QO/KVFGTIGUEJNQUUGPGP*GKNKIGP2HQTVGKPFGT4ÒEMUGKVGPFCTUVGNNWPI&CX# /WPVQPK 5GJTCVVTCMVKXGUXQT\ÒINKEJGU'ZGORNCT

304




ITALIEN

1809

1811

1810



+PPQEGP\:+2KCUVTCQ,4QO&CX/WPVQPK  5GJTCVVTCMVKXGU'ZGORNCTOKVJGTTNKEJGT2CVKPCXQT\ÒINKEJ



 

2KCUVTC#0+  4QO&CX/WPVQPK 2KCUVTC#+++  4QO&CX/WPVQPK

 

'ZGORNCTFGT#WMVKQP,5EJWNOCP#OUVGTFCO0T

1813

1812

(CUVXQT\ÒINKEJGU'ZGORNCT #VVTCMVKXGUUGJTUEJÌPGU'ZGORNCT

1814

 

2KCUVTC#+++  4QO&CX/WPVQPK 2KCUVTC#8++  4QO/WPVQPK

5EJTÌVNKPIUHGJNGTYKP\-TCV\GTUGJTUEJÌP 8QT\ÒINKEJGU'ZGORNCTOKVHGKPGT2CVKPC



$TQP\GOGFCKNNG #0 8+++ KO5VGORGNCWU#08++IG·PFGTV XQP)*COGTCPKCWHFKG#NNKCP\ OKV2QNGP¤UVGTTGKEJWPF8GPGFKIIGIGPFKG6ÒTMGP$TWUVDKNFTKPIGKUVNKEJGO1TPCV'EENGUKCUVGJV XXFGP-QRHPCEJTIGYCPFVOKV2CVTKCEJGPMTGW\WPF5EJNÒUUGNRCCTCWH9QNMGPNJ·NVGKP'PIGN GKPGPXKGTU·WNKIGP6GORGNTJ·NVGKP'PIGNGKPG6KCTCOOI/KUGNNK  442TCEJVXQNNG2CVKPCXQT\ÒINKEJp5VGORGNINCP\ (ÒT FKG XQTNKGIGPFG 2T·IWPI YWTFGP FKG 5VGORGN FGT ,CJTGUOGFCKNNG XQP  XGTYGPFGV NGFKINKEJ FKG ,CJTGU\CJN   YWTFGXQP#08++KP#08+++IG·PFGTV

 



305


ITALIEN

1815

1816

1818

1817

  

2KCUVTC#8+++4QO&CX#%/WPVQPK 8QT\ÒINKEJGU'ZGORNCTOKVHGKPGT6ÌPWPI 6GUVQPG#8+++4QO/WPVQPK 2TCEJVGZGORNCTOKVHGKPGT2CVKPC(CUV5VGORGNINCP\ 5GFKUXCMCP\2KCUVTC4QO&CX/WPVQPK  8QT\ÒINKEJGU'ZGORNCTOKVHGKPGT6ÌPWPI





#NGZCPFGT8+++6GUVQPG#+4QO/WPVQPK  8QT\ÒINKEJGU2TCEJVGZGORNCTOKVHGKPGT6ÌPWPI



1819

    306

1820

1821

 

1822

+PPQEGP\:++2KCUVTC#+++4QO&CX/WPVQPK  *ÒDUEJG2CVKPCYKP\5EJTÌVNKPIUHGJNGTUGJTUEJÌP )KWNKQ#++++4QO/WPVQPK 8QT\ÒINKEJGU2TCEJVGZGORNCTOKVHGKPGT6ÌPWPI )KWNKQ#84QO/WPVQPK (GKPG6ÌPWPIMN5EJTÌVNKPIUHGJNGTHCUV5VGORGNINCP\ 2KCUVTC#008+  4QO&CX/WPVQPKC  5EJTÌVNKPIUHGJNGT(GNFGTFGT8QTFGTUGKVGNGKEJVIGIN·VVGVUGJTUEJÌPpXQT\ÒINKEJ

   


ITALIEN

1823

1824

1825



2KCUVTC#008+4QO&CX#PO/WPVQPK

-N5EJTÌVNKPIUHGJNGTHCUVXQT\ÒINKEJ





2KCUVTC#08+++4QO&CX/WPVQPK  2TCEJVGZGORNCTOKVHGKPGT2CVKPC-N5EJTÌVNKPIUTK­XQT\ÒINKEJp5VGORGNINCP\





2KCUVTC#08+++4QO&CX/WPVQPK



49KP\5EJTÌVNKPIUHGJNGTHCUVXQT\ÒINKEJ

1827

1829

1828

1826

 

)KWNKQ#+:4QO/WPVQPK )TQUUQ4QO/WPVQPK

8QT\ÒINKEJGU2TCEJVGZGORNCTOKVHGKPGT2CVKPC (GKPG6ÌPWPI5VGORGNINCP\

 



5GFKUXCMCP\2KCUVTC4QO&CX/WPVQPK  448QT\ÒINKEJGU'ZGORNCTOKVHGKPGT6ÌPWPI





%NGOGPU :+  2KCUVTC # ++ 4QO CWH FKG 4GUVCWTCVKQP FGT $CUKNKEC FGT TÌOKUEJGP   -KTEJG5/CTKCKP6TCUVGXGTG&CX/WPVQPK  448QT\ÒINKEJGU2TCEJVGZGORNCTOKVHGKPGT2CVKPC  307


ITALIEN

1831

1830

1830



2KCUVTC#++4QOCWHFKG4GUVCWTCVKQPFGT$CUKNKECFGTTÌOKUEJGP-KTEJG5/CTKCKP6TCUVGXGTG &CX/WPVQPK 4(CUVXQT\ÒINKEJ





5KNDGTOGFCKNNGXQP'*COGTCPKCWHFKG%CRGNNC#NDCPKKPFGT-KTEJG55GDCUVKCPQHWQTKNGOWTC KP4QO$TWUVDKNFNKPIGKUVNKEJGO1TPCV#PUKEJVFGT%CRGNNCOOI/KUGNNK  2TCEJVGZGORNCT-N5VGORGNTK­XQT\ÒINKEJp5VGORGNINCP\



1834

1832

1833



2KCUVTC#0:+++  4QO&CX/WPVQPK



$TQP\GOGFCKNNG#:+++XQP'*COGTCPKCWHFGP(TKGFGPXQP7VTGEJVWPFFCU'PFGFGUURCPK UEJGP 'TDHQNIGMTKGIGU $TWUVDKNF N KP IGKUVNKEJGO 1TPCV/QUGU HÒJTV FCU JGDT·KUEJG 8QNM FWTEJ FCU   IGVGKNVG4QVG/GGTOO/KUGNNK -N5VGORGNHGJNGTXQT\ÒINKEJ



%NGOGPU:++2KCUVTC4QO/WPVQPK  2TCEJVGZGORNCTOKVHGKPGT6ÌPWPI(CUV5VGORGNINCP\



 308

4(CUVXQT\ÒINKEJ




ITALIEN

1835



5KNDGTOGFCKNNG#0+++XQP1*COGTCPKCWHFGP$CWFGTPGWGP8QTJCNNGFGT$CUKNKMC5CP)KQ XCPPK KP .CVGTCPQ $TWUVDKNF T KP IGKUVNKEJGO 1TPCV OKV UGIPGPFGT 4GEJVGP#PUKEJV FGT PGWGP 8QT   JCNNGOOI$ÌTPGT2CVTKIPCPKD  8QPITQ­GT5GNVGPJGKV-N4CPFHGJNGTYKP\-TCV\GTXQT\ÒINKEJ 

1837

1836

1836 1838



2KCUVTC#+8  4QO/WPVQPK

8QT\ÒINKEJGU'ZGORNCTOKVHGKPGT6ÌPWPI





6GUVQPG#8+4QO/WPVQPKC8CT+

2TCEJVGZGORNCTOKVHGKPGT2CVKPC5VGORGNINCP\





$GPGFKMV:+85EWFQ )KWNKQ #:8+4QO/WPVQPKG  8QT\ÒINKEJGU'ZGORNCTOKVHGKPGT6ÌPWPI



'ZGORNCTFGT#WMVKQP%T¾FKVFGNC$QWTUG2CTKU0T

1839

1840

1839



5GFKUXCMCP\5EWFQTQOCPQ4QO&CX/WPVQPK  48QT\ÒINKEJGU'ZGORNCTOKVHGKPGT2CVKPC





%NGOGPU:+++5EWFQTQOCPQ#+++4QO/WPVQPK  8QT\ÒINKEJGU2TCEJVGZGORNCTOKVHGKPGT6ÌPWPI

 309


ITALIEN

1841

1843

1842



6GUVQPG#+84QO/WPVQPK

8QT\ÒINKEJGU'ZGORNCTOKVHGKPGT6ÌPWPI





5GFKUXCMCP\5EWFQTQOCPQ4QO/WPVQPK  9KP\4CPFHGJNGTXQT\ÒINKEJGU'ZGORNCTOKVHGKPGT6ÌPWPI





2KWU8+5EWFQ#++4QO/WPVQPK



1844

1845

8QT\ÒINKEJGU'ZGORNCT

1846



2KWU8++5EWFQ#:8++$$QNQIPC&CX2CICPK  2TCEJVGZGORNCTOKVHGKPGT6ÌPWPI8QT\ÒINKEJp5VGORGNINCP\





5EWFQ#:8+++$$QNQIPC&CX2CICPK

8QT\ÒINKEJp5VGORGNINCP\





5GFKUXCMCP\5EWFQ44QO&CX2CICPK  2TCEJVGZGORNCTOKVHGKPGT6ÌPWPI8QT\ÒINKEJp5VGORGNINCP\



1847

 310

5EWFQ$$QNQIPC2CICPK

2TCEJVGZGORNCTOKVHGKPGT6ÌPWPI(CUV5VGORGNINCP\




ITALIEN

1848



.GQ:++5KNDGTOGFCKNNG#0+++  XQP)%GTDCTCCWHUGKPGP$GUWEJKO*QU RKVCN FK 5CPVQ 5RKTKVQ $TWUVDKNF N KP IGKUVNKEJGO 1TPCV&GT 2CRUV KP $GINGKVWPI XQP T\VGP WPF FGT   2QNK\GKDGUWEJVGKPGP-TCPMGPUCCNWPFUGIPGVGKPGP-TCPMGPFGTGKPGDTGPPGPFG-GT\GJ·NVOO I4KPCNFK5NI$TGVVCWGT (GKPG6ÌPWPI5VGORGNINCP\

1849

1850



1851



5EWFQ#001+++$$QNQIPC&CX2CICPK

8QT\ÒINKEJGU'ZGORNCTOKVHGKPGT2CVKPC





5GFKUXCMCP\5EWFQ$$QNQIPC&CX2CICPK  2TCEJVGZGORNCTOKVHGKPGT2CVKPC(CUV5VGORGNINCP\





5EWFQ$$QNQIPC&CX2CICPK 2TCEJVGZGORNCTOKVHGKPGT2CVKPC(CUV5VGORGNINCP\



1852

1853



5EWFQ$$QNQIPC2CICPK

2TCEJVGZGORNCTOKVHGKPGT6ÌPWPI5VGORGNINCP\





2KWU8+++5EWFQ#001+$$QNQIPC&CX2CICPK  8QT\ÒINKEJGU'ZGORNCTOKVHGKPGT2CVKPC

 311


ITALIEN

1854

1855



5GFKUXCMCP\5EWFQ$$QNQIPC&CX2CICPK  2TCEJVGZGORNCTOKVHGKPGT2CVKPC(CUV5VGORGNINCP\





)TGIQT:8+5EWFQ#0+4QO&CX2CICPK

8QT\ÒINKEJ



1856

1857



$CKQEEJK 5EWFQ #+844QO2CICPK

8QT\ÒINKEJGU'ZGORNCTOKVHGKPGT2CVKPC





5EWFQ#8++44QO&CX2CICPK 2TCEJVGZGORNCTOKVHGKPGT6ÌPWPI5VGORGNINCP\



1859



1858

1860

5KNDGTOGFCKNNG #0 :+8 XQP ) %GTDCTC CWH FKG 'TYGKVGTWPI FGU 5V ,CMQDU*QURKVCNU HÒT 7P   JGKNDCTG$TWUVDKNFTKPIGKUVNKEJGO1TPCV#PUKEJVFGT(CUUCFGXQP-KTEJGWPF*QURKVCNVTCMVGPOO I4KPCNFK5NI$TGVVCWGT 2TCEJVGZGORNCTOKVHGKPGT6ÌPWPI5VGORGNINCP\





5GFKUXCMCP\5EWFQ44QO&CX2CICPK  2TCEJVGZGORNCTOKVHGKPGT2CVKPC(CUV5VGORGNINCP\





5EWFQ44QO&CX2CICPK



312

5EJÌPG6ÌPWPIMN4CPFHGJNGTXQT\ÒINKEJ


ITALIEN

1861

1863

1862



1864

1862

2KWU+:5EWFQ#001+44QO&CX2CICPK  42TCEJVGZGORNCTXQPRQNKGTVGP5VGORGNP5VGORGNINCP\ 2TQQH





$CKQEEJK )KWNKQ #0+++$$QNQIPC





5KNDGTOGFCKNNG #001 8+ XQP ) %GTDCTC CWH FCU 4KEJVHGUV FGT #TKEEKC$TÒEMG $TWUVDKNF N KP   IGKUVNKEJGO1TPCV#PUKEJVFGTFTGKUVÌEMKIGP$TÒEMGOOI4KPCNFK  (GKPG2CVKPCXQT\ÒINKEJp5VGORGNINCP\



5KNDGTOGFCKNNG #001 8++   XQP $ <CEECIPKPK CWH FKG 4GUVCWTCVKQP FGT CPVKMGP 8KC #RRKC   $TWUVDKNF T KP IGKUVNKEJGO 1TPCV#PUKEJV FGT 8KC#RRKCOKVFGO6GORGN5CP5GDCUVKCPQOO I4KPCNFK 8QT\ÒINKEJGU'ZGORNCTOKVHGKPGT6ÌPWPI





1866

(CUV5VGORGNINCP\

1865

1867



5EWFQ#08+++44QO&CX2CICPK



.GQ:+++5KNDGTOGFCKNNG#0:+:XQP($KCPEJKCWHFKG'KPJGKVFGT-KTEJG$TWUV DKNFNKPIGKUVNKEJGO1TPCV%JTKUVWUOKV(CJPGUVGJVXXWOIGDGPXQPFTGK/KUUKQPCTGPOO I4KPCNFK 2TCEJVGZGORNCT(CUV5VGORGNINCP\



2KWU:++5KNDGTOGFCKNNG#+XQP#/KUVTW\\KCWHUGKPG9CJN$TWUVDKNFNKPIGKUV NKEJGO 1TPCV9CRRGPUEJKNF QDGP /KVTC ÒDGT \YGK IGMTGW\VGP 5EJNÒUUGNP  OO  I 4K   PCNFK 2TCEJVGZGORNCTXQPRQNKGTVGP5VGORGNP(CUV5VGORGNINCP\





'VYCUHNGEMKIXQT\ÒINKEJ



313


ITALIEN

1868

1869

1869

.7%%# 

4GRWDNKM5CP/CTVKPQFC$QNQIPKPKI$GNNGUKCp%0+:+p  W­GTUVUGNVGPGT,CJTICPI8GTOWVNKEJWPGFKGTVWPF7PKMWO5EJÌPpUGJTUEJÌP



/#+.#0& 

'TUVG 4GRWDNKM  #ODTQUKPQ Q ,  I -TGW\ KO \YGKVGP WPF FTKVVGP 9KPMGN GKP   *CNDOQPF&GT*GKNKIG#ODTQUKWUVJTQPVXXOKV-TWOOUVCDWPFUGIPGPFGT4GEJVGP$KCIIKXCT (GKPG6ÌPWPIHCUVXQT\ÒINKEJ

1871

1870



.QFQXKEQ:++XQP1TNGCPU6GUVQPGQ,%TKRRC#  5GJTCVVTCMVKXGUHCUVXQT\ÒINKEJGU'ZGORNCTOKVHGKPGT6ÌPWPI



)TQUUQTGICNGFC5QNFKQ,8CTKCPVGOKV-TGW\CO#PHCPIFGT8QTFGTUGKVGPWOUEJTKHV%TKRRC#PO (CUVXQT\ÒINKEJ

1872

 

1873

 

1874



2JKNKRR+8XQP5RCPKGP(KNKRRQ%TKRRC#&CX  )WVGU2QTVT·VYKP\5EJTÌVNKPIUHGJNGTUGJTUEJÌP





-CTN+++ 8+ XQP*CDUDWTI(KNKRRQ%TKRRC&CX  5GJTUEJÌPpXQT\ÒINKEJ





(KNKRRQ/CKNCPF/KVFTGK'KPRWP\WPIGPCWHFGT8QTFGTUGKVG%TKRRC#&CX  44(CUVXQT\ÒINKEJ 9GKVGTG 2T·IWPIGP XQP /CKNCPF /CPVWC WPF %QTTGIKQ CWU FGO 5EJCV\HWPF XQP *GTDQTP HKPFGP 5KG   WPVGTFGP0TP

314




ITALIEN

1876



1875

1877

5VCFV 5KNDGTOGFCKNNG  UR·VGTG 2T·IWPI FGU  ,CJTJWPFGTVU  WPUKIPKGTV CWH FKG GTHQNITGKEJG   4GIGPVUEJCHV FGU -CTFKPCNU )GQTIGU F #ODQKUG $TWUVDKNF FGU -CTFKPCNU N OKV $KTGVV5VCFVCPUKEJV   FCTÒDGTUVTCJNGPFG5QPPGOOI,QPGU+ *GTTNKEJG2CVKPCXQT\ÒINKEJ

)GQTIGU -CTFKPCN F #ODQKUG YCT UGKV  GTUVGT /KPKUVGT FGU HTCP\ÌUKUEJGP -ÌPKIU .QWKU :++ FGP GT\WT'TQDG TWPIXQP/CKNCPFDGYQI0CEJFGT'TQDGTWPIXQP/CKNCPFKO#RTKNYWTFGF #ODQKUGFKG4GIGPVUEJCHVÒDGT FKG5VCFVÒDGTVTCIGP



