Page 1


138. AUKTION GOLD- UND SILBERPRÄGUNGEN VON ITALIEN UND DEM VATIKAN MÜNZEN UND MEDAILLEN AUS MITTELALTER UND NEUZEIT SPEZIALSAMMLUNG WIED 11. - 12. März 2008 Steigenberger Hotel Remarque Osnabrück Natruper-Tor-Wall 1 Hotel-Telefon +49 (0)5 41 60 96 633 Hotel-Fax +49 (0)5 41 60 96 634 (nur während der Auktion/only during the auction/ uniquement pendant la vente/solamente durante l'asta/solamente durante la subasta/только во время аукциона)

ZEITPLAN AUKTIONEN 136 - 139 AUKTION 136 ANTIKE MÜNZEN DER INSEL KRETA DIE SAMMLUNG DR. BURKHARD TRAEGER MÜNZEN AUS DER WELT DER ANTIKE AUKTION 137 THE DE WIT COLLECTION OF MEDIEVAL COINS PART III

AUKTION 138 ITALIEN UND VATIKAN ITALIEN UND VATIKAN MÜNZEN UND MEDAILLEN AUS MITTELALTER UND NEUZEIT SPEZIALSAMMLUNG WIED AUKTION 139 GOLDPRÄGUNGEN RUSSISCHE MÜNZEN UND MEDAILLEN IN GOLD UND SILBER DEUTSCHE MÜNZEN AB 1871

Detaillierter Zeitplan siehe Seite 5 Besichtigungen siehe Seite 9 Horaire détaillé voir page 5 Exposition des monnaies voir page 9

Montag, den 10. März 2008 10.00 Uhr - 13.00 Uhr Nr. 1 bis Nr. 616 14.00 Uhr - 19.00 Uhr Nr. 617 bis Nr. 1652 Dienstag, den 11. März 2008 9.30 Uhr - 13.00 Uhr Nr. 3035 bis Nr. 3852 14.00 Uhr - 15.30 Uhr Nr. 3853 bis Nr. 4256 15.30 Uhr - 19.00 Uhr Nr. 4501 bis Nr. 5102 Mittwoch, den 12. März 2008 9.30 Uhr - 13.00 Uhr Nr. 5103 bis Nr. 5983 14.00 Uhr - 20.00 Uhr Nr. 5984 bis Nr. 7318 Donnerstag, den 13. März 2008 9.30 Uhr - 13.00 Uhr Nr. 7501 bis Nr. 8294 14.00 Uhr - 19.00 Uhr Nr. 8295 bis Nr. 9014 Freitag, den 14. März 2008 9.30 Uhr - 13.00 Uhr Nr. 9101 bis Nr. 9839 Detailed timetable view page 5 Viewing of auction good view page 9 Calendario dettagliato veda pagina 5 Esposizione veda pagina 9


Sehr geehrte Kundin, sehr geehrter Kunde und Münzfreund, ich freue mich, daß Sie bereits heute, 4 Wochen vor unserer nächsten Auktion, die neuen Kataloge erhalten haben und wünsche Ihnen viel Freude bei der Lektüre unseres Auktionsangebotes. Wir wurden oft gebeten, den Ablauf einer Auktion etwas näher zu beschreiben, diesem Wunsch kommen wir gerne nach. Am Ende dieses Kataloges finden Sie die Rubrik: “Wie biete ich richtig“, die Ihnen als Ratgeber zur erfolgreichen Teilnahme an unseren Auktionen dienen soll. Sollten Sie darüber hinaus Fragen zum Auktionsablauf haben, helfen wir Ihnen auch gerne persönlich weiter. Die Mitarbeiterinnen unserer Kundenbetreuung stellen wir Ihnen auf der nächsten Seite vor. Mit herzlichen Grüßen aus Osnabrück,

Ihr Fritz Rudolf Künker UNSERE ADRESSE OUR ADDRESS

Fritz Rudolf Künker GmbH & Co. KG Gutenbergstr. 23 · 49076 Osnabrück Telefon/Phone: Fax: Gebührenfrei: E-Mail: Internet:

+49 (0)5 41-96 20 20 +49 (0)5 41-96 20 222 0800-58 36 537 service@kuenker.de www.kuenker.de

Montag-Donnerstag Freitag Sonnabend

9.00 - 17.00 Uhr 9.00 - 15.30 Uhr nach Vereinbarung

Außerhalb unserer Geschäftszeit steht unseren Kunden ein automatischer Anrufbeantworter zur Verfügung. Monday-Thursday 9.00 a. m. to 5.00 p. m. Friday 9.00 a. m. to 3.30 p. m. Saturday by prior appointment Answering machine available after opening hours. WWW.KUENKER.DE WWW.KUENKER.COM

Auf unserer Internetseite haben Sie die Möglichkeit • die Abbildungen zu vergrößern • Ihre Gebote direkt abzugeben • die Ergebnisse der Auktionen abzurufen On our website you have the possibility • to zoom all images • to place your bids to view all auction results

AUKTIONSHOTEL AUCTION LOCATION

Steigenberger Hotel Remarque, Natruper-Tor-Wall 1, 49076 Osnabrück Telefon/Phone: Fax:

+49 (0)5 41-60 96 633 +49 (0)5 41-60 96 634

Mitglied im Verband der Deutschen Münzenhändler e. V. Associaton Internationale des Numismates Professionnels (AINP) 2


UNSERE KUNDENBETREUUNG STEHT IHNEN GERNE ZUR VERFÜGUNG Die Maxime unseres Teams lautet: Nur wenn Sie als Kunde zufrieden sind, sind wir es auch! Geben Sie uns Ihre Auktionsgebote zu treuen Händen, wir sorgen dafür, daß sie korrekt ausgeführt werden. Auch wenn Sie sich von Teilen oder Ihrer gesamten Sammlung trennen möchten, sind wir Ihre ersten Ansprechpartner. Beachten Sie dazu bitte auch die Hinweise für Einlieferer auf der folgenden Seite bzw. im hinteren Teil des Kataloges.

WIR FREUEN UNS AUF IHRE AUKTIONSGEBOTE UND EINLIEFERUNGEN!

Ulrich Künker Leitung Kundenbetreuung ulrich.kuenker@kuenker.de

Gisela Thomas Prokuristin gisela.thomas@kuenker.de

Alexandra Elflein English, Français, Italiano alexandra.elflein@kuenker.de

Marion Künker Deutsch, English marion.kuenker@kuenker.de

Sonia Russo Italiano, Español, English, Français sonia.russo@kuenker.de

Barbara Westmeyer Deutschsprachige Kundenbetreuung barbara.westmeyer@kuenker.de

Bettina Schweitzer Deutsch, Svenska bettina.schweitzer@kuenker.de

Anastasija Koepsell Russian, Deutsch anastasija.koepsell@kuenker.de

Nadine Zuber Deutsch, English nadine.zuber@kuenker.de

SO ERREICHEN SIE UNS GEBÜHRENFREI (AUS DEUTSCHLAND) TELEFON FAX INTERNET EMAIL

0800 / 5836537 (0800 / KUENKER) +49 (0) 541/ 96 20 20 +49 (0) 541/ 96 20 222 www.kuenker.de service@kuenker.de

WAS IST ZUR ERFOLGREICHEN AUKTIONSTEILNAHME BESONDERS WICHTIG? • • • • •

Ihr schriftlicher Auftrag sollte möglichst frühzeitig eintreffen, spätestens einen Tag vor der Auktion. Wenn Sie telefonisch an der Auktion teilnehmen möchten, bedarf das unserer vorherigen Genehmigung. Bitte teilen Sie uns diesen Wunsch daher mindestens 48 Stunden vor der Versteigerung mit. Nähere Informationen zum telefonischen Bieten finden Sie auf den folgenden Seiten. Beachten Sie bitte auch die Hinweise „Wie biete ich richtig“ im hinteren Teil des Kataloges. Gerne können Sie Ihre Gebote auch online abgeben. Unter www.kuenker.de bieten wir den gesamten Auktionskatalog online an. Bei Fragen rufen Sie uns an, unsere Kundenbetreuung freut sich auf Ihren Anruf! 3


WICHTIGE HINWEISE FÜR UNSERE EINLIEFERER 1.

Unser Expertenteam garantiert Ihnen eine fachgerechte Bearbeitung der von Ihnen eingelieferten Stücke. 2. Die Schätzpreise werden von uns aufgrund unserer hervorragenden Marktkenntnisse sorgfältig festgelegt. Die Stücke werden zu 80% der im Katalog angegebenen Schätzpreise ausgerufen. Durch diese Regelung werden Sie als Einlieferer geschützt. Für nicht verkaufte Objekte werden keine Gebühren erhoben. 3. Der Standard unserer Kataloge ist von hoher Qualität und findet internationale Anerkennung. Wir haben eine der besten Kundendateien, die es weltweit gibt. 4, Von der individuellen Betreuung unserer Kunden profitieren auch Sie als Einlieferer. 5. Als Einlieferer erhalten Sie Ihren Auktionserlös innerhalb von 45 Tagen nach der Auktion. Sonderregelungen sind nach Absprache möglich. 6. Auf Wunsch kann Ihre Einlieferung bei Ihnen zuhause abgeholt werden. Ab € 2.500,-- Einlieferungssumme übernehmen wir die Kosten, ab € 25.000,-können wir Ihre Einlieferungen unter Umständen und nach Absprache auch an einem vereinbarten Ort persönlich entgegennehmen. Selbstverständlich ist Ihr Versteigerungsgut durch uns versichert. 7. Nicht alle Münzen eignen sich, als Einzelstücke aufgenommen zu werden. Vertrauen Sie auf die Erfahrung unserer Experten, die niedrigpreisige Münzen liebevoll zu interessanten Lots zusammenstellen. 8. Der Schätzwert Ihrer Einlieferung sollte mindestens € 1.000,-- betragen. 9. Ihre Einlieferung wird Ihnen sofort bei Übernahme durch ein Protokoll quittiert. Spätestens fünf Wochen vor der Auktion erhalten Sie eine genaue Auflistung Ihrer Objekte mit den dazugehörenden Katalognummern. 10. Innerhalb einer Woche nach der Auktion erhalten Sie bereits die Ergebnisliste und können alle erzielten Preise feststellen. 11. Profitieren Sie von der Anziehungskraft eines führenden Unternehmens. Bitte wenden Sie sich bei Fragen an unseren Kundenservice unter 0541 – 96 20 20 oder gebührenfrei unter 0800 – 5 83 65 37. 12. Unsere Verträge für Einlieferungen können Sie unverbindlich anfordern. Haben Sie noch Fragen? Wir freuen uns auf Ihren Anruf. Telefon: 0541 – 96 20 20 oder gebührenfrei unter 0800 5 83 65 37.

RENSEIGNEMENTS IMPORTANTS A L'ATTENTION DES VENDEURS 1.

Notre équipe d’experts garantit une prise en charge compétente des pièces que vous nous confiez. 2. Notre excellente connaissance du marché nous permet de fixer soigneusement les prix estimés. Les pièces seront mises aux enchères à un prix représentant 80% du prix estimé indiqué dans le catalogue. Cette réglementation vous protège en tant que vendeur. Aucuns frais ne seront prélevés sur les pièces invendues. 3. Nos catalogues ont un niveau qualitatif élevé, reconnu au plan international. Nous disposons d’un des meilleurs fichiers clients du monde. 4. En tant que vendeur, vous profiterez vous aussi du suivi personnalisé que nous offrons à nos clients. 5. Le vendeur recevra le produit de la vente dans les 45 jours qui suivront les enchères. Des dispositions spéciales pourront être prises sur accord préalable. 6. Nous prendrons en charge les frais d´expédition des pièces dont le montant sera supérieur à € 2.500,--: Si leur montant est supérieur à € 25.000,--, l´un de nos employés se poudra charger de prendre la livraison à un lieu concordée. En concertation, notre assurance couvrira tous les risques. 7. Les pièces de monnaie ne se prêtent pas toutes à une vente individuelle. Faites confiance à l’expérience de nos spécialistes qui se chargeront avec plaisir de rassembler les pièces bon marché de manière à constituer des lots intéressants. 8. La valeur estimée des pièces fournies devrait s’élever à un minimum de € 1.000,--. 9. Au moment de la prise en charge, vous recevrez un détail des pièces fournies. Au plus tard cinq semaines avant la vente aux enchères, vous recevrez une liste exacte de vos pièces avec les numéros de catalogue correspondants. 10. Dans la semaine qui suivra la vente aux enchères, vous recevrez déjà la liste de ses résultats et pourrez prendre connaissance des prix obtenus. 11. Profitez de l’attrait du leader du marché. Pour tout renseignement, veuillez-vous adresser à notre service clientèle: +49 (0)541 – 96 20 20. 12. Vous pouvez demander sans engagement de votre part nos contrats de dépôt de pièces? Vous avez d’autres questions? Nous seront heureuses de vous répondre au +49 (0)541 – 96 20 20.

4

IMPORTANT INFORMATION FOR OUR CONSIGNERS 1.

Our team of specialists guarantees an expert treatment of the consigned items. 2. The estimates are carefully established by us due to our excellent knowledge of the market. Bidding for the items is then started at 80 % of the estimate price stated in the catalogue. This arrangement protects you as a consigner. Unsold items incur no fees. 3. The standard offered in our catalogue is of the highest quality, and is recognised internationally. We have one of the best clientele lists worldwide. 4. You as a consigner also profit from the individual consultation offered to our customers. 5. As a consigner, you receive the auction proceeds within 45 days of the close of auction. Special arrangements can be made following discussion. 6. For consignments with a value over € 2.500,-- we may bear the transportation costs. For deliveries over € 25.000,-- we may personally collect the items at an arranged place after prior consultation. Upon consultation, the shipping of your goods could be covered by our insurance. 7. Not all coins are suited to be registered as individual items. Trust in our expert´s experience as they carefully combine less-valuable coins into interesting lots. 8. The valuation price of your delivery should be at least € 1.000,--. 9. Your delivery is confirmed in writing immediately on receipt. At least five weeks before the auction, you receive an exact list of your objects with the relevant catalogue numbers. 10. Within a week of the close of auction, you receive a list with the results in order to see what prices were reached for each individual lot. 11. Profit from our position as a leading coin dealer. If you have any questions, please contact our customer service team on +49 (0)541 – 96 20 20. 12. Would you like to receive copies of our contracts for consigner, without making any commitment? Do you have any other questions? Our customer service team will be pleased to help you – please call on +49 (0)541 – 96 20 20.

INFORMAZIONI PER I NOSTRI DEPOSITANTI 1.

Il nostro team di esperti assicura un trattamento accurato dei pezzi che ci avete inviato. 2. Eseguiamo valutazioni finalizzate alla vendita. I prezzi di stima sono frutto della nostra eccezionale conoscenza del mercato e della nostra attenta valutazione. La base d´asta ammonta all´80% del prezzo di stima indicato sul catalogo. Non si addebitano spese per gli oggetti invenduti. 3. I nostri cataloghi sono di alta qualità e sono riconosciuti a livello internazionale. I nostri clienti sono fra i migliori al mondo. 4. Come depositanti potete beneficiare dell’assistenza riservata a ciascuno dei nostri clienti. 5. Come depositanti riceverete gli importi realizzati all’asta entro 45 giorni dal termine della stessa. Si possono concordare condizioni particolari. 6. A partire da un controvalore degli oggetti di € 2.500,--i costi del trasporto sono a nostro carico, mentre a partire da un controvalore di € 25.000 gli oggetti possono essere ritirati personalmente da un nostro incaricato ad un posto concordato. Naturalmente il trasporto dei vostri oggetti puó essere assicurato tramite la nostra assicurazione. 7. Non tutte le monete possono essere negoziate singolarmente. Fidatevi dell´esperienza dei nostri esperti, che raggruppano le monete non molto preziose in lotti di sicuro interesse. 8. Il valore stimato degli oggetti depositati deve ammontare ad almeno € 1.000,--. 9. Nel momento in cui gli oggetti sono presi in consegna, viene rilasciata una ricevuta numerata. Riceverete un elenco preciso degli oggetti che avete depositato con i relativi numeri di catalogo al massimo cinque settimane prima dell’asta. 10. Riceverete l’elenco degli oggetti aggiudicati entro una settimana dalla chiusura dell’asta. Potrete cosi verificare i prezzi realizzati. 11. Approfittate della capacità di un leader di mercato per aumentare il valore dei vostri oggetti. Se avete delle domande, rimaniamo a vostra disposizione per qualsiasi necessità. Rivolgetevi alla nostra consulenza ai clienti diretta al numero +49 (0)541-91 20 20. 12. Volete ricevere i nostri contratti senza impegno? Avete altre domande? Potete contattarci al numero +49 (0)541-96 20 20.


DETAILLIERTER ZEITPLAN AUKTIONEN 136-139 AUKTION 136 ANTIKE MÜNZEN DER INSEL KRETA DIE SAMMLUNG DR. BURKHARD TRAEGER MÜNZEN AUS DER WELT DER ANTIKE

Montag, den 10. März 2008 10.00 Uhr - 13.00 Uhr Nr. 1 bis Nr. 616 Sammlung Kreta, Kelten, Griechen: Hispania - Kreta 14.00 Uhr - 19.00 Uhr Nr. 617 bis Nr. 1652 Griechen: Kykladen - Lots Griechen, Römer, Völkerwanderung, Byzantinische Münzen, Kreuzfahrer, Orientalen

AUKTION 137 THE DE WIT COLLECTION OF MEDIEVAL COINS PART III

Dienstag, den 11. März 2008 9.30 Uhr - 13.00 Uhr Nr. 3035 bis Nr. 3852 England, Irland, Schottland - Italien 14.00 Uhr - 15.30 Uhr Nr. 3853 bis Nr. 4256 Balkan - Gewichte

AUKTION 138 ITALIEN UND VATIKAN

ITALIEN UND VATIKAN MÜNZEN UND MEDAILLEN AUS MITTELALTER UND NEUZEIT SPEZIALSAMMLUNG WIED

15.30 Uhr - 19.00 Uhr Nr. 4501 bis Nr. 5102 Aquileia - Lucca Mittwoch, den 12. März 2008 9.30 Uhr - 13.00 Uhr Nr. 5103 bis Nr. 5983 Mailand - Lots Italien, Europa, Übersee 14.00 Uhr - 20.00 Uhr Nr. 5984 bis Nr. 7318 Habsburgische Erblande, Deutsche Münzen und Medaillen mit der Spezialsammlung Wied, Sammlung Sedisvakanz, Medaillen, Papiergeld, Münzgefäße, Numismatische Literatur

AUKTION 139 GOLDPRÄGUNGEN RUSSISCHE MÜNZEN UND MEDAILLEN IN GOLD UND SILBER DEUTSCHE MÜNZEN AB 1871

Donnerstag, den 13. März 2008 9.30 Uhr - 13.00 Uhr Nr. 7501 bis Nr. 8294 14.00 Uhr - 19.00 Uhr Nr. 8295 bis Nr. 9014 Freitag, den 14. März 2008 9.30 Uhr - 13.00 Uhr Nr. 9101 bis Nr. 9839

5


INHALT AUKTION 138 Nr. GOLD- UND SILBERPRÄGUNGEN VON ITALIEN UND DEM VATIKAN Aquileia Alessandria Bologna Carmagnola Casale-Montferrat Cisalpine Republik Ferrara Florenz Genua Kirchenstaat Lombardei Lucca Mailand Mantua Massa di Lunigiana Messerano Mirandola Modena Neapel und Sizilien Padua Parma Pavia Piacenza Piemont Sardinien Savoyen Siena Sizilien Subalpine Republik Torriglia Toscana Trient Urbino Venedig Verona Königreich Italien Kolonie Eritrea, Lots MÜNZEN UND MEDAILLEN AUS MITTELALTER UND NEUZEIT Europäische Münzen und Medaillen Andorra Baltikum Belgien Bulgarien Dänemark Finnland Frankreich Griechenland Großbritannien Kroatien Liechtenstein Malta Monaco Niederlande 6

4501 4501

-

4505

-

4511

-

4514 4518 4524 4545 5092 5094 5103 5134

-

5141

-

5144 5146

-

5176

-

5189 5219

-

5223

-

5240 5292

-

5296 5530 5532 5571

-

5574 5574

-

5575 5580

-

5598 5603 5605 5656 5675 5730

-

5735 5738 5747

-

Seite 5573 4503 4504 4509 4510 4512 4513 4517 4523 4544 5091 5093 5102 5133 5139 5140 5142 5143 5145 5174 5175 5185 5186 5187 5188 5218 5221 5222 5237 5238 5239 5291 5294 5295 5529 5531 5570 5573 7318 5947 5574 5579 5596 5597 5602 5604 5655 5674 5729 5733 5734 5737 5746 5818

11

-

11

-

13

-

15 18

-

79 81 85

-

86 87

-

91

-

92 96

-

97

-

99

-

107

-

133

-

139 139

-

139 140

-

145 152 154

-

163 164

-

138 11 11 12 12 12 13 14 14 18 79 79 80 84 86 86 86 86 87 91 91 92 92 92 92 96 97 97 98 99 99 107 107 107 133 133 138 138 426 199 139 140 143 144 144 145 152 154 162 162 163 163 164 178


Nr. Polen Rumänien San Marino Schweden Schweiz Serbien Spanien Tschechien Ungarn Zypern Münzen und Medaillen aus Übersee Ägypten Argentinien Bolivien China Dominikanische Republik Ecuador Hawaii Israel Japan Kambodscha Malediven Mexiko Persien Peru Südafrika Thailand Vereinigte Staaten von Amerika/USA Habsburgische Erblande - Österreich Tirol, Grafschaft Römisch-Deutsches Reich Kaiserreich Österreich Lots Habsburg Geistlichkeit Standesherren Deutsche Münzen und Medaillen Aachen Altenburg Anhalt Augsburg Baden Bamberg Bayern Sammlung Bentheim Brandenburg in Franken Brandenburg-Preußen Braunschweig und Lüneburg Breisach Bremen Breslau Corvey Crailsheim Deuscher Orden in Mergentheim Donauwörth Eichstätt Eisleben Erbach Erlangen

5819 5857 5878 5880 5892

-

5929 5932 5944

-

5948 5948

-

5951 5954

-

5962

-

5965

-

5969 5972

-

5975

-

5984 5984 5986 6098 6109 6114 6241 6247

-

6249 6254 6268 6279 6287

-

6325 6339 6444 6507 6511 6514 6517

-

6522 6526

-

6529

-

Seite 5856 5877 5879 5891 5927 5928 5931 5943 5946 5947

178 184

-

189 192

-

197

-

5983 5949 5950 5953 5956 5957 5958 5959 5960 5961 5963 5964 5967 5968 5971 5973 5974 5983

200

-

6246 5985 6097 6108 6113 6240 6246 7210 6247 6248 6253 6267 6278 6286 6323 6324 6338 6443 6506 6510 6513 6516 6518 6519 6520 6521 6525 6527 6528 6530

-

204

-

206

-

206 227 228 229 247 249

-

249 250 252 254 255

-

262 264 281 291

-

183 189 189 191 197 197 197 199 199 199 205 200 200 200 200 201 201 201 201 201 201 201 202 202 203 204 204 205 248 206 226 228 229 247 248 411 249 249 250 252 253 255 261 261 264 280 291 292 293 293 294 294 294 295 295 295 296 296 7


Erzgebirge Essen Fränkischer Kreis Frankfurt Freiburg Friedberg Fürstenberg Fugger Goslar Halberstadt Hamburg Hameln Hanau Hannover Harz Henneberg Hessen Hildesheim Hohenzollern Isenburg Jever Jülich-Kleve-Berg Kempten Kiel Köln Konstanz Korbach Lindau Lippe Löwenstein Lübeck Lüneburg Magdeburg Mainz Mansfeld Marsberg Mecklenburg Montfort Mühlhausen in Thüringen Münster Nabburg Nassau Naumburg Neuss Nürnberg Öttingen Oldenburg Osnabrück Ostfriesland Paderborn Passau Pfalz Pommern Rastatt Ravensburg Regensburg Reuss Rietberg Rottweil 8

Nr. 6531 - 6532 6533 - 6534 6535 6536 - 6546 6547 - 6561 6562 - 6565 6566 - 6568 6569 6570 6571 - 6574 6575 - 6580 6581 - 6583 6584 6585 6586 - 6587 6588 - 6589 6590 - 6603 6604 - 6606 6607 - 6609 6610 - 6612 6613 - 6614 6615 - 6628 6629 - 6630 6631 6632 - 6648 6649 6650 6651 - 6653 6654 - 6655 6656 6657 - 6661 6662 - 6664 6665 - 6667 6668 - 6680 6681 - 6684 6685 - 6686 6687 - 6691 6692 6693 - 6696 6697 - 6704 6705 - 6706 6707 - 6719 6720 6721 - 6722 6723 - 6734 6735 6736 - 6741 6742 - 6743 6744 - 6747 6748 - 6750 6751 - 6755 6756 - 6767 6768 - 6769 6770 6771 6772 - 6789 6790 - 6796 6797 6798 - 6799

Seite

297 299

-

303 304

-

306 307

-

309

-

311

-

313

-

316 317

-

318

-

321

-

322 323

-

325

-

328

-

330 331

-

334 335

-

338 341

-

296 297 297 299 302 302 303 303 303 304 305 305 305 306 306 307 309 309 310 310 310 312 313 313 315 315 315 315 316 316 317 318 318 320 321 321 322 322 323 325 325 327 327 327 330 330 331 332 333 334 335 337 337 338 338 340 342 342 342


6800 6902 6904 6910 6914 6916

Nr. -

6921

-

6926

-

6933 6937

-

6940

-

6951 6960 6965 6968

-

7058

-

7063 7092 7099

Medaillen Papiergeld Münzbecher, Münzpokal Numismatische Literatur, Lots

Sachsen, sächsische Herzogtümer Sayn Schaumburg-Lippe Schlesien Schleswig-Holstein Schwäbisch Hall Schwäbischer Bund Schwarzburg Sigmaringen-Helfenstein Speyer St. Blasien Stolberg Stralsund Thurn und Taxis Trier Überlingen Ulm Waldeck Westfalen Spezialsammlung Wied Wiedenbrück Wismar Worms Württemberg Würzburg Sammlung Sedisvakanz

-

6901 6903 6909 6913 6915 6919 6920 6924 6925 6931 6932 6936 6938 6939 6949 6950 6959 6964 6967 7056 7057 7061 7062 7091 7098 7210

Seite 361 361 362 363 363 364 364 365 365 365 365 366 366 366 367 367 367 368 369 369 369 370 370 371 371 372 384 384 384 385 385 385 389 390 391 411

7211

-

7234

412

-

416

7235 7272 7275

-

7271 7274 7318

416 422 424

-

421 423 426

342

Ein Stichwortverzeichnis finden Sie am Ende dieses Auktionskataloges. ___________________________

BESICHTIGUNG Besichtigung des Auktionsgutes in unseren Geschäftsräumen, Gutenbergstr. 23, 49076 Osnabrück, ab dem 11. Februar 2008, nach vorheriger telefonischer Vereinbarung unter +49 (0)5 41 96 20 20.

EXPOSITION Les monnaies seront visibles à partir du 11 Février 2008, Gutenbergstr. 23, 49076 Osnabrück, sur rendez-vous téléphonique +49 (0)541 96 20 20.

EXPOSICIÓN Con cita previa +49 (0)541 96 20 20 podrá ver todos los lotes el 11 de febrero de 2008 en nuestras oficinas en 49076 Osnabrück, Gutenbergstr. 23.

ON VIEW The coins are on view at our premises in 49076 Osnabrueck, Gutenbergstr. 23, from February 11th 2008, by prior appointment: +49 (0)541 96 20 20.

ESPOSIZIONE Tutti i lotti 11 Febbraio Gutenbergstr. appuntamento 20.

sono visionabili a partire dal 2008 presso la nostra sede, 23, 49076 Osnabrück previo telefonico +49 (0)541 96 20

ПРОСМОТР АУКЦИОННЫХ ЛОТОВ Просмотр аукционных лотов проходит с 11 февраля 2008 года в нашем офисе по телефонной договоренности +49 (0)541 96 20 20 по адресу: Gutenbergstr. 23, 49076 Osnabrück.

9


WICHTIGE HINWEISE FÜR UNSERE TELEFONBIETER

IMPORTANT INFORMATION ON TELEPHONE BIDDING

Wenn Sie telefonisch mitbieten möchten, bitten wir Sie aus organisatorischen Gründen, uns diesen Wunsch bis spätestens 48 Stunden vor der Versteigerung schriftlich mitzuteilen. Voraussetzung für ein telefonisches Mitbieten ist, daß Sie mindestens den Schätzpreis bieten. Telefonisches Bieten ist erst ab einem Schätzpreis von ca. 500 Euro pro Los möglich.

If you wish to participate in the auction as a telephone bidder, please inform us at least 48 hours in advance as we have to approve and schedule all calls. To register for telephone bidding, we require that you submit at least the estimate as written bid in addition to being called. Telephone bidding is accepted on lot numbers with estimates starting at 500 Euro.

Bitte beachten Sie, daß wir keinerlei Haftung übernehmen, falls die telefonische Verbindung während der Auktion nicht zustande kommt.

We do not assume liability should the telephone line be interrupted or not be achieved.

Sollten Sie Fragen zu der telefonischen Teilnahme an unseren Auktionen haben, können Sie uns vor der Auktion unter +49 (0)5 41 96 20 20 oder 0800 5836 537 (gebührenfrei) anrufen. Während der Auktion erreichen Sie uns unter der auf der ersten Seite angegebenen Telefonnummer.

INFORMATIONS POUR LA PARTICIPATION PAR TELEPHONE

Please call +49 541 96 20 20 for more information or to register for telephone bidding. During the auction you will be able to reach us at the telephone number indicated on page 1.

INFORMAZIONI PER LA PARTECIPAZIONE TELEFONICA

Si vous désirez participer par téléphone à nos ventes aux enchères, veuillez vous mettre en relation avec Alexandra Elflein au moins 48 heures avant la vente au numéro +49 541 96 20 233. Pendant la vente aux enchères nous vous prions d'appeler le numéro indiqué sur page no. 1 de ce catalogue.

Se desiderate la partecipazione telefonica in diretta durante l´asta, siete pregati di chiamare la Signorina Sonia Russo al numero diretto +49 541 96 20 245 come minimo 48 ore prima dell´asta e di inviarci la vostra offerta, la quale deve ammontare come minimo al prezzo di stima anche per iscritto.

Une participation téléphonique à la vente sera possible à la condition que vous nous fassiez parvenir aussi votre ordre par écrit. Cet ordre devra être au moins égal au minimum au prix d’estimation et concerner un lot estimé au moins 500 Euros.

Accettiamo una partecipazione telefonica in diretta durante l´asta per oggetti il cui prezzo di stima ammonta come minimo ai 500 Euro. Non assumeremo nessuna responsabilità se la linea telefonica è occupata o se non siete raggiungibili.

Nous déclinons toute responsabilité dans le cas où la communication téléphonique serait interrompue, ou bien ne pourrait être établie.

INFORMACIONES DE COMO PARTICIPAR POR TELÉFONO Si quiere participar por teléfono en la subasta por favor se ponga en contacto anteriormente con la señora Sonia Russo +49 541 96 20 245 y envienos las pujas tambien por escrito por lo menos 48 oras antes de la subasta.

Для участия в торгах по телефону просим Вас связаться с нами не позднее 48 часов до начала аукциона. Условием проведения телефонных торгов является письменное подтверждение ставки, равной как минимум стартовой цене.

Autorizamos una participación por teléfono solamente para lotes cuyos precio de estima es por lo menos 500 Euro.

Участие в телефонных торгах возможно только для лотов со стартовой ценой свыше 500 евро.

No asumimos la responsabilidad si la conexión telefónica se interumpa sin previsión o si está comunicando.

10

ВАЖНАЯ ИНФОРМАЦИЯ ДЛЯ УЧАСТИЯ ПО ТЕЛЕФОНУ

Для получения дополнительной информации и регистрации на аукционе звоните Анастасии Кепселль до аукциона по телефону +49 541 96 20 268 и во время аукциона по телефону, указанному на первой странице каталога.


BOLOGNA

)1.&70&5+.$'424)70)'0 810+6#.+'070&&'/8#6+-#0

1,5:1

4501

1,5:1

#37+.'+#2#64+#4%*#6 

$GTVQNFQ  &GPCTQ EQP NC $GCVC 8GTIKPG  I &GT 2CVTKCTEJ OKV /KVTC -TGW\UVCD WPF   $WEJ UKV\V X X$TWUVDKNF FGT JN ,WPIHTCW OKV GTJQDGPGP *·PFGP X X $GTPCTFK  C $KCIIK   

4  44(CUVXQT\ÒINKEJ

4502



4503



)TGIQTKQ FK /QPVGNQPIQ  &GPCTQ  I 2CVTKCTEJ UVGJV X X<YGK *GKNKIG UVGJGP   PGDGPGKPCPFGTXX$GTPCTFK$KCIIK 4  4-PCRRGT5EJTÌVNKPIUGJTUEJÌP





&GPCTQWOI2CVTKCTEJUKV\VXXOKV-TGW\UVCDWPF$WEJ#FNGTXXFGP-QRHPCEJT IGYCPFV$GTPCTFK$KCIIK 4  5GJTUEJÌPHCUVUGJTUEJÌP



4504

#.'55#0&4+# 

5VCFV -NKRRGPHÌTOKIG $TQP\GIW­OGFCKNNG  WPUKIPKGTV CWH )KCP )KCEQOQ 6TKXWN\KQ 

   Ó /CTUEJCNNXQP(TCPMTGKEJ/CTEJGUGXQP8KIGXCPQWPFFKG'TQDGTWPIXQP#NGUUCPFTKC$TWUV DKNF N OKV .QTDGGTMTCP\#EJV <GKNGP 5EJTKHV QDGP ,CJTGU\CJN WPVGP .CWDDNCVV  Z  OO   $ÌTPGT6QFGTK8CPPGN+5 5R·VGTGT)W­5GJTUEJÌP &KGXQTNKGIGPFG/GFCKNNGGTKPPGTVCPFKG'KPPCJOGXQP#NGUUCPFTKCCPFKG)GHCPIGPPCJOGFGU/CKN·PFGT*GT\QIU .QFQXKEQKN/QTQUQYKGCPUGKPG8GTVTGKDWPICWU0QXCTC



4505

$1.1)0# 

2TQXKUQTKUEJG4GIKGTWPI5EWFQ 2CQNK &CX8CTGUK  #VVTCMVKXGU'ZGORNCTUGJTUEJÌPpXQT\ÒINKEJ

 11


CASALE-MONTFERRAT

4506

   

4507

5EWFQ 2CQNK &CX8CTGUK 5EWFQ 2CQNK &CX8CTGUK 5EWFQ 2CQNK &CX8CTGUK 5EWFQ 2CQNK &CX8CTGUK

4508

5EJTÌVNKPIUHGJNGTUGJTUEJÌP 5VGORGNHGJNGTUGJTUEJÌP 5GJTUEJÌP (CUVUGJTUEJÌP

4510

   

4511

4511 1,5:1



%#4/#)01.#

/KEJGNG#PVQPKQFK5CNW\\Q%QTPWVQQ,8CTGUK

4'VYCU$GNCIUGJTUEJÌP



$QPKHCEKWU++6GUVQPGQ,8CTGUK  449KP\4CPFHGJNGTCVVTCMVKXGUUGJTUEJÌPGU'ZGORNCTOKVUEJÌPGT6ÌPWPI



%#5#.'/106('44#6 

4512

 12

%QTPWVQQ,8CTGUK

44&QRRGNUEJNCIUGJTUEJÌP




FERRARA

4514

4513

4513

%+5#.2+0'4'27$.+- 

5EWFQ  .KTG  #001 8+++   /CKNCPF CWH FKG 5EJNCEJV DGK /CTGPIQ &CX  2CICPK    2TCEJVGZGORNCTOKVJGTTNKEJGT6ÌPWPI(CUV5VGORGNINCP\  +O 8GTNCWH FGU <YGKVGP -QCNKVKQPUMTKGIGU   HCPF CO  ,WPK  DGK FGO MNGKPGP KVCNKGPKUEJGP &QTH   /CTGPIQ \YKUEJGP 0CRQNGQP $QPCRCTVG WPF FGO ÌUVGTTGKEJKUEJGP )GPGTCN /GNCU FKG 'PVUEJGKFWPIUUEJNCEJV UVCVV   0CRQNGQP JCVVG ÒDGTTCUEJGPF FKG #NRGP ÒDGTUEJTKVVGP WO UKEJ FGT ÌUVGTTGKEJKUEJGP #TOGG \W UVGNNGP FKG \WP·EJUV   LGFQEJ MGKPGP #PITKHH YCIVG #NU FKG (TCP\QUGP \YKUEJGP FGP &ÌTHGTP /CTGPIQ %CUVGN %GTKQNQ WPF 6QTTG FKG   )CTQHCNG5VGNNWPIDG\QIGPITKHH/GNCUFKG\GTURNKVVGTVGP6TWRRGPXGTD·PFGCP0CEJFGOFKGHTCP\ÌUKUEJGP6TWRRGP \WP·EJUV\WTÒEMIGUEJNCIGPYWTFGPVTCHFKG8GTUV·TMWPIKP)GUVCNVFGT&KXKUKQPFGU)GPGTCNU.QWKU%JCTNGU#PVQKPG &GUCKZ  GKPFKGXQPGKPGT'TMWPFWPIUOKUUKQP\WTÒEMMGJTVG8QPFGTRNÌV\NKEJGPªDGTOCEJVGTUEJTGEMV GTITKHH\WP·EJUVFKGÌUVGTTGKEJKUEJG-CXCNNGTKGFKG(NWEJVWPFTK­FKG+PHCPVGTKGOKVUKEJ)GPGTCN&GUCKZYWTFGDGKO #PITKHH XQP GKPGT -WIGN VÌFNKEJ IGVTQHHGP &GT WPGTYCTVGVG 5KGI FGT (TCP\QUGP YCT GPVUEJGKFGPF &GT   ÌUVGTTGKEJKUEJG 1DGTDGHGJNUJCDGT UEJNQUU PWT GKPGP 6CI UR·VGT GKPGP 8GTVTCI KPFGO GT UKEJ XGTRHNKEJVGVG )GPWC   2KGTOQPV WPF FKG .QODCTFGK \W ÒDGTIGDGP 0CEJ FKGUGT 5EJNCEJV YGTFGP CWEJ KO YGKVGTGP 8GTNCWH FGU     ,CJTJWPFGTVU FKGPCEJHTCP\ÌUKUEJGO/ÒP\HW­IGRT·IVGPIQNFGPGP(TCPEJK5VÒEMGKP+VCNKGPō/CTGPIKŋIGPCPPV



('44#4#

'TEQNG+F 'UVG)TQUUQPGQ,$GNNGUKC$

5GJTUEJÌP



6GUVQPGQ, WO I-QRHN4GKVGTT$GNNGUKC)  44#VVTCMVKXGUUGJTUEJÌPGU'ZGORNCTOKVUEJÌPGT6ÌPWPI



4515

1,5:1



1,5:1

'TEQNG + F 'UVG   YCT FGT 5QJP 0KEEQNQU +++   FGU /CTMITCHGP XQP (GTTCTC /QFGPC WPF   4GIIKQCWUFGUUGPFTKVVGT'JG#NUUGKP8CVGTUVCTDYCTGTIGTCFG,CJTGCNVUQFC­UGKPWPGJGNKEJGT*CNDDTWFGT .GQPGNNQ\WP·EJUVFKG4GIKGTWPIUIGUEJ·HVGÒDGTPCJO0CEJFGOCWEJFKGUGTXGTUVQTDGPYCTJ·VVGGTGKIGPVNKEJOKV  ,CJTGP UGNDUV FCU #OV FGU /CTMITCHGP CWUÒDGP MÌPPGP FQEJ CWH &TWEM FGT WONKGIGPFGP 5KIPQTKGP YWTFG   UVCVVFGUUGPUGKP*CNDDTWFGT$QTUQKPVJTQPKUKGTV0CEJFGUUGP6QFKO,CJTÒDGTPCJO'TEQNG+GPFNKEJUGNDUVFKG *GTTUEJCHVWPFXQNN\QIGKPGPTCFKMCNGP9CPFGNKPFGT2QNKVKMFGT/CTMITCHUEJCHV&CU$ÒPFPKUOKV8GPGFKIYWTFG DGGPFGV WPF GT JGKTCVGVG  'NGQPQTC FKG 6QEJVGT UGKPGU DKUJGTKIGP (GKPFGU (GTTCPVG XQP #TCIQP -ÌPKI \W   0GCRGN 5GKPG 8GTUWEJG FKG 'ZRCPUKQP 8GPGFKIU CWH FGO KVCNKGPKUEJGP (GUVNCPF \W DGGPFGP OÒPFGVGP UEJNKG­NKEJ   KP GKPGO XGTNWUVTGKEJGP WPF GTHQNINQUGP -TKGI   &KG UEJOGT\NKEJG 'THCJTWPI FGT 0KGFGTNCIG OCEJVG   LGFQEJ CWU 'TEQNG GKPGP (TKGFGPUHÒTUVGP FGT UKEJ PWP XGTUV·TMV FGT YKTVUEJCHVNKEJGP WPF MWNVWTGNNGP $NÒVG UGKPGT   $GUKV\WPIGP YKFOGVG &KG XQP KJO IGRNCPVG +PVGITCVKQP GKPGT OQFGTPGP 5VCFVCPNCIG KP GKPGP OKVVGNCNVGTNKEJGP   5VCFVMGTP IKNV DKU JGWVG CNU XQTDKNFNKEJG #TEJKVGMVWTOC­PCJOG FGT 4GPCKUUCPEG 8QP DGUQPFGTGT 5EJÌPJGKV WPF   MÒPUVNGTKUEJGO #PURTWEJ UKPF CWEJ FKG WPVGT KJO IGRT·IVGP 6GUVQPG FKG W C 5\GPGP CWU FGO O[VJQNQIKUEJGP   .GDGPUGKPGU0COGPUXGVVGTP*GTMWNGUFCTUVGNNGP&GTJKGTCPIGDQVGPG6GUVQP\·JNV\WFGPUEJÌPUVGP2T·IWPIGPFGT KVCNKGPKUEJGP4GPCKUUCPEG

13


FLORENZ

4516

4518

4517



'TEQNG++F 'UVG/WTCKQNCQ,$GNNGUKC0



#NHQPUQ++F 'UVG)KQTIKPQ$GNNGUKCXCT

4519

5GJTUEJÌP



-TCV\GTUGJTUEJÌP



(.14'0< 

4GRWDNKM  (KQTKPQ F QTQ Q ,    I .KNKG5V ,QJCPPGU UVGJV X X CO   'PFGFGT7OUEJTKHV/ÒP\\GKEJGP4KPIGNFCTKP2WPMV$GTPQEEJK(D )1.&5GJTUEJÌP





(KQTKPQ F CTIGPVQ 2QRQNKPQ  Q ,  *CNDLCJT    I /ÒP\OGKUVGT )TC\KC FK %QTPCEEJKPQ   .KNKG5V,QJCPPGUUVGJVXXOKV-TGW\UVCDKPFGT4GEJVGP\WFGP5GKVGPLGGKP5VTCWEJCO#PHCPIFGT 7OUEJTKHV/ÒP\\GKEJGP.GKVGT$GTPQEEJK 45GJTUEJÌP



4520

4521



(KQTKPQF QTQQ,  I.KNKG5V,QJCPPGUUVGJVXXCO'PFGFGT7OUEJTKHV/ÒP\ \GKEJGP&TGK*CNDOQPFG$GTPQEEJK(D )1.&8QT\ÒINKEJ



(KQTKPQF QTQQ,  I/ÒP\OGKUVGT/CTEQFK7DGTVQ5VTQ\\K.KNKG5V,QJCPPGUUVGJVX XCO'PFGFGT7OUEJTKHV/ÒP\\GKEJGP)QVKUEJGU/FCTÒDGT\WPGJOGPFGT/QPF$GTPQEEJK (D )1.&5GNVGPKPFKGUGT'TJCNVWPI#VVTCMVKXGUXQT\ÒINKEJGU'ZGORNCT 



'UMÌPPVGUKEJDGKFGO/ÒP\\GKEJGPFGUXQTNKGIGPFGP)QNFIWNFGPUCWEJWOGKPGP4KPIGNÒDGTFGOIQVKUEJGP/ JCPFGNP'KPUQNEJGU$GK\GKEJGPKUVCNNGTFKPIUDGK$GTPQEEJKPKEJVXGT\GKEJPGV

4522

4523





14

4523

)TQUUQ IWGNHQ Q ,  *CNDLCJT    I /ÒP\OGKUVGT .WKIK FK #PVQPKQ FK /KINKQTG )WKFQVVK   .KNKG5V ,QJCPPGUOKVWOIGNGIVGO/CPVGNUVGJVHCUVXXKPFGT.KPMGP-TGW\UVCD$GTPQEEJK 5GJTUEJÌP



5VCFV $TQP\GOGFCKNNG Q ,   XQP # FG ,CPWCTKQ CWH FGP )GNGJTVGP WPF $KDNKQVJGMCT #PVQPKQ   /CINKCDGEEJK $TWUVDKNF /CINKCDGEEJKUTOKVWOIGNGIVGO/CPVGN/CINKCDGEEJKUKV\VPCEJTCPGKPGP $CWOIGNGJPVWPFNKGUVCO$QFGPNKGIGPYGKVGTG$ÒEJGTKO*KPVGTITWPFTUVGJVGKP$GVVNGTOO 9WT\DCEJ 5GJTCVVTCMVKXGUXQT\ÒINKEJGU'ZGORNCTOKVUEJÌPGT2CVKPC




GENUA

4525

4524

4527

4526

)'07# 

)CDTKGNG#FQTPQ8)GPQXKPQQ,I/KV/ÒP\\GKEJGP.CWHFGT8QTFGTWPF+CWH FGT4ÒEMUGKVG(D.WPCTFK )1.&-PCRRGT5EJTÌVNKPIUGJTUEJÌPpXQT\ÒINKEJ



)GPQXKPQ Q ,  I /KV /ÒP\\GKEJGP 5 CWH FGT 8QTFGT WPF 4 CWH FGT 4ÒEMUGKVG (D    .WPCTFK )1.&5GJTUEJÌPpXQT\ÒINKEJ





)CNGC\\Q /CTKC 5HQT\C  &WECVQ Q ,   /KV /ÒP\\GKEJGP #% CWH FGT 4ÒEMUGKVG   I(D.WPCTFK )1.&45GJTUEJÌPpXQT\ÒINKEJ





$CVVKUVC FK %CORQHTGIQUQ  &WECVQ Q ,   /KV /ÒP\\GKEJGP ) CWH FGT 4ÒEMUGKVG   I(D.WPCTFK )1.&45GJTUEJÌPpXQT\ÒINKEJ 



4529

4528

4528



4GRWDNKM &QIK$KGPPCNK 6GUVQPGDGPGFK\KQPGI&GTJGKNKIG,QJCPPGUUVGJVN WPFUGIPGVFGPOKVGKPGT(CJPGPNCP\GXQTKJOMPKGGPFGP&QIGP8GT\KGTVGU-TGW\KPFGP9KPMGNPLG GKP-CUVGNNXQP)GPWC.WPCTFK 445EJTÌVNKPIUTK­HCUVUGJTUEJÌP 



5EWFQ.WPCTFK

-PCRRGT5EJTÌVNKPIUGJTUEJÌP



4530



5EWFK)GPWCI9CRRGP5VKNKUKGTVGU6QT\WFGP5GKVGPLGGKP)TGKHQDGP-TQPGWPVGP IGHNÒIGNVGT 'PIGNUMQRH8GT\KGTVGU -TGW\ KP FGP 9KPMGNP LG GKPG $NWOG WPF GKP IGHNÒIGNVGT 'PIGNU   MQRH&CX.WPCTFK 4FQTVOKV/ÒP\OGKUVGT\GKEJGP  445GJTUEJÌP  15


GENUA

4531

1,5:1



1,5:1

 &QRRKC  )GPWC /KV /ÒP\\GKEJGP +$6 CWH FGT 4ÒEMUGKVG  I $NWOGPMTGW\/CFQPPC   OKV <GRVGT KP FGT 4GEJVGP WPF -KPF KO NKPMGP #TO UKV\V X X CWH 9QNMGPFGP-QRHFGTXQPGKPGO 5VGTPGPMTCP\WOIGDGPKUVJCVUKGFGO-KPF\WIGYCPFV(D.WPCTFK \W   )1.&8QPCNNGTITÌ­VGT5GNVGPJGKV8GTOWVNKEJWPGFKGTV5GJTUEJÌPGU'ZGORNCT 

4532



5EWFQUVTGVVQ)GPWC/KV/ÒP\\GKEJGP5/CWHFGT4ÒEMUGKVG&CX.WPCTFK  7PDGFGWVGPFGU<CKPGPFGCVVTCMVKXGUUGJTUEJÌPGU'ZGORNCTOKVUEJÌPGT6ÌPWPI



4533



2TQDGCDUEJNCIXQPFGP5VGORGNPFGUFQRRGNVGP5EWFQIGRT·IVCWHGKPGO$NGK\CKP+PFGP'EMGP KUVLGYGKNUFCU-CUVGNNXQP)GPWCKPGKPGOQXCNGP5VGORGNCPIGDTCEJV.WPCTFK\W  +PVGTGUUCPVGUPWOKUOCVKUEJGU&QMWOGPV5GJTUEJÌP



4535

4534

4534



5EWFQUVTGVVQ)GPWC/KV/ÒP\\GKEJGP5/CWHFGT4ÒEMUGKVG&CX.WPCTFK  $TGKVGT5EJTÌVNKPIOKP-QTTQUKQPKO4CPFDGTGKEJMN5EJTÌVNKPIUHGJNGTUGJTUEJÌP





<GEEJKPQI/KV/ÒP\\GKEJGP1/CWHFGT8QTFGTUGKVG(D.WPCTFK  )1.&5GJTUEJÌP



16


GENUA

4536

 

4537

.KTGI(D.WPCTFK .KTGI(D.WPCTFK

)1.&.GKEJVG(CUUWPIUURWTGPUGJTUEJÌP )1.&5GJTUEJÌP

4539

4538

 

.KTG.WPCTFK .KTG.WPCTFK

4(CUVXQT\ÒINKEJ 8QT\ÒINKEJGU'ZGORNCTOKVUEJÌPGT2CVKPC

4540

 

 

 

4541

.KTGI(D.WPCTFK .KTGI(D.WPCTFK

)1.&9KP\-TCV\GTUGJTUEJÌPpXQT\ÒINKEJ )1.&9KP\5EJTÌVNKPIUHGJNGTUGJTUEJÌP

 

4543

4542

 

.KTG&CX.WPCTFK .KTG.WPCTFK

4542

8QT\ÒINKEJ 4-N4CPFHGJNGTHCUVXQT\ÒINKEJ

  17


KIRCHENSTAAT

4544

1,5:1

1,5:1



 .KTG  2TQDGRT·IWPI  I 8QP \YGK )TGKHGP IGJCNVGPGU IGMTÌPVGU 9CRRGP5V ,QJCPPGU   UVGJV JCNDN OKV *GKNKIGPUEJGKP GTJQDGPGT 4GEJVGP WPF 5VCD KP FGT .KPMGP .WPCTFK  8CTGUK  C  

4  8QPCNNGTITÌ­VGT5GNVGPJGKV8QT\ÒINKEJGU'ZGORNCTOKVHGKPGT6ÌPWPI  (ÒT FKG 8QTFGTUGKVG FKGUGT GZVTGO UGNVGPGP 2TQDGRT·IWPI YWTFG FGT 8QTFGTUGKVGPUVGORGN FGU .KTG5VÒEMGU    XGTYGPFGV

1,5:1

4545

1,5:1

-+4%*'056##6 

.GQ +8  WPF .QVJCT +  &GPCTQ 4QO  I /QPQITCOO/QPQITCOO   $KCIIK 4 /WPVQPK 445GJTUEJÌP

1,5:1



4546

1,5:1

0KMQNCWU +  WPF .WFYKI ++  &GPCTQ 4QO  I /QPQITCOO/QPQITCOO   $KCIIK 4 /WPVQPK 45GJTUEJÌP

4547





4548



4ÌOKUEJGT5GPCV)TQUUQCPQPKOQQ,  4QOI.ÌYGN4QOCVJTQPV XXOKV)NQDWUWPF2CNO\YGKI$KCIIK/WPVQPK 9KP\4CPFHGJNGTUGJTUEJÌP





,QJCPPGU::++)TQUUQQ,/CEGTCVCI&GT2CRUVVJTQPVXXOKV/KVTCUGIPGP FGT4GEJVGPWPF-TGW\UVCD-TGW\$KCIIK 4 /WPVQPK 45GJTUEJÌP



18


KIRCHENSTAAT

4550

4549





4ÌOKUEJGT 5GPCV  &WECVQ Q , 4QO 5V 2GVTWU UVGJV T WPF ÒDGTTGKEJV FGO XQT KJO   MPKGPFGP5GPCVQTGKPG(CJPG%JTKUVWUUVGJVXXOKV$WEJWOJGT/CPFQTNCWPFPGWP5VGTPGI (D/WPVQPK )1.&(CUVXQT\ÒINKEJGU'ZGORNCT



+PPQEGP\8+)TQUUQQ,#XKIPQPI&GT2CRUVVJTQPVXXOKV/KVTCUGIPGP FGT4GEJVGPWPF-TGW\UVCD-TGW\KPFGP9KPMGNPIGMTGW\VG5EJNÒUUGN/WPVQPK 5GJTUEJÌP



4552

4551

4553



7TDCP 8  )TQUUQ Q , #XKIPQP  I &GT 2CRUV VJTQPV X X OKV /KVTC UGIPGPFGT   4GEJVGPWPF-TGW\UVCD)GMTGW\VG5EJNÒUUGN/WPVQPK FKGUGU'ZGORNCT  445GJTUEJÌP 



%NGOGPU 8++ )GIGPRCRUV  )TQUUQ Q , #XKIPQP  I &GT 2CRUV VJTQPV X X OKV   /KVTCUGIPGPFGT4GEJVGPWPF-TGW\UVCD)GMTGW\VG5EJNÒUUGN/WPVQPK 445GJTUEJÌP 



)TGIQT:++)TQUUQQ,4QO/WPVQPK  445GJTUEJÌPGU'ZGORNCTOKVUEJÌPGT6ÌPWPI



4555

4554



/CTVKP8%CTNKPQQ,#XKIPQP/WPVQPK

45GJTUEJÌP





%CTNKPQQ,#XKIPQP/WPVQPK

45GJTUEJÌP



4556

4557



'WIGP+8)TQUUQQ,4QO/WPVQPK



)TQUUQQ,4QO/WPVQPK



%CTNKPQQ,#XKIPQP/WPVQPK

4558

445GJTUEJÌP



445EJÌPpUGJTUEJÌP



45GJTUEJÌP

 19


KIRCHENSTAAT

4559

4562

4561

4560



0KEQNCWU8&WECVQRCRCNGQ,4QOI(D/WPVQPK  )1.&5GJTUEJÌPpXQT\ÒINKEJ





)TQUUQ#001+7$+.'+  4QOCWHFCU*GKNKIG,CJT/WPVQPK

445EJÌP





%CNKZV+++&WECVQRCRCNGQ,4QOI(D/WPVQPK  )1.&44/KPIGYGNNVUGJTUEJÌP





&WECVQRCRCNGQ,4QOI(D/WPVQPK



)TQUUQQ,4QO8CTKCPVGP/WPVQPKHH

4565

4564

)1.&4-N-TCV\GTUGJTUEJÌPpXQT\ÒINKEJ



5VÒEM44#NNGIGNQEJVUEJÌPpUGJTUEJÌP



4565



2KWU++&WECVQRCRCNGQ,4QOI(D/WPVQPK  )1.&448QT\ÒINKEJGU'ZGORNCT



)TQUUQQ,4QO/WPVQPKXCT

4(CUVUGJTUEJÌP





)TQUUQQ,4QO&C\W)TQUUQQ,#PEQPC/WPVQPKXCT  5VÒEM45EJÌPpUGJTUEJÌPWPFZIGNQEJVUEJÌP



1,5:1



4567 1,5:1

2CWN ++  &WECVQ RCRCNG Q , 4QO  I 9CRRGP FCTÒDGT IGMTGW\VG 5EJNÒUUGN WPF   /KVTCWOJGT8KGTRC­%JTKUVWUUVGJVPCEJNWPFÒDGTTGKEJVFGOXQTKJOMPKGPFGP2CRUVFKG5EJNÒUUGN (D/WPVQPK )1.&8QPITQ­GT5GNVGPJGKV/KPIGYGNNVUGJTUEJÌP 

4568



&WECVQRCRCNGQ,4QOI(D/WPVQPK



&WECVQRCRCNGQ,4QOI(D/WPVQPK

20



4569

)1.&44-N5EJTÌVNKPIUTK­UGJTUEJÌP



)1.&45GJTUEJÌPpXQT\ÒINKEJ




KIRCHENSTAAT

4570

4571

4571



)TQUUQQ,#PEQPC/WPVQPK

45GJTUEJÌP





$TQP\GIW­OGFCKNNG$TWUVDKNFT9CRRGPOO/QFGUVK+

8QT\ÒINKEJGT1TKPIKPCNIW­





)TQUUQQ,#PEQPC&C\W$QNQIPKPQTQOCPQQ,4QO/WPVQPKXCT  5VÒEMZIGYGNNVUGJTUEJÌP



4574

4573

4575

4576



5KZVWU+8&WECVQRCRCNGQ,4QOI(D/WPVQPK  )1.&49KP\2TÒHURWTHCUVXQT\ÒINKEJ



(KQTKPQFKECOGTCQ,4QOI(D/WPVQPKXCT

 )1.&/GJTGTG4CPFHGJNGTUGJTUEJÌP





+PPQEGP\8+++(KQTKPQFKECOGTCQ,4QOI(D/WPVQPK  )1.&5GJTUEJÌP





(KQTKPQFKECOGTCQ,4QOI(D/WPVQPK

)1.&5GJTUEJÌP





#NGZCPFGT8+(KQTKPKFKECOGTCQ,4QOI(D/WPVQPK8CT+  )1.&44(CUUWPIUURWTGPUGJTUEJÌP





(KQTKPQFKECOGTCQ,4QOI(D/WPVQPK



4578

4577

1,5:1





)1.&(CUVXQT\ÒINKEJGU'ZGORNCT

4579 1,5:1

(KQTKPQFKECOGTCQ,#PEQPCI9CRRGPFCTÒDGTIGMTGW\VG5EJNÒUUGNWPF/KVTCWOJGT8KGT RC­5V2GVTWUNKP5EJKHH(DC/WPVQPK  )1.&8QPITQ­GT5GNVGPJGKV5GJTUEJÌPGU'ZGORNCT

 21


KIRCHENSTAAT

4582

4580

4583



)TQUUQQ,#PEQPC$KCIIK/WPVQPK



)TQUUQQ, 5VÒEM &C\W+PPQEGP\8+++3WCVVTKPQQ, 5VÒEM %CXCNNQQ,#SWKNC 5VÒEM  5VÒEMZIGNQEJVUEJÌPpUGJTUEJÌP

'VYCU$GNCIMN4CPFCWUDTWEJUGJTUEJÌP





,WNKWU++&WECVQRCRCNGQ,$QNQIPCI(D/WPVQPK  )1.&#VVTCMVKXGUUGJTUEJÌPGU'ZGORNCT





&WECVQRCRCNGQ,$QNQIPCI(D/WPVQPK  )1.&4#VVTCMVKXGUUGJTUEJÌPGU'ZGORNCT



4584



4585



&WECVQRCRCNGQ,$QNQIPCI(DC FQTVHCNUEJG#DDKNFWPI /WPVQPKXCT  )1.&45GJTUEJÌP





&WECVQRCRCNGQ,$QNQIPCI(DC FQTVHCNUEJG#DDKNFWPI /WPVQPKXCT  )1.&-N5EJTÌVNKPIUTK­UGJTUEJÌP



1,5:1



22

1,5:1

.GQ :  &WECVQ RCRCNG Q , #PEQPC  I 9CRRGP FCTÒDGT IGMTGW\VG 5EJNÒUUGN WPF   /KVTCWOJGT&TGKRC­5V2CWNWUOKV5EJYGTVWPF$WEJWPF5V2GVTWUOKV5EJNÒUUGNWPF$WEJUVGJGP PGDGPGKPCPFGTXX(D/WPVQPKXCT  )1.&8QPITQ­GT5GNVGPJGKV#VVTCMVKXGUHCUVXQT\ÒINKEJGU'ZGORNCT 

4587

 

4586

)KWNKQQ,#PEQPC/WPVQPK )KWNKQQ,#PEQPC/WPVQPKXCT

4588

44'VYCUDGTKGDGPUGJTUEJÌP 9KP\5EJTÌVNKPIUTKUUGUGJTUEJÌP

 


KIRCHENSTAAT

4589

4590

4591



)KWNKQQ,2GTWIKC/WPVQPK

445GJTUEJÌP





%NGOGPU8++5EWFQF QTQQ,$QNQIPCI(D/WPVQPK  )1.&5GJTUEJÌP





)KWNKQQ,4QO/WPVQPK

45GJTUEJÌP

4592





4593

#PQP[OGT&WECVQRCRCNGQ,$QNQIPCI(D/WPVQPK $CPF+86GKN+++#PQP[OG 2T·IWPIGP  )1.&'VYCUIGYGNNVUGJTUEJÌP



&GTUR·VGTG2CRUV%NGOGPU8++YCTGKPWPGJGNKEJIGDQTGPGT5QJPXQP)WKNKCPQ+FG/GFKEKCWU(NQTGP\(TÒJVTCV GT FGO ,QJCPPKVGTQTFGP DGK &WTEJ GKPGP 6TKEM UGKPGU 8GVVGTU 2CRUV .GQU : FGT KJP \W GKPGO 5QJP CWU GKPGT   ōJGKONKEJGP 'JGŋ GTMN·TVG MQPPVG $KUEJQH XQP 0CTDQPPG WPF  'T\DKUEJQH XQP (NQTGP\ YGTFGP #O    0QXGODGT  YWTFG GT \WO 2CRUV IGY·JNV WPF XGTHQNIVG \WP·EJUV GKPG PGWVTCNG 2QNKVKM KP FGP #WUGKPCPFGT   UGV\WPIGP \YKUEJGP FGO TÌOKUEJFGWVUEJGP -CKUGT -CTN 8   WPF FGP HTCP\ÌUKUEJGP -ÌPKI (TCP\ +  

 WOFKG*GTTUEJCHVÒDGT1DGTKVCNKGPUEJNQ­GTUKEJFGTō*GKNKIGP.KICXQP%QIPCEŋCPWPFUVGNNVG UKEJFCOKVCWHFKG5GKVG(TCPMTGKEJU-CKUGTNKEJG5ÌNFPGTGTQDGTVGPFCTCWHJKPCO/CKFKG*GKNKIG5VCFVWPF TKEJVGVGPXGTJGGTGPFG8GTYÒUVWPIGPCPFKGCNUō5CEEQFK4QOCŋKPFKG)GUEJKEJVGGKPIGICPIGPUKPF%NGOGPU8++ YWTFGIGHCPIGPIGPQOOGPWPFFKG/GFKEKCWU(NQTGP\XGTVTKGDGPPCEJFGO(TKGFGPXQP$CTEGNQPCMQPPVG GT PCEJ 4QO \WTÒEMMGJTGP YQ GT CO  (GDTWCT  -CTN 8 \WO -CKUGT MTÌPVG %NGOGPU 8++ UVCTD CO    5GRVGODGT  CP GKPGT 8GTIKHVWPI OKV FGO )TÒPGP -PQNNGPDN·VVGTRKN\ WPF YWTFG KP FGT -KTEJG5CPVC /CTKC   UQRTC/KPGTXCDGUVCVVGV



)TQUUQQ,#PEQPC/WPVQPKXCT $CPF+86GKN+++#PQP[OG2T·IWPIGP   4-N5EJTÌVNKPIUTK­HCUVUGJTUEJÌP



4594

1,5:1



1,5:1

2CWN +++   (KQTKPK FK ECOGTC Q , 4QO  I $TWUVDKNF N KP IGKUVNKEJGO 1TPCV5V   2GVTWUNKP5EJKHH(D/WPVQPK  )1.&8QPITQ­GT5GNVGPJGKV#VVTCMVKXGUUGJTUEJÌPGU'ZGORNCT  23


KIRCHENSTAAT

4595

1,5:1



1,5:1

(KQTKPQFKECOGTCQ,4QOI9CRRGPFCTÒDGTIGMTGW\VG5EJNÒUUGNWPF/KVTC5V2GVTWUTKP 5EJKHH(D/WPVQPK  )1.&5GJTUGNVGPKPFKGUGT'TJCNVWPI5GJTCVVTCMVKXGUXQT\ÒINKEJGU'ZGORNCT

4596

 

4597

(KQTKPQFKECOGTCQ,4QOI(D/WPVQPK (KQTKPQFKECOGTCQ,4QOI(D/WPVQPK

4599

4598



)1.&4(CUVXQT\ÒINKEJGU'ZGORNCT )1.&48QT\ÒINKEJGU'ZGORNCT

 

4601

4600



5EWFQF QTQQ,4QOI(D/WPVQPK  )1.&4&WTEJIGJGPFGT5EJTÌVNKPIUTK­UGJTUEJÌP



  

5EWFQF QTQQ,$QNQIPCI(D/WPVQPK 5EWFQF QTQQ,$QNQIPCI(D/WPVQPK 5EWFQF QTQQ,$QNQIPCI(D/WPVQPK

  

)1.&5GJTUEJÌP )1.&5GJTUEJÌP )1.&5GJTUEJÌP

4602

4603

4603

 

5EWFQF QTQQ,2KCEGP\CI(D/WPVQPK $KCPEQQ,$QNQIPC/WPVQPK



$KCPEQ Q , $QNQIPC )KWNKQ Q , 4QO /CEGTCVC  8CTKCPVGP  )TQUUQ Q , 4QO /CEGTCVC   $CKQEEQQ,4QO-W3WCVVTKPQ 5VÒEM &C\W.GQ:)KWNKQQ,-W3WCVVTKPQQ,%NG OGPU8++-W3WCVVTKPQQ, 5VÒEM5EJÌPpUGJTUEJÌP

24

)1.&5GJTUEJÌP 5GJTUEJÌP

  


KIRCHENSTAAT

4606

4605

ex 4609

4607

  

,WNKWU+++)KWNKQQ,#PEQPC/WPVQPKXCT )KWNKQQ,#PEQPC/WPVQPK 5GFKUXCMCP\)KWNKQ4QO/WPVQPK



/CTEGNNWU ++  )KWNKQ Q , #PEQPC 44  &C\W ,WNKWU +++ )KWNKQ Q , 4QO 4ÒEMUGKVGP   WOUEJTKHV1OPKCVWVCXKFGU44IGNQEJV )KWNKQQ,#PEQPC)TQUUQQ,4QO  5VÒEMZIGNQEJVUEJÌPpUGJTUEJÌP 2CWN+86GUVQPGQ,4QO/WPVQPK 5GJTUEJÌP

 

6GUVQPG Q , 4QO #PEQPC  8CTKCPVGP  $KCPEQ Q , $QNQIPC )KWNKQ Q , 4QO  8CTKCPVGP    #PEQPC 8CTKCPVGP 2CQNQQ,$QNQIPC 5VÒEM5EJÌPpUGJTUEJÌP



 

5GJTUEJÌP 5EJÌPG2CVKPCUGJTUEJÌP 445GJTUEJÌP

  

4612

ex 4611



5GFKUXCMCP\6GUVQPG4QO&C\W)KWNKQQ,4QO/WPVQPK  5VÒEM5GJTUEJÌPWPFUEJÌP





)KWNKQ4QO/WPVQPKXCT

5GJTUEJÌP



-N2T·IGUEJY·EJGUGJTUEJÌP



4613

4615

4616



2KWU+86GUVQPGQ,4QO/WPVQPK



6GUVQPG Q , 4QO  8CTKCPVGP  #PEQPC  8CTKCPVGP  $KCPEQ Q , $QNQIPC )KWNKQ Q , 4QO  

8CTKCPVGP  5VÒEM(CUVUGJTUEJÌP



 

2KWU8)TQUUQQ,4QO/WPVQPK $KCPEQ .KTC Q,$QNQIPC/WPVQPK

 

5GJTUEJÌP 5GJTUEJÌP

25


KIRCHENSTAAT

4617

1,5:1



)TGIQT:+++5EWFQF QTQ#8++  4QOI9CRRGPFCTÒDGTIGMTGW\VG 5EJNÒUUGNWPF/KVTC$TWUVDKNFXQP%JTKUVWUNOKV*GKNKIGPUEJGKP(D/WPVQPKD  )1.&44(CUVXQT\ÒINKEJGU'ZGORNCT

4618

1,5:1



26

1,5:1

4619

1,5:1

5EWFQF QTQQ,$QNQIPCI9CRRGPFCTÒDGTIGMTGW\VG5EJNÒUUGNWPF/KVTC-TGW\WPVGP\W FGP5GKVGPLGGKP9CRRGPUEJKNF(D/WPVQPK )1.&448QT\ÒINKEJ

4620

   



5EWFQ F QTQ Q , #PEQPC  I 9CRRGP FCTÒDGT IGMTGW\VG 5EJNÒUUGN WPF /KVTC&KG RGTUQPKHK   \KGTVG$CTOJGT\KIMGKVUVGJVXXOKVFTGK-KPFGTP(D/WPVQPK  )1.&8QPITQ­GT5GNVGPJGKV5GJTUEJÌPpXQT\ÒINKEJ 

1,5:1



1,5:1

4621

4622



4623

6GUVQPGQ,4QO/WPVQPK 44(CUVUGJTUEJÌP 6GUVQPG4QO/WPVQPK )WVGU2QTVT·V4ÒEMUGKVGGVYCU(WPFDGNCIUGJTUEJÌP 6GUVQPG#:+++  4QO/WPVQPKD (CUVUGJTUEJÌP 6GUVQPG#PEQPC/WPVQPKC 45EJÌPpUGJTUEJÌP

   


KIRCHENSTAAT

4625

4624

 

6GUVQPGQ,#PEQPC/WPVQPK )TGIQTKQQ,$QNQIPC/WPVQPK

5GJTUEJÌP 45GJTUEJÌP



6GUVQPGQ,4QO 8CTKCPVGP #PEQPC 8CTKCPVGP )KWNKQQ,4QO 8CTKCPVGP )TQUUQ Q,4QO&C\W2KWU86GUVQPQ,4QO$CKQEEQQ,4QO3WCVVTKPQQ,4QO  5VÒEM<WO6GKNUGNVGP5EJÌPpUGJTUEJÌP

4627



1,5:1

4629



4627

5KZVWU82KCUVTC#0++++4QOI$TWUVDKNFNKPIGKUVNKEJGO1TPCV5V(TCP EGUEQMPKGVNWPFGTJGDVFKG*·PFG\WO*KOOGNXQTKJO5VCFVCPUKEJVT$CWO&CX/WPVQPK NGKEJVXCT 45GJTUEJÌP

4628

 



4630

 

2KCUVTC#0++++4QO&CX/WPVQPK 6GUVQPG#+  4QO/WPVQPK

44CPFWPF(GNFGTNGKEJVDGCTDGKVGVUGJTUEJÌP 5EJTÌVNKPIUTK­UGJTUEJÌP



5KNDGTOGFCKNNG#08XQP0FG$QPKUCWHFKG'TDCWWPIFGT2QPUHGNKZÒDGTFGP6KDGTDGK%KXKVC %CUVGNNCPC$TWUVDKNFTKPIGKUVNKEJGO1TPCV#PUKEJVFGT$TÒEMGOOI/QFGUVK 4  8QPITQ­GT5GNVGPJGKV5GJTUEJÌP

   27


KIRCHENSTAAT

4632 1,5:1

1,5:1



6GUVQPG#+  4QO 8CTKCPVGP $KCPEQQ,$QNQIPC/WPVQPK  5VÒEM45EJÌPpUGJTUEJÌP



)TGIQT :+8  &QRRKC Q , $QNQIPC  I 9CRRGP FCTÒDGT IGMTGW\VG 5EJNÒUUGN WPF   /KVTC-TGW\WPVGP\WFGP5GKVGPLGGKP9CRRGPUEJKNF(D/WPVQPK  )1.&8QPITQ­GT5GNVGPJGKV5GJTUEJÌPpXQT\ÒINKEJ 



4633

4634

4634

  

%NGOGPU8+++&QRRKCQ,$QNQIPCI9CRRGPFCTÒDGTIGMTGW\VG5EJNÒUUGNWPF /KVTC-TGW\WPVGP\WFGP5GKVGPLGGKP9CRRGPUEJKNF(D/WPVQPK  )1.&8QPITQ­GT5GNVGPJGKV)GUVQRHVGU.QEJ*GPMGNURWTUGJTUEJÌP 6GUVQPGQ,4QO/WPVQPK 4-N&QRRGNUEJNCIMN&TWEMUVGNNGUGJTUEJÌP 6GUVQPQ, 8CTKCPVGP 4QO)TQUUQQ,4QO 8CTKCPVGP  5VÒEM(CUVUGJTUEJÌP

  

4636

1,5:1



28

1,5:1

2CWN 8  3WCFTWRNC # +8 4QO  I Ú 2#8.85 Ú 8 Û  Û 2 /#: Û # Û +8 Ú   9CRRGPFCTÒDGTIGMTGW\VG5EJNÒUUGNWPF/KVTCÛ5Û2#8.85Û#./#Û41/#$TWUVDKNFXQP5V 2CWNWUOKV*GKNKIGPUEJGKPNKO#DUEJPKVVFKGTÌOKUEJG,CJTGU\CJN/Û&%Û8+++(D/WPVQPK )1.&8QPITQ­GT5GNVGPJGKV-N&QRRGNUEJNCIUGJTUEJÌPGU'ZGORNCT 


KIRCHENSTAAT

4637

4639

4638

4640



5EWFQ F QTQ Q , 4QO  I 9CRRGP FCTÒDGT IGMTGW\VG 5EJNÒUUGN WPF /KVTC5V 2CWNWU UKV\V N   OKV5VCD(D/WPVQPK )1.&445GJTUEJÌP 

  

6GUVQPG#++++  4QO/WPVQPK 5GJTUEJÌP 6GUVQPG#++++  4QO/WPVQPK 5EJÌP 6GUVQPG#8++4QO/WPVQPKCXCT 5EJÌPG6ÌPWPIMN<CKPGPFGUGJTUEJÌPpXQT\ÒINKEJ

  

4642 4641

 

4641

2KCUVTC(GTTCTC&CX/WPVQPKXCT )KWNKQ(GTTCTC/WPVQPKXCT

4643

4644

44(CUUWPIUURWTGPUGJTUEJÌP 5GJTUEJÌP

 

4645

 

(TCPEQ#XKIPQP/WPVQPK (TCPEQ#:+++#XKIPQP/WPVQPK

(CUVUGJTUEJÌP 4)GNQEJVUGJTUEJÌP

 



(TCPEQ#XKIPQP/WPVQPK

4(CUVUGJTUEJÌP





6GUVQPG # +++   8CTKCPVGP  # 8   # 8++   4QO )KWNKQ # 8+++  

 4QOFKXGTUG)TQUUKWPFGKP-W3WCVVTKPQ4QOUQYKG)TQUUQWPF)TQUUQ Z CWU (GTTCTCFC\WYGKVGTG-NGKPOÒP\GP 5VÒEM(CUVUGJTUEJÌP

 29


KIRCHENSTAAT

4647

1,5:1



1,5:1

)TGIQT:83WCFTWRNCQ,4QOI  )4')14+8  :8 2106 /  9CRRGP FCTÒDGT IGMTGW\VG 5EJNÒUUGN WPF /KVTC 9CRRGPUEJKNF $QPCPPK 2CINKCTK G /CTVGNNK    58$ 688/  24“5+&+8/ &KGDGVGPFG,WPIHTCW/CTKCOKV5VGTPGPMTCP\UVGJVXXCWH /QPFUKEJGNWPF9QNMGPWOJGT5VTCJNGPMTCP\(D/WPVQPK  )1.&8QPITQ­GT5GNVGPJGKV9KP\5EJTÌVNKPIUHGJNGTCVVTCMVKXGUUGJTUEJÌPGU'ZGORNCT 

ex 4650

4648

ex 4650



5EWFQ F QTQ # ++   4QO  I $TWUVDKNF T KP IGKUVNKEJGO 1TPCV&KG DGVGPFG ,WPIHTCW   /CTKCOKV5VGTPGPMTCP\UVGJVXXCWH/QPFUKEJGNWPF9QNMGPWOJGT5VTCJNGPMTCP\(D/WPVQPK )1.&445GJTUEJÌP 



)TQUUQ(GTTCTC)TQUUQ#++  Q,4QO-W3WCVVTKPQQ,4QO(GTTCTC  5VÒEM5EJÌPpUGJTUEJÌP





5GFKUXCMCP\)KWNKQ4QOWPF(GTTCTC/WPVQPK  5VÒEM44(CUVUGJTUEJÌPWPFUGJTUEJÌP



1,5:1



30

1,5:1

7TDCP 8+++  5EWFQ F QTQ # :+++   4QO  I $TWUVDKNF T KP IGKUVNKEJGO   1TPCV&KG DGVGPFG ,WPIHTCW /CTKC OKV 5VGTPGPMTCP\ UVGJV X X CWH /QPFUKEJGN WPF 9QNMGP WOJGT   5VTCJNGPMTCP\(D/WPVQPK  )1.&5GJTUGNVGPDGUQPFGTUKPFKGUGT'TJCNVWPI8QT\ÒINKEJGU'ZGORNCT 

1,5:1



4651

4652

1,5:1

5EWFQ F QTQ Q , 4QO  I $TWUVDKNF T KP IGKUVNKEJGO 1TPCV&KG DGVGPFG ,WPIHTCW /CTKC OKV   5VGTPGPMTCP\UVGJVXXCWH/QPFUKEJGNWPF9QNMGPWOJGT5VTCJNGPMTCP\(D/WPVQPK8CT+ )1.&5GJTUGNVGPDGUQPFGTUKPFKGUGT'TJCNVWPI8QT\ÒINKEJGU'ZGORNCT 


KIRCHENSTAAT

4653

4654

4654



5EWFQF QTQ#::4QOI(D/WPVQPKXCT

)1.&445GJTUEJรŒP





2KCUVTC#:+  4QO&CX/WPVQPK  45EJTรŒVNKPIUHGJNGTCWHFGT8QTFGTUGKVGMN4CPFHGJNGTUGJTUEJรŒP



4655

  

4656

2KCUVTC#0:++  4QO&CX/WPVQPK 2KCUVTC#::4QO&CX/WPVQPK 2KCUVTC#::+4QO&CX/WPVQPK

4658

4659

4657

5EJรŒPpUGJTUEJรŒP 4(CUUWPIUURWTUGJTUEJรŒP 4-N&TWEMUVGNNGUGJTUEJรŒP

  

4660

 

6GUVQPG#8+  4QO/WPVQPK 6GUVQPG#:+8  4QO/WPVQPKC

5GJTUEJรŒP 5GJTUEJรŒP

 



6GUVQPG#0:: ,CJTGU\CJNPKEJVNGUDCT 4QO/WPVQPK  7PTGIGNOยทยญKIGT5EJTรŒVNKPIUGJTUEJรŒP

 31


KIRCHENSTAAT

4661

4662

4662



(TCPEQQFGT ,CJTGU\CJNPKEJVNGUDCT #XKIPQPI$TWUVDKNFTKPIGKUVNKEJGO1TPCV $NWOGPMTGW\/WPVQPK 445GJTUEJÌP





5KNDGTOGFCKNNG#:8++XQP)/QNC$TWUVDKNFTKPIGKUVNKEJGO1TPCV&GT2CRUVMPKGVPCEJN XQTKJO6KCTCFCTÒDGTUEJYGDVFGTJGKNKIG/KEJCGNOKV5EJYGTVWPF9CCIGOOI5RKPM  FQTVKP$TQP\G  8QT\ÒINKEJGU2TCEJVGZGORNCTOKVHGKPGT6ÌPWPI





2KCUVTC #0 :++   4QO &CX  *GPMGNURWT XGTIQNFGV HCUV UGJT UEJÌP  2KCUVTC #   ::4QO&CX UEJÌPUGJTUEJÌP &C\W6GUVQPG#++#8+  4QO XGTUEJKGFGPG )TQUUK WPF  XGTUEJKGFGPG  )TQUUK CWU4QOUQYKG-W$QNQIPKPQWPF-W 3WCVVTKPQ(GTTCTC 5VÒEM5EJÌPpUGJTUEJÌP



4665

4664

4664

 

+PPQEGP\:2KCUVTC#001++  4QO&CX#/WPVQPK 45GJTUEJÌP )TQUUQ#:  4QO/WPVQPK 5GJTUEJÌP

 



6GUVQPG#8+4QO 4 )KWNKQ(GTTCTC/WTCKQNCQ,$QNQIPC)TQUUQ#8   4QOFKXGTUG)TQUUKUQYKG-WRHGTOÒP\GP $CKQEEJKWPF3WCVVTKPK CWU)WDDKQ  5VÒEM<WO6GKNUGNVGP5EJÌPpUGJTUEJÌP



4667

1,5:1



32

1,5:1

#NGZCPFGT8++3WCFTWRNC$QNQIPCI9CRRGPFCTÒDGTIGMTGW\VG5EJNÒUUGN WPF /KVTC-TGW\ WPVGP \W FGP 5GKVGP LG GKP 9CRRGPUEJKNF QDGP FKG IGVGKNVG ,CJTGU\CJN (D    /WPVQPK )1.&445GJTUEJÌPpXQT\ÒINKEJ 


KIRCHENSTAAT

4669

4668

 

&QRRKC$QNQIPCI9CRRGPFCTÒDGTIGMTGW\VG5EJNÒUUGNWPF/KVTC-TGW\WPVGP\WFGP 5GKVGPLGGKP9CRRGPUEJKNFQDGPFKGIGVGKNVG,CJTGU\CJN(D/WPVQPK  )1.&4-N5EJTÌVNKPIUHGJNGTCO4CPFUGJTUEJÌP 5EWFQF QTQ$QNQIPCI(D/WPVQPKXCT )1.&-N2TQDKGTURWTGPUGJTUEJÌP

 

4671

4670

4670

 

2KCUVTCQ,  4QO&CX#/WPVQPK 5EJÌPG2CVKPCCVVTCMVKXGUUGJTUEJÌPGU'ZGORNCT 6GUVQPGQ,4QO/WPVQPK -N2T·IGUEJY·EJGUGJTUEJÌP

 



6GUVQPG(GTTCTC%CTNKPQ#XKIPQPFKXGTUG)TQUUKWPFGKP)TQUUQCWU4QOUQYKGGKP $CKQEEQWPFGKP3WCVVTKPQCWU)WDDKQ 5VÒEM(CUVUGJTUEJÌP





%NGOGPU+:)KWNKQQ, IGNQEJV FKXGTUG)TQUUKWPFFKXGTUG)TQUUKCNNG/ÒP\ UV·VVG4QO 5VÒEM(CUVUGJTUEJÌP





5GFKUXCMCP\  2KCUVTC  *GPMGNURWT HCUV UGJT UEJÌP  6GUVQPG  UGJT UEJÌP  WPF   )KWNKQ IGNQEJV CNNG/ÒP\UV·VVG4QO 5VÒEMZOKV/·PIGNPUGJTUEJÌP



4675

1,5:1



1,5:1

%NGOGPU:3WCFTWRNCQ,4QOI%.'/'05:Û2106Û/#:Û9CRRGP FCTÒDGTIGMTGW\VG5EJNÒUUGNWPF/KVTC0'241++%+#5/'+06'/214'5'0'%686+5-ÌPKI &CXKFMPKGVTWPFURKGNV*CTHGKO#DUEJPKVV9CRRGP(D/WPVQPK  )1.&8QPITQ­GT5GNVGPJGKV*GPMGNURWTWPFMN5EJTÌVNKPIUHGJNGTUGJTUEJÌPpXQT\ÒINKEJ  33


KIRCHENSTAAT

1,5:1 4676

4678 4679

1,5:1



2KCUVTC#0+8$4QO/KVFGTIGUEJNQUUGPGP*GKNKIGP2HQTVGKPFGT4ÒEMUGKVGPFCTUVGNNWPI&CX /WPVQPK 5EJÌPG2CVKPCMN5EJTÌVNKPIUHGJNGTUGJTUEJÌPpXQT\ÒINKEJ



2KCUVTC FKXGTUGCNNGOKV/·PIGNP 6GUVQPG4QO UGNVGPIGNQEJV FKXGTUG)KWNKQ)TQUUK WPFFKXGTUG)TQUUK4QO.KTC$QNQIPCUQYKG-WRHGTOÒP\GPCWU(GTTCTCWPF)WDDKQ  5VÒEM&KGOGKUVGPOKV/·PIGNPUGJTUEJÌP





5GFKUXCMCP\2KCUVTC4QO&CX/WPVQPK

#O4CPFDGCTDGKVGVUGJTUEJÌP





+PPQEGP\:+5EWFQF QTQ4QOI(D/WPVQPK  )1.&445GJTUEJÌP



4680

4681



4682



2KCUVTCQ,4QO&CX/WPVQPK

5GJTUEJÌPpXQT\ÒINKEJ





2KCUVTC#0+  4QO&CX/WPVQPK  #VVTCMVKXGUUGJTUEJÌPGU'ZGORNCTOKVUEJÌPGT2CVKPC





2KCUVTC #0 ++   4QO /KV FGT (CUUCFG FGU 2GVGTUFQOU KP FGT 4ÒEMUGKVGPFCTUVGNNWPI &CX   /WPVQPK 5GJTUEJÌP



34


KIRCHENSTAAT

4683

4684

4685



2KCUVTC #0 ++   4QO /KV FGT (CUUCFG FGU 2GVGTUFQOU KP FGT 4ÒEMUGKVGPFCTUVGNNWPI &CX   /WPVQPK 4(CUUWPIUURWTGPHCUVUGJTUEJÌP





2KCUVTC # ++   4QO /KV FGT (CUUCFG FGU 2GVGTUFQOGU KP FGT 4ÒEMUGKVGPFCTUVGNNWPI &CX   /WPVQPK 4#O4CPFOKPDGCTDGKVGVUGJTUEJÌP





2KCUVTC4QO&CX/WPVQPK



4686

4*GPMGNURWTUGJTUEJÌP

4688



2KCUVTC#8+++  4QO&CX/WPVQPK

 

4687

5GJTUEJÌPpXQT\ÒINKEJ



2KCUVTC#+:4QO&CX/WPVQPK

(CUVXQT\ÒINKEJ



2KCUVTC#8++  4QO/WPVQPK

5GJTUEJÌP

 35


KIRCHENSTAAT

4689

4690



2KCUVTC#8++  4QO/WPVQPK

5GJTUEJÌP





2KCUVTCQ,4QO/WPVQPK

5GJTUEJÌP



4691

4692



6GUVQPG#8+++4QO/WPVQPK



4693

4694

5GJTUEJÌPpXQT\ÒINKEJ



6GUVQPG#+:4QO/WPVQPK

5GJTUEJÌP





6GUVQPG#+:4QO/WPVQPK

5GJTUEJÌP





6GUVQPG#+:4QO/WPVQPK

8QT\ÒINKEJ



4695

4696

4697

4698



6GUVQPG#+:4QO/WPVQPK

5GJTUEJÌP





6GUVQPG#+:4QO/WPVQPK

8QT\ÒINKEJ





)KWNKQ#++++  4QO/WPVQPK

5GJTUEJÌPpXQT\ÒINKEJ





)KWNKQ#:4QO/WPVQPK

5GJTUEJÌP



36


KIRCHENSTAAT

4699

4700

 

)KWNKQ#:4QO/WPVQPK )KWNKQ#:+4QO/WPVQPK

8QT\ÒINKEJ 5GJTUEJÌP

 



2KCUVTC FKXGTUG 2KCUVTC FKXGTUG 6GUVQPG FKXGTUG )KWNKQ FKXGTUG )TQUUQ FKXGTUG  )TQUUQ FKXGTUG #NNG/ÒP\UV·VVG4QO&C\W'KPG/WTCKQNCCWU$QNQIPCWPFFKXGTUG-WR HGTOÒP\GPCWU)WDDKQ5GJTKPVGTGUUCPVGU.QVDKVVGDGUKEJVKIGP  5VÒEM<WO6GKNOKV/·PIGNPOGKUVUGJTUEJÌP 



5GFKUXCMCP\2KCUVTC *GPMGNURWT Z6GUVQPG Z*GPMGNURWTZIGNQEJV )TQUUQ)TQUUQ #NNG/ÒP\UV·VVG4QO 5VÒEM5GJTUEJÌP



4703

1,5:1



1,5:1

#NGZCPFGT 8+++  3WCFTWRNC # + 4QO  I Û #.':#0&'4Û 8+++ Û 2106 Û   /#: Û # Û + $TWUVDKNF T KP IGKUVNKEJGO 1TPCV FCTWPVGT FKG 5KIPCVWT # Û 6 Û ( Û #PVQPKQ 6TCXCPK   5VGORGNUEJPGKFGT KP 4QO  &KG DGKFGP *GKNKIGP 5V 2GVTWU WPF 5V 2CWNWU OKV KJTGP #VVTK   DWVGP UVGJGP PGDGPGKPCPFGT HCUV X X QDGP UVTCJNGPFG 6CWDG KO #DUEJPKVV 9CRRGP WPF FKG IGVGKNVG   ,CJTGU\CJN(D/WPVQPK  )1.&8QPITQ­GT5GNVGPJGKV(GNFGTNGKEJVDGCTDGKVGVFGPPQEJCVVTCMVKXGUUGJTUEJÌPGU'ZGORNCT 

1,5:1



1,5:1

5EWFQF QTQ#+4QOI9CRRGPFCTÒDGTIGMTGW\VG5EJNÒUUGNWPF/KVTC&KG$TWUVDKNFGT XQP5V2GVTWUWPF5V2CWNWUOKV*GKNKIGPUEJGKPGPPGDGPGKPFGTT(D/WPVQPK  )1.&9KP\4CPFHGJNGTWPF2TQDKGTURWTCVVTCMVKXGUXQT\ÒINKEJGU'ZGORNCT

4705

 

4704

6GUVQPGQ,4QO/WPVQPK 6GUVQPG#+4QO/WPVQPK



4706

5GJTUEJÌPpXQT\ÒINKEJ 44-N4CPFHGJNGTUGJTUEJÌP

  37


KIRCHENSTAAT

4709

4707



6GUVQPG#+4QO/WPVQPK



2KCUVTC6GUVQPG#0++ FKXGTUG )KWNKQ)TQUUQ#NNG/ÒP\UV·VVG4QO&C\W 'KPG/WTCKQNCCWU$QNQIPCWPFGKP-W3WCVVTKPQCWU)WDDKQ  5VÒEM#NNGOKV/·PIGNPUEJÌPpUGJTUEJÌP 5GFKUXCMCP\6GUVQPG4QO/WPVQPK 45VGORGNHGJNGTHCUVUGJTUEJÌP

 

6GUVQPG *GPMGNURWT )TQUUQ IGNQEJV )TQUUQ Z #NNG/ÒP\UV·VVG4QO  5VÒEM5EJÌPpUGJTUEJÌP



 

4711

5GJTUEJÌP

4713



4712



+PPQEGP\:++2KCUVTC#08+++4QO&CX/WPVQPK



2KCUVTC#+:4QO/KVFGTIGÌHHPGVGP*GKNKIGP2HQTVGKPFGT4ÒEMUGKVGPFCTUVGNNWPI&CX /WPVQPK 45GJTUEJÌP





2KCUVTC#0++4QO/WPVQPK



4714

 

38

2KCUVTC#08  4QO/WPVQPK 6GUVQPG#+:4QO/WPVQPK

45GJTUEJÌP

45GJTUEJÌP



4715

5EJTÌVNKPIUHGJNGTCO4CPFUGJTUEJÌP 8QT\ÒINKEJ

 


KIRCHENSTAAT

4718

4717

4716

4717

4716

  

6GUVQPG#0:4QO/WPVQPK )KWNKQ#++++4QO/WPVQPK )TQUUQ#+++  4QO/WPVQPK



2KCUVTC FKXGTUG 2KCUVTC FKXGTUG 6GUVQPG FKXGTUG )KWNKQ FKXGTUG )TQUUQ FKXGTUG  )TQUUQ FKXGTUG #NNG/ÒP\UV·VVG4QO&C\WZ/WTCKQNCCWU$QNQIPCUQYKGFKXGTUG-WR HGTOÒP\GPCWU)WDDKQ 5VÒEM6GKNYGKUGOKV/·PIGNPOGKUVUGJTUEJÌP  5GFKUXCMCP\2KCUVTC6GUVQPG4QO/WPVQPK 5VÒEM$GKFGIGNQEJVUGJTUEJÌP 



(CUVXQT\ÒINKEJ 5GJTUEJÌP 8QT\ÒINKEJ

  

4721 1,5:1



1,5:1

%NGOGPU:+5EWFQF QTQ#:+++  4QOI9CRRGPFCTÒDGTIGMTGW\VG 5EJNÒUUGNWPF/KVTC8KGT<GKNGP5EJTKHVKP-CTVWUEJG(D/WPVQPK  )1.&448QT\ÒINKEJGU'ZGORNCT



4722 1,5:1



1,5:1

 5EWFQ F QTQ  4QO  I $GTI OKV FTGK (GNUGP5VTCJNGPFGT 5VGTP WPF $QIGP ÒDGT /GGT   (D/WPVQPK )1.&448QT\ÒINKEJ 

4724

4723

4725



5EWFQF QTQ#+:  4QOI(D/WPVQPK  )1.&44#VVTCMVKXGUXQT\ÒINKEJGU'ZGORNCT





5EWFQF QTQ#:8++  4QOI(D/WPVQPK  )1.&)GUVQRHVGU.QEJUGJTUEJÌPpXQT\ÒINKEJ





2KCUVTC#8+  4QO&CX/WPVQPK



45GJTUEJÌP

39


KIRCHENSTAAT

4726

4727

4728



2KCUVTC #00 :+   4QO /KV FGT %KXKVC %CUVGNNCPC$TÒEMG KP FGT 4ÒEMUGKVGPFCTUVGNNWPI   &CX/WPVQPK 4-N*GPMGNURWTUGJTUEJÌP





2KCUVTC #00 :+   4QO /KV FGT %KXKVC %CUVGNNCPC$TÒEMG KP FGT 4ÒEMUGKVGPFCTUVGNNWPI   &CX/WPVQPK 4-N5EJTÌVNKPIUHGJNGT4CPFOKPDGCTDGKVGVUGJTUEJÌP





2KCUVTC#+++4QOHÒT7TDKPQ/WPVQPKC  45EJTÌVNKPIUHGJNGTCWHFGT4ÒEMUGKVGUGJTUEJÌP



4729

4730



2KCUVTC#08+4QO/KVFGT#PUKEJVFGU*CHGPUXQP4KRGVVC 4QO KPFGT4ÒEMUGKVGPFCTUVGN NWPI/WPVQPK 4*GPMGNURWT(GNFGTDGTKGDGPUGJTUEJÌP





2KCUVTC#08+++  4QO/WPVQPK



4731

-N5EJTÌVNKPIUHGJNGTUGJTUEJÌPpXQT\ÒINKEJ

4732

 

6GUVQPG#++4QO/WPVQPK )KWNKQ#+++4QO/WPVQPKC



2KCUVTC  FKXGTUG   2KCUVTC 6GUVQPG  FKXGTUG  )KWNKQ  FKXGTUG  )TQUUQ  FKXGTUG      )TQUUQ  FKXGTUG  #NNG /ÒP\UV·VVG4QO&C\W'KP6GUVQPGWPFZ/WTCKQNCCWU(GTTCTCGKPG/W TCKQNCCWU$QNQIPCWPF-WRHGTOÒP\GPCWU(GTTCTCWPF)WDDKQ&CTWPVGTGKPKIGUGNVGPG5VÒEMG5GJT KPVGTGUUCPVGU.QVDKVVGDGUKEJVKIGP 5VÒEM<WO6GKNOKV/·PIGNPOGKUVUGJTUEJÌP 

40

4&TWEMUVGNNGMN-TCV\GTUGJTUEJÌP 8QT\ÒINKEJGU'ZGORNCT

 


KIRCHENSTAAT

4737 4734

4734



+PPQEGP\ :+++   2KCUVTC #00 ++ 4QO  I 9CRRGP FCTÒDGT IGMTGW\VG   5EJNÒUUGNWPF/KVTC<YGK$CWGTPDGKFGT(GNFCTDGKV/WPVQPKC 44(GKPG6ÌPWPIXQT\ÒINKEJ  'ZGORNCTFGT#WMVKQP/ÒP\GPWPF/GFCKNNGP#)$CUGN0T



)TQUUQ#0+)TQUUQ .CVGTCP /ÒP\UV·VVG4QO&C\W-WRHGTOÒP\GPCWU)WDDKQ  5VÒEM5GJTUEJÌP





5GFKUXCMCP\6GUVQPG4QO&C\WGKP)KWNKQFGT5GFKUXCMCP\/WPVQPK  5VÒEM4$GKFGIGNQEJVUEJÌPWPFUGJTUEJÌP





$GPGFKMV:+++<GEEJKPQ4QOI&KGRGTUQPKHK\KGTVG-KTEJGOKV5EJNÒUUGNPWPF -KTEJGPOQFGNNUKV\VXXCWH9QNMGP4QUG(D/WPVQPK )1.&48QT\ÒINKEJ



4738

4739

4739



-W$CKQEEQ#8)WDDKQ/WPVQPKE8CT+



5KNDGTOGFCKNNGXQP)98GUVPGTCWHUGKPG2CRUVYCJN$TWUVDKNFHCUVXXKPIGKUVNKEJGO1TPCV /KV6KCTCDGNGIVGU9CRRGPFCJKPVGTIGMTGW\VG5EJNÒUUGNOOI$GTPJGKOGT/K UGNNK 5GJTUEJÌPXQT\ÒINKEJ



6GUVQPG *GPMGNURWT )KWNKQ 5VÒEMIGNQEJV )TQUUQ FKXGTUG )TQUUQ FKXGTUG #NNG/ÒP\ UV·VVG4QO&C\W-WRHGTOÒP\GPCWU)WDDKQ 5VÒEM<WO6GKNOKV/·PIGNPUGJTUEJÌP





1,5:1



4741

5EJTÌVNKPIUHGJNGTCO4CPFXQT\ÒINKEJ



1,5:1

5GFKUXCMCP\  <GEEJKPQ  4QO  I 9CRRGP FCTÒDGT IGMTGW\VG 5EJNÒUUGN WPF 5EJKTO   QDGP UVTCJNGPFG 6CWDG&KG RGTUQPKHK\KGTVG -KTEJG OKV 5EJNÒUUGNP WPF -KTEJGPOQFGNN UKV\V X X CWH   9QNMGP(D/WPVQPK )1.&8QPITQ­GT5GNVGPJGKV/KPIGYGNNVUGJTUEJÌPpXQT\ÒINKEJ  41


KIRCHENSTAAT

4742

4743

4744

4745



%NGOGPU:++<GEEJKPQ4QOI(D/WPVQPKC  )1.&9KP\5EJTÌVNKPIUHGJNGTCVVTCMVKXGUXQT\ÒINKEJGU'ZGORNCT





<GEEJKPQ4QOI(D/WPVQPK

)1.&(CUVXQT\ÒINKEJ





5EWFQF QTQ#84QOI(D/WPVQPK

 )1.&#VVTCMVKXGUXQT\ÒINKEJGU'ZGORNCT





5EWFQF QTQ#84QOI(D/WPVQPK

 )1.&#VVTCMVKXGUXQT\ÒINKEJGU'ZGORNCT



4747

4746



2KCUVTC#+8  4QO/WPVQPK



6GUVQPG#00++++4QO/WPVQPK

4748

4749



6GUVQPG#084QO/WPVQPK



6GUVQPG#84QO/WPVQPK



6GUVQPG#084QO/WPVQPK



6GUVQPG#08+  4QO/WPVQPK

42

-N5EJTÌVNKPIUHGJNGTUGJTUEJÌP



-N5VGORGNHGJNGTUGJTUEJÌP



4750

4751

9KP\5EJTÌVNKPIUHGJNGTUGJTUEJÌP



-N5EJTÌVNKPIUHGJNGTUGJTUEJÌP



5GJTUEJÌP



(CUVXQT\ÒINKEJ




KIRCHENSTAAT

4752

 

4753

6GUVQPG#08+4QO/WPVQPK 6GUVQPG#08++4QO/WPVQPK

4754

5GJTUEJÌP 5GJTUEJÌP

4755

4756

 

4757



)KWNKQ4QO/WPVQPK



)KWNKQ#8+  4QO8CTKCPVGOKV2016Û/Û#Û8+KPFGT8QTFGTUGKVGPWOUEJTKHV/WP VQPK8CT+ /KPLWUVKGTVXQT\ÒINKEJ

5GJTUEJÌP

 



)KWNKQ#8+  4QO/WPVQPKC

8QT\ÒINKEJ



8QT\ÒINKEJ (CUVXQT\ÒINKEJ

 

4760

4758

 

-W3WCVVTKPQ#8+++4QO/WPVQPK -W3WCVVTKPQQ,)WDDKQ/WPVQPK



 2KCUVTC  FKXGTUG LGYGKNU OKV *GPMGNURWT  6GUVQPG  FKXGTUG  )KWNKQ  FKXGTUG  )TQUUQ    FKXGTUG )TQUUQ FKXGTUG -W$CKQEEQ FKXGTUG #NNG/ÒP\UV·VVG4QO&C\W'KP%CTNKPQ CWU$QNQIPCWPF-WRHGTOÒP\GPCWU)WDDKQ 5VÒEM<WO6GKNOKV(GJNGTPUGJTUEJÌP





5GFKUXCMCP\)TQUUQ4QO8CTKCPVGOKV5'&'Û8#%#06'Û/&%%:.KPFGT8QTFGT UGKVGPWOUEJTKHV/WPVQPK8CT+ (CUVXQT\ÒINKEJ





)TQUUQ 8CTKCPVGP -W$CKQEEQ 8CTKCPVGP -W$CKQEEQ 8CTKCPVGP #NNG/ÒP\UV·VVG4QO 5VÒEM(CUVUGJTUEJÌPWPFUGJTUEJÌP



4763 4762

4764



$GPGFKMV:+8<GEEJKPQ4QOI(D/WPVQPKE  )1.&5GJTCVVTCMVKXGUXQT\ÒINKEJGU'ZGORNCT



 

<GEEJKPQ4QOI(D/WPVQPKC )1.&8QT\ÒINKEJGU2TCEJVGZGORNCT <GEEJKPQ4QOI(D/WPVQPKD )1.&5GJTCVVTCMVKXGUXQT\ÒINKEJGU'ZGORNCT

  43


KIRCHENSTAAT

4765

4766



<GEEJKPQ#+:4QOI(D/WPVQPK  )1.&'VYCUIGYGNNVMN-TCV\GTUGJTUEJÌP





<GEEJKPQ#:+4QOI(D/WPVQPK8CT  )1.&4CWJGT5EJTÌVNKPIUGJTUEJÌP



4768

4767

4768



5EWFQ )KWNKQ #:+84QO/WPVQPK



5KNDGTOGFCKNNGWPUKIPKGTVXQP1*COGTCPKCWHFKGJGTXQTTCIGPFGP'KIGPUEJCHVGPFGU2CRUVVWOU $TWUVDKNFTKPIGKUVNKEJGO1TPCV'EENGUKCUVGJVHCUVXXOKV9CCIGWPF-TGW\WPFFGO/QPQITCOO %JTKUVK\WKJTGP(Ò­GP5EJNCPIGOOI2CVTKIPCPK 5GJTUEJÌP

8QT\ÒINKEJ

 



5EWFQ *GPMGNURWT 5EWFQ5EWFQ 5VÒEM )TQUUQ 5VÒEM )TQUUQ 5VÒEM %CTNKPK %CTNKPQ #NNG /ÒP\UV·VVG 4QO &C\W  FKXGTUG -WRHGTOÒP\GP CWU (GTTCTC )WDDKQ 4CXGPPC WPF   4QO 5VÒEM5EJÌPpUGJTUEJÌP





5GFKUXCMCP\5EWFQ5EWFQ5EWFQ 5VÒEM )TQUUQ 5VÒEM #NNG/ÒP\UV·VVG4QO  5VÒEM#NNGOKV/·PIGNPHCUVUGJTUEJÌP



4771

1,5:1

1,5:1



%NGOGPU:+++<GEEJKPK#0+4QOI9CRRGPFCTÒDGTIGMTGW\VG5EJNÒUUGN WPF /KVTC&KG RGTUQPKHK\KGTVG -KTEJG OKV 5EJNÒUUGNP WPF -KTEJGPOQFGNN UKV\V X X CWH 9QNMGP (D   /WPVQPK )1.&445GJTCVVTCMVKXGUXQT\ÒINKEJGU'ZGORNCTOKVUEJÌPGT)QNFVÌPWPI 

4773

   44

4772

<GEEJKPK#8+++4QOI(D/WPVQPK <GEEJKPQ#0+4QOI(D/WPVQPK <GEEJKPQ#+84QOI(D/WPVQPK

4774

)1.&445GJTUEJÌP )1.&8QT\ÒINKEJ )1.&(CUVXQT\ÒINKEJ

  


KIRCHENSTAAT

4776

4775

 

)TQUUQ#++4QO/WPVQPK )TQUUQ#+84QO/WPVQPKC



6GUVQPG  5VÒEM *GPMGNURWT WPF IGNQEJV  &QRRKQ IKWNKQ  5VÒEM  )KWNKQ  5VÒEM  )TQUUQ  

5VÒEM )TQUUQ$CKQEEJKCNNG/ÒP\UV·VVG4QOUQYKGFKXGTUG-WRHGTOÒP\GPCWU)WDDKQ WPF4QO&C\W5GFKUXCMCP\&QRRKQIKWNKQWPF)KWNKQ  5VÒEM<WO6GKNOKV/·PIGNPUEJÌPpUGJTUEJÌP

4778

8QT\ÒINKEJ 8QT\ÒINKEJ

4779

 



4781

4780



%NGOGPU:+8<GEEJKPQ#+4QOI(D/WPVQPK  )1.&(CUVXQT\ÒINKEJ



  

<GEEJKPQ#++4QOI(D/WPVQPKC <GEEJKPQ#+++4QOI(D/WPVQPKD <GEEJKPQ#++4QOI(D/WPVQPKC

  

1,5:1

4782

)1.&8QT\ÒINKEJ )1.&(CUVXQT\ÒINKEJ )1.&/KPIGYGNNVUGJTUEJÌP

1,5:1



<GEEJKPQ  $QNQIPC  I 5EJKTO OKV \YGK IGMTGW\VGP 5EJNÒUUGNP WPVGP \W FGP 5GKVGP LG GKP   9CRRGPUEJKNF.ÌYGNOKV(CJPG(D/WPVQPK  )1.&8QPITQ­GT5GNVGPJGKV-N5EJTÌVNKPIUTK­XQT\ÒINKEJ 



5EWFQ6GUVQPG 5VÒEM &QRRKQ)KWNKQ 5VÒEM )TQUUQ 5VÒEM %CTNKPQ$CKQEEJK 5VÒEM  #NNG/ÒP\UV·VVG4QO&C\W5GFKUXCMCP\5EWFQWPF)KWNKQ/ÒP\UV·VVG4QO  5VÒEM(CUVCNNGOKV/·PIGNPUEJÌPpUGJTUEJÌP



4784 1,5:1



1,5:1

2KWU8+&QRRKGTQOCPG4QOI.KNKGPUVTCWEJ5V2GVTWUOKVUVTCJNGPFGO *CWRVWPFGTJQDGPGT4GEJVGPUKV\VXXCWH9QNMGPFKG.KPMGCWHFCU$WEJWPFFKG5EJNÒUUGNIGNGJPV (D/WPVQPK  )1.&449KP\2TÒHURWTUGJTCVVTCMVKXGUXQT\ÒINKEJGU'ZGORNCTOKVHGKPGT6ÌPWPI  45


KIRCHENSTAAT

4785

  

4786

4787

&QRRKCTQOCPC4QOI(D/WPVQPK &QRRKC4QOI(D/WPVQPK &QRRKG$QNQIPCI(D/WPVQPKXCT

)1.&(CUVXQT\ÒINKEJ )1.&5GJTUEJÌP )1.&5GJTUEJÌP

  

4788

1,5:1

1,5:1



<GEEJKPK$QNQIPCI9CRRGPFCTÒDGTIGMTGW\VG5EJNÒUUGNWPF/KVTC5V2GVTQPKWUOKV UGIPGPFGT4GEJVGPWPF-TWOOUVCDUKV\VXXCWH9QNMGPWPVGP\YGK9CRRGP(D/WPVQPK )1.&445GJTCVVTCMVKXGUXQT\ÒINKEJGU'ZGORNCTOKVHGKPGT)QNFVÌPWPI



4790

4789

4789



5EWFQ TQOCPQ # 8+ 4QO 8CTKCPVG QJPG 5VTCJNGP WO 6KCTC CWH FGT 8QTFGTUGKVG &CX    /WPVQPK8CT+ 5GJTUEJÌPpXQT\ÒINKEJ



5EWFQTQOCPQ#00++4QO/WPVQPK

4791

  46

5EWFQTQOCPQ#+++4QO/WPVQPK 5EWFQ#8++4QO/WPVQPKC

4792

(GKPG6ÌPWPIUGJTUEJÌP

 

4791

5GJTUEJÌPpXQT\ÒINKEJ -TCV\GTHCUVXQT\ÒINKEJ

 


KIRCHENSTAAT

4793

 

4794

5EWFQ#:8+4QO/WPVQPKC %CTNKPK#001::++4QO/WPVQPK

4795

 

8QT\ÒINKEJ 8QT\ÒINKEJ

 

(CUVXQT\ÒINKEJ 8QT\ÒINKEJ

 

4796

-W/CFQPPKPC $CKQEEJK #001::+++4QO/WPVQPK -W$CKQEEJK#:8+++  4QO/WPVQPK

4797

4798

 

-W3WCVVTKPQ#:++  4QO/WPVQPKD 5EWFQTQOCPQ$QNQIPC&CX/WPVQPK

4799

 

-W$CKQEEJK$QNQIPC/WPVQPKC -W$CKQEEJK#::+  (QNKIPQ/WPVQPK

4801

4798

8QT\ÒINKEJ -N-TCV\GTUGJTUEJÌP

 

4800

5GJTUEJÌP <CKPGPFGUGJTUEJÌP

 

4802



-W/CFQPPKPC $CKQEEJK #001::+++/CEGTCVC/WPVQPKC  442T·IGUEJY·EJGUGJTUEJÌP





-W/CFQPPKPC $CKQEEJK #001::+++/CVGNKEC/WPVQPK



44(CUVUGJTUEJÌP

47


KIRCHENSTAAT

4803

4804



-W5CORKGVTKPQ   $CKQEEJK   5CP 5GXGTKPQ 8CTKCPVG QJPG 0KODWU CWH FGT 8QTFGTUGKVG   /WPVQPKC8CT+ 5GJTUEJÌPpXQT\ÒINKEJ





5KNDGTOGFCKNNG#0+WPUKIPKGTVXQP(*COGTCPKCWHFCU*GKNKIG,CJT$TWUVDKNFNKPIGKUVNKEJGO 1TPCV2CRUV UVGJV T OKV UGKPGO )GHQNIG WPF DGIKPPV OKV FGT <GTGOQPKG FGT ¤HHPWPI FGT *GKNKIGP   2HQTVGOOI2CVTKIPCPKC #VVTCMVKXGUXQT\ÒINKEJGU'ZGORNCT





5GJTWOHCPITGKEJG5COONWPIXQP/ÒP\GPFKGUGU2CRUVGUXQO-W3WCVVTKPQDKU\WO5EWFQCWUFGP /ÒP\UV·VVGP 4CO #PEQPC #UEQNK $QNQIPC %KXKVCXGEEJKC (GTOQ (QNKIPQ )WDDKQ 2GTWIKC 5CP   5GXGTKPQ 6GTPK 6KXQNK WPF 8KVGTDQ &CTWPVGT GKPKIG DGUUGTG 5VÒEMG 5GJT KPVGTGUUCPVGU .QV DKVVG DG   UKEJVKIGP 5VÒEM5EJÌPUEJÌPpUGJTUEJÌPWPFUGJTUEJÌP 

4806

4807

4808



4ÌOKUEJG4GRWDNKM5EWFQTQOCPQQ,4QO&CX/WPVQPK  2T·IGUEJY·EJGXQT\ÒINKEJ



 

5EWFQTQOCPQQ,4QO&CX/WPVQPK 5GJTUEJÌPGU'ZGORNCTOKVUEJÌPGT6ÌPWPI 5EWFQ#08++4QO&CX/WPVQPK2CICPK 4  445EJÌPG6ÌPWPIHCUVXQT\ÒINKEJ

 

4810

4809

1,5:1

1,5:1



$NGK<KPP/CVTKV\GHÒTFGP8QTFGTUGKVGPUVGORGNFGU5EWFQU#08++4QO&CX\W2CICPK \W 5GJTUEJÌP





-W3WCVVTKPQQ,(QNKIPQ/WPVQPK



48

8QPITQ­GT5GNVGPJGKV8QT\ÒINKEJ


KIRCHENSTAAT

4813

4812



-W$CKQEEQQ,)WDDKQ/WPVQPK



-W/CFQPPKPC $CKQEEJK 4QPEKINKQPGQFGT8KVGTDQCWHFKG$TCPFUVKHVWPIKPFGT5VCFV4QPEKI NKQPGFWTEJFKG5VTGKVMT·HVGFGUHTCP\ÌUKUEJGP)GPGTCNU8CNVGTTG/WPVQPK2CICPK  44-N-TCV\GTWPF5EJTÌVNKPIUHGJNGTCO4CPFUGJTUEJÌP



-W/CFQPPKPC $CKQEEJK 4QPEKINKQPGQFGT8KVGTDQCWHFKG$TCPFUVKHVWPIKPFGT5VCFV4QPEKI NKQPGFWTEJFKG5VTGKVMT·HVGFGUHTCP\ÌUKUEJGP)GPGTCNU8CNVGTTG/WPVQPK2CICPK  44-N5EJTÌVNKPIUHGJNGTUGJTUEJÌP



-W$CKQEEQ  8CTKCPVGP  -W $CKQEEQ  8CTKCPVGP  #NNG /ÒP\UV·VVG (GTOQ &C\W -W   $CKQEEJK4QPEKINKQPG 5VÒEM  5VÒEM<WO6GKNUGNVGP5EJÌPWPFUEJÌPpUGJTUEJÌP







-N5EJTÌVNKPIUHGJNGTUGJTUEJÌP



'KP(TCPE5VÒEM0CRQNGQPU+CWUFGT/ÒP\UV·VVG4QOHKPFGP5KGWPVGTFGT0T

4815

4816



2KWU8++&QRRKC#:8+  4QOI(GKPIQNF(D2CICPK5EJN )1.&5GJTUEJÌP





&QRRKC#:8+++  4QOI(GKPIQNF(D2CICPK5EJN  )1.&-N-TCV\GTUGJTUEJÌPpXQT\ÒINKEJ



4817

4819

4818



5EWFQ#0+++4QO&CX2CICPKD

5GJTUEJÌP





5EWFQ#08+++4QO&CX2CICPK

-N(NGEMGPUGJTUEJÌP





5EWFQ#++4QO2CICPKD

5GJTUEJÌP

 49


KIRCHENSTAAT

4821

4820

 

-W$CKQEEQ#05'%80&14QO2CICPK .GKEJVFG\GPVTKGTVMN5VGORGNHGJNGTXQT\ÒINKEJ -W$CKQEEQ#05'%870&14QO2CICPK 8QT\ÒINKEJ

4822

  

4820

4823

5EWFQ#:8++$$QNQIPC&CX2CICPK 5EWFQ#:8++$$QNQIPC&CX2CICPK 5EWFQ#:8+++$$QNQIPC&CX2CICPK

 

4824

5GJTUEJÌPpXQT\ÒINKEJ 5GJTUEJÌP 5GJTUEJÌPpXQT\ÒINKEJ

  

4825

4827

4827

 

)KWNKQ#:8+++$$QNQIPC2CICPK -W3WCVVTKPQ#001:8+$$QNQIPC2CICPK



5KNDGTOGFCKNNGXQP6/GTECPFGVVKCWHFKG*GKNKIGP2GVTWUWPF2CWNWU$TWUVDKNFTKPIGKUVNKEJGO 1TPCV&KG $TWUVDKNFGT FGT DGKFGP *GKNKIGP GKPCPFGT IGIGPÒDGT  OO  I 4KPCNFK  5RKPM    #VVTCMVKXGUXQT\ÒINKEJGU'ZGORNCTOKVHGKPGT6ÌPWPI

50

-N-TCV\GTXQT\ÒINKEJ (CUVXQT\ÒINKEJ

  


KIRCHENSTAAT

4828



5KNDGTOGFCKNNGXQP6/GTECPFGVVKCWHFKG9KGFGTJGTUVGNNWPIFGT-KTEJG5CP2KGVTQKP/QPVQTKQ CWHFGOTÌOKUEJGP*ÒIGN)KCPKEQNQ$TWUVDKNFNKPIGKUVNKEJGO1TPCV#PUKEJVFGT-KTEJGOO I2CVTKIPCPKD 49KP\4CPFHGJNGTHCUVXQT\ÒINKEJ

4830

4829



4831



5GFKUXCMCP\5EWFQ$$QNQIPC&CX2CICPK  45EJÌPG2CVKPCNGKEJVLWUVKGTVWPFMN-TCV\GTUGJTUEJÌPpXQT\ÒINKEJ





5EWFQ$$QNQIPC2CICPK

8QT\ÒINKEJGU2TCEJVGZGORNCTOKVJGTTNKEJGT6ÌPWPI





5EWFQ$$QNQIPC2CICPK

*GPMGNURWTUGJTUEJÌP



4832

4833



)KWNKQ$$QNQIPC2CICPK

8QT\ÒINKEJp5VGORGNINCP\



.GQ :++  &QRRKC # ++   $ $QNQIPC  I (GKPIQNF (D  2CICPK    5EJN )1.&5GJTUEJÌPXQT\ÒINKEJ

  51


KIRCHENSTAAT

4834

4836

4835



5EWFQ#001++44QO&CX2CICPK  -CDKPGVVUVÒEM2TCEJVXQNNG2CVKPCHCUV5VGORGNINCP\





5EWFQ#001+++$$QNQIPC&CX2CICPK  #VVTCMVKXGU'ZGORNCTOKVHGKPGT6ÌPWPIOKP4CPFHGJNGTHCUVXQT\ÒINKEJ





5GFKUXCMCP\5EWFQ$$QNQIPC&CX2CICPK  8QT\ÒINKEJGU'ZGORNCTOKVHGKPGT2CVKPC





5EWFQ  4 4QO *MUR  &CX  2CICPK  &C\W -W3WCVVTKPK FGU 2CRUVGU .GQ :++     5VÒEM  5VÒEM5GJTUEJÌP



4839 4838



2KWU8+++5EWFQ#001+4QO&CX2CICPK  /GJTGTGMN4CPFHGJNGTHCUVXQT\ÒINKEJ





$CKQEEJK 6GUVQPG #001++4QO2CICPK

8QT\ÒINKEJ



4840 4841

 

-W$CKQEEQ#001+4QO2CICPKC 5EWFQ#001+$$QNQIPC&CX2CICPK

8QT\ÒINKEJp5VGORGNINCP\ 5GJTUEJÌP

 



7OHCPITGKEJG5COONWPIXQP/ÒP\GPFKGUGU2CRUVGUXQO-W3WCVVTKPQDKU\WO5EWFQ  5VÒEM5EJÌPHCUVUGJTUEJÌPWPFUGJTUEJÌP





&KXGTUG-WRHGTOÒP\GPFKGUGU2CRUVGU$CKQEEQ$CKQEEQ 5VÒEM 3WCVVTKPQ 5VÒEM   5VÒEM5GJTUEJÌP



52


KIRCHENSTAAT

4844

4845



5GFKUXCMCP\5EWFQ4QO&CX2CICPK



5EWFQ$$QNQIPC&CX2CICPK

4846

5GJTUEJÌP



(GKPG6ÌPWPIYKP\-TCV\GTXQT\ÒINKEJ



4847

4849

4848



$CKQEEJK 6GUVQPG $$QNQIPCWPF4QO2CICPK  5VÒEM(CUVXQT\ÒINKEJWPFUGJTUEJÌP



)TGIQT:8+&QRRKC#0+++44QOI(GKPIQNF(D2CICPK5EJN )1.&48QT\ÒINKEJ





5EWFK#8+44QOI(GKPIQNF(D2CICPK5EJN FQTVOKV#PICDG#08+  )1.&(GKPG)QNFVÌPWPIYKP\-TCV\GTXQT\ÒINKEJ





5EWFK#8++44QOI(GKPIQNF(D2CICPK5EJN

4850

4851

)1.&8QT\ÒINKEJ





4852



5EWFQ#0+4QO&CX2CICPK

(CUVXQT\ÒINKEJ





5EWFQ#0+4QO&CX2CICPK

-N4CPFHGJNGTHCUVXQT\ÒINKEJ





5EWFQ#+++4QO&CX2CICPK

5GJTUEJÌP

 53


KIRCHENSTAAT

4853

 

4854

5EWFQ#8+++44QO&CX2CICPK $CKQEEJK 5EWFQ #+844QO2CICPK

4853

-N5EJTÌVNKPIUHGJNGTXQT\ÒINKEJ /KPLWUVKGTVXQT\ÒINKEJp5VGORGNINCP\

 

4857 4856

4855



$CKQEEJK 5EWFQ #:8+44QO2CICPK  2TCEJVGZGORNCTOKVHGKPGT6ÌPWPI8QT\ÒINKEJp5VGORGNINCP\





$CKQEEJK 6GUVQPG #0+84QO2CICPK  2TCEJVGZGORNCTOKVHGKPGT6ÌPWPI(CUVXQT\ÒINKEJ





$CKQEEJK )KWNKQ #:+44QO2CICPK



4858

 

-W$CKQEEQ#:+44QO2CICPK -W$CKQEEQ#8+++44QO2CICPK

4860

   54

4859

8QT\ÒINKEJp5VGORGNINCP\

4858

8QT\ÒINKEJ 8QT\ÒINKEJp5VGORGNINCP\

4861

 

4862

$CKQEEJK 5EWFQ #++$$QNQIPC2CICPK 8QT\ÒINKEJGU'ZGORNCTOKVHGKPGT6ÌPWPI $CKQEEJK 5EWFQ #++$$QNQIPC2CICPK 8QT\ÒINKEJ $CKQEEJK 5EWFQ #8+$$QNQIPC2CICPK 8QT\ÒINKEJ

  


KIRCHENSTAAT

4863 4864

4864



$CKQEEJK )KWNKQ #8+++$$QNQIPC2CICPK

/KP-TCV\GTXQT\ÒINKEJ



5KNDGTOGFCKNNG#++XQP))KTQOGVVKCWHUGKPG#OVUGKPHÒJTWPI$TWUVDKNFTKPIGKUVNKEJGO1TPCV <YGK %JGTWDKO OKV 5EJNÒUUGNP WPF 6KCTC CWH 9QNMGP QDGP 6CWDG KP 5VTCJNGP  OO  I   4KPCNFK5RKPM FQTVKP$TQP\G  8QT\ÒINKEJGU'ZGORNCTOKVHGKPGT6ÌPWPI

 

4865



5KNDGTOGFCKNNGQ,XQP)%GTDCTC2T·OKGFGUR·RUVNKEJGP9GVVDGYGTDUDGKFGTMÒPUVNGTKUEJGP-QP ITGICVKQPKO2CPVJGQP$TWUVDKNFNKPIGKUVNKEJGO1TPCV#PUKEJVFGU2CPVJGQPUOOI 4KPCNFK 8QT\ÒINKEJGU'ZGORNCTOKVHGKPGT6ÌPWPI





7OHCPITGKEJG5COONWPIXQP/ÒP\GPFKGUGU2CRUVGUXQO-W3WCVVTKPQDKU\WO5EWFQFCTWPVGTGKPKIG DGUUGTG5VÒEMG+PVGTGUUCPVGU.QVDKVVGDGUKEJVKIGP 5VÒEM/GKUVUGJTUEJÌPWPFDGUUGT



4867

4868

4869



5GFKUXCMCP\5EWFQ44QO&CX2CICPK  2TCEJVGZGORNCTOKVHGKPGT6ÌPWPI(CUV5VGORGNINCP\





5EWFQ44QO&CX2CICPK





2KWU+:2T·IGRGTKQFG5EWFQ#001+44QO&CX2CICPK (GKPG6ÌPWPIYKP\4CPFHGJNGTXQT\ÒINKEJp5VGORGNINCP\

8QT\ÒINKEJGU'ZGORNCTOKVHGKPGT6ÌPWPI

 55


KIRCHENSTAAT

4870

4871



5EWFQ#001+44QO&CX2CICPK

9KP\4CPFHGJNGTXQT\ÒINKEJ





5EWFQ#001+44QO&CX2CICPK

5GJTUEJÌP



4872

4873



5EWFQ#001++44QO&CX2CICPK

(CUVXQT\ÒINKEJ





5EWFQ#001++44QO&CX2CICPK

8QT\ÒINKEJp5VGORGNINCP\



4876

4875

4874



$CKQEEJK )KWNKQ #0+++44QO2CICPK

8QT\ÒINKEJ





$CKQEEJK )KWNKQ #001++44QO2CICPK

(GKPG6ÌPWPIXQT\ÒINKEJ





$CKQEEJK )TQUUQ #00++ ,CJTGU\CJNKO5VGORGNCWUIG·PFGTV 44QO2CICPKC  8QT\ÒINKEJp5VGORGNINCP\



4877

4878



-W$CKQEEJK#0+++44QO2CICPKC



-W$CKQEEQ#001+44QO2CICPK

4879

4880

8QT\ÒINKEJ



(GKPG6ÌPWPIXQT\ÒINKEJ





-W$CKQEEQ#001++44QO2CICPK

8QT\ÒINKEJ





5EWFQ#001+$$QNQIPC&CX2CICPK

8QT\ÒINKEJ



56


KIRCHENSTAAT

4882 4881

4881



5EWFQ#001++$$QNQIPC&CX2CICPK

9KP\4CPFHGJNGTUGJTUEJÌPpXQT\ÒINKEJ





$CKQEEJK )KWNKQ #001++$$QNQIPC2CICPK  8QPITQ­GT5GNVGPJGKV5EJÌPG6ÌPWPIOKPLWUVKGTVXQT\ÒINKEJ



4884

4883

 

-W$CKQEEJK#0+++$$QNQIPC2CICPK -W$CKQEEQ#001+$$QNQIPC2CICPK

(CUVXQT\ÒINKEJ 9KP\5EJTÌVNKPIUHGJNGTCO4CPFXQT\ÒINKEJ

4885

4886



<GEEJKPQ))CGVC-WRHGTDTQP\KGTVI-/:C



<GEEJKPQ))CGVC<KPPI-/:D

 



8QT\ÒINKEJp5VGORGNINCP\



4888 4887

5EWFQTQOCPQ))CGVC/GUUKPII-/XIN: $CKQEEJK))CGVC/GUUKPII-/:

4890

  

8QT\ÒINKEJ

&KGUGUWPFFKGHQNIGPFGP5VÒEMGIGJÌTGP\WGKPGT5GTKGXQP2T·IWPIGPFKGKP$GNIKGPHÒT2CRUV2KWU+:CPIGHGTVKIV YWTFG FGT CO 0QXGODGTCWHITWPFFGTTGXQNWVKQP·TGP7PTWJGPKP4QOIGHNÒEJVGVYCT+TTGHÒJTGPFYKTF CWHFGP5VÒEMGPFCUIGMTÌPVG/ÒP\\GKEJGP)HÒTFKGKO-ÌPKITGKEJ0GCRGNIGNGIGPG*CHGPUVCFV)CGVCCPIGIGDGP

4887

 

4889

$CKQEEJK))CGVC<KPPI-/:C $CKQEEJK))CGVC/GUUKPII-/: $CKQEEJK))CGVC-WRHGTXGTUKNDGTVI-/:C

8QT\ÒINKEJ 8QT\ÒINKEJ

 

4891

8QT\ÒINKEJ 8QT\ÒINKEJ -N4CPFHGJNGTXQT\ÒINKEJ

   57


KIRCHENSTAAT

4893

4892

   

4894

4895

-W$CKQEEJK))CGVCI-/XIN:C 8QT\ÒINKEJ -W$CKQEEJK))CGVCI-/: (GKPG6ÌPWPIXQT\ÒINKEJp5VGORGNINCP\ 4ÌOKUEJG4GRWDNKM$CKQEEJK44QO2CICPK 48QT\ÒINKEJGU'ZGORNCT $CKQEEJK44QO2CICPK (CUVXQT\ÒINKEJ

4896

4898

4900

   

4899

4900



-W$CKQEEJK44QO2CICPKC



-QORNGVVG0QOKPCNUGTKG$CKQEEJK 5VÒEMZ-WRHGT $CKQEEJK$CKQEEJK$CKQEEJK

CNNG /ÒP\UV·VVG 4QO  -W $CKQEEJK  5VÒEM Z 4QO Z $QNQIPC Z )CGVC  -W $CKQEEQ     5VÒEMZ4QOZ#PEQPC $CKQEEQ 5VÒEMZ-WRHGT  5VÒEM/GKUVUGJTUEJÌP





8GTUKNDGTVG/GUUKPIMNKRRG\W$CKQEEJK#0++2CTKUIGRT·IVXQP3)\WO#PFGPMGPCPFKG 8GTVGKFKIWPI 4QOU XQT FGP HTCP\ÌUKUEJGP $GNCIGTGTP  I 4QOWNWU WPF 4GOWU UKV\GP GKPCPFGT   \WIGYCPFV WPVGTJCND FGT PCEJ N UVGJGPFGP 9ÌNHKP/QPQITCOOMTGW\ KP 2GTNTGKH QDGP WPF WPVGP LG   XKGT<GKNGP5EJTKHV-/:2CICPK5#PO 8QT\ÒINKEJGU'ZGORNCTOKVHGKPGT6ÌPWPI





8GTUKNDGTVG/GUUKPIMNKRRG\W$CKQEEJK2CTKUIGRT·IVXQP3)\WO#PFGPMGPCPFKG8GTVGK FKIWPI4QOUXQTFGPHTCP\ÌUKUEJGP$GNCIGTGTPI4QOWNWUWPF4GOWUUKV\GPGKPCPFGT\WIGYCPFV WPVGTJCND FGT PCEJ N UVGJGPFGP 9ÌNHKP(ÒPH <GKNGP 5EJTKHV -/ :  2CICPK 5  #PO   8QT\ÒINKEJGU'ZGORNCTOKVUEJÌPGT2CVKPC



8GTUKNDGTVG/GUUKPIMNKRRG\W$CKQEEJK2CTKUIGRT·IVXQP3)\WO#PFGPMGPCPFKG8GTVGK FKIWPI4QOUXQTFGPHTCP\ÌUKUEJGP$GNCIGTGTPI4QOWNWUUKV\VTWPVGTJCNDFGTPCEJTUVGJGPFGP 9ÌNHKP9GTV-/:2CICPK5#PO 8QT\ÒINKEJ





58

8QT\ÒINKEJ




KIRCHENSTAAT

4902

4901





4901

/GUUKPIMNKRRG\W$CKQEEJK2CTKUIGRT·IVXQP3)\WO#PFGPMGPCPFKG8GTVGKFKIWPI4QOU XQT FGP HTCP\ÌUKUEJGP $GNCIGTGTP  I 4QOWNWU UKV\V T WPVGTJCND FGT PCEJ T UVGJGPFGP 9ÌNHKP   9GTV-/:2CICPK5#PO 8QT\ÒINKEJ