/1&'0# 

(TCPEGUEQ + F 'UVG  5EWFQ Q , .GXCPVKPKUEJGT $GKUEJNCI \W GKPGO 'OFGPGT  5VÒDGT   &CX#)CODGTKPK8CTGUK 5GJTUEJÌP





5EWFQQ,.GXCPVKPKUEJGT$GKUEJNCI\WGKPGO'OFGPGT5VÒDGT&CX#)CODGTKPK8CTGUK 5GJTUEJÌP



1878

1880

1879

1880

0'#2'.70&5+<+.+'0 

#NHQPU+XQP#TCIQP%CTNKPQQ,0GCRGN2CPPWVK4KEEKQXCT  'VYCU$GNCIUGJTUEJÌPpXQT\ÒINKEJ





(GTFKPCPF + XQP #TCIQP  %QTQPCVQ Q , 0GCRGN /KV /ÒP\OGKUVGT\GKEJGP m   2CPPWVK4KEEKQDNGKEJVXCT -N5EJTÌVNKPIUTK­UGJTUEJÌP





2JKNKRR++XQP5RCPKGP&WECVQQ,  0GCRGN2CPPWVK4KEEKQD  5GJTUEJÌP

 315


ITALIEN

1882

1881

1881



(GTFKPCPF+8XQP$QWTDQP2GTKQFG)TCPC0GCRGN2CPPWVK4KEEKQ  8QT\ÒINKEJ



,QUGRJ $QPCRCTVG -ÌPKI XQP 0GCRGN  2KCUVTC  )TCPC   0GCRGN &CX    2CICPK 5GNVGPGT,CJTICPI5GJTUEJÌPpXQT\ÒINKEJ 



1883

1,5:1



1,5:1

2KCUVTC )TCPC 0GCRGN&CX2CICPKC  2TCEJVGZGORNCTOKVHGKPGT6ÌPWPI(CUV5VGORGNINCP\



1885

1884

1884

2#4/# 

1FQCTFQ(CTPGUG5EWFQ8CTKCPVGOKVFGT,CJTGU\CJNCWHFGT4ÒEMUGKVG&CXp \W  8CTGUKp \W  8QPITQ­GT5GNVGPJGKV5EJTÌVNKPIUHGJNGTUGJTUEJÌP





/CTKC.QWKUC.KTG/CKNCPF2CICPK



316

448QT\ÒINKEJp5VGORGNINCP\


ITALIEN

1886

1887

 

5#4&+0+'0

1887

8KEVQT#OCFGWU+++5EWFQ6WTKP%WFC\\QO 5QNFK6WTKP%WFC\\QE

1888

1889

5GJTUEJÌP 5GJTUEJÌP

 

1890



8KEVQT'OCPWGN+.KTG6WTKP&CX2CICPK

 9KP\4CPFHGJNGTUGJTUEJÌP



-CTN(GNKZ.KTG6WTKP&CX2CICPK  9KP\4CPFHGJNGTUGJTUEJÌPpXQT\ÒINKEJ





.KTG6WTKP&CX2CICPKC



#VVTCMVKXGU'ZGORNCTOKVJÒDUEJGT2CVKPCUGJTUEJÌP



1891

615%#0# 

(GTFKPCPFQ++/GFKEK8GTUKNDGTVG$TQP\GOGFCKNNG UR·VGTG2T·IWPIXGTOWVNKEJFGU  ,CJTJWPFGTVU  XQP ) ( 6TCXCPK CWH FKG 5GGOCEJV FGT 6QUECPC WPVGT 2TKP\ %QUKOQ +++ /GFKEK   )GJCTPKUEJVGU $TWUVDKNF N OKV WOIGNGIVGO /CPVGN&TGKOCUVGT CWH /GGT QDGP FCU 5VGTP\GKEJGP FGU   5VGKPDQEMUWOJGTXKGT5VGTPGOO9WT\DCEJ  5R·VGTG2T·IWPI-N5VGORGNHGJNGTXQT\ÒINKEJ

 317


ITALIEN

1892

1893

1894



%QUKOQ+++/GFKEK2KCUVTC(NQTGP\&CX)CNGQVVK8++

8QT\ÒINKEJ





(TCPEGUEQ++ +++ FK.QTGPC(TCPEGUEQPG 2CQNK (NQTGP\)CNGQVVK:8+ 2T·IGUEJY·EJGUGJTUEJÌP





(TCPEGUEQPG 2CQNK (NQTGP\&CX)CNGQVVK:+8  5GNVGPKPFKGUGT'TJCNVWPI8QT\ÒINKEJGU'ZGORNCTOKVHGKPGT6ÌPWPI



1897

1896

1895 1898



%CTNQ.WFQXKEQFK$QTDQPG-ÌPKIXQP6QUECPCWPFUGKPG/WVVGT/CTKC.WKIKC (TCPEGUEQPG &GPC (NQTGP\&CX2CICPK  5GNVGPKPFKGUGT'TJCNVWPI2TCEJVGZGORNCT(CUV5VGORGNINCP\





(TCPEGUEQPG &GPC (NQTGP\&CX2CICPK  5GNVGPKPFKGUGT'TJCNVWPI2TCEJVGZGORNCTOKVHGKPGT6ÌPWPI5VGORGNINCP\





(GTFKPCPFQ+++FK.QTGPC4GIKGTWPIU\GKV5QNFK(NQTGP\2CICPK  (CUV5VGORGNINCP\





.GQRQNFQ++FK.QTGPC(TCPEGUEQPG(NQTGP\2CICPK  2TCEJVGZGORNCTOKVHGKPGT2CVKPCXQT\ÒINKEJp5VGORGNINCP\



318


ITALIEN

1899 1900

1900



2CQNQ(NQTGP\2CICPK



(TCPEGUEQPG 2CQNK (NQTGP\&CX2CICPK

8QT\Ã&#x2019;INKEJp5VGORGNINCP\



/KPDGTKGDGPXQT\Ã&#x2019;INKEJp5VGORGNINCP\



1902

1901

1903

8'0'&+) 

2TQXKUQTKUEJG 4GIKGTWPI   .KTG  8 8GPGFKI /KV 4CPFUEJTKHV &+1 $'0'&+6'   . +6#.+#»&CX2CICPK 8QT\Ã&#x2019;INKEJ





.KTG8GPGFKI/KV4CPFUEJTKHV&+124'/+'4# .#%156#0<#»&CX2CICPK (CUVXQT\Ã&#x2019;INKEJ



-¤0+)4'+%*+6#.+'0 

7ODGTVQ+.KTG44QO&CX2CICPK

1905

1904

(CUV5VGORGNINCP\



1906

1904



.KTG44QO&CX2CICPK

#VVTCMVKXGU'ZGORNCTOKVHGKPGT2CVKPCXQT\Ã&#x2019;INKEJ





.KTG44QO2CICPK

8QT\Ã&#x2019;INKEJp5VGORGNINCP\





.KTG44QO2CICPK

8QT\Ã&#x2019;INKEJ

 319


LUXEMBURG

1908

1907



8KEVQT'OCPWGN+++.KTG4QO,CJTG-ÌPKITGKEJ+VCNKGP2CICPK  8QT\ÒINKEJ



%GPVGUKOK44QO)NCVVGT4CPF2CICPK

1909

448QT\ÒINKEJ

1912

1911

1910

 



.KTG#8+44QO&CX2CICPK

5GJTUEJÌP





.KTG#8+44QO&CX2CICPK

-N4CPFHGJNGTUGJTUEJÌP





.KTG#8+44QOCWHFGP,CJTGUVCIFGT$GGPFKIWPIFGU'TUVGP9GNVMTKGIGU&CX 2CICPK 8QT\ÒINKEJ



.KTG:+844QO2CICPK



8QT\ÒINKEJ



5GNVGPKPFKGUGT'TJCNVWPI/KPLWUVKGTVXQT\ÒINKEJ



1914

1913

4#)75# &7$4180+-  

5VCFV6CNNGTQ&CX

1913

-41#6+'0

.7:'/$74) *'4<1)67/#$)4155*'4<1)67/  320

'NKUCDGVJXQP)ÌTNKV\)TQUQ,  .WZGODWTI2TQDUV.p  5EJÌPG2CVKPCUGJTUEJÌP




MONTENEGRO

1916

1915

1915

/10#%1

(ª456'067/ 



*QPQT¾++8GTIQNFGVG5KNDGTOGFCKNNGWPUKIPKGTV$TWUVDKNFTOKVWOIGNGIVGO/CP VGN$GJGNOVGU WPF IGMTÌPVGU 9CRRGP WOJGT 1TFGPUMGVVG \W FGP 5GKVGP \YGK 5EJKNFJCNVGT OKV GTJQ   DGPGP5EJYGTVGTPOOIFG8QU/  8QPITQ­GT5GNVGPJGKV)GNQEJVMN4CPFHGJNGTUGJTUEJÌP  —EW&CX8CTGUK 4(GKPG6ÌPWPIGVYCU$GNCICVVTCMVKXGUUGJTUEJÌPGU'ZGORNCT 

'UIGNCPI*QPQT¾++CWUFGT(COKNKG)TKOCNFKFKGUGKVFGO,CJTJWPFGTVFKG*GTTUEJCHVÒDGT/QPCEQKPPGJCVVG KO,CJTFWTEJFGP8GTVTCIXQP2¾TQPPGOKV-ÌPKI.WFYKI:+++XQP(TCPMTGKEJFKG'TJGDWPI/QPCEQU\WO (ÒTUVGPVWO\WGTTGKEJGP&CDGKYWTFG*QPQT¾++CWEJFCU/ÒP\TGEJV\WGTMCPPVPCEJFGOGTDGTGKVU/ÒP\GP JCVVG RT·IGP NCUUGP +O ,CJT  YWTFG FGP OQPGICUUKUEJGP /ÒP\GP RGT )GUGV\ -WTU KO IGUCOVGPHTCP\ÌUKUEJGP -ÌPKITGKEJXGTNKGJGP

1917



  

1918

1919

5QNFK8CTGUK

(ª456'067/

1920

42T·IGUEJY·EJGUGJTUEJÌP



8QT\ÒINKEJ 5GJTUEJÌPpXQT\ÒINKEJ -N*GPMGNURWTUGJTUEJÌP

  

/106'0')41

0KMQNCWU+2GTRGTC9KGP&CX 2GTRGTC9KGP&CX 2GTRGTC9KGP&CX

321


NIEDERLANDE

1921

0+'&'4.#0&' /'&#+..'0 *+5614+'2'00+0)'0  

5KNDGTOGFCKNNGWPUKIPKGTVCWHFKG0KGFGTNCIGFGTURCPKUEJGP#TOCFCKOTOGNMCPCN&GT-ÌPKI XQP5RCPKGPFGT-CKUGTXGTUEJKGFGPG-WTHÒTUVGPFGT2CRUVWPFYGKVGTG)GKUVNKEJGUKV\GPOKVXGTDWP FGPGP #WIGP KO *CNDMTGKU FGT (W­DQFGP KUV OKV UEJCTHGP 5RKV\GP XGTUGJGP&KG WPVGTIGJGPFG URCPK   UEJG(NQVVGOOIX.QQP+5 448QT\ÒINKEJGU'ZGORNCTOKVUEJÌPGT2CVKPC  'ZGORNCTFGT#WMVKQP.CWTGPU5EJWNOCP*KNXGTUWO0T

1922



5KNDGTPG *QJNIW­OGFCKNNG Q , WO   XQP 2 XCP #DGGNG CWH FKG .KGDG WPF FKG 6TCWWPI   9GKDNKEJG#NNGIQTKGUKV\VTKPFGTGTJQDGPGP.KPMGPJ·NVUKGGKPHNCOOGPFGU*GT\PGDGPKJTUVGJVGKP %WRKFQFGTCWHGKPGPDTGPPGPFGP#NVCT\GKIVKO8QTFGTITWPF\YGK5EJY·PGXQPFGPGPFGTNKPMGKP FGPTGEJVGP#TOFGTYGKDNKEJGP)GUVCNVDGK­V)GMTÌPVGYGKDNKEJG#NNGIQTKGUKV\VXXCWH9QNMGPKO NKPMGP#TOJ·NVUKGGKP<GRVGTOKVFGT4GEJVGPJ·NVUKGGKPG-TQPGGORQTCPFGTGKP6TCWTKPIJ·PIV TGEJVUWPFKO8QTFGTITWPFLGGKP2HCWQDGP5VTCJNGPOOI  *GTUVGNNWPIUDGFKPIVGUXGTHÒNNVGU.QEJKO4CPFUGJTUEJÌPGU'ZGORNCT



1923



322

6TCIDCTG 5KNDGTOGFCKNNG  XQP 2 * /ÒNNGT CWH FGP 5KGI DGK 1WFGPCCTFG FWTEJ 2TKP\ 'WIGP   WPF FGP *GT\QI XQP /CTNDQTQWIJ 5EJNCEJVU\GPG XQT FGT 5VCFVCPUKEJV XQP 1WFGPCCTFG2TKP\   'WIGP WPF /CTNDQTQWIJ CNU &KQUMWTGP TGKVGP T ÒDGT KJPGP \YGK 5VGTPG /KV 4CPFUEJTKHV r 0+.   &'52'4#0&7/ 6'8%41 &8%' '6 #852+%' 6'8%41 Û *14 Û  OO  I (QTUVGT   2QRGNMC5NI/QPVGPWQXQX.QQP+85  /KVCNVGO*GPMGN'VYCUIGYGNNVUGJTUEJÌP




NIEDERLANDE

1924



5CVKTKUEJG5KNDGTOGFCKNNGXQP,)*QNV\JG[CWHFGP$GIKPPFGU0GWGP,CJTGUWPFFGP(TKGFGP XQP*WDGTVWUDWTI2CZUEJYGDVXXKP9QNMGPKPFGT4GEJVGP.QTDGGT\YGKIOKVFGT.KPMGPGTITGKHV UKG FGP *WV FGU XQT KJT \YKUEJGP *CPFGNUYCTGP UVGJGPFGP /GTMWT FGT UKEJ CWH GKPGP 9CTGPDCNNGP   UVÒV\V N DNCUGP 9KPFMÌRHG GKPGP *CWHGP 9GEJUGN CWUGKPCPFGT/·PPNKEJG )GUVCNV KP TÌOKUEJGT 5GPC   VQTGPVTCEJV UVGJV X X CP 5VTCPF KP FGT 4GEJVGP /GTMWTUVCD OKV FGT .KPMGP UVÒV\V UKG UKEJ CWH GKPG   5·WNGKO*KPVGTITWPF/GGTOKV#OUVGTFCOGTWPF*CODWTIGT5GIGNUEJKHHGPNUVTCJNGPFG5QPPG OOI%QNN(KGYGIGT2CZKP0WOOKU8GTXX.QQP  -N4CPFHGJNGTWPF-TCV\GTXQT\ÒINKEJ



1925

1926



1926

5KNDGTOGFCKNNGXQP#XCP$CGTNNCWHFKG5GGUEJNCEJVCWHFGT&QIIGTDCPM<YGK5EJKHHGKO)G HGEJVCWH5GG#EJV<GKNGP5EJTKHVOOI8GTXX.QQP  5EJÌPG2CVKPCYKP\4CPFHGJNGTXQT\ÒINKEJ



5KNDGTOGFCKNNG  XQP , 'XGTVU CWH FGP (TKGFGP XQP (QPVCKPGDNGCW \YKUEJGP (TCPMTGKEJ WPF FGP   8GTGKPKIVGP 0KGFGTNCPFGP &KG 2GTUQPKHKMCVKQP (TCPMTGKEJU UVGJV PCEJ T OKV 5RGGT WPF 9CRRGPUEJKNF   \WKJTGP(Ò­GPUVGJVFGTICNNKUEJG*CJPKJTIGIGPÒDGTUVGJVFKGPKGFGTN·PFKUEJG/CIFOKV(TGKJGKVUJWV 9CRRGPUEJKNFWPFCWUIGUEJÒVVGVGO(ÒNNJQTPOKV)GNF\WKJTGP(Ò­GPFGTPKGFGTN·PFKUEJG.ÌYGKPFGT /KVVG GKP #NVCT OKV FGP MNGKPGP 9CRRGP XQP (TCPMTGKEJ WPF FGP 0KGFGTNCPFGP#EJV <GKNGP 5EJTKHV   \YKUEJGP\YGKIGDWPFGPGP2CNO\YGKIGPWPF)KTNCPFGOOI5NI,WNKWUp8GTXX.QQP *GTTNKEJG2CVKPCXQT\ÒINKEJp5VGORGNINCP\



&KG&QIIGTDCPMKUVGKPGHNCEJG$CPMKPFGT0QTFUGGOKVGKPGT9CUUGTVKGHGXQPPWTO5KGGTUVTGEMVUKEJMO KP9GUV1UV4KEJVWPIWPFKUVTWPFMODTGKV$KUXQTGVYC,CJTGPDKNFGVGFKG&QIIGTDCPMFGP5ÒFTCPFFGT 0QTFUGGYGUVNKEJXQPKJTNCIFKG4JGKPOÒPFWPIÌUVNKEJFKG'NDG9GUGT/ÒPFWPI



1927



9KNJGNO 8 )GPGTCNUVCVVJCNVGT FGT 0KGFGTNCPFG  5KNDGTOGFCKNNG  XQP , )   *QNV\JG[ CWH UGKPG #WHPCJOG KP FGP *QUGPDCPFQTFGP KO #NVGT XQP  ,CJTGP $TWUVDKNF FGU LWPIGP   2TKP\GP T OKV (GFGTJWV WPF WOIGNGIVGO /CPVGN FKG .KPMG CO 5EJYGTVITKHH#PUKEJV FGU *QUGPDCP   FQTFGPUOOI8GTXX.QQP 44*ÒDUEJG2CVKPCMN4CPFHGJNGTXQT\ÒINKEJ

 323


NIEDERLANDE

1928

#/56'4&#/ 

5VCFV 5KNDGTOGFCKNNG  XQP , $NWO CWH FGP 5RCPKUEJ0KGFGTN·PFKUEJGP (TKGFGP #WH GKPGO XQP   FTGK 'PIGNP CWUIGDTGKVGVGP 6WEJ CEJV <GKNGP 5EJTKHV KO *KPVGTITWPF FKG 5VCFVCPUKEJV XQP #OUVGTFCO   KO 8QTFGTITWPF \CJNTGKEJG 5GIGNUEJKHHG2CZ OKV /GTMWTUVCD WPF (ÒNNJQTP UKV\V KP GKPGO XQP \YGK   .ÌYGPIG\QIGPGO9CIGPPCEJTFGTXQTFGTGOKV<GRVGTWPFFGT-ÌPKIUMTQPG5RCPKGPUFGTJKPVGTG OKV 2HGKNDÒPFGN WPF FGT -TQPG FGT 8GTGKPKIVGP 2TQXKP\GP CO $QFGP NKGIGP XGTUVTGWVG 9CHHGP    OOI&GVJ1TF,WPIM2CZKP0WOOKUX.QQP++5  5VGORGNHGJNGTKO(GNFFGT4ÒEMUGKVGUGJTUEJÌP



1930

1929





1929

)TCXKGTVG 5KNDGTIW­OGFCKNNG  WPUKIPKGTV CWH FKG INÒEMNKEJ ÒDGTUVCPFGPG $GNCIGTWPI FGT 5VCFV   5VCFVCPUKEJVXQP#OUVGTFCOKO8QTFGTITWPFFKGDGYCHHPGVGP$ÒTIGTKP\CJNTGKEJGP5EJKHHGPWPF$QQ VGPQDGPGKPGCWU9QNMGPWPF5VTCJNGPMQOOGPFG*CPFOKV*GT\FCTÒDGTFCUIGMTÌPVG5VCFVYCRRGP CWH 5EJTKHVDCPF&TGK <GKNGP ITCXKGTVG 5EJTKHV WOJGT .QTDGGTMTCP\ WOIGDGP XQP GKPGO ITCXKGTVGP   5EJTKHVMTGKUOOIX.QQPXIN++5  44(GKP\KUGNKGTVGT)W­5GJTUEJÌPpXQT\ÒINKEJ

5KNDGTOGFCKNNGWPUKIPKGTVCWHFCUL·JTKIG4CVULWDKN·WOFGU5GPCVQTU0KMQNCWU6WNRKWU

 Ó  $TWUVDKNF T KP #OVUVTCEJV#JQTPDCWO FKG 5RKV\G KP 9QNMGP  OO  I X .QQP   +++5 -CDKPGVVUVÒEM2TCEJVXQNNG2CVKPC5VGORGNINCP\  &GT /GFK\KPGT WPF #OUVGTFCOGT $ÒTIGTOGKUVGT 0KMQNCWU 6WNRKWU WPVGTUWEJVG  FCU 5Q\KCNXGTJCNVGP FGT ITQ­GP   /GPUEJGPCHHGP PCEJFGO GKP NGDGPFGT 5EJKORCPUG CWU #HTKMC PCEJ *QNNCPF IGNCPIVG 5KG YWTFGP XQP 6WNRKWU OKV   FGO QUVCUKVCKUEJGP 0COGP 1TCPI 7VCP DGNGIV &KGU YCT PWP HÒT OGJT CNU  ,CJTG FKG $G\GKEJPWPI HÒT ITQ­G   #HHGP /GPUEJGPFGU9CNFGU 

324




NIEDERLANDE

1932

1931



1931

5KNDGTPG*QJNIW­OGFCKNNGQ, ITCXKGTV WPUKIPKGTVCPIGHGTVKIVXQO5KNDGTUEJOKGF9FG9KLU 'KPNC­OCTMG FGU *QTVWU /GFKEWU HÒT #DTCJCO &GFGN #GUEWNCR UVGJV X X KP -T·WVGTICTVGP5VCFV   YCRRGP \YGK (ÒNNJÌTPGT WPF 5EJNCPIGPUVCD CWH GKPGO 2QFGUV OKV FGT )TCXWT #DTCJCOKU  &GFGN    *CIKG %QO  PCVWU  (GDT  /KV ITCXKGTVGT 4CPFUEJTKHV %QPUWN #OUVGNCGFCOKU  %WTCVQT   *QTVK/GFKEKOOI-QPKPI5NI$TGVVCWGTXINHH 8QT\ÒINKEJ



&GT *QTVWU /GFKEWU JGWVG *QTVWU $QVCPKEWU  KP #OUVGTFCO YWTFG  IGITÒPFGV WPF KUV GKPGT FGT ·NVGUVGP   DQVCPKUEJGP)·TVGPFGT9GNV  #DTCJCO &GFGN YWTFG  IGDQTGP WPF OCEJVG GKPG IN·P\GPFG -CTTKGTG CNU *·PFNGT $CPMKGT WPF 2QNKVKMGT 'T   UVCTD

$#6'0$74) 

9KNJGNOXQP$TQPEMJQTUV6CNGTQ,OKV6KVGN-CTNU8&CX&GNO  45GJTUEJÌP



1933

$4'&# 

5KNDGTOGFCKNNGXQP%JT#FQNRJ\QQPCWHFGP(TKGFGPXQP$TGFC\YKUEJGPFGP0KGFGTNCPFGPWPF )TQ­DTKVCPPKGP &KG 2GTUQPKHKMCVKQP FGT 0KGFGTNCPFG UVGJV X X KP CPVKMGT 4ÒUVWPI KP FGT 4GEJVGP   <GRVGTKPFGT.KPMGP.CP\GOKVCPIGDWPFGPGO2HGKNDÒPFGNOKVFGONKPMGP(W­FTÒEMVUKGFGPRGTUQ PKH\KGTVGP0GKF\W$QFGP\WFGP5GKVGP5EJCHWPF.ÌYGKO*KPVGTITWPF(NW­OKV\WO6GKNDTGPPGPFGP 5EJKHHGP9GKDNKEJG )GUVCNV OKV 5EJYGTV /GTMWTUVCD WPF (ÒNNJQTP UVGJV X X CWH 9CHHGP QDGP )QV   VGUJCPFOKV\YGKOKVGKPCPFGTXGTDWPFGPGP9CRRGPUEJKNFGPKO*KPVGTITWPF*CPFGNUUEJKHHGCWHTWJKIGT 5GG /KV 4CPFUEJTKHV È 07/+5/# Û 2156'4+6#6+ Û 5#%47/ Û $'.)# Û $4+6#00137' Û   4'%10%+.+#6+5 Û %7/ Û 24+8+. Ù 14&+0 Ù *1..#0& Ù '6 Û 9'56 Ù  OO  I   'KOGTp2CZKP0WOOKUX.QQP++5 44*ÒDUEJG2CVKPCYKP\4CPFHGJNGTXQT\ÒINKEJ  325


NIEDERLANDE

1934



5VCFV5KNDGTOGFCKNNGXQP%JT#FQNRJ\QQPCWHFGP(TKGFGPXQP$TGFC\YKUEJGPFGP0KGFGTNCP FGPWPF)TQ­DTKVCPPKGP&KGCPGKPCPFGTIGNGJPVGPWPFOKVGKPCPFGTXGTDWPFGPGP9CRRGPXQP)TQ­DTK VCPPKGP WPF FGP 0KGFGTNCPFGP FCTÒDGT -TCP\ FCTWPVGT .QTDGGT WPF 2CNO\YGKI IGMTGW\V'KP PKG   FGTN·PFKUEJGUWPFGKPGPINKUEJGU5EJKHHUGIGNPHTKGFNKEJPGDGPGKPCPFGTOOI'KOGT 2CZKP0WOOKUX.QQP++5 #VVTCMVKXGUUGJTUEJÌPGU'ZGORNCTOKVUEJÌPGT2CVKPC



1935

&14&4'%*6 

5VCFV5KNDGTLGVQP&KGDGHGUVKIVG5VCFV)GTVTWFGPDGTIYKTFXQPFGP5RCPKGTPDGNCIGTVKO8QTFGT ITWPF RHNÒIGPFGT $CWGT'KPG #TOGG DGUVÒTOV FGP $GTI #QTPQU CWH FGUUGP )KRHGN GKPG <KVCFGNNG \W   UGJGPKUVOOI&WIPKQNNGX.QQP+5 45GJTUEJÌP



'ZGORNCTFGT#WMVKQP(TKV\4WFQNH-ÒPMGT1UPCDTÒEM0T

1936

)17&# 

5VCFV5KNDGTOGFCKNNQPXQP,&TCRRGPVKGTCWHFGP(TKGFGPUMQPITGUUKP4KLUYKLMIGUVKHVGVXQPFGT 5VCFV)QWFC9KNJGNO+++CNU*GTMWNGUUVGJVTOKV-GWNGFGP(W­CWHFKGCO$QFGPNKGIGPFGRGTUQPK HK\KGTVG<YKGVTCEJVIGUVGNNVWPFGPV\ÒPFGVOKVGKPGT(CEMGNGKPGP#NVCTOKV-TKGIUVTQRJ·GPQDGPDGHKP FGV UKEJ FCU IGMTÌPVG 5VCFVYCRRGP2CZ OKV <YGKI WPF *CTHG VJTQPV X X CWH GKPGO 5QEMGN N FCXQT   NCIGTP2CPWPF6[EJG )QWFC T0GRVWP )QWYG WPF/GTMWTKO*KPVGTITWPFT/GGTOKV5EJKHHGP NFCU5EJNQ­4KLUYKLMOOI2CZKP0WOOKUX.QQP+85  42TCEJVXQNNG2CVKPCOKP4CPFHGJNGTXQT\ÒINKEJp5VGORGNINCP\  'ZGORNCTFGT#WMVKQP(TKV\4WFQNH-ÒPMGT1UPCDTÒEM0T  &GT (TKGFG XQP 4KLUYKLM XQO  5GRVGODGT  DGGPFGVG FGP 2H·N\KUEJGP 'TDHQNIGMTKGI   FGT ICP\   'WTQRC KP /KVNGKFGPUEJCHV IG\QIGP JCVVG .WFYKI :+8 XQP (TCPMTGKEJ UEJNQ­ (TKGFGP OKV )TQ­DTKVCPPKGP FGP   0KGFGTNCPFGP5RCPKGPUQYKGOKV-CKUGTWPF4GKEJ

326


NIEDERLANDE

1938

1937

)410+0)'0 

5VCFV 5KNDGTOGFCKNNG  WPUKIPKGTV CWH FKG 8GTVGKFKIWPI FGT 5VCFV Y·JTGPF FGT $GNCIGTWPI FWTEJ   FGPOÒPUVGTKUEJGP$KUEJQH%JTKUVQRJ$GTPJCTFXQP)CNGP'JTGPICDGCPFKG5VWFGPVGPFGT7PKXGTUKV·V )TQPKPIGP#NVCTFCXQTFCUXKGTHGNFKIG9CRRGPFGT7PKXGTUKV·V\WFGP5GKVGPLGGKPGIGFTGJVG5·WNG CWHFGO#NVCTUVGJV2CNNCUOKV5VCDKPFGT.KPMGPFKG4GEJVGCWHGKPGPCDIGUEJNCIGPGP-QRHIGNGIV\W FGP 5GKVGP (CJPGP WPF #TOCVWTGP0GWP <GKNGP 5EJTKHV  OO  I X .QQP +++ 5    9GKNGT 4(GKPG2CVKPCXQT\ÒINKEJ



&KG5VCCVGPXQP)TQPKPIGPWPF7OIGDWPID\YFKG-WTCVQTGPFGT7PKXGTUKV·VXGTNKGJGPFKGXQTNKGIGPFG/GFCKNNGCP FKG  5VWFGPVGP FGT *QEJUEJWNG )TQPKPIGP CNU 'TKPPGTWPI CP FKG $GHTGKWPI UQYKG KJT /KVYKTMGP DGK FGT   8GTVGKFKIWPIFGT5VCFVIGIGPFKG6TWRRGPFGU$KUEJQHUXQP/ÒPUVGT%JTKUVQRJ$GTPJCTFXQP)CNGP



'KPUGKVKIG#EJVGNVCNGTMNKRRG\W5VÒDGTPIGHGTVKIVY·JTGPFFGT$GNCIGTWPIFWTEJFGPOÒPUVG TKUEJGP$KUEJQH%JTKUVQRJ$GTPJCTFXQP)CNGP$TCWUG/CPUHGNF6H FQTVOKVITCXKGTVGT4ÒEM UGKVG &GNO#PO (GKPG2CVKPCUGJTUEJÌPpXQT\ÒINKEJ



1939

*##4.'/ 

5VCFV 5KNDGTOGFCKNNG  WPUKIPKGTV CWH FKG 4ÒEMXGTNGIWPI FGT *CCTNGOGT 5EJÒV\GP CWU FGT 5VCFV   *CUUGNV KP FKG *GKOCVUVCFV 5VCFVCPUKEJV XQP *CUUGNV FCTÒDGT FGT 5VCFVUEJKNF UQYKG GKP NGGTGT 5EJKNF  5VCFVCPUKEJVXQP*CCTNGOFCTÒDGT\YGK9CRRGPUEJKNFGOOI-2-X.QQP++5 8QT\ÒINKEJ



1940



5KNDGTPG 2T·OKGPOGFCKNNG Q ,   XQP , ) *QNV\JG[ IGYKFOGV XQP FGT JQNN·PFKUEJGP )GUGNN   UEJCHV FGT 9KUUGPUEJCHVGP 8GTKVCU UVGJV X X OKV -TCP\ WPF 2CNO\YGKI KO *KPVGTITWPF 5VCFVCPUKEJV   XQP *CCTNGO'EENGUKCWPF*QNNCPFKCUKV\GPXXJKPVGTGKPGO#NVCTOKV$KDGNCWHFKG'EENGUKCKJTGP NKPMGP#TONGIVOOI8GTXX.QQP *ÒDUEJG2CVKPCXQT\ÒINKEJ

 327


NIEDERLANDE

1942 1941

1941

*1..#0& 



2TQXKP\ 2JKNKRRUVCNGT  XQP $GNIKGP $TCDCPV 2JKNKRR ++ XQP 5RCPKGP  /ÒP\UV·VVG   #PVYGTRGPOKV)GIGPUVGORGNXQP*QNNCPFCWHFGT8QTFGTUGKVG.ÌYGKPIGRGTNVGO1XCNIGIGPIGUVGO RGNVFWTEJFKG2TQXKP\*QNNCPFY·JTGPFFGU(TGKJGKVUMCORHGU&CX FQTVQJPG)GIGP UVGORGN &GNO FQTVQJPG)GIGPUVGORGN  5GJTUEJÌP 4GCN .GKEGUVGTUVQVGT 8GTMCFG6H 445GJTUEJÌP

 

1943



5KNDGTOGFCKNNG Q ,   WPUKIPKGTV CWH FGP 6QF FGU PKGFGTN·PFKUEJGP 2QNKVKMGTU ,QJCP XCP 1NFGP   DCTPGXGNV$TWUVDKNFXCP1NFGPDCTPGXGNVUHCUVXXOKVWOIGNGIVGO/CPVGNWPFDTGKVGO-TCIGP5GEJU <GKNGP 5EJTKHV QDGP IGMTGW\VG 2CNO\YGKIG WPVGP IGMTGW\VG .QTDGGT\YGKIG  OO  I X   .QQP++5 42TCEJVXQNNG2CVKPCMN4CPFHGJNGTXQT\ÒINKEJp5VGORGNINCP\  ,QJCP XCP 1NFGPDCTPGXGNV  5GRVGODGT  KP #OGTUHQQTV YCT UGKV  4CVURGPUKQP·T FGT 2TQXKP\ *QNNCPF   WPF XGTVTCV CNU RQNKVKUEJGT (ÒJTGT FGU 7PCDJ·PIKIMGKVUMCORHGU GKPG CTKUVQMTCVKUEJTGRWDNKMCPKUEJG 4KEJVWPI -QP   HNKMVG OKV FGO 5VCVVJCNVGT /QTKV\ XQP 1TCPKGP UQYKG UGKPG TGNKIKÌUG #WHHCUUWPI DTCEJVGP KJP \W (CNN 'T YWTFG   XGTJCHVGVWPFCO/CKKP&GP*CCIGPVJCWRVGV

1944



5KNDGTOGFCKNNGXQP(#XT[CWHFKG'TOQTFWPIFGT)GDTÒFGT,QJCPWPF%QTPGNKWUFG9KVV$GK FGT$TWUVDKNFGTGKPCPFGTIGIGPÒDGT&KGDGKFGP$TÒFGTHCNNGPOGJTGTGP(CDGNYGUGP\WO1RHGTOO IX.QQP+++5 44CPFHGJNGTHCUVXQT\ÒINKEJ

,QJCPFG9KVVICNVUGKVCNU(ÒJTGTFGTTGRWDNKMCPKUEJUV·PFKUEJGP2CTVGKFKGFKG5VCVVJCNVGTUEJCHVICP\CWH\WJG DGP UVTGDVG &GT 'KPHCNN .WFYKIU :+8 XQP (TCPMTGKEJ KP FKG 4GRWDNKM   HÒJTVG \W FG 9KVV U 5VWT\ WPF \WT   $GTWHWPI 9KNJGNOU XQP 1TCPKGP \WO 5VCVVJCNVGT XQP *QNNCPF /KV UGKPGO $TWFGT %QTPGNKWU YWTFG FG 9KVV DGK   GKPGO8QNMUCWHNCWHCO#WIWUVGTOQTFGV

328




NIEDERLANDE

1947

1946

1945

1948



5KNDGTOGFCKNNGWPUKIPKGTVCWHFKG'TOQTFWPIFGT)GDTÒFGT,QJCPWPF%QTPGNKWUFG9KVV$GKFGT $TWUVDKNFGT PGDGPGKPCPFGT T<YGK 5GIGNUEJKHHG KP UVÒTOKUEJGT 5GG \GTUEJGNNGP CP (GNUGP /KV   4CPFUEJTKHV f 8+1.'06# /146' &'.'6+ Û *#)“ %1/+6+5 Û  #8) Ù # 1 Û + Û    OOIX.QQP+++5 8QT\ÒINKEJGU'ZGORNCTOKVHGKPGT6ÌPWPI



'ZGORNCTFGT#WMVKQP(TKV\4WFQNH-ÒPMGT1UPCDTÒEM0T



5KNDGTOGFCKNNGQ,  WPUKIPKGTVCWHFKG'TOQTFWPIFGT)GDTÒFGT,QJCPWPF%QTPGNKWUFG9KVV $GKFGT $TWUVDKNFGT PGDGPGKPCPFGT T#EJV <GKNGP 5EJTKHV WOJGT $NWOGPXGT\KGTWPIGP  OO   IX.QQP+++5 (CUVXQT\ÒINKEJGU'ZGORNCT



'ZGORNCTFGT#WMVKQP(TKV\4WFQNH-ÒPMGT1UPCDTÒEM0T

/+&&'.$74) 

5VCFV'KPUGKVKIG6CNGTMNKRRG\W5VÒDGTPIGRT·IVY·JTGPFFGT$GNCIGTWPIFWTEJFKG6TWRRGP FGT)GPGTCNUVCCVGP$TCWUG/CPUHGNF6H&GNO 4   4(GKPG2CVKPCUGJTUEJÌPpXQT\ÒINKEJ