2KWU+:2T·IGRGTKQFG5EWFK#001844QOI(GKPIQNF (D2CICPK5EJN )1.&4'VYCUDGTKGDGPUGJTUEJÌPpXQT\ÒINKEJ



4903

4904

4905

4906

4907



5EWFK#00+844QOI(GKPIQNF(D2CICPK5EJN  )1.&4#VVTCMVKXGU'ZGORNCTXQT\ÒINKEJp5VGORGNINCP\





5EWFK#0+:44QOI(GKPIQNF(D2CICPK5EJN  )1.&#VVTCMVKXGU'ZGORNCTXQT\ÒINKEJp5VGORGNINCP\





5EWFK#08+++44QOI(GKPIQNF(D \W 2CICPK5EJN  )1.&8QT\ÒINKEJp5VGORGNINCP\





5EWFK#08+++44QOI(GKPIQNF(D \W 2CICPK5EJN  )1.&5GJTUEJÌPpXQT\ÒINKEJ





5EWFK#0:44QOI(GKPIQNF(D2CICPK5EJN

4908

4909

4910

 )1.&5GJTUEJÌP

4911



4912



5EWFK#0:44QOI(GKPIQNF(D2CICPK5EJN  )1.&-N4CPFXGTRT·IWPIXQT\ÒINKEJ





5EWFK#0:44QOI(GKPIQNF(D2CICPK5EJN )1.&8QT\ÒINKEJ





5EWFK#0:+44QOI(GKPIQNF(D2CICPK5EJN  )1.&48QT\ÒINKEJp5VGORGNINCP\





5EWFK#0:++44QOI(GKPIQNF(D2CICPK5EJN  )1.&2TCEJVGZGORNCT(CUV5VGORGNINCP\





5EWFK#0:++44QOI(GKPIQNF8CTKCPVGOKVITQ­GO/ÒP\DWEJUVCDGP4(D 2CICPKC5EJN )1.&449KP\-TCV\GTXQT\ÒINKEJ

 59


KIRCHENSTAAT

4913

4914

4915

4916



5EWFK#0:+++44QOI(GKPIQNF(D2CICPK5EJN  )1.&8QT\ÒINKEJ





5EWFK#0:+++44QOI(GKPIQNF(D2CICPK5EJN  )1.&8QT\ÒINKEJ





5EWFK#0:+844QOI(GKPIQNF(D2CICPK5EJN  )1.&8QT\ÒINKEJ





5EWFK#0:844QOI(GKPIQNF(D2CICPK5EJN  )1.&8QT\ÒINKEJp5VGORGNINCP\



4918

4917

4919

4920

4921



5EWFK#0:844QOI(GKPIQNF(D2CICPK5EJN  )1.&8QT\ÒINKEJ





5EWFK#0:844QOI(GKPIQNF(D2CICPK5EJN  )1.&8QT\ÒINKEJ





5EWFK#0:8+44QOI(GKPIQNF(D2CICPK5EJN  )1.&8QT\ÒINKEJ





5EWFK#0:8++44QOI(GKPIQNF(D2CICPK5EJN  )1.&8QT\ÒINKEJp5VGORGNINCP\





5EWFK#0:8++44QOI(GKPIQNF(D2CICPK5EJN \W   )1.&8QT\ÒINKEJ



4922

4923

4924

4925

4926



5EWFQF QTQ#08+++44QOI(GKPIQNF(D2CICPK5EJN  )1.&8QT\ÒINKEJ





5EWFQF QTQ#08+++44QOI(GKPIQNF(D2CICPK5EJN  )1.&(CUVXQT\ÒINKEJ





5EWFQF QTQ#08+++44QOI(GKPIQNF(D2CICPK5EJN  )1.&8QT\ÒINKEJ





5EWFQF QTQ#0:++44QOI(GKPIQNF(D2CICPK5EJN  )1.&5GJTUEJÌPpXQT\ÒINKEJ





5EWFQF QTQ#0:++44QOI(GKPIQNF(D2CICPK5EJN  )1.&5GJTUEJÌPpXQT\ÒINKEJ



60


KIRCHENSTAAT

4927

4928

4929

4930

4932

4931



5EWFQF QTQ#0:+++44QOI(GKPIQNF(D2CICPK5EJN  )1.&9KP\5VGORGNHGJNGTXQT\ÒINKEJp5VGORGNINCP\





5EWFQF QTQ#0:+++44QOI(GKPIQNF(D2CICPK5EJN  )1.&-N5EJTÌVNKPIUHGJNGTUGJTUEJÌPpXQT\ÒINKEJ





5EWFQF QTQ#0:8+44QOI(GKPIQNF(D2CICPK5EJN  )1.&8QT\ÒINKEJ





5EWFQF QTQ#0:8++44QOI(GKPIQNF(D2CICPK5EJN  )1.&8QT\ÒINKEJp5VGORGNINCP\





5EWFQF QTQ#0:8++44QOI(GKPIQNF(D2CICPK5EJN  )1.&8QT\ÒINKEJ





5EWFQF QTQ#0:8++44QOI(GKPIQNF(D2CICPK5EJN  )1.&8QT\ÒINKEJ



4933



5EWFQ#00+844QO&CX2CICPK



5EWFQ#08++44QO&CX2CICPK

4935

4934

4/KP4CPFHGJNGTXQT\ÒINKEJ



8QT\ÒINKEJ



4936



5EWFQ#08+++44QO&CX2CICPK

8QT\ÒINKEJGU'ZGORNCTOKVHGKPGT2CVKPC





5EWFQ#08+++44QO&CX2CICPK

/KP-TCV\GTXQT\ÒINKEJ



4937



5EWFQ#001+:44QO&CX2CICPK



5EWFQ#0:+44QO&CX2CICPK

4938

8QT\ÒINKEJ



44'VYCUDGTKGDGPUGJTUEJÌP

 61


KIRCHENSTAAT

4939

4940

4941

4942

  

$CKQEEJK 5EWFQ #001844QO2CICPK $CKQEEJK 5EWFQ #008++44QO2CICPK $CKQEEJK 5EWFQ #008+++44QO2CICPK

(GKPG6ÌPWPIHCUVXQT\ÒINKEJ 445GJTUEJÌP 9KP\1Z[FUVGNNGXQT\ÒINKEJ

  



$CKQEEJK )KWNKQ #00+844QO2CICPK  442TCEJVGZGORNCT8QT\ÒINKEJp5VGORGNINCP\



4943

4944

4945

4946

4947



$CKQEEJK )KWNKQ #0+844QO2CICPKC

4(CUVXQT\ÒINKEJ





$CKQEEJK )KWNKQ #00844QO/KV5VGORGNUEJPGKFGTUKIPCVWT2CICPK  8QT\ÒINKEJp5VGORGNINCP\





$CKQEEJK )KWNKQ #00844QO1JPG5VGORGNUEJPGKFGTUKIPCVWT2CICPKC  8QT\ÒINKEJp5VGORGNINCP\

 

$CKQEEJK )KWNKQ #08++44QO2CICPK $CKQEEJK )KWNKQ #08+++44QO2CICPK

48QT\ÒINKEJp5VGORGNINCP\ 448QT\ÒINKEJ

  

4948 4949

   62

$CKQEEJK )KWNKQ #00:44QO2CICPK $CKQEEJK )KWNKQ #0:844QO2CICPK $CKQEEJK )KWNKQ #:+:44QO2CICPK

4950

48QT\ÒINKEJ 8QT\ÒINKEJ (CUV5VGORGNINCP\

  


KIRCHENSTAAT

4951

4952

4953



$CKQEEJK )KWNKQ #0:+:44QO2CICPK



4954

4955

8QT\ÒINKEJ



$CKQEEJK )KWNKQ #08+++44QO2CICPK

44(GKPG6ÌPWPIXQT\ÒINKEJp5VGORGNINCP\





$CKQEEJK )KWNKQ #00:44QO2CICPK

8QT\ÒINKEJp5VGORGNINCP\





$CKQEEJK )KWNKQ #0:8+44QO2CICPK

8QPITQ­GT5GNVGPJGKV5GJTUEJÌP





$CKQEEJK )TQUUQ #0+:44QO2CICPK

44(GKPG6ÌPWPIXQT\ÒINKEJ



4956

4958

4957



-W$CKQEEJK#00+844QO2CICPK

8QT\ÒINKEJ





-W$CKQEEJK#001844QO2CICPK

8QT\ÒINKEJ





-W$CKQEEJK#001844QO2CICPK

8QT\ÒINKEJp5VGORGNINCP\



4959

4960



-W$CKQEEJK#008++44QO2CICPK

8QT\ÒINKEJ





-W$CKQEEJK#008+++44QO2CICPK

8QT\ÒINKEJ

 63


KIRCHENSTAAT

4961

4962

4963

4964

 

-W$CKQEEJK#008+++44QO2CICPK -W$CKQEEJK#001+:44QO2CICPK



-W$CKQEEJK#00+844QO2CICPKD  2TCEJVGZGORNCT(GKPG6ÌPWPIHCUV5VGORGNINCP\





-W$CKQEEJK#00+844QO2CICPKD



4965

 

8QT\ÒINKEJp5VGORGNINCP\

8QT\ÒINKEJ 8QT\ÒINKEJ

 

8QT\ÒINKEJ 8QT\ÒINKEJ

 

4968

-W$CKQEEJK#08++44QO2CICPK -W$CKQEEJK#08+++44QO2CICPK

4969

 

4966

-W$CKQEEJK#008+44QO2CICPK -W$CKQEEJK#08++44QO2CICPK

4967

 

8QT\ÒINKEJ 48QT\ÒINKEJ

4970



-W$CKQEEQ#00+844QO2CICPK

8QT\ÒINKEJ





-W$CKQEEQ#001+844QO/ÒP\DWEJUVCDG4KO5VGORGNCWU$IG·PFGTV2CICPKC  48QT\ÒINKEJ



64


KIRCHENSTAAT

4971

4972

4973

4974

4975

 

-W$CKQEEQ#001844QO2CICPKC -W$CKQEEQ#001844QO2CICPKC



-W$CKQEEQ #001 8 $QNQIPC QFGT 4QO (GJNRT·IWPI FKG DGKFUGKVKI OKV FGO 8QTFGTUGKVGPUVGORGN   DGRT·IVKUV 445GJTUEJÌP



 

-W$CKQEEQ#0018++44QO2CICPK -W$CKQEEQ#0018++44QO2CICPK

 

4976

 

-W$CKQEEQ#00844QO2CICPK -W3WCVVTKPQ#008+44QO2CICPK

8QT\ÒINKEJp5VGORGNINCP\ 8QT\ÒINKEJp5VGORGNINCP\

48QT\ÒINKEJ 49KP\5EJTÌVNKPIUHGJNGTXQT\ÒINKEJ

 

4977

8QT\ÒINKEJp5VGORGNINCP\ 8QT\ÒINKEJp5VGORGNINCP\

 

4979

4978



5EWFQ#08+++$$QNQIPC&CX2CICPK

4#VVTCMVKXGUXQT\ÒINKEJGU'ZGORNCT





$CKQEEJK 5EWFQ #001+:$$QNQIPC2CICPK  8QT\ÒINKEJGU'ZGORNCTOKVHGKPGT6ÌPWPI



4980

 

4981

$CKQEEJK 5EWFQ #001+:$$QNQIPC2CICPK (GKPG6ÌPWPIUGJTUEJÌPpXQT\ÒINKEJ -W$CKQEEJK#00+8$$QNQIPC2CICPK 9KP\-TCV\GTXQT\ÒINKEJ

  65


KIRCHENSTAAT

4983

  

4982

-W$CKQEEJK#0018$$QNQIPC2CICPK -W$CKQEEJK#0+++$$QNQIPC2CICPK -W$CKQEEJK#0+8$$QNQIPC2CICPK

4984

8QT\Ã&#x2019;INKEJp5VGORGNINCP\ 8QT\Ã&#x2019;INKEJ 8QT\Ã&#x2019;INKEJ

4986

4985

  

4985



-W$CKQEEQ#0018+$$QNQIPC2CICPK

8QT\Ã&#x2019;INKEJ





 2T·IGRGTKQFG   .KTG # ::+ 4 4QO  I (GKPIQNF (D 2CICPK 5EJN )1.&40WT'ZGORNCTGIGRT·IV8QT\Ã&#x2019;INKEJGU'ZGORNCT 

4987

1,5:1



66

1,5:1

.KTG#::+++44QOI(GKPIQNF(D2CICPK5EJN  )1.&440WT'ZGORNCTGIGRT·IV8QT\Ã&#x2019;INKEJ




KIRCHENSTAAT

4988

1,5:1



1,5:1

.KTG#::+++44QOI(GKPIQNF(D2CICPK5EJN  )1.&8QPITQ­GT5GNVGPJGKV0WT'ZGORNCTGIGRT·IV9KP\-TCV\GTXQT\Ã&#x2019;INKEJ



4989

1,5:1



1,5:1

.KTG#::+844QOI(GKPIQNF(D2CICPK5EJN  )1.&8QPITQ­GT5GNVGPJGKV0WT'ZGORNCTGIGRT·IV9KP\-TCV\GTXQT\Ã&#x2019;INKEJ



4990

1,5:1



1,5:1

.KTG#::++44QOI(GKPIQNF(D2CICPK5EJN  )1.&440WT'ZGORNCTGIGRT·IV8QT\Ã&#x2019;INKEJ

 67


KIRCHENSTAAT

4991

4992



.KTG#::++44QOI(GKPIQNF(D2CICPK5EJN  )1.&440WT'ZGORNCTGIGRT·IV8QT\ÒINKEJ





.KTG#::+844QOI(GKPIQNF(D2CICPK5EJN  )1.&440WT'ZGORNCTGIGRT·IV9KP\-TCV\GTXQT\ÒINKEJ



4993

4994

4995

4996

4997



.KTG#::44QOI(GKPIQNF(D2CICPK5EJN  )1.&445GJTUEJÌPpXQT\ÒINKEJ





.KTG#0::+44QOI(GKPIQNF(D2CICPK5EJN

)1.&5GJTUEJÌP





.KTG#0::+44QOI(GKPIQNF(D2CICPK5EJN  )1.&5EJÌPpUGJTUEJÌPUGJTUEJÌP





.KTG#::+44QOI(GKPIQNF(D2CICPK5EJN  )1.&5GNVGPKPFKGUGT'TJCNVWPI2TCEJVGZGORNCT(CUV5VGORGNINCP\





.KTG#::++44QOI(GKPIQNF(D2CICPK5EJN FQTVOKV#0::++   )1.&(CUVXQT\ÒINKEJ



4998

4999

5000

5001

5002



.KTG#::++44QOI(GKPIQNF(D2CICPK5EJN  )1.&5GJTUEJÌPpXQT\ÒINKEJ





.KTG#::+++44QO)TQ­G$ÒUVGI(GKPIQNF(D2CICPK5EJN  )1.&5GJTUEJÌP





.KTG#::+++44QO)TQ­G$ÒUVGI(GKPIQNF(D2CICPK5EJN  )1.&5GJTUEJÌP





.KTG#::+++44QOI(GKPIQNF(D2CICPK5EJN  )1.&5GJTUEJÌPHCUVXQT\ÒINKEJ





.KTG#::+844QOI(GKPIQNF(D2CICPK5EJN



68

)1.&8QT\ÒINKEJ


KIRCHENSTAAT

5003

5004

5005

5006

5007



.KTG#::+844QOI(GKPIQNF(D2CICPK5EJN

)1.&8QT\ÒINKEJ





.KTG#::844QOI(GKPIQNF(D2CICPK5EJN

)1.&5GJTUEJÌP





.KTG#0::+44QOI(GKPIQNF(D2CICPK5EJN  )1.&5GNVGPKPFKGUGT'TJCNVWPI5GJTCVVTCMVKXGU'ZGORNCTXQT\ÒINKEJp5VGORGNINCP\





.KTG#::+44QOI(GKPIQNF(D2CICPK5EJN  )1.&44/KP4CPFHGJNGTHCUV5VGORGNINCP\





.KTG#::++44QOI(GKPIQNF(D2CICPK5EJN )1.&8QT\ÒINKEJ



5009

5008

5010



.KTG#::+844QOI(GKPIQNF(D2CICPK5EJN  )1.&449KP\5VGORGNHGJNGTXQT\ÒINKEJp5VGORGNINCP\





.KTG#::+44QOI(GKPIQNF(D2CICPK5EJN )1.&448QT\ÒINKEJ





.KTG#::++44QOI(GKPIQNF(D2CICPK5EJN  )1.&449KP\-TCV\GTXQT\ÒINKEJ



5011

5012



.KTG#::+44QO&CX2CICPK



.KTG#::+844QO&CX2CICPK



.KTG#::844QO&CX2CICPK

5013

5GNVGPGT,CJTICPI8QT\ÒINKEJ



5GJTUEJÌPpXQT\ÒINKEJ



(GKPG6ÌPWPIXQT\ÒINKEJ

 69


KIRCHENSTAAT

5015

5014



.KTG#::844QO&CX2CICPK

8QT\ÒINKEJ





.KTG#0::+44QO2CICPK

8QT\ÒINKEJ



5017

5016



.KTG#0::+44QO2CICPK



.KTG#::+44QO2CICPK



.KTG#::++44QO2CICPK



.KTC#0::+44QO2CICPK

5018

5019

5GJTUEJÌPpXQT\ÒINKEJ



8QT\ÒINKEJp5VGORGNINCP\



8QT\ÒINKEJ



48QT\ÒINKEJp5VGORGNINCP\



5022

5021

5020



.KTC#0::++44QO2CICPK

8QT\ÒINKEJp5VGORGNINCP\





5QNFK %GPVGUKOK #::+++44QO2CICPK

4(CUVXQT\ÒINKEJ





5QNFK %GPVGUKOK #::++44QO2CICPK  2TCEJVGZGORNCTXQPRQNKGTVGP5VGORGNP5VGORGNINCP\



5023

5024



-W5QNFK %GPVGUKOK #00::+44QO2CICPK

(GKPG6ÌPWPIXQT\ÒINKEJ





-W5QNFK %GPVGUKOK #00:++44QO2CICPK

(GKPG6ÌPWPIXQT\ÒINKEJ



70


KIRCHENSTAAT

5026

5025

 

-W5QNFK44QO2CICPK -W5QNFK %GPVGUKOK #00::+++44QO2CICPK

-W5QNFK %GPVGUKOK #00::+844QO2CICPK -W5QNFK %GPVGUKOK #00::+44QO2CICPK

-W5QNFK %GPVGUKOK #00::+44QO2CICPK -W5QNFQ %GPVGUKOK #00::+44QO2CICPKD

5032

  

8QT\ÒINKEJ 8QT\ÒINKEJ

 

8QT\ÒINKEJ 8QT\ÒINKEJ

 

5030

5029

 

 

5028

5027

 

(GKPG2CVKPCXQT\ÒINKEJ (GKPG6ÌPWPIXQT\ÒINKEJ

5031

-W5QNFQ %GPVGUKOK #00::+44QO2CICPK -W%GPVGUKOQ#0::+44QO2CICPK -W%GPVGUKOQ#0::++44QO2CICPK

5033

8QT\ÒINKEJ 8QT\ÒINKEJp5VGORGNINCP\ 8QT\ÒINKEJ

  

5034





5KNDGTOGFCKNNG#001+:XQP/5GDCNFCWHFCU&QIOCFGTWPDGHNGEMVGP'ORH·PIPKU/CTKCU $TWUVDKNFTKPIGKUVNKEJGO1TPCV/CTKCUVGJVXXCWH/QPFUKEJGNÒDGT9QNMGPKPFGT4GEJVGP.KNKG \W FGP 5GKVGP \YGK 2WVVGP FKG KJT <GRVGT WPF -TQPG TGKEJGP  OO  I 4KPCNFK  5NI   $TGVVCWGT 2TCEJVGZGORNCTOKVHGKPGT6ÌPWPI8QT\ÒINKEJp5VGORGNINCP\ 5GJTWOHCPITGKEJG5COONWPIXQP/ÒP\GPFKGUGU2CRUVGUXQO-W3WCVVTKPQDKU\WO5EWFQFCTWPVGT \CJNTGKEJGDGUUGTG5VÒEMG+PVGTGUUCPVGU.QVDKVVGDGUKEJVKIGP 5VÒEM/GKUVUGJTUEJÌPWPFDGUUGT

  71


KIRCHENSTAAT

ex 5036



5GJTIGRHNGIVG5COONWPIXQP/ÒP\GPFKGUGU2CRUVGUXQO-W3WCVVTKPQDKU\WO5EWFQKPOGKUVJÒD UEJGP 'TJCNVWPIGP &CTWPVGT CWEJ \CJNTGKEJG DGUUGTG ,CJTI·PIG 5GJT KPVGTGUUCPVGU .QV DKVVG DGUKEJVK   IGP 5VÒEM/GKUVXQT\ÒINKEJWPFDGUUGT 

5037 5038

5038





.GQ:+++5KNDGTOGFCKNNG#0:XQP($KCPEJKCWHUGKPL·JTKIGU2TKGUVGTLWDKN·WO $TWUVDKNFNKPIGKUVNKEJGO1TPCV5VTCJNGPFGU-TGW\CWH9QNMGOOI4KPCNFK  +P1TKIKPCNGVWK5EJÌPG2CVKPCXQT\ÒINKEJp5VGORGNINCP\



5KNDGTOGFCKNNG#0::+XQP($KCPEJKCWHFKG4GUVCWTKGTWPIFGT(TGUMGPXQP$GTPCTFKPQ2KPVW TKWEEJKQKPFGT#WNC$QTIKCPC$TWUVDKNFNKPIGKUVNKEJGO1TPCV2CRUV#NGZCPFGT8+MPKGVXQTGKPGO 5CTMQRJCIFCTCWHUVGJVFGT'TNÌUGTKP5VTCJNGPMTCP\OOI4KPCNFK  +P1TKIKPCNGVWK2TCEJVXQNNG2CVKPC5VGORGNINCP\



5040 5039





72

5039

5KNDGTOGFCKNNG#0::8  XQP($KCPEJKCWHUGKPL·JTKIGU2QPVKHKMCVULWDKN·WO$TWUVDKNF N KP IGKUVNKEJGO 1TPCV5V 2GVTWU VJTQPV X X OKV 5EJNÒUUGNP WPF $WEJ  OO  I 4KPCNFK   \W CPFGTG8QTFGTUGKVGPFCTUVGNNWPI  8QT\ÒINKEJGU'ZGORNCTOKVHGKPGT6ÌPWPI



2KWU:+.KTG#0018+++4QOI(GKPIQNF(D2CICPK5EJN )1.&8QT\ÒINKEJ




KIRCHENSTAAT

5041

ex 5043

ex 5044

ex 5045



.KTG#0018+++4QOI(GKPIQNF(D2CICPK5EJN  )1.&8QT\ÒINKEJ





-WTUOÒP\GPUCV\#0018+++4QODGUVGJGPFCWU.KTG.KTC%GPVGUKOK -WWPF-W%GPVGUKOKFCTKPGPVJCNVGPI(GKPIQNF 5VÒEMZ)1.&8QT\ÒINKEJ





-WTUOÒP\GPUCV\ #001 :+ 4QO DGUVGJGPF CWU     .KTG  .KTC   %GPVGUKOK   -WWPF-W%GPVGUKOKFCTKPGPVJCNVGPI(GKPIQNF 5ÒEMZ)1.&8QT\ÒINKEJ





-WTUOÒP\GPUCV\#001:+++4QODGUVGJGPFCWU.KTG.KTC%GPVGUKOK -WWPF-W%GPVGUKOKFCTKPGPVJCNVGPI(GKPIQNF 5VÒEMZ)1.&8QT\ÒINKEJ





-WTUOÒP\GPUCV\4QOCWHFCU*GKNKIG,CJTDGUVGJGPFCWU.KTG.KTC %GPVGUKOK-WWPF-W%GPVGUKOKFCTKPGPVJCNVGPI(GKPIQNF  5VÒEMZ)1.&8QT\ÒINKEJ



ex 5047

ex 5046



-WTUOÒP\GPUCV\#001:+84QODGUVGJGPFCWU.KTG.KTC%GPVGUKOK -WWPF-W%GPVGUKOKFCTKPGPVJCNVGPI(GKPIQNF 5VÒEMZ)1.&8QT\ÒINKEJ





-WTUOÒP\GPUCV\ #001 :8 4QO DGUVGJGPF CWU   .KTG.KTC%GPVGUKOK -W WPF -W %GPVGUKOK FCTKP GPVJCNVGP  I (GKPIQNF &C\W &GT QTKIKPCNG 5KNDGTLGVQP FKGUGU   ,CJTICPIGU 5VÒEMZ)1.&+PDNCWGO1TKIKPCNGVWK8QT\ÒINKEJ



5050

5048







5048

5KNDGTOGFCKNNG#0018+++XQP#/KUVTW\\KCWHUGKPL·JTKIGU2TKGUVGTLWDKN·WOWPFFKG.CVGT CPXGTVT·IG $TWUVDKNF N KP IGKUVNKEJGO 1TPCV-GNEJ OKV UVTCJNGPFGT *QUVKG CWH #NVCTRNCVVG KO *KPVGT   ITWPF.CVGTCPRCNCUVWPFFGT2GVGTUFQOOOI4KPCNFK (GKPG6ÌPWPIXQT\ÒINKEJ



5COONWPIXQP/ÒP\GPFKGUGU2CRUVGUXQO-W%GPVKUKOKDKU\W.KTG 5VÒEM &C\W5GFKUXC MCP\WPF.KTG2KWU:++5COONWPIXQPFGT.KTCDKU\W.KTG 5VÒEM 5GFKUXCMCP\ .KTGWPF5GFKUXCMCP\.KTG 5VÒEM/GKUVXQT\ÒINKEJWPFDGUUGT



2KWU:++.KTG#0++4QOI(GKPIQNF(D2CICPK5EJN  )1.&0WT'ZGORNCTGIGRT·IV8QT\ÒINKEJ

 73


KIRCHENSTAAT

5051

5052

ex 5053

5054

ex 5055



.KTG#+++4QOI(GKPIQNF(D2CICPK5EJN  )1.&0WT'ZGORNCTGIGRT·IV8QT\Ã&#x2019;INKEJ





.KTG#001:4QOI(GKPIQNF(D2CICPK5EJN  )1.&0WT'ZGORNCTGIGRT·IV8QT\Ã&#x2019;INKEJ





-WTUOÃ&#x2019;P\GPUCV\ #001 : 4QO DGUVGJGPF CWU     .KTG WPF  .KTC FCTKP GPVJCNVGP   I(GKPIQNF 5VÃ&#x2019;EMZ)1.&+P1TKIKPCNXGTRCEMWPI5VGORGNINCP\





.KTG#+8$/%/.  4QOCWHFCU*GKNKIG,CJTI(GKPIQNF(D2CICPK5EJN )1.&0WT'ZGORNCTGIGRT·IV8QT\Ã&#x2019;INKEJp5VGORGNINCP\





-WTUOÃ&#x2019;P\GPUCV\#+8$4QOCWHFCU*GKNKIG,CJTDGUVGJGPFCWU.KTGWPF.KTC FCTKPGPVJCNVGPI(GKPIQNF 5VÃ&#x2019;EMZ)1.&+P1TKIKPCNXGTRCEMWPI5VGORGNINCP\





-WTUOÃ&#x2019;P\GPUCV\#+8$4QOCWHFCU*GKNKIG,CJTDGUVGJGPFCWU.KTGWPF.KTC FCTKPGPVJCNVGPI(GKPIQNF 5VÃ&#x2019;EMZ)1.&8QT\Ã&#x2019;INKEJ WPFDGUUGT



ex 5057



ex 5058

5059

5061

ex 5062

-WTUOÃ&#x2019;P\GPUCV\#0:+++4QODGUVGJGPFCWU.KTGWPF.KTCFCTKPGPVJCNVGPI (GKPIQNF 5VÃ&#x2019;EMZ)1.&4,GYGKNUPWT'ZGORNCTGIGRT·IV +P1TKIKPCNXGTRCEMWPI5VGORGNINCP\





-WTUOÃ&#x2019;P\GPUCV\#0:+:4QODGUVGJGPFCWU ZFCXQPZ)QNF .KTGWPF .KTCFCTKPGPVJCNVGPI(GKPIQNF 5VÃ&#x2019;EMZ)1.&+P1TKIKPCNXGTRCEMWPI5VGORGNINCP\





.KTG#0::4QOI(GKPIQNF(D2CICPK5EJN  )1.&0WT'ZGORNCTGIGRT·IV 2TCEJVGZGORNCTXQPRQNKGTVGP5VGORGNP8QT\Ã&#x2019;INKEJp5VGORGNINCP\



-WTUOÃ&#x2019;P\GPUCV\ #0 :: 4QO DGUVGJGPF CWU   Z FCXQP Z )QNF        .KTGWPF.KTCFCTKPGPVJCNVGPI(GKPIQNF  5VÃ&#x2019;EMZ)1.&+P1TKIKPCNXGTRCEMWPI5VGORGNINCP\







,QJCPPGU::+++.KTG#+4QOI(GKPIQNF(D2CICPK5EJN )1.&(CUV5VGORGNINCP\





-WTUOÃ&#x2019;P\GPUCV\#+4QODGUVGJGPFCWU ZFCXQPZ)QNF .KTGWPF .KTCFCTKPGPVJCNVGPI(GKPIQNF 5VÃ&#x2019;EMZ)1.&+P1TKIKPCNXGTRCEMWPI5VGORGNINCP\



74


KIRCHENSTAAT

ex 5063





5064

ex 5063

)QNFOGFCKNNG  XQP 2 /CP\Ð CWH FCU  ¤MWOGPKUEJG 8CVKMCPKUEJG -QP\KN $TWUVDKNF JCNDN KP   IGKUVNKEJGO 1TPCV2CRUV GORH·PIV )NCWDGPUDTWFGT  OO  I &C\W ,GYGKNU GKP YGKVGTGU   'ZGORNCTKP5KNDGT OOI WPF$TQP\G OO   5VÒEMZ)1.&+PTQVGO1TKIKPCNGVWK8QT\ÒINKEJp5VGORGNINCP\



)QNFOGFCKNNG\W&WMCVGPQ,WPUKIPKGTVCWHFCU++¤MWOGPKUEJG8CVKMCPKUEJG-QP\KN$TWUVDKNFN KPIGKUVNKEJGO1TPCV#PUKEJVFGT(CUUCFGFGU2GVGTUFQOGUOOI4KPCNFK  )1.&8QT\ÒINKEJ



ex 5067

5065







5065

5GFKUXCMCP\  )QNFOGFCKNNG  XQP 5CXGNNK -CTFKPCNUJWV ÒDGT 9CRRGP5EJKTO OKV \YGK   IGMTGW\VGP5EJNÒUUGNPXGTDWPFGPOOI  )1.&+PYGK­GO1TKIKPCNGVWK8QT\ÒINKEJp5VGORGNINCP\



)QNFOGFCKNNG  XQP 5CXGNNK -CTFKPCNUJWV ÒDGT 9CRRGP5EJKTO OKV \YGK IGMTGW\VGP 5EJNÒUUGNP   XGTDWPFGPOOI&C\W,GYGKNUGKPYGKVGTGU'ZGORNCTKP5KNDGT OOI WPF $TQP\G OO  5VÒEMZ)1.&+PTQVGO1TKIKPCNGVWK8QT\ÒINKEJp5VGORGNINCP\



)QNFOGFCKNNG  XQP 5CXGNNK -CTFKPCNUJWV ÒDGT 9CRRGP.KGIGPFGT 5EJNÒUUGN FCTÒDGT HÒPH <GKNGP   5EJTKHVOOI&C\W,GYGKNUGKPYGKVGTGU'ZGORNCTKP5KNDGT OOI WPF $TQP\G OO  5VÒEMZ)1.&+PTQVGO1TKIKPCNGVWK8QT\ÒINKEJp5VGORGNINCP\



ex 5068



2CWN8+)QNFOGFCKNNG#0+XQP)KCPRCQNKCWHUGKPG+PVJTQPKUCVKQP$TWUVDKNFN 6KCTC ÒDGT 9CRRGP  OO  I &C\W ,GYGKNU GKP YGKVGTGU 'ZGORNCT KP 5KNDGT  OO   I WPF$TQP\G OO  5VÒEMZ)1.&+PTQVGO1TKIKPCNGVWK2QNKGTVG2NCVVG

 75


KIRCHENSTAAT

ex 5069

ex 5070





ex 5070

)QNFOGFCKNNGXQP'/CPHTGFKCWHFKG#WHJGDWPIFGTIGIGPUGKVKIGP'ZMQOOWPKMCVKQPUDWNNGFGU ,CJTGUFWTEJ2CWN8+WPFFGP2CVTKCTEJGP#VJGPCIQTCUXQP-QPUVCPVKPQRGN&GT2CRUVDGIGIPGV FGO 2CVTKCTEJGP5V 2GVTWU WPF GKP YGKVGTGT #RQUVGN UKV\GP PGDGPGKPCPFGT X X  OO  I   &C\W,GYGKNUGKPYGKVGTGU'ZGORNCTKP5KNDGT OOI WPF$TQP\G OO   5VÃ&#x2019;EMZ)1.&+PTQVGO1TKIKPCNGVWK8QT\Ã&#x2019;INKEJp5VGORGNINCP\



)QNFOGFCKNNG  XQP ' 5GPGUK CWH FCU *GKNKIG ,CJT %JTKUVWU WOCTOV 2GVTWU1NKXGPDCWO    OO  I &C\W ,GYGKNU GKP YGKVGTGU 'ZGORNCT KP 5KNDGT  OO  I  WPF $TQP\G  

OO  5VÃ&#x2019;EMZ)1.&+PTQVGO1TKIKPCNGVWK8QT\Ã&#x2019;INKEJp5VGORGNINCP\



ex 5071

ex 5072





76

ex 5072

)QNFOGFCKNNG#001:+++  XQP')TGEQCWHFGP*GKNKIGP)GKUV$Ã&#x2019;UVGNKPIGKUVNKEJGO 1TPCV6CWDGHNKGIVTOOI&C\W,GYGKNUGKPYGKVGTGU'ZGORNCTKP5KNDGT OO I WPF$TQP\G OO   5VÃ&#x2019;EMZ)1.&+PTQVGO1TKIKPCNGVWK8QT\Ã&#x2019;INKEJp5VGORGNINCP\



)QNFOGFCKNNG #001 :8+   XQP 1 ) CWH FCU *GKNKIG #DGPFOCJN $TWUVDKNF N KP IGKUVNKEJGO   1TPCV%JTKUVWU UKV\V CP GKPGO 6KUEJ WPF VGKNV GKP $TQV OKV FGP DGKFGP 'OOCWULÃ&#x2019;PIGTP  OO   I&C\W,GYGKNUGKPYGKVGTGU'ZGORNCTKP5KNDGT OOI WPF$TQP\G OO  5VÃ&#x2019;EMZ)1.&+PTQVGO1TKIKPCNGVWK8QT\Ã&#x2019;INKEJp5VGORGNINCP\




KIRCHENSTAAT

ex 5073

ex 5074

ex 5074





 5GFKUXCMCP\  )QNFOGFCKNNG  XQP )KUOQPFK -CTFKPCNUJWV Ã&#x2019;DGT 9CRRGP5EJKTO OKV   \YGK IGMTGW\VGP 5EJNÃ&#x2019;UUGNP XGTDWPFGP  OO  I &C\W ,GYGKNU GKP YGKVGTGU 'ZGORNCT KP   5KNDGT OOI WPF$TQP\G OO   5VÃ&#x2019;EMZ)1.&+PTQVGO1TKIKPCNGVWK8QT\Ã&#x2019;INKEJp5VGORGNINCP\



 5GFKUXCMCP\  )QNFOGFCKNNG  XQP 4 8KUVQNK -CTFKPCNUJWV Ã&#x2019;DGT 9CRRGP5EJKTO OKV   \YGK IGMTGW\VGP 5EJNÃ&#x2019;UUGNP XGTDWPFGP  OO  I &C\W ,GYGKNU GKP YGKVGTGU 'ZGORNCT KP   5KNDGT OOI WPF$TQP\G OO   5VÃ&#x2019;EMZ)1.&+PTQVGO1TKIKPCNGVWK8QT\Ã&#x2019;INKEJp5VGORGNINCP\



5075



,QJCPPGU 2CWN ++   .KTG # :+: 4QO $CUKNKMC 5CP 2CQNQ HWQTK NG /WTC   I(GKPIQNF&C\W.KTG#:+:4QO5V2CWNWUI(GKPIQNF(D  5VÃ&#x2019;EM)1.&Z+PTQVGO1TKIKPCNGVWK2QNKGTVG2NCVVG



5076



.KTG#::4QO$CUKNKMC5CPVC/CTKC/CIIKQTGI(GKPIQNF&C\W.KTG #::4QO/CFQPPCOKV-KPFI(GKPIQNF(D  5VÃ&#x2019;EM)1.&+PTQVGP1TKIKPCNGVWKU2QNKGTVG2NCVVG



5077



.KTG#::+4QO2GVGTUFQOI(GKPIQNF&C\W.KTG#::+4QO 5V2GVTWUI(GKPIQNF(D 5VÃ&#x2019;EM)1.&+PTQVGP1TKIKPCNGVWKU2QNKGTVG2NCVVG

 77


KIRCHENSTAAT

5081

ex 5078

5080



'WTQ-WTUOÃ&#x2019;P\GPUCV\#001::+844QO  5VÃ&#x2019;EM+PDNCWGT1TKIKPCNXGTRCEMWPI5VGORGNINCP\





'WTQ-WTUOÃ&#x2019;P\GPUCV\#001::+844QO  5VÃ&#x2019;EM+PDNCWGT1TKIKPCNXGTRCEMWPI5VGORGNINCP\





'WTQ#0::8+4QO&CU5CNQOQPKUEJG7TVGKNI(GKPIQNF;GQ  )1.&+PTQVGO1TKIKPCNGVWK2QNKGTVG2NCVVG





'WTQ#0::8+4QO&CXKFWPF)QNKCVJI(GKPIQNF;GQ  )1.&+PTQVGO1TKIKPCNGVWK2QNKGTVG2NCVVG



ex 5082

ex 5083

ex 5084



)QNFOGFCKNNG#0018XQP')*CPUKPICWHFKG/CFQPPCXQP(CVKOC$TWUVDKNFTKPIGKUVNK EJGO1TPCVOKVFGO-TGW\%JTKUVK&KG/CFQPPCXQP(CVKOCWPVGPFTGK*KTVGPOOI &C\W,GYGKNUGKPYGKVGTGU'ZGORNCTKP5KNDGT OOI WPF$TQP\G OO   5VÃ&#x2019;EMZ)1.&+PYGK­GO1TKIKPCNGVWK8QT\Ã&#x2019;INKEJp5VGORGNINCP\





)QNFOGFCKNNG#001+:XQP'/CPHTGFKCWHFKGR·RUVNKEJG(TKGFGPUDQVUEJCHV$TWUVDKNFNKPIGKUV NKEJGO 1TPCV5V (TCPEGUEQ XQT /GPUEJGPOGPIG \W FGP 5GKVGP $·WOG KO *KPVGTITWPF FKG $CUKNKMC   XQP#UUKUKOOI&C\W,GYGKNUGKPYGKVGTGU'ZGORNCTKP5KNDGT OOI WPF $TQP\G OO  5VÃ&#x2019;EMZ)1.&+PYGK­GO1TKIKPCNGVWK8QT\Ã&#x2019;INKEJp5VGORGNINCP\





)QNFOGFCKNNGXQP'4QEEJKCWHFGP,CJTVCWUGPFYGEJGN$TWUVDKNFHCUVXXKPIGKUVNKEJGO1TPCV OKV FGO -TGW\ %JTKUVK KP FGT .KPMGP(Ã&#x2019;PH UVKNKUKGTVG 6CWDGP CWH -TGW\  OO  I &C\W   ,GYGKNUGKPYGKVGTGU'ZGORNCTKP5KNDGT OOI WPF$TQP\G OO   5VÃ&#x2019;EMZ)1.&+PYGK­GO1TKIKPCNGVWK8QT\Ã&#x2019;INKEJp5VGORGNINCP\



&KXGTUG'WTQ-WTUOÃ&#x2019;P\GPU·V\G 2TQQH5GVU XQP 2TQDGPWT5·V\GJGTIG UVGNNV UQYKGLGYGKNUGKPG/GFCKNNGRTQ5GV  5GVUOKVLGYGKNU5VÃ&#x2019;EMGP+P1TKIKPCNGVWKU DNCWTQVITÃ&#x2019;PITCW 2QNKGTVG2NCVVG





78


LUCCA 



&KXGTUG'WTQ-WTUOÒP\GPU·V\GXQP&C\W$GPGFKMV:8+'WTQ-WTUOÒP\GP UCV\ 5GVUOKVLGYGKNU5VÒEMGP +P1TKIKPCNXGTRCEMWPIGP DNCWUKNDGTTQVITÒPITCW 5VGORGNINCP\



.KTG 8CTKCPVGP  8CTKCPVGP  8CTKCPVGP .KTG 'WTQ&C\W5GFKUXCMCP\'WTQ$GPGFKMV:8+'WTQ'WTQ  5VÒEM+P1TKIKPCNGVWKU2QNKGTVG2NCVVG



.165-+4%*'056##6 

-NGKPG5COONWPIR·RUVNKEJGT/ÒP\GPFGU/KVVGNCNVGTUXQT )GUCOVGKPFTWEMUGJTUEJÌP FCTWPVGT XGTUEJKGFGPG$QNQIPKPKXQP)TGIQT:+$QPKHCVKWU+:WPF0KEQNCWU8&C\WGKPWOHCPITGKEJGU-QP XQNWVXQP-NGKPOÒP\GPFGUJGKNKIGP5VWJNUXQO,CJTJWPFGTVKPOGKUVO·­KIGP'TJCNVWPIGP  5VÒEM5EJÌPpUGJTUEJÌP





&KXGTUGR·RUVNKEJG/ÒP\GPFGUDKU,CJTJWPFGTVUFCTWPVGTGKP5EWFQFGT5GFKUXCMCP\ OKV ¤UG UQYKG5CORKGVTKPKCWU%KXKVCXGEEJKC)WDDKQ2GTWIKC5CP5GXGTKPQ8KVGTDQGVE  5VÒEM5EJÌPpXQT\ÒINKEJ





,WNKWU+++$TQP\GOGFCKNNG #+++ 5RKPM7TDCP8+++$TQP\GOGFCKNNG #:+: CWHFGP0GWDCWFGU )GVTGKFGURGKEJGTUKP4QO%NGOGPU:$TQP\GOGFCKNNG #+++ CWHFKG)GVTGKFGGTPVG2KWU+:$TQP \GOGFCKNNG #0::+ CWHFGP'TYGKVGTWPIUDCWFGTRU[EJCVTKUEJGP-NKPKM 5VÒEM8QT\ÒINKEJ



5#//.70)2#256/'&#+..'0 

5COONWPI XQP /GFCKNNGP FGU  ,CJTJWPFGTVU CWU 5KNDGT WPF WPGFNGP /GVCNNGP OKV \CJNTGKEJGP   DGUUGTGP 5VÒEMGP &KG 5COONWPI URKGIGNV KP GKPFTWEMUXQNNGT 9GKUG FKG )GUEJKEJVG FGU JGKNKIGP 5VWJNU   YKGFGTWPFGKIPGVUKEJJGTXQTTCIGPF\WO#WUDCWQFGTCNU'TI·P\WPIGKPGTDGTGKVUDGUVGJGPFGP5COO NWPI*QEJKPVGTGUUCPVGU1DLGMVOKV\CJNTGKEJGP5GNVGPJGKVGPDKVVGDGUKEJVKIGP  5VÒEM7PVGTUEJKGFNKEJGTJCNVGPFGT)GUCOVGKPFTWEMKUVUGJTUEJÌPpXQT\ÒINKEJ  'KPRT·EJVKIKNNWUVTKGTVGU$WEJÒDGTFKG/QPWOGPVGFGUCPVKMGPWPFCNVEJTKUVNKEJGP4QOHKPFGP5KGWPVGT FGT0T

5092

5093

5093

.1/$#4&'+ 

2TQXKUQTKUEJG 4GIKGTWPI   .KTG  / /CKNCPF  I (GKPIQNF (D  2CICPK    5EJN )1.&(CUVXQT\ÒINKEJ 



.KTG/CKNCPF)GRT·IVY·JTGPFFGU#WHUVCPFGUKP/CKNCPF&CX2CICPK  (GKPG6ÌPWPIYKP\-TCV\GTXQT\ÒINKEJ

5095

 

.7%%#

5094

4GRWDNKM5EWFQF QTQI$GNNGUKC#(D 5CP/CTVKPQFC$QNQIPKPK$GNNGUKC OQNVQTCTQ 



5095

)1.&5GJTUEJÌP 44(CUVUGJTUEJÌP

  79


LUCCA

5096

  

5098

5097

5EWFQ$GNNGUKC&CX 5EWFQ$GNNGUKC&CX 5EWFQ$GNNGUKC&CX

5GJTUEJÌP 9KP\5EJTÌVNKPIUHGJNGTCO4CPFUGJTUEJÌP 5EJÌPG2CVKPCUGJTUEJÌP

  

5100

5099



'NKUC$QPCRCTVGWPF(GNKZ$CEKQEEJK(TCPEJK(NQTGP\&CX2CICPKD  8QT\ÒINKEJGU'ZGORNCTOKVUEJÌPGT6ÌPWPI





(TCPEJK(NQTGP\&CX2CICPKE



5101

5EJÌPG2CVKPCUGJTUEJÌPpXQT\ÒINKEJ

5102

1,5:1

1,5:1



(TCPEQ(NQTGP\2CICPK

8QT\ÒINKEJGU'ZGORNCTOKVHGKPGT6ÌPWPI





%CTN.WFYKIXQP$WTIWPF.KTG.WEEC2CICPK  49KP\5EJTÌVNKPIUHGJNGTHCUV5VGORGNINCP\



80


MAILAND

5103

1,5:1



1,5:1

/#+.#0&

'TUVG4GRWDNKM#ODTQUKPQQ,I$KCIIK(D )1.&5GJTUEJÌP



5105

5104



'PTKEQ8++XQP.WZGODWTI)TQUUQFC5QNFKQ,I$KCIIK  44(CUVUGJTUEJÌP





)TQUUQQ,I$KCIIK

5GJTUEJÌP



(KNKRRQ/CTKC8KUEQPVK(KQTKPQF QTQQ,I(D%TKRRC%  )1.&#VVTCMVKXGUUGJTUEJÌPGU'ZGORNCT



5106

1,5:1

1,5:1



5107

5108

5109

5110

 

)CNGC\\Q/CTKC5HQT\C6GUVQPGQ,%TKRRC 4  6GUVQPGQ,%TKRRC 4 

445GJTUEJÌP 44(CUVUGJTUEJÌP



)KCP)CNGC\\Q/CTKC5HQT\CWPF.WFQXKEQ/CTKC5HQT\C)TQUUQFC5QNFKQ,%TKRRC  (GKPG6ÌPWPIVGKNYGKUGUEJYCEJCWUIGRT·IVUGJTUEJÌPpXQT\ÒINKEJ



(TCPEGUEQ++5HQT\C5QNFKQ,%TKRRC

#O4CPFXGTRT·IVUGJTUEJÌP

    81


MAILAND

5111

5111 1,5:1



2JKNKRR++XQP5RCPKGP&GPCTQFC5QNFKQ,%TKRRC#  45EJÌPGU2QTVT·V5GJTUEJÌPGU'ZGORNCT



5113

5112

5112



5EWFQ<YKVVGTRT·IWPIOKVFGT,CJTGU\CJNCWH8QTFGTWPF4ÒEMUGKVG%TKRRC# 4 &CX# 445GJTUEJÌP





&QRRKCI%TKRRC$(D



5115

)1.&5GJTUEJÌPGU'ZGORNCT

5114

5116



5EWFQ%TKRRC&&CX



2JKNKRR+8XQP5RCPKGP&WECVQPG ,CJTGU\CJNPKEJVNGUDCT %TKRRC$&CX 5GJTUEJÌP





(KNKRRQ%TKRRC#&CX



82

'VYCURQTÌUGT5EJTÌVNKPIUGJTUEJÌP

)WVGU2QTVT·VYKP\5EJTÌVNKPIUHGJNGTUGJTUEJÌP




MAILAND

5117

5118

5119



(KNKRRQ%TKRRC#&CX

5GJTUEJÌP





-CTN++XQP5RCPKGP(KNKRRQ%TKRRC&CX  5EJTÌVNKPIUHGJNGTCO4CPFUGJTUEJÌP





(KNKRRQ ,CJTGU\CJNPKEJVNGUDCT %TKRRC&CX



5EJÌPpUGJTUEJÌP

5121

5120

5120



(KNKRRQ%TKRRC&CX  'VYCU(WPFDGNCIXQT\ÒINKEJGU'ZGORNCTOKVJGTXQTTCIGPFGO2QTVT·V



/CTKC 6JGTGUKC XQP *CDUDWTI   &QRRKG   I 8GTUEJNGKGTVGU $TWUVDKNF T   )GMTÌPVGUXKGTHGNFKIGU9CRRGPOKV/KVVGNUEJKNF\YKUEJGP2CNOGPWPF.QTDGGT\YGKIGP%TKRRC# (D'[RGNVCWGT )1.&445GJTUEJÌPpXQT\ÒINKEJ 

5122

5123



5122



5EWFQ/CKNCPF%TKRRC$ 4 '[RGNVCWGT



,QUGH ++ XQP *CDUDWTI  5QXTCPQ  / /CKNCPF  I %TKRRC # (D  C   )1.&#VVTCMVKXGUXQT\ÒINKEJGU'ZGORNCT

445GJTUEJÌPpXQT\ÒINKEJ

  83


MAILAND

5125

5124

5126

5128

5127

 

5QXTCPQ//CKNCPFI%TKRRC#(DC 5QXTCPQ//CKNCPFI%TKRRC& 4 (DC

)1.&(CUVXQT\ÒINKEJXQT\ÒINKEJ )1.&(CUVXQT\ÒINKEJ

 



(TCP\++XQP*CDUDWTI.KTCFGN)KWTCOGPVQ/CKNCPF%TKRRC 4   2TCEJVGZGORNCTOKVHGKPGT6ÌPWPI8QT\ÒINKEJp5VGORGNINCP\





5QXTCPQ  / /CKNCPF  I (GKPIQNF (D  C 2CICPK  5EJN  FQTV WPVGT ¤UVGTTGKEJ    )1.&5GJTUEJÌP





5QXTCPQ  / /CKNCPF  I (GKPIQNF (D  C 2CICPK  5EJN  FQTV WPVGT ¤UVGTTGKEJ    )1.&5GJTUEJÌP



5130

5131

5129



(TCP\+XQP¤UVGTTGKEJ5QXTCPQ//CKNCPFI(GKPIQNF(DE2CICPK 5EJN FQTVWPVGT¤UVGTTGKEJ  )1.&-N-TCV\GTUGJTUEJÌPHCUVXQT\ÒINKEJ





 5QXTCPQ  / /CKNCPF  I (GKPIQNF (D  G 2CICPK  5EJN  FQTV WPVGT ¤UVGT   TGKEJ  )1.&/KPLWUVKGTVXQT\ÒINKEJGU'ZGORNCT





 5QXTCPQ  / /CKNCPF  I (GKPIQNF (D  G 2CICPK  5EJN  FQTV WPVGT ¤UVGT   TGKEJ  )1.&9KP\4CPFHGJNGTUGJTUEJÌP



5132

5133

5133



(GTFKPCPF+XQP¤UVGTTGKEJ5QXTCPQ//CKNCPFI(GKPIQNF(DI 2CICPK5EJN FQTVWPVGT¤UVGTTGKEJ  )1.&5GJTUEJÌP





5VCFV$TQP\GOGFCKNNGXQP./CPHTGFKPKCWH.WKIK5CEEQ#T\VCO1URGFCNGOCIIKQTGKP/CK NCPF$GITÒPFGTWPF)GPGTCNFKTGMVQTFGT8CM\KPCVKQPKP+VCNKGP 8CTGUGÓ/CKNCPF*[IKGKC N·­V GKP IGKORHVGU -KPF FKG $ÒUVG 5CEEQU DGMT·P\GP FKG XQT KJPGP CWH GKPGO 2QUVCOGPV UVGJV5GEJU   <GKNGP5EJTKHVOO5NI$TGVVCWGT 8QT\ÒINKEJ



84


MANTUA

5134

1,5:1

1,5:1

/#067# 

8KPEGP\Q+6CNNGTQQ,/CPVWCI9CN\GPRT·IWPI8+0Ù&Ù)Ù&8:Ù/Ù ++++Ù'6Ù/106+5Ù('4Ù++Ù)GJCTPKUEJVGU*ÒHVDKNFTOKVFGT4GEJVGPFCU<GRVGTUEJWNVGTPFFKG .KPMG CO 5EJYGTVITKHHr /10'6# Ù 018# Ù #4) Ù %+8+6 Ù /#0 #FNGT  FGP -QRH PCEJ N IG   YCPFV CWH FGT $TWUV 9CRRGPUEJKNF $KIPQVVK  4  &CX  /QTQUKPK ++ 5   FK GUKOKC   TCTKV¯  8QPITÌ­VGT5GNVGPJGKV#VVTCMVKXGUHCUVXQT\ÒINKEJGU'ZGORNCT 

5135

5136

 

5136

.KTCQ,/CPVWC$KIPQVVK -N5EJTÌVNKPIUTK­HCUVUGJTUEJÌP 8KPEGP\Q++&WECVQ 5QNFK Q,  /CPVWC$KIPQVVK 445GJTUEJÌP

 

5137 5138

5138



(GTFKPCPFQ%CTNQ.KTC$KIPQVVK 4   44'VYCUTCWJGT5EJTÌVNKPIOKVMN(GJNGTPUGJTUEJÌP





5EWFQ$KIPQVVK&CX



5GJTUEJÌP

85


MODENA

5140

5139



5139

.GQRQNF++XQP¤UVGTTGKEJ 5KNDGTOGFCKNNGXQP,8KPC\GTCWHFKG*WNFKIWPIXQP /CPVWC $ÒUVG T OKV .QTDGGTMTCP\&GT -CKUGT GTJGDV FKG N XQT KJO MPKGPFG 5VCFVIÌVVKP  OO   I5NI/QPVGPWQXQ 4-N4CPFHGJNGTUGJTUEJÌPpXQT\ÒINKEJ



/#55#&+.70+)+#0# 

#NDGTKEQ+%[DQ/CNCURKPC2TKPEKRG+FK/CUUC$QNQIPKPQ 5QNFK Q,%0+:+5 HH 44<WO6GKNUEJYCEJIGRT·IVUGJTUEJÌP



5141

5142

5142

/'55'4#01 

(TCPEGUEQ(KNKDGTVQ(GTTGTQ(KGUEJK6CNNGTQQ,$GKUEJNCI\WFGPJQNN·PFKUEJGP.ÌYGP VCNGTPI4KVVGTUVGJVJKPVGT.ÌYGPYCRRGP.ÌYGN&CX)CODGTKPK8CTGUK FQTV OKV,CJTGU\CJN  45GJTUEJÌP



'ZGORNCT FGT #WMVKQP (TKV\ 4WFQNH -ÒPMGT  1UPCDTÒEM  0T8CTGUKMGPPVPWTFGP6[ROKVFGTIG VGKNVGP,CJTGU\CJNWPVGTFGO5EJKNFFGT8QTFGTUGKVG )CODGTKPK 



6CNNGTQ&CX8CTGUK 4 

5143

/+4#0&1.#

445EJTÌVNKPIUTK­HCUVUGJTUEJÌP



5144



)CNGQVVQ++2KEQ/WTCKQNCQ,8CTGUK

5GJTUEJÌP





(TCPEGUEQ+F 'UVG5EWFQ 5QNFK Q,I(D8CTGUK  )1.&5GNVGPKPFKGUGT'TJCNVWPI/KPIGYGNNVXQT\ÒINKEJ



86

/1&'0#


NEAPEL UND SIZILIEN

5146

5145



.KTC8CTGUK 4 

4-N&TWEMUVGNNGPUGJTUEJÌP



#NHQPU+XQP#TCIQP%CTNKPQQ,0GCRGN2CPPWVK4KEEKQXCT

0'#2'.70&5+<+.+'0

5147

5148

5GJTUEJÌPXQT\ÒINKEJ

 

5149



(GTFKPCPF + XQP #TCIQP  %QTQPCVQ Q , 0GCRGN /KV /ÒP\OGKUVGT\GKEJGP m 2CP   PWVK4KEEKQDNGKEJVXCT -N5EJTÌVNKPIUTK­UGJTUEJÌP





%QTQPCVQQ,0GCRGN2CPPWVK4KEEKQD

5GJTUEJÌPGU'ZGORNCTOKVUEJÌPGT6ÌPWPI





%QTQPCVQQ,0GCRGN2CPPWVK4KEEKQD  7PDGFGWVGPFGT&QRRGNUEJNCICVVTCMVKXGUHCUVXQT\ÒINKEJGU'ZGORNCTOKVUEJÌPGT2CVKPC



5150

1,5:1



1,5:1

-CTN85EWFKQ,  0GCRGNI%#41.85Û8Û41/Û+/2)GJCT PKUEJVGU $TWUVDKNF T OKV 5VTCJNGPMTCP\ N KO (GNF +$4 NGIKGTV Û /#)0# Û 12'4# Û &1/    &KG2GTUQPKHKMCVKQPFGU(TKGFGPUUVGJVNOKV(ÒNNJQTPKPFGT.KPMGPKPFGT4GEJVGPJ·NVUKGGKPG(CEMGN OKVFGTUKGGKP$WEJWPF9CHHGPGPV\ÒPFGV(D2CPPWVK4KEEKQC  )1.&5GJTUGNVGPDGUQPFGTUKPFKGUGT'TJCNVWPI#VVTCMVKXGUHCUVXQT\ÒINKEJGU'ZGORNCT  &KGKPVGTGUUCPVGWPFUGJTUGNVGPG2T·IWPIDG\KGJVUKEJCWHFCU'FKMV-CKUGT-CTNU8XQO1MVQDGTFWTEJ FCU FKG 0GCRQNKVCPGT DGIPCFKIV YWTFGP FKG UKEJ FGP URCPKUEJGP 6TWRRGP OKV 9CHHGPIGYCNV YKFGTUGV\V JCVVGP &GT   *GT\QI XQP 6QNGFQ JCVVG XGTUWEJV CWEJ KP 0GCRGN GKP +PSWKUKVKQPUVTKDWPCN \W KPUVCNNKGTGP &CU 'FKMV DGUV·VKIVG FKG   DGTGKVUXQOURCPKUEJGP-ÌPKI(GTFKPCPFFGO-CVJQNKUEJGP  CWUIGURTQEJGPG<WUCIGFC­FKG+PSWKUKVKQP PKEJV KP 0GCRGN FWTEJIGHÒJTV YGTFGP UQNNG &GT /ÒP\OGKUVGT )KQXCP $CVVKUVC 4CXCUEJKGTK FGUUGP +PKVKCNGP PGDGP   FGO$TWUVDKNF\WNGUGPUKPFYCTXQPDKU/ÒP\OGKUVGTKP0GCRGN'UJCPFGNVUKEJWOGKPGFGTDGNKGDVG UVGPUÒFKVCNKGPKUEJGP2T·IWPIGPOKVFGO2QTVT·VFGU-CKUGTU WPFURCPKUEJGP-ÌPKIU -CTNU8KPFGUUGP4GKEJFKG 5QPPGPKGOCNUWPVGTIKPI

87


NEAPEL UND SIZILIEN

5151

5152



&WECVQQ,0GCRGN2CPPWVK4KEEKQ

5GJTUEJÌP





2JKNKRR++XQP5RCPKGP&WECVQQ,  0GCRGN2CPPWVK4KEEKQ  'VYCUTCWJXQT\ÒINKEJ



5154

5153

 

&WECVQQ,  0GCRGN2CPPWVK4KEEKQ 6CTKQ,  0GCRGN2CPPWVK4KEEKQD

)WVGU2QTVT·V5GJTUEJÌP (GKPG6ÌPWPIUGJTUEJÌP

 

5156

ex 5155



&WECVQQ,  6CTKQ,  &C\W-CTN++XQP5RCPKGP6CTK#NNG/ÒP\UV·VVG 0GCRGN2CPPWVK4KEEKQ 5VÒEM(CUVUGJTUEJÌPWPFUGJTUEJÌP





2JKNKRR +8 XQP 5RCPKGP  6CTK  0GCRGN /KV /ÒP\OGKUVGT\GKEJGP /%% 2CP   PWVK4KEEKQC -PCRRGT5EJTÌVNKPIWPF2T·IGUEJY·EJGUGJTUEJÌPpXQT\ÒINKEJ



5158

5157

5157



-CTN++XQP5RCPKGP&WECVQ )TCPC 0GCRGN2CPPWVK4KEEKQ&CXXCT *ÒDUEJG2CVKPCYKP\4CPFHGJNGTNGKEJVLWUVKGTVUGJTUEJÌP





-CTN 8+ XQP ¤UVGTTGKEJ -CTN N++ XQP 5RCPKGP    &WECVQ  0GCRGN 2CP   PWVK4KEEKQ 5GJTUEJÌPpXQT\ÒINKEJ



88


NEAPEL UND SIZILIEN

5159

5160

5160





-CTN+++XQP$QWTDQP2KCUVTC )TCPC 0GCRGNI(NW­IQVVNCIGTVNKO *KPVGTITWPFTCWEJGPFGT8WNMCP)GMTÌPVGU9CRRGP&CX2CPPWVK4KEEKQ  5GNVGPKPFKGUGT'TJCNVWPI#O4CPFLWUVKGTVXQT\ÒINKEJ



2KCUVTC  )TCPC   ,CJTGU\CJN KO 5VGORGN CWU  IG·PFGTV  0GCRGN  I )GJCTPKUEJVGU   $TWUVDKNFTOKVWOIGNGIVGO/CPVGN)GMTÌPVGU9CRRGP&CX2CPPWVK4KEEKQ  5GJTUGNVGPKPFKGUGT'TJCNVWPI2TCEJVGZGORNCT,WUVKGTVUQPUV5VGORGNINCP\ 

5161

5162

5163



,QUGRJ$QPCRCTVG-ÌPKIXQP0GCRGN2KCUVTC )TCPC 0GCRGN&CX2C ICPKC (CUVXQT\ÒINKEJGU'ZGORNCTOKVHGKPGT6ÌPWPI



,QCEJKO/WTCV-ÌPKIXQP0GCRGN5KNDGTPG8GTFKGPUVOGFCKNNGWPUKIPKGTVHÒTFKG 2TQXKP\KCNNGIKQPGP KP 0GCRGN -QRH N/KV GKPGO $CPF \WUCOOGPIGDWPFGPGU (CJPGPDÒPFGN FCTÒDGT   -TQPGOOI&C\W'KPYGKVGTGU'ZGORNCTKP$TQP\GOO5NI,WNKWU 5VÒEM448QT\ÒINKEJ 



$TQP\GOGFCKNNG  WPUKIPKGTV CWH FKG 'KPYGKJWPI FGT 2KC\\C /WTCV KP 0GCRGN -QRH N5KGDGP   <GKNGP5EJTKHVOO5NI,WNKWU 8QT\ÒINKEJGU'ZGORNCT



 89


NEAPEL UND SIZILIEN

5164

5165

5166



%CTNKPK 2KCUVTC 0GCRGN&CX$2CICPK  4ÒEMUGKVGNGKEJVLWUVKGTVUGJTUEJÌPpXQT\ÒINKEJ





%CTNKPK 2KCUVTC 0GCRGN&CX%2CICPKQ





(GTFKPCPF +8 XQP $QWTDQP   2GTKQFG 2KCUVTC  )TCPC   0GCRGN &CX    2CICPKC 4(CUVXQT\ÒINKEJ

5GJTUEJÌP



5167

5168

5168



(GTFKPCPF+&WECVK0GCRGNI(GKPIQNF(D2CICPKC5EJN )1.&5GJTUEJÌP





(GTFKPCPF++2KCUVTC )TCPC 0GCRGN&CX2CICPKC  2TCEJVGZGORNCT/KPLWUVKGTVHCUV5VGORGNINCP\



5170

5169

5171



)TCPC ,CJTGU\CJNKO5VGORGNCWUIG·PFGTV 0GCRGN2CICPK  (GKPG6ÌPWPIHCUVXQT\ÒINKEJ



)TCPC0GCRGN2CICPK

/KPLWUVKGTVXQT\ÒINKEJ





-W6QTPGUK0GCRGN2CICPK 4   5GJTUGNVGPGT,CJTICPI-N4CPFHGJNGTUEJÌPpUGJTUEJÌP



90




PARMA

5172

5173

5174



)TCPC0GCRGN2CICPK 4 



&WECVK0GCRGNI(GKPIQNF(D2CICPK5EJN  )1.&9KP\4CPFHGJNGTCVVTCMVKXGUXQT\ÒINKEJGU'ZGORNCT





(TCP\++-W6QTPGUK0GCRGN2CICPK



5175

2#&7# 



48QT\ÒINKEJ

8QT\ÒINKEJp5VGORGNINCP\

5176

7NTKEQ FK 8CNUGG  )TQUUQ CSWKNKPQ Q ,  I #FNGT FGP -QRH PCEJ T IGYCPFV.CPI   MTGW\$KCIIK 5GJTUEJÌP

2#4/#

4CPWEEKQ(CTPGUG+5QNFKQ,8CTGUK

5177



445GJTUEJÌPpXQT\ÒINKEJ

 

5178 5177



1FQCTFQ(CTPGUG5EWFQQ,&CX8CTGUK  (GNFGTGVYCUIGIN·VVGVUGJTUEJÌP





(GTFKPCPFQFK$QTDQPG&WECVQ8CTGUK 4   8QPITQ­GT5GNVGPJGKV5EJÌP



 

.KTG8CTGUK &QRRKCI(D8CTGUK

5179

5181

 

5180

45GJTUEJÌPpXQT\ÒINKEJ )1.&5GJTUEJÌP

 

5182

/CTKC.QWKUCYCTFKG)GOCJNKP0CRQNGQPU+

/CTKC .QWKUC   .KTG  /CKNCPF  I (GKPIQNF (D  2CICPK  5EJN    )1.&$GTKGDGPUGJTUEJÌP



.KTG/CKNCPFI(GKPIQNF(D2CICPK5EJN  )1.&9KP\4CPFHGJNGTHCUVXQT\ÒINKEJ

 91


SARDINIEN

5183

5184

5185

5185



.KTG/CKNCPF2CICPK

(GKPG2CVKPCYKP\4CPFHGJNGTUGJTUEJÌPXQT\ÒINKEJ





.KTG/CKNCPFI(GKPIQNF(D2CICPK5EJN  )1.&5GJTUGNVGPGT,CJTICPI-N-TCV\GTUGJTUEJÌP





.KTG/CKNCPF&CX2CICPK



1,5:1

(CUVXQT\ÒINKEJ

5186

1,5:1

2#8+# 

%CTNQ /CIPQ  &GPCTQ  I %#4.854':(4 -TGW\ 2#2+# %CTQNWUOQPQITCOO   $KCIIK/) 48QT\ÒINKEJ 

5188

5187

5189

5187

2+#%'0<# 

1FQCTFQ(CTPGUG5EWFQ&CX8CTGUK

45GJTUEJÌP



2+'/106 

7PVGT0CRQNGQP+XQP(TCPMTGKEJ(TCPEU76WTKPI(GKPIQNF(D

FQTVWPVGT(TCPMTGKEJ )CFQWT[/C\CTF2CICPK5EJN )1.&45GJTUEJÌP



5#4&+0+'0 

92

-CTN'OCPWGN+++<GEEJKPQ6WTKPI%WFC\\QD 4 (D  )1.&444CPFWPF(GNFGTNGKEJVDGCTDGKVGV(CUUWPIUURWTGPHCUVUGJTUEJÌP




SARDINIEN

5190

5191

5191



 5EWFQ PWQXQ  6WTKP  I)GJCTPKUEJVGU$TWUVDKNFNOKVWOIGNGIVGO/CPVGN)GMTÌPVGU 9CRRGP%WFC\\QF 48QT\ÒINKEJ 



5EWFQPWQXQ .KTG 6WTKP%WFC\\QI&CX

4CPFHGJNGTUGJTUEJÌP



5192

5193

5193



8KEVQT#OCFGWU+++&QRRKC6WTKPI%WFC\\Q(D  )1.&4-NGKPG-TCV\GTUGJTUEJÌPXQT\ÒINKEJ



<KPPOGFCKNNG  WPUKIPKGTV CWH FKG KVCNKGPKUEJG -CORCIPG FGU HTCP\ÌUKUEJGP )GPGTCNU 0CRQNGQP   $QPCRCTVG 7PKHQTOKGTVGU $TWUVDKNF 0CRQNGQP $QPCRCTVGU T/KPGTXC OKV <YGKI KP FGT 4GEJVGP UKV\V   PCEJNCWH#TOCVWTGPFGPNKPMGP#TOCWHGKPGP5EJKNFIGNGIVOO5NI,WNKWU  8QT\ÒINKEJ





5194

5195

5195



8KEVQT'OCPWGN+.KTG6WTKPI(GKPIQNF(D2CICPK5EJN )1.&5GJTUEJÌP





5KNDGTOGFCKNNGXQP#.CX[CWHFKG8GTO·JNWPIUGKPGT6QEJVGT/CTKC6JGTGUKCOKV-CTN.WFYKI XQP $QWTDQP $ÒUVGP FGU -ÌPKIURCCTGU PGDGPGKPCPFGT T$TWUVDKNFGT FGU $TCWVRCCTGU GKPCPFGT IGIGP   ÒDGTOOI5NI,WNKWU FQTVKP)QNF 7FK5  448QT\ÒINKEJGU'ZGORNCTOKVUEJÌPGT2CVKPC

 93


SARDINIEN

5197

5196

5196



-CTN(GNKZ.KTG6WTKP&CX2CICPK 4   5GJTUGNVGPGT,CJTICPI#VVTCMVKXGU'ZGORNCTOKVHGKPGT6ÌPWPIXQT\ÒINKEJ





.KTG6WTKPI(GKPIQNF(D2CICPK5EJN )1.&5GJTUEJÌPpXQT\ÒINKEJ



5199

5198



.KTG)GPWC&CX2CICPK 4  5GJTUGNVGPGT,CJTICPI9KP\4CPFHGJNGTUGJTUEJÌP





.KTG6WTKPI(GKPIQNF(D2CICPK5EJN



5200

)1.&(CUVXQT\ÒINKEJ

5201



-W%GPVGUKOK6WTKP2CICPK

9KP\5VGORGNHGJNGTXQT\ÒINKEJ





.KTG6WTKPI(GKPIQNF(D2CICPK5EJN  )1.&-N4CPFHGJNGTUGJTUEJÌP



5202

5203



.KTG6WTKPI(GKPIQNF(D2CICPK5EJN  )1.&2T·IGDGFKPIVG4CPFWPGDGPJGKVGPHCUVXQT\ÒINKEJ





.KTG6WTKP2CICPK 4   5GNVGPGT,CJTICPI-N5EJTÌVNKPIUHGJNGTCWHFGT8QTFGTUGKVGUGJTUEJÌP



94


SARDINIEN

5205

5204

 

.KTG)GPWCI(GKPIQNF(D2CICPK5EJN .KTG)GPWCI(GKPIQNF(D2CICPK5EJN

)1.&5GJTUEJÌP )1.&5GJTUEJÌP

5206

 

5207



.KTG)GPWCI(GKPIQNF(D2CICPK5EJN



.KTG6WTKPI(GKPIQNF(D2CICPK5EJN

)1.&5GJTUEJÌP



 )1.&5GJTUEJÌPpXQT\ÒINKEJ



5208

5209



-CTN#NDGTV.KTG)GPWCI(GKPIQNF(D2CICPK5EJN )1.&5GJTUEJÌP





.KTG6WTKPI(GKPIQNF(D2CICPK5EJN



)1.&5GJTUEJÌP

5210

5211

5211



.KTG)GPWC&CX2CICPK

-TCV\GTCWHFGT8QTFGTUGKVGUGJTUEJÌPXQT\ÒINKEJ





.KTG6WTKPI(GKPIQNF(D2CICPK5EJN  )1.&-N4CPFHGJNGTUGJTUEJÌP



5212

5213



.KTG)GPWCI(GKPIQNF(D2CICPK5EJN  )1.&5GJTUEJÌPpXQT\ÒINKEJ





.KTG6WTKPI(GKPIQNF(D2CICPK5EJN



)1.&5GJTUEJÌP

95


SAVOYEN

5215

5214



.KTG)GPWCI(GKPIQNF(D2CICPK5EJN  )1.&5GNVGPGT,CJTICPI'VYCUDGTKGDGPUGJTUEJÌP





.KTG6WTKPI(GKPIQNF(D2CICPK5EJN  )1.&'VYCUDGTKGDGPUGJTUEJÌP



5218

5216

  

5217

.KTG6WTKP2CICPK 8KEVQT'OCPWGN++.KTG6WTKP2CICPK %GPVGUKOK//CKNCPF2CICPK

1,5:1

5219

44(CUVUGJTUEJÌP 445GJTUEJÌP 8QT\ÒINKEJ

  

1,5:1

5#81;'0 

.WFQXKEQ  &WECVQ Q ,   %QTPCXKP  I &GT IGJCTPKUEJVG WPF DGJGNOVG   *GT\QITGKVGVTOKV5EJYGTVKPFGTGTJQDGPGP4GEJVGP$GJGNOVGU9CRRGP\YKUEJGP('46KP8KGT RC­%WFC\\QC 4 (D5KOQPGVVKC )1.&44-N*GPMGNURWTUGJTUEJÌP 

5220

1,5:1



96

1,5:1

%CTNQ+6GUVQPGQ,%QTPCXKPI$TWUVDKNFTOKVFGT4GEJVGPFCU5EJYGTVUEJWN VGTPF9CRRGP FCTÒDGT 5EJNKPIG \W FGP 5GKVGP KP IQVJKUEJGP $WEJUVCDGP ('  46 WOJGT 8KGTRC­   %WFC\\QE5KOQPGVVKD 44#VVTCMVKXGU'ZGORNCTOKVJÒDUEJGT2CVKPCUGJTUEJÌP 


SIZILIEN

5221

5222

5221



6GUVQPGQ,%QTPCXKP%WFC\\QC5KOQPGVVK

448QTFGTUGKVGUVCTMRQNKGTVHCUVUGJTUEJÌP



5VCFV)TQUUQQ, XQT I5\YKUEJGP&QRRGNRWPMVGP-TGW\$KCIIK

5+'0#

5223

5224

5GJTUEJÌP

 

5225

5+<+.+'0 

(GFGTKEQ++/GJTHCEJGT6CTKF QTQWO/GUUKPCQFGT$TKPFKUKI#FNGT -TGW\\YKUEJGP5EJTKHV(DC5RCJT )1.&5GJTUEJÌP





6CTK F QTQ WO  /GUUKPC QFGT $TKPFKUK  I #FNGT FGP -QRH PCEJ T IGYCPFV-TGW\   WOJGT5EJTKHV(DC5RCJT )1.&5GJTUEJÌPpXQT\ÒINKEJ





/GJTHCEJGT 6CTK F QTQ Q , /GUUKPC QFGT $TKPFKUK  I -TGKU OKV UGEJU -WIGNP-TGW\ XQP   5EJTKHV\GKEJGPWOIGDGPD5RCJT )1.&(CUVXQT\ÒINKEJ



5226

1,5:1



1,5:1

#WIWUVCNKU PCEJ  /GUUKPCI)GJCTPKUEJVGU$TWUVDKNFTOKV.QTDGGTMTCP\WPFWOIGNGIVGO /CPVGN#FNGTFGP-QRHPCEJTIGYCPFV(D FQTVWPVGT$TKPFKUK -QYCNUMK7#  )1.&45GJTCVVTCMVKXGUXQT\ÒINKEJGU'ZGORNCT  +P FGP -QPUVKVWVKQPGP XQP /GNHK  YGTFGP FKG #WIWUVCNGP \WO GTUVGP /CN IGPCPPV +O INGKEJGP ,CJT DGTKEJVGV   FGTMCKUGTNKEJG0QVCT4KEJCTFXQP5CP)GTOCPQKO&G\GODGT0WOOKCWTGKSWKCWIWUVCNGUXQECPVWT$TWPFWUKKGV /GUUKPCEWFWPVWT )QNFOÒP\GPFKG#WIWUVCNGPIGPCPPVYGTFGPUKPFKP$TKPFKUKWPF/GUUKPCIGRT·IVYQTFGP &GT 0COG #WIWUVCNKU HÒT FKGUG CW­GTIGYÌJPNKEJG )QNFOÒP\G KUV CNUQ \GKVIGPÌUUKUEJ WPF QHHK\KGNN CWEJ FKG DGKFGP   /ÒP\UV·VVGP YGTFGP DGPCPPV &KG &CTUVGNNWPI ITGKHV CPVKMG8QTDKNFGTCWHQJPGFC­GKPIGPCWGU/WUVGTUGKGUCWU FGT CWIWUVGKUEJGP QFGT EQPUVCPVKPKUEJGP /ÒP\RT·IWPI \W GTOKVVGNP KUV 8KGNNGKEJV YCT GKP ITQ­GT -COGQ OKV FGO   $KNFFGU-CKUGTU#WIWUVWUFGTUKEJFCOCNUKP#CEJGPDGHCPFWPFFGP(TKGFTKEJ++FQTVIGUGJGPJCDGPFÒTHVGFCU 8QTDKNF&CUINGKEJGIKNVHÒTFKG#FNGT4ÒEMUGKVG&KGUG2T·IWPIURKGIGNVKPCWUFTWEMUXQNNGT9GKUGFCU)GUEJKEJVU XGTUV·PFPKUFGUNGV\VGP5VCWHGTMCKUGTUYKFGTFGTUKEJICP\DGYW­VKPFGT-QPVKPWKV·VFGTTÌOKUEJGP-CKUGTUCJWPF FKG 9GNV FGT #PVKMG PKEJV PWT DGK UGKPGP /ÒP\GP YKGFGT CWHIGITKHHGP JCV 5Q IGUGJGP MCPP OCP (TKGFTKEJ ++   FWTEJCWU CNU 8QTN·WHGT FGT 4GPCKUUCPEG XGTUVGJGP 'U KUV CDGT PKEJV RTQRCICPFKUVKUEJG #DUKEJV FKG \WT *GTUVGNNWPI   FKGUGT GTUVGP DGFGWVGPFGP GWTQR·KUEJGP )QNFRT·IWPI UGKV FGT #PVKMG HÒJTVG UQPFGTP YKTVUEJCHVNKEJG 0QVYGPFKIMGKV   #WHUGKPGT,GTWUCNGO4GKUGJCVVGFGT-CKUGTFKG)QNFY·JTWPIFGT$[\CPVKPGTKP)GUVCNVFGT*[RGTR[TCWPFFKG &KPCTGFGTKUNCOKUEJGP&[PCUVKGPMGPPGPIGNGTPV<WTÒEMIGMGJTVQTFPGVGGTFKG2T·IWPIFGTPGWGP)QNFOÒP\GPCP FKGGKPPGWGU<GKVCNVGTFGT)QNFY·JTWPIGKPNGKVGPUQNNVGWPFUR·VGTKJTGP*ÌJGRWPMVKPFGP)QNFOÒP\GPXQP(NQTGP\ WPF8GPGFKIHCPF

5227



#WIWUVCNKU PCEJ  /GUUKPCI)GJCTPKUEJVGU$TWUVDKNFTOKV.QTDGGTMTCP\WPFWOIGNGIVGO /CPVGN#FNGTFGP-QRHPCEJTIGYCPFV(D FQTVWPVGT$TKPFKUK -QYCNUMK9#  )1.&4-N-TCV\GTKPFGP(GNFGTPUGJTUEJÌP  97


SIZILIEN

5229

 

5228

5229

%CTNQ86CTK/GUUKPC8CTGUK 6CTK/GUUKPC8CTGUK

5GJTUEJÌP 5GJTUEJÌPpXQT\ÒINKEJ

5230

 

5231



(KNKRRQ++6CTK;//GUUKPC8CTGUK

5GJTUEJÌP





-CTN+++XQP¤UVGTTGKEJ6CTK2CNGTOQ8CTGUK  4(GKPG6ÌPWPIUGJTUEJÌPpXQT\ÒINKEJ



5232

5233

5234

5235



6CTK2CNGTOQ8CTGUK

5GJTUEJÌP





-CTNXQP$QWTDQP1PEKCF QTQ2CNGTOQI(D8CTGUK  )1.&5GJTUEJÌP



 

1PEKCF QTQ2CNGTOQI(D8CTGUK &QRRKC1PEKC2CNGTOQI(D8CTGUK

)1.&5GJTUEJÌP )1.&45VCTMLWUVKGTVUGJTUEJÌP

'ZGORNCTFGT#WMVKQP/ÒP\GPWPF/GFCKNNGP#)$CUGN0T

 

5237

5236

  98

5236

(GTFKPCPF+++1PEKC 6CTK 2CNGTOQI)GJCTPKUEJVGU$TWUVDKNFTFCT WPVGT9GTVCPICDG&GTCWUFGT#UEJGYKGFGTIGDQTGPGO[VJQNQIKUEJG8QIGN2JÌPKZQDGPTUVTCJNGPFG 5QPPG&CX8CTGUK 445GJTUEJÌP  -W)TCPK2CNGTOQ2CICPK -N5EJTÌVNKPIUpWPF5VGORGNHGJNGTUGJTUEJÌPpXQT\ÒINKEJ 


TOSCANA

5239

5238



5238

57$#.2+0'4'27$.+-

(TCPEU#0  6WTKP&CX2CICPK

5GJTUEJÌP



8KQNCPVG&QTKC.QOGNNKPK.WKIKPQ%COOCTCPQ 4 8CTGUKXCT 4   48QT\ÒINKEJ



6144+).+# 

5240

5241

615%#0# 

#NGUUCPFTQ  5EWFQ F QTQ Q ,   (NQTGP\  I )GMTÌPVGU 9CRRGP4GKEJ   XGT\KGTVGU-TGW\KPFGP9KPMGNPLGGKP&KCOCPVTKPI(D)CNGQVVK::+  )1.&4#VVTCMVKXGUHCUVXQT\ÒINKEJGU'ZGORNCT 



%QUKOQ + /GFKEK  CNU *GT\QI XQP (NQTGP\  5EWFQ F QTQ Q ,     (NQTGP\I)GMTÌPVGU9CRRGP4GKEJXGT\KGTVGU-TGW\(D)CNGQVVK8  )1.&4(CUVUGJTUEJÌP



5243

5242



6GUVQPGQ,(NQTGP\)CNGQVVK XIN:+8WPF:8 



%QUKOQ+/GFKEKCNU*GT\QIXQP(NQTGP\WPF5KGPC)KWNKQ(NQTGP\ )CNGQVVK:.+: -PCRRGT5EJTÌVNKPIUGJTUEJÌP

445EJÌP

 

5244



(TCPEGUEQ+/GFKEK2KCUVTC(NQTGP\I)GJCTPKUEJVGU$TWUVDKNFTOKVWOIG NGIVGO /CPVGN5V ,QJCPPGU UVGJV X X KP .CPFUEJCHV KP FGT .KPMGP -TGW\UVCD FKG 4GEJVG GTJQDGP   &CX)CNGQVVK8+++XCT 44/KP<CKPGPFGCVVTCMVKXGUUGJTUEJÌPGU'ZGORNCT  99


TOSCANA

5246

5245

5245



2KCUVTC  ,CJTGU\CJN KO 5VGORGN XGTOWVNKEJ CWU  IG·PFGTV  (NQTGP\  I )GJCTPKUEJVGU   $TWUVDKNF T5V ,QJCPPGU OKV GTJQDGPGT 4GEJVGP WPF -TGW\UVCD KP FGT .KPMGP UVGJV X X KP .CPF   UEJCHV&CX)CNGQVVK8+++ 4#VVTCMVKXGUHCUVXQT\ÒINKEJGU'ZGORNCTOKVHGKPGT2CVKPC 



6GUVQPG(NQTGP\)CNGQVVK:+++

5GJTUEJÌPGU'ZGORNCTOKVUEJÌPGT6ÌPWPI



5247

1,5:1

1,5:1



(GTFKPCPFQ+/GFKEK-CTFKPCN2KCUVTC(NQTGP\I)GJCTPKUEJ VGU$TWUVDKNFTOKVWOIGNGIVGO/CPVGN&KG6CWHG%JTKUVK&CX)CNGQVVK::8++  8QPITQ­GT5GNVGPJGKV5GJTCVVTCMVKXGUHCUVXQT\ÒINKEJGU'ZGORNCTOKVUEJÌPGT2CVKPC 

5248

 100

6CNNGTQ2KUC&CX)CNGQVVK.:++

44CPFHGJNGTUGJTUEJÌP




TOSCANA

5251

5249

5250



%QUKOQ++/GFKEK2KCUVTC(NQTGP\&CX)CNGQVVK:  44)GTKPIGTJCNVGPpUEJÌP





6CNNGTQ2KUC&CX)CNGQVVK:::+





%TKUVKPCFK.QTGPC&WECVQPG(NQTGP\I8GTUEJNGKGTVGU$TWUVDKNFT)GMTÌPVGU 9CRRGP)CNGQVVK:::+: 8QPITQ­GT5GNVGPJGKV(CUVUGJTUEJÌPUGJTUEJÌP

5252

5253

4(CUUWPIUURWTGPHCUVUGJTUEJÌP



5254



(GTFKPCPFQ++/GFKEK2KCUVTC(NQTGP\&CX)CNGQVVK:+ (CUVXQT\ÒINKEJ





6GUVQPG(NQTGP\)CNGQVVK:8++

5GJTUEJÌPGU'ZGORNCTOKVUEJÌPGT2CVKPC





6QNNGTQ.KXQTPQ&CX)CNGQVVK.  5GJTUGNVGPGT,CJTICPI-NGKPGT5EJTÌVNKPIUHGJNGTUGJTUEJÌP

 101


TOSCANA

5255

5256

5256



2G\\CFGNNC4QUC.KXQTPQ)CNGQVVK.+++NGKEJVXCT 8QPITQ­GT5GNVGPJGKV5EJÌPpUGJTUEJÌP





6QNNGTQ.KXQTPQ&CX)CNGQVVK.



5257

44(CUVUGJTUEJÌP

5259

5258



%QUKOQ+++/GFKEK2KCUVTC(NQTGP\&CX)CNGQVVK8++XCT  7PDGFGWVGPFG*GPMGNURWTUGJTUEJÌP





2KCUVTC(NQTGP\&CX)CNGQVVK+: #VVTCMVKXGUXQT\ÒINKEJGU'ZGORNCTOKVHGKPGT2CVKPC





6QNNGTQ.KXQTPQ)CNGQVVK.

4-N4CPFHGJNGTHCUVUGJTUEJÌP



(GNFGTOKPDGTKGDGPUGJTUEJÌP



5260

 102

2KCUVTC(NQTGP\&CX)CNGQVVK:


TOSCANA

5261

5262

5263



6QNNGTQ.KXQTPQ&CX)CNGQVVK:.8



6QNNGTQ.KXQTPQ&CX)CNGQVVK:.8++  /KP$GCTDGKVWPIUURWTGPCWHFGT8QTFGTUGKVGUGJTUEJÌPpXQT\ÒINKEJ

5GNVGPGT,CJTICPI5GJTUEJÌP





6QNNGTQ.KXQTPQ&CX)CNGQVVK:.8++



(GNFGTNGKEJVDGCTDGKVGVUGJTUEJÌP

5265

5264

5267



5266

5267



(TCPEGUEQ++ +++ FK.QTGPC(TCPEGUEQPG 2CQNK (NQTGP\)CNGQVVK8+  5GJTUEJÌP





6CNNGTQ+<8(NQTGP\&CX FQTV/ÒP\UV·VVG9KGP )CNGQVVK:+:  5GJTUGNVGPKPFKGUGT'TJCNVWPI-N2T·IGUEJY·EJGXQT\ÒINKEJ





2KGVTQ .GQRQNFQ FK .QTGPC  (TCPEGUEQPG  2CQNK   (NQTGP\ &CX  )CNGQVVK   :++ 5GJTUEJÌP





&QRRKQ2CQNQ(NQTGP\)CNGQVVK:8++



8QT\ÒINKEJ

103


TOSCANA

ex 5268

5269

5270



6CNNGTQ(NQTGP\&CX)CNGQVVK+:8+++  5VÒEM(CUVUGJTUEJÌPWPFUGJTUEJÌP





(TCPEGUEQPG 2CQNK (NQTGP\&CX)CNGQVVK::8+





.QFQXKEQ + FK $QTDQPG -ÌPKI XQP 6QUECPC  4WURQPG  <GEEJKPK   (NQTGP\   I(GKPIQNF(D2CICPK5EJN  )1.&4-N2T·IGUEJY·EJGPCO4CPFHCUVXQT\ÒINKEJ 

5271

5272

45GJTUEJÌP

5273



(TCPEGUEQPG 2CQNK (NQTGP\&CX2CICPKC

#VVTCMVKXGUHCUVXQT\ÒINKEJGU'ZGORNCT





(TCPEGUEQPG 2CQNK (NQTGP\&CX2CICPKG

5GJTUEJÌP





%CTNQ .WFQXKEQ FK $QTDQPG -ÌPKI XQP 6QUECPC WPF UGKPG /WVVGT /CTKC .WKIKC     (TCPEGUEQPG &GPC (NQTGP\&CX2CICPK  #VVTCMVKXGU'ZGORNCTOKVHGKPGT6ÌPWPIXQT\ÒINKEJp5VGORGNINCP\ 

104


TOSCANA

5275

5274

5276



(TCPEGUEQPG 2CQNK (NQTGP\&CX2CICPK  -N$GCTDGKVWPIUUVGNNGPKO4CPFDGTGKEJXQT\ÒINKEJ



(GTFKPCPFQ +++ FK .QTGPC  4GIKGTWPIU\GKV  (TCPEGUEQPG  2CQNK   (NQTGP\   &CX2CICPK 4.GKEJVLWUVKGTVXQT\ÒINKEJp5VGORGNINCP\ 



(TCPEGUEQPG 2CQNK (NQTGP\&CX2CICPK

5EJÌPG6ÌPWPIUGJTUEJÌP





5278

5277

5277



(TCPEGUEQPG 2CQNK (NQTGP\&CX2CICPK  44#VVTCMVKXGUHCUVXQT\ÒINKEJGU'ZGORNCTOKVHGKPGT6ÌPWPI



.GQRQNFQ ++ FK .QTGPC  4WURQPG  (NQTGP\  I (GKPIQNF (D  2CICPK    5EJN )1.&4+O4CPFDGTGKEJGVYCUDGCTDGKVGVUGJTUEJÌPpXQT\ÒINKEJ 



5280 5279

5279



(TCPEGUEQPG 2CQNK (NQTGP\&CX2CICPK  44(GKPG6ÌPWPIYKP\5EJTÌVNKPIUHGJNGTUGJTUEJÌPpXQT\ÒINKEJ



(KQTKPQ 3WCVVTKPK (NQTGP\2CICPK

(GKPG6ÌPWPIUGJTUEJÌPpXQT\ÒINKEJ

  105


TOSCANA

5281

5282



(KQTKPK 2CQNK (NQTGP\I(GKPIQNF(D2CICPK 4 5EJN  )1.&4-N4CPFHGJNGTXQT\ÒINKEJGU'ZGORNCT





(KQTKPK 2CQNK (NQTGP\I(GKPIQNF(D2CICPK5EJN  )1.&4-N$GCTDGKVWPIUUVGNNGCO4CPFUGJTUEJÌPpXQT\ÒINKEJ



5283

5284

5284



<GEEJKPQ(NQTGP\I(GKPIQNF(D2CICPK5EJN  )1.&4/KPIGYGNNVXQT\ÒINKEJ





(TCPEGUEQPG 2CQNK (NQTGP\&CX2CICPK



5286

442T·IGUEJY·EJGUGJTUEJÌP

5287

5285

5288

5285



3WCVVTKPK(NQTGP\2CICPK

(CUV5VGORGNINCP\





(TCPEGUEQPG 2CQNK (NQTGP\&CX2CICPK  (GKPG2CVKPCNGKEJVLWUVKGTVUGJTUEJÌPpXQT\ÒINKEJ





(TCPEGUEQPG 2CQNK (NQTGP\&CX2CICPK  2TCEJVGZGORNCTOKVHGKPGT6ÌPWPI5VGORGNINCP\





(TCPEGUEQPG 2CQNK (NQTGP\&CX2CICPK  #VVTCMVKXGUXQT\ÒINKEJGU'ZGORNCTOKVHGKPGT6ÌPWPI



106


VENEDIG

5289

5291

5290



(TCPEGUEQPG 2CQNK (NQTGP\&CX2CICPK

.GKEJVIGTGKPKIVXQT\ÒINKEJ





(TCPEGUEQPG 2CQNK (NQTGP\&CX2CICPK

(GNFGTNGKEJVDGTKGDGPHCUVXQT\ÒINKEJ





(TCPEGUEQPG 2CQNK (NQTGP\&CX2CICPK

'VYCUHNGEMKIUGJTUEJÌPpXQT\ÒINKEJ



5293

5292

1,5:1

1,5:1

1,5:1

1,5:1

64+'06 

0KEQNQFC$TWPC3WCTVQI$TWUVDKNFFGU$KUEJQHUXX#FNGTXXFGP-QRHPCEJ NIGYCPFV$KCIIK 448QTFGTUGKVGGVYCUFG\GPVTKGTVUGJTUEJÌPpXQT\ÒINKEJ





&GPCTQI$TWUVDKNFFGU$KUEJQHUXX#FNGTXXFGP-QRHPCEJNIGYCPFV$KCIIK  445GJTUEJÌP



5294

5295

5296



2KGVTQ 8KIKNKQ  5KNDGTCDUEJNCI XQP FGP 5VGORGNP FGU &WMCVGP  CWH UGKPG 9CJN \WO   $KUEJQH%0+8+5 /KPLWUVKGTVXQT\ÒINKEJ



(TCPEGUEQ/CTKC++FGNNC4QXGTG)TQUUQFKOQFWNQNCTIQQ,7TDKPQ%CXKEEJK  5GJTUEJÌP



.WFQXKEQ KN 2KQ  &GPCTQ  I -TGW\ KP -TGKU WOJGT 5EJTKHV 8'0  '%+#5 )CO   DGTKPK/) -N2T·IGUEJY·EJGUGJTUEJÌPpXQT\ÒINKEJ



74$+01 

8'0'&+)  107


VENEDIG

1,5:1

5297

5298

1,5:1



&GPCTQI-TGW\KP-TGKUWOJGT5EJTKHV 8'0'%+#5)CODGTKPK/) 5GJTUEJÌP





8KVCNG ++ /KEJKGN  &GPCTQ UEQFGNNCVQ  I  /+%*+. &8: -TGW\ GKPG -WIGN KP   LGFGO9KPMGN 5/#4%8580#$TWUVDKNFXX$KCIIK 4 )CODGTKPK 4   8QPITÌ­VGT5GNVGPJGKV5GJTUEJÌP



$GKFKGUGO·W­GTUVUGNVGPGP&GPCTJCPFGNVGUUKEJWOFKGGTUVGXGPG\KCPKUEJG/ÒP\GOKVFGO0COGPGKPGU&QIGP )CODGTKPKFGTPWTQFGT'ZGORNCTGMCPPVGWPFKJOHQNIGPF$KCIIKDG\GKEJPGVGPFCU5VÒEMCNUJCNDGP&GPCT

5299

5300

5301



5GDCUVKCPQ<KCPK&GPCTQUEQFGNNCVQI$KCIIK 4 )CODGTKPK 4   45GJTUEJÌP





'PTKEQ&CPFQNQ)TQUUQQ,I$KCIIK 4 )CODGTKPK 4   444GRCTKGTVGT4CPFCWUDTWEJUGJTUEJÌP





,CEQRQ6KGRQNQ)TQUUQQ,I$KCIIK)CODGTKPK

5302

5303

5304

5GJTUEJÌP

5305



5306

   

/CTKPQ/QTQUKPK)TQUUQQ,I$KCIIK 4 )CODGTKPK 4  45GJTUEJÌP 4CPKGTK<GPQ)TQUUQQ,I$KCIIK)CODGTKPK 5GJTUEJÌPpXQT\ÒINKEJ .QTGP\Q6KGRQNQ)TQUUQQ,I$KCIIK)CODGTKPK 5GJTUEJÌP )TQUUQQ,I$KCIIK%0+8++5)CODGTKPK 8QPITQ­GT5GNVGPJGKV5GJTUEJÌP

   



)TQUUQQ,I$KCIIK%0+8++5)CODGTKPK  8QPITQ­GT5GNVGPJGKV5EJYCEJCWUIGRT·IVUGJTUEJÌP



5307

5308

5311

5309

5310

  

,CEQRQ%QPVCTKPK)TQUUQQ,I$KCIIK)CODGTKPK 5GJTUEJÌPpXQT\ÒINKEJ )KQXCPPK&CPFQNQ)TQUUQQ,I$KCIIK)CODGTKPK 5GJTUEJÌP 2KGVTQ)TCFGPKIQ)TQUUQQ,I$KCIIK)CODGTKPK 5GJTUEJÌPpXQT\ÒINKEJ

  



/CTKPQ<QT\K)TQUUQQ,I$KCIIK 4 )CODGTKPK 4   445GJTUEJÌP





)KQXCPPK5QTCP\Q&WECVQQ,I(D)CODGTKPK  )1.&4)GTGKPKIVHCUVUGJTUEJÌP



108


VENEDIG

5313

5312

5314



)TQUUQQ,I$KCIIK)CODGTKPK

5GJTUEJÌPpXQT\ÒINKEJ





(TCPEGUEQ&CPFQNQ)TQUUQQ,I$KCIIK 4 )CODGTKPK 4   5GJTUEJÌP





$CTVQNQOGQ)TCFGPKIQ)TQUUQQ,I$KCIIK 4 )CODGTKPK 4   5GJTUEJÌP



5315

5316

5317

5318

5319

   

#PFTGC&CPFQNQ&WECVQQ,I(D)CODGTKPK )1.&8QT\ÒINKEJ &WECVQQ,I(D)CODGTKPK )1.&5GJTUEJÌPpXQT\ÒINKEJ &WECVQQ,I(D)CODGTKPK )1.&5GJTUEJÌP &WECVQQ,I(D)CODGTKPK )1.&5GJTUEJÌP

   



)KQXCPPK&QNHKP&WECVQQ,I(D)CODGTKPK  )1.&45GJTUEJÌPpXQT\ÒINKEJ



5320

    

5321

5323

5322

5324

&WECVQQ,I(D)CODGTKPK )1.&45GJTUEJÌP .QTGP\Q%GNUK&WECVQQ,I(D)CODGTKPK )1.&48QT\ÒINKEJ &WECVQQ,I(D)CODGTKPK )1.&4-TCV\GTCWHFGT8QTFGTUGKVGHCUVXQT\ÒINKEJ 5QNFKPQQ,I$KCIIK)CODGTKPK 5GJTUEJÌPpXQT\ÒINKEJ /CTEQ%QTPGT&WECVQQ,I(D)CODGTKPK )1.&5GJTUEJÌP

5325

5327

    

5326



/KEJGNG/QTQUKPK5QNFKPQQ,I$KCIIK 4 )CODGTKPK 4   445GJTUEJÌPpXQT\ÒINKEJ



6QTPGUGNNQQ,I$KCIIK 4 )CODGTKPK 4 

44(CUVUGJTUEJÌP





#PVQPKQ8GPKGT&WECVQQ,I(D)CODGTKPK  )1.&9KP\4CPFHGJNGTXQT\ÒINKEJ





109


VENEDIG

5328

5329

5330

5332

5331



&WECVQQ,I(D)CODGTKPK

)1.&(CUVXQT\ÒINKEJ





&WECVQQ,I(D)CODGTKPK

)1.&'VYCU$GNCIUGJTUEJÌPpXQT\ÒINKEJ





&WECVQQ,I(D)CODGTKPK

)1.&5GJTUEJÌP





)TQUUQQ, WO /ÒP\OGKUVGT2KGVTQ8KCTQI$KCIIK)CODGTKPK

5GJTUEJÌP





)TQUUQQ,I$KCIIK 4 )CODGTKPK

5GJTUEJÌP



5333

5334

5335

5337

5336



/KEJGNG5VGPQ&WECVQQ,I(D)CODGTKPK

)1.&8QT\ÒINKEJ





&WECVQQ,I(D)CODGTKPK

)1.&8QT\ÒINKEJ





6QOCUQ/QEGPKIQ&WECVQQ,I(D)CODGTKPK

)1.&8QT\ÒINKEJ





&WECVQQ,I(D)CODGTKPK

)1.&5GJTUEJÌP





(TCPEGUEQ(QUECTK&WECVQQ,I(D)CODGTKPK

)1.&8QT\ÒINKEJ



5338

5340



&WECVQQ,I(D)CODGTKPK



)TQUUQPGFC5QNFKQ,I)CODGTKPK

5339

5341

5342

)1.&5GJTUEJÌP



44<WO6GKNUEJYCEJCWUIGRT·IVUGJTUEJÌP





2CUSWCNG/CNKRKGTQ&WECVQQ,I(D)CODGTKPK  )1.&5GJTUEJÌPpXQT\ÒINKEJ





&WECVQQ,I(D)CODGTKPK

)1.&5GJTUEJÌP





&WECVQQ,I(D)CODGTKPK

)1.&5GJTUEJÌP



110


VENEDIG

5344

5343

5345

5347

5346



%TKUVQHQTQ/QTQ&WECVQQ,I(D)CODGTKPK  )1.&5GJTUEJÌPpXQT\ÒINKEJ





&WECVQQ,I(D)CODGTKPK





0KEQNQ6TQP6TQPQ .KTC\W5QNFK Q,OKVUGEJU)GIGPUVGORGNPXQP<[RGTPI )CODGTKPK 445EJÌPpUGJTUEJÌP

)1.&5EJTÌVNKPIUTK­HCUVUGJTUEJÌP



#WH<[RGTPYWTFGPMGKPGGKIGPGP/ÒP\GPIGRT·IV0CEJFGT#DFCPMWPIFGTNGV\VGP-ÌPKIKP%CVJGTKPG%QTPGTCWU FGT(COKNKG.WUKIPCPDGJGTTUEJVGPFKG8GPG\KCPGTDKUFKG+PUGN(WPFGJCDGPIG\GKIVFC­QHHGPUKEJVNKEJ CNVGU WPF UEJNGEJV IGRT·IVGU XGPG\KCPKUEJGU )GNF PCEJ <[RGTP IGDTCEJV WPF FQTV HÒT FGP 7ONCWH IGIGPIGUVGORGNV   YWTFG &KG )GIGPUVGORGN \GKIGP YKG CWH FGO XQTNKGIGPFGP 5VÒEM \W GTMGPPGP KP FGT 4GIGN GKP ITQ­GU : QFGT   GKPGP2WPMVKO4KPIGN XIN2CQNWEEK++0T5 



$CICVVKPQ )TQUUQ Q,I)CODGTKPK



0KEQNQ /CTEGNNQ  /CTEGNNQ Q , WO   /ÒP\OGKUVGT $QTVQNQOKQ &QP¯  I   )CODGTKPK 5GJTUEJÌP

5348

5GJTUEJÌP

1,5:1



#PFTGC 8GPFTCOKP  /CTEGNNQ Q , WO   /ÒP\OGKUVGT 2KGTQ /CNKRKGTQ  I   )CODGTKPK 5GJTUEJÌP



)KQXCPPK/QEGPKIQ&WECVQQ,I(D)CODGTKPK  )1.&45GJTCVVTCMVKXGUUEJCTHCWUIGRT·IVGU'ZGORNCTXQT\ÒINKEJ



/CTEQ $CTDCTKIQ  /CTEGNNQ Q , WO   /ÒP\OGKUVGT #NXKUG .QTGFCP  I   )CODGTKPK 45GJTUEJÌP

5351



5350

5349

1,5:1



  

5353

5352



#IQUVKPQ$CTDCTKIQ&WECVQQ,I(D)CODGTKPK

)1.&8QT\ÒINKEJ



 

&WECVQQ,I(D)CODGTKPK

)1.&(CUVXQT\ÒINKEJ



&WECVQQ,I(D)CODGTKPK

)1.&5GJTUEJÌP

 111


VENEDIG

5355

5354

5354



/QEGPKIQQ, WO /ÒP\OGKUVGT<CP#NXKUG2KUCPKI)CODGTKPK

5GJTUEJÌP





/CTEGNNQQ, WO /ÒP\OGKUVGT<CP(TCPEGUEQ6TGXKUCPI)CODGTKPK

5GJTUEJÌP





.GQPCTFQ.QTGFCP&WECVQQ,I(D)CODGTKPK  )1.&9KP\&TWEMUVGNNGUGJTUEJÌPpXQT\ÒINKEJ





&QRRKQ$CICVVKPQQ,)CODGTKPK 4 



#PVQPKQ)TKOCPK5QNFKQ, WO /ÒP\OGKUVGT8KPEGP\Q1TKQ)CODGTKPK 4  45GJTUEJÌP

5357 5356

5359

5358

5360

445EJÌPpUGJTUEJÌP

5361

 

5362



5QNFKQ, WO /ÒP\OGKUVGT8KPEGP\Q1TKQ)CODGTKPK 4 

5GJTUEJÌP





5QNFKQ, WO /ÒP\OGKUVGT8KPEGP\Q1TKQ)CODGTKPK 4 

45GJTUEJÌP





#PFTGC)TKVVK5EWFQF QTQQ,I(D)CODGTKPK

)1.&5GJTUEJÌP





5EWFQF QTQQ,I(D)CODGTKPK  )1.&4-N5EJTÌVNKPIUHGJNGTCO4CPFUGJTUEJÌP



5363



/QEGPKIQQ, WO /ÒP\OGKUVGT2KGTQ.QTGFCP)CODGTKPK



/QEGPKIQQ, WO /ÒP\OGKUVGT(TCPEGUEQ'TK\\Q)CODGTKPK

112

5364

5GJTUEJÌP



5GJTUEJÌP




VENEDIG

5366

5365

 

/QEGPKIQQ, WO /ÒP\OGKUVGT4W\KGT%QPVCTKPK)CODGTKPK /CTEGNNQQ, WO /ÒP\OGKUVGT$GTPCTFKPQFC%CPCN)CODGTKPK

5367

5369

5GJTUEJÌP 5GJTUEJÌP

 

5368

5370

5370

  

2KGVTQ.CPFQ&WECVQQ,I(D)CODGTKPK &WECVQQ,I(D)CODGTKPK 5EWFQF QTQQ,I(D)CODGTKPK 4 

)1.&5GJTUEJÌP )1.&5GJTUEJÌP )1.&5GJTUEJÌP

  



/QEGPKIQ 5QNFK Q, WO /ÒP\OGKUVGT8GVVQT5CNCOQP)CODGTKPK  4(GKPG6ÌPWPIUGJTUEJÌP



5372

5371

5373

5374

5375



/CTECPVQPKQ6TGXKUCPK<GEEJKPQQ,I(D)CODGTKPK 4   )1.&445GJTUEJÌP



 

<GEEJKPQQ,I(D)CODGTKPK 4  <GEEJKPQQ,I(D)CODGTKPK 4 

)1.&445GJTUEJÌP )1.&449KP\-TCV\GTUGJTUEJÌP

 



(TCPEGUEQ&QPCVQ<GEEJKPQQ,I(D)CODGTKPK  )1.&45GJTUEJÌP





<GEEJKPQQ,I(D)CODGTKPK



5376

  

)1.&45GJTUEJÌP

5377

5378

(TCPEGUEQ8GPKGT<GEEJKPQQ,I(D)CODGTKPK )1.&8QT\ÒINKEJ .QTGP\Q2TKWNK<GEEJKPQQ,I(D)CODGTKPK )1.&8QT\ÒINKEJ <GEEJKPQQ,I(D)CODGTKPK )1.&5GJTUEJÌPpXQT\ÒINKEJ

   113


VENEDIG

5379

5380

5381



#NXKUG + /QEGPKIQ  &WECVQ Q ,  I /KV LG  5VGTPGP CWH FGT 4ÒEMUGKVG (D    )CODGTKPK )1.&(CUVUGJTUEJÌP





5QNFK 5CPVC)KWUVKPC Q, WO /ÒP\OGKUVGT/CTKP5CPWFQ)CODGTKPK

5GJTUEJÌP





5QNFK 5CPVC)KWUVKPC Q, WO /ÒP\OGKUVGT/CTEQ%QTPGT)CODGTKPK  (GKPG6ÌPWPIUGJTUEJÌP



5382

5383



1UGNNC#001+)CODGTKPK2CQNWEEK 4 

445GJTUEJÌPGU'ZGORNCT





1UGNNC#001++CWHFGP5KGIÒDGTFKG6ÒTMGPDGK.GRCPVQ)CODGTKPK2CQNWEEK 4   8QPITQ­GT5GNVGPJGKV)GUVQRHVGU.QEJUGJTUEJÌP



5384

5385

5385



5GDCUVKCPQ8GPKGT<GEEJKPQQ,I(D)CODGTKPK  )1.&44#VVTCMVKXGUHCUVXQT\ÒINKEJGU'ZGORNCT





5QNFKQ,  /ÒP\OGKUVGT(GNKEG$QP)CODGTKPK 4 



5386

4(CUVUGJTUEJÌP

5387



0KEQNQFC2QPVG5EWFQFGNNCETQEG 5QNFK Q, WO /ÒP\OGKUVGT#PFTGC &QNHKPQFGT#PFTGC&KGFQ&CX)CODGTKPK (CUVUGJTUEJÌP





5EWFQ 5QNFK Q,)CODGTKPK 4 



114

45GJTUEJÌP


VENEDIG

5389

5388



5EWFQ 5QNFK Q, WO /ÒP\OGKUVGT#PFTGC/QTQUKPK)CODGTKPK 4   45GJTUEJÌP



5QNFK 5CPVC)KWUVKPC Q, WO /ÒP\OGKUVGT)GTQNCOQ/QTQUKPK)CODGTKPK

 5GJTUEJÌP

 

ex 5391

5390





5390

$TQP\GOGFCKNNG  WPUKIPKGTV CWH FKG ªDGTHÒJTWPI FGT )GDGKPG FGU *GKNKIGP 5VGRJCP KP FKG PGW   GTDCWVG -KTEJG 5CP )KQTIKQ /CIIKQTG 5KGDGP <GKNGP 5EJTKHV5GEJU <GKNGP 5EJTKHV  OO 8QNVQ   NKPC 5GJTUEJÌP



2CUSWCNG%KEQIPC<GEEJKPQQ,IWPFI(D Z )CODGTKPK Z  8CTKCPVGP)1.&(CUVUGJTUEJÌP



5393

5392



5EWFQ  5QNFK  Q , WO   /ÒP\OGKUVGT &QOGPGIQ .QODCTFQ &CX  )CODGTKPK   

4  -N-TCV\GTUGJTUEJÌP





&WECVQ  5QNFK  Q , 8CTKCPVG OKV )CNGGTGP KO *KPVGTITWPF FGT 4ÒEMUGKVG &CX    )CODGTKPK 4  5GJTUEJÌP



5394

5395

5394



5QNFK 5CPVC)KWUVKPC Q, WO /ÒP\OGKUVGT/CTEQ&QNHKP)CODGTKPK 4   44/KPIGIN·VVGVUGJTUEJÌP





5QNFKQ, WO /ÒP\OGKUVGT/CTEQ&QNHKP)CODGTKPK



5GJTUEJÌP

115


VENEDIG

5397

5396





5396

$TQP\GOGFCKNNG  WPUKIPKGTV CWH FGP $CW FGT (GUVWPI 2CNOC 0QXC \WT 8GTVGKFKIWPI IGIGP FKG   6ÒTMGP)GHNÒIGNVGT.ÌYGNOKV5EJYGTV-TGW\ÒDGTFGT#PUKEJVFGT(GUVWPIOO#VVYQQFC 8QNVQNKPC 8QT\ÒINKEJ



/CTKPQ)TKOCPK<GEEJKPQQ,I(D)CODGTKPK  )1.&45GJTUEJÌP



5398

5400

5399



5EWFQ FGNNC ETQEG  5QNFK  Q , WO   /ÒP\OGKUVGT 5GDCUVKCPQ /CTEGNNQ &CX  )CO   DGTKPK 4  4'VYCUMQTTQFKGTVUGJTUEJÌP



 

&WECVQ 5QNFK Q,&CX)CODGTKPK 4  4(CUUWPIUURWTGPHCUVUGJTUEJÌP 5QNFKQ, WO /ÒP\OGKUVGT2QNQ/CTEGNNQ)CODGTKPK 4  45GJTUEJÌP

 

5401

5402

5402



.GQPCTFQ&QPCVQ<GEEJKPQQ,I(D)CODGTKPK )1.&45GJTUEJÌP





5EWFQFGNNCETQEG 5QNFK Q, WO /ÒP\OGKUVGT%QUVCPVKP<QT\K&CX)CODGTKPK 45GJTUEJÌP



116


VENEDIG

5403

5405

5404



5EWFQFGNNCETQEG 5QNFK Q, WO /ÒP\OGKUVGT%QUVCPVKP<QT\K&CX)CODGTKPK 4  45GJTUEJÌP





)KQXCPPK $GODQ  5EWFQ FGNNC ETQEG  5QNFK  Q , WO   /ÒP\OGKUVGT.GQPCTFQ 8GPFTCOKP&CX)CODGTKPK 5GJTUEJÌP





5EWFQ FGNNC ETQEG  5QNFK  Q , WO   /ÒP\OGKUVGT .GQPCTFQ 8GPFTCOKP &CX  )CO   DGTKPK 5GJTUEJÌP



5408

5406

5407

5409



#PVQPKQ2TKWNK<GEEJKPQQ,I(D)CODGTKPK

)1.&45GJTUEJÌP





<GEEJKPQQ,I(D)CODGTKPK

)1.&45GJTUEJÌP





5EWFQFGNNCETQEG 5QNFK Q, WO /ÒP\OGKUVGT8KEGP\Q%QTTGT&CX)CODGTKPK 5GJTUEJÌP





&WECVQ 5QNFK Q,&CX)CODGTKPK  #VVTCMVKXGU'ZGORNCTOKVJÒDUEJGT2CVKPCUGJTUEJÌP

 117


VENEDIG

5410

5412

5411



&WECVQ 5QNFK Q,&CX)CODGTKPK

4(GNFGTIGIN·VVGVUGJTUEJÌP





5EWFQFGNNCETQEG 5QNFK Q, WO /ÒP\OGKUVGT)KCEQOQ4GPKGT)CODGTKPK  5GJTUEJÌP





(TCPEGUEQ%QPVCTKPK5EWFQFGNNCETQEG 5QNFK Q, WO /ÒP\OGKUVGT<WCPG &QNHKP&CX)CODGTKPK 4  5GJTUEJÌP



5415

5413

5416

5414

5416



5EWFQ FGNNC ETQEG  5QNFK  Q , WO   /ÒP\OGKUVGT (GTKIQ FC /QNKP &CX    )CODGTKPK 4  5GJTUEJÌP





)KQXCPPK+%QTPGT5EWFQFGNNCETQEG 5QNFK Q, WO /ÒP\OGKUVGT(GTKIQFC /QNKP&CX)CODGTKPK 5GJTUEJÌP





5EWFQ 5QNFK Q,/ÒP\OGKUVGT\GKEJGP(#2)CODGTKPK

5GJTUEJÌP





5QNFQ 6QTPGUK Q,HÒT%CPFKCCWH-TGVC/KVITKGEJKUEJGT.GIGPFG)CODGTKPK 4   42T·IGUEJY·EJGUGJTUEJÌP



118


VENEDIG

5417

5418

5418



0KEQNQ%QPVCTKPK5EWFQFGNNCETQEG 5QNFK Q, WO /ÒP\OGKUVGT&QOGPGIQ $CUCFQPPC&CX)CODGTKPK 4  445GJTUEJÌP





$TQP\GIW­OGFCKNNGWPUKIPKGTVCWHFGP$CWFGT-KTEJG5CPVC/CTKCFGNNC5CNWVG&QIGMPKGVPCEJ N CWH GKPGO 5EJGOGN FGP -QRH PCEJ XQTP IGYCPFV WPF YGKUV OKV DGKFGP *·PFGP CWH FCU   -KTEJGPIGD·WFG KO *KPVGTITWPF&KG ,WPIHTCW /CTKC UEJYGDV KP 9QNMGP ÒDGT 5VCFVCPUKEJV QDGP FGT   *GKNKIG)GKUVKP)GUVCNVGKPGT6CWDGKPGKPGO5VTCJNGPMTCP\OO8QNVQNKPC 5GJTUEJÌP



5422

5421

5420

5419

5419



(TCPEGUEQ'TK\\Q<GEEJKPQQ,I(D)CODGTKPK  )1.&-N4CPFHGJNGTXQT\ÒINKEJ





5EWFQFGNNCETQEG 5QNFK Q, WO /ÒP\OGKUVGT.WEC(CNKGT&CX)CODGTKPK  5GJTUEJÌP





5EWFQFGNNCETQEG 5QNFK Q, WO /ÒP\OGKUVGT<WCPG&KGFQ&CX)CODGTKPK 5GJTUEJÌP





5EWFQFGNNCETQEG 5QNFK Q, WO /ÒP\OGKUVGT)GTQNCOQ%QPVCTKPK&CX)CODGTKPK 5GNVGPKPFKGUGT'TJCNVWPI'VYCU$GNCIKO4CPFDGTGKEJXQT\ÒINKEJp5VGORGNINCP\

 119


VENEDIG

5423

5425

5424



5EWFQFGNNCETQEG 5QNFK Q, WO /ÒP\OGKUVGT#P\QNQ$CNDK&CX)CODGTKPK 5GJTUEJÌP





&WECVQ 5QNFK Q, WO /ÒP\OGKUVGT/CTECPVQPKQ/CNKRKGTQ&CX)CODGTKPK

4  45GJTUEJÌP





5EWFQFGNNCETQEG 5QNFK Q, WO /ÒP\OGKUVGT$GTPCTFQ$CNDK)CODGTKPK  5GJTUEJÌP



5427

5426

5428



(TCPEGUEQ /QNKP  5EWFQ FGNNC ETQEG  5QNFK  Q , WO   /ÒP\OGKUVGT /CTKPQ   $QNFÏ&CX)CODGTKPK 5GJTUEJÌP





1UGNNC#0018+CWHFGP5KGIÒDGTFKG6ÒTMGPDGK2CTQU/ÒP\OGKUVGT<CP#PVQPKQ5GOKVGEQNQ )CODGTKPKC2CQNWEEK 4  45GJTUEJÌP





1UGNNC#0018+++/ÒP\OGKUVGT(TCPEGUEQFC4KXC)CODGTKPK2CQNWEEK 4   4(CUVUGJTUEJÌP



120


VENEDIG

5429

5431

5430

5432



$GTVWEEK8CNKGT<GEEJKPQQ,I(D)CODGTKPK

)1.&48QT\ÒINKEJ





<GEEJKPQQ,I(D)CODGTKPK

)1.&45GJTUEJÌPpXQT\ÒINKEJ





&QOGPKEQ%QPVCTKPK<GEEJKPQQ,I(D)CODGTKPK  )1.&5GJTUEJÌP





<GEEJKPQQ,I(D)CODGTKPK



5434

)1.&/KPIGYGNNVUGJTUEJÌP

5433

5435



5EWFQFGNNCETQEG 5QNFK Q, WO /ÒP\OGKUVGT)CDTKGNG.QODCTFQ&CX)CODGTKPK 5GJTUEJÌP





&WECVQ Q , WO   /ÒP\OGKUVGT /CTKPQ FC /QNKP QFGT /CTEQ /QTQUKPK &CX    )CODGTKPK -N2T·IGUEJY·EJGPUGJTUEJÌP





&WECVQQ, WO /ÒP\OGKUVGT)KCEQOQFC4KXC)CODGTKPK

5GJTUEJÌP



5437 5436

5436



1UGNNC#001:++++/ÒP\OGKUVGT2KGVTQ<CIWTKUGUVQ)CODGTKPK2CQNWEEK

5GJTUEJÌP





0KEQNQ5CITGFQ<GEEJKPQQ,I(D)CODGTKPK 4   )1.&442T·IGUEJY·EJGUGJTUEJÌP

 121


VENEDIG

5438

5440

5439



#NXKUG%QPVCTKPK<GEEJKPQQ,I(D)CODGTKPK  )1.&-N&QRRGNUEJNCIHCUVXQT\ÒINKEJ





/CTE#PVQPKQ)KWUVKPKCP<GEEJKPQQ,I(D)CODGTKPK  )1.&8QT\ÒINKEJ





<GEEJKPQQ,I(D)CODGTKPK



)1.&5GJTUEJÌPpXQT\ÒINKEJ

5442 5441

5441



&WECVQQ, WO /ÒP\OGKUVGT<CP#PFTGC.QTGFCP&CX)CODGTKPK 45GJTUEJÌP





-W 5QNFK )C\GVVC  Q , CD   IGRT·IV HÒT FKG +PUGNP KP FGT I·KU WPF KO KQPKUEJGP /GGT   )CODGTKPK 5GJTUEJÌP



9GKNFKGGTUVGXGPG\KCPKUEJG<GKVWPI5QNFKMQUVGVGYWTFGPFKGUG/ÒP\GPXQNMUVÒONKEJ)C\GVVCIGPCPPV

5443

5445

5444



1UGNNC#001+  OKV#PUKEJVFGT2KC\\C5CP/CTEQ)CODGTKPK2CQNWEEK 4   44-N5EJTÌVNKPIUHGJNGTUGJTUEJÌP



5KNDGTOGFCKNNGXQP)*CWVUEJCWHFKG5KGIGÒDGTFKG6ÒTMGP)GHNÒIGNVGT/CTMWUNÌYGNQDGP GKPGCWU9QNMGPMQOOGPFG*CPFOKV-TQPGWPF2CNO\YGKI\WFGP5GKVGPOKV-GVVGPIGHGUUGNVGVÒTMK UEJG5QNFCVGP-CTVGFGT*CNDKPUGN2GNGRQPPGUOKVFGT&CTUVGNNWPIWPFFGP0COGPFGTGTQDGTVGP5V·FVG /KV 4CPFUEJTKHV 8+4676' '6 (14670# 8'0'6147/  OO  I 5NI ,WNKWU    5NI/QPVGPWQXQ8QNVQNKPC 445EJÌPG2CVKPCUGJTUEJÌP



122





5KNDGTOGFCKNNGXQP.).CWHHGTWPF)*CWVUEJCWHFKG5KGIGÒDGTFKG6ÒTMGP2WVVQOKVFGP /GFCKNNQPU FGU &QIGP WPF /QTQUKPKU CWH 2QFGUV FCXQT \YGK YGKVGTG 2WVVGP OKV FGP #PUKEJVGP FGT   GTQDGTVGP (GUVWPIGP \W FGP 5GKVGP VÒTMKUEJG 5VCPFCTVGP8KMVQTKC UKV\V N OKV 2CNO\YGKI WPF 5EJKNF   WOJGT HÒPH 2WVVGP FKG 6CHGNP WPF GKP $NCVV OKV FGP &CTUVGNNWPIGP FGT GTQDGTVGP 2N·V\G JCNVGP /KV   4CPFUEJTKHV r *1% &7%67 #&4+#%+5 8'0'6#/ /+4#/74 +0 70&+5 56#4' 84$'/ '6   6161210'4'+74#/#4+ÛOOI5NI,WNKWU5NI/QPVGPWQXQ8QNVQNKPC 48QT\ÒINKEJGU2TCEJVGZGORNCTOKVHGKPGT6ÌPWPI 


VENEDIG

5447

5446







5KNDGTOGFCKNNGXQP.).CWHHGTWPF)*CWVUEJCWHFKG5KGIGÒDGTFKG6ÒTMGP2WVVQOKVFGP /GFCKNNQPU FGU &QIGP WPF /QTQUKPKU CWH 2QFGUV FCXQT \YGK YGKVGTG 2WVVGP OKV FGP #PUKEJVGP FGT   GTQDGTVGP (GUVWPIGP \W FGP 5GKVGP VÒTMKUEJG 5VCPFCTVGP8KMVQTKC UKV\V N OKV 2CNO\YGKI WPF 5EJKNF   WOJGT HÒPH 2WVVGP FKG 6CHGNP WPF GKP $NCVV OKV FGP &CTUVGNNWPIGP FGT GTQDGTVGP 2N·V\G JCNVGP /KV   4CPFUEJTKHV r *1% &7%67 #&4+#%+5 8'0'6#/ /+4#/74 +0 70&+5 56#4' 84$'/ '6   6161210'4'+74#/#4+ÛOOI5NI,WNKWU5NI/QPVGPWQXQ8QNVQNKPC 4#VVTCMVKXGUUGJTUEJÌPGU'ZGORNCTOKVUEJÌPGT2CVKPC 5KNDGTOGFCKNNGXQP.).CWHHGTWPF)*CWVUEJCWHFKG5KGIGÒDGTFKG6ÒTMGP5VCFVCPUKEJVXQP 8GPGFKI8KMVQTKC UKV\V N OKV 2CNO\YGKI WPF 5EJKNF WOJGT HÒPH 2WVVGP FKG 6CHGNP WPF GKP $NCVV OKV   FGP &CTUVGNNWPIGP FGT GTQDGTVGP 2N·V\G JCNVGP /KV 4CPFUEJTKHV r 8GT\KGTWPI  +/2'4+8/ 8GT\KG   TWPI 5+0' 8GT\KGTWPI &'&+Ő 8GT\KGTWPI OOI5NI,WNKWU5NI/QPVGPWQXQ 8QNVQNKPC 445EJÌP $TQP\GOGFCKNNGXQP.).CWHHGTWPF)*CWVUEJCWHFKG5KGIGÒDGTFKG6ÒTMGP5VCFVCPUKEJV XQP 8GPGFKI8KMVQTKC UKV\V N OKV 2CNO\YGKI WPF 5EJKNF WOJGT HÒPH 2WVVGP FKG 6CHGNP WPF GKP $NCVV   OKV FGP &CTUVGNNWPIGP FGT GTQDGTVGP 2N·V\G JCNVGP /KV 4CPFUEJTKHV r 8GT\KGTWPI  +/2'4+8/  

8GT\KGTWPI 5+0' 8GT\KGTWPI &'&+Ő 8GT\KGTWPI OO5NI,WNKWU5NI/QPVGPWQXQ 8QNVQNKPC -N-TCV\GTXQT\ÒINKEJ

5449

 





 

5452

-W5QNFK )C\GVVC Q,  IGRT·IVHÒTFKG(NQVVGWPF/QTGC OKVVGNCNVGTNKEJGT0COGFGT *CNDKPUGN2GNQRQPPGU )CODGTKPK  W­GTUVUGNVGPKPFKGUGT'TJCNVWPI8QT\ÒINKEJGU2TCEJVGZGORNCTOKVJGTTNKEJGT6ÌPWPI



1UGNNC#0018+  /ÒP\OGKUVGT<WCPGFG4KXC)CODGTKPK2CQNWEEK 4   5CWDGTIGUVQRHVGU.QEJ(GNFGTDGCTDGKVGVUGJTUEJÌP



9GKNFKGGTUVGXGPG\KCPKUEJG<GKVWPI5QNFKMQUVGVGYWTFGPFKGUG/ÒP\GPXQNMUVÒONKEJ)C\GVVCIGPCPPV





5450

(TCPEGUEQ/QTQUKPK<GEEJKPQQ,I(D)CODGTKPK  )1.&5GJTUEJÌPpXQT\ÒINKEJ <GEEJKPQQ,I(D)CODGTKPK )1.&5GJTUEJÌPpXQT\ÒINKEJ

5451



5448

123


VENEDIG

5454

5455

5453

5453



5KNXGUVTQ 8CNKGT  &WECVQ Q , WO   /ÒP\OGKUVGT 2KGTQ /KPQVVQ &CX    )CODGTKPK 5GJTUEJÌP





#NXKUG++/QEGPKIQ<GEEJKPQQ,I(D)CODGTKPK  )1.&5GJTUEJÌPpXQT\ÒINKEJ





<GEEJKPQQ,I(D)CODGTKPK



)1.&5GJTUEJÌPpXQT\ÒINKEJ

5457

5456

5456



&WECVQQ, WO /ÒP\OGKUVGT2KGVTQ/CIPQ&CX)CODGTKPK  5EJTÌVNKPIUTK­UGJTUEJÌPpXQT\ÒINKEJ





.GQPGFCUQNFKQ,HÒT&CNOCVKGPWPF#NDCPKGP)CODGTKPK 4 



445GJTUEJÌP

5458

5460

5459

5460



.GQPGFCUQNFKQ,HÒT&CNOCVKGPWPF#NDCPKGP)CODGTKPK 4   8QPITQ­GT5GNVGPJGKV5GJTUEJÌP





)KQXCPPK++%QTPGT<GEEJKPQQ,I(D)CODGTKPK  )1.&5GJTUEJÌP





5EWFQFGNNCETQEG 5QNFK Q, WO /ÒP\OGKUVGT(TCPEGUEQ#PVQPKQ2CUSWCNKIQ&CX )CODGTKPK -N)TCHHKVQWPF2T·IGUEJY·EJGUGJTUEJÌP



124


VENEDIG

5462

5461

5461



&WECVQPG 5QNFK Q,  /ÒP\OGKUVGT(TCPEGUEQ#PVQPKQ2CUSWCNKIQ&CX)CODGTKPK  4  4(CUUWPIUURWTGPUGJTUEJÌPpXQT\ÒINKEJ





$TQP\GCDUEJNCIXQPFGP5VGORGNPFGTCPQP[OGP.KTC\\C\W5QNFK)CODGTKPK\W  445GJTUEJÌP



5464

5463



$TQP\GOGFCKNNGXQP229GTPGTCWH/CVVJKCU,QJCPPXQP5EJWNGPDWTIFGP8GTVGKFKIGT-QTHWU IGIGP FKG 6ÒTMGP &GPMOCN 5EJWNGPDWTIU XQT FGT 5VCFVCPUKEJV XQP -QTHW <GKNGP 5EJTKHV KP 1XCN   WOJGT.QTDGGTMTCP\OO8QNVQNKPC 8QT\ÒINKEJ





#NXKUG+++/QEGPKIQ1UGNNC#00+)CODGTKPK2CQNWEEK 4   4(CUVUGJTUEJÌPGU'ZGORNCT



5466

5465

5467

5467

 

%CTNQ4W\\KPK<GEEJKPQQ,I(D)CODGTKPK <GEEJKPQQ,I(D)CODGTKPK



1UGNNC #001++CWHFKG4ÒEMMGJTFGT)GDGKPGFGUXGPG\KCPKUEJGP*GKNKIGP2KGVTQ1TUGQNQXQP (TCPMTGKEJ WPF FGTGP $GKUGV\WPI KO /CWUQNGWO /ÒP\OGKUVGT $QTVQNQOKQ <GP )CODGTKPK    2CQNWEEK 4  4-N<CKPGPFGXQT\ÒINKEJGU'ZGORNCTOKVHGKPGT6ÌPWPI

5468

5469

)1.&45GJTUEJÌP )1.&45GJTUEJÌP

  

5470

 

#NXKUG2KUCPK<GEEJKPQQ,I(D)CODGTKPK <GEEJKPQQ,I(D)CODGTKPK

)1.&5GJTUEJÌP )1.&5GJTUEJÌP

 



2KGVTQ)TKOCPK<GEEJKPQQ,I(D)CODGTKPK  )1.&-N2T·IGUEJY·EJGXQT\ÒINKEJ

 125


VENEDIG

5471 5472

 

5472

<GEEJKPQQ,I(D)CODGTKPK )1.&2T·IGUEJY·EJGXQT\ÒINKEJ &WECVQQ, WO /ÒP\OGKUVGT<CP#NXKUG$CTDCTQ&CX)CODGTKPK 5GJTUEJÌP

5474

 

5475

5473

5473



1UGNNC#:+/ÒP\OGKUVGT#NXKUG$CTDCTQ)CODGTKPK2CQNWEEK



(TCPEGUEQ.QTGFCP<GEEJKPQQ,I(D)CODGTKPK  )1.&(CUVXQT\ÒINKEJ





<GEEJKPQQ,I(D)CODGTKPK



)1.&-N2T·IGUEJY·EJGUGJTUEJÌPpXQT\ÒINKEJ

<GEEJKPQQ,I(D)CODGTKPK <GEEJKPQQ,I(D)CODGTKPK



5477

5476

 

5GJTUEJÌP

)1.&4-N*GPMGNURWTUGJTUEJÌP )1.&45GJTUEJÌPpXQT\ÒINKEJ

 

5479

5478

5478



5EWFQFGNNCETQEG 5QNFK Q,/ÒP\OGKUVGT)KCEQOQ#PVQPKQ%QPVCTKPK&CX)CODGTKPK 5GNVGPKPFKGUGT'TJCNVWPI#VVTCMVKXGUXQT\ÒINKEJGU'ZGORNCTOKVHGKPGT6ÌPWPI





&WECVQQ,  /ÒP\OGKUVGT)KCEQOQ#PVQPKQ%QPVCTKPK&CX)CODGTKPK 5GJTUEJÌP



126


VENEDIG

5480

5481

5482



6CNNGTQIGRT·IVHÒTFKG.GXCPVG6[ROKVIGUEJYWPIGPGT<KHHGTKPFGT,CJTGU\CJN&CX )CODGTKPK 4  4(CUVXQT\ÒINKEJ





6CNNGTQIGRT·IVHÒTFKG.GXCPVG6[ROKVIGUEJYWPIGPGT<KHHGTKPFGT,CJTGU\CJN&CX )CODGTKPK 4   5GNVGPGT,CJTICPI-N4CPFXGTRT·IWPIHCUVXQT\ÒINKEJGU'ZGORNCTOKVHGKPGT6ÌPWPI





 6CNNGTQ  IGRT·IV HÒT FKG .GXCPVG  6[R OKV IGUEJYWPIGPGT <KHHGT  KP FGT ,CJTGU\CJN   )CODGTKPK XIN   8QPCNNGTITÌ­VGT5GNVGPJGKV9CJTUEJGKPNKEJWPGFKGTVGT,CJTICPI5GJTUEJÌPpXQT\ÒINKEJ  +PFGT.KVGTCVWTYKTFFGT$GIKPPFGT2T·IWPIFGU6[RUGTUVOKVFGO,CJTCPIGIGDGP XIN2CQNWEEK++0T 5 

5483

5484



1UGNNC#0+/ÒP\OGKUVGT)KCEQOQ#PVQPKQ%QPVCTKPK)CODGTKPK2CQNWEEK  (CUVUGJTUEJÌP





1UGNNC#0018/ÒP\OGKUVGT(TCPEGUEQ6TGXKUCP)CODGTKPK2CQNWEEK



5485





5486

5GJTUEJÌP

5485

1UGNNC#8+++CWHFKGªDGTICDGFGT)QNFGPGP4QUGXQP2CRUV%NGOGPU:+++CPUGKPG*GKOCVUVCFV 8GPGFKI/ÒP\OGKUVGT2KGTQ2CUVC)CODGTKPK2CQNWEEK 4   4-N5EJTÌVNKPIUHGJNGTCO4CPFXQT\ÒINKEJ