8QO (TÒJLCJT  DKU  JKGNVGP FKG )GWUGP GKPGP $NQEMCFGTKPI WO /KFFGNDWTI CWHTGEJV 0CEJFGO OGJTGTG   8GTUWEJG\WO'PVUCV\FGTVTGWWPFHGUV\W-ÌPKI2JKNKRRXQP5RCPKGPUVGJGPFGP5VCFVHGJNIGUEJNCIGPYCTGPMCRK VWNKGTVG FKG 5VCFV CO  (GDTWCT  XQT FGO 2TKP\GP XQP 0CUUCW1TCPKGP 9·JTGPF FGT $NQEMCFG MCO GU \WT   #WUICDG \YGKGT \GKVNKEJ CWHGKPCPFGT HQNIGPFGT 0QVOÒP\GPUGTKGP GKPG FTKVVG 5GTKG JCV FKG 5VCFV DCNF PCEJ KJTGT   'KPPCJOGRT·IGPNCUUGP#O&G\GODGTDGUEJNQUUFGT/CIKUVTCV0QVOÒP\GPCWUFGOXQPFGP)KNFGPWPF XQO4CV\WT8GTHÒIWPIIGUVGNNVGP5KNDGTIGT·V\WRT·IGP#O,CPWCTHQNIVGFGT'PVUEJGKFFGT5VCFVCWEJ FKG XQTJCPFGPGP IQNFGPGP )GT·VUEJCHVGP \W 0QVIGNF \W XGTCTDGKVGP &KG NGV\VG 5GTKG LGPGT IQNFGPGT WPF UKNDGTPGT   -NKRRGPFKGPCEJFGT-CRKVWNCVKQPGPVUVCPFGPUKPFYWTFGPIGO·­'PPQXCP)GNFGTXGTOWVNKEJKO/·T\XQP FGT5VCFVJGTCWUIGIGDGPYQJNWOFGP-QPVTKDWVKQPUHQTFGTWPIGPFGT5KGIGTPCEJ\WMQOOGP

4166'4&#/ 

5VCFV 5KNDGTOGFCKNNG  WPUKIPKGTV (TGWPFUEJCHVURHGPPKI 5VCFVIÌVVKP UKV\V PCEJ T OKV /GTMWTUVCD   WPF (ÒNNJQTP PGDGP *CPFGNUYCTGP FCJKPVGT J·NV GKP 'PIGN FGP 5VCFVUEJKNF XQP 4QVVGTFCO KO *KPVGT   ITWPF 5VCFVCPUKEJV XQP 4QVVGTFCO OKV FGT /CCU WPF FGO *CHGP/GTMWTMQRH \YKUEJGP \YGK (ÒNNJÌT   PGTP /GTMWTUVCD WPF GKPGT 6TQORGVG KO *KPVGTITWPF GKP 7PYGVVGT ÒDGT FGT /CCUOÒPFWPI KO #D   UEJPKVVUKGDGP<GKNGP5EJTKHVOOI8GTXX.QQP 8QT\ÒINKEJ



'ZGORNCTFGT#WMVKQP(TKV\4WFQNH-ÒPMGT1UPCDTÒEM0T

329


NIEDERLANDE

1949

1950

1950

764'%*6 



$KUVWO $GTPQNF  2HGPPKI &GXGPVGT  I $TWUVDKNF X X-TGW\ KP FGP 9KPMGNP LG   GKPG-WIGN&CPPGPDGTI+NKUEJ,CCTDQGMXQQT/WPVGP2GPPKPIMWPFG5  2T·IGUEJY·EJGCO4CPFUGJTUEJÌP



5VCFV5KNDGTOGFCKNNGWPUKIPKGTVCWHFGP(TKGFGPXQP7VTGEJV2CZOKV)NQDWUWPF(ÒNNJQTPUVGJV PCEJ T WPF XGTUEJNKG­V FGP ,CPWUVGORGN CP FGO\YGKCPGKPCPFGTIGMGVVGVG-TKGIGTNGJPGPKO*KPVGT ITWPF /GTMWT OKV 5EJTKHVDCPF&CU RGTUQPKHK\KGTVG 'WTQRC OKV ¤N\YGKI WPF (ÒNNJQTP NGJPV CP GKPGO   (GNUGPWPFDNKEMVCWHU/GGTFCTCWH5GIGNUEJKHHGOOI2CZKP0WOOKUX.QQP+8 5 8QT\ÒINKEJGU'ZGORNCTOKVHGKPGT6ÌPWPI



'ZGORNCTFGT#WMVKQP(TKV\4WFQNH-ÒPMGT1UPCDTÒEM0T &KG(TKGFGPUXGTVT·IGXQP7VTGEJVDGGPFGVGPFGP5RCPKUEJGP'TDHQNIGMTKGI



1952

1951



1951

5KNDGTOGFCKNNGXQP0XCP5YKPFGTGPCWHFCUL·JTKIG,WDKN·WOFGU(TKGFGPUXQP7VTGEJV&KG IGMTÌPVGP 9CRRGP XQP 'PINCPF 2TGW­GP (TCPMTGKEJ 5RCPKGP 2QTVWICN &·PGOCTM WPF 2QNGP&KG   JQNN·PFKUEJG /CIF UKV\V HCUV X X OKV 5VCD FCTCWH (TGKJGKVUJWV OKV FGT .KPMGP J·NV UKG GKP CWHIG   UEJNCIGPGU$WEJJKPVGTKJTNKGIVFGTIGMTÌPVGPKGFGTN·PFKUEJG.ÌYGOKV2HGKNDÒPFGNTNKGIGPFGTIGHGU UGNVGT/CTUN,CPWUVGORGNQDGP'PIGNOKV\YGK2QUCWPGPOOI2CZKP0WOOKU 8GTXX.QQP 5GJTCVVTCMVKXGU'ZGORNCTOKVHGKPGT6ÌPWPI



&KG(TKGFGPUXGTVT·IGXQP7VTGEJVDGGPFGVGPFGPURCPKUEJGP'TDHQNIGMTKGI

<''.#0&  330

2TQXKP\4GCN .GKEGUVGTTGCCN &CX&GNO 4   44*ÒDUEJG2CVKPCCVVTCMVKXGUUGJTUEJÌPGU'ZGORNCT




NIEDERLANDE

1954

1953

1955



&QRRGNVGT5KNDGTFWMCVI&CX#&GNOC 4 

445GJTUEJÌP





5KNDGTFWMCV 4GKEJUVCNGT 7VTGEJV&CX5EJWNOCP 5GJTUGNVGPGT,CJTICPI5GJTUEJÌP



$#6#8+5%*'4'27$.+- -¤0+)4'+%**1..#0& 

.WFYKI0CRQNGQP5VÒDGT7VTGEJV&CX5EJWNOCP  5GJTUGNVGPDGUQPFGTUKPFKGUGT'TJCNVWPI2TCEJVGZGORNCT(GKPG6ÌPWPIHCUV5VGORGNINCP\

1956

1958



1957

 

5VÒDGT7VTGEJV&CX5EJWNOCP 5VÒDGT7VTGEJV&CX5EJWNOCP

8QT\ÒINKEJ #VVTCMVKXGUUGJTUEJÌPGU'ZGORNCT

 



4GKEJUVCNGT7VTGEJV&CX5EJWNOCP  8QPITQ­GT5GNVGPJGKV2TCEJVGZGORNCT(GKPG6ÌPWPIHCUV5VGORGNINCP\

 331


NORWEGEN

1960

1959

-¤0+)4'+%*0+'&'4.#0&'

1,5:1



9KNJGNO++)WNFGP7VTGEJV5EJWNOCP  -CDKPGVVUVÒEMXQPHGKPUVGT'TJCNVWPI2TCEJVXQNNG2CVKPC5VGORGNINCP\





%GPVU7VTGEJV5EJWNOCPC



8QT\ÒINKEJp5VGORGNINCP\

1963

1962

1961

1964



9KNJGNO+++)WNFGP7VTGEJV&CX5EJWNOCP  8QT\ÒINKEJp5VGORGNINCP\



  

)WNFGP7VTGEJV&CX5EJWNOCP )WNFGP7VTGEJV&CX5EJWNOCP )WNFGP7VTGEJV&CX5EJWNOCP

  

8QT\ÒINKEJp5VGORGNINCP\ 9KP\4CPFHGJNGTXQT\ÒINKEJp5VGORGNINCP\ 8QT\ÒINKEJp5VGORGNINCP\

1965 2:1



-¤0+)4'+%*

2:1

0149')'0

*CTCNF*CTFTCFG&GPCT0KFCTPGUI *#4#.&4':0#41&TGKRC­ÒDGTNKGIGP FGO-TGW\&QRRGNHCFGPMTGW\LGFTGK-WIGNPKO\YGKVGPWPFFTKVVGP9KPMGNP5EJKXG  8QPITÌ­VGT5GNVGPJGKV/KPIGYGNNV5EJTÌVNKPIUHGJNGTUGJTUEJÌP 

&KG/ÒP\GPFGU6TKSWGVTC6[RUUKPFFKG·NVGUVGP)GRT·IG0QTYGIGPUFKGGKPGP-ÌPKIUPCOGPPGPPGP XIN5MCCTG - 0QTIGU /[PVJKUVQTKG 1UNQ  $F  5  WPF $F  5  0T   'U KUV OÌINKEJ FC­ FGWVUEJG   /ÒP\GP CWU #PFGTPCEJ XIN &CPPGPDGTI  HH  QFGT -ÌNP U &CPPGPDGTI   FCU 8QTDKNF HÒT FKGUGU &TGKGK   PKIMGKVUU[ODQNNKGHGTVGP

332


NORWEGEN

1966

1967 1,5:1



%JTKUVKCP+85MKNNKPI%JTKUVKCPKC#JNUVTÌO# 4   4/KPIGYGNNVUGJTUEJÌP





(TGFGTKM+++5RGEKGFCNGT 5MKNNKPI %JTKUVKCPKC#JNUVTÌO  4#VVTCMVKXGUUGJTUEJÌPGU'ZGORNCTOKVUEJÌPGT2CVKPC



1969

1968

1970



%JTKUVKCP8-TQPG /CTM %JTKUVKCPKC#JNUVTÌO#&CX  8QT\ÒINKEJGU'ZGORNCTOKVHGKPGT6ÌPWPI



5KNDGTOGFCKNNGWPUKIPKGTVXQP,*GTEWNGUCWHFKG)TWPFUVGKPNGIWPIFGU2CNCKUHÒTFGPPQTYGIK UEJGP5VCVVJCNVGT7NTKEJ(TKGFTKEJ)[NFGPNÎXGCO-QRGPJCIGPGT-QPIGPU0[VQTX$TWUVDKNFTOKVWO IGNGIVGO/CPVGNWPF'NGHCPVGPQTFGP#PUKEJVFGU2CNCKUOOI)CNUVGT  8QPITQ­GT5GNVGPJGKV8QT\ÒINKEJGU'ZGORNCTOKVHGKPGT2CVKPC 



-TQPG /CTM %JTKUVKCPKC#JNUVTÌO&CX

 8QT\ÒINKEJGU'ZGORNCTOKVHGKPGT6ÌPWPI





1971 1,5:1



1,5:1

5KNDGTOGFCKNNGWPUKIPKGTVCWHUGKPG4GKUGPCEJ0QTYGIGP5GEJU<GKNGP5EJTKHVWOJGT.QTDGGT MTCP\5VTCJNGPFG 5QPPG ÒDGT PQTYGIKUEJGT .CPFUEJCHV OKV (NW­ FCTCWH $QQV  OO  I   )CNUVGT 8QPITÌ­VGT5GNVGPJGKV#VVTCMVKXGUUGJTUEJÌPGU'ZGORNCTOKVHGKPGT2CVKPC  333


NORWEGEN

1972

1,5:1



1,5:1

 5RGEKGFCNGT Q ,   %JTKUVKCPKC  I &GT -ÌPKI TGKVGV T OKV (GFGTJWV&CU 5EJKHH FGU   F·PKUEJPQTYGIKUEJGP-ÌPKIUCWH5GG#JNUVTÌO :4 )CNUVGT  8QPITQ­GT5GNVGPJGKV5GJTCVVTCMVKXGU'ZGORNCTHGKPG2CVKPCYKP\5EJTÌVNKPIUTK­XQT\ÒINKEJ 

1973

1,5:1



1,5:1

/CTM 5MKNNKPI %JTKUVKCPKC9+06'45%*;&6<#JNUVTÌO

 445GJTUEJÌPpXQT\ÒINKEJ



1975

1974

1,5:1



-TQPG /CTM -QPIUDGTI#JNUVTÌO&CX$ FQTVWPVGT&·PGOCTM   5GJTUEJÌPUGJTUEJÌPpXQT\ÒINKEJ



(TGFGTKM +8  -TQPG  /CTM   -QPIUDGTI  I )GJCTPKUEJVGU$TWUVDKNFTOKV WOIGNGIVGO'NGHCPVGPQTFGP&TGKIGMTÌPVG/QPQITCOOGKPU&TGKGEMIGUVGNNVKPFGT/KVVGUVTCJNGPFGU &TGKGEMKPFGP9KPMGNPLGGKP9CRRGPUEJKNF#JNUVTÌO$&CXp 448QT\ÒINKEJ 

334




NORWEGEN

1977

1976



1976

5KNDGTOGFCKNNG  WPUKIPKGTV XGTOWVNKEJ XQP % $CTVJ CWH FGP $GUWEJ FGU -ÌPKIU KP FGP 5KNDGT   DGTIYGTMGP XQP -QPIUDGTI &GT -ÌPKI TGKVGV N OKV (GFGTJWV'KPG OKV .QTDGGTMTCP\ IGUEJOÒEMVG   2[TCOKFGOKVFTGK<GKNGP5EJTKHVKP$GTIYGTMUNCPFUEJCHV/KV4CPFUEJTKHVOOI)CNUVGT /ÒUGNGTC FQTVWPVGT&·PGOCTM   44-N4CPFHGJNGTUGJTUEJÌPGU'ZGORNCTCWHFKEMGO5EJTÌVNKPI  &GT $GUWEJ FGT GTVTCITGKEJGP 5KNDGTDGTIYGTMG KP -QPIUDGTI YQ UGKV  CNNG PQTYGIKUEJGP /ÒP\GP JGTIGUVGNNV   YWTFGPDQVFGP#PNC­HÒTFKG2T·IWPIFKGUGTKPVGTGUUCPVGP/GFCKNNG5KGKUVGKPGO·JPNKEJGP5VÒEMCWHFGP$GUWEJ %JTKUVKCPU 8 KP FGT -QPIUDGTIGT 5KNDGTOKPG PCEJGORHWPFGP &CU XQTNKGIGPFG 'ZGORNCT KO )GYKEJV XQP \YGK   6CNGTPKUVCWHGKPGODGUQPFGTUFKEMGP5EJTÌVNKPIIGRT·IV



5MKNNKPI-QPIUDGTI#JNUVTÌO

5GJTUEJÌP



1979

1978



1978

5KNDGTOGFCKNNGXQP2$GTICWHFGP6QF-CTNU:++XQP5EJYGFGPXQTFGTPQTYGIKUEJGP(GUVWPI (TGFGTKMUVGP CO  0QXGODGT  PCEJ ITGIQTKCPKUEJGO -CNGPFGT CO  &G\GODGT  .CPFUEJCHV   OKV FGT PQTYGIKUEJGP (GUVWPI (TGFGTKMUVGP XQP FGT CWU GKP 5EJW­ CDIGHGWGTV YKTF KO 8QTFGTITWPF   NKGIV FGT VQVG UEJYGFKUEJG XQT FGO PQTYGIKUEJGP .ÌYGP#EJV <GKNGP F·PKUEJG 5EJTKHV  OO   I)CNUVGT1UUDCJT 8QPITQ­GT5GNVGPJGKV0WT'ZGORNCTGIGRT·IV *ÒDUEJG2CVKPCYKP\4CPFHGJNGTUGJTUEJÌP  &KG F·PKUEJG 4ÒEMUGKVGPKPUEJTKHV FKGUGT ·W­GTUV UGNVGPGP /GFCKNNG NCWVGV &GT UEJYGFKUEJG .ÌYG H·NNV FGO PQTYG   IKUEJGP.ÌYGPXQTFKG(Ò­G&CDGKJCVGTUGKP.GDGPXGTNQTGPWPFNGV\VGTGT$NWVXGTIQUUGP



5KNDGTOGFCKNNG  WPUKIPKGTV XGTOWVNKEJ XQP # , .WPFG CWH FGP $GUWEJ FGU -ÌPKIU WPF UGKPGU   5QJPGU-TQPRTKP\%JTKUVKCPKPFGP$GTIYGTMGPXQP-QPIUDGTI$ÒUVGTOKV.QTDGGTMTCP\WOIGNGIVGO /CPVGN WPF 'NGHCPVGPQTFGP CWH 2QFGUV OKV IGMTÌPVGO 0COGPU\WI <GKNGP 5EJTKHV /KV 4CPFUEJTKHV   OOI)CNUVGT/ÒUGNGT  4#VVTCMVKXGUXQT\ÒINKEJGU'ZGORNCTOKVHGKPGT6ÌPWPI  335


NORWEGEN

1980



1981

1982

5KNDGTOGFCKNNG  XQP 1 9KH CWH FKG ,CJTHGKGT FGT 5KNDGTITWDG KP -QPIUDGTI )GJCTPKUEJVGU   $TWUVDKNF T OKV WOIGNGIVGO /CPVGN WPF 'NGHCPVGPQTFGP KO #DUEJPKVV FTGK <GKNGP 5EJTKHV(NW­ OKV   0GDGPHNÒUUGP FCPGDGP XGTUEJKGFGPG 5EJCEJVÌHHPWPIGP )GD·WFG $·WOG UQYKG (GNFGT  OO   I)CNUVGT/ÒUGNGT 445GJTUEJÌPGU'ZGORNCTOKVUEJÌPGT6ÌPWPI  +O,CJTJCVVGFGT$CWGTPUQJP,CMQD%JTKUVQRJGTUÎP)TQUXQNFKOJGWVKIGO-QPIUDGTI\WH·NNKI5KNDGTGPVFGEMV &KGUGT <WHCNNUHWPF UQNNVG UKEJ CNU )NÒEMUHCNN WPF GTIKGDKIUVG 5KNDGTOKPG 0QTYGIGPU GTYGKUGP  ,CJTG UR·VGT   UEJPKVV FGT /GFCKNNGWT 1NCX 9KH KO #WHVTCI FGU MÌPKINKEJ 1DGTUGMTGV·TU 4QUVICCTF FKG XQTNKGIGPFG JÒDUEJG /G   FCKNNG CPN·­NKEJ FGU ,WDKN·WOU +P UGKPGT #DTGEJPWPI DGVQPVG 9KH FC­ FKG +PUEJTKHVGP OKV ICPV\ UWDVKNGP PGWIG   UEJPKVVGP $WEJUVCDGP IGUVCNVGV UGK WPF GT HÒT UQNEJG #TDGKV \WO CNNGTYGPKIUVGP  6CNGT UCWGT XGTFKGPV JCDG   -ÌPKI(TGFGTKM+8FGTFKG/GFCKNNGCPUGKPGP)GDWTVUVCIXGTVGKNVGDGYKNNKIVGFKGIGHQTFGTVG5WOOGWPFNKG­1NCX 9KHCNU5VGORGNUEJPGKFGTCPFGT/ÒP\UV·VVG-QPIUDGTICPUVGNNGP



-TQPG /CTM -QPIUDGTI#JNUVTÌO&CX

-N5EJTÌVNKPIUHGJNGTHCUVXQT\ÒINKEJ





-TQPG /CTM -QPIUDGTI#JNUVTÌO&CX

.GKEJVLWUVKGTVHCUVXQT\ÒINKEJ



1983

1984

1984



%JTKUVKCP8+5MKNNKPI-QPIUDGTI#JNUVTÌO

(CUVXQT\ÒINKEJ





%JTKUVKCP8++5RGEKGFCNGT-QPIUDGTI#JNUVTÌO&CX  5GJTUEJÌPpXQT\ÒINKEJ



1985

1987



5MKNNKPI-QPIUDGTI#JNUVTÌO



.QV5MKNNKPI Z  Z  Z CNNG/ÒP\UV·VVG-QPIUDGTI&C\W-W5MKNNKPI -QPIUDGTI#JNUVTÌO#JNUVTÌO Z  Z  Z  5VÒEM8QT\ÒINKEJWPFDGUUGT



(TGFGTKM8+5MKNNKPI-QPIUDGTI#JNUVTÌO

336

8QT\ÒINKEJp5VGORGNINCP\

8QT\ÒINKEJp5VGORGNINCP\

  


USA

2275

2274

2276



&QNNCT %GPVU 2JKNCFGNRJKC.KDGTV[%CRRGF$WUVV[RG;GQ5



5KNXGT&QNNCT2JKNCFGNRJKC.KDGTV[UGCVGF;GQ5



5KNXGT&QNNCT10GY1TNGCPU.KDGTV[UGCVGF;GQ5

2277

8QT\ÒINKEJ



(CUVUGJTUEJÌP



5GJTUEJÌP



2278

2279

2279



-W%GPV2JKNCFGNRJKC+PFKCP*GCF%GPVYKVJ.;GQ5

48QT\ÒINKEJ





%GPVU2JKNCFGNRJKC.KDGTV[*GCF;GQ5

445EJÌP





&QNNCT2JKNCFGNRJKC.KDGTV[$CTDGTJGCFV[RG;GQ5  9KP\4CPFHGJNGTXQT\ÒINKEJXQT\ÒINKEJp5VGORGNINCP\



2280

2281

2282

2282



&QNNCT2JKNCFGNRJKC.KDGTV[$CTDGTJGCFV[RG;GQ5 8QT\ÒINKEJp5VGORGNINCP\





&QNNCT2JKNCFGNRJKC.KDGTV[UVCPFKPI;GQ5

(CUV5VGORGNINCP\





5KNXGT&QNNCT2JKNCFGNRJKC2GCEG;GQ5

48QT\ÒINKEJ

 385


USA

2283 1:2



)TQ­GT 2T·IGUVGORGN  OKV 5KIPCVWT &ÌDTKEJ CWH FKG ,CJTHGKGT XQP )GQTIG 9CUJKPIVQP )G   QTIG9CUJKPIVQPCWHGKPGO2HGTF)GYKEJVMI*ÌJGECOO&WTEJOGUUGTECOO 8QT\ÒINKEJ



2284



&QNNCT&CPKGN$QQPG$KEGPVGPPKCN;GQ5  2TCEJVGZGORNCT(CUV5VGORGNINCP\





.QV(ÌFGTCVKQP3WCTVGT&QNNCT5&KOG *CNHFKOG1%GPVU%GPVU-W%GPV +PVGTGUUCPVGU.QVDKVVGDGUKEJVKIGP  5VÒEM)GTKPIGTJCNVGPpUGJTUEJÌP



2286

2'4510'0/'&#+..'0 

386

.KPEQNP #DTCJCO  -GPVWEM[ Ó 9CUJKPIVQP & % $GHTGKGT FGT 5MNCXGP WPF    2T·UKFGPVFGT75#$TQP\GOGFCKNNGXQP5'NNKUCWHFKG#WHJGDWPIFGT5MNCXGTGK$TWUVDKNFT OKV WOIGNGIVGO /CPVGN4KPI FCTKP RHNÒIGPFGT +PFKCPGT PCEJ N KP COGTKMCPKUEJGT .CPFUEJCHV KO   *KPVGTITWPF *CHGPCPUKEJV CW­GTJCND FGU 4KPIGU KPFKCPKUEJGT -TKGIGT OKV /GUUGT KP FGT 4GEJVGP OKV   FGT.KPMGPITGKHVGTKPFKG*CCTGGKPGUYGKVGTGPWPDGMNGKFGVGP+PFKCPGTUWOKJP\WUMCNRKGTGPFCTWP VGT \W FGP 5GKVGP -ÌEJGT 2HGKN WPF $QIGP WPVGP OGPUEJNKEJGT -QRH  OO 5NI (QPTQDGTV p   9WT\DCEJp 5VGORGNINCP\




VIETNAM

2287



$TQP\GOGFCKNNGWPUKIPKGTVCWHUGKPGP6QF$ÒUVGT0GWP<GKNGP\WO6GKNIGDQIGPG5EJTKHVOKV UGKPGP4GIKGTWPIUWPF5VGTDGFCVGPFCTWPVGT.QTDGGTWPF2CNOGP\YGKIIGMTGW\VWPFFWTEJ5EJNCPIGP TKPIXGTDWPFGPWOJGT'KEJGPWPF.QTDGGTMTCP\OO5NI(QPTQDGTVp9WT\DCEJp  5VGORGNINCP\



2288



9CUJKPIVQP )GQTIG  8KTIKPKC Ó 8KTIKPKC 'TUVGT 2T·UKFGPV FGT 8GTGKPKIVGP 5VCCVGP   XQP#OGTKMC$TQP\GOGFCKNNGXQP25$&WXKXKGTCWHFKG'KPPCJOGXQP$QUVQP$TWUVDKNFT )GQTIG 9CUJKPIVQP \W 2HGTFG DGINGKVGV XQP XKGT DGTKVVGPGP 5VCDUQHHK\KGTGP DGQDCEJVGV FKG $GNCIG   TWPI$QUVQPUFKGKO*KPVGTITWPFFCTIGUVGNNVKUVKO8QTFGTITWPFT-CPQPGPWPF-CPQPGPMWIGNPOO #FCOU$GPVNG[5HH'KOGT5NI(QPTQDGTV -N4CPFHGJNGTHCUV5VGORGNINCP\

2289



2289

$TQP\GOGFCKNNG  XQP , %JT 4GKEJ CWH UGKPGP 4ÒEMVTKVV XQP FGT 2T·UKFGPVUEJCHV 7PKHQTOKGTVGU   $TWUVDKNF T2QUVCOGPV OKV 9CRRGPUEJKNF FCTCWH NKGIGP CWH GKPGT &GEMG .QTDGGTMTCP\ (CUEGU WPF   5EJYGTVOO#FCOU$GPVNG[p5NI(QPTQDGTV9WT\DCEJ 5VGORGNINCP\

#00#/ 

2290





8+'60#/

6W&WE6KGPQ,-/5EJTQGFGT

5GJTUEJÌPpXQT\ÒINKEJ

 387


MÜNZWAAGEN

/ª0<9##)'0

2291

$'4)*'4<1)67/ 

&'765%*'44#7/

,QJCPP&CPKGNXQO$GTI.GPPGR Ó/ÒP\YCCIG4GEJVGEMKIGT-CUVGPCWU#JQTP JQN\OKVGKPGT/GUUKPIUEJNKG­G/C­GZZOO&CU&GEMGNKPPGTGKUVOKVFGO/GKUVGTGVKMGVV CWUIGHÒNNV WPF VT·IV KP FGT WPVGTGP TGEJVGP 'EMG FGP $TCPFUVGORGN ,756+46 9CCIG CWU 5VCJN OKV   5EJYCPGPJCNUGPFGPWPFOKVTWPFGP/GUUKPIYCCIUEJCNGPCPDGUEJ·FKIVGPVÒTMKUHCTDGPGP$·PFGTP&KG 9CCIGKUVMQORNGVVOKV)GYKEJVGPCNNGOKVFGPDGTIKUEJGP.ÌYGPIGRWP\VWPF#WUINGKEJUIG YKEJVGPªDGTFGP)TWDGP0QOKPCNDG\GKEJPWPIKPTQVGT(CTDG (CUVXQT\ÒINKEJGU'ZGORNCT



2292



388

,QJCPP%CURCT/KVVGNUVGPUEJGKF.GPPGR Ó/ÒP\YCCIG PCEJ 4GEJVGE MKIGT-CUVGPCWU#JQTPJQN\OKV5EJNKG­GP/C­GZZ&CU&GEMGNKPPGTGKUVOKVFGO/GK UVGTGVKMGVVCWUIGHÒNNV+O6GZVXQP+JTQ)TQ­JGT\QIN&WTEJNKO)TQ­JGT\QIVJWO$GTI9CCIGCWU 5VCJNOKV5EJYCPGPJCNUGPFGPWPFOKVTWPFGP/GUUKPIUEJCNGPCPITÒPGP$·PFGTP&KG9CCIGJCV )GYKEJVG DKU CWH FKG .UFQT)GYKEJVG UKPF CNNG OKV FGO DGTIKUEJGP .ÌYGP IGRWP\V 7PVGT FGO   /GUUKPIMN·RREJGPUKPF#UUIGYKEJVGªDGTFGP)TWDGP0QOKPCNDG\GKEJPWPIKPTQVGT(CTDG  (CUVXQT\ÒINKEJGU'ZGORNCT




MÜNZWAAGEN

2293

0ª40$'4)56#&6 

,QJCPP(TKGFTKEJ/C[GT /G[GT /GKUVGT.ÌYGPYCCIGPCEJ&GTCWUJGNNGO0W­DCWO JQN\IGHGTVKIVG-CUVGPJCVFKG/C­GZZOO*ÌJGOKV5VCVKXOO#WHFGOJKPVGTGP -CUVGPVGKN KUV OKVVKI GKP *QN\UQEMGN OKV /GUUKPIUEJTCWDIGYKPFG CPIGDTCEJV KP FGP FKG VGKNKIG   /GUUKPIU·WNG OKV GKPGO FTCEJGP·JPNKEJGP )CNIGP GKPIGUEJTCWDV YKTF +P FGO XQTFGTGP 6GKN FGU   )CNIGPU YKTF FKG 9CCIG CWU 5VCJN $CNMGPN·PIG  OO FGT6TQRHGTKUVNQUGFKG5EJPÒTGHGJNGP  OKV  TWPFGP /GUUKPIUEJCNGP &WTEJOGUUGT  OO  GKPIGJ·PIV &KG 5EJCNGP UKPF OKV FGO /GK   UVGT\GKEJGP FCU /·PPNGKP OKV FGT 5KEJGN WPF FKG +PKVKCNGP +(/ D\Y OKV FGO 0ÒTPDGTIGT   5VCFVYCRRGPIGRWP\V8QOJKPVGTGP6GKNFGU)CNIGPUHÒJTVGKPG5EJPWT HGJNV \WO(W­FGT5·WNGWPF YKTFFWTEJFKGUGXQTPG\WGKPGO.ÌYGPIGHÒJTV<KGJVOCPCPFGO.ÌYGPJGDVUKEJFKG9CCIGHCUV GTUEJÒVVGTWPIUHTGK+O-CUVGPDGHKPFGVUKEJGKPG.CFGOKVGKPGORTQHKNKGTVGP/GUUKPIMPQRH+PDGUQPFG TGP OKV TQUC IGOWUVGTVGO  2CRKGT CWUIGUEJNCIGPGP 8GTVKGHWPIGP NKGIGP FKG IGVGKNVG 5VCPFU·WNG FKG   9CCIG FKG 5EJCNGP FGT .ÌYG WPF FKG WTURTÒPINKEJ  )GYKEJVG CNNG OKV FGO 0ÒTPDGTIGT 9CRRGP   IGRWP\V  )GYKEJV HGJNV  /'4.&10!   )GYKEJV \W  5'8'4 CWU GKPGT DGTIKUEJGP 9CCIG  

/KVVGNUVGPUEJGKF! KUVDGKIGHÒIV+PFGT8GTVKGHWPIWPVGTFGP9CCIUEJCNGPKUVNQUGFCU'VKMGVVXQP,( /C[GT GKPIGNGIV #NU $GUQPFGTJGKV WPF UGNVGP IKNV FKG UR·VGTG 'KEJWPI FWTEJ FGP /ÒP\OGKUVGT -CTN   %JTKUVKCP4GDOCPP5VWVVICTV'TJCVUGKPGP0COGPUQYKGFKG9CRRGPXQP5VWVVICTVWPF9ÒTVVGODGTI OKVVGNU5VGORGNKONKPMGP6GKNFGT.CFGCPIGDTCEJV/KV·JPNKEJGP5VGORGNPJCVGTCWEJDGTIKUEJO·TMK UEJG /ÒP\YCCIGP KP FGT <GKV PCEJ  DKU  IGGKEJV 4GDOCPP GTUEJGKPV KO 5VWVVICTVGT #FTG­   DWEJXQPCNUMIN/ÒP\OGKUVGTWPF/GEJCPKMGT.KVGTCVWT *.QEMPGT&KG/GTM\GKEJGPFGT 0ÒTPDGTIGT4QVUEJOKGFG %NCWU*CIGT9ÒTVVGODGTIKUEJG5VGKPWPF/GVCNNIGYKEJVG 48QT\ÒINKEJGU'ZGORNCT  389


EINSATZGEWICHTE

51056+)'9##)'0 













.QV XQP  9CCIGP   /CKNCPF PCEJ  NGFGTÒDGT\QIGPGT -CUVGP KPPGP 9CUEJNGFGT OKV    )GYKEJVGP9CCIGPKEJV\WIGJÌTKI ! OKVFGHGMVGP$·PFGTPUEJNGEJVGT)GUCOV\WUVCPF 5RCPKGPWO JGNNGT*QN\MCUVGPOKVUVCTMGP)GDTCWEJUURWTGP9CCIGOKVTWPFGP5EJCNGPWPF)GYKEJVGP  )GUCOVGKPFTWEMUGJTUEJÌP



.QV XQP  9CCIGP   )GDTÒFGT 2QRRGPDGTI 5RTQEMJÌXGN FCVKGTV  OKV TGUVNKEJGP  )GYKEJVGP   FCXQP  PKEJV \WIGJÌTKI &KG 9CCIGHGJNVFCU'VKMGVVKUVUVCTMDGUEJ·FKIVD\YHNGEMKIGKPG5EJNKG­G HGJNVTWKPÌUGT)GUCOV\WUVCPF $GTNKPGT9CCIGOKV)GYKEJVGPKPTQVIGRTG­VGO2CRKGTÒDGT\QIG PGP-CUVGPFGT&GEMGNKUVNQUG 5EJPGNNYCCIG&GWVUEJGU4GKEJHÒTWPF/CTM )GN FTQNNGPRTÒHGTHÒT&/(C-CYCNGV\ )GUCOVGKPFTWEMUGJTUEJÌP



.QV XQP  $TKGHYCCIGP  'ZGORNCTG GPINKUEJGT WPF  FGWVUEJGT 2TQXKPKGP\GP OKV  Z  WPF  Z    5VCRGNIGYKEJVGPZFGWVUEJG)TCOOIGYKEJVGWPF'ZGORNCTQJPG)GYKEJVG  )GUCOVGKPFTWEMUGJTUEJÌP



.QV XQP    /ÒP\ #RQVJGMGT *CPFGNUIGYKEJVGP WPF  UKCOGUKUEJGP 2QT\GNNCP6QMGP   GKPGT   $CNMGPYCCIGOKVNQUGP5EJCCNGP GPINKUEJGP5VCRGNIGYKEJVGP PKEJV\WUCOOGPIGJÌTKI   )GUCOVGKPFTWEMUGJTUEJÌP



.QV XQP  0ÒTPDGTIGT 9CCIGP   2CWNWU &GNPGTV IGUVQTDGP   OKV  )GYKEJVGP FKG -WNGTIG   YKEJVG HGJNGP VGKNYGKUG 1TKIKPCNYCCIG OKV DGUEJ·FKIVGP 5EJPÒTGP  #UUIGYKEJVG   *QN\MCUVGP OKV   &GEMGNXGT\KGTWPIGP FGT &GEMGN KUV NQUG WPF FKG )GYKEJVG HGJNGP 9CCIG OKV FTGKGEMKIGT WPF TWPFGT   5EJCNGQJPG/GKUVGTOCTMG 5GJTUEJÌPUEJÌP



.QVXQPGPINKUEJGP9CCIGP 5QXGTGKIP4QEMGT(C9$NGYKP2CRRUEJCEJVGN 5QXGTGKIP4QE MGTNQUG $NCEMLCRCPPGFVKPPGFKTQPECUG6[ROKV9CCIGWPFXGTUEJKGFGPG)TCKP)GYKEJVGP UEJNGEJVGT<WUVCPF #RQVJGMGTYCCIGKO'KEJGPMCUVGP9CCIGOKV)NCUUEJCNGP)GYKEJVGHGJNGP  )GUCOVGKPFTWEMUGJTUEJÌP



.QVXQP9CCIGPWPF)GYKEJVUU·V\GP 9CCIGPCWU#HIJCPKUVCP2GTUKGPKPRTKOKVKXGP*QN\M·UVGP OKV 9CCIG WPF  D\Y  CEJVGEMKIGP )GYKEJVGP UV·TMGTG )GDTCWEJUURWTGP   /QFGTPG 9CCIG CWU   KPFKUEJGT 2TQFWMVKQP OKV  )GYKEJVGP WPF FKXGTUGP /KNNKITCOOIGYKEJVGP &GMQTCVKQPUQDLGMV     &KCOCPVYCCIG CWU FGO  ,CJTJWPFGTV JGNNGT -CUVGP OKV &TWEMXGTUEJNW­ 9CCIG XGTEJTQOV    XGTUEJKGFGPG -CTCVIGYKEJVG FKXGTUG /KNNKITCOOIGYKEJVG UQYKG  )TCOOIGYKEJVG   'KP 5CV\ &G   \KOCNIGYKEJVG XQP    I WPF FKXGTUG /KNNKITCOOIGYKEJVG KO TÌVNKEJGP *QN\MCUVGP     #RQVJGMGPYCCIG HÒT  I OKV $CMGNKV5EJCNG KP GKPGT 2CRRUEJCEJVGN DGKIGNGIV KUV GKP $NQEM OKV    #PCN[UGIGYKEJVGP )GUCOVGKPFTWEMUGJTUEJÌP