/CTEQ(QUECTKPK<GEEJKPQQ,I(D)CODGTKPK  )1.&45GJTUEJÌP

 127


VENEDIG

5487 5488

5488



<GEEJKPQQ,I(D)CODGTKPK

)1.&45GJTUEJÌP





6CNNGTQIGRT·IVHÒTFKG.GXCPVG&CX)CODGTKPK 4   44/GJTGTG5EJTÌVNKPIUHGJNGTUQPUVUGJTUEJÌPpXQT\ÒINKEJ



5489



5KNDGTOGFCKNNG  WPUKIPKGTV XGTNKGJGP CP ,QUGRJ -CVVKEJ HÒT UGKPGP 'KPUCV\ DGKO $CW GKPGT 5VTC­G   FWTEJ FCU 2WUVGTVCN )GHNÒIGNVGT /CTMWUNÌYG N OKV \WTÒEMIGYCPFVGO -QRH FKG NKPMG 6CV\G CWH GKP   $WEJIGNGIVFCXQT6WTO&TGK<GKNGP5EJTKHV\YKUEJGP8GT\KGTWPIGPOOI8QNVQNKPC 442TCEJVGZGORNCT*GTTNKEJG6ÌPWPIXQT\ÒINKEJp5VGORGNINCP\ 

5490

5491

5492



#NXKUG +8 /QEGPKIQ  &WECVQ Q , WO   /ÒP\OGKUVGT 4K\\CTFQ $CNDK &CX    )CODGTKPK 5GJTUEJÌP





&WECVQQ, WO /ÒP\OGKUVGT.QTGP\Q$QPNKPK&CX)CODGTKPK  5GJTUEJÌPpXQT\ÒINKEJ





&WECVQQ, WO /ÒP\OGKUVGT8CNGTKQ8CNKGT&CX)CODGTKPK  <YGKMN5EJTÌVNKPIUTKUUGXQT\ÒINKEJ



128


VENEDIG

5494

5493



&WECVQQ, WO /ÒP\OGKUVGT8CNGTKQ8CNKGT&CX)CODGTKPK  5GJTUEJÌPpXQT\ÒINKEJ





&WECVQQ, WO /ÒP\OGKUVGT)KCEQOQ2CUSWCNKIQ)CODGTKPK

5GJTUEJÌP



5496

5495



6CNNGTQIGRT·IVHÒTFKG.GXCPVG&CX)CODGTKPK

-N5EJÌVNKPIUHGJNGTUGJTUEJÌP





1UGNNC#0+8/ÒP\OGKUVGT/CTKQ5QTCP\Q)CODGTKPK2CQNWEEK  -N5EJTÌVNKPIUHGJNGTUGJTUEJÌPpXQT\ÒINKEJ



5497

5499

5498

5500

5498



1UGNNC#08+)CODGTKPK2CQNWEEK 4   4#VVTCMVKXGU'ZGORNCTOKVHGKPGT6ÌPWPI-N2T·IGUEJY·EJGXQT\ÒINKEJ



2CQNQ4GPKGT<GEEJKPQQ,I(D)CODGTKPK



5EWFQ FGNNC ETQEG  5QNFK  Q , WO   /ÒP\OGKUVGT .WPCTFQ #NXKUG (QUECTKPK &CX    )CODGTKPK 8QT\ÒINKEJGU2TCEJVGZGORNCTOKVHGKPGT6ÌPWPI





&WECVQPG 5QNFK Q, WO /ÒP\OGKUVGT$GPGVVQ%CRGNNQ&CX)CODGTKPK  8QT\ÒINKEJGU'ZGORNCTOKVHGKPGT6ÌPWPI



)1.&8QT\ÒINKEJ

 

129


VENEDIG

5502

5501

5501



&WECVQQ, WO /ÒP\OGKUVGT$GPGVVQ%CRGNNQ&CX)CODGTKPK  5GJTUEJÌPpXQT\ÒINKEJ



&WECVQQ, WO /ÒP\OGKUVGT$GPGVVQ%CRGNNQ)CODGTKPK

5503

5504



5GJTUEJÌP



5506

5505

  

6CNNGTQIGRT·IVHÒTFKG.GXCPVG)CODGTKPK 8QT\ÒINKEJ 6CNNGTQIGRT·IVHÒTFKG.GXCPVG)CODGTKPK 5GJTUEJÌP 1UGNNC#0018+)CODGTKPK2CQNWEEK 48QT\ÒINKEJGU'ZGORNCTOKVHGKPGT6ÌPWPI

  



1UGNNC/WTCPQ)CODGTKPK2CQNWEEK 4   44#VVTCMVKXGUXQT\ÒINKEJGU'ZGORNCTOKVJGTTNKEJGT2CVKPC



5507

5508

5508



.QFQXKEQ/CPKP<GEEJKPQQ,I(D)CODGTKPK  )1.&5GJTUEJÌPpXQT\ÒINKEJ





&WECVQQ, WO /ÒP\OGKUVGT)KCEQOQ(QUECTKPK&CX)CODGTKPK  5GNVGPKPFKGUGT'TJCNVWPI-N5EJTÌVNKPIUTK­CVVTCMVKXGUXQT\ÒINKEJGU'ZGORNCT



130


VENEDIG

5509 5511

5511



#PQP[OG.KTC\\C\W5QNFK)CODGTKPK  5GNVGPKPFKGUGT'TJCNVWPI8QT\ÒINKEJGU'ZGORNCTOKVUEJÌPGT6ÌPWPI





-W5QNFK )C\GVVC Q,  IGRT·IVHÒT&CNOCVKGPWPF#NDCPKGP&C\WGKPYGKVGTGU'ZGORNCTCWU FGO,CJTJWPFGTV)CODGTKPK 5VÒEM5GJTUEJÌPWPFHCUVUGJTUEJÌP



9GKNFKGGTUVGXGPG\KCPKUEJG<GKVWPI5QNFKMQUVGVGYWTFGPFKGUG/ÒP\GPXQNMUVÒONKEJ)C\GVVCIGPCPPV



6CNNGTQIGRT·IVHÒTFKG.GXCPVG&CX)CODGTKPK

5512

5GJTUEJÌPpXQT\ÒINKEJ



5513

5514



6CNNGTQIGRT·IVHÒTFKG.GXCPVG&CX)CODGTKPK

5GJTUEJÌPpXQT\ÒINKEJ





6CNNGTQIGRT·IVHÒTFKG.GXCPVG&CX)CODGTKPK  -N5EJTÌVNKPIUHGJNGTKO2QTVT·VUGJTUEJÌPpXQT\ÒINKEJ





1UGNNC#+++)CODGTKPK2CQNWEEK



5516

9KP\5EJTÌVNKPIUHGJNGTCO4CPFHCUVXQT\ÒINKEJ

5515

5516



1UGNNC#08)CODGTKPK2CQNWEEK

9KP\5EJTÌVNKPIUTKUUGXQT\ÒINKEJ





4GRWDNKM.KTG&CX)CODGTKPK (GKPG2CVKPCUGJTUEJÌPpXQT\ÒINKEJ

 131


VENEDIG

ex 5517



2TQXKUQTKUEJG4GIKGTWPI.QV-W%GPVGUKOK-W%GPVGUKOK-W%GP VGUKOQCNNG/ÒP\UV·VVG8GPFKI2CICPK 5VÒEM(CUVXQT\ÒINKEJWPFXQT\ÒINKEJ 'KPGP5QXTCPQCWU8GPGFKIOKVFGT,CJTGU\CJNHKPFGP5KGWPVGTFGT0T



5#//.70)'08'0'&+) 

-NGKPG 5COONWPI XQP )QNF\GEEJKPGP XGTUEJKGFGPGT &QIGP FGU  ,CJTJWPFGTVU FCTWPVGT DGUUGTG   6[RGP&C\W.KVGTCVWT%GUCTG)CODGTKPKFK5ECTH¾C/QPGVGFK8GPG\KC  5VÒEM$WEJ)1.&/GKUVOKVMNGKPGP(GJNGTPUGJTUEJÌP 

ex 5519



5GJT WOHCPITGKEJG 5COONWPIXGPG\KCPKUEJGT/ÒP\GPFGU,CJTJWPFGTVUFCTWPVGT5VÒEMGKP 6CNGTITÌ­GWPFGKPKIG5GNVGPJGKVGPYKG\$2KGVTQ<CPK)TQUUQ/CTKPQ/QTQUKPK)TQUUQ5GDCUVK CPQ8GPKGT5QNFKQ,%CTNQ4W\\KPK6TCKTQ 5QNFK 1UGNNC#001+++/CTEQ(QUEC TKPK&WECVQPG 5QNFK \GKVIGPÌUUKUEJG-WRHGTH·NUEJWPIGPGKPGU5EWFQFGNNCETQEGFGU #PVQPKQ 2TKWNK WPF GKPGU &WECVQ FGU #NXKUG 2KUCPQ GVE *QEJKPVGTGUUCPVG 5COONWPI  FKG WPDGFKPIV   DGUKEJVKIVYGTFGPUQNNVG 5VÒEM/GKUVUGJTUEJÌP 



+PVGTGUUCPVG5COONWPIXGPG\KCPKUEJGT/GFCKNNGPFGU,CJTJWPFGTVUKP$TQP\GWPFCPFGTGPWPGF NGP /GVCNNGP W C #PVQPKQ )TKOCPK $TQP\GIW­OGFCKNNG Q , 8QNVQNKPC  UR·VGTG #PHGTVKIWPI    #PFTGC)TKVVK$TQP\GIW­OGFCKNNGCWHFKG-KTEJG5CP(TCPEGUEQFGNNC8KIPC 8QNVQNKPCUR· VGTG#PHGTVKIWPI /CTKQ)TKOCPK$TQP\GIW­OGFCKNNG 8QNVQNKPCUR·VGTG#PHGTVKIWPI /CTE #PVQPKQ)KWUVKPKCP$TQP\GOGFCKNNGCWHFKG5KGIG8GPGFKIUCWH/QTGC 8QNVQNKPC $TQP\G OGFCKNNGCWHFKG5KGIGÒDGTFKG6ÒTMGP 8QNVQNKPC UQYKGYGKVGTGDGUUGTG5VÒEMG  5VÒEM5GJTUEJÌPpXQT\ÒINKEJ 

.+6'4#6748'0'&+)70&41/ 

-.'+02#7. 4 4QO KP 9QTV WPF $KNF $CPF + .GKR\KI   5  -WRHGTUVKEJG $CPF ++   .GKR\KI5-WRHGTUVKEJG  $·PFG+PRTCEJVXQNNGP)CP\NGKPGPGKPD·PFGPOKV1TPCOGPVGPWPF)QNFXGT\KGTWPIGP

&CU XQTNKGIGPFG 9GTM FCU -ÌPKI #NDGTV XQP 5CEJUGP IGYKFOGV KUV UEJKNFGTV GKPG 9CPFGTWPI FWTEJ FKG 'YKIG   5VCFV WPF UVGNNV FKG /QPWOGPVG FGU CPVKMGP WPF CNVEJTKUVNKEJGP 4QO CWUHÒJTNKEJ FCT FKG KPUDGUQPFGTG FWTEJ FKG   MWPUVXQNNGP-WRHGTUVKEJGGKPFTWEMUXQNNJGTXQTIGJQDGPYGTFGP

132




KÖNIGREICH ITALIEN 

.#<#4+8.G/QPGVGFGKRQUUGFKOGPVKXGPG\KCPKFKQNVTGOCTGGFKVGTTCHGTOC8GPGFKI8+++ 56HP-CTVQPKGTV++



/KV9KFOWPIFGU8GTHCUUGTUCP%QPVG&QOGPKEQ)KWUVKPKCPKCWHFGO'KPDCPFFGEMGN



/'0+<<+#&GNNGOQPGVGFG 8GPG\KCPKFCN2TKPEKRKQCNHKPGFGNNCNQTQTGRWDNKEEC2CTVGRTKOC8G PGFKI5/CTOQTKGTVGT2CRRDCPFFGT<GKV++





/75'1%+8+%1%144'48'0'<+) *TUI 5COOGNDCPFOKVXKGT5EJTKHVGP/GFCINKGFGNNC4KXQ NW\KQPG (TCPEGUG FGNN  'RQRGC 0CRQNGQPKEC 8GPGFKI   5 6GUUGTG 8GPGFKI    5   $QNNG8GPGFKI52NCEEJGVVG5GEQNK:8G:8+8GPGFKI5.GKPGP++





241/+585WNN 1TKIKPGFGNNC<GEEC8GPGVC6QTKPQ56H/CTOQTKGTVGT2CRRDCPF++





225#06#/#4+#4QO#WMVKQPXQO1UGNNGF 1TQ0TP6HP5GKVGPWPF6HP VGKNYGKUG NQUG $TQUEJKGTV &C\W 4#661 4 /KNCPQ .CIGTNKUVG :+++ XQP   0TP  6HP   'KPKIG#PUVTGKEJWPIGP5GKVGPWPF6HPNQUG$TQUEJKGTV+++ 



561%-'46-&KGXQTXGPG\KCPKUEJGP/ÒP\GPFGT)GOGKPFGXQP%CVVCTQ55&CWU0<8 :.8  $TQUEJKGTV+++





/KV9KFOWPIFGU#WVQTU



<#0'66+)&GNN QTKIKPGGFGNNCCPVKEJKVCFGNNCOQPGVC8KPK\KCPC4CIKQPCOGPVQ8GPGFKI   5(TQPVKURK\6CHGN/QFGTPGT2CRRDCPF++





8'0'&+)-QPXQNWVXQP5EJTKHVGPOGKUV\WTXGPG\KCPKUEJGP/ÒP\MWPFGFCTWPVGT)9'4&0+) .G 1UGNNG 0 2#2#&121.+ .G OQPGVG CPQPKOG FK 8GPG\KC FCN  CN  0&   2   81.61.+0#)CNNGTKCFGNNC4GRWDDNKECFK8GPG\KC./#0+0+NNWUVTC\KQPGFGNNG/GFCINKGFGK&QIK FK8GPG\KCFGPQOKPCVG1UGNNG7PVGTUEJKGFNKEJIGDWPFGP+++++



5531

5530

8'410# 

(GFGTKEQ++FK5XGXKC)TQUUQFC&GPCTKQ,I$GKFGTUGKVU-TGW\KPFQRRGNVGT 7OUEJTKHV$KCIIK%0+8+5HH 8QT\ÒINKEJGU'ZGORNCTOKVHGKPGT2CVKPC





)TQUUQ FC  &GPCTK Q ,  I $GKFGTUGKVU -TGW\ KP FQRRGNVGT 7OUEJTKHV $KCIIK  %0+ 8+   5HH 5GJTUEJÌP



5532

5533

5534

5535

-¤0+)4'+%*+6#.+'0 

0CRQNGQP.KTG//CKNCPFI(GKPIQNF(D2CICPK5EJN  )1.&5GNVGPKPFKGUGT'TJCNVWPI#VVTCMVKXGUXQT\ÒINKEJGU'ZGORNCT





.KTG//CKNCPFI(GKPIQNF(D2CICPK5EJN





.KTG ,CJTGU\CJNKO5VGORGNCWUIG·PFGTV //CKNCPFI(GKPIQNF(D2CICPK 5EJN )1.&5GNVGPKPFKGUGT'TJCNVWPI8QT\ÒINKEJ





.KTG ,CJTGU\CJNKO5VGORGNCWUIG·PFGTV //CKNCPFI(GKPIQNF(D2CICPK 5EJN )1.&5GJTUEJÌP



)1.&5GJTUEJÌP

133


KÖNIGREICH ITALIEN

5536

5537

 

5537

.KTG//CKNCPFI(GKPIQNF(D2CICPK5EJN .KTG88GPGFKI2CICPK

5538

)1.&8QT\ÒINKEJ 4(CUVXQT\ÒINKEJ

 

5539



.KTG ,CJTGU\CJNKO5VGORGNCWUIG·PFGTV //CKNCPFI(GKPIQNF(D2CICPK C5EJN )1.&8QT\ÒINKEJ





.KTG//CKNCPFI(GKPIQNF(D2CICPKC5EJN  )1.&5GJTUEJÌPpXQT\ÒINKEJ



5540

5542

5541

5541



8KEVQT'OCPWGN++-W%GPVGUKOK$KTOKPIJCO2CICPK  (CUV5VGORGNINCP\

 

.KTG(NQTGP\&CX2CICPK -W%GPVGUKOK$$QNQIPC2CICPK

5543

    134

5544

8QPITQ­GT5GNVGPJGKV(CUVUGJTUEJÌP 448QT\ÒINKEJ

5545

  

5546

-W%GPVGUKOK//CKNCPF2CICPK 5VGORGNINCP\ -W%GPVGUKOK*$KTOKPIJCO2CICPK (CUV5VGORGNINCP\ -W%GPVGUKOK1/5VTC­DWTI2CICPK (GKPG6ÌPWPIXQT\ÒINKEJp5VGORGNINCP\ .KTG4QOI(GKPIQNF(D2CICPK5EJN )1.&5GJTUEJÌP

   


KÖNIGREICH ITALIEN

5548

5547



.KTG44QO&CX2CICPK  5GJTUGNVGPGT,CJTICPI-TCV\GTWPFMN4CPFHGJNGTHCUVUGJTUEJÌP



7ODGTVQ+.KTG44QO&CX2CICPK

8QT\ÒINKEJ

5550

5549

 

5549



8KEVQT'OCPWGN+++.KTC44QO2CICPK  5GJTUGNVGPGT,CJTICPI5GJTUEJÌPpXQT\ÒINKEJ





.KTG44QOI(GKPIQNF(D2CICPK5EJN  )1.&45GJTCVVTCMVKXGU'ZGORNCTXQT\ÒINKEJ



5551



-W%GPVGUKOK44QO&C\W-W%GPVGUKOK44QO2CICPK  5VÒEM8QT\ÒINKEJ

5552



1,5:1



5552

 .KTG  4 4QO CWH UGKP L·JTKIGU 4GIKGTWPIULWDKN·WO WPF FGP  ,CJTGUVCI FGU -TKGIUGKP   VTKVVU/CVVRT·IWPII(GKPIQNF(D2CICPK5EJN  )1.&440WT'ZGORNCTGIGRT·IV/CVVKGTVHCUV5VGORGNINCP\ 

5553



.KTC4%GPVGUKOK44QO2CICPK  5VÒEM5GNVGPGT,CJTICPI5VGORGNINCP\

 135


KÖNIGREICH ITALIEN

5554



.KTC4%GPVGUKOK44QO2CICPK  5VÒEM5GJTUGNVGPGT,CJTICPI5VGORGNINCP\

5555

5556



5557

 

.KTG#8+44QO&CX2CICPK .KTG#8+44QO&CX2CICPK

-N-TCV\GTXQT\ÒINKEJ 8QT\ÒINKEJ



.KTG#8+44QOCWHFGP,CJTGUVCIFGT$GGPFKIWPIFGU'TUVGP9GNVMTKGIGU&CX 2CICPK 5GJTUEJÌP

  

5558



136

4GRWDNKM +VCNKGP UGKV  /ÒP\GPUCV\  4 4QODGUVGJGPFCWUWPF.KTGUQYKG.KTC #NWOKPKWO2CICPK  5VÒEM,CJTICPIXQPITÌ­VGT5GNVGPJGKV8QT\ÒINKEJp5VGORGNINCP\ 


KÃ&#x2013;NIGREICH ITALIEN

ex 5560

ex 5559



.KTG44QOCWHFKG,CJTHGKGTFGT8GTGKPKIWPIFGU-KTEJGPUVCCVGUOKV+VCNKGP2TQDGKP 5KNDGT&C\W&KG1TKIKPCN#WUHÃ&#x2019;JTWPIFKGUGT)GFGPMOÃ&#x2019;P\G-/2T  5VÃ&#x2019;EM+P1TKIKPCNGVWK5VGORGNINCP\





.KTG44QO)GDWTVUVCIFGU2J[UKMGTU)/CTEQPK2TQDGKP5KNDGT&C\W&KG1TKIK PCN#WUHÃ&#x2019;JTWPIFKGUGT)GFGPMOÃ&#x2019;P\G-/2T 5VÃ&#x2019;EM+P1TKIKPCNGVWK5VGORGNINCP\



5562

5561

5563



.KTG44QO,CJTHGKGTFGT$CUKNKMCXQP5CPVC%TQEGI(GKPIQNF(D-/ )1.&2QNKGTVG2NCVVG





 .KTG  4 4QO ,CJTHGKGT FGT 'KPYGKJWPI FGT $CUKNKMC 5CP 0KEQNC FK $CTK  I   (GKPIQNF(D-/ )1.&2QNKGTVG2NCVVG





 .KTG  4 4QO ,CJTHGKGT FGU 6QTTG FGN /CPIKC KP 5KGPC  I (GKPIQNF (D    -/ )1.&+PDTCWPGO1TKIKPCNGVWK2QNKGTVG2NCVVG



5564

5565

5566

5568



.KTG44QOCWHFKG,CJTHGKGTFGT'KPHÃ&#x2019;JTWPIFGU*GKNKIGP,CJTGUI(GKPIQNF (D-/ )1.&+PDTCWPGO1TKIKPCNGVWK2QNKGTVG2NCVVG





.KTG44QO,CJTHGKGTFGT'TDCWWPIFGU2CNCUVGUKP%CUGTVCI(GKPIQNF(D -/ )1.&2QNKGTVG2NCVVG





'WTQ44QO(W­DCNNYGNVOGKUVGTUEJCHVKP&GWVUEJNCPFI(GKPIQNF-/  )1.&2QNKGTVG2NCVVG





'WTQ44QO(W­DCNNYGNVOGKUVGTUEJCHVKP&GWVUEJNCPFI(GKPIQNF-/  )1.&2QNKGTVG2NCVVG





'WTQ44QO1N[ORKUEJG9KPVGTURKGNGKP6WTKPI(GKPIQNF-/  )1.&2QNKGTVG2NCVVG

 137


KOLONIE ERITREA

5569

5570



'WTQ44QO1N[ORKUEJG9KPVGTURKGNGKP6WTKPI(GKPIQNF-/  )1.&2QNKGTVG2NCVVG





'WTQ44QO1N[ORKUEJG9KPVGTURKGNGKP6WTKPI(GKPIQNF-/  )1.&2QNKGTVG2NCVVG



5571

5572

 

5572

-1.10+''4+64'#

7ODGTVQ+.KTG 6CNNGTQ 4QO&CX2CICPK .KTG 6CNNGTQ 4QO&CX2CICPK

5GJTUEJÌPpXQT\ÒINKEJ 5GJTUEJÌP

 

&KXGTUG-NGKPOÒP\GPFGU,CJTJWPFGTVUWC$QNQIPC.WEEC2KCEGP\CWPF8GPGFKI  5VÒEM5EJÌPpUGJTUEJÌPWPFUGJTUEJÌP



ex 5573

.16 

138


BALTIKUM

/ª0<'070&/'&#+..'0 #75/+66'.#.6'470&0'7<'+6



'7412+5%*'/ª0<'070&/'&#+..'0

5574

5575

5576

#0&144# 

4GXQNWVKQP-W%GPVKOQU-/ 7PWUCN9QTNF%QKPU :  8QPITQ­GT5GNVGPJGKV(CUV5VGORGNINCP\

$#.6+-7/

-74.#0& 



2GVGT$KTQP$TQP\GOGFCKNNGXQP%.GDGTGEJVCWHFCUXQPKJOIGUVKHVGVG5VKRGPFKWO HÒT /KVCWGT )[OPCUKCUVGP HÒT GKPGP 5VWFKGPCWHGPVJCNV $ÒUVG T OKV WOIGNGIVGO /CPVGN0GWP <GKNGP   5EJTKHVWOJGT.QTDGGTWPF'KEJGPNCWDMTCP\OOI*%\ 4   9KP\4CPFHGJNGTXQT\ÒINKEJ



4+)#56#&6 

5KNDGTOGFCKNNGQ,WPUKIPKGTVFGT.CPFYKTVUEJCHVNKEJGP)GUGNNUEJCHVKP4KIC&TGK<GKNGP5EJTKHVÒDGT JTGP9GKDNKEJG)GUVCNVUVGJVPCEJTWPFJ·NVOKVFGT.KPMGPGKPGP'KEJGPNCWDMTCP\ÒDGTCO$QFGP NKGIGPFG-QTPICTDGPKO*KPVGTITWPF(GNFWPF*·WUGTOOI 8QT\ÒINKEJ 'KPGP&TGKITÌUEJGTCWU4KICXQPOKVFGO2QTVT·V5KIKUOWPFU+++XQP2QNGPHKPFGP5KGWPVGTFGT 0T

1,5:1



5577 1,5:1

.+6#7'0 

4GRWDNKM-W5CPVKOK-/

8QPITÌ­VGT5GNVGPJGKV8QT\ÒINKEJp5VGORGNINCP\

 139


BELGIEN

5579

5578

 

-W5CPVKOK-/ -W5CPVKOU-/

8QPITÌ­VGT5GNVGPJGKV8QT\ÒINKEJp5VGORGNINCP\ 8QPITQ­GT5GNVGPJGKV8QT\ÒINKEJp5VGORGNINCP\

5580

5581

 

5582

$'.)+'0

$4#$#06 

2JKNKRR ++ XQP 5RCPKGP  'EW 2JKNKRRG  /CCUVTKEJV &CX  &GNO 0CEJVTCI   

4  8QPITQ­GT5GNVGPJGKV2TÒHJKGDUEJÌPpUGJTUEJÌP





-CTN ++ XQP 5RCPKGP  5KNDGTPGT ,GVQP Q ,   CWH FKG 'KPHÒJTWPI FGU PGWGP 2T·IG   CRRCTCVGU KP FGT /ÒP\UV·VVG #PVYGTRGP )GMTÌPVGU OKV .QTDGGT\YGKIGP XGT\KGTVGU XKGTHGNFKIGU   9CRRGP$CNCPEKGT KO 8QTFGTITWPF HTKUEJ IGRT·IVG /ÒP\GP WPF -ÌTDG XQNN /ÒP\GP  OO   I&WIPKQNNGX.QQP 8QT\ÒINKEJ



$4ª55'. 

5VCFV5KNDGTOGFCKNNGQ,  XQP,2$TCGOVFGT#MCFGOKGFGT9KUUGPUEJCHVGPWPFFGT .KVGTCVWT$ÒUVG9KNJGNOU+-ÌPKIFGT0KGFGTNCPFGT(ÒPH<GKNGP5EJTKHVKP.QTDGGTMTCP\OO I5GTHCU 8QT\ÒINKEJ



5584 5583

5583

(.#0&'40 

2JKNKRR++XQP5RCPKGP'EW2JKNKRRG&CX&GNO  #VVTCMVKXGUUGJTUEJÌPGU'ZGORNCT





/CTKC 6JGTGUKC  5KNDGTPGT ,GVQP Q ,   FGT %J³VGNNGPKG XQP ;RGTP XQP   0 *G[NDTQWEM $TWUVDKNF T OKV &KCFGO FCTWPVGT FKG 5KIPCVWT *.ÌYG N J·NV OKV $·PFGTP FCU   9CRRGPFGT%J³VGNNGPKGOOI-GPKU /KPLWUVKGTVUGJTUEJÌPpXQT\ÒINKEJ



140


BELGIEN

5585

5586

5586

.ª66+%* 

#FQNH XQP FGT /CTEM  )TQU Q , .ÒVVKEJI#FNGTFGP-QRHPCEJTIGYCPFVKP #EJVRC­WPVGP9CRRGPUEJKNF-TGW\KPFQRRGNVGO5EJTKHVMTGKU/KIPQNGV  44'VYCU$GNCIHCUVUGJTUEJÌP





)GQTIXQP¤UVGTTGKEJ6CNGT*CUUGNVOKV6KVGN-CTNU8&CX&GNO 4  /KIPQNGV 4  44(CUVXQT\ÒINKEJGU'ZGORNCTOKVHGKPGT2CVKPC



5588

5587

5587



)GTJCTFXQP)TQGUDGEM4GKEJUVCNGT*CUUGNVOKV6KVGN/CZKOKNKCPU++&CX &GNO 9KP\5EJTÌVNKPIUHGJNGTUGJTUEJÌP





(GTFKPCPFXQP$C[GTP.GKEJVGT6CNGT 5VÒDGT *CUUGNV&GNO/KIPQNGV 445EJÌP



5589







5590

-CTNXQP1WNVTGOQPV5KNDGTOGFCKNNGCWHUGKPG9CJN\WO$KUEJQHXQP2,,CEQD[ $TWUVDKNF N KP IGKUVNKEJGO 1TPCV9GKDNKEJG )GUVCNV UVGJV JCNDN WPF DGHGUVKIV FGP OKV FGO (ÒTUVGPJWV   DGFGEMVGP.ÒVVKEJGT5EJKNFCPGKPGT5·WNGQDGPNUVTCJNGPFGU&TGKGEMKP9QNMGPOOI (GWCTFGPV<GRGTPKEM 44(GKPG6ÌPWPIXQT\ÒINKEJp5VGORGNINCP\



8GTIQNFGVG$TQP\GOGFCKNNGCWHUGKPG9CJN\WO$KUEJQHXQP2,,CEQD[$TWUVDKNFNKPIGKUVNK EJGO 1TPCV9GKDNKEJG )GUVCNV UVGJV JCNDN WPF DGHGUVKIV FGP OKV FGO (ÒTUVGPJWV DGFGEMVGP .ÒVVKEJGT   5EJKNF CP GKPGT 5·WNG QDGP N UVTCJNGPFGU &TGKGEM KP 9QNMGP  OO  I (GWCTFGPV    <GRGTPKEM 49KP\5EJTÌVNKPIUTK­XQT\ÒINKEJ



.QV&KXGTUG-NGKPOÒP\GPFGU,CJTJWPFGTVUUQYKG-WRHGTOÒP\GPFGT#DVGK6JQTGP  5VÒEM5EJÌPpUGJTUEJÌP

 141


BELGIEN

ex 5592

5#//.70).ª66+%* 

5GJTWOHCPITGKEJG5COONWPI.ÒVVKEJGT/ÒP\GP/GFCKNNGPWPF/CTMGPFGUDKU,CJTJWPFGTVU FCTWPVGT \CJNTGKEJG DGUUGTG 5VÒEMG &GT 5EJYGTRWPMV FGT 5COONWPI NKGIV DGK FGP -WRHGTOÒP\GP GU   UKPF CDGT CWEJ FKXGTUG 6CNGT  5VÒEM FCDGK 6CNGT    WPF 2CVCIQP FGT 5GFKUXCMCP\    WPF6GKNUVÒEMGUQYKG&GPCTGWPF)TQUEJGPGPVJCNVGP 5VÒEM5EJÌPpXQT\ÒINKEJ  9GKVGTG/ÒP\GPXQP.ÒVVKEJHKPFGP5KGWPVGTFGP0TP

5593

56#8'.16 

142

%JTKUVQRJ XQP /CPFGTUEJGKF  4GKEJUVCNGT  OKV 6KVGN /CZKOKNKCPU ++ &CX    &GNOXCT 4  45GJTUEJÌP




BELGIEN

5594



$'.)+5%*-10)1

.GQRQNF++(TCPEU-/

(CUVXQT\ÒINKEJ



ex 5595

.165$'.)+'0 

7OHCPITGKEJG5COONWPIXQP4GEJGPRHGPPKIGPÒDGTYKGIGPFCWU6QWTPCKXQO/KVVGNCNVGTDKUKPU ,CJTJWPFGTV FCTWPVGT \CJNTGKEJG XGTUEJKGFGPG 6[RGP W C +*5/QPQITCOOG 6[RG FG TQ[CWZ %QW   TQPPGUWPF6TQKUEGTENGUCXGEFGHNGWTFGNKU UQYKGGKPKIGDGUUGTG5VÒEMG*QEJKPVGTGUUCPVGU.QVFCU UKEJJGTXQTTCIGPF\WO$GIKPPQFGT#WUDCWGKPGTDGTGKVUDGUVGJGPFGP5COONWPIGKIPGVDKVVGWPDGFKPIV DGUKEJVKIGP 5VÒEM/GKUVUGJTUEJÌPWPFDGUUGT 

ex 5596



7OHCPITGKEJG 5COONWPI XQP /GFCKNNGP WPF 9CNNHCJTVU\GKEJGP KP 5KNDGT WPF WPGFNGP /GVCNNGP OGKUV   OKV$G\WI\W4GNKIKQPWPF-KTEJGÒDGTYKGIGPFCWUFGODGNIKUEJGP4CWO #PVYGTRGP$TÒUUGN&KGI JGO/CNKPGU/CNEQWTV8GTXKGTU$TWIGU)TCPF%JGXTGOQPVGVE FC\WCDGTCWEJYGKVGTGGWTQR·K UEJG/GFCKNNGPUQYKGPKGFGTN·PFKUEJG0QVOÒP\GP5GJTKPVGTGUUCPVGU.QVDKVVGDGUKEJVKIGP  5VÒEM7PVGTUEJKGFNKEJGTJCNVGPFGT)GUCOVGKPFTWEMKUVUGJTUEJÌP

 143


DÄNEMARK

5597

5598

5598

$7.)#4+'0 

$QTKU+++.GYC9KGP-/

-¤0+)4'+%* 

 5GJTUGNVGPKPFKGUGT'TJCNVWPI2QNKGTVG2NCVVG



&0'/#4-

(TGFGTKM+++6TCIDCTGQXCNG5KNDGTJQJNIW­OGFCKNNGXQP*.6CWHFGP(TKGFGP XQP-QRGPJCIGP\YKUEJGP&·PGOCTMWPF5EJYGFGP)GJCTPKUEJVGU$TWUVDKNFTOKV.QTDGGTMTCP\WPF WOIGNGIVGO/CPVGN&KGUEJYGFKUEJG*CPFITGKHVPCEJGKPGT-TQPGWPFYKTFXQPIÌVVNKEJGT*CPFOKV GKPGO5EJYGTVCDIGUEJNCIGPZOOI)CNUVGT2CZKP0WOOKU  44*GTTNKEJG2CVKPCXQT\ÒINKEJGU'ZGORNCT



5599



5RGEKGUVCNGT-QRGPJCIGPI)GJCTPKUEJVGU$TWUVDKNFTOKV.QTDGGTMTCP\WPFWOIGNGIVGO 'NGHCPVGPQTFGP)GMTÌPVGU FTGKHGNFKIGU 9CRRGP CWH -TGW\ WOJGT .QTDGGTMTCP\ WPVGP FKG 5KIPCVWT   %* %CURCT*GTDCEJ/ÒP\OGKUVGTKP-QRGPJCIGP &CX#*GFG$ 44   5GJTUGNVGPDGUQPFGTUKPFKGUGT'TJCNVWPI (GKPG2CVKPCYKP\5EJTÌVNKPIUHGJNGTNGKEJVG2T·IGUEJY·EJGXQT\ÒINKEJ 

5601 5600

5602



%JTKUVKCP8-TQPG-QRGPJCIGP&KEMUVÒEMI*GFG

5GJTUEJÌP





%JTKUVKCP8++-W2TQDGGKPGU5RGEKGUVCNGTUQ,OOI*GFG#PO 448QT\ÒINKEJ





%JTKUVKCP:-TQPG*GFG#



144

445GJTUEJÌP


FRANKREICH

5603 (Fe)

1,5:1

1,5:1

(+00.#0& 

4GRWDNKMUGKV2GPPKC2TQDGKP'KUGPI-/65  8QPITQ­GT5GNVGPJGKV5VGORGNINCP\



5605

5604



/CTMMCC*GNUKPMKCWHFKG:81N[ORKUEJG5RKGNGKP*GNUKPMK-/

 48QT\ÒINKEJ



(4#0-4'+%*/'419+0)'4

61745 

5604

&GPCT  I -QRH T)TKGEJKUEJGU -TGW\ OKV \YGK PCEJ T IGDQIGPGP *CUVGP KP \YGK 9KPMGNP LG   GKPG-WIGN$GNHQTV)TKGTUQP$NCEMDWTP 8GTDTCWEJVGT#XGTUUVGORGNUGJTUEJÌP

5606



5607

(4#0-4'+%*-#41.+0)'4 

-CTN FGT )TQ­G  &GPCT 6QWTU  I %#4.854':(4 -TGW\ 68410+5 -CTQNWU   OQPQITCOO/) 44-N(GJNUVGNNGCO4CPFUGJTUEJÌP 



.WFYKI FGT (TQOOG  &GPCT4GKOUI *.8&188+%85+/2-TGW\4'/+5 ÛÛ %+8+5/) 4*ÒDUEJG2CVKPCHCUVXQT\ÒINKEJ

5608

5609



5610



&GPCT5GPUI *.8&188+%85+/2-TGW\ 5'010'5 &TGKGEM /)  445GJTUEJÌP





2KRRKP+-ÌPKIXQP#SWKVCPKGPQFGT2KRRKP++-ÌPKIXQP#SWKVCPKGP&GPCT /GNNGI 2+2+0854':'3-TGW\ /'68..12KRRKPWUOQPQITCOO/)  45GJTUEJÌP



.QVJCT +  &GPCT &QTGUVCF  I +++16+#++85+'# -TGW\&14  '5 Û 6#  685   /)XCT 45GJTUEJÌP





2)TKGTUQPIGJVCWHITWPFFGTXGTDCNNJQTPVGP.GIGPFGWPFFGUITQDGTGP5VGORGNUEJPKVVUFCXQPCWUFC­GUUKEJDGK FGOXQTNKGIGPFGP5VÒEMWOGKPGHTKGUKUEJG+OKVCVKQPJCPFGNPMÌPPVG XIN)TKGUQP$NCEMDWTPWPF'X)GNFGT &GMCTQNKPIKUEJGOWPVUNCIVG&WWTUVGFGKP,/2  5 

145


FRANKREICH

5611



5613

5612

5614

-CTN FGT -CJNG  &GPCT /GNNG  I %#4.854': -TGW\ /'68..1 -CTQNWUOQ   PQITCOO/) 8QPITQ­GT5GNVGPJGKV7PTGIGNO·­KIG2CVKPCUGJTUEJÌP



$GKFGOXQTNKGIGPFGP6[RHGJNVFCU(4 #0%148/ CO'PFGFGT8QTFGTUGKVGPWOUEJTKHV



&GPCT/GNNGI %#4.854':(4-TGW\ /'68..1-CTQNWUOQPQITCOO/)  8QT\ÒINKEJ





&GPCT/GNNGI %#4.854':(4-TGW\ /'68..1-CTQNWUOQPQITCOO/)  &WPMNG2CVKPCXQT\ÒINKEJ





&GPCT 4GPPGU  I  )4#6+#&  +4': -CTQNWUOQPQITCOO  *4'& 4CWVG 0+5%+8+6#5   -TGW\/) 5GJTUEJÌPpXQT\ÒINKEJ



5615

5616



&GPCT5V&GPKUI %4#6+#&+4':-CTQNWUOQPQITCOO 5%+D+1085++/-TGW\/) 5GJTUEJÌP





1FQ  &GPCT .KOQIGU  I  )4#6+#&+4' WPF 1&1 \YKUEJGP \YGK -TGW\GP    .+/18+%#5%+8+5-TGW\/) (CUVXQT\ÒINKEJ



5617

1,5:1



1,5:1

4CQWN&GPCT$TKQWFGI4#&8.(854':-TGW\KPFGP9KPMGNPLGGKP&TGKGEM  $4+8+6'5-CTQNWUOQPQITCOO/)  8QPITÌ­VGT5GNVGPJGKV8GTOWVNKEJGKP\KIGUDGMCPPVGU'ZGORNCT8QT\ÒINKEJ  4CQWN   YCT UGKV  OKV 'OOC GKPGT 6QEJVGT -ÌPKI 4QDGTVU +   XGTJGKTCVGV 0CEJFGO   4QDGTV DGK GKPGO &WGNN KP FGT 0·JG XQP 5QKUUQPU WOU .GDGP MCO YWTFG 4CQWN \WO -ÌPKI FGU YGUVHT·PMKUEJGP   4GKEJGU IGY·JNV 5GKPG 4GIKGTWPIU\GKV YCT IGRT·IV FWTEJ CPJCNVGPFG -QPHNKMVG OKV FGP )TQ­GP FGU 4GKEJGU WPF   FWTEJ FGP #DHCNN.QVJTKPIGPUFGUUGP*GT\QI)KUGNDGTV  UKEJFGOQUVHT·PMKUEJGP-ÌPKI*GKPTKEJ+   WPVGTYCTH&GTXQTNKGIGPFG6[RQTKGPVKGTVUKEJCPFGP2T·IWPIGPFGU)TCHGP)WKNNCWOG++XQPFGT#WXGTIPG

  CWU $TKQWFG XIN &WRNGUU[  KOOQDKNKUKGTV &WRNGUU[   .GFKINKEJ FGT 0COG FGU /ÒP\JGTTGP   KUV XQP 8.'./1 %1/5 KP 4#&8.(85 4': IG·PFGTV YQTFGP 5ÒFNKEJ FGT .QKTG UKPF XQP 4CQWN CPUQPUVGP PWT   PQEJ/ÒP\GPCWU$QWTIGU /) #PIQWN¿OG /) WPF.G2W[ /) DGMCPPV

146


FRANKREICH

5618

-¤0+)4'+%* 

5619

5620

(4#0-4'+%*

2JKNKRRG+8NG$GN)TQUVQWTPQKU¯N 1NQPIQ,  I-TGW\WOJGT\YGK <GKNGP5EJTKHV-CUVGNNWOJGT-TGKUXQP.KNKGP&WRNGUU[ -N2T·IGUEJY·EJGUGJTUEJÌP



(TCP¼QKU+6GUVQPQ,6[R2CTKU&WRNGUU[



6GUVQPFW&CWRJKP¾Q, PCEJ 6[R4QOCPU/KVGKPGO(ÒDGTFGO9CRRGPFGT4ÒEMUGKVG &WRNGUU[# 45GJTUEJÌP

-PCRRGT5EJTÌVNKPIUGJTUEJÌP

  

5621



.QWKU:+++5KNDGTOGFCKNNGWPUKIPKGTVXQP0$TKQVCWHFGP9KGFGTCWHDCWFGU2QPV 5CKPV /KEJGN )GJCTPKUEJVGU $TWUVDKNF T OKV .QTDGGTMTCP\ WPF .ÌYGPMQRH CWH FGT 5EJWNVGT#PUKEJV   FGT$TÒEMGOOI,QPGU++ 448QT\ÒINKEJGU'ZGORNCTOKVHGKPGT2CVKPC  &KG CNVG *QN\DTÒEMG YWTFG CO  ,CPWCT  FWTEJ 'KU \GTUVÌTV .QWKU :+++ NGIVG CO  5GRVGODGT  FGP   )TWPFUVGKPHÒTGKPGPGWGUVCDKNGTG5VGKPDTÒEMG

5622



$TQP\GIW­OGFCKNNGXQP,9CTKPCWHUGKPGP/KPKUVGTWPFGPIGP$GTCVGT#TOCPF,GCPFW2NGUUKU -CTFKPCN4KEJGNKGW$TWUVDKNFFGU-CTFKPCNUT'TFMWIGNWOJGTGKP4KPIOKV5VGTPGPFGT XQPGKPGOIGHNÒIGNVGP)GPKWUIGJCNVGPYKTFOO,QPGU++  5GJTUEJÌPGT\GKVIGPÌUUKUEJGT)W­

 147


FRANKREICH

5624

5623



.QWKU:+8'EW¯NCO½EJGEQWTVG#2CTKU&WRNGUU[)CFQWT[  *ÒDUEJG2CVKPCXQT\ÒINKEJ





'EW¯NCO½EJGEQWTVG#2CTKU&WRNGUU[)CFQWT[  *ÒDUEJG2CVKPCXQT\ÒINKEJp5VGORGNINCP\



5625



5625

1,5:1

'EW¯NCETCXCVG#2CTKUI)GJCTPKUEJVGU$TWUVDKNFTOKVWOIGNGIVGO/CPVGNWPF*CNU VWEJ)GMTÌPVGU9CRRGP&CX&WRNGUU[)CFQWT[  5GJTUGNVGPKPFKGUGT'TJCNVWPI2TCEJVGZGORNCTXQPUEJÌPUVGT'TJCNVWPI5VGORGNINCP\ &KGUGUWPFFCUHQNIGPFG5VÒEMYGTFGPCWEJCNU'EWFW2CTNGOGPVDG\GKEJPGV

5626

5628



5627



'EW¯NCETCXCVG/ÒP\\GKEJGP4GPPGU&CX&WRNGUU[)CFQWT[  5GNVGPKPFKGUGT'TJCNVWPI,WUVKGTVXQT\ÒINKEJ





'EWCWZVTQKUEQWTQPPGU54GKOU&CX&WRNGUU[)CFQWT[  #VVTCMVKXGU'ZGORNCTOKVJGTTNKEJGT2CVKPCOKPLWUVKGTVXQT\ÒINKEJ





.QWKU:8'EWCWZTCOGCWZF QNKXKGT:#OKGPU&WRNGUU[)CFQWT[ 5GJTUEJÌPpXQT\ÒINKEJ



148


FRANKREICH

5629

5630

5632



%QPXGPVKQP.KXTGU#0++#2CTKU&CX)CFQWT[/C\CTF  *GTTNKEJG2CVKPCNGKEJVLWUVKGTVXQT\ÒINKEJGU'ZGORNCT





0CRQN¾QP+(TCPEU44QO&CX)CFQWT[/C\CTFC  44-N4CPFHGJNGTWPF-TCV\GTUGJTUEJÌP





.QWKU2JKNKRRG-W%GPVKOGU2TQDG 'UUCK XQP,,$CTTGOOWPFI -W%GPVKOGU2TQDG 'UUCK XQP,,$CTTGOOWPFI&C\W4GRWDNKM -W%GPVKOGUQ,2TQDG 'UUCK XQP'4QICVOOWPFI/C\CTF 5VÒEM8QT\ÒINKEJp5VGORGNINCP\





0CRQN¾QP+++(TCPEU#2CTKU2TQDG 'UUCK KP5KNDGTI/C\CTF  8QPITQ­GT5GNVGPJGKV8QT\ÒINKEJGU'ZGORNCTOKVHGKPGT2CVKPC



5633 (Piéfort)



 4GRWDNKM   (TCPEU Q ,   &KEMCDUEJNCI 2K¾HQTV  GKPGT 2TQDG 'UUCK  KP 5KNDGT   I$TWUVDKNFFGUHTCP\ÌUKUEJGP5VCCVUOCPPGU.¾QP)CODGVVCN)GPKWUUEJTGKDV%1056+676+10 CWHGKPG6CHGN/C\CTFD  8QPITQ­GT5GNVGPJGKV9KP\4CPFHGJNGTXQT\ÒINKEJGU'ZGORNCTOKVHGKPGT2CVKPC  .¾QP)CODGVVCYWTFGCO#RTKNCNU5QJPGKPGU-CWHOCPPUCWU)GPWCWPFGKPGT/WVVGTCWUFGT)CUEQIPGKP %CJQTUIGDQTGPPCJOGTFKGHTCP\ÌUKUEJG5VCCVUDÒTIGTUEJCHVCPWPFYWTFG#PYCNV+O,CJTGIGYCPPGT GKPGP 5KV\ KP FGT 0CVKQPCNXGTUCOONWPI WPF URTCEJ UKEJ CNU #PJ·PIGT FGT TGRWDNKMCPKUEJGP /KPFGTJGKV  IGIGP   FGP &GWVUEJ(TCP\ÌUKUEJGP -TKGI CWU #O  5GRVGODGT TKGH GT \WUCOOGP OKV ,WNGU (CXTG FKG ō&TKVVG 4GRWDNKMŋ   CWUFGTGPGTUVGT+PPGPOKPKUVGTGTYWTFG)CODGVVCMQPPVGFCUXQPFGPFGWVUEJGP6TWRRGPDGNCIGTVG2CTKUKPGKPGO $CNNQP XGTNCUUGP WO GKPG #TOGG \WO 'PVUCV\ FGT *CWRVUVCFV \WUCOOGP\WUVGNNGP 5GKP 2NCP UEJGKVGTVG LGFQEJ   1DYQJN2CTKUCO,CPWCTMCRKVWNKGTGPOW­VGURTCEJGTUKEJXGJGOGPVHÒTGKPG(QTVUGV\WPIFGU-TKGIGUCWU YGUJCNDOCPKJPCWEJCNUHQWHWTKGWZ ō\QTPKIGP8GTTÒEMVGPŋ DG\GKEJPGVG0CEJFGO-TKGIXGTVTCVGTGKPG2QNKVKM FGU 4GXCPEJKUOWU IGIGPÒDGT FGO &GWVUEJGP -CKUGTTGKEJ WPF UGKP /QVVQ YWTFG ō+OOGT FCTCP FGPMGP CDGT PKG   FCXQP URTGEJGPŋ 'T UVCTD CO  &G\GODGT  PCEJFGO KJP GKP 2KUVQNGPUEJW­ CP FGT *CPF XGTNGV\V JCVVG CP   GKPGT$NWVXGTIKHVWPIņQHHK\KGNNDGKFGT4GRCTCVWTUGKPGT2KUVQNG

.16(4#0-4'+%* 

+PVGTGUUCPVG5COONWPIHTCP\ÌUKUEJGT/ÒP\GPXQO/KVVGNCNVGTDKUKPU,CJTJWPFGTVXQO2HGPPKIDKU \WO'EWFCTWPVGT0CRQNGQP+++(TCPEU# Z 5EJÌPGU-QPXQNWVFCUDGUKEJVKIVYGTFGPUQNNVG 5VÒEM'KPKIGOKVMN(GJNGTPOGKUVUGJTUEJÌP

 149


FRANKREICH

5636

5635

5635

(4#0-4'+%*('1&#.'5

$'#40 

*GPTK++(TCPE&WRNGUU[

45GJTUEJÌP



(4#0-4'+%*'.5#55 

*#)'0#74'+%*5/ª0<5666'

(TKGFTKEJ ++  2HGPPKI  I 4QUG)GD·WFG OKV FTGK 6QTGP WPF FTGK 6ÒTOGP FG /G[   'PIGN.GJT0GUUGN5NI*QJGPUVCWHGP\GKV 5GJTUEJÌP



5637

/74$#%*70&.ª&'45#$6'+ 

.GQRQNFXQP¤UVGTTGKEJCNU#FOKPKUVTCVQT6CNGTQ,'PUKUJGKO&KXQXCT  449KP\5EJTÌVNKPIUHGJNGTUGJTUEJÌP

1,5:1



5638



1,5:1

564#55$74)$+567/

#PQP[O 2HGPPKI WO   I $TWUVDKNF FGU $KUEJQHU OKV -TWOOUVCD N<YGK GKPCPFGT \WIG   YCPFVG(KIWTGPJCNVGP-TGW\UVCD'PIGN.GJTFG/G[0GUUGN 448QT\ÒINKEJ



&GT XQTNKGIGPFG 6[R XQP FGO PWT YGPKIG 'ZGORNCTG DGMCPPV UKPF MQOOV YGFGT DGK 0GUUGN PQEJ DGK 'PIGN    .GJTXQT'KPGGTUVG#DDKNFWPIWPF$GUEJTGKDWPIFWTEJ*$WEJGPCWHKPFGVUKEJKPFGP$N·VVGTPHÒT/ÒP\HTGWPFG :8  55VKNKUVKUEJGJPNKEJMGKVGP\W0GUUGNWPFNCUUGPGKPG2T·IWPIKPQFGTWO5VTC­DWTIXGT OWVGP

5639



5640

5641

2HGPPKI.COOFGPCTI)GD·WFGOKV-WIGNMTGW\KO2QTVCNFCTÒDGT.COOOKV-TGW\ UVCD \YKUEJGP \YGK 4QUGVVGP$KUEJQH OKV -TWOOUVCD N FCXQT MNGKPGTG (KIWT OKV $WEJ 'PIGN.GJT   FG/G[0GUUGN 45GJTUEJÌP





2HGPPKII$TWUVDKNFFGU$KUEJQHUNOKV-TGW\WPF-TWOOUVCD/CWGTOKV2QTVCNWPF 6WTO\YKUEJGP\YGK5VGTPGP'PIGN.GJTFG/G[0GUUGN 5GJTUEJÌPpXQT\ÒINKEJ





2HGPPKI1HHGPDWTII$TWUVDKNFFGU-ÌPKIUNOKV-TGW\WPF4GKEJUCRHGN/CWGTOKV 2QTVCNWPF6WTO\YKUEJGP\YGK5VGTPGP'PIGN.GJTFG/G[0GUUGN (CUVXQT\ÒINKEJ



150


FRANKREICH

5643

5642



2HGPPKI1HHGPDWTII-ÌPKITGKVGVTOKV5EJYGTV-KTEJGPIGD·WFGOKVFTGK-TGW\GP 'PIGN.GJTFG/G[0GUUGN 5GJTUEJÌPpXQT\ÒINKEJ





2HGPPKI5EJYCT\CEJCO4JGKP ! I$TWUVDKNFFGU#DVGUNOKV5EJNÒUUGNWPF$WEJ -KTEJGPIGD·WFGOKVFTGK-TGW\GP'PIGN.GJTFG/G[0GUUGN 445GJTUEJÌPpXQT\ÒINKEJ



&CUXQTNKGIGPFG'ZGORNCTMÌPPVGGKPG2T·IWPIFGT$GPGFKMVKPGTCDVGK5EJYCT\CEJCO4JGKPKO'KP\WIUDGTGKEJFGT 5VTC­DWTIGT /ÒP\UV·VVG UGKP &KG #DVGK GTJKGNV  FWTEJ -CKUGT 1VVQ +++   FCU /ÒP\TGEJV /)*   &1+++ 0T   YGNEJGU  DGUV·VKIV YWTFG &CU -NQUVGT YCT FGO *N 2GVTWU IGYKFOGV YCU FKG &CTUVGNNWPI   FGUUEJNÒUUGNVTCIGPFGP#DVGUGTMN·TGPMÌPPVG XIN5NI(ÒTUVGPDGTI#WMVKQP%CJP0T 

5645

5644

5644

564#55$74)56#&6 

6CNGT-CPQPGPVCNGTI-CPQPGKP.CPFUEJCHVKO*KPVGTITWPF<GNVQDGPFCU5VTC­DWTIGT 9CRRGP\WFGP5GKVGP.KNKG&CX'PIGN.GJT  445EJÌPG2CVKPCUGJTUEJÌPpXQT\ÒINKEJ



6*#0056#&6 

2NCRRCTVQ, WO 'PIGN.GJT

4<WO6GKNGVYCUUEJYCEJCWUIGRT·IVUGJTUEJÌP

5646

5647

5646 1,5:1





$TCMVGCV <YG[NKPI PCEJFGO8GTVTCIXQPI)GMTÌPVGU9CRRGP\YKUEJGP6#$N·VVGT HÒT/ÒP\HTGWPFG5RCNVG 8QPITQ­GT5GNVGPJGKV-N4CPFTK­HCUVXQT\ÒINKEJ



'ZGORNCTFGT5COONWPI&QNKXQ#WMVKQP/ÒP\GPWPF/GFCKNNGP#)$CUGN0T



*QJNRHGPPKI 4CRRGP PCEJFGO8GTVTCIXQPI5NI9ÒVJTKEJG



5649

5648

*'4<1)67/

5GJTUEJÌP

(4#0-4'+%*.16*4+0)'0



#PVQP6GUVQP0CPE[(NQP *GTXQTTCIGPFGU4GPCKUUCPEGRQTVT·V -NGKPG4GUVGXQP)TÒPURCPCVVTCMVKXGUHCUVXQT\ÒINKEJGU'ZGORNCT





-CTN+8\WOGTUVGP/CN6GUVQP0CPE[(NQP



*ÒDUEJG2CVKPCUGJTUEJÌP

151


GRIECHENLAND

5651

ex 5650

(4#0-4'+%*-1.10+'0 %1.10+'5)'0'4#.'5 

%JCTNGU :  -W %GPVKOGU  # -W %GPVKOGU  # DGKFG /ÒP\UV·VVG 2CTKU   2T·IWPIGPHÒT)W[CPCWPFFGP5GPGICN.GEQORVG/C\CTF 5VÒEM8QT\ÒINKEJ



-#0#&# 

.QWKU :8  5KNDGTLGVQP  XQP ( /CTVGCW )GJCTPKUEJVG $ÒUVG T OKV .QTDGGTMTCP\   &CU5EJKHHFGT#TIQPCWVGPCWHJQJGT5GGCO/CUVFCU)QNFGPG8NKGUOOI.GEQORVG 8QT\ÒINKEJ



(4#0<¤5+5%*+0&1%*+0# 

7OHCPITGKEJGT $GUVCPF XQP   WPF  %GPV5VÒEMGP FGU <GKVTCWOGU  FCTWPVGT DGUUGTG   ,CJTI·PIGWCZ%GPV UKE *QEJKPVGTGUUCPVGT2QUVGPDKVVGDGUKEJVKIGP  5VÒEM5GJTUEJÌPpHCUV5VGORGNINCP\ 

5653

5654

5655

)7;#0# 

.QWKU:8+++%GPVKOGU#2CTKU.GEQORVG/C\CTF  (CUV5VGORGNINCP\



+.'&'.#4'70+10 

(TCPMTGKEJ4GRWDNKM%GPVKOGU DQPRQWT .GEQORVG/C\CTF  5GJTUEJÌPpXQT\ÒINKEJ



0178'..'%#.—&10+' 0GWMCNGFQPKGP  

(TCPEU&KIGQP%Q5QEKGV¾(TCPEQ#WUVTCNKGPPGKP)QOGP.GEQORVG  8QPITQ­GT5GNVGPJGKV8QT\ÒINKEJ



5658 5660

5656

)4+'%*'0.#0& 

,QJCPPGU-CRQFKUVTKCU2T·UKFGPV2JÌPKZIKPC&KXQ  49KP\4CPFHGJNGTUGJTUEJÌP



-W.GRVCIKPC-W.GRVCIKPC&KXQ  5VÒEM-N4CPFHGJNGTHCUVUGJTUEJÌP



  

-W.GRVQPIKPC&KXQ 5GJTUEJÌP -W.GRVCIKPC-W.GRVCIKPC&KXQ 5VÒEM-N4CPFHGJNGTUGJTUEJÌP -W.GRVQPIKPC&KXQ <CKPGPFGXQT\ÒINKEJ

  

152




GRIECHENLAND

5661

5662

5662



1VVQ+&TCEJOG#VJGP&KXQC

5GJTUEJÌP





&TCEJOGP/ÒPEJGP&CX&KXQC  9KP\5EJTÌVNKPIUHGJNGTCO4CPFXQT\ÒINKEJp5VGORGNINCP\



5664

5663

 

5663

&TCEJOGP/ÒPEJGP&CX&KXQC &TCEJOG/ÒPEJGP&KXQE

.GKEJVDGTKGDGPXQT\ÒINKEJ /KP4·PFGNWPIUHGJNGTXQT\ÒINKEJp5VGORGNINCP\

 

5665

5667

5666

  

&TCEJOG/ÒPEJGP&KXQC -W.GRVC/ÒPEJGP&KXQC -W.GRVC/ÒPEJGP&KXQC

5668

8QT\ÒINKEJ 8QT\ÒINKEJ 2TCEJVGZGORNCT-N5EJTÌVNKPIUHGJNGT5VGORGNINCP\

5669

5670

  

5671



-W.GRVC/ÒPEJGP&KXQD



-W.GRVQP/ÒPEJGP&KXQD  5GNVGPKPFKGUGT'TJCNVWPI2TCEJVGZGORNCT(CUV5VGORGNINCP\

8QT\ÒINKEJ



 

-W.GRVQP#VJGP&KXQC )GQTI+.GRVC#2CTKU&KXQC

 

-N5EJTÌVNKPIUHGJNGTXQT\ÒINKEJ (CUV5VGORGNINCP\



153


GROSSBRITANNIEN

5672

5673



5673

&TCEJOGP#2CTKU&CX&KXQC

(CUVXQT\ÒINKEJ



-4'6# 

7PVGT VÒTMKUEJGT *GTTUEJCHV  $TQP\GOGFCKNNG Q ,    WPUKIPKGTV CWH FGP #WHUVCPF   IGIGP FKG VÒTMKUEJG *GTTUEJCHV 2JÌPKZ XQP (NCOOGP WOIGDGP GPVUVGKIV FGT #UEJG2TKGUVGT OKV   (CEMGN WPF -TGW\ GPV\ÒPFGV FCU 2WNXGTHCUU KO -NQUVGT #TMCF WOJGT /ÒVVGT OKV -KPFGTP  OO   9WT\DCEJ 448QT\ÒINKEJ



.16)4+'%*'0.#0& 

-NGKPG5COONWPIXQP/ÒP\GPFGU,CJTJWPFGTVUFCTWPVGTCWEJDGUUGTG6[RGPWPF,CJTI·PIGW C  &TCEJOGP  #  &TCEJOGP  &TCEJOG    &TCEJOG  -W .GRVC   -W.GRVCGVE*QEJKPVGTGUUCPVGU.QVDKVVGDGUKEJVKIGP 5VÒEM5EJÌPpXQT\ÒINKEJ

5675

9+-+0)'4&#0'.#9 

5676

)4155$4+6#00+'0

0QTVJWODTKC2GPP[I5KGHTGF%PWV)TQWR;QTMc%80Ð0'6Ð6+Ð-TGW\N QDGP WPF T WPVGP LG GKP 2WPMV2CVTKCTEJCNMTGW\ CP FGP $CNMGPGPFGP Ð %086 FC\YKUEJGP 4' Ð :   0QTVJ5GCD[ 44*ÒDUEJG6ÌPWPIUGJTUEJÌPpXQT\ÒINKEJ



2GPP[  I 5KGHTGF%PWV)TQWR ;QTM c %+8 Ð +06 Ð 6 Ð + -TGW\ N QDGP WPF T WPVGP LG GKP   2WPMV2CVTKCTEJCNMTGW\CPFGP$CNMGPGPFGPÐ%086FC\YKUEJGP4':0QTVJ5GCD[  445GJTUEJÌPpXQT\ÒINKEJ



+O8GTVTCIXQP9GFOQTG  OW­VG#NHTGFFGT)TQ­GFGP5MCPFKPCXKGTPDGVT·EJVNKEJG)GDKGVG$TKVCPPKGPUCDVTG VGPFKGCNU&CPGNCYDG\GKEJPGVYGTFGP





5677

 154

'0).#0&

'FYCTF8+%TQYP5QWVJYCTM&CX5GCD[

4(CUVUGJTUEJÌP




GROSSBRITANNIEN

5679

5680

5678



5JKNNKPI 2GPEG Q,  .QPFQP/ÒP\\GKEJGP(C­5GCD[

(CUVUGJTUEJÌP





%QOOQPYGCNVJ)TQCVQ,.QPFQP 6QYGTOKPV 5GCD[  2TCEJVGZGORNCT(CUV5VGORGNINCP\





5KZRGPEG.QPFQP 6QYGTOKPV /ÒP\\GKEJGP5QPPG5GCD[



8'4'+0+)6'5-¤0+)4'+%*

5681



'VYCUIGYGNNVUGJTUEJÌP

5682 5681

%TQYP 5JKNNKPIU .QPFQP 6QYGTOKPV /ÒP\\GKEJGP5QPPG&CX5GCD[  445GJTCVVTCMVKXGU'ZGORNCTOKVJGTTNKEJGT2CVKPCHCUVXQT\ÒINKEJ



5EJQP WPVGT 'NK\CDGVJ + JCVVG UKEJ GKP NCDKNGU 8GTJ·NVPKU \YKUEJGP -TQPG WPF 2CTNCOGPV URG\KGNN \YKUEJGP -TQPG   WPF 7PVGTJCWU GPVYKEMGNV &KGUG 5RCPPWPIGP XGTUV·TMVGP UKEJ GTJGDNKEJ Y·JTGPF FGT *GTTUEJCHV FGT DGKFGP GTUVGP   5VWCTVMÌPKIG ,COGU + WPF %JCTNGU + FKG UKEJ KP UV·PFKIGT (KPCP\PQV DGHCPFGP WPF FCJGT CWH FKG $GTGKVUVGNNWPI   \WU·V\NKEJGT /KVVGN FWTEJ FCU 7PVGTJCWU CPIGYKGUGP YCTGP &CU 2CTNCOGPV URCNVGVG UKEJ \W #PHCPI FGT GT ,CJTG   FGU  ,CJTJWPFGTVU KP FKG MÌPKIUVTGWGP -CXCNKGTG FKG UR·VGTGP 6QTKGU  WPF FKG 4WPFMÌRHG FKG UR·VGTGP 9JKIU    FKGFKG#WHHCUUWPIXQOIÌVVNKEJGP4GEJVFGT-ÌPKIGKP(TCIGUVGNNVGP'UMCO\WT2WTKVCPKUEJGP4GXQNWVKQPWPF\WO ITQ­GP$ÒTIGTMTKGI0CEJFGO5KGIFGU2CTNCOGPVUJGGTGUYWTFG'PINCPFCO/CK\WGKPGOHTGKGP%QO OQPYGCNVJGTMN·TVGKPGTXQPGKPGOMÌRHKIGP5VCCVUTCVTGIKGTVGP4GRWDNKM#WEJCWHFGTJKGTCPIGDQVGPGPUGNVG PGP %TQYP MQOOV FGT RQNKVKUEJG 7OUEJYWPI \WO #WUFTWEM &KG 7OUEJTKHV KUV GPINKUEJ .CVGKPKUEJG .GIGPFGP   YWTFGPCNUÒDGTVTKGDGPG2CRUVVTGWGCPIGUGJGP



%TQYP.QPFQP 6QYGTOKPV /ÒP\\GKEJGP5QPPG5GCD[

-TCV\GTUGJTUEJÌP



5683



1NKXGT%TQOYGNN%TQYP ,CJTGU\CJNKO5VGORGNCWUIG·PFGTV .QPFQP 6QYGT OKPV   I $TWUVDKNF N OKV .QTDGGTMTCP\ WPF WOIGNGIVGO /CPVGN)GMTÌPVGU XKGTHGNFKIGU 9CR   RGPOKV/KVVGNUEJKNF/KV4CPFUEJTKHV&CX5GCD[  44*GTTNKEJG2CVKPCÒDNKEJGT5VGORGNHGJNGTXQT\ÒINKEJGU'ZGORNCT  &WTEJ FCU +PUVTWOGPV QH )QXGTPOGPV XQO  &G\GODGT  YWTFG FGT (ÒJTGT FGU 2CTNCOGPVUJGGTGU 1NKXGT   %TQOYGNNCNU.QTF2TQVGMVQT\WO#NNGKPJGTTUEJGTGTPCPPV0GDGPKJOGZKUVKGTVGP5VCCVUTCVWPF2CTNCOGPVFCUDCNF 1RRQUKVKQPÒDVGWPFFKG#DNGJPWPIFGUPGWGP5[UVGOUFWTEJITQ­G$GXÌNMGTWPIUVGKNGGTMGPPGPNKG­+O,CPWCT YWTFG FCU 2CTNCOGPV CWHIGNÌUV WPF %TQOYGNN DGICPP GKPG /KNKV·TFKMVCVWT 6TQV\ FGT GTPGWVGP 'KPDGTWHWPI FGU   2CTNCOGPVU WPF FGT 'TPGPPWPI \WO .QTF2TQVGMVQT CWH .GDGPU\GKV IGTKGV 1NKXGT %TQOYGNN  KP +UQNCVKQP XQP   RTCMVKUEJ CNNGP RQNKVKUEJIGUGNNUEJCHVNKEJGP )TWRRGP -WT\ XQT UGKPGO 6QF CO  5GRVGODGT  GTPCPPVG %TQO   YGNN UGKPGP WPH·JKIGP 5QJP 4KEJCTF \WO 0CEJHQNIGT FGT UKEJ LGFQEJ PWT GKP JCNDGU ,CJT CP FGT 4GIKGTWPI JCNVGP   MQPPVG #WH FGT XQTNKGIGPFGP 2QTVT·VOÒP\G YKTF 1NKXGT %TQOYGNN CNU TÌOKUEJGT-CKUGTFTCRKGTVWPFOKV.QTDGGT MTCP\FCTIGUVGNNV&KG.GIGPFGKUVYKGFGTNCVGKPKUEJWPFCWHFGT4ÒEMUGKVGDGHKPFGVUKEJFGT9CJNURTWEJFGU.QTF 2TQVGMVQTU 2#: 38“4+684 $'..1 &GT (TKGFG DGMNCIV FGP -TKGI  OKV FGO FKG $GGPFKIWPI FGU $ÒTIGTMTKGIU   WPFFGTGTNCPIVG(TKGFGDGUEJYQTGPYKTF

155


GROSSBRITANNIEN

5685

5686

5684

5684



%JCTNGU++%TQYP.QPFQP/KV4CPFUEJTKHV&CX'KOGT5GCD[  -N4CPFHGJNGTHCUVUGJTUEJÌPUGJTUEJÌP





(CTVJKPI2TQDGKP5KNDGTI*CYMKPU6H:.+:X.QQP++5

45GJTUEJÌP





(CTVJKPI2TQDGKP5KNDGTI*CYMKPU6H:.+:X.QQP++5

4(CUVUGJTUEJÌP



&KG 2T·IWPI IGUEJCJ CPN·­NKEJ FGT ªDGTOCEJV FGT GPINKUEJGP (NQVVG KO *QNN·PFKUEJGP -TKGI 'U JCPFGNV UKEJ WO   GKPG2TQDGHÒTGKPGP(CTVJKPIFGTGTUVCDIGRT·IVYWTFG

5687

5688



%TQYP 4GIKGTWPIULCJT .QPFQP/KV4CPFUEJTKHV&CX5GCD[  #VVTCMVKXGU'ZGORNCTOKVJGTTNKEJGT2CVKPCUGJTUEJÌP





%TQYP 4GIKGTWPIULCJT .QPFQP/KV4CPFUEJTKHV&CX5GCD[  *ÒDUEJG2CVKPCYKP\4CPFHGJNGTUGJTUEJÌP



5689

5690

5690



9KNNKCO+++WPF/CT[%TQYP 4GIKGTWPIULCJT .QPFQP/KV4CPFUEJTKHV&CX 5GCD[ 9KP\4CPFHGJNGTHCUVUGJTUEJÌPUGJTUEJÌP





5KNDGTOGFCKNNGXQP,XCP&KUJQGEMGCWHFGP6QFUGKPGT)GOCJNKP/CT[$TWUVDKNF/CT[ UNOKV WOIGNGIVGO /CPVGN'KP OKV 2CNO WPF .QTDGGT\YGKIGP IGUEJOÒEMVGT 6QVGPMQRH CWH #NVCT OKV +P   UEJTKHVKO8QTFGTITWPF-TÌPWPIUKPUKIPKGPKO*KPVGTITWPF5CTMQRJCIWPF<[RTGUUGPQDGPCO*KO OGNGKPGUVTCJNGPFGT5VGTPGPMTCP\KP9QNMGPOOI'KOGT*CYMKPU6H%X.QQP +85 4*GTTNKEJG2CVKPCXQT\ÒINKEJ



156


GROSSBRITANNIEN

5692

5693

5691

5691

  

9KNNKCO+++5KNDGTOGFCKNNGWPUKIPKGTVXQP,)5QTDGTIGTCWHFKG0CVKQPCNG8GTGK PKIWPI )GJCTPKUEJVGU $TWUVDKNF T'PIGN OKV 6TQORGVG WPF 5EJTKHVDCPF ÒDGT 'TFDCNN  OO   I'KOGT*CYMKPU6H%+80T -N4CPFHGJNGTMN-TCV\GTXQT\ÒINKEJ 2GPEG.QPFQP5GCD[ 2TCEJVGZGORNCT*GTTNKEJG2CVKPCHCUV5VGORGNINCP\

 

5KNDGTCDUEJNCIXQPFGP5VGORGNPFGU-W(CTVJKPI5GCD[\W  44-N2TQDKGTURWTCO4CPFUGJTUEJÌP



5694

5695



#PPG%TQYP 4GIKGTWPIULCJT .QPFQP/KV4CPFUEJTKHV&CX5GCD[ *ÒDUEJG2CVKPCMN4CPFHGJNGTUGJTUEJÌP





%TQYP 4GIKGTWPIULCJT ''FKPDWTIJ/KV4CPFUEJTKHV&CX5GCD[  4-N5EJTÌVNKPIUHGJNGTUGJTUEJÌP



5696

5697

5698



)GQTIG +  %TQYP  ,CJTGU\CJN KO 5VGORGN CWU  IG·PFGTV  4GIKGTWPIULCJT    .QPFQP/KV4CPFUEJTKHV&CX5GCD[ *ÒDUEJG2CVKPCHCUVUGJTUEJÌP





%TQYP 4GIKGTWPIULCJT .QPFQP/KV4CPFUEJTKHV&CX5GCD[  4*ÒDUEJG2CVKPCHCUVUGJTUEJÌP





)GQTIG++%TQYP 4GIKGTWPIULCJT .QPFQP/KV4CPFUEJTKHV&CX5GCD[ *ÒDUEJG2CVKPC5EJTÌVNKPIUHGJNGTCO4CPFUGJTUEJÌP

 157


GROSSBRITANNIEN

5699

5700

5700



%TQYP 4GIKGTWPIULCJT .QPFQP/KV4CPFUEJTKHV&CX5GCD[  -N4CPFHGJNGTYKP\-TCV\GTUGJTUEJÌP



)GQTIG+++-W2GPP[2TQDGI/KV4CPFUEJTKHV-/2P#5GCD[ 44CPFHGJNGTUGJTUEJÌP

5701



5702

5703

 

5704

$TQP\GOGFCKNNG  WPUKIPKGTV CWH FKG 8QTXGTJCPFNWPIGP \WO (TKGFGP XQP #OKGPU &GT GPINKUEJG   9CRRGPUEJKNFCWH\YGKIGMTGW\VGP&GIGPWOJGT5EJTKHV2CZUVGJVTCPGKPGO*CHGPMCKWPFUEJÒVVGV OKVKJTGT.KPMGPGKP(ÒNNJQTPCWUKPFGT4GEJVGPGKPGP¤N\YGKIKO*KPVGTITWPF5EJKHHGOO 'KOGT5NI,WNKWU2CZKP0WOOKU (CUVXQT\ÒINKEJ 5JKNNKPIU $CPMFQNNCT .QPFQP&CX5GCD[ *GTTNKEJG2CVKPCXQT\ÒINKEJ

 



5JKNNKPIU$CPM6QMGP5GCD[5GCD[ $TKVKUJ6QMGPU $6  2CVKPCYKP\4CPFHGJNGTXQT\ÒINKEJ





2GPEG$CPM6QMGP5GCD[5GCD[ $TKVKUJ6QMGPU $6





8QT\ÒINKEJ

5705



158

/GUUKPI5VGEMFQUGQ, PCEJ XQP6JQOCUQP,QPGU<[NKPFTKUEJGT-QTRWUOKVFGT#WHUEJTKHV $TKVKUJ 8KEVQTKGU KP VJG 2GPKPUWNC FCTKP  /GUUKPI/KPKCVWTOGFCKNNGP CWH FKG 5KGIG FGT DTKVKUEJGP   #TOGGCWHFGTKDGTKUEJGP*CNDKPUGNY·JTGPFFGT0CRQNGQPKUEJGP-TKGIG+O&GEMGNDGHKPFGVUKEJGKPG /KPKCVWTOGFCKNNG OKV FGO 2QTVT·V FGU DTKVKUEJGP )GPGTCNU 9GNNKPIVQP WPF FGT 7OUEJTKHV /CTSWKU QH   9GNNKPIVQPGKPGYGKVGTG/GFCKNNGOKVFGTUKGDGP\GKNKIGP5EJTKHV(+456$#66.'21467)#. #7)  .#56 $#66.'  (4#0%'  #2 KUV KP FGP $QFGP GKPIGNCUUGP  *ÌJG   OO&WTEJOGUUGTOO)GYKEJVI5GCD[+5  5VÒEM5GJTKPVGTGUUCPVGUJKUVQTKUEJGU&QMWOGPVXQT\ÒINKEJ




GROSSBRITANNIEN

5707

5706

5706



5JKNNKPIU$CPM6QMGP5GCD[5GCD[ $TKVKUJ6QMGPU $6

8QT\ÒINKEJ





2GPEG 5JKNNKPI2GPEG $CPM6QMGP5GCD[5GCD[ $TKVKUJ6QMGPU $6  8QT\ÒINKEJ



5708

5709

5711

5710



%TQYP.QPFQP5GCD[

5EJÌPG2CVKPCYKP\2T·IGUEJY·EJGXQT\ÒINKEJ



)GQTIG+8%TQYP 4GIKGTWPIULCJT .QPFQP/KV4CPFUEJTKHV&CX5GCD[ -CDKPGVVUVÒEM2TCEJVXQNNG2CVKPC'TUVCDUEJNCIXQPRQNKGTVGP5VGORGNP5VGORGNINCP\ 2TQQH

 



5JKNNKPI.QPFQP5GCD[

2TCEJVGZGORNCT*GTTNKEJG2CVKPCHCUV5VGORGNINCP\





%TQYP 4GIKGTWPIULCJT .QPFQP/KV4CPFUEJTKHV&CX5GCD[  *GTTNKEJG2CVKPCMN4CPFHGJNGTXQT\ÒINKEJ





2GPEG.QPFQP&C\W9KNNKCO+8)TQCV.QPFQP5GCD[  8QT\ÒINKEJWPF5VGORGNINCP\



5713

5713 1,5:1



%TQYP 4GIKGTWPIULCJT .QPFQP/KV4CPFUEJTKHV&CX5GCD[  440WT'ZGORNCTGIGRT·IV-CDKPGVVUVÒEM 2TCEJVXQNNG2CVKPCYKP\4CPFHGJNGTHCUV5VGORGNINCP\ 2TQQH

 159


GROSSBRITANNIEN

5714



9KNNKCO+85KNDGTOGFCKNNGXQP99[QPCWHUGKPG-TÌPWPICO5GRVGODGT -QRHT-QRHFGT-ÌPKIKP#FGNCKFGTOKV&KCFGOOOI'KOGT  9KP\4CPFHGJNGTUGJTUEJÌPpXQT\ÒINKEJ

5715



5715

1,5:1

%TQYP.QPFQPI&CX5GCD[ 440WT'ZGORNCTGIGRT·IV *GTTNKEJG2CVKPCMN4CPFHGJNGTXQT\ÒINKEJp5VGORGNINCP\CWURQNKGTVGT2NCVVG 2TQQH

5716

5719





5717



%TQYP.QPFQP5GCD[

(GKPG2CVKPCHCUVXQT\ÒINKEJ



8KEVQTKC$TQP\GOGFCKNNGXQP6*CNNKFC[CWH4KEJCTF1CUVNGT-QRHT%QVVCIGKP .CPFUEJCHVKO*KPVGTITWPF-KTEJGOO'KOGT 8QT\ÒINKEJ 4KEJCTF1CUVNGT ÓUGV\VGUKEJHÒTGKPG8GTDGUUGTWPIFGT.GDGPFUDGFKPIWPIGPXQP#TDGKVGTPGKP

 



%TQYP.QPFQP/KV4CPFUEJTKHV&CX5GCD[

5VÒEM(CUVUGJTUEJÌP





%TQYP 4GIKGTWPIULCJT .QPFQP)QVKUEJGT6[R/KV4CPFUEJTKHV&CX5GCD[  *GTTNKEJG2CVKPCXQT\ÒINKEJp5VGORGNINCP\CWURQNKGTVGT2NCVVG



160


GROSSBRITANNIEN

5721

5720



%TQYP 4GIKGTWPIULCJT .QPFQP)QVKUEJGT6[R/KV4CPFUEJTKHV&CX5GCD[  2CVKPCYKP\4CPFHGJNGTXQT\ÒINKEJ5VGORGNINCP\





%TQYP 4GIKGTWPIULCJT .QPFQP/KV4CPFUEJTKHV&CX5GCD[  (GKPG2CVKPCXQT\ÒINKEJp5VGORGNINCP\



ex 5722



)GQTIG8+2TQQH5GVDGUVGJGPFCWU%TQYP%TQYP5JKNNKPIU5JKNNKPI  8CTKCPVGP 5KZRGPEG(QWTRGPEG6JTGGRGPEG 8CTKCPVGP 6YQRGPEG2GPP[-W6JTGGRGPEG-W 2GPP[-W2GPP[-W(CTVJKPI 5VÒEM+PTQVGO1TKIKPCNGVWK2QNKGTVG2NCVVG

5723

5725



5724

5%*166.#0& 

/CT[6GUVQP'FKPDWTIJ<YKVVGTRT·IWPIOKVFGT,CJTGU\CJNCWHDGKFGP5GKVGP5GCD[ *ÒDUEJG2CVKPCUGJTUEJÌP





6YGNXGRGPP[)TQCV 0QPUWPV 'FKPDWTIJ5GCD[

5GJTUEJÌP





,COGU8+5JKNNKPIU'FKPDWTIJ5GCD[  *ÒDUEJG2CVKPCMN5EJTÌVNKPIUHGJNGTCO4CPFUGJTUEJÌP

 161


KROATIEN

5726

5726

5726

5726

$4+6+5%*'-1.10+'0 

$TKVKUJ'CUV+PFKC%QORCP[5COONWPIXQP/ÒP\GPFGU,CJTJWPFGTVUXQPFGT-W#PPC DKU\WT4WRKG&C\WGKPKIG5VÒEMGOKV)GIGPUVGORGNPXQP/Q\CODKSWGUQYKGGKPKIGUR·VGTG2T·IWPIGP FGU/CTKC6JGTGUKGP6CNGTUXQP+PVGTGUUCPVGU.QVDKVVGDGUKEJVKIGP  5VÒEM5GJTUEJÌPpXQT\ÒINKEJ



5728

5727



$TKVKUJ9GUV+PFKGU6TCFG&QNNCT$$QODC[-/6

2QNKGTVG2NCVVG 2TQQH





6TCFG&QNNCT$$QODC[-/6  5GNVGPGT,CJTICPI2TCEJVGZGORNCT9KP\4CPFHGJNGTHCUV5VGORGNINCP\





6TCFG&QNNCT$$$CNNG/ÒP\UV·VVG$QODC[&C\W)TQ­DTKVCPPKGP)GQTIG+8 5JKNNKPIU %TQYP  5VÒEM9KP\4CPFHGJNGT Z XQT\ÒINKEJp5VGORGNINCP\



5730

5733

4'27$.+-

5731

5733

-41#6+'0



-WPC/ÒP\UV·VVGXGTOWVNKEJ9KGP2TQDGKP5KNDGTI/KV2WP\G#CWHFGT9GTVUGKVG -/2P 445VGORGNINCP\

 

5VCFV)TQUUQQ,I%0+8+5HH &WECVQPWQXQ+RGTRGTQ)TQUUQQ, 5V$NCUKWU 



162

4#)75# &7$4180+- 

5GJTUEJÌP 5VÒEM5GJTUEJÌP

  

<#4# <#&#4 

7PVGTHTCP\ÌUKUEJGT*GTTUEJCHV(TCPEU%GPVKOGU 1PEG IGRT·IVY·JTGPFFGT$GNCIGTWPI FWTEJÌUVGTTGKEJKUEJG6TWRRGP$TCWUG/CPUHGNF6H&CX 45GJTUEJÌP




MONACO

5734

5736

5735

(ª456'067/ 

5735

.+'%*6'056'+0

,QJCPP++-TQPGP9KGP&CX*/<  2TCEJVGZGORNCT(CUV5VGORGNINCP\



4COQP&GURWKI6CTK4GUVGNNK 'OOCPWGNFG4QJCP6CTK&CX4GUVGNNK

5GJTUEJÌP  .GKEJVLWUVKGTVHCUVXQT\ÒINKEJ (GTFKPCPFXQP*QORGUEJ6CTK&CX4GUVGNNK  .GKEJVLWUVKGTVHCUVXQT\ÒINKEJ

5738

(ª456'067/    



/#.6#

,1*#00+6'414&'0  

5737

5740

5739

  

5741

/10#%1

*QPQT¾++5QNFK8CTGUK 4  42T·IGUEJY·EJGUGJTUEJÌP 4CKPKGT+++(TCPEU2TQDG 'UUCK KP5KNDGTI)GTKHHGNVGT4CPFFG/G[ \W FQTVCDGT#DDKNFWPIFGT2TQDG )CFQWT[  440WT'ZGORNCTGIGRT·IV'TUVCDUEJNCIHCUV5VGORGNINCP\ (TCPEU&KEMCDUEJNCI 2K¾HQTV KP5KNDGTI)NCVVGT4CPFFG/G[\W)CFQWT[\W 440WT'ZGORNCTGIGRT·IV(CUV5VGORGNINCP\ (TCPEU2TQDG 'UUCK KP5KNDGTI)NCVVGT4CPFFG/G[\W FQTVCDGT#DDKNFWPIFGT 2TQDG )CFQWT[ 440WT'ZGORNCTGIGRT·IV'TUVCDUEJNCIHCUV5VGORGNINCP\

    163


NIEDERLANDE

5743

5742



(TCPEU&KEMCDUEJNCI 2K¾HQTV KP5KNDGTI)NCVVGT4CPFFG/G[\W)CFQWT[\W 440WT'ZGORNCTGIGRT·IV(CUV5VGORGNINCP\





(TCPEU2TQDG 'UUCK KP5KNDGTI)NCVVGT4CPFFG/G[\W FQTVCDGT#DDKNFWPIFGT 2TQDG )CFQWT[ 440WT'ZGORNCTGIGRT·IV'TUVCDUEJNCI5VGORGNINCP\



5744

5745

5746



(TCPEU&KEMCDUEJNCI 2K¾HQTV KP5KNDGTI)NCVVGT4CPFFG/G[\W)CFQWT[\W 440WT'ZGORNCTGIGRT·IV5VGORGNINCP\





(TCPEU2TQDG 'UUCK KP5KNDGTI)NCVVGT4CPFFG/G[\W FQTVCDGT#DDKNFWPIFGT 2TQDG )CFQWT[ 440WT'ZGORNCTGIGRT·IV'TUVCDUEJNCI(CUV5VGORGNINCP\





(TCPEU&KEMCDUEJNCI 2K¾HQTV KP5KNDGTI)NCVVGT4CPFFG/G[\W)CFQWT[\W 440WT'ZGORNCTGIGRT·IV(CUV5VGORGNINCP\



5747

1,5:1

5747

0+'&'4.#0&' /'&#+..'0 *+5614+'2'00+0)'0  

5KNDGTIW­OGFCKNNGWPUKIPKGTVCWHFGPPKGFGTN·PFKUEJGP5EJTKHVUVGNNGT1HHK\KGTWPF2QNKVKMGT2JKNKRR XCP/CTPKZ*GTTXQP/QPV5CKPV#NFGIQPFG KP$TÒUUGNÓKP.GKFGP$TWUVDKNF2JKNKRRUXCP /CTPKZTOKVWOIGNGIVGO/CPVGN4GKVGTCWHGKPGOPCEJTURTKPIGPFGO4Q­QDGPYGKDNKEJG)GUVCNVKP GKPGTXQP8ÌIGNPIG\QIGPGP$KICCWH9QNMGPKPFGTCWUIGUVTGEMVGP4GEJVGPJ·NVUKGGKPG-TQPGOO IX.QQP+5 44<GKVIGPÌUUKUEJGT)W­(GNFGTHGKP\KUGNKGTVXQT\ÒINKEJ 

2JKNKRU XCP /CTPKZ YWTFG  KP $TÒUUGN IGDQTGP 'T UVWFKGTVG KP )GPH WPVGT CPFGTGO DGK ,QJCPPGU %CNXKP WPF   MGJTVGCNUGPVUEJKGFGPGT)GIPGTFGTURCPKUEJGP(TGOFJGTTUEJCHVKPUGKPG*GKOCV\WTÒEM#NU5EJTKHVUVGNNGTWPF $GTCVGT 9KNJGNOU + XQP 1TCPKGP0CUUCW VTCV /CTPKZ HÒT FKG PKGFGTN·PFKUEJG (TGKJGKVUDGYGIWPI GKP WPF ITKHH FKG   -CVJQNKUEJG -KTEJG KP OGJTGTGP UEJCTHGP 5CVKTGP CP 8GTUEJKGFGPG FKRNQOCVKUEJG /KUUKQPGP HÒJTVGP KJP DKU PCEJ   2CTKUWPF.QPFQP$GKGKPGTFKGUGT4GKUGPYWTFGGTXQPFGP5RCPKGTPXGTJCHVGVWPFKPJCHVKGTVMQPPVGLGFQEJ GKP ,CJT UR·VGT CWUIGVCWUEJV YGTFGP  ÒDGTPCJO GT FCU #OV FGU $ÒTIGTOGKUVGTU XQP #PVYGTRGP   2JKNKRU XCP /CTPKZ *GTT XQP /QPV 5CKPV #NFGIQPFG UVCTD CO  &G\GODGT  KP .GKFGP +JO YKTF FGT 6GZV   ō9KNJGNOWUXCP0CUUQWYGPŋņFGTPKGFGTN·PFKUEJGP0CVKQPCNJ[OPGņ\WIGUEJTKGDGP

164


NIEDERLANDE

5748



5KNDGTOGFCKNNGWPUKIPKGTVCWHFKG0KGFGTNCIGFGTURCPKUEJGP#TOCFCKOTOGNMCPCN&GT-ÌPKI XQP5RCPKGPFGT-CKUGTXGTUEJKGFGPG-WTHÒTUVGPFGT2CRUVWPFYGKVGTG)GKUVNKEJGUKV\GPOKVXGTDWPFG PGP#WIGPKO*CNDMTGKUFGT(W­DQFGPKUVOKVUEJCTHGP5RKV\GPXGTUGJGP&KGWPVGTIGJGPFGURCPKUEJG (NQVVGOOIX.QQP+5 44-T·HVKIG2CVKPCXQT\ÒINKEJGU'ZGORNCT



5749



5KNDGTOGFCKNNG  WPUKIPKGTV CWH FKG 9KGFGTGKPPCJOG XQP 1UVGPFG FWTEJ FGP URCPKUEJGP )GPGTCN   5RKPQNCWPFFKG'KPPCJOGXQP5NW[UUQYKGFGTWONKGIGPFGP)GDKGVG.CPFMCTVGXQP5NW[UWPF7OIG DWPI.CPFMCTVGPCPUKEJVXQP1UVGPFGOKVGKPOCTUEJKGTGPFGP6TWRRGPOOIX+UGIJGO X.QQP++5 8QT\ÒINKEJ

&GT URCPKUEJG )GPGTCN #ODTQUKQ 5RKPQNC  KP )GPWC Ó KP %CUVGNPWQXQ FK 5ETKXKNC \GKEJPGVG UKEJ UGKV    OGJTHCEJ KP FGP &KGPUVGP -ÌPKI 2JKNKRRU +++ XQP 5RCPKGP CWU WPF WPVGTUVÒV\VG OKV GKPGO -QTRU XQP    /CPPUGNDUVIGYQTDGPGTKVCNKGPKUEJGTWPFURCPKUEJGT6TWRRGP'T\JGT\QI#NDTGEJVXQP¤UVGTTGKEJDGKFGT$GNCIGTWPI XQP1UVGPFG0CEJFGTGTHQNITGKEJGP9KGFGTGKPPCJOGYWTFGGT\WO)GPGTCNNGWVPCPVWPF-QOOCPFKGTGPFGPCNNGTKP FGP 0KGFGTNCPFGP M·ORHGPFGP URCPKUEJGP 6TWRRGP GTPCPPV 5GKV  UVCPF GT FGO 2TKP\GP /QTKV\ XQP 1TCPKGP   IGIGPÒDGTWPFJGOOVGFGUUGP5KGIGUNCWH<W$GIKPPFGU&TGK­KIL·JTKIGP-TKGIGUWPVGTUVÒV\VGGTFGP-CKUGTWPFFKG MCVJQNKUEJG .KIC 'T HÒJTVG KO 5QOOGT  FKG $GNCIGTWPI XQP $TGFC CP &KG ªDGTICDG GTHQNIVG LGFQEJ GTUV KO   ,WPKYGKNGTXQTJGTFKGOGWVGTPFGPKVCNKGPKUEJGP6TWRRGPGPVNCUUGPJCVVGYQFWTEJUGKP*GGTUVCTMIGUEJY·EJV YCT5GKVFGOMT·PMGNPFOW­VGGTFGP1DGTDGHGJNPKGFGTNGIGP



5750



5KNDGTOGFCKNNGXQP,XCP.QQHCWHFKG'TQDGTWPIFGT5VCFV*WNUVFWTEJFKG5VTGKVMT·HVGFGU2TKP \GP(TKGFTKEJ*GKPTKEJXQP0CUUCW1TCPKGP#PUKEJVFGTDGNCIGTVGPWPFWPVGT$GUEJW­NKGIGPFGP5VCFV FCTÒDGTJCNVGP\YGK2WVVGPFGP5VCFVUEJKNF-CTVWUEJGOKV<GKNGP5EJTKHVWOJGT9GKPTCPMGPQDGP IGMTÌPVGT.ÌYGPUEJKNFOOIX.QQP++5  8QPITQ­GT5GNVGPJGKV(GKPG2CVKPCXQT\ÒINKEJGU'ZGORNCT  165


NIEDERLANDE

5751



5KNDGTPG*QJNIW­OGFCKNNGWPUKIPKGTVXQP1/ÒNNGTCWHFGP6QFFGUJQNN·PFKUEJYGUVHTKGUKUEJGP #FOKTCNU/CCTVGP*CRGTVU\QQP6TQOR$TWUVDKNFFGU#FOKTCNUHCUVXXOKVWOIGNGIVGO1TFGPUDCPF \WFGP5GKVGP2CNO\YGKIGWPF#TOCVWTGPQDGPJCNVGP\YGK)GPKGPOKV2QUCWPGPGKPG-TQPGÒDGTFCU *CWRV FGU #FOKTCNU&CTUVGNNWPI UGKPGT NGV\VGP 5GGUEJNCEJV KO 8QTFGTITWPF WPVGTIGJGPFGU 5EJKHH   OOI'KOGTX.QQP++5XCT  44*GTTNKEJG2CVKPC(GNFFGT8QTFGTUGKVGHGKP\KUGNKGTVXQT\ÒINKEJGU'ZGORNCT  #FOKTCN /CCTVGP *CRGTVU\QQP 6TQOR  $TKGN XGTPKEJVGVG CO  FKG URCPKUEJG (NQVVG CWH FGT 4GGFG   XQP&QYPUWPFNGKVGVGFGP-CORHIGIGPFKGV[RGPO·­KIDGTGKVUÒDGTNGIGPGGPINKUEJG(NQVVGPQEJGTHQNI TGKEJ'TUVCTDCOKO5GGIGHGEJVXQT6GT*GKFG

5753

5752

5752



5KNDGTOGFCKNNGXQP,5OGNV\KPICWHFCU(GWGTYGTMKP&GP*CCIDGKO'KP\WI9KNJGNOU+++XQP 1TCPKGP0CUUCW &TGK 6TKWORJDÌIGP \YKUEJGP FGP <YGKIGP GKPGU 1TCPIGPDCWOGU CP FGP 5GKVGP FKG   9CRRGPXQP*QNNCPFWPFU )TCCXGPJCCIG1TCPIGPDCWOOKVXKGT<GRVGTPKPFGT$CWOMTQPGUVGJVCWH GKPGO 2QFGUV OKV FGT &CTUVGNNWPI FGU (GWGTYGTMU CWU FGT 8QIGNRGTURGMVKXG QDGP /GFCKNNQP OKV FGT   $ÒUVG 9KNJGNOU N -TCP\ OKV FGT .CPFWPI FGU -ÌPKIU CP FGT JQNN·PFKUEJGP -ÒUVG T -TCP\ OKV FGT   &CTUVGNNWPIUGKPGU'KP\WIGUOOIX.QQP+++5 448QT\ÒINKEJ 



5KNDGTOGFCKNNGXQP,)*QNV\JG[CWHFGP*CPFGN#VJGPCWPF/GTMWUUKV\GPKPOKVVGPXQP*CP FGNUYCTGP WPF $ÒEJGTP#WHIGJGPFG 5QPPG *CNDOQPF WPF 9QNMGP ÒDGT )NQDWU FCTCWH 2HGKNDÒPFGN   OOI8GTXX.QQP (CUVXQT\ÒINKEJ

166




NIEDERLANDE

5754



/QTKV\ XQP 1TCPKGP )TCH XQP 0CUUCW 5VCVVJCNVGT FGT 0KGFGTNCPFG   5KNDGTOGFCKNNG   WPUKIPKGTVXQP)X$KLNCGTCWHUGKPGP5KGIDGK6WTPJQWVÒDGTFKG5RCPKGTUQYKGFKG'KPPCJOG FGT 5V·FVG #NRGP 4JGKPDGTI /QGTU )TQN $TGXQTV 'PUEJGFG 1NFGP\CCN 1QVOCUWO WPF .KPIGP   5EJNCEJVU\GPGKO*KPVGTITWPF5VCFVCPUKEJVXQP6WTPJQWV8KGT<GKNGP5EJTKHVWOJGT4KPIKPFGOFKG #PUKEJVGPFGTPGWPGTQDGTVGP5V·FVGFCTIGUVGNNVUKPFOOIX.QQP+5 8QT\ÒINKEJ



5755



5KNDGTOGFCKNNG  WPUKIPKGTV XQP ) X $KLNCGT CWH FKG 'TQDGTWPI FGT (GUVWPI 5CKPV#PFT¾  

)GNFGTNCPF WPFFGP5KGIÒDGT#NDGTVXQP¤UVGTTGKEJDGK0KGWYRQQTV/QTKV\XQP1TCPKGPKP*CTPKUEJ WPFOKV*GNOTGKVGVTKPFGTGTJQDGPGP4GEJVGP5EJYGTVWOJGT5EJNCEJVU\GPGÒDGTUGKPGO*CWRVGKP -TCP\ KO *KPVGTITWPF /GGT OKV 5EJKHHGP QDGP UVTCJNGPFGT 0COG ,GJQXCU&KG 'TQDGTWPI FGT   (GUVWPICWUFGT8QIGNRGTURGMVKXGOOIX.QQP+5  445GJTCVVTCMVKXGU'ZGORNCTOKVRTCEJVXQNNGT2CVKPCXQT\ÒINKEJ 

5756



9KNJGNO85KNDGTOGFCKNNGXQP,)*QNV\JG[CWHFCU$GIT·DPKUXQP$CTQP9QNVGT ,CP$GPVKPEM#FLWVCPV9KNJGNOU8IGUVKHVGVXQO#FOKTCNKV·VUWPF5GGTCV#OUVGTFCO7TPGCWH#NVCT WOIGDGP XQP -TKGIUGODNGOGP KO *KPVGTITWPF T GKP 5EJKHH FGT PKGFGTN·PFKUEJGP (NQVVG)GMTÌPVGU   9CRRGP FGT #FOKTCNKV·V CWH GKPGO 4WPFCNVCT WOJGT -TKGIUVTQRJ·GP  OO  I 8GTX X   .QQP (GNFGTCNVIGIN·VVGVFGPPQEJCVVTCMVKXGUXQT\ÒINKEJGU'ZGORNCTOKVHGKPGT2CVKPC



&KG&QIIGTDCPMKUVGKPGHNCEJG$CPMKPFGT0QTFUGGOKVGKPGT9CUUGTVKGHGXQPPWTO5KGGTUVTGEMVUKEJMO KP9GUV1UV4KEJVWPIWPFKUVTWPFMODTGKV$KUXQTGVYC,CJTGPDKNFGVGFKG&QIIGTDCPMFGP5ÒFTCPFFGT 0QTFUGGYGUVNKEJXQPKJTNCIFKG4JGKPOÒPFWPIÌUVNKEJFKG'NDG9GUGT/ÒPFWPI

167


NIEDERLANDE

5757

#/56'4&#/ 

5VCFV5KNDGTOGFCKNNGXQP)2QQNNCWHFKG'KPYGKJWPIFGUPGWGP4CVJCWUGU&CU5EJKHH#TIQCWU FGTITKGEJKUEJGP/[VJQNQIKGCNU)CNGGTGFCTIGUVGNNVKO*KPVGTITWPFFKG5VCFVCPUKEJVXQP#OUVGTFCOOKV *CHGP#PUKEJVFGUPGWGP4CVJCWUGUOKVFGTPGWGP-KTEJGFCXQT/GPUEJGPOGPIGQDGPUEJYGDGPFGT *GTOGUOKV/GTMWTUVCDWPF(TGKJGKVUJWVKO8QTFGTITWPFUKV\V#ORJKQPCWHFGP6TÒOOGTPFGUCNVGP 4CVJCWUGU CWH GKPGO 5VGKP FKG 0COGP FGT $ÒTIGTOGKUVGT WPF 5EJCV\OGKUVGT  OO  I X   .QQP++5 8QT\ÒINKEJ 

1,5:1

5758

1,5:1

$#6'0$74) 

/CZKOKNKCPXQP$TQPEMJQTUV-TGW\GT )TQUEJGP Q,$CVGPDWTIOKV6KVGNXQP/CV VJKCU 0CEJCJOWPI GKPGU )TQUEJGP XQP 7TK 5EJY[\ WPF 0KFYCNFGP  I &TGK 9CRRGPUEJKNFG KP   -NGGDNCVVUVGNNWPI FC\YKUEJGP 8GT\KGTWPIGP&QRRGNCFNGT OKV IGMTÌPVGO 4GKEJUCRHGN CWH FGT $TWUV   FCTKP9GTV\CJN-WP\OCPP 8QPITÌ­VGT5GNVGPJGKV5GJTUEJÌP 

5759

$'4)'012<11/ 

168

5VCFV5KNDGTOGFCKNNGWPUKIPKGTVXQP,XQP$[NCGTCWHFKG$GHTGKWPIFGT5VCFV$GTIGPQR<QQO XQP FGP 5RCPKGTP FWTEJ /QTKV\ XQP 0CUUCW1TCPKGP #PUKEJV FGT DGNCIGTVGP 5VCFV CWU FGT 8QIGNRGT   URGMVKXG OKV $GHGUVKIWPIUCPNCIGP*GNO CWH 6TQOOGN FCJKPVGT \YGK -CPQPGP WPF YGKVGTG 9CHHGP   OOIX.QQP++5XCT 448QT\ÒINKEJ 


NIEDERLANDE

5760



5KNDGTOGFCKNNGXQP,.QQHCWHFGP'PVUCV\XQP$GTIGPQR<QQOWPFFGP5KGIÒDGTFKGURCPKUEJG (NQVVG KO /ÒPFWPIUIGDKGV FGT 5EJGNFG #WH 9GUVGP CWUIGTKEJVGVGT 2NCP FGU XQP $GTIGP QR <QQO DKU   )QGU TGKEJGPFGP /ÒPFWPIUIGDKGVU FGT 5EJGNFG OKV \CJNTGKEJGP 5EJKHHGP <GKNGP 5EJTKHV WPVGP   IGMTÌPVGT9CRRGPUEJKNFFGT2TQXKP\<GGNCPFOOIX.QQP++5  8QT\ÒINKEJ

5761

  

5762



5763

%#/2'0

5VCFV4GKEJUVCNGTQ,  OKV6KVGN4WFQNHU++&CX&GNO 5GJTUEJÌP .ÌYGPVCNGTQ,&CX&GNO 4  -N5EJTÌVNKPIUHGJNGTUGJTUEJÌP .ÌYGPVCNGT&CX&GNO 5GJTUEJÌP 'ZGORNCTFGT#WMVKQP(TKV\4WFQNH-ÒPMGT1UPCDTÒEM0T

  

5764



&'8'06'4

5VCFV5VÒDGT.GXKPUQP+++ 4 

'VYCUMQTTQFKGTVHCUVUGJTUEJÌP

 169


NIEDERLANDE

5766

5765



&WMCVQP 5KNDGTPGT4GKVGT &CX&GNO 4 



5VÒDGT&GNO 4 



5767

-N<CKPGPFGUGJTUEJÌP



5GJTUEJÌP



)GOGKPUEJCHVNKEJ6CNGTQ,  OKV6KVGN-CTNU8&CX&GNONGKEJVXCT 4   445GJTUEJÌP



&'8'06'4%#/2'070&<91..'

5768



5769

6CNGTOKV6KVGN-CTNU8&CX&GNO 4 

5770

(CUVUGJTUEJÌP



'KPGP-CTQNKPIGTFGPCTXQP.QVJCT+CWUFGT/ÒP\UV·VVG&QTGUVCFHKPFGP5KGWPVGTFGT0T

)'.&'40 

*GT\QIVWO-CTNXQP'IOQPF5VÒDGTXF%JKLU6H:8+ 4(CUVUGJTUEJÌP





2JKNKRR++XQP5RCPKGP4GKEJUVCNGTPCEJDWTIWPFKUEJGO(W­&CX&GNO

4  #VVTCMVKXGUUGJTUEJÌPGU'ZGORNCT



170


NIEDERLANDE

5771

5772

5773

)410+0)'0 





5VCFV 5KNDGTOGFCKNNG  WPUKIPKGTV XQP ) X $KLNCGT CWH FKG $GHTGKWPI XQP %QGXQTFGP WPF FKG   'KPPCJOGXQP)TQPKPIGPFWTEJ2TKP\/QTKV\XQP1TCPKGP#PUKEJVFGTDGNCIGTVGP5VCFV)TQPKPIGPCWU FGT8QIGNRGTURGMVKXG<GJP<GKNGP5EJTKHVFCTÒDGTIGMTÌPVGU9CRRGPOOIX.QQP+ 5 5GJTUEJÌPpXQT\ÒINKEJ



5KNDGTOGFCKNNG  CWH FKG $GNCIGTWPI FGT 5VCFV WPF FKG 'TUVÒTOWPI %QGXQTFGPU #PUKEJV FGT DGNC   IGTVGP 5VCFV )TQPKPIGP)TWPFTK­ FGT $GHGUVKIWPIUCPNCIGP XQP %QGXQTFGP WOJGT FKG $GNCIGTWPIU   VTWRRGPOOIX.QQP+++59GKNGT 8QT\ÒINKEJ



5KNDGTOGFCKNNG  CWH FKG $GNCIGTWPI FGT 5VCFV WPF FKG 'TUVÒTOWPI %QGXQTFGPU #PUKEJV FGT DGNC   IGTVGP 5VCFV )TQPKPIGP#PUKEJV FGT DGNCIGTVGP 5VCFV %QGXQTFGP  OO  I X .QQP +++ 5   9GKNGT -N2T·IGUEJY·EJGXQT\ÒINKEJ



5774

*##4.'/ 

5VCFV 5KNDGTOGFCKNNG  WPUKIPKGTV CWH FKG 4ÒEMXGTNGIWPI FGT *CCTNGOGT 5EJÒV\GP CWU FGT 5VCFV   *CUUGNV KP FKG *GKOCVUVCFV 5VCFVCPUKEJV XQP *CUUGNV FCTÒDGT FGT 5VCFVUEJKNF UQYKG GKP NGGTGT 5EJKNF   5VCFVCPUKEJVXQP*CCTNGOFCTÒDGT\YGK9CRRGPUEJKNFGOOI-2-X.QQP++5 8QT\ÒINKEJ

 171


NIEDERLANDE

5775

5 *''4'0$'4) 

9KNJGNO+86CNGT 5VÒDGT Q,&CX&GNO 4   8QPITQ­GT5GNVGPJGKV(CUVUGJTUEJÌP



5777

5776

5776

5 *'461)'0$15%* 

5KNDGTOGFCKNNGIGHGTVKIVPCEJGKPGT#TDGKVXQP,XCP.QQHCWHFKG'TQDGTWPIFGT5VCFVUQYKGFKG 'KPPCJOGXQP9GUGNWPFFKG$GHTGKWPIFGT8GNWYGFWTEJ2TKP\(TKGFTKEJ*GKPTKEJXQP0CUUCW1TCPKGP &GT2TKP\CWHGKPGOPCEJNURTKPIGPFGP4Q­KO*KPVGTITWPF5VCFVCPUKEJV1DGPFKG5VCFVCPUKEJVXQP 9GUGNOKVFGO4JGKPKO8QTFGTITWPFWPVGPFGT2NCPFGU$TÒEMGPMQRHGUCPFGT+LUUGNOKV&CTUVGNNWPI FGT CPTÒEMGPFGP PKGFGTN·PFKUEJGP 5VTGKVMT·HVG WPF FGT CD\KGJGPFGP URCPKUEJGP $GUCV\WPI DGKFG   &CTUVGNNWPIGPYGTFGPFWTEJGKP5EJTKHVDCPFIGVGKNVOOIX.QQP++5  4*ÒDUEJG2CVKPCYKP\4CPFHGJNGTUGJTUEJÌPpXQT\ÒINKEJ 



)TCHUEJCHV(NQTGU8)TQQVQ,  I-TGW\WOJGT\YGK<GKNGP5EJTKHV -CUVGNNWOJGT-TGKUXQP.KNKGP)TQNNGD 45GJTUEJÌP

*1..#0&

5778



ex 5779



2TQXKP\2JKNKRRUVCNGTFGU*GT\QIVWOU)GNFGTP2JKNKRR++XQP5RCPKGP/ÒP\ UV·VVG0KLOGIGPOKV)GIGPUVGORGNFGT5V·PFGXQP*QNNCPFCWHFGT8QTFGTUGKVG.ÌYGPUEJKNFKPIGRGTN VGO 1XCN IGIGPIGUVGORGNV FWTEJ FKG 2TQXKP\ *QNNCPF Y·JTGPF FGU (TGKJGKVUMCORHGU  X   )*F FQTVQJPG)GIGPUVGORGN  *ÒDUEJG2CVKPCHCUVXQT\ÒINKEJ





 2JKNKRRUVCNGT  FGU *GT\QIVWOU )GNFGTP 2JKNKRR ++ XQP 5RCPKGP  /ÒP\UV·VVG   0KLOGIGP OKV )GIGPUVGORGN FGT 5V·PFG XQP *QNNCPF CWH FGT 8QTFGTUGKVG .ÌYGPUEJKNF KP IGRGTNVGO   1XCNIGIGPIGUVGORGNVFWTEJFKG2TQXKP\*QNNCPFY·JTGPFFGU(TGKJGKVUMCORHGU&C\W 2JKNKRRUVCNGT ,CJTGU\CJNPKEJVGTMGPPDCT FGT)TCHUEJCHV*QNNCPF/ÒP\UV·VVG&QTFTGEJVGDGPHCNNUOKV )GIGPUVGORGNCWHFGT8QTFGTUGKVG.ÌYGNKPIGRGTNVGO1XCNX)*F FQTVDGKFG QJPG)GIGPUVGORGN  5VÒEM5EJÌPWPFUGJTUEJÌP



172


NIEDERLANDE

5780 5781





5781

 2JKNKRRUVCNGT  FGT *GTTUEJCHV 7VTGEJV 2JKNKRR ++ XQP 5RCPKGP  /ÒP\UV·VVG   7VTGEJV OKV )GIGPUVGORGN FGT 5V·PFG XQP *QNNCPF CWH FGT 8QTFGTUGKVG .ÌYG N KP IGRGTNVGO 1XCN   IGIGPIGUVGORGNVFWTEJFKG2TQXKP\*QNNCPFY·JTGPFFGU(TGKJGKVUMCORHGUX)* E FQTVQJPG)GIGPUVGORGN  *ÒDUEJG2CVKPCHCUVXQT\ÒINKEJ



.ÌYGPVCNGT  OKV \YGK )GIGPUVGORGNP CWH FGT 4ÒEMUGKVG .KNKG WPF *GZCITCOO !  &CX    &GNO&WHHKGNFXGTINHH&CX&GNO  /ÒP\GUEJÌPpUGJTUEJÌP)GIGPUVGORGNUGJTUEJÌP



&GT .KNKGP)GIGPUVGORGN MÌPPVG  CPIGDTCEJV YQTFGP UGKP Y·JTGPF FGT +PXCUKQP FGT (TCP\QUGP WPVGT   .WFYKI:+8&GTJGZCITCOO·JPNKEJG)GIGPUVGORGNMÌPPVGOCTQMMCPKUEJUGKPOÌINKEJGTYGKUGCDGTCWEJ(CPVCUKG

5782



5KNDGTOGFCKNNGXQP%9[PVLGUCWHFGP5KGIFGT)GPGTCNUVCCVGPÒDGTFKGURCPKUEJG(NQVVGKPFGT <WKLFGT\GG  &CTUVGNNWPI FGT 5GGUEJNCEJV KO *KPVGTITWPF -ÒUVGPCDUEJPKVV OKV FGP #PUKEJVGP XQP   *QQTP WPF 'PMJWK\GP#EJV <GKNGP 5EJTKHV WPVGP ,CJTGU\CJN QDGP /GFCKNNGWTUUKIPCVWT  OO   IX.QQP+5 48QT\ÒINKEJ 

5784 5783

5783

.';&'0 



5KNDGTOGFCKNNGWPUKIPKGTVCWHFGP'PVUCV\.G[FGPUXQPFGTURCPKUEJGP$GNCIGTWPICO1MVQ DGT 5VCFVCPUKEJV XQP .G[FGP KO 8QTFGTITWPF #D\WI FGT URCPKUEJGP 6TWRRGP CWU FGO DGHGUVKIVGP   .CIGT'KP'PIGNXGTPKEJVGVFCU*GGT5CPJGTKDUXQTFGTDGNCIGTVGP5VCFV,GTWUCNGOOOI X.QQP+5 *ÒDUEJG2CVKPCXQT\ÒINKEJ



5KNDGTOGFCKNNGXQP%(-QPUGCWHFKG,CJTHGKGTFGT$GHTGKWPI.G[FGPUXQPFGTURCPKUEJGP $GNCIGTWPICO1MVQDGT5VCFVCPUKEJVXQP.G[FGPKO8QTFGTITWPFGTIKG­VUKEJGKP5VTQOCWU GKPGT 7TPG FCTÒDGT CWU 9QNMGP MQOOGPFGT #TO OKV 5EJYGTV#P GKPGT OKV )KTNCPFGP XGT\KGTVGP   5·WNG J·PIGP FTGK 5EJKNFG OKV FGP 2QTVT·VU FGT $ÒTIGTOGKUVGT FGT 5VCFV  OO  I 8GTX X   .QQP$ 5GJTUEJÌPpXQT\ÒINKEJ

 173


NIEDERLANDE

5786

5785

5785

/+&&'.$74) 

5VCFV5CVKTKUEJG5KNDGTOGFCKNNGXQP,XCP&KUJQGEMGCWHFKG7PVGTFTÒEMWPIFGT7PTWJGPKPFGT 2TQXKP\<GGNCPF2GTUGWUKPCPVKMGT4ÒUVWPIUVGJVXXKPFGT4GEJVGP5·DGNKPFGT.KPMGPFCUCDIG UEJNCIGPG*CWRVFGTCO$QFGPNKGIGPFGP/GFWUCN2GICUWUKO*KPVGTITWPF0QTFUGGWPFFKG5VCFVCP UKEJV XQP /KFFGNDWTI$ÒTIGTYGJT CWH FGO 4CVJCWURNCV\ FGT 5VCFV KO 8QTFGTITWPF UVGJV GKPG YGKDNK   EJG)GUVCNVFKGKPFGT4GEJVGPGKPGOKVFGO(TGKJGKVUJWVDGFGEMVG.CP\GJ·NVPGDGPKJTIGMTÌPVGT#FNGT OKVFGO5VCFVUEJKNFCWHFGT$TWUVOOI%QNN(KGYGIGTX.QQP+85-2- 5NI,WNKWU 4*GTTNKEJG2CVKPCYKP\4CPFHGJNGTXQT\ÒINKEJp5VGORGNINCP\



18'4+,55'. 

2JKNKRR++XQP5RCPKGP4GCN8GTMCFG6H FQTV,CJTICPI   45GJTUEJÌP

5787

5788



5790

5789

764'%*6 

$KUVWO&CXKFXQP$WTIWPF5VÒDGTQ,IXF%JKLU6H:+:XCT  46GKNYGKUGGVYCUMQTTQFKGTVUGJTUEJÌP





2TQXKP\4GKEJUVCNGT&CX&GNO

5GJTUEJÌP





2TQXKP\4GKEJUVCNGT*QQTP&CX&GNO

-N5EJTÌVNKPIUTK­UGJTUEJÌP





5VÒDGT8GTMCFG6H

445GJTUEJÌP



174

9'56(4+'5.#0&


NIEDERLANDE

5791



<''.#0&

2TQXKP\4GKEJUVCNGT&CX&GNO

5GJTUEJÌP



5792



5KNDGTOGFCKNNGWPUKIPKGTVCWHFKG$GTIWPIXQP-WPUVUEJ·V\GPCWUGKPGOXQTFGT+PUGN9GUVMCRRGN IGUWPMGPGP -CWHOCPPUUEJKHH /GGTOCPP WPF /GGTLWPIHTCW JCNVGP FCU IGMTÌPVG \GGN·PFKUEJG 9CRRGP   FCJKPVGT\YGK5GIGNUEJKHHGFGTGP$GUCV\WPIFKG-WPUVUEJ·V\GDKTIVTWPFKO*KPVGTITWPFNFTGKYGK VGTG 5GIGNUEJKHHG UQYKG FKG +PUGN 9GUVMCRRGN <GKNGP 5EJTKHV WOJGT .QTDGGTMTCP\ FGT OKV FGP   5EJKNFGPWPF0COGPFGT\GGN·PFKUEJGP4CVUJGTTGPDGNGIVKUVOOIX.QQP++5 4(GKPIGVÌPVGUXQT\ÒINKEJGU'ZGORNCT  7PVGT .GKVWPI FGU 4CVUJGTTGP /CTUGNKU XCP FGT )QGU YWTFGP 9GTVIGIGPUV·PFG CWU FGO IGUWPMGPGP *CPFGNUUEJKHH   FGU *GTTGP 9CVGTFTKPMGT IGDQTIGP 'U MCOGP GKPG ITQ­G /GPIG XQP IGOÒP\VGO WPF WPIGOÒP\VGO 5KNDGT 'FGN   UVGKPGUQYKGGKP)GUEJÒV\\WVCIG

5794

5793

  

5KNDGTFWMCV&GNO 4  *QGFLGUUEJGNNKPI8GTMCFG6H 5KNDGTFWMCV&GNOC

5795

5793

4-N5EJTÌVNKPIUTK­HCUVUGJTUEJÌP *ÒDUEJG2CVKPCUGJTUEJÌPpXQT\ÒINKEJ .GKEJVLWUVKGTVXQT\ÒINKEJ

   175


NIEDERLANDE

5797



5796

5797

5KNDGTFWMCV ,CJTGU\CJNKO5VGORGNCWUIG·PFGTV &GNOC  5GJTUGNVGPDGUQPFGTUKPFKGUGT'TJCNVWPI2TCEJVGZGORNCT(CUV5VGORGNINCP\



-¤0+)4'+%**1..#0& 

.WFYKI0CRQNGQP5VÒDGT7VTGEJV&CX5EJWNOCP  (CUVXQT\ÒINKEJGU'ZGORNCTOKVHGKPGT6ÌPWPI

5798

5799



5800

-¤0+)4'+%*&'40+'&'4.#0&' 

9KNJGNO+)WNFGP7VTGEJV&CX5EJWNOCP  44/GJTGTG4CPFHGJNGTHCUVUGJTUEJÌP



 

)WNFGP7VTGEJV&CX5EJWNOCPC )WNFGP7VTGEJV&CX5EJWNOCP

 

(CUVUGJTUEJÌP 5GJTUEJÌP

5801 5802

  176

)WNFGP7VTGEJV5EJWNOCP 9KNJGNO++)WNFGP7VTGEJV&CX5EJWNOCP

5802

5GJTUEJÌP 5GJTUEJÌP

 


NIEDERLANDE

5803

5804

 

5804

9KNJGNO+++%GPVU7VTGEJV5EJWNOCP )WNFGP7VTGEJV&CX5EJWNOCP

48QT\ÒINKEJp5VGORGNINCP\ 8QT\ÒINKEJ

 

5806

5805

 

5805

)WNFGP7VTGEJV&CX5EJWNOCP %GPVU7VTGEJV5EJWNOCP

8QT\ÒINKEJ 8QT\ÒINKEJ

5807

5808

5809

  

%GPVU7VTGEJV5EJWNOCP %GPVU7VTGEJV5EJWNOCPC 9KNJGNOKPC)WNFGP7VTGEJV5EJWNOCP

5811

5812

   

%GPVU7VTGEJV5EJWNOCP %GPVU7VTGEJV5EJWNOCP )WNFGP7VTGEJV5EJWNOCP %GPVU7VTGEJV5EJWNOCP

5810

 

8QT\ÒINKEJp5VGORGNINCP\ 45GJTUEJÌP 8QT\ÒINKEJ

  

5813

5812

8QT\ÒINKEJp5VGORGNINCP\ 5GJTUEJÌP 5GJTUGNVGPGT,CJTICPI8QT\ÒINKEJ 8QT\ÒINKEJ

    177


POLEN

5818

5816

5814



)WNFGP7VTGEJV)GRT·IVKO,CJTKJTGT8QNNL·JTKIMGKV&CX5EJWNOCP  -N-TCV\GTUGJTUEJÌP





)WNFGP7VTGEJV%GPVU7VTGEJV&CX5EJWNOCP  5VÒEM(CUVUGJTUEJÌPWPFUGJTUEJÌP





%GPVU7VTGEJV5EJWNOCP



48QT\ÒINKEJ

.160+'&'4.#0&' 

+PVGTGUUCPVG5COONWPIFKXGTUGTPKGFGTN·PFKUEJGT/ÒP\GPFGUDKU,CJTJWPFGTVUXQO-WRHGTFWKV DKU \WO 6CNGT FCTWPVGT \CJNTGKEJG DGUUGTG 5VÒEMG WPF ,CJTI·PIG +PUIGUCOV  5VÒEM KP 6CNGTITÌ­G   5GJTKPVGTGUUCPVGU.QVDKVVGDGUKEJVKIGP 5VÒEM5GJTUEJÌPpXQT\ÒINKEJ 

0+'&'4.0&+5%*')'$+'6'+0ª$'45'' 

8'4'+0+)6'156+0&+5%*'-1/2#0+'

9GUVHTKGUNCPF)WNFGP ,CJTGU\CJNKO5VGORGNCWUIG·PFGTV 5EJQNVGPDG 45GJTUEJÌP

5821

5820

5819

-¤0+)4'+%*

ex 5822

21.'0



9NCFKUNCY++,CIGNNQ4WUUKUEJGT*CNDITQUEJGPI#FNGTFGP-QRHPCEJTIGYCPFV .ÌYGN)WOXCT 4-N2T·IGUEJY·EJGUGJTUEJÌP



5KIKUOWPF+++)TÌUEJGT2T·IWPIFGT5VCFV4KIC)WO0GWOCPP  (CUVXQT\ÒINKEJ



)TÌUEJGT/CTKGPDWTI)WO



)TÌUEJGT/CTKGPDWTI&C\W&CP\KI)TÌUEJGT2QNGP)TQUEJGP)WO  5VÒEM5GJTUEJÌPWPFDGUUGT

178



48QT\ÒINKEJ

   


POLEN

5823

5825

5824



)TÌUEJGT/CTKGPDWTI8CTKCPVGQJPG9GTV\CJN)WO  44#VVTCMVKXGU'ZGORNCTUGJTUEJÌP





)TÌUEJGT/CTKGPDWTI)WO

442TCEJVGZGORNCT(CUV5VGORGNINCP\





)TÌUEJGT-TCMCW.GV\VG<KHHGTFGT,CJTGU\CJNURKGIGNXGTMGJTV)WO  42TCEJVGZGORNCT*GTTNKEJG2CVKPCHCUV5VGORGNINCP\



5827 5826

5826



4GKEJUVCNGT++$TQODGTIQFGT-TCMCW*ÒHVDKNFOKV(GNFDKPFG&CX)WO  5GJTUEJÌP





)TÌUEJGT Z CNNG/ÒP\UV·VVG/CTKGPDWTI)WO Z   5VÒEM6GKNYGKUGUGNVGP5GJTUEJÌPpXQT\ÒINKEJ



5828

5828

1,5:1



#WIWUV++FGT5VCTMG 4GKEJUVCNGT.GKR\KII)GMTÌPVGUWPFIGJCTPKUEJVGU $WTUVDKNF T OKV WOIGNGIVGO /CPVGN)GMTÌPVGU XKGTHGNFKIGU 9CRRGP OKV /KVVGNUEJKNF CWH #PFTGCU   MTGW\\WFGP5GKVGPLGGKPIGMTÌPVGU/QPQITCOO&CX)WO  5GNVGPDGUQPFGTUKPFKGUGT'TJCNVWPI 5GJTCVVTCMVKXGU'ZGORNCTOKVJÒDUEJGT2CVKPCYKP\5EJTÌVNKPIUHGJNGTHCUVXQT\ÒINKEJ  179


POLEN

5830

5829



5829

#WIWUV+++5KNDGTOGFCKNNGXQP(9GTOWVJCWHFGP(GKGTVCIFGT5VKHVWPIFGU1T FGPUXQO9GK­GP#FNGT$TWUVDKNFTOKVWOIGNGIVGO/CPVGNWPFFGT-GVVGFGU1TFGPUXQO)QNFGPGP 8NKGU$CTQEMGT 6KUEJ FCTCWH FKG -GVVG FGU 1TFGPU XQO 9GK­GP #FNGT  OO  I *%\    4CPFHGJNGTMN-TCV\GTKO(GNFFGT4ÒEMUGKVGUGJTUEJÌP



7PVGTFGOKP5CEJUGPWPF2QNGPTGIKGTGPFGP/KPKUVGT*GKPTKEJ)TCHXQP$TÒJNMQPPVGOCPUKEJFKG4KVVGTYÒTFGFGU 1TFGPUXQO9GK­GP#FNGTHÒTRQNPKUEJG)WNFGPGTMCWHGP<YKUEJGPWPFYWTFGPGVYC8GT NGKJWPIGPXQTIGPQOOGP



5VCPKUNCWU #WIWUV  8GTUKNDGTVG $TQP\GOGFCKNNG Q , XQP # FG )GPPCTQ CWH ,WNKWU +   1FGUECNEJK *GT\QI XQP %GTK $TCEJKCPQ WPF 5KTOKGP 0GHHG XQP 2CRUV +PPQEGP\ :+ $TWUVDKNF T OKV   WOIGNGIVGO/CPVGN)GHNÒIGNVGT)GPKWUUVGJVXXCWH9QNMGKPFGT4GEJVGP2QUCWPGKPFGT.KPMGP (ÒNNJQTPCWUFGOFTGK-TQPGPJGTCWUHCNNGPOOI*%\ 8QT\ÒINKEJ

5831 1:1,5



5832



5833

$TQP\GOGFCKNNG  XQP , 2 *QN\J·WUGT ICNXCPQRNCUVKUEJ CWU \YGK 6GKNGP \WUCOOGPIGUGV\V CWH   5KOQP #OCFGWU <WI 'TDCWGT FGT GXCPIGNKUEJGP -KTEJG KP 9CTUEJCW $TWUVDKNF FGU #TEJKVGMVGP KP   )GJTQEMT3WGTUEJPKVVFWTEJFKG-KTEJGOO*%\ FQTVKP5KNDGT   )CNXCPQCWU\YGK6GKNGP\WUCOOGPIGUGV\VXQT\ÒINKEJ





-QPX6CNGT9CTUEJCW)WO

5GJTUEJÌP





6CNGT <NQV[ 9CTUEJCW&CX)WO

5GJTUEJÌP



180


POLEN

5834

5836



4GXQNWVKQP<NQV[-)9CTUEJCW2T·IWPIFGT#WHUV·PFKUEJGP)WO  (CUVXQT\ÒINKEJ





 <NQV[  -) 9CTUEJCW 2T·IWPI FGT #WHUV·PFKUEJGP &C\W -TCMCW 5VCFV  )TQU\[      <NQV[)WO FQTVKTTVÒONKEJCNU-WRHGTUVÒEMDGUEJTKGDGP   5VÒEM5GJTUEJÌP



4GRWDNKM<NQV[9CTUEJCW&CX)WO





5839

5837



8QT\ÒINKEJ

5837

<NQV[9CTUEJCWCWHFKG,CJTHGKGTFGU5KGIGUÒDGTFKG6ÒTMGPFWTEJ,QJCPP+++5QDKGUMK &CX)WO 8QT\ÒINKEJ



.1621.'0 

-NGKPG5COONWPIXQP/ÒP\GPFGU,CJTJWPFGTVUXQO-TGW\GTDKU\WO)TÌUEJGTFCTWPVGT CWEJ2T·IWPIGPXQP&CP\KIWPF'NDKPI 5VÒEM/GKUVUGJTUEJÌP



&#0<+) 

5VCFV )TÌUEJGT  OKV 6KVGN 5KIKUOWPFU +   /KV &TGKDN·VVGTP PGDGP FGT 9GTV\CJN   &WVMQYUMK5WEJCPGM++C 'VYCUDGTKGDGPUGJTUEJÌP

5840

5841

5842

5843

5844



5845



)TQUEJGP  IGRT·IV Y·JTGPF FGT $GNCIGTWPI FGT 5VCFV \WT <GKV FGU $ÒTIGTCWHUVCPFU  &WV   MQYUMK5WEJCPGMG 445EJÌPpUGJTUEJÌP





)TQUEJGP  IGRT·IV Y·JTGPF FGT $GNCIGTWPI FGT 5VCFV \WT <GKV FGU $ÒTIGTCWHUVCPFU  &WV   MQYUMK5WEJCPGM 44-N5EJTÌVNKPIUHGJNGTWPFIGYGNNVUGJTUEJÌP





)TQUEJGPOKV6KVGN5VGRJCP$CVJQT[U  &WVMQYUMK5WEJCPGM  #VVTCMVKXGUUGJTUEJÌPGU'ZGORNCT





5EJKNNKPIOKV6KVGN5VGRJCP$CVJQT[U  &WVMQYUMK5WEJCPGM+

8QT\ÒINKEJ





5EJKNNKPIOKV6KVGN5VGRJCP$CVJQT[U  &WVMQYUMK5WEJCPGM+8

8QT\ÒINKEJ





&GPCTCWUFGT<GKV5KIKUOWPFU+++  &WVMQYUMK5WEJCPGM8++  5GNVGPKPFKGUGT'TJCNVWPI8QT\ÒINKEJ

 181


POLEN

5846 5847

5847





1TV 4GKEJUVCNGT OKV6KVGN5KIKUOWPFU+++  /KV5KIPCVWT5$CWHFGT9CRRGPUGKVG

5VCPKUNCY$GTOCP/ÒP\OGKUVGTKP&CP\KI WPFOKV5#WPVGTFGO$TWUVDKNF 5COWGN#O OQP/GFCKNNGWTWPF5VGORGNUEJPGKFGTKP&CP\KI &WVMQYUMK5WEJCPGM+D  *ÒDUEJG2CVKPCMN2T·IGUEJY·EJGXQT\ÒINKEJ



4GKEJUVCNGTOKV6KVGN,QJCPP-CUKOKTU  &CX&WVMQYUMK5WEJCPGM+CXCT -N5EJTÌVNKPIUHGJNGTMN&TWEMUVGNNGUGJTUEJÌP



5848

5850

5849



5KNDGTOGFCKNNG  XQP , *ÌJP CWH FKG ,CJTHGKGT FGU .QUNÌUWPI FGT 5VCFV &CP\KI XQP FGT 1T   FGPUJGTTUEJCHV &GT RTGW­KUEJG #FNGT OKV 5EJYGTV UVGJV CWH 2QUVCOGPV XQT 5VCFVCPUKEJV FCTÒDGT FGT   HNKGIGPFG IGMTÌPVG RQNPKUEJG #FNGT OKV IGUEJWNVGTVGO <GRVGT WPF FGT UVTCJNGPFG 0COG ,GJQXCU   <GKNGP5EJTKHVFCTÒDGTFCU&CP\KIGT9CRRGPOOI&WVMQYUMK5WEJCPGMC  48QT\ÒINKEJ 



5KNDGTIW­OGFCKNNGQ, WO WPUKIPKGTVPCEJ5&CFNGT  CWHFKG'JG$TCWVRCCTTGKEJVUKEJ FKG*·PFGÒDGTGKPGO#NVCTFCTÒDGTHNCOOGPFGU*GT\QDGP6CWDGKP5VTCJNGP\YKUEJGP\YGK'PIGNP (ÒPHMÌRHKIG (COKNKG UVGJV DGVGPF XQT GKPGO IGFGEMVGP 6KUEJ /KV 4CPFITCXWT 6GT )GFCIVGPKU FGT   5KNXGTFG $TWKLNQHHV XCP 2KGVGT $QTOGGUVGT GP 6KGVKLG 1WNOCP IGXKGTVFGP  ,WNKL  ô.@  OO   I9KGEGM 5GJTUEJÌP



)TQUEJGP )WNFGP<NQV[ OKV6KVGN#WIWUVU+++ (TKGFTKEJ#WIWUV++XQP5CEJUGP  &WVMQYUMK5WEJCPGM .GKEJVLWUVKGTVYKP\5EJTÌVNKPIUHGJNGTXQT\ÒINKEJp5VGORGNINCP\





182


POLEN

5851



$TQP\GOGFCKNNGWPUKIPKGTVCWHFKG+PVGTPCVKQPCNG$TKGHOCTMGP#WUUVGNNWPIKP&CP\KIXQO ,WNK 5EJKHH XQT 5VCFVCPUKEJV.QTDGGTMTCP\ OKV FGP HÒPH 9CRRGP XQP 6KGIGPJQH 1NKXC &CP\KI <QR   RQVWPF0GWVGKEJFCTÒDGT(ª48'4&+'05681..'.'+5670)mOO 8QT\ÒINKEJ



.QVU&KXGTUG/ÒP\GPFGU,CJTJWPFGTVUWC&GPCT5EJKNNKPI 4 GVE+PVGT GUUCPVGU.QVDKVVGDGUKEJVKIGP 5VÒEM5GJTUEJÌP





1TV 6CNGT  Z  Z 



5VÒEM/GKUVUGJTUEJÌP



5854

'.$+0) 

5VCFV<KPPOGFCKNNGWPUKIPKGTVCWHFKG,CJTHGKGTFGT5VCFV5VCFVYCRRGP-QIIGOO &WVMQYUMK5WEJCPGM 5VGORGNINCP\



5855

5856

5856

-4#-#7 

5VCFV $TQP\GOGFCKNNG  WPUKIPKGTV CWH FKG ,CJTHGKGT FGT -QPUVKVWVKQP )GMTÌPVGU 9CRRGP   \YKUEJGP'KEJGPWPF2CNO\YGKI<YGK<GKNGP5EJTKHVFC\YKUEJGP8GT\KGTWPIGPOO  8QT\ÒINKEJ



9#45%*#7 

5VCFV 5KNDGTOGFCKNNG Q , XQP - $ CWH FKG ,CIFCWUUVGNNWPI KP 9CTUEJCW *KTUEJ UVGJV N5VGTP   FCTKPFGTIGMTÌPVGTWUUKUEJG&QRRGNCFNGTÒDGT,CIFVTQRJ·GOOI 8QT\ÒINKEJ

 183


RUMÄNIEN

5857

-¤0+)4'+%* 

47/0+'0

-CTN +  5KNDGTOGFCKNNG  XQP ( 9 -WNNTKEJ CWH UGKPG 8GTO·JNWPI OKV 'NKUCDGVJ   1VVKNKG XQP 9KGF %CTOGP 5[NXC  $GKFGT $ÒUVGP PGDGPGKPCPFGT N#PUKEJV FGT $WTI *QJGP\QNNGTP   OOI5QOOGT- 2TCEJVGZGORNCTOKVJGTTNKEJGT6ÌPWPI5VGORGNINCP\



'NKUCDGVJ 1VVKNKG \W 9KGF FKG UR·VGTG -ÌPKIKP XQP 4WO·PKGP YWTFG CO  &G\GODGT  CNU GTUVGU -KPF FGU   (ÒTUVGP *GTOCPP WPF FGT (ÒTUVKP /CTKG IGDQTGPG 2TKP\GUUKP XQP 0CUUCW9GKNDWTI CWH 5EJNQ­ /QPTGRQU DGK   0GWYKGF CO 4JGKP IGDQTGP 5KG GTJKGNV XQP 'T\KGJGTKPPGP WPF *CWUNGJTGTP GKPG UGJT WOHCUUGPFG #WUDKNFWPI FKG   KPUDGUQPFGTGKJTG$GICDWPIHÒT(TGOFURTCEJGPHÌTFGTVGWPFYGKVÒDGTFCUÒDNKEJG/C­JKPCWUIKPI+PFGT<GKVXQP  YCT KJT *CWUNGJTGT )GQTI 5CWGTYGKP OKV FGO UKG GKP .GDGP NCPI $TKGHMQPVCMV JKGNV +P FKGUG <GKV IGJV   KJT 2UGWFQP[O %CTOGP 5KNXC \WTÒEM 5CWGTYGKP PCPPVG UKEJ 5[NXCVKEWU  /KV  ,CJTGP NGTPVG UKG CO *QH KP   $GTNKPFGP1HHK\KGT2TKP\-CTN'KVGNXQP*QJGP\QNNGTP5KIOCTKPIGP(ÒTUVXQP4WO·PKGPMGPPGPWPFJGKTCVGVGKJP #O0QXGODGTVTCHFKGLWPIG'JGHTCWKP4WO·PKGPGKPYQHÒTUKGGKPXÌNNKIPGWGT.GDGPUCDUEJPKVV KPGKPGOHTGOFGP.CPFOKVGKPGTHTGOFGP-WNVWTDGICPP(ÒT-CTNWPF'NKUCDGVJYCTGPFKGGTUVGP,CJTGKP4WO· PKGP UKEJGTNKEJ FKG UEJYGTUVGP &KG CPVKFGWVUEJG 5VKOOWPI KO .CPF WPF GTPUVJCHVG YKTVUEJCHVNKEJG 5EJYKGTKIMGKVGP   DGFTQJVGPKOOGTYKGFGTFGP$GUVCPFFGUPQEJLWPIGP(ÒTUVGPVJTQPGU+PFKGUGT<GKVXGTUVCPFGU'NKUCDGVJPKEJVPWT KJTGP /CPP FGT UKEJ OKV #DFCPMWPIURN·PGP VTWI CWH\WTKEJVGP UQPFGTP FWTEJ KJT GKPPGJOGPFGU 9GUGP GEJVG   5[ORCVJKGPKPFGT$GXÌNMGTWPIHÒTFCUCWUN·PFKUEJG*GTTUEJGTJCWU\WIGYKPPGP&WTEJFKG*GKTCVGTÌHHPGVGUKEJKJT KP4WO·PKGPGKP$GV·VKIWPIHGNFCWHFGOUKGUKEJDGUQPFGTUFWTEJKJTUQ\KCNGUWPFMCTKVCVKXGU'PICIGOGPVFCUUKEJ XQT CNNGO CWH -KPFGT WPF FCU $KNFWPIU WPF 'T\KGJWPIUYGUGP KJTGU .CPFGU MQP\GPVTKGTVG JGTXQTVCV 0CEJFGO KJT   GKP\KIGU-KPFKJTG6QEJVGT/CTKG

Ó CPGKPGO5EJCTNCEJHKGDGTIGUVQTDGPYCTUVGNNVG'NKUCDGVJKOOGT OGJTKJTGMÒPUVNGTKUEJG6·VKIMGKVFKGPGDGPFGT&KEJVMWPUVCWEJFKG/CNGTGKWPFFKG/WUKMWOHC­VGKPFGP/KVVGN RWPMV+O,CJTGCNU-CTN\WO-ÌPKIXQP4WO·PKGPGTJQDGPYWTFGGTUEJKGPKJTGGTUVG8GTÌHHGPVNKEJWPIWPVGT FGO 0COGP %CTOGP 5[NXC 7PVGT FKGUGO 2UGWFQP[O XGTÌHHGPVNKEJVG FKG -ÌPKIKP OGJT CNU  9GTMG #O    1MVQDGTUVCTD-CTN+MPCRRCPFGTVJCND,CJTGUR·VGTCO/·T\GTNCIFKG-ÌPKIKPGKPGTFQRRGNUGKVKIGP .WPIGPGPV\ÒPFWPI   +JTGTTJGKPKUEJGP*GKOCVKUVUKGDKU\WKJTGO6QFKOOGTGPIXGTDWPFGPIGDNKGDGP1DYQJNFKG9GTMGFGTFKEJVGP FGP-ÌPKIKPJGWVGMCWOPQEJDGMCPPVUKPFKUVFKG'TKPPGTWPICP'NKUCDGVJKP0GWYKGFKOOGTPQEJRT·UGPV

5859

5858

5858



$TQP\GOGFCKNNGWPUKIPKGTVCWHFKG)TÒPFWPIFGT-KTEJGFGU9CKUGPJCWUGU'NGPC&ÈOPCFWTEJ (ÒTUVKP'NKUCDGVJ#PUKEJVFGU)GD·WFGU<GKNGP5EJTKHVOO9WT\DCEJ 8QT\ÒINKEJ





$CPK2CTKU2TQDG &KEMUVÒEM KP-WRHGT0KEMGN<KPMI4CWVC5





$TQP\GOGFCKNNGXQP,%JCWHFKG-TÌPWPIFGU-ÌPKIURCCTGU$ÒUVGP-CTNUWPFUGKPGT)GOCJNKP 'NKUCDGVJ 1VVKNKG XQP 9KGF %CTOGP 5[NXC  PGDGPGKPCPFGT T FCTÒDGT -TQPG8KGT <GKNGP 5EJTKHV   OO&C\W'KPYGKVGTGUXGTIQNFGVGU'ZGORNCTOKV6TCIGÌUGWPF$CPFOO  5VÒEM8QT\ÒINKEJ

184

5GJTUEJÌP




RUMÄNIEN

5863

5861

5862



<KPPOGFCKNNGQ,  XQP(9-WNNTKEJCWHUGKPG)GOCJNKP-ÌPKIKP'NKUCDGVJ1VVKNKGXQP9KGF

%CTOGP 5[NXC  $ÒUVG FGT -ÌPKIKP T'KEJGPNCWDMTCP\ OKV NGGTGO (GNF  OO 5QOOGT -   &C\W'KPUGKVKIGT#DUEJNCIXQO8QTFGTUGKVGPUVGORGNFGT$TQP\GOGFCKNNGQ,  XQP(9 -WNNTKEJCWHFKG#WHPCJOGFGT-ÌPKIKP'NKUCDGVJ %CTOGP5[NXC CNU'JTGPOKVINKGFKPFKG4WO·PK UEJG#MCFGOKG$ÒUVGFGT-ÌPKIKPTOO5QOOGT-5QOOGT-  5VÒEM8QT\ÒINKEJp5VGORGNINCP\





'KPUGKVKIGTGEJVGEMKIG$TQP\GRNCMGVVGQ,XQP#)CNCODQUCWHUGKPG)GOCJNKP-ÌPKIKP'NKUCDGVJ 1VVKNKGXQP9KGF %CTOGP5[NXC $TWUVDKNF'NKUCDGVJUTOKV5EJNGKGTZOO 8QT\ÒINKEJ





.GK$$WMCTGUV&CX4CWVC

8QT\ÒINKEJp5VGORGNINCP\



2TCEJVGZGORNCT(CUV5VGORGNINCP\



5864



.GK89KGP4CWVC

5865



$TQP\GOGFCKNNGXQP(9-WNNTKEJCWHFKG8QNNGPFWPIFGU.WUVUEJNQUUGU2GNGUEJKP4WO·PKGP $ÒUVGP -CTNU WPF UGKPGT )GOCJNKP 'NKUCDGVJ 1VVKNKG XQP 9KGF %CTOGP 5[NXC  PGDGPGKPCPFGT N   #PUKEJVFGU5EJNQUUGUOO5QOOGT- 2TCEJVGZGORNCT(CUV5VGORGNINCP\

 185


RUMÄNIEN

5866



<KPPOGFCKNNG  XQP ( 9 -WNNTKEJ CWH FKG 8QNNGPFWPI FGU .WUVUEJNQUUGU 2GNGUEJ KP 4WO·PKGP   $ÒUVGP -CTNU WPF UGKPGT )GOCJNKP 'NKUCDGVJ 1VVKNKG XQP 9KGF %CTOGP 5[NXC  PGDGPGKPCPFGT N   #PUKEJVFGU5EJNQUUGUOO5QOOGT- (CUV5VGORGNINCP\



5867



$TQP\GOGFCKNNG  XQP ( 9 -WNNTKEJ WPF 4 (GUUNGT CWH FKG 4GUVCWTKGTWPI FGT $KUEJQHUMKTEJG   %WTVGCFG#TIGUKP4WO·PKGP$ÒUVGP-CTNUWPFUGKPGT)GOCJNKP'NKUCDGVJ1VVKNKGXQP9KGF %CTOGP 5[NXC PGDGPGKPCPFGTN#PUKEJVFGT-KTEJGOO5QOOGT- 8QT\ÒINKEJ



'KPG 5KNDGTOGFCKNNG FGU RTGW­KUEJGP -ÌPKIU (TKGFTKEJ +++ XQP  OKV GKPGT 9KFOWPI HÒT -ÌPKIKP   'NKUCDGVJHKPFGP5KGWPVGTFGT0T

5869

5868





186

5868

$TQP\GOGFCKNNG  XQP 2 6GNIG $GTNKP CWH FKG ,CJTHGKGT FGT #ECFGOKC 4QOCPC KP $WMCTGUV   $ÒUVGP -CTNU WPF UGKPGT )GOCJNKP 'NKUCDGVJ 1VVKNKG XQP 9KGF %CTOGP 5[NXC  PGDGPGKPCPFGT  N   /KPGTXCOKV5RGGTWPF5EJKNFUVGJVHCUVXXKPFGT4GEJVGPJ·NVUKG8KMVQTKCCWH)NQDWUOO 5QOOGT-#PO -N(NGEMGPXQT\ÒINKEJ



5KNDGTOGFCKNNG  XQP (GUUNGT CWH FCU L·JTKIG 'JGLWDKN·WO FGU -ÌPKIURCCTGU &KG KPGKPCPFGT   XGTUEJNWPIGPGP/QPQITCOOG-CTNUWPFUGKPGT)GOCJNKP'NKUCDGVJ1VVKNKGXQP9KGF %CTOGP5[NXC  -TQPGÒDGT::8OOI (CUVXQT\ÒINKEJ




RUMÄNIEN

5870 1:1,3



$TQP\GOGFCKNNG  XQP ( : 2CYNKM 4 0GWDGTIGT WPF , 4GUEJ CWH FGP TWO·PKUEJGP -NGTWU   $TWUVDKNFGT-CTNUKP7PKHQTOWPFUGKPGT)GOCJNKP'NKUCDGVJ1VVKNKGXQP9KGF %CTOGP5[NXC PGDGP GKPCPFGTN8GT\KGTVGU9CRRGPOO 8QT\ÒINKEJ



5872

5871





5871

5KNDGTOGFCKNNG  WPUKIPKGTV CWH FKG 8QNNGPFWPI FGT PGWGP &QPCWDTÒEMG DGK %GTPCXQFC $ÒUVGP   -CTNU WPF UGKPGT )GOCJNKP 'NKUCDGVJ 1VVKNKG XQP 9KGF %CTOGP 5[NXC  PGDGPGKPCPFGT N <GKNGP   5EJTKHVOOI9WT\DCEJ (GKPG6ÌPWPIXQT\ÒINKEJ



6TCIDCTG5KNDGTOGFCKNNGXQP%JT.CWGTCWHFKG8QNNGPFWPIFGT'KUGPDCJPDTÒEMGÒDGTFKG&QPCW DGK%GTPCXQFC$ÒUVGP-CTNUWPFUGKPGT)GOCJNKP'NKUCDGVJ1VVKNKGXQP9KGF %CTOGP5[NXC PGDGP GKPCPFGTN#PUKEJVFGT'KUGPDCJPDTÒEMGOOI (GKPG6ÌPWPIXQT\ÒINKEJ



5873



5KNDGTOGFCKNNGXQP&KOKVTGUEWCWHFKG'KPYGKJWPIFGT&GRQUKVGPWPF5RCTMCUUG %CUCFG&GRW PKGTK  KP $WMCTGUV 7PKHQTOKGTVGU $TWUVDKNF N OKV /CPVGN WPF WOIGNGIVGT 1TFGPUMGVVG#PUKEJV FGU   )GD·WFGUOOI9WT\DCEJ FQTVKP$TQP\G   +P5KNDGTUGNVGP-N4CPFHGJNGTWPF-TCV\GTXQT\ÒINKEJ

 187


RUMÄNIEN

5874



8GTIQNFGVG $TQP\GOGFCKNNG  XQP / %CTPKQN CWH FKG )GDWTV UGKPGU )TQ­PGHHGP 0KMQNCWU 5QJP   UGKPGU0GHHGP(GTFKPCPF UR·VGT-ÌPKI(GTFKPCPF+ $TWUVDKNFGTFGU-ÌPKIURCCTGUWPFFGU<CTGPRCCTGU XQP 4W­NCPF 0KMQNCWU ++ 2CVGFGU-KPFGUWPFUGKPG)GOCJNKP#NGZCPFTC(GQFQTQYPC GKPCPFGTIG IGPÒDGTKO*KPVGTITWPFNGGTVGKP'PIGNGKP(ÒNNJQTPÒDGTFGOPGWIGDQTGPGP2TKP\GPFCPGDGPFKGFTGK ·NVGUVGP -KPFGT (GTFKPCPFU 2TKP\ -CTN UR·VGT -CTN ++  2TKP\GUUKP 'NKUCDGVJ WPF 2TKP\GUUKP /CTKC   WPVGP 5EJTKHVDCPF ÒDGT FGT #PUKEJV FGU 5EJNQUUGU 2GNGUEJ-GNEJ ÒDGT UKGDGP <GKNGP 5EJTKHV WOJGT   IGMTÌPVGT9CRRGPMTCP\OO9WT\DCEJ 44(CUVXQT\ÒINKEJ



5875



4GEJVGEMKIG $TQP\GRNCMGVVG  XQP ( 5VQTEM CWH FKG )QNFGPG *QEJ\GKV FGU -ÌPKIURCCTGU $ÒUVGP   -CTNU KP 7PKHQTO WPF UGKPGT )GOCJNKP 'NKUCDGVJ 1VVKNKG XQP 9KGF %CTOGP 5[NXC  GKPCPFGT IGIGP   ÒDGTWPVGP\YGK.ÌYGPOKV9CRRGPUEJKNFGPFCTÒDGT-TQPG5GEJU<GKNGP5EJTKHVKPXGT\KGTVGO4CJ OGPZOO 8QT\ÒINKEJ



5876



188

$TQP\GOGFCKNNG  XQP / 0GNNK (NQTGP\ CWH FKG 'KPINKGFGTWPI DWNICTKUEJGT )GDKGVG PCEJ FGO   $CNMCPMTKGIKO(TKGFGPXQP$WMCTGUV$TWUVDKNFGT-CTNUWPFUGKPGT)GOCJNKP'NKUCDGVJ1VVKNKGXQP9KGF

%CTOGP 5[NXC  PGDGPGKPCPFGT N&CU RGTUQPKHK\KGTVG 4WO·PKGP UVGJV X X WOJGT XKGT MPKGPFG   YGKDNKEJG)GUVCNVGPOO9WT\DCEJ (CUVXQT\ÒINKEJ




SCHWEDEN

5877



4GEJVGEMKIG$TQP\GRNCMGVVGXQP)&GXTGGUGCWHUGKPG)GOCJNKP-ÌPKIKP'NKUCDGVJ1VVKNKGXQP 9KGF %CTOGP 5[NXC  $TWUVDKNF FGT -ÌPKIKP T OKV 5EJNGKGT6CHGN OKV FTGK <GKNGP 5EJTKHV CWH .QT   DGGT\YGKIQDGPXKGT<GKNGP5EJTKHVWPVGP\YGK<GKNGP5EJTKHVZOO (CUVXQT\ÒINKEJ



ex 5879

ex 5878

5#0/#4+01 

4GRWDNKM 5KNDGTOÒP\GPUCV\  WPF  4 4QO DGUVGJGPF CWU  .KTG  .KTC WPF  %GPVGUKOK   UQYKG.KTG.KTGWPF.KTC  5VÒEM+P\GKVIGPÌUUKUEJGOTQVGP5COVNGFGTGVWK(GKPG6ÌPWPIXQT\ÒINKEJp5VGORGNINCP\ 



5KNDGTOÒP\GPUCV\44QODGUVGJGPFCWUWPF.KTG  5VÒEM+PDNCWGO5COVNGFGTGVWK8QT\ÒINKEJp5VGORGNINCP\



5881 5880

-¤0+)4'+%* 



5880

5%*9'&'0

)WUVCX++#FQNH1XCNG5KNDGTOGFCKNNGQ,WPUKIPKGTV)GJCTPKUEJVGU$TWUVDKNFFGU-Ì PKIUTOKV.QTDGGTMTCP\WPFWOIGNGIVGO/CPVGN$TWUVDKNFUGKPGT)GOCJNKP/CTKC'NGQPQTC6QEJVGT ,QJCPP5KIKUOWPFUXQP$TCPFGPDWTINZOOI$TQEMOCPP*KNFGDTCPF+5  FQTVCNU)W­  442TCEJVGZGORNCT8QT\ÒINKEJp5VGORGNINCP\ -W-NKRRG\W¤TG5·VGTQFGT0[MÌRKPI#JNUVTÌO

5GJTUEJÌP

  189


SCHWEDEN

5882

5883 1:2



%JTKUVKPC/CTM5VQEMJQNO#JNUVTÌO

5GJTUEJÌP





-CTN:+-WRHGTRNCVVG\W&CNGT5KNXGTO[PV#XGUVCZOO8KGTGEMKIG 2NCVVG OKV GKPGO 4ÒEMUGKVGPUVGORGN KP FGT /KVVG WPF LG GKPGO 8QTFGTUGKVGPUVGORGN KP FGP 'EMGP   #JNUVTÌO6KPIUVTÌO5' 445GJTUEJÌP 

5884

5885 1:1,5



(TKGFTKEJ+4KMUFCNGT5VQEMJQNO/KV4CPFUEJTKHV#JNUVTÌO&CX  #VVTCMVKXGU'ZGORNCTOKVJÒDUEJGT2CVKPCUGJTUEJÌP





-WRHGTRNCVVG\W&CNGT5KNXGTO[PV#XGUVCZOO#JNUVTÌO6KPIUVTÌO5# 5GJTUEJÌP



190


SCHWEDEN

5887

5887

5888

5886 1:2

5888



-WRHGTRNCVVG\W&CNGT5KNXGTO[PV#XGUVCZOO#JNUVTÌO6KPIUVTÌO5# 45GJTUEJÌP





5KNDGTOGFCKNNG  IGRT·IV   5WKVGPOGFCKNNG XQP % 'PJÌTPKPI $TWUVDKNF T OKV WOIGNGIVGO   *GTOGNKP8KGT<GKNGP5EJTKHVKP.QTDGGTMTCP\OOI*KNFGDTCPF++5  (GKPG6ÌPWPIXQT\ÒINKEJ





#FQNH(TKGFTKEJ4KMUFCNGT5VQEMJQNO#JNUVTÌO&CX  (GKPG2CVKPCUGJTUEJÌPpXQT\ÒINKEJ



5890 5889

5889



-CTN:+8,QJCPP4KMUFCNGT5VQEMJQNO#JNUVTÌO&CX  /KPLWUVKGTVXQT\ÒINKEJ





1UMCT++-TQPG5VQEMJQNO#JNUVTÌO  2TCEJVGZGORNCT*GTTNKEJG2CVKPCXQT\ÒINKEJp5VGORGNINCP\5VGORGNINCP\



.165%*9'&'0 

-NGKPG 5COONWPI XQP /ÒP\GP FGU  ,CJTJWPFGTVU XQO -W¤TG DKU \WO 4KMUFCNGT FCTWPVGT   CWEJDGUUGTG6[RGPWPFVGKNYGKUGJÒDUEJG3WCNKV·VGP+PVGTGUUCPVGU.QVDKVVGDGUKEJVKIGP  5VÒEM6GKNYGKUGOKVMN(GJNGTPUGJTUEJÌPWPFDGUUGT  191


SCHWEIZ

5893

5892



1,5:1

5%*9'+<

##4)#7

-CPVQP$CV\GP#CTCWQFGT.W\GTP&6

5EJÌPG2CVKPCUGJTUEJÌPpXQT\ÒINKEJ



$#5'. 

$KUVWO $GTVJQNF ++ XQP 2HKTV  'KPUGKVKIGT 2HGPPKI  I 6WTO ÒDGT -QRH \YKUEJGP   \YGK&QNEJGP$GTIGT5NI9ÒVJTKEJ9KGNCPFV $CUGN G 445GJTUEJÌP



(9KGNCPFVXGTOWVGVJKPVGTFKGUGO6[RGKPGPYGNVNKEJGP$GKUEJNCIFGU)TCHGP7NTKEJXQP2HKTV

5894

5896

 

5VCFV)WNFGPVCNGT -TGW\GT &CX*/<K )WNFGPVCNGT -TGW\GT &CX*/<P



5VCFV6CNGT&CX#&6XCT

$'40

5897

5895

5GJTUEJÌPGU'ZGORNCT -N5EJTÌVNKPIUTKUUGUGJTUEJÌP

 

.GKEJVLWUVKGTVUGJTUEJÌPpXQT\ÒINKEJ



5898



6CNGT\W$CV\GP&CX&6C  4#VVTCMVKXGUXQT\ÒINKEJGU'ZGORNCTOKVHGKPGT6ÌPWPI





6CNGT\W$CV\GP&CX&6



192

(GKPG6ÌPWPIXQT\ÒINKEJ


SCHWEIZ

5900

5899

5900



-CPVQP(TCPMGP$GTP&6



5KNDGTOGFCKNNG  WPUKIPKGTV XQP %J (WGVGT CWH FKG #PINKGFGTWPI FGU GJGOCNU HÒTUVDKUEJÌHNKEJ   DCUNGTKUEJGP,WTCCPFGP-CPVQP$GTPWPFCWHFKG*WNFKIWPIKP&GNUDGTI &¾N¾OQPV 5QIGPCPPVGT,WTC 6CNGT )GMTÌPVGU 5VCFVYCRRGP#EJV <GKNGP 5EJTKHV KP .QTDGGTMTCP\  OO  I 5EJYGK\GT   /GFCKNNGP#WMVKQP.GW<ÒTKEJ0T  2TCEJVGZGORNCTOKVJGTTNKEJGT6ÌPWPI8QT\ÒINKEJp5VGORGNINCP\

8QT\ÒINKEJp5VGORGNINCP\





5902

5901

5901





5KNDGTOGFCKNNG  WPUKIPKGTV XQP %J (WGVGT CWH FKG #PINKGFGTWPI FGU GJGOCNU HÒTUVDKUEJÌHNKEJ   DCUNGTKUEJGP,WTCCPFGP-CPVQP$GTPWPFCWHFKG*WNFKIWPIKP&GNUDGTI &¾N¾OQPV 5QIGPCPPVGT,WTC 6CNGT )GMTÌPVGU 5VCFVYCRRGP#EJV <GKNGP 5EJTKHV KP .QTDGGTMTCP\  OO  I 5EJYGK\GT   /GFCKNNGP#WMVKQP.GW<ÒTKEJ0T  2TCEJVGZGORNCTOKVHGKPGT6ÌPWPI8QT\ÒINKEJp5VGORGNINCP\



5KNDGTOGFCKNNG Q , WO   WPUKIPKGTV 5EJWNRT·OKG )GMTÌPVGU 9CRRGP \YKUEJGP .QTDGGT WPF   2CNO\YGKI)·TVPGTMPKGVPCEJTWPFRHNCP\VGKPGPLWPIGP$CWOGKPOOI 8QT\ÒINKEJ



5903

5904

$'41/ª056'4 

%JQTJGTTGPUVKHV  /KEJCGNURHGPPKI Q , WO   XQP , /G[GT $GJGNOVGU 9CRRGP CWH GKPGT   GEMKIGP -CTVWUEJG FKG OKV GKPGO 1TFGPUUVGTP .QTDGGT WPF 2CNO\YGKI XGT\KGTV KUV&GT JGKNKIG /K   EJCGN OKV $NKV\DÒPFGN WPF 1XCNUEJKNF GTUEJN·IV OKV IG\CEMVGO $NKV\ FGP &TCEJGP  OO  I   5EJYGK\GT/GFCKNNGP#WMVKQP.GW<ÒTKEJ0T 8QT\ÒINKEJ



&CU%JQTJGTTGPUVKHV$GTQOÒPUVGTNKGIVKO-CPVQP.W\GTP&KG)TÒPFWPIFGU5VKHVGUYKTFCWHGKPGP)TCHGP$GTQXQP .GP\DWTI \WTÒEMIGHÒJTV YGNEJGT CPIGDNKEJ KO ,CJTG  CP FGT 5VGNNG GKPG FGO 'T\GPIGN /KEJCGN IGYGKJVG -C   RGNNGGTTKEJVGPNKG­YQUGKPGKP\KIGT5QJPCWHFGT,CIFXQPGKPGO$·TGPGTFTÒEMVYWTFG  2HGPPKIGYKGCWEJWPUGTXQTNKGIGPFGU5VÒEMYWTFGPWCFGPPCEJ$GTQOÒPUVGTMQOOGPFGPHTGOFGP/WUKMCPVGP IGUEJGPMV



%*74

$KUVWO7NTKEJ8+XQP/QPV-TGW\GTOKV6KVGN.GQRQNFU+&6C  -N2T·IGUEJY·EJGUGJTUEJÌP

 193


SCHWEIZ

5905

 

5906

6CNGTOKV6KVGN.GQRQNFU+&CX&6C 5VCFV-TGW\GT&6G

5907

5GJTUEJÌP -N<CKPGPFGHCUVXQT\ÒINKEJ

 

'+05+'&'.0 

0KMQNCWU+++OHGNF5KNDGTOGFCKNNGQ,  OKV5KIPCVWT)5PCEJGKPGO5VGORGN XQP , % *GFNKPIGT CWH FKG ,CJTHGKGT FGT 'PIGNYGKJG &GT JGKNKIG 5V /GKPTCF MPKGV PCEJ T KP   GKPGT IG\KOOGTVGP /ÌPEJU\GNNG XQT GKPGO $NQEMCNVCT OKV FGT 'KPUKGFNGTOCFQPPC WPVGP FKG #VVTKDWVG   -GWNG$TQV$GEJGTWPF4CDGPRCCT#PUKEJVFGT'KPUKGFNGT)PCFGPMCRGNNGOOI(GNFGT #PO5EJYGK\GT/GFCKNNGP#WMVKQP.GW<ÒTKEJ0T  4#O4CPFNGKEJVDGCTDGKVGVXQT\ÒINKEJ



5909

5908



 194

5908

(+5%*+0)'0

#DVGK$TQP\GOGFCKNNGXQP*,)GUUPGTCWHFGP6QFGUVCIFGT*GKNKIGP+FFCXQP6QIIGP DWTI $TWUVDKNF XQP ,QJCPP (TCP\ 5EJGPM XQP 5VCWHGPDGTI $KUEJQH XQP -QPUVCP\   T KP   IGKUVNKEJGO 1TPCV*ÒHVDKNF FGT *GKNKIGP +FFC XQP 6QIIGPDWTI OKV *KTUEJ XQT FGT 5V +FFCMCRGNNG KP   (KUEJKPIGPKO#DUEJPKVVFTGK<GKNGP5EJTKHVWPF,CJTGU\CJNOO 48QT\ÒINKEJ

)'0(

-CPVQP(TCPMGP&CX&6

(CUVXQT\ÒINKEJ

 


SCHWEIZ

5910

5912

5911

5912

.#7('0$74) 

/ÒP\UV·VVGFGT*CDUDWTIGT'KPUGKVKIGTXKGT\KRHGNKIGT2HGPPKII.ÌYGOKVGTJQDG PGT2TCPMGUEJTGKVGVN$GTIGT5NI9ÒVJTKEJ9KGNCPFV .CWHGPDWTI  5GJTUEJÌP





'KPUGKVKIGTXKGT\KRHGNKIGT2HGPPKII.ÌYGOKVGTJQDGPGT2TCPMGUEJTGKVGVN$GTIGT 5NI9ÒVJTKEJ9KGNCPFV .CWHGPDWTI  5GJTUEJÌP





.7<'40

-CPVQP$CV\GP (TCPMGP &6C

'VYCU(WPFDGNCICWHFGT4ÒEMUGKVGUGJTUEJÌP



5914

5913

 

5913

(TCPMGP 0GWVCNGT .W\GTP&CX&6D

/+51:

,QJCPP,CMQD6TKXWN\KQ%CXCNNQVVQQ,*/<

5915

ex 5916

5917

(GKPG6ÌPWPIXQT\ÒINKEJ



45GJTUEJÌPpXQT\ÒINKEJ



5918

5%*#((*#75'0 

5VCFV'KPUGKVKIGT2HGPPKI#PHCPI,CJTJWPFGTVI9KFFGTURTKPIVNCWUGKPGO6WTOFGTOKV <KPPGPWPFGKPGT-WIGNXGT\KGTVKUV9KGNCPFV 5EJCHHJCWUGP  4#WUIGDTQEJGPUGJTUEJÌP



56)#..'0 



#DVGK 7NTKEJ +8  $TCMVGCV   I -QRH FGU JGKNKIGP )CNNWU X X OKV $CTV   $GTIGT-NGKP7NOGT %% &C\W-·TPVGP7NTKEJ++2HGPPKI5V8GKVCPFGT)NCP  5VÒEM5EJÌPpUGJTUEJÌP



#PQP[O'KPUGKVKIGTXKGT\KRHGNKIGT2HGPPKII9KFFGTUVGJVTFGP-QRH\WTÒEMIG YCPFVFCJKPVGT-TGW\HCJPGWOJGT2GTNMTGKU$GTIGT-NGKP7NOGT %% 5NI9ÒVJTKEJ  4(CUVXQT\ÒINKEJ



&GTXQTNKGIGPFG6[R\GKIV\YGK*ÌTPGTCWHFGO-QRHFGU6KGTGUDGKFGOGUUKEJCNUQPKEJVWOGKP.COOUQPFGTP GJGT WO GKPGP 9KFFGT JCPFGNP FÒTHVG &GT 9KFFGT YKGFGTWO KUV FCU TGFGPFG 9CRRGP XQP 5EJCHHJCWUGP 'U   MÌPPVGUKEJJKGTDGKCNUQCWEJWOGKPGP5EJCHHJCWUGT$GKUEJNCI 5NI9ÒVJTKEJ JCPFGNP

74+5%*9;<70&706'49#.&'0 

-TGW\GT 'VUEJMTGW\GT Q,  $GNNKP\QPC*/<C  447PTGIGNO·­KIGT5EJTÌVNKPIHCUVUGJTUEJÌP

 195


SCHWEIZ

5920

5919 5920

9##&6



-CPVQP$CV\GP.CWUCPPG&6C

8QT\ÒINKEJGU'ZGORNCTOKVHGKPGT6ÌPWPI





$CV\GP 0GWVCNGT .CWUCPPG&CX&6  0WT'ZGORNCTGIGRT·IV#VVTCMVKXGUXQT\ÒINKEJGU'ZGORNCTOKVJGTTNKEJGT2CVKPC



5921

5922

<7)



5VCFV&KEMGP&6D

(CUVXQT\ÒINKEJ



5VCFV5KNDGTOGFCKNNGXQP*,)GUUPGTCWHFKG'THQNIGFGT6TWRRGPFGT5V·PFG<ÒTKEJWPF$GTP KO6QIIGPDWTIGT 8KNNOGTIGT -TKGI&GT<ÒTKEJGT.ÌYGWPFFGT$GTPGT$·TDGKFGOKV5EJYGTVWPF 9CRRGPUEJKNF UVGJGP GKPCPFGT IGIGPÒDGT QDGP UVTCJNGPFG 5QPPG9CHHGPVTQRJ·G KO #DUEJPKVV ,CJ   TGU\CJNOOI5EJYGK\GT/GFCKNNGP#WMVKQP.GW<ÒTKEJ0T  (GKPG6ÌPWPIXQT\ÒINKEJ



<ª4+%*



&GT  8KNNOGTIGT -TKGI YCT FGT XQTNGV\VG 4GNKIKQPUMTKGI KP FGT 5EJYGK\ GPV\ÒPFGV CP 4GNKIQPU WPF #WVQPQOKG   \YKUVKIMGKVGPKO6QIIGPDWTI0CEJOGJTGTGP'KP\GNIGHGEJVGPYWTFGPFKGGPVUEJGKFGPFGP5EJNCEJVGPDGK8KNNOGTIGP CO,WNKFWTEJ$GTPGTWPFDGK*ÒVVGPFWTEJ<ÒTEJGT6TWRRGPIGYQPPGP

5924

5923

  196

6CNGT&CX&6P -CPVQP$CV\GP&6C

5923

8QT\ÒINKEJ (CUVXQT\ÒINKEJ

 


TSCHECHIEN

5925 5926

5926

'+&)'0155'05%*#(6 

(TCPMGP$GTP&KXQ

5GNVGPKPFKGUGT'TJCNVWPI2TCEJVGZGORNCT(CUV5VGORGNINCP\



5%*ª6<'06#.'4  (TCPMGP  /ÒPEJGP 'KFIGPÌUUKUEJGU (TGKUEJKG­GP KP %JWT &CX    &KXQ5 4#VVTCMVKXGUXQT\ÒINKEJGU'ZGORNCTOKVHGKPGT6ÌPWPI

 

.165%*9'+< 

-NGKPOÒP\GP FGU  WPF  ,CJTJWPFGTVU FGT $KUVÒOGT $CUGN WPF 5KVVGP 5KQP  UQYKG FGT #DVGK   5V)CNNGP 5VÒEM5EJÌPUEJÌPpUGJTUEJÌPWPFUGJTUEJÌP



5930

5929

5'4$+'0 



5VGHCP 7TQU +++  /CVCRCP  I &GT -ÌPKI UVGJV X X PGDGP FGO JGKNKIGP 5VGRJCP   %JTKUVWUVJTQPVXX,QXCPQXKE 5GJTUEJÌP



52#0+'0

)+410#

7PVGTHTCP\ÌUKUEJGT$GUGV\WPI.QWKU:+++4GCNGU .KDTC%CVCNCPC )KTQPC $TCWUG/CPUHGNF6H%%6&WRNGUU[ 47PTGIGNO·­KIGT5EJTÌVNKPIUGJTUEJÌP 

-¤0+)4'+%* 

(GNKRG++4GCNGU ! 25GXKNNC%%6

5GJTUEJÌP



.1652#0+'0 

-NGKPG5COONWPI5EJKHHUIGNF\WWPF4GCNGUOGKUVDQNKXKCPKUEJG2T·IWPIGPFGU,CJTJWP FGTVU+PVGTGUUCPVGU.QVDKVVGDGUKEJVKIGP 5VÒEM5EJÌPpUGJTUEJÌP

1,5:1

$¤*/'0/*4'0 

5932



1,5:1

65%*'%*+'0

$QNGUNCWU +  &GPCT 2TCI  I -TGW\ KP FGP 9KPMGNP -WIGN-WIGN4KPIGN-WIGN   -KTEJGPIGD·WFG%CEJ#WMVKQP.CP\:+++)TC\ 448QT\ÒINKEJ  197


TSCHECHIEN

5934

5933

5935

5936



7NTKEJ&GPCT2TCII-KTEJGPIGD·WFGOKV&8:\YKUEJGP)KGDGNWPF$CUKU 5%59'0%'<.#85%CEJ#WMVKQP.CP\:+++)TC\ 4*GTTNKEJG2CVKPCXQT\ÒINKEJ





$TGVKUNCWU+&GPCT2TCII*ÒHVDKNFXXOKV-TGW\2HCWN%CEJ #WMVKQP.CP\:+++)TC\ 8QT\ÒINKEJ





&GPCT2TCII*ÒHVDKNFXXOKV-TGW\2HCWN%CEJ#WMVKQP.CP\:+++)TC\  8QT\ÒINKEJ





&GPCT2TCII$TWUVDKNFXX\YKUEJGP\YGK2WPMVGP$TWUVDKNFTOKV-TGW\%CEJ #WMVKQP.CP\:+++)TC\ (CUVXQT\ÒINKEJ



5937

5938

5939

5940

5941



9TCVKUNCWU ++  &GPCT  2TCI  I $TWUVDKNF N OKV (CJPG$TWUVDKNF T   %CEJ#WMVKQP.CP\:+++)TC\ 8QT\ÒINKEJ





&GPCT  2TCI  I -QRH X X*CPF OKV 5VCD %CEJ  #WMVKQP .CP\  :+++ )TC\    8QT\ÒINKEJ





&GPCT2TCII-QRHÒDGT6JTQP$TWUVDKNFTOKV<GRVGT#WMVKQP.CP\:+++)TC\  48QT\ÒINKEJ





&GPCT  2TCI  I )GMTÌPVGT -QRH T ÒDGT &QRRGNDQIGP OKV FTGK 2WPMVGP*CPF OKV   5VCDPGDGP-CRGNNG%CEJ#WMVKQP.CP\:+++)TC\ 5GJTUEJÌP





1VVQ+FGT5EJÌPG&GPCT1NOÒV\I*CPF-TGW\KPFGP9KPMGNPLG GKP-QRH%CEJ#WMVKQP.CP\:+++)TC\ 45GJTUEJÌP



5942

$¤*/+5%*'2'4510'0/'&#+..'0 

198

*WU,QJCPPGU Ó4GHQTOCVQT5KNDGTPG)W­OGFCKNNGQ, WO 9GTMUVCVV*KGQP[ OWU/CIFGDWTIGT$TWUVDKNFXQP,QJCPPGU*WUTOKV/ÒV\G*WUCWHFGO5EJGKVGTJCWHGPOO I&QPGD-CV\5NI9JKVKPI FKGUGU'ZGORNCT   <GKVIGPÌUUKUEJGT)W­*GPMGNURWT(GNFGTIGIN·VVGVUGJTUEJÌP




ZYPERN

5943

65%*'%*15.19#-'+ 

4GRWDNKM 5KNDGTCDUEJNCI XQP FGP 5VGORGNP FGU&WMCVGP5VÒEMGU-TGOPKV\CWHFKG9KGFGT HPWPI FGU -TGOPKV\GT $GTIDCWU 1TKIKPCNRT·IWPI  OO  I (D XIN  /ÒUGNGT  C   5EJNXIN (CUV5VGORGNINCP\



5944

5945

5945

70)#40 

)¾\C&GPCTI-TGW\KPFGP9KPMGNP-GKN-TGW\-GKN-GKN-TGW\KPFGP9KPMGNP LGGKP-GKN*WU\CTNGKEJVXCT 5GJTUEJÌP



5+'$'0$ª4)'0(ª456'0 

)CDTKGN$GVJNGP4GKEJUVCNGT-$-TGOPKV\&CX4GUEJ

 (NGEMKIUGJTUEJÌP



5947

5946

5946



)GQTI4CMQE\K+$GKUEJNCI\WGKPGOJQNN·PFKUEJGP.ÌYGPVCNGTI&CX

FQTVKTTVÒONKEJWPVGT7VTGEJV )CODGTKPKXCT -N<CKPGPFGUGJTUEJÌP

(#/#)756# 



<;2'40

5VCFV WPVGT XGPG\KCPKUEJGT *GTTUEJCHV -W$KUCPVG  IGRT·IV Y·JTGPF FGT $GNCIGTWPI  FWTEJ   VÒTMKUEJG6TWRRGP$TCWUG/CPUHGNF6H)CODGTKPK 4&QRRGNUEJNCIUGJTUEJÌP

 199


CHINA

/ª0<'070&/'&#+..'0#75ª$'45''

5950

5948

5949

);26'0 

#DFWN#\K\/GUUKPI9GTVOCTMG\W%GPVKOGUFGT)GUGNNUEJCHV$QTGN.CXCNNG[GV %KGCWUIGIGDGPY·JTGPFFGT'TDCWWPIFGU5WG\-CPCNU-/6P.GEQORVG  5GJTUEJÌPpXQT\ÒINKEJ





/GUUKPI9GTVOCTMG\W%GPVKOGUFGT)GUGNNUEJCHV$QTGN.CXCNNG[GV%KGCWUIGIGDGPY·JTGPF FGT'TDCWWPIFGU5WG\-CPCNU-/6P.GEQORVG (CUVXQT\ÒINKEJ





2TQXKP\GPFGU4KQFGNC2NCVC4GCN2QVQUK-/

#4)'06+0+'0

5951

8QT\ÒINKEJ



5952

$1.+8+'0 

(GTFKPCPF8++4GCNGU2,2QVQUK%%6)TWPVJCN5GNNUEJQRRR  8QT\ÒINKEJp5VGORGNINCP\





4GRWDNKM5QNGU(,2QVQUK-/



8QT\ÒINKEJp5VGORGNINCP\

1,5:1

5953



%GPVCXQU9KGP-/

5953

5GJTUGNVGPKPFKGUGT'TJCNVWPI2QNKGTVG2NCVVG

5954



5955

%*+0#  

2TQXKP\*WRGJ.KCPI 6CGN ,CJT  &CX-CPP .KCPI 6CGN ,CJT  &CX-CPP



2TQXKP\-YCPIVWPI%GPVU Z 2TQXKP\/CPUEJWTGK%GPVU2TQXKP\ 5\GEJWCP%GPVU-YCPI*UW-W%CUJQ,  /CPEJQWMWQ- CPI6G-W (GP 5VÒEM/GKUVXQT\ÒINKEJ

200

(CUVXQT\ÒINKEJ 5GJTUEJÌP

 

.16%*+0#




MALEDIVEN

5957

5958

5959

&1/+0+-#0+5%*'4'27$.+- 

4GRWDNKM-W%GPVGUKOQU#2CTKU-/



4GRWDNKMUGKV5WETGU-/

2TCEJVGZGORNCT5VGORGNINCP\



448QT\ÒINKEJp5VGORGNINCP\



(CUVXQT\ÒINKEJ



'%7#&14 &KGIGUCOVG#WHNCIGFKGUGU6[RUXQP/KNNKQPGP5VÒEMYWTFGDKUCWH'ZGORNCTGYKGFGTGKPIGUEJOQN\GP

*#9#++ 

-CNCMCWC&QNNCT-/

+54#'.

.165 

&KXGTUG-WTUOÒP\GPFGU<GKVTCWOGUKP#NWOKPKWO-WRHGT/GUUKPIWPF5KNDGTXQP2TWVC DKU2TWVQV 5VÒEM+P#NDWO Z D\Y2NCUVKMJQNFGT/GKUVXQT\ÒINKEJ

5961



5962 5961

,#2#0 



/WVUWJKVQ;GP,CJT/GKLKTC  1UCMC&CX,CEQDU8GTOGWNG3  8QT\ÒINKEJ

-¤0+)4'+%*



-#/$1&5%*#

0QTQFQO+(TCPEU5R·VGTG2T·IWPII-/

5GJTUEJÌP



8QT\ÒINKEJ



2QNKGTVG2NCVVG



5964

5963



%GPVKOGU2TQDGKP-WRHGTI-/'#



4GRWDNKM4WHK[CC%WVV[5CTM-/

/#.'&+8'0 201


PERSIEN

5965

5966

5967

/':+-1 

%CTNQU+++4GCNGU/(/Q/GZKMQ%KV[)TQXG  'VYCU$GNCIUGJTUEJÌPpXQT\ÒINKEJ





4GRWDNKM4GCNGU/Q///GZKEQ%KV[2TQDGKP-WRHGTI)TQXG \W  -/2P 48QT\ÒINKEJp5VGORGNINCP\





4GRWDNKM4GCNGU/Q/*/GZKEQ%KV[2GUQ/Q#//GZKEQ%KV[2GUQ %0,3%WNKCECP)TQXG 5VÒEM8QT\ÒINKEJ Z WPF5VGORGNINCP\ Z



5968

2'45+'0 

202

0CUTGFFKP$TQP\GOGFCKNNGXQP#$9[QPCWHUGKPGP$GUWEJKP.QPFQP$TWUV DKNFFGU5EJCJUNKP7PKHQTO&CURGTUQPKHK\KGTVG.QPFQPUVGJVXXFGP-QRHPCEJNIGYCPFVKPFGT 4GEJVGP 5EJTKHVTQNNG OKV 6*  ,70'   \W FGP 5GKVGP FKG 9CRRGPUEJKNFG XQP 2GTUKGP WPF   .QPFQPKO*KPVGTITWPFNFKG5V2CWN U%CVJGFTCNGWPFTFGT6QYGTOO'KOGT  449KP\4CPFHGJNGTHCUV5VGORGNINCP\




PERU

5969

2'47 

4GRWDNKMUGKV5KNDGTOGFCKNNGXQP4$TKVVGPCWHFKG,CJTHGKGTFGT7PCDJ·PIKIMGKVXQP 5RCPKGP 5VTCJNGPFG 5QPPG OKV OGPUEJNKEJGO )GUKEJV5KGDGP <GKNGP 5EJTKHV FCTWPVGT ,CJTGU\CJN \W   FGP5GKVGP2CNOWPF.QTDGGT\YGKIOOI5NI(QPTQDGTV\W FQTVXQP   8QT\Ã&#x2019;INKEJ



5970



$TQP\GOGFCKNNGXQP*'OCPWGN.QPFQPCWHFCU$Ã&#x2019;PFPKUXQP2GTW#TIGPVKPKGP'EWCFQTWPF %JKNG UQYKG FKG 8GTVGKFKIWPI FGT5VCFV%CNNCQIGIGPFKGURCPKUEJG(NQVVG&KGXKGT4GRWDNKMGPFWTEJ #OC\QPGPFCTIGUVGNNVUVGJGPCPGKPGODTGPPGPFGP#NVCTKO#DUEJPKVV5EJKNF\YKUEJGP.QTDGGT\YGKIGP #PUKEJV FGT CPITGKHGPFGP URCPKUEJGP (NQVVG XQT %CNNCQ QDGP \YGK UEJYGDGPFG )GPKGP  OO   5NI(QPTQDGTV 8QT\Ã&#x2019;INKEJ



5971



5KNDGTOGFCKNNGWPUKIPKGTVCWHFKG'KPYGKJWPIFGU*CHGPUXQP%CNNCQ#PUKEJVFGU*CHGPUCWUFGT 8QIGNRGTURGMVKXG WOJGT 8KGTRC­5KGDGP <GKNGP \WO 6GKN IGDQIGPG 5EJTKHV  OO  I   5NI(QPTQDGTV 8QT\Ã&#x2019;INKEJ

 203


USA

5972

5973

5973

5ª&#(4+-#  

5ÒFCHTKMCPKUEJG4GRWDNKM2GPEG-/ 5JKNNKPIU-/

8QT\ÒINKEJ 8QT\ÒINKEJ

 

5974

5975

5975

6*#+.#0& 

4COC8 %JWNCNQPIMQTP $CJVQ,  ;GQ

5GJTUEJÌP



8'4'+0+)6'56##6'0810#/'4+-#75# 

(ÌFGTCVKQP $TQP\GOGFCKNNG  UR·VGTG #PHGTVKIWPI  XQP 5 $TQQMU WPF , /CPNG[ CWH )GQTIG   9CUJKPIVQP WPF UGKPG 9CJN \WO 2T·UKFGPVGP FGT 8GTGKPKIVGP 5VCCVGP KO ,CJT  7PKHQTOKGTVGU   $TWUVDKNF N OKV <QRHl  )'0'4#.  1( 6*'  #/'4+%#0 #4/+'5    4'5+)0'&    24'5+&'061(6*'70+6'&56#6'5FCTWPVGT/GFCKNNGWTUUKIPCVWTOO 9WT\DCEJ -N4CPFHGJNGTWPF-TCV\GTUGJTUEJÌP

5976

  204



5977

&QNNCT %GPVU 2JKNCFGNRJKC.KDGTV[%CRRGF$WUVV[RG;GQ5 8QT\ÒINKEJ &QNNCT %GPVU 2JKNCFGNRJKC.KDGTV[%CRRGF$WUVV[RG;GQ5 5GJTUEJÌP

 


USA

5979

5978

5978



&QNNCT %GPVU 2JKNCFGNRJKC.KDGTV[%CRRGF$WUVV[RG;GQ5  (GKPG6ÌPWPIXQT\ÒINKEJ



%GPVU2JKNCFGNRJKC.KDGTV[0KEMGN;GQ5

8QT\ÒINKEJp5VGORGNINCP\

 

5980

5981

5981



&QNNCT+UCDGNNC3WCTVGT%QNWODKCP'ZRQUKVKQPKP%JKECIQ;GQ5  5GJTUEJÌPpXQT\ÒINKEJ





&QNNCT&CPKGN$QQPG$KEGPVGPPKCN;GQ5  2TCEJVGZGORNCT(CUV5VGORGNINCP\



5982



5KNDGTOGFCKNNG  WPUKIPKGTV CWH FKG ,CJTHGKGT XQP 0GY ;QTM  WPF FKG 9GNVCWUUVGNNWPI   &CU5VCFVYCRRGPXQP0GY;QTM&KG'TFMWIGNKO9GNVCNNOOI  -N4CPFHGJNGTXQT\ÒINKEJ



.1675# 

(ÌFGTCVKQP-NGKPG5COONWPIXQP/ÒP\GPFGU<GKVTCWOGUFCTWPVGTDGUUGTG5VÒEMGWC &QNNCT HCUVXQT\ÒINKEJ &KOG UGJTUEJÌP %GPV UEJÌP  UGJTUEJÌP  %GPV UEJÌP  UGJTUEJÌP GVE&C\W5VÒEMGHÒT*CYCKK+PVGTGUUCPVGU.QVDKVVGDGUKEJ VKIGP 5VÒEM5EJÌPpXQT\ÒINKEJ

 205


RÖMISCH-DEUTSCHES REICH

*#$5$74)+5%*''4$.#0&'¤56'44'+%*

5984

6+41.)4#(5%*#(6 

#NDTGEJV +++  8KGTGT Q , /GTCP  I -TGW\ OKV 4QUGVVGP KP FGP 9KPMGNP#FNGT   XXFGP-QRHPCEJNIGYCPFV%0#+,C/6 445EJTÌVNKPIUTK­UGJTUEJÌP



5985



'T\JGT\QI5KIKUOWPFFGT/ÒP\TGKEJG )WNFKPGT*CNNI5VGORGNUEJPGKFGT 9GP\GN -TÌPFN &GT 'T\JGT\QI UVGJV X X N .ÌYG OKV 9CRRGP T *GNO4KVVGT OKV (CJPG TGKVGV T   FCTWPVGTFKG,CJTGU\CJNWOJGT9CRRGPUEJKNFG&CX/68QINJ++++8  449KP\)TCHHKVKCVVTCMVKXGUUGJTUEJÌPGU'ZGORNCT  $GK FKGUGT 2T·IWPI JCPFGNV GU UKEJ WO FKG ·NVGUVG 6CNGTRT·IWPI 'T\JGT\QI 5KIKUOWPF JCV  PCEJ 8QTCTDGKVGP   FKG DKU KPU ,CJT  \WTÒEMTGKEJGP FKGUG )TQ­UKNDGTOÒP\G RT·IGP NCUUGP 8QTCWUIGICPIGP YCT  FKG 2T·IWPI   XQP *CNDIWNFKPGTP $KU FCJKP JCVVG GT KP ITQ­GT #P\CJN )QNFIWNFGP JGTUVGNNGP NCUUGP WO FGO UVGKIGPFGP $GFCTH   PCEJ GKPGTYGTVXQNNGP/ÒP\GPCEJ\WMQOOGP&C6KTQNMGKPGGKIGPGP)QNFXQTMQOOGPJCVVGYCTFKG)QNFRT·IWPI CDGT IGTCFG MQUVGPFGEMGPF &CIGIGP YCT FKG #WUDGWVG FGU 5EJYC\GT 5KNDGTDGTIDCWU CW­GTQTFGPVNKEJ ITQ­ 5Q   GPVUVCPF FKG +FGG \W GKPGT ITQ­GP 5KNDGTOÒP\G KO 9GTV GKPGU )QNFIWNFGPU GU YCT FKG )GDWTVUUVWPFG FGU 6CNGTU   +JTGP0COGPGTJKGNVGPFKGUG/ÒP\GPCNNGTFKPIUGTUV#PHCPIFGU,CJTJWPFGTVUFWTEJFKG,QCEJKOUVCNGTUR·VGT MWT\ 6CNGT IGPCPPV FKG KO DÌJOKUEJGP ,QCEJKOUVCN XQP FGP )TCHGP 5EJNKEM IGRT·IV YWTFGP &CU 8GTJ·NVPKU XQP   )QNF\W5KNDGTXQPHÒJTVG\WGKPGT)TQ­UKNDGTOÒP\GXQPITCWJWPFGKPGO(GKPIGYKEJVXQPI&KG CNU )WNFKPGT DG\GKEJPGVGP 5VÒEMG YWTFGP CWEJ 7PEKCNKU IGPCPPV YGKN KJT )GYKEJV GKPGT 7P\G FGT 6KTQNGT )G   YKEJVUOCTMGPVURTCEJ&KGPGWG/ÒP\GYCTNÌVKI HGKP WPFGPVURTCEJYKGFGT)QNFIWNFGPFGO9GTV XQP-TGW\GTP

5987

5986

5986

4¤/+5%*&'765%*'54'+%* 



206

/CZKOKNKCP+5EJCWIWNFKPGTQ, WO <YKVVGTRT·IWPI$TWUVDKNFTOKV $CTGVV WOIGNGIVGO /CPVGN WPF 1TFGPUMGVVG&CTUVGNNWPI FGU JGKNKIGP #DGPFOCJNU FCTWPVGT UGEJU   <GKNGP5EJTKHVOOI2TQDU\V 5EJCWOÒP\GP  44*GPMGNURWTUEJÌPpUGJTUEJÌP



(GTFKPCPF+2HWPFPGT9KGP/CTMNXCT  &TWEMUVGNNG2T·IGUEJY·EJGUGJTUEJÌP




RÖMISCH-DEUTSCHES REICH

5989



5988

5989

6CNGTMNKRRGIGRT·IVY·JTGPFFGT$GNCIGTWPIFGT5VCFV9KGPFWTEJFKG6ÒTMGP$TCWUG/CPU HGNF6H/CTMN 4*GPMGNURWTUGJTUEJÌP



&GTVÒTMKUEJG5WNVCP5WNGKOCPGKPGKHTKIGT#PJ·PIGTFGU2TQRJGVGPJCVVGUKEJ\WO<KGNIGUGV\VFKG9GNVOKV )GYCNVFGO+UNCO\WWPVGTLQEJGPWPFCNNGUVCWDINGKEJGP7PIN·WDKIGPWPFFGTGPIGMTÌPVG*·WRVGTWPF8QTHGEJVGT CWHFGT'TFG\WVKNIGP5EJQPKO8QTLCJTJCVVGKJO(GTFKPCPF+XGTIGDNKEJGKPGP6TKDWVXQP&WMCVGPCNU 2TGKU HÒT FGP (TKGFGP CPIGDQVGP+O*GTDUVUEJNWI5WNGKOCPUGKP*CWRVSWCTVKGTKO&QTH5GOGTKPIXQT9KGP CWH 'U HQNIVGP UEJYGTG #PITKHHG CWH 9KGP CDGT CWHITWPF FGT VQFGUOWVKIGP 6CRHGTMGKV FGT $GNCIGTVGP FKG VTQV\   ITQ­GT 8GTNWUVG JGHVKIGP 9KFGTUVCPF NGKUVGVGP MQPPVG FKG 5VCFV PKEJV GKPIGPQOOGP YGTFGP #O  1MVQDGT DG   UEJNQ­ OCP GKPGP YGKVGTGP ITQ­GP 5VWTO CWH FKG 5VCFV CNNGTFKPIU YCT FKG 6TWRRG KP\YKUEJGP UGJT WP\WHTKGFGP   UEJQPDGKONGV\VGP/CNOW­VGUKGOKV5·DGNWPF2TÒIGN\WO#PITKHHIGVTKGDGPYGTFGP&GUJCNDYWTFGFGP/·PPGTP FKGUGU /CN GKPG $GNQJPWPI KP )QNF XGTURTQEJGP YCU UKG CDGT CDNGJPVGP 5KG YQNNVGP NKGDGT FWTEJ FKG *CPF KJTGT   -TKGIUQDGTUVGP IGVÌVGV YGTFGP CNU FWTEJ FKG NCPIGP 4ÌJTGP WPF FKG $TCVURKG­G \YGKJ·PFKIG 5EJYGTVGT  FGT &GWV   UEJGP5QHQNIVGGKPPWTMWT\GTWPFUKPPNQUGT#PITKHHCWHFKG5VCFVDKU5WNGKOCPPCEJPWT\YGK5VWPFGPFGP$GHGJN \WO 4ÒEM\WI ICD LGFQEJ PKEJV QJPG GKPG ITQ­G #P\CJN /·PPGT CNU 5MNCXGP OKV\WPGJOGP &KG $GNCIGTWPIU WPF   0QVOÒP\GP YKG CWEJ FKG XQTNKGIGPFG -NKRRG YWTFGP CWU 5KNDGTIGUEJKTT JGTIGUVGNNV WPF Y·JTGPF D\Y PCEJ FGT   $GNCIGTWPICWUIGRT·IV



6CNGTQ, PCEJ .KP\I)GMTÌPVGUWPFIGJCTPKUEJVGU*ÒHVDKNFTOKVFGT4GEJVGPFCU <GRVGT UEJWNVGTPF FKG .KPMG CO 5EJYGTVITKHH#FNGT CWH FGT $TWUV 9CRRGP &CX  8QINJ    48QT\ÒINKEJp5VGORGNINCP\ 

5990

5991

5992



6CNGT Q ,   ,QCEJKOUVCN /ÒP\OGKUVGT *CPU 9GK\GNOCPP &CX  &KGVKMGT  *C   NCEMC8QINJ 5GJTUEJÌP



6CNGT Q , XQT   -NCIGPHWTV /KV /ÒP\OGKUVGT\GKEJGP -TGW\  I )GMTÌPVGU WPF IGJCT   PKUEJVGU *ÒHVDKNF T OKV FGT 4GEJVGP FCU <GRVGT UEJWNVGTPF FKG .KPMG CO 5EJYGTVITKHH#FNGT CWH   FGT$TWUV9CRRGP&CX8QINJ 448QT\ÒINKEJp5VGORGNINCP\ 



6CNGT-WVVGPDGTII/ÒP\OGKUVGT/CVGL.ÃFNWPF2CXGN2QFKXKEMÓ)GMTÌPVGUWPFIGJCT PKUEJVGU*ÒHVDKNFTOKV5EJYGTVOKVFGT4GEJVGPFCU<GRVGTUEJWNVGTPFKPFGT.KPMGP4GKEJUCRHGN\W FGP5GKVGP#FNGTCWHFGT$TWUV9CRRGP&CX&KGVKMGT*CNCEMC8QINJ++ 2TCEJVGZGORNCT8QT\ÒINKEJp5VGORGNINCP\ 



207


RÖMISCH-DEUTSCHES REICH

5993

5995

5994



6CNGT-WVVGPDGTI/ÒP\OGKUVGT/CVGL.KFNWPF.WFXKM-CTGN&CX&KGVKMGT*CNCEMC 8QINJ+8 5GJTUEJÌPGU'ZGORNCTOKVHGKPGT2CVKPC





6CNGT-WVVGPDGTI/ÒP\OGKUVGT/CVGL.KFNWPF.WFXKM-CTGN&CX&KGVKMGT*CNCEMC 8QINJ+8 5GJTUEJÌP





 6CNGT,QCEJKOUVCNI/ÒP\OGKUVGT4WRTGEJV2WGNNCEJGT)GMTÌPVGUWPFIGJCTPKUEJVGU *ÒHVDKNFTOKVFGT4GEJVGPFCU<GRVGTUEJWNVGTPFFKG.KPMGCO5EJYGTVITKHH)GMTÌPVGT&QRRGNCFNGT CWHFGT$TWUV9CRRGP&KGVKMGT*CNCEMC/CTMNXCT  44#VVTCMVKXGUHCUVXQT\ÒINKEJGU'ZGORNCT 

5996

5997

5998



/CZKOKNKCP++)WNFGPVCNGT -TGW\GT 2TCI/ÒP\OGKUVGT*CPU*CTFGTI )GMTÌPVGUWPFIGJCTPKUEJVGU*ÒHVDKNFTOKVFGT4GEJVGPFCU<GRVGTUEJWNVGTPFKPFGT.KPMGP4GKEJU CRHGN FCTKP 9GTV\CJN )GMTÌPVGT &QRRGNCFNGT CWH FGT $TWUV 9CRRGP &CX  &KGVKMGT    *CNCEMC8QINJ+ 445GJTUEJÌP 



)WNFGPVCNGT  -TGW\GT   ,QCEJKOUVCN /ÒP\OGKUVGT ,ÌTI )GKV\MÌHNGT &CX  &KGVKMGT    *CNCEMC8QINJ #VVTCMVKXGUUGJTUEJÌPGU'ZGORNCTOKVHGKPGT6ÌPWPI



'T\JGT\QI-CTN4GKEJUVCNGT-NCIGPHWTVI)GMTÌPVGUWPFIGJCTPKUEJVGU*ÒHV DKNFTOKVFGT4GEJVGPFCU<GRVGTUEJWNVGTPFFKG.KPMGCO5EJYGTVITKHH9CRRGPUEJKNFXQP-·TPVGP WOJGTXKGTYGKVGTGMNGKPG9CRRGPUEJKNFG&CX8QINJ+ 44(CUVXQT\ÒINKEJ 

208




RÖMISCH-DEUTSCHES REICH

5999

  





6001

'T\JGT\QI(GTFKPCPF4GKEJUVCNGTQ,'PUKUJGKO&CX8QINJ8CT  2TCEJVGZGORNCT<CKPGPFGHCUV5VGORGNINCP\ 4GKEJUVCNGTQ,'PUKUJGKO&CX#8QINJ8CT 8QT\ÒINKEJ 4GKEJUVCNGTQ,'PUKUJGKO&CX8QINJ8CT <CKPGPFGXQT\ÒINKEJ

6002 (doppelt)



6000

6003 (doppelt)

  

6004 (doppelt)

&QRRGNVGT4GKEJUVCNGTQ, IGRT·IVPCEJ 'PUKUJGKOI)GMTÌPVGUWPFIGJCTPKUEJVGU*ÒHV DKNFTOKVFGT4GEJVGPFCU<GRVGTUEJWNVGTPFFKG.KPMGCO5EJYGTVITKHH)GMTÌPVGU9CRRGPWOJGT 1TFGPUMGVVG \W FGP 5GKVGP LG GKP MNGKPGTGU 9CRRGPUEJKNF &GT *CTPKUEJ KUV OKV -WIGNP WPF 4QUGVVGP   XGT\KGTV&CX/6 8QT\ÒINKEJGU'ZGORNCTOKVHGKPGT2CVKPC  &QRRGNVGT 4GKEJUVCNGT Q , RQUVJWOG 2T·IWPI   *CNN  I 'KUGPUEJPGKFGT 2GVGT   *CTVGPDGEM )GJCTPKUEJVGU $TWUVDKNF N OKV WOIGNGIVGO /CPVGN)GMTÌPVGT 6KTQNGT #FNGT OKV   'JTGPMT·P\EJGPXXFGP-QRHPCEJNIGYCPFVCWHFGT$TWUV5EJKNFOKVFGOIGMTÌPVGP4GKEJUCFNGT &CX/6 5VGORGN  48QT\ÒINKEJGU'ZGORNCTOKVHGKPGT6ÌPWPI  &QRRGNVGT4GKEJUVCNGTQ, RQUVJWOG2T·IWPI *CNNI'KUGPUEJPGKFGT2GVGT*CTVGP DGEM)GJCTPKUEJVGU$TWUVDKNFTOKVWOIGNGIVGO/CPVGN)GMTÌPVGT6KTQNGT#FNGTOKV'JTGPMT·P\EJGP XXFGP-QRHPCEJNIGYCPFV&CX/6 5VGORGN  *GTTNKEJG2CVKPCXQT\ÒINKEJ  209


RÖMISCH-DEUTSCHES REICH

6005 (doppelt)



4WFQNH ++  &QRRGNVGT 4GKEJUVCNGT  ,QCEJKOUVCN &QRRGNVGT &TGKMCKUGTVCNGT  I   /ÒP\OGKUVGT 2CWN *QHOCPP &KG IGMTÌPVGP WPF IGJCTPKUEJVGP $TWUVDKNFGT FGT -CKUGT /CZKOKNKCP +   -CTN 8 WPF (GTFKPCPF + PGDGPGKPCPFGT PCEJ N&QRRGNCFNGT OKV FGO MCUVKNKUEJÌUVGTTGKEJKUEJGP    9CRRGP CWH FGT $TWUV &CX  FQTV WPVGT 'T\JGT\QI (GTFKPCPF /\UV *CNN  &KGVKMGT  *CNCEMC   #DD6[RE 44#VVTCMVKXGUHCUVXQT\ÒINKEJGU'ZGORNCTOKVHGKPGT6ÌPWPI  *CNCEMCNGIVFKGUGP6CNGTKPUGKPGO0CEJVTCIWPVGTFGT0TCPCEJ,QCEJKOUVCNWPFIKDVCNU/ÒP\OGKUVGT2CWN *QHOCPPCP'UMÌPPVGGXGPVWGNNCDGTCWEJ2TCICNU/ÒP\UV·VVGKP(TCIGMQOOGP&KG&TGKMCKUGTRT·IWPIGP\·JNGP \WFGPDGIGJTVGUVGP/ÒP\GPFGU4ÌOKUEJ&GWVUEJGP4GKEJGU

6006

6007

6008



4GKEJUVCNGT'PUKUJGKO&CX8QINJ++XCT

,WUVKGTVUGJTUEJÌP





4GKEJUVCNGT'PUKUJGKO&CX8QINJ:++

5EJÌPG6ÌPWPIXQT\ÒINKEJ





'T\JGT\QI/CZKOKNKCPCNU*QEJOGKUVGTFGU&GWVUEJGP1TFGPU 4GKEJUVCNGT *CNN&CX/60GWOCPP 8QT\ÒINKEJGU'ZGORNCTOKVHGKPGT6ÌPWPI



6009

 210

4GKEJUVCNGT*CNN&CX/60GWOCPP

*ÒDUEJG2CVKPCUGJTUEJÌPpXQT\ÒINKEJ




RÖMISCH-DEUTSCHES REICH

6010

6011

6013



4GKEJUVCNGT  ,CJTGU\CJN KO 5VGORGN CWU  IG·PFGTV  *CNN &CX  /6  XCT 0GW   OCPP *ÒDUEJG2CVKPCUGJTUEJÌP





&QRRGNVGT4GKEJUVCNGT*CNNI&CX/60GWOCPP  -N<CKPGPFGUGJTUEJÌP





.164GKEJUVCNGT4GKEJUVCNGTQ, 8CTKCPVGP #NNG/ÒP\UV·VVG*CNN/6 XCT0GWOCPPXCT 5VÒEM5GJTUEJÌPpXQT\ÒINKEJ





'T\JGT\QI /CZKOKNKCP CNU .CPFGUHÒTUV XQP 6KTQN  4GKEJUVCNGT  *CNN &CX    /68QINJ+++ (CUVXQT\ÒINKEJ



6014



/CVVJKCU  5KNDGTOGFCKNNG  XQP %JT /CNGT CWH FGP 4GKEJUVCI KP 4GIGPUDWTI   'NH-CKUGT/GFCKNNG )GMTÌPVGT &QRRGNCFNGT CWH FGT $TWUV \YGKHGNFKIGU 9CRRGP WOJGT UGEJU   /GFCKNNQPU OKV FGP $TWUVDKNFGTP JCDUDWTIKUEJGT *GTTUEJGT)GMTÌPVG 5EJTKHVVCHGN WOJGT HÒPH YGKVGTG   2QTVT·VUOOI5NI'TNCPIGT++5NI/QPVGPWQXQ 48QT\ÒINKEJ



&KGUG /GFCKNNG KUV CWH FGP 'KP\WI FGU -CKUGTU /CVVJKCUKP4GIGPUDWTIWPFUGKPG6GKNPCJOGCO4GKEJUVCIIGRT·IV 7PVGT -CKUGT 4WFQNH ++ FGO $TWFGT WPF 8QTI·PIGT XQP /CVVJKCU YCT 4GIGPUDWTI DGXQT\WIVGT 6CIWPIUQTV FGU   YKEJVKIUVGPRQNKVKUEJGP)TGOKWOUFGU#NVGP4GKEJGUIGYQTFGP4GKEJUVCIGHCPFGPFQTVWC  WPF  UVCVV #WH DGKFGP 5GKVGP FGT /GFCKNNG YKTF KP 2QTVT·VOGFCKNNQPU UVCOODCWOCTVKI FKG /CEJV WPF   *GTTUEJGTVTCFKVKQP FCTIGUVGNNV FKG FCU *CWU *CDUDWTI KPPGJCVVG )G\GKIV YGTFGP CNNG *CDUDWTIGT FKG FGWVUEJG   -ÌPKIG WPF -CKUGT YCTGP XQP -ÌPKI 4WFQNRJ +   DKU /CVVJKCU   ªDGT FGO 2QTVT·V XQP   /CVVJKCU KUV UGKPG &GXKUG \W NGUGP #/#6 8+%614+# %84#/ &GT 5KGI NKGDV FKG 5QTIHCNV  5KEJGTNKEJ KUV FKG   2T·IWPICWEJCNU5KIPCNCPGKPKIGRTQVGUVCPVKUEJG5V·PFG\WXGTUVGJGPFKGKO,CJTWPVGT(ÒJTWPIFGT-WTRHCN\ FGP4GKEJVCIWPVGT2TQVGUVXGTNCUUGPJCVVGP&KG0ÒPDGTIGT/GFCKNNGFGU/GFCKNNGWTU%JTKUVKCP/CNGTFGTCO'PFG FGT 4ÒEMUGKVGPNGIGPFG OKV 014+$(%/ UKIPKGTVG KUV OKVJKP GKP CPUEJCWNKEJGU &QMWOGPV FGT JCDUDWTIKUEJGP   /CEJVRQNKVKM

211


RÖMISCH-DEUTSCHES REICH

6015

6016

6017



4GKEJUVCNGT-$-TGOPKV\&CX8QINJ+++



(GTFKPCPF++4GKEJUVCNGT)TC\&CX8QINJ+XCT



4GKEJUVCNGT2TCI/ÒP\OGKUVGT*CPU5WVVPGT&CX&KGVKMGT*CNCEMC8QINJ+ 5GJTUEJÌP

6018

6020

5GJTUEJÌP



5GJTUEJÌP

 

6019



4GKEJUVCNGT  2TCI /ÒP\OGKUVGT $GPGFKMV *WGDOGT &CX  &KGVKMGT  *CNCEMC    8QINJ+ 5GJTUEJÌP





4GKEJUVCNGT)TC\&CX8QINJ8+++





(TKGFTKEJXQPFGT2HCN\ FGT9KPVGTMÌPKI 5KNDGTPGT,GVQPCWHUGKPG-TÌPWPI\WO -ÌPKI XQP $ÌJOGP 5KGDGP <GKNGP 5EJTKHV WOJGT .QTDGGTMTCP\(ÒPH *·PFG CWU 9QNMGP FKG GKPG   -TQPG\W5VTCJNGPGORQTJCNVGPOOI&QPGDNGKEJVXCT5VGORGT 5GJTUEJÌP

212

5GJTUEJÌPpXQT\ÒINKEJ




RÖMISCH-DEUTSCHES REICH

6022

6021



-KRRGT-TGW\GT,QCEJKOUVCN/ÒP\OGKUVGT%GPVWTKQ.GPIGHGNFGT&KGVKMGT*CNCEMC 45GJTUEJÌP





-KRRGT-TGW\GT-WVVGPDGTI/ÒP\OGKUVGT5GDCUVKCP*ÌN\N&KGVKMGT*CNCEMC  4-N5EJTÌVNKPITK­UGJTUEJÌP



6023 6024

6024



-KRRGT-TGW\GT2TCI/ÒP\OGKUVGT5MT¾VC5QVPQXUM[&KGVKMGT*CNCEMC 5GJTUEJÌP





'T\JGT\QI.GQRQNF84GKEJUVCNGT ,CJTGU\CJNKO5VGORGNCWUIG·PFGTV 'PUKU JGKO&CX8QINJ+8 -N5VGORGNHGJNGTXQT\ÒINKEJGU'ZGORNCTOKVHGKPGT6ÌPWPI



6025

6026

6027



4GKEJUVCNGT ,CJTGU\CJNKO5VGORGNCWUIG·PFGTV *CNN&CX/68QINJ+++ 5GJTUEJÌP





4GKEJUVCNGT*CNN2QUVJWOG2T·IWPI&CX/68QINJ+8

8QT\ÒINKEJ





4GKEJUVCNGT*CNN2QUVJWOG2T·IWPI&CX/68QINJ+8  9KP\-TCV\GTUGJTUEJÌPpXQT\ÒINKEJ

 213


RÖMISCH-DEUTSCHES REICH

6029

6028

6030



&QRRGNVGT4GKEJUVCNGTQ, RQUVJWOG2T·IWPIXQP *CNNCWHUGKPG8GTO·JNWPIOKV%NCWFKCXQP /GFKEKI&CX/6 #VVTCMVKXGUXQT\ÒINKEJGU'ZGORNCT





&QRRGNVGT4GKEJUVCNGTQ, RQUVJWOG2T·IWPIXQP *CNNCWHUGKPG8GTO·JNWPIOKV%NCWFKCXQP /GFKEKI&CX/6 #VVTCMVKXGUXQT\ÒINKEJGU'ZGORNCT





&QRRGNVGT4GKEJUVCNGTQ, RQUVJWOG2T·IWPIXQP *CNNCWHUGKPG8GTO·JNWPIOKV%NCWFKCXQP /GFKEKI&CX/6 8QT\ÒINKEJGU'ZGORNCTOKVHGKPGT6ÌPWPI



6031

6032

6032



'T\JGT\QI(GTFKPCPF-CTN4GKEJUVCNGT*CNN&CX/68QINJ+ 4#VVTCMVKXG2CVKPCUGJTUEJÌPpXQT\ÒINKEJ





&QRRGNVGT4GKEJUVCNGTQ,  *CNNI&CX/6  4(GKPG2CVKPCYKP\5EJTÌVNKPIUHGJNGTUGJTUEJÌPpXQT\ÒINKEJ



214


RÖMISCH-DEUTSCHES REICH

6033



(GTFKPCPF +++  $TGKVGT FTGKHCEJGT 4GKEJUVCNGT  )TC\  I )GJCTPKUEJVGU   $TWUVDKNF T OKV .QTDGGTMTCP\ WOIGNGIVGO /CPVGN WPF FGT -GVVG FGU 1TFGPU XQO )QNFGPGP 8NKGU   )GMTÌPVGU XGT\KGTVGU OGJTHGNFKIGU 9CRRGP WOJGT FKG -GVVG FGU 1TFGPU XQO )QNFGPGP 8NKGU   &CX*GTKPGM 44/GJTGTG5EJTÌVNKPIUHGJNGTCWHFGT2QTVT·VUGKVG CPUQPUVGPXQT\ÒINKEJGTJCNVGPWPFOKVHGKPGT2CVKPC 

6034

6035

6036



4GKEJUVCNGT)TC\&CX8QINJ+8  9KP\5EJTÌVNKPIUTK­XQT\ÒINKEJGU'ZGORNCTOKVUEJÌPGT6ÌPWPI



 

4GKEJUVCNGT)TC\&CX8QINJ8 -N5EJTÌVNKPIUHGJNGTXQT\ÒINKEJp5VGORGNINCP\ 4GKEJUVCNGT-$-TGOPKV\&CX8QINJ 5GJTUEJÌP

 

6037



4GKEJUVCNGT-X$-TGOPKV\2QUVJWOG2T·IWPI&CX8QINJ

8QT\ÒINKEJ

 215


RÖMISCH-DEUTSCHES REICH

6038

6039

6039



 4GKEJUVCNGT  ,CJTGU\CJN KO 5VGORGN CWU  IG·PFGTV  -X$ -TGOPKV\ 2QUVJWOG 2T·IWPI   *GTKPGM #VVTCMVKXGUHCUVXQT\ÒINKEJGU'ZGORNCTOKVHGKPGT2CVKPC





.GQRQNF +  5KNDGTOGFCKNNG Q ,   XQP , $WEJJGKO CWH UGKPG 5KGIG )GJCTPKUEJVGU   $TWUVDKNF T OKV .QTDGGTMTCP\ WOIGNGIVGO /CPVGN WPF 1TFGPUMGVVG#WHIGTKEJVGVGT .ÌYG UEJTGKVGV T   OKV<GRVGTWPF5EJYGTV\WFGP5GKVGP$NWOGWPF$CWOQDGP5QPPG9QNMGPWPF/QPFOO I(W55NI*QTUM[ 5GJTUEJÌPpXQT\ÒINKEJ



6040

6041 (doppelt)

6042



4GKEJUVCNGT-X$-TGOPKV\&CX8QINJ+



&QRRGNVGT4GKEJUVCNGTQ, EC *CNNI&CX/6



5KNDGTOGFCKNNGXQP*,9QNTCDCWHFGP8GTVGKFKIGT9KGPUIGIGPFKG6ÒTMGP'TPUV4ÒFKIGTXQP 5VCTJGODGTI )GJCTPKUEJVGU $TWUVDKNF FGU )TCHGP T5GEJU <GKNGP 5EJTKHV FCTWPVGT GKP 6ÒTMG FGT CP   GKPG-CPQPGIGMGVVGVKUVKO*KPVGTITWPF#TOCVWTGPOOI*KTUEJ5NI/QPVGPWQXQ 44#VVTCMVKXGUUGJTUEJÌPGU'ZGORNCT

216

8QT\ÒINKEJ



(CUVXQT\ÒINKEJ






RÖMISCH-DEUTSCHES REICH

6044 6043





5KNDGTOGFCKNNG  XQP , 4 'PIGNJCTF CWH FKG $GNCIGTWPI WPF FGP 'PVUCV\ 9KGPU )GJCTPKUEJVGU   $TWUVDKNFT\YKUEJGP#TOCVWTGPQDGPGKPGCWU9QNMGPMQOOGPFG*CPFOKVUVTCJNGPFGO)QVVGUCWIG WPVGP -CTVWUEJG OKV FTGK <GKNGP 5EJTKHV WPF ,CJTGU\CJN)GMTÌPVGU WPF IGJCTPKUEJVGU $TWUVDKNF -CKUGT   (GTFKPCPFU+TQDGPGKPGCWU9QNMGPMQOOGPFG*CPFOKV5EJYGTVWPVGP-CTVWUEJGOKVFTGK<GKNGP 5EJTKHVWPF,CJTGU\CJNOOI(W5 XIN *KTUEJ XIN 5NI/QPVGPWQXQ

XIN  5EJÌPG6ÌPWPIMN-TCV\GTHCUVXQT\ÒINKEJ



5KNDGTOGFCKNNGWPUKIPKGTVCWHFKG$GNCIGTWPIWPFFGP'PVUCV\9KGPU#PUKEJVFGTDGNCIGTVGP5VCFV 9KGP#EJV<GKNGP5EJTKHV/KV4CPFUEJTKHVOOI*KTUEJ5NI/QPVGPWQXQ  5GJTUEJÌP



6045



6043

6046

6047

5KNDGTOGFCKNNG  WPUKIPKGTV CWH FKG 5EJNCEJV DGK )TCP UQYKG FKG 4ÒEMGTQDGTWPI WPF $GHTGKWPI   0GWJ·WUGNUXQPFGP6ÒTMGP5EJNCEJVU\GPGFCTÒDGTJ·NVGKPIGMTÌPVGT#FNGTFGP(GUVWPIURNCP0GWJ·W UGNU&TGK <GKNGP PKGFGTN·PFKUEJG 5EJTKHV FCTÒDGT FKG 9CRRGPUEJKNFG XQP $C[GTP .QVJTKPIGP WPF   9CNFGEM WPVGP FTGK IGMTGW\VG 2HGKNG /KV PKGFGTN·PFKUEJGT 4CPFUEJTKHV &+6 &''&'0 &+' &4+'   *'.&'0 Ü  Ü 5#/ Ü  Ü 8 Ü  Ü  OO  I 5NI *GPPKI  5NI /QPVGPWQXQ   

XIN 9KVV 448QT\ÒINKEJGU'ZGORNCTOKVHGKPGT6ÌPWPI



+O#WIWUVXGTUWEJVGPFKG6ÒTMGP)TCPCDGTOCNUGKP\WPGJOGPFQEJYWTFGPUKGPQEJXQTFGP6QTGPFGT5VCFV XQO MCKUGTNKEJGP *GGT IGUEJNCIGP +O UGNDGP /QPCV INÒEMVG FGP -CKUGTNKEJGP CWEJ FKG 'KPPCJOG FGT (GUVWPI   0GWJ·WUGN 'TUGMWLX±T  GKPGO YKEJVKIGP UVTCVGIKUEJGP 2NCV\ FGT FGP 6ÒTMGP \WXQT \WT )TGP\UKEJGTWPI 7PICTPU   IGFKGPVJCVVG



-TGW\GT9ÒT\DWTIHÒT*QJGPNQJG*GTKPGM

45GJTUEJÌPpXQT\ÒINKEJ



5KNDGTOGFCKNNG  XQP , , 9QNTCD CWH FKG 'KPPCJOG XQP 1HGP $WFC  5VCFVCPUKEJV QDGP FCU   $TWUVDKNF .GQRQNFU + KP .QTDGGTMTCP\ ÒDGT IGMTGW\VGP 2CNO\YGKIGP&GT -CKUGT CNU ,QUWC UVGJV X X   KP 4ÒUVWPI OKV <GRVGT WPF 5EJKNF QDGP N 5QPPG KP 9QNMGP T UKPMGPFGT *CNDOQPF KO *KPVGTITWPF   5EJNCEJVU\GPG/KV4CPFUEJTKHVOOI5NI/QPVGPWQXQ2QRGNMC  8QT\ÒINKEJGU'ZGORNCTOKVUEJÌPGT2CVKPC



 217


RÖMISCH-DEUTSCHES REICH

6049

6048

6048





<KPPOGFCKNNG  WPUKIPKGTV XGTOWVNKEJ XQP 2 * /ÒNNGT CWH FKG 9KGFGTGKPPCJOG XQP 5VWJN   YGKUUGPDWTI.GQRQNF+WPFUGKP5QJPFGTWPICTKUEJG-ÌPKI,QUGHUKV\GPKPGKPGO6TKWORJYCIGPFGT XQP\YGKHNKGIGPFGP#FNGTPIG\QIGPYKTFWPFFGTÒDGT9CHHGPWPFFGPCO$QFGPNKGIGPFGPRGTUQPKHK \KGTVGP 0GKF JKPYGITQNNV ÒDGT FGP #FNGTP UEJYGDV 8KMVQTKC FKG KP FGT 4GEJVGP GKPGP 5EJNCPIGPTKPI   VT·IV WPF OKV FGT .KPMGP GKPGP -TCP\ ÒDGT FKG *GTTUEJGT J·NV5VCFVCPUKEJV QDGP N UVTCJNGPFG 5QPPG   TCO*QTK\QPVFGTWPVGTIGJGPFG*CNDOQPF/KV4CPFUEJTKHVOO(QTUVGT FQTVKP5KNDGT  5NI/QPVGPWQXQ FQTVKP5KNDGT  /KV-WRHGTUVKHV(GKPG2CVKPCXQT\ÒINKEJ



1XCNG 5KNDGTOGFCKNNG Q ,   XQP , 4 'PIGNJCTF CWH FKG -TÌPWPI UGKPGT )GOCJNKP 'NGQPQTG   /CIFCNGPG 6JGTGUG XQP FGT 2HCN\ \WT -CKUGTKP $TWUVDKNF 'NGQPQTG /CIFCNGPGU JCNDN&KG JCDUDWTIK   UEJG*CWUMTQPGCWH-KUUGPZOOI5NI/QPVGPWQXQ5VGORGT  4*GPMGNURWT(GNFGTRQNKGTVUGJTUEJÌP



6050

6051 (doppelt)

6052



4GKEJUVCNGT-$-TGOPKV\&CX8QINJ+8XCT



&QRRGNVGT4GKEJUVCNGTQ, PCEJ *CNNI&CX/6



4GKEJUVCNGT*CNN&CX/68QINJ8

218

*ÒDUEJG2CVKPCHCUVXQT\ÒINKEJ



5GJTUEJÌPpXQT\ÒINKEJ



8QT\ÒINKEJp5VGORGNINCP\




RÖMISCH-DEUTSCHES REICH

6053

6054

6055

 

4GKEJUVCNGT*CNN&CX/68QINJ8+ 4GKEJUVCNGT-$-TGOPKV\&CX8QINJ8+

(CUVXQT\ÒINKEJ 5GJTUEJÌP

 



4GKEJUVCNGT-$-TGOPKV\*GTKPGM  2TCEJVGZGORNCTOKVHGKPGT6ÌPWPI8QT\ÒINKEJp5VGORGNINCP\



6056

6057 (doppelt)

6058



4GKEJUVCNGT9KGP&CX8QINJ8+++

9KP\-TCV\GTXQT\ÒINKEJ





,QUGH+&QRRGNVGT4GKEJUVCNGTQ,*CNNI&CX/6  -N$GCTDGKVWPIUURWTGPCWHFGT8QTFGTUGKVGFGPPQEJCVVTCMVKXGUHCUVXQT\ÒINKEJGU'ZGORNCT





4GKEJUVCNGT/ÒPEJGP&CX*CJP8QINJ+  44*ÒDUEJG2CVKPCMN5VGORGNHGJNGTYKP\)TCHHKVQUGJTUEJÌPpXQT\ÒINKEJ

 219


RÖMISCH-DEUTSCHES REICH

6059 (doppelt)

6060

6061



4GKEJUVCNGT  *CNN 8CTKCPVG OKV /ÒP\OGKUVGT\GKEJGP +#- CO WPVGTGP 4CPF FGT 8QTFGTUGKVG   &CX/68QINJ+ 8QT\ÒINKEJ





4GKEJUVCNGT*CNN&CX/68QINJ+ 8QT\ÒINKEJGU'ZGORNCTOKVHGKPGT6ÌPWPI





4GKEJUVCNGT ,CJTGU\CJNXGTOWVNKEJKO5VGORGNCWUIG·PFGTV *CNN&CX/6D 8QINJ++ -N<CKPGPFGXQT\ÒINKEJ



6062

6063

6064



4GKEJUVCNGT*CNN&CX/6C8QINJ+

2TCEJVGZGORNCT(CUV5VGORGNINCP\





4GKEJUVCNGT*CNN&CX/6C8QINJ+  8QT\ÒINKEJGU2TCEJVGZGORNCTOKVHGKPGT6ÌPWPI





-CTN8+&QRRGNVGT4GKEJUVCNGTQ,*CNNI&CX/6  8QT\ÒINKEJGU2TCEJVGZGORNCTOKVHGKPGT2CVKPC



220


RÖMISCH-DEUTSCHES REICH

6065 (doppelt)

6066

6067



&QRRGNVGT4GKEJUVCNGTQ,*CNNI&CX/6



4GKEJUVCNGT ,CJTGU\CJNKO5VGORGNCWUIG·PFGTV %*292TGUUDWTI&CX8QINJ+ 44(GKPG2CVKPCHCUVXQT\ÒINKEJGU'ZGORNCT



4GKEJUVCNGT$TGUNCW&CX#(W58QINJ+8  9KP\5EJTÌVNKPIUHGJNGTUGJTUEJÌP

6068

6070

5GJTUEJÌP

  

6069



4GKEJUVCNGT ,CJTGU\CJNKO5VGORGNXGTOWVNKEJCWUIG·PFGTV *CNN&CX/6 8QINJ++ 8QT\ÒINKEJp5VGORGNINCP\





4GKEJUVCNGT ,CJTGU\CJNKO5VGORGNXGTOWVNKEJCWUIG·PFGTV *CNN&CX/6 8QINJ++ <CKPGPFGHCUVXQT\ÒINKEJ





4GKEJUVCNGT-$-TGOPKV\*GTKPGM  2TCEJVGZGORNCTOKVHGKPGT6ÌPWPI8QT\ÒINKEJp5VGORGNINCP\

 221


RÖMISCH-DEUTSCHES REICH

6071

6072

6073



4GKEJUVCNGT ,CJTGU\CJNKO5VGORGNCWUIG·PFGTV *CNN&CX/68QINJ++ 5GJTUEJÌP



4GKEJUVCNGT*CNN&CX/68QINJ++

 8QT\ÒINKEJGU'ZGORNCTOKVHGKPGT6ÌPWPI





4GKEJUVCNGT*CNN&CX/68QINJ++  (CUVXQT\ÒINKEJGU'ZGORNCTOKVUEJÌPGT2CVKPC





6074

6075

6075



4GKEJUVCNGT*CNN&CX/68QINJ++  8QT\ÒINKEJGU'ZGORNCTOKVUEJÌPGT2CVKPC



5KNDGTOGFCKNNGXQP(,9WTUEJDCWGTWPF229GTPGTCWHFCUL·JTKIG$GUVGJGPFGU+PPGT DGTIGT JGWVG 'KUGPGT\  $GTIYGTMUXGTGKPU )GJCTPKUEJVGU $TWUVDKNF T OKV .QTDGGTMTCP\ WOIGNGIVGO   /CPVGNWPFFGT-GVVGFGU1TFGPUXQO)QNFGPGP8NKGU5QPPGOKVFGO$KNFPKU-CTNU8+DGUEJGKPVFGP 'T\DGTIKPFGOIGCTDGKVGVYKTFKO*KPVGTITWPFN5EJNCEJVHGNFT5GIGNUEJKHHGKO/GGTKO8QTFGT ITWPF9CHHGPWPF)GPKWUOKV9CRRGPUEJKNFOOI/ÒUGNGT5NI/QPVGPWQXQ 44#VVTCMVKXGU'ZGORNCTOKVHGKPGT2CVKPCUGJTUEJÌPpXQT\ÒINKEJ  &KG4ÒEMUGKVGPWOUEJTKHVGPVJ·NVFKG,CJTGU\CJNCNU%JTQPQITCOO

222




RÖMISCH-DEUTSCHES REICH

6076

6077

6078



4GKEJUVCNGT*CNN&CX/68QINJ8

(CUVXQT\ÒINKEJGU'ZGORNCT





4GKEJUVCNGT*CNN&CX/68QINJ8  -N5EJTÌVNKPIUTK­XQT\ÒINKEJp5VGORGNINCP\





4GKEJUVCNGT*CNN&CX/68QINJ8  9KP\5EJTÌVNKPIUHGJNGTXQT\ÒINKEJGU'ZGORNCTOKVHGKPGT2CVKPC



6079

6080

6081



4GKEJUVCNGT*CNN&CX/68QINJ8  8QT\ÒINKEJGU2TCEJVGZGORNCTOKVHGKPGT2CVKPC





4GKEJUVCNGT*CNN&CX/68QINJ8  2TCEJVGZGORNCTOKVHGKPGT6ÌPWPI(CUV5VGORGNINCP\





4GKEJUVCNGT*CNN&CX/68QINJ8



*ÒDUEJG2CVKPCHCUVXQT\ÒINKEJ

223


RÖMISCH-DEUTSCHES REICH

6083

6082

6084



4GKEJUVCNGT*CNN/KV<KHHGTWPVGTFGO$TWUVDKNF&CX/68QINJ8+  8QT\ÒINKEJGU'ZGORNCTOKVHGKPGT2CVKPC





/CTKC6JGTGUKC5KNDGTOGFCKNNGQ,  XQP/&QPPGTCWHFGP6QFFGUMCKUGTNKEJGP (KPCP\OKPKUVGTU )WPFCEMGT 6JQOCU )TCH 5VCTJGODGTI )GJCTPKUEJVGU $TWUVDKNF FGU )TCHGP T2KGVCU   WPF/KPGTXCTGKEJGPUKEJÒDGTDTGPPGPFGO#NVCTFKG*CPFOOI5NI/QPVGPWQXQ (CUVXQT\ÒINKEJGU'ZGORNCTOKVHGKPGT6ÌPWPI &WMCVQP#PVYGTRGP&GNO'[RGNVCWGT 5GJTUEJÌP

 



6085

6087

6086



-QPX6CNGT2TCI#WUDGWVGFGT,QCEJKOUVCNGT)TWDGP/ÒP\OGKUVGT2CWN'TFOCPPXQP5EJYKPIGT UEJWJ&CX&KGVKMGT'[RGNVCWGT*CNCEMC/ÒUGNGT (CUVXQT\ÒINKEJ





5KNDGTOGFCKNNG  XQP # 9KFGOCPP CWH FKG 8GTO·JNWPI FGU 'T\JGT\QIU ,QUGH OKV 'NKUCDGVJ XQP   $QWTDQP $GKFGT $TWUVDKNFGT PGDGPGKPCPFGT T*[OGP OKV .QTDGGTMT·P\GP GPV\ÒPFGV OKV GKPGT (CEMGN   GKP(GWGTCWHGKPGO#NVCTOOI5NI/QPVGPWQXQ 5GJTUEJÌP



5KNDGTOGFCKNNG  XQP # 9KFGOCPP CWH FKG 8GTO·JNWPI FGU 'T\JGT\QIU ,QUGH OKV 'NKUCDGVJ XQP   $QWTDQP$GKFGT$TWUVDKNFGTPGDGPGKPCPFGTT*[OGPOKV.QTDGGTMT·P\GPGPV\ÒPFGVOKVGKPGT(CEMGNGKP (GWGTCWHGKPGO#NVCTOOI5NI/QPVGPWQXQD\Y (GKPG6ÌPWPIXQT\ÒINKEJ





224


RÖMISCH-DEUTSCHES REICH

6088

6089

6090



-QPX6CNGT9KGP&CX'[RGNVCWGT  5GNVGPKPFKGUGT'TJCNVWPI8QT\ÒINKEJ5VGORGNINCP\





-QPX6CNGT)ÒP\DWTI8CTKCPVGOKVPCEJTXGTNCWHGPFGT$ÒIGNMTQPGWPFOKV$74)18+#'KP FGT4ÒEMUGKVGPWOUEJTKHV&CX'[RGNVCWGTC 8QT\ÒINKEJGU'ZGORNCTOKVHGKPGT6ÌPWPI





-TQPGPVCNGT$TÒUUGN&GNO'[RGNVCWGT  5GNVGPKPFKGUGT'TJCNVWPI5GJTCVVTCMVKXGUXQT\ÒINKEJGU'ZGORNCT



6091

6092

6092



-QPX6CNGT+%5-9KGP&CX'[RGNVCWGT

 2TCEJVGZGORNCT8QT\ÒINKEJp5VGORGNINCP\



5KNDGTOGFCKNNGXQP,/-TCHHVCWHFKG*WNFKIWPIXQP)CNK\KGPWPFFGT.QODCTFGK&KG$ÒUVGP XQP ,QUGHU ++ WPF UGKPGT /WVVGT /CTKC 6JGTGUKC PGDGPGKPCPFGT T&KG RGTUQPKHK\KGTVG #WUVTKC UKV\V T   OKV9CRRGPUEJKNFWPF.QTDGGT\YGKIFCXQTMPKGVFKGRGTUQPKH\KGTVG)CNK\KCKO8QTFGTITWPF\YGK9CR RGPUEJKNFGOOI5NI*QTUM[5NI,WNKWU5NI/QPVGPWQXQ  8QT\ÒINKEJ



 225


RÖMISCH-DEUTSCHES REICH

6093



,QUGH++<KPPOGFCKNNGWPUKIPKGTVXQP,%JTQFGT,/4GKEJCWHFKG'TQDGTWPI XQP $GNITCF 7PKHQTOKGTVGU $TWUVDKNF FGU MCKUGTNKEJGP )GPGTCNHGNFOCTUEJCNNU )KFGQP .CWFQP N   OKV WOIGNGIVGO 1TFGPUDCPF-TKGIGT KP XQNNGT 4ÒUVWPI OKV IG\QIGPGO 5EJYGTV CWH GKPGO PCEJ N   URTKPIGPFGO 2HGTF KO *KPVGTITWPF 5VCFVCPUKEJV  OO 5NI *QTUM[  FQTV KP 5KNDGT    5NI/QPVGPWQXQ5NI9KNO /KV-WRHGTUVKHVUGJTUEJÌPpXQT\ÒINKEJ



6095

6094





6094

.GQRQNF++5KNDGTOGFCKNNGWPUKIPKGTVXQP6JXCP$GTEMGNCWHFKGDGNIKUEJG*WNFKIWPI )GJCTPKUEJVGU $TWUVDKNF T OKV .QTDGGTMTCP\ WPF WOIGNGIVGO /CPVGN&GT -CKUGT UVGJV T CWH GKPGO   2QFGUVXQTGKPGO6KUEJOKV-TÌPWPIUKPUKIPKGPKPFGT.KPMGPJ·NVGTGKPGP5EJKNFOKVFGOGTFKGXQTKJO MPKGPFG$GNIKCDGUEJKTOVOKVFGT4GEJVGPTGKEJVGTKJTGKPGP¤N\YGKICPFGP5VWHGPFGU2QFGUVGUNKGIGP .ÌYG5EJNCPIGPUVCDWPF(ÒNNJQTPOOI-GPKU5NI/QPVGPWQXQ45GJTUEJÌP -TGW\GT )TQUEJGP #9KGP, 8QT\ÒINKEJ

 

6097

6096

6096



5KNDGTOGFCKNNGXQP,)*QNV\JG[CWHUGKPGP6QF)GMTÌPVGU$TWUVDKNFNOKVWOIGNGIVGO/CPVGN 9GKDNKEJGWPFO·PPNKEJG)GUVCNVVTCWGTPCP5CTMQRJCIFCTCWHIGMTÌPVG7TPGOKVUVTCJNGPFGO5VGTPGP MTCP\OOI5NI*QTUM[5NI/QPVGPWQXQ 2TCEJVGZGORNCT5VGORGNINCP\ 



(TCP\++-TQPGPVCNGT$TÒUUGN&CX,F  5GJTUGNVGPKPFKGUGT'TJCNVWPI8QT\ÒINKEJp5VGORGNINCP\

226




KAISERREICH ÖSTERREICH

6099

6098

6098

-#+5'44'+%*¤56'44'+%* 

(TCP\ +  5KNDGTOGFCKNNG  XQP . /CPHTGFKPK CWH FKG 8GTO·JNWPI UGKPGT 6QEJVGT   /CTKG .QWKUG OKV 0CRQN¾QP + KP 9KGP $GKFGT $TWUVDKNFGT PGDGPGKPCPFGT T)GHNÒIGNVGT )GPKWU XGT   VTGKDVGKPGP-TKGIGTOOI5NI,WNKWU5NI/QPVGPWQXQ 8QT\ÒINKEJ



/CTKG .QWKUG FKG ·NVGUVG 6QEJVGT XQP -CKUGT (TCP\ + YWTFG IGIGP KJTGP 9WPUEJ OKV 0CRQN¾QP PCEJ FGUUGP   6TGPPWPI XQP ,QUGRJKPG XGTO·JNV <W FGP (GKGTNKEJMGKVGP KP 9KGP CO  /·T\  YWTFG FGT NCPIL·JTKIG   )GH·JTVG WPF GPIG 8GTVTCWVG 0CRQN¾QPU #NGZCPFTG $GTVJKGT IGUCPFV WO FGP HTCP\ÌUKUEJGP -CKUGT \W XGTVTGVGP   $GTVJKGT YWTFG  \WO (ÒTUV WPF *GT\QI FGT XQP 2TGW­GP CDIGVTGVGPGP (ÒTUVGPVÒOGT 0GWGPDWTI WPF 8CNCPIKP   UQYKG\WO(ÒTUVXQP9CITCOGTPCPPV



-TGW\GT%2TCI&KG7OUEJTKHVCWHFGT4ÒEMUGKVGGPFGVOKV&Û.1Û5#.Û9+4%ÛÛ ,( 5GJTUGNVGPG8CTKCPVG8QT\ÒINKEJ 

6100

6101

6102



-QPX6CNGT%2TCI&CX,-CJPV  *GTTNKEJG2CVKPCXQT\ÒINKEJp5VGORGNINCP\5VGORGNINCP\





-QPX6CNGT#9KGP&CX,-CJPV  2TCEJVGZGORNCT*GTTNKEJG2CVKPCHCUV5VGORGNINCP\5VGORGNINCP\





(TCP\ ,QUGH +  &QRRGNIWNFGP  # 9KGP CWH UGKPG 8GTO·JNWPI OKV 'NKUCDGVJ XQP   $C[GTP&CX,-CJPV (GKPG2CVKPCXQT\ÒINKEJp5VGORGNINCP\

 227


KAISERREICH ÖSTERREICH

6104

6103

 

6103

-QPX6CNGT#9KGP, -W-TGW\GT88GPGFKI,

448QT\ÒINKEJ 8QT\ÒINKEJp5VGORGNINCP\

6105

 

6106



&QRRGNIWNFGP#9KGP&CX,-CJPV6JWP

8QT\ÒINKEJ





&QRRGNIWNFGP9KGP9KGPGT5EJÒV\GPHGUV&CX,6JWP  44*GTTNKEJG2CVKPCXQT\ÒINKEJGU'ZGORNCT



6108

ex 6107





ex 6107

5KNDGTOGFCKNNG  XQP # 5EJCTHH WPF , 6CWVGPJC[P CWH UGKPG 5KNDGTJQEJ\GKV OKV 'NKUCDGVJ XQP   $C[GTP IGYKFOGV XQP FGT5VCFV9KGP$GKFGT$TWUVDKNFGTPGDGPGKPCPFGTT8KPFQDQPCDGINGKVGVXQP GKPGO2CIGPOKV9CRRGPUEJKNFÒDGTTGKEJVFGO-CKUGTRCCTGKPG5EJTKHVTQNNGOOI&C\W 'KP\YGKVGU'ZGORNCTKP$TQP\GOO5NI*QTUM[9KVV  5VÒEM+P1TKIKPCNGVWK8QT\ÒINKEJ



5KNDGTOGFCKNNG  XQP # 5EJCTHH CWH FGP  )GDWTVUVCI FGU )TCHGP #FQNH 2QFUVCV[.KEJVGPUVGKP   $TWUVDKNF FGU )TCHGP N OKV WOIGNGIVGO /CPVGN<YGK .ÌYGP JCNVGP IGMTÌPVGU 9CRRGP  OO   I5NI*QTUM[ 8QT\ÒINKEJ



.165*#$5$74) 

228

'T\JGT\QI .GQRQNF 6CNGT  *CNN .GQRQNF + 4GKEJUVCNGT  -TGOPKV\ ,QUGRJ 4GKEJUVCNGT   /CTKC6JGTGUKC-TQPGPVCNGT#PVYGTRGP,QUGRJ++-TQPGPVCNGT#(TCP\+ -QPX6CNGT#&C\WYGKVGTG6GKNUVÒEMG-NGKPOÒP\GPWPF/GFCKNNGPXQP*CDUDWTI Z $C[GTP

Z 5VQNDGTI Z 5RCPKGP Z /KV*GPMGN Z IGNQEJV Z *GPMGNURWT Z   5VÒEM6GKNYGKUGOKVMNGKPGP(GJNGTPOGKUVUEJÌPpUGJTUEJÌP




GEISTLICHKEIT 

'T\JGT\QI(GTFKPCPF4GKEJUVCNGTQ,*CNN,QUGH+4GKEJUVCNGT*CNN/CTKC6JGTGUKC-QPX 6CNGT5%,QUGH++5EWFQ.$.GQRQNF++-QPX6CNGT*  5VÒEM(CUVUGJTUEJÌPWPFUGJTUEJÌP





-CTN8+4GKEJUVCNGT*CNN/CTKC6JGTGUKC-QPX6CNGT)ÒP\DWTI,QUGH++-QPX 6CNGT$-TGOPKV\ 5VÒEM5GJTUEJÌPpXQT\ÒINKEJ





&KXGTUG/ÒP\GPFGU,CJTJWPFGTVUXQO-TGW\GTDKU\WO6CNGTFCTWPVGT/CTKC6JGTGUKC&WMCV  -$ -TGOPKV\ Z  &C\W GKPG MNGKPG 5GTKG XQP 2T·IWPIGP FGU $KUVWOU 1NOÒV\ +PVGTGUUCPVGU   1DLGMVOKVDGUUGTGP6[RGPWPFJÒDUEJGP3WCNKV·VGPDKVVGDGUKEJVKIGP  5VÒEM6GKNYGKUGOKVMN(GJNGTPUGJTUEJÌPWPFDGUUGT 



&KXGTUG/ÒP\GPFGU,CJTJWPFGTVUFCTWPVGTXKGNG)GFGPMOÒP\GP\WWPF5EJKN NKPIGP EC  ¤U  MQORNGVVGT 5CV\ FGT 5EJKNNKPI)GFGPMOÒP\GP  GVE &C\W GKPKIG   CNVFGWVUEJG/ÒP\GPWPF/GFCKNNGP+PVGTGUUCPVGU.QVDKVVGDGUKEJVKIGP  5VÒEM(CUVUGJTUEJÌPp5VGORGNINCP\



6115

6114

6114

&+')'+56.+%*-'+6+0&'0*#$5$74)+5%*'0'4$.#0&'0 $4+:'0$+567/ 

5GFKUXCMCP\  5KNDGTOGFCKNNG  WPUKIPKGTV (ÒPH <GKNGP 5EJTKHV WOJGT  9CRRGP FGT   &QOJGTTGP#FNGT X X OKV SWGT IGJCNVGPGO $KUEJQHUUVCD &QOMCRKVGNYCRRGP   OO  I   5NI/QPVGPWQXQ<GRGTPKEM 8QT\ÒINKEJ 9GKVGTG2T·IWPIGPFGU$KUVWOU$TKZGPHKPFGP5KGWPVGTFGP0TP



)74-$+567/ 

(TCP\:CXGTXQP5CNO4GKHHGTUEJGKF-QPX6CNGT&CX*QN\OCKT5  8QT\ÒINKEJ

ex 6116

6117



ex 6118

1./ª6<$+567/ 

(TCP\XQP&KGVTKEJUVGKP-TGW\GTQ,5WEJQOGN8KFGOCP Z   5VÒEM5GJTUEJÌP





-TGW\GT )TQUEJGP 5WEJQOGN8KFGOCP

8QT\ÒINKEJ





-TGW\GT )TQUEJGP Q, Z  Z  Z 

5VÒEM5GJTUEJÌP





.GQRQNF 9KNJGNO   -TGW\GT )TQUEJGP    &C\W -TGW\GT  5WEJQ   OGN8KFGOCP 5VÒEM5GJTUEJÌP

 229


GEISTLICHKEIT

6120

  

6122

-TGW\GT5WEJQOGN8KFGOCP -TGW\GT Z 5WEJQOGN8KFGOCP Z  -CTN+,QUGH-TGW\GT5WEJQOGN8KFGOCP

6123

6124

6125

5GJTUEJÌP 5VÒEM5EJÌPpUGJTUEJÌP 45GJTUEJÌP

ex 6127

6126



-CTN++XQP.KGEJVGPUVGKP-TGW\GT5WEJQOGN8KFGOCP



-TGW\GT )TQUEJGP  ,CJTGU\CJNKO5VGORGNCWUIG·PFGTV 5WEJQOGN8KFGOCP  8QT\ÒINKEJ

  

-TGW\GT )TQUEJGP 5WEJQOGN8KFGOCP -TGW\GT )TQUEJGP 5WEJQOGN8KFGOCP -TGW\GT

6128

6129

  

5GJTUEJÌP

8QT\ÒINKEJ 8QT\ÒINKEJ 5VÒEM8QT\ÒINKEJ

6130

    

6132

    

-TGW\GT5WEJQOGN8KFGOCP -TGW\GT5WEJQOGN8KFGOCP -TGW\GT5WEJQOGN8KFGOCP -TGW\GT5WEJQOGN8KFGOCP -TGW\GT5WEJQOGN8KFGOCP

8QT\ÒINKEJ 8QT\ÒINKEJGU2TCEJVGZGORNCT 8QT\ÒINKEJ 5VÒEM5GJTUEJÌP 5GJTUEJÌPpXQT\ÒINKEJ

    



-TGW\GT<CJNTGKEJG8CTKCPVGP+PVGTGUUCPVGU.QV5WEJQOGN8KFGOCP  5VÒEM/GKUVUGJTUEJÌP



230


GEISTLICHKEIT

6139

6134

6134



4GKEJUVCNGT&CX5WEJQOGN8KFGOCP  9KP\-TCV\GTUGJTCVVTCMVKXGUXQT\ÒINKEJGU'ZGORNCTOKVHGKPGT2CVKPC





-TGW\GT Z 





-TGW\GT Z  Z  Z  Z  Z  Z 

Z  5VÒEM/GKUVUGJTUEJÌP -TGW\GT )TQUEJGP  Z  Z  Z  5VÒEM/GKUVUGJTUEJÌP -TGW\GT )TQUEJGP  Z  5VÒEM8QT\ÒINKEJ

  

-CTN+++XQP.QVJTKPIGP4GKEJUVCNGT&CX5WEJQOGN8KFGOCP  4(CUVXQT\ÒINKEJGU'ZGORNCTOKVHGKPGT2CVKPC



  

6140

  

6141

5VÒEM/GKUVUGJTUEJÌP

6142

4GKEJUVCNGT&CX5WEJQOGN8KFGOCP 5GJTUEJÌPGU'ZGORNCTOKVHGKPGT2CVKPC 4GKEJUVCNGT&CX5WEJQOGN8KFGOCP 8QT\ÒINKEJGU'ZGORNCTOKVHGKPGT2CVKPC 4GKEJUVCNGT&CX5WEJQOGN8KFGOCP (CUVXQT\ÒINKEJGU'ZGORNCTOKVJÒDUEJGT2CVKPC

   231


GEISTLICHKEIT

6143

6144

6145



4GKEJUVCNGT5WEJQOGN8KFGOCP

5GJTUEJÌPpXQT\ÒINKEJ





4GKEJUVCNGT ,CJTGU\CJNKO5VGORGNCWUIG·PFGTV &CX5WEJQOGN8KFGOCP  (CUVXQT\ÒINKEJGU'ZGORNCTOKVHGKPGT2CVKPC





4GKEJUVCNGT ,CJTGU\CJNKO5VGORGNXGTOWVNKEJCWUIG·PFGTV &CX5WEJQOGN8KFGOCP #VVTCMVKXGUHCUVXQT\ÒINKEJGU'ZGORNCTOKVHGKPGT2CVKPC



6146

6147

6149

  

4GKEJUVCNGT&CX5WEJQOGN8KFGOCP 4GKEJUVCNGT&CX5WEJQOGN8KFGOCP -TGW\GT Z  Z  Z 

8QT\ÒINKEJGU'ZGORNCTOKVHGKPGT2CVKPC (CUVXQT\ÒINKEJGU'ZGORNCTOKVHGKPGT6ÌPWPI 5VÒEM5EJÌPpUGJTUEJÌP

  



9QNHICPIXQP5EJTCVVGPDCEJ4GKEJUVCNGT&CX5WEJQOGN8KFGOCP  #VVTCMVKXGUUGJTUEJÌPGU'ZGORNCTOKVHGKPGT2CVKPC



232


GEISTLICHKEIT

6150

6151

6152



4GKEJUVCNGT ,CJTGU\CJNKO5VGORGNCWUIG·PFGTV &CX5WEJQOGN8KFGOCP  (CUVXQT\ÒINKEJGU'ZGORNCTOKVHGKPGT6ÌPWPI





4GKEJUVCNGT&CX5WEJQOGN8KFGOCP

#VVTCMVKXGUUGJTUEJÌPGU'ZGORNCT





4GKEJUVCNGT&CX5WEJQOGN8KFGOCP

8QT\ÒINKEJGU'ZGORNCTOKVHGKPGT6ÌPWPI



6153

6154

6155



4GKEJUVCNGT&CX5WEJQOGN8KFGOCP

5GJTUEJÌPGU'ZGORNCT





4GKEJUVCNGT&CX5WEJQOGN8KFGOCP

(GKPG6ÌPWPIUGJTUEJÌPpXQT\ÒINKEJ





4GKEJUVCNGT&CX5WEJQOGN8KFGOCP  9KP\-TCV\GTFGPPQEJCVVTCMVKXGUHCUVXQT\ÒINKEJGU'ZGORNCT

 233


GEISTLICHKEIT

6156

6157

6158



4GKEJUVCNGT&CX5WEJQOGN8KFGOCP

8QT\ÒINKEJGU'ZGORNCTOKVHGKPGT6ÌPWPI





4GKEJUVCNGT&CX5WEJQOGN8KFGOCP

(CUVXQT\ÒINKEJGU'ZGORNCTOKVHGKPGT6ÌPWPI





4GKEJUVCNGT&CX5WEJQOGN8KFGOCP

(CUVXQT\ÒINKEJGU'ZGORNCTOKVHGKPGT2CVKPC



6159

6160

6161



4GKEJUVCNGT&CX5WEJQOGN8KFGOCP

5GJTUEJÌPGU'ZGORNCT





4GKEJUVCNGT&CX5WEJQOGN8KFGOCP

(CUVXQT\ÒINKEJGU'ZGORNCTOKVHGKPGT2CVKPC





4GKEJUVCNGT&CX5WEJQOGN8KFGOCP

(CUVXQT\ÒINKEJGU'ZGORNCTOKVHGKPGT2CVKPC



234


GEISTLICHKEIT

6162

6163



4GKEJUVCNGT5WEJQOGN8KFGOCP



4GKEJUVCNGT&CX5WEJQOGN8KFGOCP



6164

5GJTUEJÌP



8QT\ÒINKEJGU'ZGORNCTOKVHGKPGT6ÌPWPI



4GKEJUVCNGT&CX5WEJQOGN8KFGOCP  -N5EJTÌVNKPIUHGJNGTHCUVXQT\ÒINKEJGU'ZGORNCTOKVHGKPGT2CVKPC



6165

6168

6169



4GKEJUVCNGT&CX5WEJQOGN8KFGOCP

-N5EJTÌVNKPIUHGJNGTUGJTUEJÌPpXQT\ÒINKEJ





-TGW\GT Z  ,CJTGU\CJNKO5VGORGNCWUIG·PFGTV  Z  5VÒEM5GJTUEJÌP





-TGW\GT Z  Z  ZFCXQPZKO5VGORGNCWUIG·PFGTV  Z  Z  5VÒEM5EJÌPpUGJTUEJÌP





,CMQD'TPUVXQP.KGEJVGPUVGKP4GKEJUVCNGT&CX5WEJQOGN8KFGOCP  (CUVXQT\ÒINKEJGU'ZGORNCTOKVHGKPGT2CVKPC





4GKEJUVCNGT&CX5WEJQOGN8KFGOCP



8QT\ÒINKEJGU'ZGORNCT

235


GEISTLICHKEIT

6171

6170

6170



4GKEJUVCNGT&CX5WEJQOGN8KFGOCP



.GQRQNF ++ XQP 'IMJ WPF *WPIGTUDCEJ  5KNDGTOGFCKNNG  WPUKIPKGTV CWH UGKPG   +PVJTQPKUCVKQP KO ,CJTG  -CTFKPCNUJWV ÒDGT 9CRRGP FCTWPVGT UGEJU <GKNGP 5EJTKHV9GKDNKEJG   )GUVCNVOKV¤N\YGKIWPFYGKDNKEJG)GUVCNVKPIGDÒEMVGT*CNVWPIOKV#PMGTWOCTOGPGKPCPFGTKP.CPF UEJCHVOOI.KEJP/5WEJQOGN8KFGOCP5 *GPMGNURWTUGJTUEJÌP

6174

6173

6172



-N5EJTÌVNKPIUHGJNGTHCUVXQT\ÒINKEJ





6175

6172

/CZKOKNKCPXQP*COKNVQP-NGKPG5KNDGTOGFCKNNGXQP)6QFCCWHUGKPG+PVJTQPKUC VKQP $TWUVDKNF N KP IGKUVNKEJGO 1TPCV.GICVGPJWV ÒDGT 5VKHVU WPF (COKNKGPYCRRGP FCTWPVGT UGEJU   <GKNGP5EJTKHVOOI5WEJQOGN8KFGOCP5 48QT\ÒINKEJ





#PVQP6JGQFQTXQP%QNNQTGFQ-QPX6CNGT&CX5WEJQOGN8KFGOCP 48QT\ÒINKEJGU2TCEJVGZGORNCTOKVHGKPGT2CVKPC





4WFQNH,QJCPPXQP¤UVGTTGKEJ5KNDGTOGFCKNNGXQP,-NKGDGTWPF,*CTPKUEJCWH UGKPG +PVJTQPKUCVKQP &KG PCEJ N UVGJGPFG 4GNKIKQP UGIPGV GKPG XQT KJT MPKGPFG 2GTUQP FKG OKV FGT   4GEJVGPCWHGKPGPCO$QFGPUKV\GPFGP$GVVNGTYGKUVKO*KPVGTITWPFGKP'PIGNOKV.CP\GWPF.QTDGGT MTCP\ T #VVTKDWVG FGT HTGKGP -ÒPUVG<GJP <GKNGP 5EJTKHV  OO  I .KEJP/  XCT   5WEJQOGN8KFGOCP5 8QT\ÒINKEJGU2TCEJVGZGORNCT



-QPX6CNGT&CX5WEJQOGN8KFGOCP  2TCEJVGZGORNCTOKVHGKPGT6ÌPWPI5VGORGNINCP\





236


GEISTLICHKEIT

6176

6177

6176



-QPX6CNGT5WEJQOGN8KFGOCP  2TCEJVGZGORNCTOKVHGKPGT6ÌPWPI(CUV5VGORGNINCP\





-TGW\GT5WEJQOGN8KFGOCP



/KPLWUVKGTVXQT\ÒINKEJp5VGORGNINCP\

6178

 

-TGW\GT5WEJQOGN8KFGOCP -TGW\GT5WEJQOGN8KFGOCP

ex 6180



6179

8QT\ÒINKEJp5VGORGNINCP\ 5GJTUEJÌP

ex 6182

 

6181

/CZKOKNKCP++,QUGHXQP5QOGTCW$GGEMJ5KNDGTOGFCKNNGXQP,5EJÌPCWHUGKPG +PVJTQPKUCVKQP$TWUVDKNFNKPIGKUVNKEJGO1TPCVN'T\DKUEJÌHNKEJG+PUKIPKGPCWH2QUVCOGPVOO  I &C\W 'KP YGKVGTGU ITÌ­GTGU 'ZGORNCT KP $TQP\G  OO .KEJP/   FQTV KP   5KNDGT  5VÒEM8QT\ÒINKEJ





(TKGFTKEJ .CPFITCH XQP (ÒTUVGPDGTI  5KNDGTOGFCKNNG  XQP % 4CFPKV\M[ CWH UGKPG   +PVJTQPKUCVKQP $TWUVDKNF N KP IGKUVNKEJGO 1TPCV/KV FGO -CTFKPCNUJWV DGFGEMVGU 9CRRGP OKV FGO   IGMTÌPVGP 9CRRGP XQP (ÒTUVGPDGTI CNU /KVVGNUEJKNF FCJKPVGT +PUKIPKGP WPF -TGW\ \W FGP 5GKVGP CWH   FGO5EJTKHVTCPFLGGKPO·JTKUEJGT#RQUVGNOOI.KEJP/ 8QT\ÒINKEJ





.QVU1NOÒV\5COONWPIXQP6CNGTPFGT,CJTGUQYKG -NGKPOÒP\GP 5VÒEM<WO6GKNOKV(GJNGTPFGT)GUCOVGKPFTWEMKUVUGJTUEJÌP 



-NGKPG 5COONWPI XQP /ÒP\GP FGU  ,CJTJWPFGTVU XQO -TGW\GT DKU \WO  6CNGT FCTWPVGT   DGUUGTG6[RGPUQYKGVGKNYGKUGJÒDUEJG'TJCNVWPIGP+PVGTGUUCPVGU.QVDKVVGDGUKEJVKIGP  5VÒEM'KPKIGOKVMNGKPGP(GJNGTPUEJÌPpXQT\ÒINKEJ

 237


GEISTLICHKEIT

6185

6184

6184

24#)'4<$+567/ 

(GTFKPCPF)TCHXQP-JÒGPDWTI5KNDGTOGFCKNNGWPUKIPKGTVXQP)98GUVPGTCWH FKG*GKNKIURTGEJWPI,QJCPPXQP0GRQOWMUFWTEJ2CRUV%NGOGPU:+$TWUVDKNFFGUJGKNKIGP0GRQOWM JCNDT KO #DUEJPKVV 2#641085 (#/# 2'4+%.+6#06+8/9CRRGP XQP  %NGOGPU :+ FCTÒDGT   6KCTCOOI$GTPJGKOGT XIN &QPGD5NI*QTUM[ FQTVOKV,CJTGU \CJN  5GJTUEJÌP



(GTFKPCPF )TCH XQP -JÒGPDWTI YWTFG  CNU 5QJP FGU )TCHGP ,QJCPP (TKGFTKEJ WPF UGKPGT )GOCJNKP ,QJCPPC   )WUUOCPIGDQTGP'TYWTFGPCEJFGO6QFFGU'T\DKUEJQHU,QJCPP,QUGRJ)TCHGPXQP$TGWPGT\WUGKPGO0CEJHQN IGTGTPCPPVVTCVCDGTUGKP#OVYGIGPFGTKP2TCIJGTTUEJGPFGP2GUVGTUVCP'TUVCTDCO

5#.<$74)'4<$+567/ 

/CVVJ·WU.CPIXQP9GNNGPDWTI-TGW\GT2TQDU\V  44(GKPG6ÌPWPIUGJTUEJÌPpXQT\ÒINKEJ

6186



6188

6187



)WNFKPGT   I 5VKHVU WPF (COKNKGPYCRRGP PGDGPGKPCPFGT WPVGT -CTFKPCNUJWV FCTWPVGT   /&:::8+5V 4WFDGTVWU UKV\V X X OKV /KVTC 5CN\IGH·­ WPF -TWOOUVCD &CX  2TQDU\V    8QPITÌ­VGT5GNVGPJGKVKPFKGUGT'TJCNVWPI-N2T·IGUEJY·EJGXQT\ÒINKEJGU'ZGORNCT 



'TPUVXQP$C[GTP)WNFKPGT&CX2TQDU\V



/KEJCGNXQP-ÒGPDWTI)WNFKPGT&CX2TQDU\V

238

5EJÌPG6ÌPWPIUGJTUEJÌP 5GJTUEJÌPpXQT\ÒINKEJ

 


GEISTLICHKEIT

6189

6190

6191



)WNFKPGT&CX2TQDU\V

5GJTUEJÌP





,QJCPP,CMQD-JWGPXQP$GNCUK6CNGT&CX2TQDU\V

5GJTUEJÌP





6CNGT&CX2TQDU\V

4CPFHGJNGTUGJTUEJÌP



6192

6194

6193



6CNGT&CX2TQDU\V

*ÒDUEJG2CVKPCUGJTUEJÌPpXQT\ÒINKEJ





6CNGT&CX2TQDU\V

#VVTCMVKXGU'ZGORNCTGVYCU$GNCICO4CPFHCUVXQT\ÒINKEJ





)WNFGPVCNGT -TGW\GT OKV6KVGN/CZKOKNKCPU++&CX2TQDU\V

4(CUVUGJTUEJÌP

 239


GEISTLICHKEIT

6195

6197

6196



)WNFGPVCNGT -TGW\GT OKV6KVGN/CZKOKNKCPU++&CX2TQDU\V  4-N-TCV\GTUGJTUEJÌP



 

9QNH&KGVTKEJXQP4CKVGPCW4GKEJUVCNGTQ,&CX2TQDU\V 4GKEJUVCNGTQ,&CX2TQDU\V

(CUVXQT\ÒINKEJ 5GJTUEJÌP

 

45GJTUEJÌP



6198



4GKEJUVCNGTQ,2TQDU\V

6199

6200 (doppelt)

6200 (doppelt)



4GKEJUVCNGTMNKRRG 1TVUVCNGTMNKRRG Q,2TQDU\V  8QPITQ­GT5GNVGPJGKV#VVTCMVKXGUUGJTUEJÌPGU'ZGORNCT





&QRRGNVG4GKEJUVCNGTMNKRRG6WTORT·IWPII&CX#PO2TQDU\V  5GNVGPKPFKGUGT'TJCNVWPI8QT\ÒINKEJ



240


GEISTLICHKEIT

6202

6201

6201



4GKEJUVCNGTMNKRRGQ,  6WTORT·IWPI2TQDU\V  *ÒDUEJG2CVKPCYKP\5EJTÌVNKPIUHGJNGTCO4CPFUGJTUEJÌP





/CTMWU5KVVKMWUXQP*QJGPGOU4GKEJUVCNGT2TQDU\V  44#VVTCMVKXGU'ZGORNCTOKVJGTTNKEJGT2CVKPCUGJTUEJÌP



6203

ex 6204

6205



2CTKUXQP.QFTQP4GKEJUVCNGT&CX2TQDU\V

(GKPG6ÌPWPIXQT\ÒINKEJ





4GKEJUVCNGT&CX2TQDU\V  5VÒEM4CPFNGKEJVDGCTDGKVGV Z UGJTUEJÌPWPFHCUVXQT\ÒINKEJ





4GKEJUVCNGT2TQDU\V

44(CUVUGJTUEJÌP



(CUVXQT\ÒINKEJ



6206



4GKEJUVCNGTCWHFKG&QOYGKJG&CX2TQDU\V

241


GEISTLICHKEIT

6207

6208



4GKEJUVCNGTCWHFKG&QOYGKJG&CX2TQDU\V



6CNGT2TQDU\V



4GKEJUVCNGT&CX2TQDU\V

ex 6210

6211

6209

5GJTUEJÌP



*ÒDUEJG2CVKPCHCUVXQT\ÒINKEJ



8QT\ÒINKEJp5VGORGNINCP\



6212



.16 4GKEJUVCNGT    Z         &CX     Z  5VÒEM/GKUVUGJTUEJÌP 



)WKFQDCNFXQP6JWPWPF*QJGPUVGKP4GKEJUVCNGT&CX2TQDU\V  5GJTUEJÌP





4GKEJUVCNGT&CX2TQDU\V



242

8QT\ÒINKEJ


GEISTLICHKEIT

6213



/CZ)CPFQNRJXQP-ÒGPDWTI<YKVVGT5EJTCWDVCNGTQ,+PJCNVMQNQTKGTVG/CTK GPINCUDKNFEJGPCWHFGPGPXGTUEJKGFGPG-NGKFGTWPF5\GPCTKGPFCTIGUVGNNVUKPFKPFGP&GEMGNKPPGPUGKVGP DGHKPFGP UKEJ \YGK NQUG MQNQTKGTVG $KNFGT %JTKUVWU X X OKV *GKNKIGPUEJGKP WPF UGIPGPFGT 4GEJVGP   UGKPG 7OIGDWPI MCPP FWTEJ #WHNGIGP FGT /CTKGPINCUDKNFEJGP XGT·PFGTV YGTFGP$GVGPFG /CTKC UKV\V   TXQT-TGW\WPFCWHIGUEJNCIGPGO$WEJ&CX\W2TQDU\V\W2TG­NGT  /CTKGPINCUDKNFGTNGKEJVDGUEJ·FKIVMN5EJTÌVNKPIUTK­UGJTUEJÌPpXQT\ÒINKEJ

ex 6214

6215



6216



4GKEJUVCNGT&CX Z 2TQDU\V  5VÒEM5GJTUEJÌPWPFUGJTUEJÌPpXQT\ÒINKEJ





4GKEJUVCNGT&CX2TQDU\V

*GTTNKEJG2CVKPCXQT\ÒINKEJ





4GKEJUVCNGT&CX2TQDU\V

(CUVXQT\ÒINKEJ



5GJTUEJÌPpXQT\ÒINKEJ



6217



4GKEJUVCNGT&CX2TQDU\V

243


GEISTLICHKEIT

6218

6219

6220



4GKEJUVCNGTCWHFCUL·JTKIG,WDKN·WOFGU'T\UVKHVGU&CX#2TQDU\V  8QT\ÒINKEJp5VGORGNINCP\





4GKEJUVCNGTCWHFCUL·JTKIG,WDKN·WOFGU'T\UVKHVGU&CX#2TQDU\V  5EJÌPG6ÌPWPIHCUVXQT\ÒINKEJ





,QJCPP'TPUVXQP6JWPWPF*QJGPUVGKP4GKEJUVCNGT&CX2TQDU\V  9KP\4CPFHGJNGTHCUVXQT\ÒINKEJ



6222

6221

6223



4GKEJUVCNGT2TQDU\V

*GTTNKEJG2CVKPCXQT\ÒINKEJp5VGORGNINCP\





4GKEJUVCNGT ,CJTGU\CJNKO5VGORGNCWUIG·PFGTV &CX2TQDU\V  *GTTNKEJG2CVKPCXQT\ÒINKEJ





4GKEJUVCNGT ,CJTGU\CJNKO5VGORGNCWUIG·PFGTV &CX2TQDU\V



244

8QT\ÒINKEJ


GEISTLICHKEIT

ex 6224

6226

ex 6225



.164GKEJUVCNGT&CX Z 



(TCP\#PVQPXQP*CTTCEJ4GKEJUVCNGT&CX2TQDU\V



4GKEJUVCNGT&CX2TQDU\V

6228

6227

5VÒEM5GJTUEJÌPWPFDGUUGT



8QT\ÒINKEJ



5GJTUEJÌPpXQT\ÒINKEJ



6229



4GKEJUVCNGT2TQDU\V

48QT\ÒINKEJ





4GKEJUVCNGT&CX2TQDU\V

445GJTUEJÌP





5KIKUOWPF +++ XQP 5EJTCVVGPDCEJ  -QPX6CNGT   &CX   2TQDU\V    5VÒEM5GJTUEJÌP

 245


GEISTLICHKEIT

ex 6231

6230

6230



-QPX6CNGT&CX2TQDU\V



5KNDGTOGFCKNNGWPUKIPKGTVXQP(/CV\GPMQRHLWPCWHFKG8QNNGPFWPIFGU5KIKUOWPFVQTGU$TWUV DKNFTKPIGKUVNKEJGO1TPCV&CU5ÒFRQTVCNFGU5KIKUOWPFVQTGU\YKUEJGP\YGK2[TCOKFGPFGTGPCDIG DTQEJGPG5RKV\GPCO$QFGPNKGIGPOOI&C\W5KNDGTOGFCKNNGXQP(/CV\GPMQRH LWP CWH FKG ,CJTHGKGT FGU 'T\UVKHVGU $TWUVDKNF T KP IGKUVNKEJGO 1TPCV6GORGN  OO   I$4 5VÒEM5GJTUEJÌPpXQT\ÒINKEJ