'+05#6<)'9+%*6' 



.QVXQP'KPUCV\IGYKEJVGP 2HWPF/GKUVGT,QJCPP)GQTI$TWPPGT0ÒTPDGTI1TKIKPCNVGKNG OKV*KTUEJUVCPIGPIGRWP\VWPF'TI·P\WPIGP )TCOOGU5EJYGK\OKV2WP\G<+').'4WPF 0ÒTPDGTI /GKUVGTOCTMG XQP ,QJCPP )GQTI $TWPPGT OKV  1TKIKPCNVGKNGP    ) OKV WPIGFGWVGVGP   $CPFUVGORGNWPF6GKNG 6GKNGXQP'KPUCV\IGYKEJVGP )GUCOVGKPFTWEMUGJTUEJÌP



.QV XQP  'KPUCV\IGYKEJVGP    2HWPF 0ÒTPDGTI 'KEJOCTMG -GNEJ WPF $ )GJ·WUG WPF    'KPU·V\GCNNGOKVDC[TKUEJGP9CRRGP )$CPFUVGORGN&4)GJ·WUGWPF'KPU·V\G UKPF QTKIKPCN    )  $CPFUVGORGN   0&$   KO )GJ·WUG  'KPU·V\G OKV *KTUEJUVCPIGP   IGRWP\V'KPUCV\OKVDC[TKUEJGP9CRRGP 2HWPF$C[GTP ! QJPG&GEMGN'KPU·V\GOKVDC[TK UEJGP9CRRGP )GUCOVGKPFTWEMUGJTUEJÌP



2303



390

(TCPMTGKEJ  1PEGU   ) (TCPMTGKEJ OKV /CTMG / WPVGT FGT -TQPG /GKUVGT 8CTCPIQV 2¾TG  

 D\Y/QPVKGT  .CXCIPG0T(-QORNGVVOKV'KPU·V\GPKPMNWUKXG5EJNW­ UVGKP 5GJTUEJÌP




MÜNZBECHER

/ª0<)'(55'

2305 (verkleinert)

2304 (verkleinert)

/ª0<$'%*'4 &'765%*.#0& 

-ÌNP5KNDGTPGT$GEJGTIGHGTVKIVXQT'KPG#TDGKVFGU-ÌNPGT/GKUVGTU*GKPTKEJ5VTÌVIGP IGDQTGP IGUVQTDGPPCEJ )GH·­OKVINCVVGTUKEJKPIGTCFGT.KPKGNGKEJVPCEJCW­GPPGKIGPFGT9CP FWPIWPFRTQHKNKGTVGT.KRRG&GT9CPFWPIUFGMQTDGUVGJVCWUFTGKJQEJQXCNGPOKV$NWOGPITCXWTCWUIG UVCVVGVGP/GFCKNNQPUKPPGTJCNDGKPGUHN·EJKICPIGNGIVGP5EJNCPIGPJCWVOWUVGTUFCUPCEJQDGPJKPFWTEJ GKPWONCWHGPFITCXKGTVGUHGKPGU.KPKGPRCCTXQPGKPGTUEJOCNGPINCVVGPTCPFDGINGKVGPFGP<QPGCDIGUGV\V KUV +O $QFGP DGKFUGKVKI GKPIGCTDGKVGV KUV GKP  KP &TGUFGP KO 0COGP FGU U·EJUKUEJGP -WTHÒTUVGP   ,QJCPP)GQTI+IGRT·IVGT8KGTVGNVCNGT 5NI/GTUGDWTIGT%NCWUU-CJPV #WHFGT$QFGPWP VGTUGKVGDGHKPFGPUKEJ\YGK2WP\KGTWPIGPOKVFGO/GKUVGT\GKEJGP5VTÌVIGPU UEJKNFHÌTOKIGT5VGORGNOKV GKPGO /QPQITCOO CWU FGP +PKVKCNGP * WPF 5  UQYKG FKG 9KFOWPIU QFGT $GUKV\GTUKIPCVWT OKV FGP   +PKVKCNGP6WPF#UQYKGFKG,CJTGUCPICDG&KGFTGK<KGTOGFCKNNQPUWPFFKGWONCWHGPFGINCVVGQDGTG 4CPF\QPGUKPFFWTEJ(GWGTXGTIQNFWPIDGVQPVFCU+PPGTGFGU$GEJGTUKUVGDGPHCNNUXGTIQNFGV*ÌJG OO/ÒPFWPIUFWTEJOGUUGTOO$QFGPFWTEJOGUUGTOO)GYKEJVI  W­GTUVUGNVGPG#TDGKVFGU-ÌNPGT/GKUVGTU*GKPTKEJ5VTÌVIGP <YGKMNGKPGWPDGFGWVGPFG4GRCTCVWTUVGNNGPKPFGT9CPFWPIUGJTUEJÌPGTJCNVGP  #WHH·NNKIGTYGKUG VT·IV FKGUGT -ÌNPGT $GEJGT MGKP $GUEJCW\GKEJGP FGT 5VCFV 9KG LÒPIUV &T .WV\ +NKUEJ 6ÒDKPIGP   DGNGIGPMQPPVGKUVFKGUGU1DLGMVGKPHTÒJGUDGTGFVGU<GWIPKUHÒTFKG2TCZKUFGT-ÌNPGT)QNFWPF5KNDGTUEJOKGFG OGKUVGT FKG GPVIGIGP FGT )QNFUEJOKGFGCOVUQTFPWPI #TDGKVGP CWU NÌVKIGO 5KNDGT JGTUVGNNVGP WPF FKGUG NGFKINKEJ   OKVKJTGO<GKEJGPWPFGKPGO6TGOQNKGTUVKEJMGPP\GKEJPGVGP+NKUEJYGKUVFCTCWHJKPFC­GTUVCDFGO,CJTKP -ÌNP NÌVKIGU 5KNDGT OKV GKPGO $GUEJCW\GKEJGP \W XGTUGJGP YCT YKG FKG KP FKGUGO ,CJT GKPIGHÒJTVG PGWG )QNF   UEJOKGFGCOVUQTFPWPI FQMWOGPVKGTV &CDGK YWTFG FGT XQP GVNKEJGP /GKUVGTP OKUDTCWEJVGT 5VKEJ I·P\NKEJ CDIG   UEJCHHV )ÒPVJGT+TOUEJGT&CU-ÌNPGT)QNFUEJOKGFGJCPFYGTM-ÌNP5   +PFGTITWPFNGIGPFGP5VWFKG\WFGPTJGKPKUEJGP5KNDGTCTDGKVGPMQPPVGPNGFKINKEJHÒPH#TDGKVGPFGU/GKUVGTU*GKPTKEJ 5VTÌVIGP GTHC­V YGTFGP *KGTDGK JCPFGNV GU UKEJ CWUUEJNKG­NKEJ WO ITÌ­GTHQOCVKIGU -KTEJGPIGT·V /QPUVTCP\GP   -GNEJG #NVCTNGWEJVGT FCTWPVGT CWEJ GKP <KDQTKWO XQP  GDGPHCNNU QJPG $GUEJCW\GKEJGP  UKGJG %CTN9KNJGNO   %NCUGP4JGKPKUEJG5KNDGTOCTMGP4JGKPDCEJ/GT\DCEJ50T

4755.#0& 

5KNDGTPGT/ÒP\DGEJGT 6WOONGT IGHGTVKIVWO*GTIGUVGNNVCWUGKPGOUEJCNGPHÌTOKIIGVTKGDGPGP TWUUKUEJGP 4WDGN FGUUGP 4CPFUEJTKHV CWH FGO )GH·­TCPF GTJCNVGP IGDNKGDGP KUV +O $QFGP DGKFUGKVI   UKEJVDCTGKPIGCTDGKVGV4W­NCPF'NKUCDGVJ2GVTQXPC)TKXGPPKM9CPFWPIKPPGPUQYKGGKPGTCPF PCJG<QPGCW­GPXGTIQNFGV*ÌJGOO&WTEJOGUUGT-QTRWUOO)GYKEJVI  8QPITQ­GT5GNVGPJGKV5RCPPWPIUTK­CO4CPFUQPUVXQPUGJTUEJÌPGT'TJCNVWPI  0CEJ FGT 8GTVTGKDWPI FGT TWUUKUEJGP 6TWRRGP MCOGP CNU XCVGTN·PFKUEJG 5QWXGPKTU FKG CWU TWUUKUEJGP 4WDGNP   CWUIGVTKGDGPGP 4WDGNDGEJGT KP /QFG  DGUEJTGKDV )GQTI *KNVN &CU *QJGP\QNNGTP/WUGWO KO 5EJNQUUG /QP   DKLQW \W $GTNKP KP &CJGKO $F   5  2GTUÌPNKEJG )GIGPUV·PFG CWU FGO $GUKV\ (TKGFTKEJU FGU   )TQ­GPKO*QJGP\QNNGTP/WUGWO$GTNKPFCKUVFGTCWUGKPGO4WDGNPCEJFGT5EJNCEJVXQP<QTPFQTHIGHGTVKIVG UKNDGTPG 6TKPMDGEJGT OKV FGT +PUEJTKHV #WU 4WUUNCPF -COGP YKT IGICPIGP WPF DG[ <QTPFQTH WORHCPIGP XQP   (TKGFTKEJ FGO )TQUUGP *GNF 9KT YQNVGP '[NKIUV PCEJ $GTNKP DNKGDGP CDGT XQT %ÒUVTKP FC YWTFGP YKT IGUEJNCIGP   WPFFWTHVGPPKGOCPFUCIGP8KXCV.G4QKF#WIWUV

391


MÜNZSCHALE

2306 (ca. 1:2)

/ª0<5%*#.' 

$GTNKP &GMQTCVKXG UKNDGTPG /ÒP\UEJCNG IGHGTVKIV WO  5KNDGTPG HNCEJ IGOWNFGVG 2NCVVG   #TDGKVFGU$GTNKPGT5KNDGTYCTGPJGTUVGNNGTU)GDTÒFGT(TKGFN·PFGT#WHXKGTDNCVVHÌTOKIIGCT DGKVGVGP (Ò­GP UVGJGPFGT VGNNGTHÌTOKIGT -QTRWU KP FGUUGP 5RKGIGN KPUIGUCOV  VCNGTHÌTOKIG /ÒP\GP   FGU  DKU  ,CJTJWPFGTVU GKPIGCTDGKVGV UKPF W C *CDUDWTI 'T\JGT\QI (GTFKPCPF 6CNGT Q ,   ,QUGRJ + 6CNGT  $TCWPUEJYGKI9QNHGPDÒVVGN 2HCHHGPHGKPFVCNGT  )NQEMGPVCNGT    &GWVUEJGT1FGP6CNGT5CEJUGP4GKEJUVCNGTCWHFKG,CJTHGKGTFGTªDGTICDGFGT#WIU DWTIGT-QPHGUUKQP5VGTDGVCNGT6CNGTFKXGTUG6CNGTOKV5VCFVCPUKEJVGPFGU,CJTJWPFGTVU 1NOÒV\6CNGT&GWVUEJGU4GKEJ2TGWUUGP/CTMGVE&KG$GTGKEJG\YKUEJGPFGP/ÒP\GP UKPF OKV TGKEJGT 2HNCP\GPQTPCOGPVKM IGHÒNNV &GT OKV GKPGT OGJTHCEJ RTQHKNKGTVGP 4CPFDQTVG   CWUIGUVCVVGVGUQPUVUEJNKEJVG5EJCNGPTCPFVT·IV\YGK9KFOWPIUITCXWTGP<WO'KPGPFKG&CVWOUCPICDG  /#+  UQYKG \WO #PFGTGP FKG ,WDKN·WOUYKFOWPI &4 /14+6< )7/$+00'4     &GT4CPFFGT5EJCNG\GKIVCWHFGT7PVGTUGKVGGKPG/GKUVGTRWP\GUQYKGGKPGPGT5KNDGTUVGORGN #VVTCMVKXGU 1DLGMV GKPGT DGFGWVGPFGP $GTNKPGT 5KNDGTYCTGPOCPWHCMVWT FGU  ,CJTJWPFGTVU   &WTEJOGUUGTECEO)GYKEJVI )GRHNGIVGU1DLGMVXQPUGJTUEJÌPGT'TJCNVWPI  &GT,QWTPCNKUV6JGCVGTMTKVKMGTWPF5EJTKHVUVGNNGT&T/QTKV\)WODKPPGT  YCTDKU\WO,CJTG  NCPIL·JTKIGT /KVCTDGKVGT WPF .GKVGT FGU 2CTNCOGPVCTKUEJGP $ÒTQU FGT -ÌNPKUEJGP <GKVWPI $GTNKP  #WH FGT   ,QWTPCNKUVGPVTKDÒPG FGU 4GKEJUVCIGU WPF FGU .CPFVCIGU YCT GT GKPG FGT DGMCPPVGUVGP 2GTUÌPNKEJMGKVGP 'T YCT   $GITÒPFGTFGU8GTGKPU$GTNKPGT2TGUUGFGOGTUGKVDKU\WUGKPGO6QFGCPIGJÌTVGWPFDGVGKNKIVGUKEJTGIGKO $GTNKPGT -WNVWT WPF ÌHHGPVNKEJGP .GDGP 5Q YCT GT UGKV  JKGT /KVINKGF KO 9QJNHCJTVUXGTGKP )GUGNNUEJCHV FGT   (TGWPFGFGTKONGV\VGP8KGTVGNFGU,CJTJWPFGTVUGKPGPOC­IGDNKEJGP6TGHHRWPMVFGT$GTNKPGT9KTVUEJCHVUWPF (KPCP\GNKVG FCTUVGNNVG  UVCPF GT KO 8GTFCEJV CNU RQNKVKUEJGT ,QWTPCNKUV KPVGTPG +PHQTOCVKQPGP FGU FGWVUEJGP   $WPFGUTCVGUCPFKG¤HHGPVNKEJMGKVIGDTCEJV\WJCDGP$KUOCTEMNKG­FCTCWHJKPIGIGPKJPGKP'TOKVVNWPIUXGTHCJTGPKP FKG9GIGNGKVGPFCULGFQEJQJPGGTPUVJCHVG-QPUGSWGP\GPHÒTFGP$GUEJWNFKIVGPCDIGUEJNQUUGPYWTFG

392


16 Figuren aus der Affenkapelle. Meißen, die Modelle von J.J. Kaendler und P. Reinicke, um 1753, Ausformungen ab 1753 - ca. 1780. Auktion am 15. Mai 2009

Einladung zu Einlieferungen Herbstauktionen 2009 in Köln Antiquarische Bücher, Alte Kunst und Kunstgewerbe Moderne und Zeitgenössische Kunst, Photographie sowie Asiatische Kunst

LEMPERTZ gegründet 1845

Neumarkt 3 50667 Köln Poststraße 22 10178 Berlin www.Lempertz.com

Tel. 02 21 ⁄ 92 57 29 - 0 Fax - 6 Tel. 030 ⁄ 27 87 60 8 -0 Fax - 6 info@Lempertz.com


HINWEISE FÜR UNSERE BIETENDEN AUKTIONSKUNDEN 1. Die Auktionsbedingungen finden Sie am Ende dieses Katalogs. 2. Bitte senden Sie uns Ihre Aufträge möglichst frühzeitig zu. Wenn uns Ihr Auftrag erst kurz vor der Auktion erreicht, können sich bei der Bearbeitung Fehler einschleichen. 3. Das beiliegende Formular macht es Ihnen leicht, ein schriftliches Gebot abzugeben. Falls Sie Ihre Gebote faxen möchten: unser Telefax 05 41-96 20 222 steht Ihnen Tag und Nacht zur Verfügung. 4. Die von Ihnen ersteigerten Objekte werden Ihnen innerhalb von acht Tagen nach Beendigung der Auktion zugeschickt. Die Aufträge werden in der Reihenfolge des Eingangs bearbeitet, d. h. die zuerst eingegangenen Aufträge werden auch zuerst bearbeitet. Auch alle Bieter, die keinen Zuschlag erhalten haben, werden von uns nach der Auktion benachrichtigt. 5. Wenn Sie telefonisch bieten möchten, teilen Sie uns diesen Wunsch bitte mindestens 48 Stunden vor der Auktion mit. Unseren Kundenservice erreichen Sie unter 05 41-96 20 20 oder gebührenfrei unter 08 00-58 36 537. 6. Wenn Sie als neuer Kunde noch nicht bei uns gekauft haben, ist es empfehlenswert, wenn Sie uns Referenzen angeben. Nennen Sie uns eine Münzhandlung, mit der Sie bereits in Geschäftsverbindung stehen. Oder rufen Sie unseren Kundenservice an. 7. Die Echtheit aller verkauften Objekte wird auch über die gesetzliche Frist hinaus gewährleistet. 8. Alle Kunden, die als Bieter an einer unserer Auktionen teilnehmen, erhalten innerhalb von zwei Wochen nach der Auktion unsere Ergebnisliste gratis. 9. Sie haben Fragen zu einer bestimmten Münze? Sie möchten persönlich an unserer Auktion teilnehmen? Sie haben andere Fragen? Unser Kundenservice freut sich auf Ihren Anruf, entweder direkt unter 05 41-96 20 20 oder gebührenfrei unter 08 00-58 36 537.

IMPORTANT INFORMATION FOR PLACING BIDS 1. The terms and conditions of the auction can be found at the end of this catalogue. 2. Please send us your instructions as early as possible. The likelihood of errors occurring increases if we do not receive your instructions until shortly before the auction. 3. The enclosed form makes it simple for you to submit a written bid. Our fax machine +49 (0)541 – 96 20 222 is on standby day and night in case you wish to fax your bids. 4. The objects which you purchase will be delivered to you within eight days of the close of auction. Instructions are processed in the same order as they were received – in other words, the first instructions to be received are the first to be processed. All unsuccessful bidders will be also informed after the auction. 5. If you would like to bid by telephone, please ring our customer service beforehand on +49 (0)541 - 96 20 20. 6. If you are a new customer who has not yet bought anything through us, we recommend that you give us references. Name a coin dealer with whom you have already done business. Or call our customer service. 7. The genuineness of all sold objects is also warranted beyond the statutory length of time. 8. All customers who participate as bidders in our auction receive our list of results free of charge within two weeks of the close of auction. 9. Do you have questions about a particular coin? Would you like to participate personally in our auction? Do you have any other questions? Our customer service team will be pleased to help you – call on +49 (0)541 - 96 20 20.

RENSEIGNEMENTS À L'ATTENTION DE NOS CLIENTS DES VENTES AUX ENCHÈRES 1. Vous trouverez les conditions générales de vente aux enchères à la fin de ce catalogue. 2. Veuillez nous faire parvenir vos ordres le plus tôt possible. Si vos ordres nous parviennent juste avant la vente aux enchères, des erreurs risquent d’être commises lors de leur traitement. 3. Le formulaire ci-joint vous aidera à rédiger facilement votre offre. Si vous souhaitez faxer votre offre, vous pourrez le faire 24 heures sur 24 au +49 (0)541 – 96 20 222. 4. Les objets dont vous serez adjudicataire vous seront envoyés dans les huit jours suivant la fin de la vente aux enchères. Les commandes seront prises en compte dans l’ordre de leur arrivée, c’est-à-dire que les commandes nous parvenant les premières seront d’abord traitées. Après la vente aux enchères, nous préviendrons tous les enchérisseurs n’ayant pas obtenu l’adjudication. 5. Si vous souhaitez faire des enchères par téléphone, veuillez appeler aupravant notre service clientèle au +49 (0)541 – 96 20 20. 6. Si vous êtes un nouveau client et n’avez encore fait aucune acquisition chez nous, il serait conseillé de nous fournir quelques références. Indiquez nous si vous traitez déjà avec un professionnel du commerce des monnaies. Ou contactez notre service clientèle au +49 (0)541 – 96 20 20. 7. L’authenticité des pièces vendues sera garantie même au-delà des délais légaux. 8. Tous les clients participant à l’une de nos ventes aux enchères en tant qu’enchérisseurs recevront gratuitement une liste de résultats dans les deux semaines suivant la vente aux enchères. 9. Vous avez des questions concernant une pièce particulière? Vous désirez prendre part personnellement à notre vente aux enchères? Vous avez d’autres questions? Notre service clientèle se fera un plaisir de vous répondre au +49 (0)541 – 96 20 20.

INFORMAZIONI PER GLI OFFERENTI DELLE NOSTRE ASTE 1. Le condizioni d’asta si trovano alla fine di questo catalogo. 2. Siete pregati di inviarci i vostri ordini il più presto possibile. Se il vostro ordine ci perviene poco tempo prima dell’apertura dell’asta, si possono verificare errori nell’elaborazione dello stesso. 3. Per le vostre offerte scritte potete utilizzare il modulo allegato al catalogo. Nel caso voleste trasmettere le vostre offerte per fax, siete pregati di inviarle al seguente numero: +49 (0)541-96 20 222. 4. Gli oggetti che avete acquistato all’asta vi saranno spediti entro otto giorni dal termine della stessa. Gli ordini vengono evasi in base alla data di ricevimento, quindi hanno precedenza quelli pervenuti prima. Anche gli offerenti che non hanno avuta alcuna aggiudicazione riceveranno una nostra comunicazione al termine dell’asta. 5. Se desiderate la partecipazione telefonica in diretta durante l´asta, siete pregati di chiamare prima la consulenza ai clienti al numero diretto +49 (0)541-96 20 20. 6. Se siete clienti nuovi e non avete mai acquistato da noi, vi proponiamo di inviarci delle referenze. Dateci il nome di un negozio di monete presso il quale avete già fatto degli acquisti, oppure chiamate la nostra consulenza ai clienti al numero +49 (0)541 96 20 20. 7. Il certificato d’autenticità di tutti gli oggetti venduti viene rilasciato anche oltre i termini privisti per legge. 8. Tutti i clienti che hanno partecipato ad una nostra asta riceveranno gratuitamente l´elenco delle aggiudicazioni entro quindici giorni dal termine della stessa. 9. Avete delle domande su una moneta in particolare ? Desiderate partecipare personalmente ad una nostra asta? Avete altre domande? Rivolgetevi al nostro Servizio Clienti al numero +49 (0)541 – 96 20 20.


MEINE TEILNAHME ALS SCHRIFTLICHER BIETER 1. 2. 3. 4. 5. 6. 7.

Studieren Sie den Katalog sorgfältig und notieren Sie alle Lose, die interessant für Sie sind. Legen Sie für jedes Los Ihr persönliches Limit fest, das Sie maximal zu zahlen bereit sind. Füllen Sie das beiliegende Formular aus (siehe rechte Seite) und tragen Sie für jedes Los Ihr Höchstgebot ein. Schicken Sie uns Ihren Auftrag frühzeitig. Bei gleich hohen Geboten erhält das zuerst eingegangene Gebot den Zuschlag. Sie haben interessante Lose für insgesamt € 10.000,-- gefunden, möchten jedoch nur € 2.000,-- ausgeben. Kein Problem: Sie geben als Gesamtlimit (ohne Aufgeld) € 2.000,-- an. Wenn Sie Fragen haben: Die MitarbeiterInnen unserer Kundenbetreuung sind für Sie da. Tel. 0800 – 583 65 37 (gebührenfrei). Wenn Sie telefonisch an unseren Auktionen teilnehmen möchten, ist das ab einer Schätzung von € 500,- pro Los möglich. Bitte teilen Sie uns diesen Wunsch mindestens einen Werktag vor Beginn der Versteigerung schriftlich mit.

MEINE PERSÖNLICHE TEILNAHME IN OSNABRÜCK 1.

3.

Wir freuen uns sehr, wenn Sie persönlich nach Osnabrück kommen möchten. Das Flair einer Auktion und die Stimmung im Auktionssaal sind ein besonderes Erlebnis für Sie als Sammler. Osnabrück ist außerdem immer eine Reise wert und die persönliche Betreuung durch unsere Mitarbeiter wissen immer mehr Kunden zu schätzen. 2. Bitte rufen Sie uns rechtzeitig an, damit wir Ihnen Tipps für die Anreise geben und Ihnen ein Hotelzimmer reservieren können. Sie erreichen uns gebührenfrei unter: 0800 – 5 83 65 37. Als erfolgreicher Bieter können Sie Ihre neu erworbenen Stücke gleich persönlich mit nach Hause nehmen. Als guter Kunde unseres Hauses haben Sie 20 Tage Zahlungsziel nach der Auktion.

WIE ENTSTEHT DER PREIS EINER AUKTION? 1. 2.

Der im Auktionskatalog angegebene Preis ist ein Schätzpreis, der durch unsere Experten festgelegt wurde. Das Mindestgebot liegt bei 80% dieses Wertes. Die Zuschlagpreise sind oft deutlich höher als die Schätzpreise. Als Auktionshaus müssen wir bereits vor der Auktion alle schriftlichen Gebote koordinieren. Folgende Beispiele sind im Bietverfahren möglich:

Beispiel 1 (Schätzpreis: € 1.000,--) Es liegt kein schriftlicher Auftrag vor: der Auktionator ruft das Los in der Auktion mit € 800,-- aus. Wenn im Saal nur ein Bieter darauf ein Gebot abgibt, erhält der Saalbieter den Zuschlag für € 800,--.

Beispiel 3 (Schätzpreis: € 1.000,--) Es liegt dem Auktionator nur ein schriftliches Gebot von € 850,-- vor: das Los wird in der Auktion mit € 800,-ausgerufen. Falls kein Bieter im Saal ein Gegenangebot abgibt, erhält der schriftliche Bieter den Zuschlag bei € 800,--.

Beispiel 2 (Schätzpreis: € 1.000,--) Es liegen dem Auktionator drei schriftliche Gebote vor:

Beispiel 4: (Schätzpreis: € 1.000,--) Es liegt dem Auktionator nur ein schriftliches Gebot von € 1.200,-- vor: der Auktionator ruft das Los mit € 800,-- aus. Gibt es im Saal keinen Gegenbieter, erhält der schriftliche Bieter den Zuschlag bei € 800,--. Falls es im Saal Gegenbieter gibt, bietet der Auktionator für seinen schriftlichen Bieter bis maximal € 1.200,-- und erteilt einem Gegenbieter im Saal erst bei mehr als € 1.200,-- den Zuschlag.

Bieter 1: Limit € 2.900,-Bieter 2: Limit € 1.800,-Bieter 3: Limit: € 800,-Nach der Versteigerungsordnung muss der Auktionator im Interesse von Bieter 1 und 2 angemessen überbieten (um ca. 5 bis 10%). Der Ausrufpreis in der Auktion beträgt daher im Interesse von Bieter 1, € 1.900,-- (obwohl die Schätzung € 1.000,-- beträgt). Falls keine höheren Gebote aus dem Saal erfolgen, erhält Bieter 1 den Zuschlag für € 1.900,--. Das Höchstangebot von € 2.900,-- musste nicht ausgeschöpft werden.

Beispiel 5 (Schätzpreis: € 1.000,--) Es liegen drei Gebote von je € 975,-- vor: um Missverständnisse zu vermeiden, überzieht der Auktionator das zuerst eingegangene Gebot geringfügig und erteilt den Zuschlag bei € 1.000,--.


MUSTERAUKTIONSAUFTRAG FÜR SCHRIFTLICHE BIETER 1. Name, Adresse, Telefon: Ihre vollständige Anschrift ist wichtig, damit wir Ihren Auktionsauftrag annehmen und bearbeiten können. Ihre Telefonnummer brauchen wir, um Sie bei Rückfragen zu Ihren Geboten schnell erreichen zu können.

5. Ihre Kundennummer Die Angabe Ihrer Kundennummer unterstützt uns bei der Bearbeitung Ihres Auktionsauftrages. Viele Vorarbeiten für die Auktion werden dadurch einfacher und es werden Fehler vermieden.

2. Losnummern und Gebote Listen Sie alle Lose, für die Sie sich interessieren, mit ihrer Katalognummer auf und legen Sie für sich selbst fest, wie viel Sie bereit sind für jedes einzelne Los zu bieten.

6. Ihr Limit pro Einzellos An dieser Stelle geben Sie an, was Sie für jedes einzelne Stück maximal bereit sind auszugeben.

3. „Oder“-Gebote Wenn Sie sich für mehrere Münzen interessieren, aber nur ein Stück davon erwerben wollen, können Sie Ihre Gebote einfach mit einem „oder“ verbinden. Wichtig: bei den „oder“-Geboten können Sie nicht auf frühere Katalognummern zurückgreifen (z.B. 2890 oder 1558), da die Nr. 1558 dann bereits versteigert ist.

4. Unterschreiben Sie Ihren Auktionsauftrag . . .nachdem Sie Ihre Angaben noch einmal überprüft haben. Ihre Unterschrift ist wichtig, denn damit bestätigen Sie uns, dass sie tatsächlich teilnehmen wollen.

7. Überschreitung Ihrer Limits pro Einzellos In der Praxis zeigt sich, daß oft mehrere Bieter mit ihren Geboten dicht beieinander liegen. Deshalb empfiehlt es sich, an dieser Stelle einer geringfügigen Überschreitung Ihrer Gebote zuzustimmen. Dadurch erhöhen sich Ihre Chancen, im Wettbewerb mit anderen den Zuschlag zu erhalten. 8. Begrenzung Ihres Gesamtlimits Hier können sie die Gesamtsumme Ihrer Gebote begrenzen und festlegen, was Sie insgesamt maximal bereit sind auszugeben. Aufgeld und Mehrwertsteuer kommen später noch hinzu.

ANTWORTEN AUF FRAGEN, DIE UNS OFT GESTELLT WERDEN 1.

Zuschlagpreis/Aufgeld: Wir berechnen als Auktionshaus ein Aufgeld von 15% auf den Zuschlagpreis, dazu kommt die gesetzliche Mehrwertsteuer.

Beispiel 2: Zuschlagpreis: € 1.000,-€ 100,-Aufgeld 15% € 150,-€ 15,00 Versandkosten, z. B.* € 5,90 € 5,90 MwSt. 7% € 80,91 € 8,46 ______ ________ Rg.-Betrag € 1.236,81 Rg.-Betrag € 129,36 Mehrwertsteuer: üblicherweise in Deutschland 7%, seit dem 01.01.2000 sind viele Goldmünzen, die nach 1800 geprägt wurden, steuerfrei. Bei Fragen zu der MWSt-Berechnung rufen Sie uns an, gebührenfrei unter: 0800 / 5836537. Rücklosverkauf: Alle Lose, die in der Auktion nicht verkauft wurden, können Sie innerhalb von vier Wochen nach der Versteigerung zu 80% des Schätzpreises (zzgl. Aufgeld und Mehrwertsteuer) erwerben. Achtung: Viele Rücklose sind schnell vergriffen. Unser Spezialservice: Alle Bieter erhalten gratis die Ergebnisliste innerhalb von zwei Wochen nach der Auktion. Im Internet können Sie die Ergebnisliste der Auktion sofort nach der Auktion unter www.kuenker.de einsehen. Beispiel 1:

2. 3.

4.

Zuschlagpreis Aufgeld 15%: Versandkosten, z.. B.* MwSt. 7%

* Die Kosten für Versand und Versicherung werden nach Aufwand berechnet.


VERSTEIGERUNGSBEDINGUNGEN Die Versteigerung erfolgt im Auftrag und für Rechnung der Eigentümer unter Einhaltung der sich aus der Versteigerungsordnung (BGB1 I 1976, 1346) ergebenden und für Kommissionäre geltenden gesetzlichen Bestimmungen des BGB und HGB gegen Barzahlung des Kaufpreises in € - Währung. Durch Abgabe eines Gebotes werden die Versteigerungsbedingungen anerkannt, dies gilt auch für die schriftlichen Gebote. Der Zuschlagpreis ist Nettopreis im Sinne des Umsatzsteuergesetzes und bildet die Berechnungsgrundlage für das vom Käufer zu zahlende Aufgeld in Höhe von 15 %. Auf den daraus entstehenden Gesamtpreis (Zuschlag + Aufgeld) wird die jeweils gültige Umsatzsteuer erhoben, soweit dies gesetzlich vorgeschrieben ist. Ausländischen Käufern aus Ländern der europäischen Gemeinschaft wird die in Deutschlang gültige Umsatzsteuer berechnet. Anderen ausländischen Käufern (aus Drittländern) wird, sofern die Münzen durch uns exportiert werden, ein Aufgeld von 15 % netto auf den Zuschlagpreis berechnet; sie erhalten die Lieferung nur gegen Zahlung des Kaufpreises in € - Währung, bankspesenfrei. Ausländischen Münzhändlern aus Ländern der europäischen Gemeinschaft wird bei Nachweis der Umsatzsteuer-Identifikationsnummer (§ 27 a UStG) und der sonstigen Voraussetzungen gemäß § 4 Nr. 1 b UStG in Verbindung mit § 6 a UStG die Lieferung ohne Umsatzsteuer berechnet. Sofern nichts anderes vereinbart wird, ist die Zahlung der Auktionsrechnung bei anwesenden Käufern sofort, bei schriftlichen Bietern spätestens 20 Tage nach Erhalt fällig. Bei Zahlungsverzug werden Zinsen von 1 % pro Monat berechnet. Wird die Zahlung nicht sofort an den Versteigerer geleistet oder die Abnahme der zugeschlagenen Sache verweigert, so findet die Übergabe der Sache an den Ersteigerer nicht statt. Der Ersteigerer verliert vielmehr seine Rechte aus dem Zuschlag, und die Sache kann auf seine Kosten erneut versteigert werden. In diesem Fall haftet der Ersteigerer für den Ausfall, dagegen hat er auf den Mehrerlös keinen Anspruch. Der Zuschlag erfolgt nach dreimaligem Ausruf des höchsten Gebotes und verpflichtet zur Abnahme und Zahlung. Bei Meinungsverschiedenheiten über den Zuschlag wird die Nummer noch einmal ausgerufen. Der Versteigerer ist berechtigt, Nummern zu vereinigen oder zu trennen. Eine Vorausnahme von Nummern erfolgt nicht. Der Zutritt zur Versteigerung ist nur Interessenten gestattet, die einen Katalog besitzen.

Schriftliche Aufträge werden von uns ohne Auftragsprovision gewissenhaft ausgeführt. Aufträge von uns unbekannten Sammlern können nur ausgeführt werden, wenn ein Depot hinterlegt wird oder Referenzen benannt werden. Schriftliche Gebote können nur bis 24 Stunden vor Auktionsbeginn verbindlich berücksichtigt werden. Im Bedarfsfall ist der Auktionator berechtigt, die Limits um 3 – 5 % zu überschreiten. Bei mehreren gleichhohen Geboten erhält das zuerst eingegangene den Zuschlag. Unlimitierte Aufträge haben keinen Anspruch auf unbedingte Ausführung. Telefonisches Bieten ist nur in Ausnahmefällen möglich. Telefonische Bieter müssen sich mindestens einen Werktag vor der Auktion voranmelden. Der Versand geht zu Lasten und auf Risiko des Ersteigerers bzw. Empfängers. Das Auktionsgut bleibt bis zur vollständigen Bezahlung aller Forderungen aus Anlaß der Versteigerung Eigentum des Verkäufers. Ist der Käufer Vollkaufmann, so ist Osnabrück als Gerichtsstand vereinbart. Für das Mahnverfahren gilt die Zuständigkeit des Amtsgerichts Osnabrück auch in allen anderen Fällen als vereinbart. Ansonsten ist es Osnabrück nur, wenn nur die Firma Fritz Rudolf Künker GmbH & Co. KG ihren allgemeinen Gerichtsstand in der BRD hat, oder wenn alle Ansprüche im Wege des Mahnverfahrens geltend gemacht werden, oder wenn die im Klageweg in Anspruch zu nehmende Vertragspartei nach Vertragsabschluß ihren gewöhnlichen Aufenthaltsort aus dem Geltungsbereich der BRD verlegt hat, oder ihr Wohnsitz oder gewöhnlicher Aufenthaltsort zum Zeitpunkt der Klage nicht bekannt ist. Die Beschreibung im Katalog ist gewissenhaft durchgeführt. Sie begründet jedoch keine Rechts- oder Sachmängelhaftung gemäß §§ 434, 459 ff BGB. Die Angabe der Erhaltung ist streng nach den im deutschen Münzhandel üblichen Erhaltungseinstufungen vorgenommen und gilt als persönliche Beurteilung. Bei der Auktion anwesende Käufer kaufen grundsätzlich „wie besehen“. Da durch Vorbesichtigung Gelegenheit gegeben ist, sich vom Erhaltungszustand des Versteigerungsgutes zu überzeugen, können nach erfolgtem Zuschlag Reklamationen nur bei irrtümlich übersehener Henkel- oder Fassungsspur oder gestopftem Loch berücksichtigt werden. Bei Losen mit mehreren Stücken sind die Stückzahlen nur Circa-Angaben, irrtümliche Zuschreibungen sind im Einzelfall nicht ausgeschlossen. Diese Lose sind nach erfolgtem Zuschlag von jeder Reklamation ausgeschlossen. Der Versteigerer kann bei eventuellen Meinungsverschiedenheiten bzw. Beanstandungen einen vereidigten Sachverständiger seiner Wahl (die Kosten trägt der unterliegende Teil) beauftragen. Eventuelle Beanstandungen können nur innerhalb von 8 Tagen nach der Auktion bzw. nach Erhalt der ersteigerten Stücke berücksichtigt werden.