.164GKEJUVCNGT&CX Z   5VÒEM/GKUVUGJTUEJÌP





5GJTUEJÌPpXQT\ÒINKEJ



ex 6233

6235

6235



*KGTQP[OWUXQP%QNNQTGFQ-QPX6CNGT&CX2TQDU\V 5VÒEM5GJTUEJÌPWPFHCUVXQT\ÒINKEJ





.16-QPX6CNGT&CX Z  Z  5VÒEM5GJTUEJÌPpXQT\ÒINKEJ



 246

5#.<$74)-74(ª456'067/

(GTFKPCPF-QPX6CNGT&CX2TQDU\V

(CUVXQT\ÒINKEJXQT\ÒINKEJ




STANDESHERREN .1655#.<$74) 



5COONWPI5CN\DWTIGT/ÒP\GPFGUDKU,CJTJWPFGTVUOKVGKPKIGPDGUUGTGP5VÒEMGP&CTWPVGT FKXGTUG6CNGTWPFMWRHGTPG9GKPJCPFGNUOCTMGP5GJTKPVGTGUUCPVGU.QVDKVVGDGUKEJVKIGP  5VÒEM7PVGTUEJKGFNKEJGTJCNVGPFGT)GUCOVGKPFTWEMKUVUGJTUEJÌP



-NGKPG5COONWPIXQP/ÒP\GPFGU,CJTJWPFGTVUCWUFGO'T\DKUVWO5CN\DWTIXQO2HGPPKIDKU \WO6CNGTFCTWPVGT\CJNTGKEJG-NKRRGPWPFDGUUGTG6[RGP+PVGTGUUCPVGU.QVDKVVGDGUKEJVKIGP  5VÒEM<WO6GKNOKVMN(GJNGTPOGKUVUGJTUEJÌPWPFDGUUGT





5COONWPI XQP /ÒP\GP FGU  ,CJTJWPFGTVU XQO 2HGPPKI DKU \WO *CNDVCNGT FCTWPVGT DGUUGTG   6[RGPWPFVGKNYGKUGJÒDUEJG3WCNKV·VGP+PVGTGUUCPVGU.QVDKVVGDGUKEJVKIGP  5VÒEM'KPKIGOKVMNGKPGP(GJNGTPUEJÌPpXQT\ÒINKEJ 



&KXGTUG6GKNUVÒEMGFGU<GKVTCWOGUFCTWPVGTDGUUGTG6[RGPWPFVGKNYGKUGJÒDUEJG3WCNKV·VGP +PVGTGUUCPVGU.QVDKVVGDGUKEJVKIGP 5VÒEM-NGKPG*GPMGNURWT Z UGJTUEJÌPpHCUV5VGORGNINCP\



6240

9;5%*'*4#& 

%GUNCWU)QVVJCTFXQP5EJCHHIQVUEJ5KNDGTOGFCKNNGWPUKIPKGTVCWHUGKPG+PVJTQPKUC VKQPKP2TCI<YGKCPGKPCPFGTIGNGJPVGQXCNG9CRRGPUEJKNFGKPXGT\KGTVGP-CTVWUEJGPCWHFGONKPMGP 9CRRGP-TQPGWPF/KVTCCWHFGOTGEJVGPFTGK*GNOG5VCFVCPUKEJVXQP2TCIOKVFGO*TCFUEJKPWPF FGT 2TQRUVGK KO *KPVGTITWPF T CWHIGJGPFG 5QPPG  OO  I 5NI &QPGDCWGT    5NI*QTUM[5NI/QPVGPWQXQ 8QT\ÒINKEJ



6242

6241

6241

&+'¤56'44'+%*+5%*'056#0&'5*'44'0 '))'0$'4)(ª456'0 

,QJCPP%JTKUVQRJWPF,QJCPP5G[HTKGF4GKEJUVCNGT-TWOOCW&CX &QPGD 5GJTUEJÌPpXQT\ÒINKEJ



'56'4*#<; 

0KMQNCWU)TCH'UVGTJC\[XQP)CNCPVJC-QPX6CNGT9KGP/KV4CPFUEJTKHV&CX *QN\OCKT 440WT'ZGORNCTGIGRT·IV8QT\ÒINKEJGU'ZGORNCTOKVHGKPGT6ÌPWPI

 247


STANDESHERREN

6243

-*'8'0*ª..'4/'65%* 

,QJCPP,QUGH-QPX6CNGT9KGPI)GJCTPKUEJVGU$TWUVDKNFTOKVWOIGNGI VGO *GTOGNKP WPF OKV 1TFGPUMGVVG/GJTHGNFKIGU 9CRRGP CWH IGMTÌPVGO (ÒTUVGPOCPVGN WOJGT 1T   FGPUMGVVG /KV 4CPFUEJTKHV 8GT\KGTWPI  %#0&+&' 8GT\KGTWPI  5'& 8GT\KGTWPI  2418+&'    CWHTKEJVKICDGTOKV$GFCEJV &CX*QN\OCKT  440WT'ZGORNCTGIGRT·IV8QT\ÒINKEJGU2TCEJVGZGORNCT  &KG 4ÒEMUGKVGPWOUEJTKHV KUV YKG HQNIV \W ÒDGTUGV\GP 4KVVGT FGU )QNFGPGP 8NKGUGU WPF FGU )TQ­MTGW\GU FGU CWUIG   \GKEJPGVGP 1TFGPU FGU #RQUVQNKUEJGP -ÌPKIU *N 5VGRJCP DGKFGT *GKNKIGP -CKUGTNKEJGP WPF -ÌPKINKEJGP #RQUVQNK   UEJGP/CLGUV·VGPYKTMNKEJGT)GJGKOTCV-QPHGTGP\/KPKUVGTWPF1DGTUVJQHOGKUVGT

6245



6244

6246

,QJCPP(TCP\#PVQP (ÒTUVÓ5KNDGTOGFCKNNGWPUKIPKGTVCWHUGKPG#PMWPHV KP .CKDCEJ \WT 'TÌHHPWPI FGU MTCKPKUEJGP .CPFVCIGU IGYKFOGV XQP FGP -TCKPGT .CPFUV·PFGP &GT   IGMTÌPVG MTCKPKUEJG #FNGT KP IGMTÌPVGO XGT\KGTVGP 5EJKNF(ÒPH <GKNGP 5EJTKHV KP 'KEJGPNCWDMTCP\   OOI2TQDU\V5NI9GNNGPJGKO5NI9KPFKUEJIT·V\  (GKPG6ÌPWPIXQT\ÒINKEJ



5%*.+%-)4#('0 

*GKPTKEJ+84GKEJUVCNGT ,CJTGU\CJNKO5VGORGNCWUIG·PFGTV 2NCPOKV6KVGN (GTFKPCPFU+++#WUDGWVG&CX&QPGDXCT *GPMGNURWT(GNFGTIGIN·VVGVUGJTUEJÌP





.GQRQNF*GKPTKEJ-QPX6CNGT2TCIOKV6KVGN/CTKC6JGTGUKCU&CX*QN\ OCKT 8QT\ÒINKEJGU'ZGORNCTOKVHGKPGT6ÌPWPI



248


ANHALT

/ª0<'070&/'&#+..'0 #75/+66'.#.6'470&0'7<'+6

1,5:1

4'+%*5/ª0<5666' 

6247

1,5:1

##%*'0

#PQP[O  ,CJTJWPFGTV 2HGPPKI  I %#418 )GMTÌPVGT -QRH X X#++0+ 5·WNGPVGO   RGN/GPCFKGT 8QPITQ­GT5GNVGPJGKV(CUVUGJTUEJÌP  &KGUGT 6[R YCT * &CPPGPDGTI PWT KP GKPGO GKP\KIGP 'ZGORNCT DGMCPPV XIN &CPPGPDGTI + 0T  WPF -TWO   DCEJ 5GKP8QTMQOOGPKO(WPFXQP/CCUVTKEJV+ U&CPPGPDGTI+5WPF4GXWGDGNIG++50T 6H::++0T WPFFGUUGP8GTITCDWPIU\GKVWOFCU,CJTNGIGPGKPG2T·IWPIKPFGT\YGKVGP*·NHVGFGU ,CJTJWPFGTVUKPFGT<GKVFGTUCNKUEJGP-CKUGTPCJG&KG7OUEJTKHVPGPPV-CTNFGP)TQ­GP %#41.85 FGTCO ,CPWCT  KP FGT #CEJGPGT 2HCN\MCRGNNG DGKIGUGV\V YWTFG WPF FGP NGKEJV GPVUVGNNVGP OKVVGNCNVGTNKEJNCVGKPKUEJGP   5VCFVPCOGP #38+5)4#0+ 

6249

6248

4'+%*5/ª0<5666' 

#.6'0$74)

*GKPTKEJ8+$TCMVGCVI-CKUGTVJTQPVXXOKV.KNKGP\GRVGTWPF4GKEJUCRHGN\YK UEJGP \YGK 5VGTPGP T QDGP KO (GNF FKG +PKVKCNG h $GTIGT  $WEJGPCW (F XQP 5GGIC    5NI.ÌDDGEMG #VVTCMVKXGU'ZGORNCTOKVJGTTNKEJGT2CVKPCXQT\ÒINKEJ



#0*#.6 #0*#.6-¤6*'0(ª456'067/5'+6*'4<1)67/ 

.GQRQNF WPVGT 8QTOWPFUEJCHV UGKPGT /WVVGT )KUGNC #IPGU  5KNDGTOGFCKNNG   XQP   %JT 9GTOWVJ CWH FGP 6QF UGKPGU 8CVGTU 'OCPWGN .GDTGEJV )GJCTPKUEJVGU $TWUVDKNF 'OCPWGN   .GDTGEJVU T OKV WOIGNGIVGO /CPVGN'KP #FNGT XGTN·­V UGKPGP *QTUV OKV XKGT ,WPIGP CWH (GNUGP KO   /GGTWPFHNKGIV\WT5QPPGCWHOOI/CPP9QJNHCJTV  44-N4CPFHGJNGTXQT\ÒINKEJ 

6250

6251

#0*#.6$'40$74)(ª456'067/5'+6*'4<1)67/ 

#NGZCPFGT%CTN8GTGKPUVCNGT#-5&CX-CJPV6JWP  2TCEJVGZGORNCT0WT'ZGORNCTGIGRT·IV(CUV5VGORGNINCP\5VGORGNINCP\



#0*#.6&'55#7(ª456'067/5'+6*'4<1)67/ 

.GQRQNF (TKGFTKEJ  8GTGKPUVCNGT  CWH FKG 8GTGKPKIWPI FGT CPJCNVKPKUEJGP (ÒTUVGPVÒ   OGT#-5&CX-CJPV6JWP 2TCEJVGZGORNCT'TUVCDUEJNCIXQT\ÒINKEJp5VGORGNINCP\

 249


AUGSBURG

6253

6252



8GTGKPUVCNGT#-5&CX-CJPV6JWP  2TCEJVGZGORNCT*GTTNKEJG2CVKPCHCUV5VGORGNINCP\





8GTGKPUVCNGT#-5&CX-CJPV6JWP



8QT\ÒINKEJ

6254

6255

 

56#&6

6255

#7)5$74) (GKPG2CVKPCUGJTUEJÌPpXQT\ÒINKEJ



4GKEJUVCNGTOKV6KVGN(GTFKPCPFU++5V7NTKEJUVCNGT&CX(QTUVGT  4(GNFGTFGT8QTFGTUGKVGNGKEJVIGIN·VVGVUGJTUEJÌP

-KRRGT-TGW\GT(QTUVGT5NI-TCC\



6256

6257

6258



4GKEJUVCNGTOKV6KVGN(GTFKPCPFU++ 5V7NTKEJUVCNGT 4GKEJUVCNGTOKV6KVGN(GTFKPCPFU++ &CX(QTUVGT 5VÒEM-N-TCV\GTUGJTUEJÌP



 

4GKEJUVCNGTOKV6KVGN(GTFKPCPFU++&CX(QTUVGT 4GKEJUVCNGTOKV6KVGN(GTFKPCPFU++&CX(QTUVGT

 

250

8QT\ÒINKEJp5VGORGNINCP\ 5GJTUEJÌP


AUGSBURG

6259 6260

6260



6CNGTOKV6KVGN(GTFKPCPFU++(QTUVGT

*ÒDUEJG2CVKPCUGJTUEJÌP



4GKEJUVCNGTIGRT·IVWPVGTUEJYGFKUEJGT$GUGV\WPIFWTEJ)WUVCX++#FQNH#JNUVTÌO&CX (QTUVGT 5GJTUEJÌP

6263

6261

 

6262



4GKEJUVCNGTOKV6KVGN(GTFKPCPFU+++&CX#(QTUVGT  (GKPG2CVKPCUGJTUEJÌPpXQT\ÒINKEJ





4GKEJUVCNGTOKV6KVGN(GTFKPCPFU+++&CX(QTUVGT





5KNDGTOGFCKNNGXQP2*/ÒNNGTCWHFKG,CJTHGKGTFGT4GHQTOCVKQP.WVJGTUEJN·IVFKG6JG UGP CP FKG -KTEJGPVÒT4GNKIKQ UVGJV PCEJ N OKV /CWGTMTQPG DTGPPGPFGO *GT\GP WPF $WEJ N #NVCT   FCTCWHCWHIGUEJNCIGPG$KDGNWPF-GT\GOOI(QTUVGT5NI9JKVKPI 8QT\ÒINKEJ

6264

*ÒDUEJG2CVKPCUGJTUEJÌP



6265



4GKEJUVCNGTOKV6KVGNXQP(TCP\+(QTUVGTNGKEJVXCT

*ÒDUEJG2CVKPCHCUVXQT\ÒINKEJ



5KNDGTOGFCKNNG  XQP % $QGTGT CWH FKG ,CJTHGKGT FGU 4GNKIKQPUHTKGFGPU 5VCFVUEJKNF OKV 2[T   \YKUEJGP\YGK7TMWPFGPQDGPUVTCJNGPFGT0COG,GJQXCU'PIGNOKV2QUCWPGHNKGIVNÒDGT#TOCVWTGP WPF-TGW\OOI(QTUVGT5NI9JKVKPI -N5VGORGNHGJNGTXQT\ÒINKEJ



 251


BADEN

6266 6267

6267



5KNDGTCDUEJNCIXQPFGP5VGORGNPFGU-W2HGPPKIU(QTUVGT0CEJVTCI  4*GTTNKEJG2CVKPCXQT\ÒINKEJ



-QPX6CNGTOKV6KVGNXQP(TCP\+&CX(QTUVGT

6268

6269

(CUVXQT\ÒINKEJXQT\ÒINKEJ

 

6270

$#&'0 

$#&'0$#&'0/#4-)4#(5%*#(6

.WFYKI )GQTI  WPVGT 8QTOWPFUEJCHV UGKPGT /WVVGT (TCP\KUMC 5KD[NNC  #WIWUVC  

Ó 6TCIDCTG5KNDGTOGFCKNNGWPUKIPKGTVCWHFGP(TKGFGPXQP4CUVCVV2TKP\'WIGPWPF/CT UEJCNNFG8KNNCTUKPTÌOKUEJGT-NGKFWPIUKV\GPGKPCPFGTIGIGPÒDGTWPFTGKEJGPUKEJFKG*·PFG\WFGP 5GKVGP2CNOGPWPF-TKGIUVTQRJ·GP6CHGNOKV\YGK(KUEJGP\WFGP5GKVGPFKG<GKEJGPFGU,WRKVGTUWPF FGT5QPPGOOI$GTUVGVV2CZKP0WOOKU2QRGNMC5NI/QPVGPWQXQ 9KP\4CPFHGJNGTYKP\-TCV\GTUGJTUEJÌP &GT(TKGFGPUUEJNW­XQP4CUVCVVXQO/·T\\YKUEJGP2TKP\'WIGPCNU$GXQNNO·EJVKIVGPFGU4GKEJUWPFFGO HTCP\ÌUKUEJGP/CTUEJCNN8KNNCTUDGGPFGVGFGP5RCPKUEJGP'TDHQNIGMTKGI



$#&'0&74.#%*/#4-)4#(5%*#(65'+6-74(ª456'067/ 5'+6)4155*'4<1)67/



(TKGFTKEJ 8++ /CIPWU  $TQP\GOGFCKNNG  XQP , /CWIGT CWH FGP (GNF\WI .WFYKIU   :+8CO1DGTTJGKP -GJNWPF7OIGDWPI $ÒUVG.WFYKIU:+8T&GT-ÌPKICNUTÌOKUEJGT(GNFJGTT UVGJVPCEJTKP3WCFTKICWPFYKTFXQPFGTÒDGTKJOUEJYGDGPFGP8KEVQTKCDGMT·P\VOO&KXQ 8QT\ÒINKEJ





$TQP\GOGFCKNNGXQP,/CWIGTWPF,&QNNKPCWHFGP5KGI.WFYKIU:+8ÒDGT-CTN)WUVCXFGO $TWFGT FGU /CTMITCHGP DGK (TKGFNKPIGP $ÒUVG .WFYKIU :+8 T&GT (NW­IQVV FGU 4JGKPU NCIGTV PCEJ   N KP FGT 4GEJVGP 5VGWGTTWFGT FGP NKPMGP #TO CWH 3WGNNWTPG IGNGJPV N 9CHHGPVTQRJ·G  OO   &KXQ 8QT\ÒINKEJ



252


BADEN

6272

6273

6273

6271



6271

-CTN.WFYKI(TKGFTKEJ-TQPGPVCNGT#-5&CX-CJPV6JWP  5GJTUEJÌPpXQT\ÒINKEJ





.WFYKI-TGW\GT#-5,

49KP\5EJTÌVNKPIUHGJNGTHCUV5VGORGNINCP\





-CTN.GQRQNF(TKGFTKEJ)WNFGP#-5,  2TCEJVGZGORNCT(CUV5VGORGNINCP\



6274

 

6275

&QRRGNIWNFGP#-5&CX-CJPV6JWP &QRRGNIWNFGP#-5&CX-CJPV6JWP

6276



2TCEJVGZGORNCT(CUV5VGORGNINCP\ 8QT\ÒINKEJ

 

6276

(TKGFTKEJ+)WNFGP$CFKUEJGU.CPFGUUEJKG­GPKP/CPPJGKO#-5, &C\W9ÒTVVGODGTI9KNJGNO+)WNFGPL·JTKIGU4GIKGTWPIULWDKN·WO#-5,  5VÒEM8QT\ÒINKEJWPFUGJTUEJÌP



6277

6278

6278



-W-TGW\GT)GFGPM-TGW\GTCWHFKGGXCPIGNKUEJG-KTEJG\W5GEMGPJGKO#-5,  40WT'ZGORNCTGIGRT·IV8QT\ÒINKEJp5VGORGNINCP\





5KNDGTOGFCKNNG  WPUKIPKGTV 9GTMUVCVV % &TGPVYGVV CWH FCU L·JTKIG ,WDKN·WO FGT 7PKXGTUKV·V   *GKFGNDGTI -QRH N$TWUVDKNF FGU 7PKXGTUKV·VUITÒPFGTU -WTHÒTUV 4WRTGEJV XQP FGT 2HCN\ X X OKV   -WTJWVWPFWOIGNGIVGO*GTOGNKPOOI.CXGTTGP\9KGNCPFV<GKV\  8QPRQNKGTVGP5VGORGNPHCUV5VGORGNINCP\

 253


BAMBERG

1,5:1

$+567/ 

6279 1,5:1

$#/$'4)

*GTOCPP++2HGPPKII)GMTÌPVGU$TWUVDKNFXX\WFGP5GKVGPFKG$WEJUVCDGP* WPF'$KUEJQHVJTQPVXXOKV-WOOUVCDWPF$WEJ-TWI 445GJTUEJÌP

6280



6282

6281



/CTSWCTF 5GDCUVKCP 5EJGPM XQP 5VCWHHGPDGTI   -TGW\GT )TQUEJGP   0ÒTPDGTI   CWHUGKPGP6QF-TWI 4*ÒDUEJG2CVKPCXQT\ÒINKEJp5VGORGNINCP\





.QVJCT (TCP\ XQP 5EJÌPDQTP   -TGW\GT )TQUEJGP   0ÒTPDGTI CWH UGKPGP 6QF   -TWI *ÒDUEJG2CVKPCXQT\ÒINKEJ





,QJCPP2JKNKRR#PVQPXQP(TCPMGPUVGKP)TQUEJGP0ÒTPDGTICWHUGKPGP6QF-TWI *ÒDUEJG2CVKPCXQT\ÒINKEJ



6284

6283





254

6283

5GFKUXCMCP\5KNDGTOGFCKNNGXQP229GTPGT-CKUGT*GKPTKEJ++VJTQPVXXOKV<GRVGT WPF 4GKEJUCRHGN WOJGT 9CRRGPMTCP\2QUVCOGPV OKV 5VKHVUYCRRGP FCTCWH 5EJYGTV $KUEJQHUUVCD   (ÒTUVGPJWV /KVTC WPF -TGW\ FCTÒDGT UVTCJNGPFGU )QVVGUCWIG N PGDGP FGO 2QUVCOGPV NGJPV -CKUGT   *GKPTKEJ++TUVGJV-CKUGTKP%WPKIWPFCOKV<GRVGTKO*KPVGTITWPFLGYGKNUFKG#PUKEJVFGT&QOMKT EJGWOJGT9CRRGPMTCP\OOI*GNNGT<GRGTPKEM  8QT\ÒINKEJGU'ZGORNCTOKVHGKPGT6ÌPWPI



%JTKUVQRJ(TCP\XQP$WUGEM-QPX6CNGT0ÒTPDGTI&CX-TWI  5GJTUEJÌPpXQT\ÒINKEJ




BAYERN

6285

6288

6287



-QPX6CNGT0ÒTPDGTI&CX#-TWI

5GJTUEJÌP



&KXGTUG/ÒP\GPFGU,CJTJWPFGTVUXQO2HGPPKIDKU\WO6CNGTWC6CNGT Z 6CNGT 5VGTDGITQUEJGPGVE+PVGTGUUCPVGU.QVOKV5GNVGPJGKVGPDKVVGDGUKEJVKIGP  5VÒEM/GKUVUGJTUEJÌP 9GKVGTG2T·IWPIGPFGU$KUVWOU$CODGTIHKPFGP5KGWPVGTFGP0TP



.16$#/$'4) 

$#;'40 *'4<1)67/5'+6-74(ª456'067/5'+6-¤0+)4'+%*  

/CZKOKNKCP+4GKEJUVCNGT/ÒPEJGP&CX*CJP

 8QT\ÒINKEJp5VGORGNINCP\ 4GKEJUVCNGT/ÒPEJGP&CX*CJP  9KP\5EJTÌVNKPIUHGJNGTCO4CPFMN5VGORGNHGJNGTXQT\ÒINKEJ

6289

6290

 

6289



(GTFKPCPF/CTKC4GKEJUVCNGT/ÒPEJGPCWHFCU8KMCTKCVI5VGORGNXQP2 <GIIKP <GJP <GKNGP 5EJTKHV FCTWPVGT 8GT\KGTWPIGP/CFQPPC OKV -KPF VJTQPV CWH 9QNMGP XQT KJT   MPKGV FGT -WTHÒTUV WPF J·NV KJT FGP 4GKEJUCRHGN GPVIGIGP KO 8QTFGTITWPF FCU OKV -WTJWV DGFGEMVG   QXCNG9CRRGPWPVGP\WFGP5GKVGPFKGIGVGKNVG,CJTGU\CJN&CX*CJP  44-N5EJTÌVNKPIUHGJNGTHCUVXQT\ÒINKEJ 



/CZKOKNKCP ++ 'OCPWGN  5KNDGTOGFCKNNG  XQP ) *CWVUEJ CWH FKG ªDGTPCJOG FGT   5VCVVJCNVGTUEJCHV FGT URCPKUEJGP 0KGFGTNCPFG )GJCTPKUEJVGU $TWUVDKNF T KO *GTOGNKP OKV WOIGNGIVGT   -GVVG FGU 1TFGPU XQO )QNFGPGP 8NKGU/CZKOKNKCP 'OCPWGN CNU 2GTUGWU CWH 2GICUWU DGHTGKV $GNIKGP   CNU #PFTQOGFC FKG XQP GKPGO /GGTGUWPIGJGWGT DGFTQJV YKTF /KV 4CPFUEJTKHV È &1/+085   &+55+2#6%105+.+#)'06+8/Û25ÛÛ8ÛÛOOI5NI/QPVGPWQXQX .QQP+85XCT9KVV 8QT\ÒINKEJGU'ZGORNCTOKVHGKPGT6ÌPWPI

 255


BAYERN

6291

6292

6293

 

4GKEJUVCNGT/ÒPEJGP&CX*CJP 4GKEJUVCNGT/ÒPEJGP&CX*CJP

9KP\-TCV\GTXQT\ÒINKEJ *ÒDUEJG2CVKPCUGJTUEJÌPpXQT\ÒINKEJ

 



-CTN 6JGQFQT  -QPX6CNGT  /CPPJGKO HÒT FKG 4JGKPRHCN\ &CX  *CCU    *CJP 2TCEJVGZGORNCTOKVHGKPGT6ÌPWPI(CUV5VGORGNINCP\ 

6295

6294





256

6294

5KNDGTOGFCKNNGXQP,/$ÒEMNG*WNFKIWPIFGTDC[GTKUEJGP.CPFUV·PFGCWHUGKPL·JTKIGU4G IKGTWPIULWDKN·WO CNU -WTHÒTUV XQP FGT 2HCN\ 2CNCVKPC WPF $CXCTKC LGFG OKV KJTGO 9CRRGPUEJKNF \WT   5GKVGDGMT·P\GPIGOGKPUCOFKG$ÒUVGFGU-WTHÒTUVGPFKGXXCWHGKPGO2QUVCOGPVUVGJVKO#DUEJPKVV FTGK<GKNGP5EJTKHV#PGKPGO1DGNKUMGPFGTDC[GTKUEJG4CWVGPUEJKNFQDGP)QVVGUCWIGKP9QNMGPWPF 5VTCJNGP \W FGP 5GKVGP LG \YGK 2CNOD·WOG CP FGPGP FKG 9CRRGP FGT DC[GTKUEJGP *CWRVUV·FVG /ÒP   EJGP.CPFUJWV$WTIJCWUGPWPF5VTCWDKPIDGHGUVKIVUKPFKO#DUEJPKVVXKGT<GKNGP5EJTKHVOO I(QTUVGT5NI/GOOGUJ5VGORGT9KVV  5EJÌPG6ÌPWPIMN4CPFHGJNGTXQT\ÒINKEJ



/CZKOKNKCP+ +8 ,QUGRJ-QPX6CNGT#-5&CX-CJPV6JWP /KPLWUVKGTVXQT\ÒINKEJ




BAYERN

6296

6297

6298



-QPX6CNGT-ÌPKIUVCNGT#-5&CX-CJPV6JWP  *ÒDUEJG2CVKPCMN-TCV\GTNGKEJVLWUVKGTVUGJTUEJÌPpXQT\ÒINKEJ





-TQPGPVCNGT#-5&CX-CJPV6JWP  #VVTCMVKXGU'ZGORNCTXQT\ÒINKEJHCUV5VGORGNINCP\





.WFYKI+-QPX6CNGT4GIKGTWPIUCPVTKVV#-5&CX-CJPV6JWP 8QT\ÒINKEJp5VGORGNINCP\



6299

ex 6300

6301



-QPX6CNGT4GKEJGPDCEJ(TCWPJQHGT#-5&CX-CJPV6JWP  5GJTUEJÌPpXQT\ÒINKEJ





-QPX6CNGT  6JGTGUKGP1TFGP 8GTGKPUFQRRGNVCNGT  4GKVGTU·WNG /KV 4CPFUEJTKHV m m   &4';'+0*#.$ )7.&'0 m m 8++ 'Ü (Ü / #-5   D &CX   -CJPV     6JWP 5VÒEM5GJTUEJÌPWPFUGJTUEJÌPpXQT\ÒINKEJ



-QPX6CNGT8GTHCUUWPIUU·WNG#-5&CX-CJPV6JWP





8QT\ÒINKEJ

257


BAYERN

6302

6303



-QPX6CNGT5GIGPFGU*KOOGNU#-5&CX-CJPV6JWP  2TCEJVGZGORNCT(GKPG2CVKPC5VGORGNINCP\





-QPX6CNGT  &GPMOCN FGT  $C[GTP YGNEJG KO TWUUKUEJGP -TKGIG FGP 6QF HCPFGP #-5   &CX-CJPV6JWP 8QT\ÒINKEJ



6304

6305



-QPX6CNGT&GP$GPGFKMVKPGTPYKGFGTGKPG.GJTCPUVCNVÒDGTIGDGP#-5&CX-CJPV 6JWP 8QT\ÒINKEJp5VGORGNINCP\





-QPX6CNGT'TUVG'KUGPDCJP0ÒTPDGTI(ÒTVJ#-5&CX-CJPV6JWP  5GJTUEJÌPpXQT\ÒINKEJ



6306

6307



8GTGKPUFQRRGNVCNGT'KPVGKNWPIFGU-ÌPKITGKEJU#-5&CX-CJPV6JWP  8QT\ÒINKEJ





8GTGKPUFQRRGNVCNGT4GKVGTU·WNG/KV4CPFUEJTKHVmm&4';'+0*#.$)7.&'0mm8++'Ü(Ü /#-5D&CX-CJPV6JWP 5GJTUEJÌP



6308

6309



8GTGKPUFQRRGNVCNGT  5VCPFDKNF XQP #NDTGEJV &ÒTGT /KV 4CPFUEJTKHV m m &4';'+0*#.$   )7.&'0mm8++'Ü(Ü/Ü#-5D&CX-CJPV6JWP 5GJTUEJÌPpXQT\ÒINKEJ





8GTGKPUFQRRGNVCNGT#-5&CX-CJPV6JWP 2TCEJVGZGORNCT(CUV5VGORGNINCP\



258


BAYERN

6310

6311

6312



8GTGKPUFQRRGNVCNGT  5VCPFDKNF FGU (TGKJGTTP XQP -TGKVVOC[T /KV 4CPFUEJTKHV m m &4';   '+0*#.$)7.&'0mm8++'Ü(Ü/Ü#-5D&CX-CJPV6JWP 8QT\ÒINKEJ



/CZKOKNKCP++8GTGKPUFQRRGNVCNGT5VCPFDKNFXQP,QJCPP%JTKUVQRJ4KVVGTXQP)NWEM /KV4CPFUEJTKHVô8'4'+05/ª0<'ô8++'+0'(/#4-#-5C&CX-CJPV6JWP 44'ZGORNCTXQPRQNKGTVGP5VGORGNPXQT\ÒINKEJp5VGORGNINCP\



8GTGKPUFQRRGNVCNGT  8GTHCUUWPI /KV 4CPFUEJTKHV ô 8'4'+05/ª0<'ô8++'+0'(/#4- #-5C&CX-CJPV6JWP 5GJTUEJÌP





6313

6314



6315



8GTGKPUFQRRGNVCNGT5VCPFDKNFXQP4QNCPFFG.CVTGIGPCPPV1TNCPFQFK.CUUQ/KV4CPFUEJTKHVô 8'4'+05/ª0<'ô8++'+0'(/#4-#-5&CX-CJPV6JWP 448QT\ÒINKEJ





8GTGKPUFQRRGNVCNGT  )NCURCNCUV /KV 4CPFUEJTKHV ô 8'4'+05/ª0<' ô 8++ '+0' ( /#4-   #-5C&CX-CJPV6JWP  5GNVGPKPFKGUGT'TJCNVWPI2TCEJVGZGORNCT2QNKGTVG2NCVVGOKPDGTÒJTV



8GTGKPUFQRRGNVCNGT  )NCURCNCUV /KV 4CPFUEJTKHV ô 8'4'+05/ª0<' ô 8++ '+0' ( /#4-   #-5C&CX-CJPV6JWP 8QT\ÒINKEJ





259


BAYERN

6316



6317

6318

8GTGKPUFQRRGNVCNGT UR·VGTG2T·IWPICD &GPMOCNFGU-ÌPKIUKP.KPFCW/KV4CPFUEJTKHVn &4';'+0*#.$)7.&'0n:8'+02(70&('+0#-5&CX-CJPV6JWP  0WT'ZGORNCTGIGRT·IV8QT\ÒINKEJ





&QRRGNVGT8GTGKPUVCNGT#-5&CX-CJPV6JWP

/KPDGTKGDGPXQT\ÒINKEJ





&QRRGNVGT8GTGKPUVCNGT#-5&CX-CJPV6JWP  *ÒDUEJG2CVKPCYKP\4CPFHGJNGTHCUVXQT\ÒINKEJ



6320

6319

6321



&QRRGNVGT8GTGKPUVCNGT#-5&CX-CJPV6JWP  2TCEJVGZGORNCTOKVHGKPGT6ÌPWPI8QT\ÒINKEJp5VGORGNINCP\



8GTGKPUVCNGT#-5&CX-CJPV6JWP



.WFYKI++8GTGKPUVCNGT5VGORGNXQP,4KGU#-5&CX-CJPV6JWP 5GNVGPDGUQPFGTUKPFKGUGT'TJCNVWPI8QT\ÒINKEJp5VGORGNINCP\

260

 *GTTNKEJG2CVKPCXQT\ÒINKEJp5VGORGNINCP\

  


SAMMLUNG BENTHEIM

6322



5KNDGTOGFCKNNGXQP,6CWVGPJC[PCWHFKG8GTO·JNWPIUGKPGU%QWUKPU.GQRQNF/CZKOKNKCP,QUGRJ OKV)KUGNC6QEJVGT-CKUGT(TCP\,QUGHUXQP¤UVGTTGKEJ&KG$TWUVDKNFGTFGU2CCTGUPGDGPGKPCPFGTT )GHNÒIGNVGT)GPKWUUVGJVXXOKVFGPDGKFGP9CRRGPUEJKNFGPXQP¤UVGTTGKEJWPF$C[GTPOO I5NI/QPVGPWQXQ9KVV  2TCEJVGZGORNCTOKVHGKPGT6ÌPWPI+PTQVGO1TKIKPCNGVWK(CUV5VGORGNINCP\

.GQRQNF /CZKOKNKCP ,QUGRJ YWTFG CO  (GDTWCT  KP /ÒPEJGP CNU 5QJP XQP .WKVRQNF FGO UR·VGTGP 2TKP\TG   IGPV XQP $C[GTP WPF UGKPGT )GOCJNKP #WIWUVG 'T\JGT\QIKP XQP ¤UVGTTGKEJ WPF 2TKP\GUUKP XQP 6QUMCPC IGDQTGP   'TXGTO·JNVGUKEJCO#RTKNKP9KGPOKV'T\JGT\QIKP)KUGNC6QEJVGTXQP-CKUGT(TCP\,QUGRJWPFUGKPGT )GOCJNKP 'NKUCDGVJ *GT\QIKP KP $C[GTP <W UGKPGO 5EJYKGIGTXCVGT JCVVG 2TKP\ .GQRQNF FGT LÒPIGTG $TWFGT FGU   UR·VGTGP NGV\VGP DC[GTKUEJGP -ÌPKIU .WFYKI +++ XQT CNNGO YGIGP UGKPGT OKNKV·TKUEJGP 8GTFKGPUVG \GKVNGDGPU GKP   JGTXQTTCIGPFGU 8GTJ·NVPKU 5QYQJN KPFGP-TKGIGPWPFCNUCWEJPQEJKO'TUVGP9GNVMTKGIYQGT CO  #WIWUV  KO #NVGT XQP  ,CJTGP \WO 0CEJHQNIGT *KPFGPDWTIU KO 1DGTMQOOCPFQ 1UV GTPCPPV YWTFG   MQPPVG2TKP\.GQRQNFITQ­G'THQNIGGTTKPIGP'TUVCTDKO#NVGTXQP,CJTGPCO5GRVGODGTKP/ÒPEJGP



.16$#;'40 

-NGKPG 5COONWPI XQP /ÒP\GP FGU  ,CJTJWPFGTVU XQO 2HGPPKI DKU \WO &QRRGNVCNGT FCTWPVGT   DGUUGTG6[RGPWPF,CJTI·PIG*QEJKPVGTGUUCPVGU.QVDKVVGDGUKEJVKIGP 5VÒEM/GKUVUGJTUEJÌP



ex 6324

5#//.70)$'06*'+/ 

$GPVJGKO6GEMNGPDWTI4JGFC -NGKPG 5COONWPI XQP 5KNDGT WPF-WRHGTOÒP\GPFGU,CJTJWP FGTVUFCTWPVGT5GNVGPJGKVGPWC4GKEJUVCNGT5VÒDGT$NCOÒUGTQ,GVE*QEJKPVGTGUUCP VGU1DLGMVDKVVGDGUKEJVKIGP 5VÒEM/GKUVUGJTUEJÌP  261


BRANDENBURG IN FRANKEN

6325

6327

6326

$4#0&'0$74)+0(4#0-'0 $4#0&'0$74)+0(4#0-'0/#4-)4#(5%*#(6 

)GQTIWPF#NDTGEJV OKV6KVGN)GQTIUDKU 6CNGT5EJYCDCEJ&CXX 5EJTC #VVTCMVKXGU'ZGORNCTOKVJGTTNKEJGT2CVKPCOKP2T·IGUEJY·EJGXQT\ÒINKEJ





#NDTGEJV FGT ,ÒPIGTG  CNNGKP UGKV  6CNGT  'TNCPIGP &CX  X 5EJT    NGKEJVXCT -N-TCV\GTUGJTUEJÌP





6CNGT'TNCPIGP&CXX5EJT



6328

5EJÒTHURWTCWHFGT4ÒEMUGKVGUGJTUEJÌP

6329

$4#0&'0$74)$#;4'76*/#4-)4#(5%*#(6

6330



(TKGFTKEJ6CNGT$C[TGWVJ&CX5NI9KNO

5GJTUEJÌP





-QPX6CNGT$C[TGWVJCWHUGKPGP6QF&CX5NI9KNO  *ÒDUEJG2CVKPCYKP\-TCV\GTXQT\ÒINKEJGU'ZGORNCT



 262

$4#0&'0$74)#05$#%*/#4-)4#(5%*#(6

,QCEJKO'TPUV4GKEJUVCNGT(ÒTVJ&CX5NI9KNO

5GJTUEJÌP




BRANDENBURG IN FRANKEN

6331

6332

6333



4GKEJUVCNGT(ÒTVJ&CX5NI9KNO



-CTN 9KNJGNO (TKGFTKEJ  $TQP\GOGFCKNNG Q ,   XQP , &CUUKGT CWH UGKPG 6CPVG   9KNJGNOKPG -CTQNKPG )GOCJNKP )GQTIU ++ XQP $TCWPUEJYGKI%CNGPDGTI*CPPQXGT $TWUVDKNF 9KNJGN   OKPG-CTQNKPGUT9GKDNKEJG)GUVCNVUKV\VHCUVXXWPFP·JTVGKPGP5·WINKPIWOJGTFTGK-KPFGTXQP FGPGPLGGKPGUUEJTGKDVNKGUVWPFUKPIVOO$TQEMOCPP(KUEJGT/CW¾5NI9KNO 8QT\ÒINKEJ



%JTKUVKCP(TKGFTKEJ-CTN#NGZCPFGT<KPPOGFCKNNGXQP,5)ÌV\KPIGTCWHFKG-TGKU QDTKUVGPYÒTFG /CTMITCH TGKVGV N.ÌYGPUEJKNF CWH #TOCVWTGP FCTÒDGT IGMTÌPVGT #FNGT  OO   (KUEJGT/CW¾5NI9KNO FQTVKP5KNDGT  /KV-WRHGTUVKHVUGJTUEJÌP





6334

6335

4(CUUWPIUURWTGPUGJTUEJÌP



6336



-QPX6CNGT5EJYCDCEJ&CX5NI9KNO

(CUVUGJTUEJÌP





-QPX6CNGT5EJYCDCEJ&CX5NI9KNO

5GJTUEJÌP





-QPX6CNGT5EJYCDCEJ&CX5NI9KNO

5GJTUEJÌP

 263


BRANDENBURG-PREUSSEN

6338

6337

 

6337

-QPX6CNGT5EJYCDCEJ&CX5NI9KNO -QPX6CNGT5EJYCDCEJ&CX5NI9KNO

6339

5GJTUEJÌP 5GJTUEJÌPpXQT\ÒINKEJ

 

1,5:1

$4#0&'0$74)24'755'0



$4#0&'0$74)/#4-)4#(5%*#(65'+6&'/,#*4*70&'46 -74(ª456'067/

#NDTGEJVFGT$·T$TCMVGCV9GIGNGDGP$CNNGPUVGFVQFGT#UEJGTUNGDGPI$TWUVDKNF FGU/CTMITCHGPXXOKV5EJYGTVWPF(CJPGÒDGT$TÒUVWPI\YKUEJGP\YGK6ÒTOGPFCTÒDGT$QIGPOKV 6WTO$CJTH$GTIGT6JQTOCPP  442TCEJVGZGORNCTOKVJGTTNKEJGT2CVKPC8QT\ÒINKEJp5VGORGNINCP\



6341

6340

  264

(TKGFTKEJ++)TQUEJGPQ,*CXGNDGTI$CJTHC ,QCEJKO++)TQUEJGP$GTNKP$CJTHE

6340

-N4CPFHGJNGTUGJTUEJÌP 5GJTUEJÌP

 


BRANDENBURG-PREUSSEN

6342



)GQTI9KNJGNO5KNDGTOGFCKNNGXQP5&CFNGTCWHFGP9CHHGPUVKNNUVCPFKP2TGW­GP )GQTI9KNJGNOWPFUGKP5QJP-WTRTKP\(TKGFTKEJ9KNJGNODGKFGKO*CTPKUEJUVGJGPPGDGPGKPCPFGTX XCPGKPGO6KUEJCWHFGO-WTJWVWPF<GRVGTNKGIGPCO$QFGPDGHKPFGPUKEJFKGDGKFGP*GNOG&KG 2GTUQPKHKMCVKQPFGU(TKGFGPUOKV¤N\YGKIWPF$WEJUKV\VXXCWH\GTDTQEJGPGP9CHHGPKO*KPVGTITWPF FKG#PUKEJVXQP-ÌPKIUDGTIWPFFKGRTGW­KUEJG-ÒUVGOKV(KUEJJCWUGP2KNNCW$CNICWPF$TCPFGPDWTI OOI$TQEMOCPP9KGEGM  -N4CPFHGJNGTXQT\ÒINKEJGU'ZGORNCTOKVHGKPGT2CVKPC  )GQTI9KNJGNOFGTCOKP%ÌNNPIGDQTGPGECNXKPKUVKUEJG5QJPFGU-WTHÒTUVGP,QJCPP5KIKUOWPFIGTKGV UGKVCNU5VCVVJCNVGTKPFGPGTYQTDGPGPTJGKPKUEJGP)GDKGVGP-NGXG/CTMWPF4CXGPUDGTITCUEJWPVGTFGP 'KPHNW­ FGU MCVJQNKUEJGP )TCHGP #FCO XQP 5EJYCT\GPDGTI FGT PCEJ FGO 4GIKGTWPIUCPVTKVV FGU WPGPVUEJNQUUGPGP   )GQTI 9KNJGNO  YGKVIGJGPF FKG DTCPFGPDWTIKUEJG 2QNKVKM DGUVKOOVG /KV \YGK FGT \GPVTCNGP 2GTUÌPNKEJMGKVGP   FGU&TGK­KIL·JTKIGP-TKGIGUYCT)GQTI9KNJGNOXGTUEJY·IGTV&WTEJUGKPGCO,WNKIGHGKGTVG*QEJ\GKVOKV 'NKUCDGVJ%JCTNQVVGXQPFGT2HCN\YCTGT5EJYCIGTFGU9KPVGTMÌPKIU(TKGFTKEJ8XQPFGT2HCN\WPFFWTEJFKGXQP UGKPGT/WVVGT#PPCGKPIGH·FGNVGP*QEJ\GKVUGKPGT5EJYGUVGT/CTKC'NGQPQTGOKV)WUVCX++#FQNHCO&G\GODGT  YWTFG GT 5EJYCIGT FGU ITQ­GP 5EJYGFGPMÌPKIU &GPPQEJ XGTUWEJVG FGT DTCPFGPDWTIKUEJG -WTHÒTUV FKG 0GW   VTCNKV·V\WYCJTGPWPFUGKP.CPFCWUFGO)TQ­GP-TKGIJGTCWU\WJCNVGP0CEJFGOFKG/CTM$TCPFGPDWTIUGKV XQP /CPUHGNF WPF 9CNNGPUVGKP XGTYÒUVGV YQTFGP YCT VTCV GT  CWEJ WPVGT FGO &TWEM 5EJYCT\GPDGTIU  CWH FKG   MCKUGTNKEJG 5GKVG #NU UGKP 5EJYCIGT )WUVCX ++ #FQNH 2QOOGTP WPF FKG (GUVWPIGP (TCPMHWTV WPF $TCPFGPDWTI   GTQDGTVG YGEJUGNVG )GQTI 9KNJGNO  FKG 5GKVG WPF UEJNQ­ 8GTVT·IG OKV FGP 5EJYGFGP  JKPIGIGP VTCV GT   FGO FWTEJ FKG *CDUDWTIGT FKMVKGTVGP 2TCIGT (TKGFGP DGK YQTCWHJKP FKG 5EJYGFGP FKG /CTM DKU CWH -ÒUVTKP WPF   5RCPFCWDGUGV\VGP&KGYGKVIGJGPFG<GTUVÌTWPIFGUDTCPFGPDWTIKUEJGP6GTTKVQTKWOUFWTEJFGP-TKGIKUVKOYGUGPV NKEJGP FGT UEJYCEJGP 2GTUÌPNKEJMGKV WPF YCPMGNOÒVKIGP 2QNKVKM )GQTI 9KNJGNOU CP\WNCUVGP FGT UKEJ  PCEJ   2TGW­GP\WTÒEM\QIWPFCO&G\GODGTKP-ÌPKIUDGTIKO#NVGTXQP,CJTGPCPFGT9CUUGTUWEJVUVCTD

6343



(TKGFTKEJ9KNJGNOFGT)TQ­G-WTHÒTUV4GKEJUVCNGTQ,WPFQJPG/ÒP\OGKUVGTDWEJUVC DGP $GTNKP  I *ÒHVDKNF T KO -WTQTPCV OKV FGT 4GEJVGP FCU <GRVGT UEJWNVGTPF FKG .KPMG CO   5EJYGTVITKHH5KGDGPHCEJ DGJGNOVGU HGNFKIGU 9CRRGP XQP \YGK DGJGNOVGP YKNFGP /·PPGTP IGJCN   VGP#PFGP-GWNGPFGTYKNFGP/·PPGTDGHKPFGVUKEJQDGP.CWD&CXX5EJT  445GJTCVVTCMVKXGU'ZGORNCTOKVJÒDUEJGT2CVKPCUGJTUEJÌPpXQT\ÒINKEJ  265


BRANDENBURG-PREUSSEN

6344



5KNDGTOGFCKNNGXQP,*ÌJPCWHFKG'KPPCJOGFGT5VCFV5VTCNUWPF)GJCTPKUEJVGU$TWUVDKNFTOKV .QTDGGTMTCP\ CWH FGT $TWUV /GFWUGPRTQVQO&GT DTCPFGPDWTIKUEJG #FNGT OKV 5EJTKHVDCPF WPF -TCP\   ÒDGTFGT5VCFVCPUKEJVXQP5VTCNUWPFOOI$TQEMOCPP  448QT\ÒINKEJGU'ZGORNCTOKVHGKPGT6ÌPWPI 

6345



(TKGFTKEJ +++  5KNDGTOGFCKNNG  XQP 4 (CNV\ CWH FKG 5KGIG CO 0KGFGTTJGKP )GJCT   PKUEJVGU $TWUVDKNF T OKV WOIGNGIVGO /CPVGN+P GKPGT .CPFUEJCHV NCIGTV FGT (NW­IQVV FGU 4JGKPU PCEJ   NOKV5VGWGTTWFGTKPFGT4GEJVGPFGPNKPMGP#TOCWHGKPG9CUUGTWTPGIGNGJPVOOI $TQEMOCPP5VGIWYGKV9GKNGT 449KP\-TCV\GTXQT\ÒINKEJGU'ZGORNCTOKVHGKPGT2CVKPC 

6346

6347

6347



6CNGT5&5VCTICTF&CXX5EJT  5GNVGPDGUQPFGTUKPFKGUGT'TJCNVWPI5GJTUEJÌPpXQT\ÒINKEJ





6CNGT$*/KPFGP&CXX5EJT



266

5GJTUEJÌP


BRANDENBURG-PREUSSEN

6348



5KNDGTOGFCKNNGWPUKIPKGTVCWHUGKPG*WNFKIWPIKP/CIFGDWTI<YGKCWU9QNMGPMQOOGPFG*·PFG JCNVGPGKPNQTDGGTWOTCPFGVGU/GFCKNNQPOKVFGO$TWUVDKNFFGU-WTHÒTUVGPCPFGO1XCNJ·PIVCPFTGK -GVVGP FKG 5KNJQWGVVG FGT 5VCFV /CIFGDWTI+P GKPGT .CPFUEJCHV GKP ITQ­GT $CWO \YKUEJGP GKPGO   CDIGDTQEJGPGOWPFGKPGOMNGKPGP5VTCWEJTFCXQPUKV\VFKG5VCFVIÌVVKPXQP/CIFGDWTIOO I$TQEMOCPP 8QT\ÒINKEJGU'ZGORNCTOKVHGKPGT6ÌPWPI  +O#PUEJNW­CPFGP$GUWEJDGKUGKPGP6TWRRGPKP%NGXGWPFCPGKP6TGHHGPOKVFGOGPINKUEJGP-ÌPKIDGK.ÌYGP PCJO FGT -WTHÒTUV FKG *WNFKIWPI KP *CNDGTUVCFV CO  1MVQDGT WPF KP /CIFGDWTI CO  1MVQDGT GPVIGIGP   (TKGFTKEJ +++ YCT KPUQYGKV \YGKVGT YGNVNKEJGT *GTTUEJGT KP /CIFGDWTI CNU UGKP 8CVGT (TKGFTKEJ 9KNJGNO  FCU   U·MWNCTKUKGTVG $KUVWO KP $GUKV\ IGPQOOGP JCVVG #WEJ HÒT KJP KUV  GKPG *WNFKIWPIUOGFCKNNG IGRT·IV YQTFGP   FGTGP8QTFGTUGKVGPFCTUVGNNWPIFCU8QTDKNFHÒTFCUXQTNKGIGPFG5VÒEMIGYGUGPKUV

6350

6349

6349



6CNGT*(*/CIFGDWTI&CXX5EJTD

5GJTUEJÌP





(TKGFTKEJ +++ +5KNDGTOGFCKNNGXQP%JT9GTOWVJCWHFKG,CJTHGKGTFGT7PK XGTUKV·V (TCPMHWTV1FGT WPF FKG #OVUGKPHÒJTWPI UGKPGU 5QJPGU -TQPRTKP\ (TKGFTKEJ 9KNJGNO UR·VGT   (TKGFTKEJ9KNJGNO+ CNU4GMVQT)GJCTPKUEJVGU$TWUVDKNFTOKV.QTDGGTMTCP\WPFWOIGNGIVGO/CPVGN )GJCTPKUEJVGU $TWUVDKNF FGU -TQPRTKP\GP (TKGFTKEJ 9KNJGNO N OKV WOIGNGIVGO /CPVGN /KV 4CPF   UEJTKHVOOI$TQEMOCPP.CXGTTGP\9QJNHCJTV 448QT\ÒINKEJ 

24'755'0-¤0+)4'+%*

6351 6352

6352



4GKEJUVCNGT0GWGPDWTI 0GWEJ³VGN &6D*/</CTVKP  2TCEJVGZGORNCT*GTTNKEJG2CVKPCXQT\ÒINKEJp5VGORGNINCP\



(TKGFTKEJ9KNJGNO+FGT5QNFCVGPMÌPKI4GKEJUVCNGT*(*$GTNKPHÒTFCU*GT\QI VWO )GNFGTP  I )GJCTPKUEJVGU $TWUVDKNF T OKV WOIGNGIVGO 1TFGPUDCPF CO #TOCDUEJPKVV FCU   5VGORGNUEJPGKFGT\GKEJGP . %JTKUVKCP (TKGFTKEJ .ÒFGTU 5VGORGNUEJPGKFGT KP $GTNKP  )G   MTÌPVGUXKGTHGNFKIGU9CRRGPOKVIGMTÌPVGO/KVVGNUEJKNF\WFGP5GKVGPFGT-TQPGFKGIGVGKNVG,CJTGU \CJN\WFGP5GKVGPFGU9CRRGPUFKG5KIPCVWT*Û(*Û *GKPTKEJ(TKGFTKEJ*CNVGT/ÒP\OGKUVGTKP /CIFGDWTI &CXX5EJT  4#VVTCMVKXGU'ZGORNCTOKVJÒDUEJGT2CVKPCOKPDGTKGDGPUGJTUEJÌPpXQT\ÒINKEJ 



&CU/ÒP\OGKUVGT\GKEJGPFGUXQTNKGIGPFGP4GKEJUVCNGTUN·­VGKIGPVNKEJFCTCWHUEJNKG­GPFC­FKGUGU5VÒEMKP/CIFG DWTIIGRT·IVYQTFGPKUV8QP5EJTÌVVGTUEJTGKDVLGFQEJFC­*GKPTKEJ(TKGFTKEJ*CNVGTFKG/ÒP\GPHÒTFCU*GT\QI VWO)GNFGTPKP$GTNKPIGOÒP\VJCV

267


BRANDENBURG-PREUSSEN

6354

6353

6353



4GKEJUVCNGT$GTNKPCWHFKG*WNFKIWPIKP5VGVVKP5NI*GPEMGNX5EJT5#PO  9KP\4CPFHGJNGTUGJTUEJÌPpXQT\ÒINKEJ





5EJKNNKPI%)-ÌPKIUDGTIX5EJTE  5GNVGPKPFKGUGT'TJCNVWPI-N5EJTÌVNKPIUHGJNGTCO4CPFHCUV5VGORGNINCP\



6356 6355

6355



(TKGFTKEJ++FGT)TQ­G5RGEKGUVCNGT')0$GTNKPI)GJCTPKUEJVGU$TWUV DKNF T OKV 1TFGPUDCPF -TGW\ WPF WOIGNGIVGO *GTOGNKP1XCNGT 5EJKNF KP IGMTÌPVGT 4QMQMQGKPHCU   UWPI FCTKP IGMTÌPVGT RTGW­KUEJGT #FNGT OKV <GRVGT WPF 4GKEJUCRHGN KP FGP (·PIGP CWH FGT $TWUV IG   MTÌPVGU/QPQITCOOWPVGP.QTDGGTWPF2CNO\YGKI&CX1NFX5EJT  445GJTUEJÌPpXQT\ÒINKEJ 



4GKEJUVCNGTRTGW­#$GTNKP1NFEX5EJT  5GNVGPKPFKGUGT'TJCNVWPI8QT\ÒINKEJp5VGORGNINCP\

6357

6358



6359



4GKEJUVCNGTRTGW­$$TGUNCW&CX1NFX5EJT



4GKEJUVCNGTRTGW­#$GTNKP&CX1NFFX5EJT  2TCEJVGZGORNCT(GKPG2CVKPCOKPLWUVKGTVXQT\ÒINKEJp5VGORGNINCP\





4GKEJUVCNGTRTGW­#$GTNKP&CX1NFX5EJT





4GKEJUVCNGT RTGW­  # $GTNKP 4GKEJUVCNGT RTGW­  # $GTNKP &CX  Z  1NF  Z    X5EJT&C\W(TKGFTKEJ9KNJGNO++4GKEJUVCNGTRTGW­#$GTNKP&CX,  5VÒEM5GJTUEJÌP

268

45GJTUEJÌP

(CUV5VGORGNINCP\






BRANDENBURG-PREUSSEN

6363

6362

6361



4GKEJUVCNGTRTGW­$$TGUNCW(W51NFX5EJT  5GNVGPKPFKGUGT'TJCNVWPI/KPLWUVKGTVHCUV5VGORGNINCP\



 

4GKEJUVCNGTRTGW­$$TGUNCW1NFX5EJT 5GNVGPKPFKGUGT'TJCNVWPI8QT\ÒINKEJ )WVG2HGPPKI(/CIFGDWTI1NFX5EJT 449KP\<CKPGPFGXQT\ÒINKEJ

 

6364

6366

6365



-TGW\GT9#*'$TGUNCW1NFDX5EJT  44(GKPG2CVKPCYKP\5EJTÌVNKPIUHGJNGTHCUV5VGORGNINCP\





)WVG)TQUEJGP$$TGUNCW1NFX5EJTNGKEJVXCT  5GNVGPDGUQPFGTUKPFKGUGT'TJCNVWPI(GKPG2CVKPCXQT\ÒINKEJ





6CNGT(/CIFGDWTI1NFX5EJT  5GNVGPKPFKGUGT'TJCNVWPI-N5EJTÌVNKPIUHGJNGTXQT\ÒINKEJp5VGORGNINCP\



'ZGORNCTFGT5COONWPI/CPHTGF1NFKPI#WMVKQP(TKV\4WFQNH-ÒPMGT1UPCDTÒEM0T

6367

6368

6368



/GFCKNNGP (TKGFTKEJU ++ 5KNDGTOGFCKNNG  XQP 6 2KPIQ CWH FKG 5KGIG FGU ,CJTGU  )GJCT   PKUEJVGU $TWUVDKNF T OKV WOIGNGIVGO 1TFGPUDCPF0CEJ N UEJTGKVGPFG 8KMVQTKC OKV 2CNO\YGKI DG   MT·P\VGKPG6TQRJ·GFCTÒDGTGKPUEJYGDGPFGT#FNGTKO#DUEJPKVV\YGK<GKNGP5EJTKHVWPF,CJTGU\CJN OOI(W51NF 8QT\ÒINKEJ 



5KNDGTOGFCKNNGXQP62KPIQCWHFKG5KGIGFGU,CJTGU)GJCTPKUEJVGU$TWUVDKNFTOKVWOIG NGIVGO 1TFGPUDCPF0CEJ N UEJTGKVGPFG 8KMVQTKC OKV 2CNO\YGKI DGMT·P\V GKPG 6TQRJ·G FCTÒDGT GKP   UEJYGDGPFGT#FNGTKO#DUEJPKVV\YGK<GKNGP5EJTKHVWPF,CJTGU\CJNOOI(W5 1NF 9KP\4CPFHGJNGTHCUVXQT\ÒINKEJ

 269


BRANDENBURG-PREUSSEN

6370

6369







6371

5KNDGTOGFCKNNGXQP,.1GZNGKPCWHFGP(TKGFGPXQP*WDGTVWUDWTI(COCOKV2QUCWPGUEJYGDV TÒDGT*WDGTVWUDWTIGT5EJNQ­)GPKWUOKV<GRVGTWPFJTGUVGJVXXKP.CPFUEJCHVKO*KPVGTITWPF RHNÒIGPFGT$CWGTOOI(W51NF2CZKP0WOOKU  8QT\ÒINKEJGU'ZGORNCTOKVHGKPGT6ÌPWPI



5KNDGTOGFCKNNGXQP,(5VKGNGTCWHFGP(TKGFGPXQP6GUEJGP<GTDTQEJGPG5·WNGCWH5EJNCEJV HGNF \W FGP 5GKVGP #TOCVWTGP9KGFGTJGTIGUVGNNVG 5·WNG FKG OKV .QTDGGT WPF 2CNO\YGKI DGNGIV KUV   WPFCPFGTGKPIGHNÒIGNVGT%CFWEGWUUQYKGGKPG.GKGTCPIGDTCEJVUKPFUVGJVKPDNÒJGPFGT.CPFUEJCHVKO *KPVGTITWPFRHNÒIGPFGT$CWGTOOI(W51NF2CZKP0WOOKU  (GKPG2CVKPCXQT\ÒINKEJ



5KNDGTOGFCKNNG  XQP & ( .QQU CWH FGP (TKGFGP XQP 6GUEJGP $ÒUVG T OKV .QTDGGTMTCP\ CWH   2QUVCOGPV OKV HÒPH <GKNGP +PUEJTKHV N ,WUVKVKC T $GNNQPC FKG OKV FGO 5EJYGTV CWH GKPG -CTVG OKV   $#8#4+# \GKIV5KV\GPFG $GNNQPC UEJOÒEMV KJTGP *GNO OKV FGO .CWD FGU PGDGP KJT UVGJGPFGP   ¤NDCWOUCO$QFGP5EJYGTVWPF5EJKNFOOI(W51NF2CZKP0WOOKU 5QOOGT# 5GJTCVVTCMVKXGUXQT\ÒINKEJGU'ZGORNCT



6373

6372

6372



(TKGFTKEJ9KNJGNO++4GKEJUVCNGTRTGW­#$GTNKP&CX,  9KP\-TCV\GTXQT\ÒINKEJ



-QPX6CNGT55EJYCDCEJHÒT#PUDCEJ$C[TGWVJ,C

270

5GJTUEJÌP

 


BRANDENBURG-PREUSSEN

6374



#NDGTVWUVCNGT $CPEQVCNGT $GTNKP*CPFGNUOÒP\GI)GMTÌPVGT#FNGTUEJKNF\YKUEJGP 9KNFGT /CPP OKV IGUEJWNVGTVGT -GWNG NGIV FKG .KPMG CWH FCU IGMTÌPVG XKGTHGNFKIG 9CRRGP OKV   /KVVGNUEJKNF&CX, 40WT'ZGORNCTGIGRT·IV8QT\ÒINKEJ 

6375



6376

6377

/GFCKNNGP(TKGFTKEJ9KNJGNOU++5KNDGTOGFCKNNGXQP##DTCOUQPCWHUGKPGP4GIKGTWPIUCP VTKVV CO  #WIWUV )GJCTPKUEJVGU $TWUVDKNF N OKV WOIGNGIVGO *GTOGNKP&GT PCEJ T UKV\GPFG *GT   MWNGUOKVGKPGT.GKGTPGDGPUKEJGORH·PIVXQPFGTXQTKJOUVGJGPFGP/KPGTXCFCU5VCCVUTWFGTOO I*QHHOCPP/CTKGPD 48QT\ÒINKEJGU'ZGORNCTOKVHGKPGT6ÌPWPI



&C(TKGFTKEJFGT)TQ­GMGKPG-KPFGTJKPVGTNKG­TÒEMVGCNU0CEJHQNIGT(TKGFTKEJ9KNJGNOFGTCOIGDQ TGPG5QJPUGKPGULÒPIGTGP$TWFGTU#WIWUV9KNJGNOPCEJ&GTCNVG(TKV\·W­GTVGIGIGPÒDGTUGKPGO/KPKUVGT )TCH *Q[O +EJ YGTFG +JO UCIGP YKG GU PCEJ OGKPGO 6QFG IGJGP YKTF GU YKTF GKP NWUVKIGU .GDGP CO *QHG   YGTFGP OGKP 0GHHG YKTF FGP 5EJCV\ XGTUEJYGPFGP FKG #TOGG CWUCTVGP NCUUGP &KG 9GKDGT YGTFGP TGIKGTGP WPF   FGT5VCCVYKTF\WITWPFGIGJGP&CPPVTGVG'TCWHWPFUCI FGO-ÌPKI&CUIGJVPKEJV&GT5EJCV\KUVFGO.CPFG WPF PKEJV +JPGP 7PF YGPP OGKP 0GHHG CWHH·JTV FC UCIG 'T KJO +EJ JCDG GU UQ DGHQJNGP 8KGNNGKEJV JKNHV GU   FGPPGTJCVMGKPDÌUGU*GT\6CVU·EJNKEJXGTUEJNGWFGTVG(TKGFTKEJ9KNJGNO++YGIGPUGKPGT/·VTGUUGPYKTVUEJCHV ITQ­G 6GKNG FGU XQP UGKPGP DGKFGP 8QTI·PIGTP CPIGUCOOGNVGP 5VCCVUUEJCV\GU #PFGTGTUGKVU HÌTFGTVG GT CWEJ FKG   RTGW­KUEJG -WNVWT WPF $KNFWPI WPF UQTIVG HÒT FGP MNCUUK\KUVKUEJGP #WUDCW $GTNKPU $CW FGU $TCPFGPDWTIGT 6QTU     +O ,CJT  MQPPVG GT XQO NGV\VGP #PUDCEJGT /CTMITCHGP #NGZCPFGT IGIGP GKPG ,CJTGUTGPVG FKG   (ÒTUVGPVÒOGT#PUDCEJWPF$C[TGWVJGTYGTDGP#W­GPRQNKVKUEJUVGNNVGGTUKEJ\WP·EJUVCPFKG5GKVG¤UVGTTGKEJU IGIGP(TCPMTGKEJOW­VGCDGTHÒTFKG'TJCNVWPIFGTRTGW­KUEJGP)GDKGVGOKV(TCPMTGKEJFGP5QPFGTHTKGFGPXQP $CUGNUEJNKG­GP#NU(TKGFTKEJ9KNJGNO++COKP2QVUFCOCPFGT(COKNKGPMTCPMJGKV9CUUGTUWEJVUVCTD JKPVGTNKG­GTUGKPGO5QJPGKPJQEJXGTUEJWNFGVGU.CPF





5KNDGTOGFCKNNGQ,  XQP&(.QQUCWHUGKPGP)GDWTVUVCICO5GRVGODGT)GJCTPKUEJ VGU $TWUVDKNF N OKV WOIGNGIVGO *GTOGNKP'KPG 9CCIG UEJYGDV KP 9QNMGP KO #DUEJPKVV \YGK <GKNGP   5EJTKHVWPF,CJTGU\CJNOOI/CTKGPD5QOOGT# (GKPG2CVKPCXQT\ÒINKEJ



5KNDGTOGFCKNNGXQP&.QQUCWHFKG*WNFKIWPIFGT-WTOCTM$TCPFGPDWTIKP$GTNKPCO1MVQDGT )GJCTPKUEJVGU $TWUVDKNF N OKV WOIGNGIVGO /CPVGN&TGK <GKNGP 5EJTKHV KP .QTDGGTMTCP\  OO   I/CTKGPD5QOOGT# 2TCEJVGZGORNCTOKVHGKPGT2CVKPC(CUV5VGORGNINCP\

 271


BRANDENBURG-PREUSSEN

6379

6378

6380



5KNDGTOGFCKNNG  XQP & ( .QQU CWH FKG 7PVGTFTÒEMWPI FGT 7PTWJGP KP *QNNCPF )GJCTPKUEJVGU   $TWUVDKNFNOKVWOIGNGIVGO*GTOGNKPWPF1TFGPUDCPF)GMTÌPVG*QNNCPFKCUKV\VTFKG.KPMGCWHFGP JQNN·PFKUEJGP5EJKNFIGNGIVQDGPHNKGIVFGTRTGW­KUEJG#FNGTOKV¤N\YGKIKO5EJPCDGNWPF&QPPGTMGKN KP FGP (·PIGP KO #DUEJPKVV \YGK <GKNGP 5EJTKHV WPF ,CJTGU\CJN  OO  I 5QOOGT #    8GTXX.QQP 48QT\ÒINKEJGU'ZGORNCTOKVJGTTNKEJGT6ÌPWPI





(TKGFTKEJ9KNJGNO+++6CNGT##-5&CX-CJPV6JWP  9KP\5EJTÌVNKPIUHGJNGTXQT\ÒINKEJp5VGORGNINCP\





6CNGT  # /KV 8 24'755'0 KP FGT 8QTFGTUGKVGPWOUEJTKHV #-5  &CX  -CJPV    6JWP 8QT\ÒINKEJ



6382

6381 6382 1,5:1



6CNGT##-5,



-W2TQDGGKPGUPKEJVXGTCWUICDVGP6CNGT5VÒEMGU#/KV4KHHGNTCPFI#-5#POX 5EJTG FQTV-WRHGTXGTUKNDGTV  448QT\ÒINKEJ

6383

  272

6CNGT#-COOGTJGTTGPVCNGT#-5&CX-CJPV6JWP

8QT\ÒINKEJ



6384

5EJÌPpUGJTUEJÌP



8QT\ÒINKEJ



&KG8QTFGTUGKVGPWOUEJTKHVOKVFGT#DMÒT\WPI-824'755UQNNFGP-ÌPKI\WFGT$GOGTMWPIXGTCPNC­VJCDGP +EJDKPFQEJPKEJVFGT-COOGTJGTTXQP2TGWUU&CJGTYKTFFKGUGT6[R-COOGTJGTTGPVCNGTIGPCPPV

6CNGT##-5&CX-CJPV6JWP




BRANDENBURG-PREUSSEN

6385

 

6386

6CNGT##-5&CX-CJPV6JWP 6CNGT##-5,C

6385

(CUVXQT\ÒINKEJ *ÒDUEJG2CVKPCHCUV5VGORGNINCP\

6387

 

 

6388

6CNGT##-5&CX-CJPV6JWP 6CNGT##-5&CX-CJPV6JWP

8QT\ÒINKEJ 8QT\ÒINKEJ

 

/KP4CPFHGJNGTXQT\ÒINKEJ (CUV5VGORGNINCP\

 

6390 6389

 

6CNGT##-5&CX-CJPV6JWP 5KNDGTITQUEJGP##-5,

6391

  

6389

6392

8GTGKPUFQRRGNVCNGT##-5&CX-CJPV6JWP 8GTGKPUFQRRGNVCNGT##-5&CX-CJPV6JWP 8GTGKPUFQRRGNVCNGT##-5&CX-CJPV6JWP

6393

5GJTUEJÌPpXQT\ÒINKEJ *ÒDUEJG2CVKPCXQT\ÒINKEJ 5GJTUEJÌP

   273


6394



8GTGKPUFQRRGNVCNGT#I(4+'&4Ü9+.*'./+++-1'0+)8Ü24'755'0-QRHTFCT WPVGT /ÒP\\GKEJGP 6*#.'4 8++ '+0'  (Ü /#4-   )7.&'0  f 8'4'+05      /ª0<' f /GJTHGNFKIGU 9CRRGP XQP 1TFGPUMGVVG WOIGDGP CWH IGMTÌPVGO 9CRRGPOCPVGN #-5    &CX-CJPV6JWP ,CJTICPIXQPCNNGTITÌ­VGT5GNVGPJGKV8QT\ÒINKEJGU'ZGORNCT 



-N6[RGPUCOONWPIXQO2HGPPKIDKU\WO&QRRGNVCNGTWC&QRRGNVCNGT#6CNGT# ###WUDGWVGVCNGT#6CNGT#GVE+PVGTGUUCPVGU.QVDKVVGDGUKEJVKIGP  5VÒEM4CPFDGCTDGKVGV Z UGJTUEJÌPpXQT\ÒINKEJ



6CNGT####&&## #WUDGWVG &6JWP  Z & Z & 5VÒEM/GKUVUGJTUEJÌP





6398







274

6397

6399

/GFCKNNGP (TKGFTKEJ 9KNJGNOU +++ 5KNDGTOGFCKNNG  XQP ( 9 .QQU WPF,8&ÌNNCWHUGKPGP 4GIKGTWPIUCPVTKVV$ÒUVGNOKVCPVKMGO*GNOFGTOKVGKPGO.QTDGGTMTCP\IGUEJOÒEMVKUV'KP-TKGIGT KOCPVKMGP*CTPKUEJUVGJVHCUVXX\YKUEJGP\YGK5QEMGNPWPFFGWVGVCWHFGP*GNOFGU/CTUOKVFGT 4GEJVGP J·NV GT FGP *GNO FGT /KPGTXC CO $QFGP NKGIGP 5EJKNF WPF )GIGPUV·PFG FGT -WPUV WPF FGT   9KUUGPUEJCHV KO #DUEJPKVV \YGK <GKNGP 5EJTKHV WPF ,CJTGU\CJN  OO  I /CTKGPD    5QOOGT# 2TCEJVGZGORNCTOKVHGKPGT6ÌPWPI(CUV5VGORGNINCP\



5KNDGTOGFCKNNG  XQP , 8 &ÌNNWPF&(.QQUCWHFGP(TKGFGPXQP.WP¾XKNNG\YKUEJGP(TCPM TGKEJWPF¤UVGTTGKEJCO(GDTWCT(TKGFGPUIÌVVKPOKV.QTDGGT\YGKIWPF(ÒNNJQTPUVGJVCWH'TFDCNNKP 9QNMGPCWHFGO'TFDCNNUKPFFKG5V·FVGPCOGP2CTKUWPF9KGP\WNGUGP&KG2GTUQPKHKMCVKQPFGU-TKG IGU YKTF XQP FGT /KPGTXC FWTEJ 8QTJCNVGP FGU )QTIQPGPUEJKNFGU GPVYCHHPGV  OO   I   /CTKGPD  2CZ KP 0WOOKU  5NI ,WNKWU  5NI /QPVGPWQXQ  5QOOGT #    8QT\ÒINKEJGU'ZGORNCTOKVHGKPGT2CVKPC



5KNDGTOGFCKNNG  XQP # #DTCOUQP CWH FKG 8GTGKPKIWPI XQP 'THWTV OKV 2TGW­GP WPF FKG FCTCWH   GTHQNIVG *WNFKIWPI 7PKHQTOKGTVGU $TWUVDKNF N OKV 1TFGPUUVGTP WPF WOIGNGIVGO *GTOGNKP$QTWUUKC   UKV\VNOKV9CCIGWPF(ÒNNJQTPFCPGDGP#FNGTUEJKNFKO#DUEJPKVVFTGK<GKNGP5EJTKHVOOI *QHHOCPP/CTKGPD 8QT\ÒINKEJGU'ZGORNCTOKVHGKPGT6ÌPWPI




BRANDENBURG-PREUSSEN

6401 6400





6400

5KNDGTOGFCKNNGXQP&(QFGT(9.QQUCWHFKG8GTGKPKIWPIXQP*KNFGUJGKOWPF)QUNCTOKV 2TGW­GPKO,CJTGWPFFKGFCTCWHGTHQNIVG*WNFKIWPI7PKHQTOKGTVGU$TWUVDKNFNOKVWOIGNGIVGO *GTOGNKP$QTWUUKCKPCPVKMGT-NGKFWPIUVGJVXQTGKPGO5VGKPDNQEMCWHFGOGKPCWHIGUEJNCIGPGU$WEJ NKGIVWOJGT/GTMWTUVCDJTGP5EJYGTVWPFCPFGTG)GIGPUV·PFGOOI/CTKGPD 5QOOGT# -N4CPFHGJNGTXQT\ÒINKEJGU'ZGORNCTOKVHGKPGT2CVKPC



5KNDGTOGFCKNNGQ, WO XQP(9.QQU2T·OKGFGT#MCFGOKGFGT9KUUGPUEJCHVGPKP$GTNKP $TWUVDKNFNKP7PKHQTOOKVWOIGNGIVGO*GTOGNKP#FNGTHNKGIV\WT5QPPGWPVGPFKG5VTC­G7PVGTFGP .KPFGPOOI$QN\GPVJCN/CTKGPD5QOOGT#  44#VVTCMVKXGUXQT\ÒINKEJGU'ZGORNCTOKVHGKPGT6ÌPWPI



6402



'KUGPIW­OGFCKNNGXQP)**GPUEJGNCWHFGP$GHTGKWPIUMTKGI-ÌPKIUVGJV\YKUEJGP \YGK 5QNFCVGPITWRRGP KO *KPVGTITWPF IGMTÌPVGT 8QTJCPI FWTEJ FGP OCP TGKVGPFG 6TWRRGP UKGJV   (ÒPH<GKNGP5EJTKHVKP-TCP\OO/CTKGPD 5GJTUEJÌP

6403







6404

5KNDGTOGFCKNNG  XQP & ( .QQU 2T·OKG FGT EJKTWTIKUEJGP WPF CWIGP·T\VNKEJGP -NKPKM KP $GTNKP   8QTFGTUGKVGPCPUKEJVFGT-NKPKMUMWNCRUVCDOOI*ÒUMGP.CXGTTGP\5NI $TGVVCWGT5QOOGT# 4(GKPG6ÌPWPIXQT\ÒINKEJ



5KNDGTOGFCKNNG  WPUKIPKGTV CWH FCU L·JTKIG $ÒJPGPLWDKN·WO FGU 5EJCWURKGNGTU %CTN 9KNJGNO   (GTFKPCPF 7P\GNOCPP  $TCWPUEJYGKI Ó $GTNKP $TWUVDKNF 7P\GNOCPPU T0GWP <GKNGP   5EJTKHVFCTWPVGT,CJTGU\CJNOOI/CTKGPD (GKPG6ÌPWPIXQT\ÒINKEJ

 275


BRANDENBURG-PREUSSEN

6405



5KNDGTOGFCKNNG  XQP ( -ÌPKI 9GTMUVCVV ) .QQU CWH FCU L·JTKIG &KGPUVLWDKN·WO FGU RTGW­K   UEJGP)GPGTCNUWPF5VCCVUOKPKUVGTU)(*)TCHXQP9[NKEJWPF.QVVWO$ÒUVGXQP9[NKEJUN&GT 9CRRGPUEJKNF FGU )GPGTCNU UVGJV CWH GKPGO 5QEMGN CP GKPGP 'KEJDCWO IGNGJPV WPF YKTF XQP FGO T   UVGJGPFGP/CTUDGMT·P\VOOI(W5/CTKGPD FQTVKP$TQP\G   +P5KNDGTUGJTUGNVGP2TCEJVGZGORNCT*GTTNKEJG2CVKPCXQT\ÒINKEJp5VGORGNINCP\

6406



6407



(TKGFTKEJ9KNJGNO+86CNGT##-5&CX-CJPV6JWP  5GNVGPKPFKGUGT'TJCNVWPI8QT\ÒINKEJXQT\ÒINKEJp5VGORGNINCP\





6CNGT##WUDGWVG#-5&CX-CJPV6JWP



6408

6409

8QT\ÒINKEJ

6410



8GTGKPUFQRRGNVCNGT##-5&CX-CJPV6JWP

8QT\ÒINKEJ





8GTGKPUFQRRGNVCNGT##-5&CX-CJPV6JWP

8QT\ÒINKEJ





8GTGKPUFQRRGNVCNGT##-5&CX-CJPV6JWP

8QT\ÒINKEJ



276


BRANDENBURG-PREUSSEN

6411

6412

6413



8GTGKPUFQRRGNVCNGT##-5&CX-CJPV6JWP

8QT\ÒINKEJ





8GTGKPUFQRRGNVCNGT##-5&CX-CJPV6JWP  W­GTUVUGNVGPGT,CJTICPIKPCW­GTIGYÌJPNKEJGT'TJCNVWPI8QT\ÒINKEJp5VGORGNINCP\





8GTGKPUFQRRGNVCNGT##-5&CX-CJPV6JWP

8QT\ÒINKEJp5VGORGNINCP\

6416

6415

6414



6CNGT##-5,





6417

6414

8QT\ÒINKEJ



8GTGKPUFQRRGNVCNGT##-5&CX-CJPV6JWP

*ÒDUEJG2CVKPCXQT\ÒINKEJ





8GTGKPUFQRRGNVCNGT##-5&CX-CJPV6JWP

8QT\ÒINKEJ





8GTGKPUFQRRGNVCNGT##-5&CX-CJPV6JWP

(CUVXQT\ÒINKEJ

 277


BRANDENBURG-PREUSSEN

6418

6420

6419

6421

6419

 

&QRRGNVGT8GTGKPUVCNGT##-5&CX-CJPV6JWP 6CNGT##-5,

8QT\ÒINKEJ 8QT\ÒINKEJ

 



&QRRGNVGT8GTGKPUVCNGT##-5&CX-CJPV6JWP  -N4CPFHGJNGTHCUVXQT\ÒINKEJ





&QRRGNVGT8GTGKPUVCNGT##-5&CX-CJPV6JWP  *ÒDUEJG2CVKPC4CPFHGJNGTUGJTUEJÌP



6423

6422 6423



6CNGT##-5,

8QT\ÒINKEJ





8GTGKPUVCNGT#CWHUGKPGP6QF#-5&CX-CJPV6JWP  *GTTNKEJG2CVKPCXQT\ÒINKEJp5VGORGNINCP\





-NGKPG6[RGPUCOONWPIXQO2HGPPKIDKU\WO6CNGTWC6CNGT####WUDGWVGVCNGT ###6CNGT#GVE+PVGTGUUCPVGU.QVDKVVGDGUKEJVKIGP  5VÒEM5GJTUEJÌPpXQT\ÒINKEJ



6425





278

6426 6425

/GFCKNNG (TKGFTKEJ 9KNJGNOU +8 5KNDGTOGFCKNNG  XQP - (KUEJGT WPF %JT 2HGWHHGT CWH UGKPG   *WNFKIWPIKP$GTNKP$ÒUVGTFCTWPVGT\YGK<GKNGP5EJTKHV'KUGTPGU-TGW\OKVFGOIGMTÌPVGP#FNGT UEJKNFDGNGIVFCXQT5EJYGTV<GRVGTWPF4GKEJUCRHGNIGMTGW\VWOJGT1TFGPUMGVVGFKGOKVCEJVMNGKPGP 9CRRGPUEJKNFGPDGNGIVKUVOOI/CTKGPD5QOOGT2  2TCEJVGZGORNCTOKVHGKPGT6ÌPWPI8QT\ÒINKEJp5VGORGNINCP\



9KNJGNO+8GTGKPUVCNGT##-5&CX-CJPV6JWP  8QT\ÒINKEJp5VGORGNINCP\




BRANDENBURG-PREUSSEN

6427

 

6428

6427

8GTGKPUVCNGT##WUDGWVG#-5&CX-CJPV6JWP 6CNGT##-5,

8QT\ÒINKEJ (CUV5VGORGNINCP\

 

6430

6429

6429



&QRRGNVGT8GTGKPUVCNGT##-5&CX-CJPV6JWP  2TCEJVGZGORNCT/KP4CPFHGJNGTHCUV5VGORGNINCP\CWURQNKGTVGT2NCVVG



8GTGKPUVCNGT##-5&CX-CJPV6JWP

2TCEJVGZGORNCT(CUV5VGORGNINCP\

6431

 

6432



&QRRGNVGT8GTGKPUVCNGT%#-5&CX-CJPV6JWP%

8QT\ÒINKEJ





&QRRGNVGT8GTGKPUVCNGT%#-5&CX-CJPV6JWP%

 9KP\-TCV\GTXQT\ÒINKEJ



6433

6434



&QRRGNVGT8GTGKPUVCNGT%#-5&CX-CJPV6JWP%

5GJTUEJÌP





&QRRGNVGT8GTGKPUVCNGT##-5&CX-CJPV6JWP  5GJTUGNVGPGT,CJTICPI4CPFNGKEJVDGCTDGKVGVXQT\ÒINKEJ

 279


BRANDENBURG-PREUSSEN

6437

6435

6435



8GTGKPUVCNGT%#-5&CX-CJPV6JWP% 2TCEJVGZGORNCT(CUV5VGORGNINCP\





-NGKPG6[RGPUCOONWPIXQO2HGPPKIDKU\WO6CNGTWC6CNGT##WUDGWVGVCNGT#5KGIG UVCNGT  #  # -TÌPWPIUVCNGT   6CNGT  #  # GVE +PVGTGUUCPVGU .QV DKVVG   DGUKEJVKIGP 5VÒEM/GKUVXQT\ÒINKEJ



(TKGFTKEJ +++  5KNDGTOGFCKNNG  XQP ' 9GKICPF 9KFOWPI HÒT %CTOGP 5[NXC 'NKUCDGVJ   1VVKNKG XQP 9KGF  Ó -ÌPKIKP XQP 4WO·PKGP  $ÒUVG T&TGK <GKNGP 5EJTKHV FCTWPVGT   5EJTKHV\WI(TKGFTKEJU+++OOI5QOOGT9 8QT\ÒINKEJ





6438



9KNJGNO ++  6TCIDCTG 5KNDGTOGFCKNNG  WPUKIPKGTV CWH FKG ,CJTHGKGT FGU -ÌPKI   TGKEJU2TGW­GP)GJCTPKUEJVGU$TWUVDKNF(TKGFTKEJU+NOKV.QTDGGTMTCP\WPFWOIGNGIVGO/CPVGN&KG -TÌPWPIUKPUKIPKGPCWHGKPGO-KUUGP\YKUEJGP.QTDGGTWPF2CNO\YGKIQDGPUKGDGP<GKNGP5EJTKHV/KV 4CPFITCXWT8GTGKPKIVG5EJÒV\GP8GTGKPG++4KVVGTOOI/CTKGPD  *ÒDUEJG2CVKPCUGJTUEJÌPpXQT\ÒINKEJ



.165$4#0&'0$74)24'755'0 

5COONWPIXQP/ÒP\GPWPF/GFCKNNGPFGU,CJTJWPFGTVU&KG5COONWPIWOHC­VHCUVU·OVNKEJG 0QOKPCNGFCTWPVGT&GPCTG$TCMVGCVGP6CNGTWPF6CNGTVGKNUVÒEMGUQYKGKPVGTGUUCPVG/GFCKNNGPKP5KNDGT WPF WPGFNGP /GVCNNGP &C\W GKPKIG 5EJKNNKPIG FGU &GWVUEJGP 1TFGPU *QEJKPVGTGUUCPVGU 1DLGMV DKVVG   DGUKEJVKIGP 5VÒEM/GKUVUGJTUEJÌP 



-NGKPG6[RGPUCOONWPIRTGW­KUEJGT/ÒP\GPFGU,CJTJWPFGTVUXQO-W2HGPPKIDKU\WO&QR RGNVCNGTFCTWPVGTDGUUGTG6[RGPWPF,CJTI·PIG*QEJKPVGTGUUCPVGU1DLGMVOKVVGKNUJÒDUEJGT3WCNKV·VGP DKVVGDGUKEJVKIGP 5VÒEM'KPKIGOKVMNGKPGP(GJNGTPUGJTUEJÌPpHCUV5VGORGNINCP\ 



&KXGTUG/ÒP\GPFGU<GKVTCWOGUXQO5EJKNNKPIDKU\WO6CNGTFCTWPVGTDGUUGTG6[RGPWPF VGKNUJÒDUEJG3WCNKV·VGP*QEJKPVGTGUUCPVGU.QVDKVVGDGUKEJVKIGP 5VÒEM5GJTUEJÌPpXQT\ÒINKEJ





&KXGTUG/ÒP\GPFGU,CJTJWPFGTVUXQO-W2HGPPKIDKU\WO6CNGTWC6CNGT## #&## -TÌPWPI +PVGTGUUCPVGU.QVDKVVGDGUKEJVKIGP  5VÒEM/GKUVUGJTUEJÌPWPFDGUUGT



-NGKPG 6[RGPUCOONWPI FGU  ,CJTJWPFGTVU XQO -W2HGPPKI DKU \WO &QRRGNVCNGT FCTWPVGT CWEJ   DGUUGTG6[RGP+PVGTGUUCPVGU.QVDKVVGDGUKEJVKIGP 5VÒEM+P#NDWO5GJTUEJÌPWPFDGUUGT





280


BRAUNSCHWEIG UND LÜNEBURG

6445

6446

6444

$4#705%*9'+)70&.ª0'$74) $4#705%*9'+).ª0'$74)*'4<1)67/ 



*GKPTKEJFGT.ÌYG*GT\QIXQP5CEJUGP$TCMVGCV$TCWPUEJYGKII.ÌYGNKGIVN FGP-QRHPCEJXQTPIGYCPFVQDGPKO(GNF-WIGN$GTIGT&GPKEMGC9GNVGT  4*GTTNKEJG2CVKPCXQT\ÒINKEJGU'ZGORNCT



(TKGFTKEJFGT(TQOOGWPF)TQUEJGPPCEJ/GK­PGT#TVQ,9GNVGTC  445V·TMGTG2T·IGUEJY·EJGUQPUVUGJTUEJÌP



$4#705%*9'+))47$'0*#)'0(ª456'067/ 

#NDTGEJV+++)TQUEJGPPCEJ/GK­PGT#TVQ,9WPUVQTH9GNVGT  442T·IGUEJY·EJGUGJTUEJÌP

6447

6449



6448

$4#705%*9'+)91.('0$ª66'.(ª456'067/ 

*GKPTKEJFGT,ÒPIGTG6CNGT)QUNCT&CX9GNVGT  *ÒDUEJG2CVKPCUGJTUEJÌP





,WNKWU4GKEJUVCNGT)QUNCT$TKNNGPVCNGT&CX#9GNVGT  -N2T·IGUEJY·EJGUGJTUEJÌP





4GKEJUVCNGT)QUNCT*CNDGT$TKNNGPVCNGTI&TGKHCEJDGJGNOVGUUGEJUHGNFKIGU9CRRGP 9KNFGT/CPPUVGJVPCEJNKPFGT4GEJVGP$CWOUVCOOKPFGT.KPMGP.KEJV6QVGPMQRH5VWPFGPINCUWPF $TKNNGNURTKPIGPFGU4Q­9GNVGT 8QPITÌ­VGT5GNVGPJGKV#VVTCMVKXGUUGJTUEJÌPGU'ZGORNCT

 281


BRAUNSCHWEIG UND LÜNEBURG

6450

6451

6452



4GKEJUVCNGT9QNHGPDÒVVGNCWHUGKPGP6QF&CX#9GNVGT  4*GTTNKEJG2CVKPCUGJTUEJÌPpXQT\ÒINKEJ





*GKPTKEJ,WNKWU4GKEJUVCNGT)QUNCT9GNVGT

445GJTUEJÌP





4GKEJUVCNGT)QUNCT4GDGNNGPVCNGT&CX9GNVGT *ÒDUEJG2CVKPCUGJTUEJÌPpXQT\ÒINKEJ



7PVGT *GKPTKEJ ,WNKWU GPVUVCPF GKPG ICP\G 4GKJG UQIGPCPPVGT GODNGOCVKUEJGT 6CNGT FKG CWH 5VTGKVKIMGKVGP FGU *GT   \QIUOKVGKPKIGPNCPFUV·PFKUEJGP#FGNKIGP$G\WIPGJOGPFCTWPVGTFKGXQP5CNFGTP5VGKPDGTIWPF5VQEMJGKO&GT *WPF CWH FKGUGO UQIGPCPPVGP 4GDGNNGPVCNGT U[ODQNKUKGTV FKG IGIGP FGP 5VCEJGN NÌEMGPFGP WP\WHTKGFGPGP #FGNKIGP   FKG FGP *GT\QI XQT FGO 4GKEJUMCOOGTIGTKEJV XGTMNCIV JCVVGP &KG 4ÒEMUGKVG UQNN CP\GKIGP FC­ UKG YKG FKG 4QVVG   -QTCJWPVGTIGJGPYGTFGP

6453

6455

6454



4GKEJUVCNGT)QUNCT4GDGNNGPVCNGT&CX9GNVGT

5GJTUEJÌP





4GKEJUVCNGT)QUNCT9CJTJGKVUVCNGT&CX9GNVGT  #VVTCMVKXGU'ZGORNCTOKVJÒDUEJGT2CVKPCUGJTUEJÌP





4GKEJUVCNGT)QUNCT9GNVGT



282

445GJTUEJÌP


BRAUNSCHWEIG UND LÜNEBURG

6457

6456

6456



(TKGFTKEJ7NTKEJ4GKEJUVCNGT<GNNGTHGNF&CX9GNVGT  4CWJG1DGTHN·EJGUGJTUEJÌP





6CNGT)QUNCTQFGT<GNNGTHGNF9GNVGT

45GJTUEJÌP



5GJTUEJÌP 5GJTUEJÌP

 

5GJTUEJÌP 5GJTUEJÌP

 

5GJTUEJÌP 445GJTUEJÌP

 

6459

 

6459

4GKEJUVCNGT)QUNCTQFGT<GNNGTHGNF9GNVGT 4GKEJUVCNGT)QUNCTQFGT<GNNGTHGNF&CX9GNVGT#

6461

 

6458

6460

6461

4GKEJUVCNGT)QUNCTQFGT<GNNGTHGNF9GNVGT 4GKEJUVCNGT)QUNCTQFGT<GNNGTHGNF&CX9GNVGT#

6463 6462

 

4GKEJUVCNGT)QUNCTQFGT<GNNGTHGNF&CX9GNVGT$ /CTKGPIWNFGP%NCWUVJCN9GNVGT

6462

283


BRAUNSCHWEIG UND LÜNEBURG

6464

6465

6466



4GKEJUVCNGT  <GNNGTHGNF #WUDGWVG FGT )TWDG 5V ,CEQD  I (ÒPHHCEJ DGJGNOVGU HGNFKIGU   9CRRGP5V,CEQDOKV*WV5VCDWPF$WEJIGJVJCNDNÒDGT9GNNGPKO*KPVGTITWPFN5EJCEJVIÌRGNT -KTEJGPIGD·WFG&CX/ÒUGNGT9GNVGT 445GJTUEJÌP 



#WIWUVFGT,ÒPIGTG4GKEJUVCNGT<GNNGTHGNF&CX9GNVGT  -N2T·IGUEJY·EJGHCUVXQT\ÒINKEJ



4GKEJUVCNGT<GNNGTHGNF)NQEMGPVCNGT&CX9GNVGT

 5GJTUGNVGPKPFKGUGT'TJCNVWPI *GTTNKEJG2CVKPCMN5EJTÌVNKPIUHGJNGTCO4CPFXQT\ÒINKEJp5VGORGNINCP\





6467

6468

6468



4GKEJUVCNGT<GNNGTHGNF)NQEMGPJCNDVCNGT9GNVGT  *ÒDUEJG2CVKPCUGJTUEJÌPpXQT\ÒINKEJ





.ÌUGT\W4GKEJUVCNGTP<GNNGTHGNF/KV9GTVRWP\GI&CX&WXG9GNVGT  5VCTMIGTGKPKIV5EJTÌVNKPIUHGJNGTUGJTUEJÌP



284


BRAUNSCHWEIG UND LÜNEBURG

6469

6470





4WFQNH#WIWUV5KNDGTOGFCKNNGXQP//ÌNNGTCWHFKG'TQDGTWPIFGT5VCFV$TCWP UEJYGKI #WHIGUEJNCIGPGU $WEJ CWH 6TQOOGN KO *KPVGTITWPF 6TQRJ·GP CWU -TKGIUYCHHGP0CEJ   TGEJVUUGIGNPFGT&TGKOCUVGT/KV2WP\GCWHFGT4ÒEMUGKVGOOI$TQEMOCPP 445GJTUEJÌP



4WFQNH#WIWUVWPF#PVQP7NTKEJ4GKEJUVCNGT<GNNGTHGNF&CX9GNVGT 8QT\ÒINKEJGU'ZGORNCTOKVUEJÌPGT2CVKPC



6471

  

6470

6473

6472

4GKEJUVCNGT<GNNGTHGNF9GNVGT  (GKPG6ÌPWPIOKV2WP\G*p*\WFGP5GKVGPFGU9CRRGPU ÒDNKEJGT5VGORGNHGJNGTUQPUVXQT\ÒINKEJ 4GKEJUVCNGT<GNNGTHGNF9GNVGT ªDNKEJGT5VGORGNHGJNGTCWHFGT4ÒEMUGKVGUGJTUEJÌP

 

4GKEJUVCNGT<GNNGTHGNF&CX# FQTVHGJNVFKGUGT,CJTICPI 9GNVGT  5GJTUEJÌPpXQT\ÒINKEJ

 285


BRAUNSCHWEIG UND LÜNEBURG

6474

6475



6475

5KNDGTOGFCKNNG  XQP %JT 9GTOWVJ CWH FGP  )GDWTVUVCI FGT *GT\QIKP 'NKUCDGVJ ,WNKCPG XQP   *QNUVGKP0QTDWTI )GOCJNKP #PVQP 7NTKEJU &CU 5EJNQ­ 5CN\FCJNWO YKTF XQP FGT 5QPPG DGUVTCJNV   <GKNGP5EJTKHVOOI$TQEMOCPP9QJNHCJTV 4(GKPG2CVKPCXQT\ÒINKEJ



'NKUCDGVJ,WNKCPG ÓCWH5EJNQ­5CN\FCJNWO5KGXGTUVCTDMWT\PCEJFGO4GIKGTWPIUCPVTKVV KJTGU )GOCJNGU 5KG YCT FKG 6QEJVGT FGU *GT\QIU (TKGFTKEJ XQP *QNUVGKP0QTDWTI WPF FGUUGP )GOCJNKP 'NGQPQTG   XQP#PJCNV8GTO·JNVYWTFGUKGOKV#PVQP7NTKEJXQP$TCWPUEJYGKICOKP0QTDWTI  )GO·­ FGP #PICDGP DGK 2 , 4GVJOGKGT $TCWPUEJYGKI.ÒPGDWTIKUEJG %JTQPKEC YWTFGP \W FKGUGT )GDWTVUVCIU   HGKGTUQXKGNG)·UVGPCEJ5CN\FCJNWOGKPIGNCFGPYKGFKG*GT\QIKPCP,CJTGP\·JNVGP·ONKEJ



4GKEJUVCNGT)QUNCTQFGT<GNNGTHGNF'KPVTCEJVUVCNGT&CX9GNVGT  *ÒDUEJG2CVKPC-TCV\GTKO(GNFFGT8QTFGTUGKVGUGJTUEJÌP

6476

6477



6478



4GKEJUVCNGT)QUNCTQFGT<GNNGTHGNF'KPVTCEJVUVCNGT&CX9GNVGT  9KP\5EJTÌVNKPIUHGJNGTXQT\ÒINKEJGU'ZGORNCTOKVHGKPGT6ÌPWPI





4GKEJUVCNGT<GNNGTHGNF9GNVGT

5GNVGPGT,CJTICPI-N)TCHHKVKHCUVUGJTUEJÌP





#PVQP7NTKEJ4GKEJUVCNGT$TCWPUEJYGKI&CX9GNVGT  5GJTCVVTCMVKXGUXQT\ÒINKEJGU'ZGORNCT



286


BRAUNSCHWEIG UND LÜNEBURG

6479

6480

6481



4GKEJUVCNGT<GNNGTHGNF&CX9GNVGT

2T·IGUEJY·EJGUGJTUEJÌP





4GKEJUVCNGT<GNNGTHGNF&CX9GNVGT

5GJTUEJÌP





#WIWUV9KNJGNO4GKEJUVCNGT<GNNGTHGNF&CX9GNVGT

5GJTUEJÌP



 .GKEJVLWUVKGTVHCUVXQT\ÒINKEJ



6482

6483



-CTN+#NDGTVWUVCNGT$TCWPUEJYGKI9GNVGT



-CTN 9KNJGNO (GTFKPCPF  -QPX6CNGT 5RGEKGUVCNGT   $TCWPUEJYGKI &CX    9GNVGT  W­GTUVUGNVGPGT,CJTICPI#VVTCMVKXGU'ZGORNCTOKVHGKPGT2CVKPCUGJTUEJÌPpXQT\ÒINKEJ

6484



6485



9KNJGNO/CTKGPITQUEJGP%X%#-5,

/KPLWUVKGTVHCUV5VGORGNINCP\



%JTKUVKCP$KUEJQHXQP/KPFGP4GKEJUVCNGT1UVGTQFG9GNVGT  9KP\5EJTÌVNKPIUHGJNGTCO4CPFXQT\ÒINKEJ



$4#705%*9'+).ª0'$74)%'..'(ª456'067/  287


BRAUNSCHWEIG UND LÜNEBURG

6486

6487

6487



(TKGFTKEJ5KNDGTOGFCKNNGXQP,$NWOCWHUGKPGP)GDWTVUVCIWPFFKG(TKGFGPU XGTJCPFNWPIGP\WO9GUVH·NKUEJGP(TKGFGP)GJCTPKUEJVGU$TWUVDKNFTOKV5RKV\GPMTCIGPWPFWOIGNGI VGO /CPVGN/GTEWTKWU UVGJV N CWH GKPGO 5EJYGTV WPF J·NV GKPGP *GNO FGT XQP $KGPGP WOUEJY·TOV   KUVNGKP2WVVQOKV2HGKNDÒPFGNKO*KPVGTITWPF.CPFUEJCHVOKVGKPGT$WTIOOI$TQEM OCPP&GVJ1TF,WPIM 8QT\ÒINKEJGU'ZGORNCTOKVHGKPGT6ÌPWPI



%JTKUVKCP.WFYKI.ÌUGT\W4GKEJUVCNGTP<GNNGTHGNF/KV9GTVRWP\GI&GTIG JCTPKUEJVG*GT\QITGKVGVTKPFGT4GEJVGP-QOOCPFQUVCD(ÒPHHCEJDGJGNOVGUHGNFKIGU9CRRGPOKV 8GT\KGTWPIGPWPVGP\WFGP5GKVGPFKG5KIPCVWT*5 *GPPKPI5EJNÒVGT/ÒP\OGKUVGTKP<GNNGTHGNF  &CXC&WXG9GNVGT45GJTCVVTCMVKXGU'ZGORNCTOKVHGKPGT2CVKPCHCUVXQT\ÒINKEJ 



6488



288

.ÌUGT\W4GKEJUVCNGTP%NCWUVJCN/KV9GTVRWP\GI)GMTÌPVGU/QPQITCOOKP.QTDGGT MTCP\WOIGDGPXQPMNGKPGPIGMTÌPVGP9CRRGPWPVGP/ÒP\OGKUVGT\GKEJGP.9 .KRRQNF9G HGT /ÒP\OGKUVGT KP %NCWUVJCN  4Q­ N ÒDGT FGT 5VCFVCPUKEJV XQP %GNNG &CX  &WXG    ++9GNVGT 44(GNFGTNGKEJVIGIN·VVGVUGJTUEJÌP 


BRAUNSCHWEIG UND LÜNEBURG

6489



6490

4GKEJUVCNGT%NCWUVJCN&CX9GNVGT

6491

*ÒDUEJG2CVKPCUGJTUEJÌP



$4#705%*9'+)%#.'0$'4)*#0018'4#$-74(ª456'067/ *#0018'4#$-¤0+)4'+%**#0018'4 

'TPUV #WIWUV  UGKV  $KUEJQH XQP 1UPCDTÒEM  6CNGT  *CPPQXGT &CX    9GNVGT0CEJVTCI 8QPITÌ­VGT5GNVGPJGKV9KP\<CKPGPFGXQT\ÒINKEJ





4GKEJUVCNGT ,CJTGU\CJNXGTOWVNKEJKO5VGORGNCWUIG·PFGTV <GNNGTHGNF&CX9GNVGT /KP$GCTDGKVWPIUURWTGPCO4CPF2CVKPCUGJTUEJÌP



6492

6493



)GQTI + .WFYKI   6CNGT  %NCWUVJCN #WUDGWVG FGT )TWDG 5V #PFTGCU /ÒUGNGT   9GNVGT 5GJTUEJÌP





6CNGT%NCWUVJCN#WUDGWVGFGT)TWDG5V#PFTGCU/ÒUGNGTC9GNVGT  *ÒDUEJG2CVKPCHCUVXQT\ÒINKEJ



6494

6495



4GKEJUVCNGT ,CJTGU\CJNKO5VGORGNCWUIG·PFGTV %NCWUVJCN&CX9GNVGT  5GJTUEJÌP





5KNDGTOGFCKNNG Q , CD   XQP ' *CPPKDCN $TWUVDKNF T OKV WOIGNGIVGO /CPVGN5·WNG KP .CPF   UEJCHVOOI$TQEMOCPP 48QT\ÒINKEJ



&GT HTÒJGUVG <GKVRWPMV HÒT FKG #WURT·IWPI FKGUGT /GFCKNNG KUV FCU ,CJT  FC FGT *GT\QI GTUV UGKV FKGUGO ,CJT   FGP6KVGNFGU'T\UEJCV\OGKUVGTUHÒJTV

289


BRAUNSCHWEIG UND LÜNEBURG

6496



6497

6498

CNU)GQTI+-ÌPKIXQP)TQ­DTKVCPPKGP$TQP\GOGFCKNNGXQP,%TQMGTCWHUGKPG #PMWPHV KP .QPFQP )GJCTPKUEJVGU $TWUVDKNF T OKV .QTDGGTMTCP\ WPF WOIGNGIVGO /CPVGN&GT -ÌPKI   UKV\VPCEJNKP3WCFTKICXQTKJOFKG5VCFVIÌVVKPXQP.QPFQPFKGKJOFGP6QTUEJNÒUUGNFCTTGKEJV OO$TQEMOCPP 8QT\ÒINKEJ





)GQTI++4GKEJUVCNGT<GNNGTHGNF9GNVGT \W   447PGFKGTVGT,CJTICPI)TÌUUGTGT5EJTÌVNKPIUHGJNGTUGJTUEJÌP



5KNDGTOGFCKNNG  XQP ' *CPPKDCN CWH FKG )TÒPFWPI FGT 7PKXGTUKV·V )ÌVVKPIGP )GJCTPKUEJVGU   $TWUVDKNF N OKV .QTDGGTMTCP\ WPF WOIGNGIVGO /CPVGN)ÌVVKPIKC OKV /CWGTMTQPG UKV\V PCEJ T KO   NKPMGP #TO J·NV UKG GKP (ÒNNJQTP CWU FGO /ÒP\GP HCNNGP KJT TGEJVGT #TO NGJPV CWH FGO )ÌVVKPIGT   5VCFVYCRRGPN#VVTKDWVGFGT9KUUGPUEJCHVT(NW­NCPFUEJCHVQDGPUEJYGDVGKPIGHNÒIGNVGT)GPKWUFGT GKPGP-TCP\ÒDGTFCU*CWRVFGT5VCFVIÌVVKPJ·NVOOI$TQEMOCPP.CXGTTGP\ 48QT\ÒINKEJGU2TCEJVGZGORNCT 



&KG )GQTIKC#WIWUVC7PKXGTUKV·V KP )ÌVVKPIGP YWTFG  XQP )GQTI ++ IGUVKHVGV #O  5GRVGODGT  GT   HQNIVGFKGHGKGTNKEJG'TÌHHPWPIPCEJFGOKO,CJTG\WXQTFCUMCKUGTNKEJG2TKXKNGIKWOGTVGKNVYQTFGPYCT-WTCVQTWPF .GKVGTFGT*QEJUEJWNGYWTFG)GTNCEJ#FQNRJXQP/ÒPEJJCWUGP

6499



290

5KNDGTOGFCKNNG  XQP ' *CPPKDCN CWH FKG HGKGTNKEJG 'TÌHHPWPI FGT 7PKXGTUKV·V )ÌVVKPIGP )GJCT   PKUEJVGU $TWUVDKNF N OKV .QTDGGTMTCP\ WPF WOIGNGIVGO /CPVGN5KGDGP <GKNGP 5EJTKHV  OO   I$TQEMOCPP.CXGTTGP\ 4-N-TCV\GTUGJTUEJÌP




BREISACH

6501 6500

6500



4GKEJUVCNGT%NCWUVJCN&CX9GNVGT

5GJTUEJÌP





)GQTI+++)WVG)TQUEJGP#-5,C  5GNVGPDGUQPFGTUKPFKGUGT'TJCNVWPI8QT\ÒINKEJ



6503

6502



6504

9KNJGNO+86CNGT$#-5&CX-CJPV6JWP  5GNVGPKPFKGUGT'TJCNVWPI*ÒDUEJG2CVKPCOKPLWUVKGTVXQT\ÒINKEJ





'TPUV#WIWUV6CNGT##-5&CX-CJPV6JWP

8QT\ÒINKEJ





)GQTI88GTGKPUVCNGT$#-5&CX-CJPV6JWP  *ÒDUEJG2CVKPCHCUV5VGORGNINCP\



.165$4#705%*9'+).ª0'$74) 



$TCWPUEJYGKI9QNHGPDÒVVGN(TKGFTKEJ7NTKEJ/CTKGPITQUEJGP/CTKGPITQUEJGP/CTK GPITQUEJGP  4WFQNH #WIWUV WPF #PVQP 7NTKEJ  6CNGT   6CNGT   /CTKGPITQUEJGP    /CTKGPITQUEJGP/CTKGPITQUEJGP/CTKGPITQUEJGP 6CNGT  /CTKGPITQUEJGP#PVQP7NTKEJ2HGPPKI 5VÒEM/GKUVUGJTUEJÌP



#NNIGOGKP&KXGTUG/ÒP\GPXGTUEJKGFGPGT.KPKGPFGU,CJTJWPFGTVUXQP/CTKGPITQUEJGPDKU \WO &QRRGNVCNGT W C &QRRGNVCNGT  6CNGT      GVE  &C\W 5KNDGTOG   FCKNNGCWHFKG8GTO·JNWPIFGU2TKP\GP'TPUV#WIWUV+PVGTGUUCPVGU.QVDKVVGDGUKEJVKIGP  5VÒEM/GKUVUGJTUEJÌP



6507

56#&6 

$4'+5#%*

-NKRRG \W  -TGW\GTP  IGRT·IV Y·JTGPF FGT $GNCIGTWPI FWTEJ 4JGKPITCH 1VVQ WPF /CTMITCH   (TKGFTKEJXQP$CFGP$GTUVGVVXCT$TCWUG/CPUHGNF6HXCT (CUVUGJTUEJÌP

 291


BREISACH

6508



-NKRRG \W  -TGW\GTP  IGRT·IV Y·JTGPF FGT $GNCIGTWPI FWTEJ 4JGKPITCH 1VVQ WPF /CTMITCH   (TKGFTKEJXQP$CFGP$GTUVGVVXCT$TCWUG/CPUHGNF6H *GPMGNURWTUGJTUEJÌP



6509



5KNDGTOGFCKNNGXQP,$NWOCWHFKG'KPPCJOGFGTDGNCIGTVGP5VCFVFWTEJ*GT\QI$GTPJCTFXQP 5CEJUGP9GKOCT +P GKPGO TGKEJ XGT\KGTVGP QXCNGP 4CJOGP FCU IGJCTPKUEJVG *ÒHVDKNF $GTPJCTFU HCUV   X X OKV -QOOCPFQUVCD&KG 5VCFVCPUKEJV $TGKUCEJU XQP 9GUVGP OKV FGO 4JGKP WPF FGT (GUVWPI   $TGKUCEJKO8QTFGTITWPFFCTÒDGTXKGT<GKNGP5EJTKHVOOI$GTUVGVV5NI/GTUGD 42TCEJVGZGORNCTOKVHGKPGT6ÌPWPI(CUV5VGORGNINCP\  $GTPJCTF *GT\QI XQP 5CEJUGP9GKOCT IKNV CNU FGT YQJN DGFGWVGPFUVG FGWVUEJG RTQVGUVCPVKUEJG (GNFJGTT FGU &TGK   ­KIL·JTKIGP-TKGIGU&GTCO#WIWUVKP9GKOCTIGDQTGPG*GT\QIUEJNQ­UKEJPCEJGKPKIGP5VWFKGPOQPCVGP KP,GPCFGPRTQVGUVCPVKUEJGP6TWRRGPCPWPFHQEJVDGK9KGUNQEJWPF9KORHGP#NU)GPGTCN)WUVCX#FQNHUXQP 5EJYGFGPJKGNV$GTPCTFFKGGTQDGTVGP4JGKPNCPFGPCJOCO5VWTOCWH9CNNGPUVGKPU.CIGTVGKNWPFDGJCWRVGVG PCEJFGO6QF)WUVCX#FQNHUFCU5EJNCEJVHGNFDGK.ÒV\GP0CEJFGO8GTNWUVXQP4GIGPUDWTIYWTFG$GTPJCTF DGK 0ÌTFNKPIGP XGTPKEJVGPF IGUEJNCIGP WPF XGTNQT UGKP *GT\QIVWO +PFGPDGKFGPHQNIGPFGP,CJTGPM·ORHVGGTOKV HTCP\ÌUKUEJGP8GTDÒPFGVGPOKVYGEJUGNPFGP'THQNIGPXQTCNNGOKP.QVJTKPIGPUEJNWIFKGMCKUGTNKEJGP6TWRRGP DGK 4JGKPHGNFGP WPF PCJO PCEJOGJTOQPCVKIGT$GNCIGTWPICO&G\GODGT$TGKUCEJGKPYQTCWHFKGXQTNKG IGPFG /GFCKNNG $G\WI PKOOV 0CEJ FGP #PUVTGPIWPIGP FGT (GNF\ÒIG GTNCI $GTPJCTF CO  ,WNK  DGK0GWGP DWTICO4JGKPGKPGTMWT\GP-TCPMJGKV

6510



292

5KNDGTOGFCKNNGXQP5&CFNGTCWHFKG'KPPCJOGFGTDGNCIGTVGP5VCFVFWTEJ*GT\QI$GTPJCTFXQP 5CEJUGP9GKOCT&GTIGJCTPKUEJVG*GT\QITGKVGVTWPFYKTFXQPGKPGTCWU9QNMGPMQOOGPFGP*CPF DGMT·P\V KO *KPVGTITWPF 5EJNCEJVU\GPG KP GKPGT (NW­NCPFUEJCHV<YGK 'PIGN JCNVGP FCU 5VCFVYCRRGP   ÒDGTFGT5VCFVCPUKEJVXQP9GUVGPOKVFGO4JGKPWPFFGT(GUVWPI$TGKUCEJKO8QTFGTITWPFOO I$GTUVGVV5NI/GTUGD9KGEGM 448QT\ÒINKEJGU'ZGORNCTOKVHGKPGT6ÌPWPI 


BRESLAU

6514

6514

 

56#&6

6515

6512

6511

$4'/'0

4GKEJUVCNGTOKV6KVGN-CTNU8+&CX,WPIM 4GKEJUVCNGTOKV6KVGN-CTNU8++&CX,WPIM

8QT\ÒINKEJ *GTTNKEJG2CVKPCXQT\ÒINKEJ

 

.16$4'/'0 

 

&KXGTUG /ÒP\GP FGT 5VCFV $TGOGP FGU  ,CJTJWPFGTVU XQO -W5YCTGP DKU \WO 8GTGKPUVCNGT   FCTWPVGTDGUUGTG6[RGPUQYKGGKPKIGJÒDUEJG3WCNKV·VGP+PVGTGUUCPVGU.QVDKVVGDGUKEJVKIGP  5VÒEM(CUVUGJTUEJÌPpXQT\ÒINKEJ

$+567/



$4'5.#7

,QJCPPXQP6WT\Q)TQUEJGP(TKGFGPUDWTID

5GJTUEJÌP



(TCP\.WFYKIXQP0GWDWTI4GKEJUVCNGT0GKUUGI$TWUVDKNFTKPIGKUVNKEJGO 1TPCV$KUEJQHUOÒV\G ÒDGT TGKEJ XGT\KGTVGO 9CRRGP OKV IGMTÌPVGO OGJTHGNFKIGP /KVVGNUEJKNF FC   JKPVGT-TWOOUVCDWPF5EJYGTVIGMTGW\V&CX(W5  4#VVTCMVKXGUHCUVXQT\ÒINKEJGU'ZGORNCTOKVHGKPGT6ÌPWPI 

6516

56#&6 

5KNDGTOGFCKNNG  XQP , $WEJJGKO CWH FKG *WNFKIWPI .GQRQNFU + )GJCTPKUEJVGU $TWUVDKNF T OKV   .QTDGGTMTCP\ WPF WOIGNGIVGO /CPVGN5VCFVCPUKEJV XQP $TGUNCW FCTÒDGT JCNVGP \YGK 'PIGN FCU   DGJGNOVG5VCFVYCRRGPOOI(W55NI/QPVGPWQXQ FQTVKTTVÒONKEJOKV FGT,CJTGU\CJN  (GNFGTIGIN·VVGVUGJTUEJÌPpXQT\ÒINKEJ

 293


DEUTSCHER ORDEN

6518

6517

#$6'+

6517

%148';



%JTKUVQRJXQP$GNNKPIJCWUGP4GKEJUVCNGT*ÌZVGT&CX+NKUEJ5EJYGFG 5VGORGN *ÒDUEJG2CVKPCUGJTUEJÌP





(NQTGP\XQPFGT8GNFG4GKEJUVCNGT$TCWPUEJYGKI&CX+NKUEJ5EJYGFG 5GJTUEJÌP



6520

6519

56#&6 

6519

%4#+.5*'+/

$TQP\GOGFCKNNGXQP/)WDGCWHFKG5KNDGTJQEJ\GKVFGU(TGKJGTTP-TCHHVXQP%TCKNUJGKOWPFFGT (TGKHTCW.QWKUGXQP%TCKNUJGKOIGD(TGKKPXQP.KPFGPHGNU$GKFGT$TWUVDKNFGTGKPCPFGTIGIGPÒDGTWO JGT .QTDGGTMTCP\<YGK 9CRRGPUEJKNFG FC\YKUEJGP *GT\ CWU FGO GKP $NÒVGP\YGKI PCEJ QDGP TCPMV   FCTCWH5EJTKHVDCPFOO*CWUGT5NI9KNO9KVV #VVTCMVKXGUXQT\ÒINKEJGU'ZGORNCT



&'765%*'414&'0 &'765%*'414&'0+0/'4)'06*'+/  294

,QJCPP%CURCTXQP#ORTKPIGP4GKEJUVCNGT&CX0GWOCPP  #VVTCMVKXGU'ZGORNCTOKVJÒDUEJGT2CVKPCUGJTUEJÌP




EISLEBEN

6521

4'+%*5/ª0<5666' 

6522

6523

&10#79¤46*

(TKGFTKEJ++$TCMVGCVI)GMTÌPVGU$TWUVDKNFXXKPLGFGT*CPFGKP-TGW\$GTIGT )GDJCTV5VGKPJKNDGT (CUVXQT\ÒINKEJ



'+%*5666

$+567/ 

,QJCPP%JTKUVQRJXQP9GUVGTUVGVVGP-TGW\GTQ,OKV6KVGN(GTFKPCPFU++%CJP 2TCEJVGZGORNCT(CUV5VGORGNINCP\





-TGW\GTOKV6KVGN(GTFKPCPFU+++%CJP

8QT\ÒINKEJ



6525 6524

6524



5GFKUXCMCP\-QPX6CNGT0ÒTPDGTI%CJP&CX<GRGTPKEM

8QT\ÒINKEJ





,QJCPP#PVQP+++XQP<GJOGP-QPX6CNGT/ÒPEJGP%CJP  'VYCULWUVKGTVUGJTUEJÌPpXQT\ÒINKEJ 9GKVGTG/ÒP\GPFGU$KUVWOU'KEJUV·VVHKPFGP5KGWPVGTFGP0TP



6527

6526

6526

56#&6

'+5.'$'0



6CNGTCWHFKG,CJTHGKGTFGT0CWODWTIGT-QPXGPVKQP5NI9JKVKPI XINFQTVOKV /ÒP\\GKEJGP5EJYCP 6QTPCWEXCT 4*GTTNKEJG2CVKPCYKP\2T·IGUEJY·EJGXQT\ÒINKEJ





6CNGTCWHFKG,CJTHGKGTFGT0CWODWTIGT-QPXGPVKQP5NI9JKVKPI XINFQTVOKV /ÒP\\GKEJGP5EJYCP 6QTPCWG 4#VVTCMVKXGUUGJTUEJÌPGU'ZGORNCT

 295


ERZGEBIRGE

6529



)4#(5%*#(6

6528

6529

'4$#%*

)GQTI#NDTGEJVCNNGKP#NDWU(ÒTUVGPCW,QUGRJ 4-N5EJTÌVNKPIUTK­UGJTUEJÌP

56#&6



'4.#0)'0



-TGW\GTCWHFKG,CJTHGKGTFGU$GUVGJGPUXQP0GW'TNCPIGP5NI9KNO FQTVCNU -QPX6CNGTWPFKTTVÒONKEJOKV9GTV\CJN:.DGUEJTKGDGP  5GJTUEJÌP





$TQP\GOGFCKNNGXQP-4-TÒIGTCWHFCUL·JTKIG&QMVQTLWDKN·WOFGU$GITÒPFGTUFGT*QOÌQ RCVJKG 5COWGN *CJPGOCPP

 /GK­GP Ó 2CTKU  -QRH T5+/+.+#  5+/+.+$75 WOJGT   5EJTKHVMTCP\  OO 5NI $TGVVCWGT  $TQP\GOGFCKNNG  XQP # 5VCPIGT CWH FCU L·JTKIG   &QMVQTLWDKN·WO FGU $QVCPKMGTU -CTN (TKGFTKEJ 9KNJGNO /CTVKWU

 'TNCPIGP  Ó /ÒPEJGP    IGYKFOGVXQPFGT$C[GTKUEJGP#MCFGOKG-QRHN#EJV<GKNGP5EJTKHVWOJGT5EJTKHVMTCP\OO 5NI$TGVVCWGT&C\W'KEJUV·VV-CTN#WIWUVXQP4GKUCEJ$TQP\GOGFCKNNGXQP%8QKIVCWH FKG,CJTHGKGTFGU$KUVWOUKO)GFGPMGPCPUGKPG)TÒPFWPIFWTEJFGPJGKNKIGP$QPKHCEKWUKO,CJTG 5KV\GPFGTJGKNKIGT9KNNKDCNFTGKEJVUVGJGPFGOJGKNKIGP$QPKHCEKWUFKG*CPF5GEJU<GKNGP5EJTKHVKP -TCP\OO 5VÒEM5GJTUEJÌPpXQT\ÒINKEJ



6531

6532

6532

'4<)'$+4)' 

5EJCWVCNGT  XQP %CURCT XQP /GTIGPVJCN CWH FKG 2GUV &KG GJGTPG 5EJNCPIG CO -TGW\ \W FGP   5GKVGP LG UGEJU MPKGPFG 2GTUQPGP CO $QFGP XKGT 6QVG%JTKUVWU CO -TGW\ \W FGP 5GKVGP LG UGEJU   MPKGPFG2GTUQPGPOOI&QPGD-CV\5NI$TGVVCWGT  449KP\*GPMGNURWTUGJTUEJÌP &KGGJGTPG5EJNCPIGIGJVCWH/QUGU::+8\WTÒEM/CEJGGKPGGJGTPG5EJNCPIGWPFTKEJVGUKG\WO<GKEJGP CWHYGTIGDKUUGPKUV UÒPFKIKUV WPFUKGCPUKGJVUQNNNGDGP&KGGJGTPG5EJNCPIGIKNVCNU2TQRJG\GKJWPIXQP%JTKUVK -TGW\GUVQFUQUVGJVGUKP,QJCPPGU+++8



296



5KNDGTOGFCKNNGOKV5KIPCVWT.4OÌINKEJGTYGKUGXQP.GQPJCTF4GWVGTQFGT.WMCU4KEJVGTCWH FGP 5ÒPFGPHCNN #FCO WPF 'XC CO $CWO FGT 'TMGPPVPKU KO *KPVGTITWPF FKG 8GTVTGKDWPI CWU FGO   2CTCFKGU#PDGVWPIFGT*KTVGPKP6GORGNTWKPGPOOI&QPGD-CV\  442TCEJVXQNNG2CVKPCXQT\ÒINKEJGU'ZGORNCT 


FRANKFURT

6533

6534

6534

'55'0

#$6'+ 

#PPC5CNQOGXQP5CNO4GKHHGTUEJGKF6CNGT (GVVO·PPEJGP -TCOGT  5GJTUEJÌP



(TCP\KUMC%JTKUVKPC5KNDGTOGFCKNNGQ,  XQP#5EJ·HHGTCWHFCUL·JTKIG4GIKG TWPIULWDKN·WOFGT2HCN\IT·HKPCNU(ÒTUV·DVKUUKPXQP6JQTGP$TWUVDKNFFGTDVKUUKPNKPURKV\GPDGUGV\VGT 5VCCVUTQDG WPF OKV WOIGNGIVGO /CPVGN(ÒPH PCEMVG -KPFGT 2GTUQPKHKMCVKQPGP FGT HÒPH ,CJT\GJPVG    WO$TWPPGPFKGUKEJCPUEJKEMGPXQPFGO3WGNNFGU.GDGPU\WVTKPMGPOOI-TCOGT 5VGORGT 5GJTUEJÌPpXQT\ÒINKEJ





6537 6536

6535

(40-+5%*'4-4'+5 

 

-TGW\GT0ÒTPDGTI-TWI  (GKPG6ÌPWPIYKP\5EJTÌVNKPIUHGJNGTCO4CPFXQT\ÒINKEJp5VGORGNINCP\

56#&6



(4#0-(746

6WTPQUGQ, ,CJTJWPFGTV ,W( 'PINKUEJQ, ,CJTJWPFGTV ,W(

5GJTUEJÌP 45GJTUEJÌP

 

6538



5KNDGTOGFCKNNGWPUKIPKGTVXGTOWVNKEJXQP2*/ÒNNGTCWHFKG-CKUGTYCJN-CTNU8+-QPUVGNNC VKQP FGU 5VGTPGPJKOOGNU CO 6CI FGT 9CJN FCJKPVGT FGT 0COGPU\WI FGU -CKUGTU&CU *QTQUMQR FGU   IGY·JNVGP-CKUGTUOOI(ÌTUEJPGT(QTUVGT,W(5NI/QPVGPWQXQ 48QT\ÒINKEJ  297


FRANKFURT

6539

6540

6541



5KNDGTOGFCKNNGWPUKIPKGTVXQP2*/ÒNNGTCWHFKG-TÌPWPI-CTNU8+\WOTÌOKUEJGP-CKUGT /GFCKNNQP OKV FGO IGJCTPKUEJVGP $TWUVDKNF -CTNU 8+ T OKV .QTDGGTMTCP\ WPF WOIGNGIVGO /CPVGN   WOJGT UGEJU YGKVGTG /GFCKNNQPU OKV FGP $TWUVDKNFGTP FGT -WTHÒTUVGP XQP /CKP\ FGT 2HCN\ $TCPFGP   DWTI $TCWPUEJYGKI.ÒPGDWTI 5CEJUGP WPF 6TKGT&QRRGNCFNGT OKV <GRVGT 5EJYGTV WPF 4GKEJUCRHGN   KPFGP(·PIGPCWHFGT$TWUV*GT\FCTCWH-CKUGTMTQPGOOI(ÌTUEJPGT(QTUVGT ,W(5NI/QPVGPWQXQ 8QT\ÒINKEJGU2TCEJVGZGORNCTOKVHGKPGT6ÌPWPI 



5KNDGTOGFCKNNG  XQP 2 * /ÒNNGT CWH FKG -CKUGTYCJN -CTNU 8+ )GJCTPKUEJVGU $TWUVDKNF T OKV   .QTDGGTMTCP\ WPF WOIGNGIVGO /CPVGN)GMTÌPVGT 4GKEJUCFNGT OKV $NKV\ WPF <GRVGT KP FGP (·PIGP   WOJGTFKGUKGDGP-WTYCRRGPQDGPUVTCJNGPFGU&TGKGEMOOI(ÌTUEJPGT(QTUVGT ,W(5NI/QPVGPWQXQ 49KP\4CPFHGJNGTXQT\ÒINKEJ -QPX6CNGT&CX,W(C (CUVXQT\ÒINKEJ



 

6542

6543



 298

6543

<KPPRTQDGFGU&QRRGNIWNFGP)NCVVGT4CPFI)GRT·IVCWHFKG9CJNFGURTGW­KUEJGP-ÌPKIU (TKGFTKEJ9KNJGNO+8\WO-CKUGTFGT&GWVUEJGPCO/·T\#-5 XIN &CX XIN  -CJPV XIN 6JWP XIN 5VWV\OCPPC8CTG  44-N4CPFHGJNGTHCUVXQT\ÒINKEJ &QRRGNVGT8GTGKPUVCNGT#-5&CX-CJPV6JWP 8QT\ÒINKEJ

 


FREIBURG

6544 6545



6545

8GTGKPUVCNGT#-5&CX-CJPV6JWP  2TCEJVGZGORNCT(GKPG2CVKPC5VGORGNINCP\



(ª456'067/(4#0-(746 

%CTN6JGQFQTXQP&CNDGTI(ÒTUVRTKOCUFGU4JGKPDWPFGU-QPX6CNGT/ÒP\\GK EJGP$*QJPG2WPMVG#-5&CX-CJPV6JWP 8QT\ÒINKEJ



ex 6546

6547 6548

.16(4#0-(746 

5KNDGTCDUEJNCI XQP FGP 5VGORGNP FGU &WMCVGP  -TQPG WPF 5RTWEJDCPF  CWH FKG -TÌPWPI (GTFK   PCPFU++\WOFGWVUEJGP-CKUGT5KNDGTCDUEJNCIXQPFGP5VGORGNPFGU&QRRGNFWMCVGP -CKUGTWPF )GTGEJVKIMGKV  XQP , . ¤ZNGKP CWH FKG 9CJN -CTNU 8++ \WO TÌOKUEJGP -CKUGT 5KNDGTCDUEJNCI XQP   FGP 5VGORGNP FGU &WMCVGP  -CKUGTMTQPG  XQP , . ¤ZNGKP CWH FKG 9CJN -CTNU 8++ \WOTÌOK UEJGP-CKUGT5KNDGTCDUEJNCIXQPFGP5VGORGNPFGU&WMCVGPQ, .CPFUEJCHVOKVCWHIGJGPFGT 5QPPG XQP,.¤ZNGKPCWHFKG-TÌPWPI-CTNU8++\WOTÌOKUEJGP-CKUGT  5VÒEM*GTTNKEJG2CVKPCXQT\ÒINKEJp5VGORGNINCP\

)4#(5%*#(6 

(4'+$74)

#PQP[O'KPUGKVKIGTXKGT\KRHGNKIGT2HGPPKIWOI#FNGTXXFGP-QRHPCEJNIGYCPFV OKVCWUIGDTGKVGVGP(NÒIGNPWPFOKVGKPGTCWUFTGK-WIGNPIGDKNFGVGP-TQPG$GTIGT5NI9ÒVJTKEJ 9KGNCPFV $TGKUICW  45GJTUEJÌP

&KG 8GTQTVWPI FKGUGU 2HGPPKIU KUV PKEJV \YGKHGNUHTGK IGMN·TV ( 9KGNCPFV J·NV CWEJ GKPG 2T·IWPI FGT )TCHGP XQP   (ÒTUVGPDGTIHÒTOÌINKEJ







56#&6

)WNFGPVCNGT -TGW\GT OKV6KVGN(GTFKPCPFU+$GTUVGVV&CX  4.GKEJVG-QTTQUKQPUURWTGPHCUVUGJTUEJÌP



ex 6549



$TQP\GOGFCKNNGXQP,/CWIGTCWHFKG'KPPCJOGFGT5VCFVFWTEJFKG(TCP\QUGPWPVGT.WFYKI:+8 /KPGTXCUVGJVXXOKV5RGGTWPF5EJKNFNCO$QFGP'WNG$ÒUVG.WFYKIU:+8TOO&C\W 'KP YGKVGTGU KO  ,CJTJWPFGTV IGRT·IVGU 'ZGORNCT KP 5KNDGT  OO  I $GTUVGVV    &KXQ/¾FCKNNGUHTCP¼CKUGU5 5VÒEM8QT\ÒINKEJ

 299


FREIBURG

6550 (1 1/2 fach)



HCEJGT6CNGTI5VCFVCPUKEJVKO#DUEJPKVV\YGK<GKNGP5EJTKHVWPF,CJTGU\CJN7PVGT FGTMCKUGTNKEJGP*CWUMTQPGGKPPCEJTCWHUGJGPFGT#FNGTOKV5EJYGTVWPF<GRVGTKPFGP(·PIGPWPVGP \WFGP5GKVGPNGJPGP\YGK9CRRGPUEJKNFGKO#DUEJPKVV6CHGNOKV\YGK<GKNGP5EJTKHVÒDGTIGMTGW\VGP 2CNO\YGKIGP$GTUVGVVXIN&CX\W FQTVCNU6CNGT   48QTIGIQUUGPGTNGKEJVRQTÌUGT5EJTÌVNKPIUGJTUEJÌPGU'ZGORNCT 

6551





6552

6553

$TQP\GOGFCKNNGXQP,/CWIGTWPF,&QNNKPCWHFKG'KPPCJOGXQP(TGKDWTIWPF.CPFCWFWTEJ FKG(TCP\QUGPWPVGT.WFYKI:+8/CTUOKV*GNOWPF5RGGTUVGJVPCEJTFGPNKPMGP(W­CWHFKGCO $QFGP NKGIGPFGP 5VCFVUEJKNFG XQP (TGKDWTI WPF .CPFCW IGUVGNNV$ÒUVG .WFYKIU :+8 T  OO   $GTUVGVV&KXQ/¾FCKNNGUHTCP¼CKUGU 8QT\ÒINKEJ



5KNDGTOGFCKNNGXQP(,/CTVGCWCWHFKG'KPPCJOG(TGKDWTIUFWTEJFKG(TCP\QUGPWPVGT)GPG TCNOCTUEJCNN(TCP¼QKUFG(TCPSWGVQV&WEFW%QKIP[5VCFVIÌVVKPOKVDGUEJ·FKIVGO5EJKNFNKGIVCO$QFGP WPF DNKEMV CWH GKPG $WTITWKPG FGTGP 6WTO CWUGKPCPFGTDTKEJV$ÒUVG -ÌPKI .WFYKIU :8 XQP (TCPM   TGKEJTOKV*CCTDCPFOOI$GTUVGVV/¾FCKNNGUHTCP¼CKUGU5XCT  8QPITQ­GT5GNVGPJGKV5EJÌPG6ÌPWPIMN4CPFHGJNGTXQT\ÒINKEJ  # (TGKJGTT XQP $GTUVGVV UEJTGKDV \W FGT XQTNKGIGPFGP /GFCKNNG +EJ DGFCWGTG FKGUGU 5VÒEM PKEJV XQNNUV·PFKI DG   UEJTGKDGP\WMÌPPGPGUMCOOKTPKG\W)GUKEJVGYKGÒDGTJCWRVFKG5EJCWOÒP\GPFKGUGU-ÌPKIUYGKVUGNVGPGTUKPF CNUFKGUGKPGU8QTI·PIGTU





300

$TQP\GOGFCKNNGXQP(,/CTVGCWCWHFKG'KPPCJOG(TGKDWTIUFWTEJFKG(TCP\QUGPWPVGT)GPG TCNOCTUEJCNN (TCP¼QKU FG (TCPSWGVQV &WE FW %QKIP[ 5VCFVIÌVVKP OKV DGUEJ·FKIVGO 5EJKNF  NKGIV CO   $QFGP WPF DNKEMV CWH GKPG $WTITWKPG FGTGP 6WTO CWUGKPCPFGTDTKEJV$ÒUVG -ÌPKI  .WFYKIU :8 XQP   (TCPMTGKEJTOKV*CCTDCPFOO$GTUVGVV FQTVKP5KNDGT /¾FCKNNGUHTCP¼CKUGU5 XCT FQTVKP5KNDGT  448QT\ÒINKEJ



$TQP\GOGFCKNNGXQP(,/CTVGCWCWHFKG'KPPCJOG(TGKDWTIUFWTEJFKG(TCP\QUGPWPVGT)GPG TCNOCTUEJCNN(TCP¼QKUFG(TCPSWGVQV&WEFW%QKIP[5VCFVIÌVVKPOKVDGUEJ·FKIVGO5EJKNFNKGIVCO$QFGP WPF DNKEMV CWH GKPG $WTITWKPG FGTGP 6WTO CWUGKPCPFGTDTKEJV$ÒUVG -ÌPKI .WFYKIU :8 XQP (TCPM   TGKEJTOKV*CCTDCPFOO8CTKCPVGOKVFGT5VGORGNUEJPGKFGTUKIPCVWTKP$NQEMDWEJUVCDGP$GT UVGVV FQTVKP5KNDGT /¾FCKNNGUHTCP¼CKUGU5 FQTVKP5KNDGT  448QT\ÒINKEJ




FREIBURG

6555



6557

6558

5KNDGTOGFCKNNG  XQP . -CEJGN CWH FKG8GTNGIWPIFGU'T\DKUVWOU/CKP\PCEJ(TGKDWTI#PUKEJV FGU (TGKDWTIGT /ÒPUVGTU-QRH FGU )TQ­JGT\QIU .WFYKI XQP $CFGP T  OO  I 9KG   NCPFV<GKV\ 8QT\ÒINKEJGU'ZGORNCTOKVHGKPGT6ÌPWPI



#WU FGP 8GTJCPFNWPIGP $CFGPU WPF UGKPGT 0CEJDCTUVCCVGP OKV FGT -WTKG ÒDGT FKG 0GWQTFPWPI FGT MKTEJNKEJGP   1TICPKUVKQP IKPIGP FKG $WNNGP XQP 2CRUV 2KWU 8++ CWU FGO ,CJT  WPF UGKPGU 0CEJHQNIGTU .GQ :++ XQO    #RTKN  JGTXQT &CU $KUVWO -QPUVCP\ YWTFG CWHIGJQDGP WPF (TGKDWTI \WO 5KV\ FGU 'T\DKUEJQHU GTJQDGP FGO   FKGQDGTTJGKPKUEJG-KTEJGPRTQXKP\WPVGTUVCPF<WFKGUGO$GTGKEJIGJÌTVGCWEJFCUCNVG'T\DKUVWO/CKP\PWPOGJT CNUGKPHCEJGU$KUVWO



$TQP\GOGFCKNNGXQP.-CEJGNCWHFKG8GTNGIWPIFGU'T\DKUVWOU/CKP\PCEJ(TGKDWTI#PUKEJV FGU(TGKDWTIGT/ÒPUVGTU-QRHFGU)TQ­JGT\QIU.WFYKIXQP$CFGPTOO9KGNCPFV<GKV\ +PTQVGO1TKIKPCNGVWK8QT\ÒINKEJ





5KNDGTOGFCKNNG  XQP . -CEJGN WPF % 8QKIV CWH FKG ,CJTHGKGT FGT 7PKXGTUKV·V (TGKDWTI KO   $TGKUICW&KGYGKDNKEJG#NNGIQTKGFGT7PKXGTUKV·VUKV\VXXOKV/CWGTMTQPGKPFGT4GEJVGPGKPGP-QTD OKV 2HNCP\GP JCNVGPF KP FGT .KPMGP <GRVGT WPVGP FCU 5VCFVYCRRGP XQP (TGKDWTI-QRH FGU )TQ­JGT   \QIU(TKGFTKEJXQP$CFGPTOOI.CXGTTGP\5GTHCU9KGNCPFV<GKV\  (CUV5VGORGNINCP\





5KNDGTOGFCKNNG  XQP . -CEJGN WPF % 8QKIV CWH FKG ,CJTHGKGT FGT 7PKXGTUKV·V (TGKDWTI KO   $TGKUICW&KGYGKDNKEJG#NNGIQTKGFGT7PKXGTUKV·VUKV\VXXOKV/CWGTMTQPGKPFGT4GEJVGPGKPGP-QTD OKV 2HNCP\GP JCNVGPF KP FGT .KPMGP <GRVGT WPVGP FCU 5VCFVYCRRGP XQP (TGKDWTI-QRH FGU )TQ­JGT   \QIU(TKGFTKEJXQP$CFGPTOOI&C\W'KP\YGKVGU'ZGORNCTKP$TQP\G XQT\ÒINKEJ  .CXGTTGP\5GTHCU9KGNCPFV<GKV\ 5VÒEM5EJÌPG6ÌPWPIMN4CPFHGJNGTXQT\ÒINKEJ



6559



8GTUKNDGTVG$TQP\GOGFCKNNGXQP'9GKICPFCWHFKGQDGTTJGKPKUEJG)GYGTDGCWUUVGNNWPIKP(TGK DWTI -QRH FGU 2TQVGMVQTU FGT #WUUVGNNWPI (TKGFTKEJ 'TDITQ­JGT\QI XQP $CFGP T&KG 9CRRGP   UEJKNFGXQP$CFGPWPF1DGTGNUC­PGDGPGKPCPFGTKPTGKEJXGT\KGTVGT-CTVWUEJGOO5QOOGT9 9KGNCPFV<GKV\ 8QT\ÒINKEJ

 301


FRIEDBERG

6560



5KNDGTOGFCKNNGWPUKIPKGTVCWHFKG+OOCVTKMWNCVKQPFGU5VWFGPVGP5VCFVCPUKEJVKO8QTFGT ITWPF 9CRRGPUEJKNF0CEMVG YGKDNKEJG )GUVCNV UEJTGKDV FKG <CJN  CWH GKPGP (GNU   OO   I5GTHCU 8QT\ÒINKEJ



5#//.70)(4'+$74)'4/'&#+..'0 

+PVGTGUUCPVG5COONWPI(TGKDWTIGT/GFCKNNGPFGU,CJTJWPFGTVUKP5KNDGT Z WPFWPGFNGP/G VCNNGPWC$TQP\GOGFCKNNG 5KGIFGT(TCP\QUGP  'KPPCJOGFGT5VCFVFWTEJFKG(TCP\QUGP  5KNDGTOGFCKNNG  .CPFYKTVUEJCHVNKEJG #WUUVGNNWPI   .CPFYKTVUEJCHVNKEJG #WUUVGNNWPI     5EJÒV\GPHGUV   2T·OKG FGU )GHNÒIGN\WEJVXGTGKPU  UQYKG 5KNDGTOGFCKNNG  (CJPGPYGKJG   FGU 5·PIGTDWPFGU  &C\W /GFCKNNGP XQP -GP\KPIGP WPF -NKPIGTUJGKO UQYKG 9CNNHCJTVUOGFCKNNGP XQP   'VVGPJGKO5·EMKPIGPWPF5V/·TIGP+PVGTGUUCPVG*GKOCVUCOONWPI  5VÒEM<WO6GKNUGNVGP(CUVUGJTUEJÌPpXQT\ÒINKEJ <YGKYGKVGTG5KNDGTOGFCKNNGPFGU$KUVWOU(TGKUKPIHKPFGP5KGWPVGTFGP0TPWPF

6562

4'+%*5$74)

6564



6563

(4+'&$'4)



(TCP\*GKPTKEJXQP&CNDGTI-QPX6CNGT0ÒTPDGTIOKV6KVGN,QUGHU++&CX .GLGWPG ,WUVKGTVHCUVXQT\ÒINKEJ



-QPX6CNGT0ÒTPDGTIOKV6KVGN,QUGHU++&CX.GLGWPG  #VVTCMVKXGUUGJTUEJÌPGU'ZGORNCTOKVUEJÌPGT2CVKPC





-QPX6CNGT0ÒTPDGTIOKV6KVGN,QUGHU++.GLGWPG



5GJTUEJÌP



6565

 302

,QJCPP /CTKC 4WFQNRJ XQP 9CNFDQVV$CUUGPJGKO  -QPX6CNGT  OKV 6KVGN  XQP   (TCP\++&CX-CJPV6JWP .GKEJVG,WUVKGTURWTGPUGJTUEJÌPpXQT\ÒINKEJ




HALBERSTADT

6567 6566

(ª456'0$'4)

)4#(5%*#(6 

6568

1,5:1

#PQP[O8KGT\KRHGNKIGT2HGPPKIQ, WO 8KNNKPIGPI-QRHFGU5VCFVRCVTQPU 5V$CTPC DCU N$GTIGT5NI9ÒVJTKEJ FQTVOKVKTTVÒONKEJGT&CVKGTWPIWO   44(CUVXQT\ÒINKEJGU'ZGORNCTOKVHGKPGT6ÌPWPI



(ª456'067/ 

'IQP 8+++  -KRRGT-W-TGW\GT Q , *GKNKIGPDGTI &QNNKPIGT  XCT FQTV KTTVÒONKEJ   WPVGT*GTOCPP'IQP 5NI-TCC\XCT 445EJÌPpUGJTUEJÌP





-CTN,QCEJKO-TGW\GT#-5



4(GKPG6ÌPWPIOKPLWUVKGTVXQT\ÒINKEJ

ex 6570 6569

6569

(7))'4 (7))'4$#$'0*#75'09'..'0$74))4#(5%*#(6 



/CZKOKNKCP ++  4GKEJUVCNGT  ,CJTGU\CJN KO 5VGORGN CWU  IG·PFGTV  OKV 6KVGN   (GTFKPCPFU++&CX-WNNE -N<CKPGPFGXQT\ÒINKEJGU'ZGORNCT 'KPGP6CNGTFGU$KUVWOU(WNFCHKPFGP5KGWPVGTFGT0T



)15.#4

56#&6

/CTKGPITQUEJGP$WEM$ÒVVPGT-NWIG$D#C

5VÒEM5GJTUEJÌP



6572

6571

$+567/

6573

*#.$'456#&6



7NTKEJXQP4GKPUVGKP$TCMVGCVI&GTJGKNKIG5VGRJCPUKV\VXXOKV-TWOOUVCDWPF $WEJTKO(GNF5VGKPG$GTIGT$GUUGT$T·OGT$ÒTIGT 2T·IGUEJY·EJGXQT\ÒINKEJ





-QPTCF XQP -TQUKIM  2HGPPKI  I %10%1275 $TWUVDKNF T KP 2QTVCN   FCTÒDGT -WRRGNVWTO \YKUEJGP \YGK YGKVGTGP MNGKPGTGP 6ÒTOGP5%55V 5VGRJCP UVGJV X X OKV   2CNO\YGKIWPF-TGW\UVCD$GUUGT$T·OGT$ÒTIGT\W FQTVCPFGTG8QTFGTUGKVGPWOUEJTKHV   442T·IGUEJY·EJGHCUVUGJTUEJÌP



&QOMCRKVGN4GKEJUVCNGT$GUUGT$T·OGT$ÒTIGT&CX<GRGTPKEM  -N$GCTDGKVWPIUUVGNNGKO(GNFFGT4ÒEMUGKVGUGJTUEJÌP





303


HAMBURG

6574



5KNDGTOGFCKNNGXQP##DTCOUQPCWHFGP)GDWTVUVCIWPFFCUL·JTKIG,WDKN·WOXQP'TPUV .WFYKI (TGKJGTT 5RKGIGN \WO &GUGPDGTI CNU &QOJGTT XQP *CNDGTUVCFV $TWUVDKNF N OKV WOIGNGIVGO   /CPVGN &QOMTGW\ WPF 5V 5VGRJCPUQTFGP <GKNGP 5EJTKHV  OO  I *QHHOCPP    <GRGTPKEM 8QT\ÒINKEJ



'TPUV .WFYKI (TGKJGTT 5RKGIGN \WO &GUGPDGTI YCT GKP ITQ­GT 8GTGJTGT (TKGFTKEJU FGU )TQ­GP XQP 2TGW­GP 'T   DGUWEJVGKJPJ·WHKICWH-TKGIUUEJCWRN·V\GPWPFHGKGTVGFGUUGP5KGIGKP*CNDGTUVCFVWPFCWHFGP5RKGIGNDGTIGP&GT 5V 5VGRJCPUQTFGP FGP 'TPUV .WFYKI CWH FGT 8QTFGTUGKVGPFCTUVGNNWPI VT·IV KUV XQP -ÌPKI (TKGFTKEJ ++ HÒT FKG   *CNDGTUV·FVGT&QOJGTTGPIGUVKHVGVYQTFGP'UJCPFGNVUKEJFCDGKWOGKP-TGW\FCUCWHFGTGKPGP5GKVGFGP5EJYCT \GP#FNGTOKVCWUIGDTGKVGVGP(NÒIGNPCWHFGTCPFGTGPFCU-TGW\FGU*CNDGTUV·FVGT&QORCVTQPU\GKIV

6575

6576

6577

*#/$74) 56#&6 

4GKEJUVCNGTOKV6KVGN4WFQNHU++&CX)CGFG  *ÒDUEJG2CVKPCYKP\2T·IGUEJY·EJGXQT\ÒINKEJ





5KNDGTOGFCKNNGQ,  XQP2*)QGFGEMGCWHFGP#WHUVCPFFGT5EJPGKFGTIGUGNNGP#PUKEJVFGT 5VCFVXQPFGT'NDUGKVGCWUIGUGJGPQDGP.QTDGGT\YGKI(CUEGUWPF/GTMWTUVCDCNU5KPPDKNFGTFGTFTGK 5V·PFG&KGRGTUQPKHK\KGTVG)GUGV\IGDWPIOKVKJTGP#VVTKDWVGPVJTQPVXX\WFGP5GKVGPN\YGKDGVGPFG *·PFG (TÌOOKIMGKV CWHGKPGO#NVCTT$KGPGPWO$KGPGPMQTD FKGJ·WUNKEJG#TDGKVUCOMGKV OO I)CGF+++ (CUVXQT\ÒINKEJGU'ZGORNCT



 304

4GKEJUVCNGT 5EJKNNKPI OKV6KVGNXQP(TCP\+&CX)CGF

 .GKEJVLWUVKGTVUGJTUEJÌP




HAMELN

6578



5KNDGTOGFCKNNG  OKV 5KIPCVWT # * CWH FKG ,CJTHGKGT FGT 'PINCPFHCJTGT)GUGNNUEJCHV 'KP   'PIGN UVGJV X X WPF J·NV XQT UKEJ FCU 9CRRGP FGT )GUGNNUEJCHV5GEJU <GKNGP 5EJTKHV KP -CTVWUEJG   OOI)CGF+++C  4.GKEJVGT5VGORGNHGJNGTXQT\ÒINKEJGU'ZGORNCTOKVHGKPGT6ÌPWPI



.165*#/$74) 



5CVKTKUEJG5KNDGTOGFCKNNGQ, WO XQP&(QFGT(9.QQUCWHFKG$GUVGEJNKEJMGKVFGTMCK UGTNKEJGP -QOOKUUKQP 5KNDGTOGFCKNNG  XQP %JT 2HGWHHGT CWH FCU PGWGTDCWVG -TCPMGPJCWU 5KN   DGTOGFCKNNGXQP%JT2HGWHHGTCWHFCUL·JTKIG$GUVGJGPFGU,QJCPPGWOU5KNDGTOGFCKNNG XQP(-ÌPKICWHFKGFGWVUEJGP0CVWTHQTUEJGTWPFT\VGXGTUCOONWPI5KNDGTOGFCKNNGWPUKIPKGTV CWHFKG,CJTHGKGTFGU(TGKOCWTGT-TCPMGPJCWUGU 5VÒEM8QT\ÒINKEJ



5VCFV&KXGTUG/ÒP\GPFGU,CJTJWPFGTVUXQO&TGKNKPIDKU\WO4GKEJUVCNGT+PVGTGUUCPVGU.QV DKVVGDGUKEJVKIGP 5VÒEM(CUVUGJTUEJÌPpXQT\ÒINKEJ



6581 6582

 

56#&6

6582

*#/'.0

/CTKGPITQUEJGP-CNXGNCIG5EJTQEMD

445EJÌPpUGJTUEJÌP

6CNGT )TQUEJGP OKV6KVGN-CTNU8I/ÒP\OGKUVGT\GKEJGP*GT\OKV<CKPJCMGP 9WNH 9CIGPGT/ÒP\OGKUVGTKP*COGNP &CX-CNXGNCIG5EJTQEMD  44.GKEJVG)N·VVWPIUURWTGPKO(GNFFGT8QTFGTUGKVGYKP\5EJTÌVNKPIUHGJNGTUGJTUEJÌP

 

6584

6584 6583



6CNGT  )TQUEJGP   OKV 6KVGN -CTNU 8  I /ÒPUVGTMKTEJG WPVGP \YKUEJGP FGP 6ÒTOGP   5EJKNF OKV /ÒJNGKUGP)GMTÌPVGT &QRRGNCFNGT OKV 4GKEJUCRHGN WPF FGT 9GTV\CJN  CWH FGT $TWUV   /ÒP\OGKUVGT\GKEJGP *GT\ OKV <CKPJCMGP 9WNH 9CIGPGT /ÒP\OGKUVGT KP *COGNP     &CX-CNXGNCIG5EJTQEMD  44#VVTCMVKXGU'ZGORNCTOKVJÒDUEJGT2CVKPCMN5EJTÌVNKPIUHGJNGTCO4CPFUGJTUEJÌP 

*#0#7 

*#0#7.+%*6'0$'4))4#(5%*#(6

2JKNKRR8-TGW\GT $CV\GP 5WEJKGT

2T·IGUEJY·EJGUGJTUEJÌP

 305


HENNEBERG

ex 6585

56#&6 

*#0018'4

.QV/CTKGPITQUEJGP/CTKGPITQUEJGP/CTKGPITQUEJGP$WEM/GKGT

6[RWU+  6[RWU+  5VÒEM5GJTUEJÌPpXQT\ÒINKEJ

6586

6588



6587

*#4< 

6CWHVCNGT**<GNNGTHGNF/ÒP\OGKUVGT*GKPTKEJ*QTUV-CVUQWTQU  *ÒDUEJG2CVKPCHCUVXQT\ÒINKEJ





6CWHVCNGT+$*<GNNGTHGNF/ÒP\OGKUVGT,QJCPP$GPLCOKP*GEJV-CVUQWTQU  8QT\ÒINKEJ



*'00'$'4))4#(5%*#(6 

*'00'$'4)

)GOGKPUEJCHVNKEJ U·EJUKUEJGT #PVGKN 4GKEJUVCNGT  +NOGPCW #WUDGWVG FGT )TWDGP KP +NOGPCW   &CX/ÒUGNGT 2TCEJVGZGORNCTOKVHGKPGT2CVKPC9KP\4CPFHGJNGTXQT\ÒINKEJ  +NOGPCWNKGIV-KNQOGVGTUÒFYGUVNKEJXQP9GKOCT5EJQPKO,CJTJWPFGTVUQNNGKP5KNDGTGT\DGTIYGTMDGVTKGDGP YQTFGP UGKP 5GKV GVYC  YCTGP \CJNTGKEJG 5EJ·EJVG \WT )GYKPPWPI FGU UKNDGTJCNVKIGP -WRHGTUEJKGHGTU KP $G   VTKGD  CWHN·UUKI IGYQTFGP  DGICPP KP +NOGPCW FKG \YGKVG $GTIDCWRGTKQFG FKG  OKV FGO $TWEJ FGU   ITQ­GP 4ÌFGNUVGKEJGU WPF FGT FCTCWU TGUWNVKGTGPFGP 8GTYÒUVWPI FGT #PNCIGP GPFGVG 9KGFGTCWHPCJOGXGTUWEJG KP   FGP,CJTGPWPFUEJGKVGTVGP5GKV,CJTGNCPINGKVGVG)QGVJGPGWG8GTUWEJGCDGT7PDCWYÒTFKI MGKVURTCEJFCU6QFGUWTVGKNÒDGTFGP+NOGPCWGT$GTIDCW&GPNGV\VGP8GTUWEJFGP$GTIDCWDGK+NOGPCWYKGFGTCWH \WPGJOGPWPVGTPCJO\YKUEJGPWPFFGT+NOGPCWGTWPF4QFCGT$GTIDCW

306


HESSEN

6590

6589





6589

4GKEJUVCNGT+NOGPCW#WUDGWVGFGT)TWDGPKP+NOGPCW&CX#/ÒUGNGTCNGKEJVXCT *ÒDUEJG2CVKPCUGJTUEJÌPpXQT\ÒINKEJ

*'55'0.#0&)4#(5%*#(6



*'55'0

9KNJGNO++#NDWU-CUUGN5EJÒV\XCT

5GJTUEJÌP



6591

*'55'0-#55'..#0&)4#(5%*#(65'+6-74(ª456'067/ 

9KNJGNO8$TGKVGTFQRRGNVGT4GKEJUVCNGT-CUUGN&QRRGNVGT9GKFGPDCWOVCNGTI &TGKHCEJ DGJGNOVGU XKGTHGNFKIGU 9CRRGP OKV /KVVGNUEJKNF KP XGT\KGTVGT -CTVWUEJG QDGP FKG 5KIPCVWT   65 XGTDWPFGP6GTGPVKWU5EJOKFV/ÒP\OGKUVGTKP-CUUGN 7PVGTFGOUVTCJNGPFGP0COGP ,GJQXCU UVGJV GKP 9GKFGPDCWO KP GKPGT .CPFUEJCHV OKV UGEJU *·WUGTP QDGP 9QNMGP OKV $NKV\ 4GIGP   WPF5VWTO&CX5EJÒV\ 44(GNFGTNGKEJVDGCTDGKVGVUGJTUEJÌP  &GT9GKFGPDCWOVCNGTD\YFQRRGNVCNGTKPFGP,CJTGPIGRT·IVUQNNVGGKIGPVNKEJGKP2CNODCWOVCNGT YKG CWEJKPGKPKIGP$ÒEJGTPCPIGIGDGP YGTFGPFCFKG2CNOGGKP5[ODQNFGT5V·TMGFCTUVGNNV&GTJGUUKUEJG5VGORGN UEJPGKFGTUVGNNVGFKG2CNOGLGFQEJKPFGT(QTOFGTKJODGMCPPVGTGP9GKFGFCT

6592



9KNJGNO 8+  4GKEJUVCNGT  -CUUGN  I 5EJKHHUVCNGT )GMTÌPVGU UGEJUHGNFKIGU   9CRRGPOKV/KVVGNUEJKNF\YKUEJGPFGTIGVGKNVGP,CJTGU\CJN5GIGNUEJKHHCWH/GGTFCTÒDGT 5·WNG$WEJWPF9CCIGWPVGT9QNMGP&CX5EJÒV\  4*GTTNKEJG2CVKPCMN5COONGT\GKEJGPKO(GNFXQT\ÒINKEJ  307


HESSEN

6594

6593

6593



-CTN5KNDGTOGFCKNNGXQP+.G%NGTECWHUGKPGP)GDWTVUVCIFKG,CJTHGKGTFGT 7PKXGTUKV·V /CTDWTI UQYKG FGP  )GDWTVUVCI UGKPGU 'PMGNU (TKGFTKEJ UR·VGT (TKGFTKEJ ++  )GJCT   PKUEJVGU $TWUVDKNF N OKV WOIGNGIVGO /CPVGN <GKNGP 5EJTKHV  OO  I .CXGTTGP\    5EJÒV\ 445EJÌPG2CVKPCYKP\-TCV\GTXQT\ÒINKEJ 



9KNJGNO ++  -W *GNNGT  2TQDG OKV 4KHHGNTCPF  I #-5 ,+85VWV\ OCPP2 442TCEJVGZGORNCT(CUV5VGORGNINCP\

6595

 

6596

*'55'0&#4/56#&6.#0&)4#(5%*#(65'+6)4155*'4<1)67/

.WFYKI+-QPX6CNGT#-5&CX-CJPV6JWP -QPX6CNGT#-5&CX-CJPV6JWP

6597



6598

8QT\ÒINKEJ 5GJTUEJÌP

 

6599



-TQPGPVCNGT#-5&CX-CJPV6JWP  *ÒDUEJG2CVKPCMN,WUVKGTURWTGPUGJTUEJÌP





.WFYKI++-TQPGPVCNGT#-5&CX-CJPV6JWP  W­GTUVUGNVGPKPFKGUGT'TJCNVWPI-CDKPGVVUVÒEM 2TCEJVXQNNG2CVKPCRQNKGTVG2NCVVGOKPDGTÒJTV 8GTGKPUFQRRGNVCNGT#-5&CX-CJPV6JWP 8QT\ÒINKEJ

 

 308


HILDESHEIM

6600

6601



.WFYKI+++-TGW\GTQ,  CWHFGP$GUWEJFGU2TKP\GP.WFYKIWPF*GKPTKEJKP FGT&CTOUV·FVGT/ÒP\G#-5, 448QT\ÒINKEJ





 -TGW\GT  CWH FGP $GUWEJ FGU 2TKP\GP 9KNJGNO WPF FGT 2TKP\GUUKP #PPC KP FGT &CTOUV·FVGT   /ÒP\G#-5, 44(CUV5VGORGNINCP\



6602

6603

6603



8GTGKPUVCNGT/KV4CPFUEJTKHVHGJNGT/70<8(464#)#-5&CX-CJPV6JWP *GTTNKEJG2CVKPCXQT\ÒINKEJ5VGORGNINCP\





'TPUV.WFYKI5KNDGTOGFCKNNG9GTMUVCVV1GTVGN$GTNKPCWHFKG-WPUVJCNNGKP&CTO UVCFV-QRHN)GD·WFGCPUKEJVOOI *GTTNKEJG2CVKPCXQT\ÒINKEJGU2TCEJVGZGORNCT



6606

6604

6607

6605

$+567/ 

*+.&'5*'+/

#FGNJQIXQP&QTUVCFV$TCMVGCVI$KUEJQHOKV4GNKSWKGPM·UVEJGP$WEJWPF-TWOO UVCD UKV\V X X CWH GKPGO OKV 6KGTMÌRHGP WPF HÒ­GP XGT\KGTVGO -NCRRUVWJN WOJGT (CFGPMTGKU OKV LG   GKPGO6WTOPGDGPFGO-QRH$GTIGT/GJN 4*ÒDUEJG2CVKPCUGJTUEJÌP





$TCMVGCVI$KUEJQHOKV-TWOOWPF.KNKGPUVCDUKV\VXXCWHGKPGO$QIGP\WFGP5GKVGPLGGKP -WRRGNVWTO$GTIGT/GJN *ÒDUEJG2CVKPCUGJTUEJÌP





(GTFKPCPFXQP$C[GTP4GKEJUVCNGT/QTKV\DGTI&CX/GJNE  *ÒDUEJG2CVKPCHCUVUGJTUEJÌP 9GKVGTG2T·IWPIGPFGU$KUVWOU*KNFGUJGKOHKPFGP5KGWPVGTFGP0TP



*1*'0<1..'40 *1*'0<1..'40*'%*+0)'0(ª456'067/ 

*GTOCPP(TKGFTKEJ1VVQ-QPX6CNGT/KVMNGKPGT5VGORGNUEJPGKFGTUKIPCVWT9CWH FGT8QTFGTUGKVG#-5&CX-CJPV6JWP /KP4CPFHGJNGTUGJTUEJÌPpXQT\ÒINKEJ

 309


JEVER

6609 6608

6608

*1*'0<1..'405+)/#4+0)'0(ª456'067/ 

%CTN8GTGKPUFQRRGNVCNGT1JPG5VGTPPCEJ%108'06+10KPFGT4CPFUEJTKHV#-5 &CX-CJPV6JWP  0WT'ZGORNCTGIGRT·IV*ÒDUEJG2CVKPCUGJTUEJÌPpXQT\ÒINKEJ





%CTN#PVQP)WNFGP#-5,  (GKPG2CVKPCMN-TCV\GTXQT\ÒINKEJp5VGORGNINCP\



6611

6610

6612

 

(ª456'067/

+5'0$74)

%CTN(TKGFTKEJ-TGW\GT#-5, 4(GKPG2CVKPCXQT\ÒINKEJp5VGORGNINCP\ -TGW\GT#-5, 4#VVTCMVKXGUXQT\ÒINKEJGU'ZGORNCTOKVHGKPGT6ÌPWPI

 

+5'0$74)$ª&+0)'0(ª456'067/ 

,QJCPP .WFYKI   -TGW\GT )WNFGP   $ÒFKPIGP OKV 6KVGN .GQRQNFU + &CX    )TQVGC 41JPGFGPUQPUVÒDNKEJGP5VGORGNDTWEJUGJTUEJÌP

6614

*'445%*#(6 

6613

6614

,'8'4

/CTKC&KEMGT2GPPKPI,GXGT.GJOCPP/GT\FQTH  8QPITQ­GT5GNVGPJGKV5EJÌPpUGJTUEJÌP

+PFGT·NVGTGP.KVGTCVWTYGTFGPFKGUGPFKEMGP2GPPKPIG\W5VÒDGTPDTCDCPVKUEJH·NUEJNKEJCNU8KGTVGNVCNGTDG\GKEJ PGV#WEJFKGOKVFGPQUVHTKGUKUEJGP)GNFXGTJ·NVPKUUGPPKEJVXGTVTCWVGMCKUGTNKEJG-CP\NGKKP9KGPGTDNKEMVGKPKJPGP YKGCWEJKO(CNNGFGTQUVHTKGUKUEJGP2GPPKPIGWPVGTIGYKEJVKICWUIGDTCEJVG8KGTVGNVCNGTWPFUVTGPIVGFGUJCNDDGKO 4GKEJUHKUMCN GKPGP 2TQ\G­ CWH 'PV\WI FGU /ÒP\TGEJVU CP &KGU YCT PKEJV ICP\ WPDGTGEJVKIV FGPP CW­GTJCND 1UV   HTKGUNCPFUOW­VGPUKGFGP'KPFTWEMGKPGU6GUVQPUOCEJGP



310





%CTN9KNJGNOXQP#PJCNV<GTDUV6CNGTWPDGUVKOOVG/ÒP\UV·VVG/KV5KIPCVWT %2 \W FGP 5GKVGP FGU 9CRRGPU KP FGT 4ÒEMUGKVGPFCTUVGNNWPI %JTKUVKCP 2HCJNGT CPJCNVKUEJGT   /ÒP\OGKUVGT HÒT ,GXGT  QFGT  DKU EC   &CX  FQTV WPVGT #PJCNV  /CPP  SSS   /GT\FQTH 44.GKEJVG2T·IGUEJY·EJGUGJTUEJÌP 


JÜLICH-KLEVE-BERG

6615

,ª.+%*-.'8'$'4) ,ª.+%*$'4)*'4<1)67/ 

9QNHICPI 9KNJGNO  5KNDGTOGFCKNNG  WPUKIPKGTV CWH FKG $GKUGV\WPI UGKPGU  XGT   UVQTDGPGP1PMGNU*GT\QI,QJCPP9KNJGNOKPFGT&ÒUUGNFQTHGT.CODGTVKMKTEJG0GWP<GKNGP5EJTKHV 'TVTKPMGPFGT/CPPGTITGKHVGKPGCWU9QNMGPMQOOGPFG*CPFOOI0QUUC  8QPITQ­GT5GNVGPJGKV5GJTUEJÌP

6616

6618

6617



6619



#NDWU&ÒUUGNFQTH0QUUE

5GJTUEJÌP





,QJCPP9KNJGNO++6CNGT&ÒUUGNFQTH0QUUC  4*GTTNKEJG2CVKPCMN4CPFHGJNGTXQT\ÒINKEJ



 

6CNGT&ÒUUGNFQTH0QUUE 6CNGT&ÒUUGNFQTHCWHFCU8KMCTKCV0QUU

 

6620

445GJTUEJÌPpXQT\ÒINKEJ 8QT\ÒINKEJ

6622

6621

 

6CNGT&ÒUUGNFQTH0QUU -CTN2JKNKRR6CNGT )WNFGP &ÒUUGNFQTH0QUUD

8QT\ÒINKEJ 4(CUVUGJTUEJÌP



6CNGT(GKPUKNDGT&ÒUUGNFQTH#WUDGWVGFGT$GTIKUEJGP)TWDGP 9KNFDGTI &CX0QUU /ÒUGNGT FQTVWPVGT2HCN\0GWDWTI  4(GKPG2CVKPCUGJTUEJÌPpXQT\ÒINKEJ

   311


JÜLICH-KLEVE-BERG

6623

6624

6625



-CTN6JGQFQT4GKEJUVCNGT(GKPUKNDGT/CPPJGKO#WUDGWVGFGT9KNFDGTIGT)TWDGP &CX FQTVWPVGT2HCN\ *CCU/ÒUGNGT FQTVWPVGT2HCN\ 0QUU 5GJTUEJÌP





-QPX6CNGT&ÒUUGNFQTH&CX#0QUU (CUVXQT\ÒINKEJGU'ZGORNCTOKVHGKPGT6ÌPWPI





-QPX6CNGT&ÒUUGNFQTH&CX0QUU  #VVTCMVKXGUUGJTUEJÌPGU'ZGORNCTOKVUEJÌPGT2CVKPC





.QV -NGKPG 5COONWPI XQP -NGKPOÒP\GP FGU  ,CJTJWPFGTVU XQP ,ÒNKEJ$GTI WPF 4CXGPUDGTI   FCTWPVGTGKPKIGDGUUGTG5VÒEMGYKG\$,QJCPP9KNJGNO++6CNGTCWHUGKPGP6QF+PVGTGU UCPVG5COONWPI 5VÒEM/GKUVUGJTUEJÌP



6627



6628

$'4)*'4<1)67/5'+6)4155*'4<1)67/

/CZKOKNKCP,QUGRJXQP$C[GTP6CNGT.CPFOÒP\G#-5&CX-CJPV 6JWP #VVTCMVKXGUÒDGTFWTEJUEJPKVVNKEJGTJCNVGPGU'ZGORNCTHCUVXQT\ÒINKEJ



,ÒNKEJ  $GTI YCT GKP 0GDGPNCPF FGU -WTHÒTUVGPVWOU $C[GTP &WTEJ FGP 8GTVTCI XQP &ÒUUGNFQTH  FGT GTUV    XQO -CKUGT DGUV·VKIV YWTFG JCVVG 2HCN\0GWDWTI GKPG YKVVGNUDCEJKUEJG 0GDGPNKPKG FKG *GT\QIVÒOGT ,ÒNKEJ   WPF $GTI GTJCNVGP &KG 2HCN\ITCHGPJGT\ÌIG TGUKFKGTVGP OGKUV KP &ÒUUGNFQTH 5GNDUV CNU ,QJCPP 9KNJGNO     FWTEJ 'TDUEJCHV -WTHÒTUV XQP FGT 2HCN\ YWTFG DNKGD GT CO 0KGFGTTJGKP 'TUV UGKP $TWFGT WPF 0CEJHQNIGT -CTN   2JKNKRRTGUKFKGTVG\WGTUVKP0GWDWTIFCPPKP*GKFGNDGTI5EJNKG­NKEJ\QIGTPCEJ/CPPJGKOPWPYWTFGP,ÒNKEJWPF $GTI0GDGPNCPFGFGTRH·N\KUEJGP-WT#NU-CTN2JKNKRRUVCTDYCTFGTP·EJUVG#IPCV-CTN6JGQFQTXQP2HCN\ 5WN\DCEJ FGT CWEJ FWTEJ GKPG *GKTCV GPIGT OKV FGT .KPKG 0GWDWTI XGTDWPFGP YCT 0CEJ FGO #PHCNN XQP $C[GTP    YWTFG /ÒPEJGP \WT 4GUKFGP\ ,ÒNKEJ WPF $GTI TÒEMVGP KP YGKVGTG (GTPG 0CEJFGO -CTN 6JGQFQT  QJPG   GTDDGTGEJVKIVG 0CEJMQOOGP IGUVQTDGP YCT HQNIVG FKG GKP\KIG PQEJ ÒDTKIG 9KVVGNUDCEJGT .KPKG 2HCN\<YGKDTÒEMGP   $KTMGPHGNFOKV/CZKOKNKCP+8,QUGRJ+P\YKUEJGPYCTGPCDGTFKGNKPMUTJGKPKUEJGP)GDKGVGFGT2HCN\WPF,ÒNKEJCP FKGUKGITGKEJGHTCP\ÌUKUEJG4GRWDNKMXGTNQTGPIGICPIGP+O(TKGFGPXQP.WP¾XKNNGGTJKGNV-WTHÒTUV/CZKOKNKCP ,QUGRJFCU)GDKGV$GTIPQEJGKPOCN\WTÒEMWPFKP&ÒUUGNFQTHMCOGU\WGKPGTTGIGP/ÒP\RT·IGV·VKIMGKVYQDGKKO 6CNGTHW­ \W  5VÒDGT QFGT  #NDWU CWUIGRT·IV YWTFG FKG 6CNGT GPVURTCEJGP FGO PKGFGTTJGKPKUEJGP 4GEJ   PWPIUVCNGT +O (TKGFGP XQP 2TG­DWTI  YWTFG /CZKOKNKCP +8 ,QUGRJ \WO -ÌPKI XQP $C[GTP GTJQDGP OW­VG   CDGT$GTICP(TCPMTGKEJCDVTGVGP



312

,QCEJKO/WTCV6CNGT%CUUCVCNGT#-5&CX-CJPV6JWP  44(GKPG2CVKPCYKP\-TCV\GTCWHFGT4ÒEMUGKVGUGJTUEJÌP




KIEL

6629 6630

6630

#$6'+ 



-'/26'0

4WFQNH ++ DKU *GKPTKEJ +++  $TCMVGCV WO   I )GMTÌPVGU $TWUVDKNF FGT   *GKNKIGP*KNFGICTFKUXXOKV.KNKGWPF-TGW\UVCD$GTIGT-NGKP7NOGT %%   -N4CPFHGJNGTUGJTUEJÌP

56#&6

4GKEJUVCNGTOKV6KVGN(GTFKPCPFU++&CX*CGTVNG

445GJTUEJÌP

 

6631

56#&6 

-+'.

$TQP\GOGFCKNNG  XQP ( %JT -TQJP CWH FKG L·JTKIG /KVINKGFUEJCHV (TKGFTKEJU 8+ XQP &·PG   OCTM KO 5VCCVUTCV IGUVKHVGV XQP FGP 7PKXGTUKV·VGP -KGN WPF -QRGPJCIGP -QRH (TKGFTKEJU 8+ T OKV   .QTDGGTMTCP\2CNNCUHÒJTVGKPGP,ÒPINKPI\WGKPGO#NVCTCWHFGO-TÌPWPIUKPUKIPKGPNKGIGPOO .CPIG.CXGTTGP\ 8QT\ÒINKEJp5VGORGNINCP\

6632 6634

'4<$+567/ 







6633

-¤.0

2JKNKRR XQP *GKPUDGTI  1DQN *·NDNKPI   I $GKUEJNCI GKPGT /ÒP\UV·VVG FGU -CKUGTU   (TKGFTKEJ + XGTOWVNKEJ &WKUDWTI -CKUGT VJTQPV X X OKV $ÒIGNMTQPG 4GKEJUCRHGN WPF 2CNO\YGKI   /CWGT OKV 6QT FCTKP CEJVUVTCJNKIGT 5VGTP CWH FGT /CWGT 6WTO \YKUEJGP \YGK YGKVGTGP MNGKPGTGP   6ÒTOGP*·XGTPKEM 4'VYCUFG\GPVTKGTVUGJTUEJÌP



*GKPTKEJ+XQP/QNGPCTM&GPCT#VVGPFQTPI'T\DKUEJQHVJTQPVXX OKV /KVTC -TWOOUVCD WPF $WEJ ÒDGT FGO $WEJ FCU #VVGPFQTPGT <GKEJGP /QPFUKEJGN  OKV -WIGN   $TWUVDKNFGKPGU*GKNKIGPXXOKV\YGK-TGW\HCJPGPFCTÒDGT&CEJOKV\YGKMNGKPGP6ÒTOGP*·XGTPKEM 445GJTUEJÌP &KGVTKEJ++XQP/QGTU9GK­RHGPPKIQ,  -ÌPKIUFQTH0QUU 45GJTUEJÌP

  313


KÖLN

6635



6636

6637

6638

*GTOCPP+8XQP*GUUGP9GK­RHGPPKIQ,  $QPP0QUU

45GJTUEJÌP



.CPFITCH *GTOCPP +8 XQP *GUUGP YWTFG DGTGKVU CO  /·T\  XQO .CPFVCI \WO $GUEJKTOGT WPF8GTYGUGT FGU 'T\UVKHVGU IGY·JNV GTNCPIVG FKG WPDGUVTKVVGPG *GTTUEJCHV LGFQEJ GTUV PCEJ FGT #DFCPMWPI 4WRTGEJVU 2HCN\ITCH   DGK4JGKPKO,CJTGWPFFKGGT\DKUEJÌHNKEJG9ÒTFGPCEJFGUUGP6QF#O1MVQDGTGTNKG­-CKUGT (TKGFTKEJ +++ GKP /ÒP\RTKXKNGI \WIWPUVGP *GTOCPPU KP YGNEJGO KJO IGUVCVVGV YWTFG )QNF QFGT 5KNDGT CP GKPGO   DGNKGDKIGP 1TV FGU 'T\UVKHVGU RT·IGP \W NCUUGP &GT XQTNKGIGPFG 9GK­RHGPPKI KUV GKPGT FGT GTUVGP 2T·IWPIGP *GT   OCPPUFKGCWHITWPFFKGUGU2TKXKNGIUGPUVCPFGPUKPFYGKNFGT/ÒP\QTVCWHFKGUGO5VÒEMPQEJKPJGTIDTCEJVGT9GKUG CNU$800#DG\GKEJGVYKTFWPFPKEJVYKGDGKUR·VGTGP2T·IWPIGPCNU$100#



#NDWU&GWV\0QUU

445GJTUEJÌP





#NDWU&GWV\0QUU

45GJTUEJÌP





2JKNKRR++XQP&CWP1DGTUVGKP#NDWU&GWV\0QUU

5GJTUEJÌPpXQT\ÒINKEJ



6640

6639

6641

6642



#NDWU&GWV\0QUU

5GJTUEJÌPpXQT\ÒINKEJ





#NDWU&GWV\0QUU

5GJTUEJÌPpXQT\ÒINKEJ





*GTOCPP8XQP9KGF#NDWU&GWV\0QUU  5GNVGPKPFKGUGT'TJCNVWPI8QT\ÒINKEJ





#NDWU&GWV\0QUU

5GJTUEJÌP



5GNVGPKPFKGUGT'TJCNVWPI8QT\ÒINKEJ



6643



#NDWU&GWV\0QUU

6644

9GKVGTG/ÒP\GPFKGUGU'T\DKUEJQHUHKPFGP5KGKPFGT5RG\KCNUCOONWPI9KGFWPVGTFGP0TP 

/CZKOKNKCP(TKGFTKEJXQP-ÌPKIUGII-QPX6CNGT0QUU 9GKVGTG2T·IWPIGPFGU'T\DKUVWOU-ÌNPHKPFGP5KGWPVGTFGP0TP

314

448QT\ÒINKEJ




LINDAU

6645

  

6647

6646

56#&6

#NDWU0QUU -N2T·IGUEJY·EJGUGJTUEJÌPpXQT\ÒINKEJ #NDWU0QUU W­GTUVUGNVGPGT,CJTICPI4CWJGT5EJTÌVNKPIUGJTUEJÌP 6CNGTOKV6KVGN.GQRQNFU+0QUU 5GJTUEJÌP

  

.16-¤.0 

+PVGTGUUCPVG 5COONWPI XQP -ÌNPGT 2HGPPKIGP *QJNRHGPPKIGP 5EJKNNKPIGP WPF #NDWU5VÒEMGP FGU   ,CJTJWPFGTVUFGU'T\DKUVWOUWPFFGT5VCFVUQYKGGKPKIGUR·VGTG-NGKPOÒP\GPFCTWPVGTGKPKIG DGUUGTG5VÒEMGWPFIWVG'TJCNVWPIGP+PVGTGUUCPVG5COONWPI 5VÒEM/GKUVUGJTUEJÌP



6650 6649

-1056#0<

$+567/ 



'DGTJCTF ++ XQP 9CNFDWTI  $TCMVGCV   I $TWUVDKNF FGU $KUEJQHU X X   OKV\YGKURKV\KIGT/KVTC-TWOOUVCDWPF.KNKGP\GRVGT$GTIGT-NGKP7NOGT %%   8QT\ÒINKEJ



-14$#%*

56#&6

/CTKGPITQUEJGPQ,)TQVGNGKEJVXCT

6651

4'+%*5/ª0<5666'

44.GKEJVIGYGNNVUEJÌPpUGJTUEJÌP

6652



6653

.+0&#7



#PQP[OWO$TCMVGCVI.KPFGPDCWOOKVFTGKVGKNKIGT9WT\GNUKGDGP$N·VVGTP WPF$NÒVGP$GTIGT-NGKP7NOGT %%   -N2T·IGUEJY·EJGCO4CPFUGJTUEJÌPpXQT\ÒINKEJ





$TCMVGCV   I .KPFGPDCWO OKV FTGKVGKNKIGT 9WT\GN UKGDGP $N·VVGTP WPF  $NÒVGP   $GTIGT-NGKP7NOGT %%  5GJTUEJÌPpXQT\ÒINKEJ





#PQP[O  $TCMVGCV   I <YKUEJGP \YGK UKEJ U[OOGVTKUEJ MTÒOOGP   FGP .KPFGP\YGKIGP OKV $NÒVGP WPF $N·VVGTP GKPG DGUVKGNVG -WIGN FCTCWH -TGW\ $GTIGT    -NGKP7NOGT %%  5EJÌPG2CVKPCHCUVXQT\ÒINKEJ

 315


LÜBECK

6654

6655

6655

.+22' )4#(5%*#(65'+6(ª456'067/ 

(TKGFTKEJ 9KNJGNO .GQRQNF  )WNFGP  /ÒP\UV·VVG XGTOWVNKEJ &GVOQNF 2T·OKGPIWN   FGPIGUVKHVGVHÒTFGP(NCEJUDCW)TQVG 4-N5EJTÌVNKPIUTK­CO4CPFHCUVXQT\ÒINKEJ





2CWN#NGZCPFGT.GQRQNF8GTGKPUFQRRGNVCNGT#-5&CX-CJPV6JWP *ÒDUEJG2CVKPCXQT\ÒINKEJ



6656

6657

6658

.¤9'056'+0 

.¤9'056'+09'46*'+/41%*'(146)4#(5%*#(65'+6(ª456'067/ -CTN6JQOCU-QPX6CNGT0ÒTPDGTI&CX9KDGN

56#&6

44(CUVXQT\ÒINKEJ



.ª$'%-



4GKEJUVCNGT 5EJKNNKPI OKV6KVGN4WFQNHU++WPFFGO#D\GKEJGPFGU$ÒTIGTOGKUVGTU*GTOCPP XQP&QTPG$GJTGPUCNGKEJVXCT&CX 5GJTUEJÌP





4GKEJUVCNGT 5EJKNNKPI OKV6KVGN4WFQNHU++WPFFGO#D\GKEJGPFGU$ÒTIGTOGKUVGTU)QVVJCTF XQP*ÌXGNP$GJTGPUC&CX 2T·IGUEJY·EJGXQT\ÒINKEJp5VGORGNINCP\



316


LÜNEBURG

6660







6659

6661

5KNDGTOGFCKNNGXQP+(*KNMGPCWHFKG$ÒTIGTOGKUVGT,QJCPP9GUVMGP5GDCUVKCP)GTMGP6JQ OCU XQP 9KEMGFG WPF #FQNRJ /CVVJ·WU 4QFFG 5VCFVCPUKEJV XQP 1UVGP$TWUVDKNFGT FGT XKGT   $ÒTIGTOGKUVGTKP/GFCKNNQPUOOI$GJTGPU4ÌJN 448QT\ÒINKEJ



5KNDGTOGFCKNNG  WPUKIPKGTV CWH FGP $ÒTIGTOGKUVGT *GKPTKEJ $CNGOCPP $TWUVDKNF $CNGOCPPU T   5VCFVCPUKEJVXQP1UVGPFCXQT(CNMGPJCNDKPUGNOKV*ÒVVGPWPF$·WOGPOOI$GJTGPU 4ÌJN 45GJTUEJÌPpXQT\ÒINKEJ



6CNGT 5EJKNNKPI OKV#D\GKEJGPFGU$ÒTIGTOGKUVGTU*GKPTKEJ4WUV$GJTGPUC&CX 2CVKPCUGJTUEJÌP 'KPGP6CNGTFGU$KUVWOU.ÒDGEMHKPFGP5KGWPVGTFGT0T



6662

6663

56#&6

6663

.ª0'$74)



6CNGT/ÒP\OGKUVGT\GKEJGP)CPU *GTOCPP)CPVG -P[RJ  445GJTCVVTCMVKXGU'ZGORNCTOKVJGTTNKEJGT2CVKPCUGJTUEJÌP



$TGKVGT 5EJCWVCNGT  OKV 5KIPCVWT / * -TGW\KIWPI %JTKUVK#WHGTUVGJWPI %JTKUVK  I   $GJTGPU)CGF-PKIIG-P[RJ 44(GKPG2CVKPCUGJTUEJÌP 



&KG <WYGKUWPI FGU XQTNKGIGPFGP 5EJCWVCNGTU KUV PKEJV IGUKEJGTV 'U MQOOGP CWEJ *CODWTI QFGT.ÒDGEMKP(TCIG 7PVGTFGT5KIPCVWT/*KUVGKPPCOGPVNKEJPKEJVDGMCPPVGT/GFCKNNGWTKPFGT\YGKVGP*·NHVGFGU,CJTJWPFGTVU CWUFGOPQTFFGWVUEJGP4CWODGNGIV XIN.(QTTGT++5 

317


MAGDEBURG

6664



1,5:1

6664

4GKEJUVCNGT 5EJKNNKPI OKV6KVGN4WFQNHU++I5VCFVDWTIOKVJCNDIGÌHHPGVGO6QT FCTKP9CRRGPUEJKNF)GMTÌPVGT&QRRGNCFNGTCWHFGT$TWUV4GKEJUCRHGNFCTKP9GTV\CJN-P[RJ  8QPITQ­GT5GNVGPJGKV9KP\5EJTÌVNKPIUHGJNGTHCUVXQT\ÒINKEJGU'ZGORNCT 

6665

'4<$+567/

6667

6666

/#)&'$74)



%JTKUVKCP9KNJGNOXQP$TCPFGPDWTI4GKEJUVCNGT*CNNGX5EJT  8QPITQ­GT5GNVGPJGKV5GJTUEJÌP



4GKEJUVCNGTOKV6KVGN(GTFKPCPFU++X5EJT  44(GKPG2CVKPCMN5EJTÌVNKPIUHGJNGTCO4CPFUGJTUEJÌPpXQT\ÒINKEJ



4GKEJUVCNGT   I 5VCFVCPUKEJV FCTÒDGT UVTCJNGPFGT 0COG ,GJQXCU$GJGNOVGU XKGTHGNFKIGU   9CRRGP&CXX5EJT 44-N-TCV\GTUGJTUEJÌPpXQT\ÒINKEJ 



56#&6 

6668

'4<$+567/ 

318

/#+0<

&KGVTKEJ ++ XQP +UGPDWTI \W $ÒFKPIGP \WO  /CN  9GK­RHGPPKI )TQUEJGP  Q ,  

 /CKP\5NI9CNVJGT 4)GYGNNVUGJTUEJÌP




MAINZ

6669

6670

6671

6672



$GTVJQNFXQP*GPPGDGTI5EJKNNKPI/CKP\.GXKPUQP+5NI9CNVJGT  45GJTUEJÌP





,CMQDXQP.KGDGPUVGKP)TQUEJGP/CKP\5NI9CNVJGT  44'VYCUIGYGNNVHCUVUGJTUEJÌP





7TKGN XQP )GOOKPIGP  )TQUEJGP  /CKP\ 5NI 9CNVJGT  XIN  FQTV CPFGTG   4GKJGPHQNIGFGT9CRRGP  44#W­GTIGYÌJPNKEJIWVCWUIGRT·IVUGJTUEJÌPpXQT\ÒINKEJ





#NDTGEJV++XQP$TCPFGPDWTI)TQUEJGP/CKP\5NI9CNVJGT  48QTFGTUGKVG\WO6GKNUEJYCEJCWUIGRT·IVUGJTUEJÌP



6673



5KNDGTIW­OGFCKNNGWPUKIPKGTV$TWUVDKNFNOKV$KTGVV-CTFKPCNUJWVÒDGTXKGTHGNFKIGO9CRRGPOKV /KVVGNUEJKNF FCJKPVGT -TWOOUVCD WPF 5EJYGTV IGMTGW\V  OO  I *CDKEJ ++     5NI9CNVJGT #VVTCMVKXGT\GKVIGPÌUUKUEJGT)W­5GJTUEJÌPpXQT\ÒINKEJ

6674

6675



6676



'OGTKEJ ,QUGRJ XQP $TGKVDCEJ$ÒTTGUJGKO  -QPX6CNGT  /CKP\ &CX    5NI9CNVJGT 5GJTUEJÌPpXQT\ÒINKEJ



 

-QPX6CNGT/CKP\&CX5NI9CNVJGT -QPX6CNGT/CKP\&CX5NI9CNVJGT

 

5GJTUEJÌP -N4CPFHGJNGTUGJTUEJÌP

319


MAINZ

6677 6678

6678



-WRHGTCDUEJNCI XQP FGP 5VGORGNP FGU  6CNGTU  CWH UGKPGP 6QF 5NI 9CNVJGT   FQTV KP   5KNDGT  448QT\ÒINKEJ





(TKGFTKEJ-CTN,QUGRJXQP'TVJCN-QPX6CNGT/CKP\&CX#5NI9CNVJGT 8QT\ÒINKEJ



6679

6679 1,5:1



-QPX6CNGT/CKP\CWHFGP'PVUCV\FGTXQPFGP(TCP\QUGPDGNCIGTVGP5VCFVFWTEJFGPMCKUGTNKEJGP (GNFOCTUEJCNN )TCH %NGTHC[V  I 5VCFVCPUKEJV OKV FGO 4JGKPUVTQO WPF FGT 5EJKHHUDTÒEMG QDGP   &QRRGNCFNGTOKV5EJYGTV<GRVGTWPF4GKEJUCRHGNKPFGP(·PIGP2[TCOKFGOKV-TKGIUVTQRJ·GPFCTCWH 9GNVMWIGN\YKUEJGP.QTDGGT\YGKIGP&CX5NI9CNVJGT  42TCEJVGZGORNCT(CUV5VGORGNINCP\ 

+PFGT·NVGTGPPWOKUOCVKUEJGP.KVGTCVWTWPFKO/ÒP\JCPFGNYKTFFGTXQTNKGIGPFG6[RWUCNU<YKVVGTRT·IWPIIGHÒJTV 'DGTJCTF .KPM KP )GNFIGUEJKEJVNKEJG 0CEJTKEJVGP  ,I    MQPPVG PCEJYGKUGP FC­ GU UKEJ UVCVV   FGUUGP WO GKPGP TGIWN·TGP /CKP\GT -QPXGPVKQPUVCNGT JCPFGNV FGT CPN·­NKEJ FGT $GHTGKWPI FGT 5VCFV JGTCWUIGIGDGP   YWTFGOÌINKEJGTYGKUGCNU2T·OKGWPF#PFGPMGPHÒTFCUCO'PVUCV\DGVGKNKIVG/KNKV·T   9GKVGTG2T·IWPIGPFGU'T\DKUVWOU/CKP\HKPFGP5KGWPVGTFGP0TP

6680

56#&6 

320

5KNDGTOGFCKNNGXQP#(-ÌPKICWHFKG,CJTHGKGTFGT'THKPFWPIFGU$WEJFTWEMU$TWUVDKNF XQP ,QJCPPGU )WVGPDGTI N OKV (GNNOÒV\G WPF /CPVGN)WVGPDGTI UKV\V N \YKUEJGP &TWEMGTRTGUUG WPF   .GVVGTPMCUVGPWPFRTÒHVGKPGP&TWEMDQIGPOOI,GJPG5NI9CNVJGT  9KP\-TCV\GTXQT\ÒINKEJp5VGORGNINCP\




MECKLENBURG

6682

6681

/#05('.&)4#(5%*#(6

/#05('.&



)ÒPVJGT +++ )GDJCTF 8+ WPF 8QNTCV +++  $TGKVITQUEJGP Q , PCEJ   'KUNGDGP   6QTPCW 5GJTUEJÌP





)ÒPVJGT+8'TPUV++*Q[GT8+)GDJCTF8++WPF#NDTGEJV8++)TQUEJGP 'KUNGDGP6QTPCW -N5EJÌTVNKPIUTK­HCUVUGJTUEJÌP



6683

6684



6CNGT'KUNGDGP6QTPCW

6684

44(CUUWPIUURWTGPWPFNGKEJVMQTTQFKGTVUEJÌPpUGJTUEJÌP



/#05('.&$14056'&6)4#(5%*#(6 

*GKPTKEJ(ÒTUVXQP(QPFK4GKEJUVCNGT'KUNGDGP&CX6QTPCWF  *GPMGNURWTLWUVKGTVUGJTUEJÌP

6685

 



6686

/#45$'4)

56#&6

6CNGT )TQUEJGP OKV6KVGN4WFQNHU++5VCFGNOCKGT 6CNGT )TQUEJGP OKV6KVGN4WFQNHU++5VCFGNOCKGT

6687

5GJTUEJÌPpXQT\ÒINKEJ 5GJTUEJÌP

 

6688

/'%-.'0$74) /'%-.'0$74)(ª456'067/5'+6*'4<1)67/ 

*GKPTKEJ8&QRRGNUEJKNNKPI)TGXGUOÒJNGP-WP\GN$E  #VVTCMVKXGUUGJTUEJÌPGU'ZGORNCTOKVUEJÌPGT2CVKPCWPFJGTXQTTCIGPFGO2QTVT·V



/'%-.'0$74))ª56419*'4<1)67/ 

7NTKEJ+++4GKEJUVCNGT)TGXGUOÒJNGP-WP\GN#C  442T·IGUEJY·EJGUGJTUEJÌP

 321


MÜHLHAUSEN

6690

6689

6691

/'%-.'0$74)5%*9'4+0*'4<1)67/5'+6)4155*'4<1)67/  

%JTKUVKCP+.WFYKI6CNGT )WNFGP  UR·VGTG2T·IWPICD 4CV\GDWTI&CX -WP\GN#C 5GJTUEJÌPpXQT\ÒINKEJ (TKGFTKEJ(TCP\+6CNGT8CVGTNCPFUIWNFGP#-5,  8QT\ÒINKEJGU'ZGORNCTOKVHGKPGT2CVKPC



(TKGFTKEJ(TCP\++8GTGKPUVCNGT#-5&CX-CJPV6JWP  -CDKPGVVUVÒEM(GKPG2CVKPC'TUVCDUEJNCIHCUV5VGORGNINCP\5VGORGNINCP\



#O/·T\GTNKG­FGT*GT\QIGKPGP#WHTWH\WT$KNFWPIGKPGU,·IGTEQTRUFCUUKEJCPFGP$GHTGKWPIUMTKGIGP DGVGKNKIGPUQNNVG&WTEJ5RGPFGPUQNNVGFCU7PVGTPGJOGPWPVGTUVÒV\VYGTFGP#WUFGOGKPIGICPIGPGP5KNDGTYWTFGP FKG8CVGTNCPFUIWNFGPIGRT·IV





6693 6692

6692

/106(146

)4#(5%*#(6 

#PVQP8)WNFGP -TGW\GT .CPIGPCTIGP&CX'DPGT  *ÒDUEJG2CVKPCMN5EJTÌVNKPIUHGJNGTCO4CPFUGJTUEJÌPpXQT\ÒINKEJ

56#&6 



/ª*.*#75'0+06*ª4+0)'0

6CNGT )TQUEJGP $GJT

8QPITQ­GT5GNVGPJGKV5GJTUEJÌP



45VCTMÒDGTCTDGKVGVUGJTUEJÌP



6694

 322

-QPX6CNGTOKV6KVGN,QUGHU++&CX,


MÜNSTER

6695



6CNGT -QPX6CNGT ,



.166CNGT Z 6CNGT2HGPPKI2HGPPKI 2HGPPKI+PVGTGUUCPVGU.QVDKVVGDGUKEJVKIGP  5VÒEM(CUVUGJTUEJÌPpHCUV5VGORGNINCP\

(GKPG2CVKPCXQT\ÒINKEJ

 

6697

6698

6698

/ª056'4

$+567/ 

5GFKUXCMCP\   HCEJGT 4GKEJUVCNGT  /ÒPUVGT  I 5EJWN\G  F <GRGTPKEM   

UKGJG6H::++  #VVTCMVKXGU'ZGORNCTOKVHGKPGT2CVKPCYKP\5EJTÌVNKPIUHGJNGTHCUVXQT\ÒINKEJ





HCEJGT4GKEJUVCNGT/ÒPUVGTI5EJWN\GE<GRGTPKEM

(CUVUGJTUEJÌP





5GFKUXCMCP\6CNGT#WIUDWTI5EJWN\G<GRGTPKEM  (GKPG6ÌPWPIHCUVXQT\ÒINKEJ





5GFKUXCMCP\6CNGT%NCWUVJCN5EJWN\G<GRGTPKEM  9KP\5EJTÌVNKPIUHGJNGTNGKEJVLWUVKGTVXQT\ÒINKEJ



6699

6700

9GKVGTG2T·IWPIGPFGU$KUVWOU/ÒPUVGTHKPFGP5KGWPVGTFGP0TP 323


SAMMLUNG MÜNSTER

ex 6701

5#//.70)/ª056'4 

7OHCPITGKEJG 5COONWPI XQP /ÒP\GP /GFCKNNGP WPF /CTMGP FGU $KUVWOU WPF FGT 5VCFV /ÒPUVGT   &KG5COONWPIWOHC­VU·OVNKEJG2T·IGRGTKQFGPXQPFGP#PH·PIGPFGT/ÒPUVGTUEJGP/ÒP\RT·IWPIKO ,CJTJWPFGTVDKU\WFGPNGV\VGP2T·IWPIGPFGU,CJTGUFC\WGKPKIG0QVOÒP\GPWPF/CTMGPFGU ,CJTJWPFGTVU'KPJQEJKPVGTGUUCPVGU1DLGMVFCUUKEJJGTXQTTCIGPF\WO#WUDCWQFGTCNU'TI·P\WPI GKPGTDGTGKVUDGUVGJGPFGP5COONWPIGKIPGV'KPG$GUKEJVKIWPIUQNNVGWPDGFKPIVGTHQNIGP  5VÒEM7PVGTUEJKGFNKEJGTJCNVGPFGT)GUCOVGKPFTWEMKUVUGJTUEJÌP 



7OHCPITGKEJG 5COONWPI XQP OÒPUVGTKUEJGP -WRHGTOÒP\GP UQYKG YGKVGTG /ÒP\GP FGU YGUVH·NKUEJGP   4CWOGUWCXQP-ÌNP1UPCDTÒEMWPF2CFGTDQTP  5VÒEM5EJÌPUEJÌPpUGJTUEJÌPWPFUGJTUEJÌP

324




NASSAU

6704

6703

6703

&'49'56(.+5%*'(4+'&'0810/ª056'470&150#$4ª%- 

/ÒPUVGT5VCFV5KNDGTOGFCKNNGXQP'-GVVGNGTCWHFGP5RCPKUEJ0KGFGTN·PFKUEJGP(TKGFGP2CZ UKV\V T KP GKPGO XQP \YGK .ÌYGP IG\QIGPGP 5QPPGPYCIGP KO 8QTFGTITWPF NKGIGP 9CHHGP CWH FGO   $QFGP<GJP<GKNGP5EJTKHVOOI&GVJ1TF2CZKP0WOOKUXCT  (CUVXQT\ÒINKEJGU'ZGORNCTOKVUEJÌPGT2CVKPC





5KNDGTOGFCKNNGXQP,6JKGDCWFCWHFKG,CJTHGKGTFGU9GUVH·NKUEJGP(TKGFGPU)GTOCPKCUKV\V PCEJN\YKUEJGP#TOCVWTGPKPFGT.KPMGPJ·NVUKGGKP<GRVGTOKVFGT4GEJVGPYGKUVUKGCWHFKG5VCFVCP UKEJVXQP/ÒPUVGTKO*KPVGTITWPFNUVTCJNGPFG5QPPG)GPKWUOKVR[TIGUEJOÒEMVGT/CWGTMTQPGIGJV PCEJNXQTKJOGKP9CIGPOKV9CTGPDCNNGPWPFGKP2HNWIKO*KPVGTITWPF5VCFVCPUKEJVXQP#WIUDWTI QDGPUVTCJNGPFG5QPPGOKV)GUKEJVOOI&GVJ1TF(QTUVGT2CZKP0WOOKU 448QT\ÒINKEJ



6705

6706

6709

6707

6708

0#$$74) /ª0<5666'&'4*'4<¤)'810$#;'40 



*GKPTKEJ++FGT(TKGFHGTVKIG&GPCT6[R/ÒP\OGKUVGT9+I-TGW\KP FGP 9KPMGNP LG FTGK -WIGNP.GVVGTPMKTEJG OKV /ÒP\OGKUVGT\GKEJGP WPF \YGK 5VWHGP *CJP  # E    5GJTUEJÌP



&GPCT   6[R /ÒP\OGKUVGT 2'4  I -TGW\ KP FGP 9KPMGNP  2WPMVG   2WPMVG    2WPMVGNGGT.GVVGTPMKTEJGOKV/ÒP\OGKUVGT\GKEJGPWPF\YGK5VWHGP*CJP$D 5GJTUEJÌP



0#55#7 0#55#7)4#(5%*#(6#$(ª456'067/ 

,QJCPP (TCP\ *GKPTKEJ 9KNJGNO /QTKV\ *GKPTKEJ %CUKOKT WPF (TCP\ #NGZCPFGT    #NDWU*GTDQTP8CTKCPVGOKV/ÒP\OGKUVGT\GKEJGP#++UGPDGEMXCT 5GJTUEJÌP





#NDWU*GTDQTP+UGPDGEM





-CTN#WIWUV-TGW\GT9GKNDWTI8CTKCPVGOKV/ÒP\OGKUVGT\GKEJGP'%+UGPDGEM XCT (CUVXQT\ÒINKEJ

5GJTUEJÌP

0#55#79'+.$74)(ª456'067/  325


NASSAU

6710



6711

0#55#75+')'0)4#(5%*#(6

,QJCPP/QTKV\6CNGT+UGPDGEM

4-N5VGORGNHGJNGTUGJTUEJÌP



0#55#75%*#7/$74)*1.<#22'.(ª456'067/ 

'NKUCDGVJ%JCTNQVVG#NDWU%TCODGTI+UGPDGEM  8QPITQ­GT5GNVGPJGKV5GJTUEJÌP



6713

6712

6712

0#55#7&+'<14#0+'0(ª456'067/ 



9KNJGNO +++ 5VCVVJCNVGT FGT 0KGFGTNCPFG  5KNDGTPG *QJNIW­OGFCKNNG  XQP   2X#DGGNG$TWUVDKNFFGULWPIGP2TKP\GPKO#NVGTXQPECHÒPH,CJTGPHCUVXX/KPGTXCUKV\VPCEJN OKV *GNO 5RGGT WPF 5EJKNF XQT KJT UVGJV FGT LWPIG 2TKP\ OKV WOIGNGIVGO /CPVGN WPF 5VCD KP FGT   .KPMGPOOI'KOGTX.QQP++5 2CVKPC(GNFGTHGKP\KUGNKGTVXQT\ÒINKEJ



5KNDGTOGFCKNNGQ,  WPUKIPKGTVCWHUGKPG8GTO·JNWPIOKV/CT[XQP;QTMUR·VGTG-ÌPKIKPXQP )TQ­DTKVCPPKGP )GJCTPKUEJVGU $TWUVDKNF 9KNJGNOU +++ T$TWUVDKNF /CT[U N OKV WOIGNGIVGT 2GTNGP   MGVVGOOI'KOGTX.QQP+++5  2TCEJVGZGORNCT'PVHGTPVG6TCIGÌUGJGTTNKEJG2CVKPCXQT\ÒINKEJp5VGORGNINCP\



6714

6715

0#55#7*'4<1)67/ 

9KNJGNO-TQPGPVCNGT$GUWEJFGT/ÒP\UV·VVG9KGUDCFGP#-5&CX-CJPV 6JWP 48QT\ÒINKEJ





-TQPGPVCNGT$GUWEJFGT/ÒP\UV·VVG9KGUDCFGP#-5&CX-CJPV6JWP  4*GTTNKEJG2CVKPCXQT\ÒINKEJ



326


NEUSS

6717

6716

6718



-TQPGPVCNGT#-5&CX-CJPV6JWP

8QT\ÒINKEJ





#FQNRJ8GTGKPUFQRRGNVCNGT#-5&CX-CJPV6JWP  (GKPG2CVKPCHCUVXQT\ÒINKEJ





8GTGKPUFQRRGNVCNGT#-5&CX-CJPV6JWP

5GJTUEJÌP



8GTGKPUFQRRGNVCNGT#-5&CX-CJPV6JWP  *GTTNKEJG2CVKPCYKP\5EJTÌVNKPIUHGJNGTXQT\ÒINKEJp5VGORGNINCP\



6720

6719



0#7/$74)

$+567/ 

5KNDGTIW­OGFCKNNG Q , WPUKIPKGTV CWH FGP 0CWODWTIGT $KUEJQHUUVTGKV XQP  &QRRGNMQRH 2CRUV   WPF6GWHGN&QRRGNMQRH-CTFKPCNWPF0CTTOOI%QNN(KGYGIGT5NI9JKVKPI (GNFGTIGIN·VVGVHCUVUGJTUEJÌP

6721

 

6719

56#&6

9GK­RHGPPKIQ, ,CJTJWPFGTV 0QUU #NDWUQ, WO 0QUU



6722

0'755 44'VYCU$GNCIUGJTUEJÌP 4'VYCUUEJYCEJIGRT·IVUGJTUEJÌP

  327


NÜRNBERG

6724

6723

6723

0ª40$'4)

56#&6 



5KNDGTPG*QEJ\GKVUOGFCKNNGQ,XQP2*/ÒNNGT2CCTKPCPVKMGO)GYCPFFCUUKEJXQTGKPGOVTC IGPFGP 9GKPUVQEM FKG *·PFG TGKEJV7PVGT FGO UVTCJNGPFGP 0COGP ,GJQXCU GKP *GT\ FCU XQP GKPGT   O·PPNKEJGPWPFGKPGTYGKDNKEJGPCWU9QNMGPMQOOGPFGP*CPFIGJCNVGPYKTFFCTWPVGT6CWDGPRCCTCWH ¤N\YGKIGPOOI(QTUVGT5NI'TNCPIGT5NI)QRRGN  -N4CPFHGJNGTUGJTUEJÌP )WNFGPVCNGT -TGW\GT OKV6KVGN4WFQNHU++&CX-GNNPGT  *ÒDUEJG2CVKPCOKPDGTKGDGPYKP\5EJTÌVNKPIUHGJNGTHCUVXQT\ÒINKEJ

6725

6726

 

6727



4GKEJUVCNGTOKV6KVGN(GTFKPCPFU++&CX-GNNPGTD  -N5VGORGNHGJNGTNGKEJVLWUVKGTVUGJTUEJÌPpXQT\ÒINKEJ





)WNFGPVCNGT -TGW\GT OKV6KVGN(GTFKPCPFU++&CX-GNNPGT  4-N-TCV\GTWPF4CPFHGJNGTOKP$GCTDGKVWPIUURWTGPCO4CPFUGJTUEJÌP





5KNDGTOGFCKNNGXQP%JT/QNNGTCWHFCU5VÒEMUEJKG­GP#PUKEJVFGU5EJKG­RNCV\GUOKVXKGT-CPQ PGP \YGK $ÌNNGTP WPF FGO <KGN LGPUGKVUFGT2GIPKV\KO*KPVGTITWPFFKG5VCFVCPUKEJVQDGPIGMTÌPVGT #FNGT OKV 5EJYGTV <GRVGT WPF FTGK 9CRRGPUEJKNFGP KO #DUEJPKVV TÌOKUEJG ,CJTGU\CJN WPF 5VGORGN   UEJPGKFGTUKIPCVWT5KGDGP<GKNGP5EJTKHVWOJGT-TCP\CWUFGP9CRRGPUEJKNFGPFGTUKGDGPNVGUVGPFGU 4CVUOOI5NI'TNCPIGT 45GJTUEJÌP

328




NÜRNBERG

6728

6729



4GKEJUVCNGT&CX-GNNPGT



4GKEJUVCNGT&CX-GNNPGT&C\W-TGW\GTOKV6KVGNXQP(TCP\+-GNNPGT 5VÒEM(GNFGTNGKEJVIGIN·VVGVUGJTUEJÌPWPF5EJTÌVNKPIUHGJNGTXQT\ÒINKEJ

6730







(CUVXQT\ÒINKEJ

6731

 

6732

5KNDGTOGFCKNNGXQP229GTPGTCWHFKG,CJTHGKGTFGTªDGTICDGFGT#WIUDWTIGT-QPHGUUKQP $TWUVDKNFGT/CTVKP.WVJGTUWPF/GNCPEJVJQPUPGDGPGKPCPFGTT&KGªDGTICDGFGT-QPHGUUKQPCWHFGO 4GKEJUVCIOOI5NI'TNCPIGT++5NI9JKVKPI (GKPG6ÌPWPIHCUVXQT\ÒINKEJ



5KNDGTOGFCKNNG  XQP 2 2 9GTPGT WPF & 5 &QEMNGT CWH FKG ,CJTHGKGT FGT ªDGTICDG FGT   #WIUDWTIGT -QPHGUUKQP $TWUVDKNFGT /CTVKP .WVJGTU WPF /GNCPEJVJQPU PGDGPGKPCPFGT T&KG YGKDNK   EJGP2GTUQPKHKMCVKQPGPFGTUKGDGPRTQVGUVCPVKUEJGP4GKEJUUV·PFGMPKGPWOGKPGPDTGPPGPFGP#NVCTQDGP UVTCJNGPFGU&TGKGEMKP9QNMGPOOI5NI'TNCPIGT5NI9JKVKPI 8QT\ÒINKEJ



4GKEJUVCNGTOKV6KVGNXQP(TCP\+&CX-GNNPGT



2TCEJVXQNNG2CVKPCXQT\ÒINKEJ

329


ÖTTINGEN

6734

6733

6735



-QPX6CNGTOKV6KVGNXQP(TCP\+&CX-GNNPGT  *ÒDUEJG2CVKPCUGJTUEJÌPpXQT\ÒINKEJ





5KNDGTOGFCKNNGXQP229GTPGTCWHFKG,CJTHGKGTFGU4GNKIKQPUHTKGFGPU&KGIGJCTPKUEJVGP $TWUVDKNFGT XQP -CTN 8 WPF (TCP\ + OKV WOIGNGIVGP /·PVGNP GKPCPFGT IGIGPÒDGT<YGK KPGKPCPFGT   ITGKHGPFG *·PFG ÒDGT #NVCT CWH FGO GKPG 7TMWPFG NKGIV  OO  I 5NI 'TNCPIGT    5NI/QPVGPWQXQ5NI9JKVKPI (GKPG2CVKPCYKP\4CPFHGJNGTWPF-TCV\GTXQT\ÒINKEJ



¤66+0)'0)4#(5%*#(6 

¤66+0)'0

.WFYKI'DGTJCTF4GKEJUVCNGTOKV6KVGN(GTFKPCPFU++&CX.ÌHHGNJQN\ 5EJTÌVNKPIUHGJNGTUGJTUEJÌPpXQT\ÒINKEJ



6736 6737

6737

1.&'0$74) )4#(5%*#(65'+6*'4<1)67/#$)4155*'4<1)67/ 

%JTKUVQRJ Ó&QRRGNUEJKNNKPI/CNOÌQFGT-QRGPJCIGPOKV6KVGN%JTKUVKCPU++XQP &·PGOCTM-CNXGNCIG6TKRRNGTE 4-N2T·IGUEJY·EJGUGJTUEJÌP



%JTKUVQRJYCTMGKPTGIKGTGPFGT)TCHXQP1NFGPDWTI$GKFGOXQTNKGIGPFGP&QRRGNUEJKNNKPIJCPFGNVGUUKEJWOGKPG 2T·IWPI CWU FGT <GKV FGT )TCHGPHGJFG  7PVGT FGO 8QTYCPF %JTKUVKCP ++ XQP &·PGOCTM FGT    XGTVTKGDGPYWTFGYKGFGTGKP\WUGV\GPXGTUWEJVG%JTKUVQRJUGNDGT&·PGOCTMCPUKEJ\WDTKPIGP$GKFKGUGO8QTJC DGPYWTFGGTXQPFGT5VCFV.ÒDGEMWPVGTUVÒV\V+O(TKGFGPXQP*CODWTILGFQEJOW­VG.ÒDGEMWPFFCOKVCWEJ %JTKUVQRJCNNG#ODKVKQPGPCWHIGDGP



330

#PVQP)ÒPVJGT)WNFGP 5VÒDGT Q,,GXGTOKV6KVGN.GQRQNFU+$GPFKI&CX -CNXGNCIG6TKRRNGTD 45GJTUEJÌP




OLDENBURG

6738



/CTM )TQVG ,GXGT/ÒP\RGTKQFG/ÒP\OGKUVGT,ÒTIGP*CTVOCPP  $GPFKI -CNXGNCIG6TKRRNGTD 8QPITQ­GT5GNVGPJGKV5EJÌP

6739



6739 1,5:1



(TKGFTKEJ8XQP&·PGOCTM6CNGT1NFGPDWTII-QRHTOKV\WUCOOGP IGDWPFGPGP *CCTGP WPF <QRHUEJNGKHG WPVGP 5VGORGNUEJPGKFGT\GKEJGP $  ,QJCPP 'RJTCKO $CWGTV   5VGORGNUEJPGKFGTKP-QRGPJCIGP 9GTV\CJN&CX-CNXGNCIG6TKRRNGTD  8QPITQ­GT5GNVGPJGKV5GJTUEJÌPpXQT\ÒINKEJ 

6740

6741



2CWN(TKGFTKEJ#WIWUV6CNGT#-5&CX-CJPV6JWP  2TCEJVGZGORNCT(GKPG2CVKPC5VGORGNINCP\





0KEQNCWU(TKGFTKEJ2GVGT8GTGKPUVCNGT#-5&CX-CJPV6JWP  (CUV5VGORGNINCP\



6742

1,5:1

1,5:1

$+567/ 

150#$4ª%-

#PHCPIFGU,CJTJWPFGTVU&GPCT1UPCDTÒEMI150+0*8))'-TGW\KPFGP9KPMGNPLG GKPG-WIGN%QNQPKCOQPQITCOO-GPPGRQJN 445GJTUEJÌP

 331


OSNABRÜCK

ex 6743

5#//.70)150#$4ª%- 

332

7OHCPITGKEJG 5COONWPI XQP /ÒP\GP /GFCKNNGP WPF /CTMGP FGU $KUVWOU WPF FGT 5VCFV 1UPCDTÒEM   &KG5COONWPIWOHC­VU·OVNKEJG2T·IGRGTKQFGPXQPFGP#PH·PIGPFGT1UPCDTÒEMGT/ÒP\RT·IWPIKO ,CJTJWPFGTVDKU\WFGPNGV\VGP-WRHGTOÒP\GPFGU,CJTGUFC\WFKXGTUG/CTMGPWPF/GFCKNNGP FGU,CJTJWPFGTVU'KPJQEJKPVGTGUUCPVGU1DLGMVOKV5GNVGPJGKVGPFCUUKEJJGTXQTTCIGPF\WO#WUDCW QFGT CNU 'TI·P\WPI GKPGT DGTGKVU DGUVGJGPFGP 5COONWPI GKIPGV 'KPG $GUKEJVKIWPI UQNNVG WPDGFKPIV   GTHQNIGP 5VÒEM7PVGTUEJKGFNKEJGTJCNVGPFGT)GUCOVGKPFTWEMKUVUGJTUEJÌP  9GKVGTG2T·IWPIGPFGU$KUVWOU1UPCDTÒEMHKPFGP5KGWPVGTFGP0TP


OSTFRIESLAND

6744

156(4+'5.#0& 156(4+'5.#0&)4#(5%*#(65'+6(ª456'067/ 

'F\CTF ++ %JTKUVQRJ WPF ,QJCPP  4GKEJUVCNGT  'OFGP OKV 6KVGN (GTFKPCPFU +   /ÒP\OGKUVGT *GKPTKEJ /GKPGTVU  I $GJGNOVGT *CTR[KGPUEJKNF)GMTÌPVGU WPF IGJCTPKUEJVGU   *ÒHVDKNF (GTFKPCPFU + T OKV FGT 4GEJVGP FCU 5EJYGTV UEJWNVGTPF KP FGT .KPMGP 4GKEJUCRHGN   &CX-CRRGNJQHH-P[RJ 8QPITÌ­VGT5GNVGPJGKV(CUVUGJTUEJÌP 

6745

6746

6746



4GKEJUVCNGT Q ,   'OFGP OKV 6KVGN (GTFKPCPFU + /ÒP\OGKUVGT &KTM +FGP -TWKVMTGOGT   &CX-CRRGNJQHHXCT -N5EJTÌVNKPIUHGJNGTUGJTUEJÌP





'F\CTF ++ WPF ,QJCPP  4GKEJUVCNGT  'OFGP /ÒP\OGKUVGT ,QGUV ,CPUUGP 1JPG   /ÒP\OGKUVGT\GKEJGP&CX-CRRGNJQHHXCT 9KP\4CPFHGJNGTUGJTUEJÌP



6747



)GQTI #NDTGEJV  4GKEJUVCNGT  'UGPU  I )GJCTPKUEJVGU $TWUVDKNF T5GEJU   HGNFKIGU9CRRGPWPVGT(ÒTUVGPJWV&CX-P[RJ  8QPITÌ­VGT5GNVGPJGKV-N5EJTÌVNKPIUHGJNGTCWHFGT8QTFGTUGKVGXQT\ÒINKEJGU'ZGORNCT  333


PASSAU

1,5:1

1,5:1

2#&'4$140

$+567/ 

6748

5KOQP+\WT.KRRG2HGPPKIQ, WO $TCMGNI$KUEJQHVJTQPVXXOKV\YGK -TGW\UV·DGP&TGKVÒTOKIGU-KTEJGPIGD·WFGCWH)KGDGNFCTKP5VCFVYCRRGPXQP$TCMGN9GKPI  44)GDQIGPCW­GTIGYÌJPNKEJIWVCWUIGRT·IVUGJTUEJÌP



6750 6749

6749





*GTOCPP9GTPGTXQP9QNHH/GVVGTPKEJ\WT)TCEJV4GKEJUVCNGT0GWJCWU&CX 5EJYGFG#C 5GJTUEJÌP

&1/-#2+6'.

-W2HGPPKI4KGVDGTI5EJYGFG$C9GKPI 445EJÌPpUGJTUEJÌP 9GKVGTG2T·IWPIGPFGU$KUVWOU2CFGTDQTPHKPFGP5KGWPVGTFGP0TP

6751

$+567/

6752

 

6753

2#55#7



,QJCPP 2JKNKRR XQP .CODGTI  4GKEJUVCNGT  4GIGPUDWTI 5VGORGNUEJPGKFGT 2 *   /ÒNNGT&CX(QTUVGT-GNNPGT 0WT5VÒEMIGRT·IV5GJTUEJÌPpXQT\ÒINKEJ 



4GKEJUVCNGT#WIUDWTI&CX(QTUVGT-GNNPGT



4C[OWPF(GTFKPCPFXQP4CDCVVC4GKEJUVCNGT#WIUDWTI&CX(QTUVGT -GNNPGT /KP-TCV\GTXQT\ÒINKEJGU'ZGORNCT

334

<CKPGPFGHCUVXQT\ÒINKEJ

 


PFALZ

6754

6757

6756



6755

6756

,QUGRJ&QOKPKMWUXQP.CODGTI4GKEJUVCNGT IGRT·IV 4GIGPUDWTI8CTKCPVG OKV.CWDTCPFFCTCWHKP#DUV·PFGPFKG5KIPCVWT+%$&CX-GNNPGT  *GTTNKEJG2CVKPCXQT\ÒINKEJ

&KG 5VGORGN \W FGO XQTNKGIGPFGP 5VÒEM UVCOOGP XQP $ 4KEJVGT 9KGP &KG 2T·IWPI KP 4GIGPUDWTI GTHQNIVG   YCJTUEJGKPNKEJFWTEJFGP/ÒP\OGKUVGT,QJCPP%JTKUVQRJ$WUEJ



,QUGH (TCP\ #PVQP XQP #WGTURGTI  -QPX6CNGT  /ÒPEJGP 5VGORGN XQP  ,QUGRJ   +IPC\5EJ·WHGNXQP#JCOUVGKP&CX-GNNPGT (CUVXQT\ÒINKEJ <YGK5KNDGTOGFCKNNGPFGU$KUVWOU2CUUCWHKPFGP5KGWPVGTFGP0TPWPF

2(#.<-74(ª456'067/





2(#.<



.WFYKI8#NDWU*GKFGNDGTI5NI/GOOGUJ5NI0QUU



,QJCPP9KNJGNO5KNDGTOGFCKNNGQ,  XQP,5GNVGT)GJCTPKUEJVGU$TWUVDKNFT $TWUVDKNFUGKPGT)GOCJNKP#PPC/CTKC.WKUGXQP/GFKEKOKVJQJGT.QEMGPHTKUWTNOOI 5NI/GOOGUJ5VGORGT 445GJTUEJÌPGU'ZGORNCTOKVUEJÌPGT2CVKPC

45GJTUEJÌP

 

6758

6759

6759



-CTN 6JGQFQT   -TGW\GT  /CPPJGKO *CCU  NGKEJV XCT 5NI /GOOGUJ    2TCEJVGZGORNCT(GKPG2CVKPCHCUV5VGORGNINCP\



5KNDGTOGFCKNNGXQP#5EJ·HHGTCWHFKG'KPYGKJWPIFGT,GUWKVGPMKTEJGKP/CPPJGKO<GKNGP 5EJTKHV QDGP \YGK 'PIGNUMÌRHEJGP KP 9QNMGP WPVGP FKG /GFCKNNGWTUUKIPCVWT#PUKEJV FGT -KTEJG   OOI5VGORGT 44(CUVXQT\ÒINKEJ 



335


PFALZ

6760

6761

 

6761

5KNDGTOGFCKNNG  XQP # 5EJ·HHGT CWH FKG 'KPYGKJWPI FGT ,GUWKVGPMKTEJG KP /CPPJGKO <YGK IG   MTGW\VG 2CNO\YGKIG FCTWPVGT  <GKNGP 5EJTKHV#PUKEJV FGT ,GUWKVGPMKTEJG OKV )GD·WFGVTCMV WPF FGU   FCTCPCPUEJNKG­GPFGP,GUWKVGPMQNNGIUOOI5VGORGT 44(CUVXQT\ÒINKEJ



-QPX6CNGT/CPPJGKO&CX*CCU5NI/GOOGUJ



5GJTUEJÌPpXQT\ÒINKEJ

6762



5KNDGTOGFCKNNGQ, PCEJ XQP#5EJ·HHGT5VKHVWPIUWPF2TGKUOGFCKNNGFGUKP/CPPJGKO GTTKEJVGVGP %QNNGIKWO EJKTWTIKEWO  2TGKU HÒT #PCVQOKG)GJCTPKUEJVGU$TWUVDKNFTOKVWOIGNGIVGO *GTOGNKP *WDGTVWUQTFGP WPF FGT -GVVG FGU 1TFGPU XQO )QNFGPGP 8NKGU#WU \YGK 'KEJGP\YGKIGP   IGDKNFGVGT-TCP\FCTKP24#'/+8/#0#61/+%8/KO#DUEJPKVVFTGK<GKNGP5EJTKHVOO I5VGORGT# 8QPITÌ­VGT5GNVGPJGKV*ÒDUEJG2CVKPCXQT\ÒINKEJGU'ZGORNCT 

6763



336

5KNDGTOGFCKNNGQ, PCEJ XQP#5EJ·HHGT5VKHVWPIUWPF2TGKUOGFCKNNGFGUKP/CPPJGKO GTTKEJVGVGP%QNNGIKWOEJKTWTIKEWO2TGKUHÒT#PCVQOKG$TWUVDKNFTOKVWOIGNGIVGO*GTOGNKPWPF FGT -GVVG FGU 1TFGPU XQO )QNFGPGP 8NKGU#WU \YGK 'KEJGP\YGKIGP IGDKNFGVGT -TCP\ FCTKP   24#'/+8/#0#61/+%8/KO#DUEJPKVVFTGK<GKNGP5EJTKHVOOI5VGORGT# 8QPITÌ­VGT5GNVGPJGKV*ÒDUEJG2CVKPCXQT\ÒINKEJGU'ZGORNCT 


POMMERN

6764

6764 1,5:1



5KNDGTOGFCKNNGQ, PCEJ XQP#5EJ·HHGT5VKHVWPIUWPF2TGKUOGFCKNNGFGUKP/CPPJGKO GTTKEJVGVGP%QNNGIKWOEJKTWTIKEWO2TGKUHÒT%JKTWTIKG$TWUVDKNFTOKVWOIGNGIVGO*GTOGNKPWPF FGT -GVVG FGU 1TFGPU XQO )QNFGPGP 8NKGU#WU \YGK 'KEJGP\YGKIGP IGDKNFGVGT -TCP\ FCTKP   24#'/+8/%*+484)+%8/KO#DUEJPKVVFTGK<GKNGP5EJTKHVOOI5VGORGT# 8QPITÌ­VGT5GNVGPJGKV*ÒDUEJG2CVKPCXQT\ÒINKEJ 

6767

6765



-QPX6CNGT/CPPJGKO*CCU5NI/GOOGUJ  (GKPG2CVKPCYKP\5EJTÌVNKPIUHGJNGTCO4CPFHCUVXQT\ÒINKEJ



-TGW\GT-TGW\GT-TGW\GT&C\W9GK­RHGPPKIQ,$CEJC TCEJ 5VÒEM5EJÌPpUGJTUEJÌP



)GQTI)WUVCX4GKEJUVCNGTQ,4QVJCW0QUU5NI/GOOGUJHHXCT  'VYCULWUVKGTVMN5EJTÌVNKPIUHGJNGTUGJTUEJÌP

 

2(#.<8'.&'0< 

6768

6769

6769

21//'40 

21//'4056'66+0*'4<1)67/

(TCP\&QRRGNUEJKNNKPI5VGVVKP*KNFKUEJNGKEJVXCT

5GJTUEJÌP



7NTKEJ4GKEJUVCNGT/ÒP\UV·VVGYCJTUEJGKPNKEJ-ÌUNKPCWHUGKPGP6QF  8QPITQ­GT5GNVGPJGKV*GPMGNURWTUGJTUEJÌP



%#//+0$+567/ 

337


REGENSBURG

6771

6770

4#56#66

56#&6 

$TQP\GOGFCKNNG  XGTOWVNKEJ XQP , .G $NCPE CWH FGP (TKGFGP XQP 4CUVCVV $ÒUVG .WFYKIU :+8   XQP(TCPMTGKEJT,CPWUVGORGNOKVIGUEJNQUUGPGT6ÒTOO&KXQXIN FQTVXQP/CWIGT  5NI,WNKWUXIN FQTVXQP/CWIGT 2CZKP0WOOKUXIN FQTVXQP/CWIGT  8QT\ÒINKEJ



4#8'05$74)

4'+%*5/ª0<5666' 

6770

#PQP[O  $TCMVGCV  I &TGK IGFGEMVG <KPPGPVÒTOG FGTOKVVNGTGJCVGKPG6QTÌHHPWPI FKG ·W­GTGP UVGJGP CWH GKPGO 7PVGTDCW KP FGO UKEJ LGYGKNU GKP 4KPIGN DGHKPFGV $GTIGT    -NGKP7NOGT %%  5GJTUEJÌPpXQT\ÒINKEJ

6773

6772



6774

4')'05$74) /ª0<5666'&'4*'4<¤)'810$#;'40 

*GKPTKEJ+&GPCT/ÒP\OGKUVGT'01I-TGW\OKVLGGKPGT-WIGNKPFTGK9KPMGNP .GVVGTPMKTEJGOKV/ÒP\OGKUVGT\GKEJGPWPF\YGK5VWHGP*CJPG 5GJTUEJÌP





*GKPTKEJ++FGT<·PMGT&GPCT6[R/ÒP\OGKUVGT'0%I-TGW\OKVLG FTGK-WIGNPKPFTGK9KPMGNP.GVVGTPMKTEJGOKV/ÒP\OGKUVGT\GKEJGPWPF\YGK5VWHGP*CJPG  5GJTUEJÌP



&GPCT   6[R /ÒP\OGKUVGT 91  I -TGW\ OKV LG FTGK -WIGNP KP FTGK 9KPMGNP.GV   VGTPMKTEJGOKV/ÒP\OGKUVGT\GKEJGPWPF\YGK5VWHGP*CJPM 5GJTUEJÌP





6775

6776

6777

6778



&GPCT   6[R /ÒP\OGKUVGT /#1  I -TGW\ OKV LG \YGK -WIGNP KP FTGK 9KPMGNP   .GVVGTPMKTEJGOKV/ÒP\OGKUVGT\GKEJGPWPF\YGK5VWHGP*CJPH 5GJTUEJÌP





1VVQ  &GPCT /ÒP\OGKUVGT 5+)+  I -TGW\ OKV -WIGNP KP FGP 9KPMGNP.GVVGTPMKTEJG   OKV/ÒP\OGKUVGT\GKEJGPWPF\YGK5VWHGP*CJPJ 5GJTUEJÌP





*GKPTKEJ +++ FGT ,ÒPIGTG  &GPCT /ÒP\OGKUVGT '.0  I -TGW\ OKV GKPGT -WIGN KP   LGFGO9KPMGN.GVVGTPMKTEJGOKV/ÒP\OGKUVGT\GKEJGPWPF\YGK5VWHGP*CJPD 5GJTUEJÌP





*GKPTKEJ8FGT/QUGNGT 4GIKGTWPI &GPCT/ÒP\OGKUVGT'%%1I5EJTKHVCWH -TGW\KPFGP9KPMGNPLGFTGK2WPMVGWPFGKP&TGKGEM.GVVGTPMKTEJGOKV/ÒP\OGKUVGTPCOGP*CJPF 8QT\ÒINKEJGU'ZGORNCTOKVJGTTNKEJGT2CVKPC



338


REGENSBURG

6780

6780

6779

$+567/ 

5GFKUXCMCP\-QPX6CNGT4GIGPUDWTI&CX'OOGTKI-Q\KPQYUMK<GRGTPKEM 8QT\ÒINKEJ 9GKVGTG2T·IWPIGPFGU$KUVWOU4GIGPUDWTIHKPFGP5KGWPVGTFGP0TP



4GKEJUVCNGTOKV6KVGN(GTFKPCPFU+++$GEMGPD  44*ÒDUEJG2CVKPCUGJTUEJÌPpXQT\ÒINKEJ



56#&6 

6781

6782

6782



5KNDGTOGFCKNNG  XQP 7 )TCXGPCWGT WPF * 5 (GFGTGT CWH FCU &CPMHGUV CPN·­NKEJ FGU 9GUVH·   NKUEJGP(TKGFGPU&KG#TEJG0QCJCWH5GGÒDGTFGO$QQVHNKGIV6CWDGOKV¤N\YGKINWPVGPFGT4G IGPUDWTIGT 9CRRGPUEJKNF KP -CTVWUEJG#EJV <GKNGP 5EJTKHV KP .QTDGGTMTCP\  OO  I   &GVJ1TF2CZKP0WOOKU2NCVQ 4*ÒDUEJG2CVKPCUGJTUEJÌP





4GKEJUVCNGTOKV6KVGN.GQRQNFU+$GEMGPD&CX



2CVKPCYKP\-TCV\GTUGJTUEJÌP

6783



4GKEJUVCNGT Q ,   OKV 6KVGN -CTNU 8+  I 5VCFVCPUKEJV WPVGP 9CRRGPUEJKNF QDGP   UVTCJNGPFGU )QVVGUCWIG)GJCTPKUEJVGU $TWUVDKNF -CTNU 8+ T OKV .QTDGGTMTCP\ WPF WOIGNGIVGO /CP   VGN$GEMGPD&CX 2TCEJVGZGORNCTOKVJGTTNKEJGT2CVKPC(CUV5VGORGNINCP\  339


REGENSBURG

6784

6785

6786



-QPX6CNGTOKV6KVGNXQP(TCP\+$GEMGPD&CX$

8QT\ÒINKEJ





-QPX6CNGTOKV6KVGNXQP(TCP\+$GEMGPD&CX$  (GNFGTHGKPIGIN·VVGVUGJTUEJÌP





-QPX6CNGTOKV6KVGNXQP(TCP\+$GEMGPD&CX



6788

6787

5GJTUEJÌP

6789



-QPX6CNGTOKV6KVGN,QUGHU++$GEMGPD&CX

5GJTUEJÌP





%CTN6JGQFQTXQP&CNDGTI-QPX6CNGT#-5,  (GKPG2CVKPCOKPLWUVKGTVXQT\ÒINKEJp5VGORGNINCP\





-QPX6CNGT#-5,



(ª456'067/

340

/KPLWUVKGTVXQT\ÒINKEJGU'ZGORNCTOKVUEJÌPGT2CVKPC


REUSS

6790

6792

6791

4'755 4'7551$'4)4'+<)4#(5%*#(65'+6(ª456'067/ 

*GKPTKEJ:+++-QPX6CNGT4ÒEMUGKVGPUVGORGNXQP,QJCPP8GKV&ÌNN#-58CTK CPVG&CX-CJPV6JWP  440WT'ZGORNCTGIGRT·IV#VVTCMVKXGUUGJTUEJÌPGU'ZGORNCT





*GKPTKEJ::8GTGKPUFQRRGNVCNGT#-5&CX-CJPV6JWP  9KP\4CPFHGJNGTUGJTUEJÌPpXQT\ÒINKEJ





8GTGKPUFQRRGNVCNGT#-5&CX-CJPV6JWP



6793

(GKPG6ÌPWPIXQT\ÒINKEJ

6794

6793

4'7555%*.'+<)4#(5%*#(65'+6(ª456'067/ 

*GKPTKEJ.:++8GTGKPUFQRRGNVCNGTL·JTKIGU4GIKGTWPIULWDKN·WO#-5&CX -CJPV6JWP 40WT'ZGORNCTGIGRT·IV9KP\4CPFHGJNGTHCUVXQT\ÒINKEJ



*GKPTKEJ:+88GTGKPUVCNGT#-5&CX-CJPV6JWP  *GTTNKEJG2CVKPCXQT\ÒINKEJp5VGORGNINCP\

 

6795

4'755'$'45&14()4#(5%*#(65'+6(ª456'067/ 

*GKPTKEJ.::++8GTGKPUFQRRGNVCNGTL·JTKIGU4GIKGTWPIULWDKN·WO#-5&CX -CJPV6JWP  5GNVGPDGUQPFGTUKPFKGUGT'TJCNVWPI0WT'ZGORNCTGIGRT·IV-CDKPGVVUVÒEM 2TCEJVXQNNG2CVKPC'TUVCDUEJNCIHCUV5VGORGNINCP\  341


RIETBERG

6797 6796



6796

8GTGKPUFQRRGNVCNGT#-5&CX-CJPV6JWP  9KP\4CPFHGJNGTGVYCUDGTKGDGPXQT\ÒINKEJ



4+'6$'4) )4#(5%*#(65'+6(ª456'067/ 

,QJCPP+++XQP1UVHTKGUNCPF#FNGTUEJKNNKPIOKV6KVGNXQP/CVVJKCU$WUGXCT  445GJTUEJÌP



6799

6798

41669'+. 4'+%*5/ª0<5666' 

#PQP[O$TCMVGCVI5VKNKUKGTVGT#FNGTXX-QRHPCEJTIGYCPFV$GTIGT FQTV WPVGT(TKGFTKEJ++ -NGKP7NOGT %%  *GTTNKEJG2CVKPCXQT\ÒINKEJ





#PQP[O$TCMVGCVI5VKNKUKGTVGT#FNGTXX-QRHPCEJTIGYCPFV$GTIGT FQTV WPVGT(TKGFTKEJ++ -NGKP7NOGT %%  (CUVXQT\ÒINKEJGU'ZGORNCTOKVUEJÌPGT2CVKPC



6800

5#%*5'0 5#%*5'0-74(ª456'067/ 

(TKGFTKEJ+++FGT9GKUG)GQTIWPF,QJCPP6CNGTQ,#PPCDGTI-NCRROÒV\GPVCNGT I)GJCTPKUEJVGU$TWUVDKNFTKP-WTQTPCVOKVIGUEJWNVGTVGO<GRVGT&KG$TWUVDKNFGT)GQTIUWPF ,QJCPPUGKPCPFGTIGIGPÒDGT&CX$5EJPGG 5GJTUGNVGPDGUQPFGTUKPFKGUGT'TJCNVWPI #VVTCMVKXGU'ZGORNCTOKVJÒDUEJGT2CVKPCYKP\4CPFHGJNGTUGJTUEJÌP 

6801



342

(TKGFTKEJ+++FGT9GKUG,QJCPPWPF)GQTI6CNGTQ,#PPCDGTI-NCRROÒV\GPVCNGT &CX5EJPGG #VVTCMVKXGUUGJTUEJÌPGU'ZGORNCTOKVHGKPGT6ÌPWPI 


SACHSEN

6802



6CNGTQ,#PPCDGTI-NCRROÒV\GPVCNGT&CX5EJPGGXCT  /KP-QTTQUKQPUURWTGPKO4CPFDGTGKEJUGJTUEJÌPUGJTUEJÌPpXQT\ÒINKEJ



6803



,QJCPP (TKGFTKEJ FGT )TQ­OÒVKIG  5KNDGTIW­OGFCKNNG  9GTMUVCVV * 4GKPJCTV  FGU   NVGTGP*ÒHVDKNFHCUVXXOKVWOIGNGIVGO2GN\OCPVGNIGUEJWNVGTVGO5EJYGTVWPFOKV5EJKNFHCUVXX &TGKHCEJDGJGNOVGUTGKEJXGT\KGTVGU9CRRGPOOI*CDKEJ++5NI/GTUGD <GKVIGPÌUUKUEJGT)W­*GTTNKEJG2CVKPC(GNFGTCNVIGIN·VVGVUGJTUEJÌPpXQT\ÒINKEJ  &CU2QTVT·VFGU-WTHÒTUVGPCWHFGTXQTNKGIGPFGP/GFCKNNGIGJVCWHGKPGP*QN\UEJPKVVXQP.WECU%TCPCEJ\WTÒEM

6804



5KNDGTIW­OGFCKNNG9GTMUVCVV*4GKPJCTVFGUNVGTGP*ÒHVDKNFOKVIGUEJWNVGTVGO5EJYGTVHCUVX X&TGKHCEJ DGJGNOVGU TGKEJ XGT\KGTVGU 9CRRGP  OO  I *CDKEJ ++   5NI /GT   UGD #NVGT)W­*GPMGNURWT(GNFGTIGIN·VVGVUGJTUEJÌP

 343


SACHSEN

6806

6805

6807



,QJCPP(TKGFTKEJFGT)TQ­OÒVKIG*GKPTKEJWPF,QJCPP'TPUV6CNGT$WEJJQN\ &CX5EJPGG *ÒDUEJG2CVKPCCVVTCMVKXGUUGJTUEJÌPGU'ZGORNCT





,QJCPP(TKGFTKEJFGT)TQ­OÒVKIGWPF/QTKV\6CNGT$WEJJQN\&CX5EJPGG 45GJTUEJÌP





6CNGT#PPCDGTI&CX5EJPGG

5GJTUEJÌP





#WIWUV6CNGT#PPCDGTI&CX5EJPGG  5GNVGPGT,CJTICPI#VVTCMVKXGUUGJTUEJÌPGU'ZGORNCT





6CNGT#PPCDGTI&CX5EJPGG



6808

6810

6809

-N4CPFHGJNGTUGJTUEJÌP

6811



6CNGT ,CJTGU\CJNKO5VGORGNCWUIG·PFGTV &TGUFGP&CX5EJPGG  9KP\-TCV\GTUGJTUEJÌP





6CNGT&TGUFGP&CX5EJPGG



344

5GJTUEJÌPpXQT\ÒINKEJ


SACHSEN

6812

6812 1,5:1



%JTKUVKCP++,QJCPP)GQTI+WPF#WIWUV4GKEJUVCNGT&TGUFGP-GKNKV\-CJPV 5GJTUGNVGPKPFKGUGT'TJCNVWPI2TCEJVGZGORNCT(CUV5VGORGNINCP\

6814

6813



4GKEJUVCNGT&TGUFGP-GKNKV\-CJPV



6816



6815

(CUVXQT\ÒINKEJ



4GKEJUVCNGT&TGUFGP&CX5EJPGG

5GJTUEJÌPpXQT\ÒINKEJ





4GKEJUVCNGT&TGUFGP-GKNKV\-CJPV

5GJTUEJÌPpXQT\ÒINKEJ





4GKEJUVCNGT&TGUFGP&CX5EJPGG

5GJTUEJÌP



6817

6818



4GKEJUVCNGT&TGUFGP&CX5EJPGG

#VVTCMVKXGUHCUVXQT\ÒINKEJGU'ZGORNCT





4GKEJUVCNGT&TGUFGP&CX5EJPGG

5GJTUEJÌP

 345


SACHSEN

6819

6820

6821



,QJCPP)GQTI+WPF#WIWUV4GKEJUVCNGT&TGUFGP&CX5EJPGG  -N)TCHHKVQCWHFGT8QTFGTUGKVGUGJTUEJÌPpXQT\ÒINKEJ





4GKEJUVCNGT&TGUFGP&CX5EJPGG





-NGKPG FKEMG 4GKEJUVCNGTMNKRRG  &TGUFGP CWH FCU #TODTWUVUEJKG­GP DGK FGT 6CWHG FGU 2TKP\GP   #WIWUV5QJP,QJCPP)GQTIU+&CX5EJPGGXCT FQTVQJPG4QUGVVGPKPFGP'EMGP   4(CUUWPIUURWTGPUGJTUEJÌP

8QT\ÒINKEJGU'ZGORNCTOKVHGKPGT6ÌPWPI

&KG,CJTGU\CJNDGHKPFGVUKEJCNU%JTQPQITCOOKPFGT4ÒEMUGKVGPWOUEJTKHV

6822

6823



6824



,QJCPP)GQTI+4GKEJUVCNGT&TGUFGPCWHFCU8KMCTKCV&CX5EJPGG  8QT\ÒINKEJ



 

-KRRGT)TQUEJGP0GWUVCFVCPFGT1TNC+++5QTVG4CJPGPHÒJTGT-TWI 4GKEJUVCNGT&TGUFGP&CX5EJPGG

 

346

445GJTUEJÌP 5GJTUEJÌP


SACHSEN

6825 (doppelt)

6827

6826



&QRRGNVGT4GKEJUVCNGT&TGUFGPI&CX5EJPGG  4*GPMGNURWT(GNFGTIGIN·VVGVUGJTUEJÌP





4GKEJUVCNGT&TGUFGPCWHUGKPGP6QF&CX5EJPGG  *ÒDUEJG2CVKPCYKP\5COONGT\GKEJGPKO(GNFXQT\ÒINKEJ





4GKEJUVCNGT&TGUFGPCWHUGKPGP6QF&CX5EJPGG  *ÒDUEJG2CVKPCUGJTUEJÌPpXQT\ÒINKEJ



6828 6829

6829



,QJCPP)GQTI++4GKEJUVCNGT&TGUFGP&KEMCDUEJNCIXQPFGP5VGORGNPFGU 4GKEJUVCNGTUI%NCW­-CJPV 44*ÒDUEJG2CVKPCMN-TCV\GTUGJTUEJÌP





6CNGTPCEJ\KPPCKUEJGO(W­&TGUFGPCWHFKG8GTNGKJWPIFGU*QUGPDCPFQTFGPUWPFCWHFCU5V )GQTIU1TFGPUHGUVI&CX5EJPGG 2TCEJVXQNNG2CVKPCXQT\ÒINKEJp5VGORGNINCP\



6830



(GKPUKNDGTVCNGTPCEJ\KPPCKUEJGO(W­&TGUFGPCWHFKG8GTNGKJWPIFGU*QUGPDCPFQTFGPUWPFCWH FCU5V)GQTIU1TFGPUHGUVI&CX5EJPGG *ÒDUEJG2CVKPCUGJTUEJÌPpXQT\ÒINKEJ

 347


SACHSEN

6833

6831

6832



,QJCPP)GQTI+++6CNGTPCEJ.GKR\KIGT(W­&TGUFGPCWHUGKPGP6QF&CX 5EJPGG <CKPGPFGYKP\5EJTÌVNKPIUHGJNGTXQT\ÒINKEJ





6CNGTPCEJ.GKR\KIGT(W­&TGUFGPCWHUGKPGP6QF&CX5EJPGG





,QJCPP)GQTI+86CNGTMNKRRGPCEJ.GKR\KIGT(W­&TGUFGPCWHFGP'ORHCPIFGU *QUGPDCPFQTFGPU&CX5EJPGG  *ÒDUEJG2CVKPCYKP\5EJTÌVNKPIUHGJNGTXQT\ÒINKEJGU'ZGORNCT

5GJTUEJÌP



6835

6834

6834



6CNGT&TGUFGP%NCW­-CJPV&CX



(TKGFTKEJ#WIWUV+ #WIWUVFGT5VCTMG 5KNDGTOGFCKNNGXQP,-KVVGNCWHFKG)G DWTV FGU -WTRTKP\GP UR·VGT (TKGFTKEJ #WIWUV ++ $TWUVDKNF FGU 5VCOOXCVGTU #NDGTVWU #PKOQUWU OKV   *CWDGWPFWOIGNGIVGO2GN\HCUVXXKO#DUEJPKVV\YGK<GKNGP5EJTKHV&CU0GWIGDQTGPGCWHGKPGO -KUUGPOOI5NI/GTUGD *ÒDUEJG2CVKPCUGJTUEJÌPpXQT\ÒINKEJ

348

2TCEJVGZGORNCT8QT\ÒINKEJp5VGORGNINCP\






SACHSEN

6836



5KNDGTOGFCKNNG  WPUKIPKGTV 5VCOODCWOOGFCKNNG $TWUVDKNF (TKGFTKEJ #WIWUVU + T WOIGDGP XQP   FGP CEJV $TWUVDKNFGTP FGT -WTHÒTUVGP FGT CNDGTVKPKUEJGP .KPKG-WTYCRRGP WOIGDGP XQP FGP UGEJU   $TWUVDKNFGTP FGT -WTHÒTUVGP FGT GTPGUVKPKUEJGP .KPKG /KV 4CPFRWP\G ,5  OO   I 5NI   /GTUGD FQTVKP$TQP\G  44-N5VGORGNHGJNGTMN-TCV\GTHCUVXQT\ÒINKEJ 

6837

6838

6838



 6CNGT  &TGUFGP CWH FGP 6QF UGKPGT )GOCJNKP %JTKUVKPG 'DGTJCTFKPG XQP $TCPFGPDWTI   $C[TGWVJ&CX-QJN 9KP\5EJTÌVNKPIUHGJNGTUGJTUEJÌP





 6CNGT  &TGUFGP CWH FGP 6QF UGKPGT )GOCJNKP %JTKUVKPG 'DGTJCTFKPG XQP $TCPFGPDWTI   $C[TGWVJ &CX  -QJN  &C\W  4GKEJUVCNGT  &TGUFGP CWH FKG ,CJTHGKGT FGT   4GHQTOCVKQP-QJN5NI9JKVKPI 5VÒEM$GKFGFGHGMVUGJTUEJÌP



6839



(TKGFTKEJ#WIWUV++4GKEJUVCNGT&TGUFGP&CX5EJPGG  -N5EJTÌVNKPIUHGJNGTUGJTUEJÌP

 349


SACHSEN

ex 6841

6840

6842



4GKEJUVCNGT&TGUFGP&CX5EJPGG



(TKGFTKEJ %JTKUVKCP -QPX6CNGT&TGUFGP&C\W:CXGT-QPX6CNGT &TGUFGP&CX%5EJPGG 5VÒEM-N-TCV\GT Z UGJTUEJÌP





-QPX6CNGT.GKR\KI&CX#5EJPGG



6843

44*GPMGNURWTUGJTUEJÌP

-N5EJTÌVNKPIUHGJNGTXQT\ÒINKEJ

6846

6844

6845



6845



-QPX6CNGT.GKR\KI&CX$5EJPGG

5GJTUEJÌPpXQT\ÒINKEJ





-QPX6CNGT.GKR\KI&CX$5EJPGG

5GJTUEJÌPpXQT\ÒINKEJ





6CNGT &QRRGNITQUEJGP &TGUFGP2TQDGI$WEMC

445GJTUEJÌP





:CXGT-QPX6CNGT&TGUFGP&CX5EJPGG

5GJTUEJÌP



350


SACHSEN

6847

6849

6848



-QPX6CNGT&TGUFGP&CX5EJPGG  &WPMNG2CVKPCYKP\-TCV\GTUGJTUEJÌPpXQT\ÒINKEJ



 

-QPX6CNGT&TGUFGP&CX5EJPGG -QPX6CNGT&TGUFGP&CX5EJPGG

 

5GJTUEJÌP 5GJTUEJÌP

6850



(TKGFTKEJ #WIWUV +++ +   5KNDGTOGFCKNNG  WPUKIPKGTV CWH FGP 6QF XQP /CTKC   #OCNKC (TGFGTKMG /PKU\GEJ 6QEJVGT UGKPGU 2TGOKGTOKPKUVGTU *GKPTKEJ )TCH XQP $TÒJN IGRT·IV CWH   8GTCPNCUUWPIKJTGU)GOCJNU)GPGTCN)GQTI/PKU\GEJ&KGCPGKPCPFGTIGNGJPVGP9CRRGPXQP/PKU\GEJ WPF$TÒJN\WFGP5GKVGP)TGKHWPF.ÌYGCNU5EJKNFJCNVGTFCTÒDGT-TQPGQDGPUGEJU<GKNGP5EJTKHV 0GWP<GKNGP5EJTKHVFCTWPVGT\YGKIGMTGW\VG(CEMGNPOOI*%\ 8QT\ÒINKEJ



6851

6852

6852



5KNDGTCDUEJNCIXQPFGP5VGORGNPFGU2HGPPKI5VÒEMGU%&TGUFGPI$WEMC$  49KP\2TQDKGTURWTCO4CPFXQT\ÒINKEJ





-QPX6CNGT&TGUFGP&CX5EJPGG



-N-TCV\GTXQT\ÒINKEJ

351


SACHSEN

6853



6854

-QPX6CNGT&TGUFGP&CX5EJPGG

6853

8QT\ÒINKEJ



5#%*5'0-¤0+)4'+%* 

(TKGFTKEJ #WIWUV +   -QPX6CNGT  5)* #-5  FQTV OKV HCNUEJGT 8QTFGT   UGKVGPCDDKNFWPI , 9KP\5EJTÌVNKPIUTK­XQT\ÒINKEJ



6855



5KNDGTOGFCKNNGXQP(5VCFGNOCPPWPF-4-TÒIGT2T·IWPIFGT)TWDG*KPVGT'TDKUFQTHCPN·­ NKEJUGKPGUL·JTKIGP4GIKGTWPIULWDKN·WOU$ÒUVGTFCTWPVGT5EJNCPIGKO1XCN*ÒIGNKIG.CPFUEJCHV OKV6CPPGPFCTKP5EJCEJVIGD·WFGWPFOGJTGTG$GVTKGDUIGD·WFGKO#DUEJPKVV5EJN·IGNWPF'KUGPIG MTGW\VOOI/ÒUGNGT5NI/GTUGD 45GJTUEJÌP 

6856

6857

6857



-QPX6CNGT)5#WUDGWVG#-5&CX#-CJPV6JWP  4*ÒDUEJG2CVKPCMN5VGORGNHGJNGTXQT\ÒINKEJ





(TKGFTKEJ#WIWUV++5KNDGTOGFCKNNGXQP#(-ÌPKICWHFKG'PVJÒNNWPIFGU&GPM OCNU HÒT (TKGFTKEJ #WIWUV ++ KO &TGUFGPGT <YKPIGT #PUKEJV FGU &GPMOCNU&TGK JWNFKIGPFG YGKDNK   EJG)GUVCNVGPOOI5NI/GTUGD 45VGORGNINCP\



352


SACHSEN

6858

6859

6859



,QJCPP6CNGT(#WUDGWVG#-5&CX-CJPV6JWP  4*GTTNKEJG2CVKPCOKP5EJTÌVNKPIUHGJNGTXQT\ÒINKEJp5VGORGNINCP\





&QRRGNVGT8GTGKPUVCNGT$#-5&CX-CJPV6JWP

8QT\ÒINKEJ



&QRRGNVGT8GTGKPUVCNGT$)QNFGPG*QEJ\GKV#-5&CX-CJPV6JWP  (GKPG6ÌPWPIXQT\ÒINKEJ



6861 6860

6860



$GKFKGUGO5VÒEMJCPFGNVGUUKEJWOFKGNGV\VG6CNGTRT·IWPIKP&GWVUEJNCPF

'+0'5+.$'4/'&#+..'#75#00#$'4) 

#PPCDGTI5KNDGTOGFCKNNGXQP(*-TÒIGTCWHFKG,CJTHGKGTFGT$GTIUVCFV5VCFVCPUKEJVXQP #PPCDGTIXQTFGO2ÌJNDGTIKO*KPVGTIWPF5QPPGPCWHICPI#EJV<GKNGP5EJTKHVOOI /ÒUGNGTC5NI/GTUGD 5GJTUEJÌPpXQT\ÒINKEJ



6862

5#%*5'0<'+6<*'4<1)67/ 

/QTKV\  4GKEJUVCNGT  CWH FGP $CW FGU 5EJNQUUGU /QTKV\DWTI KP <GKV\ &CX    5EJPGG 445GJTUEJÌP  -WTUCEJUGPGTNKVVGTJGDNKEJGVGTTKVQTKCNG8GTNWUVGCNU-WTHÒTUV,QJCPP)GQTI+FWTEJUGKP6GUVCOGPVUGKPGLÒPIGTGP 5ÌJPG #WIWUV %JTKUVKCP WPF /QTKV\ OKV WOHCPITGKEJGP )GDKGVGP CWUUVCVVGVG WPF FGT ·NVGUVG 5QJP ,QJCPP)GQTI++ FKGU KO *CWRVXGTINGKEJ \W &TGUFGP CO  #RTKN  CPGTMCPPVG 5Q GPVUVCPFGP FKG FTGK MWTU·EJUKUEJGP 0GDGPNK   PKGP5CEJUGP9GK­GPHGNU5CEJUGP/GTUGDWTIWPF5CEJUGP<GKV\&CU*GT\QIVWO5CEJUGP<GKV\WOHC­VGCW­GTFGO XQTJGTKIGP 5VKHV 0CWODWTI<GKV\ FGP 8QIVN·PFKUEJGP WPF 0GWUV·FVGT -TGKU 6CWVGPDWTI WPF FGP CNDGTVKPKUEJGP   #PVGKN CP *GPPGDGTI &GT GTUVG *GT\QI NKG­ FKG CWHYGPFKIG /QTKV\DWTI GTDCWGP YQTCWH FKG JKGT CPIGDQVGPG 2T·   IWPI$G\WIPKOOV

353


SACHSEN

6863

5#%*5'0*'4<1)67/ 'TPGUVKPGTPCEJFGO8GTNWUVFGT-WTYÒTFG  

,QJCPP (TKGFTKEJ ++  IGUVQTDGP  KP )GHCPIGPUEJCHV 5EJTGEMGPDGTIGT  5CCN   HGNF-QRRGE 5GJTUEJÌPpXQT\ÒINKEJ

6864

6865



6866

5#%*5'0%1$74)'+5'0#%**'4<1)67/ 

,QJCPP %CUKOKT WPF ,QJCPP 'TPUV  4GKEJUVCNGT  %QDWTI &CX  -Q\KPQYUMK    1VVQ4W­5EJPGG (CUVXQT\ÒINKEJ



5#%*5'0#.6'0$74)*'4<1)67/ 

,QJCPP 2JKNKRR (TKGFTKEJ ,QJCPP 9KNJGNO WPF (TKGFTKEJ 9KNJGNO ++   4GKEJUVCNGT   5CCNHGNF&CX-GTPDCEJ5EJPGG 5GJTUEJÌP



,QJCPP 2JKNKRR WPF (TKGFTKEJ 9KNJGNO ++  4GKEJUVCNGT  5CCNHGNF !  CWH FGP 6QF   FGU*GT\QIU,QJCPP2JKNKRRI&CX-GTPDCEJ5EJPGG  4(GKPG2CVKPCMN-TCV\GTUGJTUEJÌP 



,QJCPP 2JKNKRR YWTFG  KP #NVGPDWTI IGDQTGP 'T YCT UGKV UGKPGT 8QNNL·JTKIMGKV  DKU \W UGKPGO 6QF TGIKG   TGPFGT*GT\QIXQP5CEJUGP#NVGPDWTI+O1MVQDGTJGKTCVGVGGT'NKUCDGVJ6QEJVGTFGU*GT\QIU*GKPTKEJ,WNKWU XQP$TCWPUEJYGKI.ÒPGDWTI,QJCPP2JKNKRRXGTUVCTDWPFYWTFGKPFGT$TÒFGTMKTEJGKP#NVGPDWTIDGKIGUGV\V 'T JKPVGTNKG­ MGKPG O·PPNKEJGP 'TDGP UGKPG GKP\KIG 6QEJVGT 'NKUCDGVJ 5QRJKC XGTO·JNVG UKEJ OKV *GT\QI 'TPUV +  

FGO(TQOOGP XQP5CEJUGP)QVJC

6867



354

(TKGFTKEJ9KNJGNO++4GKEJUVCNGT5CCNHGNFI)GJCTPKUEJVGU*ÒHVDKNFTKP FGT4GEJVGP-QOOCPFQUVCDKPFGT.KPMGP*GNO5GEJUHCEJDGJGNOVGU9CRRGP&CX-GTPDCEJ 5EJPGG 445GJTUEJÌP




SACHSEN

6868



(TKGFTKEJ  $TQP\GOGFCKNNG  XQP ( -ÌPKI CWH UGKP L·JTKIGU 4GIKGTWPIULWDKN·WO   $TWUVDKNFNOKVWOIGNGIVGO/CPVGN(ÒPH<GKNGP5EJTKHVÒDGT'KEJGPNCWD\YGKII5NI/GTUGD 8QT\ÒINKEJ

(TKGFTKEJJCVVGXQPDKUKP5CEJUGP*KNFDWTIJCWUGPTGIKGTV

6869



6871

6870



6872

'TPUV+8GTGKPUVCNGT#-5&CX-CJPV6JWP$  2TCEJVGZGORNCT#WUFTWEMUXQNNG2CVKPCHCUV5VGORGNINCP\



5#%*5'09'+/#4*'4<1)67/#$5#%*5'09'+/#4'+5'0#%* 

(TKGFTKEJ9KNJGNOWPF,QJCPP6CNGT5CCNHGNF5NI/GTUGD  45GJTUEJÌPpXQT\ÒINKEJ





4GKEJUVCNGT5CCNHGNF-QRRG





,QJCPP'TPUVWPFUGKPGUGEJU$TÒFGT-KRRGT5GEJUD·V\PGT FQRRGNVGT5EJTGEMGPDGTIGT  9GKOCT$QTPGOCPP5NI/GTUGD -N<CKPGPFGUGJTUEJÌP

45GJTUEJÌP



6873



9KNJGNO5KNDGTOGFCKNNGWPUKIPKGTVCWHFKGHGKGTNKEJGªDGTHÒJTWPIFGT)GDGKPGUGKPGU $TWFGTUFGUKP0GWGPDWTIIGUVQTDGPGP*GT\QIU$GTPJCTFCWUFGTRTQXKUQTKUEJGP4WJGUV·VVGKO $TGKUCEJGT/ÒPUVGTPCEJ9GKOCT*GT\QI$GTPJCTFMPKGVXQT%JTKUVWUFGTGKPG5KGIGUHCJPGJ·NVFCT ÒDGT 'PIGN OKV -TQPGKO*KPVGTITWPFFKG5VCFVCPUKEJVXQP$TGKUCEJOKV#TOGG<GJP<GKNGP5EJTKHV OOI&C­FQTH5NI/GTUGD6GPV\GN6H+++  44ªDNKEJGT5VGORGNHGJNGTCVVTCMVKXGUXQT\ÒINKEJGU'ZGORNCTOKVHGKPGT2CVKPC  355


SACHSEN

6874 1,5:1



6874

4GKEJUVCNGT9GKOCTCWHFKGJGPPGDGTIKUEJG6GKNWPII$TWUVDKNFTOKVWOIGNGIVGO/CP VGN(ÒPH<GKNGP5EJTKHVKP5VTCJNGPMTCP\QDGP\YGK9CRRGPUEJKNFGWPVGT-TQPG&CX5EJPGG 5GJTUGNVGPDGUQPFGTUKPFKGUGT'TJCNVWPI#VVTCMVKXGUXQT\ÒINKEJGU'ZGORNCT



6875



9KNJGNO 'TPUV  5KNDGTOGFCKNNG  XQP %JT 9GTOWVJ CWH FGP 6QF UGKPGU LÒPIGTGP   $TWFGTU ,QJCPP 'TPUV )GJCTPKUEJVGU $TWUVDKNF N)GJCTPKUEJVGU $TWUVDKNF XQP ,QJCPP 'TPUV T FCXQT   FKG$TWUVDKNFGTUGKPGTFTGKXQTKJOIGUVQTDGPGP)GUEJYKUVGTNOOI5NI/GTUGD 9QJNHCJTV 45GJTCVVTCMVKXGUXQT\ÒINKEJGU'ZGORNCTOKVHGKPGT2CVKPC

6876

6877



6878



 4GKEJUVCNGT  9GKOCT CWH UGKPGP )GDWTVUVCI WPF FKG 5VKHVWPI HÒT -KTEJGP WPF 5EJWNFKGPGT   5NI/GTUGD 45GJTUEJÌP





%CTN#WIWUV-QPX6CNGT/KV.CWDTCPF#-5&CX-CJPV6JWP 5GJTUEJÌPpXQT\ÒINKEJ





5KNDGTOGFCKNNGXQP(9(CEKWUCWHFCUL·JTKIG&KGPUVLWDKN·WOFGU9GKOCTGT5VCCVUOKPKUVGTU %JTKUVKCP )QVVNQD XQP 8QKIV $TWUVDKNF FGU 5VCCVUOCPPGU N&TGK KPGKPCPFGT XGTUEJNWPIGPG -T·P\G   OOI(TGFG 5GJTCVVTCMVKXGUXQT\ÒINKEJGU'ZGORNCTOKVHGKPGT6ÌPWPI



356


SACHSEN

6879

6881

6880



%CTN(TKGFTKEJ8GTGKPUFQRRGNVCNGT#-5&CX-CJPV6JWP  5GJTUEJÌP



%CTN #NGZCPFGT  8GTGKPUFQRRGNVCNGT  #-5  &CX  -CJPV  6JWP    2TCEJVGZGORNCT5VGORGNINCP\ 



8GTGKPUFQRRGNVCNGT#-5&CX-CJPV6JWP

6882

6883

8QT\ÒINKEJ





6884

5#%*5'0,'0#*'4<1)67/ 

$GTPJCTF6CNGT'KUNGDGP&CX FKGUGU'ZGORNCT (TGFGD  4*ÒDUEJG2CVKPCCVVTCMVKXGUUGJTUEJÌPGU'ZGORNCT





6CNGT'KUNGDGP&CX(TGFGF

4/KP5EJTÌVNKPIUHGJNGTUGJTUEJÌP





6CNGT'KUNGDGP&CX \W (TGFGE  5GNVGPDGUQPFGTUKPFKGUGT'TJCNVWPI8QT\ÒINKEJ

 357


SACHSEN

6885

5#%*5'0)16*#*'4<1)67/#$5#%*5'0)16*##.6'0$74) 

'TPUV FGT (TQOOG  4GKEJUVCNGT  )QVJC CWH UGKPGP 6QF WPF UGKPG $GKUGV\WPI &CX   5EJPGG5VGIWYGKV 4*ÒDUEJG2CVKPCUGJTUEJÌPpXQT\ÒINKEJ 

6886



(TKGFTKEJ + CNNGKP  &QRRGNVGT (GKPUKNDGTVCNGT PCEJ \KPPCKUEJGO (W­ Q , )QVJC    I )GJCTPKUEJVGU $TWUVDKNF T OKV WOIGNGIVGO /CPVGN)GUEJNQUUGPG -TQPG OKV <GRVGT CWH -KU   UGP KO #DUEJPKVV FKG 5KIPCVWT + Û ) NKGIGPFGT <CKPJCMGP  9 Û ,QJCPP )QVVHTKGF 9KEJOCPPUJCWUGP   /ÒP\OGKUVGTKP)QVJC &CX#5EJPGG5VGIWYGKV FQTVCNU(GKPUKNDGTUEJCWVC NGT  44#VVTCMVKXGU'ZGORNCTOKVHGKPGT2CVKPCHCUVXQT\ÒINKEJ 

6887



358

(TKGFTKEJ ++  4GKEJUVCNGT  )QVJC (COKNKGPVCNGT  I $ÒUVG T&KG GKPCPFGT   \WIGYCPFVGP $ÒUVGP FGT UKGDGP2TKP\GPOKVKJTGP0COGPKPQXCNGPXQP2CNO\YGKIGPIGTCJOVGP/G FCKNNQPU KP FGT /KVVG FKG $ÒUVG FGU ·NVGUVGP 2TKP\GP WPF UR·VGTGP *GT\QIU (TKGFTKEJ +++ &CX    5EJPGG5VGIWYGKV 448QT\ÒINKEJ 


SACHSEN

6888



5KNDGTOGFCKNNGXQP%JT9GTOWVJCWHFKG8GTO·JNWPIUGKPGU5QJPGU(TKGFTKEJ UR·VGT(TKGFTKEJ +++  OKV .QWKUG &QTQVJGC XQP 5CEJUGP/GKPKPIGP 5VCOODCWO KP FGT /KVVG FCU OKV FGO (ÒTUVGPJWV   DGNGIVGU·EJUKUEJG9CRRGPWOJGTCWHFGP<YGKIGPRCCTYGKUGCPIGQTFPGVG/GFCKNNQPUOKVFGP$KNFPKU UGPXQP'TPUVFGO(TQOOGP(TKGFTKEJ+XQP)QVJC$GTPJCTF+XQP/GKPKPIGPUQYKG.WFYKI+XQP /GKPKPIGP LGYGKNU OKV KJTGP )GOCJNKPPGP <GKNGP IGDQIGPG 5EJTKHV QDGP FCU 5VGTPDKNF FGT CWH   9QNMGPUKV\GPFGP,WPIHTCWOKV2CNO\YGKIWPF$NWOGOOI5NI/GTUGD9QJNHCJTV  QJPG#DDKNFWPI  8QPITÌ­VGT5GNVGPJGKVDGMCPPVGU'ZGORNCT 2TCEJVGZGORNCTOKVHGKPGT6ÌPWPI8QT\ÒINKEJp5VGORGNINCP\  'ZGORNCTFGT5NI2TKP\2JKNKRRXQP5CEJUGP%QDWTI)QVJC#WMVKQP.*CODWTIGT(TCPMHWTV0T

8QPUEJÌPUVGT'TJCNVWPI   &KGUG ·W­GTUV UGNVGPG WPF JÒDUEJG /GFCKNNG FGU CW­GTQTFGPVNKEJ DGICDVGP )QVJCGT 5VGORGNUEJPGKFGTU %JTKUVKCP   9GTOWVJ KUV GTUVOCNKI  XQP 'OKN $CJTHGNFV KP UGKPGT 5EJTKHV &KG 8GTO·JNWPIUOGFCKNNGP FGU JGT\QINKEJGP   *CWUGU 5CEJUGP%QDWTI)QVJC WPVGT 0T  XGTÌHHGPVNKEJV YQTFGP 'T UEJTKGD &KG /GFCKNNG UEJGKPV DKUJGT PQEJ   PKEJVRWDNK\KGTV\WUGKPOGKPGU9KUUGPUKUVUKGPWTKPFGT5COONWPIFGU*GTTP%QOOGT\KGPTCVJU*GTOCPP8QIGNKP %JGOPKV\ XQTJCPFGP &KGUGU 'ZGORNCT YWTFG KO 1MVQDGT  XQP #FQNRJ *GUU 0CEJH KP (TCPMHWTV CO /CKP   WPVGT FGT 0T  XGTUVGKIGTV YQDGK KO -CVCNQI CWUFTÒEMNKEJ FCTCWH JKPIGYKGUGP YWTFG FC­ FKG /GFCKNNG   PKTIGPFU DGUEJTKGDGP UGK 'U YCT TGKPGT<WHCNNFC­CEJV/QPCVG\WXQTOKVFGT8GTUVGKIGTWPIFGT5COONWPIFGU 2TKP\GP 2JKNKRR XQP 5CEJUGP%QDWTI)QVJC FWTEJ .GQ *CODWTIGT GDGPHCNNU (TCPMHWTV CO /CKP GKP YGKVGTGU FCU   PWP JKGT XQTNKGIGPFG  'ZGORNCT CWH FGP /CTMV IGNCPIVG #W­GT FKGUGP DGKFGP 5VÒEMGP CWU FGP 5COONWPIGP 8QIGN   WPF 2TKP\ 2JKNKRR XQP 5CEJUGP%QDWTI)QVJC KUV PCEJ WPUGTGP 4GEJGTEJGP MGKP YGKVGTGU 'ZGORNCT DGMCPPV #WEJ   %QTFWNC9QJNHCJTVFKGCNNG/GFCKNNGP%JTKUVKCP9GTOWVJUKPFGPGKPUEJN·IKIGP/ÒP\MCDKPGVVGPTGIKUVTKGTVGMQPPVG MGKPGP 5VCPFQTV FGT UGNVGPGP 2T·IWPI PCEJYGKUGP WPF FCU 5VÒEM FCJGT CWEJ PKEJV KP KJTGO -QTRWUYGTM ÒDGT FKG   9GTOWVJ/GFCKNNGPCDDKNFGP

6889

6890



(TKGFTKEJ+++-QPX6CNGT)QVJC&CX5EJPGG5VGIWYGKV  5GJTUEJÌPpXQT\ÒINKEJXQT\ÒINKEJ



'TPUV++6CNGT -QPX6CNGT )QVJC&CX5EJPGG5VGIWYGKV 8QPITQ­GT5GNVGPJGKV#VVTCMVKXGUUGJTUEJÌPGU'ZGORNCTOKVUEJÌPGT6ÌPWPI 



&KGUG WPF FKG DGKFGP HQNIGPFGP /ÒP\GP FGU )QVJCGT *GT\QIU 'TPUV ++ IGJÌTGP \W FGP PWOKUOCVKUEJ KPVGTGUUCPVG   UVGP 2J·PQOGPGP FGT CP IGNFIGUEJKEJVNKEJGP $GUQPFGTJGKVGP PKEJV CTOGP 6JÒTKPIGT 9·JTWPIUNCPFUEJCHV 9GIGP   FKGUGT 5VÒEMG ICD GU KO IGUCOVGP 4GKEJ #WHTGIWPI &KG MWTHÒTUVNKEJDC[GTKUEJG4GIKGTWPIYCTPVGCO(GDTWCT KPGKPGO(NWIDNCVVFCUKPFGO-QTRWUYGTM\WT)QVJCGT/ÒP\RT·IWPIXQP9QNHICPI5VGIWYGKVCWH5GKVG CDIGDKNFGVKUV  0CEJFGOGUKEJXGTQHHGPDCTGVFC­GKPKIGPCEJFGPQDGPDG[IGHÒIVGP#DFTÒEMGPCWUIGOÒP\VG*GT\QINKEJ5CEJUGP )QVJCKUEJG /ÒP\GP OKV FGT #WHHUEJTKHV :8 WPF ::: GKPG HGKPG /CTM WPF FGT ,CJT\CJN  WPVGT FGP   IGTGEJVGPICP\WPFJCNDGP-QPXGPVKQPU6JCNGTPXQTXQNNCWUIGIGDGPYGTFGPYQNNGPFKGUG/ÒP\GPCDGTPKEJVPWT CNNGKPICP\-QPXGPVKQPUYKFTKIWPFUQIGH·JTNKEJGTUKPFCNUUQNEJGFGO-QPXGPVKQPU6JCNGTKPFGO·W­GTNKEJGP )GYKEJV ICP\ PCJG MÌOOGP WPF INGKEJYQJNGP XGTOÌI KJTGU KPPGTNKEJGP )GJCNVU FGP 9GTVJ GKPGU 6JCNGTU DG[   YGKVGPPKEJVGTTGKEJGPUQJKPPI·P\NKEJCW­GT-QWTU\WJCNVGPUKPF5QYKTFJKGTFWTEJLGFGTOCPPIGYCTPGVUKEJDG[ <CJNWPIGP KP -QPXGPVKQPU6JCNGTP HÒT FGTINGKEJGP #PPCJOG FKGUGT WP·EJVGP 5QTVGP YGIGP FGT KO *CPFGN WPF   9CPFGN\WDGUQTIGPUVGJGPFGP)GH·JTFGUQTIH·NVKI\WJÒVGP  &KG 5VÒEMG DGK FGPGP GU UKEJ FGO ·W­GTGP 'TUEJGKPWPIUDKNF PCEJ WO -QPXGPVKQPUVCNGT D\Y JCNDVCNGT JCPFGNV   QHHGPDCTGP KJTGP YKTMNKEJGP 9GTV  D\Y  -QPXGPVKQPUVCNGTP  GTUV DGK IGPCWGO $GVTCEJVGP WPF 0CEJXQNN\KG   JGPFGTCWHIGRT·IVGP9GTV\CJN:8D\Y:::'KPG(GKPG/CTM&CUVTÒIGTKUEJG'TUEJGKPWPIUDKNFNGIVGKPGDGVTÒ IGTKUEJG#DUKEJVPCJGGKPG·W­GTUVRGKPNKEJG#PIGNGIGPJGKVHÒT/ÒP\OGKUVGT.CPFGUTGIKGTWPIWPFFGP2T·IGJGTTP 'TPUV++UGNDUV9KTHTGWGPWPU+JPGPGKPGXQNNUV·PFKIG5GTKGFKGUGTUGJTUGNVGPGP2T·IWPIGPCPDKGVGP\WMÌPPGP

359


SACHSEN

6891

6892



6CNGT -QPX6CNGT )QVJC5VGIWYGKV

445GJTUEJÌP





6CNGT -QPX6CNGT )QVJC5VGIWYGKV

(GKPG6ÌPWPIUGJTUEJÌPpXQT\ÒINKEJ



6893





6894 6893

-QPX6CNGT)QVJC&CX5EJPGG5VGIWYGKV

8QT\ÒINKEJ



$GTPJCTF'TKEJ(TGWPF)WNFGP#-5,  2TCEJVGZGORNCTXQPRQNKGTVGP5VGORGNP-N(GKNUVGNNGCO4CPFHCUV5VGORGNINCP\



5#%*5'0/'+0+0)'0*'4<1)67/ 810$+55#%*5'0%1$74)/'+0+0)'0

6896

6895

6897

5#%*5'05##.('.&*'4<1)67/#$5#%*5'0%1$74)5##.('.& 

%JTKUVKCP 'TPUV CNNGKP  5KNDGTCDUEJNCIXQPFGP5VGORGNPFGU&QRRGNFWMCVGPQ,   5CCNHGNFCWHUGKPGP6QF)TCUUGTD-Q\KPQYUMK1VVQ4W­C5NI/GTUGD  *ÒDUEJG2CVKPCUGJTUEJÌPpXQT\ÒINKEJ



(TCP\(TKGFTKEJ#PVQP-QPX6CNGT#-5&CX-CJPV6JWP  440WTEC'ZGORNCTGIGRT·IV8QT\ÒINKEJGU'ZGORNCTOKVHGKPGT6ÌPWPI



'TPUV+-QPX6CNGT/KV4CPFUEJTKHV'+052'%+'56*#.'4#-5&CX -CJPV6JWP (GKPG2CVKPCXQT\ÒINKEJ

360

  


SAYN

6898

6900

6899



-QPX6CNGT/KV4CPFUEJTKHV'+052'%+'56*#.'4#-5&CX-CJPV6JWP .GKEJVLWUVKGTVXQT\ÒINKEJ





-QPX6CNGT/KV.CWDTCPF#-5&CX-CJPV6JWP  5EJTÌVNKPIUHGJNGTHGKPG6ÌPWPIXQT\ÒINKEJ



5#%*5'0%1$74)70&)16*#*'4<1)67/ 

'TPUV+-TQPGPVCNGT#-5&CX-CJPV6JWP  48QT\ÒINKEJGU'ZGORNCTOKVHGKPGT6ÌPWPI

6901



6903

6902

-TQPGPVCNGT#-5&CX-CJPV6JWP



45GJTUEJÌPpXQT\ÒINKEJXQT\ÒINKEJ



5#;0 5#;09+66)'056'+0*1*'056'+0)4#(5%*#(6 

,QJCPP8+++4GKEJUVCNGT/KPFGPI)GJCTPKUEJVGU$TWUVDKNFTCWHFGT$TWUV 4QUGVVG8KGTHCEJDGJGNOVGUUGEJUHGNFKIGU9CRRGPOKV/KVVGNUEJKNF&CX/,8  44*ÒDUEJG2CVKPCYKP\-TCV\GTUGJTUEJÌP



)WUVCX/CTKGPITQUEJGPWPDGUVKOOVG/ÒP\UV·VVG&CX/,8  #VVTCMVKXGUUGJTUEJÌPGU'ZGORNCT

  361


SCHAUMBURG-LIPPE

6904

5%*#7/$74).+22' 5%*#7/$74).+22')4#(5%*#(65'+6(ª456'067/ 

#NDGTV9QNHICPI5KNDGTOGFCKNNGCWHFKG9KGFGTJGTUVGNNWPIFGU5EJNQUUGUKP$ÒEMG DWTIPCEJFGO$TCPF$TGPPGPFGU5EJNQ­KO8QTFGTITWPFXKGT/·PPGTFKGOKV*CEMGPGKPGJGTCDIG UVÒT\VG 2CTVKG FGU &CEJGU \GTVGKNGP#PUKEJV FGU 0GWDCWGU FCXQT CTDGKVGPFG WPF CNNGIQTKUEJG (KIWTGP   OOI9GKPO 48QT\ÒINKEJ 

6905

6907

6906



9KNJGNO(TKGFTKEJ'TPUV6CNGT$ÒEMGDWTI/KV#PICDG(GKPUKNDGT&CX# 9GKPO 5GJTCVVTCMVKXGUHCUVXQT\ÒINKEJGU'ZGORNCT





)GQTI 9KNJGNO WPVGT 8QTOWPFUEJCHV FGU )TCHGP .WFYKI XQP 9CNNOQFGP)KODQTP    -QPX6CNGT#-5&CX-CJPV6JWP  *GTTNKEJG2CVKPCOKP5EJTÌVNKPIUHGJNGTXQT\ÒINKEJ



)GQTI9KNJGNO8GTGKPUVCNGT#-5&CX-CJPV6JWP  2TCEJVGZGORNCT'TUVCDUEJNCIHCUV5VGORGNINCP\5VGORGNINCP\





6908

6909



#FQNH)GQTI8GTGKPUVCNGT#-5&CX-CJPV6JWP  2TCEJVGZGORNCTXQPRQNKGTVGP5VGORGNP/KP(NGEMGPHCUV5VGORGNINCP\





8GTGKPUVCNGT#-5&CX-CJPV6JWP  2TCEJVGZGORNCT*GTTNKEJG2CVKPCHCUV5VGORGNINCP\



362


SCHLESIEN

6910

6911

5%*.'5+'0

*'4<1)67/ 

6911

&KGUEJNGUKUEJGP5V·PFG'KPUGKVKIG6CNGTMNKRRG1JNCW(W5NGKEJVXCT  *ÒDUEJG2CVKPCXQT\ÒINKEJ



%JTKUVKCP4GKEJUVCNGT$TKGI&CX(W5  4(GNFGTIGIN·VVGVHCUVXQT\ÒINKEJ



.+')0+6<$4+')*'4<1)67/ 

6913

6912

6912

5%*.'5+5%*'/'&#+..'0 



5KNDGTOGFCKNNG Q , XQP , $WEJJGKO 4GNKIKÌUG /GFCKNNG CWH FKG 5GJPUWEJV FGT 2TQVGUVCPVGP PCEJ   4GNKIKQPUHTGKJGKV &KG RGTUQPKHK\KGTVG *QHHPWPI OKV 2CNO\YGKI WPF #PMGT UKV\V X X CWH 5EJPGEMG   &KG 2GTUQPKHKMCVKQPGP XQP 6WIGPF )GTGEJVKIMGKV WPF (TÌOOKIMGKV OKV KJTGP #VVTKDWVGP  OO    I)CGFC#PO5NI)QRRGN 5GJTUEJÌPpXQT\ÒINKEJ 5KNDGTOGFCKNNGXQP&(QFGT(9.QQUCWHFCUL·JTKIG#OVULWDKN·WOFGU4GIKGTWPIURT·UK FGPVGP XQP )NQICW -CTN .WFYKI (TGKJGTT XQP %QEEGLK 7PKHQTOKGTVGU $TWUVDKNF N <GKNGP 5EJTKHV   OOI(W55QOOGT# (GKPG2CVKPCXQT\ÒINKEJ  2CRKGTPQVIGNFXQP5EJNGUKGPHKPFGP5KGWPVGTFGT0T

 

6914

5%*.'59+)*1.56'+0 *1.56'+0)166142*'4<1)67/ 

(TKGFTKEJ+++4GKEJUVCNGT5EJNGUYKI&CX.CPIGC  -N2TÒHJKGDUGJTUEJÌP

 363


SCHWÄBISCH-HALL

6915

*1.56'+05%*#7'0$74))4#(5%*#(6 

'TPUV+++4GKEJUVCNGT#NVQPC&CX.CPIGNGKEJVXCT9GKPO  5GJTUEJÌP



6916

1,5:1

1,5:1

5%*9$+5%**#..