Die Mindeststeigerungsstufen für das Bietungsverfahren betragen:

Mindestangebote

Mindeststeigerungsstufe

Wenn Sie in unserer Auktion erworbene Münzen an einen Grading Service in den USA verschicken möchten, übernehmen wir keine Garantie, daß die Münzen dort angenommen oder entsprechend unserer Bewertung eingestuft werden.

bis zu

€ 100,--

€ 5,--

bis zu

€ 200,--

€ 10,--

bis zu

€ 500,--

€ 20,--

bis zu

€ 1.000,--

€ 50,--

bis zu

€ 2.000,--

€ 100,--

bis zu

€ 5.000,--

€ 200,--

bis zu

€ 10.000,--

€ 500,--

Soweit nicht anders vermerkt, gelten im übrigen die allgemeinen Versteigerungsbestimmungen und – auch im Verhältnis zu ausländischen Kunden – gilt Deutsches Recht.

bis zu

€ 20.000,--

€ 1.000,--

Die Ergebnisliste erscheint sofort nach der Auktion.

bis zu

€ 50.000,--

€ 2.000,--

DIE VERSTEIGERER:

ab

€ 50.000,--

€ 5.000,--

Die Echtheit der Stücke wird bis zur Höhe des Kaufpreises garantiert. Die beigedruckten Preise sind Schätzpreise, die unter- oder überschritten werden können. Aufträge, die unter 80 % des Schätzpreises liegen, können nicht bearbeitet werden. Ausländische Kunden kaufen nach den Devisen-, Zoll- und Steuerbestimmungen ihres Landes. Versandformalitäten werden vom Versteigerer erledigt.

FRITZ RUDOLF KÜNKER DR. ANDREAS KAISER ARNE KIRSCH OLIVER KÖPP


TERMS AND CONDITIONS OF AUCTION The auction is conducted on behalf and for the account of the appropiate proprietors of the goods and is subject to the federal Auction Regulation (Versteigerungsordnung, BGB1 I 1976, 1346) published in the Federal Law GazetteVol. I, 1976, 1346 and the relevant provisions for factors in accordance with the German Cicil Code (BGB) and Commercial Code (HGB). Payment of the hammer-price has to be made in cash and in Euro. The submission of an offer implies the express acknowledgement of these Terms and Conditions of Auction; the same applies to the submission of an offer in writing. The hammer-price is exclusive of applicable German VAT according to the prevailing VAT – legislation and represents the basis for calculating the surcharge of 15 percent payable by the puchaser. The total price so calculated (hammerprice plus surcharge) is subject to the VAT (value added tax=Mehrwertsteuer), which is payabel additionally. Purchasers from abroad will be charged a surcharge of 15 per cent net on the hammer-price, provided the export of the coins is undertaken by the auctioneer. Buyers in European Community (EEC) countries (other than Germany) will be charged Value Added Tax at the rates prevailing in Germany. Dealers from EEC countries (other than Germany) will receive goods free of tax upon presentation of their VAT I.D. number, and upon fulfillment of the other conditions set forth in Paragraph 4, Nr. 1 b, and Paragraph 6 a of the GermanTurnover Tax Law Buyers from other countries are not charged Value Added Tax. Delivery will be made against payment in Euro with no bank charges to the auctioneer. Unless mutually agreed otherwise, payment of the auction bill from purchasers present at the auction is due immediately. From purchaser who have submitted a bid in writing, payment is due within 20 days after receipt of the goods. Defaulted payments shall bear an interest charge of 1 % per month in the amount in default. Should payment to the auctioneer not be made immediately or should the acceptance of the awarded item be refused, such item shall not be handed overt to the purchaser. Instead the purchaser shall forfeit all right and title in and to such item from the award and the item may again be put to auction at this buyer’s cost. In this event the buyer shall be liable for any shortfall, while he shall have no right or claim towards any excess proceeds. An item will be knocked down after the highest bid has been called three times. The award shall be a binding commitment and liability on the part of the bidder to take acceptance and delivery of the item or items so awarded. In the event of any dispute with regard to the award the lot will be put up again for bidding. The auctioneer reserves the right to combine or to seperate lots. Lots will not be called out of sequence. Access to the auction will only be permitted to interested persons who are in possession of the catalogue.

same price or prices for a given lot, the bid first received by the auctioneer shall be given the award. Unlimited bids shall not oblige the auctioneer to consider, accept or carry out such order. Telephone bidding is generally an option for lots of substantial value only. The registration is required at the latest a day before auction. Shipment (by mail or otherwise) of the goods shall be for the sole cost and risk of the purchaser or receipient, resp. The auctioned goods remain the sole and exclusiv property of the vendor until full payment and settlement of any and all dues and claims in connection with the auction. In the event the purchaser is a merchant (in the sense of the German commercial laws) Osnabrück shall be the agreed and exclusive place of jurisdiction. The competence of the District Court (Amtsgericht) of Osnabrück is agreed in respect of summary proceedings for the collection of defaulted payments (Mahnverfahren) as well as in any and all other cases. Should the purchaser not be a merchant Osnabrück shall be the place of jurisdiction with the District Court of Osnabrück’s competence, if only the auctioneer has his ordinary legal domicil in the Federal Republic of Germany or if claims are made by way of summary proceedings of collection (Mahnverfahren) or if the defendant has moved his ordinary legal domicil outside the jurisdiction of the Federal Republik of Germany or if the legal domicil of the defendant is unknown to the auctioneer at the time of filing a suit. To the exclusion of any other legislation German law, as in force at the time, shall be applied for the settlement of any and all legal or judicial matters. The specifications and descriptions in the catalogue have been prepared diligently and in good faith do, however, not constitute the acceptance by the auctioneer of any warranty or liability in respect of defect in material or title. The state of preservation of items is strictly assessed in accordance with the grades accepted by the German coin trade and only represents an individual and personal assessment. Purchasers present at the auction acquire items strictly on the basis of “as is where is” and “as inspected”. In view of the opportunity of prior inspection to ascertain the state and condition of the auction lots, complaints and objections made after the sale will only be considered, if by obvious error or mistake loop or traces or moutings, traces of trimmings or settings, or the plugging of a hole (eyelet) have remained unnoticed. If and when auctioned in lots, the quantities of individual pieces given, only represent an approximate figure. An error in the allocation of indivdual pieces to a certain lot cannot be excluded. Such lots are, therefore, excluded from any complaintes or objections after the lot is knocked down. In the event of disputes or complaints as to the quality of an item the auctioneer may call upon a gernerally sworn expert of the trade, which the auctioneer may choose at his sole discretin, for assessment an the rendering of a decision as to the justification of such dispute or complaint. The costs of such expert shall be borne by the party loosing the dispute according to the expert’s decision. Complaints or objections, if justified, will only be considered if made and received by the auctioneer within 8 days after the auction or after receipt the lots, respectively.

The minimum rates of increase for the bidding procedure are: for minimum offers

minimum increase rate

up to

€ 100,--

€ 5,--

up to

€ 200,--

€ 10,--

up to

€ 500,--

€ 20,--

up to

€ 1.000,--

€ 50,--

up to

€ 2.000,--

€ 100,--

up to

€ 5.000,--

€ 200,--

up to

€ 10.000,--

€ 500,--

up to

€ 20.000,--

€ 1.000,--

up to

€ 50.000,--

€ 2.000,--

above

€ 50.000,--

€ 5.000,--

Orders submitted in writing will be carried out diligently and without charge of an extra commission. Orders from collectors unknown to the auctioneer can only be accepted and carried out if a deposit or references to the satisfaction on the auctioneer are given. To be bindingly accepted, written bids need to be received at least 24 hours before auction. If necessary, the auctioneer is allowed to increase the bids by 3-5%. Should several bids be obtained in writing bidding the

If a coin that is sold by us is sent to a grading service ("slabbing"), we do not guarantee that the coin will be slabbed (nor that it will be slapped at any particular grade or with any particular comments ); however, we always warranty that each coin or numismatic item we sell will be genuine. The authenticity of the coins is warranted. Warranted up to the total purchase price. The prices set out in the catalogue are estimates only, which may bei exceeded or undercut. Orders for less than 80 per cent of the estimated price cannot accepted. Purchasers from abroad will have to observe all applicable laws and regulations in respect of foreign exchange, customs duties and taxation of their country. The auctioneer will only discharge such formalities, which have to be observed, in the Federal Republic of Germany in connection with the export of the purchased item(s). Unless stipulated otherwise herein, the general rules regulations for auctions applicable in Germany shall govern any transaction in respect of the auction; German Law shall also be applicable in relation to purchasers form abroad. Only the German text has legal forde. The prices realized will be published in the form of a list immediately after the auction.

THE AUCTIONEERS:

FRITZ RUDOLF KÜNKER DR. ANDREAS KAISER ARNE KIRSCH OLIVER KÖPP


NUMISMATISCHE AUSDRÜCKE EXPRESSIONS NUMISMATIQUES NUMISMATIC TERMS TERMINI DI NUMISMATICA DEUTSCH

ENGLISCH

FRANÇAIS

ITALIANO

RUSSISCH

Abschlag Am Rand Berieben Blei Dezentriert Doppelschlag Einfassung Einseitig Emailliert Erhaltung Etwas Exemplar Fassungsspuren Fehlprägung

struck at the rim/border slightly polished lead uncentered double struck frame uniface enamelled condition/preservation slightly specimen, copy trace of mounting mis-strike

frappe en tranche frotté plomb décentré double frappe encadrement uniface émaillé conservation un peu exemplaire traces de monture défaut de frappe

coniazione al bordo trattato piombo non centrato ribattitura cornice uniface smaltato conservazione un poco esemplare tracce di montatura difetto di coniazione

Feld(er) Fundexemplar Gedenkmünze Geglättet Gelocht Geprägt Gewellt Goldpatina Henkelspur Hübsch Jahrh. = Jahrhundert. Kl. = klein Korrosionsspuren Kratzer Kupfer Legierung Leicht(e) l. = links Min. = minimal Nachahmung Prachtexemplar

field(s) specimen from a hoard commemorative coin tooled holed minted bent golden patina mount mark attractive century small traces of corrosion scratch(es) copper alloy slightly left minimal imitation attractive, perfect piece

champ exemplaire de trouvaille monnaie commémorative retouché troué frappé ondulé patine dorée Trace de monture joli siècle petit traces de corrosion rayure cuivre alliage légèrement gauche minime imitation pièce magnifique

campo da tesoretto moneta commemorativa liscio bucato coniato ondolato patina d´oro Tracce di appicagnolo carino secolo piccolo segni di corrosione graffio(i) rame lega leggero sinistra minimamente contraffazzione esemplare magnifico

Prägeschwäche Randdelle Randfehler Randschrift r. = rechts Rückseite Schriftspuren

weakly struck edge nick edge faults lettered edge to right reverse traces of inscription

de frappe faible défaut sur la tranche erreur sur la tranche tranche inscrite droite revers traces de légende

conio stanco ammaccatura al bordo errore nel bordo inscrizione sul bordo destra rovescio tracce di leggenda

Schrötling Schrötlingsfehler Schwach ausgeprägt Selten in dieser Erhaltung

flan flan defect weakly struck rare in this condition

flan flan défectueux de frappe faible rare en cet état

tondello errore di tondello conio stanco conservazione rara

Seltener Jahrgang Stempel Stempelfehler Überdurchschnittlich erhalten Überprägt Unediert

rare year die(s) mistake in the die extraordinary condition

année rare coin erreur de frappe conservation extraordinaire

annata rara conio errore di conio conservazione estraordinaria

ОТТИСК НА ГУРТЕ ПОТЕРТАЯ СВИНЕЦ АССИМЕТРИЧНЫЙ ДВОЙНОЙ ЧЕКАН КАЙМА ОДНОСТОРОННЯЯ ЭМАЛИРОВАННАЯ СОХРАННОСТЬ СЛЕГКА ЭКЗЕМПЛЯР СЛЕДЫ ОБРАБОТКИ ОШИБКА В ПРОЦЕССЕ ЧЕКАНКИ ПОЛЕ ЭКЗЕМПЛЯР ПАМЯТНАЯ МОНЕТА ОТГЛАЖЕННАЯ ПРОКОЛАТАЯ ОТЧЕКАНЕННАЯ ВОЛНИСТАЯ ЗОЛОТАЯ ПАТИНА СЛЕДЫ ОТ УШКА КРАСИВАЯ СТОЛЕТИЕ МАЛЕНЬКИЙ СЛЕДЫ КОРРОЗИИ ЦАРАПИНА МЕДЬ СПЛАВ ЛЕГКИЙ СЛЕВА МИНИМАЛЬНЫЙ ИМИТАЦИЯ ПРЕВОСХОДНЫЙ ЭКЗЕМПЛЯР ИЗДЕРЖКН ПРИ ЧЕКАНКН ВМЯТИНА НА ГУРТЕ ОШИБКА НА ГУРТЕ ГУРТОВАЯ НАДПИСЬ СПРАВА РЕВЕРС СЛЕДЫ ПРЕДЫДУЩЕЙ НАДПИСИ ЗАГОТОВКА БРАК ЗАГОТОВКИ СЛАБО ОТЧЕКАНИНА РЕДКАЯ В ТАКОЙ СОХРАННОСТИ РЕДКИЙ ГОД ШТАМП ОШИБКА ШТАМПА СОХРАННОСТЬ ВЫШЕ СРЕДНЕГО

overstruck unpublished

surfrappé inédit

ribattuto inedito

Unikum Vergoldet Von allergrößter Seltenheit Vorderseite Winz.= winzig Zain Zierrand Zinn

unique specimen gilt extremely rare head tiny flan ornamental border tin

unique doré de toute rareté en face petit flan tranche ornée étain

pezzo unico dorato di estrema raritá diritto veramente piccolo tondello taglio ornato stagno

Ziseliert

chased

ciselé

cesellato

ПЕРЕЧЕКАН НЕОПУБЛИКОВАННАЯ МОНЕТА УНИКАЛЬНАЯ ПОЗОЛОЧЕННАЯ НАИРЕДЧАЙШАЯ АВЕРС НЕЗНАЧИТЕЛЬНЫЙ ЗАГОТОВКА ЦИНК ЦАРАПИНЫ НА ПОЛЕ МОНЕТЫ МУЗЕЙНЫЙ ЭКЗЕМПЛЯР ПРЕВОСХОДНАЯ ПАТИНА


Künker eAuctions

Künker eAuctions

Unsere eAuctions umfassen circa 250 Losnummern. In einem festgelegten Zeitraum von 14 Tagen haben Sie die Möglichkeit, online auf die für Sie interessanten Münzen und Medaillen zu bieten. Die einzelnen Losnummern laufen zeitlich versetzt aus. Selbstverständlich werden Sie über Ihren aktuellen Gebotsstatus laufend per Email informiert und können Ihre Gebote bei Bedarf bis zur letzten Sekunde erhöhen.

Our eAuctions contain 250 lots. During a fixed period of 14 days you have the opportunity to submit your bids online on your favourite coins and medals.

Weitere Informationen und die nächsten Termine zu den Künker eAuctions finden Sie unter:

You may find further information and the next dates of the Künker eAuctions here:

www.kuenker.de

www.kuenker.com

Each lot will expire at different times. Certainly you will be informed constantly by email about the current status of your bids so that you permanent have the possibility – if necessary – to raise your bids till the end of the eAuction.

Fritz Rudolf Künker GmbH & Co. KG Gutenbergstraße 23 · 49076 Osnabrück · Germany Tel. +49 (0)541 96 20 20 · Fax +49 (0)541 96 20 222 www.kuenker.de · service@kuenker.de Osnabrück · Berlin · München · Zürich


IMPRESSUM NUMISMATISCHE BEARBEITUNG FOTOS LAYOUT DRUCK

Eva Marowsky, Alexandra Spreu, Dr. Sebastian Steinbach, Jens Ulrich Thormann M. A., Manuela Weiß Lübke & Wiedemann, Stuttgart danner pc - gesteuerte systeme waiblingen meister print und media, Kassel Jeglicher Nachdruck, auch auszugsweise, bedarf der Genehmigung des Auktionshauses

ZAHLUNGEN AUS DEM INLAND Deutsche Bank Osnabrück Dresdner Bank Osnabrück Sparkasse Osnabrück Volksbank eG Bad Laer-Borgloh-Hilter-Melle Bankhaus Lampe KG, Bielefeld Postbank Hannover HypoVereinsbank München WestLB Dortmund Paypal

(BLZ 265 700 90) Konto-Nummer 0 177 006 (BLZ 265 800 70) Konto-Nummer 780 520 200 (BLZ 265 501 05) Konto-Nummer 247 320 (BLZ 265 624 90) Konto-Nummer 1 200 222 400 (BLZ 480 201 51) Konto-Nummer 174 076 (BLZ 250 100 30) Konto-Nummer 2900 60-308 (BLZ 700 202 70) Konto-Nummer 24 17 952 (BLZ 440 500 00) Konto-Nummer 1128 842 paypal@kuenker.de, Service charge: 3,5 %

ZAHLUNGEN AUS DEM AUSLAND - FOREIGN PAYMENTS Deutsche Bank Osnabrück Sparkasse Osnabrück Postbank Hannover Credit Suisse-5288 Credit Cards Paypal

IBAN: DE11 2657 0090 0017 7006 00 Swift-Code: DEUTDE3B265 IBAN: DE50 2655 0105 0000 2473 20 Swift-Code: NOLADE22XXX IBAN: DE73 2501 0030 0290 0603 08 Swift-Code: PBNKDEFF IBAN: CH88 0483 5013 5494 4200 1 Swift-Code: CRESCHZZ81Z We do accept VISA and MASTERCARD, Service charge: 4,5 % paypal@kuenker.de, Service charge: 3,5 %

ERHALTUNGS- UND SELTENHEITSGRADE ERHALTUNGSGRADE/ GRADING TERMS DEGRÉS DE CONSERVATION GRADI DI CONSERVAZIONE

SELTENHEITSGRADE

Polierte Platte Proof

Flan bruni Fondo specchio

Stempelglanz Uncirculated

Fleur de coin Fior di conio

Vorzüglich Extremely fine

Superbe Splendido

Sehr schön Very fine

Très beau Bellissimo

Schön Fine

Beau Molto Bello

Gering erhalten Very good

Très bien conservé Bello

R = Selten Von großer Seltenheit

RR = Sehr selten Von größter Seltenheit

Auktion 154 Künker  

Der Münzschatz von Herborn, Münzen und Medaillen aus Mittelalter und Neuzeit

Read more
Read more
Similar to
Popular now
Just for you