56#&6 

6CNGTOKV6KVGN-CTNU8I‰/10'Ç018#Ç4'+28$Ç*#.'Ç58'8+%'<YGK PGDGPGKPCPFGTIGUVGNNVG9CRRGPUEJKNFGFGTNKPMGOKV-TGW\FGTTGEJVGOKV*CPFQDGPÇÇWPVGP FCU/ÒP\UV·VVGP\GKEJGPÇ*Ç%#41.85Ç8Ç41/#Ç+/2Ç5'/2'4Ç#8))GMTÌPVGT&QR RGNCFNGTCWHFGT$TWUV9CRRGPUEJKNF4CHH  +PFKGUGT'TJCNVWPIXQPCNNGTITÌ­VGT5GNVGPJGKV2TCEJVGZGORNCT8QT\ÒINKEJp5VGORGNINCP\ 

6917 6918

6918



5KNDGTCDUEJNCIXQPFGP5VGORGNPFGU&QRRGNFWMCVGP0ÒTPDGTICWHFKG,CJTHGKGTFGT4GHQT OCVKQP4CHHC5NI9JKVKPI 5GJTUEJÌP





4GKEJUVCNGT0ÒTPDGTIOKV6KVGN-CTNU8++&TGK9CRRGPUEJKNFGKP-NGGDNCVVUVGNNWPIFC\YKUEJGP .QTDGGT\YGKIG)GJCTPKUEJVGU$TWUVDKNF-CTNU8++TOKV.QTDGGTMTCP\WPFWOIGNGIVGO/CPVGN/KV 4CPFUEJTKHV&CX#4CHH 42TCEJVGZGORNCTOKVHGKPGT2CVKPC 8QT\ÒINKEJp5VGORGNINCP\



364


SIGMARINGEN-HELFENSTEIN

6920

6919



-QPX6CNGT0ÒTPDGTIOKV6KVGN,QUGHU++4CHH

5GJTUEJÌPpXQT\ÒINKEJ



5%*9$+5%*'4$70& 

2TCIGT )TQUEJGP Q , FGU DÌJOKUEJGP -ÌPKIU 9GP\GN +++ +8   OKV )GIGPUVGORGN FGU   UEJY·DKUEJGP$WPFGUCWHFGT8QTFGTUGKVG4WPFGT#FNGTUEJKNF-TWU[5 445EJÌP

6921

6922



6923

5%*9#4<$74) 5%*9#4<$74)47&1.56#&6)4#(5%*#(65'+6(ª456'067/ 

.WFYKI)ÒPVJGT++-QPX6CNGT5CCNHGNF&CX(KUEJGT  *GTTNKEJG2CVKPCMN-TCV\GTOKP5EJTÌVNKPIUHGJNGTXQT\ÒINKEJp5VGORGNINCP\





(TKGFTKEJ)ÒPVJGT&QRRGNIWNFGP#-5&CX-CJPV6JWP  5GJTUEJÌPpXQT\ÒINKEJ





&QRRGNIWNFGP#-5&CX-CJPV6JWP



6924

9KP\4CPFHGJNGTUGJTUEJÌP

6925 1,5:1



#NDGTV8GTGKPUVCNGT#-5&CX-CJPV6JWP  2TCEJVGZGORNCT'TUVCDUEJNCIHCUV5VGORGNINCP\

)4#(5%*#(6 



5+)/#4+0)'0*'.('056'+0

)QVVHTKGF +++  $TCMVGCV   I *KTUEJ URTKPIV PCEJ N $GTIGT    -NGKP7NOGT %%  445GJTCVVTCMVKXGUXQT\ÒINKEJGU'ZGORNCTOKVCWUFTWEMUXQNNGT2CVKPC  365


STOLBERG

6927

6926

6929

6928

52';'4

$+567/ 

9CNTCO XQP 8GNFGP\  *GNNGT 8KGTUEJNCIJGNNGT  Q , WO    I $WEJUVCDG 9    6WTO\YKUEJGPFGP$WEJUVCDGP$#'JTGPF 8QT\ÒINKEJ





4CDCPXQP*GNOUV·FV'KPUGKVKIGT2HGPPKI 5EJÒUUGNRHGPPKI Q, CD 'JTGPF  5GJTUEJÌP





/CVVJKCUXQP4COOWPI'KPUGKVKIGT2HGPPKI 5EJÒUUGNRHGPPKI Q, WO 'JTGPF 45GJTUEJÌP



)GQTI 2HCN\ITCH DGK 4JGKP  'KPUGKVKIGT 2HGPPKI 5EJÒUUGNRHGPPKI  Q ,     'JTGPF 445GJTUEJÌP



6930

6931

 

6932

'KPUGKVKIGT2HGPPKI 5EJÒUUGNRHGPPKI Q, PCEJ 'JTGPF 'KPG5KNDGTOGFCKNNGFGU$KUVWOU5RG[GTHKPFGP5KGWPVGTFGT0T

5GJTUEJÌP



*GNNGT 8KGTUEJNCIJGNNGT Q, WO I)QVKUEJGU5&QOCNU5VCFVYCRRGP'JTGPF  5GJTUEJÌPpXQT\ÒINKEJ



56#&6 

#$6'+ 

56$.#5+'0

4QOCPWU  -W-TGW\GT#WUDGWVGFGT'KUGPUEJOGN\G)WVGPDWTI-KTEJJGKOGT /ÒUGNGT 44-N2T·IGUEJY·EJGUGJTUEJÌP



6933

6934

6934

561.$'4) 561.$'4)-¤0+)56'+0)4#(5%*#(6 

.WFYKI ++  6CNGT  #WIUDWTI OKV 6KVGN -CTNU 8 &CX  (QTUVGT  XCT   (TKGFGTKEJ 5GJTUEJÌPGU'ZGORNCT



561.$'4)561.$'4))4#(5%*#(6 

366

9QNHICPI)GQTICNNGKP4GKEJUVCNGT5VQNDGTI&CX(TKGFGTKEJ  9KP\-TCV\GTUGJTUEJÌP




THURN UND TAXIS

6939

6937

6936

6935

6935

561.$'4)146'0$'4))4#(5%*#(6 

.WFYKI)GQTI)TQUEJGP -TGW\GT Q,OKV6KVGN4WFQNHU++(TKGFGTKEJHH  5GJTUEJÌP



561.$'4)561.$'4)70&561.$'4)4155.#)4#(5%*#(6'0 

%JTKUVQH(TKGFTKEJWPF,QUV%JTKUVKCP4GKEJUVCNGT5VQNDGTI#WUDGWVGFGT5VQNDGT IGT)TWDGP&CX(TKGFGTKEJ/ÒUGNGTC *ÒDUEJG2CVKPCUGJTUEJÌPpXQT\ÒINKEJ

56#&6 



564#.570&

7PVGT 5EJYGFGP -CTN :++  5KNDGTOGFCKNNG  XQP , -KVVGN CWH FKG 4GUVKVWVKQP FGT   GXCPIGNKUEJGP -KTEJGP WPF FKG -QPHGUUKQPUHTGKJGKV KP 5EJNGUKGP 5VCFVCPUKEJV/CTVKP .WVJGT UVGJV HCUV   X X KP IGKUVNKEJGO )GYCPF KP FGT 4GEJVGP GKP NQTDGGTWOYWPFGPGU -TGW\ KP FGT .KPMGP GKPG   CWHIGUEJNCIGPG$KDGN\WUGKPGP(Ò­GP$CWOWPF5EJYCPQDGPUVTCJNGPFGT0COG,GJQXCUOO I'PFTW­GKV(W55NI9JKVKPI  8QPITQ­GT5GNVGPJGKV#VVTCMVKXGU'ZGORNCTUGJTUEJÌPpXQT\ÒINKEJ  'KPG5KNDGTOGFCKNNGCWHFKG'KPPCJOGXQP5VTCNUWPFFWTEJ2TGW­GPHKPFGP5KGWPVGTFGT0T

5#//.70)564#.570&'4/'&#+..'0 

7OHCPITGKEJG5COONWPIXQP5VTCNUWPFGT/GFCKNNGPFGU<GKVTCWOGU&KG5COONWPIURKGIGNV GKPFTWEMUXQNN FKG )GUEJKEJVG FGT 5VCFV WPF KJTGT 2GTUÌPNKEJMGKVGP FGT NGV\VGP  ,CJTG YKGFGT WPF   GPVJ·NVGKPKIGUGNVGPG5VÒEMGWC'PFTW­GKVDCCCCDD  D  E  C GVE 'KP JQEJKPVGTGUUCPVGU 1DLGMV FCU UKEJ JGTXQTTCIGPF \WO #WUDCW QFGT CNU   'TI·P\WPIGKPGTDGTGKVUDGUVGJGPFGP5COONWPIGKIPGVDKVVGDGUKEJVKIGP  5VÒEM5GJTUEJÌPpHCUV5VGORGNINCP\ 

(ª456'0 

6*74070&6#:+5

#NDGTV5KNDGTOGFCKNNG9GTMUVCVV.CWGTCWHFCUL·JTKIG,WDKN·WOFGUUGKVKP 4GIGPUDWTI DGUVGJGPFGP (ÒTUVGPJCWUGU WPF FCU ,WDKN·WOUUEJKG­GP FGT (GWGTUEJÒV\GPIGUGNNUEJCHV   5VCFVCOJQH KP 5VGKPYGI &KG $TWUVDKNFGT FGU (ÒTUVGPRCCTGU #NDGTV WPF /CTICTGVJG PGDGPGKPCPFGT FKG   -ÌRHG GKPCPFGT \WIGYCPFV WOJGT 8GT\KGTWPIGP(ÒPH XGT\KGTVG -CTVWUEJGP OKV FGP $TWUVDKNFGTP FGT   HTÒJGTGP(ÒTUVGP/KV4CPFRWP\GOOI5NI9WTUVGT  4(NGEMKIG2CVKPCXQT\ÒINKEJ

 367


TRIER

6940 6942

6941

'4<$+567/   

64+'4

2HGPPKIGFGT'T\DKUEJÌHG4WFQNHXQP9KGFWPF&KGVTKEJ++XQP9KGFHKPFGP5KGKPFGT5RG\KCNUCOONWPI 9KGFWPVGTFGP0TPWPF *GKPTKEJ++XQP(KPUVKPIGP2HGPPKII$TWUVDKNFFGU'T\DKUEJQHUTOKV/KVTCKP FGT4GEJVGP-TWOOUVCDKPFGT.KPMGP$WEJ5EJNÒUUGN\WFGP5GKVGP529GKNNGT  45GJTUEJÌP -CTN-CURCTXQPFGT.G[GP4GKEJUVCNGT-QDNGP\X5EJT 5GJTUEJÌP 5GFKUXCMCP\6CNGTX5EJT<GRGTPKEM 5EJÌPG2CVKPCXQT\ÒINKEJ

6945

6944

6943

  



,QJCPP2JKNKRRXQP9CNFGTFQTHH-QPX6CNGT-QDNGP\&CXX5EJT 4-N5EJTÌVNKPIUHGJNGTHCUVXQT\ÒINKEJ





%NGOGPU9GP\GNXQP5CEJUGP-QPX6CNGT-QDNGP\&CXX5EJT  *GTTNKEJG2CVKPCMN2TQDKGTURWTCO4CPFXQT\ÒINKEJ





-QPX6CNGT ,CJTGU\CJNKO5VGORGNCWUIG·PFGTV -QDNGP\&CXX5EJTC  (CUVUGJTUEJÌP



6946

  368

-QPX6CNGT)ÒP\DWTI&CXX5EJT -QPX6CNGT-QDNGP\&CXX5EJTNGKEJVXCT

6947

45GJTUEJÌPpXQT\ÒINKEJ 5GJTUEJÌP

 


ULM

6949

6948



-QPX6CNGT-QDNGP\-QPVTKDWVKQP&CX#X5EJTC  /KP5EJÌVNKPIUHGJNGTYKP\,WUVKGTURWTCO4CPFXQT\ÒINKEJp5VGORGNINCP\





-QPX6CNGT-QDNGP\-QPVTKDWVKQP&CXX5EJTD



5GJTUEJÌP

9GKVGTG2T·IWPIGPFGU'T\DKUVWOU6TKGTHKPFGP5KGWPVGTFGP0TP

6950

6951

4'+%*5/ª0<5666' 

6953

6954

ª$'4.+0)'0

#PQP[O  $TCMVGCV PCEJ   I )GMTÌPVGT .ÌYG OKV 2WPMVGP CNU (GNN UEJTGKVGV T   FCXQT -WIGN FGT 5EJYGKH JCV KP FGT /KVVG GKPG MWIGNHÌTOKIG 8GTFKEMWPI WPF CNU 3WCUVG GKPG -WIGN   $GTIGT-NGKP7NOGT %%  *ÒDUEJG2CVKPCHCUVXQT\ÒINKEJ

4'+%*5/ª0<5666' 

6952



7./

(TKGFTKEJ ++  $TCMVGCV   I )GMTÌPVGU $TWUVDKNF X X \YKUEJGP  $NÒVGP   \YGKI WPF 6WTO OKV 5RKV\FCEJ FGT *CNUCDUEJPKVV KUV IGRGTNV $GTIGT  -NGKP7NOGT %%     8QT\ÒINKEJ





$TCMVGCVI)GMTÌPVGU$TWUVDKNFXX\YKUEJGP$NÒVGP\YGKIWPF6WTOOKV5RKV\FCEJ FGT*CNUCDUEJPKVVKUVIGRGTNV$GTIGT-NGKP7NOGT %%  (GKPG6ÌPWPIXQT\ÒINKEJ





$TCMVGCVI)GMTÌPVGU$TWUVDKNFXX\YKUEJGP$NÒVGP\YGKIWPF6WTOOKV5RKV\FCEJ FGT*CNUCDUEJPKVVKUVIGRGTNV$GTIGT-NGKP7NOGT %%  8QT\ÒINKEJ





-QPTCFKP$TCMVGCVWOI)GMTÌPVGU$TWUVDKNFXXKPLGFGT*CPFGKP.KNKGP UVCD$GTIGT-NGKP7NOGT %%  (GKPG6ÌPWPIXQT\ÒINKEJ



6955

6956

6957

56#&6 

2TCIGT)TQUEJGPQ,FGUDÌJOKUEJGP-ÌPKIU9GP\GN+++ +8 OKV)GIGPUVGORGNXQP7NO CWH FGT 4ÒEMUGKVG 5VCFVYCRRGP IGVGKNVGT URCPKUEJGT 5EJKNF  &GT )GIGPUVGORGN KUV Z GKPIGUEJNCIGP   -TWU[70CW )GIGPUVGORGNZUGJTUEJÌPZUEJÌP/ÒP\GUEJÌP





'KPUGKVKIGT2HGPPKIQ,  )GOGKPUEJCHVURT·IWPIOKV4CXGPUDWTIWPFªDGTNKPIGP0CW 5GJTUEJÌP





2NCRRCTV)GOGKPUEJCHVURT·IWPIOKVªDGTNKPIGP0CW

45GJTUEJÌP

 369


WALDECK

6959

6958



6958

-NKRRG\W)WNFGPPCEJ.GKR\KIGT(W­IGRT·IVY·JTGPFFGT$GNCIGTWPIWPF'KPPCJOGFGT5VCFV FWTEJMCKUGTNKEJG6TWRRGP$TCWUG/CPUHGNF6H0CW *ÒDUEJG2CVKPCUGJTUEJÌP



#O#WIWUVTÒEMVGFGT*GT\QIXQP/CTNDQTQWIJ1DGTMQOOCPFKGTGPFGTFGT*QNN·PFGTWPF'PIN·PFGTXQT FKG (GUVWPI 7NO KP FGT FCU XGTDÒPFGVG *GGT FGT $C[GTP WPF (TCP\QUGP GKPG UVCTMG $GUCV\WPI WPVGT FGO )GPGTCN   XQP$GVVGPFQTH\WTÒEMIGNCUUGPJCVVGWOKJTGP4ÒEM\WIPCEJFGT5EJNCEJVXQP*ÌEJUV·FVIÒPUVKIGTDGYGTMUVGNNKIGP WPFFKG#NNKKGTVGPN·PIGTG<GKVCWHJCNVGP\WMÌPPGP&KG#NNKKGTVGPDGUEJNQUUGPFKG6TWRRGP\WVGKNGP&GTITÌ­GTG 6GKN OCTUEJKGTVG IGIGP FGP 4JGKP XQT FGT MNGKPGTG 6GKN DGUVGJGPF CWU MCKUGTNKEJGP 6TWRRGP DGICPP FKG 5VCFV \W   DGNCIGTP )GPGTCN XQP $GVVGPFQTH GTÌHHPGVG GKP UVCTMGU (GWGT CWH FKG $GNCIGTGT VTQV\FGO YCT UGKPG 7PVGTNGIGPJGKV   UEJPGNN CD\WUGJGP #O  5GRVGODGT  TGKEJVG GT FKG -CRKVWNCVKQP GKP CO 6CI FCTCWH \QI GT CWU FGT 5VCFV   9·JTGPF FGT $GUCV\WPI JCVVG FGT /CTSWKU FG $NCKPXKNNG FKG 'TNCWDPKU IGIGDGP CWU FGP )GH·­GP FGT -KTEJGP WPF   $ÒTIGT)GNFYKGCWEJFKGXQTNKGIGPFG-NKRRGRT·IGP\WNCUUGP



5KNDGTOGFCKNNG  XQP ( /KNNGT CWH FCU (KUEJGTUVGEJGP CPN·­NKEJ FGT 'TÌHHPWPI FGT PGWGP $TÒEMG   CO)·PUVQT#PUKEJVFGT$TÒEMGKO*KPVGTITWPF5VCFVCPUKEJV&CU(KUEJGTUVGEJGPOKVFGO7NOGT5RCV\ WPFFGO5EJPGKFGTXQP7NOQDGP\YGKQXCNG9CRRGPUEJKNFGXQT(NW­IQVVOCUMGOOI 0CW5NI9WTUVGT 2TCEJVGZGORNCT(CUV5VGORGNINCP\

6960

6962



6961

9#.&'%- )4#(5%*#(65'+6(ª456'067/ 





*GKPTKEJ ++  2HGPPKI -QTDCEJ  I )TCH UKV\V X X OKV 5VGTP WPF $NCVV&TGKRC­ KP   FGP#W­GPYKPMGNP'KEJGPDN·VVGTKPFGP$ÌIGPLGGKPUGEJUUVTCJNKIGT5VGTPKPFGT/KVVG4KPIOKV-WIGN 5NI*GPPKI5NI-C[UGT 5GJTUEJÌP



2HGPPKI-QTDCEJI)TCHUKV\VXXOKV5VGTPWPF$NCVV&TGKRC­KPFGP#W­GPYKPMGNP'KEJGP DN·VVGT KP FGP $ÌIGP LG GKP UGEJUUVTCJNKIGT 5VGTP KP FGT /KVVG 4KPI OKV -WIGN 5NI *GPPKI  5NI   -C[UGT 5GJTUEJÌP



%JTKUVKCP WPF 9QNTCF +8   -TGW\GT )TQUEJGP   9KNFWPIGP OKV 6KVGN XQP    /CVVJKCU5NI*GPPKI5NI-C[UGT 45GJTUEJÌP 

6963



370

)GQTI-QPX6CNGT#-5&CX-CJPV6JWP  4*ÒDUEJG2CVKPCUGJTUEJÌP




WESTFALEN

6964



)GQTI8KEVQT8GTGKPUFQRRGNVCNGT#-5&CX-CJPV6JWP  (GKPG2CVKPCXQT\ÒINKEJ



6965

-¤0+)4'+%* 

9'56(#.'0

*KGTQP[OWU 0CRQNGQP  5KNDGTOGFCKNNG  XQP 9 -ÌTPGT 5VGORGNUEJPGKFGTKP-CUUGN   CWH FGP $GUWEJ FGU -ÌPKIURCCTGU KP FGP %NCWUVJCNGT $GTIYGTMGP &KG -ÌRHG XQP   *KGTQP[OWU0CRQNGQPWPFUGKPGT)GOCJNKP-CVJCTKPGXQP9ÒTVVGODGTIPGDGPGKPCPFGTT8KGT<GKNGP 5EJTKHVFCTWPVGT5EJN·IGN'KUGPWPF.CORGWOJGT.QTDGGTMTCP\OOI/ÒUGNGTC 5NI,WNKWU 8QT\ÒINKEJ



/KVFKGUGT/GFCKNNGDTCEJVGPFKG$GYQJPGTXQP%NCWUVJCNKJTG*WNFKIWPIFCTCNUFCU-ÌPKIURCCTKO,CJTGFCU 5KNDGTDGTIYGTMDGUWEJVG

6966

6967

6967



-QPX6CNGT%#WUDGWVG)TQ­GT-QRH#-5&CX-CJPV6JWP  5EJCDUVGNNGKO(GNFFGT8QTFGTUGKVGUQPUVHCUVXQT\ÒINKEJ





-QPX6CNGT%-NGKPGT-QRH#-5&CX-CJPV6JWP  #VVTCMVKXGUHCUVXQT\ÒINKEJGU'ZGORNCT

 371


SPEZIALSAMMLUNG WIED

6968

52'<+#.5#//.70)9+'& &+')4#(5%*#(69+'&0'79+'&5'+6(ª456'067/ 

,QJCPP (TKGFTKEJ #NGZCPFGT  5KNDGTOGFCKNNG  XQP , % /CTO¾ CWH UGKPGP 4GIKG   TWPIUCPVTKVV )GJCTPKUEJVGU $TWUVDKNF T OKV WOIGNGIVGO /CPVGN)GMTÌPVG TGKEJ XGT\KGTVG -CTVWUEJG   OKV UGEJU <GKNGP 5EJTKHV ÒDGT 2HCW FCTWPVGT ,CJTGU\CJN WPF /GFCKNNGWTUUKIPCVWT  OO  I   5EJPGKFGT 44#VVTCMVKXGUHCUVXQT\ÒINKEJGU'ZGORNCTOKVUEJÌPGT2CVKPC  'ZGORNCTFGT5COONWPI*GTIGPJCJP#WMVKQP9KPVGT&ÒUUGNFQTH0T  ,QJCPP(TKGFTKEJ#NGZCPFGTYWTFGCO0QXGODGTCNU·NVGUVGT5QJPFGU)TCHGP(TKGFTKEJ9KNJGNOWPFFGT )T·HKP5QRJKGIGD)T·HKPXQP&QJPCIGDQTGP#NUKO2QNPKUEJGP'TDHQNIGMTKGIFGTHTCP\ÌUKUEJG/KPK UVGT -CTFKPCN (NGWT[ PCEJ FGT $GUGV\WPI XQP 6TKGT WPF 6TCTDCEJ XQP FGT )TCHUEJCHV 9KGF GKPG JQJG -TKGIUMQPVTK   DWVKQP HQTFGTVGUEJKEMVG(TKGFTKEJ9KNJGNOUGKPGP5QJPPCEJ2CTKU+PFGPHQNIGPFGP(TKGFGPUXGTJCPFNWPIGP YWTFG,QJCPP(TKGFTKEJ#NGZCPFGT8GTOKVVNGT\YKUEJGP-CKUGT-CTN8+WPF(TCPMTGKEJWPFMQPPVGFGPXQPDGKFGP 6GKNGP IGYÒPUEJVGP (TKGFGP OKV \WUVCPFG DTKPIGP &KGUGU DTCEJVG KJO FGP 6KVGN GKPGU MCKUGTNKEJGP -COOGTJGTTGP   WPFFGPHTCP\ÌUKUEJGP5V.QWKU1TFGPGKP0CEJFGO6QFUGKPGU8CVGTUCO5GRVGODGTWPFGKPGTMWT\GP 8GTVTGVWPIFWTEJUGKPGPLÒPIGTGP$TWFGT(TCP\-CTN.WFYKIÒDGTPCJO,QJCPP(TKGFTKEJ#NGZCPFGTFKG4GIKG TWPI FGT )TCHUEJCHV 'T YKFOGVG UKEJ UGJT FGT 8GTYCNVWPI WPF FGO YKTVUEJCHVNKEJGP #WHUEJYWPI UGKPGU MNGKPGP   6GTTKVQTKWOU WPF FGUUGP +PFWUVTKCNKUKGTWPI  NKG­GP UKEJ /KVINKGFGT FGT CPFGTUYQ XGTHQNIVGP +PURKTKGTVGP    *GTTPJWVGT$TÒFGTWPF/GPPQPKVGPKP0GWYKGFPKGFGT#O,WPKYWTFGGTKPFGP4GKEJUHÒTUVGPUVCPF GTJQDGP,QJCPP(TKGFTKEJ#NGZCPFGTUVCTDCO#WIWUV

6969

1,5:1



&WMCV-ÌNPQFGT&ÒUUGNFQTHI)GJCTPKUEJVGU$TWUVDKNFTOKVWOIGNGIVGO/CPVGN$CWO KP.CPFUEJCHVQDGPUVTCJNGPFGU)QVVGUCWIG(D5EJPGKFGT  )1.&4/KPIGYGNNVGUXQT\ÒINKEJGU'ZGORNCT 

6970



1,5:1

6971

6973

6972

-W5VÒDGT XGTOWVNKEJ#PHGTVKIWPIFGU,CJTJWPFGTVU 5EJPGKFGT  44'KP\KIDGMCPPVGU'ZGORNCT5GJTUEJÌP



'ZGORNCTFGT5COONWPI*GTIGPJCJP#WMVKQP9KPVGT&ÒUUGNFQTH0T



-TGW\GT )TQUEJGP 0GWYKGF5EJPGKFGT

4(CUVXQT\ÒINKEJ





-TGW\GT )TQUEJGP 0GWYKGF5EJPGKFGT

445GJTUEJÌPpXQT\ÒINKEJ





-TGW\GT )TQUEJGP 0GWYKGF8CTKCPVGQJPG5KIPCVWT&WPVGTFGO$TWUVDKNF5EJPGKFGTXCT 449KP\5EJTÌVNKPIUHGJNGTUGJTUEJÌP

372

'ZGORNCTFGT#WMVKQP&T$WUUQ2GWU0CEJH(TCPMHWTV/CKP0T 'ZGORNCTFGT#WMVKQP&T$WUUQ2GWU0CEJH(TCPMHWTV/CKP0T




SPEZIALSAMMLUNG WIED

6974

1,5:1



)QNFIWNFGP  0GWYKGF  I )GJCTPKUEJVGU $TWUVDKNF T OKV WOIGNGIVGO /CPVGN)GMTÌPVG   $CTQEMMCTVWUEJG FCTKP 2HCW \W FGP 5GKVGP FKG IGVGKNVG ,CJTGU\CJN    WPVGP 9GTVCPICDG KP \YGK   <GKNGP(D5EJPGKFGT )1.&8QPITÌ­VGT5GNVGPJGKV0WT'ZGORNCTGIGRT·IV #VVTCMVKXGU'ZGORNCT9KP\5VGORGNTK­XQT\ÒINKEJ 

6975

1,5:1



1,5:1

1,5:1

&WMCV0GWYKGFI(4+&Ü#.':Ü%1/Ü9'&#'À)GJCTPKUEJVGU$TWUVDKNFTOKVWOIG NGIVGO /CPVGN4'%61 56#6 6#.1Ü )GMTÌPVG $CTQEMMCTVWUEJG FCTKP2HCW\WFGP5GKVGP.QTDGGT WPF2CNO\YGKIFCTWPVGTFKGIGVGKNVG,CJTGU\CJNÛ(D5EJPGKFGT  )1.&8QPITÌ­VGT5GNVGPJGKV2TCEJVGZGORNCT8QT\ÒINKEJp5VGORGNINCP\  'KP\KIDGMCPPVGU'ZGORNCTFGT5NI,QUGRJ#WMVKQP*CODWTIGT(TCPMHWTV/CKP0TFGT#WMVKQP&T$WUUQ 2GWU(TCPMHWTV/CKP0TWPFFGT#WMVKQP&T$WUUQ2GWU0CEJH(TCPMHWTV/CKP0T

6976

6978

6977

1,5:1

1,5:1



-TGW\GT0GWYKGF5EJPGKFGT

8QPITQ­GT5GNVGPJGKV5GJTUEJÌP





-TGW\GT )TQUEJGP 0GWYKGF5EJPGKFGT  8QPITÌ­VGT5GNVGPJGKV5GJTCVVTCMVKXGUXQT\ÒINKEJGU'ZGORNCT



'ZGORNCT FGT 5COONWPI ,QUGRJ #WMVKQP *CODWTIGT(TCPMHWTV/CKP0TWPFFGT#WMVKQP&T$WUUQ 2GWU(TCPMHWTV/CKP0T



-TGW\GT0GWYKGF5EJPGKFGT

45GJTUEJÌP

6980

6979

1,5:1

 



1,5:1

2HGPPKI0GWYKGF5EJPGKFGT

1,5:1

1,5:1

8QPITÌ­VGT5GNVGPJGKV(CUVXQT\ÒINKEJ



2HGPPKI0GWYKGF5EJPGKFGT  8QPITÌ­VGT5GNVGPJGKV8GTOWVNKEJDGMCPPVGU'ZGORNCT8QT\ÒINKEJ



'ZGORNCTFGT5COONWPI*GTIGPJCJP#WMVKQP9KPVGT&ÒUUGNFQTH0T

'ZGORNCTFGT#WMVKQP&T$WUUQ2GWU0CEJH(TCPMHWTV/CKP0T

373


SPEZIALSAMMLUNG WIED

6981

6982

6982



5VÒDGT0GWYKGF5EJPGKFGT

4(CUVUGJTUEJÌP



5KNDGTOGFCKNNGXQP9&QDKEJVWPF3(TKVUEJCWHFKG'KPVTCEJVOKVUGKPGO$TWFGT(TCP\-CTN .WFYKI &KG IGJCTPKUEJVGP $TWUVDKNFGT FGT $TÒFGT PGDGPGKPCPFGT T OKV WOIGNGIVGP /·PVGNP.CPF   UEJCHVFCTKPDGMT·P\VGT1DGNKUMFGTXQP.QTDGGTWPF2CNO\YGKIGPWOYWPFGPKUVKO*KPVGTITWPFT FCU0GWYKGFGT5EJNQ­NGKPG$WTIOOI5EJPGKFGT  445EJÌPG2CVKPCMN&TWEMUVGNNGWPF-TCV\GTCWHFGO2QTVT·VUGJTUEJÌP





)TCH(TCP\-CTN.WFYKIYWTFGCO1MVQDGTCNUFTKVVGT5QJPFGU)TCHGP(TKGFTKEJ9KNJGNOIGDQTGP0CEJ UGKPGO 5VWFKWO KP -ÌPKIUDGTI VTCV GT UEJQP HTÒJ KP RTGW­KUEJG -TKGIUFKGPUVG  YWTFG GT 1DGTUVNGWVPCPV DGKO   PKGFGTTJGKPKUEJYGUVH·NKUEJGP -TGKUTGIKOGPV DNKGD CDGT KP RTGW­KUEJGP &KGPUVGP  PCJO GT CO 6ÒTMGPHGNF\WI   VGKN0CEJFGO6QFGUGKPGU8CVGTUCO5GRVGODGTHÒJTVGGTDKU\WT4ÒEMMGJTUGKPGU·NVGUVGP$TWFGTUFKG4GIKG TWPIUIGUEJ·HVG KP 0GWYKGF #O  5GRVGODGT JGKTCVGVG GT 5QRJKC .QWKUG FKG 6QEJVGT FGU $WTIITCHGP XQP &QJPC   %CTYKPFGP FKG LGFQEJ UEJQP  UVCTD +O UGNDGP ,CJT YWTFG GT )GPGTCNOCLQT FGT +PHCPVGTKG 0CEJFGO GT CO   5KGDGPL·JTKIGP -TKGI VGKNIGPQOOGP JCVVG NKG­ GT UKEJ  CWU IGUWPFJGKVNKEJGP )TÒPFGP RGPUKQPKGTGP WPF DGIKPI   CO1MVQDGTKO5EJNQ­/QPTGRQUCWUFGPUGNDGP)TÒPFGP5GNDUVOQTF

6983

1,5:1



1,5:1

#NGZF QT 2KUVQNG 0GWYKGFI(4+&Ü#.':#0&'4%1/Ü9'&#')GJCTPKUEJVGU$TWUV DKNFTOKVWOIGNGIVGO/CPVGNCO#TOCDUEJPKVVFKG5KIPCVWT&Ü 9KNJGNO&QDKEJV5VGORGNUEJPGKFGT KP 0GWYKGF UGKV  /1&'4#61 52.'0&'#6 858 )GMTÌPVG $CTQEMMCTVWUEJG FCTKP 2HCW N   .QTDGGT\YGKIWPVGPFKGIGVGKNVG,CJTGU\CJN(D5EJPGKFGT  )1.&8QPITÌ­VGT5GNVGPJGKV2TCEJVGZGORNCT8QT\ÒINKEJp5VGORGNINCP\  'KP\KI DGMCPPVGU 'ZGORNCT CWU FGT #WMVKQP &T $WUUQ 2GWU  (TCPMHWTV/CKP  0T  WPF FGT #WMVKQP   &T$WUUQ2GWU0CEJH(TCPMHWTV/CKP0T

6984

6985

1,5:1

6986

1,5:1



6CNGT0GWYKGF5EJPGKFGT

8QT\ÒINKEJGU'ZGORNCTOKVJÒDUEJGT2CVKPC





 6CNGT  0GWYKGF  I )GJCTPKUEJVGU $TWUVDKNF T OKV WOIGNGIVGO /CPVGN9GTV KP XKGT   <GKNGPFCTWPVGT,CJTGU\CJN5EJPGKFGT  2TCEJVGZGORNCT8QPCNNGTITÌ­VGT5GNVGPJGKV-N<CKPGPFGXQT\ÒINKEJp5VGORGNINCP\  8GTOWVNKEJ GKP\KI DGMCPPVGU 'ZGORNCT FGT 5COONWPI 5EJYCNDCEJ #WMVKQP 5CNN[ 4QUGPDGTI (TCPMHWTV  0T    FGT #WMVKQP &T $WUUQ 2GWU  (TCPMHWTV/CKP  0T  WPF FGT 5NI *GTIGPJCJP #WMVKQP 9KPVGT   &ÒUUGNFQTH0T

 374

5VÒDGT0GWYKGF5EJPGKFGT

'ZGORNCTFGT5COONWPI*GTIGPJCJP#WMVKQP9KPVGT&ÒUUGNFQTH0T

445GJTUEJÌP




SPEZIALSAMMLUNG WIED

6987

   

6989

6988

6990

5VÒDGT0GWYKGF5EJPGKFGT

44-N&TWEMUVGNNGUGJTUEJÌP



5VÒDGT0GWYKGF5EJPGKFGT 5VÒDGT0GWYKGF5EJPGKFGT 5VÒDGT0GWYKGF5EJPGKFGT

5GNVGPKPFKGUGT'TJCNVWPI8QT\ÒINKEJp5VGORGNINCP\ 5GJTUEJÌP 48QT\ÒINKEJ

  

'ZGORNCTFGT5COONWPI*GTIGPJCJP#WMVKQP9KPVGT&ÒUUGNFQTH0T

6991 6993

6992

  

5VÒDGT0GWYKGF5EJPGKFGT )WNFGP0GWYKGF5EJPGKFGT -TGW\GT0GWYKGF5EJPGKFGT

'ZGORNCTFGT5COONWPI*GTIGPJCJP#WMVKQP9KPVGT&ÒUUGNFQTH0T

6994

5GJTUEJÌP 8QT\ÒINKEJGU'ZGORNCT 445GJTUEJÌP

6995

  

6996



 5VÒDGT  0GWYKGF  8CTKCPVGP  &KG -CTVWUEJG CWH FGT 4ÒEMUGKVG KUV T IGÌHHPGV WPF KP FGT   -TQPGDGHKPFGPUKEJFTGK2GTNGP&KG-CTVWUEJGKUVTIGUEJNQUUGPWPFKPFGT-TQPGDGHKPFGPUKEJHÒPH 2GTNGP5EJPGKFGT 5VÒEM5GJTUEJÌP



 

-W2HGPPKI0GWYKGF5EJPGKFGT -W2HGPPKI0GWYKGF5EJPGKFGT

445GJTUEJÌP 445GJTUEJÌP

 

5GJTUEJÌPpXQT\ÒINKEJ 8QT\ÒINKEJ

 

'ZGORNCTFGT5COONWPI*GTIGPJCJP#WMVKQP9KPVGT&ÒUUGNFQTH0T

6997

 

-TGW\GT0GWYKGF5EJPGKFGT 5VÒDGT0GWYKGF5EJPGKFGT

6998

375


SPEZIALSAMMLUNG WIED

6999



7001

7000

-TGW\GT0GWYKGF5EJPGKFGTC

44-N-PKEMURWTUEJÌPpUGJTUEJÌP



'ZGORNCTFGT5COONWPI*GTIGPJCJP#WMVKQP9KPVGT&ÒUUGNFQTH0T



-TGW\GT0GWYKGF8CTKCPVGOKVMNGKPGTGO-QRHWPF-TGW\CO'PFGFGT4ÒEMUGKVGPWOUEJTKHV 5EJPGKFGTD 445GJTUEJÌP 



-TGW\GT0GWYKGF5EJPGKFGT

45GJTUEJÌPpXQT\ÒINKEJ



7002



-TGW\GT0GWYKGF5EJPGKFGTXCT OKVMNGKPGTGT9GTV\CJN:++ &C\W'KPG\GKVIGPÌUUKUEJG (·NUEJWPIFGUINGKEJGP6[RU 5VÒEM5GJTUEJÌP

7003

7004

7005



7006



5VÒDGT0GWYKGF5EJPGKFGT  W­GTUVUGNVGPGT,CJTICPI5GJTCVVTCMVKXGU'ZGORNCTXQT\ÒINKEJp5VGORGNINCP\





4GKEJUVCNGT0GWYKGF/KVXKGT0KGVGPCWHFGO#TOCDUEJPKVV5EJPGKFGT





4GKEJUVCNGT0GWYKGF/KVXKGT0KGVGPCWHFGO#TOCDUEJPKVVWPFOKVITÌ­GTGO-QRH5EJPGK FGT 5GJTUEJÌP





 4GKEJUVCNGT  0GWYKGF /KV XKGT 0KGVGP CWH FGO #TOCDUEJPKVV WPF OKV 6#*.'4 KP FGT   9GTVCPICDG5EJPGKFGT 4(CUVXQT\ÒINKEJ



'ZGORNCTFGT5COONWPI*GTIGPJCJP#WMVKQP9KPVGT&ÒUUGNFQTH0T

376

5GJTUEJÌP


SPEZIALSAMMLUNG WIED

7007

7008

7009

7011



4GKEJUVCNGT0GWYKGF/KVUKGDGP0KGVGPCWHFGO#TOCDUEJPKVV5EJPGKFGT  5GJTUEJÌPpXQT\ÒINKEJ





4GKEJUVCNGT0GWYKGF/KVPGWP0KGVGPCWHFGO#TOCDUEJPKVV5EJPGKFGT  5GNVGPKPFKGUGT'TJCNVWPI5GJTCVVTCMVKXGUXQT\ÒINKEJGU'ZGORNCT



'ZGORNCTFGT5COONWPI*GTIGPJCJP#WMVKQP9KPVGT&ÒUUGNFQTH0T



4GKEJUVCNGT0GWYKGF/KV\GJP0KGVGPCWHFGO#TOCDUEJPKVV5EJPGKFGT  8QT\ÒINKEJGU'ZGORNCT





4GKEJUVCNGT0GWYKGF8CTKCPVGP/KVXKGT0KGVGPCWHFGO#TOCDUEJPKVVWPFOKVMNGKPGO -QRH/KVHÒPH0KGVGPCWHFGO#TOCDUEJPKVV/KVUGEJU0KGVGPCWHFGO#TOCDUEJPKVV5EJPGKFGT 5VÒEM(CUVUGJTUEJÌPWPFUGJTUEJÌP



6CNGT0GWYKGF5EJPGKFGT





1,5:1



(CUVXQT\ÒINKEJ

7012

1,5:1

 6CNGT  0GWYKGF  I )GJCTPKUEJVGU $TWUVDKNF T OKV WOIGNGIVGO /CPVGN9GTV KP XKGT   <GKNGPFCTWPVGT,CJTGU\CJN5EJPGKFGT 8QPITÌ­VGT5GNVGPJGKV8QT\ÒINKEJp5VGORGNINCP\  'KP\KI DGMCPPVGU 'ZGORNCT FGT 5NI ,QUGRJ #WMVKQP *CODWTIGT (TCPMHWTV/CKP  0T  FGT #WMVKQP   &T $WUUQ 2GWU  (TCPMHWTV/CKP  0T  WPF FGT #WMVKQP&T$WUUQ2GWU0CEJH(TCPMHWTV/CKP 0T

7015 7013

7014



6CNGT ,CJTGU\CJNKO5VGORGNCWUIG·PFGTV 0GWYKGF5EJPGKFGT

4(CUVXQT\ÒINKEJ





-TGW\GT0GWYKGF5EJPGKFGT

445GJTUEJÌPpXQT\ÒINKEJ





-QPX-TGW\GT -TGW\GT.CPFOÒP\G Q,0GWYKGF5EJPGKFGT  8QPITQ­GT5GNVGPJGKV(CUVUGJTUEJÌP



'ZGORNCTFGT5COONWPI*GTIGPJCJP#WMVKQP9KPVGT&ÒUUGNFQTH0T 'ZGORNCTFGT5COONWPI*GTIGPJCJP#WMVKQP9KPVGT&ÒUUGNFQTH0T

377


SPEZIALSAMMLUNG WIED

1,5:1



7016

1.5:1

-QPX-TGW\GT -TGW\GT.CPFOÒP\G 0GWYKGF5EJPGKFGT  8QPITQ­GT5GNVGPJGKV5GJTUEJÌP



'ZGORNCTFGT5COONWPI*GTIGPJCJP#WMVKQP9KPVGT&ÒUUGNFQTH0T

7017

7017 1,5:1



6CNGTCWHFKG8GTO·JNWPIUGKPGU5QJPGUFGU'TDITCHGP(TKGFTKEJ%CTNOKVFGT)T·HKP/CTKC .QWKUG9KNJGNOKPGXQP5C[P9KVVIGPUVGKP$GTNGDWTI-NGKPGT&WTEJOGUUGT OO /,8 5EJPGKFGT 8QT\ÒINKEJ



(TKGFTKEJ%CTNYWTFGCO&G\GODGTKP*CEJGPDWTICNU·NVGUVGT5QJP,QJCPP(TKGFTKEJ#NGZCPFGTUIGDQTGP 'T UVWFKGTVG KP )ÌVVKPIGP WPF 'TNCPIGP WPF IKPI FCPP CWH -CXCNKGTUVQWT #O  ,CPWCT  JGKTCVGVG GT /CTKG   .QWKUG9KNJGNOKPG6QEJVGTFGU)TCHGP.WFYKI(TKGFTKEJXQP5C[P9KVVIGPUVGKP$GTNGDWTI,54GEM)GUEJKEJVG FGTIT·HNKEJGPWPFHÒTUVNKEJGP*·WUGT+UGPDWTI4WPMGN9KGFUEJKNFGTV(TKGFTKEJ%CTNCNUUQPFGTDCTGPWPFTGNKIKÌU VTÒDUKPPKIGP/GPUEJGP0CEJFGO6QFGUGKPGU8CVGTUVTCVGTFKG4GIKGTWPICP#NU.CPFGUJGTTDGIKPIGTXKGNG (GJNGTFKGQHVOCNUFWTEJUGKPGPEJQNGTKUEJGP%JCTCMVGTDGFKPIVYCTGP'TNKG­UKEJFC\WDGYGIGP\WIWPUVGP UGKPGU5QJPGU,QJCPP#WIWUV%CTNCD\WFCPMGPWPFUVCTD



-NGKPG5COONWPIXQP-W5VÒDGTP#WUDGWVG$GTIIGNFFGT)TWDG.QWKUGPINÒEMWPF#NGZCPFGT DGK0KGFGT*QPPGHGNF MOPÌTFNKEJXQP0GWYKGF 'PVJCNVGPUKPFFKG,CJTI·PIG 8CTKCPVGP   8CTKCPVGP  8CTKCPVGP &C\W6CNGTCWHFKG8GTO·JNWPIUGKPGU 5QJPGUFGU'TDITCHGP(TKGFTKEJ%CTNOKVFGT)T·HKP/CTKC.QWKUG9KNJGNOKPGXQP5C[P9KVVIGPUVGKP $GTNGDWTI)TQ­GT&WTEJOGUUGT OO 5EJPGKFGT Z  Z   5VÒEM5GJTUEJÌP

7019





378



7020

9KNJGNO#FQNH/CZKOKNKCP-CTN6TCIDCTG5KNDGTOGFCKNNGWPUKIPKGTVCWHFCU(GUV UEJKG­GP FGT 5VWVVICTVGT 5EJÒV\GPIKNFG CPN·­NKEJ FGT 8GTO·JNWPI UGKPGU 5QJPGU 9KNJGNO (TKGFTKEJ   *GTOCPP1VVQ-CTN (ÒTUV OKV2CWNKPG6QEJVGT9KNJGNOU++XQP9ÒTVVGODGTI$TWUVDKNFGT FGU 2CCTGU PGDGPGKPCPFGT T)GMTÌPVGU WPF DGJGNOVGU 9CRRGP \W FGP 5GKVGP IGMTÌPVGT .ÌYG WPF   *KTUEJCNU5EJKNFJCNVGTOOI'DPGT5NI2GNV\GT5NI9WTUVGT  8QT\ÒINKEJp5VGORGNINCP\



6TCIDCTG 5KNDGTOGFCKNNG  WPUKIPKGTV CWH FKG 8GTO·JNWPI UGKPGU 5QJPGU 9KNJGNO (TKGFTKEJ *GT   OCPP1VVQ-CTN (ÒTUV OKV2CWNKPG6QEJVGT9KNJGNOU++XQP9ÒTVVGODGTIWPFFGP'KP\WI FGU$TCWVRCCTGUKP0GWYKGFIGYKFOGVXQPFGT5VWVVICTVGT5EJÒV\GPIGUGNNUEJCHV$TWUVDKNFGTFGU2CCTGU PGDGPGKPCPFGTT0GWP<GKNGP5EJTKHVOOI'DPGT5NI2GNV\GT5NI9WTUVGT 8QT\ÒINKEJp5VGORGNINCP\




SPEZIALSAMMLUNG WIED

7021



1XCNG$TQP\GOGFCKNNGXQP-5EJ·HGT9GTMUVCVV/C[GTWPF9KNJGNOCWHFKG8GTO·JNWPIUGKPGU 5QJPGU9KNJGNO(TKGFTKEJ*GTOCPP1VVQ-CTN (ÒTUV OKV2CWNKPG6QEJVGT9KNJGNOU++XQP 9ÒTVVGODGTI $TWUVDKNFGT FGU 2CCTGU PGDGPGKPCPFGT N FCTWPVGT $NWOGP WPF .QTDGGT\YGKIG<YGK   )GPKGPJCNVGPGKPG-TQPGÒDGTGKPGP5EJKNFOKVFGP/QPQITCOOGPFGU2CCTGUWOIGDGPXQP$NWOGP IKTNCPFGPZOO&C\W'KPYGKVGTGUXGTUKNDGTVGU'ZGORNCTZOO'DPGT 5NI9WTUVGT 5VÒEM8QT\ÒINKEJWPFUGJTUEJÌP



7023 7022





7022

6TCIDCTG5KNDGTOGFCKNNGWPUKIPKGTVCWHFCU4JGKPKUEJG$WPFGUUEJKG­GPKP0GWYKGF7PKHQT OKGTVGU $TWUVDKNF X X FGP -QRH JCNDT IGYCPFV5VCFVCPUKEJV XQP 0GWYKGF QDGP IGMTÌPVGU 9CRRGP   XQP9KGFCWH.QTDGGT\YGKIGPKO#DUEJPKVV#VVTKDWVGFGU5EJÒV\GPYGUGPUCWH'KEJGPNCWDOO I5NI2GNV\GT (CUVXQT\ÒINKEJ



'KPG 5GTKG XQP /GFCKNNGP CWH 'NKUCDGVJ XQP 9KGF FKG ·NVGTG 5EJYGUVGT FGU (ÒTUVGP 9KNJGNO #FQNH   /CZKOKNKCP -CTN FKG  \WT -ÌPKIKP XQP 4WO·PKGP IGMTÌPV WPF %CTOGP 5[NXC IGPCPPV YWTFG   HKPFGP5KGWPVGTFGP0TPHH 9KNJGNO (TKGFTKEJ *GTOCPP 1VVQ -CTN  6TCIDCTG QXCNG $TQP\GOGFCKNNG  XQP   )WTUEJPGT CWH FKG +PVJTQPKUCVKQP UGKPGU $TWFGTU 9KNJGNO CNU (ÒTUV XQP #NDCPKGP $ÒUVG 9KNJGNOU    N&CU &CVWO FGT 6JTQPDGUVGKIWPI 8++ +++  ÒDGT /QPQITCOO QDGP -TQPG WPVGP ,CJTGU\CJN   ZOO9WT\DCEJ 8QT\ÒINKEJ



7024



6TCIDCTG5KNDGTOGFCKNNGWPUKIPKGTVCWHFCU4JGKPKUEJG$WPFGUUEJKG­GPWPFFKG,CJTHGKGT FGT 0GWYKGFGT 5EJÒV\GPIGUGNNUEJCHV 7PKHQTOKGTVGU $TWUVDKNF N&GT 9CUUGTVWTO XQP 0GWYKGF FCT   WPVGT9CRRGPUEJKNFCWH'KEJGPNCWDOOI5NI2GNV\GT 5GJTUEJÌP

 379


SPEZIALSAMMLUNG WIED

7026

7027

7025

7025

&+')4#(5%*#(69+'&470-'.5'+6(ª456'067/ 

*GTOCPP++1XCNG'KUGPIW­OGFCKNNG UR·VGTG#PHGTVKIWPIXGTOWVNKEJFGU,CJT JWPFGTVU  WPUKIPKGTV CWH UGKPGP 6QF $TWUVDKNF T OKV WOIGNGIVGO /CPVGN#FCO WPF 'XC TGKEJGP   UKEJFKG*CPFXQTGKPGO#RHGNDCWOWOFGUUGP5VCOOUKEJFKG5EJNCPIGYKPFGVKO)G·UVFGU$CWOGU 6CHGNOKVFTGK<GKNGP5EJTKHVZOO5EJPGKFGT 8QT\ÒINKEJ





,QJCPP.WFYKI#FQNH-W)WVGT2HGPPKI&KGTFQTH5EJPGKFGT  45GJTUEJÌPpXQT\ÒINKEJ



,QJCPP.WFYKI#FQNHYWTFGCO/CKCNU·NVGUVGT5QJPFGU)TCHGP/CZKOKNKCP*GKPTKEJXQP9KGF4WPMGN WPF5QRJKC(NQTGPVKPG6QEJVGTFGU)TCHGP5KOQP*GKPTKEJXQP.KRRG&GVOQNFKP4WPMGNIGDQTGP#NUUGKP8CVGT KO*GTDUVKPGKPGO&WGNNWOU.GDGPMCOYWTFGGKPGXQTOWPFUEJCHVNKEJG4GIKGTWPIFKGCWUFGT)T·HKPYKVYG WPF FGO .CPFITCHGP 'TPUV .WFYKI XQP *GUUGP&CTOUVCFV DGUVCPF GKPIGTKEJVGV  YWTFG GT XQNNL·JTKI WPF VTCV   UGKPG4GIKGTWPIWPGKPIGUEJT·PMVCPPCEJFGOGUNCPIG#WUGKPCPFGTUGV\WPIGPOKVUGKPGT/WVVGTIGIGDGPJCVVG#O 2QNPKUEJGP'TDHQNIGMTKGI  PCJOGTCNU1DGTUVFGT+PHCPVGTKGFGUYGUVH·NKUEJGP-TGKUTGIKOGPVGUVGKN-WT\ XQTUGKPGO6QFCO/CKJCVVGGTFKG4GIKGTWPIUGKPGO5QJP%JTKUVKCP.WFYKIÒDGTIGDGP



-W2HGPPKI&KGTFQTH5EJPGKFGT

7029

 



(CUVXQT\ÒINKEJ 5GJTUEJÌP

 

7029

-W5VÒDGT&KGTFQTH5EJPGKFGT 4GKEJUVCNGT&KGTFQTH5EJPGKFGT

1,5:1



7028

5GJTUEJÌP

7030

1,5:1

 -TGW\GT  &KGTFQTH  I )GJCTPKUEJVGU $TWUVDKNF T OKV WOIGNGIVGO /CPVGN<YGK CPGKPCP   FGTIGNGJPVG9CRRGPFCTÒDGT-TQPG5EJPGKFGT 8QPITQ­GT5GNVGPJGKV5GJTUEJÌP  'ZGORNCTFGT5COONWPI*GTIGPJCJP#WMVKQP9KPVGT&ÒUUGNFQTH0T

7032

 

7031

-TGW\GT )TQUEJGP &KGTFQTH5EJPGKFGT -TGW\GT&KGTFQTH5EJPGKFGTC

7033

445VGORGNHGJNGTXQT\ÒINKEJ 445GJTUEJÌP

 

'ZGORNCTFGT#WMVKQP&T$WUUQ2GWU(TCPMHWTV/CKP0TWPFFGT#WMVKQP&T$WUUQ2GWU0CEJH (TCPMHWTV/CKP0T

 380

-TGW\GT&KGTFQTH5EJPGKFGT

4(CUVUGJTUEJÌP




SPEZIALSAMMLUNG WIED

7034

7035

 

5VÒDGT&KGTFQTH5EJPGKFGT 5VÒDGT&KGTFQTH5EJPGKFGT

45GJTUEJÌP 44CPFHGJNGTUGJTUEJÌP



.16 -NGKPG 5COONWPI -WRHGTOÒP\GP -W2HGPPKI  -W 5VÒDGT        Z &C\W-TGW\GT5EJPGKFGT Z D  5VÒEM/GKUVUGJTUEJÌP

  

7037



%JTKUVKCP.WFYKI4GKEJUVCNGT IGRT·IV (TCPMHWTVCWHUGKPG8GTO·JNWPIOKV %JCTNQVVG5QRJKC#WIWUVCXQP5C[P9KVVIGPUVGKP5C[PIGRT·IVCWH#PTGIWPIFGT)TWDG9G[GTI $GKFGT $TWUVDKNFGT GKPCPFGT IGIGPÒDGT#PUKEJV FGT $WTI WPF FGT 5VCFV 4WPMGN OKV FGT .CJP KO   8QTFGTITWPF KO *KPVGTITWPF DGTIKIG .CPFUEJCHV FCTCWH *CURGN /KV 4CPFUEJTKHV 8GT\KGTWPI  ':   (1&+0+5 8GT\KGTWPI 9';'4+'05+$75&CX/,8/ÒUGNGT5EJPGKFGT 44(CUVXQT\ÒINKEJGU'ZGORNCT  &GT #WUDGWVGVCNGT YWTFG GTUV  KP  'ZGORNCTGP KO 4CWJIGYKEJV FGT 4GKEJUVCNGT CDGT CWU (GKPUKNDGT IG   RT·IV&KG5VÒEMGUKPFCDGTPKEJVKP7ONCWHIGMQOOGP

7038

7039 7040

/+6).+'&'4&'5*#75'59+'&#.5'4<$+5%*¤('810-¤.070&64+'4 '4<$+567/64+'4 

4WFQNH XQP 9KGF  2HGPPKI  I $TWUVDKNF FGU 'T\DKUEJQHU N OKV 6QPUWT XQT KJO   -TWOOUVCD-KTEJGPIGD·WFG OKV 6QT KP FGT /KVVG URKV\GT )KGDGN \W FGP 5GKVGP LG GKP -WRRGNVWTO   9GKNNGT 42T·IGUEJY·EJGUGJTUEJÌPpXQT\ÒINKEJ





&KGVTKEJ++XQP9KGF2HGPPKII$TWUVDKNFFGU'T\DKUEJQHUTOKV/KVTC-TWOO UVCDWPF$WEJ-KTEJGPIGD·WFGOKV6QTKPFGT/KVVGFTGKGEMKIGT)KGDGNFCTCWH-TGW\\WFGP5GKVGP LGGKP-WRRGNVWTO9GKNNGT 5GJTUEJÌP



'4<$+567/-¤.0 

*GTOCPP8XQP9KGF)QNFIWNFGPWPDGMCPPVG/ÒP\UV·VVGI%JTKUVWUUKV\VX X CWH IQVKUEJGO 6JTQP OKV UGIPGPFGT 4GEJVGP WPF 4GKEJUCRHGN WPVGP FGT -ÌNPGT 5EJKNF5RKV\GT   &TGKRC­ KP FGT /KVVG 5VKHVUUEJKNF DGNGIV OKV FGO 9CRRGP XQP 9KGF KP FGP 'EMGP FKG 5EJKNFG XQP   /CKP\6TKGTWPFFGT2HCN\(D0QUUC )1.&445GJTUEJÌP 

*GTOCPP

  YCT FGT XKGTVG 5QJP FGU )TCHGP (TKGFTKEJ + XQP 9KGF UGKP LÒPIGTGT $TWFGT (TKGFTKEJ   YWTFG $KUEJQH XQP /ÒPUVGT   &CU RQNKVKUEJG WPF MKTEJNKEJG 9KTMGP *GTOCPPU FGT  CWEJ $KUEJQH   XQP2CFGTDQTPYWTFGN·­VUKEJKP\YGK2JCUGPWPVGTVGKNGP&KGGTUVG2JCUG DKU YCTXQPYKEJVKIGP4GHQTO OC­PCJOGPKPFGT.CPFGUJGTTUEJCHVXQPGKPGTMCKUGTVTGWGP4GKEJURQNKVKMWPFXQPMQPUGSWGPVGT#DYGJTFGTTGHQT OCVQTKUEJGP $GYGIWPI IGRT·IV YQDGK GT OC­IGDNKEJ XQP UGKPGO /KVCTDGKVGT WPF $GTCVGT FGO 5QGUVGT 6JGQNQIGP   WPF,WTKUVGP,QJCPPGU%TQRRGT  WPVGTUVÒV\VYWTFG+PFGT\YGKVGP2JCUGICDGTLGFQEJFKGKPPGTMKTEJNK EJGP 4GHQTODGOÒJWPIGP CWH WPF YWTFG UEJNKG­NKEJ FGT GTUVG $KUEJQH KO 4GKEJ FGT FKG 4GHQTOCVKQP KP UGKPGP   DGKFGP 5RTGPIGNP GKPHÒJTGP YQNNVG 'T DGTKGH FKG 4GHQTOCVQTGP /GNCPEJVJQP WPF $WEGT PCEJ -ÌNP \W $GTCVWPIGP   ÒDGTFKG4GHQTOUGKPGT$KUVÒOGTNGV\VGTGTRTGFKIVGUQICTKO$QPPGT/ÒPUVGT5GKPG\CJNTGKEJGP)GIPGTKO&QOMC RKVGN WPF FGT GT\DKUEJÌHNKEJGP -WTKG UEJNQUUGP UKEJ WPVGT (ÒJTWPI XQP *GTOCPPU CNVGO 9GIIGH·JTVGP ,QJCPPGU   %TQRRGT\WUCOOGPWPFGTJQDGP#PMNCIGDGK-CKUGTWPF2CRUV2CRUV2CWN+++WPF-CKUGT-CTN8FGP'T\DKUEJQH *GTOCPPUGNDUVCO1MVQDGT\WO4ÌOKUEJGP-ÌPKIIGMTÌPVJCVVGGPVJQDGPFGPTGHQTOCVKQPUHTGWPFNKEJGP -WTHÒTUVGP UGKPGT DGKFGP OVGT *GTOCPP TGUKIPKGTVG 'PFG ,CPWCT KP-ÌNPWPF2CFGTDQTPWPF\QIUKEJPCEJ 9KGF\WTÒEMYQGTHÒPH,CJTGUR·VGTUVCTD/KVUGKPGO0GHHGP(TKGFTKEJUQNNVGXQPDKUPQEJGKP\YGKVGU /CNGKP8GTVTGVGTFU*CWUGU9KGFFCU'T\DKUVWO-ÌNPTGIKGTGP

381


SPEZIALSAMMLUNG WIED

7042

7041 7042 1,5:1

 

#NDWU&GWV\0QUU

7044

#NDWU&GWV\0QUU #NDWU&GWV\0QUU #NDWU&GWV\0QUU

1,5:1





)QNFIWNFGPWPDGMCPPVG/ÒP\UV·VVGI%JTKUVWUUKV\VXXCWHIQVKUEJGO6JTQPOKVUGIPGP FGT4GEJVGPWPF)NQDWUWPVGPFGT-ÌNPGT5EJKNF5RKV\GT&TGKRC­KPFGT/KVVGFGT5VKHVUUEJKNFDGNGIV OKV FGO 9CRRGP XQP 9KGF KP FGP 'EMGP FKG 5EJKNFG XQP /CKP\ 6TKGT WPF FGT 2HCN\ (D    0QUU )1.&445GJTUEJÌP 

7043

  

5GNVGPKPFKGUGT'TJCNVWPI8QT\ÒINKEJ

'ZGORNCTFGT5NI$CPF#WMVKQP/ÒP\\GPVTWO-ÌNP0T

7045

(CUVXQT\ÒINKEJ (CUVXQT\ÒINKEJ 8QPITQ­GT5GNVGPJGKV5GJTUEJÌP

7046

  

1,5:1

)QNFIWNFGPWPDGMCPPVG/ÒP\UV·VVGI%JTKUVWUUKV\VXXCWHIQVKUEJGO6JTQPOKVUGIPGP FGT 4GEJVGP WPF IGUEJNQUUGPGO $WEJ WPVGP FGT -ÌNPGT 5EJKNF5RKV\GT &TGKRC­ KP FGT /KVVG FGT   5VKHVUUEJKNF DGNGIV OKV FGO 9CRRGP XQP 9KGF KP FGP 'EMGP FKG 5EJKNFG XQP /CKP\ 6TKGT WPF FGT   2HCN\(D0QUU )1.&8QPITQ­GT5GNVGPJGKV5GJTUEJÌP 

7047



5KNDGTIW­OGFCKNNG  PCEJ ( *CIGPCWGT $TWUVDKNF T OKV $CTGVV WPF WOIGNGIVGO /CPVGN5KGDGP   <GKNGP5EJTKHVOOI*CDKEJ+9GKNGT  5R·VGTGT0CEJIW­YCJTUEJGKPNKEJFGU,CJTJWPFGTVU5GJTUEJÌP 'ZGORNCTFGT5NI$CPF#WMVKQP/ÒP\\GPVTWO-ÌNP0T

382




SPEZIALSAMMLUNG WIED

1,5:1



7048

1,5:1

)QNFIWNFGPWPDGMCPPVG/ÒP\UV·VVGI%JTKUVWUUKV\VXXCWHIQVKUEJGO6JTQPOKVUGIPGP FGT 4GEJVGP WPF IGUEJNQUUGPGO $WEJ WPVGP FGT -ÌNPGT 5EJKNF5RKV\GT &TGKRC­ KP FGT /KVVG FGT   5VKHVUUEJKNF OKV IGUVTGKHVGO -TGW\ DGNGIV OKV FGO 9CRRGP XQP 9KGF KP FGP 'EMGP FKG 5EJKNFG XQP   /CKP\6TKGTWPFFGT2HCN\(D0QUU )1.&445GJTUEJÌP  'ZGORNCTFGT#WMVKQP%CJP(TCPMHWTV0TWPFFGT5NI$CPF#WMVKQP/ÒP\\GPVTWO-ÌNP 0T  'UJCPFGNVUKEJDGKFKGUGO)QNFIWNFGPFGT#NHTGF0QUUPKEJVDGMCPPVYCTWOFKGNGV\VG-ÌNPGT2T·IWPIKO4JGKPK UEJGP/ÒP\XGTGKP



.16&KXGTUGGKPUGKVKIG2HGPPKIGGKP*GNNGTUQYKGFKXGTUG5EJKNNKPIGWPF#NDWU5VÒEMGFGU'T\DKUEJQHU 5VÒEM5GJTUEJÌP

1,5:1





7050 1,5:1

(TKGFTKEJXQP9KGF)QNFIWNFGPWPDGMCPPVG/ÒP\UV·VVGI%JTKUVWUUKV\VXX CWHIQVKUEJGO6JTQPOKVUGIPGPFGT4GEJVGPWPFIGUEJNQUUGPGO$WEJWPVGPFGT-ÌNPGT5EJKNF5RKV\GT &TGKRC­KPFGT/KVVGFCU9CRRGPXQP9KGFKPFGP'EMGPFKG5EJKNFGXQP/CKP\6TKGTWPFFGT2HCN\ (D0QUU )1.&8QPITÌ­VGT5GNVGPJGKV5GJTUEJÌP



7051

7052

7052

&+'56#&60'79+'& 



$TQP\GOGFCKNNGXQP4)C[TCTFCWHFGP6QFFGUHTCP\ÌUKUEJGP)GPGTCNU.C\CT*QEJG-QRHFGU )GPGTCNU N&KG 0COGP FGT XQP KJO GKPIGPQOOGPGP 5V·FVG 9GKUUGODQWTI .CPFCW WPF 0GWYKGF   UQYKGFKG.GDGPUFCVGP*QEJGUWOJGT.QTDGGTWPF'KEJGP\YGKIOO5NI,WNKWU  8QT\ÒINKEJ



6TCIDCTG5KNDGTOGFCKNNGXQP/%TGOGTCWHFCU8GTDCPFUUEJKG­GPFGU7PVGTXGTDCPFGUFGU4JGK PKUEJGP5EJKG­DWPFGU/KV/CWGTMTQPGDGNGIVGUXGT\KGTVGU9CRRGP\YKUEJGP'KEJGPNCWDWPF.QTDGGT \YGKI5EJÒV\GOKV)GYGJTKO#PUEJNCICWH5EJKG­UVCPFOOI 5GJTUEJÌP

 383


WISMAR

7053







ex 7054

)QNFOGFCKNNG\WGKPGO&WMCVGPWPUKIPKGTVCWHFCU4JGKPKUEJG$WPFGUUEJKG­GPKP0GWYKGF 2HCW UEJTGKVGV T(ÒPH <GKNGP 5EJTKHV FCTWPVGT #VVTKDWVG FGU 5EJÒV\GPYGUGPU CWH 'KEJGPNCWD\YGKI   /KV2WP\GCWHFGT8QTFGTUGKVGOOI )1.&8QT\ÒINKEJ



)QNFOGFCKNNG \W  &WMCVGP Q ,  ,CJTJWPFGTV  XQP 5EJOKFV CWH (TKGFTKEJ 9KNJGNO 4CKHHGKUGP  

*COO 5KGI Ó*GFFGUFQTH 0GWYKGF /KVDGITÒPFGTFGTIGPQUUGPUEJCHVNKEJGP$GYGIWPI KP&GWVUEJNCPF$TWUVDKNF4CKHHGKUGPUT)KGDGNMTGW\OOI&C\W-NGKPG)QNFOGFCKNNG Q,WPUKIPKGTVCWHFKG5VCFV0GWYKGF/KV/CWGTMTQPGDGNGIVGU9CRRGP5VCFVCPUKEJV/KV5VGORGN CWHFGT4ÒEMUGKVGOOI 5VÒEM)1.&8QT\ÒINKEJp5VGORGNINCP\



5KNDGTOGFCKNNGXQP-QYCT\KMCWHFKGL·JTKIG<WIGJÌTKIMGKVFGU4CUUGNUVGKPU\WT(COKNKG4GO[

IGUVQRHVGU .QEJ  FC\W  XCTKKGTGPFG 'ZGORNCTG KP $TQP\G $TQP\GTGRNKM  FGT 5VKHVWPI FGU   9KGFGPGT/·PPGTEJQTGU$TQP\GOGFCKNNGCWHFGP0GWYKGFGT)GUCPIUYGVVUVTGKV&C\W5VÒEM -TKGIUPQVIGNFWPFOQFGTPG5KNDGTOGFCKNNGP 5VÒEM5GJTUEJÌPpXQT\ÒINKEJ



5#//.70)9+'& 

-NGKPG 5COONWPI -NGKPOÒP\GP FGU  ,CJTJWPFGTVU XQP 9KGF0GWYKGF WPF 9KGF4WPMGN KP -WRHGT   WPF 5KNDGT WC9KGF0GWYKGF6CNGT Z5EJPGKFGT )WNFGP 5EJPGKFGT  5VÒDGT 5EJPGKFGT UQYKGFKXGTUG-W5VÒDGT #WUDGWVG$GTIIGNFFGT)TWDG.QWKUGP INÒEM WPF #NGZCPFGT DGK 0KGFGT*QPPGHGNF  9KGF4WPMGN  4GKEJUVCNGT  5EJPGKFGT     -W5VÒDGT 5EJPGKFGT  5VÒEM/GKUVUGJTUEJÌP



ex 7057

5#//.70)9+'&'0$4ª%- 

5COONWPI-WRHGTOÒP\GPFGU<GKVTCWOUFCTWPVGT5GNVGPJGKVGPWC2HGPPKI2HGP PKI*GNNGT2HGPPKIGVE*QEJKPVGTGUUCPVGU1DLGMVDKVVGDGUKEJVKIGP  5VÒEM)GTKPIGTJCNVGPpUGJTUEJÌP



7058 7059

56#&6

7059

9+5/#4



6CNGT 5EJKNNKPI OKV6KVGN4WFQNHU++-WP\GN  8QPITQ­GT5GNVGPJGKV9KP\2T·IGUEJY·EJGUGJTUEJÌP





4GKEJUVCNGT 5EJKNNKPI OKV6KVGN(GTFKPCPFU++&CX-WP\GN#J  *ÒDUEJG2CVKPCCVVTCMVKXGUUGJTUEJÌPGU'ZGORNCT



384


WORMS

7060



5KNDGTOGFCKNNGXQP,*ÌJPCWHFKG'TQDGTWPIFGT5VCFVFWTEJFKG&·PGP&KGVTCWGTPFG5VCFV IÌVVKP MPKGV XQT GKPGT -TKGIUVTQRJ·G FKG OKV 9CHHGP WPF XKGT (CJPGP DGUVGEMV KUV5VCFVCPUKEJV XQP   9KUOCT OKV FGO *CHGP WOIGDGP XQP -TKGIUXQNM WPF 5EJKHHGP  OO  I )CNUVGT    )TKOO5NI)CGVVGPU 449KP\5EJTÌVNKPIUTK­XQT\ÒINKEJGU'ZGORNCTOKVHGKPGT6ÌPWPI 

7062

7061



7061

7PVGT 5EJYGFGP -TKUVKPC  4GKEJUVCNGT  OKV 6KVGN (GTFKPCPFU +++  I *GKNKIGT   .CWTGPVKWUOKV2CNOYGFGNWPF4QUVÒDGT5VCFVYCRRGP)GMTÌPVGT&QRRGNCFNGTOKV4GKEJUCRHGNCWHFGT $TWUVFCTKP9GTV\CJN#JNUVTÌO&CX*CICPFGT-WP\GN#C  8QPITQ­GT5GNVGPJGKV/KPDGTKGDGPUGJTUEJÌP  'ZGORNCTFGT#WMVKQP(TKV\4WFQNH-ÒPMGT1UPCDTÒEM0T

-¤0+).+%*'/ª0<5666' 

914/5

(TKGFTKEJ ++  'KPUGKVKIGT 2HGPPKI WO   I -TGW\ KP FGP 9KPMGNP (NKGIGPFGT   .KPFYWTONDGHW­VGJGTCNFKUEJG.KNKGUVGJGPFGT.KPFYWTOFCJKPVGT4KPIGNOKV2WPMV6WTO\YK UEJGP\YGK4KPIGNP,QUGRJ#PO5NI$QPJQHH (CUVUGJTUEJÌP

7063

7064

7065



7066

9ª466'/$'4) 

9ª466'/$'4)*'4<1)67/5'+6-¤0+)4'+%* 7NTKEJ&TGKGTQ, CD 5VWVVICTV-NGKP4CHHC

5GJTUEJÌP





5EJKNNKPI5VWVVICTV-NGKP4CHH  8QPITQ­GT5GNVGPJGKV5VCTMGT5EJTÌVNKPIUTK­pWPFHGJNGTUGJTUEJÌP





&TGKGTQ,  5VWVVICTV-NGKP4CHHD



(TKGFTKEJ +   -TGW\GT )TQUEJGP   5VWVVICTV OKV 6KVGN 4WFQNHU ++ -NGKP4CHH    NGKEJVXCT 2TCEJVGZGORNCT5EJTÌVNKPIUHGJNGTCO4CPFHCUV5VGORGNINCP\

5GJTUEJÌP

  385


WÜRTTEMBERG

7068

7067

7067



,QJCPP(TKGFTKEJ-KRRGT-TGW\GT5VWVVICTV-NGKP4CHHC  4-N<CKPGPFGUGJTUEJÌP



4GKEJUVCNGT  ,CJTGU\CJN KO 5VGORGN CWU  IG·PFGTV  %JTKUVQRJUVCN  I )GJCTPKUEJVGU   $TWUVDKNFTOKVWOIGNGIVGO/CPVGN)GMTÌPVGUXKGTHGNFKIGU9CRRGP\WFGP5GKVGPLGGKPG/GGTLWPI HTCW&CX FQTVHCNUEJG4ÒEMUGKVGPCDDKNFWPI -NGKP4CHH  ªDNKEJGT5VGORGNHGJNGTCWHFGT8QTFGTUGKVGUGJTUEJÌP 



&GT 5VGORGNHGJNGT CWH FGT 8QTFGTUGKVG YKTF J·WHKI KTTVÒONKEJ CNU *GPMGNURWT DG\GKEJPGV -NGKP4CHH UEJTGKDGP   JKGT\W &KGUG 6CNGT \GKIGP CWH FGT 8QTFGTUGKVG GKPGP UVCTMGP 5VGORGNURTWPI FGT FCU /ÒP\OGKUVGT\GKEJGP PCJG\W   XGTFGEMV

7069

7071

7070

7072



,WNKWU (TKGFTKEJ #FOKPKUVTCVQT WPF 8QTOWPF XQP 'DGTJCTF +++   -TGW\GT    5VWVVICTV$GTI-NGKP4CHH 445GJTUEJÌP



 

'DGTJCTF+++-TGW\GT5VWVVICTV-NGKP4CHH -TGW\GT5VWVVICTV-NGKP4CHHD

 



-CTN 'WIGP   -TGW\GT  5VWVVICTV 8CTKCPVG OKV ITQ­GO $TWUVDKNF -NGKP4CHH  G   NGKEJVXCT 44(CUVXQT\ÒINKEJ

8QT\ÒINKEJ 8QT\ÒINKEJp5VGORGNINCP\



7073



386

-QPX6CNGT  5VWVVICTV &C\W  -TGW\GT  5VWVVICTV &CX  # -NGKP4CHH  NGKEJV   XCTC 5VÒEM(CUVUGJTUEJÌP




WÜRTTEMBERG

7074

7076

7075



-QPX6CNGT5VWVVICTV&CX-NGKP4CHH

5GJTUEJÌPpXQT\ÒINKEJ





(TKGFTKEJ++ + -QPX6CNGT#-5&CX-CJPV6JWP  4*GTTNKEJG2CVKPCMN2TQDKGTURWTCO4CPFXQT\ÒINKEJp5VGORGNINCP\





-QPX6CNGT#-5&CX-CJPV6JWP



5GJTUEJÌP

7078

7077

7079

7080

7079



-TQPGPVCNGT#-5&CX-CJPV6JWP

5GJTUEJÌPGU'ZGORNCT





-TQPGPVCNGT-NGKPGT-QRH#-5&CX-CJPV6JWP  (CUUWPIUURWTGPDGTKGDGPHCUVUGJTUEJÌP





-TGW\GT#-5,





-TQPGPVCNGT#-5&CX-CJPV6JWP 5GNVGPKPFKGUGT'TJCNVWPI (GKPG2CVKPCOKP5EJTÌVNKPIUHGJNGTOKPLWUVKGTVXQT\ÒINKEJp5VGORGNINCP\

/KPLWUVKGTVXQT\ÒINKEJp5VGORGNINCP\

 387


WÜRTTEMBERG

7081



9KNJGNO+&QRRGNIWNFGP1JPG/ÒP\OGKUVGT\GKEJGP2$WPVGTFGO-QRHWPFQJPG 2WPMVPCEJFGO/ÒP\\GKEJGP9CWHFGT4ÒEMUGKVG#-5&CX-CJPV6JWP  5GJTUGNVGPKPFKGUGT'TJCNVWPI(GKPG2CVKPCXQT\ÒINKEJp5VGORGNINCP\

7082



7083



-TQPGPVCNGT#-5&CX-CJPV6JWP  2TCEJVGZGORNCT/KPLWUVKGTVHCUV5VGORGNINCP\





-TQPGPVCNGT#-5&CX-CJPV6JWP



7084

8QT\ÒINKEJ

7085



-TQPGPVCNGT ,CJTGU\CJNKO5VGORGNCWUIG·PFGTV 8CTKCPVGOKV9WPVGTFGO-QRH#-5 #PO&CX-CJPV6JWP 5GNVGPKPFKGUGT'TJCNVWPI8QT\ÒINKEJp5VGORGNINCP\





-TQPGPVCNGT*CPFGNUHTGKJGKV#-5&CX-CJPV6JWP

8QT\ÒINKEJ



8QT\ÒINKEJ



(CUV5VGORGNINCP\



7086



8GTGKPUFQRRGNVCNGT#-5&CX-CJPV6JWP



&QRRGNIWNFGP#-5&CX-CJPV6JWP

388

7087


WÜRTTEMBERG

7089

7088

7088





-CTN  $TQP\GOGFCKNNG Q , WPUKIPKGTV XQP - 5EJYGP\GT WPF ) 5EJKNNGT \WT #PGTMGP   PWPIFGU(QTVUEJTKVVUKP)GYGTDGWPF*CPFGN-QRHT$GJGNOVGUYÒTVVGODGTIKUEJGU9CRRGPWOJGT -TGKU CWU CEJV $NWOGPMGNEJGP OKV 'ODNGOGP XGTUEJKGFGPGT )GYGTDG FC\YKUEJGP LG GKPG $KGPG /KV   4CPFITCXWT '0)'.*#46 *#..   OO 'DPGT  -NGKP  -NGKP4CHH  #PO   2TCEJVGZGORNCT+P1TKIKPCNGVWK5VGORGNINCP\



&QRRGNVGT8GTGKPUVCNGT7NOGT/ÒPUVGT#-5&CX-CJPV6JWP  2TCEJVGZGORNCTXQPRQNKGTVGP5VGORGNP(GKPG2CVKPCHCUV5VGORGNINCP\



7091

7090



7090

5KNDGTOGFCKNNG  XQP - 5EJYGP\GT CWH FKG ,CJTHGKGT FGT 7PKXGTUKV·V 6ÒDKPIGP -QRH T   9GKDNKEJG)GUVCNVUVGJVXXOKV(CEMGNKPFGTGTJQDGPGP4GEJVGP\WFGP5GKVGP)GPKGPOKVFGO9CR RGPUEJKNFGPXQP9ÒTVVGODGTID\Y6ÒDKPIGPOOI'DPGT.CXGTTGP\  2TCEJVGZGORNCTXQPRQNKGTVGP5VGORGNP5VGORGNINCP\



9ª466'/$'4)9'+.6+0)'0*'4<1)67/ 

,WNKWU(TKGFTKEJ-KRRGT)WNFGP -TGW\GT $TGP\*KTUEJIWNFGP'DPGT5NI -TCC\ 5GJTUEJÌP

 389


WÜRZBURG

7092 7093

7093

4'+%*5/ª0<5666' 

9ª4<$74)

-CKUGT 1VVQ +++  2HGPPKI   I -QRH FGU JGKNKIGP -KNKCP T-TGW\ KP FGP   9KPMGNPLGGKPG-WIGN'JYCNF 44(CUVUGJTUEJÌP



$+567/ 

,WNKWU'EJVGTXQP/GURGNDTWPP5KNDGTIW­OGFCKNNGQ,9GTMUVCVV8/CNGT$TWUVDKNF HCUV X X OKV WOIGNGIVGO /CPVGN&TGKHCEJ DGJGNOVGU XKGTHGNFKIGU 9CRRGP  OO   I   *CDKEJ++ 45GJTUEJÌPGT\GKVIGPÌUUKUEJGT)W­

7094

7095



7096



#FCO(TKGFTKEJXQP5GKPUJGKO-QPX6CNGT9ÒT\DWTI&CX*GNOUEJTQVV *ÒDUEJG2CVKPCUGJTUEJÌP





(TCP\.WFYKIXQP'TVJCN-QPX6CNGT9ÒT\DWTI&CX*GNOUEJTQVV  *ÒDUEJG2CVKPCUGJTUEJÌPpXQT\ÒINKEJ





-QPX6CNGT9ÒT\DWTI&CX*GNOUEJTQVV

-N-TCV\GTUGJTUEJÌPXQT\ÒINKEJ



-QPX6CNGT9ÒT\DWTI-QPVTKDWVKQP&CX*GNOUEJTQVV  4-N5EJTÌVNKPIUHGJNGTUGJTUEJÌP



7097



.169ª4<$74) 

390

&KXGTUG/ÒP\GPFGU,CJTJWPFGTVUXQO-W-TGW\GTDKU\WO6CNGTWC6CNGT -TGW\GTGVE+PVGTGUUCPVGU.QVDKVVGDGUKEJVKIGP  5VÒEM6GKNYGKUGOKVMNGKPGP(GJNGTPUEJÌPpUGJTUEJÌP 9GKVGTG2T·IWPIGPFGU$KUVWOU9ÒT\DWTIHKPFGP5KGWPVGTFGP0TP




SAMMLUNG SEDISVAKANZ

5#//.70)5'&+58-#0</ª0<'070&/'&#+..'0

7099



&#5$+567/4+)#

$#.6+-7/

5GFKUXCMCP\5EJKNNKPIQ,UV·FVKUEJG2T·IWPI0GWOCPP

7100

5GJTUEJÌP

7101

&#5$+567/.ª66+%*



7102

$'.)+'0



5GFKUXCMCP\2CVCIQPCW5V.CODGTV&CX&GNOXCT/KIPQNGV<GRGTPKEM 45EJÌPpUGJTUEJÌP





5GFKUXCMCP\  2CVCIQP CW 5V .CODGTV  &CX  &GNO  4  /KIPQNGV  4    <GRGTPKEM 4-N4CPFHGJNGTLWUVKGTVUGJTUEJÌP





5GFKUXCMCP\'EWCW5V.CODGTV&CX&GNO 4 /KIPQNGV<GRGTPKEM -N5EJTÌVNKPIUHGJNGTCO4CPFUGJTUEJÌP



7104

7103

7103



5GFKUXCMCP\'EWCW5V.CODGTV&CX&GNO 4 /KIPQNGV 4 <GRGTPKEM  40WT'ZGORNCTGIGRT·IV-N4CPFHGJNGTHCUVUGJTUEJÌP





'UECNKP/KIPQNGV<GRGTPKEMXCT



5GJTUEJÌP

391


SAMMLUNG SEDISVAKANZ

7105

7106

7106



5GFKUXCMCP\'EWCW5V.CODGTV&CX&GNO 4 /KIPQNGV<GRGTPKEM 40WT'ZGORNCTGIGRT·IV-N4CPFHGJNGTUGJTUEJÌP





'EWCW5V.CODGTV&CX&GNO 4 /KIPQNGV 4 <GRGTPKEM  40WT'ZGORNCTGIGRT·IV-N4CPFHGJNGTUGJTUEJÌP



7109

7107

7108

7108



'UECNKP/KIPQNGV<GRGTPKEM

(CUVXQT\ÒINKEJ



5GFKUXCMCP\'EWCW5V.CODGTV&CX&GNO 4 /KIPQNGV 4 <GRGTPKEM 40WT'ZGORNCTGIGRT·IV5GJTUEJÌP





5GFKUXCMCP\'UECNKP/KIPQNGV<GRGTPKEM





.QVU-W.KCTF'UECNKP/KIPQNGV<GRGTPKEM  5VÒEM(CUVUGJTUEJÌP





&KXGTUG-WRHGTOCTMGPFGU&QOMCRKVGNUWC5V.CODGTVWU5V2CWNWPF5V&KQP[UKWU+PVGTGUUCPVGU .QVOKVUGNVGPGP#WUICDGPDKVVGDGUKEJVKIGP 5VÒEM/GKUVUGJTUEJÌP



5GJTUEJÌP



7112

&#5$+567/%#/$4#+  392

(4#0-4'+%*

&QOMCRKVGN-W&GPKGTQ, WO $QWFGCW5NI4QDGTV

45GJTUEJÌP




SAMMLUNG SEDISVAKANZ

7113

7114

7115

&+')'+56.+%*-'+6+0&'0*#$5$74)+5%*'0'4$.#0&'0 &#5$+567/$4+:'0 





5GFKUXCMCP\  5KNDGTOGFCKNNG  XQP 2 2 9GTPGT %#2+68.8/  $4+:+0'05' WOJGT   9CRRGPMTCP\9CRRGPUEJKNF FGU &QOMCRKVGNU WOJGT 9CRRGPMTCP\  OO  I )WOOGTGT   KP*CNNGT/ÒP\DN·VVGT$CPF+++/·T\<GRGTPKEM 48QT\ÒINKEJGU'ZGORNCT



5GFKUXCMCP\5KNDGTOGFCKNNGWPUKIPKGTV%#2+68.8/$4+:+0'05'4')0#055'&' 8#%#06'ÚWOJGT9CRRGPMTCP\#FNGTXXFGP-QRHPCEJNIGYCPFVOKVSWGTIGJCNVG PGO$KUEJQHUUVCD &QOMCRKVGNYCRRGP OOI)WOOGTGTKP*CNNGT/ÒP\DN·VVGT$CPF+++ /·T\<GRGTPKEM *GPMGNURWTUGJTUEJÌP



5GFKUXCMCP\5KNDGTOGFCKNNGXQP,,0GWUUF#FNGTXXFGP-QRHPCEJNIGYCPFV OKV SWGT IGJCNVGPGO $KUEJQHUUVCD &QOMCRKVGNYCRRGP #PUKEJV FGT $TKZGPGT &QOMKTEJG  OO   I)WOOGTGTKP*CNNGT/ÒP\DN·VVGT$CPF+++/·T\<GRGTPKEM  49KP\5EJTÌVNKPIUHGJNGTXQT\ÒINKEJGU'ZGORNCT



7116

&#5'4<$+567/5#.<$74) 

5GFKUXCMCP\5KNDGTOGFCKNNGXQP(/CV\GPMQRH*ÒHVDKNFFGU5V4WFDGTVWUXXOKV /KVTC 5CN\IGH·­ WPF $KUEJQHUUVCD CWH 2QUVCOGPV FCXQT -CRKVGNYCRRGP QDGP -TQPG WOJGT 9CRRGP   MTCP\*ÒHVDKNF FGU 5V 8KTIKNKWU JCNDN OKV /KVTC /QFGNN FGT &QOMKTEJG WPF $KUEJQHUUVCD CWH 2QUVC   OGPV QDGP -TQPG WOJGT 9CRRGPMTCP\  OO  I 5NI /QPVGPWQXQ  <GRGTPKEM    8QT\ÒINKEJ

 393


SAMMLUNG SEDISVAKANZ

1,5:1



7117

&WMCVI(D2TQDU\V<GRGTPKEM

1,5:1

)1.&8QT\ÒINKEJ



5GFKUXCMCP\4GKEJUVCNGT0ÒTPDGTI&CX-TWI<GRGTPKEM  (GKPG2CVKPCUGJTUEJÌPpXQT\ÒINKEJ



&'765%*.#0&

7118

&#5$+567/$#/$'4) 

7119



5GFKUXCMCP\  5KNDGTOGFCKNNG  XQP 2 2 9GTPGT WPF  , . 1GZNGKP -CKUGT *GKPTKEJ ++   VJTQPV X X OKV <GRVGT WPF 4GKEJUCRHGN WOJGT 9CRRGPMTCP\2QUVCOGPV OKV 5VKHVUYCRRGP FCTCWH   5EJYGTV$KUEJQHUUVCD4GKEJUCRHGN(ÒTUVGPJWV/KVTCWPF-TGW\FCTÒDGT#FNGTNPGDGPFGO2QUVC OGPVUVGJV-CKUGT*GKPTKEJ++FGTGKP-KTEJGPOQFGNNWOHC­VTUKV\V-CKUGTKP%WPKIWPFCOKV<GRVGT WOJGT9CRRGPMTCP\/KV4CPFUEJTKHVOOI*GNNGT<GRGTPKEM  44*ÒDUEJG2CVKPCXQT\ÒINKEJGU'ZGORNCT



7120



394

5KNDGTOGFCKNNG  XQP , . 1GZNGKP -CKUGT *GKPTKEJ ++ VJTQPV X X OKV <GRVGT WPF 4GKEJUCRHGN   WOJGT 9CRRGPMTCP\2QUVCOGPV OKV 5VKHVUYCRRGP FCTCWH 5EJYGTV $KUEJQHUUVCD 4GKEJUCRHGN (ÒT   UVGPJWV /KVTC WPF -TGW\ FCTÒDGT #FNGT N PGDGP FGO 2QUVCOGPV UVGJV -CKUGT *GKPTKEJ ++ FGT GKP   -KTEJGPOQFGNN WOHC­V T UKV\V -CKUGTKP %WPKIWPFC OKV <GRVGT WOJGT 9CRRGPMTCP\ /KV 4CPFUEJTKHV   OOI*GNNGT<GRGTPKEM 4*ÒDUEJG2CVKPCUGJTUEJÌPpXQT\ÒINKEJ




SAMMLUNG SEDISVAKANZ

7121

7122





7122

5KNDGTOGFCKNNGXQP229GTPGT5V)GQTIOKVFGO5VKHVUYCRRGPTGKVGVNWPFVÌVGVFGP&TCEJGP OKVFGT.CP\G-CKUGT*GKPTKEJ++TGKVGVTOKVIGUEJWNVGTVGO<GRVGTWPFYGKUVOKVFGT.KPMGPCWHFGP $CODGTIGT &QO QDGP \YGK 'PIGN OKV FGO 9CRRGP FGU &QOMCRKVGNU /KV 4CPFUEJTKHV  OO   I*GNNGT<GRGTPKEM 45GJTUEJÌP



5GFKUXCMCP\  5KNDGTOGFCKNNG  XQP 2 2 9GTPGT )GMTÌPVGT &QRRGNCFNGT OKV 5EJYGTV WPF   4GKEJUCRHGN KP FGP (·PIGP CWH FGP CWUIGDTGKVGVGP (NÒIGNP FKG 9CRRGP FGT \GJP ·NVGTGP &QOJGTTGP   WPVGP 5RTWEJDCPF#WH GKPGO R[TCOKFGPHÌTOKIGP 2QUVCOGPV OKV 5VKHVUYCRRGP UKV\V GKP #FNGT N UVGJV   -CKUGT*GKPTKEJ++FGTGKP&QOOQFGNNWOHC­VTUKV\V-CKUGTKP%WPKIWPFCCPFGO2QUVCOGPVUKPFCO 4CPFFKG9CRRGPFGT\GJPLÒPIGTGP&QOJGTTGPCPIGDTCEJVOOI*GNNGT<GRGTPKEM *GTTNKEJG2CVKPCXQT\ÒINKEJGU'ZGORNCT



7123

7124





7124

$TQP\GOGFCKNNGXQP,.1GZNGKP5V)GQTIOKVFGO5VKHVUYCRRGPTGKVGVNWPFVÌVGVFGP&TCEJGP OKVFGT.CP\G-CKUGT*GKPTKEJ++TGKVGVTOKVIGUEJWNVGTVGO<GRVGTWPFYGKUVOKVFGT.KPMGPCWHFGP $CODGTIGT&QOQDGP\YGK'PIGNOKVFGO9CRRGPFGU&QOMCRKVGNUOO*GNNGT<GRGTPKEM 8QT\ÒINKEJp5VGORGNINCP\



5GFKUXCMCP\5KNDGTOGFCKNNGXQP229GTPGT7PVGTGKPGO$CNFCEJKPWPFFGOUVTCJNGPFGP )QVVGUCWIGUVGJVGKPNGGTGT$KUEJQHUVJTQPCPFGP8QTJ·PIGPFGU$CNFCEJKPUUKPF#WIGPCPIGDTCEJV \WFGP5GKVGP2QUVCOGPVGOKV5[ODQNGPFGTIGKUVNKEJGPWPFYGNVNKEJGP/CEJV&CU9CRRGPFGU&QO MCRKVGNUWOJGTFKG9CRRGPFGT&QOJGTTGPQDGP-TQPGOOI*GNNGT<GRGTPKEM 444CPFWPF(GNFGTÒDGTCTDGKVGVUGJTUEJÌPpXQT\ÒINKEJ

 395


SAMMLUNG SEDISVAKANZ

7125



5GFKUXCMCP\5KNDGTOGFCKNNGXQP,.1GZNGKP-CKUGT*GKPTKEJ++VJTQPVXXOKV<GRVGT WPF 4GKEJUCRHGN WOJGT 9CRRGPMTCP\2QUVCOGPV OKV 5VKHVUYCRRGP FCTCWH 5EJYGTV $KUEJQHUUVCD   4GKEJUCRHGN(ÒTUVGPJWV/KVTCWPF-TGW\FCTÒDGT#FNGTNPGDGPFGO2QUVCOGPVUVGJV-CKUGT*GKPTKEJ ++FGTGKP-KTEJGPOQFGNNWOHC­VTUKV\V-CKUGTKP%WPKIWPFCOKV<GRVGTWOJGT9CRRGPMTCP\ OOI*GNNGT<GRGTPKEM 442TCEJVGZGORNCT(CUV5VGORGNINCP\ 

7126







396

7127

7128

5KNDGTOGFCKNNGXQP,.1GZNGKP5V)GQTIOKVNGGTGO9CRRGPUEJKNFTGKVGVNWPFVÌVGVFGP&TC EJGPOKVFGT.CP\G-CKUGT*GKPTKEJ++TGKVGVTOKVIGUEJWNVGTVGO<GRVGTWPFYGKUVOKVFGT.KPMGPCWH FGP$CODGTIGT&QOQDGP\YGK'PIGNOKVFGO9CRRGPFGU&QOMCRKVGNUOOI*GNNGT <GRGTPKEM 4(CUUWPIUURWTGPHCUVXQT\ÒINKEJ



5GFKUXCMCP\5KNDGTOGFCKNNGXQP229GTPGT-CKUGT*GKPTKEJ++VJTQPVXXOKV<GRVGT WPF 4GKEJUCRHGN WOJGT 9CRRGPMTCP\2QUVCOGPV OKV 5VKHVUYCRRGP FCTCWH 5EJYGTV $KUEJQHUUVCD   (ÒTUVGPJWV /KVTC WPF -TGW\ FCTÒDGT UVTCJNGPFGU )QVVGUCWIG N PGDGP FGO 2QUVCOGPV NGJPV -CKUGT   *GKPTKEJ++TUVGJV-CKUGTKP%WPKIWPFCOKV<GRVGTKO*KPVGTITWPFLGYGKNUFKG#PUKEJVFGT&QOMKT EJGWOJGT9CRRGPMTCP\OOI*GNNGT<GRGTPKEM (CUVXQT\ÒINKEJ



8GTIQNFGVG5KNDGTOGFCKNNGXQP229GTPGT-CKUGT*GKPTKEJ++TGKVGVTOKVIGUEJWNVGTVGO<GR VGT WPF YGKUV OKV FGT .KPMGP CWH GKPGP 6GKN FGU $CODGTIGT &QOU-CKUGTKP %WPKIWPFC UVGJV PCEJ N   WPFYGKUVOKVFGO<GRVGTKPKJTGT4GEJVGPCWHFGPCPFGTGP6GKNFGU$CODGTIGT&QOUOOI *GNNGT<GRGTPKEM 4GUVGCNVGT8GTIQNFWPIXQT\ÒINKEJGU'ZGORNCT




SAMMLUNG SEDISVAKANZ

7129

&#5$+567/'+%*5666 

5GFKUXCMCP\-QPX6CNGT0ÒTPDGTI%CJP&CX<GRGTPKEM  *GPMGNURWTUGJTUEJÌPpXQT\ÒINKEJ

7130

7131



7132



5GFKUXCMCP\-QPX6CNGT0ÒTPDGTI%CJP&CX<GRGTPKEM  -N5EJTÌVNKPIUHGJNGTCO4CPFXQT\ÒINKEJ





5GFKUXCMCP\&QRRGNVGT-QPX6CNGT0ÒTPDGTII%CJP&CX<GRGTPKEM (GNFGTIGIN·VVGVUGJTUEJÌP



&#5$+567/(4'+5+0) 

5GFKUXCMCP\5KNDGTOGFCKNNGWPUKIPKGTV<YGK2QUVCOGPVGCWHFGONKPMGPKUVFCU$TWUVDKNF XQP5V-QTDKPKCP )TÒPFGTFGU$KUVWOU OKV*GKNKIGPUEJGKP-TWOOUVCDWPF$WEJ\WUGJGPCWHFGO TGEJVGPFCUIGMTÌPVG$TWUVDKNF5KIKUOWPFU-ÌPKIXQP$WTIWPFOKV*GKNKIGPUEJGKP*CTPKUEJ<GRVGT WPF 4GKEJUCRHGN/CFQPPC OKV -KPF KP 5VTCJNGPMTCP\ WOJGT 9CRRGPMTCP\  OO  I   5GNNKGT<GRGTPKEM *ÒDUEJG2CVKPCXQT\ÒINKEJ

 397


SAMMLUNG SEDISVAKANZ

7134

7133



7133

5GFKUXCMCP\  5KNDGTOGFCKNNG  WPUKIPKGTV 5KGDGP <GKNGP 5EJTKHV FCTWPVGT GKP OKV $NWOGP   WOYWPFGPGT5VCDWPFWPVGTFKGUGO\YGKOKVGKPGO$CPFIGMPÒRHVG'KEJGP\YGKIG/CFQPPCOKV-KPF KP 5VTCJNGPMTCP\ FCTWPVGT FCU OKV FGO (ÒTUVGPJWV DGFGEMVG 5VKHVUYCRRGP OKV $KUEJQHUUVCD 2T·NCVGP   MTGW\WPF5EJYGTVXGT\KGTVWOJGT9CRRGPMTCP\OOI5GNNKGT<GRGTPKEM  (GKPG2CVKPCUGJTUEJÌPpXQT\ÒINKEJ



&#5$+567/(7.&# 

5GFKUXCMCP\-QPX6CNGT$WEJQPKC+++5&CX<GRGTPKEM  -N4CPFHGJNGTMN<CKPGPFGXQT\ÒINKEJ



7135

7136

7136

&#5$+567/*+.&'5*'+/ 

5GFKUXCMCP\4GKEJUVCNGTOKV6KVGN.GQRQNFU+&CX/GJNC<GRGTPKEM  5GJTUEJÌPUEJÌP





5GFKUXCMCP\5KNDGTOGFCKNNGXQP229GTPGT-CTNFGT)TQ­GUVGJVHCUVXXOKV5EJYGTV WPF4GKEJUCRHGNPGDGPFGOTGEJVGP(W­FGU-CKUGTUFKG5KIPCVWTFGU5VGORGNUEJPGKFGTUWOJGT9CR RGPMTCP\.WFYKI FGT (TQOOG UVGJV HCUV X X KP FGT 4GEJVGP FCU /QFGNN FGT 5VKHVUMKTEJG KP FGT   .KPMGPGKP<GRVGTWOJGT9CRRGPMTCP\OOI/GJNC<GRGTPKEM  *ÒDUEJG2CVKPCUGJTUEJÌPpXQT\ÒINKEJ



398


SAMMLUNG SEDISVAKANZ

7137

7138

7138



4GKEJUVCNGT  OKV 6KVGN -CTNU 8+  I $GJGNOVGU 9CRRGP QDGP /CFQPPC OKV <GRVGT KP FGT   4GEJVGP WPF FGO -KPF CWH FGO NKPMGP #TO X X 5VKHVUYCRRGP )GJCTPKUEJVGU $TWUVDKNF T OKV WO   IGNGIVGO/CPVGNWPF1TFGPUMGVVG&CX/GJN<GRGTPKEM  (GKPG2CVKPCHCUVXQT\ÒINKEJGU'ZGORNCT 



5GFKUXCMCP\5KNDGTOGFCKNNGXQP,6JKGDCWF&KGCWH9QNMGPVJTQPGPFG/CTKCOKV,GUWU MKPFFGWVGVOKVGKPGO<GRVGTCWHFCUXQTKJTUEJYGDGPFGOKV(ÒTUVGPJWVDGFGEMVG5VKHVUYCRRGPFCUCWH GKPGOXGT\KGTVGP-KUUGPOKV1TFGPUMTGW\TWJVWPFOKV-TWOOUVCD5EJYGTVWPF2CNO\YGKIDGUVGEMVKUV QDGP FGT CNU 6CWDG IG\GKIVG *GKNKIG )GKUV KP 5VTCJNGP WOJGT 9CRRGPMTCP\#WH GKPGT FTGKUVWHKIGP   'UVTCFGOKV$CNFCEJKPUVGJVFGT$KUEJQHUUVWJNFGTOKVFGT/KVTCDGNGIVKUVKO*KPVGTITWPFTFGT*KN FGUJGKOGT&QOQDGPFCUIÌVVNKEJG#WIGFGT8QTUGJWPIKP5VTCJNGPWOJGT9CRRGPMTCP\OO I&C\WGKPYGKVGTGU'ZGORNCTKP'KUGPOO/GJN<GRGTPKEM  5VÒEM(CUUWPIUURWTGPD\Y-QTTQUKQPUURWTGPUGJTUEJÌP



7140

7139

7139



6CNGTOKV6KVGNXQP(TCP\+&CX/GJN<GRGTPKEM#PO  -N5EJTÌVNKPIUHGJNGTUGJTUEJÌP





5GFKUXCMCP\6CNGT/GJN<GRGTPKEM



7141

45GJTUEJÌPpXQT\ÒINKEJ

7142

 

5GFKUXCMCP\/CTKGPITQUEJGP/GJN<GRGTPKEM 6CNGT/GJN<GRGTPKEM

445GJTUEJÌPpXQT\ÒINKEJ 5GJTUEJÌP



6CNGT/CTKGPITQUEJGP6CNGT/GJNC<GRGTPKEM 5VÒEM5EJÌPpUGJTUEJÌP

   399


SAMMLUNG SEDISVAKANZ

7145

7144

7144

 

&#5'4<$+567/-¤.0

5GFKUXCMCP\4GKEJUVCNGT&CX0QUU<GRGTPKEM &QOMCRKVGN-W*GNNGT$QPP0QUU

4(CUVUGJTUEJÌP (CUVUGJTUEJÌP

 

7146



5GFKUXCMCP\5KNDGTOGFCKNNGWPUKIPKGTVXQP')GTXCKUCWHFGP6QFXQP%NGOGPU#WIWUV WPF FKG CPUEJNKG­GPFG 5GFKUXCMCP\ 2GVTWU OKV \YGK 5EJNÒUUGNP UKV\V CWH 9QNMG FGP NKPMGP #TO CWH   5VKHVUUEJKNFIGNGJPVFGPKJOGKP2WVVGPGPIGNGPVIGIGPJ·NV&KG*GKNKIGP&TGK-ÌPKIGXQTFGTUKV\GPFGP /CTKC OKV -KPF /KV 4CPFUEJTKHV %.'/'05 #7)75675 0#675  #7)  Û  '.'%6  Û     /#;Û1$;6('$ %NGOGPU#WIWUVIGDQTGPCO#WIWUVIGY·JNVCO/CK IGUVQTDGP(GDTWCT OOI0QUU UKGJG5 9GKNGT9KVV <GRGTPKEM 4(GKPG2CVKPCUGJTUEJÌPpXQT\ÒINKEJ

%NGOGPU #WIWUV YCT FGT XKGTVG 5QJP FGU DC[GTKUEJGP -WTHÒTUVGP /CZKOKNKCP ++ 'OCPWGN WPF UGKPGT \YGKVGP )G   OCJNKP 6JGTGUG -WPKIWPFG XQP 2QNGP WPF YWTFG CO  #WIWUV  KP $TÒUUGN IGDQTGP FGO #OVUUKV\ UGKPGU   8CVGTU CNU )GPGTCNUVCVVJCNVGT FGT 5RCPKUEJGP 0KGFGTNCPFG 0CEJ UGKPGT -KPFJGKV FKG GT IGOGKPUCO OKV UGKPGP $TÒ   FGTPKPÌUVGTTGKEJKUEJGT)GHCPIGPUEJCHVXGTDTCEJVJCVVGYWTFGGTIGIGPUGKPGP9KNNGP\WO0CEJHQNIGTFGTYKVVGNU DCEJKUEJGP-KTEJGPHÒTUVGPKPFGPCNVDC[GTKUEJGPWPFPQTFFGWVUEJGP$KUVÒOGTPDGUVKOOV'TÒDGTPCJOINGKEJ \GKVKIOKV/ÒPUVGTFCU$KUVWO2CFGTDQTPWPFYWTFG'T\DKUEJQHXQP-ÌNP$KUEJQHXQP*KNFGUJGKO XQP1UPCDTÒEMWPF*QEJOGKUVGTFGU&GWVUEJGP1TFGPU&CFWTEJMQPPVGGTFKGYKVVGNUDCEJKUEJGP+PVGTGUUGPKO YGUV WPF PQTFFGWVUEJGP $GTGKEJ YCJTPGJOGP &GT -KTEJGPHÒTUV FGT YGIGP UGKPGT OVGTCP\CJN /QPUKGWT FG   %KPS'INKUGU D\Y *GTT (ÒPHMKTEJGP IGPCPPV YWTFG YCT CNNGTFKPIU OKV UGKPGP RQNKVKUEJGP WPF MKTEJNKEJGP #WH   ICDGP UVCTM ÒDGTHQTFGTV WPF ÒDGTNKG­ FKG 4GIKGTWPI YGKVIGJGPF UGKPGP /KPKUVGTP WC )TCH 2NGVVGPDGTI  %NGOGPU   #WIWUV YKFOGVG UKEJ JCWRVU·EJNKEJ UGKPGT $CW WPF ,CIFNGKFGPUEJCHV WPF RHNGIVG CWEJ UQPUV GKPGP CWUUEJYGKHGPFGP   .GDGPUUVKN0QEJJGWVG\GWIGPFCXQPFKGRT·EJVKIGP5EJNÌUUGT2QRRGNUFQTHWPF#WIWUVWUDWTIKP$TÒJNDGK$QPP#O NKGDUVGP JKGNV UKEJ (ÒPHMKTEJGP \WT ,CIF KO XQP KJO GTDCWVGP 5EJNQ­ %NGOGPUYGTVJ CWH FCU KO PÌTFNKEJGP 6GKN   FGU$KUVWOU/ÒPUVGTDGK5ÌIGNNKGIV  #O(GDTWCTYCT%NGOGPU#WIWUVCWH#UEJGTOKVVYQEJPCEJCWUIKGDKIGP-CTPGXCNUHGKGTPPCEJ'JTGPDTGKVU VGKPIGTGKUVYQGTCOP·EJUVGP6CIXGTUVCTD'TYCTFGTNGV\VG-WTHÒTUVXQP-ÌNPCWUFGO)GUEJNGEJVFGT9KVVGNU DCEJGT&KG5GFKUXCMCP\FCWGTVGDKU\WO#RTKN

7147

7148



7147



-QPX6CNGT-QDNGP\&CX0QUU<GRGTPKEM  5VCTMDGCTDGKVGVGU'ZGORNCT*KV\GpWPF-QTTQUKQPUURWTGPUGJTUEJÌP





-QPX6CNGT-QDNGP\0QUU<GRGTPKEM



400

-N2T·IGUEJY·EJGLWUVKGTVUGJTUEJÌP


SAMMLUNG SEDISVAKANZ

7149

7149

7150



6CNGT-QDNGP\0QUU<GRGTPKEM  4-N5EJTÌVNKPIUHGJNGTCO4CPFUGJTUEJÌPpXQT\ÒINKEJ



5GFKUXCMCP\4GKEJUVCNGTOKV6KVGN-CTNU8+$GJTGPU&CX<GRGTPKEM  45GJTUEJÌP



&#5$+567/.ª$'%-

1,5:1

7151



7151

&#5'4<$+567//#+0< 

5GFKUXCMCP\)QNFIWNFGPQ,$KPIGPI(D5NI9CNVJGT<GRGTPKEM6H )1.&45GJTUEJÌP

7152







7153



7154

5GFKUXCMCP\  5EJCWVCNGT  WPDGUVKOOVG /ÒP\UV·VVG  I 5GEJU<GKNGP5EJTKHV\YKUEJGP 8GT\KGTWPIGP&GT *GKNKIG /CTVKP OKV 5EJYGTV TGKVGV N WPF VGKNV UGKPGP /CPVGN OKV GKPGO CO $QFGP   UKV\GPFGP$GVVNGTWPVGPFCU9CRRGPFGU&QOMCRKVGNU5NI9CNVJGT<GRGTPKEM  4-N5EJTÌVNKPIUHGJNGTCO4CPFXQT\ÒINKEJ



5EJCWVCNGTWPDGUVKOOVG/ÒP\UV·VVGI5GEJU<GKNGP5EJTKHVWOJGT-TCP\CWU¤N\YGK IGP&GT *GKNKIG /CTVKP OKV 5EJYGTV TGKVGV N WPF VGKNV UGKPGP /CPVGN OKV GKPGO CO $QFGP UKV\GPFGP   $GVVNGTWPVGPFCU9CRRGPFGU&QOMCRKVGNU5NI9CNVJGT<GRGTPKEM  4*ÒDUEJG2CVKPCYKP\5EJTÌVNKPIUHGJNGTCO4CPFXQT\ÒINKEJp5VGORGNINCP\



5GFKUXCMCP\   5EJCWVCNGT  WPDGUVKOOVG /ÒP\UV·VVG XQP 9 5EJ·HHGT  I 5GEJU   <GKNGP5EJTKHV\YKUEJGP8GT\KGTWPIGP&GT*GKNKIG/CTVKPOKV5EJYGTVTGKVGVNWPFVGKNVUGKPGP/CPVGN OKVGKPGOCO$QFGPUKV\GPFGP$GVVNGTWPVGPFCU9CRRGPFGU&QOMCRKVGNU5NI9CNVJGT<GRGTPKEM 2CVKPCXQT\ÒINKEJ

 401


SAMMLUNG SEDISVAKANZ

7155

7156

7156





 5EJCWVCNGT  WPDGUVKOOVG /ÒP\UV·VVG  I 9CRRGP FGU &QOMCRKVGNU&GT *GKNKIG /CTVKP   OKV5EJYGTVTGKVGVNWPFVGKNVUGKPGP/CPVGNOKVGKPGOCO$QFGPUKV\GPFGP$GVVNGTKO#DUEJPKVV,CJTGU \CJN5NI9CNVJGT<GRGTPKEM 48QT\ÒINKEJ



5GFKUXCMCP\5EJCWVCNGT/CKP\I9CRRGPFGU&QOMCRKVGNUWOJGTFKG,CJTGU\CJN CNU %JTQPQITCOO WPF 9CRRGPMTCP\&GT *GKNKIG /CTVKP OKV 5EJYGTV TGKVGV N WPF VGKNV UGKPGP /CPVGN   OKVGKPGOCO$QFGPUKV\GPFGP$GVVNGTWOJGT9CRRGPMTCP\5NI9CNVJGT<GRGTPKEM  2CVKPCUGJTUEJÌP



7158

7157





7157

 5EJCWVCNGT  /CKP\ XQP ( # XCP .QP  I 9CRRGP FGU &QOMCRKVGNU OKV 2CNO WPF   .QTDGGT\YGKIXGT\KGTVCWH2QUVCOGPV&GT*GKNKIG/CTVKPOKV5EJYGTVTGKVGVNWPFVGKNVUGKPGP/CPVGN OKVGKPGOCO$QFGPUKV\GPFGP$GVVNGT5NI9CNVJGT<GRGTPKEM 48QT\ÒINKEJ



 5EJCWVCNGT  /CKP\  I 9CRRGP FGU &QOMCRKVGNU OKV 2CNO WPF .QTDGGT\YGKI XGT\KGTV   &GT*GKNKIG/CTVKPOKV5EJYGTVTGKVGVNWPFVGKNVUGKPGP/CPVGNOKVGKPGOCO$QFGPUKV\GPFGP$GVVNGT 5NI9CNVJGT<GRGTPKEM 4(CUV5VGORGNINCP\



7159



402

5GFKUXCMCP\  5KNDGTOGFCKNNG  XQP # ( 5VKGNGT 0GWP <GKNGP 5EJTKHV WOJGT 9CRRGPMTCP\   OKV .QTDGGT\YGKIGP QDGP UVTCJNGPFGU )QVVGUCWIG&GT *GKNKIG /CTVKP OKV 5EJYGTV TGKVGV N WPF VGKNV   UGKPGP/CPVGNOKVGKPGOCO$QFGPUVGJGPFGP$GVVNGTQDGPJ·NVGKPGCWU9QNMGPMQOOGPFG*CPFFGP WOJGTHÒJTGPFGP9CRRGPMTCP\OKV.QTDGGT\YGKIGPOOI5NI9CNVJGT<GRGTPKEM  *GTTNKEJG2CVKPCMN4CPFHGJNGTXQT\ÒINKEJ




SAMMLUNG SEDISVAKANZ

7161

7160





 5EJCWVCNGT  /CKP\  I 9CRRGP FGU &QOMCRKVGNU KP DGMT·P\VGT -CTVWUEJG CWH MNGKPGO   2QUVCOGPV&GT *GKNKIG /CTVKP OKV 5EJYGTV TGKVGV N WPF VGKNV UGKPGP /CPVGN OKV GKPGO CO $QFGP UVG   JGPFGP$GVVNGTKO#DUEJPKVV,CJTGU\CJN5NI9CNVJGT<GRGTPKEM 8QT\ÒINKEJ



 5EJCWVCNGT  /CKP\  I 9CRRGP FGU &QOMCRKVGNU KP DGMT·P\VGT -CTVWUEJG&GT *GKNKIG   /CTVKPOKV5EJYGTVTGKVGVNWPFVGKNVUGKPGP/CPVGNOKVGKPGOCO$QFGPUVGJGPFGP$GVVNGT5NI9CNVJGT <GRGTPKEM 8QT\ÒINKEJ



7163

7162

7162

&#5$+567//ª056'4 

5GFKUXCMCP\4GKEJUVCNGT/ÒPUVGTOKV6KVGN(GTFKPCPFU+++&CX5EJWN\G<GRGT PKEM 4#VVTCMVKXGU'ZGORNCTOKVHGKPGT2CVKPCMN2T·IGUEJY·EJGUGJTUEJÌPpXQT\ÒINKEJ





6CNGT 5EJKNNKPI /ÒPUVGTOKV6KVGN(GTFKPCPFU+++5EJWN\G<GRGTPKEM  4(CUVUGJTUEJÌP



7164



5GFKUXCMCP\4GKEJUVCNGT/ÒPUVGTOKV6KVGN.GQRQNFU+&CX5EJWN\GD<GRGT PKEM /KP5EJTÌVNKPIUHGJNGTUGJTUEJÌPpXQT\ÒINKEJ



7165



5GFKUXCMCP\4GKEJUVCNGT/ÒPUVGTOKV6KVGN.GQRQNFU+&CX5EJWN\GC<GRGT PKEM *GPMGNURWTUGJTUEJÌP

 403


SAMMLUNG SEDISVAKANZ

7166



5GFKUXCMCP\4GKEJUVCNGT/ÒPUVGT&CX5EJWN\G<GRGTPKEM  $TQUEJKGTURWTGPUGJTUEJÌP

7167





7171



7169

5GFKUXCMCP\5KNDGTOGFCKNNGXQP229GTPGT5V2CWNWUUVGJVHCUVXXOKV5EJYGTVWPF $WEJ \YKUEJGP FGT IGVGKNVGP ,CJTGU\CJN WOJGT 9CRRGPMTCP\-CTN FGT )TQ­G UVGJV X X OKV 5EJYGTV   WPF4GKEJUCRHGNWOJGT9CRRGPMTCP\OOI5EJWN\G<GRGTPKEM  9KP\4CPFHGJNGTUGJTUEJÌPpXQT\ÒINKEJ



$TQP\GOGFCKNNGXQP229GTPGT5V2CWNWUUVGJVHCUVXXOKV5EJYGTVWPF$WEJ\YKUEJGPFGT IGVGKNVGP ,CJTGU\CJN WOJGT 9CRRGPMTCP\-CTN FGT )TQ­G UVGJV X X OKV 5EJYGTV WPF 4GKEJUCRHGN   WOJGT9CRRGPMTCP\OO5EJWN\G FQTVKP5KNDGT <GRGTPKEM  9KP\4CPFHGJNGTXQT\ÒINKEJ





HCEJGT4GKEJUVCNGT/ÒPUVGTI5EJWN\GE<GRGTPKEM  $TQUEJKGTURWTGPUGJTUEJÌP



6CNGT &QRRGNUEJKNNKPI /ÒPUVGT6CNGT )TQUEJGP /ÒPUVGT Z 5EJWN\GD C Z <GRGTPKEMNGKEJVXCTNGKEJVXCT 5VÒEM(CUVUGJTUEJÌPWPFUGJTUEJÌP





5GFKUXCMCP\5KNDGTOGFCKNNGXQP,6JKGDCWF5V2CWNWUOKV5EJYGTVWPF$WEJUVGJVHCUVX X WOJGT 9CRRGPMTCP\ OKV 0COGPUUEJKNFGTP-CTN FGT )TQ­G OKV 5EJYGTV WPF 4GKEJUCRHGN UVGJV X   XWOJGT9CRRGPMTCP\OKV0COGPUUEJKNFGTPOOI5EJWN\G<GRGTPKEM  -N4CPFHGJNGTHCUVXQT\ÒINKEJ



404




SAMMLUNG SEDISVAKANZ

7172



4GKEJUVCNGT#WIUDWTI&CX5EJWN\G<GRGTPKEM

7173

   

7174

5GJTUEJÌP

7176

7175

6CNGT/ÒPUVGT5EJWN\G<GRGTPKEM 6CNGT/ÒPUVGT5EJWN\G<GRGTPKEM 6CNGT#WIUDWTI5EJWN\G<GRGTPKEM 6CNGT/ÒPUVGT5EJWN\G<GRGTPKEMXCT



5GJTUEJÌPpXQT\ÒINKEJ 5GJTUEJÌP /KPLWUVKGTVXQT\ÒINKEJ 5GJTUEJÌP

   

7178

7177



 

7177

5GFKUXCMCP\  5KNDGTOGFCKNNG  XQP & ( QFGT ( 9 .QQU 5V 2CWNWU UVGJV HCUV X X OKV   5EJYGTV WPF $WEJ WOJGT 9CRRGPMTCP\ OKV 0COGPUEJKNFGTP-CTN FGT )TQ­G UVGJV X X OKV 5EJYGTV   WPF4GKEJUCRHGNWOJGT9CRRGPMTCP\OKV0COGPUEJKNFGTPOOI5EJWN\G5QOOGT #<GRGTPKEM 9KP\IGUVQRHVGU.QEJDGTKGDGPUQPUVXQT\ÒINKEJ -QPX6CNGT%NCWUVJCN5EJWN\G<GRGTPKEM 5GJTUEJÌP

 

6CNGT%NCWUVJCN6CNGT%NCWUVJCN5EJWN\G<GRGTPKEM  5VÒEM5GJTUEJÌP

 405


SAMMLUNG SEDISVAKANZ

7180

7181

&#5$+567/150#$4ª%- 

5GFKUXCMCP\4GKEJUVCNGT*CPPQXGT&CX#-GPPGRQJND<GRGTPKEM  5GNVGPKPFKGUGT'TJCNVWPI8QT\ÒINKEJGU'ZGORNCT





4GKEJUVCNGT*CPPQXGT&CX-GPPGRQJNC<GRGTPKEM  -N2T·IGUEJY·EJGXQT\ÒINKEJGU'ZGORNCT



7182

7183

7185



5GFKUXCMCP\4GKEJUVCNGT%NCWUVJCN ! &CX-GPPGRQJN<GRGTPKEM  -N5EJTÌVNKPIUHGJNGTCO4CPFUGJTUEJÌP





5GFKUXCMCP\5KNDGTOGFCKNNGXQP229GTPGT$TWUVDKNFXQP5V2GVTWUJCNDTOKV5EJNÒU UGN WOJGT 9CRRGPMTCP\ OKV 0COGP$TWUVDKNF -CTNU FGU )TQ­GP X X OKV 5EJYGTV WPF 4GKEJUCRHGN   WOJGT 9CRRGPMTCP\ OKV 0COGP  OO  I -GPPGRQJN  C <GRGTPKEM  NGKEJV XCT   *ÒDUEJG2CVKPCXQT\ÒINKEJ



5KNDGTOGFCKNNGXQP229GTPGT$TWUVDKNFXQP5V2GVTWUJCNDTOKV5EJNÒUUGNWOJGT9CRRGP MTCP\OKV0COGP$TWUVDKNF-CTNUFGU)TQ­GPXXOKV5EJYGTVWPF4GKEJUCRHGNWOJGT9CRRGPMTCP\ OKV0COGPOOI-GPPGRQJND<GRGTPKEM (CUVXQT\ÒINKEJ



5GFKUXCMCP\  5KNDGTOGFCKNNG  #OUVGTFCO WPUKIPKGTV $TWUVDKNF XQP 5V 2GVTWU JCNDT   OKV5EJNÒUUGNWOJGTFWTEJGKP$CPFXGTDWPFGPGT9CRRGPMTCP\OKV0COGPWPF<CJNGPFKGFKG4CPI QTFPWPICPFGWVGP$TWUVDKNF-CTNUFGU)TQ­GPHCUVXXOKV5EJYGTVWPF4GKEJUCRHGNWOJGTFWTEJGKP $CPF XGTDWPFGPGT 9CRRGPMTCP\ OKV 0COGP WPF <CJNGP XKGT 9CRRGP JCDGP MGKPG <CJN  OO   I-GPPGRQJN<GRGTPKEM 8QT\ÒINKEJ







406


SAMMLUNG SEDISVAKANZ

7186

&#5$+567/2#&'4$140 

5GFKUXCMCP\4GKEJUVCNGTWPDGMCPPVG/ÒP\UV·VVG&CX5EJYGFG#C<GRGTPKEM 5GJTCVVTCMVKXGUHCUVXQT\ÒINKEJGU'ZGORNCT



7187



5GFKUXCMCP\5KNDGTOGFCKNNGXQP229GTPGT-CTNFGT)TQ­GUVGJVXXOKV5EJYGTVWPF 4GKEJUCRHGNWOJGT9CRRGPMTCP\OKV0COGP5V.KDQTKWUUVGJVXXKPFGT4GEJVGPFCU/QFGNNFGT 5VKHVUMKTEJGKPFGT.KPMGPGKP-TWOOUVCDWOJGT9CRRGPMTCP\/KV4CPFUEJTKHVOOI 5EJYGFG#C<GRGTPKEM *ÒDUEJG2CVKPCMN4CPFHGJNGTHCUVXQT\ÒINKEJ



7188

7189

7189



4GKEJUVCNGT%NCWUVJCN&CX5EJYGFG#C<GRGTPKEM



5GFKUXCMCP\5KNDGTOGFCKNNGWPUKIPKGTVXQP,%JT*QJNGKUGP5VGORGNYCJTUEJGKPNKEJXQP ,6JKGDCWF&TGKR[TCOKFGPHÌTOKICPIGQTFPGVG9CRRGPUEJKNFGWOJGT9CRRGPMTCP\OKV0COGP&GT JGKNKIG .KDQTKWU OKV -TWOOUVCD WPF -CTN FGT )TQ­G OKV 5EJYGTV JCNVGP &QOOQFGNN WOJGT 9CRRGP   MTCP\OKV0COGPOOI5EJYGFG#C<GRGTPKEM 5GJTUEJÌPpXQT\ÒINKEJ



-W2HGPPKI/ÒPUVGT-W2HGPPKI/ÒPUVGT5EJYGFG#C#C<GRGTPKEM  5VÒEM(CUVUGJTUEJÌPWPFUGJTUEJÌP





5GJTUEJÌPpXQT\ÒINKEJ



407


SAMMLUNG SEDISVAKANZ

7191

&#5$+567/2#55#7 

5GFKUXCMCP\5KNDGTOGFCKNNGXQP,%JT$WUEJWPF,.1GZNGKP5V5VGRJCPUKV\VXXOKV $WEJ WPF -TWOOUVCD FCXQT FCU 9CRRGP FGU &QOMCRKVGNU *CPF OKV 5VGKP CWU -TQPG #PUKEJV FGT   5VCFV CWU FGT 8QIGNRGTURGMVKXG OKV FGP FTGK (NÒUUGP +PP &QPCW WPF +N\ WOJGT 9CRRGPMTCP\    OOI-GNNPGT<GRGTPKEM 48QT\ÒINKEJ



7192



5KNDGTOGFCKNNGXQP,%JT$WUEJWPF,.1GZNGKP5V5VGRJCPUKV\VXXOKV$WEJWPF-TWOO UVCD FCXQT FCU 9CRRGP FGU &QOMCRKVGNU *CPF OKV 5VGKP CWU -TQPG #PUKEJV FGT 5VCFV CWU FGT 8Q   IGNRGTURGMVKXG OKV FGP FTGK (NÒUUGP +PP &QPCW WPF +N\ WOJGT 9CRRGPMTCP\  OO  I   -GNNPGT<GRGTPKEM 9KP\4CPFHGJNGTXQT\ÒINKEJ



7193

&#5$+567/4')'05$74) 

408

5GFKUXCMCP\5KNDGTOGFCKNNGXQP,%$WUEJWPF,.1GZNGKP#PUKEJVFGU4GIGPDWTIGT &QOU XQP 5ÒFYGUVGP OKV PQEJ WPXQNNGPFGVGP 6ÒTOGP+P GKPGT OWUEJGNHÌTOKIGP -CTVWUEJG FCU 9CR   RGPFGU&QOMCRKVGNU 'KPCWHFGO9CUUGTHCJTGPFGT-CJPFCTKPFGT#RQUVGN2GVTWUOKV5EJNÒUUGNWPF (KUEJ WOJGT9CRRGPMTCP\OKV0COGPOOI'OOGTKI-Q\KPQYUMK<GRGTPKEM 8QT\ÒINKEJ




SAMMLUNG SEDISVAKANZ

7195

7194

7195



5KNDGTOGFCKNNGXQP,%$WUEJWPF,.1GZNGKP+PGKPGTOWUEJGNHÌTOKIGP-CTVWUEJGFCU9CR RGPFGU&QOMCRKVGNU 'KPCWHFGO9CUUGTHCJTGPFGT-CJPFCTKPFGT#RQUVGN2GVTWUOKV5EJNÒUUGNWPF (KUEJ #PUKEJV FGU 4GIGPDWTIGT &QOU XQP 5ÒFYGUVGP OKV PQEJ WPXQNNGPFGVGP 6ÒTOGP   OO   I'OOGTKI-Q\KPQYUMK<GRGTPKEM 8QT\ÒINKEJ





5GFKUXCMCP\-QPX6CNGT4GIGPUDWTI&CX'OOGTKI-Q\KPQYUMK<GRGTPKEM (CUVXQT\ÒINKEJ



7196

&#5$+567/52';'4 

5GFKUXCMCP\5KNDGTOGFCKNNGXQP#5EJ·HHGT)GMTÌPVG/CFQPPCOKV-KPFCWH/QPFUKEJGN JKPVGTKJTFCUUKNDGTPG-TGW\QDGPKPGKPGT-CTVWUEJGFKG,CJTGU\CJNWOJGT9CRRGPMTCP\OKV0COGP &CU OKV FGO (ÒTUVGPJWV DGFGEMVG XKGTHGNFKIG 9CRRGP 5RG[GT9GK­GPDWTI FCJKPVGT 5EJYGTV WPF   -TWOOUVCDIGMTGW\VWOJGT9CRRGPMTCP\OOI'JTGPF*CCU<GRGTPKEM 440WT'ZGORNCTGIGRT·IV$TQUEJKGTURWTGPUGJTUEJÌP



7198

7197

7197

&#5'4<$+567/64+'4 



5GFKUXCMCP\4GKEJUVCNGTI+PGKPGTXGT\KGTVGP-CTVWUEJGUKV\V5V2GVTWUXX OKV5EJNÒUUGNPWPF$WEJCWH9QNMGPJKPVGTKJOFCU-TGW\XQP6TKGT&KGIGMTÌPVGJN*GNGPCUVGJVX XKP*GTOGNKPOCPVGNWPFJ·NVOKVCWUIGDTGKVGVGP#TOGPGKPGP5VCDXQTUKEJFGTFWTEJFKGTOGNFGU 4QEM%JTKUVKIG\QIGPKUV&CXX5EJT<GRGTPKEM  44.GKEJVLWUVKGTVHCUVXQT\ÒINKEJGU'ZGORNCT  4GKEJUVCNGTX5EJT<GRGTPKEM 445GJTCVVTCMVKXGUXQT\ÒINKEJGU'ZGORNCT  409


SAMMLUNG SEDISVAKANZ

7200

7199



4GKEJUVCNGTX5EJT<GRGTPKEM UKGJGCWEJ#PO50CEJVTCI   -N4CPFHGJNGTUGJTUEJÌP





4GKEJUVCNGTX5EJT<GRGTPKEM



*ÒDUEJG2CVKPCXQT\ÒINKEJ

7201



&#5$+567/9ª4<$74)

5GFKUXCMCP\5EJKNNKPI9ÒT\DWTI*GNOUEJTQVV<GRGTPKEM

45GJTUEJÌP



7203

7202

7202



5GFKUXCMCP\  5KNDGTOGFCKNNG  WPUKIPKGTV XQP # 8GUVPGT +P GKPGT OKV \YGK 2CNO\YGKIGP   DGUVGEMVGP OWUEJGNHÌTOKIGP -CTVWUEJG FCU IGMTÌPVG 5VKHVUYCRRGP QDGP -CTVWUEJG WOJGT 9CRRGP   MTCP\5V -KNKCP UVGJV HCUV X X OKV /KVTC 5EJYGTV WPF $KUEJQHUUVCD WOJGT 9CRRGPMTCP\    OOI$GTPJGKOGT*GNOUEJTQVV<GRGTPKEM *ÒDUEJG2CVKPCXQT\ÒINKEJ





5KNDGTOGFCKNNG  WPUKIPKGTV XQP # 8GUVPGT +P GKPGT OKV \YGK 2CNO\YGKIGP DGUVGEMVGP OWUEJGN   HÌTOKIGP -CTVWUEJG FCU IGMTÌPVG 5VKHVUYCRRGP QDGP -CTVWUEJG WOJGT 9CRRGPMTCP\5V -KNKCP UVGJV   HCUVXXOKV/KVTC5EJYGTVWPF$KUEJQHUUVCDWOJGT9CRRGPMTCP\OOI$GTPJGKOGT *GNOUEJTQVV<GRGTPKEM *ÒDUEJG2CVKPCUGJTUEJÌPpXQT\ÒINKEJ



7204



410

5KNDGTOGFCKNNG  XQP # 8GUVPGT +P GKPGT OKV \YGK 2CNO\YGKIGP DGUVGEMVGP OWUEJGNHÌTOKIGP   -CTVWUEJG FCU IGMTÌPVG 5VKHVUYCRRGP QDGP -CTVWUEJG WOJGT 9CRRGPMTCP\5V -KNKCP UVGJV HCUV X X   OKV/KVTC5EJYGTVWPF-TWOOUVCDWOJGT9CRRGPMTCP\OOI$GTPJGKOGT*GNO UEJTQVV<GRGTPKEM 4CPFWPF(GNFGTÒDGTCTDGKVGVUQPUVHCUVXQT\ÒINKEJ




SAMMLUNG SEDISVAKANZ

7205



7207

7206

5GFKUXCMCP\  5KNDGTOGFCKNNG  XQP , . 1GZNGKP &TGK R[TCOKFGPHÌTOKI CPIGQTFPGVG 9CR   RGPUEJKNFG FCTCWH -TQPG QDGP -CTVWUEJG WOJGT 9CRRGPMTCP\)GMTÌPVG /CFQPPC OKV -KPF WPF   <GRVGT KP 5VTCJNGPMTCP\ CWH 9QNMGP N WPVGP MPKGV 5V -KNKCP OKV /KVTC $KUEJQHUUVCD WPF 5EJYGTVT WPVGPMPKGV5V%QNQPCVWUKP&KCMQPGPMNGKFWPIOKV-GNEJWPF2CNO\YGKIJKPVGTKJOMPKGV5V6QVPCPWU WPF UVÒV\V UKEJ CWH GKP $WEJ QDGP -CTVWUEJG WOJGT 9CRRGPMTCP\ OOI*GNOUEJTQVV <GRGTPKEM *ÒDUEJG2CVKPCXQT\ÒINKEJ





5KNDGTOGFCKNNGXQP,.1GZNGKPOOI*GNOUEJTQVV<GRGTPKEM  *ÒDUEJG2CVKPCXQT\ÒINKEJ





5GFKUXCMCP\5KNDGTOGFCKNNGXQP()ÌV\KPIGT&TGKR[TCOKFGPHÌTOKICPIGQTFPGVG9CRRGP UEJKNFG FCTÒDGT -TQPG QDGP -CTVWUEJG WOJGT 9CRRGPMTCP\)GMTÌPVG /CFQPPC OKV -KPF WPF <GR   VGTKP5VTCJNGPMTCP\CWH9QNMGPNWPVGPMPKGV5V-KNKCPOKV/KVTC$KUEJQHUUVCDWPF5EJYGTVTWPVGP MPKGV5V%QNQPCVWUKP&KCMQPGPMNGKFWPIOKV-GNEJWPF2CNO\YGKIJKPVGTKJOMPKGV5V6QVPCPWUWPF UVÒV\VUKEJCWHGKP$WEJQDGP-CTVWUEJGWOJGT9CRRGPMTCP\OOI*GNOUEJTQVV <GRGTPKEM -N4CPFHGJNGTUGJTUEJÌPpXQT\ÒINKEJ



7208 7209

7209



5KNDGTOGFCKNNG  XQP ( )ÌV\KPIGT &TGK R[TCOKFGPHÌTOKI CPIGQTFPGVG 9CRRGPUEJKNFG FCTCWH   -TQPG QDGP -CTVWUEJG WOJGT 9CRRGPMTCP\5V -KNKCP UVGJV HCUV X X OKV /KVTC $KUEJQHUUVCD WPF   5EJYGTVQDGP-CTVWUEJGWOJGT9CRRGPMTCP\OOI*GNOUEJTQVV<GRGTPKEM 8QT\ÒINKEJ





5GFKUXCMCP\5KNDGTOGFCKNNGXQP,29GTPGT&TGKR[TCOKFGPHÌTOKICPIGQTFPGVG9CRRGP UEJKNFG FCTÒDGT -TQPG QDGP -CTVWUEJG WOJGT 9CRRGPMTCP\)GMTÌPVG /CFQPPC OKV -KPF WPF <GR   VGTKP5VTCJNGPMTCP\CWH9QNMGPNWPVGPMPKGV5V-KNKCPOKV/KVTC$KUEJQHUUVCDWPF5EJYGTVTWPVGP MPKGV5V%QNQPCVWUKP&KCMQPGPMNGKFWPIOKV-GNEJWPF2CNO\YGKIJKPVGTKJOMPKGV5V6QVPCPWUWPF UVÒV\VUKEJCWHGKP$WEJQDGP-CTVWUEJGWOJGT9CRRGPMTCP\OOI*GNOUEJTQVV <GRGTPKEM *GPMGNURWTXQT\ÒINKEJ



.165'&+58#-#0< 

&KXGTUG0CEJRT·IWPIGPWPF)CNXCPQUCNVFGWVUEJGT/ÒP\GPWPF/GFCKNNGP\WO6JGOC5GFKUXCMCP\  5VÒEM/GKUVXQT\ÒINKEJ

 411


MEDAILLEN

/'&#+..'0

7211

7212

7212

)1'6</'&#+..'0 



5KNDGTOGFCKNNGCWHFKG,CJTHGKGTFGT4JGKPNCPFG)GTOCPKCYKTFXQP%QNQPKCWPF$ÒTIGTP FGT 5VCFV DGITÒ­V)NQEMG FCTÒDGT 5RTWEJDCPF XQP \YGK 'PIGNP IGJCNVGP FCTWPVGT  <GKNGP 5EJTKHV   OOI-KGPCUV (CUV5VGORGNINCP\



5KNDGTOGFCKNNG  CWH FKG ,CJTHGKGT FGT #WIUDWTIGT -QPHGUUKQP KP %QDWTI $TWUVDKNFGT XQP   /CTVKP .WVJGT WPF ,QJCPP FGU $GUV·PFKIGP JCNDT#PUKEJV FGT %QDWTIGT 8GUVG /KV 4CPFRWP\G   $#;'4*#726/ª0<#/6('+05+.$'4OOI-KGPCUV5NI9JKVKPI  442TCEJVGZGORNCT/CVVKGTV5VGORGNINCP\



7213





7214

5KNDGTOGFCKNNG  CWH FKG ,CJTHGKGT FGT #WIUDWTIGT -QPHGUUKQP KP %QDWTI $TWUVDKNFGT XQP   /CTVKP .WVJGT WPF ,QJCPP FGU $GUV·PFKIGP JCNDT#PUKEJV FGT %QDWTIGT 8GUVG /KV 4CPFRWP\G   $#;'4*#726/ª0<#/6('+05+.$'4OOI-KGPCUV5NI9JKVKPI  (CUV5VGORGNINCP\



5KNDGTOGFCKNNG  UKIPKGTV XQP )WKFQ )QGV\ 5QJP XQP -CTN )QGV\ CWH FKG )CTCPVKGP FGT 9GUV   O·EJVGHÒT2QNGP'KP'PIN·PFGTWPFGKPG(TCP\ÌUKPWPVGTGKPGO4GIGPUEJKTOFGT'PIN·PFGTNGIVFGP #TO WO GKPGP RQNPKUEJGP,WPIGPOKV5VGEMGPRHGTF'KPFGWVUEJGT5QNFCVUVGJVÒDGTGKPGT-CPQPGWPF J·NVGKPGPRQNPKUEJGP5QNFCVGPKPUGKPGT4GEJVGPWPFGKPGP$NKV\KPFGT.KPMGPWPVGPTGKP2HGTF/KV 4CPFRWP\G$#;'4Ü*#726/ª0<#/6Û5+.$'4HOOI-KGPCUV  8QPITQ­GT5GNVGPJGKV(GKPG2CVKPCHCUV5VGORGNINCP\



.16)1'6</'&#+..'0 

412

5KNDGTOGFCKNNG  CWH FGP 6QF FGUFGWVUEJGP,CIFHNKGIGTU/CPHTGFXQP4KEJVJQHGP $TGUNCW Ó8CWZUWT5QOOG -KGPCUV $TQP\GOGFCKNNGCWHFGP)G­NGTJWVKPFGT2HCN\ -KGPCUV   5KNDGTOGFCKNNG  CWH FKG #OGTKMCHCJTV FGU .WHVUEJKHHGU .<  -KGPCUV   5KNDGT   OGFCKNNG  CWH FGP 6QF FGU FGWVUEJGP )TQ­CFOKTCNU #NHTGF XQP 6KTRKV\  -ÒUVTKP Ó   'DGPJCWUGP/ÒPEJGP -KGPCUV 5KNDGTOGFCKNNGCWHFGP6QFGUVCIXQP-ÌPKI*GKPTKEJ+ *GT\QIXQP5CEJUGP Ó/GONGDGP -KGPCUV  5VÒEM8QT\ÒINKEJp5VGORGNINCP\




MEDAILLEN

7216

07/+5/#6+-'4 

5VQUEJ 2JKNKRR (TGKJGTT XQP  Ó $TQP\GOGFCKNNG  XQP ( , /CTVGCW -QRH XQP   5VQUEJU T&KQIGPGU KO (C­ FCXQT UVGJV #NGZCPFGT FGT )TQ­G KO *KPVGTITWPF 5VCFVOCWGT OKV 6GO   RGNOO$GTKEJVG9WT\DCEJ 4-N5VGORGNHGJNGTXQT\ÒINKEJ



7217 1:1,3



)QRRGN /CTKG .WKUG  Ó 'KUGPIW­OGFCKNNG  XQP ' 'UUGÌ $ÒUVG T#UVTQNQIKUEJG   &CTUVGNNWPIOO 5GJTUEJÌPpXQT\ÒINKEJ



7218

&'765%*'-1.10+'0 



5KNDGTOGFCKNNGQ,  XQP/QTKPCWHFKG,CJTHGKGTFGT'TYGTDWPIFGWVUEJGT-QNQPKGP'KPG O·PPNKEJG)GUVCNVDCJPVUKEJOKVFGO5EJYGTVGKPGP9GIFWTEJ&QTPGPIGUVTÒRR'TFMWIGNOKV#HTKMC FCTKP GKPIG\GKEJPGV FKG GJGOCNKIGP FGWVUEJGP -QNQPKGP KP #HTKMC WOJGT 0COGP FGT *CWRVUV·FVG FGT   FGWVUEJGP -QNQPKGP WPF FKG FQTV JCWRVU·EJNKEJ XQTMQOOGPFGP 6KGTG /KV 4CPFRWP\G 97'466   /7'0<#/65+.$'4('+0OOI$CNNE 8QT\ÒINKEJ



5KNDGTOGFCKNNGQ,  XQP/QTKPCWHFKG,CJTHGKGTFGT'TYGTDWPIFGWVUEJGT-QNQPKGP'KPG O·PPNKEJG)GUVCNVDCJPVUKEJOKVFGO5EJYGTVGKPGP9GIFWTEJ&QTPGPIGUVTÒRR'TFMWIGNOKV#HTKMC FCTKP GKPIG\GKEJPGV FKG GJGOCNKIGP FGWVUEJGP -QNQPKGP KP #HTKMC WOJGT 0COGP FGT *CWRVUV·FVG FGT   FGWVUEJGP -QNQPKGP WPF FKG FQTV JCWRVU·EJNKEJ XQTMQOOGPFGP 6KGTG /KV 4CPFRWP\G 97'466   /7'0<#/65+.$'4('+0OOI&C\WGKPYGKVGTGU'ZGORNCTKP$TQP\GOO $CNNE 5VÒEM-N4CPFHGJNGT Z XQT\ÒINKEJ

 413


MEDAILLEN

7220 7221

7221



&GWVUEJ1UVCHTKMC <YGKOCTMHÌTOKIG XGTUKNDGTVG /GFCKNNG Q , WPUKIPKGTV CWH FGP #HTKMCHQTUEJGT   'OKP2CUEJC7PKHQTOKGTVGU$TWUVDKNF9KNJGNOU++T$TWUVDKNF2CUEJCUJCNDTOOI/KV 4KHHGNTCPF/CTKGPD5NI$TGVVCWGT 42TCEJVGZGORNCT5VGORGNINCP\



'OKP2CUEJCYWTFGCNU'FWCTF5EJPKV\NGTKP1RRGNPIGDQTGP&GT#T\VWPF#HTKMCTGKUGPFGUVCPFUGKVKP ·I[RVKUEJGP &KGPUVGP YWTFG  CNU 'OKP 'HHGPFK 4GIKGTWPIUCT\V KO 5WFCP WPF  CNU 'OKP $GK )QWXGTPGWT   FGT SWCVQTKCNRTQXKP\ +PHQNIG FGU /CJFKCWHUVCPFGU YCPFVG GT UKEJ PCEJ &GWVUEJ1UVCHTKMC VTCV  KP FGWVUEJG   &KGPUVGWPFWPVGTPCJOGKPG'ZRGFKVKQP\WFGO8KEVQTKCUGGCWHFGTGTUGKPGP#WHVTCIÒDGTUEJTGKVGPFCO#WIWUV ÒDGT6CDQTCFKGFGWVUEJG(NCIIGJKUUVGYWTFGGTCWHGKPGTCPFGTGP'ZRGFKVKQPCWH$GHGJNFGU5WNVCPUXQP -KDQPIQKP-KPGOCGTOQTFGV



5KNDGTOGFCKNNGQ,WPUKIPKGTVCWH/CLQT9KUUOCPP&T'OKP2CUEJCWPF&T%CTN2GVGTU&KGFTGK $ÒUVGPPGDGPGKPCPFGTPCEJT&'06*#6'04'+%*'0(145%*'40&'070'45%*41%-' 0'0/00'4<7/)'&%*60+55WPVGP.QTDGGT\YGKIOOI5NI$TGVVCWGT 4(GKPG2CVKPCXQT\ÒINKEJp5VGORGNINCP\



7223

7222



7222

$TQP\GOGFCKNNG  9GTMUVCVV 1GTVGN $GTNKP CWH FKG ªDGTPCJOG FGU 5EJWV\IGDKGVGU KP FKG 4GKEJU   XGTYCNVWPI7PKHQTOKGTVGU$TWUVDKNFFGU/CLQTUXQP9KUUOCPPNOKV6TQRGPJGNO9GKDNKEJGT)GPKWU OKVFGWVUEJGT-TKGIUHNCIIGUEJYGDVPCEJNÒDGT/GGTOO 8QT\ÒINKEJp5VGORGNINCP\



*GTOCPP9KUUOCPPKP(TCPMHWTV1FGTIGDQTGPKP9GK­GPDCEJDGK.KG\GP 5VGKGTOCTM IGUVQTDGPYCT 1HHK\KGT GKPGU OGEMNGPDWTIKUEJGP +PHCPVGTKG4GIKOGPVU 0CEJ (QTUEJWPIUTGKUGP FKG GT  DKU  KO #WHVTCIG   FGT &GWVUEJGP #HTKMCPKUEJGP )GUGNNUEJCHV WPVGTPQOOGP JCVVG IGYCPP .GQRQNF ++ XQP $GNIKGP KJP HÒT GKPG (QT   UEJWPIUTGKUG KP FCU UÒFNKEJG -QPIQDGEMGP CWH FGT GT FGP DKU FCJKP WPDGMCPPVGP 7PVGTNCWH FGU -CUUCK GTHQTUEJVG   'KP 9CUUGTHCNN FGU (NWUUGU VT·IV UGKVFGO UGKPGP 0COGP  YWTFG 9KUUOCPP WPVGT 'TPGPPWPI \WO *CWRVOCPP   WPF -QOOKUUCT XQP $KUOCTEM DGCWHVTCIV FGP #WHUVCPFFGPFKG#TCDGTKP1UVCHTKMCIGUEJÒTVJCVVGPPKGFGT\WYGT HGP YCU KJO DKU /·T\  OKV FGT XQP KJO IGITÒPFGVGP HCTDKIGP -QNQPKCNVTWRRG IGNCPI 'T YWTFG \WO /CLQT   DGHÌTFGTVIGCFGNVWPF4GKEJUMQOOKUUCT8QPDKUYCTGT)QWXGTPGWTXQP&GWVUEJ1UVCHTKMC



5KNDGTOGFCKNNG  XQP # *WOOGN 9GTMUVCVV .CWGT 0ÒTPDGTI CWH FGP GTHQNITGKEJGP -CORH FGT   5EJWV\VTWRRG IGIGP 'PIN·PFGT $GNIKGT WPF 2QTVWIKGUGP  7PKHQTOKGTVGU $TWUVDKNF FGU   )GPGTCNOCLQTU XQP .GVVQY8QTDGEM T'KP XGTYWPFGVGT 5EJWV\VTWRRGPUQNFCV UVGJV T OKV )GYGJT WPF   (CJPG/KV4CPFRWP\GOOI<GV\OCPP  42TCEJVGZGORNCT*GTTNKEJG2CVKPCHCUV5VGORGNINCP\ 2CWNX.GVVQY8QTDGEM KP5CCTNQWKUÓKP*CODWTIYWTFGPCEJ6GKNPCJOGCPFGP-·ORHGPIGIGPFKG $QZGTKP%JKPCWPFDKUIGIGPFKGCWHUV·PFKUEJGP*GTGTQWPF*QVVGPVQVVGPKP&GWVUEJ5ÒFYGUVCHTKMC -QOOCPFGWTFGT5EJWV\VTWRRGKP&GWVUEJ1UVCHTKMCOKVFGTGTKOGTUVGP9GNVMTKGIDKU\WO9CHHGPUVKNNUVCPF GTHQNITGKEJFGTªDGTOCEJVXQP'PIN·PFGTP$GNIKGTPWPF2QTVWIKGUGPYKFGTUVCPF

414




MEDAILLEN

7224



5KNDGTOGFCKNNGXQP-)QGV\CWHFGP)GDWTVUVCIFGUGJGOCNKIGP)QWXGTPGWTUXQP&GWVUEJ 1UVCHTKMC )GPGTCN FGT +PHCPVGTKG 'FWCTF XQP .KGDGTV $TWUVDKNF N&CU )QWXGTPGOGPVUIGD·WFG KP   &CTGU5CNCO KO 8QTFGTITWPF 'KPIGDQTGPGT WPF 5EJWV\VTWRRGPUQNFCV PGDGP -WDWU /KV 4CPFRWP\G   OOI-KGPCUV 4*GTTNKEJG2CVKPCXQT\ÒINKEJp5VGORGNINCP\



'FWCTFXQP.KGDGTVKP4GPFUDWTIIGDQTGPYCTXQPDKU)QWXGTPGWTXQP&GWVUEJ1UVCHTKMC'TVTCV XQP FKGUGO #OV YGIGP /GKPWPIUXGTUEJKGFGPJGKVGP OKV FGO -QNQPKCNCOV \WTÒEM PCJO KO HQNIGPFGP ,CJT UGKPGP   #DUEJKGFWPFYKFOGVGUKEJFGT/KNKV·TUEJTKHVUVGNNGTGK5GKVYCTGT8QTUKV\GPFGTGKPGU4GKEJUXGTDCPFGUIGIGP FKG5Q\KCNFGOQMTCVKG

7225 1:1,3



)TQ­G$TQP\GIW­OGFCKNNGXQP-)QGV\CWHFGP)GDWTVUVCIFGUGJGOCNKIGP)QWXGTPGWTUXQP &GWVUEJ1UVCHTKMC)GPGTCNFGT+PHCPVGTKG'FWCTFXQP.KGDGTV$TWUVDKNFN&CU)QWXGTPGOGPVUIGD·WFG KP &CTGU5CNCO KO 8QTFGTITWPF 'KPIGDQTGPGT WPF 5EJWV\VTWRRGPUQNFCV PGDGP -WDWU  OO   -KGPCUV 448QT\ÒINKEJp5VGORGNINCP\



7226



-KCWVUEJQW 5CVKTKUEJG 5KNDGTOGFCKNNG  WPUKIPKGTV CWH FKG 8GTVGKFKIWPI -KCWVUEJQWU IGIGP FKG   ,CRCPGT'KP'PIN·PFGTUEJKEMVGKPGP#HHGPKPLCRCPKUEJGT7PKHQTOCWHGKPGP'KEJDCWOKO$CWOQDGP FGT FGWVUEJG #FNGT CP FGP WPVGTGP <YGKIGP FTGK )GJGPMVG<GJP 5EJTKHV /KV 4CPFRWP\G    5+.$'4OOI<GV\OCPP 48QT\ÒINKEJ



0CEJFGTLCRCPKUEJGP-TKGIUGTMN·TWPICPFCU&GWVUEJG4GKEJXQO#WIWUVXGTVGKFKIVGFKGTWPF/CPP UVCTMG FGWVUEJG )CTPKUQP WPVGTUVÒV\V XQP XKGT -CPQPGPDQQVGP GKPGO 6QTRGFQDQQV WPF FGO ÌUVGTTGKEJKUEJGP   -TGW\GT -CKUGTKP 'NKUCDGVJ FKG (GUVWPI 6UKPIVCW GTHQNITGKEJ DKU \WT 'TUEJÌRHWPI FGT 8GTVGKFKIWPIUOKVVGN IGIGP   FKG/CPPUVCTMGPLCRCPKUEJGPWPFDTKVKUEJGPXQPUVCTMGP/CTKPGGKPJGKVGPWPVGTUVÒV\VGP$GNCIGTWPIUVTWRRGP 'TUVCO0QXGODGTWPVGT\GKEJPGVGFGT)QWXGTPGWT-CRKV·P\WT5GG/G[GT9CNFGEMFKG-CRKVWNCVKQP  <W FGO GJGOCNKIGP FGWVUEJGP 2CEJVIGDKGV WPF (NQVVGPUVÒV\RWPMV KP %JKPC IGJÌTVGP FKG $WEJV XQP -KCWVUEJQW FKG   *CNDKPUGN6UKPIVCWWPFFKG*CNDKPUGN*CKUK

415


PAPIERGELD

7227

9'.6-4+') 

5KNDGTOGFCKNNG9GTMUVCVV/C[GTWPF9KNJGNO5VWVVICTVCWHFKG)GHCNNGPGPFGU-TKGIGU$TGPPGP FGT #NVCT-TKGIGT OKV 5RGGT WPF 5EJKNF UVGJV T WPF DGVTCWGTV IGHCNNGPGP -COGTCFGP KO *KPVGTITWPF   .CPFUEJCHVOKVWPVGTIGJGPFGT5QPPGOOI 48QT\ÒINKEJ



/'&#+..'0.165 

#NNIGOGKP+PVGTGUUCPVG5COONWPIXQPMNGKPGP5KNDGTOGFCKNNGPQ, WO XQP&·PGOCTM-ÌNP .QVJTKPIGP 6TKGT  XGTUEJKGFGPG  WPF FGO 4ÌOKUEJ&GWVUEJGP 4GKEJ OGKUV KO <WUCOOGPJCPI OKV   FGT-TÌPWPI,QUGHU+\WOTÌOKUEJGP-ÌPKIKP#WIUDWTIIGRT·IV  5VÒEM<WO6GKNUGNVGP5EJÌPG6ÌPWPIXQT\ÒINKEJ





$TQP\G5RQVVOGFCKNNGCWH(TKGFTKEJ++WPFFKG5EJNCEJVDGK4Q­DCEJ5KNDGTOGFCKNNGCWHFGP 'PVUCV\XQP/CKP\FWTEJ(TKGFTKEJ9KNJGNO++$TQP\GOGFCKNNG+ORHRT·OKG0CRQNGQPU+5KNDGT PG /KPKCVWTOGFCKNNG  CWH FKG *QEJ\GKV XQP -CTN .WFYKI WPF *GPTKGVVG KP 9GKNDWTI 5KNDGT   OGFCKNNG  CWH FKG 'KPYGKJWPI FGU 4GKEJUVCIGU 5KNDGTOGFCKNNG  HÒT FKG 5KGIGT FGT 5VCFV   -QPUVCP\KO-TKGIIGIGP(TCPMTGKEJ5KNDGTOGFCKNNGCWHFKG5KNDGTJQEJ\GKVFGU(ÒTUVGPRCCTUXQP #WGTURGTI&C\W'KPGWPDGUVKOOVGMNGKPG)QNFOGFCKNNGGKP6CNGT/CTKC6JGTGUKCUWPFZ0QVIGNFXQP $TGKUCEJWPF&QPCWGUEJKPIGP 5VÒEM/GKUVXQT\ÒINKEJ





&KXGTUG /GFCKNNGP FGU  ,CJTJWPFGTVU CWH XGTUEJKGFGPG #PN·UUG WPF 2GTUÌPNKEJMGKVGP W C XQP   )TQ­DTKVCPPKGP*CDUDWTI0KGFGTNCPFGGVE+PVGTGUUCPVGU.QVDKVVGDGUKEJVKIGP  5VÒEM5GJTUEJÌPpXQT\ÒINKEJ





5COONWPI XQP EC  /GFCKNNGP FCTWPVGT CWEJ YGPKIG /ÒP\GP &KG 5COONWPI DGUVGJV \WOGKUV CWU   /GFCKNNGP FGU  DKU  ,CJTJWPFGTVU FCTWPVGT EC  4GRNKMGP D\Y 0CEJIÒUUG XQP 4GPCKUUCPEG   OGFCKNNGP +P FGT 5COONWPI GPVJCNVGP KUV CWEJ GKPG IQNFGPG HTCP\ÌUKUEJG 8GTFKGPUVOGFCKNNG XQP   

UR·VGTG 0CEJRT·IWPI )GYKEJV EC  I  UQYKG FKG 0CEJCJOWPI GKPGU -TGOPKV\GT  &WMCVGP   5V)GQTIYQJNCWUFGO,CJTJWPFGTV'KPJQEJKPVGTGUUCPVGU1DLGMVFCUWPDGFKPIVDGUKEJVKIVYGTFGP UQNNVG EC5VÒEM5GJTWPVGTUEJKGFNKEJGTJCNVGPOGKUVUEJÌPWPFUGJTUEJÌP 



-NGKPG5COONWPIFKXGTUGT/GFCKNNGPCWU5KNDGTWPFWPGFNGP/GVCNNGPFGU,CJTJWPFGTVU  5VÒEM5EJÌPpXQT\ÒINKEJ





-NGKPG 5GTKG XQP 5KNDGT WPF $TQP\GOGFCKNNGP IGKUVNKEJGT (ÒTUVGP FGU  WPF  ,CJTJWPFGTVU 'KP   UKGFGNP 6TCIDCTG $TQP\GOGFCKNNG Q , (TGKDWTI 5KNDGTOGFCKNNG Q , )WTM $TQP\GOGFCKNNG    -ÌNP$TQP\GOGFCKNNG2CFGTDQTP5KNDGTOGFCKNNG5CN\DWTI5KNDGTOGFCKNNG9ÒT\DWTI $TQP\GOGFCKNNG 5VÒEM5GJTUEJÌPpXQT\ÒINKEJ





#NVFGWVUEJNCPF#WIUDWTI5KNDGTPG2TGKUOGFCKNNG$CFGP5KNDGTPG2TGKUOGFCKNNGQ, WO  $C[GTP5KNDGTOGFCKNNG2TGW­GP5KNDGTOGFCKNNGQ, 'JGLWDKN·WO 4GIGPUDWTI5KNDGTOGFCKNNG CWHFCU5VCJNUEJKG­GP *GPMGNURWT 4&45KNDGTOGFCKNNGCWHFKG*QEJ\GKV,QUGHU++  5VÒEM*GPMGNURWT Z UGJTUEJÌPpXQT\ÒINKEJ



2#2+'4)'.&

7235 1:2

$#0-&'765%*'4.0&'4$70&'54'27$.+-&'765%*.#0& 

&GWVUEJG/CTMQ, CWUIGIGDGPCO 2KEM4KZGPC4QUGPDGTIC  49GPKIIGDTCWEJV





&GWVUEJG/CTMQ, CWUIGIGDGPCO 2KEM4KZGPC4QUGPDGTIC  49GPKIIGDTCWEJV



416


PAPIERGELD DEUTSCH-OSTAFRIKA

2#2+'4)'.&810&'765%*156#(4+-# '+0'5#//.70)#7524+8#6$'5+6<

7237 1:1,3



4WRKGP&GWVUEJ1UVCHTKMCPKUEJG$CPM<YGKIPKGFGTNCUUWPI&CTGUUCNCOHÃ&#x2019;PHUVGNNKIG -0CWHFGT8QTFGTWPF4Ã&#x2019;EMUGKVG2KEM4QUGPDGTID +++





 4WRKGP  &GWVUEJ1UVCHTKMCPKUEJG $CPM <YGKIPKGFGTNCUUWPI &CTGUUCNCO  XKGTUVGNNKIG   -0CWHFGT8QTFGTWPF4Ã&#x2019;EMUGKVG2KEM4QUGPDGTIC +++



7239 1:2



 4WRKGP  &GWVUEJ1UVCHTKMCPKUEJG $CPM <YGKIPKGFGTNCUUWPI &CTGUUCNCO  XKGTUVGNNKIG   -0CWHFGT8QTFGTUGKVG2KEMC4QUGPDGTIC )GTGKPKIV++





 4WRKGP  &GWVUEJ1UVCHTKMCPKUEJG $CPM <YGKIPKGFGTNCUUWPI &CTGUUCNCO  HÃ&#x2019;PHUVGNNKIG   -0CWHFGT8QTFGTWPF4Ã&#x2019;EMUGKVG2KEMD4QUGPDGTIF +++



7241 1:2



4WRKGP&GWVUEJ1UVCHTKMCPKUEJG$CPM<YGKIPKGFGTNCUUWPI&CTGUUCNCO2KEM4QUGP DGTI +++





 4WRKGP  &GWVUEJ1UVCHTKMCPKUEJG $CPM <YGKIPKGFGTNCUUWPI &CTGUUCNCO 2KEM  4QUGP   DGTI +++

 417


PAPIERGELD DEUTSCH-OSTAFRIKA

7243 1:1,3



4WRKGP&GWVUEJ1UVCHTKMCPKUEJG$CPM<YGKIPKGFGTNCUUWPI&CTGUUCNCOHÃ&#x2019;PHUVGNNKIG -0CWHFGT8QTFGTWPF4Ã&#x2019;EMUGKVG2KEM4QUGPDGTI 44)GTGKPKIV+++ 

7244 1:2



 4WRKGP  &GWVUEJ1UVCHTKMCPKUEJG $CPM <YGKIPKGFGTNCUUWPI &CTGUUCNCO  +PVGTKOU   $CPMPQVG 2CRKGT JGNNITÃ&#x2019;P KP HGKPGT .GKPGPRTGUUWPI /KV JCPFUEJTKHVNKEJGP 7PVGTUEJTKHVGP $GTGPFV    (TÃ&#x2019;JNKPI2KEM4QUGPDGTI +++p+8



7245 1:2



418

4WRKGP&GWVUEJ1UVCHTKMCPKUEJG$CPM<YGKIPKGFGTNCUUWPI&CTGUUCNCO+PVGTKOU$CPM PQVG1JPG5GTKGPDG\GKEJPWPI/KVJCPFUEJTKHVNKEJGP7PVGTUEJTKHVGP5VGNNKPI-KTUV2KEMC4QUGP DGTIC ++p




PAPIERGELD DEUTSCH-OSTAFRIKA

7248 1:2 ex 7246 1:2



4WRKGP&GWVUEJ1UVCHTKMCPKUEJG$CPM<YGKIPKGFGTNCUUWPI&CTGUUCNCO+PVGTKOU$CPM PQVGP #WHFTWEM UEJYCT\  /KV JCPFUEJTKHVNKEJGP 7PVGTUEJTKHVGP 4GKPFN  'TPUV WPF 5VGNNKPI  -KTUV   4ÒEMUGKVG1XCNGT5VGORGNWPF9GTV2KEMC4QUGPDGTI 5EJGKPG++p+++



4WRKGP&GWVUEJ1UVCHTKMCPKUEJG$CPM<YGKIPKGFGTNCUUWPI&CTGUUCNCO+PVGTKOU$CPM PQVG1JPG5GTKGPDG\GKEJPWPI/KVJCPFUEJTKHVNKEJGP7PVGTUEJTKHVGP5VGNNKPI-KTUV2KEMC4QUGP DGTIC ++



4WRKGP&GWVUEJ1UVCHTKMCPKUEJG$CPM<YGKIPKGFGTNCUUWPI&CTGUUCNCO+PVGTKOU$CPM PQVG5GTKG')NCVVGTITÒPITCWGT-CTVQP.KPMUJCPFUEJTKHVNKEJG7PVGTUEJTKHV2QJNTGEJVU(CMUKOKNG (TÒJNKPI2KEME4QUGPDGTIG +p++





4WRKGP&GWVUEJ1UVCHTKMCPKUEJG$CPM<YGKIPKGFGTNCUUWPI&CTGUUCNCO+PVGTKOU$CPM PQVG5GTKG$/KVJCPFUEJTKHVNKEJGP7PVGTUEJTKHVGP5VGNNKPI$GTGPFV2KEM4QUGPDGTIC ++





 4WRKG  &GWVUEJ1UVCHTKMCPKUEJG $CPM <YGKIPKGFGTNCUUWPI &CTGUUCNCO  +PVGTKOU$CPM   PQVG5GTKGPDWEJUVCDG,OKVITQ­GO:ÒDGTUVGORGNV\WU·V\NKEJGKPDTCWPGU92KEM4QUGPDGTIE +p++







ex 7251 1:2



ex 7254 1:2

 4WRKG  &GWVUEJ1UVCHTKMCPKUEJG $CPM <YGKIPKGFGTNCUUWPI &CTGUUCNCO  +PVGTKOU$CPM   PQVGP 5GTKG # /KV JCPFUEJTKHVNKEJGP 7PVGTUEJTKHVGP 5VGNNKPI  -KTUV WPF -KTUV  $GTGPFV  5EJGKPG    &C\W4WRKG+PVGTKOU$CPMPQVG5GTKG#/KVJCPFUEJTKHVNKEJGP7PVGTUEJTKHVGP/GP\GN 'TPUV4ÒEMUGKVG8KQNGVVGT4WPFUVGORGNFGT$CPM2KEM4QUGPDGTID 5EJGKPG++p+++



 4WRKG  &GWVUEJ1UVCHTKMCPKUEJG $CPM <YGKIPKGFGTNCUUWPI &CTGUUCNCO  +PVGTKOU$CPM   PQVGP8CTKCPVGP5GTKG$ Z 234 Z 57;&(2KEM#4QUGPDGTIDIJL MOQUW 5EJGKPG++p+++





 4WRKG  &GWVUEJ1UVCHTKMCPKUEJG $CPM <YGKIPKGFGTNCUUWPI &CTGUUCNCO +PVGTKOU$CPM   PQVGP8CTKCPVGP5GTKG%&()2KEM4QUGPDGTIDEEG 5EJGKPG+++





 4WRKG  &GWVUEJ1UVCHTKMCPKUEJG $CPM <YGKIPKGFGTNCUUWPI &CTGUUCNCO  +PVGTKOU$CPM   PQVGP5GTKGPDWEJUVCDGP( XGTUEJKGFGPG-0)TÌ­GP WPF)LGYGKNUOKVGKPGOITQ­GP<ÒDGTUVGO RGNV2KEM#4QUGPDGTIE 5EJGKPG+++++



 4WRKG   &GWVUEJ1UVCHTKMCPKUEJG $CPM <YGKIPKGFGTNCUUWPI &CTGUUCNCO   5COONWPIXQP8CTKCPVGP4QUGPDGTIDCDDFGLNSUV[CDFC EIJVW&C\WFGWVUEJG5GTKGPPQVIGNFUEJGKPGOKV-QNQPKCNOQVKXGP6GNGHQPMCTVGPOKV#DDKN FWPIGKPGT/ÒP\GCWU&GWVUEJ1UVCHTKMCXGTUEJKGFGPGHCTDKIG2T·IGRQUVMCTVGPOKV/ÒP\CDDKNFWPIGP

Z &GWVUEJ1UVCHCTKMC Z $TKVKUEJ+PFKGP   1TKIPCNRQUVMCTVG WPF  -QRKGOKV#PUKEJVFGT&GWVUEJ 1UVCHTKMCPKUEJGP$CPMKP&CTGUUCNCO 5VÒEM+P#NDWO++







419


PAPIERGELD DEUTSCH-OSTAFRIKA

7257 1:2 7256 1:2



4WRKGP&GWVUEJ1UVCHTKMCPKUEJG$CPM<YGKIPKGFGTNCUUWPI&CTGUUCNCO+PVGTKOU$CPM PQVG5GTKG$*GNNDTCWPGU2CRKGT2KEM4QUGPDGTIC ++p





4WRKGP&GWVUEJ1UVCHTKMCPKUEJG$CPM<YGKIPKGFGTNCUUWPI&CTGUUCNCO+PVGTKOU$CPM PQVG5GTKG))TÃ&#x2019;PGTFÃ&#x2019;PPGT-CTVQP2KEMF4QUGPDGTIL ++



7258 1:2





7259 1:2

 4WRKG  &GWVUEJ1UVCHTKMCPKUEJG $CPM <YGKIPKGFGTNCUUWPI &CTGUUCNCO  +PVGTKOU$CPM   PQVG5GTKG6#WHFGT4Ã&#x2019;EMUGKVGFKG&CVWOU\GKNGFGUHÃ&#x2019;TFGP&TWEMDGPWV\VGP-CP\NGKDQIGPU2KEM C4QUGPDGTIW&CVWOU\GKNG6[R +



4WRKGP&GWVUEJ1UVCHTKMCPKUEJG$CPM<YGKIPKGFGTNCUUWPI&CTGUUCNCO+PVGTKOU$CPM PQVG UQIGPCPPVG $WUEJPQVG 5GTKG '4 4Ã&#x2019;EMUGKVGPUVGORGN #FNGT KO -TGKU /KV 7PVGTUEJTKHVGP   5VGNNKPI-KTUV2KEM4QUGPDGTIG +



&KGUG WPF FKG PCEJHQNIGPFGP $CPMPQVGP YGTFGP CWEJ $WUEJPQVGP IGPCPPV YGKN UKG OKV GKPHCEJUVGP /KVVGNP  

)WOOKV[RGPGKPGT-KPFGTFTWEMGTGK JGTIGUVGNNVYWTFG

7260 1:2

7261 1:2



4WRKGP&GWVUEJ1UVCHTKMCPKUEJG$CPM<YGKIPKGFGTNCUUWPI&CTGUUCNCO+PVGTKOU$CPM PQVGUQIGPCPPVG$WUEJPQVG5GTKG'4/KV7PVGTUEJTKHVGP5VGNNKPI-KTUV2KEM4QUGPDGTIE ++





4WRKGP&GWVUEJ1UVCHTKMCPKUEJG$CPM<YGKIPKGFGTNCUUWPI&CTGUUCNCO+PVGTKOU$CPM PQVGUQIGPCPPVG$WUEJPQVG5GTKG'4/KV7PVGTUEJTKHVGP5VGNNKPI-KTUV2KEM4QUGPDGTID +



420


PAPIERGELD

7262 1:2

7263 1:2



4WRKGP&GWVUEJ1UVCHTKMCPKUEJG$CPM<YGKIPKGFGTNCUUWPI&CTGUUCNCO+PVGTKOU$CPM PQVGUQIGPCPPVG$WUEJPQVG5GTKG'4/KV7PVGTUEJTKHVGP5VGNNKPI-KTUV2KEM4QUGPDGTID +p





 4WRKG  &GWVUEJ1UVCHTKMCPKUEJG $CPM <YGKIPKGFGTNCUUWPI &CTGUUCNCO  +PVGTKOU$CPM   PQVGUQIGPCPPVG$WUEJPQVG5GTKG'48QTFGTUGKVG5EJYCT\FTWEM4ÒEMUGKVG8KQNGVVFTWEMOKVMNGKPGO #FNGT2KEMEXCT4QUGPDGTICXCT 5GNVGPG8CTKCPVG+



 4WRKG  &GWVUEJ1UVCHTKMCPKUEJG $CPM <YGKIPKGFGTNCUUWPI &CTGUUCNCO  +PVGTKOU$CPM   PQVGUQIGPCPPVG$WUEJPQVGPXGTUEJKGFGPG5EJGKPGOKV5GTKG'4'2 Z (2+22KEM4QUGP DGTICDFH 5EJGKPG++p





$#0-016'070&016)'.&&'5#75.#0&'5 +54#'. 

-QPXQNWV5COONWPIXQPEC)GNFUEJGKPGPCWU+UTCGNXQPWC1PG2CN·UVKPC2QWPF ,CP*GTCWUICDG/KNU2QWPFU*GTCWUICDG/KNU2TWVC

XGTUEJKGFGPG6[RGP .KTC.KTQV*GTCWUICDG2TWVC.KTC.KTQV &KG 5COONWPI GPVJ·NV GKPKIG WPIGUEJPKVVGPG )GNFUEJGKPG $CPMPQVGPOWUVGT UQYKG NKOKVKGTVG 5·V\G   'DGPUQ -KDDW\IGUEJGKPG XQP -KDDW\ 5JCOKT WPF -KDDW\ #HKSKO +PVGTGUUCPVG 5COONWPI OKV GKPKIGP   5GNVGPJGKVGP$KVVGDGUKEJVKIGP %C5EJGKPG/GKUV+p++ 

21.'0 

)GVVQ .KV\OCPPUVCFV 5COONWPI XQP  2HGPPKI     Z   Z   /CTM  /CK    (TCPSWKPGV 5EJGKPG/GKUV+p++



5#//.70)'02#2+'4)'.& 

$#&'070&9ª466'/$'4))TQ­G5COONWPIXQP$GFCTHUIGNF5GTKGPUEJGKPGP+PHNCVKQPUUEJGK PGPUQYKGYGTVDGUV·PFKIGO0QVIGNFFGT5V·FVG)GOGKPFGPWPF(KTOGPCWU$CFGPDGUQPFGTUFGUUÒF DCFKUEJGP4CWOUWPF9ÒTVVGODGTI&KG5COONWPIKUVKPXKGT#MVGPQTFPGTP $CFGP1TFPGT5ÒFDC FGP  1TFPGT 9ÒTVVGODGTI  1TFPGT  \WUCOOGPIGVTCIGP 5KG GPVJ·NV GKPKIG 4CTKV·VGP FKG 5EJGKPG   YGTFGP KP FKGUGT <WUCOOGPUVGNNWPI WPF 8QNNUV·PFKIMGKV UGJT UGNVGP CPIGDQVGP &C\W 'KPG MNGKPG#P \CJN EC  5VÒEM OKV &WDNGVVGP  XQP OQFGTPGP 5KNDGTOGFCKNNGP FGT 5V·FVG .ÌTTCEJ -CPFGTP WPF   9[JNGP EC5EJGKPG+p+8 



5%*.'5+'0)TQ­G5COONWPIXQP$GFCTHUIGNF  5GTKGPUEJGKPGP  UQYKG+PHNC VKQPUUEJGKPGP  FGT5V·FVG)GOGKPFGPWPF(KTOGPCWU5EJNGUKGP&KG5COONWPIKUVKPXKGT #MVGPQTFPGTP\WUCOOGPIGVTCIGPWPFKPFKGUGT)TÌ­GGKPKPVGTGUUCPVGU1DLGMVFCUWPDGFKPIVDGUKEJVKIV YGTFGPOW­ EC5EJGKPG+p+8





&'765%*.#0&)TQ­G5COONWPIXQP$GFCTHUIGNF  5GTKGPUEJGKPGP  UQYKG +PHNCVKQPUUEJGKPGP   WPF )TQ­IGNF   &KG 5COONWPI KUV KP #MVGPQTFPGTP \WUCO   OGPIGVTCIGPYQTFGPWPFUGV\VUKEJYKGHQNIV\WUCOOGP$C[GTP 1TFPGT $TCPFGPDWTI 1TFPGT  *CPPQXGT 1TFPGT *GUUGP0CUUCW1UVWPF9GUVRTGW­GP2HCN\ 1TFPGT &·PKUEJ0QTF5EJNGU YKI#PJCNV$TCWPUEJYGKI.KRRG&GVOQNF5EJCWODWTI.KRRG9CNFGEM$TGOGP*CODWTI.ÒDGEM 1NFGPDWTI 1TFPGT /GEMNGPDWTI 1TFPGT 4JGKPNCPF 1TFPGT 2QOOGTP 1TFPGT 5CEJUGP

1TFPGT 2TQXKP\5CEJUGP 1TFPGT 5EJNGUYKI*QNUVGKP 1TFPGT 2QOOGTP 1TFPGT 6JÒTKP IGP 1TFPGT 9GUVHCNGP 1TFPGT +PFKGUGT)TÌ­GWPF8QNNUV·PFKIMGKVUGNVGPCPIGDQVGP  EC5EJGKPG+p+8 



5GJT WOHCPITGKEJG 5COONWPI XQP FGWVUEJGP WPF ÌUVGTTGKEJKUEJGP 0QVIGNFUEJGKPGP FGT 5V·FVG WPF   )GOGKPFGP  8QP # YKG #CEJGP DKU < YKG <YKUEJGPCJP ÒDGT  5EJGKPG CWU OGJT CNU   1TVGPOKV(GJNFTWEMGP(CTDWPF&TWEMCDYGKEJWPIGPFCTWPVGTGKPKIG5GNVGPJGKVGP*QEJKPVGTGU UCPVGU.QVDKVVGWPDGFKPIVDGUKEJVKIGP EC5VÒEM/GKUV+p++ 



5COONWPI XQP 0QVIGNF 5GTKGP WPF +PHNCVKQPUUEJGKPGP FGWVUEJGT 5V·FVG )GOGKPFGP WPF .·PFGT   ECKP\YGK\GKVIGPÌUUKUEJGP'KPUVGEMCNDGP+PVGTGUUCPVGU.QVDKVVGDGUKEJVKIGP  EC5VÒEM/GKUV+p++

 421


MÜNZBECHER

/ª0<$'%*'4

7273

7272

&'765%*.#0& 

5KNDGTPGT/ÒP\DGEJGTIGHGTVKIV+PFGT9CPFWPIUKPFDGKFUGKVKIUKEJVDCT&QRRGNVCNGTWPF6CNGT FGU &GWVUEJGP 4GKEJGU  WPF  ,CJTJWPFGTV  GKPIGCTDGKVGV &CTWPVGT (WNFC *QJGP\QNNGTP   *GEJKPIGP4GWUUWPF5CEJUGP+O(W­FGU$GEJGTUHKPFGVUKEJFKGXKGT\GKNKIG)TCXWT(XQP5EJWNVG U7TGPMGN*GTDGTV(TX-TCHHV'NDKPI/·T\*ÌJGOO&WTEJOGUUGTOO )GYKEJVI &GMQTCVKXGUGJTUEJÌPG#TDGKV 



-ÌPKIUDGTI5KNDGTPGT/ÒP\DGEJGTIGHGTVKIV+PFGT9CPFWPIUKPFDGKFUGKVKIUKEJVDCTRTGW­K UEJG6CNGTFGU<GKVTCWOUGKPIGCTDGKVGVKO$QFGPFGU$GEJGTUKUVGKPRTGW­KUEJGT&QRRGNVCNGT GKPIGCTDGKVGV&CTWPVGTDGHKPFGVUKEJFKG)TCXWT<W'TPUV'KPVTKVVKPFCU9KNJGNOU)[OPCUKWO \W -QGPKIUDGTI CO  1EVQDGT  *ÌJG  OO &WTEJOGUUGT  OO )GYKEJV  I   5GJTUEJÌPG#TDGKV

422




MÜNZPOKAL

/ª0<21-#.

7274

24'755'0 

5KNDGTPGT /ÒP\RQMCN IGHGTVKIV XQP *GPTKEJ /CW &TGUFGP WO EC  4GKEJ XGT\KGTVGT 2QMCN OKV   4CPMGPYGTMWPF8QNWVGPMCTVWUEJGPFGT*GPMGNOKVYGKDNKEJGT$ÒUVGFGMQTKGTV&GEMGNCWHUCV\KP(QTO GKPGT -TGW\DNWOG +P FGT 9CPFWPI UKPF  XGTUEJKGFGPG 8GTGKPUVCNGT FGT FGWVUEJGP 6GKNUVCCVGP KO   &GEMGN \YGK RTGW­KUEJG 8GTGKPUVCNGTUQYKG\YGK(ÒPHOCTMUVÒEMGXQP2TGW­GP ,, GKPIGCT DGKVGV 7PVGT FGO (W­ DGHKPFGV UKEJ FKG )TCXWT FGU 5KNDGTUEJOKGFU WPF FGT (GKPIGJCNVUUVGORGN    *ÌJGEO)GYKEJVI 5GJTUEJÌPG#TDGKV 

423


LITERATUR - LOTS

07/+5/#6+5%*'.+6'4#674 /101)4#2*+'0 21.'04755.#0&$#.6+-7/ 

*766'0%<#25-+ ' %CVCNQIWG FG NC EQNNGEVKQP FGU O¾FCKNNGU GV OQPPCKGU 2QNQPCKUGU $·PFG    WPF  2CTKU-TCMCW  *CNDNGFGT WPGKPJGKVNKEJ  'KPD·PFG GVYCU DGUVQ­GP GKPKIG 5GKVGP   DGUEJ·FKIV  +++ 

/'&#+..'0 

(#$4+%<; % 810 /GFCKNNGP FGT KVCNKGPKUEJGP 4GPCKUUCPEG .GKR\KI Q ,  5 OKV #DD *CND   NGKPGP&C\W-#4#<+,#2/8KNPKCWU.QDKU8KNPKWU56HP$TQUEJKGTV.CIGP WPF5GKVGPVGKNYGKUGNQUG  +++

#..)'/'+0 



.165

$4& &/  &, MQORNGVVG 5GTKG  ¤UVGTTGKEJ  5EJKNNKPI  DKU  MQORNGVVG 5GTKG     5EJKNNKPIWPF 4 &C\W&GWVUEJGU4GKEJ/CTM,/CTM)  5VÒEM/GKUVXQT\ÒINKEJ 

#.6&'765%*.#0& 

/KVVGNCNVGT5GJTKPVGTGUUCPVG5COONWPIXQP&GPCTGP$TCMVGCVGP*QJNRHGPPKIGPUQYKGGKPKIGP2TCIGT WPF/GK­PGT)TQUEJGPUQYKG6WTPQUGPFGU,CJTJWPFGTVUFCTWPVGTGKPKIGDGUUGTG5VÒEMG5GJT KPVGTGUUCPVGU.QVDKVVGDGUKEJVKIGP 5VÒEM/GKUVUGJTUEJÌP



-NGKPG 5COONWPI XQP $TCMVGCVGP FGU  ,CJTJWPFGTVU W C XQP $TCWPUEJYGKI.ÒPGDWTI Z    *KNFGUJGKO Z -QPUVCP\ Z /CIFGDWTI Z /GEMNGPDWTI/GKUUGPGVE&C\W\YGK*·PFNGKPJGNNGT XQP5EJY·DKUEJ*CNN*QEJKPVGTGUUCPVGU.QVDKVVGDGUKEJVKIGP  5VÒEM(CUVUGJTUEJÌPWPFUGJTUEJÌP





<YGK /GK­PGT $TCMVGCVGP *GKPTKEJ FGT 'TNCWEJVG   UQYKG GKP /GK­PGT )TQUEJGP WPF GKP   -QPUVCP\GT4QNNDCV\GP 5VÒEM5GJTUEJÌP





-NGKPG 5COONWPI XQP FKXGTUGP OGKUV FGWVUEJGP &GPCTGP $TCMVGCVGP WPF )TQUEJGP FGU  DKU    ,CJTJWPFGTVU5GJTKPVGTGUUCPVGU.QVDKVVGDGUKEJVKIGP  5VÒEM7PVGTUEJKGFNKEJGTJCNVGPFGT)GUCOVGKPFTWEMKUVUGJTUEJÌP 



-NGKPG5COONWPIXQPFGWVUEJGP/ÒP\GPXQTYKGIGPFFGU/KVVGNCNVGTUFCTWPVGT$TCMVGCVGPCWU/CIFG DWTI WPF (TCPMHWTV 2HGPPKIG CWU 5VTC­DWTI WPF .ÌYGPUVGKP QVVQPKUEJG 5CEJUGPRHGPPKIG UQYKG DTCP   FGPDWTIKUEJG#FNGTWPF*GNOJQJNRHGPPKIG+PVGTGUUCPVGU.QVDKVVGDGUKEJVKIGP  5VÒEM5EJÌPpUGJTUEJÌP





#NNIGOGKP&KXGTUG6CNGTFGU,CJTJWPFGTVU6JWP Z 

Z  5VÒEM/GKUVUGJTUEJÌP





$TGOGP 6CNGT  6JWP  ,CJTHGKGT FGT $GHTGKWPIUMTKGIG  6CNGT  6JWP    &GWV   UEJGU $WPFGUUEJKG­GP  (TCPMHWTV 8GTGKPUVCNGT  6JWP  (ÒTUVGPVCI  *CPPQXGT 8GTGKPUVCNGT    6JWP9CVGTNQQ &C\W5CEJUGP%QDWTI9KNJGNO5KNDGTRHGPPKI  5VÒEM5GJTUEJÌPpXQT\ÒINKEJ



&KXGTUGFGWVUEJGWPFCWUN·PFKUEJG/ÒP\GPFGU,CJTJWPFGTVUXQO2HGPPKIDKU\WO6CNGTFCT WPVGTDGUUGTG6[RGP*QEJKPVGTGUUCPVGU.QVDKVVGDGUKEJVKIGP  5VÒEM+P#NDWO'KPKIGOKVMN(GJNGTPUEJÌPpHCUV5VGORGNINCP\









7OHCPITGKEJG 5COONWPI CNVFGWVUEJGT /ÒP\GP FGU  ,CJTJWPFGTVU W C XQP $C[GTP $TCWP   UEJYGKI.ÒPGDWTI/GEMNGPDWTI0ÒTPDGTI2CFGTDQTP4GIGPUDWTIWPF5CEJUGP&C\WGKPKIGYGPKIG 'ZGORNCTG CWU &·PGOCTM +VCNKGP WPF -CPCFC 'KP JQEJKPVGTGUUCPVGU 1DLGMV OKV DGUUGTGP 6[RGP FCU   UKEJ JGTXQTTCIGPF \WO #WUDCW QFGT CNU 'TI·P\WPI GKPGT DGTGKVU DGUVGJGPFGP 5COONWPI GKIPGV $KVVG   WPDGFKPIVDGUKEJVKIGP 5VÒEM6GKNYGKUGOKVMN(GJNGTPOGKUVUGJTUEJÌP 



.QVFKXGTUGT-NGKPOÒP\GPFGU,CJTJWPFGTVUWCXQP#PJCNV$CFGP(ÒTUVGPDGTI*GUUGPWPF 0CUUCWFCTWPVGTCWEJDGUUGTG5VÒEMGYKG\$$TCPFGPDWTI)TQUEJGP.KGEJVGPUVGKP-TGW \GTGVE 5VÒEM/GKUVUGJTUEJÌP



&KXGTUGCNVFGWVUEJG-NGKPOÒP\GPFGU,CJTJWPFGTVUWCXQP$C[GTPWPF9ÒTVVGODGTIFCTWPVGT 9ÒTVVGODGTI-TGW\GT XQT\ÒINKEJ5VGORGNINCP\ +PVGTGUUCPVGU.QVDKVVGDGUKEJVKIGP  5VÒEM5GJTUEJÌPpHCUV5VGORGNINCP\





424


LOTS 











&KXGTUG CNVFGWVUEJG WPF CWUN·PFKUEJG /ÒP\GP WPF /GFCKNNGP W C XQP #PJCNV /GEMNGPDWTI %JKPC  

Z  8CVKMCP GVE &C\W &COGDTGVVUVGKP OKV FGP 2QTVT·VU (TKGFTKEJ ++ XQP *GUUGP WPF ,QJCPP +++   5QDKGUMKXQP2QNGP+PVGTGUUCPVGU.QVDKVVGDGUKEJVKIGP 5VÒEM5EJÌPpXQT\ÒINKEJ



$C[GTP-TQPGPVCNGT$TCPFGPDWTI2TGW­GP6CNGT2HCN\-QPX6CNGT5CEJ UGP6CNGT-QPX6CNGT9ÒTVVGODGTI/CTM&C\W(TCPMTGKEJ'EW4W­NCPF 4WDGN&C\W$TQP\GOGFCKNNGPFGU,CJTJWPFGTVU+PVGTGUUCPVGU.QVDKVVGDGUKEJVKIGP  5VÒEM6GKNYGKUGOKV(GJNGTPUGJTUEJÌP



$TCPFGPDWTI2TGW­GP&TGKGT OKVFGT,CJTGU\CJNCWHDGKFGP5GKVGP 6CNGT.%5$TCWP UEJYGKI9QNHGPDÒVVGN  /CTKGPITQUEJGP  $TCWPUEJYGKI%CNGPDGTI*CPPQXGT  6CNGT    2HCN\-TGW\GT4GWUU'DGTUFQTH6CNGT 5VÒEM/GKUVUGJTUEJÌP



$C[GTP -QPX6CNGT  .WFYKIU1TFGP 6JWP   5CEJUGP -QPX6CNGT  ) 6JWP  )    9ÒTVVGODGTI -TQPGPVCNGT  5EJTÌVNKPIUHGJNGT 6JWP   .KGEJVGPUVGKP  -TQPGP  9KGP  

&CX &C\W$WPFGUTGRWDNKM&GWVUEJNCPF&/) ,  5VÒEM5GJTUEJÌP



$TGOGP6CNGT ,CJTHGKGTFGT$GHTGKWPIUMTKGIG  5KGI (TCPMHWTVFQRRGNVGT8GTGKPUVCNGT  8GTGKPUVCNGT  (ÒTUVGPVCI  /GEMNGPDWTI5VTGNKV\ 8GTGKPUVCNGT  2TGW­GP 4GKEJUVCNGT    # X\5V  5CEJUGP 6CNGT  ( FQRRGNVGT  8GTGKPUVCNGT  $  $ )QNFGPG *QEJ\GKV    9ÒTVVGODGTI&QRRGNIWNFGP8GTGKPUVCNGT&C\W4GKEJUUKNDGTOÒP\GP, 5VÒEM5GJTUEJÌPpXQT\ÒINKEJWPFDGUUGT



&KXGTUG/ÒP\GPFGU,CJTJWPFGTVUOGKUVXQP$TCPFGPDWTI2TGW­GPXQO2HGPPKIDKU\WO6CNGT &C\WGKPKIG5VÒEMGXQP$TCPFGPDWTI#PUDCEJWPF5CEJUGP+PVGTGUUCPVGU.QVDKVVGDGUKEJVKIGP  5VÒEM6GKNYGKUGOKV(GJNGTPUEJÌPpUGJTUEJÌP





&KXGTUG 6CNGT FGU  ,CJTJWPFGTVU XQP #PJCNV DKU 9ÒTVVGODGTI &C\W *QJGP\QNNGTP )WNFGP    +PVGTGUUCPVGU.QVDKVVGDGUKEJVKIGP 5VÒEM6GKNYGKUGOKV(GJNGTPOGKUVUGJTUEJÌP 



$TCWPUEJYGKI9QNHGPDÒVVGN 2GNKMCPVCNGT  *GPMGNURWT  5EJYCT\DWTI 6CNGT  *CDUDWTI   6CNGTQ, 'T\JGT\QI(GTFKPCPF &QRRGNVCNGT DGTKGDGP &QRRGNIWNFGP)WN FGP 5CKIGTVCWHG2TKDTCO*GPMGNURWT -TGW\GT$GNIKGP(TCPEU&·PGOCTM 4KIUFCNGT&C\WYGKVGTG/ÒP\GPXQP$QNKXKGPWPF/GZKMQ  5VÒEM6GKNYGKUGOKV(GJNGTPOGKUVUGJTUEJÌP



&KXGTUG 6CNGT FGU  ,CJTJWPFGTVU #PJCNV 6CNGT  #WUDGWVG 6JWP   8GTGKPUVCNGT   

#WUDGWVG6JWP #PJCNV&GUUCW8GTGKPUVCNGT 6JWP 8GTGKPUVCNGT 8GTGKPKIWPI6JWP  2TGW­GP6CNGT# 6JWP 8GTGKPUVCNGT Z-TÌPWPI6JWP 8GTGKPUVCNGT # 6JWP   8GTGKPUVCNGT  Z 5KGI 6JWP   5CEJUGP 8GTGKPUVCNGT  #WUDGWVG 6JWP    8GTGKPUVCNGT 5KGI6JWP +PVGTGUUCPVGU.QVDKVVGDGUKEJVKIGP  5VÒEM/GKUVUGJTUEJÌP







-NGKPG5COONWPIXQPÒDGTYKGIGPFFGWVUEJGP6CNGTPFGUWPF,CJTJWPFGTVU&CTWPVGT5CEJUGP #NVGPDWTI  &CX   5CEJUGP9GKOCT  &CX   $TCPFGPDWTI2TGW­GP  #  

&CX WPF$TCWPUEJYGKI.ÒPGDWTI &CX +PVGTGUUCPVGU.QVDKVVGDGUKEJVKIGP  5VÒEM<WO6GKNOKVMN(GJNGTPUEJÌPpUGJTUEJÌP 



-NGKPG 5COONWPI XQP FGWVUEJGP 6CNGTP FGU  ,CJTJWPFGTVU 5CEJUGP 4GKEJUVCNGT          CWH FCU 8KMCTKCV  WPF -QPX6CNGT  $TCWPUEJYGKI.ÒPGDWTI   4GKEJUVCNGT(TCPMHWTV&QRRGNVGT8GTGKPUVCNGTWPF2TGW­GP8GTGKPUVCNGT# Z 5KGI +PVGTGUUCPVGU.QVDKVVGDGUKEJVKIGP  5VÒEM6GKNYGKUGOKVMN(GJNGTPHCUVUGJTUEJÌPpUGJTUEJÌP 



&KXGTUG/ÒP\GPFGU,CJTJWPFGTVUXQO2HGPPKIDKU\WO6CNGTWCXQP#WIUDWTI'KEJ UV·VV -GORVGP /CKP\ /ÒPUVGT 0ÒTPDGTI 4GIGPUDWTI 5RG[GT GVE *QEJKPVGTGUUCPVGU .QV DKVVG DG   UKEJVKIGP 5VÒEM'KPKIGOKVMNGKPGP(GJNGTPUEJÌPpXQT\ÒINKEJ



$TGOGP 8GTGKPUVCNGT  $WPFGUUEJKG­GP  0ÒTPDGTI -QPX6CNGT  5VCFVCPUKEJV  2TGW­GP   -TÌPWPIUVCNGT  5KGIGUVCNGT  4GIGPUDWTI  -QPX6CNGT  9ÒTVVGODGTI 5KGIGUVCNGT   &C\WGKPKIG-NGKPOÒP\GP+PVGTGUUCPVGU.QVDKVVGDGUKEJVKIGP 5VÒEM/GKUVUGJTUEJÌP







&KXGTUG OGKUV CNVFGWVUEJG /ÒP\GP WPF /GFCKNNGP FGU  ,CJTJWPFGTVU XQO OKVVGNCNVGTNKEJGP 1DQN   DKU\WO4GKEJUVCNGT*QEJKPVGTGUUCPVGU.QVOKV5GNVGPJGKVGPDKVVGDGUKEJVKIGP  5VÒEM'KPKIGOKVMNGKPGP(GJNGTPOGKUVUGJTUEJÌP 



&KXGTUGCNVFGWVUEJGWPFCWUN·PFKUEJG/ÒP\GPWPF/GFCKNNGPFGU,CJTJWPFGTVUFCTWPVGTFKXGTUG 6CNGT 5VÒEM WC$TCWPUEJYGKI9QNHGPDÒVVGN6CNGT0ÒTPDGTI-QPX6CNGT9GUVHC NGP-QPX6CNGTGVE*QEJKPVGTGUUCPVGU.QVDKVVGDGUKEJVKIGP  5VÒEM'KPKIGOKVMNGKPGP(GJNGTPOGKUVUGJTUEJÌP  425


LOTS 

-NGKPG 5COONWPI GKPGO &QRRGNVCNGTP Z  6CNGTP Z  *CNDVCNGTP Z  WPF )WNFGP Z  \WOGKUV   IGKUVNKEJGT(ÒTUVGPFCTWPVGT'KEJUV·VV&QRRGNVCNGT *GPMGNURWT 9ÒT\DWTI6CNGT *GPMGN URWT 6CNGT *GPMGNURWT  5VÒEM/KV(GJNGTPUEJÌPpUGJTUEJÌP 



&KXGTUG -NGKPOÒP\GP FGU  WPF  ,CJTJWPFGTVU OGKUV IGKUVNKEJGT (ÒTUVGP W C /CKP\ /WTDCEJ   WPF.ÒFGTU6TKGTWPF9ÒT\DWTI&C\WCWEJEC-NGKPOÒP\GPCWUCNNGT9GNV  5VÒEM5EJÌPpHCUVXQT\ÒINKEJ



#WIUDWTI4GKEJUVCNGTOKV6KVGN(GTFKPCPFU+++$TCPFGPDWTI#PUDCEJ4GKEJUVCNGT(WNFC -QPX6CNGT0ÒTPDGTI-QPX6CNGTDGKFGOKV6KVGNXQP(TCP\+  5VÒEM/KV(GJNGTPUGJTUEJÌP





$C[GTP -QPX6CNGT  # $TCPFGPDWTI2TGW­GP 4GKEJUVCNGT RTGW­  $  # 5CEJUGP   -QPX6CNGT9GUVHCNGP/CTKGPITQUEJGP 5VÒEM5GJTUEJÌP





&KXGTUG CNVFGWVUEJG OKVVGNCNVGTNKEJG 2HGPPKIG WPF $TCMVGCVGP  5VÒEM  &C\W \YGK XGPG\KCPKUEJG   -NGKPOÒP\GPUQYKGGKPKIG,GVQPU+PVGTGUUCPVGU.QVDKVVGDGUKEJVKIGP 5VÒEM5EJÌPpUGJTUEJÌP





5ÒFFGWVUEJNCPF -NGKPG 5COONWPI XQP *QJNRHGPPKIGP *CNDDCV\GP WPF $CV\GP OGKUV OKV 6KVGN D\Y   $TWUVDKNF XQP -CKUGT -CTN 8 W C XQP #WIUDWTI +UP[ -GORVGP -QPUVCP\ 0ÌTFNKPIGP FGT 1DGT   RHCN\¤VVKPIGP2CUUCWFGT2HCN\WPF4GIGPUDWTI+PVGTGUUCPVG5COONWPI  5VÒEM/GKUVUGJTUEJÌP



4JGKPKUEJGT /ÒP\XGTGKP +PVGTGUUCPVG 5COONWPI XQP *QJNRHGPPKIGP 5EJKNNKPIGP WPF #NDWU5VÒEMGP   FGU,CJTJWPFGTVUXQP/CKP\FGT2HCN\WPF6TKGTUQYKGXQPFGPDGPCEJDCTVGP)GDKGVGP 5CNO 5RG[GTWPF9QTOU FCTWPVGTGKPKIGDGUUGTG5VÒEMG 5VÒEM/GKUVUGJTUEJÌP



0ÒTPDGTI-QPX6CNGTOKV6KVGNXQP(TCP\+OKV6KVGN,QUGHU++&C\W(TCPMHWTV-QPX 6CNGT&CX 5VÒEM5GJTUEJÌP









#75.#0& 

#NNIGOGKP%JKPC&QNNCT,CJT  *CDUDWTIKUEJG'TDNCPFG4GKEJUVCNGT*CNN-TQPGPVCNGT  ( / -QPX6CNGT#/GZKMQ4GCNGU5EJYGK\$GTP6CNGT5ÒF CHTKMC5JKNNKPIU&C\W5CEJUGP6CNGT  5VÒEM'KPKIGOKVMN(GJNGTPOGKUVUGJTUEJÌP





&KXGTUG/ÒP\GPFGUWPF,CJTJWPFGTVUXGTUEJKGFGPGT-QPVKPGPVGWPF.·PFGTWCXQP#NDCPKGP (TCPMTGKEJ )TKGEJGPNCPF ,CRCP 0KECTCIWC 0KGFGTNCPFG 2GTW 2QTVWICN 4WO·PKGP WPF 7PICTP   &CTWPVGTCWEJDGUUGTG5VÒEMGWPFJÒDUEJG3WCNKV·VGP+PVGTGUUCPVGU.QVDKVVGDGUKEJVKIGP  5VÒEM5EJÌPp5VGORGNINCP\ 



'WTQRC 'WTQ-WTUOÒP\GPU·V\G 5VGORGNINCP\  /QPCEQ  Z Z KP 1TKIKPCNXGTRCEMWPI UGNVGP     KP1TKIKPCNXGTRCEMWPI 5CP/CTKPQ Z  CNNGKP1TKIKPCNXGTRCE MWPI  'WTQ-WTUOÒP\GPU·V\G 2QNKGTVG 2NCVVG  (KPPNCPF  Z   /QPCEQ  Z UGNVGP    5RCPKGP 5KNDGTOÒP\GPUCV\   5VÒEM  #NNG KP 1TKIKPCNXGTRCEMWPI &C\W KP RQNKGTVGT 2NCVVG WPF   1TKIKPCNXGTRCEMWPI+VCNKGPWPF'WTQ 1N[ORKCFGKP6WTKPLGYGKNUXGTUEJKGFGPG/QVKXG  5CP/CTKPQWPF'WTQ&C\WYGKVGTG/ÒP\GPXQP+VCNKGP5CP/CTKPQWPF2GTW 5QN   5·V\GWPF'KP\GNUVÒEMG5VGORGNINCP\WPFRQNKGTVG2NCVVG





&KXGTUG URCPKUEJG WPF RQTVWIKGUKUEJG /ÒP\GP FGU  ,CJTJWPFGTVU FCTWPVGT CWEJ 2T·IWPIGP CWU   $TCUKNKGP*QEJKPVGTGUUCPVGU1DLGMVOKVGKPKIGPDGUUGTGP6[RGPWPFJÒDUEJGP3WCNKV·VGPDKVVGDGUKEJVK IGP 5VÒEM'KPKIGOKVMN(GJNGTPUGJTUEJÌPWPFDGUUGT 



&KXGTUGHTCP\ÌUKUEJGKVCNKGPKUEJGWPFRQNPKUEJG/ÒP\GPFGU,CJTJWPFGTVUWC(NQTGP\.WK IKPQ 4 (TCPMTGKEJ'EW2QNGP)TÌUEJGT)TÌUEJGT.WDNKP 4 GVE+PVGT GUUCPVGU.QVDKVVGDGUKEJVKIGP 5VÒEM5GJTUEJÌPWPFDGUUGT



(TCPMTGKEJ5COONWPIHTCP\ÌUKUEJGT/ÒP\GPXQO,GVQPDKU\WO'EWXQO,CJTJWPFGTV&C\W 'KPU·EJUKUEJGT6CNGT4WUUNCPF-QRGMGPUQYKGGKPGUK\KNKCPKUEJG/ÒP\G  5VÒEM/GKUVUGJTUEJÌP







426

#NNG9GNV7OHCPITGKEJG5COONWPIXQP/CTMGPWPF<GKEJGPFGU,CJTJWPFGTVUCWUCNNGT9GNV FCTWPVGT#WUVTCNKGP(TCPMTGKEJ)TKGEJGPNCPF)TQ­DTKVCPPKGP+VCNKGP-CPCFC0KGFGTNCPFG2CN·UVKPC 5RCPKGP WPF FKG 8GTGKPKIVGP 5VCCVGP &KG 5COONWPI KUV KP /ÒP\CNDGP PCEJ -QPVKPGPVGP WPF .·PFGTP   IGQTFPGVWPFGPVJ·NV\CJNTGKEJGDGUUGTG5VÒEMG+PVGTGUUCPVGU1DLGMVFCUDGUKEJVKIVYGTFGPUQNNVG  EC5VÒEM/GKUVUGJTUEJÌPpXQT\ÒINKEJ 


A #CEJGP #CTICW I[RVGP VJKQRKGP #HIJCPKUVCP #NDCPKGP #NGUUCPFTKC #NVGPDWTI #OUVGTFCO #PFQTTC #PJCNV #RTCTKEKC #SWKNGKC #TIGPVKPKGP #WIUDWTI #WUDGWVG   #WUVTCNKGP  B

$CFGP $CJCOCU $CNVKMWO $CODGTI $CPMPQVGP $CPPCEKCEWO $CPWUUCE  $CTEGNQPC $CUGN $CVCXKUEJG4GRWDNKM $CVGPDWTI $C[GTP $GCTP $GNCIGTWPI$GUCV\WPI$GUGV\WPI   $GNIKGP $GPVJGKO $GTI $GTIGP1R<QQO $GTNKP $GTOWFCU $GTP $GTQOÒPUVGT $KCHTC $ÌJOGP/·JTGP $QNKXKGP $QNQIPC $TCDCPV $TCPFGPDWTIKP(TCPMGP $TCPFGPDWTI2TGWUUGP $TCUKNKGP $TCWPUEJYGKIWPF.ÒPGDWTI  $TGKUCEJ $TGOGP $TGUNCW $TKZGP $TÒUUGN $WMJCTC $WNICTKGP $WPFGUTGRWDNKM&GWVUEJNCPF $WTOC 

C

%CODTCK %COOKP

INDEX 

%CORGP %CTOCIPQNC %CUCNG/QPVHGTTCV %JKNG %JKPC %JWT %KUCNRKPG4GRWDNKM %QQM+UNCPFU %QTKPVJKC %QTXG[ %TCKNUJGKO 

D

&·PGOCTM &CJQOG[ $GPKP  &CP\KI &GWVUEJ0GW)WKPGC &GWVUEJ1UVCHTKMC &GWVUEJG&GOQMTCVKUEJG4GRWDNKM &GWVUEJG-QNQPKGP  &GWVUEJG/ÒP\GPCD &GWVUEJG/ÒP\GPWPF/GFCKNNGP  &GWVUEJGT1TFGP &GXGPVGT%CORGPWPF<YQNNG &QOKPKMC &QOKPKMCPKUEJG4GRWDNKM &QPCWYÌTVJ &QTVOWPF &TKVVGU4GKEJ 

E

'EWCFQT 'IIGPDGTI 'KEJUV·VV 'KPUKGFGNP 'KUGPDCJP.QMQOQVKXG 'KUNGDGP 'N5CNXCFQT 'NDKPI 'OFGP 'PINCPF 'TDCEJ 'THWTV 'TKVTGC 'TNCPIGP 'T\IGDKTIG 'UUGP 'UVGTJC\[ 'UVNCPF 'WTQR·KUEJG/ÒP\GPWPF/GFCKNNGP  

F

(COCIWUVC (GTTCTC (KPPNCPF (KUEJKPIGP (NCPFGTP (NQTGP\ (T·PMKUEJGT-TGKU (TCPMHWTV (TCPMTGKEJ (TGKDWTI (TGKUKPI (TKGFDGTI (ÒTUVGPDGTI


(WIIGT (WNFC 

G

)GIGPUVGORGN  )GNFGTP )GPH )GPWC )GQTIKGP )KTQPC )QGV\/GFCKNNGP )QTKPEJGO )QUNCT )TKGEJGPNCPF )TQPKPIGP )TQUUDTKVCPPKGP )WTM )W[CPC 

H

*CCTNGO *CDUDWTIKUEJG'TDNCPFG¤UVGTTGKEJ  *CIGPCW *CNDGTUVCFV *CODWTI *COGNP *CPCW *CPPQXGT *CT\ *CYCKK *GPPGDGTI *GUUGP *KNFGUJGKO *QEJ\GKV8GTO·JNWPI    *QJGP\QNNGTP *QNNCPF *QNUVGKP)QVVQTR *QNUVGKP5EJCWGPDWTI *QPI-QPI *[FGTCDCF 

I

+NG&G.C4GWPKQP +PFKGP +TCP +UGPDWTI +UNCPF +UNG1H/CP +UTCGN +VCNKGP 

J

,CRCP ,GTUG[ ,GXGT ,QJCPPKVGTCWH4JQFQUWPF/CNVC ,ÒNKEJ-NGXG$GTI ,WIQUNCYKGP 

K

-CNGPFGTOGFCKNNGP -CODQFUEJC -CPCFC -GORVGP -JGXGPJÒNNGT/GVUEJ

-JYCTK\O %JQTGUO  -KCWVUEJQW -KGN -KTEJGPUVCCV -KTKDCVK -ÌNP -QNWODKGP -QPUVCP\ -QTDCEJ -QTGC -TCMCW -TGVC -TQCVKGP -WDC -WTNCPF 

L

.CWHGPDWTI .G[FGP .KGEJVGPUVGKP .KGIPKV\$TKGI .KPFCW .KRRG .KVCWGP .ÌYGPUVGKP .ÌYGPUVGKP9GTVJGKO4QEJGHQTV .QODCTFGK .WEEC .ÒDGEM .ÒPGDWTI .ÒVVKEJ .WHVHCJTV .WZGODWTI .W\GTP 

M

/CFTCU /CIFGDWTI /CKNCPF /CKP\ /CNGFKXGP /CNVC /CPUHGNF /CPVWC /CTUDGTI /CUUC&K.WPKIKCPC /GEMNGPDWTI /GFCKNNGP   /GFCKNNGWTG #* #DGGNG2X #DTCOUQP# #JNDQTP.GC #NGZGGX# #PFTKGW$ $CTCPQX8 $CTCPQX9 $CTTG, $GTEMGN6JXCP $GTPJCTV, $KCPEJK( $KLNCGT)X $NWO, $QGTGT% $QPKU0FG $TCGOV,2 $TGPGV( $TGPGV0 $TKQV0


$TKVVGP4 $TQQMU5 $TWUPKVU[P2 $WEJJGKO, $ÒEMNG,/ $WUEJ,4 $[NCGT,X %CTDGP-$XQP %CTPKQN/ %GTDCTC) %TQMGT, &CFNGT5 &CUUKGT,# &GXTGGUG) &KOKVTGUEW &KUJQGEMG,XCP &QDKEJV9 &QEMNGT&5 &ÌNN,8 &QNNKP, &QPPGT/ &TQ\,2 &WXKXKGT, &[HGEMG2 '/ 'OCPWGN* 'PIGNJCTF,4 'UUGQ' (CEKWU# (CEKWU(9 (CNV\4 (GFGTGT*5 (GUUNGT (KUEJGT- (TKVUEJ3 (WGVGT%J )5 )CDG/ )CNCODQU# )CUU,$ )C[TCTF4 )GPPCTQ#FG )GTXCKU' )GUUPGT*, )KCPRCQNK )KTQOGVVK) )KUOQPFK )NÌEMNGT1 )QGFGEMG2* )QGV\) )QGV\- )ÌV\KPIGT( )ÌV\KPIGT,5 )QWKP5 )TCXGPCWGT7 )TGEQ' )TKNNKEJGU# )WDG* )WDG/ )WTUEJPGT *.6 *CGUNKPI& *CIGPCWGT( *CNNKFC[6 *COGTCPK( *COGTCPK1 *CPPKDCN' *CPUKPI') *CTPKUEJ, *CWVUEJ) *GFNKPIGT,%

*GPUEJGN)* *KNMGP+( *ÌJP, *ÌTPNGKP(9 *QJNGKUGP,%JT *QNV\JG[,) *QN\J·WUGT,2 *WOOGN# +YCPQHH6  ,CEQD[2, ,CGIGT,%) ,CGIGT,) ,CJP% ,CPWCTKQ#FG ,%J ,WFKP5 -$ -$# -CEJGN. -CNCUJPKMQX1 -GVVGNGT' -KVVGN, -NGRKMQY# -NKGDGT, -NKOGPVQX8 -NKOQX8 -ÌPKI#( -ÌTPGT9 -ÌVVGPUVQTHGT* -QPUG%( -QYCT\KM -TCHHV,/ -TQJP(%JT -TÒIGT-4 -WEJMKP/ -WJNGT%* -WNNTKEJ(9 .4 .CPIC, .CPIG- .CPIGT,XQP .CWGT%JT .CWHHGT.) .CX[# .GDGTGEJV% .G$NCPE, .GENGTE+ .GH½XTG, .QP(#XCP .QQH,XCP .QQU&(  .QQU(9 .QQU) .QQU9( .Q\CPQ' .[CNKP# /CNGT%JT /CPHTGFK' /CPHTGFKPK. /CPNG[, /CP\Ð2 /CTO¾,% /CTVGCW(, /CV\GPMQRH( /CV\GPMQRH(LT /CWIGT, /GKUPGT% /GTECPFGVVK6 /G[GT,


/KUVTW\\K# /ÌNNGT/ /QNNGT%JT /QNC) /QTKP /ÒNNGT1 /ÒNNGT2* 0GNNK/ 0GWUU,,F 0KMQPQX8 1) 1GZNGKP,.  2$ 2CYNKM(: 2HGWHHGT%JT 2KPIQ6 2KPITGV#, 2QIQPQX5 2QQNN) 4CFPKV\M[% 4C\WOP[( 4GKDKUEJ)( 4GKEJ, 4GVGMG, 4QEEJK' 4ÌOGT) 4QGVVKGTU,%LT 4QVJ,$ 5CXGNNK 5EJ·HHGT# 5EJ·HGT- 5EJCGHHGT9 5EJCTHH# 5EJKNNGT) 5EJOKFV 5EJÌP, 5EJWNV\# 5EJYGP\GT- 5GDCNF/ 5GNVGT, 5GPGUK' 5JVGKPOCP. 5MWFPQX/ 5OGNV\KPI, 5QTDGTIGT,) 5VCFGNOCPP( 5VKGNGT#( 5VKGNGT,( 5VQTEM( 6CWVGPJC[P, 6GNIG2 6JKGDCWF, 6JQOCUQP' 6QFC) 7VMKP2 8CU[WVKPUM[# 8GTPKGT2. 8GTPQP( 8GUVPGT# 8GUVPGT)9 8KPC\GT, 8KUVQNK4 8QKIV% 9CGEJVGT)% 9CGEJVGT,) 9CTKP, 9GKICPF' 9GTOWVJ% 9GTOWVJ( 9GTPGT,2

9GTPGT22   9KFGOCPP# 9KGPGT% 9KMUVTÌO' 9QNTCD*, 9QNTCD,, 9QQFJQWUG, 9WTUEJDCWGT(, 9[PVLGU% 9[QP#$ 9[QP9 

M

/GFK\KP   /GOOKPIGP /GUUGTCPQ /GZKMQ /KFFGNDWTI /KTCPFQNC /KUEGNNCPGC /KUQZ /QFGPC /QPCEQ /QPIQNGK /QPVGPGITQ /QPVHQTV /ÒJNJCWUGP /ÒPUVGT /ÒP\IGH·UUGWPF/ÒP\UEJOWEM /WTDCEJWPF.ÒFGTU 

N

0CDDWTI 0CUUCW 0CWODWTI 0GCRGNWPF5K\KNKGP 0GWUGGNCPF 0GWUU 0GWYKGF 0GYHQWPFNCPF 0KGFGTNCPFG 0ÌTFNKPIGP 0QTYGIGP 0QWXGNNG%CN¾FQPKG 0GWMCNGFQPKGP  0QYIQTQF 0ÒTPDGTI 0WOKUOCVKMGT 0WOKUOCVKUEJG.KVGTCVWT 

O

¤VVKPIGP 1NFGPDWTI 1NOÒV\ 1UPCDTÒEM 1UVHTKGUNCPF 1XGTKLUUGN 

P

2CFGTDQTP 2CFWC 2CPCOC 2CRKGTIGNF 2CTOC 2CUUCW 2CXKC 2GTUKGP 2GTW


2HCN\ 2JKNKRRKPGP 2KCEGP\C 2KGOQPV 2QNGP 2QOOGTP 2QTVWICN 2T·OKG2TGKU8GTFKGPUV    2TCI 2TGWUUGP  2TQDGP   2UMQY 

R

4CIWUC &WDTQXPKM  4CUVCVV 4CXGPUDWTI 4GHQTOCVKQP 4GIGPUDWTI 4GKEJUDWTI 4GKEJUIQNFOÒP\GP 4GKEJUMNGKPOÒP\GP 4GKEJUUKNDGTOÒP\GP 4GWUU 4KGVDGTI 4KIC 4LCUCP 4ÌOKUEJ&GWVUEJGU4GKEJUKGJG*CDUDWTIKUEJG'TDNCPFG 4QVVYGKN 4WO·PKGP 4WUUNCPF 

S

5 *GGTGPDGTI 5 *GTVQIGPDQUEJ 5CEJUGP 5CN\DWTI 5CP/CTKPQ 5CTFKPKGP 5CWFK#TCDKGP 5CXQ[GP 5C[P 5EJCHHJCWUGP 5EJCWODWTI.KRRG 5EJNGUKGP 5EJNGUYKI*QNUVGKP 5EJNKEM 5EJQVVNCPF 5EJWNG7PKXGTUKV·V#MCFGOKG   5EJY·DKUEJ*CNN 5EJY·DKUEJGT$WPF 5EJYCT\DWTI 5EJYGFGP 5EJYGK\ 5GFKUXCMCP\     5GTDKGP 5KGDGPDÒTIGP 5KGPC 5KIOCTKPIGP*GNHGPUVGKP

5K\KNKGP 5RCPKGP 5RG[GT 5V$NCUKGP 5V)CNNGP 5VCXGNQV 5VQNDGTI 5VTCNUWPF 5VTCUUDWTI 5VWVVICTV 5ÒFCHTKMC 5ÒFMQTGC 

T

6JCKNCPF 6JCPP 6JWTPWPF6CZKU 6KTQN 6QPIC 6QTTKINKC 6QUECPC 6QWTU 6TKGPV 6TKGT 6UEJGEJKGP 6ÒTMGK 6WPGUKGP 

U

ªDGTNKPIGP 7NO 7PICTP 7TDKPQ 7TWIWC[ 7VTGEJV 

V

8GPGFKI 8GPG\WGNC 8GTGKPKIVG5VCCVGPXQP#OGTKMC75# 8GTGKPKIVGU-ÌPKITGKEJ 8GTQPC 

W

9CCFV 9CNFGEM 9CNFGEM2[TOQPV 9CNNOQFGP)KODQTP 9CTUEJCW 9GKOCTGT4GRWDNKM 9GNVMTKGIWPF+PHNCVKQP 9GUVHCNGP 9GUVHTKGUNCPF 9KGF 9KGFGPDTÒEM 9KGP 9KMKPIGT&CPGNCY 9KUOCT 9QTOU 9ÒTVVGODGTI 9ÒT\DWTI 9[UEJGJTCF 

Z

<CTC <CFCT  <GGNCPF <ÒTKEJ <WI <YQNNG <[RGTP


NUMISMATISCHE AUSDRÜCKE EXPRESSIONS NUMISMATIQUES NUMISMATIC TERMS TERMINI DI NUMISMATICA DEUTSCH

ENGLISCH

FRANÇAIS

ITALIANO

Abschlag Am Rand Berieben Blei Dezentriert Doppelschlag Einfassung Einseitig Emailliert Erhaltung Etwas Exemplar Fassungsspuren Fehlprägung Feld(er) Fundexemplar Gedenkmünze Geglättet Gelocht Geprägt Gewellt Goldpatina Hübsch Jahrh. = Jahrhundert. Kl. = klein Korrosionsspuren Kratzer Kupfer Legierung Leicht(e) l. = links Min. = minimal Nachahmung Prachtexemplar Prägeschwäche Randdelle Randfehler Randschrift r. = rechts Rückseite Schriftspuren Schrötling Schrötlingsfehler Schwach ausgeprägt Selten in dieser Erhaltung Seltener Jahrgang Stempel Stempelfehler Überdurchschnittlich erhalten Überprägt Unediert Unikum Vergoldet Von aller größter Seltenheit Vorderseite Winz.= winzig Zain Zierrand Zinn Ziseliert

struck at the rim/border slightly polished lead uncentered double struck frame uniface enamelled condition/preservation slightly specimen, copy trace of mounting mis-strike field(s) specimen from a hoard commemorative coin tooled holed minted bent golden patina attractive century small traces of corrosion scratch(es) copper alloy slightly left minimal imitation attractive, perfect piece weakly struck edge nick edge faults lettered edge to right reverse traces of inscription flan flan defect weakly struck rare in this condition rare year die(s) mistake in the die extraordinary condition overstruck unpublished unique specimen gilt extremely rare head tiny flan ornamental border tin chased

frappe en tranche frotté plomb decentré double frappe encadrement uniface émaillé conservation un peu exemplaire traces de monture défaut de frappe champ de trésor monnaie commemorative lissé troué frappé ondulé patine dorée joli siécle petit traces de corrosion rayure cuivre alliace légère gauche minimal imitation pièce magnifique de frappe molle défaut sur la tranche erreur sur la tranche inscription sur la tranche droite revers traces de légende flan Flan défectueux de frappe molle conservation rare année rare coin erreur de frappe conservation extraordinaire surfrappé inédit pièce unique doré très rare en face petit flan tranche ornée étain ciselé

coniazione al bordo trattato piombo non centrato ribattitura cornice uniface smaltato conservazione un poco esemplare tracce di montatura difetto di coniazione campo da tesoretto moneta commemorativa liscio bucato coniato ondolato patina d´oro carino secolo piccolo segni di corrosione graffio(i) rame lega leggero sinistra minimamente contraffazzione esemplare magnifico conio stanco ammaccatura al bordo errore nel bordo inscrizione sul bordo destra rovescio tracce di leggenda tondello errore di tondello conio stanco conservazione rara annata rara conio errore di conio conservazione estraordinaria ribattuto inedito pezzo unico dorato di estrema raritá diritto veramente piccolo tondello taglio ornato stagno cesellato


HINWEISE FÜR UNSERE BIETENDEN AUKTIONSKUNDEN 1. Die Auktionsbedingungen finden Sie am Ende dieses Katalogs. 2. Bitte senden Sie uns Ihre Aufträge möglichst frühzeitig zu. Wenn uns Ihr Auftrag erst kurz vor der Auktion erreicht, können sich bei der Bearbeitung Fehler einschleichen. 3. Das beiliegende Formular macht es Ihnen leicht, ein schriftliches Gebot abzugeben. Falls Sie Ihre Gebote faxen möchten: unser Telefax 0541 - 96 20 222 steht Ihnen Tag und Nacht zur Verfügung. 4. Die von Ihnen ersteigerten Objekte werden Ihnen innerhalb von acht Tagen nach Beendigung der Auktion zugeschickt. Die Aufträge werden in der Reihenfolge des Eingangs bearbeitet, d. h. die zuerst eingegangenen Aufträge werden auch zuerst bearbeitet. Auch alle Bieter, die keinen Zuschlag erhalten haben, werden von uns nach der Auktion benachrichtigt. 5. Wenn Sie telefonisch bieten möchten, teilen Sie uns diesen Wunsch bitte mindestens 48 Stunden vor der Auktion mit. Unseren Kundenservice erreichen Sie unter 0541 – 96 20 20 oder gebührenfrei unter 0800 – 5 83 65 37. 6. Wenn Sie als neuer Kunde noch nicht bei uns gekauft haben, ist es empfehlenswert, wenn Sie uns Referenzen angeben. Nennen Sie uns eine Münzhandlung, mit der Sie bereits in Geschäftsverbindung stehen. Oder rufen Sie unseren Kundenservice an. 7. Die Echtheit aller verkauften Objekte wird auch über die gesetzliche Frist hinaus gewährleistet. 8. Alle Kunden, die als Bieter an einer unserer Auktionen teilnehmen, erhalten innerhalb von zwei Wochen nach der Auktion unsere Ergebnisliste gratis. 9. Sie haben Fragen zu einer bestimmten Münze? Sie möchten persönlich an unserer Auktion teilnehmen? Sie haben andere Fragen? Unser Kundenservice freut sich auf Ihren Anruf, entweder direkt unter 0541 – 96 20 20 oder gebührenfrei unter 0800 – 5 83 65 37.

IMPORTANT INFORMATION FOR PLACING BIDS 1. The terms and conditions of the auction can be found at the end of this catalogue. 2. Please send us your instructions as early as possible. The likelihood of errors occurring increases if we do not receive your instructions until shortly before the auction. 3. The enclosed form makes it simple for you to submit a written bid. Our fax machine +49 (0)541 – 96 20 222 is on standby day and night in case you wish to fax your bids. 4. The objects which you purchase will be delivered to you within eight days of the close of auction. Instructions are processed in the same order as they were received – in other words, the first instructions to be received are the first to be processed. All unsuccessful bidders will be also informed after the auction. 5. If you would like to bid by telephone, please ring our customer service beforehand on +49 (0)541 - 96 20 20. 6. If you are a new customer who has not yet bought anything through us, we recommend that you give us references. Name a coin dealer with whom you have already done business. Or call our customer service. 7. The genuineness of all sold objects is also warranted beyond the statutory length of time. 8. All customers who participate as bidders in our auction receive our list of results free of charge within two weeks of the close of auction. 9. Do you have questions about a particular coin? Would you like to participate personally in our auction? Do you have any other questions? Our customer service team will be pleased to help you – call on +49 (0)541 - 96 20 20.

RENSEIGNEMENTS À L'ATTENTION DE NOS CLIENTS DES VENTES AUX ENCHÈRES 1. Vous trouverez les conditions générales de vente aux enchères à la fin de ce catalogue. 2. Veuillez nous faire parvenir vos ordres le plus tôt possible. Si vos ordres nous parviennent juste avant la vente aux enchères, des erreurs risquent d’être commises lors de leur traitement. 3. Le formulaire ci-joint vous aidera à rédiger facilement votre offre. Si vous souhaitez faxer votre offre, vous pourrez le faire 24 heures sur 24 au +49 (0)541 – 96 20 222. 4. Les objets dont vous serez adjudicataire vous seront envoyés dans les huit jours suivant la fin de la vente aux enchères. Les commandes seront prises en compte dans l’ordre de leur arrivée, c’est-à-dire que les commandes nous parvenant les premières seront d’abord traitées. Après la vente aux enchères, nous préviendrons tous les enchérisseurs n’ayant pas obtenu l’adjudication. 5. Si vous souhaitez faire des enchères par téléphone, veuillez appeler aupravant notre service clientèle au +49 (0)541 – 96 20 20. 6. Si vous êtes un nouveau client et n’avez encore fait aucune acquisition chez nous, il serait conseillé de nous fournir quelques références. Indiquez nous si vous traitez déjà avec un professionnel du commerce des monnaies. Ou contactez notre service clientèle au +49 (0)541 – 96 20 20. 7. L’authenticité des pièces vendues sera garantie même au-delà des délais légaux. 8. Tous les clients participant à l’une de nos ventes aux enchères en tant qu’enchérisseurs recevront gratuitement une liste de résultats dans les deux semaines suivant la vente aux enchères. 9. Vous avez des questions concernant une pièce particulière? Vous désirez prendre part personnellement à notre vente aux enchères? Vous avez d’autres questions? Notre service clientèle se fera un plaisir de vous répondre au +49 (0)541 – 96 20 20.

INFORMAZIONI PER GLI OFFERENTI DELLE NOSTRE ASTE 1. Le condizioni d’asta si trovano alla fine di questo catalogo. 2. Siete pregati di inviarci i vostri ordini il più presto possibile. Se il vostro ordine ci perviene poco tempo prima dell’apertura dell’asta, si possono verificare errori nell’elaborazione dello stesso. 3. Per le vostre offerte scritte potete utilizzare il modulo allegato al catalogo. Nel caso voleste trasmettere le vostre offerte per fax, siete pregati di inviarle al seguente numero: +49 (0)541-96 20 222. 4. Gli oggetti che avete acquistato all’asta vi saranno spediti entro otto giorni dal termine della stessa. Gli ordini vengono evasi in base alla data di ricevimento, quindi hanno precedenza quelli pervenuti prima. Anche gli offerenti che non hanno avuta alcuna aggiudicazione riceveranno una nostra comunicazione al termine dell’asta. 5. Se desiderate la partecipazione telefonica in diretta durante l´asta, siete pregati di chiamare prima la consulenza ai clienti al numero diretto +49 (0)541-96 20 20. 6. Se siete clienti nuovi e non avete mai acquistato da noi, vi proponiamo di inviarci delle referenze. Dateci il nome di un negozio di monete presso il quale avete già fatto degli acquisti, oppure chiamate la nostra consulenza ai clienti al numero +49 (0)541 96 20 20. 7. Il certificato d’autenticità di tutti gli oggetti venduti viene rilasciato anche oltre i termini privisti per legge. 8. Tutti i clienti che hanno partecipato ad una nostra asta riceveranno gratuitamente l´elenco delle aggiudicazioni entro quindici giorni dal termine della stessa. 9. Avete delle domande su una moneta in particolare ? Desiderate partecipare personalmente ad una nostra asta? Avete altre domande? Rivolgetevi al nostro Servizio Clienti al numero +49 (0)541 – 96 20 20.


WIE BIETE ICH RICHTIG?

MEINE TEILNAHME ALS SCHRIFTLICHER BIETER 1. 2. 3. 4. 5. 6. 7.

Studieren Sie den Katalog sorgfältig und notieren Sie alle Lose, die interessant für Sie sind. Legen Sie für jedes Los Ihr persönliches Limit fest, das Sie maximal zu zahlen bereit sind. Füllen Sie das beiliegende Formular aus (siehe rechte Seite) und tragen Sie für jedes Los Ihr Höchstgebot ein. Schicken Sie uns Ihren Auftrag frühzeitig. Bei gleich hohen Geboten erhält das zuerst eingegangene Gebot den Zuschlag. Sie haben interessante Lose für insgesamt € 10.000,-- gefunden, möchten jedoch nur € 2.000,-- ausgeben. Kein Problem: Sie geben als Gesamtlimit (ohne Aufgeld) € 2.000,-- an. Wenn Sie Fragen haben: Die MitarbeiterInnen unserer Kundenbetreuung sind für Sie da. Tel. 0800 – 583 65 37 (gebührenfrei). Wenn Sie telefonisch an unseren Auktionen teilnehmen möchten, ist das ab einer Schätzung von € 500,- pro Los möglich. Bitte teilen Sie uns diesen Wunsch mindestens einen Werktag vor Beginn der Versteigerung schriftlich mit.

MEINE PERSÖNLICHE TEILNAHME IN OSNABRÜCK 1.

3.

Wir freuen uns sehr, wenn Sie persönlich nach Osnabrück kommen möchten. Das Flair einer Auktion und die Stimmung im Auktionssaal sind ein besonderes Erlebnis für Sie als Sammler. Osnabrück ist außerdem immer eine Reise wert und die persönliche Betreuung durch unsere Mitarbeiter wissen immer mehr Kunden zu schätzen. 2. Bitte rufen Sie uns rechtzeitig an, damit wir Ihnen Tipps für die Anreise geben und Ihnen ein Hotelzimmer reservieren können. Sie erreichen uns gebührenfrei unter: 0800 – 5 83 65 37. Als erfolgreicher Bieter können Sie Ihre neu erworbenen Stücke gleich persönlich mit nach Hause nehmen. Als guter Kunde unseres Hauses haben Sie 20 Tage Zahlungsziel nach der Auktion.

WIE ENTSTEHT DER PREIS EINER AUKTION? 1. 2.

Der im Auktionskatalog angegebene Preis ist ein Schätzpreis, der durch unsere Experten festgelegt wurde. Das Mindestgebot liegt bei 80% dieses Wertes. Die Zuschlagpreise sind oft deutlich höher als die Schätzpreise. Als Auktionshaus müssen wir bereits vor der Auktion alle schriftlichen Gebote koordinieren. Folgende Beispiele sind im Bietverfahren möglich:

Beispiel 1 (Schätzpreis: € 1.000,--) Es liegt kein schriftlicher Auftrag vor: der Auktionator ruft das Los in der Auktion mit € 800,-- aus. Wenn im Saal nur ein Bieter darauf ein Gebot abgibt, erhält der Saalbieter den Zuschlag für € 800,--.

Beispiel 3 (Schätzpreis: € 1.000,--) Es liegt dem Auktionator nur ein schriftliches Gebot von € 850,-- vor: das Los wird in der Auktion mit € 800,-ausgerufen. Falls kein Bieter im Saal ein Gegenangebot abgibt, erhält der schriftliche Bieter den Zuschlag bei € 800,--.

Beispiel 2 (Schätzpreis: € 1.000,--) Es liegen dem Auktionator drei schriftliche Gebote vor:

Beispiel 4: (Schätzpreis: € 1.000,--) Es liegt dem Auktionator nur ein schriftliches Gebot von € 1.200,-- vor: der Auktionator ruft das Los mit € 800,-- aus. Gibt es im Saal keinen Gegenbieter, erhält der schriftliche Bieter den Zuschlag bei € 800,--. Falls es im Saal Gegenbieter gibt, bietet der Auktionator für seinen schriftlichen Bieter bis maximal € 1.200,-- und erteilt einem Gegenbieter im Saal erst bei mehr als € 1.200,-- den Zuschlag.

Bieter 1: Limit € 2.900,-Bieter 2: Limit € 1.800,-Bieter 3: Limit: € 800,-Nach der Versteigerungsordnung muss der Auktionator im Interesse von Bieter 1 und 2 angemessen überbieten (um ca. 5 bis 10%). Der Ausrufpreis in der Auktion beträgt daher im Interesse von Bieter 1, € 1.900,-- (obwohl die Schätzung € 1.000,-- beträgt). Falls keine höheren Gebote aus dem Saal erfolgen, erhält Bieter 1 den Zuschlag für € 1.900,--. Das Höchstangebot von € 2.900,-- musste nicht ausgeschöpft werden.

Beispiel 5 (Schätzpreis: € 1.000,--) Es liegen drei Gebote von je € 975,-- vor: um Missverständnisse zu vermeiden, überzieht der Auktionator das zuerst eingegangene Gebot geringfügig und erteilt den Zuschlag bei € 1.000,--.


WIE BIETE ICH RICHTIG?

MUSTERAUKTIONSAUFTRAG FÜR SCHRIFTLICHE BIETER 1. Name, Adresse, Telefon: Ihre vollständige Anschrift ist wichtig, damit wir Ihren Auktionsauftrag annehmen und bearbeiten können. Ihre Telefonnummer brauchen wir, um Sie bei Rückfragen zu Ihren Geboten schnell erreichen zu können.

5. Ihre Kundennummer Die Angabe Ihrer Kundennummer unterstützt uns bei der Bearbeitung Ihres Auktionsauftrages. Viele Vorarbeiten für die Auktion werden dadurch einfacher und es werden Fehler vermieden.

2. Losnummern und Gebote Listen Sie alle Lose, für die Sie sich interessieren, mit ihrer Katalognummer auf und legen Sie für sich selbst fest, wie viel Sie bereit sind für jedes einzelne Los zu bieten.

6. Ihr Limit pro Einzellos An dieser Stelle geben Sie an, was Sie für jedes einzelne Stück maximal bereit sind auszugeben.

3. „Oder“-Gebote Wenn Sie sich für mehrere Münzen interessieren, aber nur ein Stück davon erwerben wollen, können Sie Ihre Gebote einfach mit einem „oder“ verbinden. Wichtig: bei den „oder“-Geboten können Sie nicht auf frühere Katalognummern zurückgreifen (z.B. 2890 oder 1558), da die Nr. 1558 dann bereits versteigert ist. 4. Unterschreiben Sie Ihren Auktionsauftrag . . .nachdem Sie Ihre Angaben noch einmal überprüft haben. Ihre Unterschrift ist wichtig, denn damit bestätigen Sie uns, dass sie tatsächlich teilnehmen wollen.

7. Überschreitung Ihrer Limits pro Einzellos In der Praxis zeigt sich, daß oft mehrere Bieter mit ihren Geboten dicht beieinander liegen. Deshalb empfiehlt es sich, an dieser Stelle einer geringfügigen Überschreitung Ihrer Gebote zuzustimmen. Dadurch erhöhen sich Ihre Chancen, im Wettbewerb mit anderen den Zuschlag zu erhalten. 8. Begrenzung Ihres Gesamtlimits Hier können sie die Gesamtsumme Ihrer Gebote begrenzen und festlegen, was Sie insgesamt maximal bereit sind auszugeben. Aufgeld und Mehrwertsteuer kommen später noch hinzu.

ANTWORTEN AUF FRAGEN, DIE UNS OFT GESTELLT WERDEN 1.

Zuschlagpreis/Aufgeld: Wir berechnen als Auktionshaus ein Aufgeld von 15% auf den Zuschlagpreis, dazu kommt die gesetzliche Mehrwertsteuer. Beispiel 2: Zuschlagpreis: € 1.000,-€ 100,-Aufgeld 15% € 150,-€ 15,00 Versandkosten, z. B.* € 5,90 € 5,90 MwSt. 7% € 80,91 € 8,46 ______ ________ Rg.-Betrag € 1.236,81 Rg.-Betrag € 129,36 Mehrwertsteuer: üblicherweise in Deutschland 7%, seit dem 01.01.2000 sind viele Goldmünzen, die nach 1800 geprägt wurden, steuerfrei. Bei Fragen zu der MWSt-Berechnung rufen Sie uns an, gebührenfrei unter: 0800 / 5836537. Rücklosverkauf: Alle Lose, die in der Auktion nicht verkauft wurden, können Sie innerhalb von vier Wochen nach der Versteigerung zu 80% des Schätzpreises (zzgl. Aufgeld und Mehrwertsteuer) erwerben. Achtung: Viele Rücklose sind schnell vergriffen. Unser Spezialservice: Alle Bieter erhalten gratis die Ergebnisliste innerhalb von zwei Wochen nach der Auktion. Im Internet können Sie die Ergebnisliste der Auktion sofort nach der Auktion unter www.kuenker.de einsehen. Beispiel 1:

2. 3.

4.

Zuschlagpreis Aufgeld 15%: Versandkosten, z.. B.* MwSt. 7%

* Die Kosten für Versand und Versicherung werden nach Aufwand berechnet.


VERSTEIGERUNGSBEDINGUNGEN Die Versteigerung erfolgt im Auftrag und für Rechnung der Eigentümer unter Einhaltung der sich aus der Versteigerungsordnung (BGB1 I 1976, 1346) ergebenden und für Kommissionäre geltenden gesetzlichen Bestimmungen des BGB und HGB gegen Barzahlung des Kaufpreises in ~-Währung. Durch Abgabe eines Gebotes werden die Versteigerungsbedingungen anerkannt, dies gilt auch für die schriftlichen Gebote. Der Zuschlagpreis ist Nettopreis im Sinne des Umsatzsteuergesetzes und bildet die Berechnungsgrundlage für das vom Käufer zu zahlende Aufgeld in Höhe von 15 %. Auf den daraus entstehenden Gesamtpreis (Zuschlag + Aufgeld) wird die jeweils gültige Umsatzsteuer erhoben, soweit dies gesetzlich vorgeschrieben ist. Ausländischen Käufern aus Ländern der europäischen Gemeinschaft wird die in Deutschlang gültige Umsatzsteuer berechnet. Anderen ausländischen Käufern (aus Drittländern) wird, sofern die Münzen durch uns exportiert werden, ein Aufgeld von 15 % netto auf den Zuschlagpreis berechnet; sie erhalten die Lieferung nur gegen Zahlung des Kaufpreises in ~ - Währung, bankspesenfrei. Ausländischen Münzhändlern aus Ländern der europäischen Gemeinschaft wird bei Nachweis der Umsatzsteuer-Identifikationsnummer (§ 27 a USTG) und der sonstigen Voraussetzungen gemäß § 4 Nr. 1 b USTG in Verbindung mit § 6 a USTG die Lieferung ohne Umsatzsteuer berechnet. Sofern nichts anderes vereinbart wird, ist die Zahlung der Auktionsrechnung bei anwesenden Käufern sofort, bei schriftlichen Bietern spätestens 20 Tage nach Erhalt fällig. Bei Zahlungsverzug werden Zinsen von 1 % pro Monat berechnet. Wird die Zahlung nicht sofort an den Versteigerer geleistet oder die Abnahme der zugeschlagenen Sache verweigert, so findet die Übergabe der Sache an den Ersteigerer nicht statt. Der Ersteigerer verliert vielmehr seine Rechte aus dem Zuschlag, und die Sache kann auf seine Kosten erneut versteigert werden. In diesem Fall haftet der Ersteigerer für den Ausfall, dagegen hat er auf den Mehrerlös keinen Anspruch. Der Zuschlag erfolgt nach dreimaligem Ausruf des höchsten Gebotes und verpflichtet zur Abnahme und Zahlung. Bei Meinungsverschiedenheiten über den Zuschlag wird die Nummer noch einmal ausgerufen. Der Versteigerer ist berechtigt, Nummern zu vereinigen oder zu trennen. Eine Vorausnahme von Nummern erfolgt nicht. Der Zutritt zur Versteigerung ist nur Interessenten gestattet, die einen Katalog besitzen.

Die Mindeststeigerungsstufen für das Bietungsverfahren betragen:

Mindestangebote

Mindeststeigerungsstufe

Schriftliche Aufträge werden von uns ohne Auftragsprovision gewissenhaft ausgeführt. Aufträge von uns unbekannten Sammlern können nur ausgeführt werden, wenn ein Depot hinterlegt wird oder Referenzen benannt werden. Schriftliche Gebote können nur bis 24 Stunden vor Auktionsbeginn verbindlich berücksichtigt werden. Im Bedarfsfall ist der Auktionator berechtigt, die Limits um 3 – 5 % zu überschreiten. Bei mehreren gleichhohen Geboten erhält das zuerst eingegangene den Zuschlag. Unlimitierte Aufträge haben keinen Anspruch auf unbedingte Ausführung. Telefonisches Bieten ist nur in Ausnahmefällen möglich. Telefonische Bieter müssen sich mindestens einen Werktag vor der Auktion voranmelden. Der Versand geht zu Lasten und auf Risiko des Ersteigerers bzw. Empfängers. Das Auktionsgut bleibt bis zur vollständigen Bezahlung aller Forderungen aus Anlaß der Versteigerung Eigentum des Verkäufers. Ist der Käufer Vollkaufmann, so ist Osnabrück als Gerichtsstand vereinbart. Für das Mahnverfahren gilt die Zuständigkeit des Amtsgerichts Osnabrück auch in allen anderen Fällen als vereinbart. Ansonsten ist es Osnabrück nur, wenn nur die Firma Fritz Rudolf Künker GmbH & Co. KG ihren allgemeinen Gerichtsstand in der BRD hat, oder wenn alle Ansprüche im Wege des Mahnverfahrens geltend gemacht werden, oder wenn die im Klageweg in Anspruch zu nehmende Vertragspartei nach Vertragsabschluß ihren gewöhnlichen Aufenthaltsort aus dem Geltungsbereich der BRD verlegt hat, oder ihr Wohnsitz oder gewöhnlicher Aufenthaltsort zum Zeitpunkt der Klage nicht bekannt ist. Die Beschreibung im Katalog ist gewissenhaft durchgeführt. Sie begründet jedoch keine Rechts- oder Sachmängelhaftung gemäß §§ 434, 459 ff BGB. Die Angabe der Erhaltung ist streng nach den im deutschen Münzhandel üblichen Erhaltungseinstufungen vorgenommen und gilt als persönliche Beurteilung. Bei der Auktion anwesende Käufer kaufen grundsätzlich „wie besehen“. Da durch Vorbesichtigung Gelegenheit gegeben ist, sich vom Erhaltungszustand des Versteigerungsgutes zu überzeugen, können nach erfolgtem Zuschlag Reklamationen nur bei irrtümlich übersehener Henkel- oder Fassungsspur oder gestopftem Loch berücksichtigt werden. Bei Losen mit mehreren Stücken sind die Stückzahlen nur Circa-Angaben, irrtümliche Zuschreibungen sind im Einzelfall nicht ausgeschlossen. Diese Lose sind nach erfolgtem Zuschlag von jeder Reklamation ausgeschlossen. Der Versteigerer kann bei eventuellen Meinungsverschiedenheiten bzw. Beanstandungen einen vereidigten Sachverständiger seiner Wahl (die Kosten trägt der unterliegende Teil) beauftragen. Eventuelle Beanstandungen können nur innerhalb von 8 Tagen nach der Auktion bzw. nach Erhalt der ersteigerten Stücke berücksichtigt werden. Die Echtheit der Stücke wird bis zur Höhe des Kaufpreises garantiert. Die beigedruckten Preise sind Schätzpreise, die unter- oder überschritten werden können. Aufträge, die unter 80 % des Schätzpreises liegen, können nicht bearbeitet werden.

bis zu

100,--

5,--

bis zu

200,--

10,--

bis zu

500,--

20,--

bis zu

1.000,--

50,--

Soweit nicht anders vermerkt, gelten im übrigen die allgemeinen Versteigerungsbestimmungen und – auch im Verhältnis zu ausländischen Kunden – gilt Deutsches Recht.

bis zu

2.000,--

100,--

Die Ergebnisliste erscheint sofort nach der Auktion.

bis zu

5.000,--

200,--

DIE VERSTEIGERER:

bis zu

10.000,--

500,--

DR. ANDREAS KAISER

bis zu

20.000,--

1.000,--

ARNE KIRSCH

bis zu

50.000,--

2.000,--

OLIVER KÖPP

ab

50.000,--

5.000,--

Ausländische Kunden kaufen nach den Devisen-, Zoll- und Steuerbestimmungen ihres Landes. Versandformalitäten werden vom Versteigerer erledigt.

FRITZ RUDOLF KÜNKER


TERMS AND CONDITIONS OF AUCTION The auction is conducted on behalf and for the account of the appropiate proprietors of the goods and is subject to the federal Auction Regulation (Versteigerungsordnung, BGB1 I 1976, 1346) published in the Federal Law GazetteVol. I, 1976, 1346 and the relevant provisions for factors in accordance with the German Cicil Code (BGB) and Commercial Code (HGB). Payment of the hammer-price has to be made in cash and in Euro. The submission of an offer implies the express acknowledgement of these Terms and Conditions of Auction; the same applies to the submission of an offer in writing. The hammer-price is exclusive of applicable German VAT according to the prevailing VAT – legislation and represents the basis for calculating the surcharge of 15 percent payable by the puchaser. The total price so calculated (hammerprice plus surcharge) is subject to the VAT (value added tax=Mehrwertsteuer), which is payabel additionally. Purchasers from abroad will be charged a surcharge of 15 per cent net on the hammer-price, provided the export of the coins is undertaken by the auctioneer. Buyers in European Community (EEC) countries (other than Germany) will be charged Value Added Tax at the rates prevailing in Germany. Dealers from EEC countries (other than Germany) will receive goods free of tax upon presentation of their VAT I.D. number, and upon fulfillment of the other conditions set forth in Paragraph 4, Nr. 1 b, and Paragraph 6 a of the GermanTurnover Tax Law Buyers from other countries are not charged Value Added Tax. Delivery will be made against payment in Euro with no bank charges to the auctioneer. Unless mutually agreed otherwise, payment of the auction bill from purchasers present at the auction is due immediately. From purchaser who have submitted a bid in writing, payment is due within 20 days after receipt of the goods. Defaulted payments shall bear an interest charge of 1 % per month in the amount in default. Should payment to the auctioneer not be made immediately or should the acceptance of the awarded item be refused, such item shall not be handed overt to the purchaser. Instead the purchaser shall forfeit all right and title in and to such item from the award and the item may again be put to auction at this buyer’s cost. In this event the buyer shall be liable for any shortfall, while he shall have no right or claim towards any excess proceeds. An item will be knocked down after the highest bid has been called three times. The award shall be a binding commitment and liability on the part of the bidder to take acceptance and delivery of the item or items so awarded. In the event of any dispute with regard to the award the lot will be put up again for bidding. The auctioneer reserves the right to combine or to seperate lots. Lots will not be called out of sequence. Access to the auction will only be permitted to interested persons who are in possession of the catalogue. The minimum rates of increase for the bidding procedure are: for minimum offers

minimum increase rate

up to

100,--

5,--

up to

200,--

10,--

up to

500,--

20,--

up to

1.000,--

50,--

up to

2.000,--

100,--

up to

5.000,--

200,--

up to

10.000,--

500,--

up to

20.000,--

1.000,--

up to

50.000,--

2.000,--

above

50.000,--

5.000,--

Orders submitted in writing will be carried out diligently and without charge of an extra commission. Orders from collectors unknown to the auctioneer can only be accepted and carried out if a deposit or references to the satisfaction on the auctioneer are given. To be bindingly accepted, written bids need to be received at least 24 hours before auction. If necessary, the auctioneer is allowed to increase the bids by 3-5%. Should several bids be obtained in writing bidding the same price or prices for a given lot, the bid first received by the auctioneer shall be given the award. Unlimited bids shall not oblige the auctioneer to consider, accept or carry out such order. Telephone bidding is generally an option for lots of substantial value only. The registration is required at the latest a day before auction. Shipment (by mail or otherwise) of the goods shall be for the sole cost and risk of the purchaser or receipient, resp. The auctioned goods remain the sole and exclusiv property of the vendor until full payment and settlement of any and all dues and claims in connection with the auction. In the event the purchaser is a merchant (in the sense of the German commercial laws) Osnabrück shall be the agreed and exclusive place of jurisdiction. The competence of the District Court (Amtsgericht) of Osnabrück is agreed in respect of summary proceedings for the collection of defaulted payments (Mahnverfahren) as well as in any and all other cases. Should the purchaser not be a merchant Osnabrück shall be the place of jurisdiction with the District Court of Osnabrück’s competence, if only the auctioneer has his ordinary legal domicil in the Federal Republic of Germany or if claims are made by way of summary proceedings of collection (Mahnverfahren) or if the defendant has moved his ordinary legal domicil outside the jurisdiction of the Federal Republik of Germany or if the legal domicil of the defendant is unknown to the auctioneer at the time of filing a suit. To the exclusion of any other legislation German law, as in force at the time, shall be applied for the settlement of any and all legal or judicial matters. The specifications and descriptions in the catalogue have been prepared diligently and in good faith do, however, not constitute the acceptance by the auctioneer of any warranty or liability in respect of defect in material or title. The state of preservation of items is strictly assessed in accordance with the grades accepted by the German coin trade and only represents an individual and personal assessment. Purchasers present at the auction acquire items strictly on the basis of “as is where is” and “as inspected”. In view of the opportunity of prior inspection to ascertain the state and condition of the auction lots, complaints and objections made after the sale will only be considered, if by obvious error or mistake loop or traces or moutings, traces of trimmings or settings, or the plugging of a hole (eyelet) have remained unnoticed. If and when auctioned in lots, the quantities of individual pieces given, only represent an approximate figure. An error in the allocation of indivdual pieces to a certain lot cannot be excluded. Such lots are, therefore, excluded from any complaintes or objections after the lot is knocked down. In the event of disputes or complaints as to the quality of an item the auctioneer may call upon a gernerally sworn expert of the trade, which the auctioneer may choose at his sole discretin, for assessment an the rendering of a decision as to the justification of such dispute or complaint. The costs of such expert shall be borne by the party loosing the dispute according to the expert’s decision. Complaints or objections, if justified, will only be considered if made and received by the auctioneer within 8 days after the auction or after receipt the lots, respectively. The authenticity of the coins is warranted. Warranted up to the total purchase price. The prices set out in the catalogue are estimates only, which may bei exceeded or undercut. Orders for less than 80 per cent of the estimated price cannot accepted. Purchasers from abroad will have to observe all applicable laws and regulations in respect of foreign exchange, customs duties and taxation of their country. The auctioneer will only discharge such formalities, which have to be observed, in the Federal Republic of Germany in connection with the export of the purchased item(s). Unless stipulated otherwise herein, the general rules regulations for auctions applicable in Germany shall govern any transaction in respect of the auction; German Law shall also be applicable in relation to purchasers form abroad. Only the German text has legal forde. The prices realized will be published in the form of a list immediately after the auction. THE AUCTIONEERS:

FRITZ RUDOLF KÜNKER DR. ANDREAS KAISER ARNE KIRSCH OLIVER KÖPP


IMPRESSUM NUMISMATISCHE BEARBEITUNG FOTOS LAYOUT DRUCK

Alexandra Spreu, Dr. Sebastian Steinbach, Jens Ulrich Thormann M. A., Manuela Weiß Lübke & Wiedemann, Stuttgart danner pc - gesteuerte systeme waiblingen media-print, Paderborn Jeglicher Nachdruck, auch auszugsweise, bedarf der Genehmigung des Auktionshauses

ZAHLUNGEN AUS DEM INLAND Deutsche Bank Osnabrück Dresdner Bank Osnabrück Sparkasse Osnabrück Volksbank eG Bad Laer-Borgloh-Hilter-Melle Bankhaus Lampe KG, Bielefeld Postbank Hannover HypoVereinsbank München WestLB Dortmund Paypal

(BLZ 265 700 90) Konto-Nummer 0 177 006 (BLZ 265 800 70) Konto-Nummer 780 520 200 (BLZ 265 501 05) Konto-Nummer 247 320 (BLZ 265 624 90) Konto-Nummer 1 200 222 400 (BLZ 480 201 51) Konto-Nummer 174 076 (BLZ 250 100 30) Konto-Nummer 2900 60-308 (BLZ 700 202 70) Konto-Nummer 24 17 952 (BLZ 440 500 00) Konto-Nummer 1128 842 paypal@kuenker.de, Service charge: 3,5 %

ZAHLUNGEN AUS DEM AUSLAND - FOREIGN PAYMENTS Deutsche Bank Osnabrück Sparkasse Osnabrück Postbank Hannover Credit Suisse-5288 Credit Cards Paypal

IBAN: DE11 2657 0090 0017 7006 00 Swift-Code: DEUTDE3B265 IBAN: DE50 2655 0105 0000 2473 20 Swift-Code: NOLADE22XXX IBAN: DE73 2501 0030 0290 0603 08 Swift-Code: PBNKDEFF IBAN: CH88 0483 5013 5494 4200 1 Swift-Code: CRESCHZZ81Z We do accept VISA and MASTERCARD, Service charge: 4,5 % paypal@kuenker.de, Service charge: 3,5 %

ERHALTUNGS- UND SELTENHEITSGRADE ERHALTUNGSGRADE/ GRADING TERMS DEGRÉS DE CONSERVATION GRADI DI CONSERVAZIONE

SELTENHEITSGRADE

Polierte Platte Proof

Flan bruni Fondo specchio

Stempelglanz Uncirculated

Fleur de coin Fior di conio

Vorzüglich Extremely fine

Superbe Splendido

Sehr schön Very fine

Très beau Bellissimo

Schön Fine

Beau Molto Bello

Gering erhalten Very good

Très bien conservé Bello

R = Selten Von großer Seltenheit

RR = Sehr selten Von größter Seltenheit

Auktion 138 Künker  

Gold- und Silberprägungen von Italien und dem Vatikan, Münzen und Medaillen aus Mittelalter und Neuzeit, Spezialsammlung Wied

Read more
Read more
Similar to
Popular now
Just for you